BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig13414

Length=1028
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009619493.1|  PREDICTED: uncharacterized protein LOC104111488    226   2e-69   Nicotiana tomentosiformis
ref|XP_009790141.1|  PREDICTED: uncharacterized protein LOC104237656    224   3e-68   Nicotiana sylvestris
ref|XP_006342786.1|  PREDICTED: uncharacterized protein LOC102605259    216   4e-65   Solanum tuberosum [potatoes]
ref|XP_004229227.1|  PREDICTED: uncharacterized protein LOC101250046    214   9e-65   Solanum lycopersicum
emb|CDP19541.1|  unnamed protein product                                205   6e-61   Coffea canephora [robusta coffee]
ref|XP_011071453.1|  PREDICTED: uncharacterized protein LOC105156...    204   2e-60   Sesamum indicum [beniseed]
gb|KJB28639.1|  hypothetical protein B456_005G059600                    194   8e-57   Gossypium raimondii
gb|EPS64545.1|  hypothetical protein M569_10240                         193   3e-56   Genlisea aurea
gb|KHG15580.1|  Dynein beta chain, ciliary                              191   2e-55   Gossypium arboreum [tree cotton]
gb|EYU45558.1|  hypothetical protein MIMGU_mgv1a014463mg                189   1e-54   Erythranthe guttata [common monkey flower]
ref|XP_007035558.1|  Uncharacterized protein TCM_021188                 188   2e-54   Theobroma cacao [chocolate]
ref|XP_012083911.1|  PREDICTED: uncharacterized protein LOC105643411    187   4e-54   Jatropha curcas
ref|XP_006389226.1|  hypothetical protein POPTR_0034s00210g             187   5e-54   Populus trichocarpa [western balsam poplar]
ref|XP_010269456.1|  PREDICTED: uncharacterized protein LOC104606105    187   6e-54   Nelumbo nucifera [Indian lotus]
ref|XP_002272645.1|  PREDICTED: uncharacterized protein LOC100252927    184   6e-53   Vitis vinifera
ref|XP_011657169.1|  PREDICTED: uncharacterized protein LOC101223121    184   8e-53   Cucumis sativus [cucumbers]
ref|XP_002516903.1|  conserved hypothetical protein                     184   1e-52   
ref|XP_011014599.1|  PREDICTED: uncharacterized protein LOC105118367    183   1e-52   Populus euphratica
ref|XP_010098298.1|  hypothetical protein L484_023546                   183   2e-52   Morus notabilis
ref|XP_010548932.1|  PREDICTED: uncharacterized protein LOC104820251    182   3e-52   Tarenaya hassleriana [spider flower]
ref|XP_008458465.1|  PREDICTED: uncharacterized protein LOC103497...    179   4e-51   Cucumis melo [Oriental melon]
ref|XP_007226741.1|  hypothetical protein PRUPE_ppa019086mg             180   4e-51   Prunus persica
ref|XP_008223178.1|  PREDICTED: uncharacterized protein LOC103323000    178   2e-50   Prunus mume [ume]
gb|KEH37275.1|  hypothetical protein MTR_2g436940                       176   9e-50   Medicago truncatula
ref|XP_004487885.1|  PREDICTED: uncharacterized protein LOC101502595    173   1e-48   Cicer arietinum [garbanzo]
ref|XP_006406274.1|  hypothetical protein EUTSA_v10021583mg             172   4e-48   Eutrema salsugineum [saltwater cress]
ref|XP_009339822.1|  PREDICTED: uncharacterized protein LOC103932017    171   1e-47   Pyrus x bretschneideri [bai li]
ref|XP_004296824.1|  PREDICTED: uncharacterized protein LOC101303989    169   3e-47   Fragaria vesca subsp. vesca
ref|XP_006419609.1|  hypothetical protein CICLE_v10005978mg             169   4e-47   
ref|XP_002885437.1|  hypothetical protein ARALYDRAFT_898585             169   4e-47   Arabidopsis lyrata subsp. lyrata
ref|XP_010024682.1|  PREDICTED: uncharacterized protein LOC104415123    169   6e-47   
ref|NP_001237555.1|  uncharacterized protein LOC100527797               168   1e-46   Glycine max [soybeans]
ref|XP_009145481.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    166   7e-46   
ref|NP_188777.1|  uncharacterized protein                               166   9e-46   Arabidopsis thaliana [mouse-ear cress]
emb|CDY32427.1|  BnaC03g42110D                                          165   1e-45   Brassica napus [oilseed rape]
ref|XP_010510183.1|  PREDICTED: uncharacterized protein LOC104786...    165   2e-45   Camelina sativa [gold-of-pleasure]
ref|XP_007138897.1|  hypothetical protein PHAVU_009G246800g             165   2e-45   Phaseolus vulgaris [French bean]
gb|KFK39445.1|  hypothetical protein AALP_AA3G246000                    164   4e-45   Arabis alpina [alpine rockcress]
ref|XP_009135748.1|  PREDICTED: uncharacterized protein LOC103859904    162   3e-44   Brassica rapa
ref|XP_010510179.1|  PREDICTED: uncharacterized protein LOC104786...    162   3e-44   Camelina sativa [gold-of-pleasure]
ref|XP_006298617.1|  hypothetical protein CARUB_v10014704mg             161   4e-44   Capsella rubella
ref|XP_010466381.1|  PREDICTED: uncharacterized protein LOC104746567    161   6e-44   Camelina sativa [gold-of-pleasure]
gb|AFK45835.1|  unknown                                                 159   7e-44   Medicago truncatula
emb|CDY55284.1|  BnaC05g51780D                                          160   1e-43   Brassica napus [oilseed rape]
ref|XP_003533433.1|  PREDICTED: uncharacterized protein LOC100806944    160   2e-43   Glycine max [soybeans]
ref|XP_010488154.1|  PREDICTED: uncharacterized protein LOC104766036    160   2e-43   Camelina sativa [gold-of-pleasure]
emb|CDY51444.1|  BnaA05g36610D                                          155   6e-42   Brassica napus [oilseed rape]
ref|XP_009349504.1|  PREDICTED: uncharacterized protein LOC103941044    155   9e-42   Pyrus x bretschneideri [bai li]
ref|XP_009352333.1|  PREDICTED: uncharacterized protein LOC103943718    155   1e-41   Pyrus x bretschneideri [bai li]
ref|XP_011627440.1|  PREDICTED: uncharacterized protein LOC18445311     154   3e-41   Amborella trichopoda
ref|XP_008340938.1|  PREDICTED: uncharacterized protein LOC103403864    155   4e-41   
ref|XP_006378112.1|  hypothetical protein POPTR_0010s02470g             151   6e-41   
ref|XP_008800866.1|  PREDICTED: swi5-dependent recombination DNA ...    149   3e-39   Phoenix dactylifera
ref|XP_008458466.1|  PREDICTED: uncharacterized protein LOC103497...    147   3e-39   Cucumis melo [Oriental melon]
ref|XP_010931613.1|  PREDICTED: uncharacterized protein LOC105052486    148   5e-39   Elaeis guineensis
ref|XP_010666731.1|  PREDICTED: uncharacterized protein LOC104883865    147   9e-39   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_011071454.1|  PREDICTED: uncharacterized protein LOC105156...    144   4e-38   Sesamum indicum [beniseed]
gb|ERN16979.1|  hypothetical protein AMTR_s00057p00205560               137   1e-35   Amborella trichopoda
ref|XP_004962831.1|  PREDICTED: pre-mRNA-splicing ATP-dependent R...    137   5e-35   Setaria italica
ref|XP_009387508.1|  PREDICTED: uncharacterized protein LOC103974411    131   9e-33   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002442262.1|  hypothetical protein SORBIDRAFT_08g017200          129   7e-32   Sorghum bicolor [broomcorn]
gb|EMS60219.1|  hypothetical protein TRIUR3_04878                       127   2e-31   Triticum urartu
dbj|BAJ93761.1|  predicted protein                                      125   1e-30   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_003575725.1|  PREDICTED: lysine-specific demethylase 6B          124   4e-30   Brachypodium distachyon [annual false brome]
gb|AFW56512.1|  hypothetical protein ZEAMMB73_554427                    125   6e-30   
gb|ABA99444.2|  expressed protein                                       122   2e-29   Oryza sativa Japonica Group [Japonica rice]
gb|ABA99446.2|  expressed protein                                       122   2e-29   Oryza sativa Japonica Group [Japonica rice]
gb|EEE53358.1|  hypothetical protein OsJ_36385                          122   2e-29   Oryza sativa Japonica Group [Japonica rice]
emb|CAN63566.1|  hypothetical protein VITISV_043427                     116   5e-27   Vitis vinifera
ref|NP_001066949.1|  Os12g0540700                                       106   2e-24   
ref|NP_001144562.1|  uncharacterized protein LOC100277567               105   4e-24   Zea mays [maize]
gb|EEC69438.1|  hypothetical protein OsI_38613                          100   6e-22   Oryza sativa Indica Group [Indian rice]
emb|CAN63567.1|  hypothetical protein VITISV_043428                   79.7    8e-15   Vitis vinifera
ref|XP_001774099.1|  predicted protein                                74.3    1e-12   



>ref|XP_009619493.1| PREDICTED: uncharacterized protein LOC104111488 [Nicotiana tomentosiformis]
Length=185

 Score =   226 bits (577),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 125/183 (68%), Positives = 149/183 (81%), Gaps = 2/183 (1%)
 Frame = +1

Query  241  MGQAFRRAAGRIGSSGMETSSSQLKKpierpp--ppppeiiSAQNVGTGAESTPKVNPKS  414
            MGQAFRRA GRIGSS ++ +SSQLKKPI+R     P      A NV   A+S+PKV    
Sbjct  1    MGQAFRRATGRIGSSNVDAASSQLKKPIDRRSPPAPAAIKTPADNVAPVADSSPKVAVGK  60

Query  415  VLEERDPQFDVMLSQMVGRIRAKPGGKLEMGEGSVVENYDRPLPKLRNTTTKSSRYEGRP  594
             LEERDP+FD ML QMVGRIRAKPGGKLEMGE SVVE YDR LPKLRNTT++SSRYE RP
Sbjct  61   TLEERDPKFDAMLGQMVGRIRAKPGGKLEMGEASVVEKYDRALPKLRNTTSESSRYEERP  120

Query  595  APPGTLNVAQLRQIIVLYQGKSDEHEGPMDVNQIANKFRIDvsqvqsivqfvsLPPEDTK  774
            APPGTLNVAQ+R+II+L+QG++D H+GPMD+NQIA +FR+D +QVQ I+QFVSLPPEDT 
Sbjct  121  APPGTLNVAQIREIILLHQGRADYHKGPMDINQIAQRFRVDAAQVQRILQFVSLPPEDTS  180

Query  775  EQK  783
            +++
Sbjct  181  KKR  183



>ref|XP_009790141.1| PREDICTED: uncharacterized protein LOC104237656 [Nicotiana sylvestris]
Length=185

 Score =   224 bits (570),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 122/185 (66%), Positives = 148/185 (80%), Gaps = 2/185 (1%)
 Frame = +1

Query  241  MGQAFRRAAGRIGSSGMETSSSQLKKpierp--pppppeiiSAQNVGTGAESTPKVNPKS  414
            MGQAFRRA GRIGSS ++ +SSQLKKPI+R            + NV   A+S+PK     
Sbjct  1    MGQAFRRATGRIGSSNVDAASSQLKKPIDRRPPLAAAAIKTPSNNVAPVADSSPKDAVGK  60

Query  415  VLEERDPQFDVMLSQMVGRIRAKPGGKLEMGEGSVVENYDRPLPKLRNTTTKSSRYEGRP  594
             LEERDP+FD ML QMVGRIRAKPGGKLEMGE SVVE YDR LPKLRNTT++SSRYE RP
Sbjct  61   TLEERDPKFDAMLGQMVGRIRAKPGGKLEMGEASVVEKYDRALPKLRNTTSESSRYEERP  120

Query  595  APPGTLNVAQLRQIIVLYQGKSDEHEGPMDVNQIANKFRIDvsqvqsivqfvsLPPEDTK  774
            APPGTLNVAQ+R+II+L+QG++D+H+GPMD+NQIA +FR+D +QVQ I+QFVSLPPEDT 
Sbjct  121  APPGTLNVAQIREIILLHQGRADDHKGPMDINQIAQRFRVDATQVQRILQFVSLPPEDTS  180

Query  775  EQKKF  789
            +++  
Sbjct  181  KKRSI  185



>ref|XP_006342786.1| PREDICTED: uncharacterized protein LOC102605259 [Solanum tuberosum]
Length=182

 Score =   216 bits (549),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 121/181 (67%), Positives = 153/181 (85%), Gaps = 1/181 (1%)
 Frame = +1

Query  241  MGQAFRRAAGRIGSSGMETSSSQLKKpierppppppeiiSAQNVGTGAESTPKVNPKSVL  420
            MGQAFRRA GRIGSS ++ +SSQLKKPI+R PPP  +   A NVG  AES+ KV  K+ +
Sbjct  1    MGQAFRRATGRIGSSTVDAASSQLKKPIDRRPPPVNKT-PADNVGPVAESSRKVAVKNTV  59

Query  421  EERDPQFDVMLSQMVGRIRAKPGGKLEMGEGSVVENYDRPLPKLRNTTTKSSRYEGRPAP  600
            EERDP+FD MLSQMVGRI AKPGGKLEMGE +VVE  DRPLPKLRN T++SSRYE RPAP
Sbjct  60   EERDPKFDAMLSQMVGRIHAKPGGKLEMGEATVVERSDRPLPKLRNITSQSSRYEERPAP  119

Query  601  PGTLNVAQLRQIIVLYQGKSDEHEGPMDVNQIANKFRIDvsqvqsivqfvsLPPEDTKEQ  780
             GTLNVAQ+++II+L+QG+SD+H+GPMD+N+I+ +FR++ +Q+Q I+QFVSLPPEDT ++
Sbjct  120  TGTLNVAQIKEIILLHQGRSDDHKGPMDINEISERFRVEAAQIQRILQFVSLPPEDTSKK  179

Query  781  K  783
            +
Sbjct  180  R  180



>ref|XP_004229227.1| PREDICTED: uncharacterized protein LOC101250046 [Solanum lycopersicum]
Length=178

 Score =   214 bits (546),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 114/181 (63%), Positives = 145/181 (80%), Gaps = 5/181 (3%)
 Frame = +1

Query  241  MGQAFRRAAGRIGSSGMETSSSQLKKpierppppppeiiSAQNVGTGAESTPKVNPKSVL  420
            MGQAFRRA GRIGSS ++ +   + + I            A NVG  AES+PKV+ K+ +
Sbjct  1    MGQAFRRATGRIGSSTVDAAKKPIDRRIPPVNRT-----PADNVGPVAESSPKVSIKNTV  55

Query  421  EERDPQFDVMLSQMVGRIRAKPGGKLEMGEGSVVENYDRPLPKLRNTTTKSSRYEGRPAP  600
            EE+DP+FD MLSQMVGRI+AKPGGKLEMGE +VVE YDRPLPKLRNTT++SSRYE RPAP
Sbjct  56   EEKDPKFDAMLSQMVGRIQAKPGGKLEMGEATVVERYDRPLPKLRNTTSESSRYEERPAP  115

Query  601  PGTLNVAQLRQIIVLYQGKSDEHEGPMDVNQIANKFRIDvsqvqsivqfvsLPPEDTKEQ  780
             GTLNVAQ+++I++L+QG+SD+H+GPMD+N I  +FRID +QVQ I+QFVSLPPEDT ++
Sbjct  116  TGTLNVAQIKEILLLHQGRSDDHQGPMDINGICERFRIDAAQVQRILQFVSLPPEDTSKK  175

Query  781  K  783
            +
Sbjct  176  R  176



>emb|CDP19541.1| unnamed protein product [Coffea canephora]
Length=184

 Score =   205 bits (521),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 117/182 (64%), Positives = 142/182 (78%), Gaps = 3/182 (2%)
 Frame = +1

