BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig13382

Length=714
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006347390.1|  PREDICTED: uncharacterized protein LOC102602040    247   2e-72   Solanum tuberosum [potatoes]
ref|XP_004241487.1|  PREDICTED: uncharacterized protein LOC101251098    241   5e-70   Solanum lycopersicum
ref|XP_009594854.1|  PREDICTED: testis-expressed sequence 2 prote...    219   2e-62   Nicotiana tomentosiformis
ref|XP_009594853.1|  PREDICTED: testis-expressed sequence 2 prote...    219   2e-62   Nicotiana tomentosiformis
ref|XP_009761973.1|  PREDICTED: uncharacterized protein LOC104214...    213   7e-60   Nicotiana sylvestris
ref|XP_009761972.1|  PREDICTED: uncharacterized protein LOC104214...    212   8e-60   Nicotiana sylvestris
ref|XP_011072097.1|  PREDICTED: uncharacterized protein LOC105157385    209   9e-59   
ref|XP_009631470.1|  PREDICTED: testis-expressed sequence 2 prote...    208   2e-58   Nicotiana tomentosiformis
ref|XP_009631469.1|  PREDICTED: testis-expressed sequence 2 prote...    208   2e-58   Nicotiana tomentosiformis
ref|XP_009789863.1|  PREDICTED: uncharacterized protein LOC104237...    203   1e-56   Nicotiana sylvestris
ref|XP_009789860.1|  PREDICTED: uncharacterized protein LOC104237...    203   1e-56   Nicotiana sylvestris
ref|XP_010317540.1|  PREDICTED: uncharacterized protein LOC101250...    203   1e-56   Solanum lycopersicum
gb|EPS62479.1|  hypothetical protein M569_12311                         190   1e-54   Genlisea aurea
ref|XP_010104942.1|  hypothetical protein L484_004290                   188   3e-51   Morus notabilis
ref|XP_008240431.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    187   7e-51   Prunus mume [ume]
ref|XP_007210364.1|  hypothetical protein PRUPE_ppa001510mg             186   1e-50   Prunus persica
ref|XP_010537536.1|  PREDICTED: testis-expressed sequence 2 protein     181   6e-49   Tarenaya hassleriana [spider flower]
ref|XP_006351568.1|  PREDICTED: uncharacterized protein LOC102588484    178   8e-48   
emb|CBI26392.3|  unnamed protein product                                178   9e-48   Vitis vinifera
ref|XP_006372281.1|  hypothetical protein POPTR_0018s14940g             178   1e-47   
ref|XP_010662020.1|  PREDICTED: testis-expressed sequence 2 prote...    177   1e-47   Vitis vinifera
ref|XP_010662022.1|  PREDICTED: uncharacterized protein LOC100244...    177   1e-47   
ref|XP_011017543.1|  PREDICTED: uncharacterized protein LOC105120863    175   1e-46   Populus euphratica
gb|KFK41758.1|  hypothetical protein AALP_AA2G168400                    174   1e-46   Arabis alpina [alpine rockcress]
ref|XP_010069545.1|  PREDICTED: uncharacterized protein LOC104456...    174   2e-46   Eucalyptus grandis [rose gum]
ref|XP_010069546.1|  PREDICTED: uncharacterized protein LOC104456...    174   2e-46   Eucalyptus grandis [rose gum]
ref|XP_010687270.1|  PREDICTED: testis-expressed sequence 2 prote...    174   2e-46   
ref|XP_010687269.1|  PREDICTED: testis-expressed sequence 2 prote...    174   2e-46   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006848627.2|  PREDICTED: testis-expressed sequence 2 protein     174   4e-46   Amborella trichopoda
ref|XP_012067294.1|  PREDICTED: uncharacterized protein LOC105630166    172   1e-45   Jatropha curcas
ref|XP_007022967.1|  Integral membrane protein conserved region (...    172   1e-45   
emb|CDX96454.1|  BnaA07g30650D                                          169   7e-45   
emb|CDY26213.1|  BnaA06g12040D                                          170   7e-45   Brassica napus [oilseed rape]
ref|XP_009149234.1|  PREDICTED: uncharacterized protein LOC103872560    169   9e-45   Brassica rapa
ref|XP_011046106.1|  PREDICTED: uncharacterized protein LOC105140810    169   1e-44   Populus euphratica
ref|XP_009105967.1|  PREDICTED: testis-expressed sequence 2 prote...    169   2e-44   Brassica rapa
gb|KJB56354.1|  hypothetical protein B456_009G116400                    166   2e-44   Gossypium raimondii
gb|ERN10208.1|  hypothetical protein AMTR_s00171p00040960               169   2e-44   Amborella trichopoda
ref|XP_010935611.1|  PREDICTED: testis-expressed sequence 2 prote...    168   4e-44   Elaeis guineensis
gb|KJB56355.1|  hypothetical protein B456_009G116400                    166   5e-44   Gossypium raimondii
ref|XP_004512702.1|  PREDICTED: uncharacterized protein LOC101503...    167   5e-44   Cicer arietinum [garbanzo]
ref|XP_010459394.1|  PREDICTED: testis-expressed sequence 2 prote...    167   6e-44   Camelina sativa [gold-of-pleasure]
ref|XP_006390581.1|  hypothetical protein EUTSA_v10018153mg             167   8e-44   Eutrema salsugineum [saltwater cress]
emb|CDY19177.1|  BnaC05g13780D                                          166   1e-43   Brassica napus [oilseed rape]
ref|XP_003535400.1|  PREDICTED: uncharacterized protein LOC100816...    166   1e-43   Glycine max [soybeans]
gb|KJB56353.1|  hypothetical protein B456_009G116400                    166   1e-43   Gossypium raimondii
ref|XP_010248365.1|  PREDICTED: uncharacterized protein LOC104591254    166   1e-43   Nelumbo nucifera [Indian lotus]
ref|XP_006306770.1|  hypothetical protein CARUB_v10008308mg             167   1e-43   Capsella rubella
ref|XP_009408154.1|  PREDICTED: uncharacterized protein LOC103990...    166   2e-43   Musa acuminata subsp. malaccensis [pisang utan]
gb|KHG07655.1|  Testis-expressed sequence 2                             165   3e-43   Gossypium arboreum [tree cotton]
ref|XP_008802615.1|  PREDICTED: uncharacterized protein LOC103716408    165   4e-43   Phoenix dactylifera
dbj|BAD94820.1|  hypothetical protein                                   162   5e-43   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002892968.1|  hypothetical protein ARALYDRAFT_889192             165   6e-43   Arabidopsis lyrata subsp. lyrata
ref|XP_004137541.1|  PREDICTED: uncharacterized protein LOC101209104    165   6e-43   Cucumis sativus [cucumbers]
ref|XP_010476945.1|  PREDICTED: uncharacterized protein LOC104756113    164   8e-43   Camelina sativa [gold-of-pleasure]
ref|XP_006372649.1|  hypothetical protein POPTR_0017s03560g             164   9e-43   
ref|XP_006416664.1|  hypothetical protein EUTSA_v10006829mg             164   9e-43   Eutrema salsugineum [saltwater cress]
ref|XP_009127977.1|  PREDICTED: uncharacterized protein LOC103852830    164   1e-42   Brassica rapa
ref|XP_002525667.1|  conserved hypothetical protein                     164   1e-42   Ricinus communis
ref|NP_177463.1|  putative integral membrane protein                    163   2e-42   Arabidopsis thaliana [mouse-ear cress]
emb|CDY48046.1|  BnaA02g16390D                                          162   2e-42   Brassica napus [oilseed rape]
ref|XP_006599667.1|  PREDICTED: uncharacterized protein LOC100812...    162   4e-42   Glycine max [soybeans]
ref|XP_010498158.1|  PREDICTED: uncharacterized protein LOC104775894    162   5e-42   Camelina sativa [gold-of-pleasure]
gb|KHN24469.1|  Testis-expressed sequence 2 protein                     162   5e-42   Glycine soja [wild soybean]
ref|XP_006599669.1|  PREDICTED: uncharacterized protein LOC100812...    162   5e-42   Glycine max [soybeans]
emb|CDX72963.1|  BnaC06g34110D                                          162   6e-42   
ref|XP_002888912.1|  hypothetical protein ARALYDRAFT_895179             162   6e-42   Arabidopsis lyrata subsp. lyrata
gb|AAF97262.1|AC034106_5  Strong similarity to a hypothetical pro...    162   6e-42   Arabidopsis thaliana [mouse-ear cress]
ref|NP_173224.2|  putative integral membrane protein conserved re...    162   7e-42   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004495486.1|  PREDICTED: testis-expressed sequence 2 prote...    162   7e-42   Cicer arietinum [garbanzo]
ref|XP_010428228.1|  PREDICTED: testis-expressed sequence 2 prote...    160   3e-41   Camelina sativa [gold-of-pleasure]
ref|XP_004512701.1|  PREDICTED: uncharacterized protein LOC101503...    160   5e-41   Cicer arietinum [garbanzo]
ref|XP_010474308.1|  PREDICTED: testis-expressed sequence 2 prote...    158   8e-41   Camelina sativa [gold-of-pleasure]
ref|XP_009117641.1|  PREDICTED: uncharacterized protein LOC103842732    157   2e-40   Brassica rapa
emb|CDY21730.1|  BnaA09g44810D                                          157   2e-40   Brassica napus [oilseed rape]
ref|XP_007161563.1|  hypothetical protein PHAVU_001G080200g             156   5e-40   Phaseolus vulgaris [French bean]
ref|XP_008437259.1|  PREDICTED: uncharacterized protein LOC103482740    156   5e-40   Cucumis melo [Oriental melon]
ref|XP_007152502.1|  hypothetical protein PHAVU_004G135600g             156   6e-40   Phaseolus vulgaris [French bean]
emb|CDY66320.1|  BnaCnng50280D                                          154   4e-39   Brassica napus [oilseed rape]
gb|KHM99770.1|  Testis-expressed sequence 2 protein                     154   5e-39   Glycine soja [wild soybean]
ref|XP_006587407.1|  PREDICTED: uncharacterized protein LOC100787...    153   8e-39   Glycine max [soybeans]
ref|XP_006587408.1|  PREDICTED: uncharacterized protein LOC100787...    153   9e-39   Glycine max [soybeans]
gb|KEH42874.1|  integral membrane protein, putative                     152   1e-38   Medicago truncatula
emb|CDX81851.1|  BnaC08g37500D                                          152   1e-38   
ref|XP_006300616.1|  hypothetical protein CARUB_v10019838mg             150   2e-38   
ref|XP_006300617.1|  hypothetical protein CARUB_v10019838mg             152   3e-38   Capsella rubella
ref|XP_010239258.1|  PREDICTED: testis-expressed sequence 2 prote...    149   3e-37   Brachypodium distachyon [annual false brome]
gb|KHG11075.1|  Testis-expressed sequence 2                             149   4e-37   Gossypium arboreum [tree cotton]
ref|XP_006649193.1|  PREDICTED: testis-expressed sequence 2 prote...    148   5e-37   Oryza brachyantha
gb|KDO56010.1|  hypothetical protein CISIN_1g003631mg                   145   7e-37   Citrus sinensis [apfelsine]
gb|KJB67990.1|  hypothetical protein B456_010G220600                    147   9e-37   Gossypium raimondii
gb|KDO56009.1|  hypothetical protein CISIN_1g003631mg                   145   1e-36   Citrus sinensis [apfelsine]
gb|KEH26662.1|  integral membrane protein, putative                     146   2e-36   Medicago truncatula
ref|XP_006478163.1|  PREDICTED: testis-expressed sequence 2 prote...    147   2e-36   Citrus sinensis [apfelsine]
ref|XP_002453085.1|  hypothetical protein SORBIDRAFT_04g038050          146   2e-36   
gb|KDO56007.1|  hypothetical protein CISIN_1g003631mg                   146   2e-36   Citrus sinensis [apfelsine]
ref|XP_003573002.1|  PREDICTED: testis-expressed sequence 2 prote...    146   3e-36   Brachypodium distachyon [annual false brome]
ref|XP_004301206.1|  PREDICTED: uncharacterized protein LOC101303523    145   6e-36   Fragaria vesca subsp. vesca
ref|XP_004954472.1|  PREDICTED: uncharacterized protein LOC101777078    145   1e-35   
gb|EEC74285.1|  hypothetical protein OsI_09535                          144   2e-35   Oryza sativa Indica Group [Indian rice]
dbj|BAD23057.1|  unknown protein                                        144   2e-35   Oryza sativa Japonica Group [Japonica rice]
gb|AFW63912.1|  hypothetical protein ZEAMMB73_732140                    143   3e-35   
ref|XP_009385248.1|  PREDICTED: uncharacterized protein LOC103972625    142   5e-35   Musa acuminata subsp. malaccensis [pisang utan]
dbj|BAK04177.1|  predicted protein                                      142   1e-34   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010239262.1|  PREDICTED: testis-expressed sequence 2 prote...    137   4e-33   
gb|EMS63454.1|  hypothetical protein TRIUR3_21249                       135   5e-33   Triticum urartu
gb|EMT07633.1|  hypothetical protein F775_06998                         132   3e-31   
gb|EMT17801.1|  hypothetical protein F775_17825                         131   4e-31   
ref|XP_009789864.1|  PREDICTED: testis-expressed sequence 2 prote...    130   1e-30   Nicotiana sylvestris
ref|XP_002439079.1|  hypothetical protein SORBIDRAFT_10g031200          129   3e-30   Sorghum bicolor [broomcorn]
ref|XP_008645130.1|  PREDICTED: testis-expressed sequence 2 prote...    127   9e-30   Zea mays [maize]
ref|XP_004966560.1|  PREDICTED: testis-expressed sequence 2 prote...    126   4e-29   
ref|XP_004966559.1|  PREDICTED: testis-expressed sequence 2 prote...    126   4e-29   
ref|XP_004966561.1|  PREDICTED: testis-expressed sequence 2 prote...    125   4e-29   
gb|EMS68899.1|  Testis-expressed sequence 2 protein                     122   4e-28   Triticum urartu
ref|XP_008645131.1|  PREDICTED: testis-expressed sequence 2 prote...    115   1e-25   Zea mays [maize]
ref|XP_002962707.1|  hypothetical protein SELMODRAFT_438325             107   1e-22   
emb|CDP18515.1|  unnamed protein product                                100   2e-20   Coffea canephora [robusta coffee]
ref|XP_002980385.1|  hypothetical protein SELMODRAFT_112533           99.8    4e-20   
ref|XP_004234314.1|  PREDICTED: testis-expressed sequence 2 prote...  89.7    9e-17   Solanum lycopersicum
ref|XP_001778334.1|  predicted protein                                88.2    4e-16   
ref|XP_010419176.1|  PREDICTED: uncharacterized protein LOC104704851  84.3    4e-15   Camelina sativa [gold-of-pleasure]
gb|AFW63911.1|  hypothetical protein ZEAMMB73_732140                  80.5    4e-15   
ref|NP_001145602.1|  uncharacterized protein LOC100279080             80.5    5e-15   
ref|XP_010317541.1|  PREDICTED: testis-expressed sequence 2 prote...  83.2    1e-14   Solanum lycopersicum
ref|XP_001756161.1|  predicted protein                                81.3    6e-14   
ref|XP_001759215.1|  predicted protein                                80.9    8e-14   
ref|XP_009408155.1|  PREDICTED: testis-expressed sequence 2 prote...  73.2    2e-11   
ref|XP_006589245.1|  PREDICTED: uncharacterized protein LOC100816...  68.9    4e-10   Glycine max [soybeans]
dbj|BAJ97472.1|  predicted protein                                    66.6    3e-09   Hordeum vulgare subsp. vulgare [two-rowed barley]



>ref|XP_006347390.1| PREDICTED: uncharacterized protein LOC102602040 [Solanum tuberosum]
Length=832

 Score =   247 bits (631),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 119/183 (65%), Positives = 147/183 (80%), Gaps = 1/183 (1%)
 Frame = +2

Query  167  MWQFVLVFILGALTVVGVEAAAAVFLIRWLSRRLSREVDKAKVSAELSSPPGLDPSYYNK  346
            M    +VF+LGA+TV+ VEA   VFLIRWL+RR++REVDKAK    LSS    D S Y K
Sbjct  1    MLLLFIVFVLGAVTVIAVEAVGVVFLIRWLNRRVAREVDKAKPDGSLSSTGDFDFSLYLK  60

Query  347  QGIVWILDLEKIPRA-PVDKALGQKKSKKEVLEVSPIQKYAKIKDHSLFLLESDGSNTEI  523
            QGIVW+L+ E+IP+A PVDKA+ Q+KSKKE+LEV+P QK+A+IKDH L L ESDGS+ EI
Sbjct  61   QGIVWVLESERIPKALPVDKAVTQQKSKKEILEVTPTQKFAQIKDHHLVLTESDGSHVEI  120

Query  524  QLRGCTIAAVSATGLSSRKWAKRYPIKVESKSSAIYKGSRTFYIYLETSWDKESWCKALR  703
             L+GC IAAVSA+ LS+RKWAKRYPIK+E ++S  Y+GSR  YIYLET W+KE+WCK+LR
Sbjct  121  PLKGCIIAAVSASSLSTRKWAKRYPIKIECRASTSYEGSRILYIYLETCWEKEAWCKSLR  180

Query  704  LAS  712
            LAS
Sbjct  181  LAS  183



>ref|XP_004241487.1| PREDICTED: uncharacterized protein LOC101251098 [Solanum lycopersicum]
Length=830

 Score =   241 bits (614),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 116/183 (63%), Positives = 144/183 (79%), Gaps = 1/183 (1%)
 Frame = +2

Query  167  MWQFVLVFILGALTVVGVEAAAAVFLIRWLSRRLSREVDKAKVSAELSSPPGLDPSYYNK  346
            M    +VF+LGA+TV+ +EA   V+LIRWL+RRL+REVDKAK    LSS    D S Y K
Sbjct  1    MLLLFIVFVLGAVTVIAIEAVCVVYLIRWLNRRLAREVDKAKPDGSLSSTEDFDFSLYLK  60

Query  347  QGIVWILDLEKIPRA-PVDKALGQKKSKKEVLEVSPIQKYAKIKDHSLFLLESDGSNTEI  523
            QG VW+L+ E+IP+A PVDKA+ Q+KSKKEVLEV+P QK+A+IKDH L   ESDGS+ EI
Sbjct  61   QGTVWVLESERIPKALPVDKAVTQQKSKKEVLEVTPTQKFAQIKDHHLVFTESDGSHVEI  120

Query  524  QLRGCTIAAVSATGLSSRKWAKRYPIKVESKSSAIYKGSRTFYIYLETSWDKESWCKALR  703
             L+GC IAAVSA+ LS+RKWAKRYPIK+E ++S   +GSR  YIYLET W+KE+WCK+LR
Sbjct  121  PLKGCIIAAVSASSLSTRKWAKRYPIKIECRASTSCEGSRILYIYLETCWEKEAWCKSLR  180

Query  704  LAS  712
            LAS
Sbjct  181  LAS  183



>ref|XP_009594854.1| PREDICTED: testis-expressed sequence 2 protein-like isoform X2 
[Nicotiana tomentosiformis]
Length=826

 Score =   219 bits (559),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 114/183 (62%), Positives = 144/183 (79%), Gaps = 7/183 (4%)
 Frame = +2

Query  167  MWQFVLVFILGALTVVGVEAAAAVFLIRWLSRRLSREVDKAKVSAELSSPPGLDPSYYNK  346
            M    +VF+LGA+TV+ VEA   V LIRWL+RR++REVDKAK   +       D S + K
Sbjct  1    MLLLFIVFVLGAVTVLAVEAVGVVLLIRWLNRRVAREVDKAKPDGDF------DFSLHQK  54

Query  347  QGIVWILDLEKIPRA-PVDKALGQKKSKKEVLEVSPIQKYAKIKDHSLFLLESDGSNTEI  523
            QGIVW+L+ E++P+A PVDKAL Q+K KKE+LEV+P QK+A+IKDH L L ESDGS+ EI
Sbjct  55   QGIVWVLESERLPKAFPVDKALKQQKVKKEILEVTPTQKFAQIKDHYLVLTESDGSHVEI  114

Query  524  QLRGCTIAAVSATGLSSRKWAKRYPIKVESKSSAIYKGSRTFYIYLETSWDKESWCKALR  703
             L+GC IAAVSA+ LSSRKWAKRYPIK+ES++S +Y+GSR  Y YLET W+KE+WCK+LR
Sbjct  115  LLKGCMIAAVSASSLSSRKWAKRYPIKIESRASTLYEGSRILYFYLETCWEKEAWCKSLR  174

Query  704  LAS  712
            LAS
Sbjct  175  LAS  177



>ref|XP_009594853.1| PREDICTED: testis-expressed sequence 2 protein-like isoform X1 
[Nicotiana tomentosiformis]
Length=830

 Score =   219 bits (559),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 114/183 (62%), Positives = 144/183 (79%), Gaps = 7/183 (4%)
 Frame = +2

Query  167  MWQFVLVFILGALTVVGVEAAAAVFLIRWLSRRLSREVDKAKVSAELSSPPGLDPSYYNK  346
            M    +VF+LGA+TV+ VEA   V LIRWL+RR++REVDKAK   +       D S + K
Sbjct  1    MLLLFIVFVLGAVTVLAVEAVGVVLLIRWLNRRVAREVDKAKPDGDF------DFSLHQK  54

Query  347  QGIVWILDLEKIPRA-PVDKALGQKKSKKEVLEVSPIQKYAKIKDHSLFLLESDGSNTEI  523
            QGIVW+L+ E++P+A PVDKAL Q+K KKE+LEV+P QK+A+IKDH L L ESDGS+ EI
Sbjct  55   QGIVWVLESERLPKAFPVDKALKQQKVKKEILEVTPTQKFAQIKDHYLVLTESDGSHVEI  114

Query  524  QLRGCTIAAVSATGLSSRKWAKRYPIKVESKSSAIYKGSRTFYIYLETSWDKESWCKALR  703
             L+GC IAAVSA+ LSSRKWAKRYPIK+ES++S +Y+GSR  Y YLET W+KE+WCK+LR
Sbjct  115  LLKGCMIAAVSASSLSSRKWAKRYPIKIESRASTLYEGSRILYFYLETCWEKEAWCKSLR  174

Query  704  LAS  712
            LAS
Sbjct  175  LAS  177



>ref|XP_009761973.1| PREDICTED: uncharacterized protein LOC104214066 isoform X2 [Nicotiana 
sylvestris]
Length=827

 Score =   213 bits (541),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 118/183 (64%), Positives = 147/183 (80%), Gaps = 1/183 (1%)
 Frame = +2

Query  167  MWQFVLVFILGALTVVGVEAAAAVFLIRWLSRRLSREVDKAKVSAELSSPPGLDPSYYNK  346
            M    +VF+LGA+TV+ VEA   V LIRWL+RR++REVDKAK    LSS    D S + K
Sbjct  1    MLLLFIVFVLGAVTVLAVEAVGVVLLIRWLNRRVAREVDKAKPDGSLSSLEDFDFSLHQK  60

Query  347  QGIVWILDLEKIPRA-PVDKALGQKKSKKEVLEVSPIQKYAKIKDHSLFLLESDGSNTEI  523
            QGIVW+L+ E+IP+A P DKAL Q+K+KKE+LEV+P QK+A+IKDH L L ESDGS+ EI
Sbjct  61   QGIVWVLESERIPKAFPADKALKQQKAKKELLEVTPTQKFAQIKDHYLVLTESDGSHVEI  120

Query  524  QLRGCTIAAVSATGLSSRKWAKRYPIKVESKSSAIYKGSRTFYIYLETSWDKESWCKALR  703
             L+GC IAAVSA+ LSSRKWAKRYPIK+ES++S +Y+GSR  YIYLET W+KE+WCK+LR
Sbjct  121  LLKGCIIAAVSASSLSSRKWAKRYPIKIESRASTLYEGSRILYIYLETCWEKEAWCKSLR  180

Query  704  LAS  712
            LAS
Sbjct  181  LAS  183



>ref|XP_009761972.1| PREDICTED: uncharacterized protein LOC104214066 isoform X1 [Nicotiana 
sylvestris]
Length=831

 Score =   212 bits (540),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 118/183 (64%), Positives = 147/183 (80%), Gaps = 1/183 (1%)
 Frame = +2

Query  167  MWQFVLVFILGALTVVGVEAAAAVFLIRWLSRRLSREVDKAKVSAELSSPPGLDPSYYNK  346
            M    +VF+LGA+TV+ VEA   V LIRWL+RR++REVDKAK    LSS    D S + K
Sbjct  1    MLLLFIVFVLGAVTVLAVEAVGVVLLIRWLNRRVAREVDKAKPDGSLSSLEDFDFSLHQK  60

Query  347  QGIVWILDLEKIPRA-PVDKALGQKKSKKEVLEVSPIQKYAKIKDHSLFLLESDGSNTEI  523
            QGIVW+L+ E+IP+A P DKAL Q+K+KKE+LEV+P QK+A+IKDH L L ESDGS+ EI
Sbjct  61   QGIVWVLESERIPKAFPADKALKQQKAKKELLEVTPTQKFAQIKDHYLVLTESDGSHVEI  120

Query  524  QLRGCTIAAVSATGLSSRKWAKRYPIKVESKSSAIYKGSRTFYIYLETSWDKESWCKALR  703
             L+GC IAAVSA+ LSSRKWAKRYPIK+ES++S +Y+GSR  YIYLET W+KE+WCK+LR
Sbjct  121  LLKGCIIAAVSASSLSSRKWAKRYPIKIESRASTLYEGSRILYIYLETCWEKEAWCKSLR  180

Query  704  LAS  712
            LAS
Sbjct  181  LAS  183



>ref|XP_011072097.1| PREDICTED: uncharacterized protein LOC105157385 [Sesamum indicum]
 ref|XP_011072098.1| PREDICTED: uncharacterized protein LOC105157385 [Sesamum indicum]
Length=793

 Score =   209 bits (532),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 103/180 (57%), Positives = 135/180 (75%), Gaps = 1/180 (1%)
 Frame = +2

Query  176  FVLVFILGALTVVGVEAAAAVFLIRWLSRRLSREVDKAKVSAELSSPPGLDPSYYNKQGI  355
             V  FI GALT+V +EA     LIR L+R++ RE  K+K +   SSP   + S Y KQG 
Sbjct  5    LVSAFITGALTIVIMEAVGLWILIRHLTRKVEREEIKSKAATSFSSPGEPNSSLYEKQGA  64

