BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig13375

Length=1276
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009611626.1|  PREDICTED: DNA repair protein RAD51 homolog        661   0.0      Nicotiana tomentosiformis
ref|NP_001233788.1|  DNA repair protein RAD51 homolog                   661   0.0      Solanum lycopersicum
ref|XP_009789565.1|  PREDICTED: DNA repair protein RAD51 homolog        660   0.0      Nicotiana sylvestris
gb|ERM96041.1|  hypothetical protein AMTR_s00129p00082230               656   0.0      Amborella trichopoda
ref|XP_007202345.1|  hypothetical protein PRUPE_ppa008236mg             655   0.0      Prunus persica
ref|XP_008800478.1|  PREDICTED: DNA repair protein RAD51 homolog        654   0.0      Phoenix dactylifera
ref|XP_010937252.1|  PREDICTED: DNA repair protein RAD51 homolog        653   0.0      Elaeis guineensis
ref|XP_008783310.1|  PREDICTED: DNA repair protein RAD51 homolog        652   0.0      Phoenix dactylifera
dbj|BAF02935.1|  RAD51 homolog                                          652   0.0      Populus nigra [black poplar]
ref|XP_010939852.1|  PREDICTED: DNA repair protein RAD51 homolog        652   0.0      Elaeis guineensis
ref|XP_006344556.1|  PREDICTED: DNA repair protein RAD51 homolog        651   0.0      Solanum tuberosum [potatoes]
ref|XP_011039902.1|  PREDICTED: LOW QUALITY PROTEIN: DNA repair p...    651   0.0      Populus euphratica
ref|XP_004144057.1|  PREDICTED: DNA repair protein RAD51 homolog        651   0.0      Cucumis sativus [cucumbers]
ref|XP_004287679.1|  PREDICTED: DNA repair protein RAD51 homolog 1      650   0.0      Fragaria vesca subsp. vesca
ref|XP_009413471.1|  PREDICTED: DNA repair protein RAD51 homolog        650   0.0      Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010261674.1|  PREDICTED: DNA repair protein RAD51 homolog ...    650   0.0      Nelumbo nucifera [Indian lotus]
ref|XP_008337793.1|  PREDICTED: LOW QUALITY PROTEIN: DNA repair p...    649   0.0      Malus domestica [apple tree]
ref|XP_009359678.1|  PREDICTED: DNA repair protein RAD51 homolog        647   0.0      Pyrus x bretschneideri [bai li]
ref|XP_010687596.1|  PREDICTED: DNA repair protein RAD51 homolog        647   0.0      Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010047431.1|  PREDICTED: DNA repair protein RAD51 homolog        646   0.0      Eucalyptus grandis [rose gum]
gb|KJB65440.1|  hypothetical protein B456_010G095300                    646   0.0      Gossypium raimondii
ref|XP_002273803.1|  PREDICTED: DNA repair protein RAD51 homolog        646   0.0      Vitis vinifera
ref|XP_012077114.1|  PREDICTED: DNA repair protein RAD51 homolog        646   0.0      Jatropha curcas
ref|XP_011628494.1|  PREDICTED: LOW QUALITY PROTEIN: DNA repair p...    641   0.0      
ref|XP_006474560.1|  PREDICTED: DNA repair protein RAD51 homolog        639   0.0      Citrus sinensis [apfelsine]
ref|XP_007154535.1|  hypothetical protein PHAVU_003G126800g             639   0.0      Phaseolus vulgaris [French bean]
ref|XP_011078154.1|  PREDICTED: DNA repair protein RAD51 homolog        637   0.0      Sesamum indicum [beniseed]
ref|XP_004508049.1|  PREDICTED: DNA repair protein RAD51 homolog ...    637   0.0      Cicer arietinum [garbanzo]
ref|XP_003542386.1|  PREDICTED: DNA repair protein RAD51 homolog ...    635   0.0      Glycine max [soybeans]
ref|XP_006288113.1|  hypothetical protein CARUB_v10001345mg             634   0.0      Capsella rubella
ref|XP_009120764.1|  PREDICTED: DNA repair protein RAD51 homolog ...    634   0.0      Brassica rapa
ref|XP_010420930.1|  PREDICTED: DNA repair protein RAD51 homolog 1      634   0.0      Camelina sativa [gold-of-pleasure]
ref|XP_009131820.1|  PREDICTED: DNA repair protein RAD51 homolog 1      634   0.0      Brassica rapa
ref|XP_010541679.1|  PREDICTED: DNA repair protein RAD51 homolog 1      633   0.0      Tarenaya hassleriana [spider flower]
ref|XP_006400650.1|  hypothetical protein EUTSA_v10014015mg             633   0.0      Eutrema salsugineum [saltwater cress]
gb|KFK26297.1|  hypothetical protein AALP_AA8G229700                    633   0.0      Arabis alpina [alpine rockcress]
ref|XP_010493197.1|  PREDICTED: DNA repair protein RAD51 homolog ...    632   0.0      Camelina sativa [gold-of-pleasure]
ref|NP_568402.1|  DNA repair protein RAD51-like 1                       632   0.0      Arabidopsis thaliana [mouse-ear cress]
gb|KJB54560.1|  hypothetical protein B456_009G038800                    632   0.0      Gossypium raimondii
ref|XP_003577363.1|  PREDICTED: DNA repair protein RAD51 homolog A      631   0.0      Brachypodium distachyon [annual false brome]
gb|KHN45044.1|  DNA repair protein RAD51 like 1                         630   0.0      Glycine soja [wild soybean]
ref|XP_003551035.1|  PREDICTED: DNA repair protein RAD51 homolog        630   0.0      Glycine max [soybeans]
ref|NP_001104919.1|  DNA repair protein RAD51 homolog B                 630   0.0      Zea mays [maize]
ref|XP_006663048.1|  PREDICTED: DNA repair protein RAD51 homolog ...    630   0.0      Oryza brachyantha
gb|ACH42252.1|  RAD51A recombination protein                            629   0.0      Triticum aestivum [Canadian hard winter wheat]
gb|ACM47238.1|  RAD51 recombination protein                             629   0.0      Triticum aestivum [Canadian hard winter wheat]
dbj|BAE99388.1|  RAD51 homolog                                          628   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_002443207.1|  hypothetical protein SORBIDRAFT_08g015360          627   0.0      Sorghum bicolor [broomcorn]
gb|ACM47239.1|  RAD51 recombination protein                             627   0.0      Triticum aestivum [Canadian hard winter wheat]
ref|XP_003575503.1|  PREDICTED: DNA repair protein RAD51 homolog ...    627   0.0      Brachypodium distachyon [annual false brome]
gb|AJF11726.1|  RAD51                                                   626   0.0      Chrysanthemum indicum
ref|XP_007012510.1|  RAS associated with diabetes protein 51            627   0.0      
ref|XP_003609937.1|  DNA repair protein RAD51-like protein              626   0.0      Medicago truncatula
ref|NP_001066806.1|  Os12g0497300                                       626   0.0      
dbj|BAB85491.1|  Rad51                                                  625   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_002463076.1|  hypothetical protein SORBIDRAFT_02g037320          626   0.0      Sorghum bicolor [broomcorn]