Query  241  MGQAFRRAAGRIGSSGMETSSSQLKKpierppppppeiiSAQNVGTGAE-STPKVNPKSV  417
            MGQA RRAAGRIGS+ ++T+ SQLK+ +E  PPP        N G+ +  S PKVN ++V
Sbjct  1    MGQAIRRAAGRIGSTKVDTTPSQLKESVEVRPPPEKF--KVDNAGSASTGSMPKVNSENV  58

Query  418  LEERDPQFDVMLSQMVGRIRAKPGGKLEMGEGSVVENYDRPLPKLRNTTTKSSRYEGRPA  597
            LEERDPQ+D ML  MVGRIR KPGGKLEMGE  V E YDRPLPK+RNTT +S RYE RPA
Sbjct  59   LEERDPQYDSMLGHMVGRIRTKPGGKLEMGEAFVAEKYDRPLPKVRNTTPESGRYEERPA  118

Query  598  PPGTLNVAQLRQIIVLYQGKSDEHEGPMDVNQIANKFRIDvsqvqsivqfvsLPPEDTKE  777
             PGTLNVAQLR I++LYQGK+D+H GPM + QIA +FRIDV+QV+ I+QFVSLPP+D+  
Sbjct  119  LPGTLNVAQLRHIMLLYQGKADDHNGPMSITQIAERFRIDVAQVEKILQFVSLPPDDSSR  178

Query  778  QK  783
            +K
Sbjct  179  KK  180



>ref|XP_011071453.1| PREDICTED: uncharacterized protein LOC105156896 isoform X1 [Sesamum 
indicum]
Length=191

 Score =   204 bits (519),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 121/189 (64%), Positives = 147/189 (78%), Gaps = 10/189 (5%)
 Frame = +1

Query  241  MGQAFRRAAGRIGSSGMETSS-SQLKKpierppppppeiiS-------AQNVGTGAESTP  396
            MGQA RRA GRIGSS ++TS+ SQL KPIER    PP           +++   G+E   
Sbjct  1    MGQALRRATGRIGSSRVDTSTTSQLGKPIERRSSAPPAPAGVPVEKLPSEDAAAGSEGAS  60

Query  397  KVNPKSVLEERDPQFDVMLSQMVGRIRAKPGGKLEMGEGSVVENYDRPLPKLRNTTTKSS  576
             VN  +VLE+RDPQ+D MLSQMVGRIR+KPGGKLEMGE SVVE Y RPLPK+RNTT +S 
Sbjct  61   VVN--AVLEDRDPQYDAMLSQMVGRIRSKPGGKLEMGEASVVEKYKRPLPKVRNTTPESG  118

Query  577  RYEGRPAPPGTLNVAQLRQIIVLYQGKSDEHEGPMDVNQIANKFRIDvsqvqsivqfvsL  756
            RYE RP PPGTLNVAQ+RQII+L+QGKSD+H+GPMDV QIA +FRID +QVQ+I++FV+L
Sbjct  119  RYEQRPVPPGTLNVAQVRQIILLHQGKSDDHDGPMDVPQIAERFRIDAAQVQNILKFVAL  178

Query  757  PPEDTKEQK  783
            PPED  ++K
Sbjct  179  PPEDDSKRK  187



>gb|KJB28639.1| hypothetical protein B456_005G059600 [Gossypium raimondii]
Length=181

 Score =   194 bits (493),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 109/183 (60%), Positives = 134/183 (73%), Gaps = 2/183 (1%)
 Frame = +1

Query  241  MGQAFRRAAGRIGSSGMETSSSQLKKpierppppppeiiSAQNVGTGAESTPKVNPKSVL  420
            MGQAFRRA GR+ S  M+ S     +    P         +Q+      S  + NP++VL
Sbjct  1    MGQAFRRATGRLRS--MDQSQPTKPRRPLGPTDEQKISRVSQHENLDHASVARSNPENVL  58

Query  421  EERDPQFDVMLSQMVGRIRAKPGGKLEMGEGSVVENYDRPLPKLRNTTTKSSRYEGRPAP  600
            EERDP++D MLSQMVGRI AKPGGKLEMGE  V EN  RPLPKLRNTT +S RYE RPAP
Sbjct  59   EERDPKYDAMLSQMVGRISAKPGGKLEMGEAFVAENPSRPLPKLRNTTVESGRYEERPAP  118

Query  601  PGTLNVAQLRQIIVLYQGKSDEHEGPMDVNQIANKFRIDvsqvqsivqfvsLPPEDTKEQ  780
            PGTLNV QLR I++L+QGK+D+HEGPMDVNQIA KF++DV+QVQ+I+QF+S+PPED  + 
Sbjct  119  PGTLNVKQLRHIMLLHQGKADDHEGPMDVNQIAEKFKLDVAQVQTILQFISIPPEDNTKP  178

Query  781  KKF  789
            +K 
Sbjct  179  EKH  181



>gb|EPS64545.1| hypothetical protein M569_10240 [Genlisea aurea]
Length=198

 Score =   193 bits (491),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 110/191 (58%), Positives = 138/191 (72%), Gaps = 9/191 (5%)
 Frame = +1

Query  241  MGQAFRRAAGRIGSSGMETSSSQLKKpierppppppeiiSA---------QNVGTGAEST  393
            MGQAFRRA G+I  S  ET+S  +K    R PPP     +A         Q V +  ++T
Sbjct  1    MGQAFRRATGKIAGSSSETASQLVKPIERRRPPPFHPPPTAAPIDDKVPKQEVISPGDTT  60

Query  394  PKVNPKSVLEERDPQFDVMLSQMVGRIRAKPGGKLEMGEGSVVENYDRPLPKLRNTTTKS  573
            P++NP++VLE RDP +D MLSQ+VGRI+AKPGGKLEMGE +VVE Y RPLPKLRNT   S
Sbjct  61   PRLNPENVLEVRDPDYDTMLSQIVGRIQAKPGGKLEMGEAAVVEKYRRPLPKLRNTRPDS  120

Query  574  SRYEGRPAPPGTLNVAQLRQIIVLYQGKSDEHEGPMDVNQIANKFRIDvsqvqsivqfvs  753
              Y+ RPAPPGTLNV QLRQII+L+QGKSD+H+GPMDV QIA++F +  +QV SI+ FV+
Sbjct  121  DSYDERPAPPGTLNVKQLRQIILLHQGKSDDHDGPMDVPQIASRFNVTAAQVNSIINFVT  180

Query  754  LPPEDTKEQKK  786
            LPPE+ +   K
Sbjct  181  LPPEEDERTSK  191



>gb|KHG15580.1| Dynein beta chain, ciliary [Gossypium arboreum]
Length=182

 Score =   191 bits (484),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 111/184 (60%), Positives = 139/184 (76%), Gaps = 3/184 (2%)
 Frame = +1

Query  241  MGQAFRRAAGRIGSSGMETSSSQLKKpierppppppeiiSAQNVGTGAESTPKVNPKSVL  420
            MGQAFRRA GR+ S   +T  ++ ++P+          +S Q+      S  + NP++VL
Sbjct  1    MGQAFRRATGRLRSVD-QTQPTKPRRPLGPTDEQKISRVS-QHENLDHASVARSNPENVL  58

Query  421  EERDPQFDVMLSQMVGRIRAKPGGKLEMGEGSVVENYDRPLPKLRNTTTKSSRYEGRPAP  600
            EERDP++D MLSQMVGRI AKPGGKLEMGE SV EN  RPLPKLRNTT +S RYE RPAP
Sbjct  59   EERDPKYDAMLSQMVGRISAKPGGKLEMGEASVAENPSRPLPKLRNTTVESGRYEERPAP  118

Query  601  PGTLNVAQLRQIIVLYQGKSDEHEGPMDVNQIANKFRIDvsqvqsivqfvsLPPEDT-KE  777
             GTLNV QLR I++L+QGK+D+HEGPMDVNQIA KFR+DV+QVQ+I+QF+S+PPED  K 
Sbjct  119  LGTLNVKQLRHIMLLHQGKADDHEGPMDVNQIAEKFRLDVAQVQTILQFISIPPEDNIKP  178

Query  778  QKKF  789
            +K +
Sbjct  179  EKHY  182



>gb|EYU45558.1| hypothetical protein MIMGU_mgv1a014463mg [Erythranthe guttata]
Length=189

 Score =   189 bits (479),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 110/184 (60%), Positives = 142/184 (77%), Gaps = 4/184 (2%)
 Frame = +1

Query  241  MGQAFRRAAGRIGSSGMETSSSQLK---KpierppppppeiiSAQNVGTGAE-STPKVNP  408
            MGQAFRRA+GRIGSS  +T S   K   +    PPP P + + A +V   +E ++ +VN 
Sbjct  1    MGQAFRRASGRIGSSRADTKSQLAKPVEQRPPPPPPLPVDKLPADDVTPASEDASSRVNV  60

Query  409  KSVLEERDPQFDVMLSQMVGRIRAKPGGKLEMGEGSVVENYDRPLPKLRNTTTKSSRYEG  588
            ++V EERDPQ+D MLSQMVGRI++K GGKLEMGE SVV+ Y RPLPK+RNTT +S  YE 
Sbjct  61   ENVSEERDPQYDAMLSQMVGRIQSKAGGKLEMGEASVVDKYRRPLPKVRNTTPESGGYEE  120

Query  589  RPAPPGTLNVAQLRQIIVLYQGKSDEHEGPMDVNQIANKFRIDvsqvqsivqfvsLPPED  768
            RPAPPGTLNV+Q+RQ+I+L+QGKSDEH G M V QIA +FR+D +QV++I+QFV+LPPED
Sbjct  121  RPAPPGTLNVSQIRQVILLHQGKSDEHNGAMSVAQIAQRFRLDAAQVENIIQFVTLPPED  180

Query  769  TKEQ  780
              ++
Sbjct  181  ASKK  184



>ref|XP_007035558.1| Uncharacterized protein TCM_021188 [Theobroma cacao]
 gb|EOY06484.1| Uncharacterized protein TCM_021188 [Theobroma cacao]
Length=180

 Score =   188 bits (477),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 106/182 (58%), Positives = 129/182 (71%), Gaps = 2/182 (1%)
 Frame = +1

Query  241  MGQAFRRAAGRIGSSGMETSSSQLKKpierppppppeiiSAQNVGTGAESTPKVNPKSVL  420
            MGQAFRRA GRI S  ++ S     +    P         +Q      E   + NP++VL
Sbjct  1    MGQAFRRATGRIRS--VDQSKPIKPRRPLGPTDEEKISRVSQYDNLDHERASRSNPENVL  58

Query  421  EERDPQFDVMLSQMVGRIRAKPGGKLEMGEGSVVENYDRPLPKLRNTTTKSSRYEGRPAP  600
            EERDP++D MLSQMVGRI AKPGGKLEMGE  V E  +RPLPKLRNTT  S RYE RP P
Sbjct  59   EERDPKYDAMLSQMVGRISAKPGGKLEMGEALVAEKPNRPLPKLRNTTPDSGRYEERPVP  118

Query  601  PGTLNVAQLRQIIVLYQGKSDEHEGPMDVNQIANKFRIDvsqvqsivqfvsLPPEDTKEQ  780
            PGTLNV QLR I++L+QGK+D+H+GPMDV+QIA KF +D + VQ I+QF+SLPPED+ +Q
Sbjct  119  PGTLNVKQLRHIMLLHQGKADDHDGPMDVHQIAEKFSLDAALVQKILQFMSLPPEDSTKQ  178

Query  781  KK  786
            KK
Sbjct  179  KK  180



>ref|XP_012083911.1| PREDICTED: uncharacterized protein LOC105643411 [Jatropha curcas]
 gb|KDP27780.1| hypothetical protein JCGZ_18860 [Jatropha curcas]
Length=190

 Score =   187 bits (475),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 103/189 (54%), Positives = 136/189 (72%), Gaps = 6/189 (3%)
 Frame = +1

Query  241  MGQAFRRAAGRIGSSGMETSSSQLKKpierppppppeiiSAQNV------GTGAESTPKV  402
            MGQAFRRA+GRI ++    +   + +            IS +           ++  PKV
Sbjct  1    MGQAFRRASGRIRAADPSPTPKSVGEQRPPLGTTDKLDISRKTTQYNNQDSIDSDDAPKV  60

Query  403  NPKSVLEERDPQFDVMLSQMVGRIRAKPGGKLEMGEGSVVENYDRPLPKLRNTTTKSSRY  582
            N  +VLEERDPQFD MLSQMVGRIR+KPGGKLE+GE +VVE Y+RP+PKLRNT   S RY
Sbjct  61   NADNVLEERDPQFDAMLSQMVGRIRSKPGGKLEIGEAAVVERYNRPMPKLRNTKPDSDRY  120

Query  583  EGRPAPPGTLNVAQLRQIIVLYQGKSDEHEGPMDVNQIANKFRIDvsqvqsivqfvsLPP  762
            E R  PPGTLNVAQLR +++L+QGK+D+H GP+D++QI+ KF+++V+QVQ I+QFVSLPP
Sbjct  121  EERATPPGTLNVAQLRHLMLLHQGKADDHNGPVDIHQISEKFQLEVAQVQQILQFVSLPP  180

Query  763  EDTKEQKKF  789
            ED+ +QK +
Sbjct  181  EDSNKQKSY  189



>ref|XP_006389226.1| hypothetical protein POPTR_0034s00210g [Populus trichocarpa]
 gb|ABK93428.1| unknown [Populus trichocarpa]
 gb|ERP48140.1| hypothetical protein POPTR_0034s00210g [Populus trichocarpa]
Length=187

 Score =   187 bits (474),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 106/184 (58%), Positives = 130/184 (71%), Gaps = 3/184 (2%)
 Frame = +1

Query  241  MGQAFRRAAGRIGSSGMETSSSQLKKpierppppppeiiSAQNVGT---GAESTPKVNPK  411
            MGQAFRRA+GRI +      S    +          EI S         G++  P++NP 
Sbjct  1    MGQAFRRASGRIRAPPDPPPSRVTDRRPPVTSTEKVEISSTTTTNQNSPGSDGAPRINPD  60

Query  412  SVLEERDPQFDVMLSQMVGRIRAKPGGKLEMGEGSVVENYDRPLPKLRNTTTKSSRYEGR  591
            +VLEERD Q+D MLSQMVGRI++KPGGKLE GE  VVE YDRP+PKLRNT   S RYE R
Sbjct  61   NVLEERDTQYDAMLSQMVGRIKSKPGGKLETGEAPVVERYDRPMPKLRNTKPDSGRYEER  120

Query  592  PAPPGTLNVAQLRQIIVLYQGKSDEHEGPMDVNQIANKFRIDvsqvqsivqfvsLPPEDT  771
               PGTLNVAQLR II++YQGK+D+HEGPM++ QIA KFR++V+QVQ I+QF+SLPPED 
Sbjct  121  AVAPGTLNVAQLRHIILMYQGKADDHEGPMNIQQIAEKFRLEVAQVQRILQFLSLPPEDN  180

Query  772  KEQK  783
             +QK
Sbjct  181  NKQK  184



>ref|XP_010269456.1| PREDICTED: uncharacterized protein LOC104606105 [Nelumbo nucifera]
 ref|XP_010269457.1| PREDICTED: uncharacterized protein LOC104606105 [Nelumbo nucifera]
Length=195

 Score =   187 bits (475),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 113/192 (59%), Positives = 139/192 (72%), Gaps = 11/192 (6%)
 Frame = +1

Query  241  MGQAFRRAAGRIGSSGME---TSSSQLKKpierppppppe-iiSAQNVGTG-------AE  387
            MGQA RR +GR  SS  +    SSS +K    R P    E    A+N G G       ++
Sbjct  1    MGQALRRVSGRARSSIKDPPVASSSHVKNVERRSPVVSFEPTQDAKNRGEGGAGDPIDSD  60