Query  356  VWILDLEKIPRAPV-DKALGQKKSKKEVLEVSPIQKYAKIKDHSLFLLESDGSNTEIQLR  532
            +W+L+ +K+P++ + DK   +++ +KE+LEV+P++KYA+I+DH L LLESDGS  +I L 
Sbjct  65   LWVLEPDKVPKSGLEDKVPTEQRRRKEILEVTPVRKYARIRDHYLILLESDGSCVQILLN  124

Query  533  GCTIAAVSATGLSSRKWAKRYPIKVESKSSAIYKGSRTFYIYLETSWDKESWCKALRLAS  712
            GCTI  VS T L+S+KWAKRYPIKVES+ SAIYKG +T YIYLETSW+KESWCKALRLAS
Sbjct  125  GCTIVTVSGTSLASKKWAKRYPIKVESRDSAIYKGCKTIYIYLETSWEKESWCKALRLAS  184



>ref|XP_009631470.1| PREDICTED: testis-expressed sequence 2 protein-like isoform X2 
[Nicotiana tomentosiformis]
Length=810

 Score =   208 bits (529),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 114/184 (62%), Positives = 141/184 (77%), Gaps = 2/184 (1%)
 Frame = +2

Query  167  MWQFVLVFILGALTVVGVEAAAAVFLIRWLSRRLSREVDKAKVSAE-LSSPPGLDPSYYN  343
            M   + VF+LG +TV+ VEA   V LI    RRLSR+  K K + E L     +DPS+Y 
Sbjct  1    MMLMLTVFVLGGVTVLAVEAVGIVMLIWCFMRRLSRQGGKGKPTEESLPFAGDIDPSFYK  60

Query  344  KQGIVWILDLEKIPR-APVDKALGQKKSKKEVLEVSPIQKYAKIKDHSLFLLESDGSNTE  520
            KQG VW+L+ E+IP+ + VDKA  Q+K++KE+LEV P+QK+ KIKDHSL L ESDGS TE
Sbjct  61   KQGKVWVLESERIPKVSNVDKATKQQKAQKEILEVIPVQKFGKIKDHSLILTESDGSRTE  120

Query  521  IQLRGCTIAAVSATGLSSRKWAKRYPIKVESKSSAIYKGSRTFYIYLETSWDKESWCKAL  700
            I L+GC +AAVSA+ LSSRKWAK+YPIK+E+ +SAIYKGS  FYIYLETSW+KESWCKAL
Sbjct  121  IPLKGCMVAAVSASSLSSRKWAKKYPIKIENGASAIYKGSSMFYIYLETSWEKESWCKAL  180

Query  701  RLAS  712
            RLAS
Sbjct  181  RLAS  184



>ref|XP_009631469.1| PREDICTED: testis-expressed sequence 2 protein-like isoform X1 
[Nicotiana tomentosiformis]
Length=815

 Score =   208 bits (529),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 114/184 (62%), Positives = 141/184 (77%), Gaps = 2/184 (1%)
 Frame = +2

Query  167  MWQFVLVFILGALTVVGVEAAAAVFLIRWLSRRLSREVDKAKVSAE-LSSPPGLDPSYYN  343
            M   + VF+LG +TV+ VEA   V LI    RRLSR+  K K + E L     +DPS+Y 
Sbjct  1    MMLMLTVFVLGGVTVLAVEAVGIVMLIWCFMRRLSRQGGKGKPTEESLPFAGDIDPSFYK  60

Query  344  KQGIVWILDLEKIPR-APVDKALGQKKSKKEVLEVSPIQKYAKIKDHSLFLLESDGSNTE  520
            KQG VW+L+ E+IP+ + VDKA  Q+K++KE+LEV P+QK+ KIKDHSL L ESDGS TE
Sbjct  61   KQGKVWVLESERIPKVSNVDKATKQQKAQKEILEVIPVQKFGKIKDHSLILTESDGSRTE  120

Query  521  IQLRGCTIAAVSATGLSSRKWAKRYPIKVESKSSAIYKGSRTFYIYLETSWDKESWCKAL  700
            I L+GC +AAVSA+ LSSRKWAK+YPIK+E+ +SAIYKGS  FYIYLETSW+KESWCKAL
Sbjct  121  IPLKGCMVAAVSASSLSSRKWAKKYPIKIENGASAIYKGSSMFYIYLETSWEKESWCKAL  180

Query  701  RLAS  712
            RLAS
Sbjct  181  RLAS  184



>ref|XP_009789863.1| PREDICTED: uncharacterized protein LOC104237408 isoform X2 [Nicotiana 
sylvestris]
Length=814

 Score =   203 bits (517),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 112/184 (61%), Positives = 140/184 (76%), Gaps = 2/184 (1%)
 Frame = +2

Query  167  MWQFVLVFILGALTVVGVEAAAAVFLIRWLSRRLSREVDKAKVSAE-LSSPPGLDPSYYN  343
            M   + VF+LG +TV+ VEA   V LI    RR+SR V K K + E L     +DPS+Y 
Sbjct  1    MMLLLTVFVLGGVTVLAVEAVGIVILIWCFMRRVSRRVGKGKPTEESLPFAGDIDPSFYK  60

Query  344  KQGIVWILDLEKIPR-APVDKALGQKKSKKEVLEVSPIQKYAKIKDHSLFLLESDGSNTE  520
            KQGIVW+L+ EKIP+ +  DKA  Q+K++KE+LEV P +K+ KIKDHSL L +SDGS TE
Sbjct  61   KQGIVWVLESEKIPKVSNGDKATKQQKAQKEMLEVIPARKFGKIKDHSLILTDSDGSRTE  120

Query  521  IQLRGCTIAAVSATGLSSRKWAKRYPIKVESKSSAIYKGSRTFYIYLETSWDKESWCKAL  700
            I L+GC ++AVSA+ LSSRKWAK+YPIK+E+ +SAIYKGS  FYIYLETSW+KESWCKAL
Sbjct  121  IPLKGCMVSAVSASSLSSRKWAKKYPIKIENGASAIYKGSGIFYIYLETSWEKESWCKAL  180

Query  701  RLAS  712
            RLAS
Sbjct  181  RLAS  184



>ref|XP_009789860.1| PREDICTED: uncharacterized protein LOC104237408 isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009789861.1| PREDICTED: uncharacterized protein LOC104237408 isoform X1 [Nicotiana 
sylvestris]
Length=819

 Score =   203 bits (517),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 112/184 (61%), Positives = 140/184 (76%), Gaps = 2/184 (1%)
 Frame = +2

Query  167  MWQFVLVFILGALTVVGVEAAAAVFLIRWLSRRLSREVDKAKVSAE-LSSPPGLDPSYYN  343
            M   + VF+LG +TV+ VEA   V LI    RR+SR V K K + E L     +DPS+Y 
Sbjct  1    MMLLLTVFVLGGVTVLAVEAVGIVILIWCFMRRVSRRVGKGKPTEESLPFAGDIDPSFYK  60

Query  344  KQGIVWILDLEKIPR-APVDKALGQKKSKKEVLEVSPIQKYAKIKDHSLFLLESDGSNTE  520
            KQGIVW+L+ EKIP+ +  DKA  Q+K++KE+LEV P +K+ KIKDHSL L +SDGS TE
Sbjct  61   KQGIVWVLESEKIPKVSNGDKATKQQKAQKEMLEVIPARKFGKIKDHSLILTDSDGSRTE  120

Query  521  IQLRGCTIAAVSATGLSSRKWAKRYPIKVESKSSAIYKGSRTFYIYLETSWDKESWCKAL  700
            I L+GC ++AVSA+ LSSRKWAK+YPIK+E+ +SAIYKGS  FYIYLETSW+KESWCKAL
Sbjct  121  IPLKGCMVSAVSASSLSSRKWAKKYPIKIENGASAIYKGSGIFYIYLETSWEKESWCKAL  180

Query  701  RLAS  712
            RLAS
Sbjct  181  RLAS  184



>ref|XP_010317540.1| PREDICTED: uncharacterized protein LOC101250278 isoform X1 [Solanum 
lycopersicum]
Length=812

 Score =   203 bits (516),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 113/184 (61%), Positives = 138/184 (75%), Gaps = 6/184 (3%)
 Frame = +2

Query  167  MWQFVLVFILGALTVVGVEAAAAVFLIRWLSRRLSREVDKAKV-SAELSSPPGLDPSYYN  343
            M   + VF+LG + V+ VEA      I WL RR    VDK K     LS    +DPS+YN
Sbjct  2    MIMMLAVFVLGGIFVLAVEAVGIAIFIWWLMRR----VDKGKQPQGSLSFAGDIDPSFYN  57

Query  344  KQGIVWILDLEKIPRA-PVDKALGQKKSKKEVLEVSPIQKYAKIKDHSLFLLESDGSNTE  520
            KQGIVW+L+ E+I +A   DKA  Q K++KE+LEV P QK+ KIK+HSL L+ESDGS+TE
Sbjct  58   KQGIVWVLESERILKALNTDKATKQNKAQKEILEVIPSQKFGKIKNHSLILIESDGSHTE  117

Query  521  IQLRGCTIAAVSATGLSSRKWAKRYPIKVESKSSAIYKGSRTFYIYLETSWDKESWCKAL  700
            I L+GC +AAVSA+ LSSRKWAKRYPIKVES +SA+YKGSR FY+YLETSW+KE+WCKAL
Sbjct  118  IPLKGCMVAAVSASSLSSRKWAKRYPIKVESGASAVYKGSRIFYLYLETSWEKEAWCKAL  177

Query  701  RLAS  712
            RLAS
Sbjct  178  RLAS  181



>gb|EPS62479.1| hypothetical protein M569_12311 [Genlisea aurea]
Length=355

 Score =   190 bits (483),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 99/182 (54%), Positives = 134/182 (74%), Gaps = 8/182 (4%)
 Frame = +2

Query  176  FVLVFILGALTVVGVEAAAAVFLIRWLSRRLSREVDKAKVSAE--LSSPPGLDPSYYNKQ  349
             V  F+LGALTVV VE      LIR LSR+L R  D     +E  L+S   +D     KQ
Sbjct  6    LVTAFLLGALTVVAVELVMLGILIRRLSRKLERHDDTPPADSETDLTSSSAVD-----KQ  60

Query  350  GIVWILDLEKIPRAPV-DKALGQKKSKKEVLEVSPIQKYAKIKDHSLFLLESDGSNTEIQ  526
            G +W+L+ EK+ ++ + DK   +++ +K+++EV+P++KYA++KDHSL LLESDGS+ +  
Sbjct  61   GFIWLLEPEKLLKSALQDKTTSERRKRKDIIEVTPVRKYARVKDHSLILLESDGSSVKFS  120

Query  527  LRGCTIAAVSATGLSSRKWAKRYPIKVESKSSAIYKGSRTFYIYLETSWDKESWCKALRL  706
            L GCT+ AVS++ LSSRKWAKRYPIKVES +SA+YKGS+  YIYLET+W+KE+WCKALRL
Sbjct  121  LSGCTVVAVSSSSLSSRKWAKRYPIKVESNNSAVYKGSKIIYIYLETTWEKEAWCKALRL  180

Query  707  AS  712
            AS
Sbjct  181  AS  182



>ref|XP_010104942.1| hypothetical protein L484_004290 [Morus notabilis]
 gb|EXC02509.1| hypothetical protein L484_004290 [Morus notabilis]
Length=796

 Score =   188 bits (477),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 99/180 (55%), Positives = 135/180 (75%), Gaps = 6/180 (3%)
 Frame = +2

Query  176  FVLVFILGALTVVGVEAAAAVFLIRWLSRRLSREVDKAKVSAE-LSSPPGLDPSYYNKQG  352
            F L   +GA+ ++G EA    FL+  + +RLSR+ +++    E L     LD S+ NKQG
Sbjct  7    FGLGIAVGAVAILGAEA----FLLFVVVKRLSRKTEQSDRKIEHLDHNQSLDYSH-NKQG  61

Query  353  IVWILDLEKIPRAPVDKALGQKKSKKEVLEVSPIQKYAKIKDHSLFLLESDGSNTEIQLR  532
            +VW+L+  K+P+  +DKA  ++K KKE  EVSP++K+A+IKD SL L +S+GS T ++L+
Sbjct  62   VVWVLESNKVPKDWLDKAPKEQKRKKEFFEVSPVRKHARIKDQSLILTDSNGSKTTMKLK  121

Query  533  GCTIAAVSATGLSSRKWAKRYPIKVESKSSAIYKGSRTFYIYLETSWDKESWCKALRLAS  712
            GC+I AVSA+ LSSRKWAKR+PIK+E+K SAIYK S+T YIYLETSW+KESWCKALRLAS
Sbjct  122  GCSIEAVSASMLSSRKWAKRFPIKLENKVSAIYKDSKTVYIYLETSWEKESWCKALRLAS  181



>ref|XP_008240431.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103338940 
[Prunus mume]
Length=807

 Score =   187 bits (474),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 100/193 (52%), Positives = 129/193 (67%), Gaps = 11/193 (6%)
 Frame = +2

Query  167  MWQFVL----VFILGALTVVGVEAAAAVFLIRWLSRRLSREVDKAKVS--AELSSPPGLD  328
            MW  +L     F+ G + ++  E      +I  L  +  +  +K  +    E+ S P L 
Sbjct  1    MWSCLLWLSVGFVAGVVAILAAEVLVVHVVINRLQHKTKQHQEKEAIQKYQEIESKPDLH  60

Query  329  PSY-----YNKQGIVWILDLEKIPRAPVDKALGQKKSKKEVLEVSPIQKYAKIKDHSLFL  493
            P         K+G VW+L+ EK+P+   +KAL ++K KKE  EVSPI+KYAKIK+  L L
Sbjct  61   PRQALEFASIKEGAVWVLEPEKVPKNWQEKALREQKRKKEFFEVSPIKKYAKIKNQLLIL  120

Query  494  LESDGSNTEIQLRGCTIAAVSATGLSSRKWAKRYPIKVESKSSAIYKGSRTFYIYLETSW  673
            +ESDGS T IQL+GCTI AVSAT L SRKWAKR+PIK++SKS+ IYKGS+ FYIYLETSW
Sbjct  121  IESDGSQTAIQLKGCTIEAVSATSLPSRKWAKRFPIKLDSKSTIIYKGSKVFYIYLETSW  180

Query  674  DKESWCKALRLAS  712
            +KESWCKALRLAS
Sbjct  181  EKESWCKALRLAS  193



>ref|XP_007210364.1| hypothetical protein PRUPE_ppa001510mg [Prunus persica]
 gb|EMJ11563.1| hypothetical protein PRUPE_ppa001510mg [Prunus persica]
Length=811

 Score =   186 bits (472),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 100/193 (52%), Positives = 129/193 (67%), Gaps = 11/193 (6%)
 Frame = +2

Query  167  MWQFVL----VFILGALTVVGVEAAAAVFLIRWLSRRLSREVDKAKV--SAELSSPPGLD  328
            MW  +L     F+ G + ++  E      ++  L  +  +  +K  +  S E+ S P L 
Sbjct  1    MWSCLLWLSVGFVAGVVAILAAEVLVVYVVVNRLQHKTKQHQEKEAIQKSQEIESKPDLH  60

Query  329  PSY-----YNKQGIVWILDLEKIPRAPVDKALGQKKSKKEVLEVSPIQKYAKIKDHSLFL  493
            P         K+G VW+LD EK+P+   +KAL ++K KKE  EVSP++KYAKIK+  L L
Sbjct  61   PRQALEFASIKEGAVWVLDPEKVPKNWQEKALREQKRKKEFFEVSPVKKYAKIKNQLLIL  120

Query  494  LESDGSNTEIQLRGCTIAAVSATGLSSRKWAKRYPIKVESKSSAIYKGSRTFYIYLETSW  673
             ESDGS T IQL+GCTI AVSAT L SRKWAKR+PIK++SKS+ IYKGS+ FYIYLETSW
Sbjct  121  TESDGSQTAIQLKGCTIEAVSATSLPSRKWAKRFPIKLDSKSTIIYKGSKVFYIYLETSW  180

Query  674  DKESWCKALRLAS  712
            +KESWCKALRLAS
Sbjct  181  EKESWCKALRLAS  193



>ref|XP_010537536.1| PREDICTED: testis-expressed sequence 2 protein [Tarenaya hassleriana]
Length=771

 Score =   181 bits (459),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 95/190 (50%), Positives = 131/190 (69%), Gaps = 19/190 (10%)
 Frame = +2

Query  176  FVLVFILGALTVVGVEAAAAVFLIRWLSRRLSREVDKAKVSAELSSPPG-----LDPSY-  337
            FV  F+LG L +V  EAA  V+L+R LSRR        K  +E +  PG     LDP   
Sbjct  9    FVSGFVLGILAIVAAEAAGLVYLVRRLSRR--------KDLSESNLDPGQSFKDLDPRQS  60

Query  338  ----YNKQGIVWILDL-EKIPRAPVDKALGQKKSKKEVLEVSPIQKYAKIKDHSLFLLES  502
                 NKQG +W+L+  E + +   DK   ++K +K+ +EV P++++A+IK+H L L ++
Sbjct  61   VDFCLNKQGAIWVLEFDESLKKWTNDKLPKEQKRRKDFVEVHPVRRFARIKEHKLILSDA  120

Query  503  DGSNTEIQLRGCTIAAVSATGLSSRKWAKRYPIKVESKSSAIYKGSRTFYIYLETSWDKE  682
            DGS T + L+GC++ AVSATGL SRKWAK++PIKVESK+SA+YKGS+ F IYLETSW+KE
Sbjct  121  DGSQTTVPLKGCSVEAVSATGLQSRKWAKKFPIKVESKTSALYKGSQMFCIYLETSWEKE  180

Query  683  SWCKALRLAS  712
            +WCKALRLA+
Sbjct  181  AWCKALRLAA  190



>ref|XP_006351568.1| PREDICTED: uncharacterized protein LOC102588484 [Solanum tuberosum]
Length=815

 Score =   178 bits (452),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 87/128 (68%), Positives = 108/128 (84%), Gaps = 1/128 (1%)
 Frame = +2

Query  332  SYYNKQGIVWILDLEKIPRA-PVDKALGQKKSKKEVLEVSPIQKYAKIKDHSLFLLESDG  508
            S  ++QGIVW+L+ E+I +A   DKA  Q K++KE+LEV P QK+ KIK +SL L+ESDG
Sbjct  56   STTSRQGIVWVLESERILKALNTDKATKQHKAQKEILEVIPSQKFGKIKKNSLILIESDG  115

Query  509  SNTEIQLRGCTIAAVSATGLSSRKWAKRYPIKVESKSSAIYKGSRTFYIYLETSWDKESW  688
            S+TEI L+GC +AAVSA+ LS+RKWAKRYPIKVES +SA+YKGSR FYIYLETSW+KE+W
Sbjct  116  SHTEIPLKGCMVAAVSASSLSTRKWAKRYPIKVESGASAVYKGSRIFYIYLETSWEKEAW  175

Query  689  CKALRLAS  712
            CKALRLAS
Sbjct  176  CKALRLAS  183



>emb|CBI26392.3| unnamed protein product [Vitis vinifera]
Length=751

 Score =   178 bits (451),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 99/183 (54%), Positives = 128/183 (70%), Gaps = 2/183 (1%)
 Frame = +2

Query  167  MWQFVLVFILGALTVVGVEAAAAVFLIRWLSRRLSREVDKAKVSAELSSPPGLDPSYYNK  346
            M+   + F+LGA T++ V+    + LI  L     ++ +   ++ +L     LD S Y K
Sbjct  2    MFTLFVGFLLGAFTILLVQVLGLLLLIGRLGHGRKQDSESPLLTRDLDLHQSLD-SAYKK  60

Query  347  QGIVWILDLEKIPRAP-VDKALGQKKSKKEVLEVSPIQKYAKIKDHSLFLLESDGSNTEI  523
            QG++WIL+ EK+P  P + K     K KKE+LEV P++KYA+IKD SL L ESDGS T I
Sbjct  61   QGVIWILEPEKVPTFPQIGKIQRDAKKKKEILEVFPMRKYARIKDRSLILTESDGSYTAI  120

Query  524  QLRGCTIAAVSATGLSSRKWAKRYPIKVESKSSAIYKGSRTFYIYLETSWDKESWCKALR  703
             L+GCTI AVSAT L S+KWAK+YPIKVESK+  IY GS+TFY+YLETSW+KESWCKALR
Sbjct  121  PLKGCTIVAVSATDLPSKKWAKKYPIKVESKTLEIYNGSKTFYLYLETSWEKESWCKALR  180

Query  704  LAS  712
            LAS
Sbjct  181  LAS  183



>ref|XP_006372281.1| hypothetical protein POPTR_0018s14940g [Populus trichocarpa]
 gb|ERP50078.1| hypothetical protein POPTR_0018s14940g [Populus trichocarpa]
Length=776

 Score =   178 bits (451),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 96/182 (53%), Positives = 128/182 (70%), Gaps = 9/182 (5%)
 Frame = +2

Query  188  FILGALTVVGVEAAAAVFLIRWLSRRLSREVDKAKVSAELSSP-PGLDPS---YY--NKQ  349
            F+ G LT+V ++A    F I+ L+R+    +   + ++  SSP   LDP    YY  NK+
Sbjct  12   FVSGLLTLVALQALGVYFFIKRLNRKT--HLQPQQQASHSSSPHQDLDPQQSLYYAFNKK  69

Query  350  GIVWILDLEKIPRA-PVDKALGQKKSKKEVLEVSPIQKYAKIKDHSLFLLESDGSNTEIQ  526
            GIVW+L+ +K+P   PV+K    +K K+E+LEV+PI+K+A IKD SL L +S GS+  I 
Sbjct  70   GIVWVLESDKVPGNWPVEKVPKDQKRKREILEVTPIRKHANIKDRSLILTDSGGSHRAIP  129

Query  527  LRGCTIAAVSATGLSSRKWAKRYPIKVESKSSAIYKGSRTFYIYLETSWDKESWCKALRL  706
            L GC I AVSAT L SRKWA+R+PIKVESK+S IY  S+T +I+LETSW+KESWCKALRL
Sbjct  130  LTGCVIEAVSATSLPSRKWAERFPIKVESKTSPIYNASKTVFIFLETSWEKESWCKALRL  189

Query  707  AS  712
            AS
Sbjct  190  AS  191



>ref|XP_010662020.1| PREDICTED: testis-expressed sequence 2 protein-like isoform X1 
[Vitis vinifera]
Length=798

 Score =   177 bits (450),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 99/183 (54%), Positives = 128/183 (70%), Gaps = 2/183 (1%)
 Frame = +2

Query  167  MWQFVLVFILGALTVVGVEAAAAVFLIRWLSRRLSREVDKAKVSAELSSPPGLDPSYYNK  346
            M+   + F+LGA T++ V+    + LI  L     ++ +   ++ +L     LD S Y K
Sbjct  2    MFTLFVGFLLGAFTILLVQVLGLLLLIGRLGHGRKQDSESPLLTRDLDLHQSLD-SAYKK  60

Query  347  QGIVWILDLEKIPRAP-VDKALGQKKSKKEVLEVSPIQKYAKIKDHSLFLLESDGSNTEI  523
            QG++WIL+ EK+P  P + K     K KKE+LEV P++KYA+IKD SL L ESDGS T I
Sbjct  61   QGVIWILEPEKVPTFPQIGKIQRDAKKKKEILEVFPMRKYARIKDRSLILTESDGSYTAI  120

Query  524  QLRGCTIAAVSATGLSSRKWAKRYPIKVESKSSAIYKGSRTFYIYLETSWDKESWCKALR  703
             L+GCTI AVSAT L S+KWAK+YPIKVESK+  IY GS+TFY+YLETSW+KESWCKALR
Sbjct  121  PLKGCTIVAVSATDLPSKKWAKKYPIKVESKTLEIYNGSKTFYLYLETSWEKESWCKALR  180

Query  704  LAS  712
            LAS
Sbjct  181  LAS  183



>ref|XP_010662022.1| PREDICTED: uncharacterized protein LOC100244234 isoform X2 [Vitis 
vinifera]
Length=796

 Score =   177 bits (450),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 99/183 (54%), Positives = 128/183 (70%), Gaps = 2/183 (1%)
 Frame = +2

Query  167  MWQFVLVFILGALTVVGVEAAAAVFLIRWLSRRLSREVDKAKVSAELSSPPGLDPSYYNK  346
            M+   + F+LGA T++ V+    + LI  L     ++ +   ++ +L     LD S Y K
Sbjct  2    MFTLFVGFLLGAFTILLVQVLGLLLLIGRLGHGRKQDSESPLLTRDLDLHQSLD-SAYKK  60

Query  347  QGIVWILDLEKIPRAP-VDKALGQKKSKKEVLEVSPIQKYAKIKDHSLFLLESDGSNTEI  523
            QG++WIL+ EK+P  P + K     K KKE+LEV P++KYA+IKD SL L ESDGS T I
Sbjct  61   QGVIWILEPEKVPTFPQIGKIQRDAKKKKEILEVFPMRKYARIKDRSLILTESDGSYTAI  120

Query  524  QLRGCTIAAVSATGLSSRKWAKRYPIKVESKSSAIYKGSRTFYIYLETSWDKESWCKALR  703
             L+GCTI AVSAT L S+KWAK+YPIKVESK+  IY GS+TFY+YLETSW+KESWCKALR
Sbjct  121  PLKGCTIVAVSATDLPSKKWAKKYPIKVESKTLEIYNGSKTFYLYLETSWEKESWCKALR  180

Query  704  LAS  712
            LAS
Sbjct  181  LAS  183



>ref|XP_011017543.1| PREDICTED: uncharacterized protein LOC105120863 [Populus euphratica]
 ref|XP_011017544.1| PREDICTED: uncharacterized protein LOC105120863 [Populus euphratica]
 ref|XP_011017545.1| PREDICTED: uncharacterized protein LOC105120863 [Populus euphratica]
Length=797

 Score =   175 bits (444),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 95/182 (52%), Positives = 126/182 (69%), Gaps = 9/182 (5%)
 Frame = +2

Query  188  FILGALTVVGVEAAAAVFLIRWLSRRLSREVDKAKVSAELSSP-PGLDPS---YY--NKQ  349
            F+ G LT+V ++A    F I+ L+R+    +   + ++  SSP   LDP    YY  NK+
Sbjct  12   FLSGLLTLVALQALGVYFFIKRLNRKT--HLQPQQQASHSSSPHQDLDPQQSLYYAFNKK  69