emb|CDP03024.1|  unnamed protein product                                625   0.0      Coffea canephora [robusta coffee]
gb|KHN17763.1|  DNA repair protein RAD51 like                           625   0.0      Glycine soja [wild soybean]
ref|NP_001068279.1|  Os11g0615800                                       625   0.0      
ref|XP_004979726.1|  PREDICTED: DNA repair protein RAD51 homolog ...    625   0.0      Setaria italica
gb|AFP73608.1|  DNA repair protein RAD51                                622   0.0      Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|ACF79638.1|  unknown                                                 621   0.0      Zea mays [maize]
ref|XP_002449862.1|  hypothetical protein SORBIDRAFT_05g024565          621   0.0      
gb|ABI58231.1|  Rad51 protein                                           619   0.0      Oryza sativa Indica Group [Indian rice]
ref|NP_001104918.1|  DNA repair protein RAD51 homolog A                 618   0.0      
gb|EYU28293.1|  hypothetical protein MIMGU_mgv1a020539mg                617   0.0      Erythranthe guttata [common monkey flower]
ref|XP_006452910.1|  hypothetical protein CICLE_v10010591mg             613   0.0      
ref|XP_006664568.1|  PREDICTED: DNA repair protein RAD51 homolog ...    613   0.0      
gb|EMT30060.1|  DNA repair RAD51-B-like protein                         615   0.0      
ref|XP_010107088.1|  DNA repair protein RAD51-like protein              606   0.0      
ref|XP_006381549.1|  hypothetical protein POPTR_0006s13750g             605   0.0      
ref|XP_004962956.1|  PREDICTED: LOW QUALITY PROTEIN: DNA repair p...    605   0.0      
emb|CDX88837.1|  BnaA03g08120D                                          580   0.0      
emb|CDX92430.1|  BnaA10g14690D                                          578   0.0      
ref|XP_010261678.1|  PREDICTED: DNA repair protein RAD51 homolog ...    573   0.0      Nelumbo nucifera [Indian lotus]
emb|CAC86604.1|  Rad51B protein                                         564   0.0      Physcomitrella patens
gb|ACH42253.1|  RAD51A recombination protein                            561   0.0      Triticum aestivum [Canadian hard winter wheat]
emb|CAC86603.1|  Rad51A protein                                         560   0.0      Physcomitrella patens
gb|EPS57838.1|  hypothetical protein M569_16980                         558   0.0      Genlisea aurea
emb|CDY16571.1|  BnaC09g37020D                                          558   0.0      Brassica napus [oilseed rape]
gb|AEW90638.1|  RAD51-like protein                                      543   0.0      Pinus sylvestris [Scotch pine]
ref|XP_002516197.1|  DNA repair protein rad51, putative                 530   0.0      
gb|KCW79343.1|  hypothetical protein EUGRSUZ_C00762                     529   0.0      Eucalyptus grandis [rose gum]
ref|XP_011433321.1|  PREDICTED: DNA repair protein RAD51 homolog ...    507   7e-176   Crassostrea gigas
gb|AAV38510.1|  RAD51 homolog (RecA homolog, E. coli) (S. cerevis...    506   1e-175   synthetic construct
dbj|BAA78377.1|  Rad51                                                  506   2e-175   Cynops pyrrhogaster [Japanese common newt]
ref|NP_002866.2|  DNA repair protein RAD51 homolog 1 isoform 1          505   4e-175   Homo sapiens [man]
ref|XP_006831828.1|  PREDICTED: DNA repair protein RAD51 homolog 1      505   5e-175   Chrysochloris asiatica
ref|NP_001116653.1|  DNA repair protein RAD51 homolog 1                 505   5e-175   Sus scrofa [pigs]
gb|AAX36891.1|  RAD51-like                                              505   6e-175   synthetic construct
ref|XP_007069443.1|  PREDICTED: DNA repair protein RAD51 homolog 1      504   8e-175   Chelonia mydas [green seaturtle]
ref|XP_011844675.1|  PREDICTED: DNA repair protein RAD51 homolog ...    504   1e-174   Mandrillus leucophaeus
dbj|BAA02962.1|  HsRad51                                                504   2e-174   Homo sapiens [man]
ref|NP_001233686.1|  DNA repair protein RAD51 homolog 1                 504   2e-174   Cricetulus griseus [Chinese hamsters]
ref|XP_003418703.1|  PREDICTED: DNA repair protein RAD51 homolog 1      504   2e-174   Loxodonta africana [African bush elephant]
ref|NP_001039644.1|  DNA repair protein RAD51 homolog 1                 503   2e-174   Bos taurus [bovine]
ref|XP_006201713.1|  PREDICTED: DNA repair protein RAD51 homolog ...    503   3e-174   Vicugna pacos
ref|XP_010622996.1|  PREDICTED: DNA repair protein RAD51 homolog 1      503   3e-174   Fukomys damarensis [Damara mole rat]
ref|NP_001003043.1|  DNA repair protein RAD51 homolog 1                 503   3e-174   Canis lupus familiaris [dogs]
gb|ERE70754.1|  putative DNA repair protein RAD51                       503   3e-174   Cricetulus griseus [Chinese hamsters]
ref|XP_005381310.1|  PREDICTED: DNA repair protein RAD51 homolog ...    503   3e-174   Chinchilla lanigera
ref|XP_004660844.1|  PREDICTED: DNA repair protein RAD51 homolog 1      503   3e-174   Jaculus jaculus
ref|XP_001503572.1|  PREDICTED: DNA repair protein RAD51 homolog ...    503   4e-174   Equus caballus [domestic horse]
ref|NP_001102674.1|  DNA repair protein RAD51 homolog 1                 503   4e-174   Rattus norvegicus [brown rat]
ref|XP_007537825.1|  PREDICTED: DNA repair protein RAD51 homolog ...    503   5e-174   Erinaceus europaeus [common hedgehog]
ref|NP_035364.1|  DNA repair protein RAD51 homolog 1                    503   5e-174   Mus musculus [mouse]
ref|XP_004274040.1|  PREDICTED: DNA repair protein RAD51 homolog ...    503   5e-174   Orcinus orca [Orca]
ref|XP_006883075.1|  PREDICTED: DNA repair protein RAD51 homolog ...    503   6e-174   Elephantulus edwardii [Cape long-eared elephant shrew]
ref|XP_006883076.1|  PREDICTED: DNA repair protein RAD51 homolog ...    502   6e-174   Elephantulus edwardii [Cape long-eared elephant shrew]
ref|XP_003475741.1|  PREDICTED: DNA repair protein RAD51 homolog ...    502   8e-174   Cavia porcellus [guinea pig]
ref|XP_006778150.1|  PREDICTED: DNA repair protein RAD51 homolog ...    502   9e-174   Myotis davidii
ref|XP_004578230.1|  PREDICTED: DNA repair protein RAD51 homolog 1      502   9e-174   Ochotona princeps [southern American pika]
gb|AAV38511.1|  RAD51 homolog (RecA homolog, E. coli) (S. cerevis...    502   1e-173   Homo sapiens [man]
ref|XP_005095899.1|  PREDICTED: DNA repair protein RAD51 homolog ...    502   1e-173   
