BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig13420

Length=951
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009611380.1|  PREDICTED: zinc finger CCCH domain-containin...    339   3e-110   Nicotiana tomentosiformis
ref|XP_009793876.1|  PREDICTED: zinc finger CCCH domain-containin...    339   3e-110   Nicotiana sylvestris
ref|XP_006353234.1|  PREDICTED: zinc finger CCCH domain-containin...    338   8e-110   Solanum tuberosum [potatoes]
ref|XP_004250094.1|  PREDICTED: zinc finger CCCH domain-containin...    337   3e-109   Solanum lycopersicum
ref|XP_006376056.1|  hypothetical protein POPTR_0013s08490g             328   3e-108   
ref|XP_009611379.1|  PREDICTED: zinc finger CCCH domain-containin...    333   6e-108   Nicotiana tomentosiformis
gb|KDO47609.1|  hypothetical protein CISIN_1g0472481mg                  325   1e-107   Citrus sinensis [apfelsine]
ref|XP_007205202.1|  hypothetical protein PRUPE_ppa005813mg             331   6e-107   Prunus persica
ref|XP_008218439.1|  PREDICTED: zinc finger CCCH domain-containin...    331   7e-107   Prunus mume [ume]
ref|XP_009611378.1|  PREDICTED: zinc finger CCCH domain-containin...    329   3e-106   Nicotiana tomentosiformis
ref|XP_008359920.1|  PREDICTED: zinc finger CCCH domain-containin...    328   1e-105   Malus domestica [apple tree]
ref|XP_012088761.1|  PREDICTED: zinc finger CCCH domain-containin...    326   4e-105   Jatropha curcas
gb|KJB82178.1|  hypothetical protein B456_013G179800                    319   7e-105   Gossypium raimondii
ref|XP_006428579.1|  hypothetical protein CICLE_v10011741mg             325   1e-104   
ref|XP_009338000.1|  PREDICTED: zinc finger CCCH domain-containin...    325   1e-104   Pyrus x bretschneideri [bai li]
ref|XP_011014133.1|  PREDICTED: zinc finger CCCH domain-containin...    325   2e-104   Populus euphratica
ref|XP_009611374.1|  PREDICTED: zinc finger CCCH domain-containin...    324   5e-104   Nicotiana tomentosiformis
ref|XP_008359919.1|  PREDICTED: zinc finger CCCH domain-containin...    323   7e-104   Malus domestica [apple tree]
emb|CDP04213.1|  unnamed protein product                                320   3e-103   Coffea canephora [robusta coffee]
gb|KJB26823.1|  hypothetical protein B456_004G261700                    321   7e-103   Gossypium raimondii
ref|XP_009337999.1|  PREDICTED: zinc finger CCCH domain-containin...    320   8e-103   Pyrus x bretschneideri [bai li]
ref|XP_002278934.2|  PREDICTED: zinc finger CCCH domain-containin...    320   1e-102   Vitis vinifera
gb|KJB82177.1|  hypothetical protein B456_013G179800                    319   2e-102   Gossypium raimondii
ref|XP_002512627.1|  nucleic acid binding protein, putative             319   3e-102   Ricinus communis
ref|XP_011014371.1|  PREDICTED: zinc finger CCCH domain-containin...    319   3e-102   Populus euphratica
ref|XP_002325901.2|  zinc finger family protein                         318   4e-102   
ref|XP_008355849.1|  PREDICTED: zinc finger CCCH domain-containin...    318   6e-102   
gb|KCW84570.1|  hypothetical protein EUGRSUZ_B01407                     313   5e-101   Eucalyptus grandis [rose gum]
ref|XP_009769498.1|  PREDICTED: zinc finger CCCH domain-containin...    315   5e-101   Nicotiana sylvestris
gb|KCW84568.1|  hypothetical protein EUGRSUZ_B01407                     313   2e-100   Eucalyptus grandis [rose gum]
ref|XP_010038283.1|  PREDICTED: zinc finger CCCH domain-containin...    313   3e-100   Eucalyptus grandis [rose gum]
ref|XP_007029391.1|  Zinc finger CCCH domain-containing protein 3...    314   4e-100   Theobroma cacao [chocolate]
gb|KJB75169.1|  hypothetical protein B456_012G028600                    310   6e-100   Gossypium raimondii
ref|XP_004302155.1|  PREDICTED: zinc finger CCCH domain-containin...    313   7e-100   Fragaria vesca subsp. vesca
gb|KJB75168.1|  hypothetical protein B456_012G028600                    310   6e-99    Gossypium raimondii
ref|XP_011015459.1|  PREDICTED: zinc finger CCCH domain-containin...    309   9e-99    Populus euphratica
gb|KHG12066.1|  Zinc finger CCCH domain-containing protein ZFN-li...    309   1e-98    Gossypium arboreum [tree cotton]
ref|XP_008812314.1|  PREDICTED: LOW QUALITY PROTEIN: zinc finger ...    309   5e-98    Phoenix dactylifera
ref|XP_011660227.1|  PREDICTED: LOW QUALITY PROTEIN: zinc finger ...    306   2e-97    Cucumis sativus [cucumbers]
ref|XP_010245962.1|  PREDICTED: LOW QUALITY PROTEIN: zinc finger ...    307   2e-97    
ref|XP_008443710.1|  PREDICTED: LOW QUALITY PROTEIN: zinc finger ...    306   3e-97    
ref|XP_009626542.1|  PREDICTED: zinc finger CCCH domain-containin...    305   7e-97    Nicotiana tomentosiformis
ref|XP_006606433.1|  PREDICTED: zinc finger CCCH domain-containin...    304   1e-96    Glycine max [soybeans]
ref|XP_007139732.1|  hypothetical protein PHAVU_008G054800g             303   3e-96    Phaseolus vulgaris [French bean]
ref|XP_003536159.1|  PREDICTED: zinc finger CCCH domain-containin...    303   4e-96    Glycine max [soybeans]
ref|XP_010525081.1|  PREDICTED: zinc finger CCCH domain-containin...    303   5e-96    Tarenaya hassleriana [spider flower]
ref|XP_010929824.1|  PREDICTED: zinc finger CCCH domain-containin...    296   1e-95    
ref|XP_010913061.1|  PREDICTED: zinc finger CCCH domain-containin...    300   1e-95    Elaeis guineensis
ref|XP_007029392.1|  Zinc finger CCCH domain-containing protein 3...    301   1e-95    
ref|XP_003534518.1|  PREDICTED: zinc finger CCCH domain-containin...    301   2e-95    Glycine max [soybeans]
gb|ACC85690.1|  zinc finger protein                                     300   2e-95    Medicago sativa [alfalfa]
ref|XP_003624157.1|  Zinc finger CCCH domain-containing protein         300   2e-95    Medicago truncatula
ref|XP_008792910.1|  PREDICTED: zinc finger CCCH domain-containin...    301   4e-95    
ref|XP_010929825.1|  PREDICTED: zinc finger CCCH domain-containin...    301   6e-95    Elaeis guineensis
ref|XP_006602842.1|  PREDICTED: zinc finger CCCH domain-containin...    299   8e-95    
ref|XP_011084651.1|  PREDICTED: zinc finger CCCH domain-containin...    299   9e-95    
ref|XP_007139733.1|  hypothetical protein PHAVU_008G054800g             298   9e-95    Phaseolus vulgaris [French bean]
gb|KEH23393.1|  zinc finger CCCH domain protein                         296   1e-93    Medicago truncatula
ref|XP_006848460.1|  PREDICTED: zinc finger CCCH domain-containin...    296   3e-93    Amborella trichopoda
sp|Q9SWF9.1|ZFNL_PEA  RecName: Full=Zinc finger CCCH domain-conta...    294   7e-93    Pisum sativum [garden pea]
ref|XP_006428577.1|  hypothetical protein CICLE_v10011741mg             293   9e-93    
ref|XP_006587810.1|  PREDICTED: zinc finger CCCH domain-containin...    293   5e-92    Glycine max [soybeans]
gb|ABD28369.2|  Zinc finger, CCCH-type; Sugar transporter superfa...    292   6e-92    Medicago truncatula
ref|XP_007143976.1|  hypothetical protein PHAVU_007G118500g             292   7e-92    Phaseolus vulgaris [French bean]
ref|XP_010929827.1|  PREDICTED: zinc finger CCCH domain-containin...    292   8e-92    Elaeis guineensis
ref|XP_010525082.1|  PREDICTED: zinc finger CCCH domain-containin...    288   1e-90    Tarenaya hassleriana [spider flower]
ref|XP_011077188.1|  PREDICTED: zinc finger CCCH domain-containin...    284   4e-90    
ref|XP_009420319.1|  PREDICTED: zinc finger CCCH domain-containin...    287   6e-90    Musa acuminata subsp. malaccensis [pisang utan]
gb|ADN33845.1|  nucleic acid binding protein                            284   1e-89    Cucumis melo subsp. melo
gb|KGN66679.1|  hypothetical protein Csa_1G659020                       284   1e-89    
gb|KHN04981.1|  Zinc finger CCCH domain-containing protein ZFN-like     286   1e-89    Glycine soja [wild soybean]
ref|XP_011077184.1|  PREDICTED: zinc finger CCCH domain-containin...    285   2e-89    Sesamum indicum [beniseed]
ref|XP_009420318.1|  PREDICTED: zinc finger CCCH domain-containin...    285   2e-89    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010558591.1|  PREDICTED: zinc finger CCCH domain-containin...    284   4e-89    Tarenaya hassleriana [spider flower]
gb|KHN14776.1|  Zinc finger CCCH domain-containing protein ZFN-like     283   1e-88    Glycine soja [wild soybean]
ref|XP_011077187.1|  PREDICTED: zinc finger CCCH domain-containin...    283   1e-88    Sesamum indicum [beniseed]
gb|EYU39704.1|  hypothetical protein MIMGU_mgv1a0076882mg               281   3e-88    Erythranthe guttata [common monkey flower]
ref|XP_010927660.1|  PREDICTED: zinc finger CCCH domain-containin...    282   1e-87    
ref|XP_008794629.1|  PREDICTED: zinc finger CCCH domain-containin...    281   4e-87    
gb|EPS74454.1|  hypothetical protein M569_00301                         272   4e-87    Genlisea aurea
gb|KJB75170.1|  hypothetical protein B456_012G028600                    278   9e-87    Gossypium raimondii
ref|XP_010673925.1|  PREDICTED: zinc finger CCCH domain-containin...    278   4e-86    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010673926.1|  PREDICTED: zinc finger CCCH domain-containin...    278   4e-86    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010111067.1|  Zinc finger CCCH domain-containing protein Z...    276   5e-86    
ref|XP_008792915.1|  PREDICTED: zinc finger CCCH domain-containin...    276   2e-85    
ref|XP_009382899.1|  PREDICTED: zinc finger CCCH domain-containin...    275   1e-84    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009392477.1|  PREDICTED: zinc finger CCCH domain-containin...    270   1e-83    Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001066624.1|  Os12g0405100                                       271   2e-83    
ref|NP_566183.1|  zinc finger protein 1                                 269   2e-83    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010501886.1|  PREDICTED: zinc finger CCCH domain-containin...    269   2e-83    Camelina sativa [gold-of-pleasure]
ref|XP_009769503.1|  PREDICTED: zinc finger CCCH domain-containin...    269   2e-83    Nicotiana sylvestris
ref|XP_010501847.1|  PREDICTED: zinc finger CCCH domain-containin...    269   2e-83    Camelina sativa [gold-of-pleasure]
ref|XP_010485612.1|  PREDICTED: zinc finger CCCH domain-containin...    269   3e-83    Camelina sativa [gold-of-pleasure]
ref|XP_010463709.1|  PREDICTED: zinc finger CCCH domain-containin...    268   4e-83    Camelina sativa [gold-of-pleasure]
ref|XP_010463710.1|  PREDICTED: zinc finger CCCH domain-containin...    268   4e-83    Camelina sativa [gold-of-pleasure]
ref|XP_002882253.1|  hypothetical protein ARALYDRAFT_477525             267   9e-83    Arabidopsis lyrata subsp. lyrata
gb|KFK37691.1|  hypothetical protein AALP_AA3G016100                    267   9e-83    Arabis alpina [alpine rockcress]
ref|XP_009406323.1|  PREDICTED: zinc finger CCCH domain-containin...    267   2e-82    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009416574.1|  PREDICTED: zinc finger CCCH domain-containin...    266   7e-82    
ref|XP_009416573.1|  PREDICTED: zinc finger CCCH domain-containin...    266   8e-82    
ref|XP_006662931.1|  PREDICTED: zinc finger CCCH domain-containin...    265   1e-81    Oryza brachyantha
ref|XP_008810537.1|  PREDICTED: LOW QUALITY PROTEIN: zinc finger ...    266   1e-81    
ref|XP_006663969.1|  PREDICTED: zinc finger CCCH domain-containin...    266   2e-81    Oryza brachyantha
gb|AAD33769.1|AF138743_1  zinc finger protein 1                         265   2e-81    Arabidopsis thaliana [mouse-ear cress]
sp|Q2R4J4.2|C3H63_ORYSJ  RecName: Full=Zinc finger CCCH domain-co...    265   2e-81    Oryza sativa Japonica Group [Japonica rice]
ref|XP_006408379.1|  hypothetical protein EUTSA_v10020900mg             263   2e-81    Eutrema salsugineum [saltwater cress]
ref|NP_001067878.1|  Os11g0472000                                       264   3e-81    
ref|XP_008676803.1|  PREDICTED: hypothetical protein isoform X1         263   9e-81    Zea mays [maize]
ref|XP_009118612.1|  PREDICTED: zinc finger CCCH domain-containin...    261   1e-80    Brassica rapa
gb|EEE52080.1|  hypothetical protein OsJ_33853                          266   1e-80    Oryza sativa Japonica Group [Japonica rice]
gb|ACN40302.1|  unknown                                                 264   1e-80    Picea sitchensis
gb|ABG22481.1|  Zinc finger CCCH type domain containing protein Z...    262   1e-80    Oryza sativa Japonica Group [Japonica rice]
ref|XP_009118604.1|  PREDICTED: zinc finger CCCH domain-containin...    261   1e-80    Brassica rapa
emb|CDY53749.1|  BnaAnng12770D                                          261   2e-80    Brassica napus [oilseed rape]
ref|XP_003577562.1|  PREDICTED: zinc finger CCCH domain-containin...    263   2e-80    Brachypodium distachyon [annual false brome]
emb|CDY67901.1|  BnaCnng56860D                                          261   2e-80    Brassica napus [oilseed rape]
ref|XP_009147316.1|  PREDICTED: zinc finger CCCH domain-containin...    261   2e-80    Brassica rapa
ref|XP_004495537.1|  PREDICTED: zinc finger CCCH domain-containin...    261   3e-80    Cicer arietinum [garbanzo]
ref|XP_003576637.1|  PREDICTED: zinc finger CCCH domain-containin...    262   4e-80    Brachypodium distachyon [annual false brome]
ref|XP_002450713.1|  hypothetical protein SORBIDRAFT_05g013190          262   4e-80    Sorghum bicolor [broomcorn]
emb|CDY51531.1|  BnaA05g33310D                                          260   5e-80    Brassica napus [oilseed rape]
ref|NP_001141157.1|  hypothetical protein                               261   5e-80    Zea mays [maize]
ref|XP_010237293.1|  PREDICTED: zinc finger CCCH domain-containin...    261   8e-80    Brachypodium distachyon [annual false brome]
emb|CDY28712.1|  BnaCnng05980D                                          259   1e-79    Brassica napus [oilseed rape]
ref|XP_004979252.1|  PREDICTED: zinc finger CCCH domain-containin...    261   1e-79    
gb|AAF26977.1|AC018363_22  zinc finger protein 1 (zfn1)                 258   2e-79    Arabidopsis thaliana [mouse-ear cress]
ref|XP_008676804.1|  PREDICTED: hypothetical protein isoform X2         259   2e-79    Zea mays [maize]
ref|XP_009626543.1|  PREDICTED: zinc finger CCCH domain-containin...    258   4e-79    
ref|XP_006663970.1|  PREDICTED: zinc finger CCCH domain-containin...    258   6e-79    Oryza brachyantha
ref|XP_004979251.1|  PREDICTED: zinc finger CCCH domain-containin...    259   8e-79    Setaria italica
gb|EAY76977.1|  hypothetical protein OsI_04935                          258   9e-79    Oryza sativa Indica Group [Indian rice]
ref|NP_001045201.2|  Os01g0917400                                       258   1e-78    
emb|CDX92015.1|  BnaC03g33170D                                          254   6e-78    
gb|EMS50271.1|  Zinc finger CCCH domain-containing protein 12           255   6e-78    Triticum urartu
ref|NP_568332.2|  zinc finger nuclease 3                                253   1e-77    Arabidopsis thaliana [mouse-ear cress]
ref|NP_001130819.1|  uncharacterized protein LOC100191923               255   1e-77    Zea mays [maize]
ref|XP_010420349.1|  PREDICTED: zinc finger CCCH domain-containin...    254   1e-77    Camelina sativa [gold-of-pleasure]
ref|XP_010420350.1|  PREDICTED: zinc finger CCCH domain-containin...    254   2e-77    Camelina sativa [gold-of-pleasure]
gb|ACU21592.1|  Zinc finger protein                                     255   2e-77    Triticum aestivum [Canadian hard winter wheat]
ref|XP_010453818.1|  PREDICTED: LOW QUALITY PROTEIN: zinc finger ...    254   2e-77    Camelina sativa [gold-of-pleasure]
emb|CDX74233.1|  BnaA03g28140D                                          253   2e-77    
ref|NP_851041.1|  zinc finger nuclease 3                                253   2e-77    Arabidopsis thaliana [mouse-ear cress]
dbj|BAJ99149.1|  predicted protein                                      253   2e-77    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004971057.1|  PREDICTED: zinc finger CCCH domain-containin...    254   2e-77    Setaria italica
ref|XP_006408377.1|  hypothetical protein EUTSA_v10020900mg             252   3e-77    Eutrema salsugineum [saltwater cress]
gb|EEE55890.1|  hypothetical protein OsJ_04549                          252   4e-77    Oryza sativa Japonica Group [Japonica rice]
ref|XP_008792914.1|  PREDICTED: zinc finger CCCH domain-containin...    254   7e-77    
gb|ACF82040.1|  unknown                                                 253   9e-77    Zea mays [maize]
ref|NP_001150019.1|  zinc finger CCCH type domain-containing prot...    253   1e-76    
ref|XP_009134713.1|  PREDICTED: zinc finger CCCH domain-containin...    249   4e-76    Brassica rapa
ref|XP_009134712.1|  PREDICTED: zinc finger CCCH domain-containin...    249   4e-76    Brassica rapa
ref|XP_006408378.1|  hypothetical protein EUTSA_v10020900mg             249   9e-76    
ref|XP_010929826.1|  PREDICTED: zinc finger CCCH domain-containin...    250   1e-75    
ref|XP_006645228.1|  PREDICTED: zinc finger CCCH domain-containin...    248   3e-75    
ref|XP_008672228.1|  PREDICTED: uncharacterized protein LOC100194...    247   1e-74    Zea mays [maize]
gb|ACN33948.1|  unknown                                                 245   2e-74    Zea mays [maize]
ref|NP_001132883.1|  uncharacterized protein LOC100194377               246   3e-74    Zea mays [maize]
tpg|DAA56151.1|  TPA: hypothetical protein ZEAMMB73_608000              246   3e-74    
ref|XP_006287837.1|  hypothetical protein CARUB_v10001057mg             246   4e-74    Capsella rubella
ref|NP_974790.1|  zinc finger nuclease 3                                243   7e-74    Arabidopsis thaliana [mouse-ear cress]
ref|XP_003564925.1|  PREDICTED: zinc finger CCCH domain-containin...    243   5e-73    Brachypodium distachyon [annual false brome]
ref|XP_006400193.1|  hypothetical protein EUTSA_v10013743mg             240   4e-72    Eutrema salsugineum [saltwater cress]
dbj|BAJ86320.1|  predicted protein                                      239   3e-71    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002871723.1|  hypothetical protein ARALYDRAFT_488510             235   6e-71    
ref|XP_010492565.1|  PREDICTED: zinc finger CCCH domain-containin...    237   1e-70    Camelina sativa [gold-of-pleasure]
gb|EEC69137.1|  hypothetical protein OsI_38063                          236   1e-70    Oryza sativa Indica Group [Indian rice]
gb|KFK25871.1|  hypothetical protein AALP_AA8G173100                    231   1e-69    Arabis alpina [alpine rockcress]
gb|KFK25872.1|  hypothetical protein AALP_AA8G173100                    232   6e-69    Arabis alpina [alpine rockcress]
ref|XP_001768387.1|  predicted protein                                  221   1e-65    
ref|XP_006480414.1|  PREDICTED: zinc finger CCCH domain-containin...    217   4e-63    
ref|XP_010929828.1|  PREDICTED: zinc finger CCCH domain-containin...    213   6e-62    
gb|KJB26822.1|  hypothetical protein B456_004G261700                    212   9e-62    Gossypium raimondii
ref|XP_006606434.1|  PREDICTED: zinc finger CCCH domain-containin...    203   2e-58    Glycine max [soybeans]
ref|XP_002993272.1|  hypothetical protein SELMODRAFT_45667              200   4e-58    
ref|XP_002993790.1|  hypothetical protein SELMODRAFT_45658              200   5e-58    
ref|XP_010523985.1|  PREDICTED: zinc finger CCCH domain-containin...    204   9e-58    Tarenaya hassleriana [spider flower]
ref|XP_010545037.1|  PREDICTED: zinc finger CCCH domain-containin...    202   4e-57    Tarenaya hassleriana [spider flower]
ref|XP_010243539.1|  PREDICTED: zinc finger CCCH domain-containin...    202   6e-57    Nelumbo nucifera [Indian lotus]
gb|KJB23207.1|  hypothetical protein B456_004G086700                    202   6e-57    Gossypium raimondii
ref|XP_010241841.1|  PREDICTED: zinc finger CCCH domain-containin...    202   7e-57    Nelumbo nucifera [Indian lotus]
ref|XP_006855486.1|  PREDICTED: zinc finger CCCH domain-containin...    201   1e-56    Amborella trichopoda
gb|KHG22563.1|  hypothetical protein F383_29382                         201   2e-56    Gossypium arboreum [tree cotton]
gb|ACL54765.1|  unknown                                                 192   4e-56    Zea mays [maize]
gb|KJB82176.1|  hypothetical protein B456_013G179800                    198   4e-56    Gossypium raimondii
gb|KJB22541.1|  hypothetical protein B456_004G053200                    194   5e-56    Gossypium raimondii
ref|XP_009769505.1|  PREDICTED: zinc finger CCCH domain-containin...    196   6e-56    Nicotiana sylvestris
ref|XP_007050814.1|  Zinc finger C-x8-C-x5-C-x3-H type family pro...    199   1e-55    Theobroma cacao [chocolate]
gb|KJB47069.1|  hypothetical protein B456_008G009500                    199   1e-55    Gossypium raimondii
ref|XP_009392482.1|  PREDICTED: zinc finger CCCH domain-containin...    196   1e-55    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009392481.1|  PREDICTED: zinc finger CCCH domain-containin...    196   1e-55    
gb|KEH43244.1|  zinc finger C-x8-C-x5-C-x3-H type protein               195   1e-55    Medicago truncatula
ref|XP_011018690.1|  PREDICTED: zinc finger CCCH domain-containin...    199   2e-55    Populus euphratica
gb|KEH43245.1|  zinc finger C-x8-C-x5-C-x3-H type protein               195   2e-55    Medicago truncatula
gb|KEH43243.1|  zinc finger C-x8-C-x5-C-x3-H type protein               195   2e-55    Medicago truncatula
gb|AFW84181.1|  hypothetical protein ZEAMMB73_594165                    196   2e-55    
ref|XP_009769504.1|  PREDICTED: zinc finger CCCH domain-containin...    196   2e-55    Nicotiana sylvestris
ref|XP_006380188.1|  hypothetical protein POPTR_0008s22730g             198   3e-55    Populus trichocarpa [western balsam poplar]
ref|XP_007147887.1|  hypothetical protein PHAVU_006G163300g             194   5e-55    Phaseolus vulgaris [French bean]
ref|XP_011627433.1|  PREDICTED: zinc finger CCCH domain-containin...    195   5e-55    Amborella trichopoda
ref|XP_007147888.1|  hypothetical protein PHAVU_006G163300g             194   5e-55    Phaseolus vulgaris [French bean]
ref|XP_009378917.1|  PREDICTED: LOW QUALITY PROTEIN: zinc finger ...    199   6e-55    Pyrus x bretschneideri [bai li]
gb|KJB22540.1|  hypothetical protein B456_004G053200                    194   1e-54    Gossypium raimondii
ref|XP_004495985.1|  PREDICTED: zinc finger CCCH domain-containin...    192   2e-54    Cicer arietinum [garbanzo]
ref|XP_010684493.1|  PREDICTED: zinc finger CCCH domain-containin...    195   2e-54    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006444253.1|  hypothetical protein CICLE_v10019968mg             195   2e-54    Citrus clementina [clementine]
ref|XP_009417932.1|  PREDICTED: zinc finger CCCH domain-containin...    191   4e-54    
gb|KJB41978.1|  hypothetical protein B456_007G130500                    194   5e-54    Gossypium raimondii
ref|XP_010652064.1|  PREDICTED: zinc finger CCCH domain-containin...    194   5e-54    Vitis vinifera
ref|XP_004495983.1|  PREDICTED: zinc finger CCCH domain-containin...    194   6e-54    Cicer arietinum [garbanzo]
ref|XP_010545038.1|  PREDICTED: zinc finger CCCH domain-containin...    194   6e-54    Tarenaya hassleriana [spider flower]
ref|XP_010112757.1|  Zinc finger CCCH domain-containing protein 32      194   6e-54    Morus notabilis
ref|XP_009417931.1|  PREDICTED: zinc finger CCCH domain-containin...    191   8e-54    
ref|XP_007154244.1|  hypothetical protein PHAVU_003G102600g             194   8e-54    Phaseolus vulgaris [French bean]
ref|XP_004309682.1|  PREDICTED: zinc finger CCCH domain-containin...    194   9e-54    Fragaria vesca subsp. vesca
ref|XP_007200997.1|  hypothetical protein PRUPE_ppa005229mg             194   9e-54    Prunus persica
ref|XP_012082692.1|  PREDICTED: zinc finger CCCH domain-containin...    193   1e-53    
ref|XP_011013662.1|  PREDICTED: zinc finger CCCH domain-containin...    194   1e-53    Populus euphratica
ref|XP_008235007.1|  PREDICTED: zinc finger CCCH domain-containin...    193   1e-53    Prunus mume [ume]
ref|XP_012082691.1|  PREDICTED: zinc finger CCCH domain-containin...    193   2e-53    Jatropha curcas
ref|XP_009416576.1|  PREDICTED: zinc finger CCCH domain-containin...    190   2e-53    
ref|XP_006575107.1|  PREDICTED: zinc finger CCCH domain-containin...    190   2e-53    Glycine max [soybeans]
ref|XP_002520668.1|  nucleic acid binding protein, putative             193   2e-53    Ricinus communis
ref|XP_006575106.1|  PREDICTED: zinc finger CCCH domain-containin...    190   2e-53    Glycine max [soybeans]
ref|XP_009339837.1|  PREDICTED: zinc finger CCCH domain-containin...    192   2e-53    Pyrus x bretschneideri [bai li]
ref|XP_007144549.1|  hypothetical protein PHAVU_007G165200g             189   3e-53    Phaseolus vulgaris [French bean]
ref|XP_006397979.1|  hypothetical protein EUTSA_v10001399mg             193   4e-53    
ref|NP_182306.2|  zinc finger CCCH domain-containing protein 32         192   5e-53    Arabidopsis thaliana [mouse-ear cress]
gb|ACU18099.1|  unknown                                                 185   5e-53    Glycine max [soybeans]
ref|XP_003518955.1|  PREDICTED: zinc finger CCCH domain-containin...    192   5e-53    Glycine max [soybeans]
ref|XP_009631343.1|  PREDICTED: zinc finger CCCH domain-containin...    189   8e-53    
ref|XP_007144548.1|  hypothetical protein PHAVU_007G165200g             191   9e-53    Phaseolus vulgaris [French bean]
ref|XP_006294141.1|  hypothetical protein CARUB_v10023134mg             191   1e-52    Capsella rubella
ref|XP_008389189.1|  PREDICTED: zinc finger CCCH domain-containin...    193   1e-52    Malus domestica [apple tree]
ref|XP_009417930.1|  PREDICTED: zinc finger CCCH domain-containin...    191   1e-52    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008386632.1|  PREDICTED: LOW QUALITY PROTEIN: zinc finger ...    191   1e-52    
ref|XP_003518958.1|  PREDICTED: zinc finger CCCH domain-containin...    187   1e-52    Glycine max [soybeans]
ref|XP_002314462.1|  hypothetical protein POPTR_0010s02320g             190   1e-52    Populus trichocarpa [western balsam poplar]
ref|XP_009774842.1|  PREDICTED: zinc finger CCCH domain-containin...    191   2e-52    Nicotiana sylvestris
ref|XP_004304076.1|  PREDICTED: zinc finger CCCH domain-containin...    189   2e-52    Fragaria vesca subsp. vesca
ref|XP_009588295.1|  PREDICTED: zinc finger CCCH domain-containin...    191   2e-52    Nicotiana tomentosiformis
gb|KHN46585.1|  Zinc finger CCCH domain-containing protein 32           190   2e-52    Glycine soja [wild soybean]
ref|XP_010921758.1|  PREDICTED: zinc finger CCCH domain-containin...    190   3e-52    Elaeis guineensis
ref|XP_009392483.1|  PREDICTED: zinc finger CCCH domain-containin...    187   3e-52    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_012069378.1|  PREDICTED: zinc finger CCCH domain-containin...    190   3e-52    Jatropha curcas
ref|XP_009369128.1|  PREDICTED: zinc finger CCCH domain-containin...    190   3e-52    Pyrus x bretschneideri [bai li]
ref|XP_010270053.1|  PREDICTED: zinc finger CCCH domain-containin...    189   3e-52    Nelumbo nucifera [Indian lotus]
ref|XP_009631342.1|  PREDICTED: zinc finger CCCH domain-containin...    190   3e-52    Nicotiana tomentosiformis
ref|XP_006356704.1|  PREDICTED: zinc finger CCCH domain-containin...    186   4e-52    Solanum tuberosum [potatoes]
ref|XP_006356705.1|  PREDICTED: zinc finger CCCH domain-containin...    184   4e-52    
ref|XP_011090931.1|  PREDICTED: zinc finger CCCH domain-containin...    190   4e-52    Sesamum indicum [beniseed]
ref|XP_010666382.1|  PREDICTED: zinc finger CCCH domain-containin...    189   5e-52    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002516892.1|  nucleic acid binding protein, putative             189   6e-52    Ricinus communis
ref|XP_008802110.1|  PREDICTED: zinc finger CCCH domain-containin...    189   6e-52    Phoenix dactylifera
ref|XP_009352233.1|  PREDICTED: zinc finger CCCH domain-containin...    189   6e-52    Pyrus x bretschneideri [bai li]
emb|CDP03533.1|  unnamed protein product                                188   6e-52    Coffea canephora [robusta coffee]
ref|XP_009626457.1|  PREDICTED: zinc finger CCCH domain-containin...    188   7e-52    Nicotiana tomentosiformis
ref|XP_010507840.1|  PREDICTED: zinc finger CCCH domain-containin...    188   9e-52    Camelina sativa [gold-of-pleasure]
ref|XP_003609624.1|  Zinc finger CCCH domain-containing protein         186   1e-51    
gb|KHN03379.1|  Zinc finger CCCH domain-containing protein 58           185   1e-51    Glycine soja [wild soybean]
gb|KCW58527.1|  hypothetical protein EUGRSUZ_H01196                     187   1e-51    Eucalyptus grandis [rose gum]
ref|XP_003529584.1|  PREDICTED: zinc finger CCCH domain-containin...    188   1e-51    Glycine max [soybeans]
ref|XP_003550189.1|  PREDICTED: zinc finger CCCH domain-containin...    188   2e-51    Glycine max [soybeans]
gb|KHN46586.1|  Zinc finger CCCH domain-containing protein 32           184   2e-51    Glycine soja [wild soybean]
ref|XP_009776613.1|  PREDICTED: zinc finger CCCH domain-containin...    187   2e-51    Nicotiana sylvestris
ref|XP_010558473.1|  PREDICTED: zinc finger CCCH domain-containin...    187   2e-51    Tarenaya hassleriana [spider flower]
ref|XP_010069978.1|  PREDICTED: zinc finger CCCH domain-containin...    187   2e-51    Eucalyptus grandis [rose gum]
ref|XP_004508292.1|  PREDICTED: zinc finger CCCH domain-containin...    187   2e-51    Cicer arietinum [garbanzo]
ref|XP_006356703.1|  PREDICTED: zinc finger CCCH domain-containin...    185   3e-51    
ref|XP_006356701.1|  PREDICTED: zinc finger CCCH domain-containin...    185   3e-51    Solanum tuberosum [potatoes]
gb|EPS74440.1|  hypothetical protein M569_00316                         184   4e-51    Genlisea aurea
gb|AES91820.2|  zinc finger C-x8-C-x5-C-x3-H type protein               187   5e-51    Medicago truncatula
ref|XP_008340827.1|  PREDICTED: zinc finger CCCH domain-containin...    186   6e-51    
ref|XP_006366677.1|  PREDICTED: zinc finger CCCH domain-containin...    184   6e-51    Solanum tuberosum [potatoes]
ref|XP_008796233.1|  PREDICTED: zinc finger CCCH domain-containin...    183   6e-51    
ref|XP_010666383.1|  PREDICTED: zinc finger CCCH domain-containin...    186   6e-51    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006359417.1|  PREDICTED: zinc finger CCCH domain-containin...    185   8e-51    Solanum tuberosum [potatoes]
ref|XP_011071464.1|  PREDICTED: zinc finger CCCH domain-containin...    186   9e-51    Sesamum indicum [beniseed]
ref|XP_010037077.1|  PREDICTED: zinc finger CCCH domain-containin...    185   1e-50    Eucalyptus grandis [rose gum]
ref|XP_004296815.1|  PREDICTED: zinc finger CCCH domain-containin...    186   1e-50    Fragaria vesca subsp. vesca
ref|XP_008223126.1|  PREDICTED: zinc finger CCCH domain-containin...    186   1e-50    
ref|XP_009626545.1|  PREDICTED: zinc finger CCCH domain-containin...    182   1e-50    
ref|XP_007222805.1|  hypothetical protein PRUPE_ppa005056mg             186   1e-50    
ref|XP_004247451.2|  PREDICTED: LOW QUALITY PROTEIN: zinc finger ...    185   1e-50    
gb|ABR16930.1|  unknown                                                 186   2e-50    
gb|KDO75085.1|  hypothetical protein CISIN_1g0118532mg                  182   2e-50    
ref|XP_009802826.1|  PREDICTED: zinc finger CCCH domain-containin...    185   2e-50    
ref|XP_008438828.1|  PREDICTED: zinc finger CCCH domain-containin...    185   2e-50    
ref|XP_003609623.1|  Zinc finger CCCH domain-containing protein         186   2e-50    
ref|XP_009416575.1|  PREDICTED: zinc finger CCCH domain-containin...    182   3e-50    
gb|KDO75084.1|  hypothetical protein CISIN_1g0118532mg                  182   3e-50    
ref|XP_008796231.1|  PREDICTED: zinc finger CCCH domain-containin...    184   3e-50    
gb|AAC63639.1|  unknown protein                                         186   4e-50    
ref|XP_004486037.1|  PREDICTED: zinc finger CCCH domain-containin...    184   4e-50    
ref|XP_009626544.1|  PREDICTED: zinc finger CCCH domain-containin...    182   4e-50    
ref|XP_010252578.1|  PREDICTED: zinc finger CCCH domain-containin...    183   4e-50    
ref|XP_009365130.1|  PREDICTED: zinc finger CCCH domain-containin...    184   5e-50    
ref|XP_007215353.1|  hypothetical protein PRUPE_ppa005469mg             183   6e-50    
ref|XP_002528968.1|  zinc finger protein, putative                      183   7e-50    
ref|XP_002880326.1|  zinc finger (CCCH-type) family protein             183   7e-50    
ref|XP_004240519.2|  PREDICTED: LOW QUALITY PROTEIN: zinc finger ...    182   7e-50    
ref|XP_008229811.1|  PREDICTED: zinc finger CCCH domain-containin...    183   8e-50    
ref|XP_006419655.1|  hypothetical protein CICLE_v10004882mg             183   8e-50    
ref|XP_008379695.1|  PREDICTED: zinc finger CCCH domain-containin...    183   9e-50    
gb|KHN03740.1|  Zinc finger CCCH domain-containing protein 32           182   9e-50    
ref|XP_006342757.1|  PREDICTED: zinc finger CCCH domain-containin...    183   1e-49    
ref|XP_011007757.1|  PREDICTED: zinc finger CCCH domain-containin...    182   1e-49    
ref|XP_010322275.1|  PREDICTED: zinc finger CCCH domain-containin...    181   1e-49    
ref|XP_010322276.1|  PREDICTED: zinc finger CCCH domain-containin...    181   1e-49    
ref|XP_006359420.1|  PREDICTED: zinc finger CCCH domain-containin...    182   1e-49    
ref|XP_004241158.2|  PREDICTED: zinc finger CCCH domain-containin...    181   1e-49    
ref|XP_004134198.1|  PREDICTED: zinc finger CCCH domain-containin...    182   2e-49    
emb|CDO98891.1|  unnamed protein product                                183   2e-49    
gb|EYU45569.1|  hypothetical protein MIMGU_mgv1a006413mg                182   2e-49    
ref|XP_004229205.1|  PREDICTED: zinc finger CCCH domain-containin...    182   2e-49    
ref|XP_006597530.1|  PREDICTED: zinc finger CCCH domain-containin...    182   2e-49    
gb|KHG04581.1|  hypothetical protein F383_30084                         179   2e-49    
gb|KDO59557.1|  hypothetical protein CISIN_1g013033mg                   181   2e-49    
ref|XP_002320490.1|  ZINC FINGER protein 2                              181   2e-49    
ref|XP_008353591.1|  PREDICTED: zinc finger CCCH domain-containin...    181   3e-49    
gb|EYU46719.1|  hypothetical protein MIMGU_mgv1a008599mg                179   3e-49    
gb|EYU46720.1|  hypothetical protein MIMGU_mgv1a008599mg                179   3e-49    
ref|XP_008342144.1|  PREDICTED: zinc finger CCCH domain-containin...    181   3e-49    
ref|XP_009391577.1|  PREDICTED: LOW QUALITY PROTEIN: zinc finger ...    181   3e-49    
gb|EYU46718.1|  hypothetical protein MIMGU_mgv1a008599mg                179   4e-49    
ref|XP_006447662.1|  hypothetical protein CICLE_v10015215mg             181   4e-49    
ref|XP_010110220.1|  Zinc finger CCCH domain-containing protein 3       181   5e-49    
ref|XP_010938478.1|  PREDICTED: zinc finger CCCH domain-containin...    181   5e-49    
gb|EYU43920.1|  hypothetical protein MIMGU_mgv1a0053871mg               178   7e-49    
gb|EPS71438.1|  hypothetical protein M569_03319                         180   7e-49    
gb|KHF99697.1|  hypothetical protein F383_18975                         181   7e-49    
ref|XP_002302855.1|  ZINC FINGER protein 2                              179   2e-48    
ref|XP_003593956.1|  Zinc finger CCCH domain-containing protein         180   2e-48    
ref|XP_009126264.1|  PREDICTED: zinc finger CCCH domain-containin...    179   2e-48    
gb|KHG07834.1|  hypothetical protein F383_35307                         179   2e-48    
emb|CDY13900.1|  BnaC09g39260D                                          178   3e-48    
ref|XP_009802825.1|  PREDICTED: zinc finger CCCH domain-containin...    179   4e-48    
gb|KHN47309.1|  Zinc finger CCCH domain-containing protein 32           179   4e-48    
ref|XP_003541660.1|  PREDICTED: zinc finger CCCH domain-containin...    179   4e-48    
gb|ABR16973.1|  unknown                                                 178   8e-48    
ref|XP_006296584.1|  hypothetical protein CARUB_v100138730mg            174   8e-48    
ref|XP_009120963.1|  PREDICTED: zinc finger CCCH domain-containin...    177   8e-48    
ref|XP_010524751.1|  PREDICTED: zinc finger CCCH domain-containin...    177   8e-48    
emb|CDX92600.1|  BnaA10g16390D                                          177   1e-47    
emb|CDX70825.1|  BnaC03g09090D                                          176   1e-47    
gb|KJB72635.1|  hypothetical protein B456_011G188400                    175   1e-47    
emb|CDX88932.1|  BnaA03g07170D                                          176   1e-47    
dbj|BAD87736.1|  putative zinc finger protein                           173   2e-47    
ref|XP_004143196.1|  PREDICTED: zinc finger CCCH domain-containin...    176   2e-47    
ref|XP_008456401.1|  PREDICTED: zinc finger CCCH domain-containin...    176   2e-47    
ref|XP_008803514.1|  PREDICTED: zinc finger CCCH domain-containin...    176   3e-47    
ref|XP_008803515.1|  PREDICTED: zinc finger CCCH domain-containin...    176   3e-47    
ref|XP_008803512.1|  PREDICTED: zinc finger CCCH domain-containin...    176   3e-47    
ref|XP_007049198.1|  Zinc finger C-x8-C-x5-C-x3-H type family pro...    173   4e-47    
ref|XP_011008920.1|  PREDICTED: zinc finger CCCH domain-containin...    176   4e-47    
gb|KJB72632.1|  hypothetical protein B456_011G188400                    176   5e-47    
ref|XP_006287665.1|  hypothetical protein CARUB_v10000876mg             176   5e-47    
gb|KFK26093.1|  hypothetical protein AALP_AA8G202000                    175   5e-47    
ref|XP_002275775.1|  PREDICTED: zinc finger CCCH domain-containin...    175   7e-47    
ref|XP_009142498.1|  PREDICTED: zinc finger CCCH domain-containin...    175   7e-47    
ref|XP_008803513.1|  PREDICTED: zinc finger CCCH domain-containin...    175   7e-47    
ref|XP_009131673.1|  PREDICTED: zinc finger CCCH domain-containin...    174   7e-47    
ref|XP_009142499.1|  PREDICTED: zinc finger CCCH domain-containin...    175   7e-47    
gb|ERM96915.1|  hypothetical protein AMTR_s00074p00110430               170   7e-47    
ref|XP_010649761.1|  PREDICTED: zinc finger CCCH domain-containin...    173   1e-46    
gb|KGN57087.1|  hypothetical protein Csa_3G152140                       175   1e-46    
emb|CDY02619.1|  BnaC02g08160D                                          173   1e-46    
ref|XP_009131674.1|  PREDICTED: zinc finger CCCH domain-containin...    173   1e-46    
emb|CDX80137.1|  BnaA05g00190D                                          174   2e-46    
ref|XP_007049197.1|  Zinc finger C-x8-C-x5-C-x3-H type family pro...    174   2e-46    
ref|XP_002276435.1|  PREDICTED: zinc finger CCCH domain-containin...    174   2e-46    
gb|KHG30243.1|  Zinc finger CCCH domain-containing protein ZFN-li...    171   2e-46    
gb|KHG01635.1|  hypothetical protein F383_21492                         173   2e-46    
gb|EYU22370.1|  hypothetical protein MIMGU_mgv1a005385mg                174   2e-46    
gb|KJB12614.1|  hypothetical protein B456_002G027000                    174   3e-46    
ref|NP_197356.2|  zinc finger CCCH domain-containing protein 58         174   3e-46    
ref|XP_010457569.1|  PREDICTED: zinc finger CCCH domain-containin...    172   4e-46    
emb|CDY53022.1|  BnaC04g00080D                                          173   5e-46    
ref|XP_007035523.1|  Zinc finger C-x8-C-x5-C-x3-H type family pro...    173   5e-46    
emb|CAN76191.1|  hypothetical protein VITISV_020358                     172   6e-46    
gb|KJB08677.1|  hypothetical protein B456_001G097100                    172   7e-46    
gb|KJB08672.1|  hypothetical protein B456_001G096900                    171   1e-45    
emb|CAN78551.1|  hypothetical protein VITISV_003243                     172   1e-45    
gb|KHG06790.1|  hypothetical protein F383_05075                         171   1e-45    
gb|KJB08671.1|  hypothetical protein B456_001G096900                    171   2e-45    
ref|XP_009411695.1|  PREDICTED: zinc finger CCCH domain-containin...    171   2e-45    
gb|KFK31098.1|  hypothetical protein AALP_AA6G067900                    171   2e-45    
ref|XP_010556971.1|  PREDICTED: zinc finger CCCH domain-containin...    171   2e-45    
gb|KJB08673.1|  hypothetical protein B456_001G096900                    171   2e-45    
ref|XP_002892258.1|  predicted protein                                  170   2e-45    
ref|XP_010532994.1|  PREDICTED: zinc finger CCCH domain-containin...    169   2e-45    
gb|KJB08674.1|  hypothetical protein B456_001G096900                    171   2e-45    
gb|KJB10318.1|  hypothetical protein B456_001G195600                    166   2e-45    
emb|CDX95738.1|  BnaC03g26190D                                          170   2e-45    
ref|XP_010475174.1|  PREDICTED: zinc finger CCCH domain-containin...    170   3e-45    
ref|XP_008777782.1|  PREDICTED: zinc finger CCCH domain-containin...    165   3e-45    
ref|XP_006852277.1|  PREDICTED: zinc finger CCCH domain-containin...    169   3e-45    
ref|XP_010522373.1|  PREDICTED: zinc finger CCCH domain-containin...    169   3e-45    
ref|XP_010943246.1|  PREDICTED: zinc finger CCCH domain-containin...    170   3e-45    
ref|XP_011629168.1|  PREDICTED: zinc finger CCCH domain-containin...    171   4e-45    
ref|XP_010943244.1|  PREDICTED: zinc finger CCCH domain-containin...    170   4e-45    
ref|XP_006829499.2|  PREDICTED: zinc finger CCCH domain-containin...    170   4e-45    
ref|XP_010542997.1|  PREDICTED: zinc finger CCCH domain-containin...    169   4e-45    
ref|XP_010484523.1|  PREDICTED: zinc finger CCCH domain-containin...    169   4e-45    
ref|XP_009418525.1|  PREDICTED: zinc finger CCCH domain-containin...    167   5e-45    
ref|NP_563725.1|  zinc finger CCCH domain-containing protein 3          169   6e-45    
gb|KJB10314.1|  hypothetical protein B456_001G195600                    167   7e-45    
gb|KHG05173.1|  hypothetical protein F383_31227                         169   7e-45    
ref|XP_010454106.1|  PREDICTED: zinc finger CCCH domain-containin...    169   1e-44    
ref|XP_008799408.1|  PREDICTED: zinc finger CCCH domain-containin...    169   1e-44    
ref|XP_008355482.1|  PREDICTED: LOW QUALITY PROTEIN: zinc finger ...    166   1e-44    
ref|XP_009133833.1|  PREDICTED: zinc finger CCCH domain-containin...    168   2e-44    
emb|CDY58107.1|  BnaA02g35100D                                          168   2e-44    
ref|XP_010532995.1|  PREDICTED: zinc finger CCCH domain-containin...    167   2e-44    
ref|XP_009418524.1|  PREDICTED: zinc finger CCCH domain-containin...    167   2e-44    
gb|KJB28621.1|  hypothetical protein B456_005G058800                    168   2e-44    
ref|XP_010024648.1|  PREDICTED: zinc finger CCCH domain-containin...    168   3e-44    
ref|XP_006400404.1|  hypothetical protein EUTSA_v10013460mg             168   3e-44    
ref|XP_010024647.1|  PREDICTED: zinc finger CCCH domain-containin...    168   4e-44    
ref|XP_009132897.1|  PREDICTED: zinc finger CCCH domain-containin...    167   4e-44    
gb|KJB10313.1|  hypothetical protein B456_001G195600                    167   5e-44    
ref|XP_002871822.1|  hypothetical protein ARALYDRAFT_488738             167   5e-44    
ref|XP_006407949.1|  hypothetical protein EUTSA_v10020686mg             167   5e-44    
gb|KJB10316.1|  hypothetical protein B456_001G195600                    167   6e-44    
ref|XP_011085489.1|  PREDICTED: zinc finger CCCH domain-containin...    166   8e-44    
ref|XP_011085488.1|  PREDICTED: zinc finger CCCH domain-containin...    166   8e-44    
ref|XP_003616871.1|  Zinc finger CCCH domain-containing protein         166   8e-44    
ref|XP_010513101.1|  PREDICTED: zinc finger CCCH domain-containin...    164   9e-44    
gb|KFK42845.1|  hypothetical protein AALP_AA1G046700                    166   9e-44    
emb|CDX79496.1|  BnaC03g18320D                                          165   1e-43    
ref|XP_002881253.1|  hypothetical protein ARALYDRAFT_345050             166   1e-43    
ref|XP_010454104.1|  PREDICTED: zinc finger CCCH domain-containin...    166   1e-43    
ref|XP_011085490.1|  PREDICTED: zinc finger CCCH domain-containin...    165   1e-43    
ref|XP_004491091.1|  PREDICTED: zinc finger CCCH domain-containin...    165   3e-43    
ref|XP_010270055.1|  PREDICTED: zinc finger CCCH domain-containin...    163   3e-43    
ref|XP_010492867.1|  PREDICTED: zinc finger CCCH domain-containin...    165   4e-43    
ref|XP_009394545.1|  PREDICTED: zinc finger CCCH domain-containin...    164   5e-43    
ref|XP_009119217.1|  PREDICTED: zinc finger CCCH domain-containin...    164   5e-43    
gb|KFK38099.1|  hypothetical protein AALP_AA3G069300                    164   5e-43    
ref|XP_010492866.1|  PREDICTED: zinc finger CCCH domain-containin...    165   5e-43    
emb|CDY53399.1|  BnaAnng12470D                                          164   5e-43    
ref|XP_007141660.1|  hypothetical protein PHAVU_008G214600g             164   6e-43    
ref|XP_007141661.1|  hypothetical protein PHAVU_008G214600g             164   6e-43    
gb|ACF80171.1|  unknown                                                 161   6e-43    
ref|XP_010928414.1|  PREDICTED: zinc finger CCCH domain-containin...    164   6e-43    
ref|XP_011100472.1|  PREDICTED: zinc finger CCCH domain-containin...    163   8e-43    
emb|CDY18279.1|  BnaC05g03020D                                          163   9e-43    
ref|XP_010546927.1|  PREDICTED: zinc finger CCCH domain-containin...    164   9e-43    
ref|XP_006294179.1|  hypothetical protein CARUB_v10023174mg             164   1e-42    
ref|XP_011100471.1|  PREDICTED: zinc finger CCCH domain-containin...    163   1e-42    
ref|XP_010469532.1|  PREDICTED: zinc finger CCCH domain-containin...    163   1e-42    
ref|XP_010413928.1|  PREDICTED: zinc finger CCCH domain-containin...    163   1e-42    
ref|XP_006418072.1|  hypothetical protein EUTSA_v10007912mg             162   1e-42    
ref|XP_010420624.1|  PREDICTED: zinc finger CCCH domain-containin...    163   2e-42    
ref|XP_010420626.1|  PREDICTED: zinc finger CCCH domain-containin...    163   2e-42    
ref|XP_009385235.1|  PREDICTED: zinc finger CCCH domain-containin...    162   2e-42    
gb|AAF08587.1|AC011623_20  hypothetical protein                         162   3e-42    
ref|XP_009124921.1|  PREDICTED: zinc finger CCCH domain-containin...    161   3e-42    
ref|NP_187292.2|  zinc finger CCCH domain-containing protein 34         162   3e-42    
emb|CDY19169.1|  BnaA04g19090D                                          161   4e-42    
dbj|BAF02113.1|  hypothetical protein                                   162   4e-42    
ref|XP_009141281.1|  PREDICTED: zinc finger CCCH domain-containin...    161   5e-42    
ref|XP_003519444.1|  PREDICTED: zinc finger CCCH domain-containin...    161   6e-42    
ref|XP_009124920.1|  PREDICTED: zinc finger CCCH domain-containin...    161   7e-42    
gb|KHN38500.1|  Zinc finger CCCH domain-containing protein 3            161   7e-42    
emb|CDY23780.1|  BnaC04g43420D                                          161   1e-41    
ref|XP_006297647.1|  hypothetical protein CARUB_v10013665mg             161   1e-41    
ref|XP_006595836.1|  PREDICTED: zinc finger CCCH domain-containin...    160   2e-41    
ref|XP_003545603.1|  PREDICTED: zinc finger CCCH domain-containin...    160   2e-41    
ref|XP_009415456.1|  PREDICTED: zinc finger CCCH domain-containin...    160   2e-41    
ref|XP_002884577.1|  hypothetical protein ARALYDRAFT_477944             160   2e-41    
ref|XP_010546925.1|  PREDICTED: zinc finger CCCH domain-containin...    160   2e-41    
ref|XP_010688921.1|  PREDICTED: zinc finger CCCH domain-containin...    160   2e-41    
ref|XP_010688919.1|  PREDICTED: zinc finger CCCH domain-containin...    160   2e-41    
emb|CBI17646.3|  unnamed protein product                                150   3e-41    
emb|CDX74105.1|  BnaA03g29420D                                          160   3e-41    
ref|XP_009134895.1|  PREDICTED: zinc finger CCCH domain-containin...    160   3e-41    
ref|XP_009143918.1|  PREDICTED: zinc finger CCCH domain-containin...    160   3e-41    
ref|XP_006307705.1|  hypothetical protein CARUB_v10009335mg             158   5e-41    
gb|KHN44751.1|  Zinc finger CCCH domain-containing protein 3            158   6e-41    
emb|CDY18858.1|  BnaAnng03230D                                          158   7e-41    
ref|XP_011015734.1|  PREDICTED: zinc finger CCCH domain-containin...    149   1e-40    
emb|CDY08054.1|  BnaC03g34690D                                          157   2e-40    
ref|XP_011015733.1|  PREDICTED: zinc finger CCCH domain-containin...    149   2e-40    
ref|XP_010248777.1|  PREDICTED: zinc finger CCCH domain-containin...    157   2e-40    
ref|XP_009415603.1|  PREDICTED: zinc finger CCCH domain-containin...    156   2e-40    
tpg|DAA54001.1|  TPA: hypothetical protein ZEAMMB73_676626              153   3e-40    
gb|AAF40461.1|AC004809_19  Contains similarity to zinc finger pro...    155   3e-40    
ref|XP_010426337.1|  PREDICTED: zinc finger CCCH domain-containin...    157   4e-40    
ref|XP_010248778.1|  PREDICTED: zinc finger CCCH domain-containin...    157   4e-40    
ref|XP_002457593.1|  hypothetical protein SORBIDRAFT_03g009930          157   4e-40    
gb|AGT16495.1|  zinc finger CCCH type domain-containing protein         157   5e-40    
ref|XP_003566542.1|  PREDICTED: zinc finger CCCH domain-containin...    157   5e-40    
ref|NP_190414.1|  zinc finger CCCH domain-containing protein 43         156   5e-40    
ref|NP_001150480.1|  LOC100284111                                       156   6e-40    
ref|XP_002875904.1|  zinc finger (CCCH-type) family protein             156   6e-40    
gb|ACN33323.1|  unknown                                                 156   7e-40    
ref|XP_009803257.1|  PREDICTED: zinc finger CCCH domain-containin...    156   8e-40    
ref|XP_010464213.1|  PREDICTED: zinc finger CCCH domain-containin...    156   9e-40    
ref|XP_010439690.1|  PREDICTED: zinc finger CCCH domain-containin...    156   9e-40    
emb|CBI17647.3|  unnamed protein product                                152   1e-39    



>ref|XP_009611380.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X4 [Nicotiana tomentosiformis]
Length=433

 Score =   339 bits (870),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 163/195 (84%), Positives = 175/195 (90%), Gaps = 5/195 (3%)
 Frame = +1

Query  367  MDFEAAAGISASMASVTEGPSSLSPPLAQETLWQLSLRSMETMESGTYPVRDGEPDCSYY  546
            MDF+A  GIS S   VTEGPSSLSP L Q+TLWQ++LRS E++ESG YPVR+GEPDCSYY
Sbjct  1    MDFDA--GISLS---VTEGPSSLSPSLDQDTLWQMNLRSRESIESGHYPVREGEPDCSYY  55

Query  547  IRTGLCRFGASCRFNHPSNRKLAIAAARMKGEYPERVGQPECQYYLKTGACKFGATCKFH  726
            IRTGLCRFG++CRFNHP NRKLAIA ARMKGEYPER+GQPECQYYLKTG CKFGATCKFH
Sbjct  56   IRTGLCRFGSTCRFNHPPNRKLAIATARMKGEYPERMGQPECQYYLKTGTCKFGATCKFH  115

Query  727  HPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGS  906
            HP+DKAGIAGRV LNVLGYPLRPN+ EC YYMRTGQCKFGSTCKFHHPQPSNMMV LRGS
Sbjct  116  HPKDKAGIAGRVTLNVLGYPLRPNEAECAYYMRTGQCKFGSTCKFHHPQPSNMMVSLRGS  175

Query  907  PAYPPVHSPTTPGQL  951
            P YPPV S TTPGQL
Sbjct  176  PVYPPVPSATTPGQL  190


 Score = 99.8 bits (247),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 45/92 (49%), Positives = 61/92 (66%), Gaps = 0/92 (0%)
 Frame = +1

Query  595  PSNRKLAIAAARMKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNV  774
            P++  +   A + +  +PER GQPECQ+Y+KTG CKFGA C+FHHPR++        L+ 
Sbjct  273  PASVPMGYYALQGENVFPERHGQPECQFYMKTGDCKFGAVCRFHHPRERLIPPPDCMLSP  332

Query  775  LGYPLRPNDIECPYYMRTGQCKFGSTCKFHHP  870
            +G PLRP +  C +Y R G CKFG +CKF HP
Sbjct  333  IGLPLRPGEPLCIFYSRYGICKFGPSCKFDHP  364


 Score = 76.3 bits (186),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 34/77 (44%), Positives = 48/77 (62%), Gaps = 1/77 (1%)
 Frame = +1

Query  505  TYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKG-EYPERVGQPECQYY  681
             +P R G+P+C +Y++TG C+FGA CRF+HP  R +      +     P R G+P C +Y
Sbjct  288  VFPERHGQPECQFYMKTGDCKFGAVCRFHHPRERLIPPPDCMLSPIGLPLRPGEPLCIFY  347

Query  682  LKTGACKFGATCKFHHP  732
             + G CKFG +CKF HP
Sbjct  348  SRYGICKFGPSCKFDHP  364



>ref|XP_009793876.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
[Nicotiana sylvestris]
Length=433

 Score =   339 bits (869),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 163/195 (84%), Positives = 175/195 (90%), Gaps = 5/195 (3%)
 Frame = +1

Query  367  MDFEAAAGISASMASVTEGPSSLSPPLAQETLWQLSLRSMETMESGTYPVRDGEPDCSYY  546
            MDF+A  GIS S   VTEGPSSLSP L Q+TLWQ++LRS E++ESG YPVR+GEPDCSYY
Sbjct  1    MDFDA--GISLS---VTEGPSSLSPSLDQDTLWQMNLRSRESIESGHYPVREGEPDCSYY  55

Query  547  IRTGLCRFGASCRFNHPSNRKLAIAAARMKGEYPERVGQPECQYYLKTGACKFGATCKFH  726
            IRTGLCRFG++CRFNHP NRKLAIA ARMKGEYPER+GQPECQYYLKTG CKFGATCKFH
Sbjct  56   IRTGLCRFGSTCRFNHPPNRKLAIATARMKGEYPERMGQPECQYYLKTGTCKFGATCKFH  115

Query  727  HPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGS  906
            HP+DKAGIAGRV LNVLGYPLRPN+ EC YYMRTGQCKFGSTCKFHHPQPSNMMV LRGS
Sbjct  116  HPKDKAGIAGRVTLNVLGYPLRPNEAECAYYMRTGQCKFGSTCKFHHPQPSNMMVSLRGS  175

Query  907  PAYPPVHSPTTPGQL  951
            P YPPV S TTPGQL
Sbjct  176  PTYPPVPSATTPGQL  190


 Score =   100 bits (248),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 45/92 (49%), Positives = 61/92 (66%), Gaps = 0/92 (0%)
 Frame = +1

Query  595  PSNRKLAIAAARMKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNV  774
            P++  +   A + +  +PER GQPECQ+Y+KTG CKFGA C+FHHPR++        L+ 
Sbjct  273  PASVPMGYYALQGENVFPERPGQPECQFYMKTGDCKFGAVCRFHHPRERLIPPPDCMLSP  332

Query  775  LGYPLRPNDIECPYYMRTGQCKFGSTCKFHHP  870
            +G PLRP +  C +Y R G CKFG +CKF HP
Sbjct  333  IGLPLRPGEPLCIFYSRYGICKFGPSCKFDHP  364


 Score = 76.3 bits (186),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 34/77 (44%), Positives = 48/77 (62%), Gaps = 1/77 (1%)
 Frame = +1

Query  505  TYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKG-EYPERVGQPECQYY  681
             +P R G+P+C +Y++TG C+FGA CRF+HP  R +      +     P R G+P C +Y
Sbjct  288  VFPERPGQPECQFYMKTGDCKFGAVCRFHHPRERLIPPPDCMLSPIGLPLRPGEPLCIFY  347

Query  682  LKTGACKFGATCKFHHP  732
             + G CKFG +CKF HP
Sbjct  348  SRYGICKFGPSCKFDHP  364



>ref|XP_006353234.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
[Solanum tuberosum]
Length=433

 Score =   338 bits (867),  Expect = 8e-110, Method: Compositional matrix adjust.
 Identities = 161/195 (83%), Positives = 175/195 (90%), Gaps = 5/195 (3%)
 Frame = +1

Query  367  MDFEAAAGISASMASVTEGPSSLSPPLAQETLWQLSLRSMETMESGTYPVRDGEPDCSYY  546
            MDF+A  GIS S   VTEGPSSLSP L Q+TLWQ++LRS +++ESG YPVR+GEPDCSYY
Sbjct  1    MDFDA--GISLS---VTEGPSSLSPSLDQDTLWQMNLRSRDSIESGHYPVREGEPDCSYY  55

Query  547  IRTGLCRFGASCRFNHPSNRKLAIAAARMKGEYPERVGQPECQYYLKTGACKFGATCKFH  726
            IRTGLCRFG++CRFNHP NRKLAIA ARMKGEYPER+GQPECQY+LKTG CKFGATCKFH
Sbjct  56   IRTGLCRFGSTCRFNHPPNRKLAIATARMKGEYPERIGQPECQYFLKTGTCKFGATCKFH  115

Query  727  HPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGS  906
            HP+DKAGIAGRV LNVLGYPLRPN+ EC YYMRTGQCKFGSTCKFHHPQPSNMMV LRGS
Sbjct  116  HPKDKAGIAGRVTLNVLGYPLRPNESECAYYMRTGQCKFGSTCKFHHPQPSNMMVSLRGS  175

Query  907  PAYPPVHSPTTPGQL  951
            P YPPV S TTPGQL
Sbjct  176  PVYPPVPSATTPGQL  190


 Score = 92.8 bits (229),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 43/82 (52%), Positives = 56/82 (68%), Gaps = 2/82 (2%)
 Frame = +1

Query  631  MKGE--YPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDI  804
            ++GE  +PER GQ ECQ+Y+KTG CKFGA C+FHHPR++        L+ +G PLR  + 
Sbjct  283  LQGENVFPERPGQAECQFYMKTGDCKFGAVCRFHHPRERLIPPPDCLLSPIGLPLRTGEP  342

Query  805  ECPYYMRTGQCKFGSTCKFHHP  870
             C +Y R G CKFG +CKF HP
Sbjct  343  LCIFYSRYGICKFGPSCKFDHP  364


 Score = 73.9 bits (180),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 33/77 (43%), Positives = 47/77 (61%), Gaps = 1/77 (1%)
 Frame = +1

Query  505  TYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKG-EYPERVGQPECQYY  681
             +P R G+ +C +Y++TG C+FGA CRF+HP  R +      +     P R G+P C +Y
Sbjct  288  VFPERPGQAECQFYMKTGDCKFGAVCRFHHPRERLIPPPDCLLSPIGLPLRTGEPLCIFY  347

Query  682  LKTGACKFGATCKFHHP  732
             + G CKFG +CKF HP
Sbjct  348  SRYGICKFGPSCKFDHP  364


 Score = 52.0 bits (123),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 25/50 (50%), Positives = 32/50 (64%), Gaps = 5/50 (10%)
 Frame = +1

Query  733  RDKAGIAGRVAL---NVLGYPLRPNDIECPYYMRTGQCKFGSTCKFHHPQ  873
            R  +G  G  AL   NV  +P RP   EC +YM+TG CKFG+ C+FHHP+
Sbjct  272  RQASGPMGYYALQGENV--FPERPGQAECQFYMKTGDCKFGAVCRFHHPR  319



>ref|XP_004250094.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
[Solanum lycopersicum]
Length=433

 Score =   337 bits (863),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 160/195 (82%), Positives = 175/195 (90%), Gaps = 5/195 (3%)
 Frame = +1

Query  367  MDFEAAAGISASMASVTEGPSSLSPPLAQETLWQLSLRSMETMESGTYPVRDGEPDCSYY  546
            MDF+A  GIS S   VTEGPSSLSP L Q+TLWQ++LRS +++ESG YPVR+GEPDCSYY
Sbjct  1    MDFDA--GISLS---VTEGPSSLSPSLDQDTLWQMNLRSRDSIESGHYPVREGEPDCSYY  55

Query  547  IRTGLCRFGASCRFNHPSNRKLAIAAARMKGEYPERVGQPECQYYLKTGACKFGATCKFH  726
            IRTGLCRFG++CRFNHP NRKLAIA ARMKGEYPER+GQPECQY+LKTG CKFGATCKFH
Sbjct  56   IRTGLCRFGSTCRFNHPPNRKLAIATARMKGEYPERIGQPECQYFLKTGTCKFGATCKFH  115

Query  727  HPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGS  906
            HP+DKAGIAGRV LNV+GYPLRPN+ EC YYMRTGQCKFGSTCKFHHPQPSNMMV LRGS
Sbjct  116  HPKDKAGIAGRVTLNVMGYPLRPNESECAYYMRTGQCKFGSTCKFHHPQPSNMMVSLRGS  175

Query  907  PAYPPVHSPTTPGQL  951
            P YPPV S TTPGQL
Sbjct  176  PVYPPVPSATTPGQL  190


 Score = 99.0 bits (245),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 44/83 (53%), Positives = 57/83 (69%), Gaps = 0/83 (0%)
 Frame = +1

Query  622  AARMKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPND  801
            A + +  +PER GQPECQ+Y+KTG CKFGA C+FHHPR++        L+ +G PLRP +
Sbjct  282  ALQEENVFPERPGQPECQFYMKTGDCKFGAVCRFHHPRERLIPPPDCLLSPIGLPLRPGE  341

Query  802  IECPYYMRTGQCKFGSTCKFHHP  870
              C +Y R G CKFG +CKF HP
Sbjct  342  PLCIFYSRYGICKFGPSCKFDHP  364


 Score = 77.4 bits (189),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 35/80 (44%), Positives = 49/80 (61%), Gaps = 1/80 (1%)
 Frame = +1

Query  496  ESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKG-EYPERVGQPEC  672
            E   +P R G+P+C +Y++TG C+FGA CRF+HP  R +      +     P R G+P C
Sbjct  285  EENVFPERPGQPECQFYMKTGDCKFGAVCRFHHPRERLIPPPDCLLSPIGLPLRPGEPLC  344

Query  673  QYYLKTGACKFGATCKFHHP  732
             +Y + G CKFG +CKF HP
Sbjct  345  IFYSRYGICKFGPSCKFDHP  364


 Score = 50.8 bits (120),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 25/50 (50%), Positives = 32/50 (64%), Gaps = 5/50 (10%)
 Frame = +1

Query  733  RDKAGIAGRVAL---NVLGYPLRPNDIECPYYMRTGQCKFGSTCKFHHPQ  873
            R  +G  G  AL   NV  +P RP   EC +YM+TG CKFG+ C+FHHP+
Sbjct  272  RQASGPMGYYALQEENV--FPERPGQPECQFYMKTGDCKFGAVCRFHHPR  319



>ref|XP_006376056.1| hypothetical protein POPTR_0013s08490g [Populus trichocarpa]
 gb|ERP53853.1| hypothetical protein POPTR_0013s08490g [Populus trichocarpa]
Length=255

 Score =   328 bits (840),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 153/197 (78%), Positives = 176/197 (89%), Gaps = 4/197 (2%)
 Frame = +1

Query  367  MDFEAAAGISAS---MASVTEGPSSLSPPLAQETLWQLSLRSMETMESGTYPVRDGEPDC  537
            MDF+A   +S S   + +VTEG +S+SP L+++ +WQ++LRS ETME+G YP R GEPDC
Sbjct  1    MDFDAGIPMSRSGVGLPAVTEG-TSMSPSLSEDAMWQMNLRSSETMEAGPYPERPGEPDC  59

Query  538  SYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKGEYPERVGQPECQYYLKTGACKFGATC  717
            SYYIRTGLCRFGA+CRFNHP NRKLAIAAARMKGE+PER+GQPECQYYLKTG CKFGATC
Sbjct  60   SYYIRTGLCRFGATCRFNHPPNRKLAIAAARMKGEFPERIGQPECQYYLKTGTCKFGATC  119

Query  718  KFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTCKFHHPQPSNMMVPL  897
            KFHHPRDKAGI+GRV+LN+LGYPL+PN+IEC YY+RTGQCKFGSTCKFHHPQP+NMMVPL
Sbjct  120  KFHHPRDKAGISGRVSLNILGYPLQPNEIECAYYLRTGQCKFGSTCKFHHPQPTNMMVPL  179

Query  898  RGSPAYPPVHSPTTPGQ  948
            RGSP YP V SPTTPGQ
Sbjct  180  RGSPIYPTVSSPTTPGQ  196



>ref|XP_009611379.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X3 [Nicotiana tomentosiformis]
Length=437

 Score =   333 bits (855),  Expect = 6e-108, Method: Compositional matrix adjust.
 Identities = 163/199 (82%), Positives = 175/199 (88%), Gaps = 9/199 (5%)
 Frame = +1

Query  367  MDFEAAAGISASMASVTEGPSSLSPPLAQETLWQLSLRSMETMESGTYPVRDGEPDCSYY  546
            MDF+A  GIS S   VTEGPSSLSP L Q+TLWQ++LRS E++ESG YPVR+GEPDCSYY
Sbjct  1    MDFDA--GISLS---VTEGPSSLSPSLDQDTLWQMNLRSRESIESGHYPVREGEPDCSYY  55

Query  547  IRTGLCRFGASCRFNHPSNRKL----AIAAARMKGEYPERVGQPECQYYLKTGACKFGAT  714
            IRTGLCRFG++CRFNHP NRKL    AIA ARMKGEYPER+GQPECQYYLKTG CKFGAT
Sbjct  56   IRTGLCRFGSTCRFNHPPNRKLYLMQAIATARMKGEYPERMGQPECQYYLKTGTCKFGAT  115

Query  715  CKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTCKFHHPQPSNMMVP  894
            CKFHHP+DKAGIAGRV LNVLGYPLRPN+ EC YYMRTGQCKFGSTCKFHHPQPSNMMV 
Sbjct  116  CKFHHPKDKAGIAGRVTLNVLGYPLRPNEAECAYYMRTGQCKFGSTCKFHHPQPSNMMVS  175

Query  895  LRGSPAYPPVHSPTTPGQL  951
            LRGSP YPPV S TTPGQL
Sbjct  176  LRGSPVYPPVPSATTPGQL  194


 Score = 99.8 bits (247),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 45/92 (49%), Positives = 61/92 (66%), Gaps = 0/92 (0%)
 Frame = +1

Query  595  PSNRKLAIAAARMKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNV  774
            P++  +   A + +  +PER GQPECQ+Y+KTG CKFGA C+FHHPR++        L+ 
Sbjct  277  PASVPMGYYALQGENVFPERHGQPECQFYMKTGDCKFGAVCRFHHPRERLIPPPDCMLSP  336

Query  775  LGYPLRPNDIECPYYMRTGQCKFGSTCKFHHP  870
            +G PLRP +  C +Y R G CKFG +CKF HP
Sbjct  337  IGLPLRPGEPLCIFYSRYGICKFGPSCKFDHP  368


 Score = 76.3 bits (186),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 34/77 (44%), Positives = 48/77 (62%), Gaps = 1/77 (1%)
 Frame = +1

Query  505  TYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKG-EYPERVGQPECQYY  681
             +P R G+P+C +Y++TG C+FGA CRF+HP  R +      +     P R G+P C +Y
Sbjct  292  VFPERHGQPECQFYMKTGDCKFGAVCRFHHPRERLIPPPDCMLSPIGLPLRPGEPLCIFY  351

Query  682  LKTGACKFGATCKFHHP  732
             + G CKFG +CKF HP
Sbjct  352  SRYGICKFGPSCKFDHP  368



>gb|KDO47609.1| hypothetical protein CISIN_1g0472481mg, partial [Citrus sinensis]
Length=238

 Score =   325 bits (834),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 155/194 (80%), Positives = 169/194 (87%), Gaps = 2/194 (1%)
 Frame = +1

Query  367  MDFEAAAGISASMASVTEGPSSLSPPLAQETLWQLSLRSMETMESGTYPVRDGEPDCSYY  546
            M FEA   +S   A+VTEGPS LSP L Q+ LWQ++LR+ E MESG+ P R GEPDCSYY
Sbjct  1    MQFEAGISLSRG-AAVTEGPS-LSPSLNQDALWQMNLRTNEAMESGSLPERPGEPDCSYY  58

Query  547  IRTGLCRFGASCRFNHPSNRKLAIAAARMKGEYPERVGQPECQYYLKTGACKFGATCKFH  726
            IRTGLCRFGA+CRFNHP NRKLAIA AR+KG+YPERVGQPECQYYLKTG CKFGATCKFH
Sbjct  59   IRTGLCRFGATCRFNHPPNRKLAIATARIKGDYPERVGQPECQYYLKTGTCKFGATCKFH  118

Query  727  HPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGS  906
            HPRDKAGIAGRV+LNVLGYPLRPN+IEC YY+RTGQCKFGSTCKFHHPQP+NMMV LRGS
Sbjct  119  HPRDKAGIAGRVSLNVLGYPLRPNEIECAYYLRTGQCKFGSTCKFHHPQPNNMMVSLRGS  178

Query  907  PAYPPVHSPTTPGQ  948
            P YP V SPTTP Q
Sbjct  179  PVYPTVQSPTTPSQ  192



>ref|XP_007205202.1| hypothetical protein PRUPE_ppa005813mg [Prunus persica]
 gb|EMJ06401.1| hypothetical protein PRUPE_ppa005813mg [Prunus persica]
Length=442

 Score =   331 bits (849),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 153/194 (79%), Positives = 171/194 (88%), Gaps = 1/194 (1%)
 Frame = +1

Query  367  MDFEAAAGISASMASVTEGPSSLSPPLAQETLWQLSLRSMETMESGTYPVRDGEPDCSYY  546
            MDF+A   +S + A VT+ PS LSP L Q+ +WQ++LRS ET+E G+YP R GEPDCSYY
Sbjct  1    MDFDAGIPMSRAAAPVTDAPS-LSPSLTQDAMWQMNLRSSETLEPGSYPERTGEPDCSYY  59

Query  547  IRTGLCRFGASCRFNHPSNRKLAIAAARMKGEYPERVGQPECQYYLKTGACKFGATCKFH  726
            IRTGLCRFGA+CRFNHP NRKLAIA ARMKGE+PER+GQPECQYYLKTG CKFGATCKFH
Sbjct  60   IRTGLCRFGATCRFNHPPNRKLAIATARMKGEFPERIGQPECQYYLKTGTCKFGATCKFH  119

Query  727  HPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGS  906
            HPRDKAGIAGRVALN+LGYPLRPN+IEC YY+RTGQCKFGSTCK+HHPQP+NMMV LRGS
Sbjct  120  HPRDKAGIAGRVALNILGYPLRPNEIECAYYLRTGQCKFGSTCKYHHPQPTNMMVSLRGS  179

Query  907  PAYPPVHSPTTPGQ  948
            P YP V SPTTPGQ
Sbjct  180  PVYPTVQSPTTPGQ  193


 Score =   102 bits (253),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 45/87 (52%), Positives = 59/87 (68%), Gaps = 0/87 (0%)
 Frame = +1

Query  610  LAIAAARMKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPL  789
            +   A + +  +PER GQPECQ+Y+KTG CKFGA C+FHHPR++   A    L+ +G PL
Sbjct  288  VGFYALQRENVFPERPGQPECQFYMKTGDCKFGAVCRFHHPRERLIPAPDCVLSPIGLPL  347

Query  790  RPNDIECPYYMRTGQCKFGSTCKFHHP  870
            RP +  C +Y R G CKFG +CKF HP
Sbjct  348  RPGEPLCIFYSRYGICKFGPSCKFDHP  374



>ref|XP_008218439.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
[Prunus mume]
Length=442

 Score =   331 bits (848),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 153/194 (79%), Positives = 171/194 (88%), Gaps = 1/194 (1%)
 Frame = +1

Query  367  MDFEAAAGISASMASVTEGPSSLSPPLAQETLWQLSLRSMETMESGTYPVRDGEPDCSYY  546
            MDF+A   +S + A VT+ PS LSP L Q+ +WQ++LRS ET+E G+YP R GEPDCSYY
Sbjct  1    MDFDAGIPMSRAAAPVTDAPS-LSPSLTQDAMWQMNLRSSETLEPGSYPERTGEPDCSYY  59

Query  547  IRTGLCRFGASCRFNHPSNRKLAIAAARMKGEYPERVGQPECQYYLKTGACKFGATCKFH  726
            IRTGLCRFGA+CRFNHP NRKLAIA ARMKGE+PER+GQPECQYYLKTG CKFGATCKFH
Sbjct  60   IRTGLCRFGATCRFNHPPNRKLAIATARMKGEFPERIGQPECQYYLKTGTCKFGATCKFH  119

Query  727  HPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGS  906
            HPRDKAGIAGRVALN+LGYPLRPN+IEC YY+RTGQCKFGSTCK+HHPQP+NMMV LRGS
Sbjct  120  HPRDKAGIAGRVALNILGYPLRPNEIECAYYLRTGQCKFGSTCKYHHPQPTNMMVSLRGS  179

Query  907  PAYPPVHSPTTPGQ  948
            P YP V SPTTPGQ
Sbjct  180  PVYPTVQSPTTPGQ  193


 Score =   100 bits (249),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 44/87 (51%), Positives = 58/87 (67%), Gaps = 0/87 (0%)
 Frame = +1

Query  610  LAIAAARMKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPL  789
            +   A + +  +PER GQPECQ+Y+KTG CKFGA C+FHHPR++        L+ +G PL
Sbjct  288  VGFYALQRENVFPERPGQPECQFYMKTGDCKFGAVCRFHHPRERLIPTPDCVLSPIGLPL  347

Query  790  RPNDIECPYYMRTGQCKFGSTCKFHHP  870
            RP +  C +Y R G CKFG +CKF HP
Sbjct  348  RPGEPLCIFYSRYGICKFGPSCKFDHP  374



>ref|XP_009611378.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X2 [Nicotiana tomentosiformis]
Length=450

 Score =   329 bits (844),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 163/212 (77%), Positives = 175/212 (83%), Gaps = 22/212 (10%)
 Frame = +1

Query  367  MDFEAAAGISASMASVTEGPSSLSPPLAQETLWQLSLRSMETMESGTYPVRDGEPDCSYY  546
            MDF+A  GIS S   VTEGPSSLSP L Q+TLWQ++LRS E++ESG YPVR+GEPDCSYY
Sbjct  1    MDFDA--GISLS---VTEGPSSLSPSLDQDTLWQMNLRSRESIESGHYPVREGEPDCSYY  55

Query  547  IRTGLCRFGASCRFNHPSNRKLAIAAARMKGEYPERVGQPECQ-----------------  675
            IRTGLCRFG++CRFNHP NRKLAIA ARMKGEYPER+GQPECQ                 
Sbjct  56   IRTGLCRFGSTCRFNHPPNRKLAIATARMKGEYPERMGQPECQTTKFMYVQRSSMSINDQ  115

Query  676  YYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTC  855
            YYLKTG CKFGATCKFHHP+DKAGIAGRV LNVLGYPLRPN+ EC YYMRTGQCKFGSTC
Sbjct  116  YYLKTGTCKFGATCKFHHPKDKAGIAGRVTLNVLGYPLRPNEAECAYYMRTGQCKFGSTC  175

Query  856  KFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQL  951
            KFHHPQPSNMMV LRGSP YPPV S TTPGQL
Sbjct  176  KFHHPQPSNMMVSLRGSPVYPPVPSATTPGQL  207


 Score = 99.8 bits (247),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 45/92 (49%), Positives = 61/92 (66%), Gaps = 0/92 (0%)
 Frame = +1

Query  595  PSNRKLAIAAARMKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNV  774
            P++  +   A + +  +PER GQPECQ+Y+KTG CKFGA C+FHHPR++        L+ 
Sbjct  290  PASVPMGYYALQGENVFPERHGQPECQFYMKTGDCKFGAVCRFHHPRERLIPPPDCMLSP  349

Query  775  LGYPLRPNDIECPYYMRTGQCKFGSTCKFHHP  870
            +G PLRP +  C +Y R G CKFG +CKF HP
Sbjct  350  IGLPLRPGEPLCIFYSRYGICKFGPSCKFDHP  381


 Score = 76.3 bits (186),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 34/77 (44%), Positives = 48/77 (62%), Gaps = 1/77 (1%)
 Frame = +1

Query  505  TYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKG-EYPERVGQPECQYY  681
             +P R G+P+C +Y++TG C+FGA CRF+HP  R +      +     P R G+P C +Y
Sbjct  305  VFPERHGQPECQFYMKTGDCKFGAVCRFHHPRERLIPPPDCMLSPIGLPLRPGEPLCIFY  364

Query  682  LKTGACKFGATCKFHHP  732
             + G CKFG +CKF HP
Sbjct  365  SRYGICKFGPSCKFDHP  381



>ref|XP_008359920.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X2 [Malus domestica]
Length=443

 Score =   328 bits (840),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 152/194 (78%), Positives = 170/194 (88%), Gaps = 1/194 (1%)
 Frame = +1

Query  367  MDFEAAAGISASMASVTEGPSSLSPPLAQETLWQLSLRSMETMESGTYPVRDGEPDCSYY  546
            MDF+A   +S + A VT+ PS LSP L Q+ +W ++LRS ET+E+G YP R GEPDCSYY
Sbjct  1    MDFDAGIPMSRAAAPVTDAPS-LSPALTQDAMWPMNLRSSETLEAGGYPERTGEPDCSYY  59

Query  547  IRTGLCRFGASCRFNHPSNRKLAIAAARMKGEYPERVGQPECQYYLKTGACKFGATCKFH  726
            IRTGLCRFGA+CRFNHP NRKLAIAAARMKGE+PER+GQPECQYYLKTG CKFGATCKFH
Sbjct  60   IRTGLCRFGATCRFNHPPNRKLAIAAARMKGEFPERIGQPECQYYLKTGTCKFGATCKFH  119

Query  727  HPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGS  906
            HPRDKAGIAGRVALN+LGYPLRPN+IEC YY+RTGQCKFG TCKFHHPQP+NMMV +RGS
Sbjct  120  HPRDKAGIAGRVALNILGYPLRPNEIECAYYLRTGQCKFGGTCKFHHPQPTNMMVSVRGS  179

Query  907  PAYPPVHSPTTPGQ  948
            P YP V SPTTPGQ
Sbjct  180  PVYPTVQSPTTPGQ  193


 Score = 99.0 bits (245),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 44/87 (51%), Positives = 58/87 (67%), Gaps = 0/87 (0%)
 Frame = +1

Query  610  LAIAAARMKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPL  789
            +   A + +  +PER GQPECQ+Y+KTG CKFGA C+FHHP ++   A    L+ +G PL
Sbjct  288  VGFYALQRENVFPERPGQPECQFYMKTGDCKFGAVCRFHHPMERLIPAPDCVLSPIGLPL  347

Query  790  RPNDIECPYYMRTGQCKFGSTCKFHHP  870
            RP +  C +Y R G CKFG +CKF HP
Sbjct  348  RPGEPMCIFYSRYGICKFGPSCKFDHP  374


 Score = 76.3 bits (186),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 34/77 (44%), Positives = 48/77 (62%), Gaps = 1/77 (1%)
 Frame = +1

Query  505  TYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKG-EYPERVGQPECQYY  681
             +P R G+P+C +Y++TG C+FGA CRF+HP  R +      +     P R G+P C +Y
Sbjct  298  VFPERPGQPECQFYMKTGDCKFGAVCRFHHPMERLIPAPDCVLSPIGLPLRPGEPMCIFY  357

Query  682  LKTGACKFGATCKFHHP  732
             + G CKFG +CKF HP
Sbjct  358  SRYGICKFGPSCKFDHP  374



>ref|XP_012088761.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
[Jatropha curcas]
 gb|KDP23293.1| hypothetical protein JCGZ_23126 [Jatropha curcas]
Length=442

 Score =   326 bits (836),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 152/195 (78%), Positives = 173/195 (89%), Gaps = 2/195 (1%)
 Frame = +1

Query  367  MDFEAAAGISASMA-SVTEGPSSLSPPLAQETLWQLSLRSMETMESGTYPVRDGEPDCSY  543
            MDF+A   +S +   SVT+GPS LSP + ++ +WQ++LRS E MESG YP R GEPDCSY
Sbjct  1    MDFDAGISMSRTAPPSVTDGPS-LSPSMNEDAMWQMNLRSGEPMESGPYPERPGEPDCSY  59

Query  544  YIRTGLCRFGASCRFNHPSNRKLAIAAARMKGEYPERVGQPECQYYLKTGACKFGATCKF  723
            YIRTGLCRFGA+CRFNHP NRKLAIAAARMKGE+PER+GQPECQYYLKTG CKFGATCKF
Sbjct  60   YIRTGLCRFGATCRFNHPPNRKLAIAAARMKGEFPERIGQPECQYYLKTGTCKFGATCKF  119

Query  724  HHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTCKFHHPQPSNMMVPLRG  903
            HHP+DKAGIAGRV+LN++GYPLRPN+IEC YY+RTGQCKFGSTCKFHHPQP+N+MVPLRG
Sbjct  120  HHPKDKAGIAGRVSLNIMGYPLRPNEIECAYYLRTGQCKFGSTCKFHHPQPTNVMVPLRG  179

Query  904  SPAYPPVHSPTTPGQ  948
            SP YP V SPTTPGQ
Sbjct  180  SPVYPNVQSPTTPGQ  194


 Score =   101 bits (252),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 44/87 (51%), Positives = 59/87 (68%), Gaps = 0/87 (0%)
 Frame = +1

Query  610  LAIAAARMKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPL  789
            +   A + +  +PER GQPECQ+Y+KTG CKFGA C+FHHPR++   A    L+ +G PL
Sbjct  288  VGFYALQTENAFPERPGQPECQFYMKTGDCKFGAVCRFHHPRERLIPAPDCVLSPIGLPL  347

Query  790  RPNDIECPYYMRTGQCKFGSTCKFHHP  870
            RP +  C +Y R G CKFG +CK+ HP
Sbjct  348  RPGEPLCIFYSRYGVCKFGPSCKYDHP  374


 Score = 75.9 bits (185),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 48/76 (63%), Gaps = 1/76 (1%)
 Frame = +1

Query  508  YPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKG-EYPERVGQPECQYYL  684
            +P R G+P+C +Y++TG C+FGA CRF+HP  R +      +     P R G+P C +Y 
Sbjct  299  FPERPGQPECQFYMKTGDCKFGAVCRFHHPRERLIPAPDCVLSPIGLPLRPGEPLCIFYS  358

Query  685  KTGACKFGATCKFHHP  732
            + G CKFG +CK+ HP
Sbjct  359  RYGVCKFGPSCKYDHP  374



>gb|KJB82178.1| hypothetical protein B456_013G179800 [Gossypium raimondii]
Length=252

 Score =   319 bits (817),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 155/199 (78%), Positives = 168/199 (84%), Gaps = 6/199 (3%)
 Frame = +1

Query  367  MDFEAAAGISASMAS-----VTEGPSSLSPPLAQETLWQLSLRSMETMESGTYPVRDGEP  531
            M+F   AGI  S  +     VTEG SSLSP L Q+ +WQ++LRS ETMES  YP R GEP
Sbjct  1    MEFSFDAGIPMSRTATAAVPVTEG-SSLSPSLNQDAMWQMNLRSSETMESSPYPERPGEP  59

Query  532  DCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKGEYPERVGQPECQYYLKTGACKFGA  711
            DCSYYIRTGLCRFGA+C FNHP NRKLAIAAARMKGE+PERVGQPECQYYLKTG CKFGA
Sbjct  60   DCSYYIRTGLCRFGATCHFNHPPNRKLAIAAARMKGEFPERVGQPECQYYLKTGTCKFGA  119

Query  712  TCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTCKFHHPQPSNMMV  891
            TCKFHHPRDKAGIAGRV+LN+LGYPLRPN+ EC YY+RTGQCKFGSTCKFHHPQP+NMMV
Sbjct  120  TCKFHHPRDKAGIAGRVSLNILGYPLRPNETECAYYLRTGQCKFGSTCKFHHPQPTNMMV  179

Query  892  PLRGSPAYPPVHSPTTPGQ  948
             LRGSP Y  V SPTTPGQ
Sbjct  180  SLRGSPIYQTVPSPTTPGQ  198



>ref|XP_006428579.1| hypothetical protein CICLE_v10011741mg [Citrus clementina]
 ref|XP_006428580.1| hypothetical protein CICLE_v10011741mg [Citrus clementina]
 ref|XP_006480413.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X1 [Citrus sinensis]
 gb|ESR41819.1| hypothetical protein CICLE_v10011741mg [Citrus clementina]
 gb|ESR41820.1| hypothetical protein CICLE_v10011741mg [Citrus clementina]
Length=439

 Score =   325 bits (833),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 154/194 (79%), Positives = 169/194 (87%), Gaps = 2/194 (1%)
 Frame = +1

Query  367  MDFEAAAGISASMASVTEGPSSLSPPLAQETLWQLSLRSMETMESGTYPVRDGEPDCSYY  546
            M FEA   +S   A+VTEGPS LSP L Q+ LWQ++LR+ E MESG+ P R GEPDCSYY
Sbjct  1    MQFEAGISLSRG-AAVTEGPS-LSPSLNQDALWQMNLRTNEAMESGSLPERPGEPDCSYY  58

Query  547  IRTGLCRFGASCRFNHPSNRKLAIAAARMKGEYPERVGQPECQYYLKTGACKFGATCKFH  726
            IRTGLCRFGA+CRFNHP NRKLAIA AR+KG+YPER+GQPECQYYLKTG CKFGATCKFH
Sbjct  59   IRTGLCRFGATCRFNHPPNRKLAIATARIKGDYPERLGQPECQYYLKTGTCKFGATCKFH  118

Query  727  HPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGS  906
            HPRDKAGIAGRV+LNVLGYPLRPN+IEC YY+RTGQCKFGSTCKFHHPQP+NMMV LRGS
Sbjct  119  HPRDKAGIAGRVSLNVLGYPLRPNEIECAYYLRTGQCKFGSTCKFHHPQPNNMMVSLRGS  178

Query  907  PAYPPVHSPTTPGQ  948
            P YP V SPTTP Q
Sbjct  179  PVYPTVQSPTTPSQ  192


 Score =   100 bits (249),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 44/87 (51%), Positives = 58/87 (67%), Gaps = 0/87 (0%)
 Frame = +1

Query  610  LAIAAARMKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPL  789
            +   A + +  +PER GQPECQ+Y+KTG CKFGA C+FHHPR++        L+ +G PL
Sbjct  287  VGFYALQRESVFPERPGQPECQFYMKTGDCKFGAVCRFHHPRERLLPVPDCVLSPIGLPL  346

Query  790  RPNDIECPYYMRTGQCKFGSTCKFHHP  870
            RP +  C +Y R G CKFG +CKF HP
Sbjct  347  RPGEPLCIFYSRYGICKFGPSCKFDHP  373


 Score = 79.0 bits (193),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 35/77 (45%), Positives = 49/77 (64%), Gaps = 1/77 (1%)
 Frame = +1

Query  505  TYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKG-EYPERVGQPECQYY  681
             +P R G+P+C +Y++TG C+FGA CRF+HP  R L +    +     P R G+P C +Y
Sbjct  297  VFPERPGQPECQFYMKTGDCKFGAVCRFHHPRERLLPVPDCVLSPIGLPLRPGEPLCIFY  356

Query  682  LKTGACKFGATCKFHHP  732
             + G CKFG +CKF HP
Sbjct  357  SRYGICKFGPSCKFDHP  373


 Score = 52.8 bits (125),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/56 (43%), Positives = 33/56 (59%), Gaps = 3/56 (5%)
 Frame = +1

Query  781  YPLRPNDIECPYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQ  948
            +P RP   EC +YM+TG CKFG+ C+FHHP+   + VP        P+  P  PG+
Sbjct  298  FPERPGQPECQFYMKTGDCKFGAVCRFHHPRERLLPVP---DCVLSPIGLPLRPGE  350



>ref|XP_009338000.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X2 [Pyrus x bretschneideri]
Length=442

 Score =   325 bits (833),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 150/194 (77%), Positives = 169/194 (87%), Gaps = 1/194 (1%)
 Frame = +1

Query  367  MDFEAAAGISASMASVTEGPSSLSPPLAQETLWQLSLRSMETMESGTYPVRDGEPDCSYY  546
            MDF+A   +S + A VT+   SLSP L Q+ +WQ++LRS ETME+G YP R GEPDCSYY
Sbjct  1    MDFDAGIPMSRAAAPVTDA-RSLSPSLTQDAMWQMNLRSSETMEAGAYPERTGEPDCSYY  59

Query  547  IRTGLCRFGASCRFNHPSNRKLAIAAARMKGEYPERVGQPECQYYLKTGACKFGATCKFH  726
            IRTGLCRFGA+CRFNHP NRKLAIAAARMKGE+PER+GQPECQYYLKTG CKFGATCKFH
Sbjct  60   IRTGLCRFGATCRFNHPPNRKLAIAAARMKGEFPERIGQPECQYYLKTGTCKFGATCKFH  119

Query  727  HPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGS  906
            HPRDKAG+AGRVALN+LGYPLRPN++EC YY+RTGQCKFGSTCKFHHPQP+NMMV +  S
Sbjct  120  HPRDKAGMAGRVALNILGYPLRPNEVECAYYLRTGQCKFGSTCKFHHPQPTNMMVSVGAS  179

Query  907  PAYPPVHSPTTPGQ  948
            P YP V SPTTPGQ
Sbjct  180  PVYPTVQSPTTPGQ  193


 Score =   102 bits (254),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 45/87 (52%), Positives = 60/87 (69%), Gaps = 0/87 (0%)
 Frame = +1

Query  610  LAIAAARMKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPL  789
            +   A + +  +PER GQPECQ+Y+KTG CKFGA C+FHHPR++   A    L+ +G PL
Sbjct  288  VGFYALQRENVFPERPGQPECQFYMKTGDCKFGAVCRFHHPRERLIPAPDCVLSPMGLPL  347

Query  790  RPNDIECPYYMRTGQCKFGSTCKFHHP  870
            RP +  C +Y R G CKFG +CKF+HP
Sbjct  348  RPGEPLCIFYSRYGICKFGPSCKFNHP  374


 Score = 77.0 bits (188),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 35/77 (45%), Positives = 49/77 (64%), Gaps = 1/77 (1%)
 Frame = +1