Query  350  GIVWILDLEKIPRA-PVDKALGQKKSKKEVLEVSPIQKYAKIKDHSLFLLESDGSNTEIQ  526
            GIVW+L+ +K+P   P +K    +K K+E+LEV+PI+K+A IKD SL L +S GS+  I 
Sbjct  70   GIVWVLESDKVPGNWPAEKVPKDQKRKREILEVTPIRKHANIKDRSLILTDSGGSHRAIP  129

Query  527  LRGCTIAAVSATGLSSRKWAKRYPIKVESKSSAIYKGSRTFYIYLETSWDKESWCKALRL  706
            L GC I AVSAT L SRKWA R+PIKVESK+S IY  S+T +I+LETSW+KESWCKALRL
Sbjct  130  LTGCVIEAVSATSLPSRKWAARFPIKVESKTSPIYNASKTVFIFLETSWEKESWCKALRL  189

Query  707  AS  712
            AS
Sbjct  190  AS  191



>gb|KFK41758.1| hypothetical protein AALP_AA2G168400 [Arabis alpina]
Length=764

 Score =   174 bits (442),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 87/182 (48%), Positives = 125/182 (69%), Gaps = 8/182 (4%)
 Frame = +2

Query  176  FVLVFILGALTVVGVEAAAAVFLIRWLSRRLSREVDKAKVSAELSSPPGLDPSYYNKQGI  355
            FV  F+LG L++V +E A  +F+++ L+R+ +        S   S P        NKQG+
Sbjct  9    FVSGFLLGILSIVAIEVAGFLFIVKRLNRKRN-----PHESNSNSDPTQSIDFTLNKQGV  63

Query  356  VWILDL-EKIPRAPVDKALG--QKKSKKEVLEVSPIQKYAKIKDHSLFLLESDGSNTEIQ  526
            +W+L+L E +     +  L   QKK + E+LEV P++++A+IKDH L L  +DGS T+I 
Sbjct  64   IWMLELDESLKDWTKENGLQKEQKKKRGEILEVHPVRRFARIKDHKLILTNADGSTTDIA  123

Query  527  LRGCTIAAVSATGLSSRKWAKRYPIKVESKSSAIYKGSRTFYIYLETSWDKESWCKALRL  706
            L+GC++ AVS + L +RKWAKR+PI++ESKSS +YKG+  FYIYLETSW+KESWCKALRL
Sbjct  124  LKGCSVDAVSGSALPTRKWAKRFPIQIESKSSVLYKGNHVFYIYLETSWEKESWCKALRL  183

Query  707  AS  712
            A+
Sbjct  184  AA  185



>ref|XP_010069545.1| PREDICTED: uncharacterized protein LOC104456447 isoform X1 [Eucalyptus 
grandis]
 gb|KCW57933.1| hypothetical protein EUGRSUZ_H00671 [Eucalyptus grandis]
Length=783

 Score =   174 bits (442),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 83/127 (65%), Positives = 103/127 (81%), Gaps = 0/127 (0%)
 Frame = +2

Query  332  SYYNKQGIVWILDLEKIPRAPVDKALGQKKSKKEVLEVSPIQKYAKIKDHSLFLLESDGS  511
            S   KQG VWIL+ E++P+  V+K   ++K KK+  E+SP++K+A IKDHSL L E+DGS
Sbjct  59   SLRRKQGDVWILEPERVPKNRVEKVQREQKKKKDFFEISPVRKHAIIKDHSLILTEADGS  118

Query  512  NTEIQLRGCTIAAVSATGLSSRKWAKRYPIKVESKSSAIYKGSRTFYIYLETSWDKESWC  691
             + + L+GC I AVSAT L SRKWAKRYPIK+ESKSSAIYKGS+ FYIYL+TSW+KESWC
Sbjct  119  PSAVLLKGCVIEAVSATDLPSRKWAKRYPIKLESKSSAIYKGSKVFYIYLDTSWEKESWC  178

Query  692  KALRLAS  712
            KALRLAS
Sbjct  179  KALRLAS  185



>ref|XP_010069546.1| PREDICTED: uncharacterized protein LOC104456447 isoform X2 [Eucalyptus 
grandis]
 gb|KCW57932.1| hypothetical protein EUGRSUZ_H00671 [Eucalyptus grandis]
Length=781

 Score =   174 bits (442),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 83/127 (65%), Positives = 103/127 (81%), Gaps = 0/127 (0%)
 Frame = +2

Query  332  SYYNKQGIVWILDLEKIPRAPVDKALGQKKSKKEVLEVSPIQKYAKIKDHSLFLLESDGS  511
            S   KQG VWIL+ E++P+  V+K   ++K KK+  E+SP++K+A IKDHSL L E+DGS
Sbjct  59   SLRRKQGDVWILEPERVPKNRVEKVQREQKKKKDFFEISPVRKHAIIKDHSLILTEADGS  118

Query  512  NTEIQLRGCTIAAVSATGLSSRKWAKRYPIKVESKSSAIYKGSRTFYIYLETSWDKESWC  691
             + + L+GC I AVSAT L SRKWAKRYPIK+ESKSSAIYKGS+ FYIYL+TSW+KESWC
Sbjct  119  PSAVLLKGCVIEAVSATDLPSRKWAKRYPIKLESKSSAIYKGSKVFYIYLDTSWEKESWC  178

Query  692  KALRLAS  712
            KALRLAS
Sbjct  179  KALRLAS  185



>ref|XP_010687270.1| PREDICTED: testis-expressed sequence 2 protein-like isoform X2 
[Beta vulgaris subsp. vulgaris]
 ref|XP_010687271.1| PREDICTED: testis-expressed sequence 2 protein-like isoform X3 
[Beta vulgaris subsp. vulgaris]
Length=771

 Score =   174 bits (441),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 94/188 (50%), Positives = 127/188 (68%), Gaps = 14/188 (7%)
 Frame = +2

Query  167  MWQFVLVFILGALTVVGVEAAAAVFLIRWLSRRLSREVDKAKVSAELSSPPG-LDP----  331
            M    L FILG L V+ +E    +F+IR L+     +  K+  S  ++SP   LDP    
Sbjct  3    MILLFLGFILGVLAVIALEGLVILFVIRRLT-----QTTKSTESVLVNSPQNTLDPGQSL  57

Query  332  -SYYNKQGIVWILDLEKIPRAPVDKALGQKKSKKEVLEVSPIQKYAKIKDHSLFLLESDG  508
             S   KQG VW+L+ +K P+ P   A  ++  KK++LEVSP+QK+A+IKD +L L E+DG
Sbjct  58   TSLCQKQGFVWVLEPDKHPKVP---ASAEQTRKKDILEVSPVQKHAEIKDRTLILTEADG  114

Query  509  SNTEIQLRGCTIAAVSATGLSSRKWAKRYPIKVESKSSAIYKGSRTFYIYLETSWDKESW  688
            S   I+L+GC + AVSAT   SRKWAKR+PIKVESK++A+Y+GS+ F IY ETS +KESW
Sbjct  115  SLATIKLKGCLVVAVSATTFPSRKWAKRFPIKVESKNTALYQGSKVFLIYAETSSEKESW  174

Query  689  CKALRLAS  712
            C+ALRLAS
Sbjct  175  CRALRLAS  182



>ref|XP_010687269.1| PREDICTED: testis-expressed sequence 2 protein-like isoform X1 
[Beta vulgaris subsp. vulgaris]
Length=787

 Score =   174 bits (441),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 94/188 (50%), Positives = 127/188 (68%), Gaps = 14/188 (7%)
 Frame = +2

Query  167  MWQFVLVFILGALTVVGVEAAAAVFLIRWLSRRLSREVDKAKVSAELSSPPG-LDP----  331
            M    L FILG L V+ +E    +F+IR L+     +  K+  S  ++SP   LDP    
Sbjct  3    MILLFLGFILGVLAVIALEGLVILFVIRRLT-----QTTKSTESVLVNSPQNTLDPGQSL  57

Query  332  -SYYNKQGIVWILDLEKIPRAPVDKALGQKKSKKEVLEVSPIQKYAKIKDHSLFLLESDG  508
             S   KQG VW+L+ +K P+ P   A  ++  KK++LEVSP+QK+A+IKD +L L E+DG
Sbjct  58   TSLCQKQGFVWVLEPDKHPKVP---ASAEQTRKKDILEVSPVQKHAEIKDRTLILTEADG  114

Query  509  SNTEIQLRGCTIAAVSATGLSSRKWAKRYPIKVESKSSAIYKGSRTFYIYLETSWDKESW  688
            S   I+L+GC + AVSAT   SRKWAKR+PIKVESK++A+Y+GS+ F IY ETS +KESW
Sbjct  115  SLATIKLKGCLVVAVSATTFPSRKWAKRFPIKVESKNTALYQGSKVFLIYAETSSEKESW  174

Query  689  CKALRLAS  712
            C+ALRLAS
Sbjct  175  CRALRLAS  182



>ref|XP_006848627.2| PREDICTED: testis-expressed sequence 2 protein [Amborella trichopoda]
Length=810

 Score =   174 bits (440),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 95/186 (51%), Positives = 124/186 (67%), Gaps = 6/186 (3%)
 Frame = +2

Query  167  MWQFVLVFILGALTVVGVEAAAAVFLIRWLSRRLSREVDKAKVSAELSSPPGLDPSYYNK  346
            M   +L + +GALTVV +EA A  F++R L +R  R  +    + EL +   L     NK
Sbjct  6    MISLLLCYFMGALTVVILEAVALFFVVRRLGQR-RRCPNSESCAPELDANQSLH-FLLNK  63

Query  347  QGIVWILDLEKIP----RAPVDKALGQKKSKKEVLEVSPIQKYAKIKDHSLFLLESDGSN  514
            QG++W+L+ +KIP      P  K+  + KSKKE +EV P++KYAKI+D +L L + DGS 
Sbjct  64   QGVIWVLEPDKIPMVFPNEPRSKSGKEPKSKKETVEVFPVKKYAKIQDRNLILTDLDGSE  123

Query  515  TEIQLRGCTIAAVSATGLSSRKWAKRYPIKVESKSSAIYKGSRTFYIYLETSWDKESWCK  694
              I+L GC I AVSA   SSRKWAKRYPI +ESK++AI  G +T YIYLETSW+KESWCK
Sbjct  124  AIIELEGCRIMAVSAGPSSSRKWAKRYPIILESKNAAILNGKKTCYIYLETSWEKESWCK  183

Query  695  ALRLAS  712
            ALRL S
Sbjct  184  ALRLTS  189



>ref|XP_012067294.1| PREDICTED: uncharacterized protein LOC105630166 [Jatropha curcas]
 gb|KDP46473.1| hypothetical protein JCGZ_08445 [Jatropha curcas]
Length=788

 Score =   172 bits (436),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 90/179 (50%), Positives = 124/179 (69%), Gaps = 1/179 (1%)
 Frame = +2

Query  176  FVLVFILGALTVVGVEAAAAVFLIRWLSRRLSREVDKAKVSAELSSPPGLDPSYYNKQGI  355
            F   F  GAL VV  EA      I+ L++++ +E  K+    +L     LD +Y NK+G+
Sbjct  7    FFCGFSFGALAVVAFEALGVYVFIKRLNQKIRKEEHKSSSHEDLDPHQSLDYAY-NKKGV  65

Query  356  VWILDLEKIPRAPVDKALGQKKSKKEVLEVSPIQKYAKIKDHSLFLLESDGSNTEIQLRG  535
            VW+L+ +K+P+  + +   ++  KK+  EV+P+++ A+IKD SL L +SDGS+  I L+ 
Sbjct  66   VWVLESDKLPKNWLAEKAPKEPKKKKFFEVNPVKRNARIKDRSLILTDSDGSHATIPLKS  125

Query  536  CTIAAVSATGLSSRKWAKRYPIKVESKSSAIYKGSRTFYIYLETSWDKESWCKALRLAS  712
            CTI AVSAT L SRKWAKR+PIKVESK+S IY  S+T YIYL+TSW+KESWCKALRLAS
Sbjct  126  CTIDAVSATDLPSRKWAKRFPIKVESKTSVIYNASKTIYIYLDTSWEKESWCKALRLAS  184



>ref|XP_007022967.1| Integral membrane protein conserved region (DUF2404), putative 
[Theobroma cacao]
 gb|EOY25589.1| Integral membrane protein conserved region (DUF2404), putative 
[Theobroma cacao]
Length=761

 Score =   172 bits (435),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 91/180 (51%), Positives = 127/180 (71%), Gaps = 10/180 (6%)
 Frame = +2

Query  176  FVLVFILGALTVVGVEAAAAVFLIRWLSRRLSREVDKAKVSAELSSPPGLDPSYYNKQGI  355
            F++   +G L +V VEA   +F++  L+R++ +E D A    +L +   LD +Y +KQGI
Sbjct  5    FIVGLFVGVLAIVSVEALGVLFVLNRLNRKIKKESD-ATQHPKLQTQQPLDFAY-SKQGI  62

Query  356  VWILDLEKIP-RAPVDKALGQKKSKKEVLEVSPIQKYAKIKDHSLFLLESDGSNTEIQLR  532
            VW+L+ EK+P R P       K+ K+ +LEVSP +K+ KI+ +SL L  SD S T I L+
Sbjct  63   VWVLEPEKVPPREP-------KRKKELLLEVSPSRKHGKIEGNSLILTHSDASRTTIPLK  115

Query  533  GCTIAAVSATGLSSRKWAKRYPIKVESKSSAIYKGSRTFYIYLETSWDKESWCKALRLAS  712
            GC I AVSAT L SRKWAK++PIK+E+++S IYKGS+  Y++LETSW+KESWCKALRLAS
Sbjct  116  GCVIEAVSATNLPSRKWAKKFPIKMENQTSLIYKGSKIVYLFLETSWEKESWCKALRLAS  175



>emb|CDX96454.1| BnaA07g30650D [Brassica napus]
Length=745

 Score =   169 bits (429),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 90/188 (48%), Positives = 131/188 (70%), Gaps = 18/188 (10%)
 Frame = +2

Query  170  WQFVLVFILGALTVVGVEAAAAVFLIRWLSRRLSREVDKAKVSAELSSPPGLDPSYYN--  343
            + FV  F+LG L VV  E AA ++L++ L+R+     D    +++ S PP L+P  +N  
Sbjct  7    FAFVTGFLLGLLAVVAAEVAAFLYLVKRLNRKQESSSDP---TSKGSDPPPLEPIDFNLN  63

Query  344  KQGIVWILDL-----EKIPRAPVDKALGQKKSKKEVLEVSPIQKYAKIKDHSLFLLESDG  508
            KQG++W+L+L     EK+P+        + K + + LEV P++K+A+IKDH L L ++D 
Sbjct  64   KQGVIWVLELDESLKEKLPK--------ETKKRNDHLEVHPVRKFARIKDHKLILTDTDS  115

Query  509  SNTEIQLRGCTIAAVSATGLSSRKWAKRYPIKVESKSSAIYKGSRTFYIYLETSWDKESW  688
            + T I L+GC++ AVS + L +RKWAKR+PI+VESK+S +YKG+R FYIYLETSW+KESW
Sbjct  116  NKTVITLKGCSVEAVSGSQLPTRKWAKRFPIQVESKTSNLYKGNRVFYIYLETSWEKESW  175

Query  689  CKALRLAS  712
            CKALRLA+
Sbjct  176  CKALRLAA  183



>emb|CDY26213.1| BnaA06g12040D [Brassica napus]
Length=779

 Score =   170 bits (430),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 88/181 (49%), Positives = 126/181 (70%), Gaps = 3/181 (2%)
 Frame = +2

Query  176  FVLVFILGALTVVGVEAAAAVFLIRWLSRRLSREVDKAKVSAELSSPPGLDPSYYNKQGI  355
            F+  F LG + V+G EAA  ++L+  L+R+    VD +K  ++ S+    +    NKQG 
Sbjct  9    FLSGFFLGIVAVLGAEAAGLMYLLNRLNRKSETRVD-SKPGSDQSTKEISNSRESNKQGT  67

Query  356  VWILDL-EKIPRAPVDKALGQKKSKKEVLEVSPIQKYAKIKDHSLFLLESDGSNTEIQLR  532
            +W+L+L E +     +K   + K K+  LE+ PI+K+A+IKDH L L ESDG+ T + L+
Sbjct  68   IWVLELDEGLKNLWKEKLPTEHKRKRAFLEIHPIRKFARIKDHKLILSESDGTMTTVSLK  127

Query  533  GCTIAAVSATGLSSRKWAKRYPIKVESKSSA-IYKGSRTFYIYLETSWDKESWCKALRLA  709
             C++ AVS + L +RKWAKR+PIKVESKSS+ +YKG++ FYIYLETSW+KESWCKALRLA
Sbjct  128  CCSVEAVSGSDLPTRKWAKRFPIKVESKSSSDVYKGNKVFYIYLETSWEKESWCKALRLA  187

Query  710  S  712
            +
Sbjct  188  A  188



>ref|XP_009149234.1| PREDICTED: uncharacterized protein LOC103872560 [Brassica rapa]
Length=779

 Score =   169 bits (429),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 88/181 (49%), Positives = 126/181 (70%), Gaps = 3/181 (2%)
 Frame = +2

Query  176  FVLVFILGALTVVGVEAAAAVFLIRWLSRRLSREVDKAKVSAELSSPPGLDPSYYNKQGI  355
            F+  F LG + V+G EAA  ++L+  L+R+    VD +K  ++ S+    +    NKQG 
Sbjct  9    FLSGFFLGIVAVLGAEAAGLMYLLNRLNRKSETRVD-SKPGSDQSTKEISNSRESNKQGT  67

Query  356  VWILDL-EKIPRAPVDKALGQKKSKKEVLEVSPIQKYAKIKDHSLFLLESDGSNTEIQLR  532
            +W+L+L E +     +K   + K K+  LE+ PI+K+A+IKDH L L ESDG+ T + L+
Sbjct  68   IWVLELDEGLKNLWKEKLPTEHKRKRAFLEIHPIRKFARIKDHKLILSESDGTMTTVSLK  127

Query  533  GCTIAAVSATGLSSRKWAKRYPIKVESKSSA-IYKGSRTFYIYLETSWDKESWCKALRLA  709
             C++ AVS + L +RKWAKR+PIKVESKSS+ +YKG++ FYIYLETSW+KESWCKALRLA
Sbjct  128  CCSVEAVSGSDLPTRKWAKRFPIKVESKSSSDVYKGNKVFYIYLETSWEKESWCKALRLA  187

Query  710  S  712
            +
Sbjct  188  A  188



>ref|XP_011046106.1| PREDICTED: uncharacterized protein LOC105140810 [Populus euphratica]
Length=791

 Score =   169 bits (429),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 97/192 (51%), Positives = 129/192 (67%), Gaps = 10/192 (5%)
 Frame = +2

Query  167  MWQFVLVF----ILGALTVVGVEAAAAVFLIRWLSRRLSREVDKAKVSAELSSPPGLDPS  334
            MW  V++F    + G LT+V ++A     LI+ L+R+  ++      S+ L     LDP 
Sbjct  1    MWPVVVIFAGGFLSGLLTLVALQALGVYVLIKRLNRKTQQQHASHSYSSSLPHHQDLDPQ  60

Query  335  Y-----YNKQGIVWILDLEKIPRA-PVDKALGQKKSKKEVLEVSPIQKYAKIKDHSLFLL  496
                  +NK+G VW+LD +K+ +  PV+K    +K KKE+LEV+PI+K AKIK  SL L 
Sbjct  61   QSLDYAHNKKGYVWVLDSDKVLKNWPVEKVPKDQKKKKELLEVTPIRKQAKIKGSSLILT  120

Query  497  ESDGSNTEIQLRGCTIAAVSATGLSSRKWAKRYPIKVESKSSAIYKGSRTFYIYLETSWD  676
            +S GS+  I L+GC I AVSAT L SRKWAKR+PIKVESK+S IY  S+T +I+LETSW+
Sbjct  121  DSGGSHRVIPLKGCAIEAVSATSLPSRKWAKRFPIKVESKTSPIYNASKTVFIFLETSWE  180

Query  677  KESWCKALRLAS  712
            KESWCKALRLAS
Sbjct  181  KESWCKALRLAS  192



>ref|XP_009105967.1| PREDICTED: testis-expressed sequence 2 protein-like [Brassica 
rapa]
Length=744

 Score =   169 bits (427),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 89/188 (47%), Positives = 131/188 (70%), Gaps = 18/188 (10%)
 Frame = +2

Query  170  WQFVLVFILGALTVVGVEAAAAVFLIRWLSRRLSREVDKAKVSAELSSPPGLDPSYYN--  343
            + FV  F+LG L VV  E AA ++L++ L+R+     D    +++ S PP L+P  +N  
Sbjct  7    FAFVTGFLLGLLAVVAAEVAAFLYLVKRLNRKQESSSDP---TSKGSDPPPLEPIDFNLN  63

Query  344  KQGIVWILDL-----EKIPRAPVDKALGQKKSKKEVLEVSPIQKYAKIKDHSLFLLESDG  508
            KQG++W+L+L     EK+P+        + K + + +EV P++K+A+IKDH L L ++D 
Sbjct  64   KQGVIWVLELDESLKEKLPK--------ETKKRNDHVEVHPVRKFARIKDHKLILTDTDS  115

Query  509  SNTEIQLRGCTIAAVSATGLSSRKWAKRYPIKVESKSSAIYKGSRTFYIYLETSWDKESW  688
            + T I L+GC++ AVS + L +RKWAKR+PI+VESK+S +YKG+R FYIYLETSW+KESW
Sbjct  116  NKTVITLKGCSVEAVSGSQLPTRKWAKRFPIQVESKTSDLYKGNRVFYIYLETSWEKESW  175

Query  689  CKALRLAS  712
            CKALRLA+
Sbjct  176  CKALRLAA  183



>gb|KJB56354.1| hypothetical protein B456_009G116400 [Gossypium raimondii]
Length=465

 Score =   166 bits (420),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 90/168 (54%), Positives = 115/168 (68%), Gaps = 9/168 (5%)
 Frame = +2

Query  209  VVGVEAAAAVFLIRWLSRRLSREVDKAKVSAELSSPPGLDPSYYNKQGIVWILDLEKIPR  388
            +V +E     F++  L+RR+ +E   +  +    S P LD +Y NKQG VW+L+ EKIP 
Sbjct  16   IVSLEVVVFFFVLNRLNRRIKQE---SLAALNPPSQPSLDFAY-NKQGTVWVLESEKIP-  70

Query  389  APVDKALGQKKSKKEVLEVSPIQKYAKIKDHSLFLLESDGSNTEIQLRGCTIAAVSATGL  568
             P +    QK+ K   LEVSP +K+AKI++  L    SD S T + L+GC I AVSAT L
Sbjct  71   VPRE----QKRKKDVTLEVSPARKHAKIQEKCLVFTHSDASRTSVPLKGCVIEAVSATNL  126

Query  569  SSRKWAKRYPIKVESKSSAIYKGSRTFYIYLETSWDKESWCKALRLAS  712
             SRKWAKR+PIKVESK+SAIY GS+  Y+YLETSW+KESWCKALRLAS
Sbjct  127  PSRKWAKRFPIKVESKTSAIYNGSKIIYLYLETSWEKESWCKALRLAS  174



>gb|ERN10208.1| hypothetical protein AMTR_s00171p00040960 [Amborella trichopoda]
Length=796

 Score =   169 bits (427),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 93/177 (53%), Positives = 120/177 (68%), Gaps = 6/177 (3%)
 Frame = +2

Query  194  LGALTVVGVEAAAAVFLIRWLSRRLSREVDKAKVSAELSSPPGLDPSYYNKQGIVWILDL  373
            +GALTVV +EA A  F++R L +R  R  +    + EL +   L     NKQG++W+L+ 
Sbjct  1    MGALTVVILEAVALFFVVRRLGQR-RRCPNSESCAPELDANQSLH-FLLNKQGVIWVLEP  58

Query  374  EKIP----RAPVDKALGQKKSKKEVLEVSPIQKYAKIKDHSLFLLESDGSNTEIQLRGCT  541
            +KIP      P  K+  + KSKKE +EV P++KYAKI+D +L L + DGS   I+L GC 
Sbjct  59   DKIPMVFPNEPRSKSGKEPKSKKETVEVFPVKKYAKIQDRNLILTDLDGSEAIIELEGCR  118

Query  542  IAAVSATGLSSRKWAKRYPIKVESKSSAIYKGSRTFYIYLETSWDKESWCKALRLAS  712
            I AVSA   SSRKWAKRYPI +ESK++AI  G +T YIYLETSW+KESWCKALRL S
Sbjct  119  IMAVSAGPSSSRKWAKRYPIILESKNAAILNGKKTCYIYLETSWEKESWCKALRLTS  175



>ref|XP_010935611.1| PREDICTED: testis-expressed sequence 2 protein-like [Elaeis guineensis]
Length=804

 Score =   168 bits (426),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 90/184 (49%), Positives = 121/184 (66%), Gaps = 6/184 (3%)
 Frame = +2

Query  176  FVLVFILGALTVVGVEAAAAVFLIRWLSRRLSREVDKAKVSAELSSPPGLDPSY-YNKQG  352
            F L F LG   +V VE  AA+++I  L RR    VD  +V           P+Y  NKQG
Sbjct  5    FFLGFFLGVAALVAVEVLAALWIIDRL-RRKGPAVDPREVEVGRDLEVERAPTYPCNKQG  63

Query  353  IVWILDLEKIPRAPVD----KALGQKKSKKEVLEVSPIQKYAKIKDHSLFLLESDGSNTE  520
            +VW+++ EK+P+   D    +   ++K KK ++EV P +K+AKIKDH L L + DGS   
Sbjct  64   VVWVIEPEKVPKVNTDGSPTRGSKEQKHKKNIVEVFPAKKFAKIKDHVLILSDQDGSQAT  123

Query  521  IQLRGCTIAAVSATGLSSRKWAKRYPIKVESKSSAIYKGSRTFYIYLETSWDKESWCKAL  700
            I+L  C + AVSA+ LSSRKWAKRYPI++ESK S +Y GS+  Y+Y++TSW+KESWCKAL
Sbjct  124  IELLDCMVVAVSASNLSSRKWAKRYPIRLESKDSVLYGGSKICYLYVDTSWEKESWCKAL  183

Query  701  RLAS  712
            RLAS
Sbjct  184  RLAS  187



>gb|KJB56355.1| hypothetical protein B456_009G116400 [Gossypium raimondii]
Length=571

 Score =   166 bits (421),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 90/168 (54%), Positives = 115/168 (68%), Gaps = 9/168 (5%)
 Frame = +2