ref|XP_005978507.1|  PREDICTED: DNA repair protein RAD51 homolog ...    501   1e-173   Pantholops hodgsonii [Tibetan antelope]
ref|XP_006128732.1|  PREDICTED: DNA repair protein RAD51 homolog 1      501   2e-173   
ref|XP_006920548.1|  PREDICTED: DNA repair protein RAD51 homolog 1      501   2e-173   Pteropus alecto
ref|XP_008267004.1|  PREDICTED: DNA repair protein RAD51 homolog ...    501   2e-173   Oryctolagus cuniculus [domestic rabbit]
ref|XP_001370830.1|  PREDICTED: DNA repair protein RAD51 homolog ...    501   2e-173   Monodelphis domestica
ref|XP_004896159.1|  PREDICTED: DNA repair protein RAD51 homolog 1      501   3e-173   
ref|XP_006979273.1|  PREDICTED: DNA repair protein RAD51 homolog 1      501   3e-173   Peromyscus maniculatus bairdii
ref|XP_005364315.1|  PREDICTED: DNA repair protein RAD51 homolog 1      501   3e-173   Microtus ochrogaster [prairie voles]
ref|XP_003224823.1|  PREDICTED: DNA repair protein RAD51 homolog 1      499   8e-173   Anolis carolinensis [Carolina anole]
ref|XP_007446679.1|  PREDICTED: DNA repair protein RAD51 homolog ...    499   1e-172   Lipotes vexillifer [baiji]
ref|XP_009555142.1|  PREDICTED: DNA repair protein RAD51 homolog 1      498   2e-172   Cuculus canorus
ref|NP_001080559.1|  DNA repair protein RAD51 homolog B                 498   2e-172   Xenopus laevis [clawed frog]
ref|XP_009890722.1|  PREDICTED: DNA repair protein RAD51 homolog ...    498   2e-172   Charadrius vociferus
ref|XP_003206184.1|  PREDICTED: DNA repair protein RAD51 homolog 1      498   2e-172   Meleagris gallopavo [common turkey]
ref|XP_009472226.1|  PREDICTED: DNA repair protein RAD51 homolog ...    498   2e-172   Nipponia nippon
ref|XP_009073633.1|  PREDICTED: DNA repair protein RAD51 homolog ...    498   3e-172   Acanthisitta chloris
ref|XP_002196004.1|  PREDICTED: DNA repair protein RAD51 homolog 1      498   3e-172   Taeniopygia guttata
ref|XP_009973165.1|  PREDICTED: DNA repair protein RAD51 homolog ...    498   3e-172   Tyto alba [Schleiereule]
ref|NP_001075493.1|  DNA repair protein RAD51 homolog 1                 498   3e-172   Oryctolagus cuniculus [domestic rabbit]
gb|KFV13426.1|  DNA repair protein RAD51 1                              498   3e-172   Pterocles gutturalis
ref|XP_009482596.1|  PREDICTED: DNA repair protein RAD51 homolog ...    498   3e-172   Pelecanus crispus
ref|XP_009948515.1|  PREDICTED: DNA repair protein RAD51 homolog ...    498   4e-172   Leptosomus discolor
ref|XP_009095390.1|  PREDICTED: DNA repair protein RAD51 homolog 1      498   4e-172   Serinus canaria [canary]
ref|XP_005243393.1|  PREDICTED: DNA repair protein RAD51 homolog 1      498   4e-172   Falco peregrinus [peregrine]
ref|XP_009669095.1|  PREDICTED: DNA repair protein RAD51 homolog 1      498   4e-172   Struthio camelus australis
ref|XP_010151121.1|  PREDICTED: DNA repair protein RAD51 homolog ...    498   4e-172   Eurypyga helias
ref|XP_009916366.1|  PREDICTED: DNA repair protein RAD51 homolog ...    498   4e-172   Haliaeetus albicilla
ref|XP_009641358.1|  PREDICTED: DNA repair protein RAD51 homolog ...    498   4e-172   Egretta garzetta
ref|XP_005529119.1|  PREDICTED: DNA repair protein RAD51 homolog 1      498   4e-172   Pseudopodoces humilis [Tibetan ground-jay]
ref|XP_005426533.1|  PREDICTED: DNA repair protein RAD51 homolog 1      498   4e-172   Geospiza fortis
ref|XP_005494864.1|  PREDICTED: DNA repair protein RAD51 homolog 1      498   4e-172   Zonotrichia albicollis
ref|XP_010079559.1|  PREDICTED: DNA repair protein RAD51 homolog 1      498   4e-172   Pterocles gutturalis
ref|XP_005095900.1|  PREDICTED: DNA repair protein RAD51 homolog ...    498   4e-172   Aplysia californica
ref|XP_005284727.1|  PREDICTED: DNA repair protein RAD51 homolog 1      498   4e-172   Chrysemys picta bellii
ref|XP_008310877.1|  PREDICTED: DNA repair protein RAD51 homolog 1      498   5e-172   Cynoglossus semilaevis [half-smooth tongue sole]
gb|KFP51963.1|  DNA repair protein RAD51 1                              498   5e-172   Cathartes aura
ref|XP_010208816.1|  PREDICTED: DNA repair protein RAD51 homolog ...    498   5e-172   Colius striatus
ref|NP_990504.1|  DNA repair protein RAD51 homolog 1                    498   5e-172   Gallus gallus [bantam]
gb|KFZ66192.1|  DNA repair protein RAD51 1                              498   6e-172   Podiceps cristatus
ref|XP_010291170.1|  PREDICTED: DNA repair protein RAD51 homolog ...    498   6e-172   Phaethon lepturus
ref|XP_009820227.1|  PREDICTED: DNA repair protein RAD51 homolog 1      498   6e-172   Gavia stellata
ref|XP_008504228.1|  PREDICTED: DNA repair protein RAD51 homolog 1      497   6e-172   Calypte anna
ref|XP_009983436.1|  PREDICTED: DNA repair protein RAD51 homolog ...    497   7e-172   Tauraco erythrolophus
ref|XP_009502502.1|  PREDICTED: DNA repair protein RAD51 homolog ...    497   7e-172   Phalacrocorax carbo [common cormorant]
ref|NP_001081236.1|  DNA repair protein RAD51 homolog A                 497   7e-172   Xenopus laevis [clawed frog]
ref|XP_007430136.1|  PREDICTED: DNA repair protein RAD51 homolog 1      497   8e-172   Python bivittatus
gb|KFQ85490.1|  DNA repair protein RAD51 1                              497   9e-172   Phoenicopterus ruber ruber
ref|XP_010022645.1|  PREDICTED: DNA repair protein RAD51 homolog 1      497   9e-172   Nestor notabilis
ref|XP_010213910.1|  PREDICTED: DNA repair protein RAD51 homolog 1      497   9e-172   Tinamus guttatus
ref|XP_003977354.1|  PREDICTED: DNA repair protein RAD51 homolog 1      497   1e-171   Takifugu rubripes [tiger puffer]
ref|XP_010306237.1|  PREDICTED: DNA repair protein RAD51 homolog ...    497   1e-171   Balearica regulorum gibbericeps
ref|XP_009929806.1|  PREDICTED: DNA repair protein RAD51 homolog 1      496   1e-171   Opisthocomus hoazin [hoatzin]
ref|XP_008924708.1|  PREDICTED: DNA repair protein RAD51 homolog ...    496   2e-171   Manacus vitellinus
ref|XP_006024651.1|  PREDICTED: DNA repair protein RAD51 homolog ...    496   2e-171   Alligator sinensis
ref|NP_001016393.1|  RAD51 recombinase                                  496   2e-171   Xenopus tropicalis [western clawed frog]
ref|XP_009896751.1|  PREDICTED: DNA repair protein RAD51 homolog 1      496   2e-171   Picoides pubescens
ref|XP_006632511.1|  PREDICTED: DNA repair protein RAD51 homolog ...    496   2e-171   Lepisosteus oculatus
ref|XP_007570669.1|  PREDICTED: DNA repair protein RAD51 homolog 1      496   2e-171   Poecilia formosa