Query  505  TYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKL-AIAAARMKGEYPERVGQPECQYY  681
             +P R G+P+C +Y++TG C+FGA CRF+HP  R + A          P R G+P C +Y
Sbjct  298  VFPERPGQPECQFYMKTGDCKFGAVCRFHHPRERLIPAPDCVLSPMGLPLRPGEPLCIFY  357

Query  682  LKTGACKFGATCKFHHP  732
             + G CKFG +CKF+HP
Sbjct  358  SRYGICKFGPSCKFNHP  374



>ref|XP_011014133.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
[Populus euphratica]
Length=447

 Score =   325 bits (832),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 152/199 (76%), Positives = 175/199 (88%), Gaps = 6/199 (3%)
 Frame = +1

Query  367  MDFEAAAGISAS-----MASVTEGPSSLSPPLAQETLWQLSLRSMETMESGTYPVRDGEP  531
            MDF+A   +S S     + +VTEG +S+S  L+++ +WQ++LRS ETME+G YP R GEP
Sbjct  1    MDFDAGIPMSRSGGGGGLPAVTEG-TSMSQSLSEDAMWQMNLRSSETMEAGPYPERSGEP  59

Query  532  DCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKGEYPERVGQPECQYYLKTGACKFGA  711
            DCSYYIRTGLCRFGA+CRFNHP NRKLAIAAARMKGE+PER+GQPECQYYLKTG CKFGA
Sbjct  60   DCSYYIRTGLCRFGATCRFNHPPNRKLAIAAARMKGEFPERIGQPECQYYLKTGTCKFGA  119

Query  712  TCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTCKFHHPQPSNMMV  891
            TCKFHHPRDKAGI+GRV+LN+LGYPL+PN+IEC YY+RTGQCKFGSTCKFHHPQP+NMMV
Sbjct  120  TCKFHHPRDKAGISGRVSLNILGYPLQPNEIECAYYLRTGQCKFGSTCKFHHPQPTNMMV  179

Query  892  PLRGSPAYPPVHSPTTPGQ  948
            PLRGSP YP V SPTTPGQ
Sbjct  180  PLRGSPIYPTVSSPTTPGQ  198


 Score =   102 bits (253),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 46/87 (53%), Positives = 59/87 (68%), Gaps = 0/87 (0%)
 Frame = +1

Query  610  LAIAAARMKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPL  789
            L   A + +  +PER GQPECQ+Y+KTG CKFGA C+FHHPR++   A    L+ +G PL
Sbjct  293  LGYYALQRESVFPERPGQPECQFYMKTGDCKFGAVCRFHHPRERLIPAPDCVLSPIGLPL  352

Query  790  RPNDIECPYYMRTGQCKFGSTCKFHHP  870
            RP +  C +Y R G CKFG +CKF HP
Sbjct  353  RPGEPLCIFYSRYGICKFGPSCKFDHP  379


 Score = 76.6 bits (187),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 34/77 (44%), Positives = 48/77 (62%), Gaps = 1/77 (1%)
 Frame = +1

Query  505  TYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKG-EYPERVGQPECQYY  681
             +P R G+P+C +Y++TG C+FGA CRF+HP  R +      +     P R G+P C +Y
Sbjct  303  VFPERPGQPECQFYMKTGDCKFGAVCRFHHPRERLIPAPDCVLSPIGLPLRPGEPLCIFY  362

Query  682  LKTGACKFGATCKFHHP  732
             + G CKFG +CKF HP
Sbjct  363  SRYGICKFGPSCKFDHP  379



>ref|XP_009611374.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009611375.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009611377.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X1 [Nicotiana tomentosiformis]
Length=454

 Score =   324 bits (830),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 163/216 (75%), Positives = 175/216 (81%), Gaps = 26/216 (12%)
 Frame = +1

Query  367  MDFEAAAGISASMASVTEGPSSLSPPLAQETLWQLSLRSMETMESGTYPVRDGEPDCSYY  546
            MDF+A  GIS S   VTEGPSSLSP L Q+TLWQ++LRS E++ESG YPVR+GEPDCSYY
Sbjct  1    MDFDA--GISLS---VTEGPSSLSPSLDQDTLWQMNLRSRESIESGHYPVREGEPDCSYY  55

Query  547  IRTGLCRFGASCRFNHPSNRKL----AIAAARMKGEYPERVGQPECQ-------------  675
            IRTGLCRFG++CRFNHP NRKL    AIA ARMKGEYPER+GQPECQ             
Sbjct  56   IRTGLCRFGSTCRFNHPPNRKLYLMQAIATARMKGEYPERMGQPECQTTKFMYVQRSSMS  115

Query  676  ----YYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKF  843
                YYLKTG CKFGATCKFHHP+DKAGIAGRV LNVLGYPLRPN+ EC YYMRTGQCKF
Sbjct  116  INDQYYLKTGTCKFGATCKFHHPKDKAGIAGRVTLNVLGYPLRPNEAECAYYMRTGQCKF  175

Query  844  GSTCKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQL  951
            GSTCKFHHPQPSNMMV LRGSP YPPV S TTPGQL
Sbjct  176  GSTCKFHHPQPSNMMVSLRGSPVYPPVPSATTPGQL  211


 Score = 99.8 bits (247),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 45/92 (49%), Positives = 61/92 (66%), Gaps = 0/92 (0%)
 Frame = +1

Query  595  PSNRKLAIAAARMKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNV  774
            P++  +   A + +  +PER GQPECQ+Y+KTG CKFGA C+FHHPR++        L+ 
Sbjct  294  PASVPMGYYALQGENVFPERHGQPECQFYMKTGDCKFGAVCRFHHPRERLIPPPDCMLSP  353

Query  775  LGYPLRPNDIECPYYMRTGQCKFGSTCKFHHP  870
            +G PLRP +  C +Y R G CKFG +CKF HP
Sbjct  354  IGLPLRPGEPLCIFYSRYGICKFGPSCKFDHP  385


 Score = 76.3 bits (186),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 34/77 (44%), Positives = 48/77 (62%), Gaps = 1/77 (1%)
 Frame = +1

Query  505  TYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKG-EYPERVGQPECQYY  681
             +P R G+P+C +Y++TG C+FGA CRF+HP  R +      +     P R G+P C +Y
Sbjct  309  VFPERHGQPECQFYMKTGDCKFGAVCRFHHPRERLIPPPDCMLSPIGLPLRPGEPLCIFY  368

Query  682  LKTGACKFGATCKFHHP  732
             + G CKFG +CKF HP
Sbjct  369  SRYGICKFGPSCKFDHP  385



>ref|XP_008359919.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X1 [Malus domestica]
Length=444

 Score =   323 bits (828),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 152/195 (78%), Positives = 170/195 (87%), Gaps = 2/195 (1%)
 Frame = +1

Query  367  MDFEAAAGISASMASVTEGPSSLSPPLAQETLWQLSLRSMETMESGTYPVRDGEPDCSYY  546
            MDF+A   +S + A VT+ PS LSP L Q+ +W ++LRS ET+E+G YP R GEPDCSYY
Sbjct  1    MDFDAGIPMSRAAAPVTDAPS-LSPALTQDAMWPMNLRSSETLEAGGYPERTGEPDCSYY  59

Query  547  IRTGLCRFGASCRFNHPSNRKLAIAAARMKGEYPERVGQPECQYYLKTGACKFGATCKFH  726
            IRTGLCRFGA+CRFNHP NRKLAIAAARMKGE+PER+GQPECQYYLKTG CKFGATCKFH
Sbjct  60   IRTGLCRFGATCRFNHPPNRKLAIAAARMKGEFPERIGQPECQYYLKTGTCKFGATCKFH  119

Query  727  HPRDKAGIAGRVALNVLGYPLRP-NDIECPYYMRTGQCKFGSTCKFHHPQPSNMMVPLRG  903
            HPRDKAGIAGRVALN+LGYPLRP N+IEC YY+RTGQCKFG TCKFHHPQP+NMMV +RG
Sbjct  120  HPRDKAGIAGRVALNILGYPLRPQNEIECAYYLRTGQCKFGGTCKFHHPQPTNMMVSVRG  179

Query  904  SPAYPPVHSPTTPGQ  948
            SP YP V SPTTPGQ
Sbjct  180  SPVYPTVQSPTTPGQ  194


 Score = 99.0 bits (245),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 44/87 (51%), Positives = 58/87 (67%), Gaps = 0/87 (0%)
 Frame = +1

Query  610  LAIAAARMKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPL  789
            +   A + +  +PER GQPECQ+Y+KTG CKFGA C+FHHP ++   A    L+ +G PL
Sbjct  289  VGFYALQRENVFPERPGQPECQFYMKTGDCKFGAVCRFHHPMERLIPAPDCVLSPIGLPL  348

Query  790  RPNDIECPYYMRTGQCKFGSTCKFHHP  870
            RP +  C +Y R G CKFG +CKF HP
Sbjct  349  RPGEPMCIFYSRYGICKFGPSCKFDHP  375


 Score = 76.3 bits (186),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 34/77 (44%), Positives = 48/77 (62%), Gaps = 1/77 (1%)
 Frame = +1

Query  505  TYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKG-EYPERVGQPECQYY  681
             +P R G+P+C +Y++TG C+FGA CRF+HP  R +      +     P R G+P C +Y
Sbjct  299  VFPERPGQPECQFYMKTGDCKFGAVCRFHHPMERLIPAPDCVLSPIGLPLRPGEPMCIFY  358

Query  682  LKTGACKFGATCKFHHP  732
             + G CKFG +CKF HP
Sbjct  359  SRYGICKFGPSCKFDHP  375



>emb|CDP04213.1| unnamed protein product [Coffea canephora]
Length=403

 Score =   320 bits (820),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 153/196 (78%), Positives = 169/196 (86%), Gaps = 7/196 (4%)
 Frame = +1

Query  367  MDFEAAAGISASMASVT-EGPSSLSPPLAQETLWQLSLRSMETMESGTYPVRDGEPDCSY  543
            MDF++  GI  S ASV  EG SSL     Q+ LWQ++LRS E ME+GTYPVR+GEPDCSY
Sbjct  1    MDFDS--GIPISRASVVAEGSSSLD----QDALWQINLRSREPMEAGTYPVREGEPDCSY  54

Query  544  YIRTGLCRFGASCRFNHPSNRKLAIAAARMKGEYPERVGQPECQYYLKTGACKFGATCKF  723
            YIRTGLCR+GA+CRFNHP NRKLAIA ARM+GEYPER+GQPECQYYLKTG CKFGATCKF
Sbjct  55   YIRTGLCRYGATCRFNHPPNRKLAIATARMRGEYPERMGQPECQYYLKTGTCKFGATCKF  114

Query  724  HHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTCKFHHPQPSNMMVPLRG  903
            HHPR+KAGIAGRV LN LGYPLRPN+IEC YY+RTG CKFGSTCKFHHPQP+NMMV +RG
Sbjct  115  HHPREKAGIAGRVTLNALGYPLRPNEIECAYYLRTGHCKFGSTCKFHHPQPANMMVSVRG  174

Query  904  SPAYPPVHSPTTPGQL  951
            SP YP VHSPT PGQL
Sbjct  175  SPVYPSVHSPTNPGQL  190


 Score =   102 bits (253),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 45/76 (59%), Positives = 55/76 (72%), Gaps = 0/76 (0%)
 Frame = +1

Query  643  YPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYM  822
            +PER GQPECQ+Y+KTG CKFGA CKFHHPR++   A    L+ +G PLRP +  C +Y 
Sbjct  261  FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERILPAPDCVLSPIGLPLRPGEPLCIFYS  320

Query  823  RTGQCKFGSTCKFHHP  870
            R G CKFG +CKF HP
Sbjct  321  RYGICKFGPSCKFDHP  336


 Score = 76.3 bits (186),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 43/119 (36%), Positives = 64/119 (54%), Gaps = 5/119 (4%)
 Frame = +1

Query  379  AAAGISASMASVTEGPSSLSPPLAQETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTG  558
            + +G +A    +  G S+ S    Q+T        M   E+  +P R G+P+C +Y++TG
Sbjct  222  SVSGWNAYSGQLGSGSSAES---QQQTAGNDQTHGMLQRET-VFPERPGQPECQFYMKTG  277

Query  559  LCRFGASCRFNHPSNRKLAIAAARMKG-EYPERVGQPECQYYLKTGACKFGATCKFHHP  732
             C+FGA C+F+HP  R L      +     P R G+P C +Y + G CKFG +CKF HP
Sbjct  278  DCKFGAVCKFHHPRERILPAPDCVLSPIGLPLRPGEPLCIFYSRYGICKFGPSCKFDHP  336


 Score = 67.0 bits (162),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 50/189 (26%), Positives = 79/189 (42%), Gaps = 39/189 (21%)
 Frame = +1

Query  490  TMESGTYPVRDGEPDCSYYIRTGLCRFGASCRF---------------------------  588
            T+ +  YP+R  E +C+YY+RTG C+FG++C+F                           
Sbjct  128  TLNALGYPLRPNEIECAYYLRTGHCKFGSTCKFHHPQPANMMVSVRGSPVYPSVHSPTNP  187

Query  589  ---NHPSNRKLAIAAARMKGEY---PERVGQPECQ---YYLKTGACKFGATCKFHHPRDK  741
               ++P +R   I + R +G     P  V Q       +   +G    G++ +       
Sbjct  188  GQLSYPLSRASFIPSPRWQGPSSYAPVLVPQSMVSVSGWNAYSGQLGSGSSAESQQQTAG  247

Query  742  AGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPP  921
                  +      +P RP   EC +YM+TG CKFG+ CKFHHP+   +  P        P
Sbjct  248  NDQTHGMLQRETVFPERPGQPECQFYMKTGDCKFGAVCKFHHPRERILPAP---DCVLSP  304

Query  922  VHSPTTPGQ  948
            +  P  PG+
Sbjct  305  IGLPLRPGE  313



>gb|KJB26823.1| hypothetical protein B456_004G261700 [Gossypium raimondii]
Length=449

 Score =   321 bits (822),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 149/185 (81%), Positives = 165/185 (89%), Gaps = 1/185 (1%)
 Frame = +1

Query  394  SASMASVTEGPSSLSPPLAQETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFG  573
            SA   +VTEG +SLSP L Q+ +WQ++LRS ETMESG YP R GEPDCSYYIRTGLCRFG
Sbjct  20   SAVAVAVTEG-ASLSPSLNQDAMWQMNLRSSETMESGYYPERPGEPDCSYYIRTGLCRFG  78

Query  574  ASCRFNHPSNRKLAIAAARMKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIA  753
            A+CRFNHP NRKLAIAAARMKGE+PERVGQPECQYYLKTG CKFGATCKFHHPR++AGIA
Sbjct  79   ATCRFNHPPNRKLAIAAARMKGEFPERVGQPECQYYLKTGTCKFGATCKFHHPREQAGIA  138

Query  754  GRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVHSP  933
            GRV+LN+LGYP RPN+ EC YY+RTGQCKFGSTCKFHHPQP+NMM+ LRGSP YP V SP
Sbjct  139  GRVSLNILGYPFRPNETECAYYLRTGQCKFGSTCKFHHPQPTNMMISLRGSPIYPTVASP  198

Query  934  TTPGQ  948
            TTPGQ
Sbjct  199  TTPGQ  203


 Score =   103 bits (257),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 49/95 (52%), Positives = 62/95 (65%), Gaps = 0/95 (0%)
 Frame = +1

Query  643  YPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYM  822
            +PER GQPECQ+Y+KTG CKFGA C+FHHPR++   A    L+ +G PLRP +  C +Y 
Sbjct  306  FPERPGQPECQFYMKTGDCKFGAVCRFHHPRERVPPAPDCLLSPIGLPLRPGEPLCDFYS  365

Query  823  RTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVH  927
            R G CKFG +CKF+HP           SP+  PVH
Sbjct  366  RYGICKFGPSCKFNHPMGIFTYNYSISSPSGAPVH  400


 Score = 75.9 bits (185),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 34/77 (44%), Positives = 48/77 (62%), Gaps = 1/77 (1%)
 Frame = +1

Query  505  TYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKG-EYPERVGQPECQYY  681
             +P R G+P+C +Y++TG C+FGA CRF+HP  R        +     P R G+P C +Y
Sbjct  305  VFPERPGQPECQFYMKTGDCKFGAVCRFHHPRERVPPAPDCLLSPIGLPLRPGEPLCDFY  364

Query  682  LKTGACKFGATCKFHHP  732
             + G CKFG +CKF+HP
Sbjct  365  SRYGICKFGPSCKFNHP  381



>ref|XP_009337999.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X1 [Pyrus x bretschneideri]
Length=443

 Score =   320 bits (821),  Expect = 8e-103, Method: Compositional matrix adjust.
 Identities = 150/195 (77%), Positives = 169/195 (87%), Gaps = 2/195 (1%)
 Frame = +1

Query  367  MDFEAAAGISASMASVTEGPSSLSPPLAQETLWQLSLRSMETMESGTYPVRDGEPDCSYY  546
            MDF+A   +S + A VT+   SLSP L Q+ +WQ++LRS ETME+G YP R GEPDCSYY
Sbjct  1    MDFDAGIPMSRAAAPVTDA-RSLSPSLTQDAMWQMNLRSSETMEAGAYPERTGEPDCSYY  59

Query  547  IRTGLCRFGASCRFNHPSNRKLAIAAARMKGEYPERVGQPECQYYLKTGACKFGATCKFH  726
            IRTGLCRFGA+CRFNHP NRKLAIAAARMKGE+PER+GQPECQYYLKTG CKFGATCKFH
Sbjct  60   IRTGLCRFGATCRFNHPPNRKLAIAAARMKGEFPERIGQPECQYYLKTGTCKFGATCKFH  119

Query  727  HPRDKAGIAGRVALNVLGYPLRP-NDIECPYYMRTGQCKFGSTCKFHHPQPSNMMVPLRG  903
            HPRDKAG+AGRVALN+LGYPLRP N++EC YY+RTGQCKFGSTCKFHHPQP+NMMV +  
Sbjct  120  HPRDKAGMAGRVALNILGYPLRPQNEVECAYYLRTGQCKFGSTCKFHHPQPTNMMVSVGA  179

Query  904  SPAYPPVHSPTTPGQ  948
            SP YP V SPTTPGQ
Sbjct  180  SPVYPTVQSPTTPGQ  194


 Score =   102 bits (254),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 45/87 (52%), Positives = 60/87 (69%), Gaps = 0/87 (0%)
 Frame = +1

Query  610  LAIAAARMKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPL  789
            +   A + +  +PER GQPECQ+Y+KTG CKFGA C+FHHPR++   A    L+ +G PL
Sbjct  289  VGFYALQRENVFPERPGQPECQFYMKTGDCKFGAVCRFHHPRERLIPAPDCVLSPMGLPL  348

Query  790  RPNDIECPYYMRTGQCKFGSTCKFHHP  870
            RP +  C +Y R G CKFG +CKF+HP
Sbjct  349  RPGEPLCIFYSRYGICKFGPSCKFNHP  375


 Score = 77.0 bits (188),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 34/77 (44%), Positives = 49/77 (64%), Gaps = 1/77 (1%)
 Frame = +1

Query  505  TYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMK-GEYPERVGQPECQYY  681
             +P R G+P+C +Y++TG C+FGA CRF+HP  R +      +     P R G+P C +Y
Sbjct  299  VFPERPGQPECQFYMKTGDCKFGAVCRFHHPRERLIPAPDCVLSPMGLPLRPGEPLCIFY  358

Query  682  LKTGACKFGATCKFHHP  732
             + G CKFG +CKF+HP
Sbjct  359  SRYGICKFGPSCKFNHP  375



>ref|XP_002278934.2| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
[Vitis vinifera]
Length=441

 Score =   320 bits (820),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 153/194 (79%), Positives = 169/194 (87%), Gaps = 3/194 (2%)
 Frame = +1

Query  367  MDFEAAAGISASMASVTEGPSSLSPPLAQETLWQLSLRSMETMESGTYPVRDGEPDCSYY  546
            M+F+A  GI      VTEG SSLSP L Q+ +WQ++LRS ETMESG YP R GEPDCSYY
Sbjct  1    MEFDA--GIPMPRGQVTEG-SSLSPSLNQDAMWQMNLRSSETMESGPYPERPGEPDCSYY  57

Query  547  IRTGLCRFGASCRFNHPSNRKLAIAAARMKGEYPERVGQPECQYYLKTGACKFGATCKFH  726
            IRTGLCRFG +CRFNHP NRKLAIA ARMKGE+PER+GQPECQYYLKTG CKFGATCKFH
Sbjct  58   IRTGLCRFGITCRFNHPPNRKLAIATARMKGEFPERMGQPECQYYLKTGTCKFGATCKFH  117

Query  727  HPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGS  906
            HPRDKAGIAGRV+LN+LGYPLRP++I+C YY+RTGQCKFGSTCKFHHPQPS+MMV LRGS
Sbjct  118  HPRDKAGIAGRVSLNILGYPLRPDEIDCAYYLRTGQCKFGSTCKFHHPQPSSMMVSLRGS  177

Query  907  PAYPPVHSPTTPGQ  948
            P YP V SPTTPGQ
Sbjct  178  PVYPSVPSPTTPGQ  191


 Score =   100 bits (250),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 44/87 (51%), Positives = 58/87 (67%), Gaps = 0/87 (0%)
 Frame = +1

Query  610  LAIAAARMKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPL  789
            +   A + +  +PER GQPECQ+Y+KTG CKFGA C+FHHPR++        L+ +G PL
Sbjct  286  IGFYALQRENVFPERPGQPECQFYMKTGDCKFGAVCRFHHPRERLIPTPDCVLSPIGLPL  345

Query  790  RPNDIECPYYMRTGQCKFGSTCKFHHP  870
            RP +  C +Y R G CKFG +CKF HP
Sbjct  346  RPGEPLCIFYSRYGICKFGPSCKFDHP  372


 Score = 77.0 bits (188),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 34/77 (44%), Positives = 48/77 (62%), Gaps = 1/77 (1%)
 Frame = +1

Query  505  TYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKG-EYPERVGQPECQYY  681
             +P R G+P+C +Y++TG C+FGA CRF+HP  R +      +     P R G+P C +Y
Sbjct  296  VFPERPGQPECQFYMKTGDCKFGAVCRFHHPRERLIPTPDCVLSPIGLPLRPGEPLCIFY  355

Query  682  LKTGACKFGATCKFHHP  732
             + G CKFG +CKF HP
Sbjct  356  SRYGICKFGPSCKFDHP  372



>gb|KJB82177.1| hypothetical protein B456_013G179800 [Gossypium raimondii]
Length=447

 Score =   319 bits (818),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 155/199 (78%), Positives = 168/199 (84%), Gaps = 6/199 (3%)
 Frame = +1

Query  367  MDFEAAAGISASMAS-----VTEGPSSLSPPLAQETLWQLSLRSMETMESGTYPVRDGEP  531
            M+F   AGI  S  +     VTEG SSLSP L Q+ +WQ++LRS ETMES  YP R GEP
Sbjct  1    MEFSFDAGIPMSRTATAAVPVTEG-SSLSPSLNQDAMWQMNLRSSETMESSPYPERPGEP  59

Query  532  DCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKGEYPERVGQPECQYYLKTGACKFGA  711
            DCSYYIRTGLCRFGA+C FNHP NRKLAIAAARMKGE+PERVGQPECQYYLKTG CKFGA
Sbjct  60   DCSYYIRTGLCRFGATCHFNHPPNRKLAIAAARMKGEFPERVGQPECQYYLKTGTCKFGA  119

Query  712  TCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTCKFHHPQPSNMMV  891
            TCKFHHPRDKAGIAGRV+LN+LGYPLRPN+ EC YY+RTGQCKFGSTCKFHHPQP+NMMV
Sbjct  120  TCKFHHPRDKAGIAGRVSLNILGYPLRPNETECAYYLRTGQCKFGSTCKFHHPQPTNMMV  179

Query  892  PLRGSPAYPPVHSPTTPGQ  948
             LRGSP Y  V SPTTPGQ
Sbjct  180  SLRGSPIYQTVPSPTTPGQ  198


 Score =   105 bits (261),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 51/110 (46%), Positives = 69/110 (63%), Gaps = 0/110 (0%)
 Frame = +1

Query  598  SNRKLAIAAARMKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVL  777
            S+  + + A + +  +PER G+PECQ+Y+KTG CKFGA CKFHHPR++   A    L+ +
Sbjct  289  SSVPVGVYALQRENVFPERPGEPECQFYMKTGDCKFGAVCKFHHPRERVLPAPDCVLSPI  348

Query  778  GYPLRPNDIECPYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVH  927
            G PLRP +  C +Y R G CKFG +CKF+HP           SP+  PVH
Sbjct  349  GLPLRPGEPLCIFYSRYGICKFGPSCKFNHPMGIFTYNYSPSSPSDAPVH  398


 Score = 78.2 bits (191),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 35/77 (45%), Positives = 49/77 (64%), Gaps = 1/77 (1%)
 Frame = +1

Query  505  TYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKG-EYPERVGQPECQYY  681
             +P R GEP+C +Y++TG C+FGA C+F+HP  R L      +     P R G+P C +Y
Sbjct  303  VFPERPGEPECQFYMKTGDCKFGAVCKFHHPRERVLPAPDCVLSPIGLPLRPGEPLCIFY  362

Query  682  LKTGACKFGATCKFHHP  732
             + G CKFG +CKF+HP
Sbjct  363  SRYGICKFGPSCKFNHP  379



>ref|XP_002512627.1| nucleic acid binding protein, putative [Ricinus communis]
 gb|EEF50079.1| nucleic acid binding protein, putative [Ricinus communis]
Length=448

 Score =   319 bits (818),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 151/201 (75%), Positives = 170/201 (85%), Gaps = 8/201 (4%)
 Frame = +1

Query  367  MDFEAAAGISAS-------MASVTEGPSSLSPPLAQETLWQLSLRSMETMESGTYPVRDG  525
            MDF+A   +S +          VTE PS LS  L ++ +WQ++LRS ETM+SG YP   G
Sbjct  1    MDFDAGIPMSRTAPPPPPPPLPVTEDPS-LSASLNEDAMWQMNLRSSETMDSGPYPEHPG  59

Query  526  EPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKGEYPERVGQPECQYYLKTGACKF  705
            EPDCSYYIRTGLCRFGA+CRFNHP NRKLAIAAARMKGE+PER+GQPECQYYLKTG CKF
Sbjct  60   EPDCSYYIRTGLCRFGATCRFNHPPNRKLAIAAARMKGEFPERIGQPECQYYLKTGTCKF  119

Query  706  GATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTCKFHHPQPSNM  885
            GATCKFHHP+DKAGIAGRV+LN+LGYPLRPN+IEC YY+RTGQCKFGSTCKFHHPQP+N+
Sbjct  120  GATCKFHHPKDKAGIAGRVSLNILGYPLRPNEIECAYYLRTGQCKFGSTCKFHHPQPTNV  179

Query  886  MVPLRGSPAYPPVHSPTTPGQ  948
            MVPLRGSP YP V SPTTPGQ
Sbjct  180  MVPLRGSPVYPTVQSPTTPGQ  200


 Score =   101 bits (252),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 45/87 (52%), Positives = 58/87 (67%), Gaps = 0/87 (0%)
 Frame = +1

Query  610  LAIAAARMKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPL  789
            +   A +    +PER GQPECQ+Y+KTG CKFGA C+FHHPR++   A    L+ +G PL
Sbjct  294  VGFYALQRDNVFPERPGQPECQFYMKTGDCKFGAVCRFHHPRERLIPAPDCVLSPIGLPL  353

Query  790  RPNDIECPYYMRTGQCKFGSTCKFHHP  870
            RP +  C +Y R G CKFG +CKF HP
Sbjct  354  RPGEPLCIFYSRYGVCKFGPSCKFDHP  380


 Score = 77.0 bits (188),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 34/77 (44%), Positives = 48/77 (62%), Gaps = 1/77 (1%)
 Frame = +1

Query  505  TYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKG-EYPERVGQPECQYY  681
             +P R G+P+C +Y++TG C+FGA CRF+HP  R +      +     P R G+P C +Y
Sbjct  304  VFPERPGQPECQFYMKTGDCKFGAVCRFHHPRERLIPAPDCVLSPIGLPLRPGEPLCIFY  363

Query  682  LKTGACKFGATCKFHHP  732
             + G CKFG +CKF HP
Sbjct  364  SRYGVCKFGPSCKFDHP  380



>ref|XP_011014371.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
[Populus euphratica]
Length=445

 Score =   319 bits (817),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 148/197 (75%), Positives = 173/197 (88%), Gaps = 4/197 (2%)
 Frame = +1

Query  367  MDFEAAAGIS---ASMASVTEGPSSLSPPLAQETLWQLSLRSMETMESGTYPVRDGEPDC  537
            MDF+A   +S     + +VTE  +SLSP L+++ +WQ++LRS ETME+G YP R GEPDC
Sbjct  1    MDFDAGIPMSRGVGGLPAVTE-ETSLSPSLSEDAIWQMNLRSSETMEAGPYPERPGEPDC  59

Query  538  SYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKGEYPERVGQPECQYYLKTGACKFGATC  717
            SYYIRTGLCRFG +CRFNHP NRKLAIAAARMKGE+PER+GQPECQYYLKTG CKFGATC
Sbjct  60   SYYIRTGLCRFGPTCRFNHPPNRKLAIAAARMKGEFPERIGQPECQYYLKTGTCKFGATC  119

Query  718  KFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTCKFHHPQPSNMMVPL  897
            KFHHPRDKAG++GRV+LN+LGYPLR N++EC YY+RTGQCKFGSTCKFHHPQP+N+MVPL
Sbjct  120  KFHHPRDKAGVSGRVSLNILGYPLRLNEMECAYYLRTGQCKFGSTCKFHHPQPTNVMVPL  179

Query  898  RGSPAYPPVHSPTTPGQ  948
            RGSP YP V+SPTTPGQ
Sbjct  180  RGSPVYPTVNSPTTPGQ  196


 Score =   106 bits (264),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 46/87 (53%), Positives = 60/87 (69%), Gaps = 0/87 (0%)
 Frame = +1

Query  610  LAIAAARMKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPL  789
            +   A + +  +PER GQPECQ+Y+KTG CKFGA C+FHHPR++   A    L+ +G PL
Sbjct  291  MGFYALQRESVFPERPGQPECQFYMKTGDCKFGAVCRFHHPRERLIPAPDCVLSAIGLPL  350

Query  790  RPNDIECPYYMRTGQCKFGSTCKFHHP  870
            RP +  C +Y R G CKFG +CKFHHP
Sbjct  351  RPGEPLCIFYSRYGICKFGPSCKFHHP  377


 Score = 80.9 bits (198),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 35/77 (45%), Positives = 49/77 (64%), Gaps = 1/77 (1%)
 Frame = +1

Query  505  TYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKG-EYPERVGQPECQYY  681
             +P R G+P+C +Y++TG C+FGA CRF+HP  R +      +     P R G+P C +Y
Sbjct  301  VFPERPGQPECQFYMKTGDCKFGAVCRFHHPRERLIPAPDCVLSAIGLPLRPGEPLCIFY  360

Query  682  LKTGACKFGATCKFHHP  732
             + G CKFG +CKFHHP
Sbjct  361  SRYGICKFGPSCKFHHP  377



>ref|XP_002325901.2| zinc finger family protein [Populus trichocarpa]
 gb|EEF00283.2| zinc finger family protein [Populus trichocarpa]
Length=445

 Score =   318 bits (816),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 148/197 (75%), Positives = 173/197 (88%), Gaps = 4/197 (2%)
 Frame = +1

Query  367  MDFEAAAGIS---ASMASVTEGPSSLSPPLAQETLWQLSLRSMETMESGTYPVRDGEPDC  537
            MDF+A   +S     + +VTE  +SLSP L+++ +WQ++LRS ETME+G YP R GEPDC
Sbjct  1    MDFDAGIPMSRGGGGLPAVTE-ETSLSPSLSEDAMWQMNLRSSETMEAGPYPERPGEPDC  59

Query  538  SYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKGEYPERVGQPECQYYLKTGACKFGATC  717
            SYYIRTGLCRFG +CRFNHP NRKLAIAAARMKGE+PER+GQPECQYYLKTG CKFGATC
Sbjct  60   SYYIRTGLCRFGPTCRFNHPPNRKLAIAAARMKGEFPERIGQPECQYYLKTGTCKFGATC  119

Query  718  KFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTCKFHHPQPSNMMVPL  897
            KFHHPRDKAG++GRV+LN+LGYPLR N++EC YY+RTGQCKFGSTCKFHHPQP+N+MVPL
Sbjct  120  KFHHPRDKAGVSGRVSLNILGYPLRLNEMECAYYLRTGQCKFGSTCKFHHPQPTNVMVPL  179

Query  898  RGSPAYPPVHSPTTPGQ  948
            RGSP YP V+SPTTPGQ
Sbjct  180  RGSPVYPTVNSPTTPGQ  196


 Score =   106 bits (264),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 46/87 (53%), Positives = 60/87 (69%), Gaps = 0/87 (0%)
 Frame = +1

Query  610  LAIAAARMKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPL  789
            +   A + +  +PER GQPECQ+Y+KTG CKFGA C+FHHPR++   A    L+ +G PL
Sbjct  291  MGFYALQRESVFPERPGQPECQFYMKTGDCKFGAVCRFHHPRERLIPAPDCVLSAIGLPL  350

Query  790  RPNDIECPYYMRTGQCKFGSTCKFHHP  870
            RP +  C +Y R G CKFG +CKFHHP
Sbjct  351  RPGEPLCIFYSRYGICKFGPSCKFHHP  377


 Score = 80.5 bits (197),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 35/77 (45%), Positives = 49/77 (64%), Gaps = 1/77 (1%)
 Frame = +1

Query  505  TYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKG-EYPERVGQPECQYY  681
             +P R G+P+C +Y++TG C+FGA CRF+HP  R +      +     P R G+P C +Y
Sbjct  301  VFPERPGQPECQFYMKTGDCKFGAVCRFHHPRERLIPAPDCVLSAIGLPLRPGEPLCIFY  360

Query  682  LKTGACKFGATCKFHHP  732
             + G CKFG +CKFHHP
Sbjct  361  SRYGICKFGPSCKFHHP  377



>ref|XP_008355849.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
[Malus domestica]
Length=442

 Score =   318 bits (815),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 148/194 (76%), Positives = 167/194 (86%), Gaps = 1/194 (1%)
 Frame = +1

Query  367  MDFEAAAGISASMASVTEGPSSLSPPLAQETLWQLSLRSMETMESGTYPVRDGEPDCSYY  546
            MDF+A   +S + A VT+   SLS  L Q+ +WQ+++RS ETME+G YP R GEPDCSYY
Sbjct  1    MDFDAGIPMSRAAAPVTDA-RSLSASLTQDAMWQMNMRSSETMEAGPYPERAGEPDCSYY  59

Query  547  IRTGLCRFGASCRFNHPSNRKLAIAAARMKGEYPERVGQPECQYYLKTGACKFGATCKFH  726
            IRTGLCRFGA+CRFNHP NRKLAIAAARMKGE+PER+GQPECQYYLKTG CKFGATCKFH
Sbjct  60   IRTGLCRFGATCRFNHPPNRKLAIAAARMKGEFPERIGQPECQYYLKTGTCKFGATCKFH  119

Query  727  HPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGS  906
            HPRDKAGIAG VALN+LGYPLRPN++EC YY+RTGQCKFGSTCKFHHPQP+NMMV + GS
Sbjct  120  HPRDKAGIAGXVALNILGYPLRPNEVECAYYLRTGQCKFGSTCKFHHPQPTNMMVSVGGS  179

Query  907  PAYPPVHSPTTPGQ  948
              YP V SPTTPGQ
Sbjct  180  TVYPTVQSPTTPGQ  193


 Score =   100 bits (249),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 44/87 (51%), Positives = 59/87 (68%), Gaps = 0/87 (0%)
 Frame = +1

Query  610  LAIAAARMKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPL  789
            +   A + +  +PER GQPECQ+Y+KTG CKFG  C+FHHPR++   A    L+ +G PL
Sbjct  288  VGFYALQRENVFPERPGQPECQFYMKTGDCKFGGVCRFHHPRERLIPAPDCVLSPMGLPL  347

Query  790  RPNDIECPYYMRTGQCKFGSTCKFHHP  870
            RP +  C +Y R G CKFG +CKF+HP
Sbjct  348  RPGEPLCIFYSRYGICKFGPSCKFNHP  374


 Score = 75.5 bits (184),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 34/77 (44%), Positives = 48/77 (62%), Gaps = 1/77 (1%)
 Frame = +1

Query  505  TYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKL-AIAAARMKGEYPERVGQPECQYY  681
             +P R G+P+C +Y++TG C+FG  CRF+HP  R + A          P R G+P C +Y
Sbjct  298  VFPERPGQPECQFYMKTGDCKFGGVCRFHHPRERLIPAPDCVLSPMGLPLRPGEPLCIFY  357

Query  682  LKTGACKFGATCKFHHP  732
             + G CKFG +CKF+HP
Sbjct  358  SRYGICKFGPSCKFNHP  374



>gb|KCW84570.1| hypothetical protein EUGRSUZ_B01407 [Eucalyptus grandis]
Length=345

 Score =   313 bits (801),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 149/188 (79%), Positives = 163/188 (87%), Gaps = 4/188 (2%)
 Frame = +1

Query  385  AGISASMASVTEGPSSLSPPLAQETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLC  564
            AGI     SV +GPS LSP    + +WQ++LRS ET+ESG YP R GEPDCSYYIRTGLC
Sbjct  5    AGIPMPRGSVADGPS-LSP---SDAMWQMTLRSNETIESGPYPERPGEPDCSYYIRTGLC  60

Query  565  RFGASCRFNHPSNRKLAIAAARMKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKA  744
            RFGA+CRFNHPS+RKLAIA ARMKGEYPERVGQPECQYYLKTG CKFGATCKFHHPRDKA
Sbjct  61   RFGATCRFNHPSDRKLAIANARMKGEYPERVGQPECQYYLKTGTCKFGATCKFHHPRDKA  120

Query  745  GIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPV  924
            GIAG+VALN+LGYP RPN++EC YY+RTGQCKFGSTCKFHHPQP+NMMV LRGSP YP V
Sbjct  121  GIAGKVALNILGYPFRPNEMECAYYLRTGQCKFGSTCKFHHPQPTNMMVSLRGSPVYPSV  180

Query  925  HSPTTPGQ  948
             SPTTP Q
Sbjct  181  QSPTTPTQ  188


 Score = 72.8 bits (177),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 32/62 (52%), Positives = 42/62 (68%), Gaps = 0/62 (0%)
 Frame = +1

Query  610  LAIAAARMKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPL  789
            +   A +    +PER GQPECQ+Y+KTG CKFGA C+FHHPR++   A    L+ +G PL
Sbjct  282  VGFYALQRDNIFPERPGQPECQFYMKTGDCKFGAVCRFHHPRERLLPAPDCLLSPIGLPL  341

Query  790  RP  795
            RP
Sbjct  342  RP  343


 Score = 50.8 bits (120),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 19/35 (54%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +1

Query  508  YPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKL  612
            +P R G+P+C +Y++TG C+FGA CRF+HP  R L
Sbjct  293  FPERPGQPECQFYMKTGDCKFGAVCRFHHPRERLL  327



>ref|XP_009769498.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X1 [Nicotiana sylvestris]
 ref|XP_009769499.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X1 [Nicotiana sylvestris]
 ref|XP_009769500.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X1 [Nicotiana sylvestris]
 ref|XP_009769502.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X1 [Nicotiana sylvestris]
Length=427

 Score =   315 bits (808),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 146/181 (81%), Positives = 161/181 (89%), Gaps = 0/181 (0%)
 Frame = +1

Query  409  SVTEGPSSLSPPLAQETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRF  588
            SV+EGP SLSP L Q++LWQ++LRSME+MESG YPVR+GE DCSYYIRTGLCRFG++C+F
Sbjct  4    SVSEGPPSLSPSLRQDSLWQMNLRSMESMESGPYPVREGESDCSYYIRTGLCRFGSTCQF  63

Query  589  NHPSNRKLAIAAARMKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVAL  768
            NHP NRKLA+AAA M GEYPER+GQ ECQYYLKTG CKFGATCKFHHPRDKAGIAGRV L
Sbjct  64   NHPPNRKLALAAASMNGEYPERIGQLECQYYLKTGTCKFGATCKFHHPRDKAGIAGRVTL  123

Query  769  NVLGYPLRPNDIECPYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQ  948
            NVLGYPLRPN+ EC YYMRT QCKFGSTCKFHHP+PSNMMV  RGSP YPP  S TTPGQ
Sbjct  124  NVLGYPLRPNENECTYYMRTAQCKFGSTCKFHHPEPSNMMVSSRGSPVYPPGPSSTTPGQ  183

Query  949  L  951
            +
Sbjct  184  M  184


 Score = 99.8 bits (247),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 46/89 (52%), Positives = 60/89 (67%), Gaps = 2/89 (2%)
 Frame = +1

Query  610  LAIAAARMKGE--YPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGY  783
            L +    ++GE  +PERVGQPECQ+Y+KTG CKFGA C+FHHPR++        L+ +G 
Sbjct  270  LPVGYYALQGENVFPERVGQPECQFYMKTGDCKFGAVCRFHHPRERLLPPPDCLLSPIGL  329

Query  784  PLRPNDIECPYYMRTGQCKFGSTCKFHHP  870
            PLR  +  C +Y R G CKFG +CKF HP
Sbjct  330  PLRAGEPMCIFYSRYGICKFGPSCKFDHP  358


 Score = 77.4 bits (189),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 35/77 (45%), Positives = 48/77 (62%), Gaps = 1/77 (1%)
 Frame = +1

Query  505  TYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKG-EYPERVGQPECQYY  681
             +P R G+P+C +Y++TG C+FGA CRF+HP  R L      +     P R G+P C +Y
Sbjct  282  VFPERVGQPECQFYMKTGDCKFGAVCRFHHPRERLLPPPDCLLSPIGLPLRAGEPMCIFY  341

Query  682  LKTGACKFGATCKFHHP  732
             + G CKFG +CKF HP
Sbjct  342  SRYGICKFGPSCKFDHP  358


 Score = 55.5 bits (132),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 49/196 (25%), Positives = 76/196 (39%), Gaps = 72/196 (37%)
 Frame = +1

Query  490  TMESGTYPVRDGEPDCSYYIRTGLCRFGASC-----------------------------  582
            T+    YP+R  E +C+YY+RT  C+FG++C                             
Sbjct  122  TLNVLGYPLRPNENECTYYMRTAQCKFGSTCKFHHPEPSNMMVSSRGSPVYPPGPSSTTP  181

Query  583  -RFNHPSNRKLAIAAARMKGE--------------YPE--------RVGQPECQYYLKTG  693
             + ++P +R   I+ AR +G               +P          V   E Q      
Sbjct  182  GQMSYPLSRASFISGARWQGSSSYAPLPVLQGVVSFPGFTYNGQLGSVSSAEGQQQTAGN  241

Query  694  ACKFGATCKFHHPRDKAGIAG-------RVALNVLGY---------PLRPNDIECPYYMR  825
            +  +G++       DKA +         RV+   +GY         P R    EC +YM+
Sbjct  242  SQVYGSS----RSSDKATMGSEGMNSSYRVSSLPVGYYALQGENVFPERVGQPECQFYMK  297

Query  826  TGQCKFGSTCKFHHPQ  873
            TG CKFG+ C+FHHP+
Sbjct  298  TGDCKFGAVCRFHHPR  313



>gb|KCW84568.1| hypothetical protein EUGRSUZ_B01407 [Eucalyptus grandis]
Length=419

 Score =   313 bits (803),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 149/188 (79%), Positives = 163/188 (87%), Gaps = 4/188 (2%)
 Frame = +1

Query  385  AGISASMASVTEGPSSLSPPLAQETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLC  564
            AGI     SV +GPS LSP    + +WQ++LRS ET+ESG YP R GEPDCSYYIRTGLC
Sbjct  5    AGIPMPRGSVADGPS-LSP---SDAMWQMTLRSNETIESGPYPERPGEPDCSYYIRTGLC  60

Query  565  RFGASCRFNHPSNRKLAIAAARMKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKA  744
            RFGA+CRFNHPS+RKLAIA ARMKGEYPERVGQPECQYYLKTG CKFGATCKFHHPRDKA
Sbjct  61   RFGATCRFNHPSDRKLAIANARMKGEYPERVGQPECQYYLKTGTCKFGATCKFHHPRDKA  120

Query  745  GIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPV  924
            GIAG+VALN+LGYP RPN++EC YY+RTGQCKFGSTCKFHHPQP+NMMV LRGSP YP V
Sbjct  121  GIAGKVALNILGYPFRPNEMECAYYLRTGQCKFGSTCKFHHPQPTNMMVSLRGSPVYPSV  180

Query  925  HSPTTPGQ  948
             SPTTP Q
Sbjct  181  QSPTTPTQ  188


 Score =   101 bits (251),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 45/87 (52%), Positives = 58/87 (67%), Gaps = 0/87 (0%)
 Frame = +1

Query  610  LAIAAARMKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPL  789
            +   A +    +PER GQPECQ+Y+KTG CKFGA C+FHHPR++   A    L+ +G PL
Sbjct  272  VGFYALQRDNIFPERPGQPECQFYMKTGDCKFGAVCRFHHPRERLLPAPDCLLSPIGLPL  331

Query  790  RPNDIECPYYMRTGQCKFGSTCKFHHP  870
            RP +  C +Y R G CKFG +CKF HP
Sbjct  332  RPGEPLCIFYSRYGICKFGPSCKFDHP  358



>ref|XP_010038283.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
[Eucalyptus grandis]
 gb|KCW84569.1| hypothetical protein EUGRSUZ_B01407 [Eucalyptus grandis]
Length=429

 Score =   313 bits (803),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 149/188 (79%), Positives = 163/188 (87%), Gaps = 4/188 (2%)
 Frame = +1

Query  385  AGISASMASVTEGPSSLSPPLAQETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLC  564
            AGI     SV +GPS LSP    + +WQ++LRS ET+ESG YP R GEPDCSYYIRTGLC
Sbjct  5    AGIPMPRGSVADGPS-LSP---SDAMWQMTLRSNETIESGPYPERPGEPDCSYYIRTGLC  60

Query  565  RFGASCRFNHPSNRKLAIAAARMKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKA  744
            RFGA+CRFNHPS+RKLAIA ARMKGEYPERVGQPECQYYLKTG CKFGATCKFHHPRDKA
Sbjct  61   RFGATCRFNHPSDRKLAIANARMKGEYPERVGQPECQYYLKTGTCKFGATCKFHHPRDKA  120

Query  745  GIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPV  924
            GIAG+VALN+LGYP RPN++EC YY+RTGQCKFGSTCKFHHPQP+NMMV LRGSP YP V
Sbjct  121  GIAGKVALNILGYPFRPNEMECAYYLRTGQCKFGSTCKFHHPQPTNMMVSLRGSPVYPSV  180

Query  925  HSPTTPGQ  948
             SPTTP Q
Sbjct  181  QSPTTPTQ  188


 Score =   101 bits (251),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 45/87 (52%), Positives = 58/87 (67%), Gaps = 0/87 (0%)
 Frame = +1

Query  610  LAIAAARMKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPL  789
            +   A +    +PER GQPECQ+Y+KTG CKFGA C+FHHPR++   A    L+ +G PL
Sbjct  282  VGFYALQRDNIFPERPGQPECQFYMKTGDCKFGAVCRFHHPRERLLPAPDCLLSPIGLPL  341

Query  790  RPNDIECPYYMRTGQCKFGSTCKFHHP  870
            RP +  C +Y R G CKFG +CKF HP
Sbjct  342  RPGEPLCIFYSRYGICKFGPSCKFDHP  368


 Score = 77.8 bits (190),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 35/76 (46%), Positives = 48/76 (63%), Gaps = 1/76 (1%)
 Frame = +1

Query  508  YPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKG-EYPERVGQPECQYYL  684
            +P R G+P+C +Y++TG C+FGA CRF+HP  R L      +     P R G+P C +Y 
Sbjct  293  FPERPGQPECQFYMKTGDCKFGAVCRFHHPRERLLPAPDCLLSPIGLPLRPGEPLCIFYS  352

Query  685  KTGACKFGATCKFHHP  732
            + G CKFG +CKF HP
Sbjct  353  RYGICKFGPSCKFDHP  368



>ref|XP_007029391.1| Zinc finger CCCH domain-containing protein 33 isoform 1 [Theobroma 
cacao]
 gb|EOY09893.1| Zinc finger CCCH domain-containing protein 33 isoform 1 [Theobroma 
cacao]
Length=451

 Score =   314 bits (804),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 154/204 (75%), Positives = 171/204 (84%), Gaps = 11/204 (5%)
 Frame = +1

Query  367  MDFEAAAGI----------SASMASVTEGPSSLSPPLAQETLWQLSLRSMETMESGTYPV  516
            M+F   AGI          +A+  +VTEG +SLSP L Q+ +WQ++LRS ETMESG YP 
Sbjct  1    MEFSFDAGIPMPRTAAAVAAAAAVAVTEG-TSLSPSLNQDAMWQMNLRSSETMESGPYPE  59

Query  517  RDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKGEYPERVGQPECQYYLKTGA  696
            R GEPDCSYYIRTGLCRFGA+CRFNHP NRKLAIAAARMKGE+PER GQPECQYYLKTG 
Sbjct  60   RPGEPDCSYYIRTGLCRFGATCRFNHPPNRKLAIAAARMKGEFPERAGQPECQYYLKTGT  119

Query  697  CKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTCKFHHPQP  876
            CKFGATCKFHHPRDKAGIAGRV+LN+LGYPLRPN+ EC YY+RTGQCKFGSTCKFHHPQP
Sbjct  120  CKFGATCKFHHPRDKAGIAGRVSLNILGYPLRPNEPECAYYLRTGQCKFGSTCKFHHPQP  179

Query  877  SNMMVPLRGSPAYPPVHSPTTPGQ  948
            +NMMV +RGSP Y  V SPTTPGQ
Sbjct  180  TNMMVSVRGSPIYQTVPSPTTPGQ  203


 Score =   103 bits (257),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 49/106 (46%), Positives = 65/106 (61%), Gaps = 0/106 (0%)
 Frame = +1

Query  610  LAIAAARMKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPL  789
            +   A + +  +PER GQPECQ+Y+KTG CKFG  C+FHHPR++   A    L+ +G PL
Sbjct  297  VGFYALQRENVFPERPGQPECQFYMKTGDCKFGTVCRFHHPRERVLPAPDCVLSPIGLPL  356

Query  790  RPNDIECPYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVH  927
            RP +  C +Y R G CKFG +CKF+HP           SP+  PVH
Sbjct  357  RPGEPLCIFYSRYGICKFGPSCKFNHPMGIFTYNYSTSSPSDAPVH  402


 Score = 76.3 bits (186),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 34/77 (44%), Positives = 48/77 (62%), Gaps = 1/77 (1%)
 Frame = +1

Query  505  TYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKG-EYPERVGQPECQYY  681
             +P R G+P+C +Y++TG C+FG  CRF+HP  R L      +     P R G+P C +Y
Sbjct  307  VFPERPGQPECQFYMKTGDCKFGTVCRFHHPRERVLPAPDCVLSPIGLPLRPGEPLCIFY  366

Query  682  LKTGACKFGATCKFHHP  732
             + G CKFG +CKF+HP
Sbjct  367  SRYGICKFGPSCKFNHP  383



>gb|KJB75169.1| hypothetical protein B456_012G028600 [Gossypium raimondii]
Length=361

 Score =   310 bits (795),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 151/196 (77%), Positives = 164/196 (84%), Gaps = 3/196 (2%)
 Frame = +1

Query  367  MDFEAAAGI--SASMASVTEGPSSLSPPLAQETLWQLSLRSMETMESGTYPVRDGEPDCS  540
            M+F   AGI  S + A+  EG +SLSP L Q+  WQ++LRS ETME G YP R GEPDCS
Sbjct  1    MEFSFGAGIPMSRTPAAGPEG-TSLSPSLNQDGTWQINLRSSETMEPGPYPERPGEPDCS  59

Query  541  YYIRTGLCRFGASCRFNHPSNRKLAIAAARMKGEYPERVGQPECQYYLKTGACKFGATCK  720
            YYIRTGLCRFGA+CRFNHP NRKLAI  ARMKGE+PERVGQPECQYYLKTG CKFGATCK
Sbjct  60   YYIRTGLCRFGATCRFNHPPNRKLAITTARMKGEFPERVGQPECQYYLKTGTCKFGATCK  119

Query  721  FHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTCKFHHPQPSNMMVPLR  900
            FHHPRDKAGIAGRV+LN LGYPLRPN+ EC YY+RTGQCKFGSTCKFHHPQP+NMMV LR
Sbjct  120  FHHPRDKAGIAGRVSLNFLGYPLRPNETECAYYLRTGQCKFGSTCKFHHPQPTNMMVSLR  179

Query  901  GSPAYPPVHSPTTPGQ  948
            GSP YP   SPTT GQ
Sbjct  180  GSPIYPTFPSPTTSGQ  195


 Score = 68.9 bits (167),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 30/62 (48%), Positives = 42/62 (68%), Gaps = 0/62 (0%)
 Frame = +1

Query  610  LAIAAARMKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPL  789
            +   A + +  +PER G+ ECQ+Y+KTG CKFGA C+FHHPR++   A    L+ +G PL
Sbjct  290  VGFYALQRENVFPERPGELECQFYMKTGDCKFGAVCRFHHPRERVLPAPDCILSPIGLPL  349

Query  790  RP  795
            RP
Sbjct  350  RP  351


 Score = 53.9 bits (128),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 27/66 (41%), Positives = 38/66 (58%), Gaps = 5/66 (8%)
 Frame = +1

Query  706  GATCKFHHPRDKAGIAGRVAL---NVLGYPLRPNDIECPYYMRTGQCKFGSTCKFHHPQP  876
            G+   F   R  +   G  AL   NV  +P RP ++EC +YM+TG CKFG+ C+FHHP+ 
Sbjct  275  GSQALFSQFRSGSAPVGFYALQRENV--FPERPGELECQFYMKTGDCKFGAVCRFHHPRE  332

Query  877  SNMMVP  894
              +  P
Sbjct  333  RVLPAP  338



>ref|XP_004302155.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
[Fragaria vesca subsp. vesca]
Length=442

 Score =   313 bits (801),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 150/196 (77%), Positives = 166/196 (85%), Gaps = 5/196 (3%)
 Frame = +1

Query  367  MDFEAAAGISASMAS--VTEGPSSLSPPLAQETLWQLSLRSMETMESGTYPVRDGEPDCS  540
            MDF+A   +S + A+  VT+   SLSP   Q+ +WQ++LRS ETME G YP R GEPDCS
Sbjct  1    MDFDAGIPMSRASAAPPVTDEAPSLSP---QDAMWQMNLRSSETMEPGPYPERAGEPDCS  57

Query  541  YYIRTGLCRFGASCRFNHPSNRKLAIAAARMKGEYPERVGQPECQYYLKTGACKFGATCK  720
            YYIRTGLCRFGA+CRFNHP NRKLAIA ARMKGE+PERVGQPECQYYLKTG CKFGATCK
Sbjct  58   YYIRTGLCRFGATCRFNHPPNRKLAIATARMKGEFPERVGQPECQYYLKTGTCKFGATCK  117

Query  721  FHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTCKFHHPQPSNMMVPLR  900
            FHHPRDKAGIAGRVALN+LGYPLRPN+IEC YY+RTGQCKF STCK+HHP P+NMMV L 
Sbjct  118  FHHPRDKAGIAGRVALNILGYPLRPNEIECAYYLRTGQCKFASTCKYHHPPPTNMMVSLS  177

Query  901  GSPAYPPVHSPTTPGQ  948
            GSP YP V SPTTPGQ
Sbjct  178  GSPVYPTVQSPTTPGQ  193


 Score =   101 bits (251),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 44/76 (58%), Positives = 55/76 (72%), Gaps = 0/76 (0%)
 Frame = +1

Query  643  YPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYM  822
            +PER GQPECQ+Y+KTG CKFGA C+FHHPR++   A    L+ +G PLRP +  C +Y 
Sbjct  299  FPERPGQPECQFYMKTGDCKFGAVCRFHHPRERLIPAPDCVLSPIGLPLRPGEPLCIFYS  358

Query  823  RTGQCKFGSTCKFHHP  870
            R G CKFG +CKF HP
Sbjct  359  RYGICKFGPSCKFDHP  374


 Score = 77.0 bits (188),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 34/77 (44%), Positives = 48/77 (62%), Gaps = 1/77 (1%)
 Frame = +1

Query  505  TYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKG-EYPERVGQPECQYY  681
             +P R G+P+C +Y++TG C+FGA CRF+HP  R +      +     P R G+P C +Y
Sbjct  298  VFPERPGQPECQFYMKTGDCKFGAVCRFHHPRERLIPAPDCVLSPIGLPLRPGEPLCIFY  357

Query  682  LKTGACKFGATCKFHHP  732
             + G CKFG +CKF HP
Sbjct  358  SRYGICKFGPSCKFDHP  374



>gb|KJB75168.1| hypothetical protein B456_012G028600 [Gossypium raimondii]
Length=444

 Score =   310 bits (795),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 151/196 (77%), Positives = 164/196 (84%), Gaps = 3/196 (2%)
 Frame = +1

Query  367  MDFEAAAGI--SASMASVTEGPSSLSPPLAQETLWQLSLRSMETMESGTYPVRDGEPDCS  540
            M+F   AGI  S + A+  EG +SLSP L Q+  WQ++LRS ETME G YP R GEPDCS
Sbjct  1    MEFSFGAGIPMSRTPAAGPEG-TSLSPSLNQDGTWQINLRSSETMEPGPYPERPGEPDCS  59

Query  541  YYIRTGLCRFGASCRFNHPSNRKLAIAAARMKGEYPERVGQPECQYYLKTGACKFGATCK  720
            YYIRTGLCRFGA+CRFNHP NRKLAI  ARMKGE+PERVGQPECQYYLKTG CKFGATCK
Sbjct  60   YYIRTGLCRFGATCRFNHPPNRKLAITTARMKGEFPERVGQPECQYYLKTGTCKFGATCK  119

Query  721  FHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTCKFHHPQPSNMMVPLR  900
            FHHPRDKAGIAGRV+LN LGYPLRPN+ EC YY+RTGQCKFGSTCKFHHPQP+NMMV LR
Sbjct  120  FHHPRDKAGIAGRVSLNFLGYPLRPNETECAYYLRTGQCKFGSTCKFHHPQPTNMMVSLR  179

Query  901  GSPAYPPVHSPTTPGQ  948
            GSP YP   SPTT GQ
Sbjct  180  GSPIYPTFPSPTTSGQ  195


 Score = 99.4 bits (246),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 48/106 (45%), Positives = 64/106 (60%), Gaps = 0/106 (0%)
 Frame = +1

Query  610  LAIAAARMKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPL  789
            +   A + +  +PER G+ ECQ+Y+KTG CKFGA C+FHHPR++   A    L+ +G PL
Sbjct  290  VGFYALQRENVFPERPGELECQFYMKTGDCKFGAVCRFHHPRERVLPAPDCILSPIGLPL  349

Query  790  RPNDIECPYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVH  927
            RP +  C +Y R G CKFG +CKF+HP           SP   PVH
Sbjct  350  RPGEPLCIFYSRYGICKFGPSCKFNHPMGVFTFNYSASSPFEAPVH  395


 Score = 75.5 bits (184),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 35/77 (45%), Positives = 48/77 (62%), Gaps = 1/77 (1%)
 Frame = +1

Query  505  TYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKG-EYPERVGQPECQYY  681
             +P R GE +C +Y++TG C+FGA CRF+HP  R L      +     P R G+P C +Y
Sbjct  300  VFPERPGELECQFYMKTGDCKFGAVCRFHHPRERVLPAPDCILSPIGLPLRPGEPLCIFY  359

Query  682  LKTGACKFGATCKFHHP  732
             + G CKFG +CKF+HP
Sbjct  360  SRYGICKFGPSCKFNHP  376



>ref|XP_011015459.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
[Populus euphratica]
Length=412

 Score =   309 bits (791),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 139/163 (85%), Positives = 153/163 (94%), Gaps = 0/163 (0%)
 Frame = +1

Query  460  LWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKG  639
            +WQ++LRS ETME+G YP R GEPDCSYYIRTGLCRFGA+CRFNHP NRKLAIAAARMKG
Sbjct  1    MWQMNLRSSETMEAGPYPERSGEPDCSYYIRTGLCRFGATCRFNHPPNRKLAIAAARMKG  60

Query  640  EYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYY  819
            E+PER+GQPECQYYLKTG CKFGATCKFHHPRDKAGI+GRV+LN+LGYPL+PN+IEC YY
Sbjct  61   EFPERIGQPECQYYLKTGTCKFGATCKFHHPRDKAGISGRVSLNILGYPLQPNEIECAYY  120

Query  820  MRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQ  948
            +RTGQCKFGSTCKFHHPQP+NMMVPLRGSP YP V SPTTPGQ
Sbjct  121  LRTGQCKFGSTCKFHHPQPTNMMVPLRGSPIYPTVSSPTTPGQ  163


 Score =   102 bits (253),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 46/87 (53%), Positives = 59/87 (68%), Gaps = 0/87 (0%)
 Frame = +1

Query  610  LAIAAARMKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPL  789
            L   A + +  +PER GQPECQ+Y+KTG CKFGA C+FHHPR++   A    L+ +G PL
Sbjct  258  LGYYALQRESVFPERPGQPECQFYMKTGDCKFGAVCRFHHPRERLIPAPDCVLSPIGLPL  317

Query  790  RPNDIECPYYMRTGQCKFGSTCKFHHP  870
            RP +  C +Y R G CKFG +CKF HP
Sbjct  318  RPGEPLCIFYSRYGICKFGPSCKFDHP  344


 Score = 76.3 bits (186),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 34/77 (44%), Positives = 48/77 (62%), Gaps = 1/77 (1%)
 Frame = +1

Query  505  TYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKG-EYPERVGQPECQYY  681
             +P R G+P+C +Y++TG C+FGA CRF+HP  R +      +     P R G+P C +Y
Sbjct  268  VFPERPGQPECQFYMKTGDCKFGAVCRFHHPRERLIPAPDCVLSPIGLPLRPGEPLCIFY  327

Query  682  LKTGACKFGATCKFHHP  732
             + G CKFG +CKF HP
Sbjct  328  SRYGICKFGPSCKFDHP  344



>gb|KHG12066.1| Zinc finger CCCH domain-containing protein ZFN-like protein [Gossypium 
arboreum]
Length=433

 Score =   309 bits (792),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 154/205 (75%), Positives = 167/205 (81%), Gaps = 12/205 (6%)
 Frame = +1

Query  367  MDFEAAAGISASMAS-----VTEGPSSLSPPLAQETLWQLSLRSMETMESGTYPVRDGEP  531
            M+F   AGI  S  +     VTEG SSLSP L Q+ +WQ++LRS ETMES  YP R GEP
Sbjct  1    MEFSFDAGIPMSRTATAAVPVTEG-SSLSPSLNQDAMWQMNLRSSETMESTPYPERPGEP  59

Query  532  DCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKGEYPERVGQPECQ------YYLKTG  693
            DCSYYIRTGLCRFGA+C FNHP NRKLAIAAARMKGE+PERVGQPECQ      YYLKTG
Sbjct  60   DCSYYIRTGLCRFGATCHFNHPPNRKLAIAAARMKGEFPERVGQPECQACTYSSYYLKTG  119

Query  694  ACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTCKFHHPQ  873
             CKFGATCKFHHPRDKAGIAGRV+LN+LGYPLRPN+ EC YY+RTGQCKFGSTCKFHHPQ
Sbjct  120  TCKFGATCKFHHPRDKAGIAGRVSLNILGYPLRPNETECAYYLRTGQCKFGSTCKFHHPQ  179

Query  874  PSNMMVPLRGSPAYPPVHSPTTPGQ  948
            P+NMMV LRGSP Y  V SP TPGQ
Sbjct  180  PTNMMVSLRGSPIYQTVPSPATPGQ  204


 Score =   103 bits (257),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 45/87 (52%), Positives = 61/87 (70%), Gaps = 0/87 (0%)
 Frame = +1

Query  610  LAIAAARMKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPL  789
            + + A + +  +PER G+PECQ+Y+KTG CKFGA CKFHHPR++   A    L+ +G PL
Sbjct  279  VGVYALQRENVFPERPGEPECQFYMKTGDCKFGAVCKFHHPRERVLPAPDCVLSPIGLPL  338

Query  790  RPNDIECPYYMRTGQCKFGSTCKFHHP  870
            RP +  C +Y R G CKFG +CKF+HP
Sbjct  339  RPGEPLCIFYSRYGICKFGPSCKFNHP  365


 Score = 78.2 bits (191),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 35/77 (45%), Positives = 49/77 (64%), Gaps = 1/77 (1%)
 Frame = +1

Query  505  TYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKG-EYPERVGQPECQYY  681
             +P R GEP+C +Y++TG C+FGA C+F+HP  R L      +     P R G+P C +Y
Sbjct  289  VFPERPGEPECQFYMKTGDCKFGAVCKFHHPRERVLPAPDCVLSPIGLPLRPGEPLCIFY  348

Query  682  LKTGACKFGATCKFHHP  732
             + G CKFG +CKF+HP
Sbjct  349  SRYGICKFGPSCKFNHP  365



>ref|XP_008812314.1| PREDICTED: LOW QUALITY PROTEIN: zinc finger CCCH domain-containing 
protein ZFN-like [Phoenix dactylifera]
Length=457

 Score =   309 bits (791),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 143/180 (79%), Positives = 158/180 (88%), Gaps = 4/180 (2%)
 Frame = +1

Query  409  SVTEGPSSLSPPLAQETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRF  588
            +VTEG SSL     +E +WQ++LR  E+MESG YP R GEPDC+YYIRTGLCRFG +C+F
Sbjct  18   AVTEGSSSLD----EEAMWQMNLRGSESMESGPYPERPGEPDCAYYIRTGLCRFGMTCKF  73

Query  589  NHPSNRKLAIAAARMKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVAL  768
            NHP NRKLAIAAAR+KG YPERVGQPECQYYLKTG CKFGATCKFHHP+DKAGIAGRV L
Sbjct  74   NHPPNRKLAIAAARIKGGYPERVGQPECQYYLKTGTCKFGATCKFHHPKDKAGIAGRVQL  133

Query  769  NVLGYPLRPNDIECPYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQ  948
            N+LGYPLRPN+ EC YY+RTGQCKFG+TCKFHHPQPSN MV LRGSP YPPVHSPTTPGQ
Sbjct  134  NILGYPLRPNEKECAYYLRTGQCKFGNTCKFHHPQPSNAMVDLRGSPVYPPVHSPTTPGQ  193


 Score =   102 bits (254),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 46/92 (50%), Positives = 60/92 (65%), Gaps = 0/92 (0%)
 Frame = +1

Query  595  PSNRKLAIAAARMKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNV  774
            P +  + + A + +  +PER  QPECQ+Y+KTG CKFGA CKFHHPR++       +L+ 
Sbjct  283  PGSIPMGVYALQRENIFPERPDQPECQFYMKTGDCKFGAVCKFHHPRERLVPVPNCSLSP  342

Query  775  LGYPLRPNDIECPYYMRTGQCKFGSTCKFHHP  870
            LG PLRP +  C +Y R G CKFG  CKF HP
Sbjct  343  LGLPLRPGEPLCVFYARYGICKFGPNCKFDHP  374


 Score = 74.7 bits (182),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 32/76 (42%), Positives = 47/76 (62%), Gaps = 1/76 (1%)
 Frame = +1

Query  508  YPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKG-EYPERVGQPECQYYL  684
            +P R  +P+C +Y++TG C+FGA C+F+HP  R + +    +     P R G+P C +Y 
Sbjct  299  FPERPDQPECQFYMKTGDCKFGAVCKFHHPRERLVPVPNCSLSPLGLPLRPGEPLCVFYA  358

Query  685  KTGACKFGATCKFHHP  732
            + G CKFG  CKF HP
Sbjct  359  RYGICKFGPNCKFDHP  374



>ref|XP_011660227.1| PREDICTED: LOW QUALITY PROTEIN: zinc finger CCCH domain-containing 
protein ZFN-like [Cucumis sativus]
Length=436

 Score =   306 bits (784),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 145/181 (80%), Positives = 161/181 (89%), Gaps = 2/181 (1%)
 Frame = +1

Query  409  SVTEGPSS-LSPPLAQETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCR  585
            SVTEG SS L+P L ++ LWQ++L S E M SG+YPVR GEPDCSYYIRTGLCRFGA+CR
Sbjct  10   SVTEGHSSALAPSLREDALWQMNLGSGEIMGSGSYPVRPGEPDCSYYIRTGLCRFGATCR  69

Query  586  FNHPSNRKLAIAAARMKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVA  765
            FNHP NR+LAIA ARMKGE+PER+GQPECQYYLKTG CKFGATCKFHHPRDKAGIAGRVA
Sbjct  70   FNHPPNRELAIATARMKGEFPERIGQPECQYYLKTGTCKFGATCKFHHPRDKAGIAGRVA  129

Query  766  LNVLGYPLRPNDIECPYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVHSPTTPG  945
            LN+LGYPLRP++ EC YY+RTGQCKFG+TCKFHHPQP+NMMV LRGSP YP V SP TPG
Sbjct  130  LNILGYPLRPSETECAYYLRTGQCKFGNTCKFHHPQPTNMMVSLRGSPIYPTVQSP-TPG  188

Query  946  Q  948
            Q
Sbjct  189  Q  189


 Score =   102 bits (253),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 46/91 (51%), Positives = 59/91 (65%), Gaps = 0/91 (0%)
 Frame = +1

Query  598  SNRKLAIAAARMKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVL  777
            SN        + +  +PER GQPECQ+Y+KTG CKFGA C+FHHPR++   A    L+ +
Sbjct  279  SNCPFGFLPLQRENVFPERPGQPECQFYMKTGDCKFGAVCRFHHPRERVLPAPDCVLSPI  338

Query  778  GYPLRPNDIECPYYMRTGQCKFGSTCKFHHP  870
            G PLRP +  C +Y R G CKFG +CKF HP
Sbjct  339  GLPLRPGEPLCIFYSRYGICKFGPSCKFDHP  369


 Score = 77.4 bits (189),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 35/77 (45%), Positives = 48/77 (62%), Gaps = 1/77 (1%)
 Frame = +1

Query  505  TYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKG-EYPERVGQPECQYY  681
             +P R G+P+C +Y++TG C+FGA CRF+HP  R L      +     P R G+P C +Y
Sbjct  293  VFPERPGQPECQFYMKTGDCKFGAVCRFHHPRERVLPAPDCVLSPIGLPLRPGEPLCIFY  352

Query  682  LKTGACKFGATCKFHHP  732
             + G CKFG +CKF HP
Sbjct  353  SRYGICKFGPSCKFDHP  369


 Score = 50.8 bits (120),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 23/56 (41%), Positives = 32/56 (57%), Gaps = 3/56 (5%)
 Frame = +1

Query  781  YPLRPNDIECPYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQ  948
            +P RP   EC +YM+TG CKFG+ C+FHHP+   +  P        P+  P  PG+
Sbjct  294  FPERPGQPECQFYMKTGDCKFGAVCRFHHPRERVLPAP---DCVLSPIGLPLRPGE  346



>ref|XP_010245962.1| PREDICTED: LOW QUALITY PROTEIN: zinc finger CCCH domain-containing 
protein ZFN-like [Nelumbo nucifera]
Length=457

 Score =   307 bits (786),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 144/188 (77%), Positives = 160/188 (85%), Gaps = 1/188 (1%)
 Frame = +1

Query  385  AGISASMASVTEGPSSLSPPLAQETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLC  564
             GI  S A+VTE  SSLSP L ++TLWQ++LR  ETMESG YP R GE DC+YY+RTGLC
Sbjct  5    TGIQMSRAAVTE-ESSLSPSLDEDTLWQMNLRPSETMESGPYPERPGELDCAYYVRTGLC  63

Query  565  RFGASCRFNHPSNRKLAIAAARMKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKA  744
            RFG +CRFNHP NRKLA+ AARM G YPER+GQPECQYYLKTG CKFGATCKFHHP+DKA
Sbjct  64   RFGMTCRFNHPPNRKLAVVAARMIGSYPERIGQPECQYYLKTGTCKFGATCKFHHPKDKA  123

Query  745  GIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPV  924
            GIAGRV LN+LGYPLRPN+ EC YY+RTGQCKFG+TCKFHHPQPSN +V L GSP YP V
Sbjct  124  GIAGRVPLNILGYPLRPNERECAYYLRTGQCKFGNTCKFHHPQPSNTVVSLPGSPVYPSV  183

Query  925  HSPTTPGQ  948
            HSPTTPGQ
Sbjct  184  HSPTTPGQ  191


 Score = 99.8 bits (247),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 44/87 (51%), Positives = 57/87 (66%), Gaps = 0/87 (0%)
 Frame = +1

Query  610  LAIAAARMKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPL  789
            + + A + +  +PER  QPECQ+Y+KTG CKFGA C+FHHPR++        L+ LG PL
Sbjct  288  VGLYALQRESVFPERPDQPECQFYMKTGDCKFGAVCRFHHPRERLIPVPNCVLSPLGLPL  347

Query  790  RPNDIECPYYMRTGQCKFGSTCKFHHP  870
            RP +  C +Y R G CKFG  CKF HP
Sbjct  348  RPGEPLCIFYSRYGICKFGPNCKFDHP  374


 Score = 75.9 bits (185),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 33/77 (43%), Positives = 47/77 (61%), Gaps = 1/77 (1%)
 Frame = +1

Query  505  TYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKG-EYPERVGQPECQYY  681
             +P R  +P+C +Y++TG C+FGA CRF+HP  R + +    +     P R G+P C +Y
Sbjct  298  VFPERPDQPECQFYMKTGDCKFGAVCRFHHPRERLIPVPNCVLSPLGLPLRPGEPLCIFY  357

Query  682  LKTGACKFGATCKFHHP  732
             + G CKFG  CKF HP
Sbjct  358  SRYGICKFGPNCKFDHP  374


 Score = 52.4 bits (124),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 20/38 (53%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = +1

Query  781  YPLRPNDIECPYYMRTGQCKFGSTCKFHHPQPSNMMVP  894
            +P RP+  EC +YM+TG CKFG+ C+FHHP+   + VP
Sbjct  299  FPERPDQPECQFYMKTGDCKFGAVCRFHHPRERLIPVP  336



>ref|XP_008443710.1| PREDICTED: LOW QUALITY PROTEIN: zinc finger CCCH domain-containing 
protein ZFN-like [Cucumis melo]
Length=437

 Score =   306 bits (783),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 145/181 (80%), Positives = 161/181 (89%), Gaps = 2/181 (1%)
 Frame = +1

Query  409  SVTEGPSS-LSPPLAQETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCR  585
            SVTEG SS L+P L ++ LWQ++L S E M SG+YPVR GEPDCSYYIRTGLCRFGA+CR
Sbjct  10   SVTEGHSSALAPSLREDALWQMNLGSGEIMGSGSYPVRPGEPDCSYYIRTGLCRFGATCR  69

Query  586  FNHPSNRKLAIAAARMKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVA  765
            FNHP NR+LAIA ARMKGE+PER+GQPECQYYLKTG CKFGATCKFHHPRDKAGIAGRVA
Sbjct  70   FNHPPNRELAIATARMKGEFPERIGQPECQYYLKTGTCKFGATCKFHHPRDKAGIAGRVA  129

Query  766  LNVLGYPLRPNDIECPYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVHSPTTPG  945
            LN+LGYPLRP++ EC YY+RTGQCKFG+TCKFHHPQP+NMMV LRGSP YP V SP TPG
Sbjct  130  LNILGYPLRPSETECAYYLRTGQCKFGNTCKFHHPQPTNMMVSLRGSPIYPTVQSP-TPG  188

Query  946  Q  948
            Q
Sbjct  189  Q  189


 Score =   102 bits (254),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 46/91 (51%), Positives = 59/91 (65%), Gaps = 0/91 (0%)
 Frame = +1

Query  598  SNRKLAIAAARMKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVL  777
            SN        + +  +PER GQPECQ+Y+KTG CKFGA C+FHHPR++   A    L+ +
Sbjct  280  SNCSFGFLPLQRENVFPERPGQPECQFYMKTGDCKFGAVCRFHHPRERVLPAPDCVLSPI  339

Query  778  GYPLRPNDIECPYYMRTGQCKFGSTCKFHHP  870
            G PLRP +  C +Y R G CKFG +CKF HP
Sbjct  340  GLPLRPGEPLCIFYSRYGICKFGPSCKFDHP  370


 Score = 77.4 bits (189),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 35/77 (45%), Positives = 48/77 (62%), Gaps = 1/77 (1%)
 Frame = +1

Query  505  TYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKG-EYPERVGQPECQYY  681
             +P R G+P+C +Y++TG C+FGA CRF+HP  R L      +     P R G+P C +Y
Sbjct  294  VFPERPGQPECQFYMKTGDCKFGAVCRFHHPRERVLPAPDCVLSPIGLPLRPGEPLCIFY  353

Query  682  LKTGACKFGATCKFHHP  732
             + G CKFG +CKF HP
Sbjct  354  SRYGICKFGPSCKFDHP  370


 Score = 50.8 bits (120),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 23/56 (41%), Positives = 32/56 (57%), Gaps = 3/56 (5%)
 Frame = +1

Query  781  YPLRPNDIECPYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQ  948
            +P RP   EC +YM+TG CKFG+ C+FHHP+   +  P        P+  P  PG+
Sbjct  295  FPERPGQPECQFYMKTGDCKFGAVCRFHHPRERVLPAP---DCVLSPIGLPLRPGE  347



>ref|XP_009626542.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X1 [Nicotiana tomentosiformis]
Length=427

 Score =   305 bits (780),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 139/169 (82%), Positives = 153/169 (91%), Gaps = 0/169 (0%)
 Frame = +1

Query  409  SVTEGPSSLSPPLAQETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRF  588
            S++EGP SLSP L Q++LWQ++LRSME+MESG YPVR+GEPDCSYYIRTGLCRFG++CRF
Sbjct  4    SMSEGPPSLSPSLRQDSLWQMNLRSMESMESGPYPVREGEPDCSYYIRTGLCRFGSTCRF  63

Query  589  NHPSNRKLAIAAARMKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVAL  768
            NHP NRKLA+AAA M GEYPER+GQ ECQYYLKTG CKFGATCKFHHPRDKAGIAGRV L
Sbjct  64   NHPPNRKLALAAASMNGEYPERIGQLECQYYLKTGTCKFGATCKFHHPRDKAGIAGRVTL  123

Query  769  NVLGYPLRPNDIECPYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAY  915
            NVLGYPLRPN+ EC YYMRT QCKFGSTCKFHHP+PSNMMV  RGSP Y
Sbjct  124  NVLGYPLRPNENECTYYMRTAQCKFGSTCKFHHPEPSNMMVSSRGSPVY  172


 Score =   101 bits (251),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 46/89 (52%), Positives = 61/89 (69%), Gaps = 2/89 (2%)
 Frame = +1

Query  610  LAIAAARMKGE--YPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGY  783
            L +    ++GE  +PER+GQPECQ+Y+KTG CKFGA C+FHHPR++        L+ +G 
Sbjct  270  LPVGYYALEGENVFPERLGQPECQFYMKTGDCKFGAVCRFHHPRERLLPPPDCLLSPIGL  329

Query  784  PLRPNDIECPYYMRTGQCKFGSTCKFHHP  870
            PLRP +  C +Y R G CKFG +CKF HP
Sbjct  330  PLRPGEPMCIFYSRYGICKFGPSCKFDHP  358


 Score = 75.9 bits (185),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 35/77 (45%), Positives = 48/77 (62%), Gaps = 1/77 (1%)
 Frame = +1

Query  505  TYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMK-GEYPERVGQPECQYY  681
             +P R G+P+C +Y++TG C+FGA CRF+HP  R L      +     P R G+P C +Y
Sbjct  282  VFPERLGQPECQFYMKTGDCKFGAVCRFHHPRERLLPPPDCLLSPIGLPLRPGEPMCIFY  341

Query  682  LKTGACKFGATCKFHHP  732
             + G CKFG +CKF HP
Sbjct  342  SRYGICKFGPSCKFDHP  358


 Score = 58.9 bits (141),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 50/192 (26%), Positives = 74/192 (39%), Gaps = 64/192 (33%)
 Frame = +1

Query  490  TMESGTYPVRDGEPDCSYYIRTGLCRFGASCRF---------------------------  588
            T+    YP+R  E +C+YY+RT  C+FG++C+F                           
Sbjct  122  TLNVLGYPLRPNENECTYYMRTAQCKFGSTCKFHHPEPSNMMVSSRGSPVYPPGPSPTTP  181

Query  589  ---NHPSNRKLAIAAARMKGEY---PERVGQPECQYYLKTGACKFGATCKFHHPRDKAG-  747
               ++P +R   I+ AR +G     P  V Q    +   T   + GA       +  AG 
Sbjct  182  GQMSYPLSRASFISGARWQGSSSYAPLPVLQGVVSFPGFTYNGQLGAVSSAEDQQQTAGN  241

Query  748  -------------IAGRVALNV--------LGY---------PLRPNDIECPYYMRTGQC  837
                           G   +N         +GY         P R    EC +YM+TG C
Sbjct  242  NQVYGSSRSSDKATMGSEGMNSSYRASSLPVGYYALEGENVFPERLGQPECQFYMKTGDC  301

Query  838  KFGSTCKFHHPQ  873
            KFG+ C+FHHP+
Sbjct  302  KFGAVCRFHHPR  313



>ref|XP_006606433.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X1 [Glycine max]
Length=430

 Score =   304 bits (778),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 137/173 (79%), Positives = 156/173 (90%), Gaps = 0/173 (0%)
 Frame = +1

Query  430  SLSPPLAQETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRK  609
            +L  P  Q++LW ++LR+ ETM+SG+YP R GEPDCSYYIRTGLCRFGA+CRFNHP NR+
Sbjct  8    NLIVPNPQDSLWMMNLRTGETMDSGSYPERPGEPDCSYYIRTGLCRFGATCRFNHPPNRR  67

Query  610  LAIAAARMKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPL  789
            LAIA ARM GE+PER+GQPECQYYLKTG CKFGATCKFHHP+D+AGIAGRVALN+LGYPL
Sbjct  68   LAIATARMIGEFPERIGQPECQYYLKTGTCKFGATCKFHHPKDQAGIAGRVALNILGYPL  127

Query  790  RPNDIECPYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQ  948
            RPN+ EC YY+RTGQCKFG+TCKFHHPQPSNMM+ LRGSP YP VHSPTTPGQ
Sbjct  128  RPNEPECTYYLRTGQCKFGNTCKFHHPQPSNMMLSLRGSPVYPTVHSPTTPGQ  180


 Score = 97.1 bits (240),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 43/76 (57%), Positives = 54/76 (71%), Gaps = 0/76 (0%)
 Frame = +1

Query  643  YPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYM  822
            +PER GQPECQ+Y+KTG CKFGA C+FHHPR++   A    L+ +G PLR  +  C +Y 
Sbjct  286  FPERPGQPECQFYVKTGDCKFGAVCQFHHPRERLIPAPDCVLSPIGLPLRLGEPLCVFYS  345

Query  823  RTGQCKFGSTCKFHHP  870
            R G CKFG +CKF HP
Sbjct  346  RYGICKFGPSCKFDHP  361


 Score = 77.4 bits (189),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 33/78 (42%), Positives = 50/78 (64%), Gaps = 1/78 (1%)
 Frame = +1

Query  508  YPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKG-EYPERVGQPECQYYL  684
            +P R G+P+C +Y++TG C+FGA C+F+HP  R +      +     P R+G+P C +Y 
Sbjct  286  FPERPGQPECQFYVKTGDCKFGAVCQFHHPRERLIPAPDCVLSPIGLPLRLGEPLCVFYS  345

Query  685  KTGACKFGATCKFHHPRD  738
            + G CKFG +CKF HP +
Sbjct  346  RYGICKFGPSCKFDHPME  363



>ref|XP_007139732.1| hypothetical protein PHAVU_008G054800g [Phaseolus vulgaris]
 gb|ESW11726.1| hypothetical protein PHAVU_008G054800g [Phaseolus vulgaris]
Length=426

 Score =   303 bits (776),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 142/194 (73%), Positives = 160/194 (82%), Gaps = 13/194 (7%)
 Frame = +1

Query  367  MDFEAAAGISASMASVTEGPSSLSPPLAQETLWQLSLRSMETMESGTYPVRDGEPDCSYY  546
            M+F+AA  +S                L Q+ +WQ++LRS ETMESG YP   GEPDCSYY
Sbjct  1    MEFDAAIPVSREH-------------LPQDAMWQINLRSSETMESGPYPEHPGEPDCSYY  47

Query  547  IRTGLCRFGASCRFNHPSNRKLAIAAARMKGEYPERVGQPECQYYLKTGACKFGATCKFH  726
            IRTGLCRFGA+CRFNHP NRKLAIAAARMKGE+PER+GQPECQYYLKTG CKFGATC+FH
Sbjct  48   IRTGLCRFGATCRFNHPPNRKLAIAAARMKGEFPERIGQPECQYYLKTGTCKFGATCRFH  107

Query  727  HPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGS  906
            HPRDKAGIAGRVALN+LGYPLRPN+ EC YY+RTGQCKFG+TCKFHHPQPSNM++ +R S
Sbjct  108  HPRDKAGIAGRVALNILGYPLRPNEPECAYYLRTGQCKFGNTCKFHHPQPSNMVLSMRSS  167

Query  907  PAYPPVHSPTTPGQ  948
            P YP V SPTTPGQ
Sbjct  168  PVYPTVQSPTTPGQ  181


 Score = 97.4 bits (241),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 42/76 (55%), Positives = 54/76 (71%), Gaps = 0/76 (0%)
 Frame = +1

Query  643  YPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYM  822
            +PER  QP+CQ+Y+KTG CKFGA C+FHHPR++   A    L+ +G PLRP +  C +Y 
Sbjct  283  FPERPDQPDCQFYMKTGDCKFGAVCRFHHPRERMIPAPDCVLSPIGLPLRPGEPLCVFYS  342

Query  823  RTGQCKFGSTCKFHHP  870
            R G CKFG +CKF HP
Sbjct  343  RYGICKFGPSCKFDHP  358


 Score = 76.3 bits (186),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 47/76 (62%), Gaps = 1/76 (1%)
 Frame = +1

Query  508  YPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKG-EYPERVGQPECQYYL  684
            +P R  +PDC +Y++TG C+FGA CRF+HP  R +      +     P R G+P C +Y 
Sbjct  283  FPERPDQPDCQFYMKTGDCKFGAVCRFHHPRERMIPAPDCVLSPIGLPLRPGEPLCVFYS  342

Query  685  KTGACKFGATCKFHHP  732
            + G CKFG +CKF HP
Sbjct  343  RYGICKFGPSCKFDHP  358



>ref|XP_003536159.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
[Glycine max]
Length=421

 Score =   303 bits (775),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 136/169 (80%), Positives = 154/169 (91%), Gaps = 0/169 (0%)
 Frame = +1

Query  442  PLAQETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIA  621
            P  Q++LW ++LR+ ETM+SG+YP R GEPDCSYY+RTGLCRFGA+CRFNHP NRKLAIA
Sbjct  13   PNPQDSLWMMNLRTGETMDSGSYPERPGEPDCSYYMRTGLCRFGATCRFNHPPNRKLAIA  72

Query  622  AARMKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPND  801
             ARM GE+PER+GQPECQYYLKTG CKFGATCKFHHP+D+AGIAGRVALN+LGYPLRPN+
Sbjct  73   TARMIGEFPERIGQPECQYYLKTGTCKFGATCKFHHPKDQAGIAGRVALNILGYPLRPNE  132

Query  802  IECPYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQ  948
             EC YY+RTGQCKFG+TCKFHHPQPSNMM+ LRGSP YP VHSPTTPGQ
Sbjct  133  PECTYYLRTGQCKFGNTCKFHHPQPSNMMLSLRGSPVYPTVHSPTTPGQ  181


 Score = 99.8 bits (247),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 43/76 (57%), Positives = 55/76 (72%), Gaps = 0/76 (0%)
 Frame = +1

Query  643  YPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYM  822
            +PER GQPECQ+Y+KTG CKFGA C+FHHP+++   A    L+ +G PLRP +  C +Y 
Sbjct  278  FPERPGQPECQFYMKTGDCKFGAVCRFHHPQERLVPAPNCVLSPIGLPLRPGEPLCVFYS  337

Query  823  RTGQCKFGSTCKFHHP  870
            R G CKFG +CKF HP
Sbjct  338  RYGICKFGPSCKFDHP  353


 Score = 76.6 bits (187),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 34/78 (44%), Positives = 49/78 (63%), Gaps = 1/78 (1%)
 Frame = +1

Query  508  YPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKG-EYPERVGQPECQYYL  684
            +P R G+P+C +Y++TG C+FGA CRF+HP  R +      +     P R G+P C +Y 
Sbjct  278  FPERPGQPECQFYMKTGDCKFGAVCRFHHPQERLVPAPNCVLSPIGLPLRPGEPLCVFYS  337

Query  685  KTGACKFGATCKFHHPRD  738
            + G CKFG +CKF HP +
Sbjct  338  RYGICKFGPSCKFDHPME  355


 Score = 51.6 bits (122),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 19/31 (61%), Positives = 24/31 (77%), Gaps = 0/31 (0%)
 Frame = +1

Query  781  YPLRPNDIECPYYMRTGQCKFGSTCKFHHPQ  873
            +P RP   EC +YM+TG CKFG+ C+FHHPQ
Sbjct  278  FPERPGQPECQFYMKTGDCKFGAVCRFHHPQ  308



>ref|XP_010525081.1| PREDICTED: zinc finger CCCH domain-containing protein 33-like 
isoform X1 [Tarenaya hassleriana]
Length=440

 Score =   303 bits (775),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 141/194 (73%), Positives = 160/194 (82%), Gaps = 5/194 (3%)
 Frame = +1

Query  367  MDFEAAAGISASMASVTEGPSSLSPPLAQETLWQLSLRSMETMESGTYPVRDGEPDCSYY  546
            MDF A   +S        G SSLSP L Q+ +W ++L S+ETME GTYP R GEPDCSYY
Sbjct  1    MDFNAGVPMSRE-----SGTSSLSPLLNQDAMWPMNLSSVETMEGGTYPERPGEPDCSYY  55

Query  547  IRTGLCRFGASCRFNHPSNRKLAIAAARMKGEYPERVGQPECQYYLKTGACKFGATCKFH  726
            IRTGLCRFG++CRFNHP +R LAIAAARMKGEYPER+GQPECQYYLKTG CKFG TCKFH
Sbjct  56   IRTGLCRFGSTCRFNHPRDRNLAIAAARMKGEYPERIGQPECQYYLKTGTCKFGVTCKFH  115

Query  727  HPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGS  906
            HPR+KAGIAGRV+LNVLGYP+RPN++EC YY+RTG CKFGSTCKF+HP P+N+MVPLRGS
Sbjct  116  HPRNKAGIAGRVSLNVLGYPIRPNEVECSYYLRTGHCKFGSTCKFNHPPPTNLMVPLRGS  175

Query  907  PAYPPVHSPTTPGQ  948
            P YP V SPT   Q
Sbjct  176  PVYPAVQSPTAGQQ  189


 Score =   106 bits (264),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 49/93 (53%), Positives = 61/93 (66%), Gaps = 0/93 (0%)
 Frame = +1

Query  592  HPSNRKLAIAAARMKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALN  771
            H  + +L I A   +  +PER GQPECQ+Y+KTG CKFGA CKFHHPRD+        L+
Sbjct  272  HSGSAQLGIYALPRENVFPERPGQPECQFYMKTGDCKFGAVCKFHHPRDRQIPPPDCVLS  331

Query  772  VLGYPLRPNDIECPYYMRTGQCKFGSTCKFHHP  870
             +G PLRP +  C +Y R G CKFG +CKF HP
Sbjct  332  PIGLPLRPGEPLCVFYSRYGICKFGPSCKFDHP  364


 Score = 76.6 bits (187),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 33/77 (43%), Positives = 50/77 (65%), Gaps = 1/77 (1%)
 Frame = +1

Query  505  TYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKG-EYPERVGQPECQYY  681
             +P R G+P+C +Y++TG C+FGA C+F+HP +R++      +     P R G+P C +Y
Sbjct  288  VFPERPGQPECQFYMKTGDCKFGAVCKFHHPRDRQIPPPDCVLSPIGLPLRPGEPLCVFY  347

Query  682  LKTGACKFGATCKFHHP  732
             + G CKFG +CKF HP
Sbjct  348  SRYGICKFGPSCKFDHP  364


 Score = 54.3 bits (129),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 31/81 (38%), Positives = 41/81 (51%), Gaps = 5/81 (6%)
 Frame = +1

Query  706  GATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTCKFHHPQPSNM  885
            G+   FH    + GI      NV  +P RP   EC +YM+TG CKFG+ CKFHHP+   +
Sbjct  266  GSFSGFHSGSAQLGIYALPRENV--FPERPGQPECQFYMKTGDCKFGAVCKFHHPRDRQI  323

Query  886  MVPLRGSPAYPPVHSPTTPGQ  948
              P        P+  P  PG+
Sbjct  324  PPP---DCVLSPIGLPLRPGE  341



>ref|XP_010929824.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
[Elaeis guineensis]
Length=263

 Score =   296 bits (758),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 139/181 (77%), Positives = 156/181 (86%), Gaps = 4/181 (2%)
 Frame = +1

Query  406  ASVTEGPSSLSPPLAQETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCR  585
            A++TEG SSL     +E +WQ++LR  E+MESG YP R GEPDC+YYIRTGLCRFG +C+
Sbjct  8    AAMTEGSSSLD----EEAMWQMNLRGSESMESGPYPERPGEPDCAYYIRTGLCRFGMTCK  63

Query  586  FNHPSNRKLAIAAARMKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVA  765
            FNHP NR LAIAAAR+KG YPERVGQPECQYYLKTG CKFGATCKFHHP+DKAG+AGRV 
Sbjct  64   FNHPPNRSLAIAAARIKGGYPERVGQPECQYYLKTGTCKFGATCKFHHPKDKAGMAGRVQ  123

Query  766  LNVLGYPLRPNDIECPYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVHSPTTPG  945
            LN+LGYPLR N+ EC YY+RTGQCKFG+TCKFHHPQPSN MV LRGSP YPPVHS TTPG
Sbjct  124  LNILGYPLRLNEKECAYYIRTGQCKFGNTCKFHHPQPSNAMVALRGSPVYPPVHSLTTPG  183

Query  946  Q  948
            Q
Sbjct  184  Q  184



>ref|XP_010913061.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
[Elaeis guineensis]
Length=381

 Score =   300 bits (768),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 140/181 (77%), Positives = 154/181 (85%), Gaps = 4/181 (2%)
 Frame = +1

Query  406  ASVTEGPSSLSPPLAQETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCR  585
            A VTEG SSL     +E +WQ++LR  E MESG YP R GEPDC+YYIRTGLCRFG +C+
Sbjct  17   ADVTEGSSSLE----EEAIWQMNLRGSELMESGPYPKRPGEPDCAYYIRTGLCRFGMTCK  72

Query  586  FNHPSNRKLAIAAARMKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVA  765
            FNHP NRK+AIAAAR+KG YPERVGQPECQYYLKTG CKFGATCKFHHP+DKAGIAGRV 
Sbjct  73   FNHPPNRKMAIAAARIKGGYPERVGQPECQYYLKTGTCKFGATCKFHHPKDKAGIAGRVQ  132

Query  766  LNVLGYPLRPNDIECPYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVHSPTTPG  945
            LN+LGYPLRPN+ EC YY+RTGQCKFG+TCKFHHPQPSN MV LRGS  Y PVHSPT PG
Sbjct  133  LNILGYPLRPNEKECAYYLRTGQCKFGNTCKFHHPQPSNAMVALRGSSVYSPVHSPTIPG  192