Query  209  VVGVEAAAAVFLIRWLSRRLSREVDKAKVSAELSSPPGLDPSYYNKQGIVWILDLEKIPR  388
            +V +E     F++  L+RR+ +E   +  +    S P LD +Y NKQG VW+L+ EKIP 
Sbjct  16   IVSLEVVVFFFVLNRLNRRIKQE---SLAALNPPSQPSLDFAY-NKQGTVWVLESEKIP-  70

Query  389  APVDKALGQKKSKKEVLEVSPIQKYAKIKDHSLFLLESDGSNTEIQLRGCTIAAVSATGL  568
             P +    QK+ K   LEVSP +K+AKI++  L    SD S T + L+GC I AVSAT L
Sbjct  71   VPRE----QKRKKDVTLEVSPARKHAKIQEKCLVFTHSDASRTSVPLKGCVIEAVSATNL  126

Query  569  SSRKWAKRYPIKVESKSSAIYKGSRTFYIYLETSWDKESWCKALRLAS  712
             SRKWAKR+PIKVESK+SAIY GS+  Y+YLETSW+KESWCKALRLAS
Sbjct  127  PSRKWAKRFPIKVESKTSAIYNGSKIIYLYLETSWEKESWCKALRLAS  174



>ref|XP_004512702.1| PREDICTED: uncharacterized protein LOC101503148 isoform X2 [Cicer 
arietinum]
Length=808

 Score =   167 bits (424),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 85/181 (47%), Positives = 127/181 (70%), Gaps = 8/181 (4%)
 Frame = +2

Query  188  FILGALTVVGVEAAAAVFLIRWLSRRLSREVDKAKVSA-----ELSSPPGLDPSY-YNKQ  349
            F+LG + VV  E    +++++ L R+   + DKAK+S+     + S+    D  + + K+
Sbjct  12   FLLGVIVVVAAEFLGFLWILKRLRRKF--DSDKAKISSITQQLDRSASSQFDSHHSFKKE  69

Query  350  GIVWILDLEKIPRAPVDKALGQKKSKKEVLEVSPIQKYAKIKDHSLFLLESDGSNTEIQL  529
            G+VW+++ EK+ +  V+++  + K KKE+ EVSP++KY K+   SL L E DG NT IQL
Sbjct  70   GVVWVVEPEKVSKYWVERSSKEVKRKKELFEVSPVRKYGKLNGQSLVLTEPDGLNTTIQL  129

Query  530  RGCTIAAVSATGLSSRKWAKRYPIKVESKSSAIYKGSRTFYIYLETSWDKESWCKALRLA  709
            +GC + AVSAT L ++KWAK++PIKVE+K+S IY GS+T Y+YLETS +KE+WCKALRLA
Sbjct  130  KGCLVEAVSATSLPTKKWAKKFPIKVENKTSVIYHGSKTLYVYLETSSEKEAWCKALRLA  189

Query  710  S  712
            S
Sbjct  190  S  190



>ref|XP_010459394.1| PREDICTED: testis-expressed sequence 2 protein-like [Camelina 
sativa]
Length=804

 Score =   167 bits (424),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 91/198 (46%), Positives = 135/198 (68%), Gaps = 18/198 (9%)
 Frame = +2

Query  167  MWQFVLV------FILGALTVVGVEAAAAVFLIRWLSRRLSREVDKAKVSAE-----LSS  313
            M+ FV        F LG L V+  EAA  ++L++ L+R+  R+  ++K  ++      ++
Sbjct  1    MFSFVCFVFLLSGFFLGILAVLAAEAAGFMYLLKRLNRK--RDQIESKPGSDDDPTSTTN  58

Query  314  PPGLDPSYY--NKQGIVWILDLEKIPRAPV--DKALGQKKSKKEVLEVSPIQKYAKIKDH  481
            PP   P  +  NKQG+VWIL+L+++ +  +  +K   + K K++ LE+ P++K+A+IKDH
Sbjct  59   PPPRQPIDFSINKQGMVWILELDEVLKNWMMKEKLPKEHKKKRDFLEIHPLRKFARIKDH  118

Query  482  SLFLLESDGSNTEIQLRGCTIAAVSATGLSSRKWAKRYPIKVESK-SSAIYKGSRTFYIY  658
             L L + DG+ T + L+GC+I AVS + L +RKWAKRYPIKVESK S  +YKG++ FYIY
Sbjct  119  KLILSDHDGTLTIVSLKGCSIEAVSGSDLPTRKWAKRYPIKVESKISPDLYKGNQVFYIY  178

Query  659  LETSWDKESWCKALRLAS  712
            LETSW+KESWCKALRLA+
Sbjct  179  LETSWEKESWCKALRLAA  196



>ref|XP_006390581.1| hypothetical protein EUTSA_v10018153mg [Eutrema salsugineum]
 gb|ESQ27867.1| hypothetical protein EUTSA_v10018153mg [Eutrema salsugineum]
Length=779

 Score =   167 bits (423),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 87/182 (48%), Positives = 127/182 (70%), Gaps = 3/182 (2%)
 Frame = +2

Query  176  FVLVFILGALTVVGVEAAAAVFLIRWLSRRLSREVDKAKVSAELS--SPPGLDPSYYNKQ  349
            FV  F+LG LT+V  E A  ++L+  L+R+ +R+         L+   PP       NKQ
Sbjct  9    FVTGFLLGILTIVTAELAGFLYLLNRLNRKRNRQESSTGSDPALTEFDPPQSSALSLNKQ  68

Query  350  GIVWILDL-EKIPRAPVDKALGQKKSKKEVLEVSPIQKYAKIKDHSLFLLESDGSNTEIQ  526
            G++W+L+L E +     +K   ++K KK++L+V P++K+A+IKDH L L E++ + T I 
Sbjct  69   GVIWVLELDESLKEWMKEKLPKEQKKKKDLLDVHPVRKFARIKDHKLILSETNNTQTIIT  128

Query  527  LRGCTIAAVSATGLSSRKWAKRYPIKVESKSSAIYKGSRTFYIYLETSWDKESWCKALRL  706
            L+GC++ AVS + L +RKWAKR+PI+VESK+S +YKG+R FYIYLETSW+KESWCKALRL
Sbjct  129  LKGCSVDAVSGSELPTRKWAKRFPIQVESKTSELYKGNRVFYIYLETSWEKESWCKALRL  188

Query  707  AS  712
            A+
Sbjct  189  AA  190



>emb|CDY19177.1| BnaC05g13780D [Brassica napus]
Length=762

 Score =   166 bits (421),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 86/181 (48%), Positives = 125/181 (69%), Gaps = 3/181 (2%)
 Frame = +2

Query  176  FVLVFILGALTVVGVEAAAAVFLIRWLSRRLSREVDKAKVSAELSSPPGLDPSYYNKQGI  355
            F+  F LG + V+  EAA  ++L+  L+R+    VD +K  ++ S+    +P   NKQG 
Sbjct  9    FLSGFFLGIVAVLAAEAAGLMYLLNRLNRKRDNRVD-SKPGSDQSTKEISNPRESNKQGT  67

Query  356  VWILDL-EKIPRAPVDKALGQKKSKKEVLEVSPIQKYAKIKDHSLFLLESDGSNTEIQLR  532
            +W+L+L E +     +K   ++K K+  LE+ P +K+A+IKDH L L ESDG+ T + L+
Sbjct  68   IWVLELDEGLKNMWKEKLPAEQKRKRAFLEIHPTRKFARIKDHKLILSESDGTLTTVSLK  127

Query  533  GCTIAAVSATGLSSRKWAKRYPIKVESKSSA-IYKGSRTFYIYLETSWDKESWCKALRLA  709
             C++ AVS + L +RKWAKR+PIKVE+KSS+ +YKG++ FYIYLETS +KESWCKALRLA
Sbjct  128  CCSVEAVSGSDLPTRKWAKRFPIKVETKSSSDVYKGNKVFYIYLETSCEKESWCKALRLA  187

Query  710  S  712
            S
Sbjct  188  S  188



>ref|XP_003535400.1| PREDICTED: uncharacterized protein LOC100816218 isoform X1 [Glycine 
max]
 gb|KHN14743.1| Testis-expressed sequence 2 protein [Glycine soja]
Length=789

 Score =   166 bits (421),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 91/185 (49%), Positives = 126/185 (68%), Gaps = 13/185 (7%)
 Frame = +2

Query  176  FVLV-FILGALTVVGVEAAAAVFLIRWLSRRLSREVDKAKVSAELSSPPGLDPSY-----  337
             +LV F LG LTVV VEA   +++++ L  +++   D+A  S++  +   LDP       
Sbjct  7    LILVGFGLGVLTVVAVEALGLLWIMKRLRHKINN--DEAYFSSKTPTTALLDPQQSLDFA  64

Query  338  YNKQGIVWILDLEKIPRAPVDKALGQKKSKKEVLEVSPIQKYAKIKDHSLFLLESDGSNT  517
            Y KQG+VW+L+  KI      K   ++K KKE LEVSP++ Y +IK  SL L E+DG +T
Sbjct  65   YRKQGVVWVLESGKI-----SKPSREQKRKKETLEVSPVKTYGQIKGQSLILREADGLHT  119

Query  518  EIQLRGCTIAAVSATGLSSRKWAKRYPIKVESKSSAIYKGSRTFYIYLETSWDKESWCKA  697
             I+L+GC + AVSA+ LSSRKWAK +PIKVE+ +S IY G++T YIYL+TSW+KE+WCKA
Sbjct  120  TIELKGCAVQAVSASILSSRKWAKMFPIKVENTNSVIYNGNKTIYIYLDTSWEKEAWCKA  179

Query  698  LRLAS  712
            L LAS
Sbjct  180  LYLAS  184



>gb|KJB56353.1| hypothetical protein B456_009G116400 [Gossypium raimondii]
Length=744

 Score =   166 bits (420),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 90/168 (54%), Positives = 115/168 (68%), Gaps = 9/168 (5%)
 Frame = +2

Query  209  VVGVEAAAAVFLIRWLSRRLSREVDKAKVSAELSSPPGLDPSYYNKQGIVWILDLEKIPR  388
            +V +E     F++  L+RR+ +E   +  +    S P LD +Y NKQG VW+L+ EKIP 
Sbjct  16   IVSLEVVVFFFVLNRLNRRIKQE---SLAALNPPSQPSLDFAY-NKQGTVWVLESEKIP-  70

Query  389  APVDKALGQKKSKKEVLEVSPIQKYAKIKDHSLFLLESDGSNTEIQLRGCTIAAVSATGL  568
             P +    QK+ K   LEVSP +K+AKI++  L    SD S T + L+GC I AVSAT L
Sbjct  71   VPRE----QKRKKDVTLEVSPARKHAKIQEKCLVFTHSDASRTSVPLKGCVIEAVSATNL  126

Query  569  SSRKWAKRYPIKVESKSSAIYKGSRTFYIYLETSWDKESWCKALRLAS  712
             SRKWAKR+PIKVESK+SAIY GS+  Y+YLETSW+KESWCKALRLAS
Sbjct  127  PSRKWAKRFPIKVESKTSAIYNGSKIIYLYLETSWEKESWCKALRLAS  174



>ref|XP_010248365.1| PREDICTED: uncharacterized protein LOC104591254 [Nelumbo nucifera]
Length=796

 Score =   166 bits (421),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 87/170 (51%), Positives = 121/170 (71%), Gaps = 3/170 (2%)
 Frame = +2

Query  206  TVVGVEAAAAVFLIRWLSRRLSREVDKAKVSAELSSPPGLDPSYYNKQGIVWILDLEKIP  385
            TV+ VE    + ++  L+R+      K+    +L S   +    YNKQG+VW+L+ E++ 
Sbjct  14   TVIVVEVLGFLHILDRLARKKEVGRRKSLSDGDLDSEQSI-AFAYNKQGVVWVLESERVS  72

Query  386  RA-PVDKALGQKKSKKEVLEVSPIQKYAKIKDHSLFLLESDGSNTEIQLRGCTIAAVSAT  562
            +  P +K L ++K+K E+LEVSP++K+AKIK+ SL L + DGS   IQL GC + AVS +
Sbjct  73   KLWPEEKVLREQKNK-EILEVSPVKKHAKIKNRSLVLTDPDGSQATIQLVGCIVLAVSGS  131

Query  563  GLSSRKWAKRYPIKVESKSSAIYKGSRTFYIYLETSWDKESWCKALRLAS  712
             LSS+KWAKRYPIKVES+ S IY GS+TFY+YLETSW+KE+WCKALRLA+
Sbjct  132  NLSSKKWAKRYPIKVESRDSVIYNGSKTFYVYLETSWEKEAWCKALRLAA  181



>ref|XP_006306770.1| hypothetical protein CARUB_v10008308mg [Capsella rubella]
 gb|EOA39668.1| hypothetical protein CARUB_v10008308mg [Capsella rubella]
Length=838

 Score =   167 bits (422),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 90/208 (43%), Positives = 131/208 (63%), Gaps = 30/208 (14%)
 Frame = +2

Query  149  TAGVERMWQFVLV-----FILGALTVVGVEAAAAVFLIRWLSRRLSREVDKAKVSAELSS  313
            T     M+ FV       F+LG L V+  EAA  ++L++ L+R+  R          + S
Sbjct  44   TQSFSEMFSFVAFVFLSGFLLGILAVLAAEAAGFMYLLKRLNRKRDR----------IES  93

Query  314  PPGLDPSY-------------YNKQGIVWILDLEKIPRAPVDKAL-GQKKSKKEVLEVSP  451
             P  DPS               NKQG VW+L+L+++ +  + + L  ++K K++ LE+ P
Sbjct  94   KPASDPSSKDLNPPRDSVDFCINKQGTVWVLELDEVLKNWMKEKLPKEQKRKRDFLEIHP  153

Query  452  IQKYAKIKDHSLFLLESDGSNTEIQLRGCTIAAVSATGLSSRKWAKRYPIKVESK-SSAI  628
            ++K+A+IKDH L L ++DG+ T + L+ C+I AVS + L +RKWAKR+PIKVESK S  +
Sbjct  154  LRKFARIKDHKLILSDADGTQTIVSLKACSIEAVSGSDLPTRKWAKRFPIKVESKISPTL  213

Query  629  YKGSRTFYIYLETSWDKESWCKALRLAS  712
            YKG++ FYIYLETSW+KESWCKALRLA+
Sbjct  214  YKGNQVFYIYLETSWEKESWCKALRLAA  241



>ref|XP_009408154.1| PREDICTED: uncharacterized protein LOC103990667 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=799

 Score =   166 bits (420),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 92/185 (50%), Positives = 126/185 (68%), Gaps = 8/185 (4%)
 Frame = +2

Query  176  FVLVFILGALTVVGVEAAAAVFLIRWLSRRLSREVDKAK---VSAELSSPPGLDPSYYNK  346
            F+L F++G   +V VE  A ++LI  L RR    V+ A+   V+ +L     L      K
Sbjct  5    FLLGFLVGFAALVAVEGLALLWLIDRL-RRKRPTVNAARPQPVAQDLGDERSLTVPL-EK  62

Query  347  QGIVWILDLEKIPRAPVDKALGQKKSKKE---VLEVSPIQKYAKIKDHSLFLLESDGSNT  517
            +G +W+L+ EK+P+   D++  ++  ++E   ++EV P++KYAKIKDHSL L + D SN 
Sbjct  63   KGSIWVLEPEKVPKIKTDESPTRRTKEQENKSIMEVIPVRKYAKIKDHSLILSDPDDSNI  122

Query  518  EIQLRGCTIAAVSATGLSSRKWAKRYPIKVESKSSAIYKGSRTFYIYLETSWDKESWCKA  697
             IQL GC + AVSA+ LSSRKWAKRYPIK+ESK S IYK S+T Y+Y +TSW+KESWCKA
Sbjct  123  TIQLVGCMVVAVSASNLSSRKWAKRYPIKLESKESKIYKESKTCYLYFDTSWEKESWCKA  182

Query  698  LRLAS  712
            LRLAS
Sbjct  183  LRLAS  187



>gb|KHG07655.1| Testis-expressed sequence 2 [Gossypium arboreum]
Length=744

 Score =   165 bits (418),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 90/168 (54%), Positives = 115/168 (68%), Gaps = 9/168 (5%)
 Frame = +2

Query  209  VVGVEAAAAVFLIRWLSRRLSREVDKAKVSAELSSPPGLDPSYYNKQGIVWILDLEKIPR  388
            +V +E     F++  L+RR+ +E   +  +    S P LD +Y NKQG VW+L+ EKIP 
Sbjct  16   IVSLEVVVFFFVLNRLNRRIKQE---SLAALNPPSQPSLDFAY-NKQGTVWVLESEKIP-  70

Query  389  APVDKALGQKKSKKEVLEVSPIQKYAKIKDHSLFLLESDGSNTEIQLRGCTIAAVSATGL  568
             P +    QK+ K   LEVSP +K+AKI++  L    SD S T + L+GC I AVSAT L
Sbjct  71   VPRE----QKRKKDVPLEVSPARKHAKIQEKCLVFTHSDASRTSVPLKGCVIEAVSATNL  126

Query  569  SSRKWAKRYPIKVESKSSAIYKGSRTFYIYLETSWDKESWCKALRLAS  712
             SRKWAKR+PIKVESK+SAIY GS+  Y+YLETSW+KESWCKALRLAS
Sbjct  127  PSRKWAKRFPIKVESKTSAIYNGSKIIYLYLETSWEKESWCKALRLAS  174



>ref|XP_008802615.1| PREDICTED: uncharacterized protein LOC103716408 [Phoenix dactylifera]
Length=804

 Score =   165 bits (418),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 91/189 (48%), Positives = 121/189 (64%), Gaps = 16/189 (8%)
 Frame = +2

Query  176  FVLVFILGALTVVGVEAAAAVFLIRWLSRRLS------REVDKAKVSAELSSPPGLDPSY  337
            F+L F LG   +V VE    +++I  L R+ +      REV +   S  L + P      
Sbjct  5    FLLGFFLGVAALVVVEGLTVLWVIDRLRRKGAVVEPPEREVGRDVESERLPTYP------  58

Query  338  YNKQGIVWILDLEKIPRAPVD----KALGQKKSKKEVLEVSPIQKYAKIKDHSLFLLESD  505
             NKQG++W+L+ EK+P+   D    +   ++K KK ++EV P +K AKIKDH L L + D
Sbjct  59   CNKQGVLWVLEQEKVPKVNTDGSPTRGSKEQKYKKNIVEVFPAKKIAKIKDHVLILSDQD  118

Query  506  GSNTEIQLRGCTIAAVSATGLSSRKWAKRYPIKVESKSSAIYKGSRTFYIYLETSWDKES  685
            GS   I+L  CT+ AVSA+ LSSRKWAKRYPIK+ESK S IY GS+  Y+Y +TSW+KES
Sbjct  119  GSQATIELLDCTVVAVSASNLSSRKWAKRYPIKLESKDSVIYSGSKMCYLYADTSWEKES  178

Query  686  WCKALRLAS  712
            WCKALRLAS
Sbjct  179  WCKALRLAS  187



>dbj|BAD94820.1| hypothetical protein [Arabidopsis thaliana]
Length=499

 Score =   162 bits (411),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 87/196 (44%), Positives = 124/196 (63%), Gaps = 26/196 (13%)
 Frame = +2

Query  170  WQFVLVFILGALTVVGVEAAAAVFLIRWLSRRLSREVDKAKVSAELSSPPGLDPSY----  337
            + FV   +LG L +V  E    ++L++ L+R+  R+   +       S    DP      
Sbjct  7    FAFVFGILLGILAIVTAEVVGFLYLLKRLNRKRDRQESNSSSDPNFKS---FDPRQSIDF  63

Query  338  -YNKQGIVWILDL---------EKIPRAPVDKALGQKKSKKEVLEVSPIQKYAKIKDHSL  487
              NKQG++WIL+L         EK+P+        QKK + ++LEV P++++A+IKDH L
Sbjct  64   SLNKQGVIWILELDENVKDWMKEKLPKE-------QKKKRVDLLEVHPVRRFARIKDHKL  116

Query  488  FLLES-DGSNTEIQLRGCTIAAVSATGLSSRKWAKRYPIKVESKSSAIYKGSRTFYIYLE  664
             L +S DG  T I L+GC + AVS +G  +RKWAKR+PI+VESK+S +YKG+R FYI+LE
Sbjct  117  ILSDSLDGPQTPITLKGCFVDAVSGSG-PTRKWAKRFPIQVESKTSVLYKGNRVFYIFLE  175

Query  665  TSWDKESWCKALRLAS  712
            TSW+KESWCKALRLA+
Sbjct  176  TSWEKESWCKALRLAA  191



>ref|XP_002892968.1| hypothetical protein ARALYDRAFT_889192 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH69227.1| hypothetical protein ARALYDRAFT_889192 [Arabidopsis lyrata subsp. 
lyrata]
Length=797

 Score =   165 bits (417),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 91/195 (47%), Positives = 125/195 (64%), Gaps = 26/195 (13%)
 Frame = +2

Query  176  FVLVFILGALTVVGVEAAAAVFLIRWLSRRLSREVDKAKVSAELSSPPGLDPSY------  337
            F+  F LG L V+  EAA  ++L++  +R+  R          + S P  DPS       
Sbjct  10   FLSGFFLGILAVLAAEAAGLMYLLKRFNRKRDR----------IESKPVSDPSTKDFDPR  59

Query  338  ------YNKQGIVWILDL-EKIPRAPVDKALGQKKSKKEVLEVSPIQKYAKIKDHSLFLL  496
                   NKQG+VWIL+L E I     +K   ++K K+ +LE+ P++K+A+IKDH L L 
Sbjct  60   ESIDFCINKQGVVWILELDEGIKNWMKEKLPKEQKRKRHLLEIHPLRKFARIKDHKLILS  119

Query  497  ESDG--SNTEIQLRGCTIAAVSATGLSSRKWAKRYPIKVESK-SSAIYKGSRTFYIYLET  667
            ++DG  S T + L+GC+I AVS + L +RKWAKR+PIKVE K S A+YKG++ FYIYLET
Sbjct  120  DADGTQSQTTVSLKGCSIEAVSGSDLPTRKWAKRFPIKVEGKISPALYKGNQVFYIYLET  179

Query  668  SWDKESWCKALRLAS  712
            SW+KESWCKALRLA+
Sbjct  180  SWEKESWCKALRLAA  194



>ref|XP_004137541.1| PREDICTED: uncharacterized protein LOC101209104 [Cucumis sativus]
 gb|KGN64230.1| hypothetical protein Csa_1G043320 [Cucumis sativus]
Length=792

 Score =   165 bits (417),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 88/188 (47%), Positives = 123/188 (65%), Gaps = 16/188 (9%)
 Frame = +2

Query  176  FVLVFILGALTVVGVEAAAAVFLIRWLSRRLSREVDKAKVSAELSSPPGLDP-----SYY  340
            F+  F+ G + +VG EA     ++  LS+R  +++ KA    + S    LDP        
Sbjct  9    FLFGFVFGVVAIVGAEAFGIFIILNKLSKRSQKDLAKANAKLDQSE---LDPLQSLEFLS  65

Query  341  NKQGIVWILD---LEKIPRAPVDKALGQKKSKKEVLEVSPIQKYAKIKDHSLFLLESDGS  511
            NKQG VWIL+   LE I    ++K   ++K +K+ LEV+P++KYA+IKDH+L + E DG 
Sbjct  66   NKQGSVWILESNVLEDI----IEKGPKEQKKRKDFLEVTPVKKYARIKDHTLVITELDGK  121

Query  512  N-TEIQLRGCTIAAVSATGLSSRKWAKRYPIKVESKSSAIYKGSRTFYIYLETSWDKESW  688
              T IQL GCT+ AVSAT L SRKW KR+P+ +E+++S IY  S+  +I+LETSW+KESW
Sbjct  122  KRTTIQLNGCTVEAVSATDLPSRKWVKRFPLILENRTSVIYHESKRIFIFLETSWEKESW  181

Query  689  CKALRLAS  712
            CKALRLAS
Sbjct  182  CKALRLAS  189



>ref|XP_010476945.1| PREDICTED: uncharacterized protein LOC104756113 [Camelina sativa]
Length=803

 Score =   164 bits (416),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 89/184 (48%), Positives = 126/184 (68%), Gaps = 9/184 (5%)
 Frame = +2

Query  188  FILGALTVVGVEAAAAVFLIRWLSRRLSR-EVDKAKVSAELSSPPGLDPSY-----YNKQ  349
            F LG L V+  EAA  ++L++ L+R+  + E   A    + SS   L P        NKQ
Sbjct  14   FFLGILAVLAAEAAGFMYLLKRLNRKRDQIESKPASSDDDPSSTTNLPPRQPTDFSINKQ  73

Query  350  GIVWILDLEKIPRAPV--DKALGQKKSKKEVLEVSPIQKYAKIKDHSLFLLESDGSNTEI  523
            G+V+IL+L+++ +  +  +K   + K K++ LE+ P++K+A+IKDH L L E DG+ T +
Sbjct  74   GMVYILELDEVLKNWMMKEKLPKENKRKRDFLEIHPLRKFARIKDHKLILSEPDGTLTIV  133

Query  524  QLRGCTIAAVSATGLSSRKWAKRYPIKVESK-SSAIYKGSRTFYIYLETSWDKESWCKAL  700
             L+GC+I AVS + L +RKWAKRYPIKVESK S  +YKG++ FYIYLETSW+KESWCKAL
Sbjct  134  SLKGCSIEAVSGSDLPTRKWAKRYPIKVESKISPDLYKGNQVFYIYLETSWEKESWCKAL  193

Query  701  RLAS  712
            RLA+
Sbjct  194  RLAA  197



>ref|XP_006372649.1| hypothetical protein POPTR_0017s03560g [Populus trichocarpa]
 gb|ERP50446.1| hypothetical protein POPTR_0017s03560g [Populus trichocarpa]
Length=802

 Score =   164 bits (416),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 97/192 (51%), Positives = 132/192 (69%), Gaps = 11/192 (6%)
 Frame = +2

Query  167  MWQFVLVF----ILGALTVVGVEAAAAVFLIRWLSRRLSREVDKAKVSAELSSPPGLDPS  334
            MW  V++F    + G LT+V ++A     LI+ L+R+ +++   +  S+       LDP 
Sbjct  1    MWPVVVIFAGGFLSGLLTLVALQALGVYVLIKRLNRK-TQQQQASHSSSSSPHHQDLDPQ  59

Query  335  Y-----YNKQGIVWILDLEKIPRA-PVDKALGQKKSKKEVLEVSPIQKYAKIKDHSLFLL  496
                  +NK+G VW+LD +++ +  PV+K    +K KKE+LEV+PI+K AKIKD SL L 
Sbjct  60   QSLDYAHNKKGYVWVLDSDQVLKNWPVEKVQKDQKKKKELLEVTPIRKQAKIKDRSLILT  119