gb|EUB57641.1|  DNA repair protein RAD51                                496   2e-171   Echinococcus granulosus
ref|XP_004564786.1|  PREDICTED: DNA repair protein RAD51 homolog ...    496   2e-171   Maylandia zebra
emb|CDQ56831.1|  unnamed protein product                                495   3e-171   Oncorhynchus mykiss
dbj|GAA50958.1|  DNA repair protein RAD51                               496   3e-171   Clonorchis sinensis [oriental liver fluke]
ref|XP_009999752.1|  PREDICTED: DNA repair protein RAD51 homolog 1      495   4e-171   Chaetura pelagica
ref|XP_008396713.1|  PREDICTED: DNA repair protein RAD51 homolog 1      495   4e-171   Poecilia reticulata
ref|XP_007905234.1|  PREDICTED: DNA repair protein RAD51 homolog ...    495   5e-171   Callorhinchus milii [Australian ghost shark]
ref|XP_010403652.1|  PREDICTED: DNA repair protein RAD51 homolog 1      497   6e-171   
ref|XP_010880620.1|  PREDICTED: DNA repair protein RAD51 homolog 1      494   7e-171   Esox lucius
ref|NP_998371.2|  DNA repair protein RAD51 homolog 1                    494   8e-171   Danio rerio [leopard danio]
ref|XP_005509908.1|  PREDICTED: DNA repair protein RAD51 homolog 1      494   9e-171   Columba livia [carrier pigeon]
gb|AAH62849.1|  RAD51 homolog (RecA homolog, E. coli) (S. cerevis...    494   1e-170   Danio rerio [leopard danio]
gb|EMC82304.1|  DNA repair protein RAD51 like protein 1                 494   1e-170   
ref|XP_005814492.1|  PREDICTED: DNA repair protein RAD51 homolog ...    494   1e-170   Xiphophorus maculatus
ref|XP_010753928.1|  PREDICTED: DNA repair protein RAD51 homolog 1      494   1e-170   
ref|NP_001266379.1|  RecA homolog Rad51                                 494   2e-170   Oreochromis niloticus
ref|XP_008275455.1|  PREDICTED: DNA repair protein RAD51 homolog 1      494   2e-170   Stegastes partitus
gb|KII75020.1|  DNA repair protein RAD51 1                              494   2e-170   Thelohanellus kitauei
ref|XP_007259922.1|  PREDICTED: DNA repair protein RAD51 homolog ...    493   2e-170   
ref|XP_788683.2|  PREDICTED: DNA repair protein RAD51 homolog 1         493   2e-170   Strongylocentrotus purpuratus [purple urchin]
emb|CCD74763.1|  putative DNA repair protein RAD51                      493   3e-170   Schistosoma mansoni
ref|XP_003386534.1|  PREDICTED: DNA repair protein RAD51 homolog B      493   5e-170   Amphimedon queenslandica
gb|KGB35409.1|  DNA repair protein RAD51 1                              492   5e-170   Schistosoma haematobium
ref|XP_004083949.1|  PREDICTED: DNA repair protein RAD51 homolog 1      492   7e-170   Oryzias latipes [Japanese rice fish]
ref|XP_010140464.1|  PREDICTED: DNA repair protein RAD51 homolog ...    492   7e-170   Buceros rhinoceros silvestris
ref|XP_009331968.1|  PREDICTED: DNA repair protein RAD51 homolog ...    491   2e-169   Pygoscelis adeliae
ref|XP_010344595.1|  PREDICTED: DNA repair protein RAD51 homolog 1      490   2e-169   Saimiri boliviensis boliviensis
ref|XP_004341892.1|  DNA repair protein RAD51, putative                 490   5e-169   Acanthamoeba castellanii str. Neff
gb|KDR10565.1|  DNA repair protein RAD51-like protein 1                 490   5e-169   Zootermopsis nevadensis
gb|AIL94182.1|  Rad51                                                   489   9e-169   Brachionus koreanus
ref|NP_001134027.1|  DNA repair protein RAD51 homolog A                 489   1e-168   Salmo salar
gb|AIW60888.1|  RAD51                                                   489   2e-168   Schmidtea mediterranea [freshwater planarian]
ref|XP_010807474.1|  PREDICTED: DNA repair protein RAD51 homolog ...    487   5e-168   
ref|XP_002169171.1|  PREDICTED: DNA repair protein RAD51 homolog ...    487   8e-168   Hydra vulgaris
gb|KFO32940.1|  DNA repair protein RAD51 like protein 1                 486   1e-167   Fukomys damarensis [Damara mole rat]
ref|XP_002126934.1|  PREDICTED: DNA repair protein RAD51 homolog ...    486   2e-167   Ciona intestinalis [sea vase]
gb|AGH55904.1|  Rad51                                                   486   2e-167   Brachionus manjavacas
ref|XP_002405184.1|  DNA repair protein RAD51/RHP55, putative           486   3e-167   Ixodes scapularis [blacklegged tick]
ref|XP_003378865.1|  DNA repair and recombination protein RadA          485   1e-166   Trichinella spiralis
gb|ADD24297.1|  DNA repair protein RAD51 homolog 1                      483   3e-166   Lepeophtheirus salmonis
ref|XP_004346233.1|  DNA repair protein RAD51 1                         483   4e-166   Capsaspora owczarzaki ATCC 30864
gb|ACO14764.1|  DNA repair protein RAD51 homolog 1                      483   4e-166   Caligus clemensi
gb|KFO93471.1|  DNA repair protein RAD51 1                              482   6e-166   Buceros rhinoceros silvestris
ref|XP_004993801.1|  rad51 protein                                      481   8e-166   Salpingoeca rosetta
gb|ACO13181.1|  DNA repair protein RAD51 homolog 1                      481   4e-165   Lepeophtheirus salmonis
ref|XP_009163242.1|  hypothetical protein T265_01035                    478   4e-164   Opisthorchis viverrini [Southeast Asian liver fluke]
emb|CDW53316.1|  DNA repair protein RAD51 1                             478   6e-164   Trichuris trichiura
ref|XP_003436320.1|  AGAP013412-PA                                      477   8e-164   Anopheles gambiae str. PEST
ref|NP_593882.1|  RecA family recombinase Rhp51                         477   1e-163   Schizosaccharomyces pombe
emb|CCF52005.1|  probable DNA repair protein RAD51                      476   2e-163   Ustilago hordei
emb|CBQ73697.1|  DNA repair protein RAD51                               476   2e-163   Sporisorium reilianum SRZ2
gb|ETS59968.1|  dna repair protein rad51                                475   4e-163   Moesziomyces aphidis DSM 70725
gb|ABI97150.1|  Rad51                                                   475   4e-163   Pneumocystis carinii
gb|KFD50713.1|  hypothetical protein M513_08369                         476   5e-163   Trichuris suis
dbj|GAK64692.1|  DNA repair protein RAD51                               475   5e-163   Moesziomyces antarcticus
ref|XP_007875500.1|  DNA repair protein RAD51                           475   6e-163   Pneumocystis murina B123
emb|CAA80878.1|  RecA-like protein                                      475   7e-163   Schizosaccharomyces pombe
dbj|GAC99057.1|  DNA repair protein RAD51                               474   8e-163   Pseudozyma hubeiensis SY62