Query  946  Q  948
            Q
Sbjct  193  Q  193


 Score = 69.3 bits (168),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 30/62 (48%), Positives = 41/62 (66%), Gaps = 0/62 (0%)
 Frame = +1

Query  610  LAIAAARMKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPL  789
            + + A + +  +P R  QPECQ+Y+KTG CKFGA C+FHHPR++        L+ LG PL
Sbjct  288  MGVYALQRENIFPNRPDQPECQFYMKTGDCKFGAACRFHHPRERLMPVPDCVLSPLGLPL  347

Query  790  RP  795
            RP
Sbjct  348  RP  349


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 21/38 (55%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = +1

Query  781  YPLRPNDIECPYYMRTGQCKFGSTCKFHHPQPSNMMVP  894
            +P RP+  EC +YM+TG CKFG+ C+FHHP+   M VP
Sbjct  299  FPNRPDQPECQFYMKTGDCKFGAACRFHHPRERLMPVP  336



>ref|XP_007029392.1| Zinc finger CCCH domain-containing protein 33 isoform 2 [Theobroma 
cacao]
 gb|EOY09894.1| Zinc finger CCCH domain-containing protein 33 isoform 2 [Theobroma 
cacao]
Length=411

 Score =   301 bits (771),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 138/163 (85%), Positives = 149/163 (91%), Gaps = 0/163 (0%)
 Frame = +1

Query  460  LWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKG  639
            +WQ++LRS ETMESG YP R GEPDCSYYIRTGLCRFGA+CRFNHP NRKLAIAAARMKG
Sbjct  1    MWQMNLRSSETMESGPYPERPGEPDCSYYIRTGLCRFGATCRFNHPPNRKLAIAAARMKG  60

Query  640  EYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYY  819
            E+PER GQPECQYYLKTG CKFGATCKFHHPRDKAGIAGRV+LN+LGYPLRPN+ EC YY
Sbjct  61   EFPERAGQPECQYYLKTGTCKFGATCKFHHPRDKAGIAGRVSLNILGYPLRPNEPECAYY  120

Query  820  MRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQ  948
            +RTGQCKFGSTCKFHHPQP+NMMV +RGSP Y  V SPTTPGQ
Sbjct  121  LRTGQCKFGSTCKFHHPQPTNMMVSVRGSPIYQTVPSPTTPGQ  163


 Score =   103 bits (256),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 49/106 (46%), Positives = 65/106 (61%), Gaps = 0/106 (0%)
 Frame = +1

Query  610  LAIAAARMKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPL  789
            +   A + +  +PER GQPECQ+Y+KTG CKFG  C+FHHPR++   A    L+ +G PL
Sbjct  257  VGFYALQRENVFPERPGQPECQFYMKTGDCKFGTVCRFHHPRERVLPAPDCVLSPIGLPL  316

Query  790  RPNDIECPYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVH  927
            RP +  C +Y R G CKFG +CKF+HP           SP+  PVH
Sbjct  317  RPGEPLCIFYSRYGICKFGPSCKFNHPMGIFTYNYSTSSPSDAPVH  362


 Score = 75.9 bits (185),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 34/77 (44%), Positives = 48/77 (62%), Gaps = 1/77 (1%)
 Frame = +1

Query  505  TYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKG-EYPERVGQPECQYY  681
             +P R G+P+C +Y++TG C+FG  CRF+HP  R L      +     P R G+P C +Y
Sbjct  267  VFPERPGQPECQFYMKTGDCKFGTVCRFHHPRERVLPAPDCVLSPIGLPLRPGEPLCIFY  326

Query  682  LKTGACKFGATCKFHHP  732
             + G CKFG +CKF+HP
Sbjct  327  SRYGICKFGPSCKFNHP  343



>ref|XP_003534518.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoformX2 [Glycine max]
Length=426

 Score =   301 bits (770),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 140/194 (72%), Positives = 160/194 (82%), Gaps = 13/194 (7%)
 Frame = +1

Query  367  MDFEAAAGISASMASVTEGPSSLSPPLAQETLWQLSLRSMETMESGTYPVRDGEPDCSYY  546
            M+F+AA  +S                L  + +WQ++LRS ETMESG YP   GEPDCSYY
Sbjct  1    MEFDAAIPVSREH-------------LPPDAMWQINLRSSETMESGPYPEHPGEPDCSYY  47

Query  547  IRTGLCRFGASCRFNHPSNRKLAIAAARMKGEYPERVGQPECQYYLKTGACKFGATCKFH  726
            IRTGLCRFGA+CRFNHP NRKLAIAAARMKGE+PER+GQPECQYYLKTG CKFGATC+FH
Sbjct  48   IRTGLCRFGATCRFNHPPNRKLAIAAARMKGEFPERIGQPECQYYLKTGTCKFGATCRFH  107

Query  727  HPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGS  906
            HPRDKAGIAGRVA+N+LGYPLRPN+ EC YY+RTGQCKFG+TCKFHHPQP+NM++ +R S
Sbjct  108  HPRDKAGIAGRVAMNILGYPLRPNEPECAYYLRTGQCKFGNTCKFHHPQPNNMVLSMRSS  167

Query  907  PAYPPVHSPTTPGQ  948
            P YP VHSPTTPGQ
Sbjct  168  PVYPTVHSPTTPGQ  181


 Score = 99.4 bits (246),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 44/87 (51%), Positives = 58/87 (67%), Gaps = 0/87 (0%)
 Frame = +1

Query  610  LAIAAARMKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPL  789
            +   A + +  +PER  QPECQ+Y+KTG CKFGA C+FHHPR++   A    L+ +G PL
Sbjct  272  VGFYALQRENIFPERPDQPECQFYMKTGDCKFGAVCRFHHPRERMIPAPDCVLSPIGLPL  331

Query  790  RPNDIECPYYMRTGQCKFGSTCKFHHP  870
            RP +  C +Y R G CKFG +CKF HP
Sbjct  332  RPGEPLCVFYSRYGICKFGPSCKFDHP  358


 Score = 74.3 bits (181),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 47/76 (62%), Gaps = 1/76 (1%)
 Frame = +1

Query  508  YPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKG-EYPERVGQPECQYYL  684
            +P R  +P+C +Y++TG C+FGA CRF+HP  R +      +     P R G+P C +Y 
Sbjct  283  FPERPDQPECQFYMKTGDCKFGAVCRFHHPRERMIPAPDCVLSPIGLPLRPGEPLCVFYS  342

Query  685  KTGACKFGATCKFHHP  732
            + G CKFG +CKF HP
Sbjct  343  RYGICKFGPSCKFDHP  358


 Score = 51.2 bits (121),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 24/56 (43%), Positives = 34/56 (61%), Gaps = 3/56 (5%)
 Frame = +1

Query  781  YPLRPNDIECPYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQ  948
            +P RP+  EC +YM+TG CKFG+ C+FHHP+    M+P        P+  P  PG+
Sbjct  283  FPERPDQPECQFYMKTGDCKFGAVCRFHHPR--ERMIPAPDC-VLSPIGLPLRPGE  335



>gb|ACC85690.1| zinc finger protein [Medicago sativa]
 gb|AFP86282.1| zinc finger protein [Medicago sativa]
Length=418

 Score =   300 bits (769),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 135/168 (80%), Positives = 151/168 (90%), Gaps = 0/168 (0%)
 Frame = +1

Query  445  LAQETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAA  624
            + QE +WQ+SLR  ETMESG YP   GEPDCSYYIRTGLCRFGA+CRFNHP NRKLAIA 
Sbjct  6    IPQEAMWQMSLRPSETMESGPYPEHPGEPDCSYYIRTGLCRFGATCRFNHPPNRKLAIAT  65

Query  625  ARMKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDI  804
            ARMKGE+PER+GQPECQYYLKTG CKFGATC+FHHP+DKAG+AGRVALN+LGYPLRPN+ 
Sbjct  66   ARMKGEFPERLGQPECQYYLKTGTCKFGATCRFHHPKDKAGVAGRVALNILGYPLRPNES  125

Query  805  ECPYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQ  948
            EC YY+RTGQCKFG+TCKFHHPQPSNM++P+RGSP YP V SPTT GQ
Sbjct  126  ECAYYLRTGQCKFGNTCKFHHPQPSNMVLPMRGSPVYPTVQSPTTAGQ  173


 Score =   100 bits (248),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 45/87 (52%), Positives = 58/87 (67%), Gaps = 0/87 (0%)
 Frame = +1

Query  610  LAIAAARMKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPL  789
            +   A + +  +PER  QPECQ+Y+KTG CKFGA C+FHHPR++   A    L+ LG PL
Sbjct  264  VGFYALQRENIFPERPDQPECQFYMKTGDCKFGAVCRFHHPRERTIPAPDCVLSPLGLPL  323

Query  790  RPNDIECPYYMRTGQCKFGSTCKFHHP  870
            RP +  C +Y R G CKFG +CKF HP
Sbjct  324  RPGEPLCVFYSRYGICKFGPSCKFDHP  350


 Score = 75.1 bits (183),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 38/95 (40%), Positives = 52/95 (55%), Gaps = 7/95 (7%)
 Frame = +1

Query  508  YPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKG-EYPERVGQPECQYYL  684
            +P R  +P+C +Y++TG C+FGA CRF+HP  R +      +     P R G+P C +Y 
Sbjct  275  FPERPDQPECQFYMKTGDCKFGAVCRFHHPRERTIPAPDCVLSPLGLPLRPGEPLCVFYS  334

Query  685  KTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPL  789
            + G CKFG +CKF HP       G    NV   PL
Sbjct  335  RYGICKFGPSCKFDHP------MGIFTYNVSASPL  363


 Score = 51.6 bits (122),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 19/38 (50%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = +1

Query  781  YPLRPNDIECPYYMRTGQCKFGSTCKFHHPQPSNMMVP  894
            +P RP+  EC +YM+TG CKFG+ C+FHHP+   +  P
Sbjct  275  FPERPDQPECQFYMKTGDCKFGAVCRFHHPRERTIPAP  312



>ref|XP_003624157.1| Zinc finger CCCH domain-containing protein [Medicago truncatula]
 gb|AES80375.1| zinc finger CCCH domain protein [Medicago truncatula]
Length=418

 Score =   300 bits (769),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 135/168 (80%), Positives = 151/168 (90%), Gaps = 0/168 (0%)
 Frame = +1

Query  445  LAQETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAA  624
            + QE +WQ+SLR  ETMESG YP   GEPDCSYYIRTGLCRFGA+CRFNHP NRKLAIA 
Sbjct  6    IPQEAMWQMSLRPSETMESGPYPEHPGEPDCSYYIRTGLCRFGATCRFNHPPNRKLAIAT  65

Query  625  ARMKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDI  804
            ARMKGE+PER+GQPECQYYLKTG CKFGATC+FHHP+DKAG+AGRVALN+LGYPLRPN+ 
Sbjct  66   ARMKGEFPERLGQPECQYYLKTGTCKFGATCRFHHPKDKAGVAGRVALNILGYPLRPNES  125

Query  805  ECPYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQ  948
            EC YY+RTGQCKFG+TCKFHHPQPSNM++P+RGSP YP V SPTT GQ
Sbjct  126  ECAYYLRTGQCKFGNTCKFHHPQPSNMVLPMRGSPVYPTVQSPTTAGQ  173


 Score =   100 bits (248),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 45/87 (52%), Positives = 58/87 (67%), Gaps = 0/87 (0%)
 Frame = +1

Query  610  LAIAAARMKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPL  789
            +   A + +  +PER  QPECQ+Y+KTG CKFGA C+FHHPR++   A    L+ LG PL
Sbjct  264  VGFYALQRENIFPERPDQPECQFYMKTGDCKFGAVCRFHHPRERTIPAPDCVLSPLGLPL  323

Query  790  RPNDIECPYYMRTGQCKFGSTCKFHHP  870
            RP +  C +Y R G CKFG +CKF HP
Sbjct  324  RPGEPLCVFYSRYGICKFGPSCKFDHP  350


 Score = 75.1 bits (183),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 38/95 (40%), Positives = 52/95 (55%), Gaps = 7/95 (7%)
 Frame = +1

Query  508  YPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKG-EYPERVGQPECQYYL  684
            +P R  +P+C +Y++TG C+FGA CRF+HP  R +      +     P R G+P C +Y 
Sbjct  275  FPERPDQPECQFYMKTGDCKFGAVCRFHHPRERTIPAPDCVLSPLGLPLRPGEPLCVFYS  334

Query  685  KTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPL  789
            + G CKFG +CKF HP       G    NV   PL
Sbjct  335  RYGICKFGPSCKFDHP------MGIFTYNVSASPL  363


 Score = 51.6 bits (122),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 19/38 (50%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = +1

Query  781  YPLRPNDIECPYYMRTGQCKFGSTCKFHHPQPSNMMVP  894
            +P RP+  EC +YM+TG CKFG+ C+FHHP+   +  P
Sbjct  275  FPERPDQPECQFYMKTGDCKFGAVCRFHHPRERTIPAP  312



>ref|XP_008792910.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X1 [Phoenix dactylifera]
 ref|XP_008792911.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X1 [Phoenix dactylifera]
 ref|XP_008792912.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X1 [Phoenix dactylifera]
Length=473

 Score =   301 bits (772),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 138/188 (73%), Positives = 160/188 (85%), Gaps = 1/188 (1%)
 Frame = +1

Query  388  GISASMASVTEGPSSL-SPPLAQETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLC  564
            G  A+ ASVTE  SSL +P   +ETLWQ+++R  E+MESG+YP R GEPDC+YY+RTG C
Sbjct  12   GYRATAASVTEASSSLLAPAFDEETLWQMNMRGSESMESGSYPQRQGEPDCAYYLRTGHC  71

Query  565  RFGASCRFNHPSNRKLAIAAARMKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKA  744
            R+G +CR+NHP NRKLAIAAAR+KG YPE VGQPECQYYLKTG CKFGATCKFHHP+DKA
Sbjct  72   RYGVTCRYNHPPNRKLAIAAARLKGGYPEIVGQPECQYYLKTGTCKFGATCKFHHPKDKA  131

Query  745  GIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPV  924
            GI GR  LN+LGYP+RPN+ EC YY+RTGQCKFG+TCKFHHPQPSN+MV LRGSP YP V
Sbjct  132  GILGRAELNILGYPIRPNEEECAYYLRTGQCKFGNTCKFHHPQPSNVMVSLRGSPFYPSV  191

Query  925  HSPTTPGQ  948
            HSPT+P Q
Sbjct  192  HSPTSPSQ  199


 Score =   100 bits (249),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 45/90 (50%), Positives = 59/90 (66%), Gaps = 0/90 (0%)
 Frame = +1

Query  622  AARMKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPND  801
            A +    +PER+ QPECQ+Y+KTG CKFGA CKFHHP+++   A    L+  G PLRP +
Sbjct  298  ALQKDNVFPERLDQPECQFYMKTGDCKFGAACKFHHPKERLITAPNCLLSPSGLPLRPGE  357

Query  802  IECPYYMRTGQCKFGSTCKFHHPQPSNMMV  891
              C +Y R G CKFG  CKF HP  ++M +
Sbjct  358  PLCVFYSRYGICKFGPNCKFDHPVVTSMGI  387


 Score = 75.5 bits (184),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 32/80 (40%), Positives = 48/80 (60%), Gaps = 1/80 (1%)
 Frame = +1

Query  496  ESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMK-GEYPERVGQPEC  672
            +   +P R  +P+C +Y++TG C+FGA+C+F+HP  R +      +     P R G+P C
Sbjct  301  KDNVFPERLDQPECQFYMKTGDCKFGAACKFHHPKERLITAPNCLLSPSGLPLRPGEPLC  360

Query  673  QYYLKTGACKFGATCKFHHP  732
             +Y + G CKFG  CKF HP
Sbjct  361  VFYSRYGICKFGPNCKFDHP  380



>ref|XP_010929825.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X1 [Elaeis guineensis]
Length=460

 Score =   301 bits (770),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 140/181 (77%), Positives = 156/181 (86%), Gaps = 4/181 (2%)
 Frame = +1

Query  406  ASVTEGPSSLSPPLAQETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCR  585
            A++TEG SSL     +E +WQ++LR  E+MESG YP R GE DC YYIRTGLCRFG +C+
Sbjct  17   AAMTEGSSSLD----EEAMWQMNLRGSESMESGPYPERPGEADCGYYIRTGLCRFGMTCK  72

Query  586  FNHPSNRKLAIAAARMKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVA  765
            FNHP NR+LAIAAAR+KG YPERVGQPECQYYLKTG CKFGATCKFHHP+DKAGIAGRV 
Sbjct  73   FNHPPNRRLAIAAARIKGGYPERVGQPECQYYLKTGTCKFGATCKFHHPKDKAGIAGRVQ  132

Query  766  LNVLGYPLRPNDIECPYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVHSPTTPG  945
            LN+LGYPLRPN+ EC YY+RTGQCKFG+TCKFHHPQPSN MV LRGSP YPPVHS TTPG
Sbjct  133  LNILGYPLRPNEKECAYYIRTGQCKFGNTCKFHHPQPSNAMVALRGSPVYPPVHSSTTPG  192

Query  946  Q  948
            Q
Sbjct  193  Q  193


 Score =   101 bits (251),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 46/92 (50%), Positives = 59/92 (64%), Gaps = 0/92 (0%)
 Frame = +1

Query  595  PSNRKLAIAAARMKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNV  774
            P +  + + A + +  +PER  QPECQ+Y+KTG CKFGA CKFHHPR++        L+ 
Sbjct  283  PGSIPMGVYALQRENIFPERPDQPECQFYMKTGDCKFGAVCKFHHPRERLVPVPNCLLSP  342

Query  775  LGYPLRPNDIECPYYMRTGQCKFGSTCKFHHP  870
            LG PLRP +  C +Y R G CKFG  CKF HP
Sbjct  343  LGLPLRPGEPLCVFYSRYGICKFGPNCKFDHP  374


 Score = 73.9 bits (180),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 32/76 (42%), Positives = 47/76 (62%), Gaps = 1/76 (1%)
 Frame = +1

Query  508  YPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKG-EYPERVGQPECQYYL  684
            +P R  +P+C +Y++TG C+FGA C+F+HP  R + +    +     P R G+P C +Y 
Sbjct  299  FPERPDQPECQFYMKTGDCKFGAVCKFHHPRERLVPVPNCLLSPLGLPLRPGEPLCVFYS  358

Query  685  KTGACKFGATCKFHHP  732
            + G CKFG  CKF HP
Sbjct  359  RYGICKFGPNCKFDHP  374



>ref|XP_006602842.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X1 [Glycine max]
Length=426

 Score =   299 bits (766),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 140/194 (72%), Positives = 159/194 (82%), Gaps = 13/194 (7%)
 Frame = +1

Query  367  MDFEAAAGISASMASVTEGPSSLSPPLAQETLWQLSLRSMETMESGTYPVRDGEPDCSYY  546
            M+F+AA  +S                L Q+ +WQ++LRS ETMES  YP   GEPDCSYY
Sbjct  1    MEFDAAIPVSREH-------------LPQDAMWQINLRSSETMESEPYPEHPGEPDCSYY  47

Query  547  IRTGLCRFGASCRFNHPSNRKLAIAAARMKGEYPERVGQPECQYYLKTGACKFGATCKFH  726
            IRTGLCRFGA+CRFNHP NRKLAIAAARMKGE+PER+GQPECQYYLKTG CKFGATC+FH
Sbjct  48   IRTGLCRFGATCRFNHPPNRKLAIAAARMKGEFPERIGQPECQYYLKTGTCKFGATCRFH  107

Query  727  HPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGS  906
            HPRDKAGIAGRVALN+LGYPLRPN+ EC YY+RTGQCKFG+TCKFHHPQP+NM++ +R S
Sbjct  108  HPRDKAGIAGRVALNILGYPLRPNEPECGYYLRTGQCKFGNTCKFHHPQPNNMVLSMRSS  167

Query  907  PAYPPVHSPTTPGQ  948
            P YP VHSPTTPG 
Sbjct  168  PVYPTVHSPTTPGH  181


 Score = 97.1 bits (240),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 43/87 (49%), Positives = 57/87 (66%), Gaps = 0/87 (0%)
 Frame = +1

Query  610  LAIAAARMKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPL  789
            +   A + +  +PER  QPECQ+Y+KTG CKFGA C+FHHP ++   A    L+ +G PL
Sbjct  272  VGFYALQRENIFPERPDQPECQFYMKTGDCKFGAVCRFHHPHERMIPAPDCVLSPIGLPL  331

Query  790  RPNDIECPYYMRTGQCKFGSTCKFHHP  870
            RP +  C +Y R G CKFG +CKF HP
Sbjct  332  RPGEPLCVFYSRYGICKFGPSCKFDHP  358


 Score = 73.9 bits (180),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 47/76 (62%), Gaps = 1/76 (1%)
 Frame = +1

Query  508  YPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKG-EYPERVGQPECQYYL  684
            +P R  +P+C +Y++TG C+FGA CRF+HP  R +      +     P R G+P C +Y 
Sbjct  283  FPERPDQPECQFYMKTGDCKFGAVCRFHHPHERMIPAPDCVLSPIGLPLRPGEPLCVFYS  342

Query  685  KTGACKFGATCKFHHP  732
            + G CKFG +CKF HP
Sbjct  343  RYGICKFGPSCKFDHP  358


 Score = 50.8 bits (120),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 24/56 (43%), Positives = 33/56 (59%), Gaps = 3/56 (5%)
 Frame = +1

Query  781  YPLRPNDIECPYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQ  948
            +P RP+  EC +YM+TG CKFG+ C+FHHP     M+P        P+  P  PG+
Sbjct  283  FPERPDQPECQFYMKTGDCKFGAVCRFHHPH--ERMIPAPDC-VLSPIGLPLRPGE  335



>ref|XP_011084651.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
[Sesamum indicum]
Length=425

 Score =   299 bits (766),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 145/188 (77%), Positives = 158/188 (84%), Gaps = 6/188 (3%)
 Frame = +1

Query  400  SMASVTEGPSSLSP----PLAQETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCR  567
            S  SVT   SS S     P  Q+ LWQ++  + E ++SG YPVR+GEPDCSYYIRTGLCR
Sbjct  2    SRVSVTAVASSASSIHLQPHHQDALWQMNT-TREQIDSGPYPVREGEPDCSYYIRTGLCR  60

Query  568  FGASCRFNHPSNRKLAIAAARMKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAG  747
            FG++CRFNHP NRKLAIA ARMKGEYPER+GQ ECQYYLKTG CKFGATCKFHHPRDKAG
Sbjct  61   FGSTCRFNHPPNRKLAIATARMKGEYPERIGQSECQYYLKTGTCKFGATCKFHHPRDKAG  120

Query  748  IAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVH  927
            IAGRVALNVLGYPLRPN+IEC YYMR GQCKFGSTCKFHHPQPSNMMV +RGS  YPP+H
Sbjct  121  IAGRVALNVLGYPLRPNEIECAYYMRNGQCKFGSTCKFHHPQPSNMMVSVRGSAVYPPIH  180

Query  928  SPTTPGQL  951
            SPT  GQL
Sbjct  181  SPTA-GQL  187


 Score =   100 bits (249),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 46/93 (49%), Positives = 59/93 (63%), Gaps = 0/93 (0%)
 Frame = +1

Query  592  HPSNRKLAIAAARMKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALN  771
            H  +  +   A +    +PER GQPECQ+Y+KTG CKFGA CKFHHPR++        L+
Sbjct  265  HSGSLPMGYYAFQRDNVFPERPGQPECQFYMKTGDCKFGAVCKFHHPRERLIPVPDCILS  324

Query  772  VLGYPLRPNDIECPYYMRTGQCKFGSTCKFHHP  870
             +G PLRP +  C +Y R G CKFG +CKF HP
Sbjct  325  PIGLPLRPGEPLCVFYSRYGICKFGPSCKFDHP  357


 Score = 76.6 bits (187),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 33/77 (43%), Positives = 49/77 (64%), Gaps = 1/77 (1%)
 Frame = +1

Query  505  TYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKG-EYPERVGQPECQYY  681
             +P R G+P+C +Y++TG C+FGA C+F+HP  R + +    +     P R G+P C +Y
Sbjct  281  VFPERPGQPECQFYMKTGDCKFGAVCKFHHPRERLIPVPDCILSPIGLPLRPGEPLCVFY  340

Query  682  LKTGACKFGATCKFHHP  732
             + G CKFG +CKF HP
Sbjct  341  SRYGICKFGPSCKFDHP  357


 Score = 52.8 bits (125),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 25/56 (45%), Positives = 33/56 (59%), Gaps = 3/56 (5%)
 Frame = +1

Query  781  YPLRPNDIECPYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQ  948
            +P RP   EC +YM+TG CKFG+ CKFHHP+   + VP        P+  P  PG+
Sbjct  282  FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERLIPVP---DCILSPIGLPLRPGE  334



>ref|XP_007139733.1| hypothetical protein PHAVU_008G054800g [Phaseolus vulgaris]
 gb|ESW11727.1| hypothetical protein PHAVU_008G054800g [Phaseolus vulgaris]
Length=408

 Score =   298 bits (764),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 135/163 (83%), Positives = 149/163 (91%), Gaps = 0/163 (0%)
 Frame = +1

Query  460  LWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKG  639
            +WQ++LRS ETMESG YP   GEPDCSYYIRTGLCRFGA+CRFNHP NRKLAIAAARMKG
Sbjct  1    MWQINLRSSETMESGPYPEHPGEPDCSYYIRTGLCRFGATCRFNHPPNRKLAIAAARMKG  60

Query  640  EYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYY  819
            E+PER+GQPECQYYLKTG CKFGATC+FHHPRDKAGIAGRVALN+LGYPLRPN+ EC YY
Sbjct  61   EFPERIGQPECQYYLKTGTCKFGATCRFHHPRDKAGIAGRVALNILGYPLRPNEPECAYY  120

Query  820  MRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQ  948
            +RTGQCKFG+TCKFHHPQPSNM++ +R SP YP V SPTTPGQ
Sbjct  121  LRTGQCKFGNTCKFHHPQPSNMVLSMRSSPVYPTVQSPTTPGQ  163


 Score = 97.4 bits (241),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 42/76 (55%), Positives = 54/76 (71%), Gaps = 0/76 (0%)
 Frame = +1

Query  643  YPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYM  822
            +PER  QP+CQ+Y+KTG CKFGA C+FHHPR++   A    L+ +G PLRP +  C +Y 
Sbjct  265  FPERPDQPDCQFYMKTGDCKFGAVCRFHHPRERMIPAPDCVLSPIGLPLRPGEPLCVFYS  324

Query  823  RTGQCKFGSTCKFHHP  870
            R G CKFG +CKF HP
Sbjct  325  RYGICKFGPSCKFDHP  340


 Score = 75.9 bits (185),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 47/76 (62%), Gaps = 1/76 (1%)
 Frame = +1

Query  508  YPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKG-EYPERVGQPECQYYL  684
            +P R  +PDC +Y++TG C+FGA CRF+HP  R +      +     P R G+P C +Y 
Sbjct  265  FPERPDQPDCQFYMKTGDCKFGAVCRFHHPRERMIPAPDCVLSPIGLPLRPGEPLCVFYS  324

Query  685  KTGACKFGATCKFHHP  732
            + G CKFG +CKF HP
Sbjct  325  RYGICKFGPSCKFDHP  340



>gb|KEH23393.1| zinc finger CCCH domain protein [Medicago truncatula]
Length=408

 Score =   296 bits (757),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 133/163 (82%), Positives = 148/163 (91%), Gaps = 0/163 (0%)
 Frame = +1

Query  460  LWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKG  639
            +WQ+SLR  ETMESG YP   GEPDCSYYIRTGLCRFGA+CRFNHP NRKLAIA ARMKG
Sbjct  1    MWQMSLRPSETMESGPYPEHPGEPDCSYYIRTGLCRFGATCRFNHPPNRKLAIATARMKG  60

Query  640  EYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYY  819
            E+PER+GQPECQYYLKTG CKFGATC+FHHP+DKAG+AGRVALN+LGYPLRPN+ EC YY
Sbjct  61   EFPERLGQPECQYYLKTGTCKFGATCRFHHPKDKAGVAGRVALNILGYPLRPNESECAYY  120

Query  820  MRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQ  948
            +RTGQCKFG+TCKFHHPQPSNM++P+RGSP YP V SPTT GQ
Sbjct  121  LRTGQCKFGNTCKFHHPQPSNMVLPMRGSPVYPTVQSPTTAGQ  163


 Score =   100 bits (248),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 45/87 (52%), Positives = 58/87 (67%), Gaps = 0/87 (0%)
 Frame = +1

Query  610  LAIAAARMKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPL  789
            +   A + +  +PER  QPECQ+Y+KTG CKFGA C+FHHPR++   A    L+ LG PL
Sbjct  254  VGFYALQRENIFPERPDQPECQFYMKTGDCKFGAVCRFHHPRERTIPAPDCVLSPLGLPL  313

Query  790  RPNDIECPYYMRTGQCKFGSTCKFHHP  870
            RP +  C +Y R G CKFG +CKF HP
Sbjct  314  RPGEPLCVFYSRYGICKFGPSCKFDHP  340


 Score = 74.7 bits (182),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 38/95 (40%), Positives = 52/95 (55%), Gaps = 7/95 (7%)
 Frame = +1

Query  508  YPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKG-EYPERVGQPECQYYL  684
            +P R  +P+C +Y++TG C+FGA CRF+HP  R +      +     P R G+P C +Y 
Sbjct  265  FPERPDQPECQFYMKTGDCKFGAVCRFHHPRERTIPAPDCVLSPLGLPLRPGEPLCVFYS  324

Query  685  KTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPL  789
            + G CKFG +CKF HP       G    NV   PL
Sbjct  325  RYGICKFGPSCKFDHP------MGIFTYNVSASPL  353


 Score = 51.6 bits (122),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 19/38 (50%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = +1

Query  781  YPLRPNDIECPYYMRTGQCKFGSTCKFHHPQPSNMMVP  894
            +P RP+  EC +YM+TG CKFG+ C+FHHP+   +  P
Sbjct  265  FPERPDQPECQFYMKTGDCKFGAVCRFHHPRERTIPAP  302



>ref|XP_006848460.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
[Amborella trichopoda]
 gb|ERN10041.1| hypothetical protein AMTR_s00013p00248880 [Amborella trichopoda]
Length=467

 Score =   296 bits (759),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 138/167 (83%), Positives = 149/167 (89%), Gaps = 1/167 (1%)
 Frame = +1

Query  448  AQETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAA  627
            +++ +W LSLRS ETMESG YP R GE DC+YYIRTGLCRFG +CRFNHP NRKLA+AAA
Sbjct  40   SEDAMWPLSLRSSETMESGPYPERPGEIDCAYYIRTGLCRFGMTCRFNHPPNRKLAVAAA  99

Query  628  RMKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIE  807
            R+KG YPERVGQPECQYYLKTG CKFGATCKFHHPRDKAGIAGRV LN+LGYPLRPN+ E
Sbjct  100  RIKGGYPERVGQPECQYYLKTGTCKFGATCKFHHPRDKAGIAGRVLLNILGYPLRPNEKE  159

Query  808  CPYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQ  948
            C YY+RTGQCKFGSTCKFHHPQP N MV LRGSP YPPVHSPTTPGQ
Sbjct  160  CAYYLRTGQCKFGSTCKFHHPQP-NAMVSLRGSPVYPPVHSPTTPGQ  205


 Score = 99.4 bits (246),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 45/91 (49%), Positives = 59/91 (65%), Gaps = 0/91 (0%)
 Frame = +1

Query  598  SNRKLAIAAARMKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVL  777
            S+  + +   + +  +PER  QPECQ+Y+KTG CKFGA CKFHHPR++        L+ +
Sbjct  296  SSVPMGLFPLQRENVFPERPDQPECQFYMKTGDCKFGAMCKFHHPRERLLPVPNCMLSPM  355

Query  778  GYPLRPNDIECPYYMRTGQCKFGSTCKFHHP  870
            G PLRP +  C +Y R G CKFG TCKF HP
Sbjct  356  GLPLRPGEPLCIFYSRYGICKFGPTCKFDHP  386


 Score = 77.0 bits (188),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 34/77 (44%), Positives = 48/77 (62%), Gaps = 1/77 (1%)
 Frame = +1

Query  505  TYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKG-EYPERVGQPECQYY  681
             +P R  +P+C +Y++TG C+FGA C+F+HP  R L +    +     P R G+P C +Y
Sbjct  310  VFPERPDQPECQFYMKTGDCKFGAMCKFHHPRERLLPVPNCMLSPMGLPLRPGEPLCIFY  369

Query  682  LKTGACKFGATCKFHHP  732
             + G CKFG TCKF HP
Sbjct  370  SRYGICKFGPTCKFDHP  386


 Score = 52.8 bits (125),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 21/38 (55%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = +1

Query  781  YPLRPNDIECPYYMRTGQCKFGSTCKFHHPQPSNMMVP  894
            +P RP+  EC +YM+TG CKFG+ CKFHHP+   + VP
Sbjct  311  FPERPDQPECQFYMKTGDCKFGAMCKFHHPRERLLPVP  348



>sp|Q9SWF9.1|ZFNL_PEA RecName: Full=Zinc finger CCCH domain-containing protein ZFN-like 
[Pisum sativum]
 gb|AAD45720.1| zinc finger protein [Pisum sativum]
Length=417

 Score =   294 bits (753),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 133/168 (79%), Positives = 150/168 (89%), Gaps = 0/168 (0%)
 Frame = +1

Query  445  LAQETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAA  624
            + QE +WQ++LRS ETMESG YP   GEPDCSYYIRTGLCRFGA+CRFNHP NRKLAIA 
Sbjct  6    IPQEAMWQMNLRSSETMESGPYPEHPGEPDCSYYIRTGLCRFGATCRFNHPPNRKLAIAT  65

Query  625  ARMKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDI  804
            ARMKGE+PER+GQPECQYYLKTG CKFGATC+FHHP+DKAG+AGRVALN+LGYPLRPN+ 
Sbjct  66   ARMKGEFPERLGQPECQYYLKTGTCKFGATCRFHHPKDKAGVAGRVALNILGYPLRPNES  125

Query  805  ECPYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQ  948
            E  YY+RTGQCKFG+TCKFHHPQPSNM++ +RGS  YP V SPTTPGQ
Sbjct  126  ERAYYLRTGQCKFGNTCKFHHPQPSNMVLSMRGSTVYPTVQSPTTPGQ  173


 Score = 99.4 bits (246),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 48/104 (46%), Positives = 63/104 (61%), Gaps = 3/104 (3%)
 Frame = +1

Query  610  LAIAAARMKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPL  789
            +   A +    +PER  QPECQ+Y+KTG CKFGA C+FHHPR++   A    L+ +G PL
Sbjct  264  VGFYALQRDNIFPERPDQPECQFYMKTGDCKFGAVCRFHHPRERQIPAPDCVLSPIGLPL  323

Query  790  RPNDIECPYYMRTGQCKFGSTCKFHHPQ---PSNMMVPLRGSPA  912
            RP +  C +Y R G CKFG +CKF HP      N+  PL  +P 
Sbjct  324  RPGEPLCVFYSRYGICKFGPSCKFDHPMGIFTYNVASPLADTPG  367


 Score = 75.1 bits (183),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 48/76 (63%), Gaps = 1/76 (1%)
 Frame = +1

Query  508  YPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKG-EYPERVGQPECQYYL  684
            +P R  +P+C +Y++TG C+FGA CRF+HP  R++      +     P R G+P C +Y 
Sbjct  275  FPERPDQPECQFYMKTGDCKFGAVCRFHHPRERQIPAPDCVLSPIGLPLRPGEPLCVFYS  334

Query  685  KTGACKFGATCKFHHP  732
            + G CKFG +CKF HP
Sbjct  335  RYGICKFGPSCKFDHP  350



>ref|XP_006428577.1| hypothetical protein CICLE_v10011741mg [Citrus clementina]
 ref|XP_006428578.1| hypothetical protein CICLE_v10011741mg [Citrus clementina]
 ref|XP_006480418.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X6 [Citrus sinensis]
 ref|XP_006480419.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X7 [Citrus sinensis]
 ref|XP_006480420.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X8 [Citrus sinensis]
 gb|ESR41817.1| hypothetical protein CICLE_v10011741mg [Citrus clementina]
 gb|ESR41818.1| hypothetical protein CICLE_v10011741mg [Citrus clementina]
Length=407

 Score =   293 bits (751),  Expect = 9e-93, Method: Compositional matrix adjust.
 Identities = 134/160 (84%), Positives = 146/160 (91%), Gaps = 0/160 (0%)
 Frame = +1

Query  469  LSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKGEYP  648
            ++LR+ E MESG+ P R GEPDCSYYIRTGLCRFGA+CRFNHP NRKLAIA AR+KG+YP
Sbjct  1    MNLRTNEAMESGSLPERPGEPDCSYYIRTGLCRFGATCRFNHPPNRKLAIATARIKGDYP  60

Query  649  ERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRT  828
            ER+GQPECQYYLKTG CKFGATCKFHHPRDKAGIAGRV+LNVLGYPLRPN+IEC YY+RT
Sbjct  61   ERLGQPECQYYLKTGTCKFGATCKFHHPRDKAGIAGRVSLNVLGYPLRPNEIECAYYLRT  120

Query  829  GQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQ  948
            GQCKFGSTCKFHHPQP+NMMV LRGSP YP V SPTTP Q
Sbjct  121  GQCKFGSTCKFHHPQPNNMMVSLRGSPVYPTVQSPTTPSQ  160


 Score =   100 bits (248),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 44/87 (51%), Positives = 58/87 (67%), Gaps = 0/87 (0%)
 Frame = +1

Query  610  LAIAAARMKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPL  789
            +   A + +  +PER GQPECQ+Y+KTG CKFGA C+FHHPR++        L+ +G PL
Sbjct  255  VGFYALQRESVFPERPGQPECQFYMKTGDCKFGAVCRFHHPRERLLPVPDCVLSPIGLPL  314

Query  790  RPNDIECPYYMRTGQCKFGSTCKFHHP  870
            RP +  C +Y R G CKFG +CKF HP
Sbjct  315  RPGEPLCIFYSRYGICKFGPSCKFDHP  341


 Score = 78.6 bits (192),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 35/77 (45%), Positives = 49/77 (64%), Gaps = 1/77 (1%)
 Frame = +1

Query  505  TYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKG-EYPERVGQPECQYY  681
             +P R G+P+C +Y++TG C+FGA CRF+HP  R L +    +     P R G+P C +Y
Sbjct  265  VFPERPGQPECQFYMKTGDCKFGAVCRFHHPRERLLPVPDCVLSPIGLPLRPGEPLCIFY  324

Query  682  LKTGACKFGATCKFHHP  732
             + G CKFG +CKF HP
Sbjct  325  SRYGICKFGPSCKFDHP  341


 Score = 52.4 bits (124),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 24/56 (43%), Positives = 33/56 (59%), Gaps = 3/56 (5%)
 Frame = +1

Query  781  YPLRPNDIECPYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQ  948
            +P RP   EC +YM+TG CKFG+ C+FHHP+   + VP        P+  P  PG+
Sbjct  266  FPERPGQPECQFYMKTGDCKFGAVCRFHHPRERLLPVP---DCVLSPIGLPLRPGE  318



>ref|XP_006587810.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X3 [Glycine max]
Length=437

 Score =   293 bits (749),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 140/205 (68%), Positives = 160/205 (78%), Gaps = 24/205 (12%)
 Frame = +1

Query  367  MDFEAAAGISASMASVTEGPSSLSPPLAQETLWQLSLRSMETMESGTYPVRDGEPDCSYY  546
            M+F+AA  +S                L  + +WQ++LRS ETMESG YP   GEPDCSYY
Sbjct  1    MEFDAAIPVSREH-------------LPPDAMWQINLRSSETMESGPYPEHPGEPDCSYY  47

Query  547  IRTGLCRFGASCRFNHPSNRKL-----------AIAAARMKGEYPERVGQPECQYYLKTG  693
            IRTGLCRFGA+CRFNHP NRKL           AIAAARMKGE+PER+GQPECQYYLKTG
Sbjct  48   IRTGLCRFGATCRFNHPPNRKLLPDSFFFENYQAIAAARMKGEFPERIGQPECQYYLKTG  107

Query  694  ACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTCKFHHPQ  873
             CKFGATC+FHHPRDKAGIAGRVA+N+LGYPLRPN+ EC YY+RTGQCKFG+TCKFHHPQ
Sbjct  108  TCKFGATCRFHHPRDKAGIAGRVAMNILGYPLRPNEPECAYYLRTGQCKFGNTCKFHHPQ  167

Query  874  PSNMMVPLRGSPAYPPVHSPTTPGQ  948
            P+NM++ +R SP YP VHSPTTPGQ
Sbjct  168  PNNMVLSMRSSPVYPTVHSPTTPGQ  192


 Score = 99.4 bits (246),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 44/87 (51%), Positives = 58/87 (67%), Gaps = 0/87 (0%)
 Frame = +1

Query  610  LAIAAARMKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPL  789
            +   A + +  +PER  QPECQ+Y+KTG CKFGA C+FHHPR++   A    L+ +G PL
Sbjct  283  VGFYALQRENIFPERPDQPECQFYMKTGDCKFGAVCRFHHPRERMIPAPDCVLSPIGLPL  342

Query  790  RPNDIECPYYMRTGQCKFGSTCKFHHP  870
            RP +  C +Y R G CKFG +CKF HP
Sbjct  343  RPGEPLCVFYSRYGICKFGPSCKFDHP  369


 Score = 74.3 bits (181),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 47/76 (62%), Gaps = 1/76 (1%)
 Frame = +1

Query  508  YPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKG-EYPERVGQPECQYYL  684
            +P R  +P+C +Y++TG C+FGA CRF+HP  R +      +     P R G+P C +Y 
Sbjct  294  FPERPDQPECQFYMKTGDCKFGAVCRFHHPRERMIPAPDCVLSPIGLPLRPGEPLCVFYS  353

Query  685  KTGACKFGATCKFHHP  732
            + G CKFG +CKF HP
Sbjct  354  RYGICKFGPSCKFDHP  369


 Score = 51.2 bits (121),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 29/81 (36%), Positives = 41/81 (51%), Gaps = 5/81 (6%)
 Frame = +1

Query  706  GATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTCKFHHPQPSNM  885
            GA  +F       G       N+  +P RP+  EC +YM+TG CKFG+ C+FHHP+    
Sbjct  271  GAYSQFRSGSVPVGFYALQRENI--FPERPDQPECQFYMKTGDCKFGAVCRFHHPR--ER  326

Query  886  MVPLRGSPAYPPVHSPTTPGQ  948
            M+P        P+  P  PG+
Sbjct  327  MIPAPDC-VLSPIGLPLRPGE  346



>gb|ABD28369.2| Zinc finger, CCCH-type; Sugar transporter superfamily [Medicago 
truncatula]
Length=428

 Score =   292 bits (747),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 135/178 (76%), Positives = 151/178 (85%), Gaps = 10/178 (6%)
 Frame = +1

Query  445  LAQETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAA  624
            + QE +WQ+SLR  ETMESG YP   GEPDCSYYIRTGLCRFGA+CRFNHP NRKLAIA 
Sbjct  6    IPQEAMWQMSLRPSETMESGPYPEHPGEPDCSYYIRTGLCRFGATCRFNHPPNRKLAIAT  65

Query  625  ARMKGEYPERVGQPECQ----------YYLKTGACKFGATCKFHHPRDKAGIAGRVALNV  774
            ARMKGE+PER+GQPECQ          YYLKTG CKFGATC+FHHP+DKAG+AGRVALN+
Sbjct  66   ARMKGEFPERLGQPECQASVNECCIMHYYLKTGTCKFGATCRFHHPKDKAGVAGRVALNI  125

Query  775  LGYPLRPNDIECPYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQ  948
            LGYPLRPN+ EC YY+RTGQCKFG+TCKFHHPQPSNM++P+RGSP YP V SPTT GQ
Sbjct  126  LGYPLRPNESECAYYLRTGQCKFGNTCKFHHPQPSNMVLPMRGSPVYPTVQSPTTAGQ  183


 Score =   100 bits (248),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 45/87 (52%), Positives = 58/87 (67%), Gaps = 0/87 (0%)
 Frame = +1

Query  610  LAIAAARMKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPL  789
            +   A + +  +PER  QPECQ+Y+KTG CKFGA C+FHHPR++   A    L+ LG PL
Sbjct  274  VGFYALQRENIFPERPDQPECQFYMKTGDCKFGAVCRFHHPRERTIPAPDCVLSPLGLPL  333

Query  790  RPNDIECPYYMRTGQCKFGSTCKFHHP  870
            RP +  C +Y R G CKFG +CKF HP
Sbjct  334  RPGEPLCVFYSRYGICKFGPSCKFDHP  360


 Score = 74.7 bits (182),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 38/95 (40%), Positives = 52/95 (55%), Gaps = 7/95 (7%)
 Frame = +1

Query  508  YPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKG-EYPERVGQPECQYYL  684
            +P R  +P+C +Y++TG C+FGA CRF+HP  R +      +     P R G+P C +Y 
Sbjct  285  FPERPDQPECQFYMKTGDCKFGAVCRFHHPRERTIPAPDCVLSPLGLPLRPGEPLCVFYS  344

Query  685  KTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPL  789
            + G CKFG +CKF HP       G    NV   PL
Sbjct  345  RYGICKFGPSCKFDHP------MGIFTYNVSASPL  373


 Score = 51.2 bits (121),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 19/38 (50%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = +1

Query  781  YPLRPNDIECPYYMRTGQCKFGSTCKFHHPQPSNMMVP  894
            +P RP+  EC +YM+TG CKFG+ C+FHHP+   +  P
Sbjct  285  FPERPDQPECQFYMKTGDCKFGAVCRFHHPRERTIPAP  322



>ref|XP_007143976.1| hypothetical protein PHAVU_007G118500g [Phaseolus vulgaris]
 gb|ESW15970.1| hypothetical protein PHAVU_007G118500g [Phaseolus vulgaris]
Length=444

 Score =   292 bits (748),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 131/167 (78%), Positives = 148/167 (89%), Gaps = 0/167 (0%)
 Frame = +1

Query  448  AQETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAA  627
             Q++LW ++LR+ ETM+SG YP R GEPDCSYYIRTGLCRFGA+CRFNHP NRKLAIA A
Sbjct  29   GQDSLWVMNLRTSETMDSGAYPERPGEPDCSYYIRTGLCRFGATCRFNHPPNRKLAIATA  88

Query  628  RMKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIE  807
            RM GE+PER+GQPECQYYLKTG CKFGATCKFHHP+D+ GIAGRV+LN LGYPLRPN+ E
Sbjct  89   RMIGEFPERIGQPECQYYLKTGTCKFGATCKFHHPKDQTGIAGRVSLNTLGYPLRPNEPE  148

Query  808  CPYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQ  948
            C YY+RTGQCKFG+TCKFHHPQPSNMM+ L+ S  YP VHSPTTPGQ
Sbjct  149  CTYYLRTGQCKFGNTCKFHHPQPSNMMLSLQDSSLYPTVHSPTTPGQ  195


 Score = 99.4 bits (246),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 44/87 (51%), Positives = 58/87 (67%), Gaps = 0/87 (0%)
 Frame = +1

Query  610  LAIAAARMKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPL  789
            +   A + +  +PER GQPECQ+Y+KTG CKFGA C+FHHP ++   A    L+ +G PL
Sbjct  290  VGFYALQRENIFPERPGQPECQFYMKTGDCKFGAVCRFHHPHERLIPAPDCVLSPMGLPL  349

Query  790  RPNDIECPYYMRTGQCKFGSTCKFHHP  870
            RP +  C +Y R G CKFG +CKF HP
Sbjct  350  RPGEPLCVFYSRYGICKFGPSCKFDHP  376


 Score = 76.6 bits (187),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 48/76 (63%), Gaps = 1/76 (1%)
 Frame = +1

Query  508  YPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMK-GEYPERVGQPECQYYL  684
            +P R G+P+C +Y++TG C+FGA CRF+HP  R +      +     P R G+P C +Y 
Sbjct  301  FPERPGQPECQFYMKTGDCKFGAVCRFHHPHERLIPAPDCVLSPMGLPLRPGEPLCVFYS  360

Query  685  KTGACKFGATCKFHHP  732
            + G CKFG +CKF HP
Sbjct  361  RYGICKFGPSCKFDHP  376



>ref|XP_010929827.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X3 [Elaeis guineensis]
Length=430

 Score =   292 bits (747),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 132/163 (81%), Positives = 145/163 (89%), Gaps = 0/163 (0%)
 Frame = +1

Query  460  LWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKG  639
            +WQ++LR  E+MESG YP R GE DC YYIRTGLCRFG +C+FNHP NR+LAIAAAR+KG
Sbjct  1    MWQMNLRGSESMESGPYPERPGEADCGYYIRTGLCRFGMTCKFNHPPNRRLAIAAARIKG  60

Query  640  EYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYY  819
             YPERVGQPECQYYLKTG CKFGATCKFHHP+DKAGIAGRV LN+LGYPLRPN+ EC YY
Sbjct  61   GYPERVGQPECQYYLKTGTCKFGATCKFHHPKDKAGIAGRVQLNILGYPLRPNEKECAYY  120

Query  820  MRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQ  948
            +RTGQCKFG+TCKFHHPQPSN MV LRGSP YPPVHS TTPGQ
Sbjct  121  IRTGQCKFGNTCKFHHPQPSNAMVALRGSPVYPPVHSSTTPGQ  163


 Score =   100 bits (250),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 46/92 (50%), Positives = 59/92 (64%), Gaps = 0/92 (0%)
 Frame = +1

Query  595  PSNRKLAIAAARMKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNV  774
            P +  + + A + +  +PER  QPECQ+Y+KTG CKFGA CKFHHPR++        L+ 
Sbjct  253  PGSIPMGVYALQRENIFPERPDQPECQFYMKTGDCKFGAVCKFHHPRERLVPVPNCLLSP  312

Query  775  LGYPLRPNDIECPYYMRTGQCKFGSTCKFHHP  870
            LG PLRP +  C +Y R G CKFG  CKF HP
Sbjct  313  LGLPLRPGEPLCVFYSRYGICKFGPNCKFDHP  344


 Score = 73.9 bits (180),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 32/76 (42%), Positives = 47/76 (62%), Gaps = 1/76 (1%)
 Frame = +1

Query  508  YPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKG-EYPERVGQPECQYYL  684
            +P R  +P+C +Y++TG C+FGA C+F+HP  R + +    +     P R G+P C +Y 
Sbjct  269  FPERPDQPECQFYMKTGDCKFGAVCKFHHPRERLVPVPNCLLSPLGLPLRPGEPLCVFYS  328

Query  685  KTGACKFGATCKFHHP  732
            + G CKFG  CKF HP
Sbjct  329  RYGICKFGPNCKFDHP  344



>ref|XP_010525082.1| PREDICTED: zinc finger CCCH domain-containing protein 33-like 
isoform X2 [Tarenaya hassleriana]
Length=429

 Score =   288 bits (738),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 130/171 (76%), Positives = 151/171 (88%), Gaps = 2/171 (1%)
 Frame = +1

Query  442  PLAQET--LWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLA  615
            P+++E+  +W ++L S+ETME GTYP R GEPDCSYYIRTGLCRFG++CRFNHP +R LA
Sbjct  8    PMSRESDAMWPMNLSSVETMEGGTYPERPGEPDCSYYIRTGLCRFGSTCRFNHPRDRNLA  67

Query  616  IAAARMKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRP  795
            IAAARMKGEYPER+GQPECQYYLKTG CKFG TCKFHHPR+KAGIAGRV+LNVLGYP+RP
Sbjct  68   IAAARMKGEYPERIGQPECQYYLKTGTCKFGVTCKFHHPRNKAGIAGRVSLNVLGYPIRP  127

Query  796  NDIECPYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQ  948
            N++EC YY+RTG CKFGSTCKF+HP P+N+MVPLRGSP YP V SPT   Q
Sbjct  128  NEVECSYYLRTGHCKFGSTCKFNHPPPTNLMVPLRGSPVYPAVQSPTAGQQ  178


 Score =   105 bits (263),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 49/93 (53%), Positives = 61/93 (66%), Gaps = 0/93 (0%)
 Frame = +1

Query  592  HPSNRKLAIAAARMKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALN  771
            H  + +L I A   +  +PER GQPECQ+Y+KTG CKFGA CKFHHPRD+        L+
Sbjct  261  HSGSAQLGIYALPRENVFPERPGQPECQFYMKTGDCKFGAVCKFHHPRDRQIPPPDCVLS  320

Query  772  VLGYPLRPNDIECPYYMRTGQCKFGSTCKFHHP  870
             +G PLRP +  C +Y R G CKFG +CKF HP
Sbjct  321  PIGLPLRPGEPLCVFYSRYGICKFGPSCKFDHP  353


 Score = 76.3 bits (186),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 33/77 (43%), Positives = 50/77 (65%), Gaps = 1/77 (1%)
 Frame = +1

Query  505  TYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKG-EYPERVGQPECQYY  681
             +P R G+P+C +Y++TG C+FGA C+F+HP +R++      +     P R G+P C +Y
Sbjct  277  VFPERPGQPECQFYMKTGDCKFGAVCKFHHPRDRQIPPPDCVLSPIGLPLRPGEPLCVFY  336

Query  682  LKTGACKFGATCKFHHP  732
             + G CKFG +CKF HP
Sbjct  337  SRYGICKFGPSCKFDHP  353


 Score = 54.3 bits (129),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 31/81 (38%), Positives = 41/81 (51%), Gaps = 5/81 (6%)
 Frame = +1

Query  706  GATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTCKFHHPQPSNM  885
            G+   FH    + GI      NV  +P RP   EC +YM+TG CKFG+ CKFHHP+   +
Sbjct  255  GSFSGFHSGSAQLGIYALPRENV--FPERPGQPECQFYMKTGDCKFGAVCKFHHPRDRQI  312

Query  886  MVPLRGSPAYPPVHSPTTPGQ  948
              P        P+  P  PG+
Sbjct  313  PPP---DCVLSPIGLPLRPGE  330



>ref|XP_011077188.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X3 [Sesamum indicum]
Length=327

 Score =   284 bits (726),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 134/168 (80%), Positives = 146/168 (87%), Gaps = 2/168 (1%)
 Frame = +1

Query  451  QETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAAR  630
            Q+ L Q+++R ME MESG YPVR+GEPDCSYYIRTGLCRFGA+CRFNHP NR LAIA AR
Sbjct  18   QDALLQMNMRPMEQMESGPYPVREGEPDCSYYIRTGLCRFGATCRFNHPLNRTLAIATAR  77

Query  631  MKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIEC  810
            MK EYPER+GQPECQYYLKTG CKFGATCKFHHPRD+ GIAGRVALNVLGYPLRPN+I C
Sbjct  78   MKSEYPERIGQPECQYYLKTGTCKFGATCKFHHPRDELGIAGRVALNVLGYPLRPNEINC  137

Query  811  PYYMRTGQCKFGSTCKFHHPQPS-NMMVPLRGSPAYPPVHSPTTPGQL  951
             YY+R G CKFG TCKFHHPQPS NMMVPLR S  +PP+ SPTT GQL
Sbjct  138  AYYIRNGLCKFGRTCKFHHPQPSNNMMVPLRDSALHPPIQSPTT-GQL  184


 Score = 70.9 bits (172),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 31/62 (50%), Positives = 41/62 (66%), Gaps = 0/62 (0%)
 Frame = +1

Query  610  LAIAAARMKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPL  789
            +   A +    +PER GQP+CQ+Y+KTG CKFGA CKFHHPR++        L+ +G PL
Sbjct  263  IGYYAFKRDNVFPERPGQPQCQFYMKTGDCKFGAVCKFHHPRERLIPLPDCVLSPIGLPL  322

Query  790  RP  795
            RP
Sbjct  323  RP  324



>ref|XP_009420319.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X2 [Musa acuminata subsp. malaccensis]
Length=429

 Score =   287 bits (734),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 138/205 (67%), Positives = 158/205 (77%), Gaps = 11/205 (5%)
 Frame = +1

Query  367  MDFEAAAGISASM---------ASVTEGPSSL--SPPLAQETLWQLSLRSMETMESGTYP  513
            MD++AA      M         A VTE  SSL   P +  ET+WQ+SLR +E+MESG YP
Sbjct  1    MDYDAATAAGVHMRGGARAGPSAPVTEAASSLPLRPTIDGETMWQMSLREIESMESGPYP  60

Query  514  VRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKGEYPERVGQPECQYYLKTG  693
             R GEPDC+YY+RTGLCRFG +CR+NHP NR++AIAAAR+KG +PERVGQPECQYYL+TG
Sbjct  61   ERPGEPDCTYYLRTGLCRFGMTCRYNHPPNRQMAIAAARIKGGFPERVGQPECQYYLRTG  120

Query  694  ACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTCKFHHPQ  873
             CKFGATCKFHHPRDKAGIAGRV LN LGYP+R N+ EC YYMR G CKFGSTCKFHHPQ
Sbjct  121  TCKFGATCKFHHPRDKAGIAGRVQLNALGYPIRLNETECAYYMRNGVCKFGSTCKFHHPQ  180

Query  874  PSNMMVPLRGSPAYPPVHSPTTPGQ  948
            PSN M  +RGS  YP VHSPT+  Q
Sbjct  181  PSNTMANVRGSTMYPGVHSPTSSQQ  205


 Score = 97.1 bits (240),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 50/103 (49%), Positives = 62/103 (60%), Gaps = 4/103 (4%)
 Frame = +1

Query  595  PSNRKLAIAAARM----KGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRV  762
            PS R  AI   +     +  +PER  QPECQ+Y+KTG CKFGA CKFHHPR++       
Sbjct  289  PSYRSSAIPLGQYVLARENVFPERPDQPECQFYMKTGDCKFGAACKFHHPRERLLPPPNC  348

Query  763  ALNVLGYPLRPNDIECPYYMRTGQCKFGSTCKFHHPQPSNMMV  891
             L+ LG PLRP +  C +Y R G CKFG  CKF HP  + + V
Sbjct  349  LLSPLGLPLRPGEPLCIFYSRYGICKFGPHCKFDHPMATPIGV  391


 Score = 72.8 bits (177),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 42/120 (35%), Positives = 60/120 (50%), Gaps = 15/120 (13%)
 Frame = +1

Query  376  EAAAGISASMASVTEGPSSLSPPLAQETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRT  555
            E  AG+  ++ S      S + PL Q  L               +P R  +P+C +Y++T
Sbjct  279  ETIAGVQGTIPSY----RSSAIPLGQYVL----------ARENVFPERPDQPECQFYMKT  324

Query  556  GLCRFGASCRFNHPSNRKLAIAAARMKG-EYPERVGQPECQYYLKTGACKFGATCKFHHP  732
            G C+FGA+C+F+HP  R L      +     P R G+P C +Y + G CKFG  CKF HP
Sbjct  325  GDCKFGAACKFHHPRERLLPPPNCLLSPLGLPLRPGEPLCIFYSRYGICKFGPHCKFDHP  384


 Score = 52.0 bits (123),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 32/51 (63%), Gaps = 5/51 (10%)
 Frame = +1

Query  781  YPLRPNDIECPYYMRTGQCKFGSTCKFHHPQ-----PSNMMVPLRGSPAYP  918
            +P RP+  EC +YM+TG CKFG+ CKFHHP+     P N ++   G P  P
Sbjct  309  FPERPDQPECQFYMKTGDCKFGAACKFHHPRERLLPPPNCLLSPLGLPLRP  359



>gb|ADN33845.1| nucleic acid binding protein [Cucumis melo subsp. melo]
Length=367

 Score =   284 bits (727),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 132/160 (83%), Positives = 145/160 (91%), Gaps = 1/160 (1%)
 Frame = +1

Query  469  LSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKGEYP  648
            ++L S E M SG+YPVR GEPDCSYYIRTGLCRFGA+CRFNHP NR+LAIA ARMKGE+P
Sbjct  1    MNLGSGEIMGSGSYPVRPGEPDCSYYIRTGLCRFGATCRFNHPPNRELAIATARMKGEFP  60

Query  649  ERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRT  828
            ER+GQPECQYYLKTG CKFGATCKFHHPRDKAGIAGRVALN+LGYPLRP++ EC YY+RT
Sbjct  61   ERIGQPECQYYLKTGTCKFGATCKFHHPRDKAGIAGRVALNILGYPLRPSETECAYYLRT  120

Query  829  GQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQ  948
            GQCKFG+TCKFHHPQP+NMMV LRGSP YP V SP TPGQ
Sbjct  121  GQCKFGNTCKFHHPQPTNMMVSLRGSPIYPTVQSP-TPGQ  159


 Score =   100 bits (250),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 44/76 (58%), Positives = 55/76 (72%), Gaps = 0/76 (0%)
 Frame = +1

Query  643  YPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYM  822
            +PER GQPECQ+Y+KTG CKFGA C+FHHPR++   A    L+ +G PLRP +  C +Y 
Sbjct  225  FPERPGQPECQFYMKTGDCKFGAVCRFHHPRERVLPAPDCVLSPIGLPLRPGEPLCIFYS  284

Query  823  RTGQCKFGSTCKFHHP  870
            R G CKFG +CKF HP
Sbjct  285  RYGICKFGPSCKFDHP  300


 Score = 77.8 bits (190),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 37/88 (42%), Positives = 51/88 (58%), Gaps = 1/88 (1%)
 Frame = +1

Query  472  SLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKG-EYP  648
            S  S +      +P R G+P+C +Y++TG C+FGA CRF+HP  R L      +     P
Sbjct  213  SSESPQQTRENVFPERPGQPECQFYMKTGDCKFGAVCRFHHPRERVLPAPDCVLSPIGLP  272

Query  649  ERVGQPECQYYLKTGACKFGATCKFHHP  732
             R G+P C +Y + G CKFG +CKF HP
Sbjct  273  LRPGEPLCIFYSRYGICKFGPSCKFDHP  300


 Score = 74.7 bits (182),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 52/177 (29%), Positives = 76/177 (43%), Gaps = 34/177 (19%)
 Frame = +1

Query  508  YPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKGEYPERVGQPECQYYLK  687
            YP+R  E +C+YY+RTG C+FG +C+F+HP    + ++  R    YP        Q    
Sbjct  105  YPLRPSETECAYYLRTGQCKFGNTCKFHHPQPTNMMVSL-RGSPIYPTVQSPTPGQQSYP  163

Query  688  TGACKFGATCKFHHPRDKA--------------GIAGRVALN-VLG--------------  780
             G+  +        PR +                + G  A N  LG              
Sbjct  164  GGSTNWSRASFIPSPRWQGPSSYASLILPQGVLSVPGWNAFNDQLGSVSSSESPQQTREN  223

Query  781  -YPLRPNDIECPYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQ  948
             +P RP   EC +YM+TG CKFG+ C+FHHP+   +  P        P+  P  PG+
Sbjct  224  VFPERPGQPECQFYMKTGDCKFGAVCRFHHPRERVLPAP---DCVLSPIGLPLRPGE  277



>gb|KGN66679.1| hypothetical protein Csa_1G659020 [Cucumis sativus]
Length=367

 Score =   284 bits (727),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 132/160 (83%), Positives = 145/160 (91%), Gaps = 1/160 (1%)
 Frame = +1

Query  469  LSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKGEYP  648
            ++L S E M SG+YPVR GEPDCSYYIRTGLCRFGA+CRFNHP NR+LAIA ARMKGE+P
Sbjct  1    MNLGSGEIMGSGSYPVRPGEPDCSYYIRTGLCRFGATCRFNHPPNRELAIATARMKGEFP  60

Query  649  ERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRT  828
            ER+GQPECQYYLKTG CKFGATCKFHHPRDKAGIAGRVALN+LGYPLRP++ EC YY+RT
Sbjct  61   ERIGQPECQYYLKTGTCKFGATCKFHHPRDKAGIAGRVALNILGYPLRPSETECAYYLRT  120

Query  829  GQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQ  948
            GQCKFG+TCKFHHPQP+NMMV LRGSP YP V SP TPGQ
Sbjct  121  GQCKFGNTCKFHHPQPTNMMVSLRGSPIYPTVQSP-TPGQ  159


 Score =   100 bits (250),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 44/76 (58%), Positives = 55/76 (72%), Gaps = 0/76 (0%)
 Frame = +1

Query  643  YPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYM  822
            +PER GQPECQ+Y+KTG CKFGA C+FHHPR++   A    L+ +G PLRP +  C +Y 
Sbjct  225  FPERPGQPECQFYMKTGDCKFGAVCRFHHPRERVLPAPDCVLSPIGLPLRPGEPLCIFYS  284

Query  823  RTGQCKFGSTCKFHHP  870
            R G CKFG +CKF HP
Sbjct  285  RYGICKFGPSCKFDHP  300


 Score = 77.8 bits (190),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 37/88 (42%), Positives = 51/88 (58%), Gaps = 1/88 (1%)
 Frame = +1

Query  472  SLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKG-EYP  648
            S  S +      +P R G+P+C +Y++TG C+FGA CRF+HP  R L      +     P
Sbjct  213  SSESPQQTRENVFPERPGQPECQFYMKTGDCKFGAVCRFHHPRERVLPAPDCVLSPIGLP  272

Query  649  ERVGQPECQYYLKTGACKFGATCKFHHP  732
             R G+P C +Y + G CKFG +CKF HP
Sbjct  273  LRPGEPLCIFYSRYGICKFGPSCKFDHP  300


 Score = 74.7 bits (182),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 52/177 (29%), Positives = 76/177 (43%), Gaps = 34/177 (19%)
 Frame = +1

Query  508  YPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKGEYPERVGQPECQYYLK  687
            YP+R  E +C+YY+RTG C+FG +C+F+HP    + ++  R    YP        Q    
Sbjct  105  YPLRPSETECAYYLRTGQCKFGNTCKFHHPQPTNMMVSL-RGSPIYPTVQSPTPGQQSYP  163

Query  688  TGACKFGATCKFHHPRDKA--------------GIAGRVALN-VLG--------------  780
             G+  +        PR +                + G  A N  LG              
Sbjct  164  GGSTNWSRASFIPSPRWQGPSSYASLILPQGVLSVPGWNAFNDQLGSVSSSESPQQTREN  223

Query  781  -YPLRPNDIECPYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQ  948
             +P RP   EC +YM+TG CKFG+ C+FHHP+   +  P        P+  P  PG+
Sbjct  224  VFPERPGQPECQFYMKTGDCKFGAVCRFHHPRERVLPAP---DCVLSPIGLPLRPGE  277



>gb|KHN04981.1| Zinc finger CCCH domain-containing protein ZFN-like [Glycine 
soja]
Length=428

 Score =   286 bits (732),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 131/173 (76%), Positives = 152/173 (88%), Gaps = 2/173 (1%)
 Frame = +1

Query  430  SLSPPLAQETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRK  609
            +L  P  Q++LW ++LR+ ET++SG+YP R GEPDCSYYIRTGLCRFGA+CRFNHP NR+
Sbjct  8    NLIVPNPQDSLWMMNLRTGETVDSGSYPERPGEPDCSYYIRTGLCRFGATCRFNHPPNRR  67

Query  610  LAIAAARMKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPL  789
            LAIA ARM GE+PER+GQPECQ   +T  CKFGATCKFHHP+D+AGIAGRVALN+LGYPL
Sbjct  68   LAIATARMIGEFPERIGQPECQ--ARTRTCKFGATCKFHHPKDQAGIAGRVALNILGYPL  125

Query  790  RPNDIECPYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQ  948
            RPN+ EC YY+RTGQCKFG+TCKFHHPQPSNMM+ LRGSP YP VHSPTTPGQ
Sbjct  126  RPNEPECTYYLRTGQCKFGNTCKFHHPQPSNMMLSLRGSPVYPTVHSPTTPGQ  178


 Score = 97.1 bits (240),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 43/76 (57%), Positives = 54/76 (71%), Gaps = 0/76 (0%)
 Frame = +1

Query  643  YPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYM  822
            +PER GQPECQ+Y+KTG CKFGA C+FHHPR++   A    L+ +G PLR  +  C +Y 
Sbjct  284  FPERPGQPECQFYVKTGDCKFGAVCQFHHPRERLIPAPDCVLSPIGLPLRLGEPLCVFYS  343

Query  823  RTGQCKFGSTCKFHHP  870
            R G CKFG +CKF HP
Sbjct  344  RYGICKFGPSCKFDHP  359


 Score = 77.4 bits (189),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 33/78 (42%), Positives = 50/78 (64%), Gaps = 1/78 (1%)
 Frame = +1

Query  508  YPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKG-EYPERVGQPECQYYL  684
            +P R G+P+C +Y++TG C+FGA C+F+HP  R +      +     P R+G+P C +Y 
Sbjct  284  FPERPGQPECQFYVKTGDCKFGAVCQFHHPRERLIPAPDCVLSPIGLPLRLGEPLCVFYS  343

Query  685  KTGACKFGATCKFHHPRD  738
            + G CKFG +CKF HP +
Sbjct  344  RYGICKFGPSCKFDHPME  361



>ref|XP_011077184.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X1 [Sesamum indicum]
 ref|XP_011077185.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X1 [Sesamum indicum]
 ref|XP_011077186.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X1 [Sesamum indicum]
Length=417

 Score =   285 bits (729),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 134/168 (80%), Positives = 146/168 (87%), Gaps = 2/168 (1%)
 Frame = +1

Query  451  QETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAAR  630
            Q+ L Q+++R ME MESG YPVR+GEPDCSYYIRTGLCRFGA+CRFNHP NR LAIA AR
Sbjct  18   QDALLQMNMRPMEQMESGPYPVREGEPDCSYYIRTGLCRFGATCRFNHPLNRTLAIATAR  77

Query  631  MKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIEC  810
            MK EYPER+GQPECQYYLKTG CKFGATCKFHHPRD+ GIAGRVALNVLGYPLRPN+I C
Sbjct  78   MKSEYPERIGQPECQYYLKTGTCKFGATCKFHHPRDELGIAGRVALNVLGYPLRPNEINC  137

Query  811  PYYMRTGQCKFGSTCKFHHPQPS-NMMVPLRGSPAYPPVHSPTTPGQL  951
             YY+R G CKFG TCKFHHPQPS NMMVPLR S  +PP+ SPTT GQL
Sbjct  138  AYYIRNGLCKFGRTCKFHHPQPSNNMMVPLRDSALHPPIQSPTT-GQL  184


 Score = 99.0 bits (245),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 44/83 (53%), Positives = 56/83 (67%), Gaps = 0/83 (0%)
 Frame = +1

Query  622  AARMKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPND  801
            A +    +PER GQP+CQ+Y+KTG CKFGA CKFHHPR++        L+ +G PLRP +
Sbjct  267  AFKRDNVFPERPGQPQCQFYMKTGDCKFGAVCKFHHPRERLIPLPDCVLSPIGLPLRPGE  326

Query  802  IECPYYMRTGQCKFGSTCKFHHP  870
              C +Y R G CKFG +CKF HP
Sbjct  327  PLCVFYSRYGICKFGPSCKFDHP  349


 Score = 75.9 bits (185),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 33/79 (42%), Positives = 48/79 (61%), Gaps = 1/79 (1%)
 Frame = +1

Query  499  SGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKG-EYPERVGQPECQ  675
               +P R G+P C +Y++TG C+FGA C+F+HP  R + +    +     P R G+P C 
Sbjct  271  DNVFPERPGQPQCQFYMKTGDCKFGAVCKFHHPRERLIPLPDCVLSPIGLPLRPGEPLCV  330

Query  676  YYLKTGACKFGATCKFHHP  732
            +Y + G CKFG +CKF HP
Sbjct  331  FYSRYGICKFGPSCKFDHP  349


 Score = 51.2 bits (121),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 24/56 (43%), Positives = 34/56 (61%), Gaps = 3/56 (5%)
 Frame = +1

Query  781  YPLRPNDIECPYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQ  948
            +P RP   +C +YM+TG CKFG+ CKFHHP+    ++PL       P+  P  PG+
Sbjct  274  FPERPGQPQCQFYMKTGDCKFGAVCKFHHPR--ERLIPLPDC-VLSPIGLPLRPGE  326



>ref|XP_009420318.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X1 [Musa acuminata subsp. malaccensis]
Length=431

 Score =   285 bits (730),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 140/209 (67%), Positives = 159/209 (76%), Gaps = 17/209 (8%)
 Frame = +1

Query  367  MDFEAAAGISASM---------ASVTEGPSSLSPPL------AQETLWQLSLRSMETMES  501
            MD++AA      M         A VTE  SSL  PL       QET+WQ+SLR +E+MES
Sbjct  1    MDYDAATAAGVHMRGGARAGPSAPVTEAASSL--PLRPTIDGGQETMWQMSLREIESMES  58

Query  502  GTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKGEYPERVGQPECQYY  681
            G YP R GEPDC+YY+RTGLCRFG +CR+NHP NR++AIAAAR+KG +PERVGQPECQYY
Sbjct  59   GPYPERPGEPDCTYYLRTGLCRFGMTCRYNHPPNRQMAIAAARIKGGFPERVGQPECQYY  118

Query  682  LKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTCKF  861
            L+TG CKFGATCKFHHPRDKAGIAGRV LN LGYP+R N+ EC YYMR G CKFGSTCKF
Sbjct  119  LRTGTCKFGATCKFHHPRDKAGIAGRVQLNALGYPIRLNETECAYYMRNGVCKFGSTCKF  178

Query  862  HHPQPSNMMVPLRGSPAYPPVHSPTTPGQ  948
            HHPQPSN M  +RGS  YP VHSPT+  Q
Sbjct  179  HHPQPSNTMANVRGSTMYPGVHSPTSSQQ  207


 Score = 96.7 bits (239),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 50/103 (49%), Positives = 62/103 (60%), Gaps = 4/103 (4%)
 Frame = +1

Query  595  PSNRKLAIAAARM----KGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRV  762
            PS R  AI   +     +  +PER  QPECQ+Y+KTG CKFGA CKFHHPR++       
Sbjct  291  PSYRSSAIPLGQYVLARENVFPERPDQPECQFYMKTGDCKFGAACKFHHPRERLLPPPNC  350

Query  763  ALNVLGYPLRPNDIECPYYMRTGQCKFGSTCKFHHPQPSNMMV  891
             L+ LG PLRP +  C +Y R G CKFG  CKF HP  + + V
Sbjct  351  LLSPLGLPLRPGEPLCIFYSRYGICKFGPHCKFDHPMATPIGV  393


 Score = 72.4 bits (176),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 42/120 (35%), Positives = 60/120 (50%), Gaps = 15/120 (13%)
 Frame = +1

Query  376  EAAAGISASMASVTEGPSSLSPPLAQETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRT  555
            E  AG+  ++ S      S + PL Q  L               +P R  +P+C +Y++T
Sbjct  281  ETIAGVQGTIPSY----RSSAIPLGQYVL----------ARENVFPERPDQPECQFYMKT  326

Query  556  GLCRFGASCRFNHPSNRKLAIAAARMKG-EYPERVGQPECQYYLKTGACKFGATCKFHHP  732
            G C+FGA+C+F+HP  R L      +     P R G+P C +Y + G CKFG  CKF HP
Sbjct  327  GDCKFGAACKFHHPRERLLPPPNCLLSPLGLPLRPGEPLCIFYSRYGICKFGPHCKFDHP  386


 Score = 52.0 bits (123),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 32/51 (63%), Gaps = 5/51 (10%)
 Frame = +1

Query  781  YPLRPNDIECPYYMRTGQCKFGSTCKFHHPQ-----PSNMMVPLRGSPAYP  918
            +P RP+  EC +YM+TG CKFG+ CKFHHP+     P N ++   G P  P
Sbjct  311  FPERPDQPECQFYMKTGDCKFGAACKFHHPRERLLPPPNCLLSPLGLPLRP  361



>ref|XP_010558591.1| PREDICTED: zinc finger CCCH domain-containing protein 33-like 
[Tarenaya hassleriana]
Length=397

 Score =   284 bits (726),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 132/194 (68%), Positives = 154/194 (79%), Gaps = 6/194 (3%)
 Frame = +1

Query  367  MDFEAAAGISASMASVTEGPSSLSPPLAQETLWQLSLRSMETMESGTYPVRDGEPDCSYY  546
            MD +A  G+S S  S T    SL P L Q+ +WQ++L S ETME G YP R GEPDC+YY
Sbjct  1    MDLDA--GVSMSRISGT----SLLPLLNQDAMWQMNLSSDETMEGGAYPDRPGEPDCAYY  54

Query  547  IRTGLCRFGASCRFNHPSNRKLAIAAARMKGEYPERVGQPECQYYLKTGACKFGATCKFH  726
            IRTGLCRFG++CRFNHP +R LAIA ARMKGEYPER+GQPECQYYLKTG CKFG TCKFH
Sbjct  55   IRTGLCRFGSTCRFNHPRDRNLAIATARMKGEYPERIGQPECQYYLKTGTCKFGVTCKFH  114

Query  727  HPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGS  906
            HPR+K GIAG V+LN LGYP+RPN+++C YY+RTG CKFGSTCKF+HP P+N+M PLRGS
Sbjct  115  HPRNKVGIAGNVSLNALGYPIRPNEVDCAYYLRTGHCKFGSTCKFNHPPPTNLMAPLRGS  174

Query  907  PAYPPVHSPTTPGQ  948
              YP V SP+   Q
Sbjct  175  SVYPAVQSPSAGQQ  188


 Score =   100 bits (249),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 43/76 (57%), Positives = 55/76 (72%), Gaps = 0/76 (0%)
 Frame = +1

Query  643  YPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYM  822
            +PE+ GQPECQ+Y+KTG CKFG+ CKFHHPR++   A    L+ +G PLRP +  C +Y 
Sbjct  274  FPEKPGQPECQFYMKTGDCKFGSVCKFHHPRNRQNPAPDCVLSPIGLPLRPGEPLCGFYS  333

Query  823  RTGQCKFGSTCKFHHP  870
            R G CKFG +CKF HP
Sbjct  334  RYGICKFGPSCKFDHP  349


 Score = 75.1 bits (183),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 38/100 (38%), Positives = 55/100 (55%), Gaps = 9/100 (9%)
 Frame = +1

Query  472  SLRSMETMESGTY--------PVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAA  627
             L   E  ESG Y        P + G+P+C +Y++TG C+FG+ C+F+HP NR+      
Sbjct  254  DLLQNEAKESGFYALPRENVFPEKPGQPECQFYMKTGDCKFGSVCKFHHPRNRQNPAPDC  313

Query  628  RMKG-EYPERVGQPECQYYLKTGACKFGATCKFHHPRDKA  744
             +     P R G+P C +Y + G CKFG +CKF HP  + 
Sbjct  314  VLSPIGLPLRPGEPLCGFYSRYGICKFGPSCKFDHPMQRV  353


 Score = 50.8 bits (120),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 24/56 (43%), Positives = 31/56 (55%), Gaps = 3/56 (5%)
 Frame = +1

Query  781  YPLRPNDIECPYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQ  948
            +P +P   EC +YM+TG CKFGS CKFHHP+      P        P+  P  PG+
Sbjct  274  FPEKPGQPECQFYMKTGDCKFGSVCKFHHPRNRQNPAP---DCVLSPIGLPLRPGE  326



>gb|KHN14776.1| Zinc finger CCCH domain-containing protein ZFN-like, partial 
[Glycine soja]
Length=405

 Score =   283 bits (724),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 129/165 (78%), Positives = 148/165 (90%), Gaps = 2/165 (1%)
 Frame = +1

Query  454  ETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARM  633
            ++LW ++LR+ ETM+SG+YP R GEPDCSYY+RTGLCRFGA+CRFNHP NRKLAIA ARM
Sbjct  3    DSLWMMNLRTGETMDSGSYPERPGEPDCSYYMRTGLCRFGATCRFNHPPNRKLAIATARM  62

Query  634  KGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECP  813
             GE+PER+GQPECQ   +T  CKFGATCKFHHP+D+AGIAGRVALN+LGYPLRPN+ EC 
Sbjct  63   IGEFPERIGQPECQACTRT--CKFGATCKFHHPKDQAGIAGRVALNILGYPLRPNEPECT  120

Query  814  YYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQ  948
            YY+RTGQCKFG+TCKFHHPQPSNMM+ LRGSP YP VHSPTTPGQ
Sbjct  121  YYLRTGQCKFGNTCKFHHPQPSNMMLSLRGSPVYPTVHSPTTPGQ  165


 Score = 99.8 bits (247),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 43/76 (57%), Positives = 55/76 (72%), Gaps = 0/76 (0%)
 Frame = +1

Query  643  YPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYM  822
            +PER GQPECQ+Y+KTG CKFGA C+FHHP+++   A    L+ +G PLRP +  C +Y 
Sbjct  262  FPERPGQPECQFYMKTGDCKFGAVCRFHHPQERLVPAPNCVLSPIGLPLRPGEPLCVFYS  321

Query  823  RTGQCKFGSTCKFHHP  870
            R G CKFG +CKF HP
Sbjct  322  RYGICKFGPSCKFDHP  337


 Score = 76.6 bits (187),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 34/78 (44%), Positives = 49/78 (63%), Gaps = 1/78 (1%)
 Frame = +1

Query  508  YPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKG-EYPERVGQPECQYYL  684
            +P R G+P+C +Y++TG C+FGA CRF+HP  R +      +     P R G+P C +Y 
Sbjct  262  FPERPGQPECQFYMKTGDCKFGAVCRFHHPQERLVPAPNCVLSPIGLPLRPGEPLCVFYS  321

Query  685  KTGACKFGATCKFHHPRD  738
            + G CKFG +CKF HP +
Sbjct  322  RYGICKFGPSCKFDHPME  339


 Score = 51.6 bits (122),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 24/56 (43%), Positives = 33/56 (59%), Gaps = 3/56 (5%)
 Frame = +1

Query  781  YPLRPNDIECPYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQ  948
            +P RP   EC +YM+TG CKFG+ C+FHHPQ   +  P   +    P+  P  PG+
Sbjct  262  FPERPGQPECQFYMKTGDCKFGAVCRFHHPQERLVPAP---NCVLSPIGLPLRPGE  314



>ref|XP_011077187.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X2 [Sesamum indicum]
Length=407

 Score =   283 bits (723),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 133/167 (80%), Positives = 145/167 (87%), Gaps = 2/167 (1%)
 Frame = +1

Query  454  ETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARM  633
            + L Q+++R ME MESG YPVR+GEPDCSYYIRTGLCRFGA+CRFNHP NR LAIA ARM
Sbjct  9    DALLQMNMRPMEQMESGPYPVREGEPDCSYYIRTGLCRFGATCRFNHPLNRTLAIATARM  68

Query  634  KGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECP  813
            K EYPER+GQPECQYYLKTG CKFGATCKFHHPRD+ GIAGRVALNVLGYPLRPN+I C 
Sbjct  69   KSEYPERIGQPECQYYLKTGTCKFGATCKFHHPRDELGIAGRVALNVLGYPLRPNEINCA  128

Query  814  YYMRTGQCKFGSTCKFHHPQPS-NMMVPLRGSPAYPPVHSPTTPGQL  951
            YY+R G CKFG TCKFHHPQPS NMMVPLR S  +PP+ SPTT GQL
Sbjct  129  YYIRNGLCKFGRTCKFHHPQPSNNMMVPLRDSALHPPIQSPTT-GQL  174


 Score = 99.0 bits (245),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 44/87 (51%), Positives = 57/87 (66%), Gaps = 0/87 (0%)
 Frame = +1

Query  610  LAIAAARMKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPL  789
            +   A +    +PER GQP+CQ+Y+KTG CKFGA CKFHHPR++        L+ +G PL
Sbjct  253  IGYYAFKRDNVFPERPGQPQCQFYMKTGDCKFGAVCKFHHPRERLIPLPDCVLSPIGLPL  312

Query  790  RPNDIECPYYMRTGQCKFGSTCKFHHP  870
            RP +  C +Y R G CKFG +CKF HP
Sbjct  313  RPGEPLCVFYSRYGICKFGPSCKFDHP  339


 Score = 75.9 bits (185),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 33/79 (42%), Positives = 48/79 (61%), Gaps = 1/79 (1%)
 Frame = +1

Query  499  SGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKG-EYPERVGQPECQ  675
               +P R G+P C +Y++TG C+FGA C+F+HP  R + +    +     P R G+P C 
Sbjct  261  DNVFPERPGQPQCQFYMKTGDCKFGAVCKFHHPRERLIPLPDCVLSPIGLPLRPGEPLCV  320

Query  676  YYLKTGACKFGATCKFHHP  732
            +Y + G CKFG +CKF HP
Sbjct  321  FYSRYGICKFGPSCKFDHP  339


 Score = 51.2 bits (121),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 24/56 (43%), Positives = 34/56 (61%), Gaps = 3/56 (5%)
 Frame = +1

Query  781  YPLRPNDIECPYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQ  948
            +P RP   +C +YM+TG CKFG+ CKFHHP+    ++PL       P+  P  PG+
Sbjct  264  FPERPGQPQCQFYMKTGDCKFGAVCKFHHPR--ERLIPLPDC-VLSPIGLPLRPGE  316



>gb|EYU39704.1| hypothetical protein MIMGU_mgv1a0076882mg [Erythranthe guttata]
Length=398

 Score =   281 bits (720),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 127/157 (81%), Positives = 141/157 (90%), Gaps = 0/157 (0%)
 Frame = +1

Query  469  LSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKGEYP  648
            ++++S E M+SG YPVR+ EPDCSYYIRTGLCRFGA+CRFNHP NRKLAIA A+MKGEYP
Sbjct  1    MNMKSSEPMDSGLYPVREDEPDCSYYIRTGLCRFGATCRFNHPPNRKLAIATAKMKGEYP  60

Query  649  ERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRT  828
            ER+GQ ECQYYLKTG CKFGATCKF HPR+KAGIAGRVALNVLGYP+R N++EC YYMR 
Sbjct  61   ERMGQSECQYYLKTGTCKFGATCKFDHPREKAGIAGRVALNVLGYPIRANEMECAYYMRN  120

Query  829  GQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVHSPTT  939
            GQCKFGSTCKFHHPQPSNMMV LRGS  YPP+ SPTT
Sbjct  121  GQCKFGSTCKFHHPQPSNMMVSLRGSAVYPPIQSPTT  157


 Score = 97.4 bits (241),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 50/114 (44%), Positives = 64/114 (56%), Gaps = 4/114 (4%)
 Frame = +1

Query  592  HPSNRKLAIAAARMKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALN  771
            H  +  +   A +    +PER GQPECQ+Y+KTG CKFG  CKFHHPR++        L+
Sbjct  238  HSGSVPMGYYAFQRDNVFPERPGQPECQFYMKTGDCKFGTVCKFHHPRERLMPVPDCVLS  297

Query  772  VLGYPLRPNDIECPYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVHSP  933
             +G PLR  +  C +Y R G CKFG +CKF HP    M V    + A P   SP
Sbjct  298  PIGLPLRTGEPLCVFYSRYGICKFGPSCKFDHP----MRVFAYNAAASPSTDSP  347


 Score = 76.3 bits (186),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 32/77 (42%), Positives = 48/77 (62%), Gaps = 1/77 (1%)
 Frame = +1

Query  505  TYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMK-GEYPERVGQPECQYY  681
             +P R G+P+C +Y++TG C+FG  C+F+HP  R + +    +     P R G+P C +Y
Sbjct  254  VFPERPGQPECQFYMKTGDCKFGTVCKFHHPRERLMPVPDCVLSPIGLPLRTGEPLCVFY  313

Query  682  LKTGACKFGATCKFHHP  732
             + G CKFG +CKF HP
Sbjct  314  SRYGICKFGPSCKFDHP  330



>ref|XP_010927660.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
[Elaeis guineensis]
 ref|XP_010927662.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
[Elaeis guineensis]
 ref|XP_010927663.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
[Elaeis guineensis]
Length=467

 Score =   282 bits (721),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 128/172 (74%), Positives = 149/172 (87%), Gaps = 1/172 (1%)
 Frame = +1

Query  433  LSPPLAQETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKL  612
            L+P L +ET+WQ++ R  E++ESG YP R GEPDC+YY+RTGLCR+G +CR+NHP +RKL
Sbjct  28   LAPALDEETMWQMNKRGSESVESGLYPERPGEPDCAYYLRTGLCRYGLTCRYNHPPDRKL  87

Query  613  AIAAARMKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLR  792
            AIAAAR++G YPERVGQPECQYYLKTG CKFGATCKFHHP+DKAGI GR  LN LGYP+R
Sbjct  88   AIAAARIRGGYPERVGQPECQYYLKTGTCKFGATCKFHHPKDKAGIFGRAPLNNLGYPIR  147

Query  793  PNDIECPYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQ  948
            PN+ EC YY+RTGQCKFG+TCKFHHPQPSN MV LRGSP YPPV SP +PGQ
Sbjct  148  PNEKECAYYLRTGQCKFGNTCKFHHPQPSNAMVSLRGSPVYPPV-SPASPGQ  198


 Score =   100 bits (249),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 47/98 (48%), Positives = 61/98 (62%), Gaps = 0/98 (0%)
 Frame = +1

Query  598  SNRKLAIAAARMKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVL  777
            S+  +   A +    +PER  QPECQ+Y+KTG CKFGA CKFHHP+++   A    L+ L
Sbjct  290  SSTPMGQYALQRDNVFPERPDQPECQFYMKTGDCKFGAACKFHHPKERLVPAPNCVLSPL  349

Query  778  GYPLRPNDIECPYYMRTGQCKFGSTCKFHHPQPSNMMV  891
            G PLRP +  C +Y R G CKFG  CKF HP  + M +
Sbjct  350  GLPLRPGEPLCVFYSRYGICKFGPNCKFDHPMATPMGI  387


 Score = 75.9 bits (185),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 41/120 (34%), Positives = 61/120 (51%), Gaps = 15/120 (13%)
 Frame = +1

Query  376  EAAAGISASMASVTEGPSSLSPPLAQETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRT  555
            E + G+  +M+S      S S P+ Q  L               +P R  +P+C +Y++T
Sbjct  275  ETSVGVQGTMSSYR----SSSTPMGQYAL----------QRDNVFPERPDQPECQFYMKT  320

Query  556  GLCRFGASCRFNHPSNRKLAIAAARMKG-EYPERVGQPECQYYLKTGACKFGATCKFHHP  732
            G C+FGA+C+F+HP  R +      +     P R G+P C +Y + G CKFG  CKF HP
Sbjct  321  GDCKFGAACKFHHPKERLVPAPNCVLSPLGLPLRPGEPLCVFYSRYGICKFGPNCKFDHP  380



>ref|XP_008794629.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
[Phoenix dactylifera]
 ref|XP_008794630.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
[Phoenix dactylifera]
 ref|XP_008794631.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
[Phoenix dactylifera]
Length=467

 Score =   281 bits (718),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 127/171 (74%), Positives = 148/171 (87%), Gaps = 1/171 (1%)
 Frame = +1

Query  436  SPPLAQETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLA  615
            +P L +ET+WQ++ R  E++ESG YP R G PDC+YY+RTGLCR+G +CR+NHP +RKLA
Sbjct  29   APALDEETMWQMNQRGSESVESGLYPERPGVPDCAYYLRTGLCRYGLTCRYNHPPDRKLA  88

Query  616  IAAARMKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRP  795
            IAAAR++G YPERVGQPECQYYLKTG CKFGATCKFHHP+DKAGI GR  LNVLGYP+RP
Sbjct  89   IAAARIRGGYPERVGQPECQYYLKTGTCKFGATCKFHHPKDKAGIFGRAPLNVLGYPIRP  148

Query  796  NDIECPYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQ  948
            N+ EC YY+RTGQCKFG+TCKFHHPQPSN MV LRGSP YPPV SP +PGQ
Sbjct  149  NEKECAYYLRTGQCKFGNTCKFHHPQPSNAMVSLRGSPVYPPV-SPASPGQ  198


 Score =   100 bits (249),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 45/83 (54%), Positives = 56/83 (67%), Gaps = 0/83 (0%)
 Frame = +1

Query  643  YPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYM  822
            +PER  QPECQ+Y+KTG CKFGA CKFHHP+++   A    L+ LG PLRP +  C +Y 
Sbjct  305  FPERPDQPECQFYMKTGDCKFGAACKFHHPKERLVPAPNCVLSPLGLPLRPGEPLCVFYS  364

Query  823  RTGQCKFGSTCKFHHPQPSNMMV  891
            R G CKFG  CKF HP  + M +
Sbjct  365  RYGICKFGPNCKFDHPMATPMGI  387


 Score = 74.7 bits (182),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 41/120 (34%), Positives = 64/120 (53%), Gaps = 15/120 (13%)
 Frame = +1

Query  376  EAAAGISASMASVTEGPSSLSPPLAQETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRT  555
            E + G+  +++S      S S P+ Q  L + S+          +P R  +P+C +Y++T
Sbjct  275  ETSMGVQGTISSYR----SSSTPMGQYALQRDSV----------FPERPDQPECQFYMKT  320

Query  556  GLCRFGASCRFNHPSNRKLAIAAARMKG-EYPERVGQPECQYYLKTGACKFGATCKFHHP  732
            G C+FGA+C+F+HP  R +      +     P R G+P C +Y + G CKFG  CKF HP
Sbjct  321  GDCKFGAACKFHHPKERLVPAPNCVLSPLGLPLRPGEPLCVFYSRYGICKFGPNCKFDHP  380



>gb|EPS74454.1| hypothetical protein M569_00301, partial [Genlisea aurea]
Length=205

 Score =   272 bits (695),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 129/165 (78%), Positives = 141/165 (85%), Gaps = 1/165 (1%)
 Frame = +1

Query  457  TLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMK  636
             LW ++ R  E  +SG YPVR+GEPDCSYYIRTGLCRFGA+CRFNHP NRKLAIA A+MK
Sbjct  1    VLWDMNSRLREPSDSGHYPVREGEPDCSYYIRTGLCRFGATCRFNHPPNRKLAIATAQMK  60

Query  637  GEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPY  816
            GEYPER+GQPECQYY+KTG CKFGATCKFHHP DKAGIAGRV LNV GYPLRPN+IEC Y
Sbjct  61   GEYPERIGQPECQYYIKTGTCKFGATCKFHHPPDKAGIAGRVPLNVHGYPLRPNEIECAY  120

Query  817  YMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQL  951
            YMR G CKFGSTCKF+HPQ SN+MV LRGS  YP +HSPT  GQL
Sbjct  121  YMRHGFCKFGSTCKFNHPQLSNIMVSLRGSTVYPTIHSPTA-GQL  164



>gb|KJB75170.1| hypothetical protein B456_012G028600 [Gossypium raimondii]
Length=401

 Score =   278 bits (710),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 129/152 (85%), Positives = 135/152 (89%), Gaps = 0/152 (0%)
 Frame = +1

Query  493  MESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKGEYPERVGQPEC  672
            ME G YP R GEPDCSYYIRTGLCRFGA+CRFNHP NRKLAI  ARMKGE+PERVGQPEC
Sbjct  1    MEPGPYPERPGEPDCSYYIRTGLCRFGATCRFNHPPNRKLAITTARMKGEFPERVGQPEC  60

Query  673  QYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  852
            QYYLKTG CKFGATCKFHHPRDKAGIAGRV+LN LGYPLRPN+ EC YY+RTGQCKFGST
Sbjct  61   QYYLKTGTCKFGATCKFHHPRDKAGIAGRVSLNFLGYPLRPNETECAYYLRTGQCKFGST  120

Query  853  CKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQ  948
            CKFHHPQP+NMMV LRGSP YP   SPTT GQ
Sbjct  121  CKFHHPQPTNMMVSLRGSPIYPTFPSPTTSGQ  152


 Score = 99.0 bits (245),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 48/106 (45%), Positives = 64/106 (60%), Gaps = 0/106 (0%)
 Frame = +1

Query  610  LAIAAARMKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPL  789
            +   A + +  +PER G+ ECQ+Y+KTG CKFGA C+FHHPR++   A    L+ +G PL
Sbjct  247  VGFYALQRENVFPERPGELECQFYMKTGDCKFGAVCRFHHPRERVLPAPDCILSPIGLPL  306