Query  497  ESDGSNTEIQLRGCTIAAVSATGLSSRKWAKRYPIKVESKSSAIYKGSRTFYIYLETSWD  676
            +S GS+  I L+GC I AVSAT LSSRKWAKR+PIKVESK+S IY  S+T +I+LETSW+
Sbjct  120  DSGGSHRVIPLKGCAIEAVSATSLSSRKWAKRFPIKVESKTSPIYNASKTVFIFLETSWE  179

Query  677  KESWCKALRLAS  712
            KESWCKALRLAS
Sbjct  180  KESWCKALRLAS  191



>ref|XP_006416664.1| hypothetical protein EUTSA_v10006829mg [Eutrema salsugineum]
 gb|ESQ35017.1| hypothetical protein EUTSA_v10006829mg [Eutrema salsugineum]
Length=802

 Score =   164 bits (415),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 90/201 (45%), Positives = 127/201 (63%), Gaps = 40/201 (20%)
 Frame = +2

Query  176  FVLVFILGALTVVGVEAAAAVFLIRWLSRRLSREVDKAKVSAELSSPPGLDPSY------  337
            F+  F LG + ++  EAA  ++L++ L+R+  R          L S PG  PS       
Sbjct  9    FLSGFFLGIVAILAAEAAGLMYLVKRLNRKRDR----------LESKPGSAPSTKDYNPG  58

Query  338  ------YNKQGIVWILD---------LEKIPRAPVDKALGQKKSKKEVLEVSPIQKYAKI  472
                   NKQG++WIL+          EK+P+       GQK+ K++ LE+ P++K+A+I
Sbjct  59   ESLDFCLNKQGVIWILEGNEGLKNWMKEKLPK-------GQKR-KRDFLEIHPLRKFARI  110

Query  473  KDHSLFLLESDGSNTEIQLRGCTIAAVSATGLSSRKWAKRYPIKVESK-SSAIYKGSRTF  649
            K+H L L ++DG+   + L+ C+I AVS + L +RKWAKR+PIKVESK SSA+YKGS+ F
Sbjct  111  KNHELILSDADGTQATVSLKCCSIEAVSGSDLPTRKWAKRFPIKVESKISSALYKGSQVF  170

Query  650  YIYLETSWDKESWCKALRLAS  712
            YIYLETSW+KESWCKALRLA+
Sbjct  171  YIYLETSWEKESWCKALRLAA  191



>ref|XP_009127977.1| PREDICTED: uncharacterized protein LOC103852830 [Brassica rapa]
Length=739

 Score =   164 bits (414),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 84/182 (46%), Positives = 125/182 (69%), Gaps = 7/182 (4%)
 Frame = +2

Query  176  FVLVFILGALTVVGVEAAAAVFLIRWLSRRLSREVDKAKVSAELSSPPGLDPSYYNKQGI  355
            F+  F+LG LT+V  E AA ++L++    RL+R+ +  + +   S PP       NKQG+
Sbjct  9    FITGFLLGILTIVAAEVAAFLYLLK----RLNRKRNLHESNKTSSDPPNSIDFSLNKQGV  64

Query  356  VWILDLEKIPRAPVDKALGQKKSKK---EVLEVSPIQKYAKIKDHSLFLLESDGSNTEIQ  526
            +W+L+ ++  +  + + L ++++KK   ++LEV P++K A IKDH L     DG+   + 
Sbjct  65   IWVLESDESLKDWMKEKLPKEQNKKKKKDILEVHPVRKSAHIKDHKLIFSNGDGTQKIVS  124

Query  527  LRGCTIAAVSATGLSSRKWAKRYPIKVESKSSAIYKGSRTFYIYLETSWDKESWCKALRL  706
            L+GC++ AVS + L +RKWAKRYPIKVESK+S + KGSR FYI+LETSW+KESWCKALRL
Sbjct  125  LKGCSVEAVSGSELPTRKWAKRYPIKVESKTSDLNKGSRVFYIFLETSWEKESWCKALRL  184

Query  707  AS  712
            A+
Sbjct  185  AA  186



>ref|XP_002525667.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF36785.1| conserved hypothetical protein [Ricinus communis]
Length=792

 Score =   164 bits (414),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 94/187 (50%), Positives = 132/187 (71%), Gaps = 8/187 (4%)
 Frame = +2

Query  167  MWQFVLVF----ILGALTVVGVEAAAAVFLIRWLSRRLSREVDKAKVSAE-LSSPPGLDP  331
            M +++LVF     +G++ +V +EA    F ++ L+ ++ +E   A  S + L S   LD 
Sbjct  3    MMRWLLVFGGGFFVGSVAIVALEALLLYFFLKRLNHKIRQEDGAADSSLQHLDSQQSLDF  62

Query  332  SYYNKQGIVWILDLEKIPRAPVDKALGQKKSKKEVLEVSPIQKYAKIKDHSLFLLESDGS  511
            ++ +K+G+VWI++ +K+P+   DK   + K KKEV+EV+P++KYA IKD  L L +SDGS
Sbjct  63   AF-DKKGVVWIIESDKVPKN--DKVSKEPKKKKEVIEVNPVRKYANIKDRILILTDSDGS  119

Query  512  NTEIQLRGCTIAAVSATGLSSRKWAKRYPIKVESKSSAIYKGSRTFYIYLETSWDKESWC  691
            +  I L+GC I +VSAT L SRKWAKR+PIKVESK+S IY  S+  YIYLETSW+KESWC
Sbjct  120  HVAIPLKGCIIESVSATDLPSRKWAKRFPIKVESKTSLIYNASKKVYIYLETSWEKESWC  179

Query  692  KALRLAS  712
            KALRLAS
Sbjct  180  KALRLAS  186



>ref|NP_177463.1| putative integral membrane protein [Arabidopsis thaliana]
 gb|AAG52130.1|AC010556_12 hypothetical protein; 41134-44253 [Arabidopsis thaliana]
 gb|AEE35428.1| putative integral membrane protein [Arabidopsis thaliana]
Length=779

 Score =   163 bits (413),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 87/196 (44%), Positives = 124/196 (63%), Gaps = 26/196 (13%)
 Frame = +2

Query  170  WQFVLVFILGALTVVGVEAAAAVFLIRWLSRRLSREVDKAKVSAELSSPPGLDPSY----  337
            + FV   +LG L +V  E    ++L++ L+R+  R+   +       S    DP      
Sbjct  7    FAFVFGILLGILAIVTAEVVGFLYLLKRLNRKRDRQESNSSSDPNFKS---FDPRQSIDF  63

Query  338  -YNKQGIVWILDL---------EKIPRAPVDKALGQKKSKKEVLEVSPIQKYAKIKDHSL  487
              NKQG++WIL+L         EK+P+        QKK + ++LEV P++++A+IKDH L
Sbjct  64   SLNKQGVIWILELDENVKDWMKEKLPKE-------QKKKRVDLLEVHPVRRFARIKDHKL  116

Query  488  FLLES-DGSNTEIQLRGCTIAAVSATGLSSRKWAKRYPIKVESKSSAIYKGSRTFYIYLE  664
             L +S DG  T I L+GC + AVS +G  +RKWAKR+PI+VESK+S +YKG+R FYI+LE
Sbjct  117  ILSDSLDGPQTPITLKGCFVDAVSGSG-PTRKWAKRFPIQVESKTSVLYKGNRVFYIFLE  175

Query  665  TSWDKESWCKALRLAS  712
            TSW+KESWCKALRLA+
Sbjct  176  TSWEKESWCKALRLAA  191



>emb|CDY48046.1| BnaA02g16390D [Brassica napus]
Length=739

 Score =   162 bits (411),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 87/182 (48%), Positives = 122/182 (67%), Gaps = 7/182 (4%)
 Frame = +2

Query  176  FVLVFILGALTVVGVEAAAAVFLIRWLSRRLSREVDKAKVSAELSSPPGLDPSYYNKQGI  355
            F+  F+LG LT+V  E AA ++L++    RL+R+ +  + +   S PP       NKQG+
Sbjct  9    FITGFLLGILTIVAAEVAAFLYLLK----RLNRKRNLHESNKTSSDPPNSIDFSLNKQGV  64

Query  356  VWILDLEKIPR---APVDKALGQKKSKKEVLEVSPIQKYAKIKDHSLFLLESDGSNTEIQ  526
            +W+L+ ++  +           QKK KK++LEV P++K A IKDH L     DG+   + 
Sbjct  65   IWVLESDESLKDWMKEKLPKEEQKKKKKDILEVHPVRKSAHIKDHKLIFSNGDGTQKIVS  124

Query  527  LRGCTIAAVSATGLSSRKWAKRYPIKVESKSSAIYKGSRTFYIYLETSWDKESWCKALRL  706
            L+GC++ AVS + L +RKWAKRYPIKVESK+S +YKGSR FYI+LETSW+KESWCKALRL
Sbjct  125  LKGCSVEAVSGSELPTRKWAKRYPIKVESKTSDLYKGSRVFYIFLETSWEKESWCKALRL  184

Query  707  AS  712
            A+
Sbjct  185  AA  186



>ref|XP_006599667.1| PREDICTED: uncharacterized protein LOC100812281 isoform X1 [Glycine 
max]
 ref|XP_006599668.1| PREDICTED: uncharacterized protein LOC100812281 isoform X2 [Glycine 
max]
Length=820

 Score =   162 bits (411),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 87/181 (48%), Positives = 125/181 (69%), Gaps = 2/181 (1%)
 Frame = +2

Query  176  FVLVFILGALTVVGVEAAAAVFLIRWLSRRLSREVDKAKVSAELSSPPGLDPSYY--NKQ  349
             +L F+LG + VV  EA   +++I+ L  ++S++  K     +L       P      K+
Sbjct  8    ILLGFLLGVVAVVAAEALGFLWVIKRLQSKISKDQAKIASKTQLGGAQSDHPQQQLLKKE  67

Query  350  GIVWILDLEKIPRAPVDKALGQKKSKKEVLEVSPIQKYAKIKDHSLFLLESDGSNTEIQL  529
            G+VW+L+ +K+ +  V+K   ++K KKEVLEV+P++KY KI   SL L ++DG +T IQL
Sbjct  68   GVVWVLEPDKVSKFWVEKQSKEQKRKKEVLEVTPVRKYGKINGQSLVLTDTDGFHTTIQL  127

Query  530  RGCTIAAVSATGLSSRKWAKRYPIKVESKSSAIYKGSRTFYIYLETSWDKESWCKALRLA  709
            +GC + AVSAT L S+KWAK++PIKVE+K+S IY  S+TFYIYLET+ DKE+WCKALRLA
Sbjct  128  KGCLVEAVSATSLPSKKWAKKFPIKVEAKTSVIYHASKTFYIYLETACDKEAWCKALRLA  187

Query  710  S  712
            S
Sbjct  188  S  188



>ref|XP_010498158.1| PREDICTED: uncharacterized protein LOC104775894 [Camelina sativa]
Length=805

 Score =   162 bits (410),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 92/199 (46%), Positives = 131/199 (66%), Gaps = 19/199 (10%)
 Frame = +2

Query  167  MWQFVLV------FILGALTVVGVEAAAAVFLIRWLSRR--------LSREVDKAKVSAE  304
            M+ FV        F LG L V+  EAA  ++L++ L+R+         S + D +  +  
Sbjct  1    MFSFVCFVFLLSGFFLGILAVLAAEAAGFMYLLKRLNRKRDQIESKPASSDDDPSSTTNP  60

Query  305  LSSPPGLDPSYYNKQGIVWILDLEKIPRAPV--DKALGQKKSKKEVLEVSPIQKYAKIKD  478
                P +D S  NKQG+VWIL+L+++ +  +  +K   + K K++ LE+ P++K+A+IKD
Sbjct  61   PPPQP-IDFSI-NKQGMVWILELDEVLKNWMMKEKLPKEHKRKRDFLEIHPLRKFARIKD  118

Query  479  HSLFLLESDGSNTEIQLRGCTIAAVSATGLSSRKWAKRYPIKVESK-SSAIYKGSRTFYI  655
            H L L E DG+ T + L+GC+I AVS + L +RKWAKRYPIKVESK S  +YKG++ FYI
Sbjct  119  HKLILSEPDGTLTIVSLKGCSIEAVSGSDLPTRKWAKRYPIKVESKISPDLYKGNQVFYI  178

Query  656  YLETSWDKESWCKALRLAS  712
            YLETSW+KESWCKALRLA+
Sbjct  179  YLETSWEKESWCKALRLAA  197



>gb|KHN24469.1| Testis-expressed sequence 2 protein [Glycine soja]
Length=815

 Score =   162 bits (411),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 87/181 (48%), Positives = 125/181 (69%), Gaps = 2/181 (1%)
 Frame = +2

Query  176  FVLVFILGALTVVGVEAAAAVFLIRWLSRRLSREVDKAKVSAELSSPPGLDPSYY--NKQ  349
             +L F+LG + VV  EA   +++I+ L  ++S++  K     +L       P      K+
Sbjct  8    ILLGFLLGVVAVVAAEALGFLWVIKRLQSKISKDQAKIASKTQLGGAQSDHPQQQLLKKE  67

Query  350  GIVWILDLEKIPRAPVDKALGQKKSKKEVLEVSPIQKYAKIKDHSLFLLESDGSNTEIQL  529
            G+VW+L+ +K+ +  V+K   ++K KKEVLEV+P++KY KI   SL L ++DG +T IQL
Sbjct  68   GVVWVLEPDKVSKFWVEKQSKEQKRKKEVLEVTPVRKYGKINGQSLVLTDTDGFHTTIQL  127

Query  530  RGCTIAAVSATGLSSRKWAKRYPIKVESKSSAIYKGSRTFYIYLETSWDKESWCKALRLA  709
            +GC + AVSAT L S+KWAK++PIKVE+K+S IY  S+TFYIYLET+ DKE+WCKALRLA
Sbjct  128  KGCLVEAVSATSLPSKKWAKKFPIKVEAKTSVIYHASKTFYIYLETACDKEAWCKALRLA  187

Query  710  S  712
            S
Sbjct  188  S  188



>ref|XP_006599669.1| PREDICTED: uncharacterized protein LOC100812281 isoform X3 [Glycine 
max]
Length=815

 Score =   162 bits (410),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 87/181 (48%), Positives = 125/181 (69%), Gaps = 2/181 (1%)
 Frame = +2

Query  176  FVLVFILGALTVVGVEAAAAVFLIRWLSRRLSREVDKAKVSAELSSPPGLDPSYY--NKQ  349
             +L F+LG + VV  EA   +++I+ L  ++S++  K     +L       P      K+
Sbjct  8    ILLGFLLGVVAVVAAEALGFLWVIKRLQSKISKDQAKIASKTQLGGAQSDHPQQQLLKKE  67

Query  350  GIVWILDLEKIPRAPVDKALGQKKSKKEVLEVSPIQKYAKIKDHSLFLLESDGSNTEIQL  529
            G+VW+L+ +K+ +  V+K   ++K KKEVLEV+P++KY KI   SL L ++DG +T IQL
Sbjct  68   GVVWVLEPDKVSKFWVEKQSKEQKRKKEVLEVTPVRKYGKINGQSLVLTDTDGFHTTIQL  127

Query  530  RGCTIAAVSATGLSSRKWAKRYPIKVESKSSAIYKGSRTFYIYLETSWDKESWCKALRLA  709
            +GC + AVSAT L S+KWAK++PIKVE+K+S IY  S+TFYIYLET+ DKE+WCKALRLA
Sbjct  128  KGCLVEAVSATSLPSKKWAKKFPIKVEAKTSVIYHASKTFYIYLETACDKEAWCKALRLA  187

Query  710  S  712
            S
Sbjct  188  S  188



>emb|CDX72963.1| BnaC06g34110D [Brassica napus]
Length=749

 Score =   162 bits (409),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 89/183 (49%), Positives = 130/183 (71%), Gaps = 8/183 (4%)
 Frame = +2

Query  170  WQFVLVFILGALTVVGVEAAAAVFLIRWLSRRLSREVDKAKVSAELSSPPGLDPSYYN--  343
            + FV  F+LG L VV  E AA ++L++ L+R+     D    +++ S PP L+P  +N  
Sbjct  7    FAFVTGFLLGLLAVVAAEVAAFLYLVKRLNRKQESSSDP---TSKGSDPPPLEPIDFNLN  63

Query  344  KQGIVWILDLEKIPRAPVDKALGQKKSKKEVLEVSPIQKYAKIKDHSLFLLESDGSNTEI  523
            KQG++W+L+L++   +  +K   + K K   LEV P++K+A+IKDH L L ++D + T I
Sbjct  64   KQGVIWVLELDE---SLKEKLPKEPKKKINHLEVHPVRKFARIKDHKLILTDTDSNKTVI  120

Query  524  QLRGCTIAAVSATGLSSRKWAKRYPIKVESKSSAIYKGSRTFYIYLETSWDKESWCKALR  703
             L+GC++ AVS + L +RKWAKR+PI+VESK+S +YKG+R FYIYLETSW+KESWCKALR
Sbjct  121  TLKGCSVEAVSGSQLPTRKWAKRFPIQVESKTSDLYKGNRVFYIYLETSWEKESWCKALR  180

Query  704  LAS  712
            LA+
Sbjct  181  LAA  183



>ref|XP_002888912.1| hypothetical protein ARALYDRAFT_895179 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH65171.1| hypothetical protein ARALYDRAFT_895179 [Arabidopsis lyrata subsp. 
lyrata]
Length=779

 Score =   162 bits (409),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 83/189 (44%), Positives = 128/189 (68%), Gaps = 12/189 (6%)
 Frame = +2

Query  170  WQFVLVFILGALTVVGVEAAAAVFLIRWLSRRLSREVDKAKVSAELSSPPGLDPSY----  337
            + F+   +LG L +V  E    +++++ L+R+  R+   +   +   +    DP      
Sbjct  7    FAFLSGILLGILAIVTAEVIGFLYILKRLNRKRDRQESNSSSDSNFKN---FDPRQSIDF  63

Query  338  -YNKQGIVWILDLEKIPRAPVDKALG--QKKSKKEVLEVSPIQKYAKIKDHSLFLLES-D  505
              NKQG++WIL+L++  +  + + L   QKK + ++LEV P++++A+IKDH LFL +S D
Sbjct  64   SLNKQGVIWILELDENVKDWMKEKLPTEQKKKRVDLLEVHPVRRFARIKDHKLFLSDSLD  123

Query  506  GSNTEIQLRGCTIAAVSATGLSSRKWAKRYPIKVESKSSAIYKGSRTFYIYLETSWDKES  685
            G+ T I L+GC + AVS +G  +RKWAKR+PI+VESK+S +YKG+R FYI+LETSW+KES
Sbjct  124  GTQTPITLKGCFVHAVSGSG-PTRKWAKRFPIQVESKTSVLYKGNRVFYIFLETSWEKES  182

Query  686  WCKALRLAS  712
            WCKALRLA+
Sbjct  183  WCKALRLAA  191



>gb|AAF97262.1|AC034106_5 Strong similarity to a hypothetical protein T18K17.13 gi|6598861 
from Arabidopsis thaliana BAC T18K17 gb|AC010556 and contains 
a PH PF|00169 domain [Arabidopsis thaliana]
Length=797

 Score =   162 bits (409),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 92/203 (45%), Positives = 127/203 (63%), Gaps = 42/203 (21%)
 Frame = +2

Query  176  FVLVFILGALTVVGVEAAAAVFLIRWLSRRLSREVDKAKVSAELSSPPGLDPSY------  337
            F+  F LG L V+  EAA  ++L++ L+R+  R          + S P  DPS       
Sbjct  10   FLSGFFLGILAVLSAEAAGFMYLLKRLNRKRDR----------IESKPVSDPSIKDFNPR  59

Query  338  ------YNKQGIVWILDL---------EKIPRAPVDKALGQKKSKKEVLEVSPIQKYAKI  472
                   NKQG+VWIL+L         EK+P+        ++K K+ +LE+ P++K+A+I
Sbjct  60   ESIDFCINKQGVVWILELDEGLKNWMKEKLPK--------EQKRKRGLLEIHPLRKFARI  111

Query  473  KDHSLFLLESDGSNTE--IQLRGCTIAAVSATGLSSRKWAKRYPIKVESK-SSAIYKGSR  643
            KDH L L ++D + +E  + L GC+I AVS + L +RKWAKR+PIKVESK S A+YKG++
Sbjct  112  KDHKLILSDADSTQSETTVSLIGCSIEAVSGSDLPTRKWAKRFPIKVESKISPALYKGNQ  171

Query  644  TFYIYLETSWDKESWCKALRLAS  712
             FYIYLETSW+KESWCKALRLAS
Sbjct  172  VFYIYLETSWEKESWCKALRLAS  194



>ref|NP_173224.2| putative integral membrane protein conserved region (DUF2404) 
[Arabidopsis thaliana]
 gb|AAM91570.1| unknown protein [Arabidopsis thaliana]
 gb|AAQ56797.1| At1g17820 [Arabidopsis thaliana]
 gb|AEE29640.1| putative integral membrane protein conserved region (DUF2404) 
[Arabidopsis thaliana]
Length=803

 Score =   162 bits (409),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 92/203 (45%), Positives = 127/203 (63%), Gaps = 42/203 (21%)
 Frame = +2

Query  176  FVLVFILGALTVVGVEAAAAVFLIRWLSRRLSREVDKAKVSAELSSPPGLDPSY------  337
            F+  F LG L V+  EAA  ++L++ L+R+  R          + S P  DPS       
Sbjct  10   FLSGFFLGILAVLSAEAAGFMYLLKRLNRKRDR----------IESKPVSDPSIKDFNPR  59

Query  338  ------YNKQGIVWILDL---------EKIPRAPVDKALGQKKSKKEVLEVSPIQKYAKI  472
                   NKQG+VWIL+L         EK+P+        ++K K+ +LE+ P++K+A+I
Sbjct  60   ESIDFCINKQGVVWILELDEGLKNWMKEKLPK--------EQKRKRGLLEIHPLRKFARI  111

Query  473  KDHSLFLLESDGSNTE--IQLRGCTIAAVSATGLSSRKWAKRYPIKVESK-SSAIYKGSR  643
            KDH L L ++D + +E  + L GC+I AVS + L +RKWAKR+PIKVESK S A+YKG++
Sbjct  112  KDHKLILSDADSTQSETTVSLIGCSIEAVSGSDLPTRKWAKRFPIKVESKISPALYKGNQ  171

Query  644  TFYIYLETSWDKESWCKALRLAS  712
             FYIYLETSW+KESWCKALRLAS
Sbjct  172  VFYIYLETSWEKESWCKALRLAS  194



>ref|XP_004495486.1| PREDICTED: testis-expressed sequence 2 protein-like [Cicer arietinum]
Length=787

 Score =   162 bits (409),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 85/185 (46%), Positives = 121/185 (65%), Gaps = 14/185 (8%)
 Frame = +2

Query  176  FVLVFILGALTVVGVEAAAAVFLIRWLSRRLSREVDKAKVSAEL-SSPPGLDPSY-----  337
             +L F +G + V  +EA   +++++ L  +L  E        +L +S   LD        
Sbjct  8    ILLGFGVGVVAVFAIEAVGVLWIMKRLRHKLHTEQSNLSSQTQLDTSSKHLDHQQSLYFS  67

Query  338  YNKQGIVWILDLEKIPRAPVDKALGQKKSKKEVLEVSPIQKYAKIKDHSLFLLESDGSNT  517
            +NKQG+VW+L+  +I + P        K K+E+LEVSPI+ Y +IK  SL L ESDG + 
Sbjct  68   FNKQGVVWVLESGQISKEP--------KRKEELLEVSPIKMYGQIKGQSLILRESDGLHK  119

Query  518  EIQLRGCTIAAVSATGLSSRKWAKRYPIKVESKSSAIYKGSRTFYIYLETSWDKESWCKA  697
             ++L+GCT+ AVSA+ LSS+KW K++PIKVESK+S IY GS+T Y+YLETSW+KE+WCKA
Sbjct  120  TVELKGCTVQAVSASILSSKKWEKKFPIKVESKTSVIYNGSKTLYVYLETSWEKEAWCKA  179

Query  698  LRLAS  712
            L LAS
Sbjct  180  LFLAS  184



>ref|XP_010428228.1| PREDICTED: testis-expressed sequence 2 protein-like [Camelina 
sativa]
Length=776

 Score =   160 bits (404),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 86/191 (45%), Positives = 124/191 (65%), Gaps = 29/191 (15%)
 Frame = +2

Query  191  ILGALTVVGVEAAAAVFLIRWLSRRLSREVDKAKVSAELSSPP--GLDPSY-----YNKQ  349
            +LG L +V  E    +F+++    RL+R+ +K   S   S P     DP        +KQ
Sbjct  14   LLGILAIVAAEVIGFLFVLK----RLNRKSNKRHESNSGSDPTSKNFDPRRSIDFSLSKQ  69

Query  350  GIVWILDL----------EKIPRAPVDKALGQKKSKKEVLEVSPIQKYAKIKDHSLFLLE  499
            G++WI+++          EK+P+        QKK + +++EV PI+++A+IKDH L L +
Sbjct  70   GVIWIMEMDESVKDWMKKEKLPKE-------QKKKRVDLMEVHPIRRFARIKDHKLILSD  122

Query  500  SDGSNTEIQLRGCTIAAVSATGLSSRKWAKRYPIKVESKSSAIYKGSRTFYIYLETSWDK  679
            SDG+ T I L+GC + AVS +G  +RKWAKR+PI+VESKSS +YKG+R FYI+LETSW+K
Sbjct  123  SDGTQTCITLKGCFVNAVSGSG-PTRKWAKRFPIQVESKSSVLYKGNRVFYIFLETSWEK  181

Query  680  ESWCKALRLAS  712
            ESWCKALRLA+
Sbjct  182  ESWCKALRLAA  192



>ref|XP_004512701.1| PREDICTED: uncharacterized protein LOC101503148 isoform X1 [Cicer 
arietinum]
Length=825

 Score =   160 bits (404),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 86/198 (43%), Positives = 126/198 (64%), Gaps = 25/198 (13%)
 Frame = +2

Query  188  FILGALTVVGVEAAAAVFLIRWLSRRLSREVDKAKVSA-----ELSSPPGLDPSYYNK--  346
            F+LG + VV  E    +++++ L R+   + DKAK+S+     + S+    D  +  K  
Sbjct  12   FLLGVIVVVAAEFLGFLWILKRLRRKF--DSDKAKISSITQQLDRSASSQFDSHHSFKKE  69