sp|P36601.1|RAD51_SCHPO  RecName: Full=DNA repair protein rhp51; ...    475   8e-163   Schizosaccharomyces pombe 972h-
ref|XP_011389700.1|  recombinase RAD51                                  474   1e-162   Ustilago maydis 521
emb|CDI54117.1|  DNA repair protein RAD51                               474   2e-162   Melanopsichium pennsylvanicum 4
emb|CCJ30383.1|  unnamed protein product                                473   2e-162   Pneumocystis jirovecii
gb|EST04967.1|  DNA repair protein RAD51                                473   2e-162   Kalmanozyma brasiliensis GHG001
gb|EFX82820.1|  hypothetical protein DAPPUDRAFT_299714                  471   1e-161   Daphnia pulex
gb|ETN58581.1|  DNA repair protein RAD51                                471   1e-161   Anopheles darlingi [American malaria mosquito]
gb|ELW48160.1|  Protein CASC5                                           508   2e-161   Tupaia chinensis
ref|XP_007882252.1|  hypothetical protein PFL1_06516                    470   3e-161   Anthracocystis flocculosa PF-1
gb|KFB52705.1|  AGAP013412-PA-like protein                              468   1e-160   Anopheles sinensis
gb|KFH66657.1|  DNA repair protein rhp51                                468   3e-160   Mortierella verticillata NRRL 6337
gb|EPX72876.1|  recombinase Rhp51                                       468   4e-160   Schizosaccharomyces octosporus yFS286
ref|NP_001037484.1|  Rad51 homolog                                      467   5e-160   Bombyx mori [silk moth]
emb|CDW75503.1|  dna repair protein rad51 homolog 1                     466   8e-160   Stylonychia lemnae
ref|XP_011560505.1|  PREDICTED: DNA repair protein RAD51 homolog ...    466   2e-159   Plutella xylostella [cabbage moth]
gb|EHJ70106.1|  Rad51-like protein                                      465   2e-159   
ref|XP_001948893.1|  PREDICTED: DNA repair protein RAD51 homolog A      464   5e-159   Acyrthosiphon pisum
gb|EJY72106.1|  hypothetical protein OXYTRI_06896                       464   5e-159   Oxytricha trifallax
ref|XP_002429975.1|  DNA repair protein rad51, putative                 464   6e-159   Pediculus humanus corporis [human body lice]
ref|XP_002172658.1|  recombinase Rhp51                                  465   1e-158   Schizosaccharomyces japonicus yFS275
gb|AGC52846.1|  Rad51                                                   464   2e-158   Macrobiotus cf. harmsworthi EABP-2013
ref|XP_003747001.1|  PREDICTED: DNA repair protein RAD51 homolog ...    462   3e-158   Galendromus occidentalis
ref|XP_005704794.1|  DNA repair protein                                 461   2e-157   Galdieria sulphuraria
emb|CCG81259.2|  Rad51                                                  459   4e-157   Taphrina deformans PYCC 5710
ref|XP_974640.1|  PREDICTED: DNA repair protein RAD51 homolog 1         459   6e-157   Tribolium castaneum [rust-red flour beetle]
emb|CDS29362.1|  dna repair protein rad51 1                             458   1e-156   Hymenolepis microstoma
ref|XP_001845458.1|  DNA repair protein RAD51                           459   1e-156   Culex quinquefasciatus
ref|XP_974146.1|  PREDICTED: DNA repair protein RAD51 homolog 1         457   3e-156   Tribolium castaneum [rust-red flour beetle]
tpg|DAA63289.1|  TPA: hypothetical protein ZEAMMB73_389397              454   2e-155   
emb|CCX31128.1|  Similar to DNA repair protein rhp51; acc. no. P3...    455   3e-155   Pyronema omphalodes CBS 100304
gb|AEE62309.1|  unknown                                                 455   3e-155   Dendroctonus ponderosae
emb|CDK25915.1|  unnamed protein product                                455   4e-155   Kuraishia capsulata CBS 1993
gb|AGC52845.1|  Rad51                                                   456   4e-155   Hypsibius dujardini
ref|XP_004182226.1|  hypothetical protein TBLA_0I00440                  459   5e-155   Tetrapisispora blattae CBS 6284
ref|XP_011117787.1|  hypothetical protein AOL_s00006g176                456   8e-155   Arthrobotrys oligospora ATCC 24927
ref|XP_011272943.1|  DNA repair protein                                 454   2e-154   Wickerhamomyces ciferrii
ref|XP_001011071.1|  DNA repair protein RAD51 containing protein        452   2e-154   Tetrahymena thermophila SB210
gb|EFA78915.1|  putative DNA repair protein                             453   2e-154   Heterostelium album PN500
gb|KDE07491.1|  DNA repair protein RAD51                                453   2e-154   Microbotryum lychnidis-dioicae p1A1 Lamole
ref|XP_011266889.1|  PREDICTED: DNA repair protein RAD51 homolog 1      453   2e-154   Camponotus floridanus
ref|XP_011788102.1|  PREDICTED: DNA repair protein RAD51 homolog 1      451   2e-154   Colobus angolensis palliatus
ref|XP_001657421.1|  AAEL006080-PA                                      452   4e-154   Aedes aegypti
ref|XP_454867.1|  hypothetical protein                                  452   1e-153   Kluyveromyces lactis
ref|XP_007081728.1|  PREDICTED: DNA repair protein RAD51 homolog ...    449   2e-153   
gb|EXX50889.1|  recombinase RAD51                                       450   2e-153   Rhizophagus irregularis DAOM 197198w
ref|XP_005872302.1|  PREDICTED: DNA repair protein RAD51 homolog ...    448   2e-153   
gb|EWC48383.1|  DNA repair protein rhp51                                450   3e-153   Drechslerella stenobrocha 248
ref|XP_001303202.1|  DNA repair protein RAD51 homolog                   449   3e-153   Trichomonas vaginalis G3
ref|XP_011111260.1|  hypothetical protein H072_5380                     452   4e-153   
gb|AAP13463.1|  Rad51p                                                  451   4e-153   
ref|XP_004030573.1|  hypothetical protein IMG5_158050                   454   1e-152   
gb|AEW27279.1|  Rad51                                                   448   1e-152   
gb|ESW96397.1|  DNA repair protein rhp51                                449   1e-152   
ref|XP_003835715.1|  similar to DNA repair protein RAD51 homolog 1      448   2e-152   
emb|CDQ01658.1|  Protein Bm13847, isoform e                             448   2e-152   
ref|XP_003707271.1|  PREDICTED: DNA repair protein RAD51 homolog A      447   2e-152   
ref|XP_005715203.1|  unnamed protein product                            447   2e-152   
gb|KHN68850.1|  DNA repair protein Rad51                                447   3e-152   
gb|KIW06919.1|  DNA repair protein rhp51                                447   3e-152   
gb|AAP74362.1|  DNA repair protein Rad51                                448   4e-152   