Query  790  RPNDIECPYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVH  927
            RP +  C +Y R G CKFG +CKF+HP           SP   PVH
Sbjct  307  RPGEPLCIFYSRYGICKFGPSCKFNHPMGVFTFNYSASSPFEAPVH  352


 Score = 74.7 bits (182),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 35/77 (45%), Positives = 48/77 (62%), Gaps = 1/77 (1%)
 Frame = +1

Query  505  TYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKG-EYPERVGQPECQYY  681
             +P R GE +C +Y++TG C+FGA CRF+HP  R L      +     P R G+P C +Y
Sbjct  257  VFPERPGELECQFYMKTGDCKFGAVCRFHHPRERVLPAPDCILSPIGLPLRPGEPLCIFY  316

Query  682  LKTGACKFGATCKFHHP  732
             + G CKFG +CKF+HP
Sbjct  317  SRYGICKFGPSCKFNHP  333



>ref|XP_010673925.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X1 [Beta vulgaris subsp. vulgaris]
Length=459

 Score =   278 bits (711),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 132/188 (70%), Positives = 153/188 (81%), Gaps = 11/188 (6%)
 Frame = +1

Query  400  SMASVTEGPSSLSPPLAQETLWQLSLRSMETMESGTYP-----VRDGEPDCSYYIRTGLC  564
            S  +V  G SSL   L ++++WQ+++RS E M++G YP      R+GE DCS+Y+RTGLC
Sbjct  30   SAVAVNSGSSSL---LDEDSMWQVNMRSTEAMDTGIYPPGPYPEREGEADCSFYLRTGLC  86

Query  565  RFGASCRFNHPSNRKLAIAAARMKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKA  744
            RFG++CRFNHP NRKLA+A ARMKGE+PER GQPECQYYLKTG CKFGATCKF+HP+DKA
Sbjct  87   RFGSTCRFNHPPNRKLALATARMKGEFPERTGQPECQYYLKTGTCKFGATCKFNHPKDKA  146

Query  745  GIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPV  924
            GIAGRV LNVLGYPLRPN+ EC YY+RTGQCKFGSTCKFHHPQPS      RGS  YPPV
Sbjct  147  GIAGRVPLNVLGYPLRPNEPECAYYLRTGQCKFGSTCKFHHPQPS---ASFRGSSVYPPV  203

Query  925  HSPTTPGQ  948
             SPTTPGQ
Sbjct  204  QSPTTPGQ  211


 Score =   103 bits (256),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 47/83 (57%), Positives = 56/83 (67%), Gaps = 0/83 (0%)
 Frame = +1

Query  622  AARMKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPND  801
            A +    +PER GQPECQYY+KTG CKFGA C+FHHPR++   A    L+ LG PLRP +
Sbjct  309  ALQRDNVFPERPGQPECQYYMKTGDCKFGAVCRFHHPRERLIPAPDCLLSALGLPLRPGE  368

Query  802  IECPYYMRTGQCKFGSTCKFHHP  870
              C +Y R G CKFG  CKF HP
Sbjct  369  PLCIFYSRYGICKFGPNCKFDHP  391


 Score = 78.2 bits (191),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 35/77 (45%), Positives = 47/77 (61%), Gaps = 1/77 (1%)
 Frame = +1

Query  505  TYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKG-EYPERVGQPECQYY  681
             +P R G+P+C YY++TG C+FGA CRF+HP  R +      +     P R G+P C +Y
Sbjct  315  VFPERPGQPECQYYMKTGDCKFGAVCRFHHPRERLIPAPDCLLSALGLPLRPGEPLCIFY  374

Query  682  LKTGACKFGATCKFHHP  732
             + G CKFG  CKF HP
Sbjct  375  SRYGICKFGPNCKFDHP  391


 Score = 51.2 bits (121),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 19/31 (61%), Positives = 24/31 (77%), Gaps = 0/31 (0%)
 Frame = +1

Query  781  YPLRPNDIECPYYMRTGQCKFGSTCKFHHPQ  873
            +P RP   EC YYM+TG CKFG+ C+FHHP+
Sbjct  316  FPERPGQPECQYYMKTGDCKFGAVCRFHHPR  346



>ref|XP_010673926.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X2 [Beta vulgaris subsp. vulgaris]
Length=457

 Score =   278 bits (710),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 132/188 (70%), Positives = 153/188 (81%), Gaps = 11/188 (6%)
 Frame = +1

Query  400  SMASVTEGPSSLSPPLAQETLWQLSLRSMETMESGTYP-----VRDGEPDCSYYIRTGLC  564
            S  +V  G SSL   L ++++WQ+++RS E M++G YP      R+GE DCS+Y+RTGLC
Sbjct  30   SAVAVNSGSSSL---LDEDSMWQVNMRSTEAMDTGIYPPGPYPEREGEADCSFYLRTGLC  86

Query  565  RFGASCRFNHPSNRKLAIAAARMKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKA  744
            RFG++CRFNHP NRKLA+A ARMKGE+PER GQPECQYYLKTG CKFGATCKF+HP+DKA
Sbjct  87   RFGSTCRFNHPPNRKLALATARMKGEFPERTGQPECQYYLKTGTCKFGATCKFNHPKDKA  146

Query  745  GIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPV  924
            GIAGRV LNVLGYPLRPN+ EC YY+RTGQCKFGSTCKFHHPQPS      RGS  YPPV
Sbjct  147  GIAGRVPLNVLGYPLRPNEPECAYYLRTGQCKFGSTCKFHHPQPS---ASFRGSSVYPPV  203

Query  925  HSPTTPGQ  948
             SPTTPGQ
Sbjct  204  QSPTTPGQ  211


 Score =   103 bits (256),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 47/83 (57%), Positives = 56/83 (67%), Gaps = 0/83 (0%)
 Frame = +1

Query  622  AARMKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPND  801
            A +    +PER GQPECQYY+KTG CKFGA C+FHHPR++   A    L+ LG PLRP +
Sbjct  307  ALQRDNVFPERPGQPECQYYMKTGDCKFGAVCRFHHPRERLIPAPDCLLSALGLPLRPGE  366

Query  802  IECPYYMRTGQCKFGSTCKFHHP  870
              C +Y R G CKFG  CKF HP
Sbjct  367  PLCIFYSRYGICKFGPNCKFDHP  389


 Score = 78.6 bits (192),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 35/77 (45%), Positives = 47/77 (61%), Gaps = 1/77 (1%)
 Frame = +1

Query  505  TYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKG-EYPERVGQPECQYY  681
             +P R G+P+C YY++TG C+FGA CRF+HP  R +      +     P R G+P C +Y
Sbjct  313  VFPERPGQPECQYYMKTGDCKFGAVCRFHHPRERLIPAPDCLLSALGLPLRPGEPLCIFY  372

Query  682  LKTGACKFGATCKFHHP  732
             + G CKFG  CKF HP
Sbjct  373  SRYGICKFGPNCKFDHP  389


 Score = 51.2 bits (121),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 19/31 (61%), Positives = 24/31 (77%), Gaps = 0/31 (0%)
 Frame = +1

Query  781  YPLRPNDIECPYYMRTGQCKFGSTCKFHHPQ  873
            +P RP   EC YYM+TG CKFG+ C+FHHP+
Sbjct  314  FPERPGQPECQYYMKTGDCKFGAVCRFHHPR  344



>ref|XP_010111067.1| Zinc finger CCCH domain-containing protein ZFN-like protein [Morus 
notabilis]
 gb|EXC29929.1| Zinc finger CCCH domain-containing protein ZFN-like protein [Morus 
notabilis]
Length=419

 Score =   276 bits (707),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 135/194 (70%), Positives = 152/194 (78%), Gaps = 24/194 (12%)
 Frame = +1

Query  367  MDFEAAAGISASMASVTEGPSSLSPPLAQETLWQLSLRSMETMESGTYPVRDGEPDCSYY  546
            M+F+A  GI  S+A+VTE    LSP  +Q+ +WQ++LRS ETMESGTYP R GEPDCSYY
Sbjct  1    MEFDA--GIPMSLAAVTE-LRELSPSFSQDAIWQMNLRSSETMESGTYPERPGEPDCSYY  57

Query  547  IRTGLCRFGASCRFNHPSNRKLAIAAARMKGEYPERVGQPECQYYLKTGACKFGATCKFH  726
            IRTGLCRFGA+CRFNHP NRKL                     YYLKTG CKFGATCKFH
Sbjct  58   IRTGLCRFGATCRFNHPPNRKL---------------------YYLKTGTCKFGATCKFH  96

Query  727  HPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGS  906
            HPRDKAGIAGRV+LN+LGYPLRPN++EC YY+RTGQCKFGSTCKFHHPQP+NMMV +RGS
Sbjct  97   HPRDKAGIAGRVSLNILGYPLRPNEMECAYYLRTGQCKFGSTCKFHHPQPTNMMVSMRGS  156

Query  907  PAYPPVHSPTTPGQ  948
            P YP V SPTTPGQ
Sbjct  157  PVYPTVQSPTTPGQ  170


 Score =   103 bits (258),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 46/87 (53%), Positives = 59/87 (68%), Gaps = 0/87 (0%)
 Frame = +1

Query  610  LAIAAARMKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPL  789
            +   A + +  +PER GQPECQ+Y+KTG CKFGA CKFHHPR++   A    L+ +G PL
Sbjct  264  VGFYALQRENVFPERTGQPECQFYMKTGDCKFGAVCKFHHPRERLIPAPDCLLSPMGLPL  323

Query  790  RPNDIECPYYMRTGQCKFGSTCKFHHP  870
            RP +  C +Y R G CKFG +CKF HP
Sbjct  324  RPGEPLCIFYSRYGICKFGPSCKFDHP  350


 Score = 76.3 bits (186),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 33/77 (43%), Positives = 48/77 (62%), Gaps = 1/77 (1%)
 Frame = +1

Query  505  TYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMK-GEYPERVGQPECQYY  681
             +P R G+P+C +Y++TG C+FGA C+F+HP  R +      +     P R G+P C +Y
Sbjct  274  VFPERTGQPECQFYMKTGDCKFGAVCKFHHPRERLIPAPDCLLSPMGLPLRPGEPLCIFY  333

Query  682  LKTGACKFGATCKFHHP  732
             + G CKFG +CKF HP
Sbjct  334  SRYGICKFGPSCKFDHP  350



>ref|XP_008792915.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X3 [Phoenix dactylifera]
Length=434

 Score =   276 bits (705),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 122/160 (76%), Positives = 141/160 (88%), Gaps = 0/160 (0%)
 Frame = +1

Query  469  LSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKGEYP  648
            +++R  E+MESG+YP R GEPDC+YY+RTG CR+G +CR+NHP NRKLAIAAAR+KG YP
Sbjct  1    MNMRGSESMESGSYPQRQGEPDCAYYLRTGHCRYGVTCRYNHPPNRKLAIAAARLKGGYP  60

Query  649  ERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRT  828
            E VGQPECQYYLKTG CKFGATCKFHHP+DKAGI GR  LN+LGYP+RPN+ EC YY+RT
Sbjct  61   EIVGQPECQYYLKTGTCKFGATCKFHHPKDKAGILGRAELNILGYPIRPNEEECAYYLRT  120

Query  829  GQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQ  948
            GQCKFG+TCKFHHPQPSN+MV LRGSP YP VHSPT+P Q
Sbjct  121  GQCKFGNTCKFHHPQPSNVMVSLRGSPFYPSVHSPTSPSQ  160


 Score =   100 bits (249),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 45/90 (50%), Positives = 59/90 (66%), Gaps = 0/90 (0%)
 Frame = +1

Query  622  AARMKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPND  801
            A +    +PER+ QPECQ+Y+KTG CKFGA CKFHHP+++   A    L+  G PLRP +
Sbjct  259  ALQKDNVFPERLDQPECQFYMKTGDCKFGAACKFHHPKERLITAPNCLLSPSGLPLRPGE  318

Query  802  IECPYYMRTGQCKFGSTCKFHHPQPSNMMV  891
              C +Y R G CKFG  CKF HP  ++M +
Sbjct  319  PLCVFYSRYGICKFGPNCKFDHPVVTSMGI  348


 Score = 75.5 bits (184),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 32/80 (40%), Positives = 48/80 (60%), Gaps = 1/80 (1%)
 Frame = +1

Query  496  ESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMK-GEYPERVGQPEC  672
            +   +P R  +P+C +Y++TG C+FGA+C+F+HP  R +      +     P R G+P C
Sbjct  262  KDNVFPERLDQPECQFYMKTGDCKFGAACKFHHPKERLITAPNCLLSPSGLPLRPGEPLC  321

Query  673  QYYLKTGACKFGATCKFHHP  732
             +Y + G CKFG  CKF HP
Sbjct  322  VFYSRYGICKFGPNCKFDHP  341



>ref|XP_009382899.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
[Musa acuminata subsp. malaccensis]
Length=467

 Score =   275 bits (702),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 130/205 (63%), Positives = 160/205 (78%), Gaps = 12/205 (6%)
 Frame = +1

Query  367  MDFEAAAGIS------ASMASVTEGPSSLSPPLA-----QETLWQLSLRSMETMESGTYP  513
            MD++ AA ++       +MAS  +   + SPPL      Q T+WQ+ +R +E++ESG +P
Sbjct  1    MDYDDAAAVTDGVDKRGAMASSADVMGAASPPLLRSPIDQVTMWQMRMREIESVESGPFP  60

Query  514  VRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKGEYPERVGQPECQYYLKTG  693
             R  EPDC+YY+RTGLCRFG +CR+NHP NR++AIAAAR+KG YPERVGQPEC++YL+TG
Sbjct  61   ERPREPDCTYYLRTGLCRFGITCRYNHPPNRQMAIAAARIKGGYPERVGQPECEFYLRTG  120

Query  694  ACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTCKFHHPQ  873
             CKFGATCKFHHPRDKAGIAGRV LNVLGYPLRP++ EC YYM+ G+CKFG+TCKFHHPQ
Sbjct  121  TCKFGATCKFHHPRDKAGIAGRVQLNVLGYPLRPDEAECAYYMKNGECKFGNTCKFHHPQ  180

Query  874  PSNMMVPLRGSPAYPPVHSPTTPGQ  948
            P N MV L GS  YP VHSPT+  Q
Sbjct  181  P-NTMVSLCGSTVYPGVHSPTSGQQ  204


 Score = 97.4 bits (241),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 44/83 (53%), Positives = 56/83 (67%), Gaps = 0/83 (0%)
 Frame = +1

Query  643  YPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYM  822
            +P R GQPEC++YLKTG CK+GA CKFHHPR++        L+ LG PLRP +  C +Y 
Sbjct  310  FPVRPGQPECEFYLKTGDCKYGAACKFHHPRERLIPIPDCVLSPLGLPLRPEEPICIFYS  369

Query  823  RTGQCKFGSTCKFHHPQPSNMMV  891
            R G CKFG+ CKF HP  + M +
Sbjct  370  RYGICKFGTHCKFDHPMAAPMGI  392


 Score = 76.6 bits (187),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 43/127 (34%), Positives = 65/127 (51%), Gaps = 17/127 (13%)
 Frame = +1

Query  505  TYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKG-EYPERVGQPECQYY  681
             +PVR G+P+C +Y++TG C++GA+C+F+HP  R + I    +     P R  +P C +Y
Sbjct  309  VFPVRPGQPECEFYLKTGDCKYGAACKFHHPRERLIPIPDCVLSPLGLPLRPEEPICIFY  368

Query  682  LKTGACKFGATCKFHHP--------------RDKAGIAGRVALNVLGYPLRPNDIECPYY  819
             + G CKFG  CKF HP                 A +A  VA N+L     P   + P  
Sbjct  369  SRYGICKFGTHCKFDHPMAAPMGIYAYSLATSSLADVA--VARNLLATSSGPPSFQAPLE  426

Query  820  MRTGQCK  840
            + TG+ +
Sbjct  427  VATGKSR  433


 Score = 51.2 bits (121),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 18/38 (47%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = +1

Query  781  YPLRPNDIECPYYMRTGQCKFGSTCKFHHPQPSNMMVP  894
            +P+RP   EC +Y++TG CK+G+ CKFHHP+   + +P
Sbjct  310  FPVRPGQPECEFYLKTGDCKYGAACKFHHPRERLIPIP  347



>ref|XP_009392477.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X1 [Musa acuminata subsp. malaccensis]
 ref|XP_009392478.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X1 [Musa acuminata subsp. malaccensis]
 ref|XP_009392479.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X1 [Musa acuminata subsp. malaccensis]
 ref|XP_009392480.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X1 [Musa acuminata subsp. malaccensis]
Length=411

 Score =   270 bits (691),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 119/163 (73%), Positives = 141/163 (87%), Gaps = 0/163 (0%)
 Frame = +1

Query  460  LWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKG  639
            +W+ ++R  + +ESG YP R GEPDC+YYIRTGLCRFG +C+FNHP NR LAIAAAR++G
Sbjct  1    MWKTNMRGRDPVESGPYPDRPGEPDCAYYIRTGLCRFGMTCKFNHPQNRMLAIAAARIRG  60

Query  640  EYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYY  819
             YPERVGQPECQYYLKTG CKFG+TCKFHHP++KAGIA +  LN+LGYPLRPN+ EC YY
Sbjct  61   GYPERVGQPECQYYLKTGTCKFGSTCKFHHPKEKAGIAKQAQLNILGYPLRPNEQECAYY  120

Query  820  MRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQ  948
            +RTG+CKFGSTCK+HHPQPSN ++ LRGSP YP  HSPTTPGQ
Sbjct  121  IRTGECKFGSTCKYHHPQPSNTILALRGSPIYPSAHSPTTPGQ  163


 Score =   106 bits (265),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 51/109 (47%), Positives = 66/109 (61%), Gaps = 2/109 (2%)
 Frame = +1

Query  550  RTGLCRFGASCRFN--HPSNRKLAIAAARMKGEYPERVGQPECQYYLKTGACKFGATCKF  723
            + G    GA  +F+   P +  + + A   +  +PER GQPECQ+Y+KTG CKFGA C+F
Sbjct  234  QQGETNIGAQGKFSSYRPGSVSMGLYAVPRENIFPERPGQPECQFYMKTGDCKFGAVCRF  293

Query  724  HHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTCKFHHP  870
            HHPR++        LN LG PLRP +  C +Y R G CKFG  CKF HP
Sbjct  294  HHPRERLIPTPNCVLNPLGLPLRPGEPLCVFYSRYGICKFGPNCKFDHP  342


 Score = 76.3 bits (186),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 47/76 (62%), Gaps = 1/76 (1%)
 Frame = +1

Query  508  YPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKG-EYPERVGQPECQYYL  684
            +P R G+P+C +Y++TG C+FGA CRF+HP  R +      +     P R G+P C +Y 
Sbjct  267  FPERPGQPECQFYMKTGDCKFGAVCRFHHPRERLIPTPNCVLNPLGLPLRPGEPLCVFYS  326

Query  685  KTGACKFGATCKFHHP  732
            + G CKFG  CKF HP
Sbjct  327  RYGICKFGPNCKFDHP  342


 Score = 52.0 bits (123),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 27/66 (41%), Positives = 37/66 (56%), Gaps = 5/66 (8%)
 Frame = +1

Query  685  KTGACKFGATCKFHHPRDKAGIAGRVAL---NVLGYPLRPNDIECPYYMRTGQCKFGSTC  855
            + G    GA  KF   R  +   G  A+   N+  +P RP   EC +YM+TG CKFG+ C
Sbjct  234  QQGETNIGAQGKFSSYRPGSVSMGLYAVPRENI--FPERPGQPECQFYMKTGDCKFGAVC  291

Query  856  KFHHPQ  873
            +FHHP+
Sbjct  292  RFHHPR  297



>ref|NP_001066624.1| Os12g0405100 [Oryza sativa Japonica Group]
 sp|Q2QT65.1|C3H66_ORYSJ RecName: Full=Zinc finger CCCH domain-containing protein 66; 
Short=OsC3H66 [Oryza sativa Japonica Group]
 gb|ABA97542.1| Zinc finger CCCH type domain containing protein ZFN, putative, 
expressed [Oryza sativa Japonica Group]
 dbj|BAF29643.1| Os12g0405100 [Oryza sativa Japonica Group]
 dbj|BAG99287.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE53085.1| hypothetical protein OsJ_35844 [Oryza sativa Japonica Group]
Length=454

 Score =   271 bits (693),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 129/188 (69%), Positives = 149/188 (79%), Gaps = 3/188 (2%)
 Frame = +1

Query  385  AGISASMASVTEGPSSLSPPLAQETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLC  564
             G+SA+  ++  GP  L    A+E +WQ++L   E+MES  YP R GEPDCSYY+RTGLC
Sbjct  24   GGVSAAAPAI--GPHHLGVAAAEEAMWQMTLGGGESMESTPYPERIGEPDCSYYMRTGLC  81

Query  565  RFGASCRFNHPSNRKLAIAAARMKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKA  744
            RFG +C+FNHP NRKLA+AAARM GEYP RVGQPECQYYLKTG CKFGATCKFHHPR+KA
Sbjct  82   RFGMTCKFNHPPNRKLAVAAARMNGEYPYRVGQPECQYYLKTGTCKFGATCKFHHPREKA  141

Query  745  GIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPV  924
             +A RV LNVLGYP+RPN+ EC YY+RTGQCKF STCKFHHPQPSN MV +R S  Y P 
Sbjct  142  ALANRVQLNVLGYPMRPNEKECAYYLRTGQCKFASTCKFHHPQPSNTMVAVRNS-MYSPG  200

Query  925  HSPTTPGQ  948
             S T+PGQ
Sbjct  201  QSATSPGQ  208


 Score =   103 bits (258),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 48/89 (54%), Positives = 60/89 (67%), Gaps = 2/89 (2%)
 Frame = +1

Query  610  LAIAAARMKGE--YPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGY  783
            + +    ++GE  +PER  QPECQ+Y+KTG CKFGA CKFHHP+++   A   ALN LG 
Sbjct  302  VPVGVYTVQGENIFPERPDQPECQFYMKTGDCKFGAVCKFHHPKERLVPAPNCALNSLGL  361

Query  784  PLRPNDIECPYYMRTGQCKFGSTCKFHHP  870
            PLRP +  C +Y R G CKFG  CKF HP
Sbjct  362  PLRPGEPVCTFYSRYGICKFGPNCKFDHP  390


 Score = 74.3 bits (181),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 47/76 (62%), Gaps = 1/76 (1%)
 Frame = +1

Query  508  YPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKL-AIAAARMKGEYPERVGQPECQYYL  684
            +P R  +P+C +Y++TG C+FGA C+F+HP  R + A   A      P R G+P C +Y 
Sbjct  315  FPERPDQPECQFYMKTGDCKFGAVCKFHHPKERLVPAPNCALNSLGLPLRPGEPVCTFYS  374

Query  685  KTGACKFGATCKFHHP  732
            + G CKFG  CKF HP
Sbjct  375  RYGICKFGPNCKFDHP  390


 Score = 52.0 bits (123),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 19/31 (61%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = +1

Query  781  YPLRPNDIECPYYMRTGQCKFGSTCKFHHPQ  873
            +P RP+  EC +YM+TG CKFG+ CKFHHP+
Sbjct  315  FPERPDQPECQFYMKTGDCKFGAVCKFHHPK  345



>ref|NP_566183.1| zinc finger protein 1 [Arabidopsis thaliana]
 sp|Q8GXX7.1|C3H33_ARATH RecName: Full=Zinc finger CCCH domain-containing protein 33; 
Short=AtC3H33; AltName: Full=Zinc finger CCCH domain-containing 
protein ZFN1 [Arabidopsis thaliana]
 dbj|BAC42614.1| putative zinc finger protein 1 zfn1 [Arabidopsis thaliana]
 gb|ABG25055.1| At3g02830 [Arabidopsis thaliana]
 gb|AEE73864.1| zinc finger protein 1 [Arabidopsis thaliana]
Length=397

 Score =   269 bits (688),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 123/186 (66%), Positives = 149/186 (80%), Gaps = 13/186 (7%)
 Frame = +1

Query  367  MDFEAAAGISASMASVTEGPSSLSPPLAQETLWQLSLRSMETMESGTYPVRDGEPDCSYY  546
            MDF A   +S           SLSP + Q+ +WQ++L S ETME+G+YP R GEPDCSYY
Sbjct  1    MDFNAGVPMS-----------SLSPLMNQDAMWQMNLSSDETMETGSYPERPGEPDCSYY  49

Query  547  IRTGLCRFGASCRFNHPSNRKLAIAAARMKGEYPERVGQPECQYYLKTGACKFGATCKFH  726
            IRTGLCRFG++CRFNHP +R+L IA ARM+GEYPER+GQPEC+YYLKTG CKFG TCKFH
Sbjct  50   IRTGLCRFGSTCRFNHPRDRELVIATARMRGEYPERIGQPECEYYLKTGTCKFGVTCKFH  109

Query  727  HPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTCKFHH--PQPSNMMVPLR  900
            HPR+KAGIAGRV+LN+LGYPLR N+++C Y++RTG CKFG TCKF+H  PQP+NMMVP  
Sbjct  110  HPRNKAGIAGRVSLNMLGYPLRSNEVDCAYFLRTGHCKFGGTCKFNHPQPQPTNMMVPTS  169

Query  901  GSPAYP  918
            G  +YP
Sbjct  170  GQQSYP  175


 Score =   101 bits (252),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 44/76 (58%), Positives = 53/76 (70%), Gaps = 0/76 (0%)
 Frame = +1

Query  643  YPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYM  822
            +PER GQPECQ+Y+KTG CKFG  CKFHHPRD+        L+ +G PLRP +  C +Y 
Sbjct  271  FPERPGQPECQFYMKTGDCKFGTVCKFHHPRDRQAPPPDCLLSSIGLPLRPGEPLCVFYT  330

Query  823  RTGQCKFGSTCKFHHP  870
            R G CKFG +CKF HP
Sbjct  331  RYGICKFGPSCKFDHP  346


 Score = 74.7 bits (182),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 32/77 (42%), Positives = 48/77 (62%), Gaps = 1/77 (1%)
 Frame = +1

Query  505  TYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKG-EYPERVGQPECQYY  681
             +P R G+P+C +Y++TG C+FG  C+F+HP +R+       +     P R G+P C +Y
Sbjct  270  VFPERPGQPECQFYMKTGDCKFGTVCKFHHPRDRQAPPPDCLLSSIGLPLRPGEPLCVFY  329

Query  682  LKTGACKFGATCKFHHP  732
             + G CKFG +CKF HP
Sbjct  330  TRYGICKFGPSCKFDHP  346


 Score = 52.0 bits (123),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 47/176 (27%), Positives = 68/176 (39%), Gaps = 56/176 (32%)
 Frame = +1

Query  508  YPVRDGEPDCSYYIRTG------LCRFG------------ASCRFNHPSNRKLAIAAARM  633
            YP+R  E DC+Y++RTG       C+F              S + ++P +R   IA+ R 
Sbjct  128  YPLRSNEVDCAYFLRTGHCKFGGTCKFNHPQPQPTNMMVPTSGQQSYPWSRASFIASPRW  187

Query  634  K------------GEYPERVGQPECQYYLKTGACKFGATCKF------------------  723
            +            G  P +   P             G    +                  
Sbjct  188  QDPSSYASLIMPQGVVPVQGWNPYSGQLGSVSPSGTGNDQNYRNLQQNETIESGSQSQGS  247

Query  724  ---HHPRDKAGIAGRVAL---NVLGYPLRPNDIECPYYMRTGQCKFGSTCKFHHPQ  873
               ++P     + G  AL   NV  +P RP   EC +YM+TG CKFG+ CKFHHP+
Sbjct  248  FSGYNPGSSVPLGGYYALPRENV--FPERPGQPECQFYMKTGDCKFGTVCKFHHPR  301



>ref|XP_010501886.1| PREDICTED: zinc finger CCCH domain-containing protein 33-like 
isoform X2 [Camelina sativa]
Length=400

 Score =   269 bits (688),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 123/186 (66%), Positives = 149/186 (80%), Gaps = 13/186 (7%)
 Frame = +1

Query  367  MDFEAAAGISASMASVTEGPSSLSPPLAQETLWQLSLRSMETMESGTYPVRDGEPDCSYY  546
            MDF A   +S           SLSP + Q+ +WQ++L S ETME+G+YP R GEPDCSYY
Sbjct  1    MDFNAGVPMS-----------SLSPLMNQDAMWQMNLGSEETMETGSYPERPGEPDCSYY  49

Query  547  IRTGLCRFGASCRFNHPSNRKLAIAAARMKGEYPERVGQPECQYYLKTGACKFGATCKFH  726
            IRTGLCRFG++CRFNHP +R+L IA ARM+GEYPER+GQPEC+YYLKTG CKFG TCKFH
Sbjct  50   IRTGLCRFGSTCRFNHPRDRELVIATARMRGEYPERIGQPECEYYLKTGTCKFGVTCKFH  109

Query  727  HPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTCKFHH--PQPSNMMVPLR  900
            HPR+KAGIAGRV+LN+LGYPLR N+++C Y++RTG CKFG TCKF+H  PQP+NMMVP  
Sbjct  110  HPRNKAGIAGRVSLNMLGYPLRSNEVDCAYFLRTGHCKFGGTCKFNHPQPQPTNMMVPTS  169

Query  901  GSPAYP  918
            G  +YP
Sbjct  170  GQQSYP  175


 Score =   102 bits (253),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 44/76 (58%), Positives = 53/76 (70%), Gaps = 0/76 (0%)
 Frame = +1

Query  643  YPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYM  822
            +PER GQPECQ+Y+KTG CKFG  CKFHHPRD+        L+ +G PLRP +  C +Y 
Sbjct  270  FPERPGQPECQFYMKTGDCKFGTVCKFHHPRDRQAPPPDCLLSSIGLPLRPGEPLCVFYT  329

Query  823  RTGQCKFGSTCKFHHP  870
            R G CKFG +CKF HP
Sbjct  330  RYGICKFGPSCKFDHP  345


 Score = 75.1 bits (183),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 32/77 (42%), Positives = 48/77 (62%), Gaps = 1/77 (1%)
 Frame = +1

Query  505  TYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKG-EYPERVGQPECQYY  681
             +P R G+P+C +Y++TG C+FG  C+F+HP +R+       +     P R G+P C +Y
Sbjct  269  VFPERPGQPECQFYMKTGDCKFGTVCKFHHPRDRQAPPPDCLLSSIGLPLRPGEPLCVFY  328

Query  682  LKTGACKFGATCKFHHP  732
             + G CKFG +CKF HP
Sbjct  329  TRYGICKFGPSCKFDHP  345


 Score = 72.8 bits (177),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 55/179 (31%), Positives = 79/179 (44%), Gaps = 63/179 (35%)
 Frame = +1

Query  508  YPVRDGEPDCSYYIRTGLCRFGASCRFNHPS------------------NRKLAIAAAR-  630
            YP+R  E DC+Y++RTG C+FG +C+FNHP                   +R   IA+ R 
Sbjct  128  YPLRSNEVDCAYFLRTGHCKFGGTCKFNHPQPQPTNMMVPTSGQQSYPWSRASFIASPRW  187

Query  631  -----------------MKGEYPERVG------------------QPECQYYLKTGACKF  705
                             ++G  P  +G                  Q E +   ++G+   
Sbjct  188  QDPSTYPSLIMPQGVVPVQGWNPYSLGSVSPSGTGNDLNYNRSLQQSETK---ESGSPSQ  244

Query  706  GATCKFHHPRDKAGIAGRVAL---NVLGYPLRPNDIECPYYMRTGQCKFGSTCKFHHPQ  873
            G+   F+ P     + G  AL   NV  +P RP   EC +YM+TG CKFG+ CKFHHP+
Sbjct  245  GSFSGFN-PGSSVPLGGFYALPRENV--FPERPGQPECQFYMKTGDCKFGTVCKFHHPR  300



>ref|XP_009769503.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X2 [Nicotiana sylvestris]
Length=406

 Score =   269 bits (688),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 130/181 (72%), Positives = 143/181 (79%), Gaps = 21/181 (12%)
 Frame = +1

Query  409  SVTEGPSSLSPPLAQETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRF  588
            SV+EGP SLSP L Q++LWQ++LRSME+MESG YPVR+GE DCSYYIRTGLCRFG++C+F
Sbjct  4    SVSEGPPSLSPSLRQDSLWQMNLRSMESMESGPYPVREGESDCSYYIRTGLCRFGSTCQF  63

Query  589  NHPSNRKLAIAAARMKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVAL  768
            NHP NRKL                     YYLKTG CKFGATCKFHHPRDKAGIAGRV L
Sbjct  64   NHPPNRKL---------------------YYLKTGTCKFGATCKFHHPRDKAGIAGRVTL  102

Query  769  NVLGYPLRPNDIECPYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQ  948
            NVLGYPLRPN+ EC YYMRT QCKFGSTCKFHHP+PSNMMV  RGSP YPP  S TTPGQ
Sbjct  103  NVLGYPLRPNENECTYYMRTAQCKFGSTCKFHHPEPSNMMVSSRGSPVYPPGPSSTTPGQ  162

Query  949  L  951
            +
Sbjct  163  M  163


 Score =   100 bits (248),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 46/89 (52%), Positives = 60/89 (67%), Gaps = 2/89 (2%)
 Frame = +1

Query  610  LAIAAARMKGE--YPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGY  783
            L +    ++GE  +PERVGQPECQ+Y+KTG CKFGA C+FHHPR++        L+ +G 
Sbjct  249  LPVGYYALQGENVFPERVGQPECQFYMKTGDCKFGAVCRFHHPRERLLPPPDCLLSPIGL  308

Query  784  PLRPNDIECPYYMRTGQCKFGSTCKFHHP  870
            PLR  +  C +Y R G CKFG +CKF HP
Sbjct  309  PLRAGEPMCIFYSRYGICKFGPSCKFDHP  337


 Score = 77.4 bits (189),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 35/77 (45%), Positives = 48/77 (62%), Gaps = 1/77 (1%)
 Frame = +1

Query  505  TYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKG-EYPERVGQPECQYY  681
             +P R G+P+C +Y++TG C+FGA CRF+HP  R L      +     P R G+P C +Y
Sbjct  261  VFPERVGQPECQFYMKTGDCKFGAVCRFHHPRERLLPPPDCLLSPIGLPLRAGEPMCIFY  320

Query  682  LKTGACKFGATCKFHHP  732
             + G CKFG +CKF HP
Sbjct  321  SRYGICKFGPSCKFDHP  337


 Score = 55.5 bits (132),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 49/196 (25%), Positives = 76/196 (39%), Gaps = 72/196 (37%)
 Frame = +1

Query  490  TMESGTYPVRDGEPDCSYYIRTGLCRFGASC-----------------------------  582
            T+    YP+R  E +C+YY+RT  C+FG++C                             
Sbjct  101  TLNVLGYPLRPNENECTYYMRTAQCKFGSTCKFHHPEPSNMMVSSRGSPVYPPGPSSTTP  160

Query  583  -RFNHPSNRKLAIAAARMKGE--------------YPE--------RVGQPECQYYLKTG  693
             + ++P +R   I+ AR +G               +P          V   E Q      
Sbjct  161  GQMSYPLSRASFISGARWQGSSSYAPLPVLQGVVSFPGFTYNGQLGSVSSAEGQQQTAGN  220

Query  694  ACKFGATCKFHHPRDKAGIAG-------RVALNVLGY---------PLRPNDIECPYYMR  825
            +  +G++       DKA +         RV+   +GY         P R    EC +YM+
Sbjct  221  SQVYGSS----RSSDKATMGSEGMNSSYRVSSLPVGYYALQGENVFPERVGQPECQFYMK  276

Query  826  TGQCKFGSTCKFHHPQ  873
            TG CKFG+ C+FHHP+
Sbjct  277  TGDCKFGAVCRFHHPR  292



>ref|XP_010501847.1| PREDICTED: zinc finger CCCH domain-containing protein 33-like 
isoform X1 [Camelina sativa]
Length=402

 Score =   269 bits (688),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 123/186 (66%), Positives = 149/186 (80%), Gaps = 13/186 (7%)
 Frame = +1

Query  367  MDFEAAAGISASMASVTEGPSSLSPPLAQETLWQLSLRSMETMESGTYPVRDGEPDCSYY  546
            MDF A   +S           SLSP + Q+ +WQ++L S ETME+G+YP R GEPDCSYY
Sbjct  1    MDFNAGVPMS-----------SLSPLMNQDAMWQMNLGSEETMETGSYPERPGEPDCSYY  49

Query  547  IRTGLCRFGASCRFNHPSNRKLAIAAARMKGEYPERVGQPECQYYLKTGACKFGATCKFH  726
            IRTGLCRFG++CRFNHP +R+L IA ARM+GEYPER+GQPEC+YYLKTG CKFG TCKFH
Sbjct  50   IRTGLCRFGSTCRFNHPRDRELVIATARMRGEYPERIGQPECEYYLKTGTCKFGVTCKFH  109

Query  727  HPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTCKFHH--PQPSNMMVPLR  900
            HPR+KAGIAGRV+LN+LGYPLR N+++C Y++RTG CKFG TCKF+H  PQP+NMMVP  
Sbjct  110  HPRNKAGIAGRVSLNMLGYPLRSNEVDCAYFLRTGHCKFGGTCKFNHPQPQPTNMMVPTS  169

Query  901  GSPAYP  918
            G  +YP
Sbjct  170  GQQSYP  175


 Score =   101 bits (252),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 44/76 (58%), Positives = 53/76 (70%), Gaps = 0/76 (0%)
 Frame = +1

Query  643  YPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYM  822
            +PER GQPECQ+Y+KTG CKFG  CKFHHPRD+        L+ +G PLRP +  C +Y 
Sbjct  272  FPERPGQPECQFYMKTGDCKFGTVCKFHHPRDRQAPPPDCLLSSIGLPLRPGEPLCVFYT  331

Query  823  RTGQCKFGSTCKFHHP  870
            R G CKFG +CKF HP
Sbjct  332  RYGICKFGPSCKFDHP  347


 Score = 75.1 bits (183),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 32/77 (42%), Positives = 48/77 (62%), Gaps = 1/77 (1%)
 Frame = +1

Query  505  TYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKG-EYPERVGQPECQYY  681
             +P R G+P+C +Y++TG C+FG  C+F+HP +R+       +     P R G+P C +Y
Sbjct  271  VFPERPGQPECQFYMKTGDCKFGTVCKFHHPRDRQAPPPDCLLSSIGLPLRPGEPLCVFY  330

Query  682  LKTGACKFGATCKFHHP  732
             + G CKFG +CKF HP
Sbjct  331  TRYGICKFGPSCKFDHP  347


 Score = 71.2 bits (173),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 53/181 (29%), Positives = 76/181 (42%), Gaps = 65/181 (36%)
 Frame = +1

Query  508  YPVRDGEPDCSYYIRTGLCRFGASCRFNH------------------PSNRKLAIAAARM  633
            YP+R  E DC+Y++RTG C+FG +C+FNH                  P +R   IA+ R 
Sbjct  128  YPLRSNEVDCAYFLRTGHCKFGGTCKFNHPQPQPTNMMVPTSGQQSYPWSRASFIASPRW  187

Query  634  KG--------------------------------------EYPERVGQPECQYYLKTGAC  699
            +                                        Y   + Q E +   ++G+ 
Sbjct  188  QDPSTYPSLIMPQGVVPVQGWNPYSGQLGSVSPSGTGNDLNYNRSLQQSETK---ESGSP  244

Query  700  KFGATCKFHHPRDKAGIAGRVAL---NVLGYPLRPNDIECPYYMRTGQCKFGSTCKFHHP  870
              G+   F+ P     + G  AL   NV  +P RP   EC +YM+TG CKFG+ CKFHHP
Sbjct  245  SQGSFSGFN-PGSSVPLGGFYALPRENV--FPERPGQPECQFYMKTGDCKFGTVCKFHHP  301

Query  871  Q  873
            +
Sbjct  302  R  302



>ref|XP_010485612.1| PREDICTED: zinc finger CCCH domain-containing protein 33 [Camelina 
sativa]
Length=401

 Score =   269 bits (687),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 123/186 (66%), Positives = 149/186 (80%), Gaps = 13/186 (7%)
 Frame = +1

Query  367  MDFEAAAGISASMASVTEGPSSLSPPLAQETLWQLSLRSMETMESGTYPVRDGEPDCSYY  546
            MDF A   +S           SLSP + Q+ +WQ++L S ETME+G+YP R GEPDCSYY
Sbjct  1    MDFNAGVPMS-----------SLSPLMNQDAMWQMNLGSEETMETGSYPERPGEPDCSYY  49

Query  547  IRTGLCRFGASCRFNHPSNRKLAIAAARMKGEYPERVGQPECQYYLKTGACKFGATCKFH  726
            IRTGLCRFG++CRFNHP +R+L IA ARM+GEYPER+GQPEC+YYLKTG CKFG TCKFH
Sbjct  50   IRTGLCRFGSTCRFNHPRDRELVIATARMRGEYPERIGQPECEYYLKTGTCKFGVTCKFH  109

Query  727  HPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTCKFHH--PQPSNMMVPLR  900
            HPR+KAGIAGRV+LN+LGYPLR N+++C Y++RTG CKFG TCKF+H  PQP+NMMVP  
Sbjct  110  HPRNKAGIAGRVSLNMLGYPLRSNEVDCAYFLRTGHCKFGGTCKFNHPQPQPTNMMVPTS  169

Query  901  GSPAYP  918
            G  +YP
Sbjct  170  GQQSYP  175


 Score =   101 bits (252),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 44/76 (58%), Positives = 53/76 (70%), Gaps = 0/76 (0%)
 Frame = +1

Query  643  YPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYM  822
            +PER GQPECQ+Y+KTG CKFG  CKFHHPRD+        L+ +G PLRP +  C +Y 
Sbjct  272  FPERPGQPECQFYMKTGDCKFGTVCKFHHPRDRQAPPPDCLLSSIGLPLRPGEPLCVFYT  331

Query  823  RTGQCKFGSTCKFHHP  870
            R G CKFG +CKF HP
Sbjct  332  RYGICKFGPSCKFDHP  347


 Score = 75.1 bits (183),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 32/77 (42%), Positives = 48/77 (62%), Gaps = 1/77 (1%)
 Frame = +1

Query  505  TYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKG-EYPERVGQPECQYY  681
             +P R G+P+C +Y++TG C+FG  C+F+HP +R+       +     P R G+P C +Y
Sbjct  271  VFPERPGQPECQFYMKTGDCKFGTVCKFHHPRDRQAPPPDCLLSSIGLPLRPGEPLCVFY  330

Query  682  LKTGACKFGATCKFHHP  732
             + G CKFG +CKF HP
Sbjct  331  TRYGICKFGPSCKFDHP  347


 Score = 51.6 bits (122),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 48/177 (27%), Positives = 69/177 (39%), Gaps = 57/177 (32%)
 Frame = +1

Query  508  YPVRDGEPDCSYYIRTG------LCRFG------------ASCRFNHPSNRKLAIAAARM  633
            YP+R  E DC+Y++RTG       C+F              S + ++P +R   IA+ R 
Sbjct  128  YPLRSNEVDCAYFLRTGHCKFGGTCKFNHPQPQPTNMMVPTSGQQSYPWSRASFIASPRW  187

Query  634  K------------GEYPERVGQPEC----------------------QYYLKTGACKFGA  711
            +            G  P +   P                        Q   K    +   
Sbjct  188  QDPSTYPSLIMPQGVVPVQGWNPYSGQLGSVSPSGTRNDLNNYRSLQQSETKESGSQSQG  247

Query  712  TCKFHHPRDKAGIAGRVAL---NVLGYPLRPNDIECPYYMRTGQCKFGSTCKFHHPQ  873
            +    +P     + G  AL   NV  +P RP   EC +YM+TG CKFG+ CKFHHP+
Sbjct  248  SFSGFNPGSSVPLGGFYALPRENV--FPERPGQPECQFYMKTGDCKFGTVCKFHHPR  302



>ref|XP_010463709.1| PREDICTED: zinc finger CCCH domain-containing protein 33-like 
isoform X1 [Camelina sativa]
Length=404

 Score =   268 bits (686),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 123/186 (66%), Positives = 149/186 (80%), Gaps = 13/186 (7%)
 Frame = +1

Query  367  MDFEAAAGISASMASVTEGPSSLSPPLAQETLWQLSLRSMETMESGTYPVRDGEPDCSYY  546
            MDF A   +S           SLSP + Q+ +WQ++L S ETME+G+YP R GEPDCSYY
Sbjct  1    MDFNAGVPMS-----------SLSPLMNQDAMWQMNLGSEETMETGSYPERPGEPDCSYY  49

Query  547  IRTGLCRFGASCRFNHPSNRKLAIAAARMKGEYPERVGQPECQYYLKTGACKFGATCKFH  726
            IRTGLCRFG++CRFNHP +R+L IA ARM+GEYPER+GQPEC+YYLKTG CKFG TCKFH
Sbjct  50   IRTGLCRFGSTCRFNHPRDRELVIATARMRGEYPERIGQPECEYYLKTGTCKFGVTCKFH  109

Query  727  HPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTCKFHH--PQPSNMMVPLR  900
            HPR+KAGIAGRV+LN+LGYPLR N+++C Y++RTG CKFG TCKF+H  PQP+NMMVP  
Sbjct  110  HPRNKAGIAGRVSLNMLGYPLRSNEVDCAYFIRTGHCKFGGTCKFNHPQPQPTNMMVPTS  169

Query  901  GSPAYP  918
            G  +YP
Sbjct  170  GQQSYP  175


 Score =   101 bits (252),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 44/76 (58%), Positives = 53/76 (70%), Gaps = 0/76 (0%)
 Frame = +1

Query  643  YPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYM  822
            +PER GQPECQ+Y+KTG CKFG  CKFHHPRD+        L+ +G PLRP +  C +Y 
Sbjct  273  FPERPGQPECQFYMKTGDCKFGTVCKFHHPRDRQAPPPDCLLSSIGLPLRPGEPLCVFYT  332

Query  823  RTGQCKFGSTCKFHHP  870
            R G CKFG +CKF HP
Sbjct  333  RYGICKFGPSCKFDHP  348


 Score = 75.1 bits (183),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 32/77 (42%), Positives = 48/77 (62%), Gaps = 1/77 (1%)
 Frame = +1

Query  505  TYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKG-EYPERVGQPECQYY  681
             +P R G+P+C +Y++TG C+FG  C+F+HP +R+       +     P R G+P C +Y
Sbjct  272  VFPERPGQPECQFYMKTGDCKFGTVCKFHHPRDRQAPPPDCLLSSIGLPLRPGEPLCVFY  331

Query  682  LKTGACKFGATCKFHHP  732
             + G CKFG +CKF HP
Sbjct  332  TRYGICKFGPSCKFDHP  348


 Score = 66.2 bits (160),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 51/178 (29%), Positives = 73/178 (41%), Gaps = 58/178 (33%)
 Frame = +1

Query  508  YPVRDGEPDCSYYIRTGLCRFGASCRF------------------NHPSNRKLAIAAARM  633
            YP+R  E DC+Y+IRTG C+FG +C+F                  ++P +R   IA+ R 
Sbjct  128  YPLRSNEVDCAYFIRTGHCKFGGTCKFNHPQPQPTNMMVPTSGQQSYPWSRASFIASPRW  187

Query  634  K------------GEYPERVGQP-----------------------ECQYYLKTGACKFG  708
            +            G  P +   P                       + Q   K    +  
Sbjct  188  QDPSTYPSLIMPQGVVPVQGWNPYSGQLGSVSPSGTGNDLNYNRSLQQQSETKESGSQSQ  247

Query  709  ATCKFHHPRDKAGIAGRVAL---NVLGYPLRPNDIECPYYMRTGQCKFGSTCKFHHPQ  873
             +    +P     + G  AL   NV  +P RP   EC +YM+TG CKFG+ CKFHHP+
Sbjct  248  GSFSGFNPGSSVPLGGFYALPRENV--FPERPGQPECQFYMKTGDCKFGTVCKFHHPR  303



>ref|XP_010463710.1| PREDICTED: zinc finger CCCH domain-containing protein 33-like 
isoform X2 [Camelina sativa]
Length=402

 Score =   268 bits (686),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 123/186 (66%), Positives = 149/186 (80%), Gaps = 13/186 (7%)
 Frame = +1

Query  367  MDFEAAAGISASMASVTEGPSSLSPPLAQETLWQLSLRSMETMESGTYPVRDGEPDCSYY  546
            MDF A   +S           SLSP + Q+ +WQ++L S ETME+G+YP R GEPDCSYY
Sbjct  1    MDFNAGVPMS-----------SLSPLMNQDAMWQMNLGSEETMETGSYPERPGEPDCSYY  49

Query  547  IRTGLCRFGASCRFNHPSNRKLAIAAARMKGEYPERVGQPECQYYLKTGACKFGATCKFH  726
            IRTGLCRFG++CRFNHP +R+L IA ARM+GEYPER+GQPEC+YYLKTG CKFG TCKFH
Sbjct  50   IRTGLCRFGSTCRFNHPRDRELVIATARMRGEYPERIGQPECEYYLKTGTCKFGVTCKFH  109

Query  727  HPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTCKFHH--PQPSNMMVPLR  900
            HPR+KAGIAGRV+LN+LGYPLR N+++C Y++RTG CKFG TCKF+H  PQP+NMMVP  
Sbjct  110  HPRNKAGIAGRVSLNMLGYPLRSNEVDCAYFIRTGHCKFGGTCKFNHPQPQPTNMMVPTS  169

Query  901  GSPAYP  918
            G  +YP
Sbjct  170  GQQSYP  175


 Score =   101 bits (252),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 44/76 (58%), Positives = 53/76 (70%), Gaps = 0/76 (0%)
 Frame = +1

Query  643  YPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYM  822
            +PER GQPECQ+Y+KTG CKFG  CKFHHPRD+        L+ +G PLRP +  C +Y 
Sbjct  271  FPERPGQPECQFYMKTGDCKFGTVCKFHHPRDRQAPPPDCLLSSIGLPLRPGEPLCVFYT  330

Query  823  RTGQCKFGSTCKFHHP  870
            R G CKFG +CKF HP
Sbjct  331  RYGICKFGPSCKFDHP  346


 Score = 75.1 bits (183),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 32/77 (42%), Positives = 48/77 (62%), Gaps = 1/77 (1%)
 Frame = +1

Query  505  TYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKG-EYPERVGQPECQYY  681
             +P R G+P+C +Y++TG C+FG  C+F+HP +R+       +     P R G+P C +Y
Sbjct  270  VFPERPGQPECQFYMKTGDCKFGTVCKFHHPRDRQAPPPDCLLSSIGLPLRPGEPLCVFY  329

Query  682  LKTGACKFGATCKFHHP  732
             + G CKFG +CKF HP
Sbjct  330  TRYGICKFGPSCKFDHP  346


 Score = 71.6 bits (174),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 53/176 (30%), Positives = 74/176 (42%), Gaps = 56/176 (32%)
 Frame = +1

Query  508  YPVRDGEPDCSYYIRTGLCRFGASCRFNH------------------PSNRKLAIAAAR-  630
            YP+R  E DC+Y+IRTG C+FG +C+FNH                  P +R   IA+ R 
Sbjct  128  YPLRSNEVDCAYFIRTGHCKFGGTCKFNHPQPQPTNMMVPTSGQQSYPWSRASFIASPRW  187

Query  631  -----------------MKGEYPERVGQP---------------ECQYYLKTGACKFGAT  714
                             ++G  P  +G                 + Q   K    +   +
Sbjct  188  QDPSTYPSLIMPQGVVPVQGWNPYSLGSVSPSGTGNDLNYNRSLQQQSETKESGSQSQGS  247

Query  715  CKFHHPRDKAGIAGRVAL---NVLGYPLRPNDIECPYYMRTGQCKFGSTCKFHHPQ  873
                +P     + G  AL   NV  +P RP   EC +YM+TG CKFG+ CKFHHP+
Sbjct  248  FSGFNPGSSVPLGGFYALPRENV--FPERPGQPECQFYMKTGDCKFGTVCKFHHPR  301



>ref|XP_002882253.1| hypothetical protein ARALYDRAFT_477525 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH58512.1| hypothetical protein ARALYDRAFT_477525 [Arabidopsis lyrata subsp. 
lyrata]
Length=397

 Score =   267 bits (683),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 122/186 (66%), Positives = 148/186 (80%), Gaps = 13/186 (7%)
 Frame = +1

Query  367  MDFEAAAGISASMASVTEGPSSLSPPLAQETLWQLSLRSMETMESGTYPVRDGEPDCSYY  546
            MDF A   +S           SLSP + Q+ +WQ++L S E ME+G+YP R GEPDCSYY
Sbjct  1    MDFNAGVPMS-----------SLSPLMNQDAMWQMNLSSDEIMETGSYPERPGEPDCSYY  49

Query  547  IRTGLCRFGASCRFNHPSNRKLAIAAARMKGEYPERVGQPECQYYLKTGACKFGATCKFH  726
            IRTGLCRFG++CRFNHP +R+L IA ARM+GEYPER+GQPEC+YYLKTG CKFG TCKFH
Sbjct  50   IRTGLCRFGSTCRFNHPRDRELVIATARMRGEYPERIGQPECEYYLKTGTCKFGVTCKFH  109

Query  727  HPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTCKFHH--PQPSNMMVPLR  900
            HPR+KAGIAGRV+LN+LGYPLR N+++C Y++RTG CKFG TCKF+H  PQP+NMMVP  
Sbjct  110  HPRNKAGIAGRVSLNMLGYPLRSNEVDCAYFLRTGHCKFGGTCKFNHPQPQPTNMMVPTS  169

Query  901  GSPAYP  918
            G  +YP
Sbjct  170  GQQSYP  175


 Score =   101 bits (252),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 44/76 (58%), Positives = 53/76 (70%), Gaps = 0/76 (0%)
 Frame = +1

Query  643  YPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYM  822
            +PER GQPECQ+Y+KTG CKFG  CKFHHPRD+        L+ +G PLRP +  C +Y 
Sbjct  271  FPERPGQPECQFYMKTGDCKFGTVCKFHHPRDRQAPPPDCLLSSIGLPLRPGEPLCVFYT  330

Query  823  RTGQCKFGSTCKFHHP  870
            R G CKFG +CKF HP
Sbjct  331  RYGICKFGPSCKFDHP  346


 Score = 74.7 bits (182),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 32/77 (42%), Positives = 48/77 (62%), Gaps = 1/77 (1%)
 Frame = +1

Query  505  TYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKG-EYPERVGQPECQYY  681
             +P R G+P+C +Y++TG C+FG  C+F+HP +R+       +     P R G+P C +Y
Sbjct  270  VFPERPGQPECQFYMKTGDCKFGTVCKFHHPRDRQAPPPDCLLSSIGLPLRPGEPLCVFY  329

Query  682  LKTGACKFGATCKFHHP  732
             + G CKFG +CKF HP
Sbjct  330  TRYGICKFGPSCKFDHP  346


 Score = 52.4 bits (124),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 48/176 (27%), Positives = 67/176 (38%), Gaps = 56/176 (32%)
 Frame = +1

Query  508  YPVRDGEPDCSYYIRTG------LCRFG------------ASCRFNHPSNRKLAIAAARM  633
            YP+R  E DC+Y++RTG       C+F              S + ++P +R   IA+ R 
Sbjct  128  YPLRSNEVDCAYFLRTGHCKFGGTCKFNHPQPQPTNMMVPTSGQQSYPWSRASFIASPRW  187

Query  634  K------------GEYPERVGQPECQYYLKTGACKFGATCKFHH----------------  729
            +            G  P +   P             G    + +                
Sbjct  188  QDPSSYASLIMPQGVVPVQGWNPYSGQLGSVSPSGTGNDQNYRNLQQNETIESGSQSQGS  247

Query  730  -----PRDKAGIAGRVAL---NVLGYPLRPNDIECPYYMRTGQCKFGSTCKFHHPQ  873
                 P     I G  AL   NV  +P RP   EC +YM+TG CKFG+ CKFHHP+
Sbjct  248  FSGFNPGSSVPIGGYYALPRENV--FPERPGQPECQFYMKTGDCKFGTVCKFHHPR  301



>gb|KFK37691.1| hypothetical protein AALP_AA3G016100 [Arabis alpina]
Length=389

 Score =   267 bits (682),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 117/165 (71%), Positives = 143/165 (87%), Gaps = 2/165 (1%)
 Frame = +1

Query  427  SSLSPPLAQETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNR  606
            SSLSP + Q+ +WQ++L S ETME+G+YP R GEP+CSYYIRTGLCRFG++CRFNHP +R
Sbjct  10   SSLSPLMNQDAMWQMNLSSDETMETGSYPERQGEPNCSYYIRTGLCRFGSTCRFNHPRDR  69

Query  607  KLAIAAARMKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYP  786
            +L IA ARM+GEYPER+GQPEC+YYLKTG CKFG TCKFHHPR+KAGIAGRV+LN+LGYP
Sbjct  70   ELVIATARMRGEYPERIGQPECEYYLKTGTCKFGVTCKFHHPRNKAGIAGRVSLNMLGYP  129

Query  787  LRPNDIECPYYMRTGQCKFGSTCKFHH--PQPSNMMVPLRGSPAY  915
            LRPN+++C Y++RTG CKFG TCKF+H  PQP+NMMVP     +Y
Sbjct  130  LRPNEVDCAYFLRTGHCKFGGTCKFNHPQPQPTNMMVPTSAQQSY  174


 Score =   102 bits (255),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 44/76 (58%), Positives = 54/76 (71%), Gaps = 0/76 (0%)
 Frame = +1

Query  643  YPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYM  822
            +PER GQPECQ+Y+KTG CKFG  CKFHHPRD+   +    L+ +G PLRP +  C +Y 
Sbjct  269  FPERPGQPECQFYMKTGDCKFGTVCKFHHPRDRQAPSPDCLLSSIGLPLRPGEPLCVFYT  328

Query  823  RTGQCKFGSTCKFHHP  870
            R G CKFG +CKF HP
Sbjct  329  RYGICKFGPSCKFDHP  344


 Score = 75.5 bits (184),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 32/77 (42%), Positives = 48/77 (62%), Gaps = 1/77 (1%)
 Frame = +1

Query  505  TYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKG-EYPERVGQPECQYY  681
             +P R G+P+C +Y++TG C+FG  C+F+HP +R+       +     P R G+P C +Y
Sbjct  268  VFPERPGQPECQFYMKTGDCKFGTVCKFHHPRDRQAPSPDCLLSSIGLPLRPGEPLCVFY  327

Query  682  LKTGACKFGATCKFHHP  732
             + G CKFG +CKF HP
Sbjct  328  TRYGICKFGPSCKFDHP  344


 Score = 50.8 bits (120),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 19/31 (61%), Positives = 24/31 (77%), Gaps = 0/31 (0%)
 Frame = +1

Query  781  YPLRPNDIECPYYMRTGQCKFGSTCKFHHPQ  873
            +P RP   EC +YM+TG CKFG+ CKFHHP+
Sbjct  269  FPERPGQPECQFYMKTGDCKFGTVCKFHHPR  299



>ref|XP_009406323.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
[Musa acuminata subsp. malaccensis]
Length=411

 Score =   267 bits (682),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 118/163 (72%), Positives = 138/163 (85%), Gaps = 0/163 (0%)
 Frame = +1

Query  460  LWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKG  639
            +W+ + R  ++MESG YP R GEPDC+YYIRTGLCRFG +C+FNHP NR LA+AA  ++G
Sbjct  1    MWKRNWRGSDSMESGPYPERPGEPDCAYYIRTGLCRFGMTCKFNHPPNRMLAVAATSIRG  60

Query  640  EYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYY  819
             YPERVGQPECQYYLKTG CKFGATCKFHHPR+KAGI+ +V LN+LGYPLRPN+ EC YY
Sbjct  61   GYPERVGQPECQYYLKTGTCKFGATCKFHHPREKAGISEQVQLNILGYPLRPNEKECAYY  120

Query  820  MRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQ  948
            +RTG+CKFGSTCKFHHPQPSN ++ L GSP YP  HSPTTP Q
Sbjct  121  LRTGECKFGSTCKFHHPQPSNAVLALHGSPVYPSAHSPTTPSQ  163


 Score =   100 bits (249),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 45/87 (52%), Positives = 57/87 (66%), Gaps = 0/87 (0%)
 Frame = +1

Query  610  LAIAAARMKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPL  789
            + + A   +  +PER GQPECQ+Y+KTG CKFGA CKFHHPR++        L+ LG PL
Sbjct  256  VGMYAVPRENIFPERPGQPECQFYMKTGDCKFGAVCKFHHPRERLVPVPNCVLSPLGLPL  315

Query  790  RPNDIECPYYMRTGQCKFGSTCKFHHP  870
            RP +  C +Y R G CKFG  CK+ HP
Sbjct  316  RPGEPLCDFYSRYGICKFGPNCKYDHP  342


 Score = 75.9 bits (185),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 32/76 (42%), Positives = 48/76 (63%), Gaps = 1/76 (1%)
 Frame = +1

Query  508  YPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKG-EYPERVGQPECQYYL  684
            +P R G+P+C +Y++TG C+FGA C+F+HP  R + +    +     P R G+P C +Y 
Sbjct  267  FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERLVPVPNCVLSPLGLPLRPGEPLCDFYS  326

Query  685  KTGACKFGATCKFHHP  732
            + G CKFG  CK+ HP
Sbjct  327  RYGICKFGPNCKYDHP  342


 Score = 52.0 bits (123),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 21/38 (55%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = +1

Query  781  YPLRPNDIECPYYMRTGQCKFGSTCKFHHPQPSNMMVP  894
            +P RP   EC +YM+TG CKFG+ CKFHHP+   + VP
Sbjct  267  FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERLVPVP  304



>ref|XP_009416574.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X2 [Musa acuminata subsp. malaccensis]
Length=442

 Score =   266 bits (681),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 131/187 (70%), Positives = 153/187 (82%), Gaps = 4/187 (2%)
 Frame = +1

Query  397  ASMASVTEGPS-SLSPPLAQETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFG  573
            A   +VTEGPS S  P   +E +W+  +R  ++ME+G YP R GEPDC+YYIRTGLCRFG
Sbjct  10   APARTVTEGPSLSSQPGTDEEAMWK-RMRESDSMETGPYPERPGEPDCAYYIRTGLCRFG  68

Query  574  ASCRFNHPSNRKLAIAAA--RMKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAG  747
             +C+FNHP NR LA+AAA  R++G YPERVGQPECQYYLKTG CKFGA CKFHHP++KAG
Sbjct  69   RTCKFNHPPNRMLAVAAAAARIRGGYPERVGQPECQYYLKTGTCKFGAICKFHHPKEKAG  128

Query  748  IAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVH  927
            IAGRV LN+LGYPLR N+ +C YY+RTG+CKFG TCKFHHPQPSN +V LRGSP YP VH
Sbjct  129  IAGRVQLNILGYPLRLNEKDCAYYIRTGECKFGGTCKFHHPQPSNAVVALRGSPVYPAVH  188

Query  928  SPTTPGQ  948
            SPTTPGQ
Sbjct  189  SPTTPGQ  195


 Score =   102 bits (255),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 50/109 (46%), Positives = 65/109 (60%), Gaps = 2/109 (2%)
 Frame = +1

Query  550  RTGLCRFGASCRF--NHPSNRKLAIAAARMKGEYPERVGQPECQYYLKTGACKFGATCKF  723
            + G    GA  +F    P +  + + A   +  +PER GQPECQ+Y+KTG CKFGA CKF
Sbjct  264  QQGETSIGAQGKFPSYRPGSTPMGLYAVPGENIFPERPGQPECQFYMKTGDCKFGAVCKF  323

Query  724  HHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTCKFHHP  870
            HHP+++        L+ LG PLRP +  C +Y R G CKFG  CKF HP
Sbjct  324  HHPKERLVPVPNCVLSPLGLPLRPGEPVCVFYSRYGICKFGPNCKFDHP  372


 Score = 76.6 bits (187),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 48/76 (63%), Gaps = 1/76 (1%)
 Frame = +1

Query  508  YPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKG-EYPERVGQPECQYYL  684
            +P R G+P+C +Y++TG C+FGA C+F+HP  R + +    +     P R G+P C +Y 
Sbjct  297  FPERPGQPECQFYMKTGDCKFGAVCKFHHPKERLVPVPNCVLSPLGLPLRPGEPVCVFYS  356

Query  685  KTGACKFGATCKFHHP  732
            + G CKFG  CKF HP
Sbjct  357  RYGICKFGPNCKFDHP  372


 Score = 53.9 bits (128),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 30/73 (41%), Positives = 40/73 (55%), Gaps = 5/73 (7%)
 Frame = +1

Query  685  KTGACKFGATCKFHHPRDKAGIAGRVAL---NVLGYPLRPNDIECPYYMRTGQCKFGSTC  855
            + G    GA  KF   R  +   G  A+   N+  +P RP   EC +YM+TG CKFG+ C
Sbjct  264  QQGETSIGAQGKFPSYRPGSTPMGLYAVPGENI--FPERPGQPECQFYMKTGDCKFGAVC  321

Query  856  KFHHPQPSNMMVP  894
            KFHHP+   + VP
Sbjct  322  KFHHPKERLVPVP  334



>ref|XP_009416573.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X1 [Musa acuminata subsp. malaccensis]
Length=444

 Score =   266 bits (681),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 131/187 (70%), Positives = 153/187 (82%), Gaps = 4/187 (2%)
 Frame = +1

Query  397  ASMASVTEGPS-SLSPPLAQETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFG  573
            A   +VTEGPS S  P   +E +W+  +R  ++ME+G YP R GEPDC+YYIRTGLCRFG
Sbjct  10   APARTVTEGPSLSSQPGTDEEAMWK-RMRESDSMETGPYPERPGEPDCAYYIRTGLCRFG  68

Query  574  ASCRFNHPSNRKLAIAAA--RMKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAG  747
             +C+FNHP NR LA+AAA  R++G YPERVGQPECQYYLKTG CKFGA CKFHHP++KAG
Sbjct  69   RTCKFNHPPNRMLAVAAAAARIRGGYPERVGQPECQYYLKTGTCKFGAICKFHHPKEKAG  128

Query  748  IAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVH  927
            IAGRV LN+LGYPLR N+ +C YY+RTG+CKFG TCKFHHPQPSN +V LRGSP YP VH
Sbjct  129  IAGRVQLNILGYPLRLNEKDCAYYIRTGECKFGGTCKFHHPQPSNAVVALRGSPVYPAVH  188

Query  928  SPTTPGQ  948
            SPTTPGQ
Sbjct  189  SPTTPGQ  195


 Score =   102 bits (255),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 50/109 (46%), Positives = 65/109 (60%), Gaps = 2/109 (2%)
 Frame = +1

Query  550  RTGLCRFGASCRF--NHPSNRKLAIAAARMKGEYPERVGQPECQYYLKTGACKFGATCKF  723
            + G    GA  +F    P +  + + A   +  +PER GQPECQ+Y+KTG CKFGA CKF
Sbjct  266  QQGETSIGAQGKFPSYRPGSTPMGLYAVPGENIFPERPGQPECQFYMKTGDCKFGAVCKF  325

Query  724  HHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTCKFHHP  870
            HHP+++        L+ LG PLRP +  C +Y R G CKFG  CKF HP
Sbjct  326  HHPKERLVPVPNCVLSPLGLPLRPGEPVCVFYSRYGICKFGPNCKFDHP  374


 Score = 76.6 bits (187),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 48/76 (63%), Gaps = 1/76 (1%)
 Frame = +1

Query  508  YPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKG-EYPERVGQPECQYYL  684
            +P R G+P+C +Y++TG C+FGA C+F+HP  R + +    +     P R G+P C +Y 
Sbjct  299  FPERPGQPECQFYMKTGDCKFGAVCKFHHPKERLVPVPNCVLSPLGLPLRPGEPVCVFYS  358

Query  685  KTGACKFGATCKFHHP  732
            + G CKFG  CKF HP
Sbjct  359  RYGICKFGPNCKFDHP  374


 Score = 53.9 bits (128),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 30/73 (41%), Positives = 40/73 (55%), Gaps = 5/73 (7%)
 Frame = +1

Query  685  KTGACKFGATCKFHHPRDKAGIAGRVAL---NVLGYPLRPNDIECPYYMRTGQCKFGSTC  855
            + G    GA  KF   R  +   G  A+   N+  +P RP   EC +YM+TG CKFG+ C
Sbjct  266  QQGETSIGAQGKFPSYRPGSTPMGLYAVPGENI--FPERPGQPECQFYMKTGDCKFGAVC  323

Query  856  KFHHPQPSNMMVP  894
            KFHHP+   + VP
Sbjct  324  KFHHPKERLVPVP  336



>ref|XP_006662931.1| PREDICTED: zinc finger CCCH domain-containing protein 63-like 
[Oryza brachyantha]
Length=407

 Score =   265 bits (676),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 122/163 (75%), Positives = 141/163 (87%), Gaps = 3/163 (2%)
 Frame = +1

Query  460  LWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKG  639
            +WQ++L   E ME+G YP R GEPDCSYY+RTGLCRFG +C+FNHP++RK+A+AAARMKG
Sbjct  1    MWQMNLG--EAMEAGPYPERIGEPDCSYYMRTGLCRFGMTCKFNHPADRKMAVAAARMKG  58

Query  640  EYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYY  819
            EYP+R+GQPECQYYLKTGACKFGATCKFHHPR+KA +A RV LN LGYPLRPN+ EC YY
Sbjct  59   EYPQRIGQPECQYYLKTGACKFGATCKFHHPREKAAMATRVQLNALGYPLRPNEKECAYY  118

Query  820  MRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQ  948
            +RTGQCKFGSTCKFHHPQPSN MV +RGS  Y P  S T+PGQ
Sbjct  119  LRTGQCKFGSTCKFHHPQPSNTMVAVRGS-VYSPGQSVTSPGQ  160


 Score =   101 bits (252),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 53/124 (43%), Positives = 68/124 (55%), Gaps = 10/124 (8%)
 Frame = +1

Query  610  LAIAAARMKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPL  789
            L +   + +  +PER  QPECQ+Y+KTG CKFGA CKFHHP+++       AL+ LG PL
Sbjct  257  LGLYTVQRESIFPERPDQPECQFYMKTGDCKFGAVCKFHHPKERIVPTPNCALSSLGLPL  316

Query  790  RPNDIECPYYMRTGQCKFGSTCKFHHP----------QPSNMMVPLRGSPAYPPVHSPTT  939
            RP +  C +Y R G CKFG  CKF HP           P+  M   R   A  P HS  +
Sbjct  317  RPGEPICTFYSRYGICKFGPNCKFDHPMGTVMYGLATSPTGDMSTARRMLAPVPAHSEVS  376

Query  940  PGQL  951
            P  +
Sbjct  377  PDSV  380


 Score = 73.6 bits (179),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 32/76 (42%), Positives = 46/76 (61%), Gaps = 1/76 (1%)
 Frame = +1

Query  508  YPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKG-EYPERVGQPECQYYL  684
            +P R  +P+C +Y++TG C+FGA C+F+HP  R +      +     P R G+P C +Y 
Sbjct  268  FPERPDQPECQFYMKTGDCKFGAVCKFHHPKERIVPTPNCALSSLGLPLRPGEPICTFYS  327

Query  685  KTGACKFGATCKFHHP  732
            + G CKFG  CKF HP
Sbjct  328  RYGICKFGPNCKFDHP  343



>ref|XP_008810537.1| PREDICTED: LOW QUALITY PROTEIN: zinc finger CCCH domain-containing 
protein ZFN-like [Phoenix dactylifera]
Length=472

 Score =   266 bits (681),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 132/181 (73%), Positives = 150/181 (83%), Gaps = 4/181 (2%)
 Frame = +1

Query  406  ASVTEGPSSLSPPLAQETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCR  585
            A+V EG SSL     +E +WQL+LR  E ME G YP R GEPDC+YY+RTGLCRFG +C+
Sbjct  17   AAVMEGSSSLH----EEAIWQLNLRGSELMEFGPYPERPGEPDCAYYMRTGLCRFGMTCK  72

Query  586  FNHPSNRKLAIAAARMKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVA  765
            FNHP NRK+AIAAAR++G YPERVGQPECQYYLKTG+CKFGATCKFHHP+DKAGI GRV 
Sbjct  73   FNHPPNRKMAIAAARIRGAYPERVGQPECQYYLKTGSCKFGATCKFHHPKDKAGIVGRVK  132

Query  766  LNVLGYPLRPNDIECPYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVHSPTTPG  945
            L++LGYPLRPN+ EC YY+RTGQCKFG+TCKFHHPQPSN M  L GSP Y P HS T PG
Sbjct  133  LSILGYPLRPNEKECAYYLRTGQCKFGNTCKFHHPQPSNAMDALCGSPVYAPAHSTTIPG  192

Query  946  Q  948
            Q
Sbjct  193  Q  193


 Score = 96.7 bits (239),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 43/87 (49%), Positives = 56/87 (64%), Gaps = 0/87 (0%)
 Frame = +1

Query  610  LAIAAARMKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPL  789
            + + A + +  +PER  QPECQ+Y+KTG CKFG  C+FHHPR++        L+ LG PL
Sbjct  292  MGVYALQRENIFPERPDQPECQFYMKTGDCKFGPACRFHHPRERLMPVPNCILSPLGLPL  351

Query  790  RPNDIECPYYMRTGQCKFGSTCKFHHP  870
            RP +  C +Y R G CKFG  CKF HP
Sbjct  352  RPGEPLCIFYSRYGICKFGPNCKFDHP  378


 Score = 73.6 bits (179),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 32/76 (42%), Positives = 47/76 (62%), Gaps = 1/76 (1%)
 Frame = +1

Query  508  YPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKG-EYPERVGQPECQYYL  684
            +P R  +P+C +Y++TG C+FG +CRF+HP  R + +    +     P R G+P C +Y 
Sbjct  303  FPERPDQPECQFYMKTGDCKFGPACRFHHPRERLMPVPNCILSPLGLPLRPGEPLCIFYS  362

Query  685  KTGACKFGATCKFHHP  732
            + G CKFG  CKF HP
Sbjct  363  RYGICKFGPNCKFDHP  378



>ref|XP_006663969.1| PREDICTED: zinc finger CCCH domain-containing protein 66-like 
isoform X1 [Oryza brachyantha]
Length=448

 Score =   266 bits (679),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 127/177 (72%), Positives = 143/177 (81%), Gaps = 2/177 (1%)
 Frame = +1

Query  421  GPSSLSPPLAQETLWQLSLRSM-ETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHP  597
            GP  L    A+E +WQ++L    E+MES  YP R GEPDCSYY+RTGLCRFG +C+FNHP
Sbjct  27   GPHHLGVAAAEEAMWQMTLGGGGESMESVPYPERIGEPDCSYYMRTGLCRFGMTCKFNHP  86

Query  598  SNRKLAIAAARMKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVL  777
             NRKLA+AAARM GEYP RVGQPECQYYLKTG CKFGATCKFHHPR+KA +A RV LNVL
Sbjct  87   PNRKLAVAAARMNGEYPYRVGQPECQYYLKTGTCKFGATCKFHHPREKAALATRVQLNVL  146

Query  778  GYPLRPNDIECPYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQ  948
            GYP+RPN+ EC YY+RTGQCKF STCKFHHPQPSN MV +RGS  Y P  S T+PGQ
Sbjct  147  GYPMRPNEKECAYYLRTGQCKFASTCKFHHPQPSNTMVSMRGS-MYSPGQSATSPGQ  202


 Score =   104 bits (260),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 51/102 (50%), Positives = 63/102 (62%), Gaps = 2/102 (2%)
 Frame = +1

Query  586  FNHPSNRKLAIAAARMKGE--YPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGR  759
            F       + I    ++GE  +PER  QPECQ+Y+KTG CKFGA CKFHHP+++   A  
Sbjct  288  FQSYQGSSVPIGVYTVQGENIFPERPDQPECQFYMKTGDCKFGAVCKFHHPKERLVPAPN  347

Query  760  VALNVLGYPLRPNDIECPYYMRTGQCKFGSTCKFHHPQPSNM  885
             ALN LG PLRP +  C +Y R G CKFG  CKF HP  + M
Sbjct  348  CALNSLGLPLRPGEPVCTFYSRYGICKFGPNCKFDHPMGTLM  389


 Score = 74.3 bits (181),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 47/76 (62%), Gaps = 1/76 (1%)
 Frame = +1

Query  508  YPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKL-AIAAARMKGEYPERVGQPECQYYL  684
            +P R  +P+C +Y++TG C+FGA C+F+HP  R + A   A      P R G+P C +Y 
Sbjct  309  FPERPDQPECQFYMKTGDCKFGAVCKFHHPKERLVPAPNCALNSLGLPLRPGEPVCTFYS  368

Query  685  KTGACKFGATCKFHHP  732
            + G CKFG  CKF HP
Sbjct  369  RYGICKFGPNCKFDHP  384



>gb|AAD33769.1|AF138743_1 zinc finger protein 1 [Arabidopsis thaliana]
Length=424

 Score =   265 bits (677),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 121/186 (65%), Positives = 147/186 (79%), Gaps = 13/186 (7%)
 Frame = +1

Query  367  MDFEAAAGISASMASVTEGPSSLSPPLAQETLWQLSLRSMETMESGTYPVRDGEPDCSYY  546
            MDF A   +S           SLSP + Q+ +WQ++L S ETME+G+YP R GEPDCSYY
Sbjct  1    MDFNAGVPMS-----------SLSPLMNQDAMWQMNLSSDETMETGSYPERPGEPDCSYY  49

Query  547  IRTGLCRFGASCRFNHPSNRKLAIAAARMKGEYPERVGQPECQYYLKTGACKFGATCKFH  726
            IRTGLCRFG++CR NHP +R+L IA ARM+GEYPER+G PEC+YYLKTG CKFG TCKFH
Sbjct  50   IRTGLCRFGSTCRVNHPRDRELVIATARMRGEYPERIGHPECEYYLKTGTCKFGVTCKFH  109

Query  727  HPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTCKFHH--PQPSNMMVPLR  900
            HPR+KAGIAGRV+LN+LGYPLR N+++C Y++RTG CKFG TCKF+H  PQP+NMMVP  
Sbjct  110  HPRNKAGIAGRVSLNMLGYPLRSNEVDCAYFLRTGHCKFGGTCKFNHPQPQPTNMMVPTS  169

Query  901  GSPAYP  918
            G  +YP
Sbjct  170  GQQSYP  175


 Score =   101 bits (251),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 44/76 (58%), Positives = 53/76 (70%), Gaps = 0/76 (0%)
 Frame = +1

Query  643  YPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYM  822
            +PER GQPECQ+Y+KTG CKFG  CKFHHPRD+        L+ +G PLRP +  C +Y 
Sbjct  271  FPERPGQPECQFYMKTGDCKFGTVCKFHHPRDRQAPPPDCLLSSIGLPLRPGEPLCVFYT  330

Query  823  RTGQCKFGSTCKFHHP  870
            R G CKFG +CKF HP
Sbjct  331  RYGICKFGPSCKFDHP  346


 Score = 74.3 bits (181),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 32/77 (42%), Positives = 48/77 (62%), Gaps = 1/77 (1%)
 Frame = +1

Query  505  TYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKG-EYPERVGQPECQYY  681
             +P R G+P+C +Y++TG C+FG  C+F+HP +R+       +     P R G+P C +Y
Sbjct  270  VFPERPGQPECQFYMKTGDCKFGTVCKFHHPRDRQAPPPDCLLSSIGLPLRPGEPLCVFY  329

Query  682  LKTGACKFGATCKFHHP  732
             + G CKFG +CKF HP
Sbjct  330  TRYGICKFGPSCKFDHP  346


 Score = 51.6 bits (122),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 47/176 (27%), Positives = 68/176 (39%), Gaps = 56/176 (32%)
 Frame = +1

Query  508  YPVRDGEPDCSYYIRTG------LCRFG------------ASCRFNHPSNRKLAIAAARM  633
            YP+R  E DC+Y++RTG       C+F              S + ++P +R   IA+ R 
Sbjct  128  YPLRSNEVDCAYFLRTGHCKFGGTCKFNHPQPQPTNMMVPTSGQQSYPWSRASFIASPRW  187

Query  634  K------------GEYPERVGQPECQYYLKTGACKFGATCKF------------------  723
            +            G  P +   P             G    +                  
Sbjct  188  QDPSSYASLIMPQGVVPVQGWNPYSGQLGSVSPSGTGNDQNYRNLQQNETIESGSQSQGS  247

Query  724  ---HHPRDKAGIAGRVAL---NVLGYPLRPNDIECPYYMRTGQCKFGSTCKFHHPQ  873
               ++P     + G  AL   NV  +P RP   EC +YM+TG CKFG+ CKFHHP+
Sbjct  248  FSGYNPGSSVPLGGYYALPRENV--FPERPGQPECQFYMKTGDCKFGTVCKFHHPR  301



>sp|Q2R4J4.2|C3H63_ORYSJ RecName: Full=Zinc finger CCCH domain-containing protein 63; 
Short=OsC3H63 [Oryza sativa Japonica Group]
 gb|ABA93650.2| Zinc finger CCCH type domain containing protein ZFN, putative, 
expressed [Oryza sativa Japonica Group]
 gb|AGT38442.1| zinc finger protein [Oryza sativa Japonica Group]
Length=444

 Score =   265 bits (678),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 122/168 (73%), Positives = 142/168 (85%), Gaps = 3/168 (2%)
 Frame = +1

Query  445  LAQETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAA  624
            + +E +WQ++L   E ME+G YP R GEPDCSYY+RTGLCRFG +C+FNHP++RK+A+AA
Sbjct  34   VDEEAMWQMNLG--EAMEAGPYPERIGEPDCSYYMRTGLCRFGMTCKFNHPADRKMAVAA  91

Query  625  ARMKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDI  804
            ARMKGEYP+R+GQPECQYYLKTG CKFGATCKFHHPR+KA IA RV LN LGYPLRPN+ 
Sbjct  92   ARMKGEYPQRIGQPECQYYLKTGTCKFGATCKFHHPREKAAIATRVQLNALGYPLRPNEK  151

Query  805  ECPYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQ  948
            EC YY+RTGQCKFGSTCKFHHPQPSN MV +RGS  Y P  S T+P Q
Sbjct  152  ECAYYLRTGQCKFGSTCKFHHPQPSNTMVAVRGS-VYSPGQSVTSPSQ  198


 Score =   100 bits (250),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 49/100 (49%), Positives = 62/100 (62%), Gaps = 1/100 (1%)
 Frame = +1

Query  610  LAIAAARMKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPL  789
            L +   + +  +PER  QPECQ+Y+KTG CKFGA CKFHHP+++       AL+ LG PL
Sbjct  295  LGLYTVQRESIFPERPDQPECQFYMKTGDCKFGAVCKFHHPKERIIPTPNCALSSLGLPL  354

Query  790  RPNDIECPYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSP  909
            RP +  C +Y R G CKFG  CKF HP    +M  L  SP
Sbjct  355  RPGEPICTFYSRYGICKFGPNCKFDHPM-GTVMYGLATSP  393


 Score = 73.9 bits (180),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 32/76 (42%), Positives = 46/76 (61%), Gaps = 1/76 (1%)
 Frame = +1

Query  508  YPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKG-EYPERVGQPECQYYL  684
            +P R  +P+C +Y++TG C+FGA C+F+HP  R +      +     P R G+P C +Y 
Sbjct  306  FPERPDQPECQFYMKTGDCKFGAVCKFHHPKERIIPTPNCALSSLGLPLRPGEPICTFYS  365

Query  685  KTGACKFGATCKFHHP  732
            + G CKFG  CKF HP
Sbjct  366  RYGICKFGPNCKFDHP  381



>ref|XP_006408379.1| hypothetical protein EUTSA_v10020900mg [Eutrema salsugineum]
 gb|ESQ49832.1| hypothetical protein EUTSA_v10020900mg [Eutrema salsugineum]
Length=389

 Score =   263 bits (673),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 120/187 (64%), Positives = 149/187 (80%), Gaps = 14/187 (7%)
 Frame = +1

Query  367  MDFEAAAGISASMASVTEGPSSLSPPLAQETLWQLSLRSMETMESGTYPVRDGEPDCSYY  546
            MDF A   +S           SLSP + Q+ +WQ++L S ETME+G+YP R GEP+CSY+
Sbjct  1    MDFNAGVPMS-----------SLSPLMNQDAMWQMNLSSDETMETGSYPERPGEPNCSYF  49

Query  547  IRTGLCRFGASCRFNHPSNRKLAIAAARMKGEYPERVGQPECQYYLKTGACKFGATCKFH  726
            IRTGLCRFG++CRFNHP +R+L IA ARM+GEYPER+GQPEC+YYLKTG CKFG +CKFH
Sbjct  50   IRTGLCRFGSTCRFNHPRDRELVIATARMRGEYPERIGQPECEYYLKTGTCKFGVSCKFH  109

Query  727  HPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTCKFHHPQP---SNMMVPL  897
            HPR+KAGIAGRV+LN+LGYPLR N+++C Y++RTG CKFG TCKF+HPQP   +NMMVP 
Sbjct  110  HPRNKAGIAGRVSLNMLGYPLRSNEVDCAYFLRTGHCKFGGTCKFNHPQPQPTTNMMVPA  169

Query  898  RGSPAYP  918
             G  +YP
Sbjct  170  SGQQSYP  176


 Score =   100 bits (248),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 44/76 (58%), Positives = 53/76 (70%), Gaps = 0/76 (0%)
 Frame = +1

Query  643  YPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYM  822
            +PER GQPECQ+Y+KTG CKFG  CKFHHPRD+        L+ +G PLRP +  C +Y 
Sbjct  272  FPERPGQPECQFYMKTGDCKFGTVCKFHHPRDRQVPPPDCLLSPIGLPLRPGEPLCVFYT  331

Query  823  RTGQCKFGSTCKFHHP  870
            R G CKFG +CKF HP
Sbjct  332  RYGICKFGPSCKFDHP  347


 Score = 75.5 bits (184),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 32/77 (42%), Positives = 49/77 (64%), Gaps = 1/77 (1%)
 Frame = +1

Query  505  TYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKG-EYPERVGQPECQYY  681
             +P R G+P+C +Y++TG C+FG  C+F+HP +R++      +     P R G+P C +Y
Sbjct  271  VFPERPGQPECQFYMKTGDCKFGTVCKFHHPRDRQVPPPDCLLSPIGLPLRPGEPLCVFY  330

Query  682  LKTGACKFGATCKFHHP  732
             + G CKFG +CKF HP
Sbjct  331  TRYGICKFGPSCKFDHP  347


 Score = 64.7 bits (156),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 52/180 (29%), Positives = 74/180 (41%), Gaps = 63/180 (35%)
 Frame = +1

Query  508  YPVRDGEPDCSYYIRTGLCRFGASCRF-------------------NHPSNRKLAIAAAR  630
            YP+R  E DC+Y++RTG C+FG +C+F                   ++P +R   IA  R
Sbjct  128  YPLRSNEVDCAYFLRTGHCKFGGTCKFNHPQPQPTTNMMVPASGQQSYPWSRASFIANPR  187

Query  631  MK------------GEYPERVGQPECQYYLKTGACKFGATCKFHHPRD------------  738
             +            G  P +   P   Y  + G+     T   H+ R+            
Sbjct  188  WQDPSSFTPLIMPQGVVPVQGWNP---YSGQLGSVSPSGTGNDHNYRNLQQNETIESGSQ  244

Query  739  ------------KAGIAGRVAL---NVLGYPLRPNDIECPYYMRTGQCKFGSTCKFHHPQ  873
                           + G  AL   NV  +P RP   EC +YM+TG CKFG+ CKFHHP+
Sbjct  245  SQGSFSGFNSGSSVPLRGFYALPRENV--FPERPGQPECQFYMKTGDCKFGTVCKFHHPR  302



>ref|NP_001067878.1| Os11g0472000 [Oryza sativa Japonica Group]
 dbj|BAF28241.1| Os11g0472000, partial [Oryza sativa Japonica Group]
Length=414

 Score =   264 bits (674),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 122/168 (73%), Positives = 141/168 (84%), Gaps = 3/168 (2%)
 Frame = +1

Query  445  LAQETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAA  624
            +  E +WQ++L   E ME+G YP R GEPDCSYY+RTGLCRFG +C+FNHP++RK+A+AA
Sbjct  4    VVGEAMWQMNLG--EAMEAGPYPERIGEPDCSYYMRTGLCRFGMTCKFNHPADRKMAVAA  61

Query  625  ARMKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDI  804
            ARMKGEYP+R+GQPECQYYLKTG CKFGATCKFHHPR+KA IA RV LN LGYPLRPN+ 
Sbjct  62   ARMKGEYPQRIGQPECQYYLKTGTCKFGATCKFHHPREKAAIATRVQLNALGYPLRPNEK  121

Query  805  ECPYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQ  948
            EC YY+RTGQCKFGSTCKFHHPQPSN MV +RGS  Y P  S T+P Q
Sbjct  122  ECAYYLRTGQCKFGSTCKFHHPQPSNTMVAVRGS-VYSPGQSVTSPSQ  168


 Score =   100 bits (250),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 49/100 (49%), Positives = 62/100 (62%), Gaps = 1/100 (1%)
 Frame = +1

Query  610  LAIAAARMKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPL  789
            L +   + +  +PER  QPECQ+Y+KTG CKFGA CKFHHP+++       AL+ LG PL
Sbjct  265  LGLYTVQRESIFPERPDQPECQFYMKTGDCKFGAVCKFHHPKERIIPTPNCALSSLGLPL  324

Query  790  RPNDIECPYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSP  909
            RP +  C +Y R G CKFG  CKF HP    +M  L  SP
Sbjct  325  RPGEPICTFYSRYGICKFGPNCKFDHPM-GTVMYGLATSP  363


 Score = 73.9 bits (180),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 32/76 (42%), Positives = 46/76 (61%), Gaps = 1/76 (1%)
 Frame = +1

Query  508  YPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKG-EYPERVGQPECQYYL  684
            +P R  +P+C +Y++TG C+FGA C+F+HP  R +      +     P R G+P C +Y 
Sbjct  276  FPERPDQPECQFYMKTGDCKFGAVCKFHHPKERIIPTPNCALSSLGLPLRPGEPICTFYS  335

Query  685  KTGACKFGATCKFHHP  732
            + G CKFG  CKF HP
Sbjct  336  RYGICKFGPNCKFDHP  351



>ref|XP_008676803.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 gb|ACN28340.1| unknown [Zea mays]
 gb|AFW60816.1| hypothetical protein ZEAMMB73_909252 [Zea mays]
Length=441

 Score =   263 bits (673),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 122/168 (73%), Positives = 141/168 (84%), Gaps = 3/168 (2%)
 Frame = +1

Query  445  LAQETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAA  624
            + QE +WQ++L   E ME G YP R GEPDCSYY+RTG+CRFG +C+FNHP++RKLA+AA
Sbjct  30   VDQEAMWQMNLE--EAMELGPYPERVGEPDCSYYMRTGMCRFGMTCKFNHPADRKLAVAA  87

Query  625  ARMKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDI  804
            ARMKGEYP+R+GQPECQYYLKTG CKFGATCKFHHPR+KA +A RV LN LGYPLRPN+ 
Sbjct  88   ARMKGEYPQRIGQPECQYYLKTGTCKFGATCKFHHPREKAAMATRVQLNELGYPLRPNEK  147

Query  805  ECPYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQ  948
            EC YY+RTGQCKFGSTCKFHH QPS MMV +RGS  Y P  S T+PGQ
Sbjct  148  ECAYYLRTGQCKFGSTCKFHHSQPSTMMVAVRGS-VYSPGQSATSPGQ  194


 Score =   102 bits (255),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 47/92 (51%), Positives = 60/92 (65%), Gaps = 0/92 (0%)
 Frame = +1

Query  610  LAIAAARMKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPL  789
            + + A + +  +PER  QPECQ+Y+KTG CKFGA CKFHHPR++       AL+ LG PL
Sbjct  290  VGLYAVQRENLFPERPDQPECQFYMKTGDCKFGAVCKFHHPRERIIPTPNCALSPLGLPL  349

Query  790  RPNDIECPYYMRTGQCKFGSTCKFHHPQPSNM  885
            RP +  C +Y R G CKFG  CKF HP  + M
Sbjct  350  RPGEPICSFYNRYGMCKFGPNCKFDHPMGNAM  381


 Score = 73.2 bits (178),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 33/80 (41%), Positives = 47/80 (59%), Gaps = 1/80 (1%)
 Frame = +1

Query  508  YPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKG-EYPERVGQPECQYYL  684
            +P R  +P+C +Y++TG C+FGA C+F+HP  R +      +     P R G+P C +Y 
Sbjct  301  FPERPDQPECQFYMKTGDCKFGAVCKFHHPRERIIPTPNCALSPLGLPLRPGEPICSFYN  360

Query  685  KTGACKFGATCKFHHPRDKA  744
            + G CKFG  CKF HP   A
Sbjct  361  RYGMCKFGPNCKFDHPMGNA  380



>ref|XP_009118612.1| PREDICTED: zinc finger CCCH domain-containing protein 33-like 
isoform X2 [Brassica rapa]
Length=372

 Score =   261 bits (667),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 121/183 (66%), Positives = 147/183 (80%), Gaps = 15/183 (8%)
 Frame = +1

Query  367  MDFEAAAGISASMASVTEGPSSLSPPLA-QETLWQLSLRSMETMESGTYPVRDGEPDCSY  543
            MDF A   +S           SLSP L  QE +WQ++L S ETME+G+YP R GEPDCSY
Sbjct  1    MDFNAGVPMS-----------SLSPLLINQEAMWQMNLSSDETMETGSYPERPGEPDCSY  49

Query  544  YIRTGLCRFGASCRFNHPSNRKLAIAAARMKGEYPERVGQPECQYYLKTGACKFGATCKF  723
            YIRTGLCRFG++CRFNHP +R+L IA ARM+GEYPER+GQPEC+YYLKTG CKFG TCKF
Sbjct  50   YIRTGLCRFGSTCRFNHPRDRELVIATARMRGEYPERIGQPECEYYLKTGTCKFGVTCKF  109

Query  724  HHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTCKFHHPQP---SNMMVP  894
            HHPR+KAG+AGRV+LN+LGYPLR N+++C Y++RTG CKFG+TCKF+HPQP   +N+MVP
Sbjct  110  HHPRNKAGVAGRVSLNMLGYPLRSNEVDCAYFLRTGHCKFGATCKFNHPQPQPTTNLMVP  169

Query  895  LRG  903
              G
Sbjct  170  TSG  172


 Score =   101 bits (252),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 44/76 (58%), Positives = 55/76 (72%), Gaps = 0/76 (0%)
 Frame = +1

Query  643  YPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYM  822
            +PER GQPECQ+Y+KTG CKFG  CKFHHPRD+   +    L+ +G PLRP +  C +Y 
Sbjct  246  FPERPGQPECQFYMKTGDCKFGTVCKFHHPRDRQPPSPDCLLSPIGLPLRPGEPVCVFYS  305

Query  823  RTGQCKFGSTCKFHHP  870
            R G CKFG +CKF+HP
Sbjct  306  RYGICKFGPSCKFNHP  321


 Score = 82.4 bits (202),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 51/152 (34%), Positives = 76/152 (50%), Gaps = 34/152 (22%)
 Frame = +1

Query  508  YPVRDGEPDCSYYIRTGLCRFGASCRFNHPS---NRKLAIAAARMKGEYPER----VGQP  666
            YP+R  E DC+Y++RTG C+FGA+C+FNHP       L +  +  +  YP      +  P
Sbjct  129  YPLRSNEVDCAYFLRTGHCKFGATCKFNHPQPQPTTNLMVPTSGQQQSYPWSRASFIASP  188

Query  667  ECQ------------------YYLKTGACKFGATCKFHH-----PRDKAGIAGRVALNVL  777
              Q                  Y L  G+     T   H+      ++++G + + + NV 
Sbjct  189  RWQDPSGFTPLMMPQGVVWNPYSL--GSVSPSGTGNEHNNYRNMQQNESGSSVQPSENV-  245