Query  388  STPKVNPKSVLEERDPQFDVMLSQMVGRIRAKPGGKLEMGEGSVVENYDRPLPKLRNTTT  567
            + P++N ++VLEERDP +D MLSQMVGRIR+KPGGKLEMGE  VVE Y+RP+PKLRNT  
Sbjct  61   NIPRINRENVLEERDPGYDAMLSQMVGRIRSKPGGKLEMGEPFVVEKYNRPMPKLRNTKP  120

Query  568  KSSRYEGRPAPPGTLNVAQLRQIIVLYQGKSDEHEGPMDVNQIANKFRIDvsqvqsivqf  747
             S RYE RP P GTLNVAQLRQI++L+QGK+D+HEGPMD +QIA KFR+DV QVQ I+QF
Sbjct  121  DSGRYEERPVPVGTLNVAQLRQILLLHQGKADDHEGPMDAHQIAEKFRVDVVQVQRILQF  180

Query  748  vsLPPEDTKEQK  783
            VS+PPED ++ K
Sbjct  181  VSIPPEDNRKTK  192



>ref|XP_002272645.1| PREDICTED: uncharacterized protein LOC100252927 [Vitis vinifera]
 emb|CBI26065.3| unnamed protein product [Vitis vinifera]
Length=192

 Score =   184 bits (468),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 104/188 (55%), Positives = 139/188 (74%), Gaps = 7/188 (4%)
 Frame = +1

Query  241  MGQAFRRAAGRIGSSGME-TSSSQLK-----KpierppppppeiiSAQNVGTGA-ESTPK  399
            MGQAFRRA+G +  + ++ +SSS LK     +P   P        +  ++G+G+ E  P+
Sbjct  1    MGQAFRRASGSVRRADLDPSSSSHLKNVGDRRPPAVPVDKVGVSKTRDDIGSGSSEGAPR  60

Query  400  VNPKSVLEERDPQFDVMLSQMVGRIRAKPGGKLEMGEGSVVENYDRPLPKLRNTTTKSSR  579
             N ++ LEERDPQ+D MLSQMVGRIR+K GG+LEMGE  V   Y+RP+PKLRNT  +S R
Sbjct  61   FNSENFLEERDPQYDAMLSQMVGRIRSKSGGRLEMGEALVGGRYNRPMPKLRNTKPESGR  120

Query  580  YEGRPAPPGTLNVAQLRQIIVLYQGKSDEHEGPMDVNQIANKFRIDvsqvqsivqfvsLP  759
            YE +PAP GTLN AQLR I++L+QGK+D+H+GPM+V QIA KFRID + V+SI+QF+SLP
Sbjct  121  YEEKPAPSGTLNAAQLRHILLLHQGKADDHDGPMNVKQIAEKFRIDATMVKSILQFLSLP  180

Query  760  PEDTKEQK  783
            PED+ +QK
Sbjct  181  PEDSTKQK  188



>ref|XP_011657169.1| PREDICTED: uncharacterized protein LOC101223121 [Cucumis sativus]
 gb|KGN47188.1| hypothetical protein Csa_6G196710 [Cucumis sativus]
Length=189

 Score =   184 bits (467),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 104/185 (56%), Positives = 136/185 (74%), Gaps = 4/185 (2%)
 Frame = +1

Query  241  MGQAFRRAAGRI--GSSGMETSSSQLKKpierpppp--ppeiiSAQNVGTGAESTPKVNP  408
            MGQAFRRAAGRI   SS   T++S LK        P       + ++    +   P  + 
Sbjct  1    MGQAFRRAAGRIKPASSIDSTTASSLKMESIVDRKPPPRVAEKARESGALDSGDVPASDS  60

Query  409  KSVLEERDPQFDVMLSQMVGRIRAKPGGKLEMGEGSVVENYDRPLPKLRNTTTKSSRYEG  588
             ++LEERDPQFD MLSQMVGRI++KPGGKLEMGE SVVE Y RP+PKLR+T   SS+YE 
Sbjct  61   GNMLEERDPQFDAMLSQMVGRIKSKPGGKLEMGEASVVERYGRPMPKLRDTNISSSKYED  120

Query  589  RPAPPGTLNVAQLRQIIVLYQGKSDEHEGPMDVNQIANKFRIDvsqvqsivqfvsLPPED  768
            RPAPPGTLNVAQ+RQII+L++GK+D+H+GPM ++QIA ++ + V+Q+Q+I+QF+SLPPED
Sbjct  121  RPAPPGTLNVAQMRQIILLHEGKADDHDGPMGLHQIAERYNVSVAQIQTILQFLSLPPED  180

Query  769  TKEQK  783
            +   K
Sbjct  181  SLRDK  185



>ref|XP_002516903.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF45517.1| conserved hypothetical protein [Ricinus communis]
Length=190

 Score =   184 bits (466),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 105/190 (55%), Positives = 138/190 (73%), Gaps = 8/190 (4%)
 Frame = +1

Query  241  MGQAFRRAAGRIGSSGM----ETSSSQ---LKKpierppppppeiiSAQNVGTGAESTPK  399
            MGQAFRRA+GRIG++      +T S +   L+              + Q+    ++   +
Sbjct  1    MGQAFRRASGRIGTTNPSPTPKTVSDRRPPLRTNDNVEISRTAGQYNNQD-NLDSDGGSR  59

Query  400  VNPKSVLEERDPQFDVMLSQMVGRIRAKPGGKLEMGEGSVVENYDRPLPKLRNTTTKSSR  579
            VN  +VLEERDPQFD MLSQMVGRI+ KPGGK EM E +VVE Y+RP+PKLRNTT  S+R
Sbjct  60   VNVDNVLEERDPQFDAMLSQMVGRIKTKPGGKDEMAEAAVVERYNRPMPKLRNTTLDSAR  119

Query  580  YEGRPAPPGTLNVAQLRQIIVLYQGKSDEHEGPMDVNQIANKFRIDvsqvqsivqfvsLP  759
            YE RPAPPGTLNVAQLRQI++L+QGK+D    P+D++QIA KFR++V+QVQ I++FVSLP
Sbjct  120  YEERPAPPGTLNVAQLRQIMLLHQGKADGQNAPIDIHQIAEKFRLEVAQVQQILEFVSLP  179

Query  760  PEDTKEQKKF  789
            PE++ +QK +
Sbjct  180  PEESNKQKDY  189



>ref|XP_011014599.1| PREDICTED: uncharacterized protein LOC105118367 [Populus euphratica]
Length=187

 Score =   183 bits (465),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 104/184 (57%), Positives = 132/184 (72%), Gaps = 3/184 (2%)
 Frame = +1

Query  241  MGQAFRRAAGRIGS--SGMETSSSQLKKpierppppppeiiSAQNVGT-GAESTPKVNPK  411
            MGQAFRRA+GRI +      T  +  + P+           +  N  + G+E  P++NP 
Sbjct  1    MGQAFRRASGRIRAPPDPPPTKITDRRPPVTSTEKVEISSTTTTNQNSLGSEGAPRINPD  60

Query  412  SVLEERDPQFDVMLSQMVGRIRAKPGGKLEMGEGSVVENYDRPLPKLRNTTTKSSRYEGR  591
            +VLEERD Q+D MLSQMVGRI++KPGGKLE GE  VVE Y+RP+PKLRNT   S RYE  
Sbjct  61   NVLEERDTQYDAMLSQMVGRIKSKPGGKLETGEAPVVERYNRPMPKLRNTKPDSRRYEES  120

Query  592  PAPPGTLNVAQLRQIIVLYQGKSDEHEGPMDVNQIANKFRIDvsqvqsivqfvsLPPEDT  771
               PGTLNVAQLR II++YQGK+D+HEGPM++ QIA KFR++V+QVQ I+QF+SLPPED 
Sbjct  121  AVAPGTLNVAQLRHIILMYQGKADDHEGPMNIQQIAEKFRLEVAQVQRILQFLSLPPEDN  180

Query  772  KEQK  783
             +QK
Sbjct  181  NKQK  184



>ref|XP_010098298.1| hypothetical protein L484_023546 [Morus notabilis]
 gb|EXB74802.1| hypothetical protein L484_023546 [Morus notabilis]
Length=194

 Score =   183 bits (464),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 112/201 (56%), Positives = 134/201 (67%), Gaps = 30/201 (15%)
 Frame = +1

Query  241  MGQAFRRAAGRI---GSSGMETSSSQLKKpierppppppeiiSAQNVG-TGAESTPKV--  402
            MGQAFRRA+GRI    S+ +  SSS  K   +R             VG TG E T K   
Sbjct  1    MGQAFRRASGRIRASSSADLTPSSSAAKNAADR----------CPPVGPTGGEETSKAGE  50

Query  403  --------------NPKSVLEERDPQFDVMLSQMVGRIRAKPGGKLEMGEGSVVENYDRP  540
                          NP +VLEERDPQFD MLSQM GRIR KPGGK EMGE  VVENY R 
Sbjct  51   LSGRALDSDGAVGKNPDNVLEERDPQFDAMLSQMAGRIRTKPGGKPEMGEAFVVENYKRS  110

Query  541  LPKLRNTTTKSSRYEGRPAPPGTLNVAQLRQIIVLYQGKSDEHEGPMDVNQIANKFRIDv  720
            LPKLRNT   SSR+E RP P GTLNV QLR +++L++GK+D+H+GPMDV+QIA K+RIDV
Sbjct  111  LPKLRNTKPDSSRFEERPTPAGTLNVTQLRHVVLLHEGKADDHDGPMDVHQIAEKYRIDV  170

Query  721  sqvqsivqfvsLPPEDTKEQK  783
            ++VQ I+QF+SLPPED K+ +
Sbjct  171  AEVQRILQFISLPPEDKKKDE  191



>ref|XP_010548932.1| PREDICTED: uncharacterized protein LOC104820251 [Tarenaya hassleriana]
Length=189

 Score =   182 bits (463),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 109/186 (59%), Positives = 131/186 (70%), Gaps = 4/186 (2%)
 Frame = +1

Query  241  MGQAFRRAAGRIGSSGMETSSSQL----KKpierppppppeiiSAQNVGTGAESTPKVNP  408
            MGQ  RRAAG+I       SS+      ++P         +   A      ++   ++NP
Sbjct  1    MGQQLRRAAGKIKEVERSPSSTSRVAVDRRPPPPEDLAAGKSAVAAASDDASDEARRLNP  60

Query  409  KSVLEERDPQFDVMLSQMVGRIRAKPGGKLEMGEGSVVENYDRPLPKLRNTTTKSSRYEG  588
             +VLEERDPQFD MLSQMVGRIRAKPGGK EMGE SV+E   RPLPKLRNT   S RYE 
Sbjct  61   DNVLEERDPQFDAMLSQMVGRIRAKPGGKAEMGEASVMERSKRPLPKLRNTIPGSGRYEE  120

Query  589  RPAPPGTLNVAQLRQIIVLYQGKSDEHEGPMDVNQIANKFRIDvsqvqsivqfvsLPPED  768
            RPAPPGTLNVAQ+R I++LYQGK+D+H GPM V +IA +++ID SQVQ IVQF+SLPPED
Sbjct  121  RPAPPGTLNVAQVRHIMLLYQGKADDHTGPMGVKEIAARYKIDESQVQKIVQFLSLPPED  180

Query  769  TKEQKK  786
            TK+QKK
Sbjct  181  TKQQKK  186



>ref|XP_008458465.1| PREDICTED: uncharacterized protein LOC103497865 isoform X1 [Cucumis 
melo]
Length=190

 Score =   179 bits (455),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 109/185 (59%), Positives = 139/185 (75%), Gaps = 4/185 (2%)
 Frame = +1

Query  241  MGQAFRRAAGRI--GSSGMETSSSQLK-KpierppppppeiiSAQNVGT-GAESTPKVNP  408
            MGQAFRRAAGRI   SS   T++S LK + I    PPP     A+  G+  +      + 
Sbjct  1    MGQAFRRAAGRIKPASSVDSTTASSLKMESIVDRKPPPRVAEKARESGSLDSGDVTASDS  60

Query  409  KSVLEERDPQFDVMLSQMVGRIRAKPGGKLEMGEGSVVENYDRPLPKLRNTTTKSSRYEG  588
             + LEERDPQFD MLSQMVGRI++KPGGKLEMGE SVVE Y RP+PKLR+T  KSS+YE 
Sbjct  61   GNRLEERDPQFDAMLSQMVGRIKSKPGGKLEMGEASVVERYGRPMPKLRDTNIKSSKYED  120

Query  589  RPAPPGTLNVAQLRQIIVLYQGKSDEHEGPMDVNQIANKFRIDvsqvqsivqfvsLPPED  768
            RPAPPGTLNVAQ+RQII+L++GK+D+H+GPM  +QIA ++ + V+Q+Q+I+QF+SLPPED
Sbjct  121  RPAPPGTLNVAQMRQIILLHEGKADDHDGPMGPHQIAERYNVSVAQIQTILQFLSLPPED  180

Query  769  TKEQK  783
            +   K
Sbjct  181  SLRDK  185



>ref|XP_007226741.1| hypothetical protein PRUPE_ppa019086mg [Prunus persica]
 gb|EMJ27940.1| hypothetical protein PRUPE_ppa019086mg [Prunus persica]
Length=199

 Score =   180 bits (456),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 107/196 (55%), Positives = 138/196 (70%), Gaps = 15/196 (8%)
 Frame = +1

Query  241  MGQAFRRAAGRI-GSSGMETSSSQLKKpierppppppeiiSAQNVGTGAES---------  390
            MGQA RRAAGRI  SS +ET+S++ K  +    PPP     +  +    ++         
Sbjct  1    MGQALRRAAGRIRPSSSIETTSAKPKTVVVDKRPPPLGPTESAEISKAGDALNSDGSAAT  60

Query  391  -----TPKVNPKSVLEERDPQFDVMLSQMVGRIRAKPGGKLEMGEGSVVENYDRPLPKLR  555
                     N ++VLEERDP +D ML+QMVGRI++KPGGKLEMGE  VVE Y RPLPKLR
Sbjct  61   AAEAEAGAANVENVLEERDPSYDAMLNQMVGRIKSKPGGKLEMGEAFVVEKYKRPLPKLR  120

Query  556  NTTTKSSRYEGRPAPPGTLNVAQLRQIIVLYQGKSDEHEGPMDVNQIANKFRIDvsqvqs  735
            +T   S RYE RPA PGTLNVAQLR II+L+QGK+++H GPM+ +QIA+KFR+DV++V+ 
Sbjct  121  DTKPDSGRYEERPAAPGTLNVAQLRHIILLHQGKAEDHNGPMEADQIADKFRVDVAEVRR  180

Query  736  ivqfvsLPPEDTKEQK  783
            I+QFVSLPPED+ +QK
Sbjct  181  ILQFVSLPPEDSSKQK  196



>ref|XP_008223178.1| PREDICTED: uncharacterized protein LOC103323000 [Prunus mume]
Length=196

 Score =   178 bits (452),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 107/193 (55%), Positives = 135/193 (70%), Gaps = 12/193 (6%)
 Frame = +1

Query  241  MGQAFRRAAGRI-GSSGMETSSSQLKKpierppppppeiiSAQNV-----------GTGA  384
            MGQA RRAAGRI  SS +ET+S++ K  +    PPP        +               
Sbjct  1    MGQALRRAAGRIRPSSSIETTSAKPKTVVVDKRPPPLGPTETAEIVPSLFTHGSAATEAE  60

Query  385  ESTPKVNPKSVLEERDPQFDVMLSQMVGRIRAKPGGKLEMGEGSVVENYDRPLPKLRNTT  564
                  N ++VLEERDP +D ML+QMVGRI++KPGGKLEMGE  VVE Y RPLPKLR+T 
Sbjct  61   AGAGAANVENVLEERDPSYDAMLNQMVGRIKSKPGGKLEMGEAFVVEKYKRPLPKLRDTK  120