ref|XP_011396138.1|  DNA repair protein RAD51-like protein              446   4e-152   
ref|XP_002616520.1|  conserved hypothetical protein                     446   6e-152   
gb|AEW27278.1|  Rad51                                                   446   7e-152   
ref|XP_007782800.1|  DNA repair protein rhp51                           447   7e-152   
dbj|GAM18036.1|  hypothetical protein SAMD00019534_012110               447   9e-152   
ref|XP_002493142.1|  Strand exchange protein, forms a helical fil...    447   9e-152   
emb|CDQ01657.1|  Protein Bm13847, isoform c                             449   1e-151   
ref|XP_007842761.1|  dna repair protein rad51                           446   1e-151   
ref|XP_006176678.1|  PREDICTED: DNA repair protein RAD51 homolog ...    446   1e-151   
ref|XP_001941739.1|  DNA repair protein RAD51                           446   1e-151   
ref|XP_011844673.1|  PREDICTED: DNA repair protein RAD51 homolog ...    444   4e-151   
ref|XP_003395677.1|  PREDICTED: DNA repair protein RAD51 homolog ...    444   4e-151   
ref|XP_004197422.1|  Piso0_004675                                       445   4e-151   
emb|CDO95014.1|  unnamed protein product                                445   5e-151   
ref|XP_001828666.1|  Rah1                                               444   5e-151   
ref|XP_011330801.1|  PREDICTED: DNA repair protein RAD51 homolog A      444   6e-151   
ref|XP_011302116.1|  PREDICTED: DNA repair protein RAD51 homolog A      444   7e-151   
emb|CDR40210.1|  CYFA0S04e05974g1_1                                     444   7e-151   
ref|XP_006608061.1|  PREDICTED: DNA repair protein RAD51 homolog ...    444   7e-151   
ref|XP_624827.3|  PREDICTED: DNA repair protein RAD51 homolog 1         444   7e-151   
ref|XP_005141317.1|  PREDICTED: DNA repair protein RAD51 homolog 1      441   1e-150   
gb|EPY52543.1|  recombinase Rhp51                                       444   1e-150   
ref|XP_011866420.1|  PREDICTED: DNA repair protein RAD51 homolog A      443   1e-150   
gb|KDR84922.1|  hypothetical protein GALMADRAFT_149454                  443   2e-150   
gb|KDD76865.1|  DNA repair and recombination protein Rad51              443   2e-150   
ref|XP_007860166.1|  Rad51-domain-containing protein                    442   2e-150   
ref|XP_001592541.1|  DNA repair protein rhp51                           443   2e-150   
ref|XP_001556626.1|  hypothetical protein BC1G_04011                    443   2e-150   
ref|XP_012057084.1|  PREDICTED: DNA repair protein RAD51 homolog B      442   3e-150   
emb|CDW85021.1|  dna repair protein rad51 homolog 1                     442   3e-150   
gb|EIF45853.1|  dna repair protein rad51                                444   4e-150   
ref|XP_001897076.1|  DNA repair protein RAD51 homolog 1                 442   4e-150   
gb|ESZ97028.1|  DNA repair protein RAD51                                442   4e-150   
ref|XP_009003793.1|  PREDICTED: DNA repair protein RAD51 homolog 1      442   5e-150   
ref|XP_011062052.1|  PREDICTED: DNA repair protein RAD51 homolog B      442   5e-150   
ref|NP_597994.3|  DNA repair protein RAD51 homolog 1 isoform 2          442   5e-150   
gb|EJY87063.1|  Rad51                                                   442   6e-150   
ref|XP_007905236.1|  PREDICTED: DNA repair protein RAD51 homolog ...    440   6e-150   
gb|KHJ33999.1|  putative dna repair protein rhp51                       442   6e-150   
dbj|BAA92869.1|  Pprad51                                                441   7e-150   
ref|XP_008080509.1|  P-loop containing nucleoside triphosphate hy...    442   7e-150   
emb|CCA68562.1|  related to DNA repair protein RAD51                    441   7e-150   
gb|EHB10309.1|  DNA repair protein RAD51-like protein 1                 441   8e-150   
emb|CEI95171.1|  Putative DNA repair protein RAD51                      441   9e-150   
dbj|BAO42667.1|  DNA repair protein RAD51                               442   1e-149   
emb|CEG68786.1|  Putative DNA repair protein RAD51                      441   1e-149   
gb|EIE79639.1|  DNA repair protein RAD51                                441   1e-149   
ref|XP_011697004.1|  PREDICTED: DNA repair protein RAD51 homolog A      441   1e-149   
ref|XP_003038529.1|  hypothetical protein SCHCODRAFT_103780             440   2e-149   
gb|EPR78654.1|  DNA repair protein RAD51                                441   3e-149   
gb|EDK39771.2|  conserved hypothetical protein                          439   3e-149   
ref|XP_002151564.1|  DNA repair protein RAD51, putative                 440   3e-149   
gb|KJX96681.1|  dna repair protein rad51                                440   4e-149   
ref|XP_505458.1|  YALI0F15477p                                          439   5e-149   
ref|XP_003146628.1|  rad51                                              440   6e-149   
ref|XP_003298683.1|  hypothetical protein PTT_09464                     439   6e-149   
emb|CCM00352.1|  predicted protein                                      439   6e-149   
gb|KFP74464.1|  DNA repair protein RAD51 1                              437   7e-149   
ref|XP_007585816.1|  putative dna repair protein rad51 protein          439   7e-149   
ref|XP_001484488.1|  conserved hypothetical protein                     438   7e-149   
dbj|GAM41421.1|  recombinase                                            439   8e-149   
ref|XP_002421794.1|  DNA repair protein rad51 homologue, putative       439   8e-149   
gb|EHH62983.1|  hypothetical protein EGM_15862                          439   8e-149   
ref|XP_713476.1|  hypothetical protein CaO19.11236                      439   8e-149   
ref|XP_002546109.1|  DNA repair protein RAD51                           439   9e-149   
ref|XP_002341472.1|  DNA repair protein RAD51, putative                 439   1e-148   
ref|XP_004751427.1|  PREDICTED: DNA repair protein RAD51 homolog 1      438   1e-148   
ref|XP_001692733.1|  DNA recombination protein                          438   1e-148   
ref|XP_007293727.1|  DNA repair protein rhp51                           438   1e-148   
ref|XP_001269222.1|  DNA repair protein RAD51, putative                 438   1e-148   
emb|CAD23442.1|  putative RAD1 protein                                  438   1e-148   
ref|XP_004534356.1|  PREDICTED: DNA repair protein RAD51 homolog ...    438   1e-148   
ref|XP_007799744.1|  DNA repair protein rhp51                           438   2e-148   