Query  778  GYPLRPNDIECPYYMRTGQCKFGSTCKFHHPQ  873
             +P RP   EC +YM+TG CKFG+ CKFHHP+
Sbjct  246  -FPERPGQPECQFYMKTGDCKFGTVCKFHHPR  276


 Score = 77.0 bits (188),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 37/98 (38%), Positives = 59/98 (60%), Gaps = 9/98 (9%)
 Frame = +1

Query  472  SLRSMETMESGT--------YPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAA  627
            + R+M+  ESG+        +P R G+P+C +Y++TG C+FG  C+F+HP +R+      
Sbjct  226  NYRNMQQNESGSSVQPSENVFPERPGQPECQFYMKTGDCKFGTVCKFHHPRDRQPPSPDC  285

Query  628  RMKG-EYPERVGQPECQYYLKTGACKFGATCKFHHPRD  738
             +     P R G+P C +Y + G CKFG +CKF+HP +
Sbjct  286  LLSPIGLPLRPGEPVCVFYSRYGICKFGPSCKFNHPME  323



>gb|EEE52080.1| hypothetical protein OsJ_33853 [Oryza sativa Japonica Group]
Length=529

 Score =   266 bits (679),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 122/166 (73%), Positives = 141/166 (85%), Gaps = 3/166 (2%)
 Frame = +1

Query  451  QETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAAR  630
            +E +WQ++L   E ME+G YP R GEPDCSYY+RTGLCRFG +C+FNHP++RK+A+AAAR
Sbjct  121  EEAMWQMNLG--EAMEAGPYPERIGEPDCSYYMRTGLCRFGMTCKFNHPADRKMAVAAAR  178

Query  631  MKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIEC  810
            MKGEYP+R+GQPECQYYLKTG CKFGATCKFHHPR+KA IA RV LN LGYPLRPN+ EC
Sbjct  179  MKGEYPQRIGQPECQYYLKTGTCKFGATCKFHHPREKAAIATRVQLNALGYPLRPNEKEC  238

Query  811  PYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQ  948
             YY+RTGQCKFGSTCKFHHPQPSN MV +RGS  Y P  S T+P Q
Sbjct  239  AYYLRTGQCKFGSTCKFHHPQPSNTMVAVRGS-VYSPGQSVTSPSQ  283


 Score =   101 bits (251),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 53/123 (43%), Positives = 68/123 (55%), Gaps = 9/123 (7%)
 Frame = +1

Query  610  LAIAAARMKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPL  789
            L +   + +  +PER  QPECQ+Y+KTG CKFGA CKFHHP+++       AL+ LG PL
Sbjct  380  LGLYTVQRESIFPERPDQPECQFYMKTGDCKFGAVCKFHHPKERIIPTPNCALSSLGLPL  439

Query  790  RPNDIECPYYMRTGQCKFGSTCKFHHPQPSNMM---------VPLRGSPAYPPVHSPTTP  942
            RP +  C +Y R G CKFG  CKF HP  + M          V  R   A  P HS  +P
Sbjct  440  RPGEPICTFYSRYGICKFGPNCKFDHPMGTVMYGLATSPTGDVSARRMLAPVPAHSEVSP  499

Query  943  GQL  951
              +
Sbjct  500  DNV  502


 Score = 73.9 bits (180),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 32/76 (42%), Positives = 46/76 (61%), Gaps = 1/76 (1%)
 Frame = +1

Query  508  YPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKG-EYPERVGQPECQYYL  684
            +P R  +P+C +Y++TG C+FGA C+F+HP  R +      +     P R G+P C +Y 
Sbjct  391  FPERPDQPECQFYMKTGDCKFGAVCKFHHPKERIIPTPNCALSSLGLPLRPGEPICTFYS  450

Query  685  KTGACKFGATCKFHHP  732
            + G CKFG  CKF HP
Sbjct  451  RYGICKFGPNCKFDHP  466



>gb|ACN40302.1| unknown [Picea sitchensis]
Length=468

 Score =   264 bits (674),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 122/170 (72%), Positives = 141/170 (83%), Gaps = 3/170 (2%)
 Frame = +1

Query  445  LAQETLWQLSLRSM-ETMES--GTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLA  615
            + +E +WQ+SL+   E ME+  G +P R GEPDC+YY+RTGLC FG SCRFNHP NRK A
Sbjct  36   VVEEAMWQMSLQQQHENMEAEVGPFPERPGEPDCTYYMRTGLCGFGMSCRFNHPPNRKQA  95

Query  616  IAAARMKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRP  795
             AAAR KGEYPER+GQPECQYYLKTG+CKFGATCKFHHPRDKAG  GR  +NV GYPLRP
Sbjct  96   AAAARNKGEYPERLGQPECQYYLKTGSCKFGATCKFHHPRDKAGSTGRAVINVYGYPLRP  155

Query  796  NDIECPYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVHSPTTPG  945
            N+ EC YYMRTGQCK+G+TCKFHHPQP + +VP+RGS  + PVHSPTTPG
Sbjct  156  NEKECAYYMRTGQCKYGATCKFHHPQPVSTLVPVRGSSLFTPVHSPTTPG  205


 Score =   100 bits (250),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 48/108 (44%), Positives = 65/108 (60%), Gaps = 0/108 (0%)
 Frame = +1

Query  547  IRTGLCRFGASCRFNHPSNRKLAIAAARMKGEYPERVGQPECQYYLKTGACKFGATCKFH  726
            I+  L  F        P   +L  ++A+ +  +PER GQ ECQ+Y+KTG CKFG TC++H
Sbjct  290  IQGTLSHFPPGSPGMGPPTLQLPSSSAQRESMFPERPGQQECQFYMKTGDCKFGMTCRYH  349

Query  727  HPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTCKFHHP  870
            HP+++        LN LG PLRP    C ++ R G CKFG+TCKF HP
Sbjct  350  HPKERIIPVPNCVLNSLGLPLRPGAPACTFFTRYGICKFGATCKFDHP  397


 Score = 80.5 bits (197),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 45/125 (36%), Positives = 64/125 (51%), Gaps = 16/125 (13%)
 Frame = +1

Query  406  ASVTEGPSSLSPPLA---QETLWQ------------LSLRSMETMESGTYPVRDGEPDCS  540
            A +  GPSS + P+A   Q TL              L L S        +P R G+ +C 
Sbjct  273  AGLVYGPSSQTDPMASGIQGTLSHFPPGSPGMGPPTLQLPSSSAQRESMFPERPGQQECQ  332

Query  541  YYIRTGLCRFGASCRFNHPSNRKLAIAAARMKG-EYPERVGQPECQYYLKTGACKFGATC  717
            +Y++TG C+FG +CR++HP  R + +    +     P R G P C ++ + G CKFGATC
Sbjct  333  FYMKTGDCKFGMTCRYHHPKERIIPVPNCVLNSLGLPLRPGAPACTFFTRYGICKFGATC  392

Query  718  KFHHP  732
            KF HP
Sbjct  393  KFDHP  397


 Score = 50.8 bits (120),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 20/38 (53%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = +1

Query  781  YPLRPNDIECPYYMRTGQCKFGSTCKFHHPQPSNMMVP  894
            +P RP   EC +YM+TG CKFG TC++HHP+   + VP
Sbjct  322  FPERPGQQECQFYMKTGDCKFGMTCRYHHPKERIIPVP  359



>gb|ABG22481.1| Zinc finger CCCH type domain containing protein ZFN, putative, 
expressed [Oryza sativa Japonica Group]
 gb|EEC68139.1| hypothetical protein OsI_36059 [Oryza sativa Indica Group]
Length=406

 Score =   262 bits (669),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 121/163 (74%), Positives = 139/163 (85%), Gaps = 3/163 (2%)
 Frame = +1

Query  460  LWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKG  639
            +WQ++L   E ME+G YP R GEPDCSYY+RTGLCRFG +C+FNHP++RK+A+AAARMKG
Sbjct  1    MWQMNLG--EAMEAGPYPERIGEPDCSYYMRTGLCRFGMTCKFNHPADRKMAVAAARMKG  58

Query  640  EYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYY  819
            EYP+R+GQPECQYYLKTG CKFGATCKFHHPR+KA IA RV LN LGYPLRPN+ EC YY
Sbjct  59   EYPQRIGQPECQYYLKTGTCKFGATCKFHHPREKAAIATRVQLNALGYPLRPNEKECAYY  118

Query  820  MRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQ  948
            +RTGQCKFGSTCKFHHPQPSN MV +RGS  Y P  S T+P Q
Sbjct  119  LRTGQCKFGSTCKFHHPQPSNTMVAVRGS-VYSPGQSVTSPSQ  160


 Score =   100 bits (250),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 49/100 (49%), Positives = 62/100 (62%), Gaps = 1/100 (1%)
 Frame = +1

Query  610  LAIAAARMKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPL  789
            L +   + +  +PER  QPECQ+Y+KTG CKFGA CKFHHP+++       AL+ LG PL
Sbjct  257  LGLYTVQRESIFPERPDQPECQFYMKTGDCKFGAVCKFHHPKERIIPTPNCALSSLGLPL  316

Query  790  RPNDIECPYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSP  909
            RP +  C +Y R G CKFG  CKF HP    +M  L  SP
Sbjct  317  RPGEPICTFYSRYGICKFGPNCKFDHPM-GTVMYGLATSP  355


 Score = 73.9 bits (180),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 32/76 (42%), Positives = 46/76 (61%), Gaps = 1/76 (1%)
 Frame = +1

Query  508  YPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKG-EYPERVGQPECQYYL  684
            +P R  +P+C +Y++TG C+FGA C+F+HP  R +      +     P R G+P C +Y 
Sbjct  268  FPERPDQPECQFYMKTGDCKFGAVCKFHHPKERIIPTPNCALSSLGLPLRPGEPICTFYS  327

Query  685  KTGACKFGATCKFHHP  732
            + G CKFG  CKF HP
Sbjct  328  RYGICKFGPNCKFDHP  343



>ref|XP_009118604.1| PREDICTED: zinc finger CCCH domain-containing protein 33-like 
isoform X1 [Brassica rapa]
Length=374

 Score =   261 bits (667),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 121/183 (66%), Positives = 147/183 (80%), Gaps = 15/183 (8%)
 Frame = +1

Query  367  MDFEAAAGISASMASVTEGPSSLSPPLA-QETLWQLSLRSMETMESGTYPVRDGEPDCSY  543
            MDF A   +S           SLSP L  QE +WQ++L S ETME+G+YP R GEPDCSY
Sbjct  1    MDFNAGVPMS-----------SLSPLLINQEAMWQMNLSSDETMETGSYPERPGEPDCSY  49

Query  544  YIRTGLCRFGASCRFNHPSNRKLAIAAARMKGEYPERVGQPECQYYLKTGACKFGATCKF  723
            YIRTGLCRFG++CRFNHP +R+L IA ARM+GEYPER+GQPEC+YYLKTG CKFG TCKF
Sbjct  50   YIRTGLCRFGSTCRFNHPRDRELVIATARMRGEYPERIGQPECEYYLKTGTCKFGVTCKF  109

Query  724  HHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTCKFHHPQP---SNMMVP  894
            HHPR+KAG+AGRV+LN+LGYPLR N+++C Y++RTG CKFG+TCKF+HPQP   +N+MVP
Sbjct  110  HHPRNKAGVAGRVSLNMLGYPLRSNEVDCAYFLRTGHCKFGATCKFNHPQPQPTTNLMVP  169

Query  895  LRG  903
              G
Sbjct  170  TSG  172


 Score =   101 bits (252),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 44/76 (58%), Positives = 55/76 (72%), Gaps = 0/76 (0%)
 Frame = +1

Query  643  YPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYM  822
            +PER GQPECQ+Y+KTG CKFG  CKFHHPRD+   +    L+ +G PLRP +  C +Y 
Sbjct  248  FPERPGQPECQFYMKTGDCKFGTVCKFHHPRDRQPPSPDCLLSPIGLPLRPGEPVCVFYS  307

Query  823  RTGQCKFGSTCKFHHP  870
            R G CKFG +CKF+HP
Sbjct  308  RYGICKFGPSCKFNHP  323


 Score = 84.3 bits (207),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 50/152 (33%), Positives = 76/152 (50%), Gaps = 32/152 (21%)
 Frame = +1

Query  508  YPVRDGEPDCSYYIRTGLCRFGASCRFNHPS---NRKLAIAAARMKGEYPER----VGQP  666
            YP+R  E DC+Y++RTG C+FGA+C+FNHP       L +  +  +  YP      +  P
Sbjct  129  YPLRSNEVDCAYFLRTGHCKFGATCKFNHPQPQPTTNLMVPTSGQQQSYPWSRASFIASP  188

Query  667  ECQ------------------YYLKTGACKFGATCKFHH-----PRDKAGIAGRVALNVL  777
              Q                  Y  + G+     T   H+      ++++G + + + NV 
Sbjct  189  RWQDPSGFTPLMMPQGVVWNPYSGQLGSVSPSGTGNEHNNYRNMQQNESGSSVQPSENV-  247

Query  778  GYPLRPNDIECPYYMRTGQCKFGSTCKFHHPQ  873
             +P RP   EC +YM+TG CKFG+ CKFHHP+
Sbjct  248  -FPERPGQPECQFYMKTGDCKFGTVCKFHHPR  278


 Score = 77.0 bits (188),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 37/98 (38%), Positives = 59/98 (60%), Gaps = 9/98 (9%)
 Frame = +1

Query  472  SLRSMETMESGT--------YPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAA  627
            + R+M+  ESG+        +P R G+P+C +Y++TG C+FG  C+F+HP +R+      
Sbjct  228  NYRNMQQNESGSSVQPSENVFPERPGQPECQFYMKTGDCKFGTVCKFHHPRDRQPPSPDC  287

Query  628  RMKG-EYPERVGQPECQYYLKTGACKFGATCKFHHPRD  738
             +     P R G+P C +Y + G CKFG +CKF+HP +
Sbjct  288  LLSPIGLPLRPGEPVCVFYSRYGICKFGPSCKFNHPME  325



>emb|CDY53749.1| BnaAnng12770D [Brassica napus]
Length=374

 Score =   261 bits (666),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 121/183 (66%), Positives = 147/183 (80%), Gaps = 15/183 (8%)
 Frame = +1

Query  367  MDFEAAAGISASMASVTEGPSSLSPPLA-QETLWQLSLRSMETMESGTYPVRDGEPDCSY  543
            MDF A   +S           SLSP +  QE +WQ++L S ETME+G+YP R GEPDCSY
Sbjct  1    MDFNAGVPMS-----------SLSPLMINQEAMWQMNLSSDETMETGSYPERPGEPDCSY  49

Query  544  YIRTGLCRFGASCRFNHPSNRKLAIAAARMKGEYPERVGQPECQYYLKTGACKFGATCKF  723
            YIRTGLCRFG++CRFNHP +R+L IA ARM+GEYPER+GQPEC+YYLKTG CKFG TCKF
Sbjct  50   YIRTGLCRFGSTCRFNHPRDRELVIATARMRGEYPERIGQPECEYYLKTGTCKFGVTCKF  109

Query  724  HHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTCKFHHPQP---SNMMVP  894
            HHPR+KAGIAGRV+LN+LGYPLR N+++C Y++RTG CKFG+TCKF+HPQP   +N+MVP
Sbjct  110  HHPRNKAGIAGRVSLNMLGYPLRSNEVDCAYFLRTGHCKFGATCKFNHPQPQPTTNLMVP  169

Query  895  LRG  903
              G
Sbjct  170  TSG  172


 Score =   101 bits (252),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 44/76 (58%), Positives = 55/76 (72%), Gaps = 0/76 (0%)
 Frame = +1

Query  643  YPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYM  822
            +PER GQPECQ+Y+KTG CKFG  CKFHHPRD+   +    L+ +G PLRP +  C +Y 
Sbjct  248  FPERPGQPECQFYMKTGDCKFGTVCKFHHPRDRQPPSPDCLLSPIGLPLRPGEPVCVFYS  307

Query  823  RTGQCKFGSTCKFHHP  870
            R G CKFG +CKF+HP
Sbjct  308  RYGICKFGPSCKFNHP  323


 Score = 84.3 bits (207),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 50/152 (33%), Positives = 76/152 (50%), Gaps = 32/152 (21%)
 Frame = +1

Query  508  YPVRDGEPDCSYYIRTGLCRFGASCRFNHPS---NRKLAIAAARMKGEYPER----VGQP  666
            YP+R  E DC+Y++RTG C+FGA+C+FNHP       L +  +  +  YP      +  P
Sbjct  129  YPLRSNEVDCAYFLRTGHCKFGATCKFNHPQPQPTTNLMVPTSGQQQSYPWSRASFIASP  188

Query  667  ECQ------------------YYLKTGACKFGATCKFHH-----PRDKAGIAGRVALNVL  777
              Q                  Y  + G+     T   H+      ++++G + + + NV 
Sbjct  189  RWQDPSGFTPLMMPQGVVWNPYSGQLGSVSPSGTGNEHNNYRNMQQNESGSSVQPSENV-  247

Query  778  GYPLRPNDIECPYYMRTGQCKFGSTCKFHHPQ  873
             +P RP   EC +YM+TG CKFG+ CKFHHP+
Sbjct  248  -FPERPGQPECQFYMKTGDCKFGTVCKFHHPR  278


 Score = 76.6 bits (187),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 37/98 (38%), Positives = 59/98 (60%), Gaps = 9/98 (9%)
 Frame = +1

Query  472  SLRSMETMESGT--------YPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAA  627
            + R+M+  ESG+        +P R G+P+C +Y++TG C+FG  C+F+HP +R+      
Sbjct  228  NYRNMQQNESGSSVQPSENVFPERPGQPECQFYMKTGDCKFGTVCKFHHPRDRQPPSPDC  287

Query  628  RMKG-EYPERVGQPECQYYLKTGACKFGATCKFHHPRD  738
             +     P R G+P C +Y + G CKFG +CKF+HP +
Sbjct  288  LLSPIGLPLRPGEPVCVFYSRYGICKFGPSCKFNHPME  325



>ref|XP_003577562.1| PREDICTED: zinc finger CCCH domain-containing protein 63-like 
[Brachypodium distachyon]
Length=445

 Score =   263 bits (672),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 121/165 (73%), Positives = 141/165 (85%), Gaps = 3/165 (2%)
 Frame = +1

Query  454  ETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARM  633
            E +W +SL   E+ME+G YP R GEPDCSYY+RTGLCRFG +C+FNHP++RK+A+AAARM
Sbjct  37   EAMWHMSLG--ESMEAGLYPERVGEPDCSYYMRTGLCRFGMTCKFNHPADRKMAVAAARM  94

Query  634  KGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECP  813
            KGEYP+R+GQPECQYYLKTG CKFGATCKFHHPR+KA +A RV LNVLGYPLRPN+ EC 
Sbjct  95   KGEYPQRIGQPECQYYLKTGMCKFGATCKFHHPREKAAMATRVQLNVLGYPLRPNEKECS  154

Query  814  YYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQ  948
            YY+RTGQCKFGSTCKF+HPQPSN MV LRGS  + P  S T+P Q
Sbjct  155  YYLRTGQCKFGSTCKFNHPQPSNTMVALRGS-VFSPGQSATSPSQ  198


 Score = 95.5 bits (236),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 43/81 (53%), Positives = 55/81 (68%), Gaps = 0/81 (0%)
 Frame = +1

Query  643  YPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYM  822
            +P+R  QPECQ+Y+KTG CKFGA CKFHHP+++   +   AL+ LG PLR  +  C +Y 
Sbjct  306  FPDRPDQPECQFYMKTGDCKFGAVCKFHHPKERIIPSPSCALSPLGLPLRSGEPICTFYS  365

Query  823  RTGQCKFGSTCKFHHPQPSNM  885
            R G CKFG  CKF HP  + M
Sbjct  366  RYGICKFGPNCKFDHPMGTVM  386


 Score = 73.9 bits (180),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 48/76 (63%), Gaps = 1/76 (1%)
 Frame = +1

Query  508  YPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKL-AIAAARMKGEYPERVGQPECQYYL  684
            +P R  +P+C +Y++TG C+FGA C+F+HP  R + + + A      P R G+P C +Y 
Sbjct  306  FPDRPDQPECQFYMKTGDCKFGAVCKFHHPKERIIPSPSCALSPLGLPLRSGEPICTFYS  365

Query  685  KTGACKFGATCKFHHP  732
            + G CKFG  CKF HP
Sbjct  366  RYGICKFGPNCKFDHP  381



>emb|CDY67901.1| BnaCnng56860D [Brassica napus]
Length=374

 Score =   261 bits (666),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 121/183 (66%), Positives = 147/183 (80%), Gaps = 15/183 (8%)
 Frame = +1

Query  367  MDFEAAAGISASMASVTEGPSSLSPPLA-QETLWQLSLRSMETMESGTYPVRDGEPDCSY  543
            MDF A   +S           SLSP +  QE +WQ++L S ETME+G+YP R GEPDCSY
Sbjct  1    MDFNAGVPMS-----------SLSPLMINQEAMWQMNLSSDETMETGSYPERPGEPDCSY  49

Query  544  YIRTGLCRFGASCRFNHPSNRKLAIAAARMKGEYPERVGQPECQYYLKTGACKFGATCKF  723
            YIRTGLCRFG++CRFNHP +R+L IA ARM+GEYPER+GQPEC+YYLKTG CKFG TCKF
Sbjct  50   YIRTGLCRFGSTCRFNHPRDRELVIATARMRGEYPERIGQPECEYYLKTGTCKFGVTCKF  109

Query  724  HHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTCKFHHPQP---SNMMVP  894
            HHPR+KAGIAGRV+LN+LGYPLR N+++C Y++RTG CKFG+TCKF+HPQP   +N+MVP
Sbjct  110  HHPRNKAGIAGRVSLNMLGYPLRSNEVDCAYFLRTGHCKFGATCKFNHPQPQPTTNLMVP  169

Query  895  LRG  903
              G
Sbjct  170  TSG  172


 Score =   101 bits (252),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 44/76 (58%), Positives = 55/76 (72%), Gaps = 0/76 (0%)
 Frame = +1

Query  643  YPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYM  822
            +PER GQPECQ+Y+KTG CKFG  CKFHHPRD+   +    L+ +G PLRP +  C +Y 
Sbjct  248  FPERPGQPECQFYMKTGDCKFGTVCKFHHPRDRQPPSPDCLLSPIGLPLRPGEPVCVFYS  307

Query  823  RTGQCKFGSTCKFHHP  870
            R G CKFG +CKF+HP
Sbjct  308  RYGICKFGPSCKFNHP  323


 Score = 84.3 bits (207),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 50/152 (33%), Positives = 76/152 (50%), Gaps = 32/152 (21%)
 Frame = +1

Query  508  YPVRDGEPDCSYYIRTGLCRFGASCRFNHPS---NRKLAIAAARMKGEYPER----VGQP  666
            YP+R  E DC+Y++RTG C+FGA+C+FNHP       L +  +  +  YP      +  P
Sbjct  129  YPLRSNEVDCAYFLRTGHCKFGATCKFNHPQPQPTTNLMVPTSGQQQSYPWSRASFIASP  188

Query  667  ECQ------------------YYLKTGACKFGATCKFHH-----PRDKAGIAGRVALNVL  777
              Q                  Y  + G+     T   H+      ++++G + + + NV 
Sbjct  189  RWQDPSGFTPLMMPQGVVWNPYSGQLGSVSPSGTGNEHNNYRNMQQNESGSSVQPSENV-  247

Query  778  GYPLRPNDIECPYYMRTGQCKFGSTCKFHHPQ  873
             +P RP   EC +YM+TG CKFG+ CKFHHP+
Sbjct  248  -FPERPGQPECQFYMKTGDCKFGTVCKFHHPR  278


 Score = 76.6 bits (187),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 37/98 (38%), Positives = 59/98 (60%), Gaps = 9/98 (9%)
 Frame = +1

Query  472  SLRSMETMESGT--------YPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAA  627
            + R+M+  ESG+        +P R G+P+C +Y++TG C+FG  C+F+HP +R+      
Sbjct  228  NYRNMQQNESGSSVQPSENVFPERPGQPECQFYMKTGDCKFGTVCKFHHPRDRQPPSPDC  287

Query  628  RMKG-EYPERVGQPECQYYLKTGACKFGATCKFHHPRD  738
             +     P R G+P C +Y + G CKFG +CKF+HP +
Sbjct  288  LLSPIGLPLRPGEPVCVFYSRYGICKFGPSCKFNHPME  325



>ref|XP_009147316.1| PREDICTED: zinc finger CCCH domain-containing protein 33 [Brassica 
rapa]
Length=392

 Score =   261 bits (667),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 119/184 (65%), Positives = 146/184 (79%), Gaps = 16/184 (9%)
 Frame = +1

Query  367  MDFEAAAGISASMASVTEGPSSLSPPLAQETLWQLSLRSMETMESGTYPVRDGEPDCSYY  546
            MDF A   +S           SLSP + QE +WQ++L   ETME+G+YP R GEP+CSYY
Sbjct  1    MDFNAGVPMS-----------SLSPLMTQEAMWQMNLSQDETMETGSYPERPGEPNCSYY  49

Query  547  IRTGLCRFGASCRFNHPSNRKLAIAAARMKGEYPERVGQPECQYYLKTGACKFGATCKFH  726
            IRTGLCRFG++CRFNHP +R+L IA ARM+GEYPER+GQPEC+YYLKTG CKFG TCKFH
Sbjct  50   IRTGLCRFGSTCRFNHPPDRELVIATARMRGEYPERIGQPECEYYLKTGTCKFGVTCKFH  109

Query  727  HPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTCKFHHPQP-----SNMMV  891
            HPR+KAGIAGRV+LN+LGYPLR N+++C Y++RTG CKFG+TCKF+HPQP     +N+MV
Sbjct  110  HPRNKAGIAGRVSLNMLGYPLRSNEVDCAYFLRTGHCKFGATCKFNHPQPQPQPTTNLMV  169

Query  892  PLRG  903
            P  G
Sbjct  170  PTSG  173


 Score =   100 bits (250),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 44/76 (58%), Positives = 53/76 (70%), Gaps = 0/76 (0%)
 Frame = +1

Query  643  YPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYM  822
            +PER GQPECQ+Y+KTG CKFG  CKFHHPRD+        L+ +G PLRP +  C +Y 
Sbjct  273  FPERPGQPECQFYMKTGDCKFGTVCKFHHPRDRQAPPPDCLLSPIGLPLRPGEPLCVFYS  332

Query  823  RTGQCKFGSTCKFHHP  870
            R   CKFG +CKFHHP
Sbjct  333  RYRICKFGPSCKFHHP  348


 Score = 76.3 bits (186),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 51/176 (29%), Positives = 76/176 (43%), Gaps = 54/176 (31%)
 Frame = +1

Query  508  YPVRDGEPDCSYYIRTGLCRFGASCRFNHPS-----NRKLAIAAARMKGEYPER----VG  660
            YP+R  E DC+Y++RTG C+FGA+C+FNHP         L +  +  +  YP      + 
Sbjct  128  YPLRSNEVDCAYFLRTGHCKFGATCKFNHPQPQPQPTTNLMVPTSGQQQSYPWSSASFIP  187

Query  661  QPECQ----------------------YYLKTGACKFGATCKFHHP-----RDKAGIAGR  759
             P  Q                      Y  + GA     T   H+      +++AG   +
Sbjct  188  SPRWQDPSGYTPLLMPQGVVPVQGWNPYTGQLGAVSPSGTGNDHNSYRNMQQNEAGSQSQ  247

Query  760  VALNVLG------------------YPLRPNDIECPYYMRTGQCKFGSTCKFHHPQ  873
             +++ L                   +P RP   EC +YM+TG CKFG+ CKFHHP+
Sbjct  248  GSVSGLNTASSVPLGGFYALPSESVFPERPGQPECQFYMKTGDCKFGTVCKFHHPR  303


 Score = 73.9 bits (180),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 32/79 (41%), Positives = 49/79 (62%), Gaps = 1/79 (1%)
 Frame = +1

Query  505  TYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKG-EYPERVGQPECQYY  681
             +P R G+P+C +Y++TG C+FG  C+F+HP +R+       +     P R G+P C +Y
Sbjct  272  VFPERPGQPECQFYMKTGDCKFGTVCKFHHPRDRQAPPPDCLLSPIGLPLRPGEPLCVFY  331

Query  682  LKTGACKFGATCKFHHPRD  738
             +   CKFG +CKFHHP +
Sbjct  332  SRYRICKFGPSCKFHHPME  350



>ref|XP_004495537.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X1 [Cicer arietinum]
Length=389

 Score =   261 bits (666),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 122/165 (74%), Positives = 140/165 (85%), Gaps = 3/165 (2%)
 Frame = +1

Query  451  QETLWQLSLRSMET-MESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAA  627
            + +LW + LRS +T M+S  YP R GEPDCSYYIRTGLCRFGA+CRFNHP N  LAI  A
Sbjct  17   EGSLWMMKLRSTQTFMDSQFYPHRPGEPDCSYYIRTGLCRFGATCRFNHPPNANLAIVTA  76

Query  628  RMKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIE  807
            RM GE+PER+GQPECQ+YLKTG CKFGATCKFHHPRD+AGI+GRVALN+LGYPLRP + E
Sbjct  77   RMIGEFPERIGQPECQFYLKTGTCKFGATCKFHHPRDQAGISGRVALNILGYPLRPTEAE  136

Query  808  CPYYMRTGQCKFGSTCKFHHPQPS-NMMVPLRGSPAY-PPVHSPT  936
            C YY+RTG+CKFG+TCKFHHPQPS NM +PL+GSP Y   VHSPT
Sbjct  137  CSYYLRTGECKFGNTCKFHHPQPSNNMTIPLKGSPIYLSTVHSPT  181


 Score = 90.1 bits (222),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 41/77 (53%), Positives = 52/77 (68%), Gaps = 1/77 (1%)
 Frame = +1

Query  643  YPERVGQPECQYYLKTGACKFGATCKFHHPRDK-AGIAGRVALNVLGYPLRPNDIECPYY  819
            +P+R GQPECQ+Y+KTG CKFGA C+FHHP  +   +     L+ LG PLR  +  C +Y
Sbjct  240  FPDRPGQPECQFYMKTGDCKFGAVCRFHHPHQRLIPVPPDCLLSSLGLPLRHGEPLCVFY  299

Query  820  MRTGQCKFGSTCKFHHP  870
             R G CKFG +CKF HP
Sbjct  300  SRYGICKFGPSCKFDHP  316


 Score = 78.2 bits (191),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 34/77 (44%), Positives = 49/77 (64%), Gaps = 2/77 (3%)
 Frame = +1

Query  508  YPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKGE--YPERVGQPECQYY  681
            +P R G+P+C +Y++TG C+FGA CRF+HP  R + +    +      P R G+P C +Y
Sbjct  240  FPDRPGQPECQFYMKTGDCKFGAVCRFHHPHQRLIPVPPDCLLSSLGLPLRHGEPLCVFY  299

Query  682  LKTGACKFGATCKFHHP  732
             + G CKFG +CKF HP
Sbjct  300  SRYGICKFGPSCKFDHP  316


 Score = 73.2 bits (178),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 47/150 (31%), Positives = 68/150 (45%), Gaps = 21/150 (14%)
 Frame = +1

Query  508  YPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKGEYPERVGQPECQY--Y  681
            YP+R  E +CSYY+RTG C+FG +C+F+HP          +    Y   V  P  Q   +
Sbjct  128  YPLRPTEAECSYYLRTGECKFGNTCKFHHPQPSNNMTIPLKGSPIYLSTVHSPTPQVRGF  187

Query  682  LKTGACKFGAT--CKFHHPRDKAGIAGRVALN-----VLG------------YPLRPNDI  804
                   +G +       P+    + G  A +     V+             +P RP   
Sbjct  188  ANWPRASYGPSSYTPLVMPQGVISVPGWSAYSGQMGSVISTPPGSPLQRENIFPDRPGQP  247

Query  805  ECPYYMRTGQCKFGSTCKFHHPQPSNMMVP  894
            EC +YM+TG CKFG+ C+FHHP    + VP
Sbjct  248  ECQFYMKTGDCKFGAVCRFHHPHQRLIPVP  277



>ref|XP_003576637.1| PREDICTED: zinc finger CCCH domain-containing protein 66-like 
isoform X2 [Brachypodium distachyon]
Length=442

 Score =   262 bits (669),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 125/167 (75%), Positives = 139/167 (83%), Gaps = 2/167 (1%)
 Frame = +1

Query  451  QETLWQLSLRSM-ETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAA  627
            +ET+WQ+SL    E+ME G YP R GEPDCSYY+RTGLCRFG +C+FNHP NRKLA+AAA
Sbjct  29   EETMWQMSLGGGGESMEPGPYPERIGEPDCSYYMRTGLCRFGMTCKFNHPPNRKLAVAAA  88

Query  628  RMKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIE  807
            RM GEYP RVGQPECQYYLKTG CKFGATCKFHHPR+KA IA R  LNVLGYPLRPN+ E
Sbjct  89   RMNGEYPYRVGQPECQYYLKTGTCKFGATCKFHHPREKAAIATRAQLNVLGYPLRPNEKE  148

Query  808  CPYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQ  948
            C YY+RTGQCKF STCKFHHPQPS+ MV +RGS  Y P  S T+PGQ
Sbjct  149  CAYYLRTGQCKFASTCKFHHPQPSSTMVAVRGS-MYSPGQSATSPGQ  194


 Score =   101 bits (252),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 54/114 (47%), Positives = 67/114 (59%), Gaps = 4/114 (4%)
 Frame = +1

Query  610  LAIAAARMKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPL  789
            L + A +    +PER  QPECQ+Y+KTG CKFGA CKF+HP+++   A   AL+ LG PL
Sbjct  291  LGVYAVQGDNVFPERPDQPECQFYMKTGDCKFGAVCKFNHPKERMIPAPNCALSPLGLPL  350

Query  790  RPNDIECPYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQL  951
            RP +  C +Y R G CKFG  CKF HP    M   + GS   P    PT   QL
Sbjct  351  RPGEPVCTFYSRYGICKFGPNCKFDHP----MGTVMYGSVTSPTSDVPTLHYQL  400


 Score = 76.6 bits (187),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 35/77 (45%), Positives = 47/77 (61%), Gaps = 1/77 (1%)
 Frame = +1

Query  505  TYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKL-AIAAARMKGEYPERVGQPECQYY  681
             +P R  +P+C +Y++TG C+FGA C+FNHP  R + A   A      P R G+P C +Y
Sbjct  301  VFPERPDQPECQFYMKTGDCKFGAVCKFNHPKERMIPAPNCALSPLGLPLRPGEPVCTFY  360

Query  682  LKTGACKFGATCKFHHP  732
             + G CKFG  CKF HP
Sbjct  361  SRYGICKFGPNCKFDHP  377



>ref|XP_002450713.1| hypothetical protein SORBIDRAFT_05g013190 [Sorghum bicolor]
 gb|EES09701.1| hypothetical protein SORBIDRAFT_05g013190 [Sorghum bicolor]
Length=446

 Score =   262 bits (669),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 121/166 (73%), Positives = 140/166 (84%), Gaps = 2/166 (1%)
 Frame = +1

Query  454  ETLWQLSL-RSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAAR  630
            E +WQ++L  +M  ME G YP R GEPDCSYY+RTG+CRFG +C+FNHP++RKLA+AAAR
Sbjct  35   EAMWQMNLGETMAPMELGPYPERVGEPDCSYYMRTGMCRFGMTCKFNHPADRKLAVAAAR  94

Query  631  MKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIEC  810
            MKGEYP+R+GQPECQYYLKTG CKFGATCKFHHPR+KA +A RV LN LGYPLR N+ EC
Sbjct  95   MKGEYPQRIGQPECQYYLKTGTCKFGATCKFHHPREKAAMATRVQLNELGYPLRANEKEC  154

Query  811  PYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQ  948
             YY+RTGQCKFGSTCKFHHPQPS MMV +RGS  Y P  S T+PGQ
Sbjct  155  AYYLRTGQCKFGSTCKFHHPQPSTMMVAVRGS-VYSPGQSATSPGQ  199


 Score =   104 bits (259),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 52/110 (47%), Positives = 67/110 (61%), Gaps = 4/110 (4%)
 Frame = +1

Query  610  LAIAAARMKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPL  789
            + + A + +  +PER  QPECQ+Y+KTG CKFGA CKFHHPR++       AL+ LG PL
Sbjct  296  VGLYAVQRENVFPERPDQPECQFYMKTGDCKFGAVCKFHHPRERIIPTPNCALSPLGLPL  355

Query  790  RPNDIECPYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVHSPTT  939
            RP +  C +Y R G CKFG  CKF HP  S M     G  + P   +PT+
Sbjct  356  RPGEPICSFYNRYGMCKFGPNCKFDHPMGSAMY----GHASSPTSEAPTS  401


 Score = 73.2 bits (178),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 33/81 (41%), Positives = 47/81 (58%), Gaps = 1/81 (1%)
 Frame = +1

Query  505  TYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKG-EYPERVGQPECQYY  681
             +P R  +P+C +Y++TG C+FGA C+F+HP  R +      +     P R G+P C +Y
Sbjct  306  VFPERPDQPECQFYMKTGDCKFGAVCKFHHPRERIIPTPNCALSPLGLPLRPGEPICSFY  365

Query  682  LKTGACKFGATCKFHHPRDKA  744
             + G CKFG  CKF HP   A
Sbjct  366  NRYGMCKFGPNCKFDHPMGSA  386



>emb|CDY51531.1| BnaA05g33310D [Brassica napus]
Length=395

 Score =   260 bits (665),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 119/184 (65%), Positives = 146/184 (79%), Gaps = 16/184 (9%)
 Frame = +1

Query  367  MDFEAAAGISASMASVTEGPSSLSPPLAQETLWQLSLRSMETMESGTYPVRDGEPDCSYY  546
            MDF A   +S           SLSP + QE +WQ++L   ETME+G+YP R GEP+CSYY
Sbjct  1    MDFNAGVPMS-----------SLSPLMTQEAMWQMNLSPDETMETGSYPERPGEPNCSYY  49

Query  547  IRTGLCRFGASCRFNHPSNRKLAIAAARMKGEYPERVGQPECQYYLKTGACKFGATCKFH  726
            IRTGLCRFG++CRFNHP +R+L IA ARM+GEYPER+GQPEC+YYLKTG CKFG TCKFH
Sbjct  50   IRTGLCRFGSTCRFNHPPDRELVIATARMRGEYPERIGQPECEYYLKTGTCKFGVTCKFH  109

Query  727  HPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTCKFHHPQP-----SNMMV  891
            HPR+KAGIAGRV+LN+LGYPLR N+++C Y++RTG CKFG+TCKF+HPQP     +N+MV
Sbjct  110  HPRNKAGIAGRVSLNMLGYPLRSNEVDCAYFLRTGHCKFGATCKFNHPQPQPQPTTNLMV  169

Query  892  PLRG  903
            P  G
Sbjct  170  PTSG  173


 Score =   105 bits (261),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 45/76 (59%), Positives = 54/76 (71%), Gaps = 0/76 (0%)
 Frame = +1

Query  643  YPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYM  822
            +PER GQPECQ+Y+KTG CKFG  CKFHHPRD+        L+ +G PLRP +  C +Y 
Sbjct  276  FPERPGQPECQFYMKTGDCKFGTVCKFHHPRDRQAPPPDCLLSTIGLPLRPGEPLCVFYS  335

Query  823  RTGQCKFGSTCKFHHP  870
            R G CKFG +CKFHHP
Sbjct  336  RYGICKFGPSCKFHHP  351


 Score = 77.4 bits (189),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 33/79 (42%), Positives = 50/79 (63%), Gaps = 1/79 (1%)
 Frame = +1

Query  505  TYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKG-EYPERVGQPECQYY  681
             +P R G+P+C +Y++TG C+FG  C+F+HP +R+       +     P R G+P C +Y
Sbjct  275  VFPERPGQPECQFYMKTGDCKFGTVCKFHHPRDRQAPPPDCLLSTIGLPLRPGEPLCVFY  334

Query  682  LKTGACKFGATCKFHHPRD  738
             + G CKFG +CKFHHP +
Sbjct  335  SRYGICKFGPSCKFHHPME  353


 Score = 50.8 bits (120),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 19/31 (61%), Positives = 24/31 (77%), Gaps = 0/31 (0%)
 Frame = +1

Query  781  YPLRPNDIECPYYMRTGQCKFGSTCKFHHPQ  873
            +P RP   EC +YM+TG CKFG+ CKFHHP+
Sbjct  276  FPERPGQPECQFYMKTGDCKFGTVCKFHHPR  306



>ref|NP_001141157.1| hypothetical protein [Zea mays]
 gb|ACF85576.1| unknown [Zea mays]
 gb|ACN34349.1| unknown [Zea mays]
 gb|AFT82654.1| C3H11 C3H type transcription factor, partial [Zea mays subsp. 
mays]
 gb|AFW60815.1| hypothetical protein ZEAMMB73_909252 [Zea mays]
Length=443

 Score =   261 bits (668),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 121/165 (73%), Positives = 139/165 (84%), Gaps = 3/165 (2%)
 Frame = +1

Query  454  ETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARM  633
            E +WQ++L   E ME G YP R GEPDCSYY+RTG+CRFG +C+FNHP++RKLA+AAARM
Sbjct  35   EAMWQMNLE--EAMELGPYPERVGEPDCSYYMRTGMCRFGMTCKFNHPADRKLAVAAARM  92

Query  634  KGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECP  813
            KGEYP+R+GQPECQYYLKTG CKFGATCKFHHPR+KA +A RV LN LGYPLRPN+ EC 
Sbjct  93   KGEYPQRIGQPECQYYLKTGTCKFGATCKFHHPREKAAMATRVQLNELGYPLRPNEKECA  152

Query  814  YYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQ  948
            YY+RTGQCKFGSTCKFHH QPS MMV +RGS  Y P  S T+PGQ
Sbjct  153  YYLRTGQCKFGSTCKFHHSQPSTMMVAVRGS-VYSPGQSATSPGQ  196


 Score =   102 bits (255),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 47/92 (51%), Positives = 60/92 (65%), Gaps = 0/92 (0%)
 Frame = +1

Query  610  LAIAAARMKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPL  789
            + + A + +  +PER  QPECQ+Y+KTG CKFGA CKFHHPR++       AL+ LG PL
Sbjct  292  VGLYAVQRENLFPERPDQPECQFYMKTGDCKFGAVCKFHHPRERIIPTPNCALSPLGLPL  351

Query  790  RPNDIECPYYMRTGQCKFGSTCKFHHPQPSNM  885
            RP +  C +Y R G CKFG  CKF HP  + M
Sbjct  352  RPGEPICSFYNRYGMCKFGPNCKFDHPMGNAM  383


 Score = 73.2 bits (178),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 33/80 (41%), Positives = 47/80 (59%), Gaps = 1/80 (1%)
 Frame = +1

Query  508  YPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKG-EYPERVGQPECQYYL  684
            +P R  +P+C +Y++TG C+FGA C+F+HP  R +      +     P R G+P C +Y 
Sbjct  303  FPERPDQPECQFYMKTGDCKFGAVCKFHHPRERIIPTPNCALSPLGLPLRPGEPICSFYN  362

Query  685  KTGACKFGATCKFHHPRDKA  744
            + G CKFG  CKF HP   A
Sbjct  363  RYGMCKFGPNCKFDHPMGNA  382



>ref|XP_010237293.1| PREDICTED: zinc finger CCCH domain-containing protein 66-like 
isoform X1 [Brachypodium distachyon]
Length=445

 Score =   261 bits (667),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 125/166 (75%), Positives = 138/166 (83%), Gaps = 2/166 (1%)
 Frame = +1

Query  454  ETLWQLSLRSM-ETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAAR  630
            ET+WQ+SL    E+ME G YP R GEPDCSYY+RTGLCRFG +C+FNHP NRKLA+AAAR
Sbjct  33   ETMWQMSLGGGGESMEPGPYPERIGEPDCSYYMRTGLCRFGMTCKFNHPPNRKLAVAAAR  92

Query  631  MKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIEC  810
            M GEYP RVGQPECQYYLKTG CKFGATCKFHHPR+KA IA R  LNVLGYPLRPN+ EC
Sbjct  93   MNGEYPYRVGQPECQYYLKTGTCKFGATCKFHHPREKAAIATRAQLNVLGYPLRPNEKEC  152

Query  811  PYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQ  948
             YY+RTGQCKF STCKFHHPQPS+ MV +RGS  Y P  S T+PGQ
Sbjct  153  AYYLRTGQCKFASTCKFHHPQPSSTMVAVRGS-MYSPGQSATSPGQ  197


 Score =   101 bits (252),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 54/114 (47%), Positives = 67/114 (59%), Gaps = 4/114 (4%)
 Frame = +1

Query  610  LAIAAARMKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPL  789
            L + A +    +PER  QPECQ+Y+KTG CKFGA CKF+HP+++   A   AL+ LG PL
Sbjct  294  LGVYAVQGDNVFPERPDQPECQFYMKTGDCKFGAVCKFNHPKERMIPAPNCALSPLGLPL  353

Query  790  RPNDIECPYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQL  951
            RP +  C +Y R G CKFG  CKF HP    M   + GS   P    PT   QL
Sbjct  354  RPGEPVCTFYSRYGICKFGPNCKFDHP----MGTVMYGSVTSPTSDVPTLHYQL  403


 Score = 76.6 bits (187),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 35/77 (45%), Positives = 47/77 (61%), Gaps = 1/77 (1%)
 Frame = +1

Query  505  TYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKL-AIAAARMKGEYPERVGQPECQYY  681
             +P R  +P+C +Y++TG C+FGA C+FNHP  R + A   A      P R G+P C +Y
Sbjct  304  VFPERPDQPECQFYMKTGDCKFGAVCKFNHPKERMIPAPNCALSPLGLPLRPGEPVCTFY  363

Query  682  LKTGACKFGATCKFHHP  732
             + G CKFG  CKF HP
Sbjct  364  SRYGICKFGPNCKFDHP  380



>emb|CDY28712.1| BnaCnng05980D [Brassica napus]
Length=390

 Score =   259 bits (661),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 118/182 (65%), Positives = 146/182 (80%), Gaps = 14/182 (8%)
 Frame = +1

Query  367  MDFEAAAGISASMASVTEGPSSLSPPLAQETLWQLSLRSMETMESGTYPVRDGEPDCSYY  546
            MDF A   +S           SLSP + QE +WQ++L   ETME+G+YP R GEP+CSYY
Sbjct  1    MDFNAGVPMS-----------SLSPLMTQEAMWQMNLSHDETMEAGSYPERPGEPNCSYY  49

Query  547  IRTGLCRFGASCRFNHPSNRKLAIAAARMKGEYPERVGQPECQYYLKTGACKFGATCKFH  726
            IRTGLCRFG++CRFNHP +R+L IA ARM+GEYPER+GQPEC+YYLKTG CKFG TCKFH
Sbjct  50   IRTGLCRFGSTCRFNHPPDRELVIATARMRGEYPERIGQPECEYYLKTGTCKFGVTCKFH  109

Query  727  HPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTCKFHHPQP---SNMMVPL  897
            HPR+KAGIAGRV+LN+LGYPLR N+++C Y++RTG CKFG+TCKF+HPQP   +++MVP 
Sbjct  110  HPRNKAGIAGRVSLNMLGYPLRSNEVDCAYFLRTGHCKFGATCKFNHPQPQPTTSLMVPT  169

Query  898  RG  903
             G
Sbjct  170  SG  171


 Score =   103 bits (258),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 45/76 (59%), Positives = 54/76 (71%), Gaps = 0/76 (0%)
 Frame = +1

Query  643  YPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYM  822
            +PER GQPECQ+Y+KTG CKFG  CKFHHPRD+        L+ +G PLRP +  C +Y 
Sbjct  271  FPERPGQPECQFYMKTGDCKFGTVCKFHHPRDRQAPPPDCLLSPIGLPLRPGEPLCVFYS  330

Query  823  RTGQCKFGSTCKFHHP  870
            R G CKFG +CKFHHP
Sbjct  331  RYGICKFGPSCKFHHP  346


 Score = 77.0 bits (188),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 33/79 (42%), Positives = 50/79 (63%), Gaps = 1/79 (1%)
 Frame = +1

Query  505  TYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKG-EYPERVGQPECQYY  681
             +P R G+P+C +Y++TG C+FG  C+F+HP +R+       +     P R G+P C +Y
Sbjct  270  VFPERPGQPECQFYMKTGDCKFGTVCKFHHPRDRQAPPPDCLLSPIGLPLRPGEPLCVFY  329

Query  682  LKTGACKFGATCKFHHPRD  738
             + G CKFG +CKFHHP +
Sbjct  330  SRYGICKFGPSCKFHHPME  348


 Score = 50.8 bits (120),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 19/31 (61%), Positives = 24/31 (77%), Gaps = 0/31 (0%)
 Frame = +1

Query  781  YPLRPNDIECPYYMRTGQCKFGSTCKFHHPQ  873
            +P RP   EC +YM+TG CKFG+ CKFHHP+
Sbjct  271  FPERPGQPECQFYMKTGDCKFGTVCKFHHPR  301



>ref|XP_004979252.1| PREDICTED: zinc finger CCCH domain-containing protein 63-like 
isoform X2 [Setaria italica]
Length=448

 Score =   261 bits (666),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 121/168 (72%), Positives = 140/168 (83%), Gaps = 3/168 (2%)
 Frame = +1

Query  445  LAQETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAA  624
            + QE +WQ++L   E +E G YP R GEPDCSYY+RTG+CRFG +C+FNHP++RKLA+AA
Sbjct  37   VDQEAMWQMNLG--EAVELGPYPERVGEPDCSYYMRTGMCRFGMTCKFNHPADRKLAVAA  94

Query  625  ARMKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDI  804
            ARMKGEYP+R GQPECQYYLKTG CKFGATCKFHHPR+KA +A RV LN LGYP RPN+ 
Sbjct  95   ARMKGEYPQRSGQPECQYYLKTGTCKFGATCKFHHPREKAAMATRVQLNELGYPFRPNEK  154

Query  805  ECPYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQ  948
            EC YY+RTGQCKFGSTCKFHHPQPS MMV +RGS  Y P  S T+PGQ
Sbjct  155  ECAYYLRTGQCKFGSTCKFHHPQPSTMMVAVRGS-GYSPGQSATSPGQ  201


 Score =   103 bits (257),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 46/87 (53%), Positives = 58/87 (67%), Gaps = 0/87 (0%)
 Frame = +1

Query  610  LAIAAARMKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPL  789
            + + A + +  +PER  QPECQ+Y+KTG CKFGA CKFHHPR++       AL+ LG PL
Sbjct  298  VGLYAVQRENVFPERPDQPECQFYMKTGDCKFGAVCKFHHPRERIIPTPNCALSSLGLPL  357

Query  790  RPNDIECPYYMRTGQCKFGSTCKFHHP  870
            RP +  C +Y R G CKFG  CKF HP
Sbjct  358  RPGEPICSFYSRYGMCKFGPNCKFDHP  384


 Score = 73.9 bits (180),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 32/77 (42%), Positives = 46/77 (60%), Gaps = 1/77 (1%)
 Frame = +1

Query  505  TYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKG-EYPERVGQPECQYY  681
             +P R  +P+C +Y++TG C+FGA C+F+HP  R +      +     P R G+P C +Y
Sbjct  308  VFPERPDQPECQFYMKTGDCKFGAVCKFHHPRERIIPTPNCALSSLGLPLRPGEPICSFY  367

Query  682  LKTGACKFGATCKFHHP  732
             + G CKFG  CKF HP
Sbjct  368  SRYGMCKFGPNCKFDHP  384



>gb|AAF26977.1|AC018363_22 zinc finger protein 1 (zfn1) [Arabidopsis thaliana]
Length=377

 Score =   258 bits (660),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 113/155 (73%), Positives = 136/155 (88%), Gaps = 2/155 (1%)
 Frame = +1

Query  460  LWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKG  639
            +WQ++L S ETME+G+YP R GEPDCSYYIRTGLCRFG++CRFNHP +R+L IA ARM+G
Sbjct  1    MWQMNLSSDETMETGSYPERPGEPDCSYYIRTGLCRFGSTCRFNHPRDRELVIATARMRG  60

Query  640  EYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYY  819
            EYPER+GQPEC+YYLKTG CKFG TCKFHHPR+KAGIAGRV+LN+LGYPLR N+++C Y+
Sbjct  61   EYPERIGQPECEYYLKTGTCKFGVTCKFHHPRNKAGIAGRVSLNMLGYPLRSNEVDCAYF  120

Query  820  MRTGQCKFGSTCKFHH--PQPSNMMVPLRGSPAYP  918
            +RTG CKFG TCKF+H  PQP+NMMVP  G  +YP
Sbjct  121  LRTGHCKFGGTCKFNHPQPQPTNMMVPTSGQQSYP  155


 Score =   101 bits (251),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 44/76 (58%), Positives = 53/76 (70%), Gaps = 0/76 (0%)
 Frame = +1

Query  643  YPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYM  822
            +PER GQPECQ+Y+KTG CKFG  CKFHHPRD+        L+ +G PLRP +  C +Y 
Sbjct  251  FPERPGQPECQFYMKTGDCKFGTVCKFHHPRDRQAPPPDCLLSSIGLPLRPGEPLCVFYT  310

Query  823  RTGQCKFGSTCKFHHP  870
            R G CKFG +CKF HP
Sbjct  311  RYGICKFGPSCKFDHP  326


 Score = 74.3 bits (181),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 32/77 (42%), Positives = 48/77 (62%), Gaps = 1/77 (1%)
 Frame = +1

Query  505  TYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKG-EYPERVGQPECQYY  681
             +P R G+P+C +Y++TG C+FG  C+F+HP +R+       +     P R G+P C +Y
Sbjct  250  VFPERPGQPECQFYMKTGDCKFGTVCKFHHPRDRQAPPPDCLLSSIGLPLRPGEPLCVFY  309

Query  682  LKTGACKFGATCKFHHP  732
             + G CKFG +CKF HP
Sbjct  310  TRYGICKFGPSCKFDHP  326


 Score = 51.6 bits (122),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 49/179 (27%), Positives = 71/179 (40%), Gaps = 62/179 (35%)
 Frame = +1

Query  508  YPVRDGEPDCSYYIRTG------LCRFG------------ASCRFNHPSNRKLAIAAARM  633
            YP+R  E DC+Y++RTG       C+F              S + ++P +R   IA+ R 
Sbjct  108  YPLRSNEVDCAYFLRTGHCKFGGTCKFNHPQPQPTNMMVPTSGQQSYPWSRASFIASPRW  167

Query  634  K------------GEYPERVGQPECQYYLKTGACKFGATCK-------------------  720
            +            G  P +   P   Y  + G+     T                     
Sbjct  168  QDPSSYASLIMPQGVVPVQGWNP---YSGQLGSVSPSGTGNDQNYRNLQQNETIESGSQS  224

Query  721  -----FHHPRDKAGIAGRVAL---NVLGYPLRPNDIECPYYMRTGQCKFGSTCKFHHPQ  873
                  ++P     + G  AL   NV  +P RP   EC +YM+TG CKFG+ CKFHHP+
Sbjct  225  QGSFSGYNPGSSVPLGGYYALPRENV--FPERPGQPECQFYMKTGDCKFGTVCKFHHPR  281



>ref|XP_008676804.1| PREDICTED: hypothetical protein isoform X2 [Zea mays]
 gb|AFW60817.1| hypothetical protein ZEAMMB73_909252 [Zea mays]
Length=407

 Score =   259 bits (661),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 120/163 (74%), Positives = 138/163 (85%), Gaps = 3/163 (2%)
 Frame = +1

Query  460  LWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKG  639
            +WQ++L   E ME G YP R GEPDCSYY+RTG+CRFG +C+FNHP++RKLA+AAARMKG
Sbjct  1    MWQMNLE--EAMELGPYPERVGEPDCSYYMRTGMCRFGMTCKFNHPADRKLAVAAARMKG  58

Query  640  EYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYY  819
            EYP+R+GQPECQYYLKTG CKFGATCKFHHPR+KA +A RV LN LGYPLRPN+ EC YY
Sbjct  59   EYPQRIGQPECQYYLKTGTCKFGATCKFHHPREKAAMATRVQLNELGYPLRPNEKECAYY  118

Query  820  MRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQ  948
            +RTGQCKFGSTCKFHH QPS MMV +RGS  Y P  S T+PGQ
Sbjct  119  LRTGQCKFGSTCKFHHSQPSTMMVAVRGS-VYSPGQSATSPGQ  160


 Score =   102 bits (255),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 47/92 (51%), Positives = 60/92 (65%), Gaps = 0/92 (0%)
 Frame = +1

Query  610  LAIAAARMKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPL  789
            + + A + +  +PER  QPECQ+Y+KTG CKFGA CKFHHPR++       AL+ LG PL
Sbjct  256  VGLYAVQRENLFPERPDQPECQFYMKTGDCKFGAVCKFHHPRERIIPTPNCALSPLGLPL  315

Query  790  RPNDIECPYYMRTGQCKFGSTCKFHHPQPSNM  885
            RP +  C +Y R G CKFG  CKF HP  + M
Sbjct  316  RPGEPICSFYNRYGMCKFGPNCKFDHPMGNAM  347


 Score = 73.2 bits (178),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 33/80 (41%), Positives = 47/80 (59%), Gaps = 1/80 (1%)
 Frame = +1

Query  508  YPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKG-EYPERVGQPECQYYL  684
            +P R  +P+C +Y++TG C+FGA C+F+HP  R +      +     P R G+P C +Y 
Sbjct  267  FPERPDQPECQFYMKTGDCKFGAVCKFHHPRERIIPTPNCALSPLGLPLRPGEPICSFYN  326

Query  685  KTGACKFGATCKFHHPRDKA  744
            + G CKFG  CKF HP   A
Sbjct  327  RYGMCKFGPNCKFDHPMGNA  346



>ref|XP_009626543.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X2 [Nicotiana tomentosiformis]
Length=406

 Score =   258 bits (660),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 123/169 (73%), Positives = 135/169 (80%), Gaps = 21/169 (12%)
 Frame = +1

Query  409  SVTEGPSSLSPPLAQETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRF  588
            S++EGP SLSP L Q++LWQ++LRSME+MESG YPVR+GEPDCSYYIRTGLCRFG++CRF
Sbjct  4    SMSEGPPSLSPSLRQDSLWQMNLRSMESMESGPYPVREGEPDCSYYIRTGLCRFGSTCRF  63

Query  589  NHPSNRKLAIAAARMKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVAL  768
            NHP NRKL                     YYLKTG CKFGATCKFHHPRDKAGIAGRV L
Sbjct  64   NHPPNRKL---------------------YYLKTGTCKFGATCKFHHPRDKAGIAGRVTL  102

Query  769  NVLGYPLRPNDIECPYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAY  915
            NVLGYPLRPN+ EC YYMRT QCKFGSTCKFHHP+PSNMMV  RGSP Y
Sbjct  103  NVLGYPLRPNENECTYYMRTAQCKFGSTCKFHHPEPSNMMVSSRGSPVY  151


 Score =   101 bits (251),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 46/89 (52%), Positives = 61/89 (69%), Gaps = 2/89 (2%)
 Frame = +1

Query  610  LAIAAARMKGE--YPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGY  783
            L +    ++GE  +PER+GQPECQ+Y+KTG CKFGA C+FHHPR++        L+ +G 
Sbjct  249  LPVGYYALEGENVFPERLGQPECQFYMKTGDCKFGAVCRFHHPRERLLPPPDCLLSPIGL  308

Query  784  PLRPNDIECPYYMRTGQCKFGSTCKFHHP  870
            PLRP +  C +Y R G CKFG +CKF HP
Sbjct  309  PLRPGEPMCIFYSRYGICKFGPSCKFDHP  337


 Score = 75.9 bits (185),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 35/77 (45%), Positives = 48/77 (62%), Gaps = 1/77 (1%)
 Frame = +1

Query  505  TYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKG-EYPERVGQPECQYY  681
             +P R G+P+C +Y++TG C+FGA CRF+HP  R L      +     P R G+P C +Y
Sbjct  261  VFPERLGQPECQFYMKTGDCKFGAVCRFHHPRERLLPPPDCLLSPIGLPLRPGEPMCIFY  320

Query  682  LKTGACKFGATCKFHHP  732
             + G CKFG +CKF HP
Sbjct  321  SRYGICKFGPSCKFDHP  337


 Score = 58.5 bits (140),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 50/192 (26%), Positives = 74/192 (39%), Gaps = 64/192 (33%)
 Frame = +1

Query  490  TMESGTYPVRDGEPDCSYYIRTGLCRFGASCRF---------------------------  588
            T+    YP+R  E +C+YY+RT  C+FG++C+F                           
Sbjct  101  TLNVLGYPLRPNENECTYYMRTAQCKFGSTCKFHHPEPSNMMVSSRGSPVYPPGPSPTTP  160

Query  589  ---NHPSNRKLAIAAARMKGEY---PERVGQPECQYYLKTGACKFGATCKFHHPRDKAG-  747
               ++P +R   I+ AR +G     P  V Q    +   T   + GA       +  AG 
Sbjct  161  GQMSYPLSRASFISGARWQGSSSYAPLPVLQGVVSFPGFTYNGQLGAVSSAEDQQQTAGN  220

Query  748  -------------IAGRVALNV--------LGY---------PLRPNDIECPYYMRTGQC  837
                           G   +N         +GY         P R    EC +YM+TG C
Sbjct  221  NQVYGSSRSSDKATMGSEGMNSSYRASSLPVGYYALEGENVFPERLGQPECQFYMKTGDC  280

Query  838  KFGSTCKFHHPQ  873
            KFG+ C+FHHP+
Sbjct  281  KFGAVCRFHHPR  292



>ref|XP_006663970.1| PREDICTED: zinc finger CCCH domain-containing protein 66-like 
isoform X2 [Oryza brachyantha]
Length=409

 Score =   258 bits (659),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 122/164 (74%), Positives = 137/164 (84%), Gaps = 2/164 (1%)
 Frame = +1

Query  460  LWQLSLRSM-ETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMK  636
            +WQ++L    E+MES  YP R GEPDCSYY+RTGLCRFG +C+FNHP NRKLA+AAARM 
Sbjct  1    MWQMTLGGGGESMESVPYPERIGEPDCSYYMRTGLCRFGMTCKFNHPPNRKLAVAAARMN  60

Query  637  GEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPY  816
            GEYP RVGQPECQYYLKTG CKFGATCKFHHPR+KA +A RV LNVLGYP+RPN+ EC Y
Sbjct  61   GEYPYRVGQPECQYYLKTGTCKFGATCKFHHPREKAALATRVQLNVLGYPMRPNEKECAY  120

Query  817  YMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQ  948
            Y+RTGQCKF STCKFHHPQPSN MV +RGS  Y P  S T+PGQ
Sbjct  121  YLRTGQCKFASTCKFHHPQPSNTMVSMRGS-MYSPGQSATSPGQ  163


 Score =   104 bits (260),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 51/102 (50%), Positives = 63/102 (62%), Gaps = 2/102 (2%)
 Frame = +1

Query  586  FNHPSNRKLAIAAARMKGE--YPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGR  759
            F       + I    ++GE  +PER  QPECQ+Y+KTG CKFGA CKFHHP+++   A  
Sbjct  249  FQSYQGSSVPIGVYTVQGENIFPERPDQPECQFYMKTGDCKFGAVCKFHHPKERLVPAPN  308

Query  760  VALNVLGYPLRPNDIECPYYMRTGQCKFGSTCKFHHPQPSNM  885
             ALN LG PLRP +  C +Y R G CKFG  CKF HP  + M
Sbjct  309  CALNSLGLPLRPGEPVCTFYSRYGICKFGPNCKFDHPMGTLM  350


 Score = 73.9 bits (180),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 47/76 (62%), Gaps = 1/76 (1%)
 Frame = +1

Query  508  YPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKL-AIAAARMKGEYPERVGQPECQYYL  684
            +P R  +P+C +Y++TG C+FGA C+F+HP  R + A   A      P R G+P C +Y 
Sbjct  270  FPERPDQPECQFYMKTGDCKFGAVCKFHHPKERLVPAPNCALNSLGLPLRPGEPVCTFYS  329

Query  685  KTGACKFGATCKFHHP  732
            + G CKFG  CKF HP
Sbjct  330  RYGICKFGPNCKFDHP  345



>ref|XP_004979251.1| PREDICTED: zinc finger CCCH domain-containing protein 63-like 
isoform X1 [Setaria italica]
Length=450

 Score =   259 bits (661),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 120/165 (73%), Positives = 138/165 (84%), Gaps = 3/165 (2%)
 Frame = +1

Query  454  ETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARM  633
            E +WQ++L   E +E G YP R GEPDCSYY+RTG+CRFG +C+FNHP++RKLA+AAARM
Sbjct  42   EAMWQMNLG--EAVELGPYPERVGEPDCSYYMRTGMCRFGMTCKFNHPADRKLAVAAARM  99

Query  634  KGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECP  813
            KGEYP+R GQPECQYYLKTG CKFGATCKFHHPR+KA +A RV LN LGYP RPN+ EC 
Sbjct  100  KGEYPQRSGQPECQYYLKTGTCKFGATCKFHHPREKAAMATRVQLNELGYPFRPNEKECA  159

Query  814  YYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQ  948
            YY+RTGQCKFGSTCKFHHPQPS MMV +RGS  Y P  S T+PGQ
Sbjct  160  YYLRTGQCKFGSTCKFHHPQPSTMMVAVRGS-GYSPGQSATSPGQ  203


 Score =   103 bits (257),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 46/87 (53%), Positives = 58/87 (67%), Gaps = 0/87 (0%)
 Frame = +1

Query  610  LAIAAARMKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPL  789
            + + A + +  +PER  QPECQ+Y+KTG CKFGA CKFHHPR++       AL+ LG PL
Sbjct  300  VGLYAVQRENVFPERPDQPECQFYMKTGDCKFGAVCKFHHPRERIIPTPNCALSSLGLPL  359

Query  790  RPNDIECPYYMRTGQCKFGSTCKFHHP  870
            RP +  C +Y R G CKFG  CKF HP
Sbjct  360  RPGEPICSFYSRYGMCKFGPNCKFDHP  386


 Score = 73.9 bits (180),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 32/77 (42%), Positives = 46/77 (60%), Gaps = 1/77 (1%)
 Frame = +1

Query  505  TYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKG-EYPERVGQPECQYY  681
             +P R  +P+C +Y++TG C+FGA C+F+HP  R +      +     P R G+P C +Y
Sbjct  310  VFPERPDQPECQFYMKTGDCKFGAVCKFHHPRERIIPTPNCALSSLGLPLRPGEPICSFY  369

Query  682  LKTGACKFGATCKFHHP  732
             + G CKFG  CKF HP
Sbjct  370  SRYGMCKFGPNCKFDHP  386



>gb|EAY76977.1| hypothetical protein OsI_04935 [Oryza sativa Indica Group]
Length=440

 Score =   258 bits (660),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 121/183 (66%), Positives = 142/183 (78%), Gaps = 1/183 (1%)
 Frame = +1

Query  400  SMASVTEGPSSLSPPLAQETLWQ-LSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGA  576
            + A+ T+ PS     L  E +WQ +++     M+ G YP R GEPDC+YY+RTGLCRFG 
Sbjct  40   ATAAATDEPSHDPAALYGEGMWQQMTMSGSGAMQPGPYPERSGEPDCTYYLRTGLCRFGM  99

Query  577  SCRFNHPSNRKLAIAAARMKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAG  756
            SCRFNHP +R LAIA+ARMKGEYPER+GQPECQYYLKTG CKFG TCKFHHPR+KAGIAG
Sbjct  100  SCRFNHPQDRNLAIASARMKGEYPERMGQPECQYYLKTGTCKFGPTCKFHHPREKAGIAG  159

Query  757  RVALNVLGYPLRPNDIECPYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVHSPT  936
            RV LN LGYPLRP++ EC YY++TGQCK+G+TCKFHHP+  N M   RGSP YP VHS  
Sbjct  160  RVQLNTLGYPLRPSEKECAYYLKTGQCKYGNTCKFHHPELFNAMASSRGSPIYPSVHSSA  219

Query  937  TPG  945
            T G
Sbjct  220  TAG  222


 Score =   100 bits (249),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 50/98 (51%), Positives = 61/98 (62%), Gaps = 4/98 (4%)
 Frame = +1

Query  622  AARMKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPND  801
            A + +  +PER  QPECQYY+KTG CKFGA CKFHHPR ++       L+ +G PLRP +
Sbjct  323  ALQRENVFPERPDQPECQYYMKTGDCKFGAVCKFHHPRVRSMPTPDCVLSPVGLPLRPGE  382

Query  802  IECPYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAY  915
              C +Y R G CKFG+ CKF HP     M P  G  AY
Sbjct  383  ELCKFYSRYGICKFGANCKFDHP----TMAPPMGVYAY  416


 Score = 74.3 bits (181),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 33/77 (43%), Positives = 47/77 (61%), Gaps = 1/77 (1%)
 Frame = +1

Query  505  TYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKGE-YPERVGQPECQYY  681
             +P R  +P+C YY++TG C+FGA C+F+HP  R +      +     P R G+  C++Y
Sbjct  329  VFPERPDQPECQYYMKTGDCKFGAVCKFHHPRVRSMPTPDCVLSPVGLPLRPGEELCKFY  388

Query  682  LKTGACKFGATCKFHHP  732
             + G CKFGA CKF HP
Sbjct  389  SRYGICKFGANCKFDHP  405



>ref|NP_001045201.2| Os01g0917400 [Oryza sativa Japonica Group]
 sp|Q5JLB5.2|C3H12_ORYSJ RecName: Full=Zinc finger CCCH domain-containing protein 12; 
Short=OsC3H12; AltName: Full=Zinc finger CCCH domain-containing 
protein ZFN-like 2 [Oryza sativa Japonica Group]
 dbj|BAD87735.1| putative zinc finger protein [Oryza sativa Japonica Group]
 dbj|BAG93826.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAF07115.2| Os01g0917400 [Oryza sativa Japonica Group]
 gb|AEM43044.1| CCCH-type zinc finger protein [Oryza sativa Indica Group]
Length=439

 Score =   258 bits (659),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 121/181 (67%), Positives = 141/181 (78%), Gaps = 1/181 (1%)
 Frame = +1

Query  406  ASVTEGPSSLSPPLAQETLWQ-LSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASC  582
            A+ T+ PS     L  E +WQ +++     M+ G YP R GEPDC+YY+RTGLCRFG SC
Sbjct  42   AAATDEPSHDPAALYGEGMWQQMTMSGSGAMQPGPYPERSGEPDCTYYLRTGLCRFGMSC  101

Query  583  RFNHPSNRKLAIAAARMKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRV  762
            RFNHP +R LAIA+ARMKGEYPER+GQPECQYYLKTG CKFG TCKFHHPR+KAGIAGRV
Sbjct  102  RFNHPQDRNLAIASARMKGEYPERMGQPECQYYLKTGTCKFGPTCKFHHPREKAGIAGRV  161

Query  763  ALNVLGYPLRPNDIECPYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVHSPTTP  942
             LN LGYPLRP++ EC YY++TGQCK+G+TCKFHHP+  N M   RGSP YP VHS  T 
Sbjct  162  QLNTLGYPLRPSEKECAYYLKTGQCKYGNTCKFHHPELFNAMASSRGSPIYPSVHSSATA  221

Query  943  G  945
            G
Sbjct  222  G  222


 Score =   100 bits (249),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 50/98 (51%), Positives = 61/98 (62%), Gaps = 4/98 (4%)
 Frame = +1

Query  622  AARMKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPND  801
            A + +  +PER  QPECQYY+KTG CKFGA CKFHHPR ++       L+ +G PLRP +
Sbjct  322  ALQRENVFPERPDQPECQYYMKTGDCKFGAVCKFHHPRVRSMPTPDCVLSPVGLPLRPGE  381

Query  802  IECPYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAY  915
              C +Y R G CKFG+ CKF HP     M P  G  AY
Sbjct  382  ELCKFYSRYGICKFGANCKFDHP----TMAPPMGVYAY  415


 Score = 74.3 bits (181),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 33/77 (43%), Positives = 47/77 (61%), Gaps = 1/77 (1%)
 Frame = +1

Query  505  TYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKGE-YPERVGQPECQYY  681
             +P R  +P+C YY++TG C+FGA C+F+HP  R +      +     P R G+  C++Y
Sbjct  328  VFPERPDQPECQYYMKTGDCKFGAVCKFHHPRVRSMPTPDCVLSPVGLPLRPGEELCKFY  387

Query  682  LKTGACKFGATCKFHHP  732
             + G CKFGA CKF HP
Sbjct  388  SRYGICKFGANCKFDHP  404



>emb|CDX92015.1| BnaC03g33170D [Brassica napus]
Length=371

 Score =   254 bits (649),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 116/163 (71%), Positives = 141/163 (87%), Gaps = 5/163 (3%)
 Frame = +1

Query  427  SSLSPPLA-QETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSN  603
            SSLSP +  QE +WQ+++ S ETME G+YP R GEPDCSYYIRTGLCRFG++CRFNHP +
Sbjct  2    SSLSPLMINQEAMWQMNMTSDETMEPGSYPERPGEPDCSYYIRTGLCRFGSTCRFNHPRD  61

Query  604  RKLAIAAARMKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGY  783
            R+L IA ARM+GEYPER+GQPEC+YYLKTG CKFG TCKFHHPR+KAGIAGRV+LN+LGY
Sbjct  62   RELVIATARMRGEYPERIGQPECEYYLKTGTCKFGVTCKFHHPRNKAGIAGRVSLNMLGY  121

Query  784  PLRPNDIECPYYMRTGQCKFGSTCKFHHPQP---SNMMVPLRG  903
            PLR N+++C Y++RTG CKFG+TCKF+HPQP   +N+MVP  G
Sbjct  122  PLR-NEVDCAYFLRTGHCKFGATCKFNHPQPQPTTNLMVPTSG  163


 Score =   103 bits (258),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 47/86 (55%), Positives = 57/86 (66%), Gaps = 0/86 (0%)
 Frame = +1

Query  613  AIAAARMKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLR  792
             I A   +  +PER GQPECQ+Y+KTG CKFG  CKFHHPRD+        L+ +G PLR
Sbjct  236  GIYALPSESVFPERPGQPECQFYVKTGDCKFGTVCKFHHPRDRQTPPPDCLLSPIGLPLR  295

Query  793  PNDIECPYYMRTGQCKFGSTCKFHHP  870
            P +  C +Y R G CKFG +CKFHHP
Sbjct  296  PGEPSCVFYSRYGICKFGPSCKFHHP  321


 Score = 78.2 bits (191),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 33/77 (43%), Positives = 49/77 (64%), Gaps = 1/77 (1%)
 Frame = +1

Query  505  TYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKG-EYPERVGQPECQYY  681
             +P R G+P+C +Y++TG C+FG  C+F+HP +R+       +     P R G+P C +Y
Sbjct  245  VFPERPGQPECQFYVKTGDCKFGTVCKFHHPRDRQTPPPDCLLSPIGLPLRPGEPSCVFY  304

Query  682  LKTGACKFGATCKFHHP  732
             + G CKFG +CKFHHP
Sbjct  305  SRYGICKFGPSCKFHHP  321


 Score = 73.2 bits (178),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 50/159 (31%), Positives = 73/159 (46%), Gaps = 40/159 (25%)
 Frame = +1

Query  508  YPVRDGEPDCSYYIRTGLCRFGASCRFNHPS---NRKLAIAAARMKGEYPER----VGQP  666
            YP+R+ E DC+Y++RTG C+FGA+C+FNHP       L +  +  +  YP      +  P
Sbjct  121  YPLRN-EVDCAYFLRTGHCKFGATCKFNHPQPQPTTNLMVPTSGQQQSYPWSRASFIPTP  179

Query  667  ECQ------------------YYLKTGACKFGATCKFHHPRDK------------AGIAG  756
              Q                  Y  + G+     T   H+   K             GI  
Sbjct  180  RWQDTSGFTALMMPQGVIWNPYTSQLGSVSPSGTGNDHNNYRKLQQNESGSSVPQGGIYA  239

Query  757  RVALNVLGYPLRPNDIECPYYMRTGQCKFGSTCKFHHPQ  873
              + +V  +P RP   EC +Y++TG CKFG+ CKFHHP+
Sbjct  240  LPSESV--FPERPGQPECQFYVKTGDCKFGTVCKFHHPR  276



>gb|EMS50271.1| Zinc finger CCCH domain-containing protein 12 [Triticum urartu]
Length=406

 Score =   255 bits (652),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 117/168 (70%), Positives = 138/168 (82%), Gaps = 1/168 (1%)
 Frame = +1

Query  445  LAQETLWQ-LSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIA  621
            +  E +WQ +++ S  TM+SG YPVR GEPDC+YY+RTGLCRFG SCRFNHP +R  AIA
Sbjct  19   MKVEGMWQQMAMSSGATMQSGPYPVRPGEPDCTYYLRTGLCRFGMSCRFNHPQDRNTAIA  78

Query  622  AARMKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPND  801
            +ARMKGEYPERVGQPECQYYLKTG CKFG TCKFHHPR+KAGIAG V LN LGYPLRPN+
Sbjct  79   SARMKGEYPERVGQPECQYYLKTGTCKFGPTCKFHHPREKAGIAGMVQLNTLGYPLRPNE  138

Query  802  IECPYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVHSPTTPG  945
             EC YY++TGQCK+G+TCKF+HP+  N +   RGSP YPPVH+  + G
Sbjct  139  RECAYYLKTGQCKYGNTCKFNHPEIFNAVASSRGSPIYPPVHNSGSTG  186


 Score = 96.3 bits (238),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 46/90 (51%), Positives = 57/90 (63%), Gaps = 0/90 (0%)
 Frame = +1

Query  622  AARMKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPND  801
            A + +  +PER  QPEC YY+KTG CKFGA CKFHHPR ++       L+ +G PLRP +
Sbjct  287  ALQRENVFPERPDQPECIYYIKTGDCKFGAVCKFHHPRVRSQPPPDCILSPMGLPLRPGE  346

Query  802  IECPYYMRTGQCKFGSTCKFHHPQPSNMMV  891
              C +Y R G CKFG  CKF HP  + M V
Sbjct  347  ELCKFYSRYGICKFGVNCKFDHPMAAPMGV  376


 Score = 70.1 bits (170),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 33/77 (43%), Positives = 45/77 (58%), Gaps = 1/77 (1%)
 Frame = +1

Query  505  TYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMK-GEYPERVGQPECQYY  681
             +P R  +P+C YYI+TG C+FGA C+F+HP  R        +     P R G+  C++Y
Sbjct  293  VFPERPDQPECIYYIKTGDCKFGAVCKFHHPRVRSQPPPDCILSPMGLPLRPGEELCKFY  352

Query  682  LKTGACKFGATCKFHHP  732
             + G CKFG  CKF HP
Sbjct  353  SRYGICKFGVNCKFDHP  369



>ref|NP_568332.2| zinc finger nuclease 3 [Arabidopsis thaliana]
 gb|AAD27875.1|AF138872_1 zinc finger protein 3 [Arabidopsis thaliana]
 dbj|BAB09623.1| zinc finger protein 3 [Arabidopsis thaliana]
 gb|AED92306.1| zinc finger nuclease 3 [Arabidopsis thaliana]
Length=368

 Score =   253 bits (647),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 115/179 (64%), Positives = 143/179 (80%), Gaps = 3/179 (2%)
 Frame = +1

Query  409  SVTEGPSSLSPPLAQETLWQLSLRSMETM-ESGTYPVRDGEPDCSYYIRTGLCRFGASCR  585
            S++   + LSP L Q  +WQ++L S +TM   G+YP R GEPDC+YYIRTGLCRFG++CR
Sbjct  5    SISRESTFLSPLLNQNAMWQMNLGSDDTMGVDGSYPERHGEPDCAYYIRTGLCRFGSTCR  64

Query  586  FNHPSNRKLAIAAARMKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVA  765
            FNHP +RKL IA AR+KGEYPER+GQPEC++YLKTG CKFG TCKFHHPR+KAGI G V+
Sbjct  65   FNHPHDRKLVIATARIKGEYPERIGQPECEFYLKTGTCKFGVTCKFHHPRNKAGIDGSVS  124

Query  766  LNVLGYPLRPNDIECPYYMRTGQCKFGSTCKFHHP--QPSNMMVPLRGSPAYPPVHSPT  936
            +NVL YPLRPN+ +C Y++R GQCKFG TCKF+HP  Q +N+MV +RGSP Y  + S T
Sbjct  125  VNVLSYPLRPNEDDCSYFLRIGQCKFGGTCKFNHPQTQSTNLMVSVRGSPVYSALQSLT  183


 Score = 86.7 bits (213),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 44/87 (51%), Positives = 52/87 (60%), Gaps = 7/87 (8%)
 Frame = +1

Query  610  LAIAAARMKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPL  789
            L   A   +  +PER GQPECQ+Y+KTG CKFG  CKFHHPRD+        L+  G PL
Sbjct  229  LGFYALPRENVFPERPGQPECQFYMKTGDCKFGTVCKFHHPRDRQTPPPDCVLSS-GEPL  287

Query  790  RPNDIECPYYMRTGQCKFGSTCKFHHP  870
                  C +Y R G CKFG +CKF HP
Sbjct  288  ------CVFYSRYGICKFGPSCKFDHP  308


 Score = 80.5 bits (197),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 47/144 (33%), Positives = 69/144 (48%), Gaps = 23/144 (16%)
 Frame = +1

Query  505  TYPVRDGEPDCSYYIRTGLCRFGASCRFNHP----SNRKLAIAAARMKGEYPERVGQPEC  672
            +YP+R  E DCSY++R G C+FG +C+FNHP    +N  +++  + +        GQP  
Sbjct  129  SYPLRPNEDDCSYFLRIGQCKFGGTCKFNHPQTQSTNLMVSVRGSPVYSALQSLTGQPSY  188

Query  673  QYY----------------LKTGACKFGATCKFHHPRDK-AGIAGRVALNVLGYPLRPND  801
             +                   +G+     +  FH       G       NV  +P RP  
Sbjct  189  SWSRTSFVANPPRLQDPSGFASGSQGGLFSSGFHSGNSVPLGFYALPRENV--FPERPGQ  246

Query  802  IECPYYMRTGQCKFGSTCKFHHPQ  873
             EC +YM+TG CKFG+ CKFHHP+
Sbjct  247  PECQFYMKTGDCKFGTVCKFHHPR  270


 Score = 71.2 bits (173),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 30/77 (39%), Positives = 46/77 (60%), Gaps = 6/77 (8%)
 Frame = +1

Query  502  GTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKGEYPERVGQPECQYY  681
              +P R G+P+C +Y++TG C+FG  C+F+HP +R+       +        G+P C +Y
Sbjct  238  NVFPERPGQPECQFYMKTGDCKFGTVCKFHHPRDRQTPPPDCVLSS------GEPLCVFY  291

Query  682  LKTGACKFGATCKFHHP  732
             + G CKFG +CKF HP
Sbjct  292  SRYGICKFGPSCKFDHP  308



>ref|NP_001130819.1| uncharacterized protein LOC100191923 [Zea mays]
 gb|ACF79183.1| unknown [Zea mays]
 gb|ACG29102.1| zinc finger CCCH type domain-containing protein ZFN-like [Zea 
mays]
 gb|ACN25540.1| unknown [Zea mays]
 gb|ACN28916.1| unknown [Zea mays]
 gb|ACR36098.1| unknown [Zea mays]
 gb|AFT82657.1| C3H19 transcription factor, partial [Zea mays subsp. mays]
 tpg|DAA38868.1| TPA: putative Zinc finger CCCH type domain-containing protein 
ZFN [Zea mays]
Length=443

 Score =   255 bits (652),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 118/165 (72%), Positives = 138/165 (84%), Gaps = 3/165 (2%)
 Frame = +1

Query  454  ETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARM  633
            E +WQ++L   + ME G YP R G+PDCSYY+RTG+CRFG +C+FNHP++RKLA+AAARM
Sbjct  35   EAMWQMNLG--DAMELGPYPERVGDPDCSYYMRTGMCRFGMTCKFNHPADRKLAVAAARM  92

Query  634  KGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECP  813
            KGEYP+R+GQPECQYYLKTG CKFGATCKFHHPR+KA +A RV LN LGYPLR N+ EC 
Sbjct  93   KGEYPQRIGQPECQYYLKTGTCKFGATCKFHHPREKAAMATRVQLNELGYPLRLNEKECA  152

Query  814  YYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQ  948
            YY+RTGQCKFGSTCKFHHPQPS MMV +RGS  Y P  S T+PG 
Sbjct  153  YYLRTGQCKFGSTCKFHHPQPSTMMVAVRGS-VYSPGQSATSPGH  196


 Score =   107 bits (268),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 53/113 (47%), Positives = 68/113 (60%), Gaps = 9/113 (8%)
 Frame = +1

Query  610  LAIAAARMKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPL  789
            + + A + +  +PER  QPECQ+Y+KTG CKFG+ CKFHHPR++       AL+ LG PL
Sbjct  293  VGLYAVQTENVFPERPDQPECQFYMKTGDCKFGSVCKFHHPRERIIPTPNCALSPLGLPL  352

Query  790  RPNDIECPYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQ  948
            RP +  C +Y R G CKFG  CKFHHP          G+P Y    SPT+  Q
Sbjct  353  RPGEPICSFYNRYGMCKFGPNCKFHHPM---------GNPMYGHASSPTSEAQ  396


 Score = 74.7 bits (182),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 32/77 (42%), Positives = 47/77 (61%), Gaps = 1/77 (1%)
 Frame = +1

Query  505  TYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKG-EYPERVGQPECQYY  681
             +P R  +P+C +Y++TG C+FG+ C+F+HP  R +      +     P R G+P C +Y
Sbjct  303  VFPERPDQPECQFYMKTGDCKFGSVCKFHHPRERIIPTPNCALSPLGLPLRPGEPICSFY  362

Query  682  LKTGACKFGATCKFHHP  732
             + G CKFG  CKFHHP
Sbjct  363  NRYGMCKFGPNCKFHHP  379



>ref|XP_010420349.1| PREDICTED: zinc finger CCCH domain-containing protein 57-like 
isoform X1 [Camelina sativa]
Length=415

 Score =   254 bits (650),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 119/194 (61%), Positives = 144/194 (74%), Gaps = 11/194 (6%)
 Frame = +1

Query  367  MDFEAAAGISASMASVTEGPSSLSPPLAQETLWQLSLRSMETMESGT--YPVRDGEPDCS  540
            MDF+       S   +T   +SLSP L Q  +WQ++L S ETM  G   YP R GEPDCS
Sbjct  1    MDFD-------SRVPITRESTSLSPLLHQNAMWQMNLGSDETMSGGDGFYPERQGEPDCS  53

Query  541  YYIRTGLCRFGASCRFNHPSNRKLAIAAARMKGEYPERVGQPECQYYLKTGACKFGATCK  720
            YYIRTGLCRFG++CRFNHP +RKL IA AR KGEYPER+GQPEC++Y+KTG CKFG TCK
Sbjct  54   YYIRTGLCRFGSTCRFNHPHDRKLVIATARTKGEYPERIGQPECEFYMKTGTCKFGVTCK  113

Query  721  FHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTCKFHHP--QPSNMMVP  894
            FHHPR+  G  GRV+++VLGYPLRPN+ +C Y++RTG CKFG TCKF+HP  Q + +MV 
Sbjct  114  FHHPRNNVGTDGRVSVDVLGYPLRPNEDDCSYFLRTGHCKFGGTCKFNHPQTQSTKLMVS  173

Query  895  LRGSPAYPPVHSPT  936
            LRGSP Y  + S T
Sbjct  174  LRGSPVYSALQSLT  187


 Score = 80.5 bits (197),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 39/76 (51%), Positives = 48/76 (63%), Gaps = 6/76 (8%)
 Frame = +1

Query  643  YPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYM  822
            +PER GQ ECQ+Y+KTG       CKFHHPRD+   A    L+ +G PLR  +  C +Y 
Sbjct  283  FPERPGQLECQFYMKTG------DCKFHHPRDRQTPAPDCVLSTVGLPLRLGEPLCVFYS  336

Query  823  RTGQCKFGSTCKFHHP  870
            R G CKFG +CKF HP
Sbjct  337  RYGICKFGPSCKFDHP  352


 Score = 59.7 bits (143),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 29/76 (38%), Positives = 44/76 (58%), Gaps = 7/76 (9%)
 Frame = +1

Query  508  YPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKL-AIAAARMKGEYPERVGQPECQYYL  684
            +P R G+ +C +Y++TG       C+F+HP +R+  A          P R+G+P C +Y 
Sbjct  283  FPERPGQLECQFYMKTG------DCKFHHPRDRQTPAPDCVLSTVGLPLRLGEPLCVFYS  336

Query  685  KTGACKFGATCKFHHP  732
            + G CKFG +CKF HP
Sbjct  337  RYGICKFGPSCKFDHP  352



>ref|XP_010420350.1| PREDICTED: zinc finger CCCH domain-containing protein 57-like 
isoform X2 [Camelina sativa]
Length=413

 Score =   254 bits (649),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 119/194 (61%), Positives = 144/194 (74%), Gaps = 11/194 (6%)
 Frame = +1

Query  367  MDFEAAAGISASMASVTEGPSSLSPPLAQETLWQLSLRSMETMESGT--YPVRDGEPDCS  540
            MDF+       S   +T   +SLSP L Q  +WQ++L S ETM  G   YP R GEPDCS
Sbjct  1    MDFD-------SRVPITRESTSLSPLLHQNAMWQMNLGSDETMSGGDGFYPERQGEPDCS  53

Query  541  YYIRTGLCRFGASCRFNHPSNRKLAIAAARMKGEYPERVGQPECQYYLKTGACKFGATCK  720
            YYIRTGLCRFG++CRFNHP +RKL IA AR KGEYPER+GQPEC++Y+KTG CKFG TCK
Sbjct  54   YYIRTGLCRFGSTCRFNHPHDRKLVIATARTKGEYPERIGQPECEFYMKTGTCKFGVTCK  113

Query  721  FHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTCKFHHP--QPSNMMVP  894
            FHHPR+  G  GRV+++VLGYPLRPN+ +C Y++RTG CKFG TCKF+HP  Q + +MV 
Sbjct  114  FHHPRNNVGTDGRVSVDVLGYPLRPNEDDCSYFLRTGHCKFGGTCKFNHPQTQSTKLMVS  173

Query  895  LRGSPAYPPVHSPT  936
            LRGSP Y  + S T
Sbjct  174  LRGSPVYSALQSLT  187


 Score = 80.5 bits (197),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 39/76 (51%), Positives = 48/76 (63%), Gaps = 6/76 (8%)
 Frame = +1

Query  643  YPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYM  822
            +PER GQ ECQ+Y+KTG       CKFHHPRD+   A    L+ +G PLR  +  C +Y 
Sbjct  281  FPERPGQLECQFYMKTG------DCKFHHPRDRQTPAPDCVLSTVGLPLRLGEPLCVFYS  334

Query  823  RTGQCKFGSTCKFHHP  870
            R G CKFG +CKF HP
Sbjct  335  RYGICKFGPSCKFDHP  350


 Score = 59.7 bits (143),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 29/76 (38%), Positives = 44/76 (58%), Gaps = 7/76 (9%)
 Frame = +1

Query  508  YPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKL-AIAAARMKGEYPERVGQPECQYYL  684
            +P R G+ +C +Y++TG       C+F+HP +R+  A          P R+G+P C +Y 
Sbjct  281  FPERPGQLECQFYMKTG------DCKFHHPRDRQTPAPDCVLSTVGLPLRLGEPLCVFYS  334

Query  685  KTGACKFGATCKFHHP  732
            + G CKFG +CKF HP
Sbjct  335  RYGICKFGPSCKFDHP  350



>gb|ACU21592.1| Zinc finger protein [Triticum aestivum]
 emb|CDM85631.1| unnamed protein product [Triticum aestivum]
Length=435

 Score =   255 bits (651),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 117/168 (70%), Positives = 139/168 (83%), Gaps = 1/168 (1%)
 Frame = +1

Query  445  LAQETLWQ-LSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIA  621
            L +E +WQ +++ S  TM+SG YPVR GEPDC+YY+RTGLCRFG SCRFNHP +R  AIA
Sbjct  48   LYEEGMWQQMAMSSGATMQSGPYPVRPGEPDCTYYLRTGLCRFGMSCRFNHPQDRNTAIA  107

Query  622  AARMKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPND  801
            +ARMKGEYPERVGQPECQYYLKTG CKFG TCKFHHPR+KAGIAG V LN LGYPLRPN+
Sbjct  108  SARMKGEYPERVGQPECQYYLKTGTCKFGPTCKFHHPREKAGIAGMVQLNTLGYPLRPNE  167

Query  802  IECPYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVHSPTTPG  945
             EC YY++TGQCK+G+TCKF+HP+  + +   RGSP YPPVH+  + G
Sbjct  168  RECAYYLKTGQCKYGNTCKFNHPEIFSAVASSRGSPIYPPVHNSGSTG  215


 Score = 96.7 bits (239),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 46/90 (51%), Positives = 57/90 (63%), Gaps = 0/90 (0%)
 Frame = +1

Query  622  AARMKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPND  801
            A + +  +PER  QPEC YY+KTG CKFGA CKFHHPR ++       L+ +G PLRP +
Sbjct  316  ALQRENVFPERPDQPECIYYIKTGDCKFGAVCKFHHPRVRSQPPPDCILSPMGLPLRPGE  375

Query  802  IECPYYMRTGQCKFGSTCKFHHPQPSNMMV  891
              C +Y R G CKFG  CKF HP  + M V
Sbjct  376  ELCKFYSRYGICKFGVNCKFDHPMAAPMGV  405


 Score = 70.5 bits (171),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 33/77 (43%), Positives = 45/77 (58%), Gaps = 1/77 (1%)
 Frame = +1

Query  505  TYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKG-EYPERVGQPECQYY  681
             +P R  +P+C YYI+TG C+FGA C+F+HP  R        +     P R G+  C++Y
Sbjct  322  VFPERPDQPECIYYIKTGDCKFGAVCKFHHPRVRSQPPPDCILSPMGLPLRPGEELCKFY  381

Query  682  LKTGACKFGATCKFHHP  732
             + G CKFG  CKF HP
Sbjct  382  SRYGICKFGVNCKFDHP  398



>ref|XP_010453818.1| PREDICTED: LOW QUALITY PROTEIN: zinc finger CCCH domain-containing 
protein 57-like [Camelina sativa]
Length=420

 Score =   254 bits (649),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 119/194 (61%), Positives = 145/194 (75%), Gaps = 11/194 (6%)
 Frame = +1

Query  367  MDFEAAAGISASMASVTEGPSSLSPPLAQETLWQLSLRSMETME--SGTYPVRDGEPDCS  540
            MDF+       S   +T   +SLSP L Q T+WQ+++ S E M    G YP R GEPDCS
Sbjct  1    MDFD-------SRVPITRESTSLSPLLHQNTMWQMNMGSDEIMSGSDGFYPERQGEPDCS  53

Query  541  YYIRTGLCRFGASCRFNHPSNRKLAIAAARMKGEYPERVGQPECQYYLKTGACKFGATCK  720
            YYIRTGLCRFG++CRFNHP +RKL IA A  KGEYPER+GQPEC++Y+KTG CKFG TCK
Sbjct  54   YYIRTGLCRFGSTCRFNHPHDRKLVIATAMTKGEYPERIGQPECEFYMKTGTCKFGVTCK  113

Query  721  FHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTCKFHHP--QPSNMMVP  894
            FHHP +KAGI GRV++NVLGYPLRPN+ +C Y++RTG CKFG TCKF+HP  Q + +MV 
Sbjct  114  FHHPSNKAGIDGRVSINVLGYPLRPNEDDCSYFLRTGHCKFGGTCKFNHPQTQSTKLMVS  173