Query  565  TKSSRYEGRPAPPGTLNVAQLRQIIVLYQGKSDEHEGPMDVNQIANKFRIDvsqvqsivq  744
              S RYE RPA PGTLNVAQLR II+L+QGK+++H GPM+ +QIA+KFR+DV++V+ I+Q
Sbjct  121  PDSGRYEERPAAPGTLNVAQLRHIILLHQGKAEDHNGPMEADQIADKFRVDVAEVRRILQ  180

Query  745  fvsLPPEDTKEQK  783
            FVSLPPED+ +QK
Sbjct  181  FVSLPPEDSSKQK  193



>gb|KEH37275.1| hypothetical protein MTR_2g436940 [Medicago truncatula]
Length=198

 Score =   176 bits (447),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 106/194 (55%), Positives = 129/194 (66%), Gaps = 14/194 (7%)
 Frame = +1

Query  241  MGQAFRRAAGRIGSSGMETSSSQLKKpierppppppeiiSAQNVGTGAEST---------  393
            MGQAFRRA+GRI ++  ET +S L KP       PP    A +    +  T         
Sbjct  1    MGQAFRRASGRIRAAS-ETDTSSLSKPKIAVDHRPPPPKVATDKAADSSKTVKGVEDSLN  59

Query  394  ----PKVNPKSVLEERDPQFDVMLSQMVGRIRAKPGGKLEMGEGSVVENYDRPLPKLRNT  561
                P  N  +VLEE+DP+FD ML QM+GRI +KPGGK EMGE SVVE Y+RP+PKLRNT
Sbjct  60   DDDRPSANLDNVLEEKDPKFDAMLGQMLGRITSKPGGKREMGEASVVEKYNRPMPKLRNT  119

Query  562  TTKSSRYEGRPAPPGTLNVAQLRQIIVLYQGKSDEHEGPMDVNQIANKFRIDvsqvqsiv  741
               S  YE RP P GTLNVAQLR II+L++GK+D+H GPMDV+QIA KFR+DV Q+Q I+
Sbjct  120  KPNSGHYEERPVPAGTLNVAQLRHIILLHEGKADDHNGPMDVHQIAEKFRVDVGQIQKIL  179

Query  742  qfvsLPPEDTKEQK  783
            QF+S PPE   E K
Sbjct  180  QFLSHPPEGRSEDK  193



>ref|XP_004487885.1| PREDICTED: uncharacterized protein LOC101502595 [Cicer arietinum]
Length=195

 Score =   173 bits (438),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 99/191 (52%), Positives = 126/191 (66%), Gaps = 11/191 (6%)
 Frame = +1

Query  241  MGQAFRRAAGRIGSSGMETSSSQLKK----------pierppppppeiiSAQNVGTGAES  390
            MGQAFRRA+GRI ++  ET +S L K                       +A       + 
Sbjct  1    MGQAFRRASGRIRAAS-ETDTSSLSKPKIAVDYRPPSKVATEKAAESSKAATRDSLNDDD  59

Query  391  TPKVNPKSVLEERDPQFDVMLSQMVGRIRAKPGGKLEMGEGSVVENYDRPLPKLRNTTTK  570
             P+ N  ++LEERDP+FD ML QM+GRI +KPGGK EMGE S+VE  +R +PKLRNT   
Sbjct  60   RPRANLDNILEERDPKFDAMLGQMLGRITSKPGGKPEMGEASLVEKSNRSMPKLRNTKPN  119

Query  571  SSRYEGRPAPPGTLNVAQLRQIIVLYQGKSDEHEGPMDVNQIANKFRIDvsqvqsivqfv  750
            S RYE RP P GTLNVAQLRQII+L++GK+ +H GPMDVNQIA KFR++V ++Q I+QF+
Sbjct  120  SGRYEERPVPAGTLNVAQLRQIILLHEGKAADHNGPMDVNQIAEKFRVNVVEIQKILQFL  179

Query  751  sLPPEDTKEQK  783
            S PPE + E K
Sbjct  180  SHPPEGSNEDK  190



>ref|XP_006406274.1| hypothetical protein EUTSA_v10021583mg [Eutrema salsugineum]
 gb|ESQ47727.1| hypothetical protein EUTSA_v10021583mg [Eutrema salsugineum]
Length=189

 Score =   172 bits (435),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 106/188 (56%), Positives = 129/188 (69%), Gaps = 8/188 (4%)
 Frame = +1

Query  241  MGQAFRRAAGRIGSSGMETSSSQLKKpierppppppeiiSAQNVGTGA------ESTPKV  402
            MGQ  RRA GRI    +E S S   K        P E +SA    + A      +   + 
Sbjct  1    MGQQLRRAVGRIKE--VERSPSSTSKVAVDRRSIPTEELSAGKSPSAAAVNGVPDEARRT  58

Query  403  NPKSVLEERDPQFDVMLSQMVGRIRAKPGGKLEMGEGSVVENYDRPLPKLRNTTTKSSRY  582
            +  +VLEERDP++D ML+QMVGRIRAKPGGK EMGE SVVE   RPLPKLRNTT +S+RY
Sbjct  59   SDDNVLEERDPKYDTMLNQMVGRIRAKPGGKAEMGEASVVETSKRPLPKLRNTTPESTRY  118

Query  583  EGRPAPPGTLNVAQLRQIIVLYQGKSDEHEGPMDVNQIANKFRIDvsqvqsivqfvsLPP  762
            E +P P GTLNVAQ+R I++LYQGK+ +H GPM V+ IA  +RIDVSQVQ I+QF+SLPP
Sbjct  119  EEKPVPQGTLNVAQVRHIMLLYQGKAQDHNGPMSVDDIAKNYRIDVSQVQKIIQFLSLPP  178

Query  763  EDTKEQKK  786
            E T +QKK
Sbjct  179  EVTDKQKK  186



>ref|XP_009339822.1| PREDICTED: uncharacterized protein LOC103932017 [Pyrus x bretschneideri]
Length=195

 Score =   171 bits (432),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 106/189 (56%), Positives = 132/189 (70%), Gaps = 16/189 (8%)
 Frame = +1

Query  241  MGQAFRRAAGRIG-SSGMETSSSQLKKpierppppppeiiSAQ------------NVGTG  381
            MGQA RRAAGR   SS +ET+SS+ K  +    PP      A+            + GTG
Sbjct  1    MGQALRRAAGRTRPSSTVETASSKPKTVVVDKRPPLVPPERAEISKAGGAIDSDGSAGTG  60

Query  382  AESTPKVNPKSVLEERDPQFDVMLSQMVGRIRAKPGGKLEMGEGSVVENYDRPLPKLRNT  561
              +    N   VLEERDP +D ML+QMVGRI+AKPGGKLEMGE +VV+ Y RPLPKLR+T
Sbjct  61   GAAEAVDN---VLEERDPNYDAMLNQMVGRIKAKPGGKLEMGEANVVDKYKRPLPKLRDT  117

Query  562  TTKSSRYEGRPAPPGTLNVAQLRQIIVLYQGKSDEHEGPMDVNQIANKFRIDvsqvqsiv  741
               S  YE RPAPPGTLNVAQLR II+L+QGK+++H G M+ +QIA KFR+DV++V+ I+
Sbjct  118  KPDSGSYEERPAPPGTLNVAQLRHIILLHQGKAEDHNGRMEPDQIAEKFRVDVAEVRRIL  177

Query  742  qfvsLPPED  768
            QFV+LPPED
Sbjct  178  QFVALPPED  186



>ref|XP_004296824.1| PREDICTED: uncharacterized protein LOC101303989 [Fragaria vesca 
subsp. vesca]
Length=183

 Score =   169 bits (429),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 108/186 (58%), Positives = 134/186 (72%), Gaps = 9/186 (5%)
 Frame = +1

Query  241  MGQAFRRAAG--RIGSSGMET--SSSQLKKpierppppppeiiSAQNVGTGAESTPKVNP  408
            MGQA RRAAG  R GS+ +ET  SSS + K +    PP         + T  +S    N 
Sbjct  1    MGQALRRAAGKARPGST-IETPSSSSSIPKTVVNHRPPVTPPEPVPEI-TKPDSDGSEN-  57

Query  409  KSVLEERDPQFDVMLSQMVGRIRAKPGGKLEMGEGSVVENYDRPLPKLRNTTTKSSRYEG  588
              +LEERDP+FD ML+QMVGRI++KPGGK EMGE  VVE Y RPLPKLR+T   S R+E 
Sbjct  58   --LLEERDPKFDSMLNQMVGRIKSKPGGKPEMGEAHVVEKYKRPLPKLRDTKPDSGRFEE  115

Query  589  RPAPPGTLNVAQLRQIIVLYQGKSDEHEGPMDVNQIANKFRIDvsqvqsivqfvsLPPED  768
            R APPGTLNV+QLR II+L+QGK+++H GPM+V +IA KFR+DV++V+ IVQFVSLPPED
Sbjct  116  RAAPPGTLNVSQLRHIILLHQGKAEDHNGPMEVQRIAEKFRVDVAEVRRIVQFVSLPPED  175

Query  769  TKEQKK  786
              +QKK
Sbjct  176  NSKQKK  181



>ref|XP_006419609.1| hypothetical protein CICLE_v10005978mg [Citrus clementina]
 ref|XP_006419610.1| hypothetical protein CICLE_v10005978mg [Citrus clementina]
 ref|XP_006489107.1| PREDICTED: uncharacterized protein LOC102624174 [Citrus sinensis]
 gb|ESR32849.1| hypothetical protein CICLE_v10005978mg [Citrus clementina]
 gb|ESR32850.1| hypothetical protein CICLE_v10005978mg [Citrus clementina]
 gb|KDO75177.1| hypothetical protein CISIN_1g029662mg [Citrus sinensis]
Length=190

 Score =   169 bits (428),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 103/189 (54%), Positives = 131/189 (69%), Gaps = 6/189 (3%)
 Frame = +1

Query  241  MGQAFRRAAGRIGSSGMETSSSQLKKpierp------pppppeiiSAQNVGTGAESTPKV  402
            MGQAFRRA+GRI SS   TSSS   K +                    + G   E    V
Sbjct  1    MGQAFRRASGRITSSSSTTSSSSKTKNVVDRGPRVVPTDEKISRTGPLDGGDHREGNRPV  60

Query  403  NPKSVLEERDPQFDVMLSQMVGRIRAKPGGKLEMGEGSVVENYDRPLPKLRNTTTKSSRY  582
            N  +VLEERDPQ+D ML+QM+GR++ K GGK EMGE +VVE   RPLPKLRNTT  SSRY
Sbjct  61   NTGNVLEERDPQYDAMLNQMLGRVKTKAGGKAEMGEAAVVERQTRPLPKLRNTTPVSSRY  120

Query  583  EGRPAPPGTLNVAQLRQIIVLYQGKSDEHEGPMDVNQIANKFRIDvsqvqsivqfvsLPP  762
            E +P+PPGTLNVAQLR+I++L+QGK+D+H GP+D  QIA KFR+DV QVQ+I+Q +SLPP
Sbjct  121  EEKPSPPGTLNVAQLRRIMLLHQGKADDHNGPLDAKQIAEKFRLDVLQVQAILQCLSLPP  180

Query  763  EDTKEQKKF  789
            E + +++ +
Sbjct  181  ESSNKERNY  189



>ref|XP_002885437.1| hypothetical protein ARALYDRAFT_898585 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH61696.1| hypothetical protein ARALYDRAFT_898585 [Arabidopsis lyrata subsp. 
lyrata]
Length=189

 Score =   169 bits (428),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 108/192 (56%), Positives = 129/192 (67%), Gaps = 16/192 (8%)
 Frame = +1

Query  241  MGQAFRRAAGRIGSSGMETSSSQLKKpierppppppeiiSAQNVGTGAESTPKVNPKS--  414
            MGQ  RRA G+I     E   S   + +      P E +SA N  + + ST  V+  S  
Sbjct  1    MGQQLRRAVGKIK----EVERSSPSRVVVDRRSLPTEELSAAN--SSSPSTAAVDGVSDK  54

Query  415  --------VLEERDPQFDVMLSQMVGRIRAKPGGKLEMGEGSVVENYDRPLPKLRNTTTK  570
                    VLEERDP++D ML+QMVGRIRAKPGGK EMGE SVVE   RPLPKLRNTT +
Sbjct  55   GRRTSEDNVLEERDPKYDTMLNQMVGRIRAKPGGKAEMGEASVVETSKRPLPKLRNTTPE  114

Query  571  SSRYEGRPAPPGTLNVAQLRQIIVLYQGKSDEHEGPMDVNQIANKFRIDvsqvqsivqfv  750
            S+RYE  P P GTLNVAQ+R I++L+QGK+ +H GPM VNQIA K+RIDVSQVQ I QF+
Sbjct  115  STRYEENPVPQGTLNVAQVRHIMLLFQGKAQDHHGPMSVNQIAEKYRIDVSQVQKITQFL  174

Query  751  sLPPEDTKEQKK  786
            SLP E T +QKK
Sbjct  175  SLPTEVTDKQKK  186



>ref|XP_010024682.1| PREDICTED: uncharacterized protein LOC104415123 [Eucalyptus grandis]
 gb|KCW61124.1| hypothetical protein EUGRSUZ_H03897 [Eucalyptus grandis]
Length=184

 Score =   169 bits (427),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 102/178 (57%), Positives = 123/178 (69%), Gaps = 4/178 (2%)
 Frame = +1

Query  241  MGQAFRRAAGRIGSS-GMETSSSQLKKpierppppppeiiSAQNVGTGAESTPKVNPKSV  417
            MGQAFRRAAGRI +  G + +     K      PP     S       A         +V
Sbjct  1    MGQAFRRAAGRIKAPPGSDVAPPPQPKRAADARPPAASADSPVAASDAAAKANA---DNV  57

Query  418  LEERDPQFDVMLSQMVGRIRAKPGGKLEMGEGSVVENYDRPLPKLRNTTTKSSRYEGRPA  597
            LEERDPQ+D ML QMVGRI++KPGGK EMGE  VVE Y+RP+PKLRNT   S RYE RP 
Sbjct  58   LEERDPQYDTMLGQMVGRIQSKPGGKPEMGEAFVVEKYNRPMPKLRNTKPDSGRYEERPV  117

Query  598  PPGTLNVAQLRQIIVLYQGKSDEHEGPMDVNQIANKFRIDvsqvqsivqfvsLPPEDT  771
            P GTLN+AQ+RQII+L+QGK+D H+GPMD+ QIA  FR+DV++VQ I+QFVSLPPED+
Sbjct  118  PEGTLNIAQVRQIILLHQGKADNHDGPMDIQQIAENFRVDVARVQKILQFVSLPPEDS  175



>ref|NP_001237555.1| uncharacterized protein LOC100527797 [Glycine max]
 gb|ACU16973.1| unknown [Glycine max]
 gb|KHN20803.1| hypothetical protein glysoja_037403 [Glycine soja]
Length=195

 Score =   168 bits (425),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 104/190 (55%), Positives = 135/190 (71%), Gaps = 9/190 (5%)
 Frame = +1

Query  241  MGQAFRRAAGRI-GSSGMETSS-SQLKKpierppppppeiiSAQNVGTGAEST-------  393
            MGQAFRRA+GRI  +S  +TSS S+ K  ++R PPP      A  +   AE         
Sbjct  1    MGQAFRRASGRIRAASEADTSSFSKSKTAVDRQPPPNAAADKAAQIPKAAEQDVLHTDDR  60

Query  394  PKVNPKSVLEERDPQFDVMLSQMVGRIRAKPGGKLEMGEGSVVENYDRPLPKLRNTTTKS  573
            P+VN  ++LEERDP+FD ML QMVGRI +KPGGK EMGE  VVE ++RP+PKLRNT    
Sbjct  61   PRVNTDNILEERDPKFDAMLGQMVGRITSKPGGKPEMGEAFVVEKFNRPMPKLRNTKPDF  120