Query  347  ----------------QGIVWILDLEKIPRAPVDKALGQKKSKKEVLEVSPIQKYAKIKD  478
                            QG+VW+++ EK+ +  V+++  + K KKE+ EVSP++KY K+  
Sbjct  70   IVHVIDFGFGFGFGFLQGVVWVVEPEKVSKYWVERSSKEVKRKKELFEVSPVRKYGKLNG  129

Query  479  HSLFLLESDGSNTEIQLRGCTIAAVSATGLSSRKWAKRYPIKVESKSSAIYKGSRTFYIY  658
             SL L E DG NT IQL+GC + AVSAT L ++KWAK++PIKVE+K+S IY GS+T Y+Y
Sbjct  130  QSLVLTEPDGLNTTIQLKGCLVEAVSATSLPTKKWAKKFPIKVENKTSVIYHGSKTLYVY  189

Query  659  LETSWDKESWCKALRLAS  712
            LETS +KE+WCKALRLAS
Sbjct  190  LETSSEKEAWCKALRLAS  207



>ref|XP_010474308.1| PREDICTED: testis-expressed sequence 2 protein-like [Camelina 
sativa]
Length=735

 Score =   158 bits (400),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 85/191 (45%), Positives = 124/191 (65%), Gaps = 29/191 (15%)
 Frame = +2

Query  191  ILGALTVVGVEAAAAVFLIRWLSRRLSREVDKAKVSAELSSPP--GLDPSY-----YNKQ  349
            +LG L +V  E    +F+++    RL+R+ +K   S   S P     DP        +KQ
Sbjct  14   LLGILAIVAAEVIGFLFVLK----RLNRKSNKRHESNSGSDPTLKNFDPRRSIDFSLSKQ  69

Query  350  GIVWILDLE----------KIPRAPVDKALGQKKSKKEVLEVSPIQKYAKIKDHSLFLLE  499
            G++WIL+++          K+P+        QKK + +++EV PI+++A+IKDH L L +
Sbjct  70   GVIWILEMDENVKDWMKKDKLPKE-------QKKKRVDLMEVHPIRRFARIKDHKLILSD  122

Query  500  SDGSNTEIQLRGCTIAAVSATGLSSRKWAKRYPIKVESKSSAIYKGSRTFYIYLETSWDK  679
            SDG+ T I L+GC + AVS +G  +RKWAKR+PI+VESK+S +YKG+R FYI+LETSW+K
Sbjct  123  SDGTQTCITLKGCFVNAVSGSG-PTRKWAKRFPIQVESKTSVLYKGNRVFYIFLETSWEK  181

Query  680  ESWCKALRLAS  712
            ESWCKALRLA+
Sbjct  182  ESWCKALRLAA  192



>ref|XP_009117641.1| PREDICTED: uncharacterized protein LOC103842732 [Brassica rapa]
Length=786

 Score =   157 bits (398),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 87/191 (46%), Positives = 128/191 (67%), Gaps = 11/191 (6%)
 Frame = +2

Query  167  MWQFV-LVFI----LGALTVVGVEAAAAVFLIRWLSRRLSREVDKAKVSAELSSPPGLDP  331
            M+ FV  VF+    LG + ++  EAA  ++L++ L+R+   +      + ++ +PP  + 
Sbjct  1    MFSFVGFVFLSGVFLGIVAILAAEAAGLMYLVKRLNRKRDSKPASDPSTDDIVNPP--NE  58

Query  332  SYYNKQGIVWILDL-EKIPRAPVDKALGQKKSKKEVLEVSPIQKYAKIKDHSLFLLE--S  502
               NKQG+VWIL++ E +     +K   + K K++ LEV P++K+A+IKDH L L +  S
Sbjct  59   FSLNKQGMVWILEVDEGVKNWGKEKVPKEHKKKRDFLEVHPLRKFARIKDHKLLLSDAGS  118

Query  503  DGSNTEIQLRGCTIAAVSATGLSSRKWAKRYPIKVESK-SSAIYKGSRTFYIYLETSWDK  679
            D + T + L+ C+I AVS   L +RKWAKR+PIKVESK SS +YKG++ FYIYLETSW+K
Sbjct  119  DSTPTMVSLKCCSIEAVSGNHLPTRKWAKRFPIKVESKISSELYKGNKVFYIYLETSWEK  178

Query  680  ESWCKALRLAS  712
            ESWCKALRLA+
Sbjct  179  ESWCKALRLAA  189



>emb|CDY21730.1| BnaA09g44810D [Brassica napus]
Length=768

 Score =   157 bits (398),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 87/191 (46%), Positives = 128/191 (67%), Gaps = 11/191 (6%)
 Frame = +2

Query  167  MWQFV-LVFI----LGALTVVGVEAAAAVFLIRWLSRRLSREVDKAKVSAELSSPPGLDP  331
            M+ FV  VF+    LG + ++  EAA  ++L++ L+R+   +      + ++ +PP  + 
Sbjct  1    MFSFVGFVFLSGVFLGIVAILAAEAAGLMYLVKRLNRKRDSKPASDPSTDDIVNPP--NE  58

Query  332  SYYNKQGIVWILDL-EKIPRAPVDKALGQKKSKKEVLEVSPIQKYAKIKDHSLFLLE--S  502
               NKQG+VWIL++ E +     +K   + K K++ LEV P++K+A+IKDH L L +  S
Sbjct  59   FSLNKQGMVWILEVDEGVKNWGKEKVPKEHKKKRDFLEVHPLRKFARIKDHKLLLSDAGS  118

Query  503  DGSNTEIQLRGCTIAAVSATGLSSRKWAKRYPIKVESK-SSAIYKGSRTFYIYLETSWDK  679
            D + T + L+ C+I AVS   L +RKWAKR+PIKVESK SS +YKG++ FYIYLETSW+K
Sbjct  119  DSTPTMVSLKCCSIEAVSGNHLPTRKWAKRFPIKVESKISSELYKGNKVFYIYLETSWEK  178

Query  680  ESWCKALRLAS  712
            ESWCKALRLA+
Sbjct  179  ESWCKALRLAA  189



>ref|XP_007161563.1| hypothetical protein PHAVU_001G080200g [Phaseolus vulgaris]
 gb|ESW33557.1| hypothetical protein PHAVU_001G080200g [Phaseolus vulgaris]
Length=787

 Score =   156 bits (395),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 89/185 (48%), Positives = 123/185 (66%), Gaps = 13/185 (7%)
 Frame = +2

Query  176  FVLV-FILGALTVVGVEAAAAVFLIRWLSRRLSREVDKAKVSAELSSPPGLDPSY-----  337
             VLV F LG L VV  EA   +++++ L  R     D+A  S++  +   LDP       
Sbjct  7    LVLVGFGLGVLAVVAAEALGLLWIMKRL--RHKSNNDEAYFSSKTLTTELLDPQQSLDFA  64

Query  338  YNKQGIVWILDLEKIPRAPVDKALGQKKSKKEVLEVSPIQKYAKIKDHSLFLLESDGSNT  517
            + KQG+VW+L+  KI      K   ++K K ++LEVSP++ Y +IK  SL L + DG +T
Sbjct  65   FRKQGVVWVLESGKIT-----KQSREQKKKSDLLEVSPVKMYGQIKGQSLILRKPDGLHT  119

Query  518  EIQLRGCTIAAVSATGLSSRKWAKRYPIKVESKSSAIYKGSRTFYIYLETSWDKESWCKA  697
             I+L+GC++ AVSA+ LSSRKWAK++PIKVESK S IY G++T YIYL+TSW+KE+WCKA
Sbjct  120  TIELKGCSVQAVSASILSSRKWAKKFPIKVESKISVIYNGNKTIYIYLDTSWEKEAWCKA  179

Query  698  LRLAS  712
            L LAS
Sbjct  180  LYLAS  184



>ref|XP_008437259.1| PREDICTED: uncharacterized protein LOC103482740 [Cucumis melo]
Length=792

 Score =   156 bits (395),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 85/177 (48%), Positives = 118/177 (67%), Gaps = 16/177 (9%)
 Frame = +2

Query  209  VVGVEAAAAVFLIRWLSRRLSREVDKAKVSAELSSPPGLDP-----SYYNKQGIVWILD-  370
            +V VEA     ++  LS+R  +++ KA    E S    LDP        NKQG VWIL+ 
Sbjct  20   IVAVEAFGIFIILNKLSKRSQKDLAKANAKLEQSE---LDPLQSLEFLSNKQGSVWILES  76

Query  371  --LEKIPRAPVDKALGQKKSKKEVLEVSPIQKYAKIKDHSLFLLESDGSN-TEIQLRGCT  541
              LE I    ++K   ++K +++ LEV+P++KYA+IKDH+L + E DG+  T IQL GCT
Sbjct  77   NVLEDI----IEKGPKEQKKRRDFLEVTPVKKYARIKDHTLMITELDGNKRTTIQLNGCT  132

Query  542  IAAVSATGLSSRKWAKRYPIKVESKSSAIYKGSRTFYIYLETSWDKESWCKALRLAS  712
            + AVSAT L SRKW KR+P+ +E+++S IY  S+  +I+LETSW+KESWCKALRLAS
Sbjct  133  VEAVSATDLPSRKWVKRFPLILENRTSVIYNESKRIFIFLETSWEKESWCKALRLAS  189



>ref|XP_007152502.1| hypothetical protein PHAVU_004G135600g [Phaseolus vulgaris]
 gb|ESW24496.1| hypothetical protein PHAVU_004G135600g [Phaseolus vulgaris]
Length=808

 Score =   156 bits (395),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 87/182 (48%), Positives = 131/182 (72%), Gaps = 5/182 (3%)
 Frame = +2

Query  176  FVLVFILGALTVVGVEAAAAVFLIRWLSRRLSREVDKAKVSAELS---SPPGLDPSYYNK  346
             +L FILG + VV  EA   +++++ L RR+SR  D+AK++++     S    +     K
Sbjct  8    ILLGFILGVVVVVAAEALGLLWVVKRLDRRISR--DQAKIASKTQLDGSQSDSNQQLLKK  65

Query  347  QGIVWILDLEKIPRAPVDKALGQKKSKKEVLEVSPIQKYAKIKDHSLFLLESDGSNTEIQ  526
            +G+VW+L+ +K+ +  V+K   ++K KK+V+EV+P++KY KI   SL + ++DG +T IQ
Sbjct  66   EGVVWVLEPDKVSKFWVEKQSKEQKKKKDVMEVTPVRKYGKINGQSLVITDADGFHTAIQ  125

Query  527  LRGCTIAAVSATGLSSRKWAKRYPIKVESKSSAIYKGSRTFYIYLETSWDKESWCKALRL  706
            L+GC++ AVSAT L S+KWAK+YPIKVE+K+S IY  S+T YIYLET+ +KE+WCKALRL
Sbjct  126  LKGCSVEAVSATSLPSKKWAKKYPIKVEAKTSVIYHRSKTLYIYLETACEKEAWCKALRL  185

Query  707  AS  712
            AS
Sbjct  186  AS  187



>emb|CDY66320.1| BnaCnng50280D [Brassica napus]
Length=742

 Score =   154 bits (388),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 81/182 (45%), Positives = 126/182 (69%), Gaps = 7/182 (4%)
 Frame = +2

Query  176  FVLVFILGALTVVGVEAAAAVFLIRWLSRRLSREVDKAKVSAELSSPPGLDPSYYNKQGI  355
            F+  F+LG LT+V  E A  ++L++    RL+R+ +  + +   S PP       NKQG+
Sbjct  9    FITGFLLGILTIVAAEVAGFLYLLK----RLNRKRNLHESNKTSSDPPNSIDFSLNKQGV  64

Query  356  VWILDLEKIPRAPVDKALGQKKSKKEVLE---VSPIQKYAKIKDHSLFLLESDGSNTEIQ  526
            +WIL+ ++  +  +++ L +++ KK+  +   V P++K + IKDH L LL +DG+   + 
Sbjct  65   IWILESDEGLKDWMNEKLPKEQKKKKKKDLLEVHPVRKSSHIKDHKLILLNADGTQKIVF  124

Query  527  LRGCTIAAVSATGLSSRKWAKRYPIKVESKSSAIYKGSRTFYIYLETSWDKESWCKALRL  706
            L+GC++ AVS + L +RKWAKRYPIKVESK+S ++KG+R FYI+LETSW+KESWCKALR+
Sbjct  125  LKGCSVEAVSGSDLPTRKWAKRYPIKVESKTSNLHKGNRVFYIFLETSWEKESWCKALRV  184

Query  707  AS  712
            A+
Sbjct  185  AA  186



>gb|KHM99770.1| Testis-expressed sequence 2 protein [Glycine soja]
Length=800

 Score =   154 bits (388),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 91/189 (48%), Positives = 128/189 (68%), Gaps = 10/189 (5%)
 Frame = +2

Query  176  FVLVF---ILGALTVVGVEAAAAVFLIRWLSRRLSREV--DKAKVSA--ELSSPPGLDPS  334
             VLVF   +LG L  V    AA      W+ +RL  ++  D+AK+++  +L S     P 
Sbjct  1    MVLVFALILLGFLLGVAAVVAAEALGFLWVIKRLQSKISKDQAKIASKTQLGSAQSDHPQ  60

Query  335  YY--NKQGIVWILDLEKIPRAPVDKALGQK-KSKKEVLEVSPIQKYAKIKDHSLFLLESD  505
                 K+G+VW+L+ +K+ +  V+K   ++ K KKEVLEV+P++KY KI   SL L ++D
Sbjct  61   QQLLKKEGVVWVLEPDKVSKFWVEKQSSKELKRKKEVLEVTPVRKYGKINGQSLVLTDAD  120

Query  506  GSNTEIQLRGCTIAAVSATGLSSRKWAKRYPIKVESKSSAIYKGSRTFYIYLETSWDKES  685
            G +T IQL+GC + AVSAT L S+KWAK++PIKVE+K+S IY GS+TF IYLET+ +KE+
Sbjct  121  GFHTTIQLKGCLVEAVSATSLPSKKWAKKFPIKVEAKTSVIYHGSKTFCIYLETACEKEA  180

Query  686  WCKALRLAS  712
            WCKALRLAS
Sbjct  181  WCKALRLAS  189



>ref|XP_006587407.1| PREDICTED: uncharacterized protein LOC100787320 isoform X1 [Glycine 
max]
Length=805

 Score =   153 bits (387),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 91/189 (48%), Positives = 128/189 (68%), Gaps = 10/189 (5%)
 Frame = +2

Query  176  FVLVF---ILGALTVVGVEAAAAVFLIRWLSRRLSREV--DKAKVSA--ELSSPPGLDPS  334
             VLVF   +LG L  V    AA      W+ +RL  ++  D+AK+++  +L S     P 
Sbjct  1    MVLVFALILLGFLLGVAAVVAAEALGFLWVIKRLQSKISKDQAKIASKTQLGSAQSDRPQ  60

Query  335  YY--NKQGIVWILDLEKIPRAPVDKALGQK-KSKKEVLEVSPIQKYAKIKDHSLFLLESD  505
                 K+G+VW+L+ +K+ +  V+K   ++ K KKEVLEV+P++KY KI   SL L ++D
Sbjct  61   QQLLKKEGVVWVLEPDKVSKFWVEKQSSKELKRKKEVLEVTPVRKYGKINGQSLVLTDAD  120

Query  506  GSNTEIQLRGCTIAAVSATGLSSRKWAKRYPIKVESKSSAIYKGSRTFYIYLETSWDKES  685
            G +T IQL+GC + AVSAT L S+KWAK++PIKVE+K+S IY GS+TF IYLET+ +KE+
Sbjct  121  GFHTTIQLKGCLVEAVSATSLPSKKWAKKFPIKVEAKTSVIYHGSKTFCIYLETACEKEA  180

Query  686  WCKALRLAS  712
            WCKALRLAS
Sbjct  181  WCKALRLAS  189



>ref|XP_006587408.1| PREDICTED: uncharacterized protein LOC100787320 isoform X2 [Glycine 
max]
Length=800

 Score =   153 bits (387),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 91/189 (48%), Positives = 128/189 (68%), Gaps = 10/189 (5%)
 Frame = +2

Query  176  FVLVF---ILGALTVVGVEAAAAVFLIRWLSRRLSREV--DKAKVSA--ELSSPPGLDPS  334
             VLVF   +LG L  V    AA      W+ +RL  ++  D+AK+++  +L S     P 
Sbjct  1    MVLVFALILLGFLLGVAAVVAAEALGFLWVIKRLQSKISKDQAKIASKTQLGSAQSDRPQ  60

Query  335  YY--NKQGIVWILDLEKIPRAPVDKALGQK-KSKKEVLEVSPIQKYAKIKDHSLFLLESD  505
                 K+G+VW+L+ +K+ +  V+K   ++ K KKEVLEV+P++KY KI   SL L ++D
Sbjct  61   QQLLKKEGVVWVLEPDKVSKFWVEKQSSKELKRKKEVLEVTPVRKYGKINGQSLVLTDAD  120

Query  506  GSNTEIQLRGCTIAAVSATGLSSRKWAKRYPIKVESKSSAIYKGSRTFYIYLETSWDKES  685
            G +T IQL+GC + AVSAT L S+KWAK++PIKVE+K+S IY GS+TF IYLET+ +KE+
Sbjct  121  GFHTTIQLKGCLVEAVSATSLPSKKWAKKFPIKVEAKTSVIYHGSKTFCIYLETACEKEA  180

Query  686  WCKALRLAS  712
            WCKALRLAS
Sbjct  181  WCKALRLAS  189



>gb|KEH42874.1| integral membrane protein, putative [Medicago truncatula]
Length=798

 Score =   152 bits (385),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 91/186 (49%), Positives = 119/186 (64%), Gaps = 17/186 (9%)
 Frame = +2

Query  176  FVLVFILGALTVVGVEAAAAVFLIRWLSRRLSREVDKAKVSAELSSPPGLDPSYY-----  340
             +L F  G + VV V+A A +++I+ L R         +V A  SS   LD         
Sbjct  9    ILLGFTFGVVAVVTVQAIAFLWIIKRL-RHSHNHSSHTQVLA-TSSTDQLDHQQSLHFAS  66

Query  341  NKQGIVWILDLEKIPRAPVDKALGQKKSKKEVLEVSPIQKYAKIKDHSLFLLESDGS--N  514
             KQG+VW+L+  KI + P        K K E+LEVSPI+ Y KIKD SL L ESD    +
Sbjct  67   QKQGVVWVLESGKISKEP--------KRKDELLEVSPIKMYGKIKDQSLILRESDNLQLH  118

Query  515  TEIQLRGCTIAAVSATGLSSRKWAKRYPIKVESKSSAIYKGSRTFYIYLETSWDKESWCK  694
            + I+L+GCT+ AVSA+ LSS+KWAK++PIKVESK+S IYK S+  Y+YLETSW+KE+WCK
Sbjct  119  STIELKGCTVQAVSASILSSKKWAKKFPIKVESKTSVIYKRSKILYVYLETSWEKEAWCK  178

Query  695  ALRLAS  712
            AL LAS
Sbjct  179  ALYLAS  184



>emb|CDX81851.1| BnaC08g37500D [Brassica napus]
Length=771

 Score =   152 bits (385),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 84/183 (46%), Positives = 122/183 (67%), Gaps = 6/183 (3%)
 Frame = +2

Query  176  FVLVFILGALTVVGVEAAAAVFLIRWLSRRLSREVDKAKVSAELSSPPGLDPSYYNKQGI  355
            F+    LG + ++  EAA  ++L+  L+R+   +      + ++ +PP  D S  NKQG+
Sbjct  9    FLSGVFLGIVAILAAEAAGLMYLVNRLNRKRGSKPASDPSTDDIVNPPA-DFSL-NKQGM  66

Query  356  VWILDL-EKIPRAPVDKALGQKKSKKEVLEVSPIQKYAKIKDHSLFLLE--SDGSNTEIQ  526
            VWIL++ E +     +K   + K K++ LEV P++K+A+IKDH L L +  SD +   + 
Sbjct  67   VWILEVDEGVKNWGKEKVPKEHKKKRDFLEVHPLRKFARIKDHKLLLSDAGSDSTPAIVS  126

Query  527  LRGCTIAAVSATGLSSRKWAKRYPIKVESK-SSAIYKGSRTFYIYLETSWDKESWCKALR  703
            L+ C+I AVS   L +RKWAKR+PIKVESK SS +YKG++ FYIYLETSW+KESWCKALR
Sbjct  127  LKCCSIEAVSGNHLPTRKWAKRFPIKVESKISSELYKGNKVFYIYLETSWEKESWCKALR  186

Query  704  LAS  712
            LA+
Sbjct  187  LAA  189



>ref|XP_006300616.1| hypothetical protein CARUB_v10019838mg [Capsella rubella]
 gb|EOA33514.1| hypothetical protein CARUB_v10019838mg [Capsella rubella]
Length=591

 Score =   150 bits (380),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 83/188 (44%), Positives = 124/188 (66%), Gaps = 25/188 (13%)
 Frame = +2

Query  191  ILGALTVVGVEAAAAVFLIRWLSRRLSREVDKAKVSAELSSPPGLDPSYYN---------  343
            +LG L +V  E    ++L++ L+R+ +R+        E SS  G DP++ N         
Sbjct  14   LLGILAIVAAEVIGFLYLVKRLNRKSNRQ--------EPSS--GSDPTHKNFDPRQSVDF  63

Query  344  ---KQGIVWILDLEKIPR--APVDKALGQKKSKKEVLEVSPIQKYAKIKDHSLFLLESDG  508
               KQG++WIL++++  +          QKK + ++LEV P++++A+IKDH L L +SDG
Sbjct  64   SLSKQGVIWILEMDESVKDWMKEKLQKEQKKKRLDLLEVHPVRRFARIKDHKLILSDSDG  123

Query  509  SNTEIQLRGCTIAAVSATGLSSRKWAKRYPIKVESKSSAIYKGSRTFYIYLETSWDKESW  688
            + T I L+GC + AVS +G  +RKWAKR+PI+VESK+S +YKG+R  YI+LETSW+KESW
Sbjct  124  TQTSITLKGCFVDAVSGSG-PTRKWAKRFPIQVESKTSVLYKGNRLLYIFLETSWEKESW  182

Query  689  CKALRLAS  712
            CKALRLA+
Sbjct  183  CKALRLAA  190



>ref|XP_006300617.1| hypothetical protein CARUB_v10019838mg [Capsella rubella]
 gb|EOA33515.1| hypothetical protein CARUB_v10019838mg [Capsella rubella]
Length=775

 Score =   152 bits (383),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 83/188 (44%), Positives = 124/188 (66%), Gaps = 25/188 (13%)
 Frame = +2

Query  191  ILGALTVVGVEAAAAVFLIRWLSRRLSREVDKAKVSAELSSPPGLDPSYYN---------  343
            +LG L +V  E    ++L++ L+R+ +R+        E SS  G DP++ N         
Sbjct  14   LLGILAIVAAEVIGFLYLVKRLNRKSNRQ--------EPSS--GSDPTHKNFDPRQSVDF  63

Query  344  ---KQGIVWILDLEKIPR--APVDKALGQKKSKKEVLEVSPIQKYAKIKDHSLFLLESDG  508
               KQG++WIL++++  +          QKK + ++LEV P++++A+IKDH L L +SDG
Sbjct  64   SLSKQGVIWILEMDESVKDWMKEKLQKEQKKKRLDLLEVHPVRRFARIKDHKLILSDSDG  123

Query  509  SNTEIQLRGCTIAAVSATGLSSRKWAKRYPIKVESKSSAIYKGSRTFYIYLETSWDKESW  688
            + T I L+GC + AVS +G  +RKWAKR+PI+VESK+S +YKG+R  YI+LETSW+KESW
Sbjct  124  TQTSITLKGCFVDAVSGSG-PTRKWAKRFPIQVESKTSVLYKGNRLLYIFLETSWEKESW  182

Query  689  CKALRLAS  712
            CKALRLA+
Sbjct  183  CKALRLAA  190



>ref|XP_010239258.1| PREDICTED: testis-expressed sequence 2 protein-like isoform X1 
[Brachypodium distachyon]
Length=793

 Score =   149 bits (376),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 83/169 (49%), Positives = 105/169 (62%), Gaps = 8/169 (5%)
 Frame = +2

Query  221  EAAAAVFLIRWLSRRLSREVDKAKVSAELSSPPGLDPSYYNKQGIVWILDLEKIPRAPVD  400
            E AA V+ +R L RR  R  + A  + +LS   G  P    KQG +W+L+ +K+P     
Sbjct  22   EGAALVWALRTLRRRGPRPPEAATAAVQLS---GDRPLTTEKQGFLWMLEPQKMPNVSSS  78

Query  401  KALGQ-----KKSKKEVLEVSPIQKYAKIKDHSLFLLESDGSNTEIQLRGCTIAAVSATG  565
              L        K KK ++EV PI+  AKI  HSL L   DGS   I+L  C+  AVSA+ 
Sbjct  79   NQLPNGVQKDTKDKKNIVEVFPIRMLAKIDGHSLILSGPDGSRITIELMNCSAVAVSASN  138

Query  566  LSSRKWAKRYPIKVESKSSAIYKGSRTFYIYLETSWDKESWCKALRLAS  712
            L SRKWAKRYPIK+ESK S I KGS+  Y+Y++TSW+KESWCKALRLAS
Sbjct  139  LPSRKWAKRYPIKLESKGSEICKGSKVCYLYVDTSWEKESWCKALRLAS  187



>gb|KHG11075.1| Testis-expressed sequence 2 [Gossypium arboreum]
Length=814

 Score =   149 bits (375),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 83/181 (46%), Positives = 117/181 (65%), Gaps = 9/181 (5%)
 Frame = +2

Query  176  FVLVFILGALTVVGVEAAAAVFLIRWLSRRLSREVDKAKVSAE--LSSPPGLDPSYYNKQ  349
            F++ F+ G   ++  E    +F++  L+R++ + + K   +A+  + +P     S  N Q
Sbjct  5    FLVGFVAGICAILSFELLVVLFVLNLLNRKIKQRIKKETHAADAAVRNPQDSFDSICNLQ  64

Query  350  GIVWILDLEKIPRAPVDKALGQKKSKKEVLEVSPIQKYAKIKDHSLFLLESDGSNTEIQL  529
            GIVW+L+  KIP         ++K K+E +EVSP +++AKI+D  L L  SD S T I L
Sbjct  65   GIVWVLEPGKIPTK-------EQKRKRETVEVSPARRHAKIQDGYLTLANSDSSCTIIPL  117