Query  895  LRGSPAYPPVHSPT  936
            +RGSP Y  + S T
Sbjct  174  VRGSPVYSALQSFT  187


 Score = 97.1 bits (240),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 43/76 (57%), Positives = 52/76 (68%), Gaps = 0/76 (0%)
 Frame = +1

Query  643  YPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYM  822
            +PER GQ ECQ+Y+KTG CKFG  CKFHHPRD+   A    L+ +G PLR  +  C +Y 
Sbjct  283  FPERPGQLECQFYMKTGDCKFGTVCKFHHPRDRQTPAPDCVLSTVGLPLRLGEPLCVFYS  342

Query  823  RTGQCKFGSTCKFHHP  870
            R G CKFG +CKF HP
Sbjct  343  RYGICKFGPSCKFDHP  358


 Score = 73.2 bits (178),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 32/76 (42%), Positives = 48/76 (63%), Gaps = 1/76 (1%)
 Frame = +1

Query  508  YPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKL-AIAAARMKGEYPERVGQPECQYYL  684
            +P R G+ +C +Y++TG C+FG  C+F+HP +R+  A          P R+G+P C +Y 
Sbjct  283  FPERPGQLECQFYMKTGDCKFGTVCKFHHPRDRQTPAPDCVLSTVGLPLRLGEPLCVFYS  342

Query  685  KTGACKFGATCKFHHP  732
            + G CKFG +CKF HP
Sbjct  343  RYGICKFGPSCKFDHP  358


 Score = 56.2 bits (134),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 21/38 (55%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = +1

Query  760  VALNVLGYPLRPNDIECPYYMRTGQCKFGSTCKFHHPQ  873
            V L +  +P RP  +EC +YM+TG CKFG+ CKFHHP+
Sbjct  276  VPLGLYAFPERPGQLECQFYMKTGDCKFGTVCKFHHPR  313



>emb|CDX74233.1| BnaA03g28140D [Brassica napus]
Length=365

 Score =   253 bits (645),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 110/156 (71%), Positives = 135/156 (87%), Gaps = 3/156 (2%)
 Frame = +1

Query  445  LAQETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAA  624
            + QE +WQ+++ S ETME G+YP R GEPDCSYYIRTGLCRFG++CRFNHP +R+L IA 
Sbjct  2    INQEAMWQMNMTSDETMEPGSYPERPGEPDCSYYIRTGLCRFGSTCRFNHPRDRELVIAT  61

Query  625  ARMKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDI  804
            ARM+GEYPER+GQPEC+YYLKTG CKFG TCKFHHPR+KAGIAG V+LN+LGYPLR N++
Sbjct  62   ARMRGEYPERIGQPECEYYLKTGTCKFGVTCKFHHPRNKAGIAGSVSLNMLGYPLRSNEV  121

Query  805  ECPYYMRTGQCKFGSTCKFHHPQP---SNMMVPLRG  903
            +C Y++RTG CKFG+TCKF+HPQP   +N+MVP  G
Sbjct  122  DCAYFLRTGHCKFGATCKFNHPQPQPTTNLMVPTSG  157


 Score =   100 bits (248),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 46/86 (53%), Positives = 56/86 (65%), Gaps = 0/86 (0%)
 Frame = +1

Query  613  AIAAARMKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLR  792
             I A   +  +PER GQPECQ+Y+KTG CKFG  CKFHHPRD+        L+ +G PLR
Sbjct  230  GIYALPSESVFPERPGQPECQFYMKTGDCKFGTVCKFHHPRDRQTPPPDCLLSPIGLPLR  289

Query  793  PNDIECPYYMRTGQCKFGSTCKFHHP  870
            P +  C +Y R   CKFG +CKFHHP
Sbjct  290  PGEPLCVFYSRYRICKFGPSCKFHHP  315


 Score = 77.0 bits (188),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 51/157 (32%), Positives = 76/157 (48%), Gaps = 35/157 (22%)
 Frame = +1

Query  508  YPVRDGEPDCSYYIRTGLCRFGASCRFNHPS---NRKLAIAAARMKGEYPER----VGQP  666
            YP+R  E DC+Y++RTG C+FGA+C+FNHP       L +  +  +  YP      +  P
Sbjct  114  YPLRSNEVDCAYFLRTGHCKFGATCKFNHPQPQPTTNLMVPTSGQQQSYPWSRASFIPTP  173

Query  667  ECQ------------------YYLKTGACKFGATCKFHH-----PRDKAGIA----GRVA  765
              Q                  Y  + G+     T   H+      ++++G +    G  A
Sbjct  174  RWQDPSGFTPLMMPQGVVWNPYTGQLGSVSPSGTGNDHNNYRELQQNESGSSVPQGGIYA  233

Query  766  L-NVLGYPLRPNDIECPYYMRTGQCKFGSTCKFHHPQ  873
            L +   +P RP   EC +YM+TG CKFG+ CKFHHP+
Sbjct  234  LPSESVFPERPGQPECQFYMKTGDCKFGTVCKFHHPR  270


 Score = 73.6 bits (179),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 32/77 (42%), Positives = 48/77 (62%), Gaps = 1/77 (1%)
 Frame = +1

Query  505  TYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKG-EYPERVGQPECQYY  681
             +P R G+P+C +Y++TG C+FG  C+F+HP +R+       +     P R G+P C +Y
Sbjct  239  VFPERPGQPECQFYMKTGDCKFGTVCKFHHPRDRQTPPPDCLLSPIGLPLRPGEPLCVFY  298

Query  682  LKTGACKFGATCKFHHP  732
             +   CKFG +CKFHHP
Sbjct  299  SRYRICKFGPSCKFHHP  315



>ref|NP_851041.1| zinc finger nuclease 3 [Arabidopsis thaliana]
 sp|Q8L7N8.2|C3H57_ARATH RecName: Full=Zinc finger CCCH domain-containing protein 57; 
Short=AtC3H57; AltName: Full=Zinc finger type domain-containing 
protein ZFN3 [Arabidopsis thaliana]
 gb|AED92308.1| zinc finger nuclease 3 [Arabidopsis thaliana]
Length=375

 Score =   253 bits (646),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 115/179 (64%), Positives = 143/179 (80%), Gaps = 3/179 (2%)
 Frame = +1

Query  409  SVTEGPSSLSPPLAQETLWQLSLRSMETM-ESGTYPVRDGEPDCSYYIRTGLCRFGASCR  585
            S++   + LSP L Q  +WQ++L S +TM   G+YP R GEPDC+YYIRTGLCRFG++CR
Sbjct  5    SISRESTFLSPLLNQNAMWQMNLGSDDTMGVDGSYPERHGEPDCAYYIRTGLCRFGSTCR  64

Query  586  FNHPSNRKLAIAAARMKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVA  765
            FNHP +RKL IA AR+KGEYPER+GQPEC++YLKTG CKFG TCKFHHPR+KAGI G V+
Sbjct  65   FNHPHDRKLVIATARIKGEYPERIGQPECEFYLKTGTCKFGVTCKFHHPRNKAGIDGSVS  124

Query  766  LNVLGYPLRPNDIECPYYMRTGQCKFGSTCKFHHP--QPSNMMVPLRGSPAYPPVHSPT  936
            +NVL YPLRPN+ +C Y++R GQCKFG TCKF+HP  Q +N+MV +RGSP Y  + S T
Sbjct  125  VNVLSYPLRPNEDDCSYFLRIGQCKFGGTCKFNHPQTQSTNLMVSVRGSPVYSALQSLT  183


 Score =   101 bits (252),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 46/87 (53%), Positives = 56/87 (64%), Gaps = 0/87 (0%)
 Frame = +1

Query  610  LAIAAARMKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPL  789
            L   A   +  +PER GQPECQ+Y+KTG CKFG  CKFHHPRD+        L+ +G PL
Sbjct  229  LGFYALPRENVFPERPGQPECQFYMKTGDCKFGTVCKFHHPRDRQTPPPDCVLSSVGLPL  288

Query  790  RPNDIECPYYMRTGQCKFGSTCKFHHP  870
            RP +  C +Y R G CKFG +CKF HP
Sbjct  289  RPGEPLCVFYSRYGICKFGPSCKFDHP  315


 Score = 80.5 bits (197),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 47/144 (33%), Positives = 69/144 (48%), Gaps = 23/144 (16%)
 Frame = +1

Query  505  TYPVRDGEPDCSYYIRTGLCRFGASCRFNHP----SNRKLAIAAARMKGEYPERVGQPEC  672
            +YP+R  E DCSY++R G C+FG +C+FNHP    +N  +++  + +        GQP  
Sbjct  129  SYPLRPNEDDCSYFLRIGQCKFGGTCKFNHPQTQSTNLMVSVRGSPVYSALQSLTGQPSY  188

Query  673  QYY----------------LKTGACKFGATCKFHHPRDK-AGIAGRVALNVLGYPLRPND  801
             +                   +G+     +  FH       G       NV  +P RP  
Sbjct  189  SWSRTSFVANPPRLQDPSGFASGSQGGLFSSGFHSGNSVPLGFYALPRENV--FPERPGQ  246

Query  802  IECPYYMRTGQCKFGSTCKFHHPQ  873
             EC +YM+TG CKFG+ CKFHHP+
Sbjct  247  PECQFYMKTGDCKFGTVCKFHHPR  270


 Score = 74.3 bits (181),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 32/77 (42%), Positives = 48/77 (62%), Gaps = 1/77 (1%)
 Frame = +1

Query  505  TYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKGE-YPERVGQPECQYY  681
             +P R G+P+C +Y++TG C+FG  C+F+HP +R+       +     P R G+P C +Y
Sbjct  239  VFPERPGQPECQFYMKTGDCKFGTVCKFHHPRDRQTPPPDCVLSSVGLPLRPGEPLCVFY  298

Query  682  LKTGACKFGATCKFHHP  732
             + G CKFG +CKF HP
Sbjct  299  SRYGICKFGPSCKFDHP  315



>dbj|BAJ99149.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=383

 Score =   253 bits (646),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 116/163 (71%), Positives = 136/163 (83%), Gaps = 1/163 (1%)
 Frame = +1

Query  460  LWQ-LSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMK  636
            +WQ +++ S  TM+SG YPVR GEPDC+YY+RTGLCRFG SCRFNHP +R  AIA+ARMK
Sbjct  1    MWQQMTMNSGVTMQSGPYPVRPGEPDCTYYLRTGLCRFGMSCRFNHPQDRNTAIASARMK  60

Query  637  GEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPY  816
            GEYPERVGQPECQYYLKTG CKFG TCKFHHPR+KAGIAG V LN LGYPLRPN+ EC Y
Sbjct  61   GEYPERVGQPECQYYLKTGTCKFGPTCKFHHPREKAGIAGMVQLNALGYPLRPNERECAY  120

Query  817  YMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVHSPTTPG  945
            Y++TGQCK+G+TCKF+HP+  N +   RGSP YPPVH+  + G
Sbjct  121  YLKTGQCKYGNTCKFNHPEIFNAVASSRGSPIYPPVHTSGSTG  163


 Score = 96.3 bits (238),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 46/90 (51%), Positives = 57/90 (63%), Gaps = 0/90 (0%)
 Frame = +1

Query  622  AARMKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPND  801
            A + +  +PER  QPEC YY+KTG CKFGA CKFHHPR ++       L+ +G PLRP +
Sbjct  264  ALQRENVFPERPDQPECIYYIKTGDCKFGAVCKFHHPRVRSQPPPDCILSPMGLPLRPGE  323

Query  802  IECPYYMRTGQCKFGSTCKFHHPQPSNMMV  891
              C +Y R G CKFG  CKF HP  + M V
Sbjct  324  ELCKFYSRYGICKFGVNCKFDHPMAAPMGV  353


 Score = 70.1 bits (170),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 33/77 (43%), Positives = 45/77 (58%), Gaps = 1/77 (1%)
 Frame = +1

Query  505  TYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKG-EYPERVGQPECQYY  681
             +P R  +P+C YYI+TG C+FGA C+F+HP  R        +     P R G+  C++Y
Sbjct  270  VFPERPDQPECIYYIKTGDCKFGAVCKFHHPRVRSQPPPDCILSPMGLPLRPGEELCKFY  329

Query  682  LKTGACKFGATCKFHHP  732
             + G CKFG  CKF HP
Sbjct  330  SRYGICKFGVNCKFDHP  346



>ref|XP_004971057.1| PREDICTED: zinc finger CCCH domain-containing protein 12-like 
[Setaria italica]
Length=425

 Score =   254 bits (649),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 127/200 (64%), Positives = 148/200 (74%), Gaps = 11/200 (6%)
 Frame = +1

Query  379  AAAGISASMA------SVTEGPSSLSPP----LAQETLWQ-LSLRSMETMESGTYPVRDG  525
            AA  +SA+ A      S T   +  S P    L  E +WQ +++ S  TM+ G YP R G
Sbjct  11   AAVTVSATSAPALPPPSATTAAADTSSPDPSALYGEGMWQQMAMNSGATMQPGPYPERPG  70

Query  526  EPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKGEYPERVGQPECQYYLKTGACKF  705
            EPDC+YY+RTGLCRFG SCRFNHP +R LAIA+ARMKGEYPERVGQPECQYYLKTG CKF
Sbjct  71   EPDCTYYLRTGLCRFGMSCRFNHPPDRNLAIASARMKGEYPERVGQPECQYYLKTGTCKF  130

Query  706  GATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTCKFHHPQPSNM  885
            G TCKFHHPR+KAGIAGRV LN LGYPLRPN+ EC YY++TGQCK+ +TCKFHHP+  N 
Sbjct  131  GPTCKFHHPREKAGIAGRVQLNTLGYPLRPNEKECAYYLKTGQCKYANTCKFHHPELFNA  190

Query  886  MVPLRGSPAYPPVHSPTTPG  945
            +   RGSP YP VHS  + G
Sbjct  191  VPSSRGSPIYPSVHSSASAG  210


 Score = 99.8 bits (247),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 46/90 (51%), Positives = 59/90 (66%), Gaps = 0/90 (0%)
 Frame = +1

Query  622  AARMKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPND  801
            A + +  +PER  QPECQYY+KTG CKFGA CKFHHPR ++       L+ +G P+RP +
Sbjct  301  ALQRENVFPERPDQPECQYYMKTGDCKFGAVCKFHHPRVRSLPPPDCVLSPMGLPIRPGE  360

Query  802  IECPYYMRTGQCKFGSTCKFHHPQPSNMMV  891
              C +Y R G CKFG+ CKF HP  + M V
Sbjct  361  ELCKFYSRYGICKFGANCKFDHPMTAPMGV  390


 Score = 73.9 bits (180),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 34/77 (44%), Positives = 47/77 (61%), Gaps = 1/77 (1%)
 Frame = +1

Query  505  TYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKG-EYPERVGQPECQYY  681
             +P R  +P+C YY++TG C+FGA C+F+HP  R L      +     P R G+  C++Y
Sbjct  307  VFPERPDQPECQYYMKTGDCKFGAVCKFHHPRVRSLPPPDCVLSPMGLPIRPGEELCKFY  366

Query  682  LKTGACKFGATCKFHHP  732
             + G CKFGA CKF HP
Sbjct  367  SRYGICKFGANCKFDHP  383



>ref|XP_006408377.1| hypothetical protein EUTSA_v10020900mg [Eutrema salsugineum]
 gb|ESQ49830.1| hypothetical protein EUTSA_v10020900mg [Eutrema salsugineum]
Length=369

 Score =   252 bits (644),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 110/156 (71%), Positives = 136/156 (87%), Gaps = 3/156 (2%)
 Frame = +1

Query  460  LWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKG  639
            +WQ++L S ETME+G+YP R GEP+CSY+IRTGLCRFG++CRFNHP +R+L IA ARM+G
Sbjct  1    MWQMNLSSDETMETGSYPERPGEPNCSYFIRTGLCRFGSTCRFNHPRDRELVIATARMRG  60

Query  640  EYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYY  819
            EYPER+GQPEC+YYLKTG CKFG +CKFHHPR+KAGIAGRV+LN+LGYPLR N+++C Y+
Sbjct  61   EYPERIGQPECEYYLKTGTCKFGVSCKFHHPRNKAGIAGRVSLNMLGYPLRSNEVDCAYF  120

Query  820  MRTGQCKFGSTCKFHHPQP---SNMMVPLRGSPAYP  918
            +RTG CKFG TCKF+HPQP   +NMMVP  G  +YP
Sbjct  121  LRTGHCKFGGTCKFNHPQPQPTTNMMVPASGQQSYP  156


 Score = 99.4 bits (246),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 44/76 (58%), Positives = 53/76 (70%), Gaps = 0/76 (0%)
 Frame = +1

Query  643  YPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYM  822
            +PER GQPECQ+Y+KTG CKFG  CKFHHPRD+        L+ +G PLRP +  C +Y 
Sbjct  252  FPERPGQPECQFYMKTGDCKFGTVCKFHHPRDRQVPPPDCLLSPIGLPLRPGEPLCVFYT  311

Query  823  RTGQCKFGSTCKFHHP  870
            R G CKFG +CKF HP
Sbjct  312  RYGICKFGPSCKFDHP  327


 Score = 74.7 bits (182),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 32/77 (42%), Positives = 49/77 (64%), Gaps = 1/77 (1%)
 Frame = +1

Query  505  TYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKG-EYPERVGQPECQYY  681
             +P R G+P+C +Y++TG C+FG  C+F+HP +R++      +     P R G+P C +Y
Sbjct  251  VFPERPGQPECQFYMKTGDCKFGTVCKFHHPRDRQVPPPDCLLSPIGLPLRPGEPLCVFY  310

Query  682  LKTGACKFGATCKFHHP  732
             + G CKFG +CKF HP
Sbjct  311  TRYGICKFGPSCKFDHP  327


 Score = 58.2 bits (139),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 52/180 (29%), Positives = 73/180 (41%), Gaps = 63/180 (35%)
 Frame = +1

Query  508  YPVRDGEPDCSYYIRTGLCRFG-------------------ASCRFNHPSNRKLAIAAAR  630
            YP+R  E DC+Y++RTG C+FG                   AS + ++P +R   IA  R
Sbjct  108  YPLRSNEVDCAYFLRTGHCKFGGTCKFNHPQPQPTTNMMVPASGQQSYPWSRASFIANPR  167

Query  631  MK------------GEYPERVGQPECQYYLKTGACKFGATCKFHHPRD------------  738
             +            G  P +   P   Y  + G+     T   H+ R+            
Sbjct  168  WQDPSSFTPLIMPQGVVPVQGWNP---YSGQLGSVSPSGTGNDHNYRNLQQNETIESGSQ  224

Query  739  ------------KAGIAGRVAL---NVLGYPLRPNDIECPYYMRTGQCKFGSTCKFHHPQ  873
                           + G  AL   NV  +P RP   EC +YM+TG CKFG+ CKFHHP+
Sbjct  225  SQGSFSGFNSGSSVPLRGFYALPRENV--FPERPGQPECQFYMKTGDCKFGTVCKFHHPR  282



>gb|EEE55890.1| hypothetical protein OsJ_04549 [Oryza sativa Japonica Group]
Length=380

 Score =   252 bits (644),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 115/163 (71%), Positives = 133/163 (82%), Gaps = 1/163 (1%)
 Frame = +1

Query  460  LWQ-LSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMK  636
            +WQ +++     M+ G YP R GEPDC+YY+RTGLCRFG SCRFNHP +R LAIA+ARMK
Sbjct  1    MWQQMTMSGSGAMQPGPYPERSGEPDCTYYLRTGLCRFGMSCRFNHPQDRNLAIASARMK  60

Query  637  GEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPY  816
            GEYPER+GQPECQYYLKTG CKFG TCKFHHPR+KAGIAGRV LN LGYPLRP++ EC Y
Sbjct  61   GEYPERMGQPECQYYLKTGTCKFGPTCKFHHPREKAGIAGRVQLNTLGYPLRPSEKECAY  120

Query  817  YMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVHSPTTPG  945
            Y++TGQCK+G+TCKFHHP+  N M   RGSP YP VHS  T G
Sbjct  121  YLKTGQCKYGNTCKFHHPELFNAMASSRGSPIYPSVHSSATAG  163


 Score =   100 bits (248),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 50/98 (51%), Positives = 61/98 (62%), Gaps = 4/98 (4%)
 Frame = +1

Query  622  AARMKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPND  801
            A + +  +PER  QPECQYY+KTG CKFGA CKFHHPR ++       L+ +G PLRP +
Sbjct  263  ALQRENVFPERPDQPECQYYMKTGDCKFGAVCKFHHPRVRSMPTPDCVLSPVGLPLRPGE  322

Query  802  IECPYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAY  915
              C +Y R G CKFG+ CKF HP     M P  G  AY
Sbjct  323  ELCKFYSRYGICKFGANCKFDHP----TMAPPMGVYAY  356


 Score = 73.9 bits (180),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 33/77 (43%), Positives = 47/77 (61%), Gaps = 1/77 (1%)
 Frame = +1

Query  505  TYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKGE-YPERVGQPECQYY  681
             +P R  +P+C YY++TG C+FGA C+F+HP  R +      +     P R G+  C++Y
Sbjct  269  VFPERPDQPECQYYMKTGDCKFGAVCKFHHPRVRSMPTPDCVLSPVGLPLRPGEELCKFY  328

Query  682  LKTGACKFGATCKFHHP  732
             + G CKFGA CKF HP
Sbjct  329  SRYGICKFGANCKFDHP  345



>ref|XP_008792914.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X2 [Phoenix dactylifera]
Length=452

 Score =   254 bits (648),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 120/188 (64%), Positives = 141/188 (75%), Gaps = 22/188 (12%)
 Frame = +1

Query  388  GISASMASVTEGPSSL-SPPLAQETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLC  564
            G  A+ ASVTE  SSL +P   +ETLWQ+++R  E+MESG+YP R GEPDC+YY+RTG C
Sbjct  12   GYRATAASVTEASSSLLAPAFDEETLWQMNMRGSESMESGSYPQRQGEPDCAYYLRTGHC  71

Query  565  RFGASCRFNHPSNRKLAIAAARMKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKA  744
            R+G +CR+NHP NRKL                     YYLKTG CKFGATCKFHHP+DKA
Sbjct  72   RYGVTCRYNHPPNRKL---------------------YYLKTGTCKFGATCKFHHPKDKA  110

Query  745  GIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPV  924
            GI GR  LN+LGYP+RPN+ EC YY+RTGQCKFG+TCKFHHPQPSN+MV LRGSP YP V
Sbjct  111  GILGRAELNILGYPIRPNEEECAYYLRTGQCKFGNTCKFHHPQPSNVMVSLRGSPFYPSV  170

Query  925  HSPTTPGQ  948
            HSPT+P Q
Sbjct  171  HSPTSPSQ  178


 Score =   100 bits (250),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 45/90 (50%), Positives = 59/90 (66%), Gaps = 0/90 (0%)
 Frame = +1

Query  622  AARMKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPND  801
            A +    +PER+ QPECQ+Y+KTG CKFGA CKFHHP+++   A    L+  G PLRP +
Sbjct  277  ALQKDNVFPERLDQPECQFYMKTGDCKFGAACKFHHPKERLITAPNCLLSPSGLPLRPGE  336

Query  802  IECPYYMRTGQCKFGSTCKFHHPQPSNMMV  891
              C +Y R G CKFG  CKF HP  ++M +
Sbjct  337  PLCVFYSRYGICKFGPNCKFDHPVVTSMGI  366


 Score = 75.5 bits (184),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 32/80 (40%), Positives = 48/80 (60%), Gaps = 1/80 (1%)
 Frame = +1

Query  496  ESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMK-GEYPERVGQPEC  672
            +   +P R  +P+C +Y++TG C+FGA+C+F+HP  R +      +     P R G+P C
Sbjct  280  KDNVFPERLDQPECQFYMKTGDCKFGAACKFHHPKERLITAPNCLLSPSGLPLRPGEPLC  339

Query  673  QYYLKTGACKFGATCKFHHP  732
             +Y + G CKFG  CKF HP
Sbjct  340  VFYSRYGICKFGPNCKFDHP  359



>gb|ACF82040.1| unknown [Zea mays]
 gb|AFT82648.1| C3H49 C3H type transcription factor, partial [Zea mays subsp. 
mays]
 gb|AFW84180.1| zinc finger CCCH type domain-containing protein ZFN-like 2 [Zea 
mays]
Length=427

 Score =   253 bits (645),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 120/175 (69%), Positives = 141/175 (81%), Gaps = 2/175 (1%)
 Frame = +1

Query  427  SSLSPP-LAQETLWQ-LSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPS  600
            SSL P  L +E +WQ +++ S  TM+ G+YP R GEPDC+YY+RTGLCRFG SCRFNHP 
Sbjct  37   SSLDPDALYEEGMWQQMAMNSGATMQPGSYPERPGEPDCTYYLRTGLCRFGMSCRFNHPP  96

Query  601  NRKLAIAAARMKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLG  780
            +R LAIA+ARMKGEYPERVGQPECQYYLKTG CKFG TCKFHHPR+KAGIAGRV LN LG
Sbjct  97   DRNLAIASARMKGEYPERVGQPECQYYLKTGTCKFGPTCKFHHPREKAGIAGRVQLNTLG  156

Query  781  YPLRPNDIECPYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVHSPTTPG  945
            YPL PN+ EC YY++TGQCK+ +TCKFHHP+  N++   RGSP Y  VHS  + G
Sbjct  157  YPLLPNEKECAYYLKTGQCKYANTCKFHHPELFNVVPSSRGSPIYTSVHSSASAG  211


 Score = 97.1 bits (240),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 43/83 (52%), Positives = 55/83 (66%), Gaps = 0/83 (0%)
 Frame = +1

Query  622  AARMKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPND  801
            A +    +PER  +PECQYY+KTG CKFGA CKFHHPR ++       L+ +G P+RP +
Sbjct  302  ALQRDNVFPERPDEPECQYYMKTGDCKFGAVCKFHHPRVRSQPPPDCVLSPMGLPIRPGE  361

Query  802  IECPYYMRTGQCKFGSTCKFHHP  870
              C +Y R G CKFG+ CKF HP
Sbjct  362  ELCKFYSRYGICKFGANCKFDHP  384


 Score = 72.4 bits (176),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 34/77 (44%), Positives = 46/77 (60%), Gaps = 1/77 (1%)
 Frame = +1

Query  505  TYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKG-EYPERVGQPECQYY  681
             +P R  EP+C YY++TG C+FGA C+F+HP  R        +     P R G+  C++Y
Sbjct  308  VFPERPDEPECQYYMKTGDCKFGAVCKFHHPRVRSQPPPDCVLSPMGLPIRPGEELCKFY  367

Query  682  LKTGACKFGATCKFHHP  732
             + G CKFGA CKF HP
Sbjct  368  SRYGICKFGANCKFDHP  384


 Score = 53.5 bits (127),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 20/31 (65%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = +1

Query  781  YPLRPNDIECPYYMRTGQCKFGSTCKFHHPQ  873
            +P RP++ EC YYM+TG CKFG+ CKFHHP+
Sbjct  309  FPERPDEPECQYYMKTGDCKFGAVCKFHHPR  339



>ref|NP_001150019.1| zinc finger CCCH type domain-containing protein ZFN-like 2 [Zea 
mays]
 gb|ACG37517.1| zinc finger CCCH type domain-containing protein ZFN-like 2 [Zea 
mays]
Length=427

 Score =   253 bits (645),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 120/175 (69%), Positives = 141/175 (81%), Gaps = 2/175 (1%)
 Frame = +1

Query  427  SSLSPP-LAQETLWQ-LSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPS  600
            SSL P  L +E +WQ +++ S  TM+ G+YP R GEPDC+YY+RTGLCRFG SCRFNHP 
Sbjct  37   SSLDPDALYEEGMWQQMAMNSGATMQPGSYPERPGEPDCTYYLRTGLCRFGMSCRFNHPP  96

Query  601  NRKLAIAAARMKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLG  780
            +R LAIA+ARMKGEYPERVGQPECQYYLKTG CKFG TCKFHHPR+KAGIAGRV LN LG
Sbjct  97   DRNLAIASARMKGEYPERVGQPECQYYLKTGTCKFGPTCKFHHPREKAGIAGRVQLNTLG  156

Query  781  YPLRPNDIECPYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVHSPTTPG  945
            YPL PN+ EC YY++TGQCK+ +TCKFHHP+  N++   RGSP Y  VHS  + G
Sbjct  157  YPLLPNEKECAYYLKTGQCKYANTCKFHHPELFNVVPSSRGSPIYTSVHSSASAG  211


 Score = 97.1 bits (240),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 43/83 (52%), Positives = 55/83 (66%), Gaps = 0/83 (0%)
 Frame = +1

Query  622  AARMKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPND  801
            A +    +PER  +PECQYY+KTG CKFGA CKFHHPR ++       L+ +G P+RP +
Sbjct  302  ALQRDNVFPERPDEPECQYYMKTGDCKFGAVCKFHHPRVRSQPPPDCVLSPMGLPIRPGE  361

Query  802  IECPYYMRTGQCKFGSTCKFHHP  870
              C +Y R G CKFG+ CKF HP
Sbjct  362  ELCKFYSRYGICKFGANCKFDHP  384


 Score = 72.4 bits (176),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 34/77 (44%), Positives = 46/77 (60%), Gaps = 1/77 (1%)
 Frame = +1

Query  505  TYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKG-EYPERVGQPECQYY  681
             +P R  EP+C YY++TG C+FGA C+F+HP  R        +     P R G+  C++Y
Sbjct  308  VFPERPDEPECQYYMKTGDCKFGAVCKFHHPRVRSQPPPDCVLSPMGLPIRPGEELCKFY  367

Query  682  LKTGACKFGATCKFHHP  732
             + G CKFGA CKF HP
Sbjct  368  SRYGICKFGANCKFDHP  384


 Score = 53.5 bits (127),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 20/31 (65%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = +1

Query  781  YPLRPNDIECPYYMRTGQCKFGSTCKFHHPQ  873
            +P RP++ EC YYM+TG CKFG+ CKFHHP+
Sbjct  309  FPERPDEPECQYYMKTGDCKFGAVCKFHHPR  339



>ref|XP_009134713.1| PREDICTED: zinc finger CCCH domain-containing protein 33-like 
isoform X2 [Brassica rapa]
Length=377

 Score =   249 bits (637),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 119/183 (65%), Positives = 144/183 (79%), Gaps = 16/183 (9%)
 Frame = +1

Query  367  MDFEAAAGISASMASVTEGPSSLSPPLA-QETLWQLSLRSMETMESGTYPVRDGEPDCSY  543
            MDF A   +S           SLSP +  QE +WQ++L S ETME G+YP R GEPDCSY
Sbjct  1    MDFNAGVPMS-----------SLSPLMINQEAMWQMNLSSDETMELGSYPERPGEPDCSY  49

Query  544  YIRTGLCRFGASCRFNHPSNRKLAIAAARMKGEYPERVGQPECQYYLKTGACKFGATCKF  723
            YIRTGLCRFG++CRFNHP +R+L IA A M+GEYPER+GQPEC+YYLKTG CKFG TCKF
Sbjct  50   YIRTGLCRFGSTCRFNHPRDRELVIATA-MRGEYPERIGQPECEYYLKTGTCKFGVTCKF  108

Query  724  HHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTCKFHHPQP---SNMMVP  894
            HHPR+KAGIAG V+LN+LGYPLR N+++C Y++RTG CKFG+TCKF+HPQP   +N+MVP
Sbjct  109  HHPRNKAGIAGSVSLNMLGYPLRSNEVDCAYFLRTGHCKFGATCKFNHPQPQPTTNLMVP  168

Query  895  LRG  903
              G
Sbjct  169  TSG  171


 Score = 96.7 bits (239),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 45/86 (52%), Positives = 55/86 (64%), Gaps = 0/86 (0%)
 Frame = +1

Query  613  AIAAARMKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLR  792
             I A   +  +PER GQPECQ+Y+KTG CKFG  CKFHHPRD+        L+ +G PLR
Sbjct  242  GIYALPSESVFPERPGQPECQFYMKTGDCKFGTVCKFHHPRDRQTPPPDCLLSPIGLPLR  301

Query  793  PNDIECPYYMRTGQCKFGSTCKFHHP  870
            P +  C +Y R   CKFG +CKFH P
Sbjct  302  PGEPLCVFYSRYRICKFGPSCKFHPP  327


 Score = 75.9 bits (185),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 49/157 (31%), Positives = 71/157 (45%), Gaps = 37/157 (24%)
 Frame = +1

Query  508  YPVRDGEPDCSYYIRTGLCRFGASCRFNHPS---NRKLAIAAARMKGEYPER----VGQP  666
            YP+R  E DC+Y++RTG C+FGA+C+FNHP       L +  +  +  YP      +  P
Sbjct  128  YPLRSNEVDCAYFLRTGHCKFGATCKFNHPQPQPTTNLMVPTSGQQQSYPWSRASFIPTP  187

Query  667  ECQY-----------------YLKTGACKFGATCKFHHPRD-----------KAGIAGRV  762
              Q                  Y        G     ++ R+           + GI    
Sbjct  188  RWQDPSGFTPLMMPQGVVWNPYTLGSVSPSGTGNDHNNYRELQQNESGSSVPQGGIYALP  247

Query  763  ALNVLGYPLRPNDIECPYYMRTGQCKFGSTCKFHHPQ  873
            + +V  +P RP   EC +YM+TG CKFG+ CKFHHP+
Sbjct  248  SESV--FPERPGQPECQFYMKTGDCKFGTVCKFHHPR  282


 Score = 70.1 bits (170),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 31/77 (40%), Positives = 47/77 (61%), Gaps = 1/77 (1%)
 Frame = +1

Query  505  TYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKG-EYPERVGQPECQYY  681
             +P R G+P+C +Y++TG C+FG  C+F+HP +R+       +     P R G+P C +Y
Sbjct  251  VFPERPGQPECQFYMKTGDCKFGTVCKFHHPRDRQTPPPDCLLSPIGLPLRPGEPLCVFY  310

Query  682  LKTGACKFGATCKFHHP  732
             +   CKFG +CKFH P
Sbjct  311  SRYRICKFGPSCKFHPP  327



>ref|XP_009134712.1| PREDICTED: zinc finger CCCH domain-containing protein 33-like 
isoform X1 [Brassica rapa]
Length=379

 Score =   249 bits (637),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 119/183 (65%), Positives = 144/183 (79%), Gaps = 16/183 (9%)
 Frame = +1

Query  367  MDFEAAAGISASMASVTEGPSSLSPPLA-QETLWQLSLRSMETMESGTYPVRDGEPDCSY  543
            MDF A   +S           SLSP +  QE +WQ++L S ETME G+YP R GEPDCSY
Sbjct  1    MDFNAGVPMS-----------SLSPLMINQEAMWQMNLSSDETMELGSYPERPGEPDCSY  49

Query  544  YIRTGLCRFGASCRFNHPSNRKLAIAAARMKGEYPERVGQPECQYYLKTGACKFGATCKF  723
            YIRTGLCRFG++CRFNHP +R+L IA A M+GEYPER+GQPEC+YYLKTG CKFG TCKF
Sbjct  50   YIRTGLCRFGSTCRFNHPRDRELVIATA-MRGEYPERIGQPECEYYLKTGTCKFGVTCKF  108

Query  724  HHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTCKFHHPQP---SNMMVP  894
            HHPR+KAGIAG V+LN+LGYPLR N+++C Y++RTG CKFG+TCKF+HPQP   +N+MVP
Sbjct  109  HHPRNKAGIAGSVSLNMLGYPLRSNEVDCAYFLRTGHCKFGATCKFNHPQPQPTTNLMVP  168

Query  895  LRG  903
              G
Sbjct  169  TSG  171


 Score = 96.7 bits (239),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 45/86 (52%), Positives = 55/86 (64%), Gaps = 0/86 (0%)
 Frame = +1

Query  613  AIAAARMKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLR  792
             I A   +  +PER GQPECQ+Y+KTG CKFG  CKFHHPRD+        L+ +G PLR
Sbjct  244  GIYALPSESVFPERPGQPECQFYMKTGDCKFGTVCKFHHPRDRQTPPPDCLLSPIGLPLR  303

Query  793  PNDIECPYYMRTGQCKFGSTCKFHHP  870
            P +  C +Y R   CKFG +CKFH P
Sbjct  304  PGEPLCVFYSRYRICKFGPSCKFHPP  329


 Score = 77.8 bits (190),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 51/157 (32%), Positives = 76/157 (48%), Gaps = 35/157 (22%)
 Frame = +1

Query  508  YPVRDGEPDCSYYIRTGLCRFGASCRFNHPS---NRKLAIAAARMKGEYPER----VGQP  666
            YP+R  E DC+Y++RTG C+FGA+C+FNHP       L +  +  +  YP      +  P
Sbjct  128  YPLRSNEVDCAYFLRTGHCKFGATCKFNHPQPQPTTNLMVPTSGQQQSYPWSRASFIPTP  187

Query  667  ECQ------------------YYLKTGACKFGATCKFHH-----PRDKAGIA----GRVA  765
              Q                  Y  + G+     T   H+      ++++G +    G  A
Sbjct  188  RWQDPSGFTPLMMPQGVVWNPYTGQLGSVSPSGTGNDHNNYRELQQNESGSSVPQGGIYA  247

Query  766  L-NVLGYPLRPNDIECPYYMRTGQCKFGSTCKFHHPQ  873
            L +   +P RP   EC +YM+TG CKFG+ CKFHHP+
Sbjct  248  LPSESVFPERPGQPECQFYMKTGDCKFGTVCKFHHPR  284


 Score = 70.1 bits (170),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 31/77 (40%), Positives = 47/77 (61%), Gaps = 1/77 (1%)
 Frame = +1

Query  505  TYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKG-EYPERVGQPECQYY  681
             +P R G+P+C +Y++TG C+FG  C+F+HP +R+       +     P R G+P C +Y
Sbjct  253  VFPERPGQPECQFYMKTGDCKFGTVCKFHHPRDRQTPPPDCLLSPIGLPLRPGEPLCVFY  312

Query  682  LKTGACKFGATCKFHHP  732
             +   CKFG +CKFH P
Sbjct  313  SRYRICKFGPSCKFHPP  329



>ref|XP_006408378.1| hypothetical protein EUTSA_v10020900mg [Eutrema salsugineum]
 gb|ESQ49831.1| hypothetical protein EUTSA_v10020900mg [Eutrema salsugineum]
Length=385

 Score =   249 bits (635),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 116/187 (62%), Positives = 145/187 (78%), Gaps = 18/187 (10%)
 Frame = +1

Query  367  MDFEAAAGISASMASVTEGPSSLSPPLAQETLWQLSLRSMETMESGTYPVRDGEPDCSYY  546
            MDF A   +S           SLSP + Q+ +WQ++L S ETME+G+YP R GEP+CSY+
Sbjct  1    MDFNAGVPMS-----------SLSPLMNQDAMWQMNLSSDETMETGSYPERPGEPNCSYF  49

Query  547  IRTGLCRFGASCRFNHPSNRKLAIAAARMKGEYPERVGQPECQYYLKTGACKFGATCKFH  726
            IRTGLCRFG++CRFNHP +R+L IA ARM+GEYPER+GQPEC+    TG CKFG +CKFH
Sbjct  50   IRTGLCRFGSTCRFNHPRDRELVIATARMRGEYPERIGQPECE----TGTCKFGVSCKFH  105

Query  727  HPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTCKFHHPQP---SNMMVPL  897
            HPR+KAGIAGRV+LN+LGYPLR N+++C Y++RTG CKFG TCKF+HPQP   +NMMVP 
Sbjct  106  HPRNKAGIAGRVSLNMLGYPLRSNEVDCAYFLRTGHCKFGGTCKFNHPQPQPTTNMMVPA  165

Query  898  RGSPAYP  918
             G  +YP
Sbjct  166  SGQQSYP  172


 Score =   100 bits (248),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 44/76 (58%), Positives = 53/76 (70%), Gaps = 0/76 (0%)
 Frame = +1

Query  643  YPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYM  822
            +PER GQPECQ+Y+KTG CKFG  CKFHHPRD+        L+ +G PLRP +  C +Y 
Sbjct  268  FPERPGQPECQFYMKTGDCKFGTVCKFHHPRDRQVPPPDCLLSPIGLPLRPGEPLCVFYT  327

Query  823  RTGQCKFGSTCKFHHP  870
            R G CKFG +CKF HP
Sbjct  328  RYGICKFGPSCKFDHP  343


 Score = 75.5 bits (184),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 32/77 (42%), Positives = 49/77 (64%), Gaps = 1/77 (1%)
 Frame = +1

Query  505  TYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKG-EYPERVGQPECQYY  681
             +P R G+P+C +Y++TG C+FG  C+F+HP +R++      +     P R G+P C +Y
Sbjct  267  VFPERPGQPECQFYMKTGDCKFGTVCKFHHPRDRQVPPPDCLLSPIGLPLRPGEPLCVFY  326

Query  682  LKTGACKFGATCKFHHP  732
             + G CKFG +CKF HP
Sbjct  327  TRYGICKFGPSCKFDHP  343


 Score = 58.9 bits (141),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 52/180 (29%), Positives = 73/180 (41%), Gaps = 63/180 (35%)
 Frame = +1

Query  508  YPVRDGEPDCSYYIRTGLCRFG-------------------ASCRFNHPSNRKLAIAAAR  630
            YP+R  E DC+Y++RTG C+FG                   AS + ++P +R   IA  R
Sbjct  124  YPLRSNEVDCAYFLRTGHCKFGGTCKFNHPQPQPTTNMMVPASGQQSYPWSRASFIANPR  183

Query  631  MK------------GEYPERVGQPECQYYLKTGACKFGATCKFHHPRD------------  738
             +            G  P +   P   Y  + G+     T   H+ R+            
Sbjct  184  WQDPSSFTPLIMPQGVVPVQGWNP---YSGQLGSVSPSGTGNDHNYRNLQQNETIESGSQ  240

Query  739  ------------KAGIAGRVAL---NVLGYPLRPNDIECPYYMRTGQCKFGSTCKFHHPQ  873
                           + G  AL   NV  +P RP   EC +YM+TG CKFG+ CKFHHP+
Sbjct  241  SQGSFSGFNSGSSVPLRGFYALPRENV--FPERPGQPECQFYMKTGDCKFGTVCKFHHPR  298



>ref|XP_010929826.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X2 [Elaeis guineensis]
Length=439

 Score =   250 bits (639),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 121/181 (67%), Positives = 136/181 (75%), Gaps = 25/181 (14%)
 Frame = +1

Query  406  ASVTEGPSSLSPPLAQETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCR  585
            A++TEG SSL     +E +WQ++LR  E+MESG YP R GE DC YYIRTGLCRFG +C+
Sbjct  17   AAMTEGSSSLD----EEAMWQMNLRGSESMESGPYPERPGEADCGYYIRTGLCRFGMTCK  72

Query  586  FNHPSNRKLAIAAARMKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVA  765
            FNHP NR+L                     YYLKTG CKFGATCKFHHP+DKAGIAGRV 
Sbjct  73   FNHPPNRRL---------------------YYLKTGTCKFGATCKFHHPKDKAGIAGRVQ  111

Query  766  LNVLGYPLRPNDIECPYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVHSPTTPG  945
            LN+LGYPLRPN+ EC YY+RTGQCKFG+TCKFHHPQPSN MV LRGSP YPPVHS TTPG
Sbjct  112  LNILGYPLRPNEKECAYYIRTGQCKFGNTCKFHHPQPSNAMVALRGSPVYPPVHSSTTPG  171

Query  946  Q  948
            Q
Sbjct  172  Q  172


 Score =   101 bits (251),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 46/92 (50%), Positives = 59/92 (64%), Gaps = 0/92 (0%)
 Frame = +1

Query  595  PSNRKLAIAAARMKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNV  774
            P +  + + A + +  +PER  QPECQ+Y+KTG CKFGA CKFHHPR++        L+ 
Sbjct  262  PGSIPMGVYALQRENIFPERPDQPECQFYMKTGDCKFGAVCKFHHPRERLVPVPNCLLSP  321

Query  775  LGYPLRPNDIECPYYMRTGQCKFGSTCKFHHP  870
            LG PLRP +  C +Y R G CKFG  CKF HP
Sbjct  322  LGLPLRPGEPLCVFYSRYGICKFGPNCKFDHP  353


 Score = 73.9 bits (180),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 32/76 (42%), Positives = 47/76 (62%), Gaps = 1/76 (1%)
 Frame = +1

Query  508  YPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKG-EYPERVGQPECQYYL  684
            +P R  +P+C +Y++TG C+FGA C+F+HP  R + +    +     P R G+P C +Y 
Sbjct  278  FPERPDQPECQFYMKTGDCKFGAVCKFHHPRERLVPVPNCLLSPLGLPLRPGEPLCVFYS  337

Query  685  KTGACKFGATCKFHHP  732
            + G CKFG  CKF HP
Sbjct  338  RYGICKFGPNCKFDHP  353



>ref|XP_006645228.1| PREDICTED: zinc finger CCCH domain-containing protein 12-like 
[Oryza brachyantha]
Length=381

 Score =   248 bits (632),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 114/163 (70%), Positives = 132/163 (81%), Gaps = 1/163 (1%)
 Frame = +1

Query  460  LWQ-LSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMK  636
            +WQ +++     M+ G YP R  EPDC+YY+RTGLCRFG SCRFNHP +R LAIA+ARMK
Sbjct  1    MWQQMTMSGSGAMQPGPYPERPEEPDCTYYLRTGLCRFGMSCRFNHPPDRNLAIASARMK  60

Query  637  GEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPY  816
            GEYPER+GQPECQYYLKTG CKFG TCKFHHPR+KAGIAGRV LN LGYPLRP++ EC Y
Sbjct  61   GEYPERMGQPECQYYLKTGTCKFGPTCKFHHPREKAGIAGRVQLNTLGYPLRPSEKECAY  120

Query  817  YMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVHSPTTPG  945
            Y++TGQCK+G+TCKFHHP+  N M   RGSP YP VHS  T G
Sbjct  121  YLKTGQCKYGNTCKFHHPELFNAMASSRGSPIYPSVHSSATTG  163


 Score =   100 bits (248),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 50/98 (51%), Positives = 61/98 (62%), Gaps = 4/98 (4%)
 Frame = +1

Query  622  AARMKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPND  801
            A + +  +PER  QPECQYY+KTG CKFGA CKFHHPR ++       L+ +G PLRP +
Sbjct  264  ALQRENVFPERPDQPECQYYMKTGDCKFGAVCKFHHPRVRSMPTPDCVLSPVGLPLRPGE  323

Query  802  IECPYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAY  915
              C +Y R G CKFG+ CKF HP     M P  G  AY
Sbjct  324  ELCKFYSRYGICKFGANCKFDHPS----MAPPMGVYAY  357


 Score = 73.9 bits (180),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 33/77 (43%), Positives = 47/77 (61%), Gaps = 1/77 (1%)
 Frame = +1

Query  505  TYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKGE-YPERVGQPECQYY  681
             +P R  +P+C YY++TG C+FGA C+F+HP  R +      +     P R G+  C++Y
Sbjct  270  VFPERPDQPECQYYMKTGDCKFGAVCKFHHPRVRSMPTPDCVLSPVGLPLRPGEELCKFY  329

Query  682  LKTGACKFGATCKFHHP  732
             + G CKFGA CKF HP
Sbjct  330  SRYGICKFGANCKFDHP  346



>ref|XP_008672228.1| PREDICTED: uncharacterized protein LOC100194377 isoform X1 [Zea 
mays]
Length=410

 Score =   247 bits (630),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 114/168 (68%), Positives = 135/168 (80%), Gaps = 1/168 (1%)
 Frame = +1

Query  445  LAQETLWQ-LSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIA  621
            L +E +WQ +++ S  TM+ G+YP R GEPDC+YY+RTGLCRFG SCRFNHP +R LAIA
Sbjct  48   LYEEGMWQQMAMDSGATMQPGSYPERPGEPDCTYYLRTGLCRFGMSCRFNHPPDRNLAIA  107

Query  622  AARMKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPND  801
            +ARMKGEYPER GQPECQYYLKTG CKFG TCKFHHPR+KAGIAGRV LN  GYPLRPN+
Sbjct  108  SARMKGEYPERAGQPECQYYLKTGTCKFGPTCKFHHPREKAGIAGRVQLNTSGYPLRPNE  167

Query  802  IECPYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVHSPTTPG  945
             EC YY++TG CK+ +TCKFHHP+  N++   RGSP Y  VHS  + G
Sbjct  168  KECAYYLKTGHCKYANTCKFHHPELFNVVPSSRGSPIYTSVHSSASAG  215


 Score = 79.0 bits (193),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 42/99 (42%), Positives = 52/99 (53%), Gaps = 20/99 (20%)
 Frame = +1

Query  595  PSNRKLAIAAARMKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNV  774
            PS+  +   A + +  +PER  +PECQYY+KTG CKFGA CKFHHPR             
Sbjct  297  PSSFPVPQYALQRENVFPERPDEPECQYYMKTGDCKFGAVCKFHHPR-------------  343

Query  775  LGYPLRPNDIECPYYMRTGQCKFGSTCKFHHPQPSNMMV  891
                    +  C +Y R G CKFG+ CKF HP     MV
Sbjct  344  -------GEELCKFYSRYGICKFGANCKFDHPTVVAPMV  375


 Score = 68.9 bits (167),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 31/76 (41%), Positives = 42/76 (55%), Gaps = 19/76 (25%)
 Frame = +1

Query  505  TYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKGEYPERVGQPECQYYL  684
             +P R  EP+C YY++TG C+FGA C+F+HP   +L                   C++Y 
Sbjct  312  VFPERPDEPECQYYMKTGDCKFGAVCKFHHPRGEEL-------------------CKFYS  352

Query  685  KTGACKFGATCKFHHP  732
            + G CKFGA CKF HP
Sbjct  353  RYGICKFGANCKFDHP  368



>gb|ACN33948.1| unknown [Zea mays]
 gb|AFW84182.1| hypothetical protein ZEAMMB73_594165 [Zea mays]
Length=377

 Score =   245 bits (626),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 112/160 (70%), Positives = 132/160 (83%), Gaps = 0/160 (0%)
 Frame = +1

Query  466  QLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKGEY  645
            ++++ S  TM+ G+YP R GEPDC+YY+RTGLCRFG SCRFNHP +R LAIA+ARMKGEY
Sbjct  2    KMAMNSGATMQPGSYPERPGEPDCTYYLRTGLCRFGMSCRFNHPPDRNLAIASARMKGEY  61

Query  646  PERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMR  825
            PERVGQPECQYYLKTG CKFG TCKFHHPR+KAGIAGRV LN LGYPL PN+ EC YY++
Sbjct  62   PERVGQPECQYYLKTGTCKFGPTCKFHHPREKAGIAGRVQLNTLGYPLLPNEKECAYYLK  121

Query  826  TGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVHSPTTPG  945
            TGQCK+ +TCKFHHP+  N++   RGSP Y  VHS  + G
Sbjct  122  TGQCKYANTCKFHHPELFNVVPSSRGSPIYTSVHSSASAG  161


 Score = 97.1 bits (240),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 43/83 (52%), Positives = 55/83 (66%), Gaps = 0/83 (0%)
 Frame = +1

Query  622  AARMKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPND  801
            A +    +PER  +PECQYY+KTG CKFGA CKFHHPR ++       L+ +G P+RP +
Sbjct  252  ALQRDNVFPERPDEPECQYYMKTGDCKFGAVCKFHHPRVRSQPPPDCVLSPMGLPIRPGE  311

Query  802  IECPYYMRTGQCKFGSTCKFHHP  870
              C +Y R G CKFG+ CKF HP
Sbjct  312  ELCKFYSRYGICKFGANCKFDHP  334


 Score = 72.4 bits (176),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 34/77 (44%), Positives = 46/77 (60%), Gaps = 1/77 (1%)
 Frame = +1

Query  505  TYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKG-EYPERVGQPECQYY  681
             +P R  EP+C YY++TG C+FGA C+F+HP  R        +     P R G+  C++Y
Sbjct  258  VFPERPDEPECQYYMKTGDCKFGAVCKFHHPRVRSQPPPDCVLSPMGLPIRPGEELCKFY  317

Query  682  LKTGACKFGATCKFHHP  732
             + G CKFGA CKF HP
Sbjct  318  SRYGICKFGANCKFDHP  334


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 20/31 (65%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = +1

Query  781  YPLRPNDIECPYYMRTGQCKFGSTCKFHHPQ  873
            +P RP++ EC YYM+TG CKFG+ CKFHHP+
Sbjct  259  FPERPDEPECQYYMKTGDCKFGAVCKFHHPR  289



>ref|NP_001132883.1| uncharacterized protein LOC100194377 [Zea mays]
 gb|ACF81912.1| unknown [Zea mays]
Length=430

 Score =   246 bits (629),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 114/168 (68%), Positives = 135/168 (80%), Gaps = 1/168 (1%)
 Frame = +1

Query  445  LAQETLWQ-LSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIA  621
            L +E +WQ +++ S  TM+ G+YP R GEPDC+YY+RTGLCRFG SCRFNHP +R LAIA
Sbjct  48   LYEEGMWQQMAMDSGATMQPGSYPERPGEPDCTYYLRTGLCRFGMSCRFNHPPDRNLAIA  107

Query  622  AARMKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPND  801
            +ARMKGEYPER GQPECQYYLKTG CKFG TCKFHHPR+KAGIAGRV LN  GYPLRPN+
Sbjct  108  SARMKGEYPERAGQPECQYYLKTGTCKFGPTCKFHHPREKAGIAGRVQLNTSGYPLRPNE  167

Query  802  IECPYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVHSPTTPG  945
             EC YY++TG CK+ +TCKFHHP+  N++   RGSP Y  VHS  + G
Sbjct  168  KECAYYLKTGHCKYANTCKFHHPELFNVVPSSRGSPIYTSVHSSASAG  215


 Score = 97.8 bits (242),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 46/90 (51%), Positives = 58/90 (64%), Gaps = 0/90 (0%)
 Frame = +1

Query  622  AARMKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPND  801
            A + +  +PER  +PECQYY+KTG CKFGA CKFHHPR ++       L+ +G PLRP +
Sbjct  306  ALQRENVFPERPDEPECQYYMKTGDCKFGAVCKFHHPRVRSLPPPDCVLSPMGLPLRPGE  365

Query  802  IECPYYMRTGQCKFGSTCKFHHPQPSNMMV  891
              C +Y R G CKFG+ CKF HP     MV
Sbjct  366  ELCKFYSRYGICKFGANCKFDHPTVVAPMV  395


 Score = 75.1 bits (183),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 35/77 (45%), Positives = 47/77 (61%), Gaps = 1/77 (1%)
 Frame = +1

Query  505  TYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKG-EYPERVGQPECQYY  681
             +P R  EP+C YY++TG C+FGA C+F+HP  R L      +     P R G+  C++Y
Sbjct  312  VFPERPDEPECQYYMKTGDCKFGAVCKFHHPRVRSLPPPDCVLSPMGLPLRPGEELCKFY  371

Query  682  LKTGACKFGATCKFHHP  732
             + G CKFGA CKF HP
Sbjct  372  SRYGICKFGANCKFDHP  388



>tpg|DAA56151.1| TPA: hypothetical protein ZEAMMB73_608000 [Zea mays]
Length=430

 Score =   246 bits (629),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 114/168 (68%), Positives = 135/168 (80%), Gaps = 1/168 (1%)
 Frame = +1

Query  445  LAQETLWQ-LSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIA  621
            L +E +WQ +++ S  TM+ G+YP R GEPDC+YY+RTGLCRFG SCRFNHP +R LAIA
Sbjct  48   LYEEGMWQQMAMDSGATMQPGSYPERPGEPDCTYYLRTGLCRFGMSCRFNHPPDRNLAIA  107

Query  622  AARMKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPND  801
            +ARMKGEYPER GQPECQYYLKTG CKFG TCKFHHPR+KAGIAGRV LN  GYPLRPN+
Sbjct  108  SARMKGEYPERAGQPECQYYLKTGTCKFGPTCKFHHPREKAGIAGRVQLNTSGYPLRPNE  167

Query  802  IECPYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVHSPTTPG  945
             EC YY++TG CK+ +TCKFHHP+  N++   RGSP Y  VHS  + G
Sbjct  168  KECAYYLKTGHCKYANTCKFHHPELFNVVPSSRGSPIYTSVHSSASAG  215


 Score = 99.0 bits (245),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 48/99 (48%), Positives = 62/99 (63%), Gaps = 0/99 (0%)
 Frame = +1

Query  595  PSNRKLAIAAARMKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNV  774
            PS+  +   A + +  +PER  +PECQYY+KTG CKFGA CKFHHPR ++       L+ 
Sbjct  297  PSSFPVPQYALQRENVFPERPDEPECQYYMKTGDCKFGAVCKFHHPRVRSLPPPDCVLSP  356

Query  775  LGYPLRPNDIECPYYMRTGQCKFGSTCKFHHPQPSNMMV  891
            +G PLRP +  C +Y R G CKFG+ CKF HP     MV
Sbjct  357  MGLPLRPGEELCKFYSRYGICKFGANCKFDHPTVVAPMV  395


 Score = 75.1 bits (183),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 35/77 (45%), Positives = 47/77 (61%), Gaps = 1/77 (1%)
 Frame = +1

Query  505  TYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKG-EYPERVGQPECQYY  681
             +P R  EP+C YY++TG C+FGA C+F+HP  R L      +     P R G+  C++Y
Sbjct  312  VFPERPDEPECQYYMKTGDCKFGAVCKFHHPRVRSLPPPDCVLSPMGLPLRPGEELCKFY  371

Query  682  LKTGACKFGATCKFHHP  732
             + G CKFGA CKF HP
Sbjct  372  SRYGICKFGANCKFDHP  388



>ref|XP_006287837.1| hypothetical protein CARUB_v10001057mg [Capsella rubella]
 gb|EOA20735.1| hypothetical protein CARUB_v10001057mg [Capsella rubella]
Length=418

 Score =   246 bits (627),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 120/193 (62%), Positives = 143/193 (74%), Gaps = 11/193 (6%)
 Frame = +1

Query  367  MDFEAAAGISASMASVTEGPSSLSPPLAQETLWQLSLRSMETME-SGTYPVRDGEPDCSY  543
            MDF++   IS    S       LSP L Q  +WQ +L S ETM   G YP R GEPDCSY
Sbjct  1    MDFDSRVPISRESIS-------LSPLLHQNAMWQTNLGSDETMGGDGLYPERPGEPDCSY  53

Query  544  YIRTGLCRFGASCRFNHPSNRKLAIAAARMKGEYPERVGQPECQYYLKTGACKFGATCKF  723
            YIRTGLCRFG++CRFNHP +RKL IA AR KGEYPER+GQPEC++Y+KTG CKFG TCKF
Sbjct  54   YIRTGLCRFGSTCRFNHPYDRKLVIATARTKGEYPERIGQPECEFYIKTGTCKFGVTCKF  113

Query  724  HHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTCKFHHP--QPSNMMVPL  897
            HHPR+KAGI  RV++NVLGYPLRPN+ +C Y++RTG CKFG +CKF+HP  Q + +MV L
Sbjct  114  HHPRNKAGIDERVSVNVLGYPLRPNEDDCSYFLRTGHCKFGGSCKFNHPQTQSTKLMVSL  173

Query  898  RGSPAYPPVHSPT  936
            R SP Y  + S T
Sbjct  174  R-SPVYSALQSLT  185


 Score = 96.7 bits (239),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 42/76 (55%), Positives = 53/76 (70%), Gaps = 0/76 (0%)
 Frame = +1

Query  643  YPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYM  822
            +PER GQ EC++Y+KTG CKFG  CKFHHPR++   A    L+ +G PLRP +  C +Y 
Sbjct  282  FPERPGQLECEFYMKTGDCKFGTVCKFHHPRNRQTPAPDCVLSTVGLPLRPGEPLCVFYS  341

Query  823  RTGQCKFGSTCKFHHP  870
            R G CKFG +CKF HP
Sbjct  342  RYGICKFGPSCKFDHP  357


 Score = 72.8 bits (177),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 33/77 (43%), Positives = 47/77 (61%), Gaps = 1/77 (1%)
 Frame = +1

Query  505  TYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKL-AIAAARMKGEYPERVGQPECQYY  681
             +P R G+ +C +Y++TG C+FG  C+F+HP NR+  A          P R G+P C +Y
Sbjct  281  VFPERPGQLECEFYMKTGDCKFGTVCKFHHPRNRQTPAPDCVLSTVGLPLRPGEPLCVFY  340

Query  682  LKTGACKFGATCKFHHP  732
             + G CKFG +CKF HP
Sbjct  341  SRYGICKFGPSCKFDHP  357


 Score = 53.5 bits (127),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 19/31 (61%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = +1

Query  781  YPLRPNDIECPYYMRTGQCKFGSTCKFHHPQ  873
            +P RP  +EC +YM+TG CKFG+ CKFHHP+
Sbjct  282  FPERPGQLECEFYMKTGDCKFGTVCKFHHPR  312



>ref|NP_974790.1| zinc finger nuclease 3 [Arabidopsis thaliana]
 gb|AAM61197.1| zinc finger protein 3 [Arabidopsis thaliana]
 gb|AED92307.1| zinc finger nuclease 3 [Arabidopsis thaliana]
Length=354

 Score =   243 bits (620),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 109/162 (67%), Positives = 134/162 (83%), Gaps = 3/162 (2%)
 Frame = +1

Query  460  LWQLSLRSMETM-ESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMK  636
            +WQ++L S +TM   G+YP R GEPDC+YYIRTGLCRFG++CRFNHP +RKL IA AR+K
Sbjct  1    MWQMNLGSDDTMGVDGSYPERHGEPDCAYYIRTGLCRFGSTCRFNHPHDRKLVIATARIK  60

Query  637  GEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPY  816
            GEYPER+GQPEC++YLKTG CKFG TCKFHHPR+KAGI G V++NVL YPLRPN+ +C Y
Sbjct  61   GEYPERIGQPECEFYLKTGTCKFGVTCKFHHPRNKAGIDGSVSVNVLSYPLRPNEDDCSY  120

Query  817  YMRTGQCKFGSTCKFHHP--QPSNMMVPLRGSPAYPPVHSPT  936
            ++R GQCKFG TCKF+HP  Q +N+MV +RGSP Y  + S T
Sbjct  121  FLRIGQCKFGGTCKFNHPQTQSTNLMVSVRGSPVYSALQSLT  162


 Score =   101 bits (251),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 46/87 (53%), Positives = 56/87 (64%), Gaps = 0/87 (0%)
 Frame = +1

Query  610  LAIAAARMKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPL  789
            L   A   +  +PER GQPECQ+Y+KTG CKFG  CKFHHPRD+        L+ +G PL
Sbjct  208  LGFYALPRENVFPERPGQPECQFYMKTGDCKFGTVCKFHHPRDRQTPPPDCVLSSVGLPL  267

Query  790  RPNDIECPYYMRTGQCKFGSTCKFHHP  870
            RP +  C +Y R G CKFG +CKF HP
Sbjct  268  RPGEPLCVFYSRYGICKFGPSCKFDHP  294


 Score = 80.1 bits (196),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 47/144 (33%), Positives = 69/144 (48%), Gaps = 23/144 (16%)
 Frame = +1

Query  505  TYPVRDGEPDCSYYIRTGLCRFGASCRFNHP----SNRKLAIAAARMKGEYPERVGQPEC  672
            +YP+R  E DCSY++R G C+FG +C+FNHP    +N  +++  + +        GQP  
Sbjct  108  SYPLRPNEDDCSYFLRIGQCKFGGTCKFNHPQTQSTNLMVSVRGSPVYSALQSLTGQPSY  167

Query  673  QYY----------------LKTGACKFGATCKFHHPRDK-AGIAGRVALNVLGYPLRPND  801
             +                   +G+     +  FH       G       NV  +P RP  
Sbjct  168  SWSRTSFVANPPRLQDPSGFASGSQGGLFSSGFHSGNSVPLGFYALPRENV--FPERPGQ  225

Query  802  IECPYYMRTGQCKFGSTCKFHHPQ  873
             EC +YM+TG CKFG+ CKFHHP+
Sbjct  226  PECQFYMKTGDCKFGTVCKFHHPR  249


 Score = 74.3 bits (181),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 32/77 (42%), Positives = 48/77 (62%), Gaps = 1/77 (1%)
 Frame = +1

Query  505  TYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKGE-YPERVGQPECQYY  681
             +P R G+P+C +Y++TG C+FG  C+F+HP +R+       +     P R G+P C +Y
Sbjct  218  VFPERPGQPECQFYMKTGDCKFGTVCKFHHPRDRQTPPPDCVLSSVGLPLRPGEPLCVFY  277

Query  682  LKTGACKFGATCKFHHP  732
             + G CKFG +CKF HP
Sbjct  278  SRYGICKFGPSCKFDHP  294



>ref|XP_003564925.1| PREDICTED: zinc finger CCCH domain-containing protein 12-like 
[Brachypodium distachyon]
Length=442

 Score =   243 bits (621),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 113/168 (67%), Positives = 134/168 (80%), Gaps = 1/168 (1%)
 Frame = +1

Query  445  LAQETLWQ-LSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIA  621
            L  E +WQ +++ S   M+ G YP R GEPDC+YY+RTGLCRFG SCRFNHP +R LAIA
Sbjct  55   LYDEGMWQEMTMSSGAPMQPGPYPERPGEPDCTYYLRTGLCRFGISCRFNHPPDRNLAIA  114

Query  622  AARMKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPND  801
            +ARMKGEYPERVGQPECQYYLKTG CKFG TCKFHHPR+KAGIAG V LN LGYPLR N+
Sbjct  115  SARMKGEYPERVGQPECQYYLKTGTCKFGPTCKFHHPREKAGIAGMVQLNTLGYPLRLNE  174

Query  802  IECPYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVHSPTTPG  945
             EC YY++TGQCK+G+TCKF+HP+  N +   RGSP YP +H+  + G
Sbjct  175  KECAYYLKTGQCKYGNTCKFNHPELFNAVASSRGSPIYPSLHTSASAG  222


 Score = 98.6 bits (244),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 49/99 (49%), Positives = 61/99 (62%), Gaps = 0/99 (0%)
 Frame = +1

Query  595  PSNRKLAIAAARMKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNV  774
            PS+  +   A + +  +PER  QPEC YY+KTG CKFGA CKFHHPR ++       L+ 
Sbjct  314  PSSFPVPQYALQRENVFPERPDQPECIYYIKTGDCKFGAVCKFHHPRVRSLPPPDCVLSP  373

Query  775  LGYPLRPNDIECPYYMRTGQCKFGSTCKFHHPQPSNMMV  891
            +G PLRP +  C +Y R G CKFG  CKF HP  S M V
Sbjct  374  MGLPLRPGEELCKFYSRYGICKFGINCKFDHPMASPMGV  412


 Score = 72.8 bits (177),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 34/77 (44%), Positives = 46/77 (60%), Gaps = 1/77 (1%)
 Frame = +1

Query  505  TYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKGE-YPERVGQPECQYY  681
             +P R  +P+C YYI+TG C+FGA C+F+HP  R L      +     P R G+  C++Y
Sbjct  329  VFPERPDQPECIYYIKTGDCKFGAVCKFHHPRVRSLPPPDCVLSPMGLPLRPGEELCKFY  388

Query  682  LKTGACKFGATCKFHHP  732
             + G CKFG  CKF HP
Sbjct  389  SRYGICKFGINCKFDHP  405



>ref|XP_006400193.1| hypothetical protein EUTSA_v10013743mg [Eutrema salsugineum]
 gb|ESQ41646.1| hypothetical protein EUTSA_v10013743mg [Eutrema salsugineum]
Length=395

 Score =   240 bits (612),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 110/163 (67%), Positives = 134/163 (82%), Gaps = 7/163 (4%)
 Frame = +1

Query  460  LWQLSLRSMETM--ESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARM  633
            +WQ++L S ETM  + G+YP R GEPDCSYYIRTGLCRFG++CRFNHP +RKL IA  R+
Sbjct  1    MWQMNLGSDETMSGDDGSYPERPGEPDCSYYIRTGLCRFGSTCRFNHPHDRKLVIATERI  60

Query  634  KGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECP  813
            KGE+PER+GQPEC++YLKTG CKFG TCKFHHPR+K   AGRV+ +VLGYPLRPN+ +C 
Sbjct  61   KGEFPERIGQPECEFYLKTGTCKFGVTCKFHHPRNK---AGRVSHSVLGYPLRPNEDDCS  117

Query  814  YYMRTGQCKFGSTCKFHHP--QPSNMMVPLRGSPAYPPVHSPT  936
            Y++RTG CKFG TCKF+HP  Q +N+MV LRGSP Y  + SPT
Sbjct  118  YFLRTGHCKFGGTCKFNHPQSQSTNLMVSLRGSPVYSALQSPT  160


 Score = 96.7 bits (239),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 43/76 (57%), Positives = 53/76 (70%), Gaps = 0/76 (0%)
 Frame = +1

Query  643  YPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYM  822
            +PER GQPEC++Y+KTG CKFG  CKFHHPRD+   A    L+ +G PLR  +  C +Y 
Sbjct  258  FPERPGQPECEFYMKTGDCKFGTVCKFHHPRDRQTPAPDCLLSPVGLPLRLGEPLCVFYS  317

Query  823  RTGQCKFGSTCKFHHP  870
            R G CKFG +CKF HP
Sbjct  318  RYGICKFGPSCKFDHP  333


 Score = 75.9 bits (185),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 32/77 (42%), Positives = 49/77 (64%), Gaps = 1/77 (1%)
 Frame = +1

Query  505  TYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMK-GEYPERVGQPECQYY  681
             +P R G+P+C +Y++TG C+FG  C+F+HP +R+       +     P R+G+P C +Y
Sbjct  257  VFPERPGQPECEFYMKTGDCKFGTVCKFHHPRDRQTPAPDCLLSPVGLPLRLGEPLCVFY  316

Query  682  LKTGACKFGATCKFHHP  732
             + G CKFG +CKF HP
Sbjct  317  SRYGICKFGPSCKFDHP  333



>dbj|BAJ86320.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=442

 Score =   239 bits (609),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 116/166 (70%), Positives = 131/166 (79%), Gaps = 2/166 (1%)
 Frame = +1

Query  454  ETLWQLSLR-SMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAAR  630
            E  WQ++L     +ME G YP R GE DCSYY+RTG CRFG +C+FNHP++RKLA+AAAR
Sbjct  32   EATWQMTLGCGGLSMEPGPYPERIGERDCSYYMRTGFCRFGVTCKFNHPADRKLAVAAAR  91

Query  631  MKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIEC  810
            MKGEYP RVGQPECQYYLKTG CKFGATCKFHHPR+KA IA    LNVLGYPLR N+ EC
Sbjct  92   MKGEYPYRVGQPECQYYLKTGTCKFGATCKFHHPREKAAIAISAQLNVLGYPLRLNEKEC  151

Query  811  PYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQ  948
             YY+RTGQCKF STCKFHHPQPS+ MV +R S    P  S T+PGQ
Sbjct  152  VYYLRTGQCKFASTCKFHHPQPSSTMVAIRSS-ICSPGQSTTSPGQ  196


 Score =   102 bits (255),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 55/116 (47%), Positives = 68/116 (59%), Gaps = 9/116 (8%)
 Frame = +1

Query  610  LAIAAARMKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPL  789
            L + A + +  +PER  QPECQ+Y+KTG CKFGA CKF+HP+ +   A   AL+ LG PL
Sbjct  292  LGVYAVQGENTFPERPEQPECQFYMKTGDCKFGAVCKFNHPKKRMVPAPNCALSPLGLPL  351

Query  790  RPNDIECPYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPA-----YPPVHSPTTP  942
            RP +  C +Y R G CKFG  CKF HP    M   L GSP       PP+H    P
Sbjct  352  RPGEPICTFYSRYGICKFGPNCKFDHP----MGTILYGSPTSPTGDVPPLHYQLAP  403


 Score = 77.0 bits (188),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 36/77 (47%), Positives = 48/77 (62%), Gaps = 1/77 (1%)
 Frame = +1

Query  505  TYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKL-AIAAARMKGEYPERVGQPECQYY  681
            T+P R  +P+C +Y++TG C+FGA C+FNHP  R + A   A      P R G+P C +Y
Sbjct  302  TFPERPEQPECQFYMKTGDCKFGAVCKFNHPKKRMVPAPNCALSPLGLPLRPGEPICTFY  361

Query  682  LKTGACKFGATCKFHHP  732
             + G CKFG  CKF HP
Sbjct  362  SRYGICKFGPNCKFDHP  378



>ref|XP_002871723.1| hypothetical protein ARALYDRAFT_488510 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH47982.1| hypothetical protein ARALYDRAFT_488510 [Arabidopsis lyrata subsp. 
lyrata]
Length=344

 Score =   235 bits (600),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 106/152 (70%), Positives = 125/152 (82%), Gaps = 2/152 (1%)
 Frame = +1

Query  499  SGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKGEYPERVGQPECQY  678
             G+YP R GEPDC+YYIRTGLCRFG +CRFNHP +RKL IA AR+KGEYPER+GQPEC++
Sbjct  4    DGSYPERHGEPDCAYYIRTGLCRFGFTCRFNHPHDRKLVIATARIKGEYPERIGQPECEF  63

Query  679  YLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTCK  858
            YLKTG CKFG TCKFHHPR+KAG  GRV++NVLGYPLRPN+ +C Y++RTG CKFG TCK
Sbjct  64   YLKTGTCKFGVTCKFHHPRNKAGNDGRVSVNVLGYPLRPNEDDCSYFLRTGHCKFGGTCK  123

Query  859  FHHP--QPSNMMVPLRGSPAYPPVHSPTTPGQ  948
            F+HP  Q +N+MV LRGSP Y  +  PT   Q
Sbjct  124  FNHPQTQSTNLMVSLRGSPVYSALQPPTDGQQ  155


 Score =   101 bits (251),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 47/87 (54%), Positives = 57/87 (66%), Gaps = 0/87 (0%)
 Frame = +1

Query  610  LAIAAARMKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPL  789
            L   A   +  +PER GQPECQ+Y+KTG CKFG  CKFHHPRD+   A   AL+ +G PL
Sbjct  198  LGFYALPRENVFPERPGQPECQFYMKTGDCKFGTVCKFHHPRDRQTPAPDCALSSVGLPL  257

Query  790  RPNDIECPYYMRTGQCKFGSTCKFHHP  870
            R  +  C +Y R G CKFG +CKF HP
Sbjct  258  RQGEPLCVFYSRYGICKFGPSCKFDHP  284


 Score = 76.3 bits (186),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 34/78 (44%), Positives = 49/78 (63%), Gaps = 1/78 (1%)
 Frame = +1

Query  502  GTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKL-AIAAARMKGEYPERVGQPECQY  678
              +P R G+P+C +Y++TG C+FG  C+F+HP +R+  A   A      P R G+P C +
Sbjct  207  NVFPERPGQPECQFYMKTGDCKFGTVCKFHHPRDRQTPAPDCALSSVGLPLRQGEPLCVF  266

Query  679  YLKTGACKFGATCKFHHP  732
            Y + G CKFG +CKF HP
Sbjct  267  YSRYGICKFGPSCKFDHP  284


 Score = 74.7 bits (182),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 50/152 (33%), Positives = 68/152 (45%), Gaps = 26/152 (17%)
 Frame = +1

Query  508  YPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKGEYPERVGQP--ECQYY  681
            YP+R  E DCSY++RTG C+FG +C+FNHP  +   +  + ++G       QP  + Q  
Sbjct  98   YPLRPNEDDCSYFLRTGHCKFGGTCKFNHPQTQSTNLMVS-LRGSPVYSALQPPTDGQQS  156

Query  682  LKTGACKFGA--------------------TCKFHHPRDK-AGIAGRVALNVLGYPLRPN  798
                   F A                    +  FH       G       NV  +P RP 
Sbjct  157  YSWPRTSFVANPPRWQDPSSFSSGSQGGLFSSGFHSGNSVPLGFYALPRENV--FPERPG  214

Query  799  DIECPYYMRTGQCKFGSTCKFHHPQPSNMMVP  894
              EC +YM+TG CKFG+ CKFHHP+      P
Sbjct  215  QPECQFYMKTGDCKFGTVCKFHHPRDRQTPAP  246



>ref|XP_010492565.1| PREDICTED: zinc finger CCCH domain-containing protein 57-like 
[Camelina sativa]
Length=418

 Score =   237 bits (604),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 116/195 (59%), Positives = 141/195 (72%), Gaps = 16/195 (8%)
 Frame = +1

Query  367  MDFEAAAGISASMASVTEGPSSLSPPLAQETLWQLSLRSMETME--SGTYPVRDGEPDCS  540
            MDF+       S   +T   +SLSP L Q  +WQ++L S ETM    G YP R GEPDCS
Sbjct  1    MDFD-------SRVPITRESTSLSPLLHQNAMWQMNLGSDETMSGCDGFYPERQGEPDCS  53

Query  541  YYIRTGLCRFGASCRFNHPSNRKLAIAAARMKGEYPERVGQPECQYYLKTGACKFGATCK  720
            YYIRTGLCRFG++CRFNHP +RKL IA AR KGEYPER+GQPEC++Y+KTG CKFG TCK
Sbjct  54   YYIRTGLCRFGSTCRFNHPHDRKLVIATARAKGEYPERIGQPECEFYMKTGTCKFGVTCK  113

Query  721  FHHPRDKAGI-AGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTCKFHHP--QPSNMMV  891
            FHHPR+ AG   GRV++    YPLRPN+ +C Y++RTG CKFG TCKF+HP  Q + +MV
Sbjct  114  FHHPRNNAGTDDGRVSV----YPLRPNEDDCSYFLRTGHCKFGGTCKFNHPPTQSTKLMV  169

Query  892  PLRGSPAYPPVHSPT  936
             +RGSP Y  + S T
Sbjct  170  SVRGSPVYSALQSLT  184


 Score = 96.7 bits (239),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 43/76 (57%), Positives = 52/76 (68%), Gaps = 0/76 (0%)
 Frame = +1

Query  643  YPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYM  822
            +PER GQ ECQ+Y+KTG CKFG  CKFHHPRD+   A    L+ +G PLR  +  C +Y 
Sbjct  280  FPERPGQLECQFYMKTGDCKFGTVCKFHHPRDRQTPAPDCVLSTVGLPLRLGEPLCVFYS  339

Query  823  RTGQCKFGSTCKFHHP  870
            R G CKFG +CKF HP
Sbjct  340  RYGICKFGPSCKFDHP  355


 Score = 73.2 bits (178),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 32/76 (42%), Positives = 48/76 (63%), Gaps = 1/76 (1%)
 Frame = +1

Query  508  YPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKL-AIAAARMKGEYPERVGQPECQYYL  684
            +P R G+ +C +Y++TG C+FG  C+F+HP +R+  A          P R+G+P C +Y 
Sbjct  280  FPERPGQLECQFYMKTGDCKFGTVCKFHHPRDRQTPAPDCVLSTVGLPLRLGEPLCVFYS  339

Query  685  KTGACKFGATCKFHHP  732
            + G CKFG +CKF HP
Sbjct  340  RYGICKFGPSCKFDHP  355


 Score = 55.5 bits (132),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 22/45 (49%), Positives = 29/45 (64%), Gaps = 0/45 (0%)
 Frame = +1

Query  760  VALNVLGYPLRPNDIECPYYMRTGQCKFGSTCKFHHPQPSNMMVP  894
            V L +  +P RP  +EC +YM+TG CKFG+ CKFHHP+      P
Sbjct  273  VPLCLYAFPERPGQLECQFYMKTGDCKFGTVCKFHHPRDRQTPAP  317



>gb|EEC69137.1| hypothetical protein OsI_38063 [Oryza sativa Indica Group]
Length=395

 Score =   236 bits (602),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 109/155 (70%), Positives = 127/155 (82%), Gaps = 2/155 (1%)
 Frame = +1

Query  391  ISASMASVTEGPSSLSPPLAQETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRF  570
            +SA+ A++  GP  L    A+E +WQ++L   E+MES  YP R GEPDCSYY+RTGLCRF
Sbjct  26   VSAAAAAI--GPHHLGVAAAEEAMWQMTLGGGESMESTPYPERIGEPDCSYYMRTGLCRF  83

Query  571  GASCRFNHPSNRKLAIAAARMKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGI  750
            G +C+FNHP NRKLA+AAARM GEYP RVGQPECQYYLKTG CKFGATCKFHHPR+KA +
Sbjct  84   GMTCKFNHPPNRKLAVAAARMNGEYPYRVGQPECQYYLKTGTCKFGATCKFHHPREKAAL  143

Query  751  AGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTC  855
            A RV LNVLGYP+RPN+ EC YY+RTGQCKF STC
Sbjct  144  ANRVQLNVLGYPMRPNEKECAYYLRTGQCKFASTC  178


 Score =   103 bits (256),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 49/94 (52%), Positives = 62/94 (66%), Gaps = 2/94 (2%)
 Frame = +1

Query  610  LAIAAARMKGE--YPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGY  783
            + +    ++GE  +PER  QPECQ+Y+KTG CKFGA CKFHHP+++   A   ALN LG 
Sbjct  243  VPVGVYTVQGENIFPERPDQPECQFYMKTGDCKFGAVCKFHHPKERLVPAPNCALNSLGL  302

Query  784  PLRPNDIECPYYMRTGQCKFGSTCKFHHPQPSNM  885
            PLRP +  C +Y R G CKFG  CKF HP  + M
Sbjct  303  PLRPGEPVCTFYSRYGICKFGPNCKFDHPMGTLM  336


 Score = 73.9 bits (180),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 47/76 (62%), Gaps = 1/76 (1%)
 Frame = +1

Query  508  YPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKL-AIAAARMKGEYPERVGQPECQYYL  684
            +P R  +P+C +Y++TG C+FGA C+F+HP  R + A   A      P R G+P C +Y 
Sbjct  256  FPERPDQPECQFYMKTGDCKFGAVCKFHHPKERLVPAPNCALNSLGLPLRPGEPVCTFYS  315

Query  685  KTGACKFGATCKFHHP  732
            + G CKFG  CKF HP
Sbjct  316  RYGICKFGPNCKFDHP  331


 Score = 68.6 bits (166),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 44/135 (33%), Positives = 64/135 (47%), Gaps = 15/135 (11%)
 Frame = +1

Query  508  YPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIA------AARMKGEYPERVGQP-  666
            YP+R  E +C+YY+RTG C+F ++C       + L         AA+M    P+   +  
Sbjct  154  YPMRPNEKECAYYLRTGQCKFASTCYAQVIVPQGLVQVPGWNPYAAQMGSSSPDDQQRTP  213

Query  667  -ECQYY-----LKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRT  828
               QYY        G    G    +       G+      N+  +P RP+  EC +YM+T
Sbjct  214  VTTQYYGSRQSETGGMGDHGMYQSYQGGSVPVGVYTVQGENI--FPERPDQPECQFYMKT  271

Query  829  GQCKFGSTCKFHHPQ  873
            G CKFG+ CKFHHP+
Sbjct  272  GDCKFGAVCKFHHPK  286



>gb|KFK25871.1| hypothetical protein AALP_AA8G173100 [Arabis alpina]
Length=325

 Score =   231 bits (589),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 112/192 (58%), Positives = 134/192 (70%), Gaps = 18/192 (9%)
 Frame = +1

Query  367  MDFEAAAGISASMASVTEGPSSLSPPLAQETLWQLSLRSMETMESGTYPVRDGEPDCSYY  546
            MDF++   IS          +SLS  L Q  +             G YP R GEPDCSYY
Sbjct  1    MDFDSRVAISREA-------TSLSHLLNQNEI---------IGGVGLYPERPGEPDCSYY  44

Query  547  IRTGLCRFGASCRFNHPSNRKLAIAAARMKGEYPERVGQPECQYYLKTGACKFGATCKFH  726
            IRTGLCRFG++CRFNHP +RKL IA AR++GEYPER+ QP+CQ+YLKTG CKFG TCKFH
Sbjct  45   IRTGLCRFGSTCRFNHPRDRKLVIATARIRGEYPERIDQPDCQFYLKTGTCKFGVTCKFH  104

Query  727  HPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTCKFHHP--QPSNMMVPLR  900
            HPR+ A IAG V++N LGYPLRP + +C Y++RTG CKFG TCKF+HP  Q SN+MV L 
Sbjct  105  HPRNNADIAGSVSVNALGYPLRPEEDDCSYFLRTGHCKFGGTCKFNHPQSQSSNLMVSLS  164

Query  901  GSPAYPPVHSPT  936
            GSP Y  + SPT
Sbjct  165  GSPVYSALQSPT  176


 Score = 73.6 bits (179),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 36/74 (49%), Positives = 48/74 (65%), Gaps = 1/74 (1%)
 Frame = +1

Query  577  SCRFNHPSNRKLAIAAARMKGE-YPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIA  753
            S RF+  ++  L   A+  + + +PER GQPECQ+Y+KTG CKFG  CKFHHPRD+   A
Sbjct  250  SSRFHSGNSVPLGYYASLAREDLFPERPGQPECQFYMKTGDCKFGTVCKFHHPRDRQAPA  309

Query  754  GRVALNVLGYPLRP  795
                L+ +  PLRP
Sbjct  310  PDCVLSPVDLPLRP  323


 Score = 51.2 bits (121),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 19/31 (61%), Positives = 24/31 (77%), Gaps = 0/31 (0%)
 Frame = +1

Query  781  YPLRPNDIECPYYMRTGQCKFGSTCKFHHPQ  873
            +P RP   EC +YM+TG CKFG+ CKFHHP+
Sbjct  273  FPERPGQPECQFYMKTGDCKFGTVCKFHHPR  303



>gb|KFK25872.1| hypothetical protein AALP_AA8G173100 [Arabis alpina]
Length=410

 Score =   232 bits (591),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 112/192 (58%), Positives = 134/192 (70%), Gaps = 18/192 (9%)
 Frame = +1

Query  367  MDFEAAAGISASMASVTEGPSSLSPPLAQETLWQLSLRSMETMESGTYPVRDGEPDCSYY  546
            MDF++   IS          +SLS  L Q  +             G YP R GEPDCSYY
Sbjct  1    MDFDSRVAISREA-------TSLSHLLNQNEI---------IGGVGLYPERPGEPDCSYY  44

Query  547  IRTGLCRFGASCRFNHPSNRKLAIAAARMKGEYPERVGQPECQYYLKTGACKFGATCKFH  726
            IRTGLCRFG++CRFNHP +RKL IA AR++GEYPER+ QP+CQ+YLKTG CKFG TCKFH
Sbjct  45   IRTGLCRFGSTCRFNHPRDRKLVIATARIRGEYPERIDQPDCQFYLKTGTCKFGVTCKFH  104

Query  727  HPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTCKFHHP--QPSNMMVPLR  900
            HPR+ A IAG V++N LGYPLRP + +C Y++RTG CKFG TCKF+HP  Q SN+MV L 
Sbjct  105  HPRNNADIAGSVSVNALGYPLRPEEDDCSYFLRTGHCKFGGTCKFNHPQSQSSNLMVSLS  164

Query  901  GSPAYPPVHSPT  936
            GSP Y  + SPT
Sbjct  165  GSPVYSALQSPT  176


 Score =   101 bits (252),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 49/99 (49%), Positives = 64/99 (65%), Gaps = 1/99 (1%)
 Frame = +1

Query  577  SCRFNHPSNRKLAIAAARMKGE-YPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIA  753
            S RF+  ++  L   A+  + + +PER GQPECQ+Y+KTG CKFG  CKFHHPRD+   A
Sbjct  250  SSRFHSGNSVPLGYYASLAREDLFPERPGQPECQFYMKTGDCKFGTVCKFHHPRDRQAPA  309

Query  754  GRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTCKFHHP  870
                L+ +  PLRP +  C +Y R G CKFG +CKF HP
Sbjct  310  PDCVLSPVDLPLRPGEPLCVFYSRYGICKFGPSCKFDHP  348


 Score = 75.5 bits (184),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 49/76 (64%), Gaps = 1/76 (1%)
 Frame = +1

Query  508  YPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKL-AIAAARMKGEYPERVGQPECQYYL  684
            +P R G+P+C +Y++TG C+FG  C+F+HP +R+  A        + P R G+P C +Y 
Sbjct  273  FPERPGQPECQFYMKTGDCKFGTVCKFHHPRDRQAPAPDCVLSPVDLPLRPGEPLCVFYS  332

Query  685  KTGACKFGATCKFHHP  732
            + G CKFG +CKF HP
Sbjct  333  RYGICKFGPSCKFDHP  348


 Score = 53.1 bits (126),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/56 (45%), Positives = 31/56 (55%), Gaps = 3/56 (5%)
 Frame = +1

Query  781  YPLRPNDIECPYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQ  948
            +P RP   EC +YM+TG CKFG+ CKFHHP+      P        PV  P  PG+
Sbjct  273  FPERPGQPECQFYMKTGDCKFGTVCKFHHPRDRQAPAP---DCVLSPVDLPLRPGE  325



>ref|XP_001768387.1| predicted protein [Physcomitrella patens]
 gb|EDQ66749.1| predicted protein, partial [Physcomitrella patens]
Length=332

 Score =   221 bits (563),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 108/167 (65%), Positives = 125/167 (75%), Gaps = 7/167 (4%)
 Frame = +1

Query  454  ETLWQLSLRSMETMESGT--YPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAA  627
            E  W ++++  E ++ G   YP R GEPDC YY+RTGLC FG +CR+NHP NRKLA AA 
Sbjct  1    EAGWAMAMQGQEGVDGGQGPYPERPGEPDCVYYMRTGLCGFGMTCRYNHPPNRKLAAAAT  60

Query  628  RMKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIE  807
            R KGEYPERVG PECQYYLKTG CKFGATCK+HHPR+KAG  GRV LNVLG PLR  + E
Sbjct  61   RGKGEYPERVGHPECQYYLKTGTCKFGATCKYHHPREKAGSTGRVHLNVLGLPLRLGEKE  120

Query  808  CPYYMRTGQCKFGSTCKFHHPQPSNM--MVPL---RGSPAYPPVHSP  933
            C YYMRTG CK+G TCKFHHPQP+ +  MVPL    G P++P   SP
Sbjct  121  CAYYMRTGSCKYGVTCKFHHPQPATVGGMVPLPFGSGVPSWPLTRSP  167


 Score =   102 bits (253),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 45/76 (59%), Positives = 57/76 (75%), Gaps = 0/76 (0%)
 Frame = +1

Query  643  YPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYM  822
            +PER GQPECQYY+KTG CKFG+TC++HHP+D+A  +    L+ +G PLRP +  C +Y 
Sbjct  256  FPERPGQPECQYYMKTGDCKFGSTCRYHHPKDRATPSPTCHLSPMGLPLRPGNPPCSFYS  315

Query  823  RTGQCKFGSTCKFHHP  870
            R G CKFG TCKF HP
Sbjct  316  RYGICKFGPTCKFDHP  331


 Score = 78.2 bits (191),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 41/106 (39%), Positives = 61/106 (58%), Gaps = 8/106 (8%)
 Frame = +1

Query  418  EGPSSLSPPLAQETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHP  597
            +G S++  P  Q T    ++   ET+    +P R G+P+C YY++TG C+FG++CR++HP
Sbjct  233  QGSSAVGLPAHQATQ---AVGGQETV----FPERPGQPECQYYMKTGDCKFGSTCRYHHP  285

Query  598  SNRKLAIAAARMKG-EYPERVGQPECQYYLKTGACKFGATCKFHHP  732
             +R        +     P R G P C +Y + G CKFG TCKF HP
Sbjct  286  KDRATPSPTCHLSPMGLPLRPGNPPCSFYSRYGICKFGPTCKFDHP  331


 Score = 52.4 bits (124),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 28/57 (49%), Positives = 34/57 (60%), Gaps = 12/57 (21%)
 Frame = +1

Query  781  YPLRPNDIECPYYMRTGQCKFGSTCKFHHPQP----------SNMMVPLRGSPAYPP  921
            +P RP   EC YYM+TG CKFGSTC++HHP+           S M +PLR  P  PP
Sbjct  256  FPERPGQPECQYYMKTGDCKFGSTCRYHHPKDRATPSPTCHLSPMGLPLR--PGNPP  310



>ref|XP_006480414.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X2 [Citrus sinensis]
 ref|XP_006480415.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X3 [Citrus sinensis]
 ref|XP_006480416.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X4 [Citrus sinensis]
 ref|XP_006480417.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X5 [Citrus sinensis]
Length=420

 Score =   217 bits (552),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 97/116 (84%), Positives = 107/116 (92%), Gaps = 0/116 (0%)
 Frame = +1

Query  601  NRKLAIAAARMKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLG  780
            +++ AIA AR+KG+YPER+GQPECQYYLKTG CKFGATCKFHHPRDKAGIAGRV+LNVLG
Sbjct  58   SKQKAIATARIKGDYPERLGQPECQYYLKTGTCKFGATCKFHHPRDKAGIAGRVSLNVLG  117

Query  781  YPLRPNDIECPYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQ  948
            YPLRPN+IEC YY+RTGQCKFGSTCKFHHPQP+NMMV LRGSP YP V SPTTP Q
Sbjct  118  YPLRPNEIECAYYLRTGQCKFGSTCKFHHPQPNNMMVSLRGSPVYPTVQSPTTPSQ  173


 Score =   100 bits (249),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 44/87 (51%), Positives = 58/87 (67%), Gaps = 0/87 (0%)
 Frame = +1

Query  610  LAIAAARMKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPL  789
            +   A + +  +PER GQPECQ+Y+KTG CKFGA C+FHHPR++        L+ +G PL
Sbjct  268  VGFYALQRESVFPERPGQPECQFYMKTGDCKFGAVCRFHHPRERLLPVPDCVLSPIGLPL  327

Query  790  RPNDIECPYYMRTGQCKFGSTCKFHHP  870
            RP +  C +Y R G CKFG +CKF HP
Sbjct  328  RPGEPLCIFYSRYGICKFGPSCKFDHP  354


 Score = 79.3 bits (194),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 35/77 (45%), Positives = 49/77 (64%), Gaps = 1/77 (1%)
 Frame = +1

Query  505  TYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMK-GEYPERVGQPECQYY  681
             +P R G+P+C +Y++TG C+FGA CRF+HP  R L +    +     P R G+P C +Y
Sbjct  278  VFPERPGQPECQFYMKTGDCKFGAVCRFHHPRERLLPVPDCVLSPIGLPLRPGEPLCIFY  337

Query  682  LKTGACKFGATCKFHHP  732
             + G CKFG +CKF HP
Sbjct  338  SRYGICKFGPSCKFDHP  354


 Score = 53.1 bits (126),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/56 (43%), Positives = 33/56 (59%), Gaps = 3/56 (5%)
 Frame = +1

Query  781  YPLRPNDIECPYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQ  948
            +P RP   EC +YM+TG CKFG+ C+FHHP+   + VP        P+  P  PG+
Sbjct  279  FPERPGQPECQFYMKTGDCKFGAVCRFHHPRERLLPVP---DCVLSPIGLPLRPGE  331



>ref|XP_010929828.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X4 [Elaeis guineensis]
Length=380

 Score =   213 bits (542),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 97/113 (86%), Positives = 104/113 (92%), Gaps = 0/113 (0%)
 Frame = +1

Query  610  LAIAAARMKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPL  789
            +AIAAAR+KG YPERVGQPECQYYLKTG CKFGATCKFHHP+DKAGIAGRV LN+LGYPL
Sbjct  1    MAIAAARIKGGYPERVGQPECQYYLKTGTCKFGATCKFHHPKDKAGIAGRVQLNILGYPL  60

Query  790  RPNDIECPYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQ  948
            RPN+ EC YY+RTGQCKFG+TCKFHHPQPSN MV LRGSP YPPVHS TTPGQ
Sbjct  61   RPNEKECAYYIRTGQCKFGNTCKFHHPQPSNAMVALRGSPVYPPVHSSTTPGQ  113


 Score =   101 bits (251),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 46/92 (50%), Positives = 59/92 (64%), Gaps = 0/92 (0%)
 Frame = +1

Query  595  PSNRKLAIAAARMKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNV  774
            P +  + + A + +  +PER  QPECQ+Y+KTG CKFGA CKFHHPR++        L+ 
Sbjct  203  PGSIPMGVYALQRENIFPERPDQPECQFYMKTGDCKFGAVCKFHHPRERLVPVPNCLLSP  262

Query  775  LGYPLRPNDIECPYYMRTGQCKFGSTCKFHHP  870
            LG PLRP +  C +Y R G CKFG  CKF HP
Sbjct  263  LGLPLRPGEPLCVFYSRYGICKFGPNCKFDHP  294


 Score = 73.9 bits (180),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 32/76 (42%), Positives = 47/76 (62%), Gaps = 1/76 (1%)
 Frame = +1

Query  508  YPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKG-EYPERVGQPECQYYL  684
            +P R  +P+C +Y++TG C+FGA C+F+HP  R + +    +     P R G+P C +Y 
Sbjct  219  FPERPDQPECQFYMKTGDCKFGAVCKFHHPRERLVPVPNCLLSPLGLPLRPGEPLCVFYS  278

Query  685  KTGACKFGATCKFHHP  732
            + G CKFG  CKF HP
Sbjct  279  RYGICKFGPNCKFDHP  294



>gb|KJB26822.1| hypothetical protein B456_004G261700 [Gossypium raimondii]
Length=370

 Score =   212 bits (540),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 95/112 (85%), Positives = 104/112 (93%), Gaps = 0/112 (0%)
 Frame = +1

Query  613  AIAAARMKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLR  792
            AIAAARMKGE+PERVGQPECQYYLKTG CKFGATCKFHHPR++AGIAGRV+LN+LGYP R
Sbjct  13   AIAAARMKGEFPERVGQPECQYYLKTGTCKFGATCKFHHPREQAGIAGRVSLNILGYPFR  72

Query  793  PNDIECPYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQ  948
            PN+ EC YY+RTGQCKFGSTCKFHHPQP+NMM+ LRGSP YP V SPTTPGQ
Sbjct  73   PNETECAYYLRTGQCKFGSTCKFHHPQPTNMMISLRGSPIYPTVASPTTPGQ  124


 Score =   102 bits (255),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 49/95 (52%), Positives = 62/95 (65%), Gaps = 0/95 (0%)
 Frame = +1

Query  643  YPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYM  822
            +PER GQPECQ+Y+KTG CKFGA C+FHHPR++   A    L+ +G PLRP +  C +Y 
Sbjct  227  FPERPGQPECQFYMKTGDCKFGAVCRFHHPRERVPPAPDCLLSPIGLPLRPGEPLCDFYS  286

Query  823  RTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVH  927
            R G CKFG +CKF+HP           SP+  PVH
Sbjct  287  RYGICKFGPSCKFNHPMGIFTYNYSISSPSGAPVH  321


 Score = 75.9 bits (185),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 34/77 (44%), Positives = 48/77 (62%), Gaps = 1/77 (1%)
 Frame = +1

Query  505  TYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKG-EYPERVGQPECQYY  681
             +P R G+P+C +Y++TG C+FGA CRF+HP  R        +     P R G+P C +Y
Sbjct  226  VFPERPGQPECQFYMKTGDCKFGAVCRFHHPRERVPPAPDCLLSPIGLPLRPGEPLCDFY  285

Query  682  LKTGACKFGATCKFHHP  732
             + G CKFG +CKF+HP
Sbjct  286  SRYGICKFGPSCKFNHP  302



>ref|XP_006606434.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X2 [Glycine max]
Length=356

 Score =   203 bits (516),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 90/106 (85%), Positives = 99/106 (93%), Gaps = 0/106 (0%)
 Frame = +1

Query  631  MKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIEC  810
            M GE+PER+GQPECQYYLKTG CKFGATCKFHHP+D+AGIAGRVALN+LGYPLRPN+ EC
Sbjct  1    MIGEFPERIGQPECQYYLKTGTCKFGATCKFHHPKDQAGIAGRVALNILGYPLRPNEPEC  60

Query  811  PYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQ  948
             YY+RTGQCKFG+TCKFHHPQPSNMM+ LRGSP YP VHSPTTPGQ
Sbjct  61   TYYLRTGQCKFGNTCKFHHPQPSNMMLSLRGSPVYPTVHSPTTPGQ  106


 Score = 96.7 bits (239),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 43/76 (57%), Positives = 54/76 (71%), Gaps = 0/76 (0%)
 Frame = +1

Query  643  YPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYM  822
            +PER GQPECQ+Y+KTG CKFGA C+FHHPR++   A    L+ +G PLR  +  C +Y 
Sbjct  212  FPERPGQPECQFYVKTGDCKFGAVCQFHHPRERLIPAPDCVLSPIGLPLRLGEPLCVFYS  271

Query  823  RTGQCKFGSTCKFHHP  870
            R G CKFG +CKF HP
Sbjct  272  RYGICKFGPSCKFDHP  287


 Score = 77.4 bits (189),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 33/78 (42%), Positives = 50/78 (64%), Gaps = 1/78 (1%)
 Frame = +1

Query  508  YPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKG-EYPERVGQPECQYYL  684
            +P R G+P+C +Y++TG C+FGA C+F+HP  R +      +     P R+G+P C +Y 
Sbjct  212  FPERPGQPECQFYVKTGDCKFGAVCQFHHPRERLIPAPDCVLSPIGLPLRLGEPLCVFYS  271

Query  685  KTGACKFGATCKFHHPRD  738
            + G CKFG +CKF HP +
Sbjct  272  RYGICKFGPSCKFDHPME  289



>ref|XP_002993272.1| hypothetical protein SELMODRAFT_45667, partial [Selaginella moellendorffii]
 gb|EFJ05693.1| hypothetical protein SELMODRAFT_45667, partial [Selaginella moellendorffii]
Length=294

 Score =   200 bits (509),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 92/126 (73%), Positives = 102/126 (81%), Gaps = 0/126 (0%)
 Frame = +1

Query  502  GTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKGEYPERVGQPECQYY  681
            G YP R GE DC YY+RTGLC FG SC+FNHP NRKLA A AR KGEYPER GQPECQY+
Sbjct  4    GPYPERPGEQDCVYYMRTGLCAFGMSCKFNHPPNRKLAAAIARGKGEYPERPGQPECQYF  63

Query  682  LKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTCKF  861
            LKTG CKFG+TCK+ HPRDKAGI  RV LN++G P RP + EC YYMRTG CK+G TCKF
Sbjct  64   LKTGTCKFGSTCKYDHPRDKAGIQSRVQLNIVGLPYRPGEKECAYYMRTGSCKYGVTCKF  123

Query  862  HHPQPS  879
            HHPQP+
Sbjct  124  HHPQPA  129


 Score = 96.7 bits (239),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 44/76 (58%), Positives = 53/76 (70%), Gaps = 0/76 (0%)
 Frame = +1

Query  643  YPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYM  822
            +PER G  ECQYYLKTG CK+GA+C+FHHPRD+   +    L+ +G PLR     C YY+
Sbjct  200  FPERPGVAECQYYLKTGDCKYGASCRFHHPRDRISASAPTMLSPMGLPLRTGVQPCSYYI  259

Query  823  RTGQCKFGSTCKFHHP  870
            R G CKFG TCKF HP
Sbjct  260  RFGICKFGPTCKFDHP  275


 Score = 77.0 bits (188),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 37/76 (49%), Positives = 48/76 (63%), Gaps = 1/76 (1%)
 Frame = +1

Query  508  YPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKG-EYPERVGQPECQYYL  684
            +P R G  +C YY++TG C++GASCRF+HP +R  A A   +     P R G   C YY+
Sbjct  200  FPERPGVAECQYYLKTGDCKYGASCRFHHPRDRISASAPTMLSPMGLPLRTGVQPCSYYI  259

Query  685  KTGACKFGATCKFHHP  732
            + G CKFG TCKF HP
Sbjct  260  RFGICKFGPTCKFDHP  275


 Score = 65.5 bits (158),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 44/151 (29%), Positives = 71/151 (47%), Gaps = 18/151 (12%)
 Frame = +1

Query  466  QLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPS----------NRKLA  615
            +  ++S   +     P R GE +C+YY+RTG C++G +C+F+HP               A
Sbjct  83   KAGIQSRVQLNIVGLPYRPGEKECAYYMRTGSCKYGVTCKFHHPQPAVVPSIYAAAAAAA  142

Query  616  IAAARMKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLG-----  780
             A A   G      G P+   + + G+        F       G+   +  +  G     
Sbjct  143  AAGASQPGTPNAATGTPQ---HFQPGSPTTADYSPFVPGSPTMGLPAGLREHKGGGGGDA  199

Query  781  YPLRPNDIECPYYMRTGQCKFGSTCKFHHPQ  873
            +P RP   EC YY++TG CK+G++C+FHHP+
Sbjct  200  FPERPGVAECQYYLKTGDCKYGASCRFHHPR  230



>ref|XP_002993790.1| hypothetical protein SELMODRAFT_45658, partial [Selaginella moellendorffii]
 gb|EFJ05156.1| hypothetical protein SELMODRAFT_45658, partial [Selaginella moellendorffii]
Length=295

 Score =   200 bits (509),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 92/126 (73%), Positives = 102/126 (81%), Gaps = 0/126 (0%)
 Frame = +1

Query  502  GTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKGEYPERVGQPECQYY  681
            G YP R GE DC YY+RTGLC FG SC+FNHP NRKLA A AR KGEYPER GQPECQY+
Sbjct  4    GPYPERPGEQDCVYYMRTGLCAFGMSCKFNHPPNRKLAAAIARGKGEYPERPGQPECQYF  63

Query  682  LKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTCKF  861
            LKTG CKFG+TCK+ HPRDKAGI  RV LN++G P RP + EC YYMRTG CK+G TCKF
Sbjct  64   LKTGTCKFGSTCKYDHPRDKAGIQSRVQLNIVGLPYRPGEKECAYYMRTGSCKYGVTCKF  123

Query  862  HHPQPS  879
            HHPQP+
Sbjct  124  HHPQPA  129


 Score = 96.7 bits (239),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 44/76 (58%), Positives = 53/76 (70%), Gaps = 0/76 (0%)
 Frame = +1

Query  643  YPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYM  822
            +PER G  ECQYYLKTG CK+GA+C+FHHPRD+   +    L+ +G PLR     C YY+
Sbjct  201  FPERPGVAECQYYLKTGDCKYGASCRFHHPRDRISASAPTMLSPMGLPLRTGVQPCSYYI  260

Query  823  RTGQCKFGSTCKFHHP  870
            R G CKFG TCKF HP
Sbjct  261  RFGICKFGPTCKFDHP  276


 Score = 77.0 bits (188),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 37/76 (49%), Positives = 48/76 (63%), Gaps = 1/76 (1%)
 Frame = +1

Query  508  YPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKG-EYPERVGQPECQYYL  684
            +P R G  +C YY++TG C++GASCRF+HP +R  A A   +     P R G   C YY+
Sbjct  201  FPERPGVAECQYYLKTGDCKYGASCRFHHPRDRISASAPTMLSPMGLPLRTGVQPCSYYI  260

Query  685  KTGACKFGATCKFHHP  732
            + G CKFG TCKF HP
Sbjct  261  RFGICKFGPTCKFDHP  276


 Score = 65.1 bits (157),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 44/152 (29%), Positives = 71/152 (47%), Gaps = 19/152 (13%)
 Frame = +1

Query  466  QLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPS-----------NRKL  612
            +  ++S   +     P R GE +C+YY+RTG C++G +C+F+HP                
Sbjct  83   KAGIQSRVQLNIVGLPYRPGEKECAYYMRTGSCKYGVTCKFHHPQPAVVPSIYAAAAAAA  142

Query  613  AIAAARMKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLG----  780
            A A A   G      G P+   + + G+        F       G+   +  +  G    
Sbjct  143  AAAGASQPGTPNAATGTPQ---HFQPGSPTTADYSPFVPGSPTMGLPAGLREHKGGGGGD  199

Query  781  -YPLRPNDIECPYYMRTGQCKFGSTCKFHHPQ  873
             +P RP   EC YY++TG CK+G++C+FHHP+
Sbjct  200  AFPERPGVAECQYYLKTGDCKYGASCRFHHPR  231



>ref|XP_010523985.1| PREDICTED: zinc finger CCCH domain-containing protein 32-like 
[Tarenaya hassleriana]
 ref|XP_010523986.1| PREDICTED: zinc finger CCCH domain-containing protein 32-like 
[Tarenaya hassleriana]
 ref|XP_010523988.1| PREDICTED: zinc finger CCCH domain-containing protein 32-like 
[Tarenaya hassleriana]
 ref|XP_010523989.1| PREDICTED: zinc finger CCCH domain-containing protein 32-like 
[Tarenaya hassleriana]
Length=475

 Score =   204 bits (520),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 90/161 (56%), Positives = 116/161 (72%), Gaps = 5/161 (3%)
 Frame = +1

Query  451  QETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAAR  630
            +E++W+L L + ET     YP R G PDC+YY+RTG+C +G+ CR+NHP +R +  AA R
Sbjct  31   EESMWRLGLSNSET-----YPERPGVPDCAYYMRTGICGYGSRCRYNHPRDRAMVEAAVR  85

Query  631  MKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIEC  810
              G+YPERVG+P CQ+YLKTG CKFGA+CKFHHP++  G   +V LN+ GYPLR  + EC
Sbjct  86   ATGDYPERVGEPPCQFYLKTGTCKFGASCKFHHPKNAGGSMSQVPLNIHGYPLREGEKEC  145

Query  811  PYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVHSP  933
             +Y++TGQCKFG TCKFHHPQP+    P      YP VHSP
Sbjct  146  SHYLKTGQCKFGVTCKFHHPQPAGTTAPASAPQFYPSVHSP  186


 Score =   104 bits (259),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 47/85 (55%), Positives = 59/85 (69%), Gaps = 1/85 (1%)
 Frame = +1

Query  619  AAARMKGE-YPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRP  795
            AA   K + +PER G+PECQYYL+TG CKFG +CKFHHPRD+        L+ +G PLRP
Sbjct  282  AAGNQKEQIFPERPGEPECQYYLRTGDCKFGLSCKFHHPRDRVPPRANCILSPIGLPLRP  341

Query  796  NDIECPYYMRTGQCKFGSTCKFHHP  870
                C +Y++ G C+FGSTCKF HP
Sbjct  342  GVQPCTFYLQNGFCRFGSTCKFDHP  366


 Score = 80.1 bits (196),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 37/76 (49%), Positives = 49/76 (64%), Gaps = 1/76 (1%)
 Frame = +1

Query  508  YPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKG-EYPERVGQPECQYYL  684
            +P R GEP+C YY+RTG C+FG SC+F+HP +R    A   +     P R G   C +YL
Sbjct  291  FPERPGEPECQYYLRTGDCKFGLSCKFHHPRDRVPPRANCILSPIGLPLRPGVQPCTFYL  350

Query  685  KTGACKFGATCKFHHP  732
            + G C+FG+TCKF HP
Sbjct  351  QNGFCRFGSTCKFDHP  366



>ref|XP_010545037.1| PREDICTED: zinc finger CCCH domain-containing protein 32 isoform 
X1 [Tarenaya hassleriana]
Length=469

 Score =   202 bits (515),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 91/161 (57%), Positives = 115/161 (71%), Gaps = 5/161 (3%)
 Frame = +1

Query  451  QETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAAR  630
            +E++W+L L S ET     YP R G PDC+YY+RTG+C +G+ CR+NHP +R +  AA R
Sbjct  31   EESMWRLGLSSSET-----YPERPGAPDCAYYMRTGICGYGSRCRYNHPRDRAVVEAAVR  85

Query  631  MKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIEC  810
              GEYPERVG+P CQ+YLKTG CKFGA+CKFHHP++  G   +V LN+ GYPLR  + EC
Sbjct  86   ATGEYPERVGEPPCQFYLKTGTCKFGASCKFHHPKNAGGSMSQVPLNIHGYPLREAEKEC  145

Query  811  PYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVHSP  933
             +Y++TGQCKFG TCKFHHPQP+    P      YP V SP
Sbjct  146  SHYLKTGQCKFGVTCKFHHPQPAGTTTPASTPRFYPSVQSP  186


 Score =   100 bits (249),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 43/76 (57%), Positives = 54/76 (71%), Gaps = 0/76 (0%)
 Frame = +1

Query  643  YPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYM  822
            +PER G+PECQYYL+TG CKFG +CKFHH RD+        L+ +G PLRP    C +Y+
Sbjct  290  FPERPGEPECQYYLRTGDCKFGLSCKFHHRRDRIPQRANCILSPIGLPLRPGVQPCTFYL  349

Query  823  RTGQCKFGSTCKFHHP  870
            + G C+FGSTCKF HP
Sbjct  350  QNGFCRFGSTCKFDHP  365


 Score = 77.4 bits (189),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 43/105 (41%), Positives = 61/105 (58%), Gaps = 3/105 (3%)
 Frame = +1

Query  427  SSLSPPLAQE--TLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPS  600
            SS +P LA    +L   +  S+ + +   +P R GEP+C YY+RTG C+FG SC+F+H  
Sbjct  261  SSSTPSLAGAYPSLSSSTAPSVGSQKEQIFPERPGEPECQYYLRTGDCKFGLSCKFHHRR  320

Query  601  NRKLAIAAARMKG-EYPERVGQPECQYYLKTGACKFGATCKFHHP  732
            +R    A   +     P R G   C +YL+ G C+FG+TCKF HP
Sbjct  321  DRIPQRANCILSPIGLPLRPGVQPCTFYLQNGFCRFGSTCKFDHP  365



>ref|XP_010243539.1| PREDICTED: zinc finger CCCH domain-containing protein 32 [Nelumbo 
nucifera]
Length=471

 Score =   202 bits (514),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 96/167 (57%), Positives = 116/167 (69%), Gaps = 6/167 (4%)
 Frame = +1

Query  451  QETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAAR  630
            +E +WQL L S ++     YP R  EPDC Y++RTG C +GA CRFNHP +R   + +AR
Sbjct  31   EEPMWQLGLGSRDS-----YPERPNEPDCVYFMRTGFCGYGARCRFNHPRDRSAVLGSAR  85

Query  631  -MKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIE  807
               GEYPERVGQP CQY+LKTG CKFGA+CK+HHPR   G A  V+LN  GYPLRP + E
Sbjct  86   PGAGEYPERVGQPVCQYFLKTGTCKFGASCKYHHPRHGGGSAIPVSLNYHGYPLRPGEKE  145

Query  808  CPYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQ  948
            C YY++TG CKFG TCKFHHPQP+ + VP      YP V SP+ P Q
Sbjct  146  CAYYVKTGHCKFGVTCKFHHPQPAGVSVPAPAPQFYPTVQSPSVPSQ  192


 Score = 96.3 bits (238),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 42/76 (55%), Positives = 52/76 (68%), Gaps = 0/76 (0%)
 Frame = +1

Query  643  YPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYM  822
            YPER GQPECQYY++TG CKFG++CK+HHP +         L+ +G PLRP    C +Y 
Sbjct  293  YPERPGQPECQYYMRTGECKFGSSCKYHHPLEWITPKTNCVLSPMGLPLRPGAQPCTFYT  352

Query  823  RTGQCKFGSTCKFHHP  870
            + G CKFG TCKF HP
Sbjct  353  QHGVCKFGPTCKFDHP  368


 Score = 73.9 bits (180),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 36/79 (46%), Positives = 47/79 (59%), Gaps = 5/79 (6%)
 Frame = +1

Query  505  TYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNR---KLAIAAARMKGEYPERVGQPECQ  675
             YP R G+P+C YY+RTG C+FG+SC+++HP      K     + M    P R G   C 
Sbjct  292  VYPERPGQPECQYYMRTGECKFGSSCKYHHPLEWITPKTNCVLSPMG--LPLRPGAQPCT  349

Query  676  YYLKTGACKFGATCKFHHP  732
            +Y + G CKFG TCKF HP
Sbjct  350  FYTQHGVCKFGPTCKFDHP  368



>gb|KJB23207.1| hypothetical protein B456_004G086700 [Gossypium raimondii]
Length=473

 Score =   202 bits (514),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 96/164 (59%), Positives = 115/164 (70%), Gaps = 5/164 (3%)
 Frame = +1

Query  451  QETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAAR  630
            +E++WQLSLR      +G+YP R G PDC YY+RTG C +G  CR+NHP NR    AA R
Sbjct  32   EESMWQLSLRG-----TGSYPERPGVPDCVYYMRTGFCGYGNRCRYNHPRNRAAVEAAVR  86

Query  631  MKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIEC  810
              GEYPER G+P CQ+YLKTG CKFGA+CKFHHP+   G  G V LN+ GYPLRP + EC
Sbjct  87   ATGEYPERPGEPACQFYLKTGTCKFGASCKFHHPKHGGGSFGHVPLNIYGYPLRPGEKEC  146

Query  811  PYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVHSPTTP  942
             YY++TGQCKFG TCKFHHPQP+   +P      Y PV SP+ P
Sbjct  147  SYYLKTGQCKFGVTCKFHHPQPAGTSMPASAPQFYQPVQSPSVP  190


 Score =   100 bits (250),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 43/76 (57%), Positives = 55/76 (72%), Gaps = 0/76 (0%)
 Frame = +1

Query  643  YPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYM  822
            +PER G+ ECQYYL+TG CKFG++C++HHPRDK        L+ +G PLRP    C +Y+
Sbjct  294  FPERPGERECQYYLRTGNCKFGSSCRYHHPRDKVVQQTNCILSPMGLPLRPGVQPCAFYL  353

Query  823  RTGQCKFGSTCKFHHP  870
            + G CKFGSTCKF HP
Sbjct  354  QNGHCKFGSTCKFDHP  369


 Score = 79.0 bits (193),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 41/108 (38%), Positives = 60/108 (56%), Gaps = 5/108 (5%)
 Frame = +1

Query  481  SMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKG-EYPERV  657
            S    +  T+P R GE +C YY+RTG C+FG+SCR++HP ++ +      +     P R 
Sbjct  285  SSSNQKEQTFPERPGERECQYYLRTGNCKFGSSCRYHHPRDKVVQQTNCILSPMGLPLRP  344

Query  658  GQPECQYYLKTGACKFGATCKFHHP----RDKAGIAGRVALNVLGYPL  789
            G   C +YL+ G CKFG+TCKF HP    R     +  + + V  YP+
Sbjct  345  GVQPCAFYLQNGHCKFGSTCKFDHPIGTMRYSPSASSLIDIPVAPYPV  392


 Score = 52.4 bits (124),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 25/54 (46%), Positives = 34/54 (63%), Gaps = 5/54 (9%)
 Frame = +1

Query  781  YPLRPNDIECPYYMRTGQCKFGSTCKFHHP-----QPSNMMVPLRGSPAYPPVH  927
            +P RP + EC YY+RTG CKFGS+C++HHP     Q +N ++   G P  P V 
Sbjct  294  FPERPGERECQYYLRTGNCKFGSSCRYHHPRDKVVQQTNCILSPMGLPLRPGVQ  347



>ref|XP_010241841.1| PREDICTED: zinc finger CCCH domain-containing protein 32-like 
[Nelumbo nucifera]
Length=475

 Score =   202 bits (514),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 95/167 (57%), Positives = 116/167 (69%), Gaps = 6/167 (4%)
 Frame = +1

Query  451  QETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAAR  630
            +E +WQ+ L S ++     YP R  EPDC YY+RTG C +GA CR+NHP +R   + +AR
Sbjct  31   EEPMWQMGLVSRDS-----YPERPNEPDCVYYMRTGFCGYGARCRYNHPRDRSAVLGSAR  85

Query  631  MKG-EYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIE  807
              G EYPERVGQP CQY++KTG CKFGA+CK+HHPR   G    V+LN  GYPLRP + E
Sbjct  86   PGGVEYPERVGQPVCQYFMKTGTCKFGASCKYHHPRHGGGSVSPVSLNYHGYPLRPGEKE  145

Query  808  CPYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQ  948
            C YY++TGQCKFG TCKFHHPQP+   VP   S  YP V SP+ P Q
Sbjct  146  CSYYVKTGQCKFGVTCKFHHPQPAGSSVPAPASSFYPMVQSPSVPSQ  192


 Score = 91.3 bits (225),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 40/76 (53%), Positives = 50/76 (66%), Gaps = 0/76 (0%)
 Frame = +1

Query  643  YPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYM  822
            YPER G PECQYY++TG CKFG++CK+HHP +         L+ +G PLR     C +Y 
Sbjct  293  YPERPGHPECQYYMRTGECKFGSSCKYHHPPEWITPKTNCILSPIGLPLRSGASPCAFYT  352

Query  823  RTGQCKFGSTCKFHHP  870
            + G CKFG TCKF HP
Sbjct  353  QYGICKFGPTCKFDHP  368


 Score = 72.8 bits (177),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 34/77 (44%), Positives = 44/77 (57%), Gaps = 1/77 (1%)
 Frame = +1

Query  505  TYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKG-EYPERVGQPECQYY  681
             YP R G P+C YY+RTG C+FG+SC+++HP           +     P R G   C +Y
Sbjct  292  VYPERPGHPECQYYMRTGECKFGSSCKYHHPPEWITPKTNCILSPIGLPLRSGASPCAFY  351

Query  682  LKTGACKFGATCKFHHP  732
             + G CKFG TCKF HP
Sbjct  352  TQYGICKFGPTCKFDHP  368



>ref|XP_006855486.1| PREDICTED: zinc finger CCCH domain-containing protein 32 isoform 
X1 [Amborella trichopoda]
 gb|ERN16953.1| hypothetical protein AMTR_s00057p00193570 [Amborella trichopoda]
Length=458

 Score =   201 bits (512),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 96/166 (58%), Positives = 118/166 (71%), Gaps = 4/166 (2%)
 Frame = +1

Query  451  QETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAAR  630
            +E++W+LSL      E   YP R GE DC +Y++TG CR+GA+CR+NHP +R  A    +
Sbjct  27   EESMWRLSLGRESGGE--YYPERPGEADCMFYMKTGFCRYGANCRYNHPHDRNPAADVLQ  84

Query  631  MKG-EYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIE  807
              G EYPERVGQP CQY++KTG CKFGATCK+HHPR   G+   V LN+LGYPLRP D E
Sbjct  85   TGGGEYPERVGQPTCQYFIKTGTCKFGATCKYHHPRYGGGLMSPVGLNILGYPLRPGDKE  144

Query  808  CPYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPA-YPPVHSPTTP  942
            C YY++TGQCKFG TCKFHHPQP N  +    +P  YP VHSP+ P
Sbjct  145  CSYYVKTGQCKFGPTCKFHHPQPVNTSLQTTPAPQFYPTVHSPSQP  190


 Score =   100 bits (248),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 43/95 (45%), Positives = 61/95 (64%), Gaps = 0/95 (0%)
 Frame = +1

Query  586  FNHPSNRKLAIAAARMKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVA  765
            F  P +  +A  +   +  +PER GQPECQ+Y++TG CK+G+TC++HHP D+        
Sbjct  271  FFSPVSSSVAGPSGTKENTFPERPGQPECQFYMRTGDCKYGSTCRYHHPPDRIVPQTNCT  330

Query  766  LNVLGYPLRPNDIECPYYMRTGQCKFGSTCKFHHP  870
            L+ +G+PLRP    C +Y + G CKFG TCKF HP
Sbjct  331  LSPIGFPLRPGAPTCSFYAQHGVCKFGPTCKFDHP  365


 Score = 81.3 bits (199),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 35/88 (40%), Positives = 54/88 (61%), Gaps = 1/88 (1%)
 Frame = +1

Query  472  SLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKG-EYP  648
            S+      +  T+P R G+P+C +Y+RTG C++G++CR++HP +R +      +    +P
Sbjct  278  SVAGPSGTKENTFPERPGQPECQFYMRTGDCKYGSTCRYHHPPDRIVPQTNCTLSPIGFP  337

Query  649  ERVGQPECQYYLKTGACKFGATCKFHHP  732
             R G P C +Y + G CKFG TCKF HP
Sbjct  338  LRPGAPTCSFYAQHGVCKFGPTCKFDHP  365



>gb|KHG22563.1| hypothetical protein F383_29382 [Gossypium arboreum]
Length=475

 Score =   201 bits (510),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 95/164 (58%), Positives = 116/164 (71%), Gaps = 5/164 (3%)
 Frame = +1

Query  451  QETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAAR  630
            +E++WQLSLR  E+     YP R G PDC YY+RTGLC +G+ CR+NHP NR    AA R
Sbjct  31   EESMWQLSLRGAES-----YPERPGVPDCVYYMRTGLCGYGSRCRYNHPRNRAAVEAAVR  85

Query  631  MKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIEC  810
              GEYPER G+P CQ+YLKTG CKFGA+CKFHHP+   G   +V LN+ GYPLRP + EC
Sbjct  86   ATGEYPERPGEPACQFYLKTGTCKFGASCKFHHPKHGGGSFSQVPLNIYGYPLRPGEEEC  145

Query  811  PYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVHSPTTP  942
             YY++ GQCKFG TCKFHHPQP+   +P+     Y PV SP+ P
Sbjct  146  SYYLKMGQCKFGVTCKFHHPQPAGTSMPVSAPQFYQPVQSPSVP  189


 Score =   104 bits (260),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 44/76 (58%), Positives = 56/76 (74%), Gaps = 0/76 (0%)
 Frame = +1

Query  643  YPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYM  822
            +PER G+PECQYYL+TG CKFG+TC++HHPRD+        L+ +G PLRP    C +Y+
Sbjct  293  FPERPGEPECQYYLRTGDCKFGSTCRYHHPRDRVVPRTNCILSPMGLPLRPGVQPCSFYL  352

Query  823  RTGQCKFGSTCKFHHP  870
            + G CKFGSTCKF HP
Sbjct  353  QNGHCKFGSTCKFDHP  368


 Score = 83.2 bits (204),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 38/85 (45%), Positives = 53/85 (62%), Gaps = 1/85 (1%)
 Frame = +1

Query  481  SMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKG-EYPERV  657
            S    +  T+P R GEP+C YY+RTG C+FG++CR++HP +R +      +     P R 
Sbjct  284  SSSNQKDQTFPERPGEPECQYYLRTGDCKFGSTCRYHHPRDRVVPRTNCILSPMGLPLRP  343

Query  658  GQPECQYYLKTGACKFGATCKFHHP  732
            G   C +YL+ G CKFG+TCKF HP
Sbjct  344  GVQPCSFYLQNGHCKFGSTCKFDHP  368


 Score = 53.1 bits (126),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 20/31 (65%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = +1

Query  781  YPLRPNDIECPYYMRTGQCKFGSTCKFHHPQ  873
            +P RP + EC YY+RTG CKFGSTC++HHP+
Sbjct  293  FPERPGEPECQYYLRTGDCKFGSTCRYHHPR  323



>gb|ACL54765.1| unknown [Zea mays]
 tpg|DAA56152.1| TPA: hypothetical protein ZEAMMB73_608000 [Zea mays]
Length=192

 Score =   192 bits (487),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 89/125 (71%), Positives = 103/125 (82%), Gaps = 1/125 (1%)
 Frame = +1

Query  445  LAQETLWQ-LSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIA  621
            L +E +WQ +++ S  TM+ G+YP R GEPDC+YY+RTGLCRFG SCRFNHP +R LAIA
Sbjct  48   LYEEGMWQQMAMDSGATMQPGSYPERPGEPDCTYYLRTGLCRFGMSCRFNHPPDRNLAIA  107

Query  622  AARMKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPND  801
            +ARMKGEYPER GQPECQYYLKTG CKFG TCKFHHPR+KAGIAGRV LN  GYPLRP  
Sbjct  108  SARMKGEYPERAGQPECQYYLKTGTCKFGPTCKFHHPREKAGIAGRVQLNTSGYPLRPVC  167

Query  802  IECPY  816
            +  P+
Sbjct  168  LPLPF  172


 Score = 94.4 bits (233),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 44/85 (52%), Positives = 56/85 (66%), Gaps = 1/85 (1%)
 Frame = +1

Query  619  AAARMKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPN  798
             A    G YPER G+P+C YYL+TG C+FG +C+F+HP D+  +A   A     YP R  
Sbjct  62   GATMQPGSYPERPGEPDCTYYLRTGLCRFGMSCRFNHPPDR-NLAIASARMKGEYPERAG  120

Query  799  DIECPYYMRTGQCKFGSTCKFHHPQ  873
              EC YY++TG CKFG TCKFHHP+
Sbjct  121  QPECQYYLKTGTCKFGPTCKFHHPR  145



>gb|KJB82176.1| hypothetical protein B456_013G179800 [Gossypium raimondii]
Length=407

 Score =   198 bits (504),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 113/205 (55%), Positives = 124/205 (60%), Gaps = 58/205 (28%)
 Frame = +1

Query  367  MDFEAAAGISASMAS-----VTEGPSSLSPPLAQETLWQLSLRSMETMESGTYPVRDGEP  531
            M+F   AGI  S  +     VTEG SSLSP L Q+ +WQ++LRS ETMES  YP R GEP
Sbjct  1    MEFSFDAGIPMSRTATAAVPVTEG-SSLSPSLNQDAMWQMNLRSSETMESSPYPERPGEP  59

Query  532  DCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKGEYPERVGQPECQ------YYLKTG  693
            DCSYYIRTGLCRFGA+C FNHP NRKLAIAAARMKGE+PERVGQPECQ      YYL+TG
Sbjct  60   DCSYYIRTGLCRFGATCHFNHPPNRKLAIAAARMKGEFPERVGQPECQNETECAYYLRTG  119

Query  694  ACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTCKFHHPQ  873
             CKFG+TCKFHH                                              PQ
Sbjct  120  QCKFGSTCKFHH----------------------------------------------PQ  133

Query  874  PSNMMVPLRGSPAYPPVHSPTTPGQ  948
            P+NMMV LRGSP Y  V SPTTPGQ
Sbjct  134  PTNMMVSLRGSPIYQTVPSPTTPGQ  158


 Score =   105 bits (262),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 51/110 (46%), Positives = 69/110 (63%), Gaps = 0/110 (0%)
 Frame = +1

Query  598  SNRKLAIAAARMKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVL  777
            S+  + + A + +  +PER G+PECQ+Y+KTG CKFGA CKFHHPR++   A    L+ +
Sbjct  249  SSVPVGVYALQRENVFPERPGEPECQFYMKTGDCKFGAVCKFHHPRERVLPAPDCVLSPI  308

Query  778  GYPLRPNDIECPYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVH  927
            G PLRP +  C +Y R G CKFG +CKF+HP           SP+  PVH
Sbjct  309  GLPLRPGEPLCIFYSRYGICKFGPSCKFNHPMGIFTYNYSPSSPSDAPVH  358


 Score = 78.6 bits (192),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 35/77 (45%), Positives = 49/77 (64%), Gaps = 1/77 (1%)
 Frame = +1

Query  505  TYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKG-EYPERVGQPECQYY  681
             +P R GEP+C +Y++TG C+FGA C+F+HP  R L      +     P R G+P C +Y
Sbjct  263  VFPERPGEPECQFYMKTGDCKFGAVCKFHHPRERVLPAPDCVLSPIGLPLRPGEPLCIFY  322

Query  682  LKTGACKFGATCKFHHP  732
             + G CKFG +CKF+HP
Sbjct  323  SRYGICKFGPSCKFNHP  339



>gb|KJB22541.1| hypothetical protein B456_004G053200 [Gossypium raimondii]
Length=274

 Score =   194 bits (493),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 95/164 (58%), Positives = 114/164 (70%), Gaps = 5/164 (3%)
 Frame = +1

Query  451  QETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAAR  630
            +E+ WQLS+R +E+     YP R G  DC YY+RTG C +G SCR+NHP NR    AA R
Sbjct  31   EESRWQLSVRGVES-----YPERLGVTDCVYYMRTGFCGYGNSCRYNHPRNRAAVEAAVR  85

Query  631  MKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIEC  810
              GEYPER G+P CQ+YLKTG CKFGA+CKFHHP+D  G    V+LN+ GYPLRP + EC
Sbjct  86   ATGEYPERPGEPVCQFYLKTGTCKFGASCKFHHPKDGGGSFSHVSLNMHGYPLRPGEKEC  145

Query  811  PYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVHSPTTP  942
             YY++TGQCKFG TCKFHHPQPS   +       Y PV SP+ P
Sbjct  146  SYYLKTGQCKFGITCKFHHPQPSGTSMSASAPQFYQPVQSPSVP  189



>ref|XP_009769505.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X4 [Nicotiana sylvestris]
Length=350

 Score =   196 bits (499),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 90/107 (84%), Positives = 94/107 (88%), Gaps = 0/107 (0%)
 Frame = +1

Query  631  MKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIEC  810
            M GEYPER+GQ ECQYYLKTG CKFGATCKFHHPRDKAGIAGRV LNVLGYPLRPN+ EC
Sbjct  1    MNGEYPERIGQLECQYYLKTGTCKFGATCKFHHPRDKAGIAGRVTLNVLGYPLRPNENEC  60

Query  811  PYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQL  951
             YYMRT QCKFGSTCKFHHP+PSNMMV  RGSP YPP  S TTPGQ+
Sbjct  61   TYYMRTAQCKFGSTCKFHHPEPSNMMVSSRGSPVYPPGPSSTTPGQM  107


 Score = 99.4 bits (246),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 46/89 (52%), Positives = 60/89 (67%), Gaps = 2/89 (2%)
 Frame = +1

Query  610  LAIAAARMKGE--YPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGY  783
            L +    ++GE  +PERVGQPECQ+Y+KTG CKFGA C+FHHPR++        L+ +G 
Sbjct  193  LPVGYYALQGENVFPERVGQPECQFYMKTGDCKFGAVCRFHHPRERLLPPPDCLLSPIGL  252

Query  784  PLRPNDIECPYYMRTGQCKFGSTCKFHHP  870
            PLR  +  C +Y R G CKFG +CKF HP
Sbjct  253  PLRAGEPMCIFYSRYGICKFGPSCKFDHP  281


 Score = 77.4 bits (189),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 35/77 (45%), Positives = 48/77 (62%), Gaps = 1/77 (1%)
 Frame = +1

Query  505  TYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKG-EYPERVGQPECQYY  681
             +P R G+P+C +Y++TG C+FGA CRF+HP  R L      +     P R G+P C +Y
Sbjct  205  VFPERVGQPECQFYMKTGDCKFGAVCRFHHPRERLLPPPDCLLSPIGLPLRAGEPMCIFY  264

Query  682  LKTGACKFGATCKFHHP  732
             + G CKFG +CKF HP
Sbjct  265  SRYGICKFGPSCKFDHP  281



>ref|XP_007050814.1| Zinc finger C-x8-C-x5-C-x3-H type family protein [Theobroma cacao]
 gb|EOX94971.1| Zinc finger C-x8-C-x5-C-x3-H type family protein [Theobroma cacao]
Length=476

 Score =   199 bits (506),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 95/164 (58%), Positives = 113/164 (69%), Gaps = 5/164 (3%)
 Frame = +1

Query  451  QETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAAR  630
            +E++WQLSLR  E+     YP R G PDC YY+RTG C +G  CR+NHP NR    AA R
Sbjct  31   EESMWQLSLRGTES-----YPERPGVPDCVYYMRTGFCGYGNRCRYNHPRNRAAVEAAVR  85

Query  631  MKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIEC  810
              GEYPER G+P CQ+YLKTG CKFGA+CKFHHP+   G    V LN+ GYPLRP + EC
Sbjct  86   ATGEYPERPGEPACQFYLKTGTCKFGASCKFHHPKHGGGSFSHVPLNIYGYPLRPGEKEC  145

Query  811  PYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVHSPTTP  942
             YY++TGQCKFG TCKFHHPQP+   +P      Y PV SP+ P
Sbjct  146  SYYLKTGQCKFGITCKFHHPQPAGTSMPASAPQFYQPVQSPSVP  189


 Score =   103 bits (258),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 43/76 (57%), Positives = 56/76 (74%), Gaps = 0/76 (0%)
 Frame = +1

Query  643  YPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYM  822
            +PER G+PECQYYL+TG CKFG++C++HHPRD+        L+ +G PLRP    C +Y+
Sbjct  293  FPERPGEPECQYYLRTGDCKFGSSCRYHHPRDRVVPRTNCVLSPMGLPLRPGVQPCSFYL  352

Query  823  RTGQCKFGSTCKFHHP  870
            + G CKFGSTCKF HP
Sbjct  353  QNGHCKFGSTCKFDHP  368


 Score = 84.0 bits (206),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 42/100 (42%), Positives = 59/100 (59%), Gaps = 5/100 (5%)
 Frame = +1

Query  505  TYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKG-EYPERVGQPECQYY  681
            T+P R GEP+C YY+RTG C+FG+SCR++HP +R +      +     P R G   C +Y
Sbjct  292  TFPERPGEPECQYYLRTGDCKFGSSCRYHHPRDRVVPRTNCVLSPMGLPLRPGVQPCSFY  351

Query  682  LKTGACKFGATCKFHHP----RDKAGIAGRVALNVLGYPL  789
            L+ G CKFG+TCKF HP    R     +  + + V  YP+
Sbjct  352  LQNGHCKFGSTCKFDHPMGTMRYSPSASSLIDMPVAPYPV  391



>gb|KJB47069.1| hypothetical protein B456_008G009500 [Gossypium raimondii]
Length=475

 Score =   199 bits (506),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 95/164 (58%), Positives = 115/164 (70%), Gaps = 5/164 (3%)
 Frame = +1

Query  451  QETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAAR  630
            +E++WQLSLR  E+     YP R G PDC YY+RTGLC +G+ CR+NHP NR    AA R
Sbjct  31   EESMWQLSLRGPES-----YPERPGVPDCVYYMRTGLCGYGSRCRYNHPRNRAAVEAAVR  85

Query  631  MKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIEC  810
              GEYPER G+P CQ+YLKTG CKFGA+CKFHHP+   G    V LN+ GYPLRP + EC
Sbjct  86   ATGEYPERPGEPACQFYLKTGTCKFGASCKFHHPKHGGGSFSHVPLNIYGYPLRPGEEEC  145

Query  811  PYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVHSPTTP  942
             YY++ GQCKFG TCKFHHPQP+   +P+     Y PV SP+ P
Sbjct  146  SYYLKMGQCKFGVTCKFHHPQPAGTSMPVSAPQFYQPVQSPSVP  189


 Score =   104 bits (260),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 44/76 (58%), Positives = 56/76 (74%), Gaps = 0/76 (0%)
 Frame = +1

Query  643  YPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYM  822
            +PER G+PECQYYL+TG CKFG+TC++HHPRD+        L+ +G PLRP    C +Y+
Sbjct  293  FPERPGEPECQYYLRTGDCKFGSTCRYHHPRDRVVPRTNCILSPMGLPLRPGVQPCSFYL  352

Query  823  RTGQCKFGSTCKFHHP  870
            + G CKFGSTCKF HP
Sbjct  353  QNGHCKFGSTCKFDHP  368


 Score = 83.2 bits (204),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 38/85 (45%), Positives = 53/85 (62%), Gaps = 1/85 (1%)
 Frame = +1

Query  481  SMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKG-EYPERV  657
            S    +  T+P R GEP+C YY+RTG C+FG++CR++HP +R +      +     P R 
Sbjct  284  SSSNQKDQTFPERPGEPECQYYLRTGDCKFGSTCRYHHPRDRVVPRTNCILSPMGLPLRP  343

Query  658  GQPECQYYLKTGACKFGATCKFHHP  732
            G   C +YL+ G CKFG+TCKF HP
Sbjct  344  GVQPCSFYLQNGHCKFGSTCKFDHP  368



>ref|XP_009392482.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X3 [Musa acuminata subsp. malaccensis]
Length=362

 Score =   196 bits (498),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 87/112 (78%), Positives = 100/112 (89%), Gaps = 0/112 (0%)
 Frame = +1

Query  613  AIAAARMKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLR  792
            AIAAAR++G YPERVGQPECQYYLKTG CKFG+TCKFHHP++KAGIA +  LN+LGYPLR
Sbjct  3    AIAAARIRGGYPERVGQPECQYYLKTGTCKFGSTCKFHHPKEKAGIAKQAQLNILGYPLR  62

Query  793  PNDIECPYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQ  948
            PN+ EC YY+RTG+CKFGSTCK+HHPQPSN ++ LRGSP YP  HSPTTPGQ
Sbjct  63   PNEQECAYYIRTGECKFGSTCKYHHPQPSNTILALRGSPIYPSAHSPTTPGQ  114


 Score =   107 bits (266),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 51/109 (47%), Positives = 66/109 (61%), Gaps = 2/109 (2%)
 Frame = +1

Query  550  RTGLCRFGASCRFN--HPSNRKLAIAAARMKGEYPERVGQPECQYYLKTGACKFGATCKF  723
            + G    GA  +F+   P +  + + A   +  +PER GQPECQ+Y+KTG CKFGA C+F
Sbjct  185  QQGETNIGAQGKFSSYRPGSVSMGLYAVPRENIFPERPGQPECQFYMKTGDCKFGAVCRF  244

Query  724  HHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTCKFHHP  870
            HHPR++        LN LG PLRP +  C +Y R G CKFG  CKF HP
Sbjct  245  HHPRERLIPTPNCVLNPLGLPLRPGEPLCVFYSRYGICKFGPNCKFDHP  293


 Score = 76.6 bits (187),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 47/76 (62%), Gaps = 1/76 (1%)
 Frame = +1

Query  508  YPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKG-EYPERVGQPECQYYL  684
            +P R G+P+C +Y++TG C+FGA CRF+HP  R +      +     P R G+P C +Y 
Sbjct  218  FPERPGQPECQFYMKTGDCKFGAVCRFHHPRERLIPTPNCVLNPLGLPLRPGEPLCVFYS  277

Query  685  KTGACKFGATCKFHHP  732
            + G CKFG  CKF HP
Sbjct  278  RYGICKFGPNCKFDHP  293


 Score = 52.4 bits (124),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 27/66 (41%), Positives = 37/66 (56%), Gaps = 5/66 (8%)
 Frame = +1

Query  685  KTGACKFGATCKFHHPRDKAGIAGRVAL---NVLGYPLRPNDIECPYYMRTGQCKFGSTC  855
            + G    GA  KF   R  +   G  A+   N+  +P RP   EC +YM+TG CKFG+ C
Sbjct  185  QQGETNIGAQGKFSSYRPGSVSMGLYAVPRENI--FPERPGQPECQFYMKTGDCKFGAVC  242

Query  856  KFHHPQ  873
            +FHHP+
Sbjct  243  RFHHPR  248



>ref|XP_009392481.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X2 [Musa acuminata subsp. malaccensis]
Length=371

 Score =   196 bits (498),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 87/112 (78%), Positives = 100/112 (89%), Gaps = 0/112 (0%)
 Frame = +1

Query  613  AIAAARMKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLR  792
            AIAAAR++G YPERVGQPECQYYLKTG CKFG+TCKFHHP++KAGIA +  LN+LGYPLR
Sbjct  12   AIAAARIRGGYPERVGQPECQYYLKTGTCKFGSTCKFHHPKEKAGIAKQAQLNILGYPLR  71

Query  793  PNDIECPYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQ  948
            PN+ EC YY+RTG+CKFGSTCK+HHPQPSN ++ LRGSP YP  HSPTTPGQ
Sbjct  72   PNEQECAYYIRTGECKFGSTCKYHHPQPSNTILALRGSPIYPSAHSPTTPGQ  123


 Score =   107 bits (266),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 51/109 (47%), Positives = 66/109 (61%), Gaps = 2/109 (2%)
 Frame = +1

Query  550  RTGLCRFGASCRFN--HPSNRKLAIAAARMKGEYPERVGQPECQYYLKTGACKFGATCKF  723
            + G    GA  +F+   P +  + + A   +  +PER GQPECQ+Y+KTG CKFGA C+F
Sbjct  194  QQGETNIGAQGKFSSYRPGSVSMGLYAVPRENIFPERPGQPECQFYMKTGDCKFGAVCRF  253

Query  724  HHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTCKFHHP  870
            HHPR++        LN LG PLRP +  C +Y R G CKFG  CKF HP
Sbjct  254  HHPRERLIPTPNCVLNPLGLPLRPGEPLCVFYSRYGICKFGPNCKFDHP  302


 Score = 76.6 bits (187),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 47/76 (62%), Gaps = 1/76 (1%)
 Frame = +1

Query  508  YPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKG-EYPERVGQPECQYYL  684
            +P R G+P+C +Y++TG C+FGA CRF+HP  R +      +     P R G+P C +Y 
Sbjct  227  FPERPGQPECQFYMKTGDCKFGAVCRFHHPRERLIPTPNCVLNPLGLPLRPGEPLCVFYS  286

Query  685  KTGACKFGATCKFHHP  732
            + G CKFG  CKF HP
Sbjct  287  RYGICKFGPNCKFDHP  302


 Score = 52.4 bits (124),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 27/66 (41%), Positives = 37/66 (56%), Gaps = 5/66 (8%)
 Frame = +1

Query  685  KTGACKFGATCKFHHPRDKAGIAGRVAL---NVLGYPLRPNDIECPYYMRTGQCKFGSTC  855
            + G    GA  KF   R  +   G  A+   N+  +P RP   EC +YM+TG CKFG+ C
Sbjct  194  QQGETNIGAQGKFSSYRPGSVSMGLYAVPRENI--FPERPGQPECQFYMKTGDCKFGAVC  251

Query  856  KFHHPQ  873
            +FHHP+
Sbjct  252  RFHHPR  257



>gb|KEH43244.1| zinc finger C-x8-C-x5-C-x3-H type protein [Medicago truncatula]
Length=344

 Score =   195 bits (496),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 93/163 (57%), Positives = 114/163 (70%), Gaps = 2/163 (1%)
 Frame = +1

Query  454  ETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARM  633
            E++W LSL S   +ES  YP R G P+C+YY+RTG C +G  CRFNHP +R    AA R 
Sbjct  30   ESMWHLSLGSGGGVES--YPERHGVPNCAYYMRTGFCGYGGRCRFNHPRDRAAVAAAVRA  87

Query  634  KGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECP  813
             G+YPER+G+P CQYYLKTG CKFGA+CKFHHP++  G   +  LN+ GYPLRP + EC 
Sbjct  88   TGDYPERLGEPPCQYYLKTGTCKFGASCKFHHPKNGGGYLSQAPLNIYGYPLRPGESECS  147

Query  814  YYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVHSPTTP  942
            YY++TGQCKFG TCKFHHPQP+   +P      Y  V SPT P
Sbjct  148  YYLKTGQCKFGVTCKFHHPQPAGTSLPASAPQFYQQVQSPTVP  190


 Score = 67.4 bits (163),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 29/51 (57%), Positives = 38/51 (75%), Gaps = 2/51 (4%)
 Frame = +1

Query  643  YPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRP  795
            +PER G+P CQYY++TG CKFG  C++HHPRD+  +A R  L+  G PLRP
Sbjct  295  FPERPGEPVCQYYMRTGDCKFGLACRYHHPRDQ--VAARPLLSPFGLPLRP  343


 Score = 51.6 bits (122),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 20/43 (47%), Positives = 30/43 (70%), Gaps = 0/43 (0%)
 Frame = +1

Query  487  ETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLA  615
             T++   +P R GEP C YY+RTG C+FG +CR++HP ++  A
Sbjct  288  STLQEKVFPERPGEPVCQYYMRTGDCKFGLACRYHHPRDQVAA  330



>ref|XP_011018690.1| PREDICTED: zinc finger CCCH domain-containing protein 34-like 
[Populus euphratica]
Length=479

 Score =   199 bits (505),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 93/164 (57%), Positives = 116/164 (71%), Gaps = 6/164 (4%)
 Frame = +1

Query  451  QETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAAR  630
            +E +WQL L   E++    YP R  E DC YY+RTG C +GA CR+NHP +R   + A R
Sbjct  29   EEGVWQLGLGETESV----YPERPNEQDCMYYLRTGWCGYGARCRYNHPRDRSAVLGAPR  84

Query  631  MKG-EYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIE  807
              G EYPERVGQP CQYY++TG CKFGA+CK+HHP+   G A  V+LN  GYPLRP + E
Sbjct  85   AGGAEYPERVGQPLCQYYMRTGTCKFGASCKYHHPKQGGGSASPVSLNYYGYPLRPGERE  144

Query  808  CPYYMRTGQCKFGSTCKFHHPQPSNMMVPLRG-SPAYPPVHSPT  936
            C YY++TGQCKFG+TCKFHHPQP N+ +P +  +P   PV SPT
Sbjct  145  CTYYIKTGQCKFGATCKFHHPQPGNIQIPAQSLAPQIAPVPSPT  188


 Score = 95.1 bits (235),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 41/76 (54%), Positives = 52/76 (68%), Gaps = 0/76 (0%)
 Frame = +1

Query  643  YPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYM  822
            +PER GQPECQYY+KTG CKF ++C++HHP +       V L+ +G PLRP    C +Y 
Sbjct  298  FPERPGQPECQYYIKTGDCKFRSSCRYHHPPELVVSKTNVVLSPIGLPLRPGAPTCSHYT  357

Query  823  RTGQCKFGSTCKFHHP  870
            + GQCKFG  CKF HP
Sbjct  358  QRGQCKFGPACKFDHP  373


 Score = 75.1 bits (183),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 35/85 (41%), Positives = 49/85 (58%), Gaps = 1/85 (1%)
 Frame = +1

Query  481  SMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKG-EYPERV  657
            S  T +   +P R G+P+C YYI+TG C+F +SCR++HP    ++     +     P R 
Sbjct  289  SSSTQKEHLFPERPGQPECQYYIKTGDCKFRSSCRYHHPPELVVSKTNVVLSPIGLPLRP  348

Query  658  GQPECQYYLKTGACKFGATCKFHHP  732
            G P C +Y + G CKFG  CKF HP
Sbjct  349  GAPTCSHYTQRGQCKFGPACKFDHP  373



>gb|KEH43245.1| zinc finger C-x8-C-x5-C-x3-H type protein [Medicago truncatula]
Length=348

 Score =   195 bits (496),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 93/163 (57%), Positives = 114/163 (70%), Gaps = 2/163 (1%)
 Frame = +1

Query  454  ETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARM  633
            E++W LSL S   +ES  YP R G P+C+YY+RTG C +G  CRFNHP +R    AA R 
Sbjct  30   ESMWHLSLGSGGGVES--YPERHGVPNCAYYMRTGFCGYGGRCRFNHPRDRAAVAAAVRA  87

Query  634  KGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECP  813
             G+YPER+G+P CQYYLKTG CKFGA+CKFHHP++  G   +  LN+ GYPLRP + EC 
Sbjct  88   TGDYPERLGEPPCQYYLKTGTCKFGASCKFHHPKNGGGYLSQAPLNIYGYPLRPGESECS  147

Query  814  YYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVHSPTTP  942
            YY++TGQCKFG TCKFHHPQP+   +P      Y  V SPT P
Sbjct  148  YYLKTGQCKFGVTCKFHHPQPAGTSLPASAPQFYQQVQSPTVP  190


 Score = 67.8 bits (164),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 29/55 (53%), Positives = 39/55 (71%), Gaps = 2/55 (4%)
 Frame = +1

Query  643  YPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIE  807
            +PER G+P CQYY++TG CKFG  C++HHPRD+  +A R  L+  G PLRP   +
Sbjct  295  FPERPGEPVCQYYMRTGDCKFGLACRYHHPRDQ--VAARPLLSPFGLPLRPEGSQ  347


 Score = 51.6 bits (122),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 20/42 (48%), Positives = 30/42 (71%), Gaps = 0/42 (0%)
 Frame = +1

Query  490  TMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLA  615
            T++   +P R GEP C YY+RTG C+FG +CR++HP ++  A
Sbjct  289  TLQEKVFPERPGEPVCQYYMRTGDCKFGLACRYHHPRDQVAA  330



>gb|KEH43243.1| zinc finger C-x8-C-x5-C-x3-H type protein [Medicago truncatula]
Length=351

 Score =   195 bits (496),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 93/163 (57%), Positives = 114/163 (70%), Gaps = 2/163 (1%)
 Frame = +1

Query  454  ETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARM  633
            E++W LSL S   +ES  YP R G P+C+YY+RTG C +G  CRFNHP +R    AA R 
Sbjct  30   ESMWHLSLGSGGGVES--YPERHGVPNCAYYMRTGFCGYGGRCRFNHPRDRAAVAAAVRA  87

Query  634  KGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECP  813
             G+YPER+G+P CQYYLKTG CKFGA+CKFHHP++  G   +  LN+ GYPLRP + EC 
Sbjct  88   TGDYPERLGEPPCQYYLKTGTCKFGASCKFHHPKNGGGYLSQAPLNIYGYPLRPGESECS  147

Query  814  YYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVHSPTTP  942
            YY++TGQCKFG TCKFHHPQP+   +P      Y  V SPT P
Sbjct  148  YYLKTGQCKFGVTCKFHHPQPAGTSLPASAPQFYQQVQSPTVP  190


 Score = 68.2 bits (165),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 29/52 (56%), Positives = 39/52 (75%), Gaps = 2/52 (4%)
 Frame = +1

Query  643  YPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPN  798
            +PER G+P CQYY++TG CKFG  C++HHPRD+  +A R  L+  G PLRP+
Sbjct  295  FPERPGEPVCQYYMRTGDCKFGLACRYHHPRDQ--VAARPLLSPFGLPLRPD  344


 Score = 51.6 bits (122),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 20/43 (47%), Positives = 30/43 (70%), Gaps = 0/43 (0%)
 Frame = +1

Query  487  ETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLA  615
             T++   +P R GEP C YY+RTG C+FG +CR++HP ++  A
Sbjct  288  STLQEKVFPERPGEPVCQYYMRTGDCKFGLACRYHHPRDQVAA  330



>gb|AFW84181.1| hypothetical protein ZEAMMB73_594165 [Zea mays]
Length=375

 Score =   196 bits (497),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 93/126 (74%), Positives = 106/126 (84%), Gaps = 2/126 (2%)
 Frame = +1

Query  427  SSLSPP-LAQETLWQ-LSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPS  600
            SSL P  L +E +WQ +++ S  TM+ G+YP R GEPDC+YY+RTGLCRFG SCRFNHP 
Sbjct  37   SSLDPDALYEEGMWQQMAMNSGATMQPGSYPERPGEPDCTYYLRTGLCRFGMSCRFNHPP  96

Query  601  NRKLAIAAARMKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLG  780
            +R LAIA+ARMKGEYPERVGQPECQYYLKTG CKFG TCKFHHPR+KAGIAGRV LN LG
Sbjct  97   DRNLAIASARMKGEYPERVGQPECQYYLKTGTCKFGPTCKFHHPREKAGIAGRVQLNTLG  156

Query  781  YPLRPN  798
            YPL P+
Sbjct  157  YPLLPS  162


 Score = 97.4 bits (241),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 43/83 (52%), Positives = 55/83 (66%), Gaps = 0/83 (0%)
 Frame = +1

Query  622  AARMKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPND  801
            A +    +PER  +PECQYY+KTG CKFGA CKFHHPR ++       L+ +G P+RP +
Sbjct  250  ALQRDNVFPERPDEPECQYYMKTGDCKFGAVCKFHHPRVRSQPPPDCVLSPMGLPIRPGE  309

Query  802  IECPYYMRTGQCKFGSTCKFHHP  870
              C +Y R G CKFG+ CKF HP
Sbjct  310  ELCKFYSRYGICKFGANCKFDHP  332


 Score = 72.8 bits (177),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 34/77 (44%), Positives = 46/77 (60%), Gaps = 1/77 (1%)
 Frame = +1

Query  505  TYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKG-EYPERVGQPECQYY  681
             +P R  EP+C YY++TG C+FGA C+F+HP  R        +     P R G+  C++Y
Sbjct  256  VFPERPDEPECQYYMKTGDCKFGAVCKFHHPRVRSQPPPDCVLSPMGLPIRPGEELCKFY  315

Query  682  LKTGACKFGATCKFHHP  732
             + G CKFGA CKF HP
Sbjct  316  SRYGICKFGANCKFDHP  332


 Score = 53.5 bits (127),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 20/31 (65%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = +1

Query  781  YPLRPNDIECPYYMRTGQCKFGSTCKFHHPQ  873
            +P RP++ EC YYM+TG CKFG+ CKFHHP+
Sbjct  257  FPERPDEPECQYYMKTGDCKFGAVCKFHHPR  287



>ref|XP_009769504.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X3 [Nicotiana sylvestris]
Length=381

 Score =   196 bits (497),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 90/107 (84%), Positives = 94/107 (88%), Gaps = 0/107 (0%)
 Frame = +1

Query  631  MKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIEC  810
            M GEYPER+GQ ECQYYLKTG CKFGATCKFHHPRDKAGIAGRV LNVLGYPLRPN+ EC
Sbjct  32   MNGEYPERIGQLECQYYLKTGTCKFGATCKFHHPRDKAGIAGRVTLNVLGYPLRPNENEC  91

Query  811  PYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQL  951
             YYMRT QCKFGSTCKFHHP+PSNMMV  RGSP YPP  S TTPGQ+
Sbjct  92   TYYMRTAQCKFGSTCKFHHPEPSNMMVSSRGSPVYPPGPSSTTPGQM  138


 Score = 99.8 bits (247),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 46/89 (52%), Positives = 60/89 (67%), Gaps = 2/89 (2%)
 Frame = +1

Query  610  LAIAAARMKGE--YPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGY  783
            L +    ++GE  +PERVGQPECQ+Y+KTG CKFGA C+FHHPR++        L+ +G 
Sbjct  224  LPVGYYALQGENVFPERVGQPECQFYMKTGDCKFGAVCRFHHPRERLLPPPDCLLSPIGL  283

Query  784  PLRPNDIECPYYMRTGQCKFGSTCKFHHP  870
            PLR  +  C +Y R G CKFG +CKF HP
Sbjct  284  PLRAGEPMCIFYSRYGICKFGPSCKFDHP  312


 Score = 77.4 bits (189),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 35/77 (45%), Positives = 48/77 (62%), Gaps = 1/77 (1%)
 Frame = +1

Query  505  TYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKG-EYPERVGQPECQYY  681
             +P R G+P+C +Y++TG C+FGA CRF+HP  R L      +     P R G+P C +Y
Sbjct  236  VFPERVGQPECQFYMKTGDCKFGAVCRFHHPRERLLPPPDCLLSPIGLPLRAGEPMCIFY  295

Query  682  LKTGACKFGATCKFHHP  732
             + G CKFG +CKF HP
Sbjct  296  SRYGICKFGPSCKFDHP  312


 Score = 55.1 bits (131),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 49/196 (25%), Positives = 76/196 (39%), Gaps = 72/196 (37%)
 Frame = +1

Query  490  TMESGTYPVRDGEPDCSYYIRTGLCRFGASC-----------------------------  582
            T+    YP+R  E +C+YY+RT  C+FG++C                             
Sbjct  76   TLNVLGYPLRPNENECTYYMRTAQCKFGSTCKFHHPEPSNMMVSSRGSPVYPPGPSSTTP  135

Query  583  -RFNHPSNRKLAIAAARMKGE--------------YPE--------RVGQPECQYYLKTG  693
             + ++P +R   I+ AR +G               +P          V   E Q      
Sbjct  136  GQMSYPLSRASFISGARWQGSSSYAPLPVLQGVVSFPGFTYNGQLGSVSSAEGQQQTAGN  195

Query  694  ACKFGATCKFHHPRDKAGIAG-------RVALNVLGY---------PLRPNDIECPYYMR  825
            +  +G++       DKA +         RV+   +GY         P R    EC +YM+
Sbjct  196  SQVYGSS----RSSDKATMGSEGMNSSYRVSSLPVGYYALQGENVFPERVGQPECQFYMK  251

Query  826  TGQCKFGSTCKFHHPQ  873
            TG CKFG+ C+FHHP+
Sbjct  252  TGDCKFGAVCRFHHPR  267



>ref|XP_006380188.1| hypothetical protein POPTR_0008s22730g [Populus trichocarpa]
 gb|ERP57985.1| hypothetical protein POPTR_0008s22730g [Populus trichocarpa]
Length=477

 Score =   198 bits (503),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 92/164 (56%), Positives = 114/164 (70%), Gaps = 6/164 (4%)
 Frame = +1

Query  451  QETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAAR  630
            +E +WQL L   E+     YP R  E DC YY+RTG C +GA CR+NHP +R   + AAR
Sbjct  29   EEGVWQLGLGETES----EYPERSNEQDCMYYLRTGFCGYGARCRYNHPRDRNAVLGAAR  84

Query  631  MKG-EYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIE  807
              G EYPER GQP CQYY++TG CKFGA+CK+HHP+   G A  V+LN  GYPLRP + E
Sbjct  85   AGGAEYPERAGQPLCQYYMRTGTCKFGASCKYHHPKQGGGSASPVSLNYYGYPLRPGERE  144

Query  808  CPYYMRTGQCKFGSTCKFHHPQPSNMMVPLRG-SPAYPPVHSPT  936
            C YY++TGQCKFG+TCKFHHPQP N+ +P +  +P   PV  PT
Sbjct  145  CTYYIKTGQCKFGATCKFHHPQPGNIQIPAQSLAPQIAPVPGPT  188


 Score = 95.5 bits (236),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 41/76 (54%), Positives = 52/76 (68%), Gaps = 0/76 (0%)
 Frame = +1

Query  643  YPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYM  822
            +PER GQPECQYY+KTG CKF ++C++HHP +       V L+ +G PLRP    C +Y 
Sbjct  298  FPERPGQPECQYYIKTGDCKFRSSCRYHHPPELVVSKSNVVLSPIGLPLRPGAPTCSHYT  357

Query  823  RTGQCKFGSTCKFHHP  870
            + GQCKFG  CKF HP
Sbjct  358  QRGQCKFGPACKFDHP  373


 Score = 75.5 bits (184),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 35/85 (41%), Positives = 50/85 (59%), Gaps = 1/85 (1%)
 Frame = +1

Query  481  SMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKG-EYPERV  657
            S  T +   +P R G+P+C YYI+TG C+F +SCR++HP    ++ +   +     P R 
Sbjct  289  SSSTQKEHLFPERPGQPECQYYIKTGDCKFRSSCRYHHPPELVVSKSNVVLSPIGLPLRP  348

Query  658  GQPECQYYLKTGACKFGATCKFHHP  732
            G P C +Y + G CKFG  CKF HP
Sbjct  349  GAPTCSHYTQRGQCKFGPACKFDHP  373



>ref|XP_007147887.1| hypothetical protein PHAVU_006G163300g [Phaseolus vulgaris]
 gb|ESW19881.1| hypothetical protein PHAVU_006G163300g [Phaseolus vulgaris]
Length=353

 Score =   194 bits (493),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 84/148 (57%), Positives = 106/148 (72%), Gaps = 4/148 (3%)
 Frame = +1

Query  451  QETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAAR  630
            +E +WQL + + E     +YP R  E DC+YY+RTG C FG+ CRFNHP +R   + A R
Sbjct  29   EEPMWQLGMGAAEE----SYPQRPDETDCTYYLRTGFCGFGSRCRFNHPRDRGTVVGAER  84

Query  631  MKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIEC  810
              GEYPERVGQP CQYY++T  CKFG++CK+HHPR   G A  V LN  GYPLRP + EC
Sbjct  85   TAGEYPERVGQPVCQYYMRTRTCKFGSSCKYHHPRLAGGAAAPVTLNYYGYPLRPGEKEC  144

Query  811  PYYMRTGQCKFGSTCKFHHPQPSNMMVP  894
             YY++TGQCKFG+TCKFHHP P+ + +P
Sbjct  145  SYYVKTGQCKFGATCKFHHPVPAGVQIP  172



>ref|XP_011627433.1| PREDICTED: zinc finger CCCH domain-containing protein 5 isoform 
X2 [Amborella trichopoda]
Length=403

 Score =   195 bits (496),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 94/169 (56%), Positives = 117/169 (69%), Gaps = 6/169 (4%)
 Frame = +1

Query  451  QETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAAR  630
            +E++W+LSL      E   YP R GE DC +Y++TG CR+GA+CR+NHP +R  A    +
Sbjct  27   EESMWRLSLGRESGGE--YYPERPGEADCMFYMKTGFCRYGANCRYNHPHDRNPAADVLQ  84

Query  631  MKG-EYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIE  807
              G EYPERVGQP CQY++KTG CKFGATCK+HHPR   G+   V LN+LGYPLRP D E
Sbjct  85   TGGGEYPERVGQPTCQYFIKTGTCKFGATCKYHHPRYGGGLMSPVGLNILGYPLRPGDKE  144

Query  808  CPYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAY---PPVHSPTTPG  945
            C YY++TGQCKFG TCKFHHPQP N  +    +P +   PPV    +PG
Sbjct  145  CSYYVKTGQCKFGPTCKFHHPQPVNTSLQTTPAPQFYPTPPVTPVASPG  193


 Score = 99.4 bits (246),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 43/95 (45%), Positives = 61/95 (64%), Gaps = 0/95 (0%)
 Frame = +1

Query  586  FNHPSNRKLAIAAARMKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVA  765
            F  P +  +A  +   +  +PER GQPECQ+Y++TG CK+G+TC++HHP D+        
Sbjct  216  FFSPVSSSVAGPSGTKENTFPERPGQPECQFYMRTGDCKYGSTCRYHHPPDRIVPQTNCT  275

Query  766  LNVLGYPLRPNDIECPYYMRTGQCKFGSTCKFHHP  870
            L+ +G+PLRP    C +Y + G CKFG TCKF HP
Sbjct  276  LSPIGFPLRPGAPTCSFYAQHGVCKFGPTCKFDHP  310


 Score = 80.5 bits (197),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 34/80 (43%), Positives = 52/80 (65%), Gaps = 1/80 (1%)
 Frame = +1

Query  496  ESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKG-EYPERVGQPEC  672
            +  T+P R G+P+C +Y+RTG C++G++CR++HP +R +      +    +P R G P C
Sbjct  231  KENTFPERPGQPECQFYMRTGDCKYGSTCRYHHPPDRIVPQTNCTLSPIGFPLRPGAPTC  290

Query  673  QYYLKTGACKFGATCKFHHP  732
             +Y + G CKFG TCKF HP
Sbjct  291  SFYAQHGVCKFGPTCKFDHP  310



>ref|XP_007147888.1| hypothetical protein PHAVU_006G163300g [Phaseolus vulgaris]
 gb|ESW19882.1| hypothetical protein PHAVU_006G163300g [Phaseolus vulgaris]
Length=361

 Score =   194 bits (493),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 84/148 (57%), Positives = 106/148 (72%), Gaps = 4/148 (3%)
 Frame = +1

Query  451  QETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAAR  630
            +E +WQL + + E     +YP R  E DC+YY+RTG C FG+ CRFNHP +R   + A R
Sbjct  29   EEPMWQLGMGAAEE----SYPQRPDETDCTYYLRTGFCGFGSRCRFNHPRDRGTVVGAER  84

Query  631  MKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIEC  810
              GEYPERVGQP CQYY++T  CKFG++CK+HHPR   G A  V LN  GYPLRP + EC
Sbjct  85   TAGEYPERVGQPVCQYYMRTRTCKFGSSCKYHHPRLAGGAAAPVTLNYYGYPLRPGEKEC  144

Query  811  PYYMRTGQCKFGSTCKFHHPQPSNMMVP  894
             YY++TGQCKFG+TCKFHHP P+ + +P
Sbjct  145  SYYVKTGQCKFGATCKFHHPVPAGVQIP  172



>ref|XP_009378917.1| PREDICTED: LOW QUALITY PROTEIN: zinc finger CCCH domain-containing 
protein 32 [Pyrus x bretschneideri]
Length=571

 Score =   199 bits (505),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 89/162 (55%), Positives = 109/162 (67%), Gaps = 5/162 (3%)
 Frame = +1

Query  451  QETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAAR  630
            +E +WQL L S E+     YP R G P+C YY+RTG C +G  CR++HP +R   +A  R
Sbjct  139  EEQMWQLGLTSSES-----YPERLGVPNCVYYMRTGFCGYGGRCRYSHPRDRAAVVATVR  193

Query  631  MKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIEC  810
              G+YPERVG+P CQYYLKTG CKFGA+CK+HHP+  AG   R  LN+ GYPLRP + EC
Sbjct  194  ATGDYPERVGEPVCQYYLKTGTCKFGASCKYHHPKHGAGSLNRAPLNIYGYPLRPGENEC  253

Query  811  PYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVHSPT  936
             YY++TGQCKFG TCKFHHP P+    P      YP V SP 
Sbjct  254  SYYLKTGQCKFGITCKFHHPHPAGTTSPASAPQFYPSVQSPV  295


 Score =   100 bits (248),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 42/76 (55%), Positives = 55/76 (72%), Gaps = 0/76 (0%)
 Frame = +1

Query  643  YPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYM  822
            +PER G+ ECQYYLKTG CK+G +C++HHPRD+        L+ +G PLRP +  C +Y+
Sbjct  400  FPERPGELECQYYLKTGDCKYGPSCRYHHPRDRTVPGITCLLSPIGLPLRPGEPPCRFYL  459

Query  823  RTGQCKFGSTCKFHHP  870
            + GQC FGSTCKF HP
Sbjct  460  KNGQCMFGSTCKFDHP  475


 Score = 84.3 bits (207),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 41/100 (41%), Positives = 59/100 (59%), Gaps = 5/100 (5%)
 Frame = +1

Query  505  TYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKL-AIAAARMKGEYPERVGQPECQYY  681
             +P R GE +C YY++TG C++G SCR++HP +R +  I         P R G+P C++Y
Sbjct  399  VFPERPGELECQYYLKTGDCKYGPSCRYHHPRDRTVPGITCLLSPIGLPLRPGEPPCRFY  458

Query  682  LKTGACKFGATCKFHHP----RDKAGIAGRVALNVLGYPL  789
            LK G C FG+TCKF HP    R     +  V + V+ YP+
Sbjct  459  LKNGQCMFGSTCKFDHPVQTMRYNLSASSLVDMPVVQYPV  498



>gb|KJB22540.1| hypothetical protein B456_004G053200 [Gossypium raimondii]
Length=377

 Score =   194 bits (493),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 95/164 (58%), Positives = 114/164 (70%), Gaps = 5/164 (3%)
 Frame = +1

Query  451  QETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAAR  630
            +E+ WQLS+R +E+     YP R G  DC YY+RTG C +G SCR+NHP NR    AA R
Sbjct  31   EESRWQLSVRGVES-----YPERLGVTDCVYYMRTGFCGYGNSCRYNHPRNRAAVEAAVR  85

Query  631  MKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIEC  810
              GEYPER G+P CQ+YLKTG CKFGA+CKFHHP+D  G    V+LN+ GYPLRP + EC
Sbjct  86   ATGEYPERPGEPVCQFYLKTGTCKFGASCKFHHPKDGGGSFSHVSLNMHGYPLRPGEKEC  145

Query  811  PYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVHSPTTP  942
             YY++TGQCKFG TCKFHHPQPS   +       Y PV SP+ P
Sbjct  146  SYYLKTGQCKFGITCKFHHPQPSGTSMSASAPQFYQPVQSPSVP  189


 Score =   103 bits (257),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 46/92 (50%), Positives = 65/92 (71%), Gaps = 1/92 (1%)
 Frame = +1

Query  595  PSNRKLAIAAARMKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNV  774
            PS+  L+ ++ + +  +PER G+PECQYYL+TG CKFG++C++HHPRD+        L+ 
Sbjct  279  PSSTGLS-SSNQKEHTFPERPGEPECQYYLRTGDCKFGSSCRYHHPRDRVVPQTNCVLSP  337

Query  775  LGYPLRPNDIECPYYMRTGQCKFGSTCKFHHP  870
            +G PLRP    C +Y++ G CKFGSTCKF HP
Sbjct  338  MGLPLRPGVQPCAFYLQNGHCKFGSTCKFDHP  369


 Score = 83.2 bits (204),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 45/105 (43%), Positives = 62/105 (59%), Gaps = 3/105 (3%)
 Frame = +1

Query  427  SSLSPPLA--QETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPS  600
            SS +P LA    +L   +  S    +  T+P R GEP+C YY+RTG C+FG+SCR++HP 
Sbjct  265  SSSTPSLAGPYSSLPSSTGLSSSNQKEHTFPERPGEPECQYYLRTGDCKFGSSCRYHHPR  324

Query  601  NRKLAIAAARMKG-EYPERVGQPECQYYLKTGACKFGATCKFHHP  732
            +R +      +     P R G   C +YL+ G CKFG+TCKF HP
Sbjct  325  DRVVPQTNCVLSPMGLPLRPGVQPCAFYLQNGHCKFGSTCKFDHP  369


 Score = 51.2 bits (121),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 19/31 (61%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = +1

Query  781  YPLRPNDIECPYYMRTGQCKFGSTCKFHHPQ  873
            +P RP + EC YY+RTG CKFGS+C++HHP+
Sbjct  294  FPERPGEPECQYYLRTGDCKFGSSCRYHHPR  324



>ref|XP_004495985.1| PREDICTED: zinc finger CCCH domain-containing protein 32-like 
isoform X3 [Cicer arietinum]
Length=352

 Score =   192 bits (489),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 89/163 (55%), Positives = 110/163 (67%), Gaps = 0/163 (0%)
 Frame = +1

Query  454  ETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARM  633
            E++W L+L         +YP R G P+C YY+RTG C +G  CRFNHP +R    AA R 
Sbjct  30   ESMWHLTLGGGGGGGGESYPERHGVPNCVYYMRTGFCGYGGRCRFNHPRDRAAVAAAVRA  89

Query  634  KGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECP  813
             G+YPER+G+P CQYYLKTG CKFGA+CKFHHP++  G   +  LN+ GYPLRP + EC 
Sbjct  90   TGDYPERLGEPPCQYYLKTGTCKFGASCKFHHPKNGGGYLSQAPLNIYGYPLRPGEKECS  149

Query  814  YYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVHSPTTP  942
            YY++TGQCKFG TCKFHHPQP+   +P      Y  V SPT P
Sbjct  150  YYLKTGQCKFGVTCKFHHPQPAGTSMPASAPQFYQQVQSPTVP  192


 Score = 69.7 bits (169),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 29/52 (56%), Positives = 41/52 (79%), Gaps = 2/52 (4%)
 Frame = +1

Query  643  YPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPN  798
            +PER G+P+CQYYL+TG CKFG  C++HHP+D+  +A R  L+ +G PLRP+
Sbjct  296  FPERPGEPDCQYYLRTGDCKFGLACRYHHPQDQ--VAARPLLSPIGLPLRPD  345


 Score = 55.1 bits (131),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 21/45 (47%), Positives = 31/45 (69%), Gaps = 0/45 (0%)
 Frame = +1

Query  481  SMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLA  615
            S   ++   +P R GEPDC YY+RTG C+FG +CR++HP ++  A
Sbjct  287  SRSNLQEKVFPERPGEPDCQYYLRTGDCKFGLACRYHHPQDQVAA  331



>ref|XP_010684493.1| PREDICTED: zinc finger CCCH domain-containing protein 32-like 
[Beta vulgaris subsp. vulgaris]
Length=462

 Score =   195 bits (496),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 94/165 (57%), Positives = 115/165 (70%), Gaps = 6/165 (4%)
 Frame = +1

Query  451  QETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAAR  630
            +E++W+L L   ET     YP R G  DC YY+RTG C FG  CR+NHP +R  A+AAAR
Sbjct  24   EESMWRLGLSGRET-----YPERPGVSDCVYYMRTGFCGFGTRCRYNHPHDRAAAVAAAR  78

Query  631  M-KGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIE  807
            +  GEYPER G+P CQY+LKTG CKFG TCKF+HPR+  G      LN+ G+PLRP + E
Sbjct  79   LVGGEYPERPGEPVCQYFLKTGTCKFGTTCKFNHPRNAGGSLTNAPLNIQGFPLRPGEKE  138

Query  808  CPYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVHSPTTP  942
            C YY++TGQCKFG TCKFHHPQP+ M +P    P YP V SP+ P
Sbjct  139  CSYYLKTGQCKFGITCKFHHPQPAGMSMPAAAPPFYPTVQSPSVP  183


 Score =   101 bits (251),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 44/77 (57%), Positives = 53/77 (69%), Gaps = 0/77 (0%)
 Frame = +1

Query  640  EYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYY  819
            ++PER G+PECQY+LKTG CKFG +C++HHP D    A    L  LG PLRP    C +Y
Sbjct  285  KFPERPGEPECQYFLKTGNCKFGGSCRYHHPPDGGASAAACFLGPLGLPLRPGTQPCTFY  344

Query  820  MRTGQCKFGSTCKFHHP  870
            M+ G CKFG TCKF HP
Sbjct  345  MQHGYCKFGPTCKFDHP  361


 Score = 78.2 bits (191),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 43/110 (39%), Positives = 61/110 (55%), Gaps = 6/110 (5%)
 Frame = +1

Query  421  GPSSLSPPL-----AQETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCR  585
            G SSLSP       +  +L     +S+       +P R GEP+C Y+++TG C+FG SCR
Sbjct  252  GVSSLSPSTPGLAGSYPSLLSSDGQSITGTTEHKFPERPGEPECQYFLKTGNCKFGGSCR  311

Query  586  FNHPSNRKLAIAAARMKG-EYPERVGQPECQYYLKTGACKFGATCKFHHP  732
            ++HP +   + AA  +     P R G   C +Y++ G CKFG TCKF HP
Sbjct  312  YHHPPDGGASAAACFLGPLGLPLRPGTQPCTFYMQHGYCKFGPTCKFDHP  361



>ref|XP_006444253.1| hypothetical protein CICLE_v10019968mg [Citrus clementina]
 ref|XP_006479891.1| PREDICTED: zinc finger CCCH domain-containing protein 32-like 
[Citrus sinensis]
 gb|ESR57493.1| hypothetical protein CICLE_v10019968mg [Citrus clementina]
 gb|KDO87366.1| hypothetical protein CISIN_1g011776mg [Citrus sinensis]
Length=477

 Score =   195 bits (496),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 91/164 (55%), Positives = 113/164 (69%), Gaps = 5/164 (3%)
 Frame = +1

Query  451  QETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAAR  630
            +E++WQ  L+  E+     YP R G PDC +Y+RTG+C +G  CR+NHP NR    AA R
Sbjct  32   EESMWQSDLKVNES-----YPQRHGVPDCVFYMRTGVCGYGDRCRYNHPRNRAAVEAAVR  86

Query  631  MKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIEC  810
              G+YP+R G+P CQ+YLKTG CKFGA+CKFHHP+   G    V LN+ GYPLRP + EC
Sbjct  87   ATGDYPDRPGEPICQFYLKTGTCKFGASCKFHHPKHSGGSMSHVPLNIYGYPLRPGEKEC  146

Query  811  PYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVHSPTTP  942
             YY++TGQCKFG TCKFHHPQP+   +P      YPPV SPT P
Sbjct  147  SYYLKTGQCKFGITCKFHHPQPAGTSLPASAPQFYPPVQSPTVP  190


 Score =   109 bits (272),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 46/81 (57%), Positives = 61/81 (75%), Gaps = 0/81 (0%)
 Frame = +1

Query  628  RMKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIE  807
            +M+  +PER G+PECQY+LKTG CKFG++C+FHHPRD+       AL+ LG PLRP    
Sbjct  289  QMEQSFPERPGEPECQYFLKTGDCKFGSSCRFHHPRDRVVPRTNCALSPLGLPLRPGAQP  348

Query  808  CPYYMRTGQCKFGSTCKFHHP  870
            C +Y++ G+CKFG+TCKF HP
Sbjct  349  CTFYLQNGRCKFGATCKFDHP  369


 Score = 83.2 bits (204),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 38/77 (49%), Positives = 51/77 (66%), Gaps = 1/77 (1%)
 Frame = +1

Query  505  TYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLA-IAAARMKGEYPERVGQPECQYY  681
            ++P R GEP+C Y+++TG C+FG+SCRF+HP +R +     A      P R G   C +Y
Sbjct  293  SFPERPGEPECQYFLKTGDCKFGSSCRFHHPRDRVVPRTNCALSPLGLPLRPGAQPCTFY  352

Query  682  LKTGACKFGATCKFHHP  732
            L+ G CKFGATCKF HP
Sbjct  353  LQNGRCKFGATCKFDHP  369



>ref|XP_009417932.1| PREDICTED: zinc finger CCCH domain-containing protein 6-like 
isoform X3 [Musa acuminata subsp. malaccensis]
Length=340

 Score =   191 bits (486),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 91/166 (55%), Positives = 112/166 (67%), Gaps = 5/166 (3%)
 Frame = +1

Query  451  QETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAAR  630
            +E++W+L            YP R GEPDC+YY+RTG C +G  CR+NHP +R     A R
Sbjct  22   EESMWRLGFGGGGDAH---YPERPGEPDCAYYMRTGTCSYGEKCRYNHPRDRGSLTGAGR  78

Query  631  MKG-EYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIE  807
                EYPERVGQP C+YY++TG+CKFG++CK+ HPR   G A  V+LN  GYPLRP + E
Sbjct  79   TGAVEYPERVGQPVCEYYMRTGSCKFGSSCKYDHPRQGGGSAQPVSLNYYGYPLRPGEKE  138

Query  808  CPYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPA-YPPVHSPTTP  942
            C YYM+TGQCKFGSTCKFHHPQP    VP   +PA YP V  P+ P
Sbjct  139  CGYYMKTGQCKFGSTCKFHHPQPGGASVPSASAPAFYPSVQHPSVP  184


 Score = 57.4 bits (137),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 22/30 (73%), Positives = 27/30 (90%), Gaps = 0/30 (0%)
 Frame = +1

Query  643  YPERVGQPECQYYLKTGACKFGATCKFHHP  732
            +PER GQPECQ+++KTG CKFGA CK+HHP
Sbjct  288  FPERPGQPECQFFMKTGDCKFGAKCKYHHP  317



>gb|KJB41978.1| hypothetical protein B456_007G130500 [Gossypium raimondii]
Length=472

 Score =   194 bits (494),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 89/164 (54%), Positives = 109/164 (66%), Gaps = 5/164 (3%)
 Frame = +1

Query  451  QETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAAR  630
            +E++WQLSL   E+     YP R G PDC YY+RTG C +G  CR+NHP N     AA R
Sbjct  31   EESMWQLSLGGTES-----YPERPGVPDCVYYMRTGFCGYGNRCRYNHPRNPAWVEAAVR  85

Query  631  MKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIEC  810
              G YPER G+P CQ+YLKTG CKFGA+CKFHHP+       +V LN+ GYPLRP + EC
Sbjct  86   ATGVYPERPGEPTCQFYLKTGTCKFGASCKFHHPKQGDQSFSQVPLNIYGYPLRPGEKEC  145

Query  811  PYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVHSPTTP  942
             YY++TG CKF +TCKFHHPQP+   +P      Y PV SP+ P
Sbjct  146  SYYLKTGHCKFDTTCKFHHPQPAGTSIPASAPQFYQPVQSPSVP  189


 Score =   103 bits (257),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 43/76 (57%), Positives = 56/76 (74%), Gaps = 0/76 (0%)
 Frame = +1

Query  643  YPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYM  822
            +PER G+PECQYYL+TG CKFG++C++HHPRDK        L+ +G PLR     C +Y+
Sbjct  290  FPERPGEPECQYYLRTGDCKFGSSCRYHHPRDKVAPWTNCILSPMGLPLRSGGQPCSFYL  349

Query  823  RTGQCKFGSTCKFHHP  870
            + G+CKFGSTCKF HP
Sbjct  350  QNGRCKFGSTCKFDHP  365


 Score = 84.3 bits (207),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 41/100 (41%), Positives = 59/100 (59%), Gaps = 5/100 (5%)
 Frame = +1

Query  505  TYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKG-EYPERVGQPECQYY  681
            T+P R GEP+C YY+RTG C+FG+SCR++HP ++        +     P R G   C +Y
Sbjct  289  TFPERPGEPECQYYLRTGDCKFGSSCRYHHPRDKVAPWTNCILSPMGLPLRSGGQPCSFY  348

Query  682  LKTGACKFGATCKFHHP----RDKAGIAGRVALNVLGYPL  789
            L+ G CKFG+TCKF HP    R    ++  + + V  YP+
Sbjct  349  LQNGRCKFGSTCKFDHPIGTMRYSPSLSSLIDMPVAPYPV  388


 Score = 52.0 bits (123),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 20/35 (57%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +1

Query  769  NVLGYPLRPNDIECPYYMRTGQCKFGSTCKFHHPQ  873
            N   +P RP + EC YY+RTG CKFGS+C++HHP+
Sbjct  286  NNQTFPERPGEPECQYYLRTGDCKFGSSCRYHHPR  320



>ref|XP_010652064.1| PREDICTED: zinc finger CCCH domain-containing protein 32 [Vitis 
vinifera]
 emb|CBI32253.3| unnamed protein product [Vitis vinifera]
Length=475

 Score =   194 bits (494),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 87/164 (53%), Positives = 111/164 (68%), Gaps = 5/164 (3%)
 Frame = +1

Query  451  QETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAAR  630
            +E++W+L L S E+     YP R G  DC YY++TG C FG+ CR+NHP +R        
Sbjct  31   EESMWRLGLSSRES-----YPERPGVADCVYYMKTGFCGFGSRCRYNHPRDRSSVSTLRS  85

Query  631  MKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIEC  810
              GEYPER+G+P CQ+YLKTG CKFGA+C+FHHPR+  G    V+LN+ GYPLR  + EC
Sbjct  86   GGGEYPERIGEPACQFYLKTGTCKFGASCRFHHPRNGGGSMSHVSLNIYGYPLRLGEKEC  145

Query  811  PYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVHSPTTP  942
             YY++TGQCKFG TCKFHHPQP+   +P      YP V SP+ P
Sbjct  146  SYYLKTGQCKFGITCKFHHPQPAGTSLPASAPTFYPTVQSPSVP  189


 Score = 99.8 bits (247),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 43/76 (57%), Positives = 54/76 (71%), Gaps = 0/76 (0%)
 Frame = +1

Query  643  YPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYM  822
            +PER GQ ECQYYL+TG CKFG++C++HHPR+         L+ LG PLRP    C +Y+
Sbjct  292  FPERPGQQECQYYLRTGDCKFGSSCRYHHPREWVVPKTNCVLSPLGLPLRPGVQPCTFYL  351

Query  823  RTGQCKFGSTCKFHHP  870
            + G CKFGSTCKF HP
Sbjct  352  QNGYCKFGSTCKFDHP  367


 Score = 74.7 bits (182),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 41/114 (36%), Positives = 62/114 (54%), Gaps = 1/114 (1%)
 Frame = +1

Query  394  SASMASVTEGPSSLSPPLAQETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFG  573
            + S+  VT+ PS+ +      +L   +  S    +   +P R G+ +C YY+RTG C+FG
Sbjct  254  AGSVYGVTQLPSTHTLAGPYASLPSSAGPSSSNQKEQVFPERPGQQECQYYLRTGDCKFG  313

Query  574  ASCRFNHPSNRKLAIAAARMKG-EYPERVGQPECQYYLKTGACKFGATCKFHHP  732
            +SCR++HP    +      +     P R G   C +YL+ G CKFG+TCKF HP
Sbjct  314  SSCRYHHPREWVVPKTNCVLSPLGLPLRPGVQPCTFYLQNGYCKFGSTCKFDHP  367



>ref|XP_004495983.1| PREDICTED: zinc finger CCCH domain-containing protein 32-like 
isoform X1 [Cicer arietinum]
Length=466

 Score =   194 bits (493),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 89/163 (55%), Positives = 110/163 (67%), Gaps = 0/163 (0%)
 Frame = +1

Query  454  ETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARM  633
            E++W L+L         +YP R G P+C YY+RTG C +G  CRFNHP +R    AA R 
Sbjct  30   ESMWHLTLGGGGGGGGESYPERHGVPNCVYYMRTGFCGYGGRCRFNHPRDRAAVAAAVRA  89

Query  634  KGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECP  813
             G+YPER+G+P CQYYLKTG CKFGA+CKFHHP++  G   +  LN+ GYPLRP + EC 
Sbjct  90   TGDYPERLGEPPCQYYLKTGTCKFGASCKFHHPKNGGGYLSQAPLNIYGYPLRPGEKECS  149

Query  814  YYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVHSPTTP  942
            YY++TGQCKFG TCKFHHPQP+   +P      Y  V SPT P
Sbjct  150  YYLKTGQCKFGVTCKFHHPQPAGTSMPASAPQFYQQVQSPTVP  192


 Score =   100 bits (249),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 42/76 (55%), Positives = 57/76 (75%), Gaps = 2/76 (3%)
 Frame = +1

Query  643  YPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYM  822
            +PER G+P+CQYYL+TG CKFG  C++HHP+D+  +A R  L+ +G PLRP    C +Y+
Sbjct  296  FPERPGEPDCQYYLRTGDCKFGLACRYHHPQDQ--VAARPLLSPIGLPLRPGVQPCSFYL  353

Query  823  RTGQCKFGSTCKFHHP  870
            + G CKFGS+CKF HP
Sbjct  354  QNGHCKFGSSCKFDHP  369


 Score = 84.0 bits (206),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 42/107 (39%), Positives = 60/107 (56%), Gaps = 5/107 (5%)
 Frame = +1

Query  481  SMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKGEYPERVG  660
            S   ++   +P R GEPDC YY+RTG C+FG +CR++HP ++  A       G  P R G
Sbjct  287  SRSNLQEKVFPERPGEPDCQYYLRTGDCKFGLACRYHHPQDQVAARPLLSPIG-LPLRPG  345

Query  661  QPECQYYLKTGACKFGATCKFHHP----RDKAGIAGRVALNVLGYPL  789
               C +YL+ G CKFG++CKF HP    R     +  + + V  YP+
Sbjct  346  VQPCSFYLQNGHCKFGSSCKFDHPVGSMRYSPSASSLIDIPVAPYPV  392



>ref|XP_010545038.1| PREDICTED: zinc finger CCCH domain-containing protein 32 isoform 
X2 [Tarenaya hassleriana]
Length=463

 Score =   194 bits (493),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 86/146 (59%), Positives = 106/146 (73%), Gaps = 0/146 (0%)
 Frame = +1

Query  496  ESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKGEYPERVGQPECQ  675
             S TYP R G PDC+YY+RTG+C +G+ CR+NHP +R +  AA R  GEYPERVG+P CQ
Sbjct  35   SSETYPERPGAPDCAYYMRTGICGYGSRCRYNHPRDRAVVEAAVRATGEYPERVGEPPCQ  94

Query  676  YYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTC  855
            +YLKTG CKFGA+CKFHHP++  G   +V LN+ GYPLR  + EC +Y++TGQCKFG TC
Sbjct  95   FYLKTGTCKFGASCKFHHPKNAGGSMSQVPLNIHGYPLREAEKECSHYLKTGQCKFGVTC  154

Query  856  KFHHPQPSNMMVPLRGSPAYPPVHSP  933
            KFHHPQP+    P      YP V SP
Sbjct  155  KFHHPQPAGTTTPASTPRFYPSVQSP  180


 Score =   100 bits (249),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 43/76 (57%), Positives = 54/76 (71%), Gaps = 0/76 (0%)
 Frame = +1

Query  643  YPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYM  822
            +PER G+PECQYYL+TG CKFG +CKFHH RD+        L+ +G PLRP    C +Y+
Sbjct  284  FPERPGEPECQYYLRTGDCKFGLSCKFHHRRDRIPQRANCILSPIGLPLRPGVQPCTFYL  343

Query  823  RTGQCKFGSTCKFHHP  870
            + G C+FGSTCKF HP
Sbjct  344  QNGFCRFGSTCKFDHP  359


 Score = 77.8 bits (190),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 43/105 (41%), Positives = 61/105 (58%), Gaps = 3/105 (3%)
 Frame = +1

Query  427  SSLSPPLAQE--TLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPS  600
            SS +P LA    +L   +  S+ + +   +P R GEP+C YY+RTG C+FG SC+F+H  
Sbjct  255  SSSTPSLAGAYPSLSSSTAPSVGSQKEQIFPERPGEPECQYYLRTGDCKFGLSCKFHHRR  314