Query  574  SRYEGRPAPPGTLNVAQLRQIIVLYQGKSDEHEGPMDVNQIANKFRIDvsqvqsivqfvs  753
             R E RP P GTLNVAQLR II+L++GK+D++ G MD +QIA KFR++V Q+Q+I+QF+S
Sbjct  121  GRNEERPVPAGTLNVAQLRHIILLHEGKADDYNGRMDAHQIAEKFRVNVVQIQTILQFLS  180

Query  754  LPPEDTKEQK  783
            LPPE++ + K
Sbjct  181  LPPENSSKDK  190



>ref|XP_009145481.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103869177 
[Brassica rapa]
Length=177

 Score =   166 bits (419),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 101/188 (54%), Positives = 124/188 (66%), Gaps = 20/188 (11%)
 Frame = +1

Query  241  MGQAFRRAAGRIGSSGMETSSSQLKKpierppppppeiiSAQNVGTGAESTPKVNPKSVL  420
            MGQ  RRA GR+    +E   S+L +             S       A  +P +N  S  
Sbjct  1    MGQQLRRAVGRVKE--VEKFPSRLDRR------------SLPKEELSAGKSPSINDVSAR  46

Query  421  ------EERDPQFDVMLSQMVGRIRAKPGGKLEMGEGSVVENYDRPLPKLRNTTTKSSRY  582
                   ERDPQ+D ML+QMVGRI+AKPGGK EMGE SVVE   RPLPKLRNTT +S+RY
Sbjct  47   GSSSDDSERDPQYDTMLNQMVGRIKAKPGGKAEMGEASVVETSKRPLPKLRNTTPESTRY  106

Query  583  EGRPAPPGTLNVAQLRQIIVLYQGKSDEHEGPMDVNQIANKFRIDvsqvqsivqfvsLPP  762
            E +P P GTLNVAQ+R I++LYQGK+ +H+GPM +N+IA  +RIDVSQVQ I QF+SLPP
Sbjct  107  EAKPVPQGTLNVAQVRHIMLLYQGKAQDHKGPMTLNEIAKNYRIDVSQVQKITQFLSLPP  166

Query  763  EDTKEQKK  786
            E T +QKK
Sbjct  167  EATDKQKK  174



>ref|NP_188777.1| uncharacterized protein [Arabidopsis thaliana]
 dbj|BAB03053.1| unnamed protein product [Arabidopsis thaliana]
 dbj|BAC43612.1| unknown protein [Arabidopsis thaliana]
 gb|AAO64053.1| unknown protein [Arabidopsis thaliana]
 gb|AEE76505.1| uncharacterized protein AT3G21400 [Arabidopsis thaliana]
Length=188

 Score =   166 bits (419),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 100/185 (54%), Positives = 122/185 (66%), Gaps = 3/185 (2%)
 Frame = +1

Query  241  MGQAFRRAAGRIGS---SGMETSSSQLKKpierppppppeiiSAQNVGTGAESTPKVNPK  411
            MGQ  RRA G+I     S     S   +              S   V   ++   + +  
Sbjct  1    MGQQLRRAVGKIKEVERSSPSRVSIDRRSLPTEELSAVKSSPSTAAVDGVSDKGRRTSED  60

Query  412  SVLEERDPQFDVMLSQMVGRIRAKPGGKLEMGEGSVVENYDRPLPKLRNTTTKSSRYEGR  591
            +VLEERDP++D ML+QMVGRI+AKPGGK EMGE SVVE   RPLPKLRNTT +S+RYE  
Sbjct  61   NVLEERDPKYDTMLNQMVGRIKAKPGGKAEMGEASVVETSKRPLPKLRNTTPESTRYEEN  120

Query  592  PAPPGTLNVAQLRQIIVLYQGKSDEHEGPMDVNQIANKFRIDvsqvqsivqfvsLPPEDT  771
            P P GTLNVAQ+R I++L+QGKS +H GPM VN+IA K+RIDVSQVQ I QF+SLP E T
Sbjct  121  PVPQGTLNVAQVRHIMLLFQGKSQDHHGPMGVNEIAEKYRIDVSQVQKITQFLSLPQEIT  180

Query  772  KEQKK  786
             +QKK
Sbjct  181  DKQKK  185



>emb|CDY32427.1| BnaC03g42110D [Brassica napus]
Length=191

 Score =   165 bits (418),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 101/189 (53%), Positives = 133/189 (70%), Gaps = 8/189 (4%)
 Frame = +1

Query  241  MGQAFRRAAGRIGSSGMETSSSQLKKpierppppppeiiSAQNVGTGA-------ESTPK  399
            MGQ  RRA G++       SS+  +  ++R   P  E+ +A++  T A       E+   
Sbjct  1    MGQQLRRAVGKVKEVERFPSSTS-RVVVDRRSFPKEELTAAKSPSTAAVDGVSDEEAQRT  59

Query  400  VNPKSVLEERDPQFDVMLSQMVGRIRAKPGGKLEMGEGSVVENYDRPLPKLRNTTTKSSR  579
             +  +VLEERDP++D ML+QMVGRI+AKPGGK EMGE SVVE+  RPLPKLRNTT +S+R
Sbjct  60   TSDDNVLEERDPKYDTMLNQMVGRIKAKPGGKAEMGEASVVESSKRPLPKLRNTTPESTR  119

Query  580  YEGRPAPPGTLNVAQLRQIIVLYQGKSDEHEGPMDVNQIANKFRIDvsqvqsivqfvsLP  759
            YE +P P GTLNVAQ+R I++LYQGK+ +H GPM V++IA  +RIDVSQV+ I QF+SLP
Sbjct  120  YEEKPVPQGTLNVAQVRHIMLLYQGKAQDHSGPMSVDEIAKNYRIDVSQVKKITQFLSLP  179

Query  760  PEDTKEQKK  786
            PE   +QKK
Sbjct  180  PEVNDKQKK  188



>ref|XP_010510183.1| PREDICTED: uncharacterized protein LOC104786456 isoform X2 [Camelina 
sativa]
Length=191

 Score =   165 bits (417),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 102/191 (53%), Positives = 125/191 (65%), Gaps = 12/191 (6%)
 Frame = +1

Query  241  MGQAFRRAAGRIGSSGMETSSS---------QLKKpierppppppeiiSAQNVGTGAEST  393
            MGQ  RRA G+I      T SS          L         P P   + + V +G  ++
Sbjct  1    MGQQLRRAVGKIKEVERSTPSSTSRVVVDRRSLPTEELTAVKPSPSTAAVEGVSSGRRTS  60

Query  394  PKVNPKSVLEERDPQFDVMLSQMVGRIRAKPGGKLEMGEGSVVENYDRPLPKLRNTTTKS  573
             + N   VLEERDP++D ML+QMVGRI+AKPGGK EMGE SVVE   RPLPKLRNTT +S
Sbjct  61   EEDN---VLEERDPKYDTMLNQMVGRIKAKPGGKAEMGEASVVETSKRPLPKLRNTTPES  117

Query  574  SRYEGRPAPPGTLNVAQLRQIIVLYQGKSDEHEGPMDVNQIANKFRIDvsqvqsivqfvs  753
            +RYE  P P GTLN+AQ+R I++LYQGK+ +H G M V +IA K+RIDVSQVQ I QF+S
Sbjct  118  TRYEENPVPQGTLNIAQVRHIMLLYQGKAQDHNGSMSVKEIAEKYRIDVSQVQKITQFLS  177

Query  754  LPPEDTKEQKK  786
            LP E T +QKK
Sbjct  178  LPTEVTDKQKK  188



>ref|XP_007138897.1| hypothetical protein PHAVU_009G246800g [Phaseolus vulgaris]
 gb|ESW10891.1| hypothetical protein PHAVU_009G246800g [Phaseolus vulgaris]
Length=195

 Score =   165 bits (417),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 97/190 (51%), Positives = 126/190 (66%), Gaps = 9/190 (5%)
 Frame = +1

Query  241  MGQAFRRAAGRI-GSSGMETSSSQLKKpierp--------pppppeiiSAQNVGTGAEST  393
            MGQAFRRA+GRI  +S  +TSS    K                     SA+     A+  
Sbjct  1    MGQAFRRASGRIRAASEADTSSFSKPKTAVDRRPPPTVAPDKTAQISKSAEQDVLHADDR  60

Query  394  PKVNPKSVLEERDPQFDVMLSQMVGRIRAKPGGKLEMGEGSVVENYDRPLPKLRNTTTKS  573
             +VN  ++LEERDP+FD ML QMVGRI++KPGGK EMGE  VVE Y+RP+PKLRNT   S
Sbjct  61   SRVNTDNILEERDPKFDAMLGQMVGRIKSKPGGKPEMGEAFVVEKYNRPMPKLRNTKPDS  120

Query  574  SRYEGRPAPPGTLNVAQLRQIIVLYQGKSDEHEGPMDVNQIANKFRIDvsqvqsivqfvs  753
             RYE R  P GTLNVAQLR II+L++GK+D++ G M+ +QIA KF++ V Q++ I+QF+S
Sbjct  121  GRYEERQVPSGTLNVAQLRHIILLHEGKADDYNGRMNAHQIAEKFQVSVVQIERILQFLS  180

Query  754  LPPEDTKEQK  783
             PPED+ + K
Sbjct  181  QPPEDSSKDK  190



>gb|KFK39445.1| hypothetical protein AALP_AA3G246000 [Arabis alpina]
Length=187

 Score =   164 bits (414),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 99/185 (54%), Positives = 122/185 (66%), Gaps = 4/185 (2%)
 Frame = +1

Query  241  MGQAFRRAAGRIGSSG---METSSSQLKKpierppppppeiiSAQNVGTGAESTPKVNPK  411
            MGQ  RRA G+I         +S   + +             SA +V    E T + N  
Sbjct  1    MGQQLRRAVGKIKQVERLPSSSSRVSVDRRSLPKDDLIAGSTSAADV-VSDEETRRSNDD  59

Query  412  SVLEERDPQFDVMLSQMVGRIRAKPGGKLEMGEGSVVENYDRPLPKLRNTTTKSSRYEGR  591
            + LEERDP++D ML+QMVGRI+ K GGK EMGE +VVE   RPLPKLRNTT +S+RYE +
Sbjct  60   NALEERDPKYDTMLNQMVGRIQTKLGGKAEMGEAAVVETSKRPLPKLRNTTPESTRYEEK  119

Query  592  PAPPGTLNVAQLRQIIVLYQGKSDEHEGPMDVNQIANKFRIDvsqvqsivqfvsLPPEDT  771
            P P GTLNVAQ+R I++LYQGK+ +H GPM VN+IA K+RID SQVQ I QF+SLPPE T
Sbjct  120  PVPQGTLNVAQVRHIMLLYQGKAQDHNGPMSVNEIAEKYRIDASQVQKITQFLSLPPEVT  179

Query  772  KEQKK  786
              QKK
Sbjct  180  NRQKK  184



>ref|XP_009135748.1| PREDICTED: uncharacterized protein LOC103859904 [Brassica rapa]
 emb|CDY48887.1| BnaA03g36260D [Brassica napus]
Length=191

 Score =   162 bits (409),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 97/188 (52%), Positives = 126/188 (67%), Gaps = 6/188 (3%)
 Frame = +1

Query  241  MGQAFRRAAGRIG------SSGMETSSSQLKKpierppppppeiiSAQNVGTGAESTPKV  402
            MGQ  RRA G++       SS    ++ +   P E          +A +  +  E     
Sbjct  1    MGQQLRRAVGKVKEVERFPSSTSRVAAHRRSLPKEELAAAKSPSTAAVDGVSDEEGRRTT  60

Query  403  NPKSVLEERDPQFDVMLSQMVGRIRAKPGGKLEMGEGSVVENYDRPLPKLRNTTTKSSRY  582
            +  +VLEERDP++D ML+QMVGRI+AKPGGK EMGE SVVE+  RPLPKLRNTT +S+RY
Sbjct  61   SDDNVLEERDPKYDTMLNQMVGRIKAKPGGKAEMGEASVVESSKRPLPKLRNTTPESTRY  120

Query  583  EGRPAPPGTLNVAQLRQIIVLYQGKSDEHEGPMDVNQIANKFRIDvsqvqsivqfvsLPP  762
            E +P P GTLNVAQ+R I++L+QGK+ +H G M V +IA  +RIDVSQV+ I QF+SLPP
Sbjct  121  EEKPVPQGTLNVAQVRHIMLLFQGKAQDHSGSMSVEEIAKNYRIDVSQVKKITQFLSLPP  180

Query  763  EDTKEQKK  786
            E T +QKK
Sbjct  181  EVTDKQKK  188



>ref|XP_010510179.1| PREDICTED: uncharacterized protein LOC104786456 isoform X1 [Camelina 
sativa]
Length=194

 Score =   162 bits (409),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 100/191 (52%), Positives = 122/191 (64%), Gaps = 9/191 (5%)
 Frame = +1

Query  241  MGQAFRRAAGRIGSSGMETSSS---------QLKKpierppppppeiiSAQNVGTGAEST  393
            MGQ  RRA G+I      T SS          L         P P   + + V +  +  
Sbjct  1    MGQQLRRAVGKIKEVERSTPSSTSRVVVDRRSLPTEELTAVKPSPSTAAVEGVSSDNKGR  60

Query  394  PKVNPKSVLEERDPQFDVMLSQMVGRIRAKPGGKLEMGEGSVVENYDRPLPKLRNTTTKS  573
                  +VLEERDP++D ML+QMVGRI+AKPGGK EMGE SVVE   RPLPKLRNTT +S
Sbjct  61   RTSEEDNVLEERDPKYDTMLNQMVGRIKAKPGGKAEMGEASVVETSKRPLPKLRNTTPES  120

Query  574  SRYEGRPAPPGTLNVAQLRQIIVLYQGKSDEHEGPMDVNQIANKFRIDvsqvqsivqfvs  753
            +RYE  P P GTLN+AQ+R I++LYQGK+ +H G M V +IA K+RIDVSQVQ I QF+S
Sbjct  121  TRYEENPVPQGTLNIAQVRHIMLLYQGKAQDHNGSMSVKEIAEKYRIDVSQVQKITQFLS  180

Query  754  LPPEDTKEQKK  786
            LP E T +QKK
Sbjct  181  LPTEVTDKQKK  191



>ref|XP_006298617.1| hypothetical protein CARUB_v10014704mg [Capsella rubella]
 gb|EOA31515.1| hypothetical protein CARUB_v10014704mg [Capsella rubella]
Length=194

 Score =   161 bits (408),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 103/195 (53%), Positives = 130/195 (67%), Gaps = 17/195 (9%)
 Frame = +1

Query  241  MGQAFRRAAGRIGSSGMETSSSQLKKpierppppppeiiSAQNVGTGAESTPKVNPKS--  414
            MGQ  RRA G+I      T SS  +  ++R   P  E+ + +     + STP V+  S  
Sbjct  1    MGQQLRRAVGKIKEVERSTPSSTSRVVVDRRSLPTEELSAVK----PSPSTPTVDVVSSD  56

Query  415  -----------VLEERDPQFDVMLSQMVGRIRAKPGGKLEMGEGSVVENYDRPLPKLRNT  561
                       VLEERDP++D ML+QMVGRI+AKPGGK EMG+ S+VE   RPLPKLRNT
Sbjct  57   NKGRRTSEEDDVLEERDPKYDTMLNQMVGRIKAKPGGKAEMGDASLVETSKRPLPKLRNT  116

Query  562  TTKSSRYEGRPAPPGTLNVAQLRQIIVLYQGKSDEHEGPMDVNQIANKFRIDvsqvqsiv  741
            T +S+RYE  P P GTLNVAQ+R I++LYQGK+ +H GPM VN IA K+R+DVSQVQ I 
Sbjct  117  TPESTRYEENPVPQGTLNVAQVRHIMLLYQGKAQDHNGPMSVNDIAAKYRVDVSQVQKIT  176