ref|XP_003865980.1|  Rad51 protein                                      439   2e-148   
ref|XP_001210316.1|  DNA repair protein RAD51                           438   2e-148   
ref|XP_001392351.1|  DNA repair protein rhp51                           438   2e-148   
gb|EMG48884.1|  DNA repair-like protein rad51, putative                 438   2e-148   
ref|XP_007596750.1|  DNA repair protein rhp51                           438   2e-148   
dbj|GAA89526.1|  DNA repair protein RAD51                               438   2e-148   
ref|XP_011636045.1|  PREDICTED: DNA repair protein RAD51 homolog A      437   3e-148   
gb|EKV21464.1|  DNA repair protein RAD51, putative                      437   3e-148   
ref|XP_005978509.1|  PREDICTED: DNA repair protein RAD51 homolog ...    437   4e-148   
ref|XP_005182965.1|  PREDICTED: DNA repair protein RAD51 homolog 1      437   4e-148   
emb|CAB02454.1|  uvsC                                                   437   5e-148   
ref|XP_001264730.1|  DNA repair protein RAD51, putative                 437   5e-148   
ref|XP_458414.2|  DEHA2C16698p                                          437   5e-148   
gb|KGO78089.1|  DNA recombination/repair protein RecA, monomer-mo...    437   5e-148   
ref|XP_011178200.1|  PREDICTED: DNA repair protein RAD51 homolog 1      437   5e-148   
ref|XP_752407.1|  DNA repair protein RAD51                              437   6e-148   
emb|CEP18855.1|  hypothetical protein                                   436   6e-148   
ref|XP_658841.1|  hypothetical protein AN1237.2                         436   6e-148   
ref|XP_001825314.1|  DNA repair protein rhp51                           436   8e-148   
ref|XP_008595377.1|  putative RAD51 protein                             436   8e-148   
ref|XP_004361265.1|  putative DNA repair protein                        437   8e-148   
emb|CCE41590.1|  hypothetical protein CPAR2_801420                      437   9e-148   
ref|XP_002560816.1|  Pc16g04650                                         436   9e-148   
gb|AEW27332.1|  Rad51                                                   435   1e-147   
gb|ENH77078.1|  DNA repair protein rad51                                436   1e-147   
gb|KFH41169.1|  DNA repair protein-like protein                         436   1e-147   
ref|XP_008728607.1|  DNA repair protein rhp51                           436   1e-147   
gb|EEH07944.1|  conserved hypothetical protein                          436   1e-147   
gb|KJJ11246.1|  AAA+ ATPase domain                                      436   1e-147   
ref|XP_011211562.1|  PREDICTED: LOW QUALITY PROTEIN: DNA repair p...    436   2e-147   
ref|XP_007283464.1|  DNA repair protein rad51                           436   2e-147   
gb|EWY94342.1|  DNA repair protein rhp51                                435   2e-147   
emb|CDO71646.1|  hypothetical protein BN946_scf184911.g117              435   2e-147   
emb|CCN27368.1|  recombinase                                            436   2e-147   
ref|XP_009863919.1|  PREDICTED: LOW QUALITY PROTEIN: DNA repair p...    434   2e-147   
gb|EPS32208.1|  hypothetical protein PDE_07168                          435   2e-147   
ref|XP_006672023.1|  DNA repair protein RAD51                           435   2e-147   
ref|XP_002848296.1|  DNA repair protein RAD51                           435   2e-147   
gb|KGQ08899.1|  DNA repair protein rhp51                                435   2e-147   
gb|KDN64845.1|  hypothetical protein CSUB01_02335                       435   3e-147   
ref|XP_002795403.1|  DNA repair protein RAD51                           435   3e-147   
gb|KGK40056.1|  hypothetical protein JL09_g739                          436   3e-147   
ref|XP_003073929.1|  DNA repair protein Rad51                           434   3e-147   
dbj|GAD96586.1|  DNA repair protein RAD51, putative                     446   3e-147   
ref|XP_003888325.1|  DNA repair protein Rad51                           434   3e-147   
ref|XP_010757628.1|  DNA repair protein rhp51                           435   3e-147   
ref|XP_003175888.1|  DNA repair protein RAD51                           435   4e-147   
ref|XP_009269507.1|  DNA repair protein RAD51                           434   4e-147   
gb|EGU80851.1|  hypothetical protein FOXB_08718                         434   5e-147   
ref|XP_007820202.2|  Nucleoporin Nup120/160                             434   5e-147   
ref|XP_007810558.1|  DNA repair protein RAD51                           434   5e-147   
ref|XP_003756060.1|  PREDICTED: DNA repair protein RAD51 homolog 1      433   5e-147   
emb|CCE35288.1|  probable Rad51 homolog MEI-3                           434   5e-147   
gb|KIW10367.1|  DNA repair protein rhp51                                434   5e-147   
gb|AGE94911.1|  DNA repair protein rad51 like-protein                   434   5e-147   
emb|CCF34743.1|  DNA repair protein rhp51                               434   6e-147   
gb|KKA28386.1|  hypothetical protein TD95_000188                        434   6e-147   
gb|KJZ72602.1|  DNA repair protein rhp51                                434   6e-147   
ref|XP_965126.1|  MEI3                                                  434   7e-147   
emb|CEJ90669.1|  Putative DNA repair protein RAD51/RHP55                434   7e-147   
gb|KIV79112.1|  DNA repair protein rhp51                                434   8e-147   
ref|XP_011172379.1|  PREDICTED: DNA repair protein RAD51 homolog A      434   8e-147   
gb|KIX08105.1|  DNA repair protein rhp51                                434   8e-147   
gb|KIL94635.1|  dna repair protein rhp51                                434   9e-147   
ref|XP_009156318.1|  DNA repair protein rhp51                           434   1e-146   
emb|CCT62132.1|  probable Rad51 homolog MEI-3                           433   1e-146   
gb|EFQ28753.1|  hypothetical protein GLRG_03897                         434   1e-146   
gb|EJW05219.1|  DNA repair protein RAD51                                432   1e-146   
ref|XP_007758664.1|  DNA repair protein rhp51                           433   1e-146   
emb|CDS08483.1|  Putative DNA repair protein rhp51                      432   1e-146   
gb|KIW46998.1|  DNA repair protein rhp51                                433   2e-146   
gb|EGE00229.1|  DNA repair protein RAD51                                433   2e-146   
ref|XP_002543898.1|  DNA repair protein RAD51                           433   2e-146   