Query  601  NRKLAIAAARMKG-EYPERVGQPECQYYLKTGACKFGATCKFHHP  732
            +R    A   +     P R G   C +YL+ G C+FG+TCKF HP
Sbjct  315  DRIPQRANCILSPIGLPLRPGVQPCTFYLQNGFCRFGSTCKFDHP  359



>ref|XP_010112757.1| Zinc finger CCCH domain-containing protein 32 [Morus notabilis]
 gb|EXC34715.1| Zinc finger CCCH domain-containing protein 32 [Morus notabilis]
Length=466

 Score =   194 bits (493),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 92/164 (56%), Positives = 111/164 (68%), Gaps = 5/164 (3%)
 Frame = +1

Query  451  QETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAAR  630
            +E++WQL L   E+     YP R G P+C YY+RTG C +G  CR+NHP +R    AA R
Sbjct  28   EESMWQLGLTGGES-----YPERPGVPNCVYYMRTGYCGYGVRCRYNHPRDRAAVAAAVR  82

Query  631  MKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIEC  810
              GEYPERVG+P CQYYLKTG CKFGA+CKFHHP+   G   +  LN+ GYPLRP + EC
Sbjct  83   ATGEYPERVGEPVCQYYLKTGTCKFGASCKFHHPKHGGGSLSQAPLNIYGYPLRPGETEC  142

Query  811  PYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVHSPTTP  942
             YY++TGQCKFG TCKFHHP P+   V       YPPV SP+ P
Sbjct  143  SYYLKTGQCKFGITCKFHHPHPAGTSVTASAPQFYPPVQSPSVP  186


 Score =   102 bits (255),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 43/76 (57%), Positives = 56/76 (74%), Gaps = 0/76 (0%)
 Frame = +1

Query  643  YPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYM  822
            +PER G+PECQYYL+TG CKFG++C++HHPRD+        L+ +G PLRP    C +Y+
Sbjct  290  FPERHGEPECQYYLRTGDCKFGSSCRYHHPRDRVMPRTNCLLSPVGLPLRPGVQPCTFYL  349

Query  823  RTGQCKFGSTCKFHHP  870
            + G CKFGSTCKF HP
Sbjct  350  QNGHCKFGSTCKFDHP  365


 Score = 82.8 bits (203),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 41/100 (41%), Positives = 58/100 (58%), Gaps = 5/100 (5%)
 Frame = +1

Query  505  TYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKG-EYPERVGQPECQYY  681
             +P R GEP+C YY+RTG C+FG+SCR++HP +R +      +     P R G   C +Y
Sbjct  289  VFPERHGEPECQYYLRTGDCKFGSSCRYHHPRDRVMPRTNCLLSPVGLPLRPGVQPCTFY  348

Query  682  LKTGACKFGATCKFHHP----RDKAGIAGRVALNVLGYPL  789
            L+ G CKFG+TCKF HP    R     +  + + V  YP+
Sbjct  349  LQNGHCKFGSTCKFDHPIGTMRYSPSASSLIDMPVAPYPV  388



>ref|XP_009417931.1| PREDICTED: zinc finger CCCH domain-containing protein 6-like 
isoform X2 [Musa acuminata subsp. malaccensis]
Length=341

 Score =   191 bits (484),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 91/166 (55%), Positives = 112/166 (67%), Gaps = 5/166 (3%)
 Frame = +1

Query  451  QETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAAR  630
            +E++W+L            YP R GEPDC+YY+RTG C +G  CR+NHP +R     A R
Sbjct  22   EESMWRLGFGGGGDAH---YPERPGEPDCAYYMRTGTCSYGEKCRYNHPRDRGSLTGAGR  78

Query  631  MKG-EYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIE  807
                EYPERVGQP C+YY++TG+CKFG++CK+ HPR   G A  V+LN  GYPLRP + E
Sbjct  79   TGAVEYPERVGQPVCEYYMRTGSCKFGSSCKYDHPRQGGGSAQPVSLNYYGYPLRPGEKE  138

Query  808  CPYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPA-YPPVHSPTTP  942
            C YYM+TGQCKFGSTCKFHHPQP    VP   +PA YP V  P+ P
Sbjct  139  CGYYMKTGQCKFGSTCKFHHPQPGGASVPSASAPAFYPSVQHPSVP  184


 Score = 73.6 bits (179),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 32/52 (62%), Positives = 39/52 (75%), Gaps = 0/52 (0%)
 Frame = +1

Query  643  YPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPN  798
            +PER GQPECQ+++KTG CKFGA CK+HHP  +      V LNVLG PLRP+
Sbjct  288  FPERPGQPECQFFMKTGDCKFGAKCKYHHPPGRRMPMTNVVLNVLGLPLRPD  339



>ref|XP_007154244.1| hypothetical protein PHAVU_003G102600g [Phaseolus vulgaris]
 ref|XP_007154245.1| hypothetical protein PHAVU_003G102600g [Phaseolus vulgaris]
 gb|ESW26238.1| hypothetical protein PHAVU_003G102600g [Phaseolus vulgaris]
 gb|ESW26239.1| hypothetical protein PHAVU_003G102600g [Phaseolus vulgaris]
Length=483

 Score =   194 bits (493),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 89/148 (60%), Positives = 109/148 (74%), Gaps = 6/148 (4%)
 Frame = +1

Query  451  QETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAI-AAA  627
            +E+ WQL L + E+     YP+R  E DC YY+RTG C +G  CRFNHP +R   I AAA
Sbjct  29   EESSWQLGLAAAES-----YPLRPDEADCIYYLRTGFCGYGTRCRFNHPRDRAAVIGAAA  83

Query  628  RMKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIE  807
            R  GE+PERVGQP CQYY++TG+CKFGA+CK+HHPR  AG A  V LN  GYPLR  + E
Sbjct  84   RTGGEFPERVGQPVCQYYMRTGSCKFGASCKYHHPRQAAGTATPVPLNYYGYPLRVGEKE  143

Query  808  CPYYMRTGQCKFGSTCKFHHPQPSNMMV  891
            C YY++TGQCKFG+TCKFHHPQP+ + V
Sbjct  144  CSYYVKTGQCKFGATCKFHHPQPAGVQV  171


 Score = 96.7 bits (239),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 43/83 (52%), Positives = 54/83 (65%), Gaps = 0/83 (0%)
 Frame = +1

Query  622  AARMKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPND  801
            A + +  +PER  QPEC YY+KTG CKFG +C++HHP DK      V L+ +G PLRP  
Sbjct  294  AIQKEHPFPERPDQPECHYYMKTGECKFGPSCRYHHPPDKGAPKANVILSPVGLPLRPGA  353

Query  802  IECPYYMRTGQCKFGSTCKFHHP  870
              C +Y + G CKFGS CKF HP
Sbjct  354  QPCTHYTQRGVCKFGSACKFDHP  376


 Score = 70.9 bits (172),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 32/76 (42%), Positives = 46/76 (61%), Gaps = 1/76 (1%)
 Frame = +1

Query  508  YPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKGE-YPERVGQPECQYYL  684
            +P R  +P+C YY++TG C+FG SCR++HP ++    A   +     P R G   C +Y 
Sbjct  301  FPERPDQPECHYYMKTGECKFGPSCRYHHPPDKGAPKANVILSPVGLPLRPGAQPCTHYT  360

Query  685  KTGACKFGATCKFHHP  732
            + G CKFG+ CKF HP
Sbjct  361  QRGVCKFGSACKFDHP  376



>ref|XP_004309682.1| PREDICTED: zinc finger CCCH domain-containing protein 32 [Fragaria 
vesca subsp. vesca]
Length=462

 Score =   194 bits (492),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 93/164 (57%), Positives = 112/164 (68%), Gaps = 5/164 (3%)
 Frame = +1

Query  451  QETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAAR  630
            +E +WQL L S E+     YP R G P+C YY+RTG C +G  CR+NHP +R   +AA R
Sbjct  27   EEQMWQLGLTSTES-----YPERPGVPNCVYYMRTGFCGYGVRCRYNHPRDRAAVVAAVR  81

Query  631  MKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIEC  810
              G+YPERVG+P CQYYLKTG CKFGA+CKFHHP+   G   R  LN+ GYPLRP + EC
Sbjct  82   ATGDYPERVGEPVCQYYLKTGTCKFGASCKFHHPKHGGGSLTRAPLNIYGYPLRPGESEC  141

Query  811  PYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVHSPTTP  942
             YY++TGQCKFG TCKFHHPQP+   VP      Y  V SP+ P
Sbjct  142  SYYLKTGQCKFGLTCKFHHPQPAGTTVPASAPQFYQSVQSPSVP  185


 Score =   102 bits (254),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 48/100 (48%), Positives = 64/100 (64%), Gaps = 5/100 (5%)
 Frame = +1

Query  643  YPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYM  822
            +PER G+PECQYYL+TG CKFG +C++HHPRD+        L+ +G PLRP    C +Y+
Sbjct  289  FPERPGEPECQYYLRTGDCKFGPSCRYHHPRDRIAPRTNCLLSPVGLPLRPGVQPCTFYL  348

Query  823  RTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVHSPTTP  942
            + G CKFGS+CKF HP     M  +R SP+   +  P  P
Sbjct  349  QNGHCKFGSSCKFDHP-----MGTMRYSPSASSLDMPVAP  383


 Score = 80.5 bits (197),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 37/77 (48%), Positives = 49/77 (64%), Gaps = 1/77 (1%)
 Frame = +1

Query  505  TYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKG-EYPERVGQPECQYY  681
            T+P R GEP+C YY+RTG C+FG SCR++HP +R        +     P R G   C +Y
Sbjct  288  TFPERPGEPECQYYLRTGDCKFGPSCRYHHPRDRIAPRTNCLLSPVGLPLRPGVQPCTFY  347

Query  682  LKTGACKFGATCKFHHP  732
            L+ G CKFG++CKF HP
Sbjct  348  LQNGHCKFGSSCKFDHP  364



>ref|XP_007200997.1| hypothetical protein PRUPE_ppa005229mg [Prunus persica]
 gb|EMJ02196.1| hypothetical protein PRUPE_ppa005229mg [Prunus persica]
Length=471

 Score =   194 bits (492),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 92/164 (56%), Positives = 112/164 (68%), Gaps = 5/164 (3%)
 Frame = +1

Query  451  QETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAAR  630
            +E +WQL L S E+     YP R G P+C YY+RTG C +G  CR+NHP +R   +AA R
Sbjct  27   EEQMWQLGLTSSES-----YPERPGVPNCVYYMRTGFCGYGIRCRYNHPRDRAAVVAAVR  81

Query  631  MKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIEC  810
              G+YPERVG+P CQYYLKTG CKFGA+CKFHHP+   G   R  LN+ G PLRP + EC
Sbjct  82   ATGDYPERVGEPICQYYLKTGTCKFGASCKFHHPKHGGGSLSRAPLNIYGLPLRPGENEC  141

Query  811  PYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVHSPTTP  942
             YY++TGQCKFG TCKFHHPQP+   +P      YP V SP+ P
Sbjct  142  SYYLKTGQCKFGITCKFHHPQPAGTTIPASAPQFYPSVQSPSVP  185


 Score =   102 bits (254),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 43/76 (57%), Positives = 55/76 (72%), Gaps = 0/76 (0%)
 Frame = +1

Query  643  YPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYM  822
            +PER G+PECQYYLKTG CK+G +C++HHPRD+        L+ +G PLRP    C +Y+
Sbjct  288  FPERPGEPECQYYLKTGDCKYGPSCRYHHPRDRVIPRTNCLLSPIGLPLRPGVQPCTFYL  347

Query  823  RTGQCKFGSTCKFHHP  870
            + G CKFGSTCKF HP
Sbjct  348  QNGHCKFGSTCKFDHP  363


 Score = 80.1 bits (196),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 40/100 (40%), Positives = 57/100 (57%), Gaps = 5/100 (5%)
 Frame = +1

Query  505  TYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKG-EYPERVGQPECQYY  681
             +P R GEP+C YY++TG C++G SCR++HP +R +      +     P R G   C +Y
Sbjct  287  VFPERPGEPECQYYLKTGDCKYGPSCRYHHPRDRVIPRTNCLLSPIGLPLRPGVQPCTFY  346

Query  682  LKTGACKFGATCKFHHP----RDKAGIAGRVALNVLGYPL  789
            L+ G CKFG+TCKF HP    R     +  V + V  YP+
Sbjct  347  LQNGHCKFGSTCKFDHPIGTMRYNPSASSLVDMPVTPYPV  386



>ref|XP_012082692.1| PREDICTED: zinc finger CCCH domain-containing protein 32 isoform 
X2 [Jatropha curcas]
Length=443

 Score =   193 bits (490),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 94/166 (57%), Positives = 112/166 (67%), Gaps = 5/166 (3%)
 Frame = +1

Query  445  LAQETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAA  624
            L  E++W+L L S E+     YP R G PDC YY+RTG C +GA CR+NHP NR    AA
Sbjct  4    LNVESMWRLGLASSES-----YPERSGVPDCVYYMRTGCCGYGARCRYNHPRNRAAVEAA  58

Query  625  ARMKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDI  804
             R  GEYPER G+P CQ+YLKTG CKFGA+CKFHHP+   G    V LN+ GYPLRP + 
Sbjct  59   VRATGEYPERAGEPLCQFYLKTGTCKFGASCKFHHPKHGGGSLSHVPLNIHGYPLRPGEK  118

Query  805  ECPYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVHSPTTP  942
            EC YY++TGQCKFG TCKFHHP P+   +P      Y PV SP+ P
Sbjct  119  ECSYYLKTGQCKFGITCKFHHPPPAGTSMPESAPQFYQPVQSPSIP  164


 Score =   108 bits (269),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 50/96 (52%), Positives = 65/96 (68%), Gaps = 2/96 (2%)
 Frame = +1

Query  589  NHPSNRKLAIAAARMKGE--YPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRV  762
             +PS   +A  ++  + E  +PER G+PECQYYL+TG CKFG++C++HHPRD+       
Sbjct  243  TYPSPSSVAGLSSGTQKELTFPERPGEPECQYYLRTGDCKFGSSCRYHHPRDRIVPRTNC  302

Query  763  ALNVLGYPLRPNDIECPYYMRTGQCKFGSTCKFHHP  870
             L+ LG PLRP    C +YMR G CKFGSTCKF HP
Sbjct  303  VLSPLGLPLRPGVQHCTFYMRNGHCKFGSTCKFDHP  338


 Score = 84.3 bits (207),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 39/85 (46%), Positives = 54/85 (64%), Gaps = 1/85 (1%)
 Frame = +1

Query  481  SMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKG-EYPERV  657
            S  T +  T+P R GEP+C YY+RTG C+FG+SCR++HP +R +      +     P R 
Sbjct  254  SSGTQKELTFPERPGEPECQYYLRTGDCKFGSSCRYHHPRDRIVPRTNCVLSPLGLPLRP  313

Query  658  GQPECQYYLKTGACKFGATCKFHHP  732
            G   C +Y++ G CKFG+TCKF HP
Sbjct  314  GVQHCTFYMRNGHCKFGSTCKFDHP  338


 Score = 53.5 bits (127),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 27/57 (47%), Positives = 38/57 (67%), Gaps = 3/57 (5%)
 Frame = +1

Query  775  LGYPLRPNDIECPYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVHSPTTPG  945
            L +P RP + EC YY+RTG CKFGS+C++HHP+  + +VP R +    P+  P  PG
Sbjct  261  LTFPERPGEPECQYYLRTGDCKFGSSCRYHHPR--DRIVP-RTNCVLSPLGLPLRPG  314



>ref|XP_011013662.1| PREDICTED: zinc finger CCCH domain-containing protein 34-like 
[Populus euphratica]
Length=476

 Score =   194 bits (492),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 93/175 (53%), Positives = 117/175 (67%), Gaps = 15/175 (9%)
 Frame = +1

Query  451  QETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAAR  630
            +E +WQL L   E+     YP R  E DC YY+RTG C +GA CR+NHP +R  A+ A R
Sbjct  29   EEGVWQLGLGETES----EYPERPNEQDCMYYLRTGFCGYGARCRYNHPRDRTAALEAGR  84

Query  631  MKG-EYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIE  807
              G E+PERVGQP CQYY++TG CKFGA+CK++HP+        V+LN  GYPLRP D E
Sbjct  85   TGGGEFPERVGQPLCQYYMRTGTCKFGASCKYNHPKQGGSSVRPVSLNFYGYPLRPGDKE  144

Query  808  CPYYMRTGQCKFGSTCKFHHPQPSNMMVP-------LRGSPA---YPPVHSPTTP  942
            C YY++TGQCKFG+TCKFHHPQP+NM +P       +   PA   YP + SP+ P
Sbjct  145  CTYYIKTGQCKFGATCKFHHPQPANMQIPAQSLAPQVASVPAPTLYPTMQSPSVP  199


 Score = 97.8 bits (242),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 41/76 (54%), Positives = 53/76 (70%), Gaps = 0/76 (0%)
 Frame = +1

Query  643  YPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYM  822
            +PER GQPECQYY+KTG CKF ++C++HHP +       V L+ +G+PLRP    C +Y 
Sbjct  298  FPERPGQPECQYYMKTGDCKFESSCRYHHPPELVASKTNVVLSPMGFPLRPGAPTCTHYT  357

Query  823  RTGQCKFGSTCKFHHP  870
            + GQCKFG  CKF HP
Sbjct  358  QHGQCKFGPACKFDHP  373



>ref|XP_008235007.1| PREDICTED: zinc finger CCCH domain-containing protein 32 [Prunus 
mume]
Length=472

 Score =   193 bits (491),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 92/164 (56%), Positives = 112/164 (68%), Gaps = 5/164 (3%)
 Frame = +1

Query  451  QETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAAR  630
            +E +WQL L S E+     YP R G P+C YY+RTG C +G  CR+NHP +R   +AA R
Sbjct  27   EEQMWQLGLTSSES-----YPERPGVPNCVYYMRTGFCGYGIRCRYNHPRDRAAVVAAVR  81

Query  631  MKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIEC  810
              G+YPERVG+P CQYYLKTG CKFGA+CKFHHP+   G   R  LN+ G PLRP + EC
Sbjct  82   ATGDYPERVGEPICQYYLKTGTCKFGASCKFHHPKHGGGSLSRAPLNIYGLPLRPGENEC  141

Query  811  PYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVHSPTTP  942
             YY++TGQCKFG TCKFHHPQP+   +P      YP V SP+ P
Sbjct  142  SYYLKTGQCKFGITCKFHHPQPAGTTIPSSAPQFYPSVQSPSVP  185


 Score =   102 bits (255),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 43/76 (57%), Positives = 55/76 (72%), Gaps = 0/76 (0%)
 Frame = +1

Query  643  YPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYM  822
            +PER G+PECQYYLKTG CK+G +C++HHPRD+        L+ +G PLRP    C +Y+
Sbjct  289  FPERPGEPECQYYLKTGDCKYGPSCRYHHPRDRVVPRTNCLLSPIGLPLRPGVQPCTFYL  348

Query  823  RTGQCKFGSTCKFHHP  870
            + G CKFGSTCKF HP
Sbjct  349  QNGHCKFGSTCKFDHP  364


 Score = 80.1 bits (196),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 40/100 (40%), Positives = 57/100 (57%), Gaps = 5/100 (5%)
 Frame = +1

Query  505  TYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKG-EYPERVGQPECQYY  681
             +P R GEP+C YY++TG C++G SCR++HP +R +      +     P R G   C +Y
Sbjct  288  VFPERPGEPECQYYLKTGDCKYGPSCRYHHPRDRVVPRTNCLLSPIGLPLRPGVQPCTFY  347

Query  682  LKTGACKFGATCKFHHP----RDKAGIAGRVALNVLGYPL  789
            L+ G CKFG+TCKF HP    R     +  V + V  YP+
Sbjct  348  LQNGHCKFGSTCKFDHPIGTMRYNPSASSLVDMPVTPYPV  387



>ref|XP_012082691.1| PREDICTED: zinc finger CCCH domain-containing protein 32 isoform 
X1 [Jatropha curcas]
 gb|KDP28101.1| hypothetical protein JCGZ_13872 [Jatropha curcas]
Length=468

 Score =   193 bits (490),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 93/164 (57%), Positives = 112/164 (68%), Gaps = 5/164 (3%)
 Frame = +1

Query  451  QETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAAR  630
            +E++W+L L S E+     YP R G PDC YY+RTG C +GA CR+NHP NR    AA R
Sbjct  31   EESMWRLGLASSES-----YPERSGVPDCVYYMRTGCCGYGARCRYNHPRNRAAVEAAVR  85

Query  631  MKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIEC  810
              GEYPER G+P CQ+YLKTG CKFGA+CKFHHP+   G    V LN+ GYPLRP + EC
Sbjct  86   ATGEYPERAGEPLCQFYLKTGTCKFGASCKFHHPKHGGGSLSHVPLNIHGYPLRPGEKEC  145

Query  811  PYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVHSPTTP  942
             YY++TGQCKFG TCKFHHP P+   +P      Y PV SP+ P
Sbjct  146  SYYLKTGQCKFGITCKFHHPPPAGTSMPESAPQFYQPVQSPSIP  189


 Score =   108 bits (269),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 50/96 (52%), Positives = 65/96 (68%), Gaps = 2/96 (2%)
 Frame = +1

Query  589  NHPSNRKLAIAAARMKGE--YPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRV  762
             +PS   +A  ++  + E  +PER G+PECQYYL+TG CKFG++C++HHPRD+       
Sbjct  268  TYPSPSSVAGLSSGTQKELTFPERPGEPECQYYLRTGDCKFGSSCRYHHPRDRIVPRTNC  327

Query  763  ALNVLGYPLRPNDIECPYYMRTGQCKFGSTCKFHHP  870
             L+ LG PLRP    C +YMR G CKFGSTCKF HP
Sbjct  328  VLSPLGLPLRPGVQHCTFYMRNGHCKFGSTCKFDHP  363


 Score = 84.0 bits (206),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 39/85 (46%), Positives = 54/85 (64%), Gaps = 1/85 (1%)
 Frame = +1

Query  481  SMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKG-EYPERV  657
            S  T +  T+P R GEP+C YY+RTG C+FG+SCR++HP +R +      +     P R 
Sbjct  279  SSGTQKELTFPERPGEPECQYYLRTGDCKFGSSCRYHHPRDRIVPRTNCVLSPLGLPLRP  338

Query  658  GQPECQYYLKTGACKFGATCKFHHP  732
            G   C +Y++ G CKFG+TCKF HP
Sbjct  339  GVQHCTFYMRNGHCKFGSTCKFDHP  363


 Score = 53.5 bits (127),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 27/57 (47%), Positives = 38/57 (67%), Gaps = 3/57 (5%)
 Frame = +1

Query  775  LGYPLRPNDIECPYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVHSPTTPG  945
            L +P RP + EC YY+RTG CKFGS+C++HHP+  + +VP R +    P+  P  PG
Sbjct  286  LTFPERPGEPECQYYLRTGDCKFGSSCRYHHPR--DRIVP-RTNCVLSPLGLPLRPG  339



>ref|XP_009416576.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X4 [Musa acuminata subsp. malaccensis]
Length=368

 Score =   190 bits (483),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 85/107 (79%), Positives = 95/107 (89%), Gaps = 0/107 (0%)
 Frame = +1

Query  628  RMKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIE  807
            R++G YPERVGQPECQYYLKTG CKFGA CKFHHP++KAGIAGRV LN+LGYPLR N+ +
Sbjct  13   RIRGGYPERVGQPECQYYLKTGTCKFGAICKFHHPKEKAGIAGRVQLNILGYPLRLNEKD  72

Query  808  CPYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQ  948
            C YY+RTG+CKFG TCKFHHPQPSN +V LRGSP YP VHSPTTPGQ
Sbjct  73   CAYYIRTGECKFGGTCKFHHPQPSNAVVALRGSPVYPAVHSPTTPGQ  119


 Score =   102 bits (255),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 50/109 (46%), Positives = 65/109 (60%), Gaps = 2/109 (2%)
 Frame = +1

Query  550  RTGLCRFGASCRF--NHPSNRKLAIAAARMKGEYPERVGQPECQYYLKTGACKFGATCKF  723
            + G    GA  +F    P +  + + A   +  +PER GQPECQ+Y+KTG CKFGA CKF
Sbjct  190  QQGETSIGAQGKFPSYRPGSTPMGLYAVPGENIFPERPGQPECQFYMKTGDCKFGAVCKF  249

Query  724  HHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTCKFHHP  870
            HHP+++        L+ LG PLRP +  C +Y R G CKFG  CKF HP
Sbjct  250  HHPKERLVPVPNCVLSPLGLPLRPGEPVCVFYSRYGICKFGPNCKFDHP  298


 Score = 76.6 bits (187),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 48/76 (63%), Gaps = 1/76 (1%)
 Frame = +1

Query  508  YPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKG-EYPERVGQPECQYYL  684
            +P R G+P+C +Y++TG C+FGA C+F+HP  R + +    +     P R G+P C +Y 
Sbjct  223  FPERPGQPECQFYMKTGDCKFGAVCKFHHPKERLVPVPNCVLSPLGLPLRPGEPVCVFYS  282

Query  685  KTGACKFGATCKFHHP  732
            + G CKFG  CKF HP
Sbjct  283  RYGICKFGPNCKFDHP  298


 Score = 53.5 bits (127),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 30/73 (41%), Positives = 40/73 (55%), Gaps = 5/73 (7%)
 Frame = +1

Query  685  KTGACKFGATCKFHHPRDKAGIAGRVAL---NVLGYPLRPNDIECPYYMRTGQCKFGSTC  855
            + G    GA  KF   R  +   G  A+   N+  +P RP   EC +YM+TG CKFG+ C
Sbjct  190  QQGETSIGAQGKFPSYRPGSTPMGLYAVPGENI--FPERPGQPECQFYMKTGDCKFGAVC  247

Query  856  KFHHPQPSNMMVP  894
            KFHHP+   + VP
Sbjct  248  KFHHPKERLVPVP  260



>ref|XP_006575107.1| PREDICTED: zinc finger CCCH domain-containing protein 32-like 
isoform X3 [Glycine max]
Length=353

 Score =   190 bits (482),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 90/164 (55%), Positives = 113/164 (69%), Gaps = 5/164 (3%)
 Frame = +1

Query  451  QETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAAR  630
            +E++W L+L   E+     YP R G P+C YY+RTG+C +G  CR+NHP +R    AA R
Sbjct  31   EESMWHLTLGGGES-----YPERSGVPNCVYYMRTGVCGYGGRCRYNHPRDRAAVAAAVR  85

Query  631  MKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIEC  810
              G+YPERVG+P CQYYLKTG CKFGA+CKFHHP++  G   +  LNV GYPLRP + EC
Sbjct  86   ATGDYPERVGEPPCQYYLKTGTCKFGASCKFHHPKNGGGYLSQAPLNVYGYPLRPGEKEC  145

Query  811  PYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVHSPTTP  942
             YY++TGQCKFG +CKFHHPQP+   +P      Y  V SPT P
Sbjct  146  SYYLKTGQCKFGISCKFHHPQPAGTSLPASAPQFYQQVQSPTVP  189


 Score = 74.3 bits (181),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 33/53 (62%), Positives = 40/53 (75%), Gaps = 2/53 (4%)
 Frame = +1

Query  643  YPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPND  801
            YPER G+PECQYYL+TG CKFG  C++HHPRD   I  R  L+ +G PLRPN+
Sbjct  293  YPERPGEPECQYYLRTGDCKFGLACRYHHPRDH--IVARPLLSPVGLPLRPNN  343


 Score = 52.4 bits (124),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 20/36 (56%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = +1

Query  508  YPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLA  615
            YP R GEP+C YY+RTG C+FG +CR++HP +  +A
Sbjct  293  YPERPGEPECQYYLRTGDCKFGLACRYHHPRDHIVA  328


 Score = 51.2 bits (121),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 21/39 (54%), Positives = 27/39 (69%), Gaps = 0/39 (0%)
 Frame = +1

Query  781  YPLRPNDIECPYYMRTGQCKFGSTCKFHHPQPSNMMVPL  897
            YP RP + EC YY+RTG CKFG  C++HHP+   +  PL
Sbjct  293  YPERPGEPECQYYLRTGDCKFGLACRYHHPRDHIVARPL  331



>ref|XP_002520668.1| nucleic acid binding protein, putative [Ricinus communis]
 gb|EEF41630.1| nucleic acid binding protein, putative [Ricinus communis]
Length=478

 Score =   193 bits (490),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 92/164 (56%), Positives = 112/164 (68%), Gaps = 2/164 (1%)
 Frame = +1

Query  451  QETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAAR  630
            +E++W+L L +    ES  YP R G PDC YY+RTG C +G  CR+NHP NR    AA R
Sbjct  31   EESMWRLGLNNSGGGES--YPERPGVPDCVYYMRTGFCGYGNRCRYNHPRNRAAVEAAVR  88

Query  631  MKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIEC  810
              GEYPER+G+P C++YLKTG CKFGA+CKFHHP+   G    V LN  GYPLRP + EC
Sbjct  89   ATGEYPERIGEPSCEFYLKTGTCKFGASCKFHHPKHGGGSLSHVPLNTHGYPLRPGENEC  148

Query  811  PYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVHSPTTP  942
             YY++TGQCKFG TCKFHHPQP+   +P      Y PV SP+ P
Sbjct  149  SYYLKTGQCKFGITCKFHHPQPAGSSLPESAPQFYQPVQSPSIP  192


 Score =   108 bits (270),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 45/85 (53%), Positives = 60/85 (71%), Gaps = 0/85 (0%)
 Frame = +1

Query  616  IAAARMKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRP  795
            ++  + +  +PER G+PECQYYL+TG CKFG++C++HHPRD+        L+ LG PLRP
Sbjct  290  LSGTQKEQTFPERPGEPECQYYLRTGDCKFGSSCRYHHPRDRVVPRTNCVLSPLGLPLRP  349

Query  796  NDIECPYYMRTGQCKFGSTCKFHHP  870
                C +Y+R G CKFGSTCKF HP
Sbjct  350  GAQHCTFYLRNGHCKFGSTCKFDHP  374


 Score = 86.3 bits (212),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 39/84 (46%), Positives = 54/84 (64%), Gaps = 1/84 (1%)
 Frame = +1

Query  490  TMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKG-EYPERVGQP  666
            T +  T+P R GEP+C YY+RTG C+FG+SCR++HP +R +      +     P R G  
Sbjct  293  TQKEQTFPERPGEPECQYYLRTGDCKFGSSCRYHHPRDRVVPRTNCVLSPLGLPLRPGAQ  352

Query  667  ECQYYLKTGACKFGATCKFHHPRD  738
             C +YL+ G CKFG+TCKF HP +
Sbjct  353  HCTFYLRNGHCKFGSTCKFDHPME  376



>ref|XP_006575106.1| PREDICTED: zinc finger CCCH domain-containing protein 32-like 
isoform X2 [Glycine max]
Length=365

 Score =   190 bits (482),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 90/164 (55%), Positives = 113/164 (69%), Gaps = 5/164 (3%)
 Frame = +1

Query  451  QETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAAR  630
            +E++W L+L   E+     YP R G P+C YY+RTG+C +G  CR+NHP +R    AA R
Sbjct  31   EESMWHLTLGGGES-----YPERSGVPNCVYYMRTGVCGYGGRCRYNHPRDRAAVAAAVR  85

Query  631  MKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIEC  810
              G+YPERVG+P CQYYLKTG CKFGA+CKFHHP++  G   +  LNV GYPLRP + EC
Sbjct  86   ATGDYPERVGEPPCQYYLKTGTCKFGASCKFHHPKNGGGYLSQAPLNVYGYPLRPGEKEC  145

Query  811  PYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVHSPTTP  942
             YY++TGQCKFG +CKFHHPQP+   +P      Y  V SPT P
Sbjct  146  SYYLKTGQCKFGISCKFHHPQPAGTSLPASAPQFYQQVQSPTVP  189


 Score = 71.2 bits (173),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 32/52 (62%), Positives = 38/52 (73%), Gaps = 2/52 (4%)
 Frame = +1

Query  643  YPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPN  798
            YPER G+PECQYYL+TG CKFG  C++HHPRD   I  R  L+ +G PLRP 
Sbjct  293  YPERPGEPECQYYLRTGDCKFGLACRYHHPRDH--IVARPLLSPVGLPLRPK  342


 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 20/36 (56%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = +1

Query  508  YPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLA  615
            YP R GEP+C YY+RTG C+FG +CR++HP +  +A
Sbjct  293  YPERPGEPECQYYLRTGDCKFGLACRYHHPRDHIVA  328


 Score = 51.2 bits (121),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 21/39 (54%), Positives = 27/39 (69%), Gaps = 0/39 (0%)
 Frame = +1

Query  781  YPLRPNDIECPYYMRTGQCKFGSTCKFHHPQPSNMMVPL  897
            YP RP + EC YY+RTG CKFG  C++HHP+   +  PL
Sbjct  293  YPERPGEPECQYYLRTGDCKFGLACRYHHPRDHIVARPL  331



>ref|XP_009339837.1| PREDICTED: zinc finger CCCH domain-containing protein 58-like 
[Pyrus x bretschneideri]
Length=473

 Score =   192 bits (489),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 85/149 (57%), Positives = 109/149 (73%), Gaps = 6/149 (4%)
 Frame = +1

Query  451  QETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAAR  630
            +E +WQL L   E+     YP R  E DCSYY+RTG+C +G+ CR+NHP +R + I AAR
Sbjct  29   EEAMWQLGLGPGES-----YPERSDEADCSYYLRTGICGYGSRCRYNHPRDRSVVIGAAR  83

Query  631  MKG-EYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIE  807
              G EYPERVGQP CQYY++TG CKFGA+CK+HHP+        V+LN  GYPLRP + +
Sbjct  84   TGGLEYPERVGQPVCQYYMRTGTCKFGASCKYHHPKQGGSSDSPVSLNYYGYPLRPGERD  143

Query  808  CPYYMRTGQCKFGSTCKFHHPQPSNMMVP  894
            C YY++TGQCKFG+TCKFHHPQP+ + +P
Sbjct  144  CSYYVKTGQCKFGATCKFHHPQPAGIQLP  172


 Score = 92.0 bits (227),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 40/76 (53%), Positives = 51/76 (67%), Gaps = 0/76 (0%)
 Frame = +1

Query  643  YPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYM  822
            +PER GQPECQYY++TG CKFG++C++HHP +       V L+  G P RP    C +Y 
Sbjct  294  FPERPGQPECQYYMRTGDCKFGSSCRYHHPPEVVQSKTTVLLSSSGLPSRPGAPLCTHYQ  353

Query  823  RTGQCKFGSTCKFHHP  870
            + G CKFGS CKF HP
Sbjct  354  QRGACKFGSACKFDHP  369


 Score = 80.1 bits (196),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 35/76 (46%), Positives = 48/76 (63%), Gaps = 1/76 (1%)
 Frame = +1

Query  508  YPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKGE-YPERVGQPECQYYL  684
            +P R G+P+C YY+RTG C+FG+SCR++HP     +     +     P R G P C +Y 
Sbjct  294  FPERPGQPECQYYMRTGDCKFGSSCRYHHPPEVVQSKTTVLLSSSGLPSRPGAPLCTHYQ  353

Query  685  KTGACKFGATCKFHHP  732
            + GACKFG+ CKF HP
Sbjct  354  QRGACKFGSACKFDHP  369



>ref|XP_007144549.1| hypothetical protein PHAVU_007G165200g [Phaseolus vulgaris]
 gb|ESW16543.1| hypothetical protein PHAVU_007G165200g [Phaseolus vulgaris]
Length=343

 Score =   189 bits (480),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 91/164 (55%), Positives = 112/164 (68%), Gaps = 5/164 (3%)
 Frame = +1

Query  451  QETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAAR  630
            +E++W L+L   E+     YP R G P+C YY+RTG+C +G+ CR+NHP +R    AA R
Sbjct  31   EESMWHLTLGGGES-----YPERPGVPNCVYYMRTGVCGYGSRCRYNHPRDRAAVAAAVR  85

Query  631  MKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIEC  810
              GEYPERVG+P CQYYLKTG CKFGA+CKFHHP++  G   +  LN  GYPLRP + EC
Sbjct  86   ATGEYPERVGEPPCQYYLKTGTCKFGASCKFHHPKNGGGYLSQAPLNTCGYPLRPGEKEC  145

Query  811  PYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVHSPTTP  942
             YY++TGQCKFG TCKFHHPQPS   +P      Y  V SP  P
Sbjct  146  SYYLKTGQCKFGVTCKFHHPQPSGTPLPASAPQFYQQVQSPAVP  189


 Score = 68.2 bits (165),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 30/51 (59%), Positives = 38/51 (75%), Gaps = 2/51 (4%)
 Frame = +1

Query  643  YPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRP  795
            +PER G+PECQY+L+TG CKFG  C++HHPRD   I  R  L+ +G PLRP
Sbjct  293  FPERPGEPECQYFLRTGDCKFGLACRYHHPRDH--IVARPFLSPIGLPLRP  341


 Score = 50.8 bits (120),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 19/45 (42%), Positives = 31/45 (69%), Gaps = 0/45 (0%)
 Frame = +1

Query  481  SMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLA  615
            S   ++   +P R GEP+C Y++RTG C+FG +CR++HP +  +A
Sbjct  284  SGNILKDQLFPERPGEPECQYFLRTGDCKFGLACRYHHPRDHIVA  328



>ref|XP_006397979.1| hypothetical protein EUTSA_v10001399mg [Eutrema salsugineum]
 gb|ESQ39432.1| hypothetical protein EUTSA_v10001399mg [Eutrema salsugineum]
Length=525

 Score =   193 bits (491),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 84/148 (57%), Positives = 106/148 (72%), Gaps = 6/148 (4%)
 Frame = +1

Query  451  QETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAAR  630
             E++WQL L S       TYP R G PDC+YY+RTG+C +G  CR+NHP +R    AA R
Sbjct  84   DESMWQLRLGSE------TYPERPGAPDCAYYMRTGVCGYGNRCRYNHPRDRATVEAAVR  137

Query  631  MKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIEC  810
              G+YPER+G+P CQ+YLKTG CKFGA+CKFHHP++  G    V LN+ GYP+R  + +C
Sbjct  138  ATGQYPERIGEPPCQFYLKTGTCKFGASCKFHHPKNAGGSMSHVPLNIYGYPVREGEKDC  197

Query  811  PYYMRTGQCKFGSTCKFHHPQPSNMMVP  894
             YY++TGQCKFG TCKFHHPQP+   VP
Sbjct  198  SYYLKTGQCKFGITCKFHHPQPAGTTVP  225


 Score =   107 bits (266),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 51/94 (54%), Positives = 61/94 (65%), Gaps = 0/94 (0%)
 Frame = +1

Query  643  YPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYM  822
            +PER G+PECQYYLKTG CKFG +CKFHHPRD+        L+ +G PLRP    C +Y+
Sbjct  342  FPERPGEPECQYYLKTGDCKFGTSCKFHHPRDRIPPRANCVLSPIGLPLRPGVQRCTFYV  401

Query  823  RTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPV  924
            + G CKFGSTCKF HP  +    P   S A  PV
Sbjct  402  QNGFCKFGSTCKFDHPMGTIRYNPSASSLADAPV  435


 Score = 81.6 bits (200),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 37/77 (48%), Positives = 50/77 (65%), Gaps = 1/77 (1%)
 Frame = +1

Query  505  TYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKG-EYPERVGQPECQYY  681
            T+P R GEP+C YY++TG C+FG SC+F+HP +R    A   +     P R G   C +Y
Sbjct  341  TFPERPGEPECQYYLKTGDCKFGTSCKFHHPRDRIPPRANCVLSPIGLPLRPGVQRCTFY  400

Query  682  LKTGACKFGATCKFHHP  732
            ++ G CKFG+TCKF HP
Sbjct  401  VQNGFCKFGSTCKFDHP  417



>ref|NP_182306.2| zinc finger CCCH domain-containing protein 32 [Arabidopsis thaliana]
 ref|NP_001078078.1| zinc finger CCCH domain-containing protein 32 [Arabidopsis thaliana]
 sp|Q84W91.2|C3H32_ARATH RecName: Full=Zinc finger CCCH domain-containing protein 32; 
Short=AtC3H32; AltName: Full=Zinc finger CCCH domain-containing 
protein ZFN-like 1 [Arabidopsis thaliana]
 gb|ABO45694.1| At2g47850 [Arabidopsis thaliana]
 gb|AEC10897.1| zinc finger CCCH domain-containing protein 32 [Arabidopsis thaliana]
 gb|AEC10899.1| zinc finger CCCH domain-containing protein 32 [Arabidopsis thaliana]
Length=468

 Score =   192 bits (487),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 84/148 (57%), Positives = 105/148 (71%), Gaps = 6/148 (4%)
 Frame = +1

Query  451  QETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAAR  630
            QE++W+L L       S +YP R G PDC+YY+RTG+C +G  CR+NHP +R    A  R
Sbjct  29   QESMWRLGL------GSDSYPERPGAPDCAYYMRTGVCGYGNRCRYNHPRDRASVEATVR  82

Query  631  MKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIEC  810
              G+YPER G+P CQ+YLKTG CKFGA+CKFHHP++  G    V LN+ GYP+R  D EC
Sbjct  83   ATGQYPERFGEPPCQFYLKTGTCKFGASCKFHHPKNAGGSMSHVPLNIYGYPVREGDNEC  142

Query  811  PYYMRTGQCKFGSTCKFHHPQPSNMMVP  894
             YY++TGQCKFG TCKFHHPQP+   VP
Sbjct  143  SYYLKTGQCKFGITCKFHHPQPAGTTVP  170


 Score =   107 bits (266),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 51/94 (54%), Positives = 61/94 (65%), Gaps = 0/94 (0%)
 Frame = +1

Query  643  YPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYM  822
            +PER G+PECQYYLKTG CKFG +CKFHHPRD+        L+ +G PLRP    C +Y+
Sbjct  286  FPERPGEPECQYYLKTGDCKFGTSCKFHHPRDRVPPRANCVLSPIGLPLRPGVQRCTFYV  345

Query  823  RTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPV  924
            + G CKFGSTCKF HP  +    P   S A  PV
Sbjct  346  QNGFCKFGSTCKFDHPMGTIRYNPSASSLADAPV  379


 Score = 79.3 bits (194),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 36/76 (47%), Positives = 49/76 (64%), Gaps = 1/76 (1%)
 Frame = +1

Query  508  YPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKG-EYPERVGQPECQYYL  684
            +P R GEP+C YY++TG C+FG SC+F+HP +R    A   +     P R G   C +Y+
Sbjct  286  FPERPGEPECQYYLKTGDCKFGTSCKFHHPRDRVPPRANCVLSPIGLPLRPGVQRCTFYV  345

Query  685  KTGACKFGATCKFHHP  732
            + G CKFG+TCKF HP
Sbjct  346  QNGFCKFGSTCKFDHP  361



>gb|ACU18099.1| unknown [Glycine max]
Length=235

 Score =   185 bits (470),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 88/161 (55%), Positives = 110/161 (68%), Gaps = 5/161 (3%)
 Frame = +1

Query  460  LWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKG  639
            +W L+L  +E+     YP R G P+C YY+RTG+C +G  CRFNHP +R    AA R  G
Sbjct  1    MWHLTLGGVES-----YPERPGVPNCVYYMRTGVCGYGDRCRFNHPRDRAAVAAAVRATG  55

Query  640  EYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYY  819
            +YPERVG+P CQYYLKTG CKFGA+CKFHHP++  G   +  LN+ GYPLR  + EC YY
Sbjct  56   DYPERVGEPPCQYYLKTGTCKFGASCKFHHPKNGGGYLSQAPLNIYGYPLRLGEKECSYY  115

Query  820  MRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVHSPTTP  942
            ++TGQCKFG +CKFHHPQP+   +P      Y  V SPT P
Sbjct  116  LKTGQCKFGISCKFHHPQPAGTSLPTSAPQFYQQVQSPTVP  156



>ref|XP_003518955.1| PREDICTED: zinc finger CCCH domain-containing protein 32-like 
isoform X1 [Glycine max]
Length=471

 Score =   192 bits (487),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 90/164 (55%), Positives = 113/164 (69%), Gaps = 5/164 (3%)
 Frame = +1

Query  451  QETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAAR  630
            +E++W L+L   E+     YP R G P+C YY+RTG+C +G  CR+NHP +R    AA R
Sbjct  31   EESMWHLTLGGGES-----YPERSGVPNCVYYMRTGVCGYGGRCRYNHPRDRAAVAAAVR  85

Query  631  MKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIEC  810
              G+YPERVG+P CQYYLKTG CKFGA+CKFHHP++  G   +  LNV GYPLRP + EC
Sbjct  86   ATGDYPERVGEPPCQYYLKTGTCKFGASCKFHHPKNGGGYLSQAPLNVYGYPLRPGEKEC  145

Query  811  PYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVHSPTTP  942
             YY++TGQCKFG +CKFHHPQP+   +P      Y  V SPT P
Sbjct  146  SYYLKTGQCKFGISCKFHHPQPAGTSLPASAPQFYQQVQSPTVP  189


 Score =   103 bits (258),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 46/76 (61%), Positives = 55/76 (72%), Gaps = 2/76 (3%)
 Frame = +1

Query  643  YPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYM  822
            YPER G+PECQYYL+TG CKFG  C++HHPRD   I  R  L+ +G PLRP    C +Y+
Sbjct  293  YPERPGEPECQYYLRTGDCKFGLACRYHHPRDH--IVARPLLSPVGLPLRPGLQPCAFYL  350

Query  823  RTGQCKFGSTCKFHHP  870
            + G CKFGSTCKF HP
Sbjct  351  QNGHCKFGSTCKFDHP  366


 Score = 82.0 bits (201),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 42/98 (43%), Positives = 57/98 (58%), Gaps = 5/98 (5%)
 Frame = +1

Query  508  YPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKGEYPERVGQPECQYYLK  687
            YP R GEP+C YY+RTG C+FG +CR++HP +  +A       G  P R G   C +YL+
Sbjct  293  YPERPGEPECQYYLRTGDCKFGLACRYHHPRDHIVARPLLSPVG-LPLRPGLQPCAFYLQ  351

Query  688  TGACKFGATCKFHHP----RDKAGIAGRVALNVLGYPL  789
             G CKFG+TCKF HP    R     +  + + V  YP+
Sbjct  352  NGHCKFGSTCKFDHPLGSMRYSPSASSLIDVPVTPYPV  389



>ref|XP_009631343.1| PREDICTED: zinc finger CCCH domain-containing protein 32-like 
isoform X2 [Nicotiana tomentosiformis]
Length=380

 Score =   189 bits (480),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 87/152 (57%), Positives = 108/152 (71%), Gaps = 8/152 (5%)
 Frame = +1

Query  451  QETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAAR  630
            +E +WQLS+ S     S +YP R  E DC YY+RTG C +G+ CRFNHP +R L + AAR
Sbjct  28   EEAMWQLSVGS----GSESYPERPNEADCIYYLRTGFCGYGSRCRFNHPPDRNLVMGAAR  83

Query  631  MKG----EYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPN  798
              G    +YPERVGQP CQYY++TG CKFGA+CK+HHPR   G    +  N+ GYPLRP 
Sbjct  84   AIGGGEEKYPERVGQPVCQYYMRTGMCKFGASCKYHHPRQGGGSPALMTHNIYGYPLRPG  143

Query  799  DIECPYYMRTGQCKFGSTCKFHHPQPSNMMVP  894
            + EC +YM+TGQCKFG TCKFHHPQP+ + VP
Sbjct  144  EKECLFYMKTGQCKFGITCKFHHPQPAGVQVP  175


 Score = 70.5 bits (171),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 28/54 (52%), Positives = 41/54 (76%), Gaps = 0/54 (0%)
 Frame = +1

Query  643  YPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDI  804
            +PER GQPECQYY+K G CKFG++C++HHP + +G      L+ +G PLRP+++
Sbjct  307  FPERPGQPECQYYIKYGDCKFGSSCRYHHPPEWSGPKSGFILSAMGLPLRPSEL  360



>ref|XP_007144548.1| hypothetical protein PHAVU_007G165200g [Phaseolus vulgaris]
 gb|ESW16542.1| hypothetical protein PHAVU_007G165200g [Phaseolus vulgaris]
Length=466

 Score =   191 bits (485),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 91/164 (55%), Positives = 112/164 (68%), Gaps = 5/164 (3%)
 Frame = +1

Query  451  QETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAAR  630
            +E++W L+L   E+     YP R G P+C YY+RTG+C +G+ CR+NHP +R    AA R
Sbjct  31   EESMWHLTLGGGES-----YPERPGVPNCVYYMRTGVCGYGSRCRYNHPRDRAAVAAAVR  85

Query  631  MKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIEC  810
              GEYPERVG+P CQYYLKTG CKFGA+CKFHHP++  G   +  LN  GYPLRP + EC
Sbjct  86   ATGEYPERVGEPPCQYYLKTGTCKFGASCKFHHPKNGGGYLSQAPLNTCGYPLRPGEKEC  145

Query  811  PYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVHSPTTP  942
             YY++TGQCKFG TCKFHHPQPS   +P      Y  V SP  P
Sbjct  146  SYYLKTGQCKFGVTCKFHHPQPSGTPLPASAPQFYQQVQSPAVP  189


 Score =   101 bits (252),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 44/76 (58%), Positives = 55/76 (72%), Gaps = 2/76 (3%)
 Frame = +1

Query  643  YPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYM  822
            +PER G+PECQY+L+TG CKFG  C++HHPRD   I  R  L+ +G PLRP    C +Y+
Sbjct  293  FPERPGEPECQYFLRTGDCKFGLACRYHHPRDH--IVARPFLSPIGLPLRPGVQPCAFYL  350

Query  823  RTGQCKFGSTCKFHHP  870
            + G CKFGSTCKF HP
Sbjct  351  QNGHCKFGSTCKFDHP  366


 Score = 80.1 bits (196),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 37/84 (44%), Positives = 52/84 (62%), Gaps = 1/84 (1%)
 Frame = +1

Query  481  SMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKGEYPERVG  660
            S   ++   +P R GEP+C Y++RTG C+FG +CR++HP +  +A       G  P R G
Sbjct  284  SGNILKDQLFPERPGEPECQYFLRTGDCKFGLACRYHHPRDHIVARPFLSPIG-LPLRPG  342

Query  661  QPECQYYLKTGACKFGATCKFHHP  732
               C +YL+ G CKFG+TCKF HP
Sbjct  343  VQPCAFYLQNGHCKFGSTCKFDHP  366



>ref|XP_006294141.1| hypothetical protein CARUB_v10023134mg [Capsella rubella]
 gb|EOA27039.1| hypothetical protein CARUB_v10023134mg [Capsella rubella]
Length=471

 Score =   191 bits (485),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 83/148 (56%), Positives = 106/148 (72%), Gaps = 6/148 (4%)
 Frame = +1

Query  451  QETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAAR  630
            +E++W+L L S       TYP R G PDC+YY+RTG+C +G  CR+NHP +R    A  R
Sbjct  31   EESMWRLGLGSE------TYPERPGAPDCAYYMRTGVCGYGNRCRYNHPRDRASVEATVR  84

Query  631  MKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIEC  810
              G+YPER+G+P CQ+YLKTG CKFGA+CKFHHP++  G    V LN+ GYP+R  + EC
Sbjct  85   ATGQYPERIGEPPCQFYLKTGTCKFGASCKFHHPKNAGGSMSHVPLNIYGYPVREGENEC  144

Query  811  PYYMRTGQCKFGSTCKFHHPQPSNMMVP  894
             YY++TGQCKFG TCKFHHPQP+   VP
Sbjct  145  SYYLKTGQCKFGITCKFHHPQPAGTTVP  172


 Score =   106 bits (264),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 46/76 (61%), Positives = 55/76 (72%), Gaps = 0/76 (0%)
 Frame = +1

Query  643  YPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYM  822
            +PER G+PECQYYLKTG CKFG +CKFHHPRD+        L+ +G PLRP    C +Y+
Sbjct  288  FPERPGEPECQYYLKTGDCKFGTSCKFHHPRDRVPPRANCILSPIGLPLRPGVQRCTFYV  347

Query  823  RTGQCKFGSTCKFHHP  870
            + G CKFGSTCKF HP
Sbjct  348  QNGFCKFGSTCKFDHP  363


 Score = 79.3 bits (194),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 36/76 (47%), Positives = 49/76 (64%), Gaps = 1/76 (1%)
 Frame = +1

Query  508  YPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKG-EYPERVGQPECQYYL  684
            +P R GEP+C YY++TG C+FG SC+F+HP +R    A   +     P R G   C +Y+
Sbjct  288  FPERPGEPECQYYLKTGDCKFGTSCKFHHPRDRVPPRANCILSPIGLPLRPGVQRCTFYV  347

Query  685  KTGACKFGATCKFHHP  732
            + G CKFG+TCKF HP
Sbjct  348  QNGFCKFGSTCKFDHP  363



>ref|XP_008389189.1| PREDICTED: zinc finger CCCH domain-containing protein 32-like 
[Malus domestica]
Length=579

 Score =   193 bits (490),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 91/162 (56%), Positives = 111/162 (69%), Gaps = 5/162 (3%)
 Frame = +1

Query  451  QETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAAR  630
            +E +WQL L   E+     YP R G P+C YY+RTG C +G  CR+NHP +R   +AA R
Sbjct  134  EEQMWQLGLTGGES-----YPERPGVPNCVYYMRTGFCGYGGRCRYNHPRDRAAVVAAVR  188

Query  631  MKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIEC  810
              G+YP+RVG+P CQYYLKTG CKFGA+CKFHHP+  AG   R  LN+ GYPLRP + EC
Sbjct  189  ATGDYPDRVGEPVCQYYLKTGTCKFGASCKFHHPKHGAGSLNRAPLNIYGYPLRPGENEC  248

Query  811  PYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVHSPT  936
             YY++TGQCKFG TCKFHHPQP+   +P      YP V SP 
Sbjct  249  SYYLKTGQCKFGITCKFHHPQPAGTTIPASAPQFYPSVQSPV  290


 Score =   100 bits (248),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 43/76 (57%), Positives = 55/76 (72%), Gaps = 0/76 (0%)
 Frame = +1

Query  643  YPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYM  822
            +PER G+ ECQYYLKTG CK+G +C++HHPRD+        L+ +G PLRP    C +Y+
Sbjct  396  FPERPGELECQYYLKTGDCKYGPSCRYHHPRDRTVPRITCLLSPMGLPLRPGVQPCTFYL  455

Query  823  RTGQCKFGSTCKFHHP  870
            + GQCKFGSTCKF HP
Sbjct  456  QNGQCKFGSTCKFDHP  471


 Score = 79.3 bits (194),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 40/100 (40%), Positives = 57/100 (57%), Gaps = 5/100 (5%)
 Frame = +1

Query  505  TYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLA-IAAARMKGEYPERVGQPECQYY  681
             +P R GE +C YY++TG C++G SCR++HP +R +  I         P R G   C +Y
Sbjct  395  VFPERPGELECQYYLKTGDCKYGPSCRYHHPRDRTVPRITCLLSPMGLPLRPGVQPCTFY  454

Query  682  LKTGACKFGATCKFHHP----RDKAGIAGRVALNVLGYPL  789
            L+ G CKFG+TCKF HP    R     +  V + V+ YP+
Sbjct  455  LQNGQCKFGSTCKFDHPVQTMRYDLSASSLVDMPVVQYPV  494



>ref|XP_009417930.1| PREDICTED: zinc finger CCCH domain-containing protein 6-like 
isoform X1 [Musa acuminata subsp. malaccensis]
Length=467

 Score =   191 bits (485),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 91/166 (55%), Positives = 112/166 (67%), Gaps = 5/166 (3%)
 Frame = +1

Query  451  QETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAAR  630
            +E++W+L            YP R GEPDC+YY+RTG C +G  CR+NHP +R     A R
Sbjct  22   EESMWRLGFGGGGDAH---YPERPGEPDCAYYMRTGTCSYGEKCRYNHPRDRGSLTGAGR  78

Query  631  MKG-EYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIE  807
                EYPERVGQP C+YY++TG+CKFG++CK+ HPR   G A  V+LN  GYPLRP + E
Sbjct  79   TGAVEYPERVGQPVCEYYMRTGSCKFGSSCKYDHPRQGGGSAQPVSLNYYGYPLRPGEKE  138

Query  808  CPYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPA-YPPVHSPTTP  942
            C YYM+TGQCKFGSTCKFHHPQP    VP   +PA YP V  P+ P
Sbjct  139  CGYYMKTGQCKFGSTCKFHHPQPGGASVPSASAPAFYPSVQHPSVP  184


 Score =   104 bits (260),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 47/76 (62%), Positives = 54/76 (71%), Gaps = 0/76 (0%)
 Frame = +1

Query  643  YPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYM  822
            +PER GQPECQ+++KTG CKFGA CK+HHP  +      V LNVLG PLRP    C YYM
Sbjct  288  FPERPGQPECQFFMKTGDCKFGAKCKYHHPPGRRMPMTNVVLNVLGLPLRPGAQPCTYYM  347

Query  823  RTGQCKFGSTCKFHHP  870
            + G CKFG TCKF HP
Sbjct  348  QHGLCKFGQTCKFDHP  363


 Score = 79.0 bits (193),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 39/105 (37%), Positives = 59/105 (56%), Gaps = 3/105 (3%)
 Frame = +1

Query  427  SSLSPPLAQETLWQLSLR--SMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPS  600
            SS++P L    +  LS    S        +P R G+P+C ++++TG C+FGA C+++HP 
Sbjct  259  SSINPALPVPQMPSLSPAGPSSTNQRGNIFPERPGQPECQFFMKTGDCKFGAKCKYHHPP  318

Query  601  NRKLAIAAARMKG-EYPERVGQPECQYYLKTGACKFGATCKFHHP  732
             R++ +    +     P R G   C YY++ G CKFG TCKF HP
Sbjct  319  GRRMPMTNVVLNVLGLPLRPGAQPCTYYMQHGLCKFGQTCKFDHP  363



>ref|XP_008386632.1| PREDICTED: LOW QUALITY PROTEIN: zinc finger CCCH domain-containing 
protein 32-like [Malus domestica]
Length=472

 Score =   191 bits (484),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 90/164 (55%), Positives = 111/164 (68%), Gaps = 5/164 (3%)
 Frame = +1

Query  451  QETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAAR  630
            +E +W L L S E+     YP R G P+C YY+RTG C +G  CR+NHP +R   +AA R
Sbjct  27   EEQMWHLGLTSSES-----YPERPGVPNCVYYMRTGFCGYGGRCRYNHPRDRAAVVAAVR  81

Query  631  MKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIEC  810
              G+YPER G+P CQYYLKT  CKFGA+CK+HHP+  AG   R  LN+ GYPLRP + EC
Sbjct  82   ATGDYPERXGEPICQYYLKTATCKFGASCKYHHPKHGAGSLSRAPLNIYGYPLRPGENEC  141

Query  811  PYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVHSPTTP  942
             YY++TGQCKFG TCKFHHPQP+   +P      YP V SP+ P
Sbjct  142  SYYLKTGQCKFGITCKFHHPQPAGTAIPASAPQFYPSVQSPSVP  185


 Score =   102 bits (255),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 44/76 (58%), Positives = 56/76 (74%), Gaps = 0/76 (0%)
 Frame = +1

Query  643  YPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYM  822
            +PER G+ ECQYYLKTG CK+GA+C++HHPRD+        L+ +G PLRP    C +Y+
Sbjct  289  FPERPGELECQYYLKTGDCKYGASCRYHHPRDRTAPRITCLLSPMGLPLRPGVQPCTFYL  348

Query  823  RTGQCKFGSTCKFHHP  870
            + GQCKFGSTCKF HP
Sbjct  349  QNGQCKFGSTCKFDHP  364


 Score = 80.5 bits (197),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 41/100 (41%), Positives = 57/100 (57%), Gaps = 5/100 (5%)
 Frame = +1

Query  505  TYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLA-IAAARMKGEYPERVGQPECQYY  681
             +P R GE +C YY++TG C++GASCR++HP +R    I         P R G   C +Y
Sbjct  288  VFPERPGELECQYYLKTGDCKYGASCRYHHPRDRTAPRITCLLSPMGLPLRPGVQPCTFY  347

Query  682  LKTGACKFGATCKFHHP----RDKAGIAGRVALNVLGYPL  789
            L+ G CKFG+TCKF HP    R    ++  V + V  YP+
Sbjct  348  LQNGQCKFGSTCKFDHPVQTMRYNPSVSSLVDMPVAPYPV  387



>ref|XP_003518958.1| PREDICTED: zinc finger CCCH domain-containing protein 32-like 
[Glycine max]
Length=339

 Score =   187 bits (475),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 89/164 (54%), Positives = 113/164 (69%), Gaps = 5/164 (3%)
 Frame = +1

Query  451  QETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAAR  630
            +E++W L+L  +E+     YP R G P+C YY+RTG+C +G  CRFNHP +R    AA R
Sbjct  28   EESMWHLTLGGVES-----YPERPGVPNCVYYMRTGVCGYGDRCRFNHPRDRAAVAAAVR  82

Query  631  MKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIEC  810
              G+YPERVG+P CQYYLKTG CKFGA+CKFHHP++  G   +  LN+ GYPLR  + EC
Sbjct  83   ATGDYPERVGEPPCQYYLKTGTCKFGASCKFHHPKNGGGYLSQAPLNIYGYPLRLGEKEC  142

Query  811  PYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVHSPTTP  942
             YY++TGQCKFG +CKFHHPQP+   +P      Y  V SPT P
Sbjct  143  SYYLKTGQCKFGISCKFHHPQPAGTSLPTSAPQFYQQVQSPTVP  186


 Score = 63.5 bits (153),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 29/51 (57%), Positives = 36/51 (71%), Gaps = 3/51 (6%)
 Frame = +1

Query  643  YPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRP  795
            +PER G+PECQYYL+TG CKFG  C++HHPRD         L+ +G PLRP
Sbjct  290  FPERPGEPECQYYLRTGDCKFGLACRYHHPRDHIVAP---LLSPVGLPLRP  337



>ref|XP_002314462.1| hypothetical protein POPTR_0010s02320g [Populus trichocarpa]
 gb|EEF00633.1| hypothetical protein POPTR_0010s02320g [Populus trichocarpa]
Length=456

 Score =   190 bits (483),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 91/175 (52%), Positives = 117/175 (67%), Gaps = 15/175 (9%)
 Frame = +1

Query  451  QETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAAR  630
            +E +WQL +   E+     YP R  E DC YY+RTG C +GA CR+NHP +R   + AAR
Sbjct  29   EEGVWQLEIGETES----EYPERPNEQDCMYYLRTGFCGYGARCRYNHPRDRTAVLGAAR  84

Query  631  MKG-EYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIE  807
              G E+PERVGQP CQYY++TG CKFGA+CK++HP+        V+LN  GYPLRP + E
Sbjct  85   AGGGEFPERVGQPLCQYYMRTGTCKFGASCKYNHPKQGGSSVRPVSLNYYGYPLRPGERE  144

Query  808  CPYYMRTGQCKFGSTCKFHHPQPSNMMVP-------LRGSPA---YPPVHSPTTP  942
            C YY++TGQCKFG+TCKFHHPQP+NM +P       +   PA   YP + SP+ P
Sbjct  145  CTYYIKTGQCKFGATCKFHHPQPANMQIPAQSLAPQVASVPAHTLYPTMQSPSVP  199


 Score = 95.5 bits (236),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 41/76 (54%), Positives = 52/76 (68%), Gaps = 0/76 (0%)
 Frame = +1

Query  643  YPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYM  822
            +PER GQPECQYY+KTG CKF ++C++HHP +       V L+ +G PLRP    C +Y 
Sbjct  298  FPERPGQPECQYYMKTGDCKFESSCRYHHPPELVTSKTNVVLSPMGLPLRPGAPTCTHYT  357

Query  823  RTGQCKFGSTCKFHHP  870
            + GQCKFG  CKF HP
Sbjct  358  QHGQCKFGPACKFDHP  373


 Score = 73.2 bits (178),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 35/87 (40%), Positives = 50/87 (57%), Gaps = 5/87 (6%)
 Frame = +1

Query  481  SMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPS---NRKLAIAAARMKGEYPE  651
            S  + +   +P R G+P+C YY++TG C+F +SCR++HP      K  +  + M    P 
Sbjct  289  SSSSQKEHVFPERPGQPECQYYMKTGDCKFESSCRYHHPPELVTSKTNVVLSPMG--LPL  346

Query  652  RVGQPECQYYLKTGACKFGATCKFHHP  732
            R G P C +Y + G CKFG  CKF HP
Sbjct  347  RPGAPTCTHYTQHGQCKFGPACKFDHP  373



>ref|XP_009774842.1| PREDICTED: zinc finger CCCH domain-containing protein 58-like 
[Nicotiana sylvestris]
Length=492

 Score =   191 bits (484),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 86/148 (58%), Positives = 104/148 (70%), Gaps = 5/148 (3%)
 Frame = +1

Query  451  QETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAAR  630
            +E +WQLSL +       +YP R  EPDC YY+RTG C +GA CRFNHP +R   + A R
Sbjct  32   EEPMWQLSLNTGPE----SYPERPNEPDCIYYLRTGFCGYGARCRFNHPRDRNSVLGAMR  87

Query  631  MKG-EYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIE  807
              G EYPERVGQP CQYY++TG CKFGA+CK+HHPR   G    V +N+ GYPLRP + E
Sbjct  88   ATGGEYPERVGQPVCQYYMRTGMCKFGASCKYHHPRQGGGSPAPVTVNIYGYPLRPGEKE  147

Query  808  CPYYMRTGQCKFGSTCKFHHPQPSNMMV  891
            C YY++TGQCKFG TCKFHHP P+   V
Sbjct  148  CSYYVKTGQCKFGVTCKFHHPHPAGAQV  175


 Score = 93.6 bits (231),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 39/76 (51%), Positives = 53/76 (70%), Gaps = 0/76 (0%)
 Frame = +1

Query  643  YPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYM  822
            +PER GQPECQYY+K G CK+G++C++HHP + +G      L+ +G PLRP    C +Y 
Sbjct  310  FPERPGQPECQYYMKYGDCKYGSSCRYHHPPEWSGPKTSFILSAMGLPLRPGAPICSHYA  369

Query  823  RTGQCKFGSTCKFHHP  870
            + G CKFG +CKF HP
Sbjct  370  QNGVCKFGPSCKFDHP  385


 Score = 73.6 bits (179),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 34/78 (44%), Positives = 49/78 (63%), Gaps = 5/78 (6%)
 Frame = +1

Query  508  YPVRDGEPDCSYYIRTGLCRFGASCRFNHP---SNRKLAIAAARMKGEYPERVGQPECQY  678
            +P R G+P+C YY++ G C++G+SCR++HP   S  K +   + M    P R G P C +
Sbjct  310  FPERPGQPECQYYMKYGDCKYGSSCRYHHPPEWSGPKTSFILSAMG--LPLRPGAPICSH  367

Query  679  YLKTGACKFGATCKFHHP  732
            Y + G CKFG +CKF HP
Sbjct  368  YAQNGVCKFGPSCKFDHP  385



>ref|XP_004304076.1| PREDICTED: zinc finger CCCH domain-containing protein 3 [Fragaria 
vesca subsp. vesca]
Length=437

 Score =   189 bits (481),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 89/154 (58%), Positives = 107/154 (69%), Gaps = 8/154 (5%)
 Frame = +1

Query  448  AQETLWQLSLRSME----TMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLA  615
             +E  WQL++   +      +S  YP R GEPDC YY+RTGLC +G++CRFNHP   K A
Sbjct  20   VEEAFWQLTINENQDGGGVAQSNLYPDRPGEPDCIYYLRTGLCGYGSNCRFNHP---KYA  76

Query  616  IAAARMKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRP  795
              AA+  GE PERVGQP+C YYLKTG CK+G+TCKFHHPRD+ G AG V  NVLG P+  
Sbjct  77   SQAAQYSGELPERVGQPDCGYYLKTGTCKYGSTCKFHHPRDRRG-AGPVLFNVLGLPMHQ  135

Query  796  NDIECPYYMRTGQCKFGSTCKFHHPQPSNMMVPL  897
             +  CPYYMRTG CKFG  CKFHHPQP ++   L
Sbjct  136  EEKSCPYYMRTGSCKFGPACKFHHPQPPSLTTAL  169


 Score = 83.2 bits (204),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 37/75 (49%), Positives = 48/75 (64%), Gaps = 3/75 (4%)
 Frame = +1

Query  646  PERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMR  825
            P+R  QPEC+YY+ TG CK+GA CK+HHP+++       A N LG P RP    C  Y+ 
Sbjct  276  PQRPDQPECRYYMNTGTCKYGAECKYHHPKER---IAESATNPLGLPSRPGQPVCSNYIM  332

Query  826  TGQCKFGSTCKFHHP  870
             G CK+G TC+F HP
Sbjct  333  YGICKYGPTCRFDHP  347


 Score = 73.9 bits (180),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 34/74 (46%), Positives = 47/74 (64%), Gaps = 2/74 (3%)
 Frame = +1

Query  511  PVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKGEYPERVGQPECQYYLKT  690
            P R  +P+C YY+ TG C++GA C+++HP  R +A +A    G  P R GQP C  Y+  
Sbjct  276  PQRPDQPECRYYMNTGTCKYGAECKYHHPKER-IAESATNPLG-LPSRPGQPVCSNYIMY  333

Query  691  GACKFGATCKFHHP  732
            G CK+G TC+F HP
Sbjct  334  GICKYGPTCRFDHP  347



>ref|XP_009588295.1| PREDICTED: zinc finger CCCH domain-containing protein 58 [Nicotiana 
tomentosiformis]
Length=494

 Score =   191 bits (484),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 86/148 (58%), Positives = 104/148 (70%), Gaps = 5/148 (3%)
 Frame = +1

Query  451  QETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAAR  630
            +E +WQLSL +       +YP R  EPDC YY+RTG C +GA CRFNHP +R   + A R
Sbjct  32   EEPMWQLSLNTGPE----SYPERPNEPDCIYYLRTGFCGYGARCRFNHPRDRNSVLGAMR  87

Query  631  MKG-EYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIE  807
              G EYPERVGQP CQYY++TG CKFGA+CK+HHPR   G    V +N+ GYPLRP + E
Sbjct  88   ATGGEYPERVGQPVCQYYMRTGMCKFGASCKYHHPRQGGGSPAPVTVNIYGYPLRPGEKE  147

Query  808  CPYYMRTGQCKFGSTCKFHHPQPSNMMV  891
            C YY++TGQCKFG TCKFHHP P+   V
Sbjct  148  CSYYVKTGQCKFGVTCKFHHPHPAGAQV  175


 Score = 93.6 bits (231),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 39/76 (51%), Positives = 53/76 (70%), Gaps = 0/76 (0%)
 Frame = +1

Query  643  YPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYM  822
            +PER GQPECQYY+K G CK+G++C++HHP + +G      L+ +G PLRP    C +Y 
Sbjct  310  FPERPGQPECQYYMKYGDCKYGSSCRYHHPPEWSGPKTSFILSAMGLPLRPGAPICSHYA  369

Query  823  RTGQCKFGSTCKFHHP  870
            + G CKFG +CKF HP
Sbjct  370  QNGVCKFGPSCKFDHP  385


 Score = 74.3 bits (181),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 38/101 (38%), Positives = 57/101 (56%), Gaps = 8/101 (8%)
 Frame = +1

Query  508  YPVRDGEPDCSYYIRTGLCRFGASCRFNHP---SNRKLAIAAARMKGEYPERVGQPECQY  678
            +P R G+P+C YY++ G C++G+SCR++HP   S  K +   + M    P R G P C +
Sbjct  310  FPERPGQPECQYYMKYGDCKYGSSCRYHHPPEWSGPKTSFILSAMG--LPLRPGAPICSH  367

Query  679  YLKTGACKFGATCKFHHPRDKA---GIAGRVALNVLGYPLR  792
            Y + G CKFG +CKF HP   +     +    + V  YP+R
Sbjct  368  YAQNGVCKFGPSCKFDHPMGMSYSPSASSLTDMAVAPYPVR  408



>gb|KHN46585.1| Zinc finger CCCH domain-containing protein 32 [Glycine soja]
Length=467

 Score =   190 bits (482),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 89/164 (54%), Positives = 113/164 (69%), Gaps = 5/164 (3%)
 Frame = +1

Query  451  QETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAAR  630
            +E++W L+L   E+     YP R G P+C YY+RTG+C +G  CR+NHP +R    AA R
Sbjct  31   EESMWHLTLGGGES-----YPERSGVPNCVYYMRTGVCGYGGRCRYNHPRDRAAVAAAVR  85

Query  631  MKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIEC  810
              G+YPERVG+P CQYYLKTG CKFGA+CKF HP++  G   +  LNV GYPLRP + EC
Sbjct  86   ATGDYPERVGEPPCQYYLKTGTCKFGASCKFRHPKNGGGYLSQAPLNVYGYPLRPGEKEC  145

Query  811  PYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVHSPTTP  942
             YY++TGQCKFG +CKFHHPQP+   +P   +  Y  V SPT P
Sbjct  146  SYYLKTGQCKFGISCKFHHPQPAGTSLPASAAQFYQQVQSPTVP  189


 Score = 95.9 bits (237),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 43/76 (57%), Positives = 52/76 (68%), Gaps = 6/76 (8%)
 Frame = +1

Query  643  YPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYM  822
            YPER G+PECQYYL+TG CKFG  C++HHP        R  L+ +G PLRP    C +Y+
Sbjct  293  YPERPGEPECQYYLRTGDCKFGLACRYHHP------VARPLLSPVGLPLRPGLQPCAFYL  346

Query  823  RTGQCKFGSTCKFHHP  870
            + G CKFGSTCKF HP
Sbjct  347  QNGHCKFGSTCKFDHP  362


 Score = 82.0 bits (201),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 38/75 (51%), Positives = 47/75 (63%), Gaps = 5/75 (7%)
 Frame = +1

Query  508  YPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKGEYPERVGQPECQYYLK  687
            YP R GEP+C YY+RTG C+FG +CR++HP  R L           P R G   C +YL+
Sbjct  293  YPERPGEPECQYYLRTGDCKFGLACRYHHPVARPLLSPVG-----LPLRPGLQPCAFYLQ  347

Query  688  TGACKFGATCKFHHP  732
             G CKFG+TCKF HP
Sbjct  348  NGHCKFGSTCKFDHP  362



>ref|XP_010921758.1| PREDICTED: zinc finger CCCH domain-containing protein 6 [Elaeis 
guineensis]
Length=466

 Score =   190 bits (482),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 92/165 (56%), Positives = 108/165 (65%), Gaps = 3/165 (2%)
 Frame = +1

Query  451  QETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAAR  630
            +E++W+L            YP R GEPDC+YY+RTG C +G  CR+NHP +R     A R
Sbjct  22   EESMWRLG--LGGGGGDSPYPERPGEPDCAYYMRTGSCGYGERCRYNHPRDRGARSGAGR  79

Query  631  MK-GEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIE  807
               GEYPERVGQP C+YY++TG CKFG+TCK+HHPR   G    V LN  GYPLRP + E
Sbjct  80   TAAGEYPERVGQPVCEYYMRTGTCKFGSTCKYHHPRQGGGSVRPVLLNYSGYPLRPGEKE  139

Query  808  CPYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVHSPTTP  942
            C YYM+TGQCKFGSTCKFHHPQP    VP      YP V  PT P
Sbjct  140  CSYYMKTGQCKFGSTCKFHHPQPGGASVPSPAPTFYPTVQPPTVP  184


 Score =   102 bits (253),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 45/76 (59%), Positives = 55/76 (72%), Gaps = 0/76 (0%)
 Frame = +1

Query  643  YPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYM  822
            +PER GQPECQ+Y++TG CKFG+TC++HHPRD +      AL+ LG PLRP    C YY 
Sbjct  288  FPERPGQPECQFYMRTGDCKFGSTCRYHHPRDWSMPKTNCALSPLGLPLRPGAQPCAYYA  347

Query  823  RTGQCKFGSTCKFHHP  870
            + G CKFG TCKF HP
Sbjct  348  QHGVCKFGPTCKFDHP  363


 Score = 76.6 bits (187),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 34/77 (44%), Positives = 48/77 (62%), Gaps = 1/77 (1%)
 Frame = +1

Query  505  TYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKG-EYPERVGQPECQYY  681
            T+P R G+P+C +Y+RTG C+FG++CR++HP +  +      +     P R G   C YY
Sbjct  287  TFPERPGQPECQFYMRTGDCKFGSTCRYHHPRDWSMPKTNCALSPLGLPLRPGAQPCAYY  346

Query  682  LKTGACKFGATCKFHHP  732
             + G CKFG TCKF HP
Sbjct  347  AQHGVCKFGPTCKFDHP  363



>ref|XP_009392483.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X4 [Musa acuminata subsp. malaccensis]
Length=359

 Score =   187 bits (475),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 81/113 (72%), Positives = 98/113 (87%), Gaps = 0/113 (0%)
 Frame = +1

Query  460  LWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKG  639
            +W+ ++R  + +ESG YP R GEPDC+YYIRTGLCRFG +C+FNHP NR LAIAAAR++G
Sbjct  1    MWKTNMRGRDPVESGPYPDRPGEPDCAYYIRTGLCRFGMTCKFNHPQNRMLAIAAARIRG  60

Query  640  EYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPN  798
             YPERVGQPECQYYLKTG CKFG+TCKFHHP++KAGIA +  LN+LGYPLRP+
Sbjct  61   GYPERVGQPECQYYLKTGTCKFGSTCKFHHPKEKAGIAKQAQLNILGYPLRPS  113


 Score =   107 bits (266),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 51/109 (47%), Positives = 66/109 (61%), Gaps = 2/109 (2%)
 Frame = +1

Query  550  RTGLCRFGASCRFN--HPSNRKLAIAAARMKGEYPERVGQPECQYYLKTGACKFGATCKF  723
            + G    GA  +F+   P +  + + A   +  +PER GQPECQ+Y+KTG CKFGA C+F
Sbjct  182  QQGETNIGAQGKFSSYRPGSVSMGLYAVPRENIFPERPGQPECQFYMKTGDCKFGAVCRF  241

Query  724  HHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTCKFHHP  870
            HHPR++        LN LG PLRP +  C +Y R G CKFG  CKF HP
Sbjct  242  HHPRERLIPTPNCVLNPLGLPLRPGEPLCVFYSRYGICKFGPNCKFDHP  290


 Score = 99.0 bits (245),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 44/79 (56%), Positives = 58/79 (73%), Gaps = 1/79 (1%)
 Frame = +1

Query  637  GEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPY  816
            G YP+R G+P+C YY++TG C+FG TCKF+HP+++  +A   A    GYP R    EC Y
Sbjct  15   GPYPDRPGEPDCAYYIRTGLCRFGMTCKFNHPQNRM-LAIAAARIRGGYPERVGQPECQY  73

Query  817  YMRTGQCKFGSTCKFHHPQ  873
            Y++TG CKFGSTCKFHHP+
Sbjct  74   YLKTGTCKFGSTCKFHHPK  92


 Score = 76.6 bits (187),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 47/76 (62%), Gaps = 1/76 (1%)
 Frame = +1

Query  508  YPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKG-EYPERVGQPECQYYL  684
            +P R G+P+C +Y++TG C+FGA CRF+HP  R +      +     P R G+P C +Y 
Sbjct  215  FPERPGQPECQFYMKTGDCKFGAVCRFHHPRERLIPTPNCVLNPLGLPLRPGEPLCVFYS  274

Query  685  KTGACKFGATCKFHHP  732
            + G CKFG  CKF HP
Sbjct  275  RYGICKFGPNCKFDHP  290


 Score = 53.5 bits (127),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/45 (51%), Positives = 30/45 (67%), Gaps = 0/45 (0%)
 Frame = +1

Query  739  KAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTCKFHHPQ  873
            K  + GR  +    YP RP + +C YY+RTG C+FG TCKF+HPQ
Sbjct  3    KTNMRGRDPVESGPYPDRPGEPDCAYYIRTGLCRFGMTCKFNHPQ  47


 Score = 52.4 bits (124),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 27/66 (41%), Positives = 37/66 (56%), Gaps = 5/66 (8%)
 Frame = +1

Query  685  KTGACKFGATCKFHHPRDKAGIAGRVAL---NVLGYPLRPNDIECPYYMRTGQCKFGSTC  855
            + G    GA  KF   R  +   G  A+   N+  +P RP   EC +YM+TG CKFG+ C
Sbjct  182  QQGETNIGAQGKFSSYRPGSVSMGLYAVPRENI--FPERPGQPECQFYMKTGDCKFGAVC  239

Query  856  KFHHPQ  873
            +FHHP+
Sbjct  240  RFHHPR  245



>ref|XP_012069378.1| PREDICTED: zinc finger CCCH domain-containing protein 34 [Jatropha 
curcas]
 gb|KDP40004.1| hypothetical protein JCGZ_02002 [Jatropha curcas]
Length=473

 Score =   190 bits (482),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 85/148 (57%), Positives = 107/148 (72%), Gaps = 5/148 (3%)
 Frame = +1

Query  451  QETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAAR  630
            +E +W L L   E+     YP R  E +C YY+RTG C +GA CRFNHP +R   I AAR
Sbjct  29   EEGVWPLGLGEGES----GYPERPDEANCIYYLRTGFCGYGARCRFNHPRDRGAVIGAAR  84

Query  631  M-KGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIE  807
               GE+PERVGQP CQYY++TG CKFGA+CK+HHP+ + G    V+LN  GYPLRP + E
Sbjct  85   AGAGEFPERVGQPVCQYYMRTGTCKFGASCKYHHPKQEGGSVSPVSLNYYGYPLRPGEKE  144

Query  808  CPYYMRTGQCKFGSTCKFHHPQPSNMMV  891
            C YY++TGQCKFG+TCKFHHPQP+N+ +
Sbjct  145  CTYYVKTGQCKFGATCKFHHPQPANLQI  172


 Score = 95.9 bits (237),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 41/76 (54%), Positives = 52/76 (68%), Gaps = 0/76 (0%)
 Frame = +1

Query  643  YPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYM  822
            +PER  QPECQYY+KTG CKFG++C++HHP +       V L+ +G PLRP    C +Y 
Sbjct  295  FPERPDQPECQYYMKTGNCKFGSSCRYHHPPELIAPKTNVVLSPIGLPLRPGAPPCTHYT  354

Query  823  RTGQCKFGSTCKFHHP  870
            + GQCKFG  CKF HP
Sbjct  355  QRGQCKFGPACKFDHP  370


 Score = 71.2 bits (173),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 33/78 (42%), Positives = 47/78 (60%), Gaps = 5/78 (6%)
 Frame = +1

Query  508  YPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNR---KLAIAAARMKGEYPERVGQPECQY  678
            +P R  +P+C YY++TG C+FG+SCR++HP      K  +  + +    P R G P C +
Sbjct  295  FPERPDQPECQYYMKTGNCKFGSSCRYHHPPELIAPKTNVVLSPIG--LPLRPGAPPCTH  352

Query  679  YLKTGACKFGATCKFHHP  732
            Y + G CKFG  CKF HP
Sbjct  353  YTQRGQCKFGPACKFDHP  370



>ref|XP_009369128.1| PREDICTED: zinc finger CCCH domain-containing protein 58-like 
[Pyrus x bretschneideri]
Length=473

 Score =   190 bits (482),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 83/148 (56%), Positives = 108/148 (73%), Gaps = 1/148 (1%)
 Frame = +1

Query  454  ETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARM  633
            ET  + S+R +      +YP R  E DCSYY+RTG+C +G+ CR+NHP +R + I AAR 
Sbjct  25   ETGLEGSMRQLGLGTGESYPERSNEADCSYYLRTGICGYGSRCRYNHPRDRSVVIGAART  84

Query  634  KG-EYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIEC  810
             G EYPER GQP CQYY++TG CKFGA+CK+HHP+        V+LN  GYPLRP++ +C
Sbjct  85   GGLEYPERAGQPVCQYYMRTGTCKFGASCKYHHPKQGGSSDSPVSLNYYGYPLRPSERDC  144

Query  811  PYYMRTGQCKFGSTCKFHHPQPSNMMVP  894
             YY++TGQCKFGSTCKFHHPQP+ + +P
Sbjct  145  SYYVKTGQCKFGSTCKFHHPQPAGIQLP  172


 Score = 94.0 bits (232),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 40/76 (53%), Positives = 52/76 (68%), Gaps = 0/76 (0%)
 Frame = +1

Query  643  YPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYM  822
            +PER GQPECQY+++TG CKFG++C++HHP +       V L+  G PLRP    C +Y 
Sbjct  294  FPERPGQPECQYFMRTGDCKFGSSCRYHHPPEVVQSKTTVLLSSSGLPLRPGAPLCTHYQ  353

Query  823  RTGQCKFGSTCKFHHP  870
            + G CKFGS CKF HP
Sbjct  354  QRGACKFGSACKFDHP  369


 Score = 78.2 bits (191),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 48/76 (63%), Gaps = 1/76 (1%)
 Frame = +1

Query  508  YPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKGE-YPERVGQPECQYYL  684
            +P R G+P+C Y++RTG C+FG+SCR++HP     +     +     P R G P C +Y 
Sbjct  294  FPERPGQPECQYFMRTGDCKFGSSCRYHHPPEVVQSKTTVLLSSSGLPLRPGAPLCTHYQ  353

Query  685  KTGACKFGATCKFHHP  732
            + GACKFG+ CKF HP
Sbjct  354  QRGACKFGSACKFDHP  369



>ref|XP_010270053.1| PREDICTED: zinc finger CCCH domain-containing protein 12 isoform 
X1 [Nelumbo nucifera]
Length=450

 Score =   189 bits (480),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 89/162 (55%), Positives = 115/162 (71%), Gaps = 11/162 (7%)
 Frame = +1

Query  451  QETLWQLSLRSMETME-----SGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLA  615
            ++++W+L ++  +  E     S  YP R GEPDC YY+RTGLC +G++CRFNHP+    A
Sbjct  25   EDSMWRLKIQPHDNQEGVAANSSPYPDRPGEPDCIYYLRTGLCGYGSNCRFNHPA---YA  81

Query  616  IAAARMKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRP  795
              A + +GE PERVGQP+CQY+LKTG CKFGATCK+HHPRD+   A  V LN+LG P+R 
Sbjct  82   GRAVQYRGELPERVGQPDCQYFLKTGTCKFGATCKYHHPRDRHDTA-HVLLNILGLPMRQ  140

Query  796  NDIECPYYMRTGQCKFGSTCKFHHPQPSN--MMVPLRGSPAY  915
             +  CPYYMRTG CKFG  CKFHHPQP+   ++ P+ G  AY
Sbjct  141  EEKSCPYYMRTGSCKFGMACKFHHPQPATLGLVSPITGPTAY  182


 Score = 96.7 bits (239),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 41/76 (54%), Positives = 51/76 (67%), Gaps = 0/76 (0%)
 Frame = +1

Query  643  YPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYM  822
            +PER  QPECQYY+KTG+CKFG TCK+HHP+++        L  LG PLRP    C +Y 
Sbjct  287  FPERPDQPECQYYMKTGSCKFGPTCKYHHPKERIAPLATSTLGPLGLPLRPGQAVCTFYT  346

Query  823  RTGQCKFGSTCKFHHP  870
              G CK+G TCK+ HP
Sbjct  347  LYGICKYGPTCKYDHP  362


 Score = 72.8 bits (177),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 31/76 (41%), Positives = 47/76 (62%), Gaps = 1/76 (1%)
 Frame = +1

Query  508  YPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKG-EYPERVGQPECQYYL  684
            +P R  +P+C YY++TG C+FG +C+++HP  R   +A + +     P R GQ  C +Y 
Sbjct  287  FPERPDQPECQYYMKTGSCKFGPTCKYHHPKERIAPLATSTLGPLGLPLRPGQAVCTFYT  346

Query  685  KTGACKFGATCKFHHP  732
              G CK+G TCK+ HP
Sbjct  347  LYGICKYGPTCKYDHP  362


 Score = 59.3 bits (142),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 47/76 (62%), Gaps = 6/76 (8%)
 Frame = +1

Query  730  PRDKAGIAGRVAL---NVLGYPLRPNDIECPYYMRTGQCKFGSTCKFHHPQPSNMMVPLR  900
            P+ ++G +G+V L   +V  +P RP+  EC YYM+TG CKFG TCK+HHP+    + PL 
Sbjct  267  PQGESGSSGQVQLLSTSVPHFPERPDQPECQYYMKTGSCKFGPTCKYHHPK--ERIAPLA  324

Query  901  GSPAYPPVHSPTTPGQ  948
             S    P+  P  PGQ
Sbjct  325  TS-TLGPLGLPLRPGQ  339



>ref|XP_009631342.1| PREDICTED: zinc finger CCCH domain-containing protein 32-like 
isoform X1 [Nicotiana tomentosiformis]
Length=488

 Score =   190 bits (482),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 87/152 (57%), Positives = 108/152 (71%), Gaps = 8/152 (5%)
 Frame = +1

Query  451  QETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAAR  630
            +E +WQLS+ S     S +YP R  E DC YY+RTG C +G+ CRFNHP +R L + AAR
Sbjct  28   EEAMWQLSVGS----GSESYPERPNEADCIYYLRTGFCGYGSRCRFNHPPDRNLVMGAAR  83

Query  631  MKG----EYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPN  798
              G    +YPERVGQP CQYY++TG CKFGA+CK+HHPR   G    +  N+ GYPLRP 
Sbjct  84   AIGGGEEKYPERVGQPVCQYYMRTGMCKFGASCKYHHPRQGGGSPALMTHNIYGYPLRPG  143

Query  799  DIECPYYMRTGQCKFGSTCKFHHPQPSNMMVP  894
            + EC +YM+TGQCKFG TCKFHHPQP+ + VP
Sbjct  144  EKECLFYMKTGQCKFGITCKFHHPQPAGVQVP  175


 Score = 94.7 bits (234),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 40/76 (53%), Positives = 53/76 (70%), Gaps = 0/76 (0%)
 Frame = +1

Query  643  YPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYM  822
            +PER GQPECQYY+K G CKFG++C++HHP + +G      L+ +G PLRP    C +Y 
Sbjct  307  FPERPGQPECQYYIKYGDCKFGSSCRYHHPPEWSGPKSGFILSAMGLPLRPGAPICSHYS  366

Query  823  RTGQCKFGSTCKFHHP  870
            + G CKFG +CKF HP
Sbjct  367  QNGVCKFGPSCKFDHP  382


 Score = 75.5 bits (184),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 36/78 (46%), Positives = 48/78 (62%), Gaps = 5/78 (6%)
 Frame = +1

Query  508  YPVRDGEPDCSYYIRTGLCRFGASCRFNHP---SNRKLAIAAARMKGEYPERVGQPECQY  678
            +P R G+P+C YYI+ G C+FG+SCR++HP   S  K     + M    P R G P C +
Sbjct  307  FPERPGQPECQYYIKYGDCKFGSSCRYHHPPEWSGPKSGFILSAMG--LPLRPGAPICSH  364

Query  679  YLKTGACKFGATCKFHHP  732
            Y + G CKFG +CKF HP
Sbjct  365  YSQNGVCKFGPSCKFDHP  382



>ref|XP_006356704.1| PREDICTED: zinc finger CCCH domain-containing protein 32-like 
isoform X4 [Solanum tuberosum]
Length=327

 Score =   186 bits (471),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 85/149 (57%), Positives = 107/149 (72%), Gaps = 5/149 (3%)
 Frame = +1

Query  451  QETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAAR  630
            +E + QLS+ +    E+G+YP R  EPDC YY+R G+C +G+ CRFNHP +R LA+   R
Sbjct  28   EEPMGQLSVGT----EAGSYPERLNEPDCIYYLRNGICGYGSRCRFNHPRDRSLAVGERR  83

Query  631  MKG-EYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIE  807
              G EYPER GQ  CQYY++TG CKFGA+CK+HHPR        V  N+ GYPLRPN+ E
Sbjct  84   ATGGEYPERAGQFVCQYYMRTGMCKFGASCKYHHPRQGGESPSLVIHNIYGYPLRPNEKE  143

Query  808  CPYYMRTGQCKFGSTCKFHHPQPSNMMVP  894
            C +YM+TGQCKFG TCKFHHPQP+ + VP
Sbjct  144  CSHYMKTGQCKFGITCKFHHPQPAGVQVP  172



>ref|XP_006356705.1| PREDICTED: zinc finger CCCH domain-containing protein 32-like 
isoform X5 [Solanum tuberosum]
Length=285

 Score =   184 bits (468),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 85/149 (57%), Positives = 107/149 (72%), Gaps = 5/149 (3%)
 Frame = +1

Query  451  QETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAAR  630
            +E + QLS+ +    E+G+YP R  EPDC YY+R G+C +G+ CRFNHP +R LA+   R
Sbjct  28   EEPMGQLSVGT----EAGSYPERLNEPDCIYYLRNGICGYGSRCRFNHPRDRSLAVGERR  83

Query  631  MKG-EYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIE  807
              G EYPER GQ  CQYY++TG CKFGA+CK+HHPR        V  N+ GYPLRPN+ E
Sbjct  84   ATGGEYPERAGQFVCQYYMRTGMCKFGASCKYHHPRQGGESPSLVIHNIYGYPLRPNEKE  143

Query  808  CPYYMRTGQCKFGSTCKFHHPQPSNMMVP  894
            C +YM+TGQCKFG TCKFHHPQP+ + VP
Sbjct  144  CSHYMKTGQCKFGITCKFHHPQPAGVQVP  172



>ref|XP_011090931.1| PREDICTED: zinc finger CCCH domain-containing protein 32 [Sesamum 
indicum]
Length=496

 Score =   190 bits (482),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 86/148 (58%), Positives = 105/148 (71%), Gaps = 5/148 (3%)
 Frame = +1

Query  451  QETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAAR  630
            +E +WQL L         +YP R  EPDC YY+RTG C +G  CRFNHP +R +A+ A R
Sbjct  41   EEPMWQLGLGGGPE----SYPERPDEPDCIYYLRTGFCGYGNRCRFNHPRDRSMAMGALR  96

Query  631  MKG-EYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIE  807
              G EYPER GQP CQYY++TG CKFGA+CK+HHP+   G +  V LNV GYPLRP + E
Sbjct  97   AGGGEYPERAGQPVCQYYMRTGMCKFGASCKYHHPKHGVGSSAPVTLNVYGYPLRPGEKE  156

Query  808  CPYYMRTGQCKFGSTCKFHHPQPSNMMV  891
            C YY++TGQCKFG TCKFHHPQP+ + V
Sbjct  157  CSYYVKTGQCKFGVTCKFHHPQPAGIQV  184


 Score = 98.6 bits (244),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 44/76 (58%), Positives = 53/76 (70%), Gaps = 0/76 (0%)
 Frame = +1

Query  643  YPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYM  822
            +PER GQPECQYYLKTG CKFGATCK+HHP + +       L+ +G PLRP    C +Y 
Sbjct  314  FPERPGQPECQYYLKTGDCKFGATCKYHHPPEWSAPKINFVLSPMGLPLRPGAPLCSHYA  373

Query  823  RTGQCKFGSTCKFHHP  870
            + G CKFG +CKF HP
Sbjct  374  QNGVCKFGPSCKFDHP  389


 Score = 76.6 bits (187),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 35/78 (45%), Positives = 50/78 (64%), Gaps = 5/78 (6%)
 Frame = +1

Query  508  YPVRDGEPDCSYYIRTGLCRFGASCRFNHP---SNRKLAIAAARMKGEYPERVGQPECQY  678
            +P R G+P+C YY++TG C+FGA+C+++HP   S  K+    + M    P R G P C +
Sbjct  314  FPERPGQPECQYYLKTGDCKFGATCKYHHPPEWSAPKINFVLSPMG--LPLRPGAPLCSH  371

Query  679  YLKTGACKFGATCKFHHP  732
            Y + G CKFG +CKF HP
Sbjct  372  YAQNGVCKFGPSCKFDHP  389



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2295928061616