Query  742  qfvsLPPEDTKEQKK  786
            QF+SLP E T +QK+
Sbjct  177  QFLSLPQEVTDKQKQ  191



>ref|XP_010466381.1| PREDICTED: uncharacterized protein LOC104746567 [Camelina sativa]
Length=195

 Score =   161 bits (407),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 101/191 (53%), Positives = 126/191 (66%), Gaps = 10/191 (5%)
 Frame = +1

Query  241  MGQAFRRAAGRIGSSGMETSSSQLKKpierppppppeiiSAQ----------NVGTGAES  390
            MGQ  RRA G+I      T SS  +  ++R   P  E+ S +           V +  + 
Sbjct  1    MGQQLRRAVGKIKEVERSTPSSTSRVVLDRRSLPTEELSSVKPSPSTPAAVDGVSSDNKG  60

Query  391  TPKVNPKSVLEERDPQFDVMLSQMVGRIRAKPGGKLEMGEGSVVENYDRPLPKLRNTTTK  570
                   +VLEERDP+FD ML+QMVGRI+AKPGGK EMGE SVVE   RPLPKLRNTT +
Sbjct  61   RRTSEEDTVLEERDPKFDTMLNQMVGRIKAKPGGKAEMGEASVVETSKRPLPKLRNTTPE  120

Query  571  SSRYEGRPAPPGTLNVAQLRQIIVLYQGKSDEHEGPMDVNQIANKFRIDvsqvqsivqfv  750
            S+RYE  P P GTLN+AQ+R I++LYQGK+ +H G M VN+IA K+R+DVSQVQ I QF+
Sbjct  121  STRYEENPVPQGTLNIAQVRHIMLLYQGKAQDHNGSMSVNEIAEKYRVDVSQVQKITQFL  180

Query  751  sLPPEDTKEQK  783
            SLP E T +QK
Sbjct  181  SLPTEVTDKQK  191



>gb|AFK45835.1| unknown [Medicago truncatula]
Length=139

 Score =   159 bits (402),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 83/124 (67%), Positives = 100/124 (81%), Gaps = 0/124 (0%)
 Frame = +1

Query  412  SVLEERDPQFDVMLSQMVGRIRAKPGGKLEMGEGSVVENYDRPLPKLRNTTTKSSRYEGR  591
            +VLEE+DP+FD ML QM+GRI +KPGGK EMGE SVVE Y+RP+PKLRNT   S  YE R
Sbjct  11   NVLEEKDPKFDAMLGQMLGRITSKPGGKREMGEASVVEKYNRPMPKLRNTKPNSGHYEER  70

Query  592  PAPPGTLNVAQLRQIIVLYQGKSDEHEGPMDVNQIANKFRIDvsqvqsivqfvsLPPEDT  771
            P P GTLNVAQLR II+L++GK+D+H GPMDV+QIA KFR+DV Q+Q I+QF+S PPE  
Sbjct  71   PVPAGTLNVAQLRHIILLHEGKADDHNGPMDVHQIAEKFRVDVGQIQKILQFLSHPPEGR  130

Query  772  KEQK  783
             E K
Sbjct  131  SEDK  134



>emb|CDY55284.1| BnaC05g51780D [Brassica napus]
Length=177

 Score =   160 bits (404),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 99/188 (53%), Positives = 122/188 (65%), Gaps = 20/188 (11%)
 Frame = +1

Query  241  MGQAFRRAAGRIGSSGMETSSSQLKKpierppppppeiiSAQNVGTGAESTPKVNPKSVL  420
            MGQ  RRA GR+    +E   S++ +             S       A  +P +N  S  
Sbjct  1    MGQQLRRAVGRVKE--VEKFPSRVDRR------------SLPKEELSAGKSPSINDVSAR  46

Query  421  ------EERDPQFDVMLSQMVGRIRAKPGGKLEMGEGSVVENYDRPLPKLRNTTTKSSRY  582
                   ERDPQ+D ML+QMVGRI+AKPGGK EMGE SVVE   RPLPKLRNTT +S+RY
Sbjct  47   GGSSEDSERDPQYDTMLNQMVGRIKAKPGGKAEMGEASVVETSKRPLPKLRNTTPESTRY  106

Query  583  EGRPAPPGTLNVAQLRQIIVLYQGKSDEHEGPMDVNQIANKFRIDvsqvqsivqfvsLPP  762
            E +P   GTLNVAQ+R I++LYQGK+ +H GPM +N+IA  +RIDVSQVQ I QF+SLPP
Sbjct  107  EEKPVSQGTLNVAQVRHIMLLYQGKAQDHNGPMTLNEIAKNYRIDVSQVQKITQFLSLPP  166

Query  763  EDTKEQKK  786
            E T +QKK
Sbjct  167  ETTDKQKK  174



>ref|XP_003533433.1| PREDICTED: uncharacterized protein LOC100806944 [Glycine max]
 gb|KHN26568.1| hypothetical protein glysoja_019807 [Glycine soja]
Length=191

 Score =   160 bits (404),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 100/190 (53%), Positives = 132/190 (69%), Gaps = 13/190 (7%)
 Frame = +1

Query  241  MGQAFRRAAGRI-GSSGMETSS-SQLKKpierppppppeiiSAQNVGTGAE-------ST  393
            MGQAFRRA+GRI  +S  +TSS S+ K  ++R PPP      A  +   AE        +
Sbjct  1    MGQAFRRASGRIRAASEADTSSFSKPKNAVDRRPPPNAAADKAAQIPKAAEHDVLHANDS  60

Query  394  PKVNPKSVLEERDPQFDVMLSQMVGRIRAKPGGKLEMGEGSVVENYDRPLPKLRNTTTKS  573
            P+VN  ++LEERDP+FD ML QM+GRI +KP    EMGE  VV+ Y+RP+PKLRNT   S
Sbjct  61   PRVNTDNILEERDPKFDAMLGQMIGRITSKP----EMGEAFVVDKYNRPMPKLRNTKPDS  116

Query  574  SRYEGRPAPPGTLNVAQLRQIIVLYQGKSDEHEGPMDVNQIANKFRIDvsqvqsivqfvs  753
             RY+ RP P GTLNVAQLR +I+L++GK+D++ G MD +QIA KFR+DV Q+Q I+QF+S
Sbjct  117  GRYDERPVPAGTLNVAQLRHVILLHEGKADDYNGRMDAHQIAEKFRVDVVQIQRILQFLS  176

Query  754  LPPEDTKEQK  783
             PPE + + K
Sbjct  177  QPPEGSSKDK  186



>ref|XP_010488154.1| PREDICTED: uncharacterized protein LOC104766036 [Camelina sativa]
Length=194

 Score =   160 bits (404),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 100/191 (52%), Positives = 121/191 (63%), Gaps = 9/191 (5%)
 Frame = +1

Query  241  MGQAFRRAAGRIGSSGMETSSS---------QLKKpierppppppeiiSAQNVGTGAEST  393
            MGQ  RRA G+I      T SS          L         P P   +   V +  +  
Sbjct  1    MGQQLRRAVGKIKEVERSTPSSTSRVVVDRRSLPTEELTAVKPSPSTAAVDGVSSDNKGR  60

Query  394  PKVNPKSVLEERDPQFDVMLSQMVGRIRAKPGGKLEMGEGSVVENYDRPLPKLRNTTTKS  573
                  +VLEERDP++D ML+QMVGRI+AKPGGK EMGE SVVE   RPLPKLRNTT +S
Sbjct  61   RTSEEDNVLEERDPKYDTMLNQMVGRIKAKPGGKAEMGEASVVETSKRPLPKLRNTTPES  120

Query  574  SRYEGRPAPPGTLNVAQLRQIIVLYQGKSDEHEGPMDVNQIANKFRIDvsqvqsivqfvs  753
            +RYE    P GTLN+AQ+R I++LYQGK+ +H G M VN+IA K+RIDVSQVQ I QF+S
Sbjct  121  TRYEENLVPQGTLNIAQVRHIMLLYQGKAQDHNGSMSVNEIAEKYRIDVSQVQKITQFLS  180

Query  754  LPPEDTKEQKK  786
            LP E T +QKK
Sbjct  181  LPTEVTDKQKK  191



>emb|CDY51444.1| BnaA05g36610D [Brassica napus]
Length=169

 Score =   155 bits (391),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 84/165 (51%), Positives = 105/165 (64%), Gaps = 20/165 (12%)
 Frame = +1

Query  241  MGQAFRRAAGRIGSSGMETSSSQLKKpierppppppeiiSAQNVGTGAESTPKVNPKSVL  420
            MGQ  RRA GR+    +E   S+L +             S       A  +P +N  S  
Sbjct  1    MGQQLRRAVGRVKE--VEKFPSRLDRR------------SLPKEELSAGKSPSINDVSAR  46

Query  421  ------EERDPQFDVMLSQMVGRIRAKPGGKLEMGEGSVVENYDRPLPKLRNTTTKSSRY  582
                   ERDPQ+D ML+QMVGRI+AKPGGK EMGE SVVE   RPLPKLRNTT +S+RY
Sbjct  47   GSSSDDSERDPQYDTMLNQMVGRIKAKPGGKAEMGEASVVETSKRPLPKLRNTTPESTRY  106

Query  583  EGRPAPPGTLNVAQLRQIIVLYQGKSDEHEGPMDVNQIANKFRID  717
            E +P P GTLNVAQ+R I++LYQGK+ +H+GPM +N+IA  +RID
Sbjct  107  EAKPVPQGTLNVAQVRHIMLLYQGKAQDHKGPMTLNEIAKNYRID  151



>ref|XP_009349504.1| PREDICTED: uncharacterized protein LOC103941044 [Pyrus x bretschneideri]
Length=192

 Score =   155 bits (392),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 100/189 (53%), Positives = 126/189 (67%), Gaps = 7/189 (4%)
 Frame = +1

Query  241  MGQAFRRAAGRIGSSGMETSSSQLKKpierppppppeiiSA---QNVGTGAESTPKVNP-  408
            MGQA RRAAGR  S+    ++S   K +     PPP          VG   +S       
Sbjct  1    MGQALRRAAGRTRSTSTVETTSSKPKTVVVDHRPPPVPPERPEISKVGGAIDSDGSAGTG  60

Query  409  ---KSVLEERDPQFDVMLSQMVGRIRAKPGGKLEMGEGSVVENYDRPLPKLRNTTTKSSR  579
               ++VLEERDP +D ML+QMVGRI++KPGGKLEMGE  VVE Y RPLPKLR+T   S  
Sbjct  61   GAVENVLEERDPNYDAMLNQMVGRIKSKPGGKLEMGEAFVVEKYKRPLPKLRDTKPDSGS  120

Query  580  YEGRPAPPGTLNVAQLRQIIVLYQGKSDEHEGPMDVNQIANKFRIDvsqvqsivqfvsLP  759
            YE RP PPGTLNVAQLR II+L+QGK+++H   M+ +QIA KF +DV++V+ I+QFVSLP
Sbjct  121  YEERPTPPGTLNVAQLRHIILLHQGKAEDHNSRMEPDQIAEKFWVDVAEVRRILQFVSLP  180

Query  760  PEDTKEQKK  786
            PED+   +K
Sbjct  181  PEDSSGNQK  189



>ref|XP_009352333.1| PREDICTED: uncharacterized protein LOC103943718 [Pyrus x bretschneideri]
Length=192

 Score =   155 bits (391),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 81/126 (64%), Positives = 103/126 (82%), Gaps = 0/126 (0%)
 Frame = +1

Query  409  KSVLEERDPQFDVMLSQMVGRIRAKPGGKLEMGEGSVVENYDRPLPKLRNTTTKSSRYEG  588
            ++VLEERDP +D ML+QMVGRI++KPGGKLEMGE  VVE Y RPLPKLR+T   S  YE 
Sbjct  64   ENVLEERDPNYDAMLNQMVGRIKSKPGGKLEMGEAFVVEKYKRPLPKLRDTKPDSGSYEE  123

Query  589  RPAPPGTLNVAQLRQIIVLYQGKSDEHEGPMDVNQIANKFRIDvsqvqsivqfvsLPPED  768
            RP PPGTLNVAQLR II+L+QGK+++H   M+ +Q+A KFR+DV++V+ I+QFVSLPPED
Sbjct  124  RPTPPGTLNVAQLRHIILLHQGKAEDHNSRMEPDQMAEKFRVDVAEVRRILQFVSLPPED  183

Query  769  TKEQKK  786
            +   +K
Sbjct  184  SSGNQK  189



>ref|XP_011627440.1| PREDICTED: uncharacterized protein LOC18445311 [Amborella trichopoda]
Length=185

 Score =   154 bits (388),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 98/188 (52%), Positives = 122/188 (65%), Gaps = 9/188 (5%)
 Frame = +1

Query  241  MGQAFRRAAGRIGSSGMETSSSQLKKpierppppppeiiSAQ-NVGTGAESTPKVNPKS-  414
            MGQA RRA  R GS   ETSS+++K   +RP   P E  +   +V   +E  P++ P+S 
Sbjct  1    MGQAMRRAISRGGSKPSETSSARVKTMEQRPRVFPSETEAPNPSVDVASEVNPEITPRSA  60

Query  415  ----VLEERDPQFDVMLSQMVGRIRAKPGGKLEMGEGSVVENYDRPLPKLRNTTTKSSRY  582
                VLEERDP +D MLSQMVGRI  KPGGKLEMGE  VVE Y RPLPKLR+T   + R 
Sbjct  61   NEGAVLEERDPGYDAMLSQMVGRIITKPGGKLEMGEAFVVEKYKRPLPKLRDTKADAGRD  120

Query  583  EGRPAPPGTLNVAQLRQIIVLYQGKSDEHEGPMDVNQIANKFRIDvsqvqsivqfvsLPP  762
            E     PGTLNV+QLRQ+  L+QGK     G M V QIA K R+D + V++I++ +SLPP
Sbjct  121  EKSVVAPGTLNVSQLRQVFFLHQGKDG---GSMGVQQIAEKLRVDAAHVENILRHLSLPP  177

Query  763  EDTKEQKK  786
            E  KE +K
Sbjct  178  ESNKETEK  185



>ref|XP_008340938.1| PREDICTED: uncharacterized protein LOC103403864 [Malus domestica]
Length=247

 Score =   155 bits (392),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 80/117 (68%), Positives = 98/117 (84%), Gaps = 0/117 (0%)
 Frame = +1

Query  418  LEERDPQFDVMLSQMVGRIRAKPGGKLEMGEGSVVENYDRPLPKLRNTTTKSSRYEGRPA  597
            LEERDP +D ML QMVGRI+AKPGGK EMGE +VV+ Y RPLPKLR+T   S  YE RPA
Sbjct  122  LEERDPNYDAMLXQMVGRIKAKPGGKFEMGEANVVDKYKRPLPKLRDTKPDSGSYEERPA  181

Query  598  PPGTLNVAQLRQIIVLYQGKSDEHEGPMDVNQIANKFRIDvsqvqsivqfvsLPPED  768
            PPGTLNVAQLR II+L+QGK+++H G M+ +QIA KFR+DV++V+ I+QFV+LPPED
Sbjct  182  PPGTLNVAQLRHIILLHQGKAEDHNGRMEPDQIAEKFRVDVAEVRRILQFVALPPED  238



>ref|XP_006378112.1| hypothetical protein POPTR_0010s02470g [Populus trichocarpa]
 gb|ERP55909.1| hypothetical protein POPTR_0010s02470g [Populus trichocarpa]
Length=141

 Score =   151 bits (382),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 76/134 (57%), Positives = 96/134 (72%), Gaps = 13/134 (10%)
 Frame = +1