Query  530  RGCTIAAVSATGLSSRKWAKRYPIKVESKSSAIYKGSRTFYIYLETSWDKESWCKALRLA  709
            +GC I AVSAT L SRKWAKRYPIKVESK+  IY  S+  Y+YL+T+W+KESWCK LRLA
Sbjct  118  KGCIIQAVSATSLPSRKWAKRYPIKVESKTKVIYNASKIIYLYLDTAWEKESWCKGLRLA  177

Query  710  S  712
            S
Sbjct  178  S  178



>ref|XP_006649193.1| PREDICTED: testis-expressed sequence 2 protein-like [Oryza brachyantha]
Length=815

 Score =   148 bits (374),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 76/136 (56%), Positives = 96/136 (71%), Gaps = 4/136 (3%)
 Frame = +2

Query  317  PGLDPSYYNKQGIVWILDLEKIPRAPVDKA-LG---QKKSKKEVLEVSPIQKYAKIKDHS  484
            PG  P  Y KQG +WIL+ EK P+A  +++ +G   + K KK ++EV P +K AKIK HS
Sbjct  48   PGERPFPYEKQGFLWILEPEKTPKANTERSSIGGPKEAKDKKNIVEVFPSKKSAKIKGHS  107

Query  485  LFLLESDGSNTEIQLRGCTIAAVSATGLSSRKWAKRYPIKVESKSSAIYKGSRTFYIYLE  664
            L L   DG  T I+L  CT+ AVSA+ + SRKWAKRYPIK+ESK   IY GS+  Y+Y E
Sbjct  108  LILSGPDGFQTTIKLLNCTVFAVSASSMQSRKWAKRYPIKLESKEYQIYNGSKACYLYAE  167

Query  665  TSWDKESWCKALRLAS  712
            TSW+KESWCKALRLA+
Sbjct  168  TSWEKESWCKALRLAA  183



>gb|KDO56010.1| hypothetical protein CISIN_1g003631mg [Citrus sinensis]
Length=501

 Score =   145 bits (367),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 96/187 (51%), Positives = 126/187 (67%), Gaps = 8/187 (4%)
 Frame = +2

Query  167  MWQFVLVFILGALTVVGVEAAAAVFLIRWLSRRLSREVDKAKVSAELSSPPGLDPSY---  337
            M  F +  I+GA+ VV VEAAA ++ I  L+++  +    +   + L S   LDP     
Sbjct  1    MISFFVGLIIGAIGVVAVEAAAVLYFIYKLNQKTKKVASFSPSPSSLDSSEVLDPQQSLE  60

Query  338  --YNKQGIVWILDLEKIPRAPVDKALGQKKSKKEVLEVSPIQKYAKIKDHSLFLLESDGS  511
              Y KQG VW+L+ EK+P+    K   ++K KKE LEV P++KYAKIK  +L L  +DGS
Sbjct  61   FAYKKQGYVWVLEPEKVPKE---KFSKEQKKKKEFLEVYPVRKYAKIKHRALILTSTDGS  117

Query  512  NTEIQLRGCTIAAVSATGLSSRKWAKRYPIKVESKSSAIYKGSRTFYIYLETSWDKESWC  691
             T   L+GC I AVSA+ LSSRKWAKR+PIKVE+KSS +Y GS+  YI+LETSW+KE+WC
Sbjct  118  QTSFPLKGCEIKAVSASSLSSRKWAKRFPIKVENKSSVLYNGSKLIYIFLETSWEKEAWC  177

Query  692  KALRLAS  712
            KALRLAS
Sbjct  178  KALRLAS  184



>gb|KJB67990.1| hypothetical protein B456_010G220600 [Gossypium raimondii]
Length=759

 Score =   147 bits (371),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 82/181 (45%), Positives = 117/181 (65%), Gaps = 9/181 (5%)
 Frame = +2

Query  176  FVLVFILGALTVVGVEAAAAVFLIRWLSRRLSREVDKAKVSAE--LSSPPGLDPSYYNKQ  349
            F++ F+ G   ++  E    +F++  L+R++ + + K   +A+  + +P     S  N Q
Sbjct  5    FLVGFVAGICAILSFEVLVVLFVLNLLNRKIKQRIKKETHAADAAVRNPQDSFDSICNLQ  64

Query  350  GIVWILDLEKIPRAPVDKALGQKKSKKEVLEVSPIQKYAKIKDHSLFLLESDGSNTEIQL  529
            GIVW+L+  KIP         ++K K+E +EVSP +++AKI+D  L L  SD S T I L
Sbjct  65   GIVWVLEPGKIPTK-------EQKRKRETVEVSPARRHAKIQDGYLTLSNSDSSCTIIPL  117

Query  530  RGCTIAAVSATGLSSRKWAKRYPIKVESKSSAIYKGSRTFYIYLETSWDKESWCKALRLA  709
            +GC I AVSAT L +RKWAKRYPIKVESK+  IY  S+  Y+YL+T+W+KESWCK LRLA
Sbjct  118  KGCIIQAVSATSLPTRKWAKRYPIKVESKTKVIYNASKIIYLYLDTAWEKESWCKGLRLA  177

Query  710  S  712
            S
Sbjct  178  S  178



>gb|KDO56009.1| hypothetical protein CISIN_1g003631mg [Citrus sinensis]
Length=608

 Score =   145 bits (367),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 96/187 (51%), Positives = 126/187 (67%), Gaps = 8/187 (4%)
 Frame = +2

Query  167  MWQFVLVFILGALTVVGVEAAAAVFLIRWLSRRLSREVDKAKVSAELSSPPGLDPSY---  337
            M  F +  I+GA+ VV VEAAA ++ I  L+++  +    +   + L S   LDP     
Sbjct  1    MISFFVGLIIGAIGVVAVEAAAVLYFIYKLNQKTKKVASFSPSPSSLDSSEVLDPQQSLE  60

Query  338  --YNKQGIVWILDLEKIPRAPVDKALGQKKSKKEVLEVSPIQKYAKIKDHSLFLLESDGS  511
              Y KQG VW+L+ EK+P+    K   ++K KKE LEV P++KYAKIK  +L L  +DGS
Sbjct  61   FAYKKQGYVWVLEPEKVPKE---KFSKEQKKKKEFLEVYPVRKYAKIKHRALILTSTDGS  117

Query  512  NTEIQLRGCTIAAVSATGLSSRKWAKRYPIKVESKSSAIYKGSRTFYIYLETSWDKESWC  691
             T   L+GC I AVSA+ LSSRKWAKR+PIKVE+KSS +Y GS+  YI+LETSW+KE+WC
Sbjct  118  QTSFPLKGCEIKAVSASSLSSRKWAKRFPIKVENKSSVLYNGSKLIYIFLETSWEKEAWC  177

Query  692  KALRLAS  712
            KALRLAS
Sbjct  178  KALRLAS  184



>gb|KEH26662.1| integral membrane protein, putative [Medicago truncatula]
Length=754

 Score =   146 bits (369),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 68/120 (57%), Positives = 93/120 (78%), Gaps = 0/120 (0%)
 Frame = +2

Query  353  IVWILDLEKIPRAPVDKALGQKKSKKEVLEVSPIQKYAKIKDHSLFLLESDGSNTEIQLR  532
             +W+L+ EK+ +  V+++  + K KKE+ EVSP++KY  IK  SL L E DGS+T IQL+
Sbjct  22   FIWVLEPEKVSKYFVERSSKEVKRKKELFEVSPVRKYGNIKCQSLVLTEPDGSHTTIQLK  81

Query  533  GCTIAAVSATGLSSRKWAKRYPIKVESKSSAIYKGSRTFYIYLETSWDKESWCKALRLAS  712
            GC + AVSAT   ++KWAK+YPIKVE+++S IY GS+T Y+YLETS +KE+WCKALRLAS
Sbjct  82   GCIVEAVSATSAPTKKWAKKYPIKVENRTSVIYHGSKTLYVYLETSSEKEAWCKALRLAS  141



>ref|XP_006478163.1| PREDICTED: testis-expressed sequence 2 protein-like isoform X1 
[Citrus sinensis]
Length=806

 Score =   147 bits (370),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 94/187 (50%), Positives = 122/187 (65%), Gaps = 8/187 (4%)
 Frame = +2

Query  167  MWQFVLVFILGALTVVGVEAAAAVFLIRWLSRRLSREVDKAKVSAELSSPPGLDPSY---  337
            M  F +  I+GA+ VV VEAAA ++ I  L+++  +    +   + L S   LDP     
Sbjct  1    MISFFVGLIIGAIGVVAVEAAAVLYFIYKLNQKTKKVASFSPSPSSLDSSEVLDPQQSLE  60

Query  338  --YNKQGIVWILDLEKIPRAPVDKALGQKKSKKEVLEVSPIQKYAKIKDHSLFLLESDGS  511
              Y KQG VW+L+ EK+P+    K   +KK   EV    PI+KYAKIK  +L L  +DGS
Sbjct  61   FAYKKQGYVWVLEPEKVPKEKFSKEQKKKKEFLEVY---PIRKYAKIKHRALILTSTDGS  117

Query  512  NTEIQLRGCTIAAVSATGLSSRKWAKRYPIKVESKSSAIYKGSRTFYIYLETSWDKESWC  691
             T   L+GC I AVSA+ LSSRKWAKR+PIKVE+KSS +Y GS+  YI+LETSW+KE+WC
Sbjct  118  QTSFPLKGCEIKAVSASSLSSRKWAKRFPIKVENKSSVLYNGSKLIYIFLETSWEKEAWC  177

Query  692  KALRLAS  712
            KALRLAS
Sbjct  178  KALRLAS  184



>ref|XP_002453085.1| hypothetical protein SORBIDRAFT_04g038050 [Sorghum bicolor]
 gb|EES06061.1| hypothetical protein SORBIDRAFT_04g038050 [Sorghum bicolor]
Length=782

 Score =   146 bits (369),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 73/136 (54%), Positives = 96/136 (71%), Gaps = 4/136 (3%)
 Frame = +2

Query  317  PGLDPSYYNKQGIVWILDLEKIPRAPVDK-ALG---QKKSKKEVLEVSPIQKYAKIKDHS  484
            PG  P  Y KQG +WIL+ EK+P+   ++ ++G   + K KK ++EV P +K AKI  HS
Sbjct  50   PGERPFPYEKQGSLWILEPEKMPKVSNERLSVGGPKETKDKKNIVEVFPAKKMAKINGHS  109

Query  485  LFLLESDGSNTEIQLRGCTIAAVSATGLSSRKWAKRYPIKVESKSSAIYKGSRTFYIYLE  664
            L L   DGS   I+L  CT+ AVSA+ + SRKWAKRYPIK+ESK S IY GS+  Y+Y +
Sbjct  110  LCLSAPDGSQATIELLNCTVLAVSASSMPSRKWAKRYPIKLESKDSEIYNGSKVCYLYTD  169

Query  665  TSWDKESWCKALRLAS  712
            TSW+KESWCKALR+A+
Sbjct  170  TSWEKESWCKALRIAA  185



>gb|KDO56007.1| hypothetical protein CISIN_1g003631mg [Citrus sinensis]
Length=806

 Score =   146 bits (369),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 96/187 (51%), Positives = 126/187 (67%), Gaps = 8/187 (4%)
 Frame = +2

Query  167  MWQFVLVFILGALTVVGVEAAAAVFLIRWLSRRLSREVDKAKVSAELSSPPGLDPSY---  337
            M  F +  I+GA+ VV VEAAA ++ I  L+++  +    +   + L S   LDP     
Sbjct  1    MISFFVGLIIGAIGVVAVEAAAVLYFIYKLNQKTKKVASFSPSPSSLDSSEVLDPQQSLE  60

Query  338  --YNKQGIVWILDLEKIPRAPVDKALGQKKSKKEVLEVSPIQKYAKIKDHSLFLLESDGS  511
              Y KQG VW+L+ EK+P+    K   ++K KKE LEV P++KYAKIK  +L L  +DGS
Sbjct  61   FAYKKQGYVWVLEPEKVPKE---KFSKEQKKKKEFLEVYPVRKYAKIKHRALILTSTDGS  117

Query  512  NTEIQLRGCTIAAVSATGLSSRKWAKRYPIKVESKSSAIYKGSRTFYIYLETSWDKESWC  691
             T   L+GC I AVSA+ LSSRKWAKR+PIKVE+KSS +Y GS+  YI+LETSW+KE+WC
Sbjct  118  QTSFPLKGCEIKAVSASSLSSRKWAKRFPIKVENKSSVLYNGSKLIYIFLETSWEKEAWC  177

Query  692  KALRLAS  712
            KALRLAS
Sbjct  178  KALRLAS  184



>ref|XP_003573002.1| PREDICTED: testis-expressed sequence 2 protein-like [Brachypodium 
distachyon]
Length=799

 Score =   146 bits (369),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 74/136 (54%), Positives = 98/136 (72%), Gaps = 4/136 (3%)
 Frame = +2

Query  317  PGLDPSYYNKQGIVWILDLEKIPRAPVDK--ALGQKKS--KKEVLEVSPIQKYAKIKDHS  484
            PG  P  Y K+G +WIL+ EK+P+   D+  + G K++  KK V+EV P +K AKIK H+
Sbjct  50   PGERPFPYEKKGSLWILEPEKLPKVSNDRLSSGGPKEANDKKNVVEVFPAKKMAKIKGHT  109

Query  485  LFLLESDGSNTEIQLRGCTIAAVSATGLSSRKWAKRYPIKVESKSSAIYKGSRTFYIYLE  664
            L L   DG+ T I+L  CT+ AVSA+ ++SRKW KRYPIK+ES+ S IY GS+  Y+Y E
Sbjct  110  LSLSGPDGAGTTIELLNCTVVAVSASSMASRKWTKRYPIKLESQESEIYNGSKVCYLYAE  169

Query  665  TSWDKESWCKALRLAS  712
            TSW+KESWCKALRLA+
Sbjct  170  TSWEKESWCKALRLAA  185



>ref|XP_004301206.1| PREDICTED: uncharacterized protein LOC101303523 [Fragaria vesca 
subsp. vesca]
Length=803

 Score =   145 bits (366),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 76/133 (57%), Positives = 103/133 (77%), Gaps = 6/133 (5%)
 Frame = +2

Query  332  SYYNKQGIVWILDLEKIPRAPVD------KALGQKKSKKEVLEVSPIQKYAKIKDHSLFL  493
            S  +KQG+VW+L+ EK+P++  D      +   ++K KKE  EVSP++K+AK+K+  L L
Sbjct  56   SLESKQGVVWVLEPEKVPKSWQDSVSREQRVSREQKRKKEFYEVSPVKKHAKLKNQLLLL  115

Query  494  LESDGSNTEIQLRGCTIAAVSATGLSSRKWAKRYPIKVESKSSAIYKGSRTFYIYLETSW  673
             ESDGS T + L+ CTI AVS+T L+SRKWAKR+P+K+ESK++ +YKGS+ FYIYLETSW
Sbjct  116  KESDGSQTAVPLKSCTIEAVSSTSLASRKWAKRFPLKLESKTAILYKGSKIFYIYLETSW  175

Query  674  DKESWCKALRLAS  712
            +KESWCKALR AS
Sbjct  176  EKESWCKALRSAS  188



>ref|XP_004954472.1| PREDICTED: uncharacterized protein LOC101777078 [Setaria italica]
Length=890

 Score =   145 bits (365),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 75/137 (55%), Positives = 97/137 (71%), Gaps = 5/137 (4%)
 Frame = +2

Query  317  PGLDP-SYYNKQGIVWILDLEKIPRAPVDK-ALG---QKKSKKEVLEVSPIQKYAKIKDH  481
            PG  P  YY K+G +WIL+ EKIP+   ++ ++G   + K KK + EV P +K AKIK H
Sbjct  128  PGERPFPYYEKKGSLWILEPEKIPKVSNERLSVGGPKETKDKKNIAEVFPAKKMAKIKGH  187

Query  482  SLFLLESDGSNTEIQLRGCTIAAVSATGLSSRKWAKRYPIKVESKSSAIYKGSRTFYIYL  661
            SL L   DGS   I+L  CT+ AVSA+ + SRKWAKRYPIK+ESK S IY GS+  Y+Y 
Sbjct  188  SLCLSGPDGSQATIELLNCTVLAVSASSMPSRKWAKRYPIKLESKDSEIYNGSKVCYLYT  247

Query  662  ETSWDKESWCKALRLAS  712
            +TSW+KESWCKALR+A+
Sbjct  248  DTSWEKESWCKALRVAA  264



>gb|EEC74285.1| hypothetical protein OsI_09535 [Oryza sativa Indica Group]
Length=819

 Score =   144 bits (362),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 74/136 (54%), Positives = 96/136 (71%), Gaps = 4/136 (3%)
 Frame = +2

Query  317  PGLDPSYYNKQGIVWILDLEKIPRAPVDKA-LG---QKKSKKEVLEVSPIQKYAKIKDHS  484
            PG  P  Y KQG +WIL+ EK P+A  +++ +G   + K KK ++EV P ++ AKIK  S
Sbjct  48   PGERPFPYEKQGFLWILEPEKTPKASNERSSIGGPKETKEKKNIVEVFPAKRSAKIKGRS  107

Query  485  LFLLESDGSNTEIQLRGCTIAAVSATGLSSRKWAKRYPIKVESKSSAIYKGSRTFYIYLE  664
            L L   DG +T I+L  CT+ AVSA+ + SRKWAKRYPIK+ESK   IY GS+  Y+Y E
Sbjct  108  LILSGPDGFHTTIKLLNCTVFAVSASSMPSRKWAKRYPIKLESKEYQIYNGSKACYLYAE  167

Query  665  TSWDKESWCKALRLAS  712
            TSW+KESWCKALRLA+
Sbjct  168  TSWEKESWCKALRLAA  183



>dbj|BAD23057.1| unknown protein [Oryza sativa Japonica Group]
 gb|EEE58095.1| hypothetical protein OsJ_08966 [Oryza sativa Japonica Group]
Length=819

 Score =   144 bits (362),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 74/136 (54%), Positives = 96/136 (71%), Gaps = 4/136 (3%)
 Frame = +2

Query  317  PGLDPSYYNKQGIVWILDLEKIPRAPVDKA-LG---QKKSKKEVLEVSPIQKYAKIKDHS  484
            PG  P  Y KQG +WIL+ EK P+A  +++ +G   + K KK ++EV P ++ AKIK  S
Sbjct  48   PGERPFPYEKQGFLWILEPEKTPKASNERSSIGGPKETKEKKNIVEVFPAKRSAKIKGRS  107

Query  485  LFLLESDGSNTEIQLRGCTIAAVSATGLSSRKWAKRYPIKVESKSSAIYKGSRTFYIYLE  664
            L L   DG +T I+L  CT+ AVSA+ + SRKWAKRYPIK+ESK   IY GS+  Y+Y E
Sbjct  108  LILSGPDGFHTTIKLLNCTVFAVSASSMPSRKWAKRYPIKLESKEYQIYNGSKVCYLYAE  167

Query  665  TSWDKESWCKALRLAS  712
            TSW+KESWCKALRLA+
Sbjct  168  TSWEKESWCKALRLAA  183



>gb|AFW63912.1| hypothetical protein ZEAMMB73_732140 [Zea mays]
Length=796

 Score =   143 bits (361),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 72/136 (53%), Positives = 96/136 (71%), Gaps = 4/136 (3%)
 Frame = +2

Query  317  PGLDPSYYNKQGIVWILDLEKIPRAPVDK--ALG--QKKSKKEVLEVSPIQKYAKIKDHS  484
            PG  P  Y KQG +WIL+ EK+P+   D+  A G  + K KK ++EV P +K AKIK +S
Sbjct  50   PGERPFPYEKQGFLWILEPEKMPKLSNDRLSAGGPRETKDKKNIVEVFPAKKMAKIKGNS  109

Query  485  LFLLESDGSNTEIQLRGCTIAAVSATGLSSRKWAKRYPIKVESKSSAIYKGSRTFYIYLE  664
            L L   DGS   I+L  CT+ AVSA+ + SRKWAKR+P+K+ESK + IY GS+  Y+Y +
Sbjct  110  LCLSGPDGSQATIELLNCTVLAVSASSMPSRKWAKRFPVKLESKDNEIYNGSKVCYLYTD  169

Query  665  TSWDKESWCKALRLAS  712
            TSW+KESWCKALR+A+
Sbjct  170  TSWEKESWCKALRIAA  185



>ref|XP_009385248.1| PREDICTED: uncharacterized protein LOC103972625 [Musa acuminata 
subsp. malaccensis]
Length=795

 Score =   142 bits (359),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 84/187 (45%), Positives = 114/187 (61%), Gaps = 10/187 (5%)
 Frame = +2

Query  182  LVF--ILGALTVVGVEAAAAVFLIRWLSRRLSREVDKAK--VSAELSSPPGLDPSYYNKQ  349
            LVF   +GA+ ++GVE   ++ L  W+S R  R     +       S      P+  NKQ
Sbjct  5    LVFGVFIGAIALLGVELLFSLLLYYWISGRRGRAPASPRRYNCCHDSDDERSLPAECNKQ  64

Query  350  GIVWILDLEKIPRAPVD---KALGQKKSKK--EVLEVSPIQKYAKIKDHSLFLLESDGSN  514
            GIVW+L+  K      D   +A G K+     E++EV P+ K+AKIK+H L L + D S 
Sbjct  65   GIVWVLEAAKAAEVGGDGGSQATGTKEEAGVVEIVEVYPVLKHAKIKNHKLILTDPDDSR  124

Query  515  T-EIQLRGCTIAAVSATGLSSRKWAKRYPIKVESKSSAIYKGSRTFYIYLETSWDKESWC  691
            T  I+L  C + AVSA+   +RKWA RYPIK+ES ++ IY+GSRT Y+YL+TSW+KESWC
Sbjct  125  TATIELLDCAVFAVSASDRETRKWANRYPIKLESMNADIYQGSRTCYVYLDTSWEKESWC  184

Query  692  KALRLAS  712
            KALR AS
Sbjct  185  KALRFAS  191



>dbj|BAK04177.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=813

 Score =   142 bits (357),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 78/158 (49%), Positives = 107/158 (68%), Gaps = 4/158 (3%)
 Frame = +2

Query  251  WLSRRLSREVDKAKVSAELSSPPGLDPSYYNKQGIVWILDLEKIPRAPVDK----ALGQK  418
            W++RRL R  + A  + +    PG  P  Y K+G +WIL+ EK+P+   ++       + 
Sbjct  27   WVARRLRRRGEGAAAAPDAQELPGEQPFPYEKKGCLWILEPEKLPKVSNERLSSGGPKET  86

Query  419  KSKKEVLEVSPIQKYAKIKDHSLFLLESDGSNTEIQLRGCTIAAVSATGLSSRKWAKRYP  598
            K KK ++EV P +K A+IK HSL L   DG +T I+L  CT+ AVSA+ +SSRKWAKRYP
Sbjct  87   KEKKSIVEVFPAKKSAQIKGHSLCLSGPDGPDTTIKLLNCTVVAVSASSMSSRKWAKRYP  146

Query  599  IKVESKSSAIYKGSRTFYIYLETSWDKESWCKALRLAS  712
            IK+ES+ S IY GS+  ++Y ETSW+KESWCKALRLA+
Sbjct  147  IKLESQESEIYNGSKVCFLYAETSWEKESWCKALRLAA  184



>ref|XP_010239262.1| PREDICTED: testis-expressed sequence 2 protein-like isoform X2 
[Brachypodium distachyon]
Length=774

 Score =   137 bits (345),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 71/136 (52%), Positives = 88/136 (65%), Gaps = 5/136 (4%)
 Frame = +2

Query  320  GLDPSYYNKQGIVWILDLEKIPRAPVDKALGQ-----KKSKKEVLEVSPIQKYAKIKDHS  484
            G  P    KQG +W+L+ +K+P       L        K KK ++EV PI+  AKI  HS
Sbjct  33   GDRPLTTEKQGFLWMLEPQKMPNVSSSNQLPNGVQKDTKDKKNIVEVFPIRMLAKIDGHS  92

Query  485  LFLLESDGSNTEIQLRGCTIAAVSATGLSSRKWAKRYPIKVESKSSAIYKGSRTFYIYLE  664
            L L   DGS   I+L  C+  AVSA+ L SRKWAKRYPIK+ESK S I KGS+  Y+Y++
Sbjct  93   LILSGPDGSRITIELMNCSAVAVSASNLPSRKWAKRYPIKLESKGSEICKGSKVCYLYVD  152

Query  665  TSWDKESWCKALRLAS  712
            TSW+KESWCKALRLAS
Sbjct  153  TSWEKESWCKALRLAS  168



>gb|EMS63454.1| hypothetical protein TRIUR3_21249 [Triticum urartu]
Length=637

 Score =   135 bits (341),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 73/137 (53%), Positives = 90/137 (66%), Gaps = 6/137 (4%)
 Frame = +2

Query  320  GLDPSYYNKQGIVWILDLEKIP------RAPVDKALGQKKSKKEVLEVSPIQKYAKIKDH  481
            G  P    KQG +W+L+  K+P      R P        K KK ++EVSPI+  AKI+ H
Sbjct  52   GDRPFPAEKQGFLWMLEPGKVPKVRNGNRLPPTGVQKGVKDKKNIVEVSPIRMRAKIQGH  111

Query  482  SLFLLESDGSNTEIQLRGCTIAAVSATGLSSRKWAKRYPIKVESKSSAIYKGSRTFYIYL  661
            SL L  SDGS   I L  CT+ AVSA+ L SRKW+KRYPIK+ESK S I K S+  Y+Y+
Sbjct  112  SLVLTGSDGSQITIGLLDCTVLAVSASNLPSRKWSKRYPIKLESKGSEICKRSKVCYLYV  171

Query  662  ETSWDKESWCKALRLAS  712
            +TSW+KESWCKALRLAS
Sbjct  172  DTSWEKESWCKALRLAS  188



>gb|EMT07633.1| hypothetical protein F775_06998 [Aegilops tauschii]
Length=742

 Score =   132 bits (331),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 79/160 (49%), Positives = 106/160 (66%), Gaps = 6/160 (4%)
 Frame = +2

Query  251  WLSRRLSREVDKAKVSAELSSP--PGLDPSYYNKQGIVWILDLEKIPRAPVDK----ALG  412
            W++RRL R  + A  +A+      PG  P    K+G +WIL+ EK+P+   ++       
Sbjct  27   WVARRLLRRQEAAAAAAQPGDQELPGEQPFPCEKKGSLWILEPEKLPKVSNERLSSGGPK  86