Query  382  AESTPKVNPKSVLEERDPQFDVMLSQMVGRIRAKPGGKLEMGEGSVVENYDRPLPKLRNT  561
            +E   +++  +VLEERD ++D +LSQMVGRI++KPGGKLE GE  VVE YDRP+PKLRNT
Sbjct  18   SEDARRISSDNVLEERDSRYDALLSQMVGRIKSKPGGKLETGEAPVVERYDRPMPKLRNT  77

Query  562  TTKSSRYEGRPAPPGTLNVAQLRQIIVLYQGKSDEHEGPMDVNQIANKFRIDvsqvqsiv  741
               S RYE RP  PGTLNVAQLRQI++LYQGK+D+HEGPM+  Q   +F           
Sbjct  78   KPDSGRYEERPGSPGTLNVAQLRQIMLLYQGKADDHEGPMNAQQGVLQF-----------  126

Query  742  qfvsLPPEDTKEQK  783
              +SLPPED  +Q+
Sbjct  127  --LSLPPEDNNKQR  138



>ref|XP_008800866.1| PREDICTED: swi5-dependent recombination DNA repair protein 1 
homolog [Phoenix dactylifera]
Length=215

 Score =   149 bits (377),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 77/120 (64%), Positives = 98/120 (82%), Gaps = 0/120 (0%)
 Frame = +1

Query  409  KSVLEERDPQFDVMLSQMVGRIRAKPGGKLEMGEGSVVENYDRPLPKLRNTTTKSSRYEG  588
            + VLEERDP +D ML QMVGRI ++PGGKLEMGE  VVE Y+RP+PKLR++  ++     
Sbjct  89   QGVLEERDPTYDEMLKQMVGRITSRPGGKLEMGEAFVVERYNRPMPKLRSSKAEAGGSVQ  148

Query  589  RPAPPGTLNVAQLRQIIVLYQGKSDEHEGPMDVNQIANKFRIDvsqvqsivqfvsLPPED  768
            +P PPGTL + Q+RQII+L+QGKSDEH+GPMD+N IA+KFR+D + VQ IVQF+SLPPED
Sbjct  149  KPLPPGTLTIEQVRQIILLHQGKSDEHQGPMDINDIASKFRVDGTHVQRIVQFMSLPPED  208



>ref|XP_008458466.1| PREDICTED: uncharacterized protein LOC103497865 isoform X2 [Cucumis 
melo]
Length=151

 Score =   147 bits (371),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 86/141 (61%), Positives = 103/141 (73%), Gaps = 4/141 (3%)
 Frame = +1

Query  241  MGQAFRRAAGRI--GSSGMETSSSQLK-KpierppppppeiiSAQNVGT-GAESTPKVNP  408
            MGQAFRRAAGRI   SS   T++S LK + I    PPP     A+  G+  +      + 
Sbjct  1    MGQAFRRAAGRIKPASSVDSTTASSLKMESIVDRKPPPRVAEKARESGSLDSGDVTASDS  60

Query  409  KSVLEERDPQFDVMLSQMVGRIRAKPGGKLEMGEGSVVENYDRPLPKLRNTTTKSSRYEG  588
             + LEERDPQFD MLSQMVGRI++KPGGKLEMGE SVVE Y RP+PKLR+T  KSS+YE 
Sbjct  61   GNRLEERDPQFDAMLSQMVGRIKSKPGGKLEMGEASVVERYGRPMPKLRDTNIKSSKYED  120

Query  589  RPAPPGTLNVAQLRQIIVLYQ  651
            RPAPPGTLNVAQ+RQII+L++
Sbjct  121  RPAPPGTLNVAQMRQIILLHE  141



>ref|XP_010931613.1| PREDICTED: uncharacterized protein LOC105052486 [Elaeis guineensis]
Length=192

 Score =   148 bits (373),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 99/188 (53%), Positives = 127/188 (68%), Gaps = 15/188 (8%)
 Frame = +1

Query  241  MGQAFRRAAGRIGSSGMETSSSQLKKpierppppppeiiSAQ-----NVG------TGAE  387
            MGQA RRA GR+  S  +  +    K  ERPPP P     A+      VG      + AE
Sbjct  1    MGQALRRATGRVRPSRSDHPARPPIKNPERPPPSPTAAAQAKPPDAPTVGQDRLGISDAE  60

Query  388  STPK-VNPKSVLEERDPQFDVMLSQMVGRIRAKPGGKLEMGEGSVVENYDRPLPKLRNTT  564
             T +  +    LEERDP++D ML QMVGRI ++PGGKLEMGE  +VE Y+RP+PKLR++ 
Sbjct  61   VTARDKDYNGALEERDPKYDEMLKQMVGRITSRPGGKLEMGEAFIVERYNRPMPKLRSSK  120

Query  565  TKSSRYEGRPAPPGTLNVAQLRQIIVLYQGKSDEHEGPMDVNQIANKFRIDvsqvqsivq  744
             ++ +   +P PPGTL + Q+RQII+L+QGKSDEH+GPMDVN IA KFR+D + VQ IVQ
Sbjct  121  GEAVQ---KPLPPGTLTIEQVRQIILLHQGKSDEHQGPMDVNDIACKFRVDAAYVQRIVQ  177

Query  745  fvsLPPED  768
            F+SLPPED
Sbjct  178  FMSLPPED  185



>ref|XP_010666731.1| PREDICTED: uncharacterized protein LOC104883865 [Beta vulgaris 
subsp. vulgaris]
Length=191

 Score =   147 bits (371),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 81/185 (44%), Positives = 116/185 (63%), Gaps = 4/185 (2%)
 Frame = +1

Query  241  MGQAFRRAAGRIGSSGMETSSSQLKKpierppppppeiiSAQNVGTGAESTPK----VNP  408
            MGQA RRA G++ ++ ++TSSS               + S  NV    +  P      + 
Sbjct  1    MGQALRRATGKLRNTNIDTSSSAPSPIQHSFDRAAKPVSSGNNVQINNKDFPSDRNSTSN  60

Query  409  KSVLEERDPQFDVMLSQMVGRIRAKPGGKLEMGEGSVVENYDRPLPKLRNTTTKSSRYEG  588
              VLEERDP ++VMLSQM G+I+ KPGGKL MGE SVV+   RPLP++RNT+  + RYE 
Sbjct  61   AQVLEERDPTYEVMLSQMAGKIKTKPGGKLVMGEASVVQKTKRPLPRIRNTSPDAGRYEE  120

Query  589  RPAPPGTLNVAQLRQIIVLYQGKSDEHEGPMDVNQIANKFRIDvsqvqsivqfvsLPPED  768
            RP   GTLNVAQLR I++L++GK  E +  + + ++A  FR+D  Q++ + ++VSLPPE+
Sbjct  121  RPVAAGTLNVAQLRHIMLLHKGKDVEQDKQLGLKEVAENFRVDAVQLEKVFKYVSLPPEN  180

Query  769  TKEQK  783
               +K
Sbjct  181  NTSRK  185



>ref|XP_011071454.1| PREDICTED: uncharacterized protein LOC105156896 isoform X2 [Sesamum 
indicum]
Length=156

 Score =   144 bits (364),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 86/137 (63%), Positives = 100/137 (73%), Gaps = 10/137 (7%)
 Frame = +1

Query  241  MGQAFRRAAGRIGSSGMETSS-SQLKKpierppppppeiiS-------AQNVGTGAESTP  396
            MGQA RRA GRIGSS ++TS+ SQL KPIER    PP           +++   G+E   
Sbjct  1    MGQALRRATGRIGSSRVDTSTTSQLGKPIERRSSAPPAPAGVPVEKLPSEDAAAGSEGAS  60

Query  397  KVNPKSVLEERDPQFDVMLSQMVGRIRAKPGGKLEMGEGSVVENYDRPLPKLRNTTTKSS  576
             VN  +VLE+RDPQ+D MLSQMVGRIR+KPGGKLEMGE SVVE Y RPLPK+RNTT +S 
Sbjct  61   VVN--AVLEDRDPQYDAMLSQMVGRIRSKPGGKLEMGEASVVEKYKRPLPKVRNTTPESG  118

Query  577  RYEGRPAPPGTLNVAQL  627
            RYE RP PPGTLNVAQ+
Sbjct  119  RYEQRPVPPGTLNVAQV  135



>gb|ERN16979.1| hypothetical protein AMTR_s00057p00205560 [Amborella trichopoda]
Length=143

 Score =   137 bits (346),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 78/135 (58%), Positives = 94/135 (70%), Gaps = 4/135 (3%)
 Frame = +1

Query  385  ESTPK-VNPKSVLEERDPQFDVMLSQMVGRIRAKPGGKLEMGEGSVVENYDRPLPKLRNT  561
            E TP+  N  +VLEERDP +D MLSQMVGRI  KPGGKLEMGE  VVE Y RPLPKLR+T
Sbjct  12   EITPRSANEGAVLEERDPGYDAMLSQMVGRIITKPGGKLEMGEAFVVEKYKRPLPKLRDT  71

Query  562  TTKSSRYEGRPAPPGTLNVAQLRQIIVLYQGKSDEHEGPMDVNQIANKFRIDvsqvqsiv  741
               + R E     PGTLNV+QLRQ+  L+QGK     G M V QIA K R+D + V++I+
Sbjct  72   KADAGRDEKSVVAPGTLNVSQLRQVFFLHQGKDG---GSMGVQQIAEKLRVDAAHVENIL  128

Query  742  qfvsLPPEDTKEQKK  786
            + +SLPPE  KE +K
Sbjct  129  RHLSLPPESNKETEK  143



>ref|XP_004962831.1| PREDICTED: pre-mRNA-splicing ATP-dependent RNA helicase PRP28-like 
[Setaria italica]
Length=188

 Score =   137 bits (345),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 88/186 (47%), Positives = 117/186 (63%), Gaps = 4/186 (2%)
 Frame = +1

Query  241  MGQAFRRAAGRIGSSGMETSSSQLKKpierppppppeiiSAQN-VGT---GAESTPKVNP  408
            MGQA RRA+GR+      +  ++   P     PPP    + Q+ V T   G  + P  N 
Sbjct  1    MGQALRRASGRVRPPPAPSPPARPPPPPPPRAPPPAAGGAPQDRVDTPTNGDVTVPTKNA  60

Query  409  KSVLEERDPQFDVMLSQMVGRIRAKPGGKLEMGEGSVVENYDRPLPKLRNTTTKSSRYEG  588
             +VLEERDP +D ML  MVGRI  KPGGK EMG  SVV+ YDRPLPK+R +  +  +   
Sbjct  61   HAVLEERDPSYDEMLKHMVGRITTKPGGKPEMGNASVVQRYDRPLPKVRTSKAEPGQSGS  120

Query  589  RPAPPGTLNVAQLRQIIVLYQGKSDEHEGPMDVNQIANKFRIDvsqvqsivqfvsLPPED  768
            R  P G LNV  +++II LYQGKS  H GPM V+ IA+KFR++ S V++IVQ VSLP ++
Sbjct  121  RQLPSGALNVQHIQEIIQLYQGKSSTHHGPMSVDDIASKFRVEASVVRNIVQSVSLPQDE  180

Query  769  TKEQKK  786
            T ++K+
Sbjct  181  TPKKKE  186



>ref|XP_009387508.1| PREDICTED: uncharacterized protein LOC103974411 [Musa acuminata 
subsp. malaccensis]
Length=189

 Score =   131 bits (330),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 84/189 (44%), Positives = 119/189 (63%), Gaps = 7/189 (4%)
 Frame = +1

Query  241  MGQAFRRAAGRIGSSGMETSSSQLKKpierppppppeiiSAQNVG------TGAESTPKV  402
            MGQA RRA G +     +     +++        PP   +A   G       GAE T ++
Sbjct  1    MGQALRRATGSVRGGRPDPPPPPVQRSPRPANVDPPHPPAASIDGQDPLGIAGAEVTERI  60

Query  403  NPKS-VLEERDPQFDVMLSQMVGRIRAKPGGKLEMGEGSVVENYDRPLPKLRNTTTKSSR  579
              +S VLEERDP++D ML  M+G+I ++ GGKLEMGE  +VE Y+RP+PKLR++  ++  
Sbjct  61   KDESGVLEERDPRYDEMLRHMLGKITSRSGGKLEMGEAGIVERYNRPMPKLRSSREEAGA  120

Query  580  YEGRPAPPGTLNVAQLRQIIVLYQGKSDEHEGPMDVNQIANKFRIDvsqvqsivqfvsLP  759
               +P PPGTL+V Q+ QII+L+QGK+ +H G MD+  IANKF +D  QVQ I QF+SLP
Sbjct  121  SGQKPLPPGTLSVEQVCQIILLHQGKAVDHPGVMDIQDIANKFGVDPGQVQQITQFMSLP  180

Query  760  PEDTKEQKK  786
            P+D K + +
Sbjct  181  PQDGKRETQ  189



>ref|XP_002442262.1| hypothetical protein SORBIDRAFT_08g017200 [Sorghum bicolor]
 gb|EES16100.1| hypothetical protein SORBIDRAFT_08g017200 [Sorghum bicolor]
Length=191

 Score =   129 bits (324),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 73/133 (55%), Positives = 95/133 (71%), Gaps = 0/133 (0%)
 Frame = +1

Query  388  STPKVNPKSVLEERDPQFDVMLSQMVGRIRAKPGGKLEMGEGSVVENYDRPLPKLRNTTT  567
            +TP  N   VL ERDP +D ML  MVGRI  KPGGK EMGE SVV+ Y+RPLPK+R +  
Sbjct  57   TTPTKNVHGVLAERDPSYDEMLKHMVGRITTKPGGKPEMGEASVVQQYNRPLPKVRTSKA  116

Query  568  KSSRYEGRPAPPGTLNVAQLRQIIVLYQGKSDEHEGPMDVNQIANKFRIDvsqvqsivqf  747
            +  +  GR  P G LNV  +++II LYQGKS  H+GPM V+ IA +FR++ S VQ+IVQF
Sbjct  117  EPGQSGGRQLPSGALNVQHIQEIIQLYQGKSTNHQGPMSVDDIALRFRVEASVVQNIVQF  176

Query  748  vsLPPEDTKEQKK  786
            VSLP ++T ++K+
Sbjct  177  VSLPQDETVKKKE  189



>gb|EMS60219.1| hypothetical protein TRIUR3_04878 [Triticum urartu]
Length=174

 Score =   127 bits (319),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 75/134 (56%), Positives = 94/134 (70%), Gaps = 2/134 (1%)
 Frame = +1

Query  382  AESTPKVNPKSVLEERDPQFDVMLSQMVGRIRAKPGGKLEMGEGSVVENYDRPLPKLRNT  561
            A + P  +   VL ERDP +D ML  MVGRI  KPGGK EMGE SVVE Y+RPLPK+R  
Sbjct  37   AVTPPTKDAHGVLVERDPSYDDMLKHMVGRITTKPGGKPEMGEASVVERYNRPLPKVR--  94

Query  562  TTKSSRYEGRPAPPGTLNVAQLRQIIVLYQGKSDEHEGPMDVNQIANKFRIDvsqvqsiv  741
            T++    + R  PPGTLNV  +++II LYQGKS  H GPM V+QIA++FR++ S V  IV
Sbjct  95   TSEPEPGQSRQLPPGTLNVGHIQEIIQLYQGKSSSHRGPMSVDQIASRFRVEASVVHGIV  154

Query  742  qfvsLPPEDTKEQK  783
            QFVSLP ++  E+K
Sbjct  155  QFVSLPQDEGTEKK  168



>dbj|BAJ93761.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=196

 Score =   125 bits (315),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 89/192 (46%), Positives = 113/192 (59%), Gaps = 13/192 (7%)
 Frame = +1

Query  241  MGQAFRRAAGRIGSSGMETSSSQLKKpierppppppeiiSAQ-----------NVGTGAE  387
            MGQA RRA+GR+         ++       PPPP      A            +V   A 
Sbjct  1    MGQALRRASGRLRPPPPPPPPARPPPTHPPPPPPRAAPAPAAGGGASPPQDRLDVSQDAV  60

Query  388  STPKVNPKSVLEERDPQFDVMLSQMVGRIRAKPGGKLEMGEGSVVENYDRPLPKLRNTTT  567
            +    +   VL ERDP +D ML  MVGRI  KPGGK EMGE SVVE Y+RPLPK+R  T+
Sbjct  61   TPSTKDSHGVLVERDPSYDDMLKHMVGRITTKPGGKPEMGEASVVERYNRPLPKVR--TS  118

Query  568  KSSRYEGRPAPPGTLNVAQLRQIIVLYQGKSDEHEGPMDVNQIANKFRIDvsqvqsivqf  747
            +S   + R  PPGTL V  +++II LYQGKS  H GPM V+QIA++FR++ S V  IVQF
Sbjct  119  ESEPGQSRQLPPGTLKVGHIQEIIQLYQGKSSNHRGPMSVDQIASRFRVEASVVHGIVQF  178

Query  748  vsLPPEDTKEQK  783
            VSLP ++  E+K
Sbjct  179  VSLPQDEGVEKK  190



>ref|XP_003575725.1| PREDICTED: lysine-specific demethylase 6B [Brachypodium distachyon]
Length=198

 Score =   124 bits (312),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 75/132 (57%), Positives = 92/132 (70%), Gaps = 2/132 (2%)
 Frame = +1

Query  388  STPKVNPKSVLEERDPQFDVMLSQMVGRIRAKPGGKLEMGEGSVVENYDRPLPKLRNTTT  567
            ST  VN   VL ERDP +D ML  MVGRI  KPGGK EMGE SVVE Y+RPLPK+R +  
Sbjct  65   STKDVN--GVLVERDPSYDDMLKHMVGRITTKPGGKPEMGEASVVERYNRPLPKVRTSEP  122

Query  568  KSSRYEGRPAPPGTLNVAQLRQIIVLYQGKSDEHEGPMDVNQIANKFRIDvsqvqsivqf  747
            +  +   R  PPGTLNV  +++II LYQG SD H GPM V++IA++FR+  S VQ IVQF
Sbjct  123  EPGQGGHRQLPPGTLNVGHIQEIIQLYQGNSDGHNGPMSVDEIASRFRVKASVVQGIVQF  182

Query  748  vsLPPEDTKEQK  783
            VSLP +   E++
Sbjct  183  VSLPQDKNVEKR  194



>gb|AFW56512.1| hypothetical protein ZEAMMB73_554427 [Zea mays]
Length=254

 Score =   125 bits (314),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 86/192 (45%), Positives = 118/192 (61%), Gaps = 6/192 (3%)
 Frame = +1

Query  229  EREQMGQAFRRAAGRIGSSGMETSSSQLKKpierppppppeii--SAQNVGTGAE----S  390
            +R  MGQA RRA+GR+      +  ++   P   PP   P     + Q+   G      +
Sbjct  61   DRRYMGQALRRASGRVKPPPAPSPPARQPHPPPPPPQASPAPAGGATQDRLDGLSGDDIT  120

Query  391  TPKVNPKSVLEERDPQFDVMLSQMVGRIRAKPGGKLEMGEGSVVENYDRPLPKLRNTTTK  570
             P  +   VLEERDP +D ML  MVGRI  KPGGK EMGE SVV+ Y+RPLPK+R +  +
Sbjct  121  APTEHGHGVLEERDPSYDEMLKHMVGRITTKPGGKPEMGEASVVQRYNRPLPKVRTSKAE  180

Query  571  SSRYEGRPAPPGTLNVAQLRQIIVLYQGKSDEHEGPMDVNQIANKFRIDvsqvqsivqfv  750
              +  GR  P G LNV  +++II LYQGKS  H+GPM V+ IA++F ++ S VQ+IV+FV
Sbjct  181  PGQGGGRQLPSGALNVQHIQEIIRLYQGKSTNHQGPMSVDDIASRFGVEASAVQNIVRFV  240

Query  751  sLPPEDTKEQKK  786
            SLP ++  E+K+
Sbjct  241  SLPQDEGVEKKE  252



>gb|ABA99444.2| expressed protein [Oryza sativa Japonica Group]
Length=192

 Score =   122 bits (307),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 86/191 (45%), Positives = 113/191 (59%), Gaps = 10/191 (5%)
 Frame = +1

Query  241  MGQAFRRAAGRIGSSGMETSSSQLKKpierppppppeiiSAQN---------VGTGAEST  393
            MGQ  R AAGR+ +            P   P P      +AQ+         V +   + 
Sbjct  1    MGQTLRGAAGRVRAPPTPAPPRPHHLPPAPPSPAGAGGAAAQDRLRVFQDDFVKSDVTTQ  60

Query  394  PKVNPKSVLEERDPQFDVMLSQMVGRIRAKPGGKLEMGEGSVVENYDRPLPKLRNTTTKS  573
            PK  P  VL+ERDP +D ML  MVGRI  KPGGK EMGE  VV+ Y+RPLP++R +  + 
Sbjct  61   PKDAP-GVLKERDPSYDEMLKHMVGRITTKPGGKPEMGEAFVVDQYNRPLPRVRTSRPEP  119

Query  574  SRYEGRPAPPGTLNVAQLRQIIVLYQGKSDEHEGPMDVNQIANKFRIDvsqvqsivqfvs  753
                 R  PPGT++VA + +II LYQGKS  H GPM V++IA+KFR++ S VQ+IVQFVS
Sbjct  120  GEGGHRQLPPGTISVAHVHEIIQLYQGKSSNHPGPMSVDKIASKFRVEASVVQNIVQFVS  179

Query  754  LPPEDTKEQKK  786
            LP E+   +K+
Sbjct  180  LPQEEHVTKKE  190



>gb|ABA99446.2| expressed protein [Oryza sativa Japonica Group]
Length=187

 Score =   122 bits (306),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 84/185 (45%), Positives = 110/185 (59%), Gaps = 3/185 (2%)
 Frame = +1

Query  241  MGQAFRRAAGRIGSSGMETSSSQLKKpierppppppeiiSAQNVGTGAESTPKVNPKS--  414
            MGQ  R AAGR+ +            P   P P      +AQ+     +      PK   
Sbjct  1    MGQTLRGAAGRVRAPPTPAPPRPHHLPPAPPSPAGAGGAAAQDRLRVFQDDVTTQPKDAP  60

Query  415  -VLEERDPQFDVMLSQMVGRIRAKPGGKLEMGEGSVVENYDRPLPKLRNTTTKSSRYEGR  591
             VL+ERDP +D ML  MVGRI  KPGGK EMGE  VV+ Y+RPLP++R +  +      R
Sbjct  61   GVLKERDPSYDEMLKHMVGRITTKPGGKPEMGEAFVVDQYNRPLPRVRTSRPEPGEGGHR  120

Query  592  PAPPGTLNVAQLRQIIVLYQGKSDEHEGPMDVNQIANKFRIDvsqvqsivqfvsLPPEDT  771
              PPGT++VA + +II LYQGKS  H GPM V++IA+KFR++ S VQ+IVQFVSLP E+ 
Sbjct  121  QLPPGTISVAHVHEIIQLYQGKSSNHPGPMSVDKIASKFRVEASVVQNIVQFVSLPQEEH  180

Query  772  KEQKK  786
              +K+
Sbjct  181  VTKKE  185



>gb|EEE53358.1| hypothetical protein OsJ_36385 [Oryza sativa Japonica Group]
Length=192

 Score =   122 bits (306),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 86/191 (45%), Positives = 113/191 (59%), Gaps = 10/191 (5%)
 Frame = +1

Query  241  MGQAFRRAAGRIGSSGMETSSSQLKKpierppppppeiiSAQN---------VGTGAEST  393
            MGQ  R AAGR+ +            P   P P      +AQ+         V +   + 
Sbjct  1    MGQTLRGAAGRLRAPPTPAPPRPHHLPPAPPSPAGAGGAAAQDRLRVFQDDFVKSDVTTQ  60

Query  394  PKVNPKSVLEERDPQFDVMLSQMVGRIRAKPGGKLEMGEGSVVENYDRPLPKLRNTTTKS  573
            PK  P  VL+ERDP +D ML  MVGRI  KPGGK EMGE  VV+ Y+RPLP++R +  + 
Sbjct  61   PKDAP-GVLKERDPSYDEMLKHMVGRITTKPGGKPEMGEAFVVDQYNRPLPRVRTSRPEP  119

Query  574  SRYEGRPAPPGTLNVAQLRQIIVLYQGKSDEHEGPMDVNQIANKFRIDvsqvqsivqfvs  753
                 R  PPGT++VA + +II LYQGKS  H GPM V++IA+KFR++ S VQ+IVQFVS
Sbjct  120  GEGGHRQLPPGTISVAHVHEIIQLYQGKSSNHPGPMSVDKIASKFRVEASVVQNIVQFVS  179

Query  754  LPPEDTKEQKK  786
            LP E+   +K+
Sbjct  180  LPQEEHVTKKE  190



>emb|CAN63566.1| hypothetical protein VITISV_043427 [Vitis vinifera]
Length=220

 Score =   116 bits (291),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 61/104 (59%), Positives = 81/104 (78%), Gaps = 0/104 (0%)
 Frame = +1

Query  472  IRAKPGGKLEMGEGSVVENYDRPLPKLRNTTTKSSRYEGRPAPPGTLNVAQLRQIIVLYQ  651
            + ++P    E+ E  V   Y+RP+PKLRNT  +S RYE +PAP GTLN AQLR I++L+Q
Sbjct  113  LFSRPFNDWELDEALVGGRYNRPMPKLRNTKPESGRYEEKPAPSGTLNAAQLRHILLLHQ  172

Query  652  GKSDEHEGPMDVNQIANKFRIDvsqvqsivqfvsLPPEDTKEQK  783
            GK+D+H+GPM+V QIA KFRID + VQSI+QF+SLPPED+ +QK
Sbjct  173  GKADDHDGPMNVKQIAEKFRIDATMVQSILQFLSLPPEDSTKQK  216



>ref|NP_001066949.1| Os12g0540700 [Oryza sativa Japonica Group]
 dbj|BAF29968.1| Os12g0540700 [Oryza sativa Japonica Group]
Length=115

 Score =   106 bits (264),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 62/113 (55%), Positives = 81/113 (72%), Gaps = 0/113 (0%)
 Frame = +1

Query  448  MLSQMVGRIRAKPGGKLEMGEGSVVENYDRPLPKLRNTTTKSSRYEGRPAPPGTLNVAQL  627
            ML  MVGRI  KPGGK EMGE  VV+ Y+RPLP++R +  +      R  PPGT++VA +
Sbjct  1    MLKHMVGRITTKPGGKPEMGEAFVVDQYNRPLPRVRTSRPEPGEGGHRQLPPGTISVAHV  60

Query  628  RQIIVLYQGKSDEHEGPMDVNQIANKFRIDvsqvqsivqfvsLPPEDTKEQKK  786
             +II LYQGKS  H GPM V++IA+KFR++ S VQ+IVQFVSLP E+   +K+
Sbjct  61   HEIIQLYQGKSSNHPGPMSVDKIASKFRVEASVVQNIVQFVSLPQEEHVTKKE  113



>ref|NP_001144562.1| uncharacterized protein LOC100277567 [Zea mays]
 gb|ACG41391.1| hypothetical protein [Zea mays]
Length=115

 Score =   105 bits (263),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 60/113 (53%), Positives = 82/113 (73%), Gaps = 0/113 (0%)
 Frame = +1

Query  448  MLSQMVGRIRAKPGGKLEMGEGSVVENYDRPLPKLRNTTTKSSRYEGRPAPPGTLNVAQL  627
            ML  MVGRI  KPGGK EMGE SVV+ Y+RPLPK+R +  +  +  GR  P G LNV  +
Sbjct  1    MLKHMVGRITTKPGGKPEMGEASVVQRYNRPLPKVRTSKAEPGQGGGRQLPSGALNVQHI  60

Query  628  RQIIVLYQGKSDEHEGPMDVNQIANKFRIDvsqvqsivqfvsLPPEDTKEQKK  786
            ++II LYQGKS  H+GPM ++ IA++F ++ S VQ+IV+FVSLP ++  E+K+
Sbjct  61   QEIIRLYQGKSTNHQGPMSLDDIASRFGVEASAVQNIVRFVSLPQDEGVEKKE  113



>gb|EEC69438.1| hypothetical protein OsI_38613 [Oryza sativa Indica Group]
Length=154

 Score =   100 bits (250),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 65/152 (43%), Positives = 82/152 (54%), Gaps = 10/152 (7%)
 Frame = +1

Query  241  MGQAFRRAAGRIGSSGMETSSSQLKKpierppppppeiiSAQN---------VGTGAEST  393
            MGQ  R AAGR+ +            P   P P      +AQ+         V +   + 
Sbjct  1    MGQTLRGAAGRVRAPPTPAPPRPHHLPPAPPSPAGAGGAAAQDRLRVFQDDFVKSDVITQ  60

Query  394  PKVNPKSVLEERDPQFDVMLSQMVGRIRAKPGGKLEMGEGSVVENYDRPLPKLRNTTTKS  573
            PK  P  VL+ERDP +D ML  MVGRI  KPGGK EMGE  VV+ Y+RPLP++R +  + 
Sbjct  61   PKDAP-GVLKERDPSYDEMLKHMVGRITTKPGGKPEMGEAFVVDQYNRPLPRVRTSRPEP  119

Query  574  SRYEGRPAPPGTLNVAQLRQIIVLYQGKSDEH  669
                 R  PPGT+NVA + +II LYQGKS  H
Sbjct  120  GEGGHRQLPPGTINVAHVHEIIQLYQGKSSNH  151



>emb|CAN63567.1| hypothetical protein VITISV_043428 [Vitis vinifera]
Length=119

 Score = 79.7 bits (195),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 47/97 (48%), Positives = 65/97 (67%), Gaps = 7/97 (7%)
 Frame = +1

Query  241  MGQAFRRAAGRIGSSGME-TSSSQLK-----KpierppppppeiiSAQNVGTGA-ESTPK  399
            MGQAFRRA+G +  + ++ +SSS LK     +P   P        +  ++G+G+ E  P+
Sbjct  1    MGQAFRRASGSVRRADLDPSSSSHLKNVGDRRPPAVPVDKVGVSKTRDDIGSGSSEGAPR  60

Query  400  VNPKSVLEERDPQFDVMLSQMVGRIRAKPGGKLEMGE  510
             N ++ LEERDPQ+D MLSQMVGRIR+K GG+LEMGE
Sbjct  61   FNSENXLEERDPQYDAMLSQMVGRIRSKSGGRLEMGE  97



>ref|XP_001774099.1| predicted protein [Physcomitrella patens]
 gb|EDQ61151.1| predicted protein [Physcomitrella patens]
Length=134

 Score = 74.3 bits (181),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 44/122 (36%), Positives = 72/122 (59%), Gaps = 5/122 (4%)
 Frame = +1

Query  430  DPQFDVMLSQMVGRIRAKPGGKLEMGEGSVVENYDRPLPKLRNTTTKSSRYEGRPAPPGT  609
            DP++  M+ Q+VG+I  +PGG  EMG   V   + RP P  R T+  +   E +    GT
Sbjct  11   DPRYSAMVQQVVGKISTRPGGTQEMGNAQVTAEFRRPRPSNRRTSAATGPDEEKVVAAGT  70

Query  610  LNVAQLRQIIVLYQGKSDE----HEGPMDVNQIANKFRIDvsqvqsivqfvsLPPEDTKE  777
            LN+A +++ + L+QG   E     E PMDV  +A KF ++V  ++ ++++ SL PE +++
Sbjct  71   LNIAGIQEALRLFQGIRAEGEKVQEKPMDVKSLAEKFNVNVVLLERVLKYTSL-PEPSRK  129

Query  778  QK  783
            QK
Sbjct  130  QK  131



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2611380075072