Query  413  QKKSKKEVLEVSPIQKYAKIKDHSLFLLESDGSNTEIQLRGCTIAAVSATGLSSRKWAKR  592
            + K KK ++EV P +K AKIK HSL L   DG +T I+L  CT+ AVSA+ +SSRKW KR
Sbjct  87   ETKEKKSIVEVFPAKKSAKIKGHSLSLSGPDGPDTTIELLNCTVVAVSASSMSSRKWTKR  146

Query  593  YPIKVESKSSAIYKGSRTFYIYLETSWDKESWCKALRLAS  712
            YPIKVES+ S IY GS+  ++Y ETSW+KESWCKALRLA+
Sbjct  147  YPIKVESQESEIYNGSKVCFLYAETSWEKESWCKALRLAA  186



>gb|EMT17801.1| hypothetical protein F775_17825 [Aegilops tauschii]
Length=720

 Score =   131 bits (329),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 69/127 (54%), Positives = 86/127 (68%), Gaps = 6/127 (5%)
 Frame = +2

Query  350  GIVWILDLEKIP------RAPVDKALGQKKSKKEVLEVSPIQKYAKIKDHSLFLLESDGS  511
            G +W+L+  K+P      R P        K KK ++EVSPI+  AKI+ HSL L  SDGS
Sbjct  3    GFLWMLEPGKVPKVRNGNRLPPTGVQKGVKDKKNIVEVSPIRMRAKIQGHSLVLTGSDGS  62

Query  512  NTEIQLRGCTIAAVSATGLSSRKWAKRYPIKVESKSSAIYKGSRTFYIYLETSWDKESWC  691
               I L  CT+ AVSA+ L SRKW+KRYPIK+ESK S I K S+  Y+Y++TSW+KESWC
Sbjct  63   QITIGLLDCTVLAVSASNLPSRKWSKRYPIKLESKESEICKRSKVCYLYVDTSWEKESWC  122

Query  692  KALRLAS  712
            KALRLAS
Sbjct  123  KALRLAS  129



>ref|XP_009789864.1| PREDICTED: testis-expressed sequence 2 protein-like isoform X3 
[Nicotiana sylvestris]
Length=728

 Score =   130 bits (327),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 68/93 (73%), Positives = 81/93 (87%), Gaps = 0/93 (0%)
 Frame = +2

Query  434  VLEVSPIQKYAKIKDHSLFLLESDGSNTEIQLRGCTIAAVSATGLSSRKWAKRYPIKVES  613
            +LEV P +K+ KIKDHSL L +SDGS TEI L+GC ++AVSA+ LSSRKWAK+YPIK+E+
Sbjct  1    MLEVIPARKFGKIKDHSLILTDSDGSRTEIPLKGCMVSAVSASSLSSRKWAKKYPIKIEN  60

Query  614  KSSAIYKGSRTFYIYLETSWDKESWCKALRLAS  712
             +SAIYKGS  FYIYLETSW+KESWCKALRLAS
Sbjct  61   GASAIYKGSGIFYIYLETSWEKESWCKALRLAS  93



>ref|XP_002439079.1| hypothetical protein SORBIDRAFT_10g031200 [Sorghum bicolor]
 gb|EER90446.1| hypothetical protein SORBIDRAFT_10g031200 [Sorghum bicolor]
Length=777

 Score =   129 bits (324),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 80/183 (44%), Positives = 107/183 (58%), Gaps = 24/183 (13%)
 Frame = +2

Query  218  VEAAAAVFLIRWLSRRLSREVDKAKVSAELSSPP-GLDPSY--------YNKQGIVWILD  370
             E  A +++IR L+RR S         A L SPP  + P+          N+QG +W+L+
Sbjct  22   AEGLALLWVIRSLTRRPS------DSEATLPSPPLPVHPTLPRSVSRHGLNRQGFLWMLE  75

Query  371  LEKIPRAPVDK----ALGQK---KSKKEVLEVSPIQKYAKIKDHSLFL--LESDGSNTEI  523
             +K P  P D     + G     + KK ++EV P++  A ++ HSL L     D S   I
Sbjct  76   QQKTPSGPKDSINRPSNGGSPGIRDKKLIIEVFPVKMSATLEGHSLTLSGPADDASQLTI  135

Query  524  QLRGCTIAAVSATGLSSRKWAKRYPIKVESKSSAIYKGSRTFYIYLETSWDKESWCKALR  703
             L  CT+ AVSA+ L SRKWAKRYPIK+ESK S I +GS+  Y+Y +TSW+KESWCKALR
Sbjct  136  DLLSCTVVAVSASNLPSRKWAKRYPIKLESKESDICRGSKVCYVYADTSWEKESWCKALR  195

Query  704  LAS  712
            LAS
Sbjct  196  LAS  198



>ref|XP_008645130.1| PREDICTED: testis-expressed sequence 2 protein-like isoform X1 
[Zea mays]
 gb|AFW69648.1| hypothetical protein ZEAMMB73_139782 [Zea mays]
Length=762

 Score =   127 bits (320),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 74/168 (44%), Positives = 102/168 (61%), Gaps = 5/168 (3%)
 Frame = +2

Query  218  VEAAAAVFLIRWLSRRLSREVDKAKVSAELSSPPGLDPSYY--NKQGIVWILDLEKIPRA  391
             E    ++ IR L+RR S        S  +   P    S +  N+QG +W+L+  K   +
Sbjct  22   AEGLTLLWAIRSLTRRTSASRSTPPPSLPIHPTPARSVSRHSLNRQGFLWMLEQPK--DS  79

Query  392  PVDKALGQKKSKKEVLEVSPIQKYAKIKDHSLFLL-ESDGSNTEIQLRGCTIAAVSATGL  568
             ++ A    + +K ++EV P++  A ++ HSL L    D S   I L GCT+AAVSA+ L
Sbjct  80   SINGASPGIRDRKLLVEVFPVKMSATLQGHSLTLSGPDDASQLTIDLLGCTVAAVSASNL  139

Query  569  SSRKWAKRYPIKVESKSSAIYKGSRTFYIYLETSWDKESWCKALRLAS  712
             SRKWAKRYPIK+ESK S I +GS+  Y+Y +TSW+KESWCKALRLAS
Sbjct  140  PSRKWAKRYPIKLESKESGICRGSKVCYVYADTSWEKESWCKALRLAS  187



>ref|XP_004966560.1| PREDICTED: testis-expressed sequence 2 protein-like isoform X2 
[Setaria italica]
Length=781

 Score =   126 bits (316),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 69/132 (52%), Positives = 89/132 (67%), Gaps = 9/132 (7%)
 Frame = +2

Query  344  KQGIVWILDLEKIP----RAPVDKAL--GQKKSKKEVLEVSPIQKYAKIKDHSLFLLESD  505
            +QG +WIL+ EK+P      P + A   G  K KK V+EV P++  AK++ HSL L   D
Sbjct  69   RQGFLWILEQEKMPAKASHHPSNDAQSHGGIKDKKTVVEVFPVKMLAKLEGHSLTLSAPD  128

Query  506  GSN---TEIQLRGCTIAAVSATGLSSRKWAKRYPIKVESKSSAIYKGSRTFYIYLETSWD  676
             ++   T I L   TI AVSA+ L SRKWAKRYPIK+ESK S + +GS+  Y+Y +TSW+
Sbjct  129  DASQQTTTIHLLDSTIVAVSASNLPSRKWAKRYPIKLESKESQVSRGSKVCYVYAQTSWE  188

Query  677  KESWCKALRLAS  712
            KESWCKALRLAS
Sbjct  189  KESWCKALRLAS  200



>ref|XP_004966559.1| PREDICTED: testis-expressed sequence 2 protein-like isoform X1 
[Setaria italica]
Length=784

 Score =   126 bits (316),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 69/132 (52%), Positives = 89/132 (67%), Gaps = 9/132 (7%)
 Frame = +2

Query  344  KQGIVWILDLEKIP----RAPVDKAL--GQKKSKKEVLEVSPIQKYAKIKDHSLFLLESD  505
            +QG +WIL+ EK+P      P + A   G  K KK V+EV P++  AK++ HSL L   D
Sbjct  69   RQGFLWILEQEKMPAKASHHPSNDAQSHGGIKDKKTVVEVFPVKMLAKLEGHSLTLSAPD  128

Query  506  GSN---TEIQLRGCTIAAVSATGLSSRKWAKRYPIKVESKSSAIYKGSRTFYIYLETSWD  676
             ++   T I L   TI AVSA+ L SRKWAKRYPIK+ESK S + +GS+  Y+Y +TSW+
Sbjct  129  DASQQTTTIHLLDSTIVAVSASNLPSRKWAKRYPIKLESKESQVSRGSKVCYVYAQTSWE  188

Query  677  KESWCKALRLAS  712
            KESWCKALRLAS
Sbjct  189  KESWCKALRLAS  200



>ref|XP_004966561.1| PREDICTED: testis-expressed sequence 2 protein-like isoform X3 
[Setaria italica]
Length=763

 Score =   125 bits (315),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 69/132 (52%), Positives = 89/132 (67%), Gaps = 9/132 (7%)
 Frame = +2

Query  344  KQGIVWILDLEKIP----RAPVDKAL--GQKKSKKEVLEVSPIQKYAKIKDHSLFLLESD  505
            +QG +WIL+ EK+P      P + A   G  K KK V+EV P++  AK++ HSL L   D
Sbjct  69   RQGFLWILEQEKMPAKASHHPSNDAQSHGGIKDKKTVVEVFPVKMLAKLEGHSLTLSAPD  128

Query  506  GSN---TEIQLRGCTIAAVSATGLSSRKWAKRYPIKVESKSSAIYKGSRTFYIYLETSWD  676
             ++   T I L   TI AVSA+ L SRKWAKRYPIK+ESK S + +GS+  Y+Y +TSW+
Sbjct  129  DASQQTTTIHLLDSTIVAVSASNLPSRKWAKRYPIKLESKESQVSRGSKVCYVYAQTSWE  188

Query  677  KESWCKALRLAS  712
            KESWCKALRLAS
Sbjct  189  KESWCKALRLAS  200



>gb|EMS68899.1| Testis-expressed sequence 2 protein [Triticum urartu]
Length=721

 Score =   122 bits (307),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 68/125 (54%), Positives = 89/125 (71%), Gaps = 4/125 (3%)
 Frame = +2

Query  350  GIVWILDLEKIPRAPVDK----ALGQKKSKKEVLEVSPIQKYAKIKDHSLFLLESDGSNT  517
            G +WIL+ EK+P+   ++       + K KK ++EV P +K AKIK HSL L   DG +T
Sbjct  23   GSLWILEPEKLPKVSNERLSSGGPKETKEKKSIVEVFPAKKSAKIKGHSLSLSGPDGPDT  82

Query  518  EIQLRGCTIAAVSATGLSSRKWAKRYPIKVESKSSAIYKGSRTFYIYLETSWDKESWCKA  697
             I+L  CT+ AVSA+ +SSRKW KRYPIKVES+ S IY GS+  ++Y ETSW+KESWCKA
Sbjct  83   TIELLNCTVVAVSASSMSSRKWTKRYPIKVESQESEIYNGSKVCFLYAETSWEKESWCKA  142

Query  698  LRLAS  712
            LRLA+
Sbjct  143  LRLAA  147



>ref|XP_008645131.1| PREDICTED: testis-expressed sequence 2 protein-like isoform X2 
[Zea mays]
Length=691

 Score =   115 bits (289),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 60/115 (52%), Positives = 80/115 (70%), Gaps = 1/115 (1%)
 Frame = +2

Query  371  LEKIPRAPVDKALGQKKSKKEVLEVSPIQKYAKIKDHSLFLL-ESDGSNTEIQLRGCTIA  547
            LE+   + ++ A    + +K ++EV P++  A ++ HSL L    D S   I L GCT+A
Sbjct  2    LEQPKDSSINGASPGIRDRKLLVEVFPVKMSATLQGHSLTLSGPDDASQLTIDLLGCTVA  61

Query  548  AVSATGLSSRKWAKRYPIKVESKSSAIYKGSRTFYIYLETSWDKESWCKALRLAS  712
            AVSA+ L SRKWAKRYPIK+ESK S I +GS+  Y+Y +TSW+KESWCKALRLAS
Sbjct  62   AVSASNLPSRKWAKRYPIKLESKESGICRGSKVCYVYADTSWEKESWCKALRLAS  116



>ref|XP_002962707.1| hypothetical protein SELMODRAFT_438325 [Selaginella moellendorffii]
 gb|EFJ36170.1| hypothetical protein SELMODRAFT_438325 [Selaginella moellendorffii]
Length=752

 Score =   107 bits (266),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 66/185 (36%), Positives = 105/185 (57%), Gaps = 8/185 (4%)
 Frame = +2

Query  176  FVLVFILGALTVVGVEAAAAVFLIRWLSRRLSREVDKAKVSAELSSPPGLDPSYYNKQGI  355
            ++  F+LGAL +  VE A   +L     R   +       S  + + P   PS  + +G 
Sbjct  37   YIASFLLGALALGVVEIAVLWYLFVHKPRHRHKAAAAILPSFSMEADPN-SPSKISIEGE  95

Query  356  VWILDLE--KIPRAPVDKAL----GQKKSKKEVLEVSPIQKYAKIKDHSLFLLESDGSNT  517
            +W+  +   ++  A   K L     QKK+ ++  E+S   K+AK++D +L L  SDG+ +
Sbjct  96   IWVASVSPFQVENANSSKLLPKDRKQKKATEQKNEISVSLKFAKLQDRTLILTGSDGAVS  155

Query  518  EIQLRGCTIAAVSATGLSSRKWAKRYPIKVESKSSAIYKGSRTFYIYLETSWDKESWCKA  697
             IQL+GC++ AVS+T   +RKWAK+YPIKVE  S  +  G+    +Y +T W+KE+WC+A
Sbjct  156  SIQLQGCSVLAVSSTAAETRKWAKKYPIKVEHSSRTLL-GTTVCLLYFKTGWEKETWCEA  214

Query  698  LRLAS  712
            LR A+
Sbjct  215  LRAAA  219



>emb|CDP18515.1| unnamed protein product [Coffea canephora]
Length=664

 Score =   100 bits (249),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 46/57 (81%), Positives = 52/57 (91%), Gaps = 0/57 (0%)
 Frame = +2

Query  542  IAAVSATGLSSRKWAKRYPIKVESKSSAIYKGSRTFYIYLETSWDKESWCKALRLAS  712
            +AAVSAT L SRKWAK+YPIKVE+K + +YKGS TFYIYLETSW+KESWCKALRLAS
Sbjct  2    VAAVSATSLPSRKWAKKYPIKVENKETTLYKGSTTFYIYLETSWEKESWCKALRLAS  58



>ref|XP_002980385.1| hypothetical protein SELMODRAFT_112533 [Selaginella moellendorffii]
 gb|EFJ18645.1| hypothetical protein SELMODRAFT_112533 [Selaginella moellendorffii]
Length=669

 Score = 99.8 bits (247),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 53/132 (40%), Positives = 84/132 (64%), Gaps = 7/132 (5%)
 Frame = +2

Query  335  YYNKQGIVWILDLE--KIPRAPVDKAL----GQKKSKKEVLEVSPIQKYAKIKDHSLFLL  496
            ++  QG +W+  +   ++  A   K L     QKK+ ++  E+S   K+AK++D +L L 
Sbjct  7    FFLFQGEIWVASVSPFQVENANSSKLLPKDRKQKKATEQKNEISVSLKFAKLQDRTLILT  66

Query  497  ESDGSNTEIQLRGCTIAAVSATGLSSRKWAKRYPIKVESKSSAIYKGSRTFYIYLETSWD  676
             SDG+ + IQL+GC++ AVS+T   +RKWAK+YPIKVE  S  +  G+    +Y +T W+
Sbjct  67   GSDGAVSSIQLQGCSVLAVSSTAAETRKWAKKYPIKVEHSSRTLL-GTTVCLLYFKTGWE  125

Query  677  KESWCKALRLAS  712
            KE+WC+ALR A+
Sbjct  126  KETWCEALRAAA  137



>ref|XP_004234314.1| PREDICTED: testis-expressed sequence 2 protein-like isoform X2 
[Solanum lycopersicum]
Length=689

 Score = 89.7 bits (221),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 39/46 (85%), Positives = 44/46 (96%), Gaps = 0/46 (0%)
 Frame = +2

Query  575  RKWAKRYPIKVESKSSAIYKGSRTFYIYLETSWDKESWCKALRLAS  712
            RKWAKRYPIKVES +SA+YKGSR FY+YLETSW+KE+WCKALRLAS
Sbjct  13   RKWAKRYPIKVESGASAVYKGSRIFYLYLETSWEKEAWCKALRLAS  58



>ref|XP_001778334.1| predicted protein [Physcomitrella patens]
 gb|EDQ56882.1| predicted protein [Physcomitrella patens]
Length=921

 Score = 88.2 bits (217),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 45/134 (34%), Positives = 76/134 (57%), Gaps = 17/134 (13%)
 Frame = +2

Query  350  GIVWI-----LDLEKI----PRAPVDKALGQKK-------SKKEVLEVSPIQKYAKIKDH  481
            G  W+     +D+ K+    PR   DK  GQ++       ++ ++LE++P+++ A +K  
Sbjct  58   GNAWVAPLPNVDIRKVVMRQPRKDKDKD-GQREVLRKAEGARGDLLEIAPMRRRAHLKGK  116

Query  482  SLFLLESDGSNTEIQLRGCTIAAVSATGLSSRKWAKRYPIKVESKSSAIYKGSRTFYIYL  661
             LFL  +DG+  E+ L  C + AVS++   SRKW K++PIK+      +Y+G   F  + 
Sbjct  117  ILFLRAADGTEEEVLLEDCKVVAVSSSSEPSRKWGKKFPIKLHHPDRVLYRGCNQFLFFS  176

Query  662  ETSWDKESWCKALR  703
            ET + KE+WC+A R
Sbjct  177  ETGYAKEAWCEAFR  190



>ref|XP_010419176.1| PREDICTED: uncharacterized protein LOC104704851 [Camelina sativa]
Length=518

 Score = 84.3 bits (207),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 51/148 (34%), Positives = 83/148 (56%), Gaps = 29/148 (20%)
 Frame = +2

Query  191  ILGALTVVGVEAAAAVFLIRWLSRRLSREVDKAKVSAELSSPP--GLDPSY-----YNKQ  349
            +LG L +V  E    +F+++    RL+R+ +K   S   S P     DP        +KQ
Sbjct  14   LLGILAIVAAEVIGFLFVLK----RLNRKSNKRHESNSGSDPTLKNFDPRRSIDFSLSKQ  69

Query  350  GIVWILDLE----------KIPRAPVDKALGQKKSKKEVLEVSPIQKYAKIKDHSLFLLE  499
            G++WI++++          K+P+        QKK + +++EV PI+++A+IKDH L L +
Sbjct  70   GVIWIMEMDENVKDWMKKDKLPKE-------QKKKRVDLMEVHPIRRFARIKDHKLILSD  122

Query  500  SDGSNTEIQLRGCTIAAVSATGLSSRKW  583
            SDG+ T I L+GC + AVS +G  +RKW
Sbjct  123  SDGTQTCITLKGCFVNAVSGSG-PTRKW  149



>gb|AFW63911.1| hypothetical protein ZEAMMB73_732140 [Zea mays]
Length=161

 Score = 80.5 bits (197),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 45/93 (48%), Positives = 59/93 (63%), Gaps = 4/93 (4%)
 Frame = +2

Query  317  PGLDPSYYNKQGIVWILDLEKIPRAPVDK--ALG--QKKSKKEVLEVSPIQKYAKIKDHS  484
            PG  P  Y KQG +WIL+ EK+P+   D+  A G  + K KK ++EV P +K AKIK +S
Sbjct  50   PGERPFPYEKQGFLWILEPEKMPKLSNDRLSAGGPRETKDKKNIVEVFPAKKMAKIKGNS  109

Query  485  LFLLESDGSNTEIQLRGCTIAAVSATGLSSRKW  583
            L L   DGS   I+L  CT+ AVSA+ + SRKW
Sbjct  110  LCLSGPDGSQATIELLNCTVLAVSASSMPSRKW  142



>ref|NP_001145602.1| uncharacterized protein LOC100279080 [Zea mays]
 gb|ACG48805.1| hypothetical protein [Zea mays]
Length=177

 Score = 80.5 bits (197),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 45/93 (48%), Positives = 59/93 (63%), Gaps = 4/93 (4%)
 Frame = +2

Query  317  PGLDPSYYNKQGIVWILDLEKIPRAPVDK--ALG--QKKSKKEVLEVSPIQKYAKIKDHS  484
            PG  P  Y KQG +WIL+ EK+P+   D+  A G  + K KK ++EV P +K AKIK +S
Sbjct  50   PGERPFPYEKQGFLWILEPEKMPKLSNDRLSAGGPRETKDKKNIVEVFPAKKMAKIKGNS  109

Query  485  LFLLESDGSNTEIQLRGCTIAAVSATGLSSRKW  583
            L L   DGS   I+L  CT+ AVSA+ + SRKW
Sbjct  110  LCLSGPDGSQATIELLNCTVLAVSASSMPSRKW  142



>ref|XP_010317541.1| PREDICTED: testis-expressed sequence 2 protein-like isoform X3 
[Solanum lycopersicum]
Length=689

 Score = 83.2 bits (204),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 39/59 (66%), Positives = 46/59 (78%), Gaps = 2/59 (3%)
 Frame = +2

Query  536  CTIAAVSATGLSSRKWAKRYPIKVESKSSAIYKGSRTFYIYLETSWDKESWCKALRLAS  712
            C I  +   G   +  AKRYPIKVES +SA+YKGSR FY+YLETSW+KE+WCKALRLAS
Sbjct  2    CKIFTIQ--GYKRQHEAKRYPIKVESGASAVYKGSRIFYLYLETSWEKEAWCKALRLAS  58



>ref|XP_001756161.1| predicted protein [Physcomitrella patens]
 gb|EDQ79027.1| predicted protein [Physcomitrella patens]
Length=930

 Score = 81.3 bits (199),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 57/198 (29%), Positives = 98/198 (49%), Gaps = 33/198 (17%)
 Frame = +2

Query  176  FVLVFILGALTVVGVEAAAAVFLIRWLSRRLSREVDKAKVSAELSSPPGLDPSYYNKQGI  355
            F  +F+L  + +V     A  F+ + L+RR S    ++  S EL S    D   ++ QG 
Sbjct  32   FRGIFVLALVEIV----CAFYFISKLLARRASHP--RSTSSLELKSE--ADSFNFSLQGA  83

Query  356  VWILDLEKIPRAPVDKAL----------------GQKKSKK------EVLEVSPIQKYAK  469
            +W+  L   P   + KA+                G K+S K      +V E++P+ ++  
Sbjct  84   LWVSPL---PEGDLSKAVLLKPGKDKKKEKEDKDGSKESAKRVEATRDVPEITPVWRHVV  140

Query  470  IKDHSLFLLESDGSNTEIQLRGCTIAAVSATGLSSRKWAKRYPIKVESKSSAIYKGSRTF  649
            +KD  LF+  +DG   +I L  C + +VS++     KWA+R+PIK+   +  IY+  +  
Sbjct  141  LKDGVLFMKGADGVEEQISLESCEVLSVSSSSRPDGKWARRFPIKLYHTTRTIYRQYKGC  200

Query  650  YIYLETSWDKESWCKALR  703
              Y E+ ++KE+WC+ LR
Sbjct  201  LFYAESGYEKEAWCEVLR  218



>ref|XP_001759215.1| predicted protein [Physcomitrella patens]
 gb|EDQ75899.1| predicted protein [Physcomitrella patens]
Length=909

 Score = 80.9 bits (198),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 52/180 (29%), Positives = 90/180 (50%), Gaps = 9/180 (5%)
 Frame = +2

Query  188  FILGALTVVGVEAAAAVFLIRWLSRRLSREVDKAKVSAELSSPPGLDPSYYNKQGIVWIL  367
            F  G L +  VE     FLIR L  R   + + +  S E  S  G   S ++ Q    IL
Sbjct  16   FFGGILLLALVECVCVFFLIRRLLERKPTQ-NPSPSSLEYRSEGGSYDSSFSLQVSKAIL  74

Query  368  DL--------EKIPRAPVDKALGQKKSKKEVLEVSPIQKYAKIKDHSLFLLESDGSNTEI  523
             +        ++  R    +   +  + K VL+++P++K+  +K+  L L E DG+  +I
Sbjct  75   QMPGKDKKREKEAERDGPKEGSNRAGTTKNVLKLAPVRKHVVLKEGILLLREVDGNEEQI  134

Query  524  QLRGCTIAAVSATGLSSRKWAKRYPIKVESKSSAIYKGSRTFYIYLETSWDKESWCKALR  703
             L GC ++++S    S+ KW+K +PIK+   +  +Y   +    Y E+ ++KE+WC+ LR
Sbjct  135  PLEGCEVSSISYDQTSNGKWSKMFPIKLHHPTHTLYGDCKDCLFYAESGYEKEAWCEVLR  194



>ref|XP_009408155.1| PREDICTED: testis-expressed sequence 2 protein-like isoform X2 
[Musa acuminata subsp. malaccensis]
Length=673

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 33/43 (77%), Positives = 38/43 (88%), Gaps = 0/43 (0%)
 Frame = +2

Query  584  AKRYPIKVESKSSAIYKGSRTFYIYLETSWDKESWCKALRLAS  712
            AKRYPIK+ESK S IYK S+T Y+Y +TSW+KESWCKALRLAS
Sbjct  19   AKRYPIKLESKESKIYKESKTCYLYFDTSWEKESWCKALRLAS  61



>ref|XP_006589245.1| PREDICTED: uncharacterized protein LOC100816218 isoform X2 [Glycine 
max]
Length=653

 Score = 68.9 bits (167),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 29/43 (67%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = +2

Query  584  AKRYPIKVESKSSAIYKGSRTFYIYLETSWDKESWCKALRLAS  712
            AK +PIKVE+ +S IY G++T YIYL+TSW+KE+WCKAL LAS
Sbjct  6    AKMFPIKVENTNSVIYNGNKTIYIYLDTSWEKEAWCKALYLAS  48



>dbj|BAJ97472.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=454

 Score = 66.6 bits (161),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 30/43 (70%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = +2

Query  584  AKRYPIKVESKSSAIYKGSRTFYIYLETSWDKESWCKALRLAS  712
            +KRYPIK+ESK S I K S+  Y+Y++TSW+KESWCKALRLAS
Sbjct  11   SKRYPIKLESKGSDICKRSKVCYLYVDTSWEKESWCKALRLAS  53



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1295251989378