gb|KEZ43162.1|  DNA repair protein rhp51                                433   2e-146   
gb|KCZ79458.1|  DNA repair protein RAD51                                432   2e-146   
ref|XP_011496301.1|  PREDICTED: DNA repair protein RAD51 homolog 1      432   2e-146   
ref|XP_003234653.1|  DNA repair protein RAD51                           433   2e-146   
ref|XP_003350973.1|  RAD51 protein                                      433   2e-146   
emb|CDH53013.1|  dna repair protein rad51 homolog 1                     432   2e-146   
ref|XP_008551479.1|  PREDICTED: DNA repair protein RAD51 homolog A      432   2e-146   
emb|CDM30336.1|  DNA repair protein rhp51                               432   2e-146   
ref|XP_003791870.1|  PREDICTED: DNA repair protein RAD51 homolog 1      431   2e-146   
ref|XP_003004814.1|  DNA repair protein RAD51                           433   3e-146   
ref|XP_007917445.1|  putative dna repair protein rad51 protein          432   3e-146   
gb|KIW85560.1|  DNA repair protein rhp51                                432   3e-146   
gb|KIW52867.1|  DNA repair protein rhp51                                432   3e-146   
ref|NP_586388.1|  DNA REPAIR PROTEIN RAD51 HOMOLOG                      432   3e-146   
ref|XP_009649408.1|  DNA repair protein RAD51                           432   3e-146   
ref|XP_007827362.1|  DNA repair protein rhp51                           432   3e-146   
ref|XP_002623823.1|  DNA repair protein RAD51                           432   4e-146   
gb|EQL00901.1|  DNA repair protein RAD51                                432   4e-146   
gb|AGG11457.1|  hypothetical protein                                    432   4e-146   
gb|KIW95416.1|  DNA repair protein rhp51                                432   5e-146   
ref|XP_009217889.1|  DNA repair protein rhp51                           432   5e-146   
ref|XP_001527554.1|  DNA repair protein RAD51                           432   5e-146   
ref|XP_009257030.1|  hypothetical protein FPSE_05637                    432   5e-146   
dbj|GAM88460.1|  hypothetical protein ANO11243_064930                   432   5e-146   
gb|KEY64800.1|  hypothetical protein S7711_08078                        432   5e-146   
ref|XP_007725524.1|  DNA repair protein rhp51                           432   5e-146   
gb|KIW67646.1|  DNA repair protein rhp51                                432   6e-146   
ref|XP_001828021.1|  DNA repair and recombination protein RAD51         431   6e-146   
gb|KFA64197.1|  hypothetical protein S40285_00871                       431   6e-146   
gb|KIX95585.1|  DNA repair protein rhp51                                431   7e-146   
emb|CBJ27144.1|  DNA repair and recombination protein Rad51A            431   8e-146   
gb|EKG19521.1|  ATPase AAA+ type core                                   430   8e-146   
ref|XP_012046913.1|  DNA repair protein RAD51                           431   8e-146   
ref|XP_007747427.1|  DNA repair protein rhp51                           431   8e-146   
ref|XP_006742549.1|  PREDICTED: DNA repair protein RAD51 homolog 1      428   9e-146   
gb|KEF56479.1|  DNA repair protein rhp51                                431   9e-146   
ref|XP_002056149.1|  GJ10382                                            431   9e-146   
gb|KDB14023.1|  DNA repair protein RAD51                                431   9e-146   
ref|XP_006073117.1|  PREDICTED: DNA repair protein RAD51 homolog ...    429   9e-146   
ref|XP_003069067.1|  DNA repair protein rhp51, putative                 431   1e-145   
ref|XP_001905059.1|  hypothetical protein                               431   1e-145   
gb|EOA94448.1|  DNA repair protein RAD51-like protein 1                 427   2e-145   
emb|CCO26708.1|  DNA repair protein rhp51 AltName: Full=RAD51 hom...    430   2e-145   
gb|KIZ00472.1|  putative DNA repair protein RAD51 like protein          429   3e-145   
gb|EKV12765.1|  DNA repair protein RAD51, putative                      439   4e-145   
ref|XP_003713761.1|  DNA repair protein rhp51                           430   4e-145   
gb|EFZ09890.1|  hypothetical protein SINV_00924                         428   4e-145   
emb|CEG01451.1|  DNA recombination/repair protein RecA,monomer-mo...    429   4e-145   
ref|XP_007603695.1|  DNA repair protein RAD51                           428   6e-145   
gb|KIW32165.1|  DNA repair protein rhp51                                429   7e-145   
emb|CBK23656.2|  unnamed protein product                                427   7e-145   
gb|KEP54258.1|  DNA repair RAD51-like protein                           429   7e-145   
gb|KGO47633.1|  DNA recombination/repair protein RecA, monomer-mo...    439   8e-145   
emb|CEJ03468.1|  Putative DNA repair protein RAD51                      428   8e-145   
ref|XP_003959669.1|  hypothetical protein KAFR_0K01800                  429   9e-145   
gb|KEQ87558.1|  DNA repair protein rhp51                                428   1e-144   
ref|XP_001239326.1|  hypothetical protein CIMG_08947                    428   2e-144   
ref|XP_007734262.1|  DNA repair protein rhp51                           427   2e-144   
ref|XP_011154144.1|  PREDICTED: DNA repair protein RAD51 homolog 1      427   2e-144   
gb|EHK26730.1|  meiosis defective protein MEI3                          428   2e-144   
ref|XP_010151122.1|  PREDICTED: DNA repair protein RAD51 homolog ...    427   3e-144   
ref|XP_001229307.1|  hypothetical protein CHGG_02791                    427   3e-144   
ref|XP_007794517.1|  putative dna repair protein rad51 protein          427   3e-144   
gb|EUC53801.1|  DNA repair RAD51-like protein                           427   3e-144   



>ref|XP_009611626.1| PREDICTED: DNA repair protein RAD51 homolog [Nicotiana tomentosiformis]
Length=343

 Score =   661 bits (1706),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/344 (93%), Positives = 336/344 (98%), Gaps = 1/344 (0%)
 Frame = +1

Query  139   MEQQHRNQQKSVQERQQDEVEEIQHGPFPIEQLQESGISAIDVKKLKDAGLCTVESVVYS  318
             MEQQ RNQ K++Q+ Q +E++++QHGPFP+EQLQ SGI+A+DVKKLKDAG+CTVESV Y+
Sbjct  1     MEQQQRNQ-KTMQQEQNEELDDVQHGPFPVEQLQASGIAALDVKKLKDAGICTVESVCYA  59

Query  319   PRKDLLQIKGISEAKVDKIIEAASKLVPLGFTSASQLHAQRLEIIQITSGSKELDKVLEG  498
             PRK+LL IKGISEAKVDKIIEAASKLVPLGFTSASQLHAQRLEIIQITSGSKELDK+LEG
Sbjct  60    PRKELLHIKGISEAKVDKIIEAASKLVPLGFTSASQLHAQRLEIIQITSGSKELDKILEG  119

Query  499   GIETGSITEIYGEFRSGKTQLCHTLCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIA  678
             GIETGSITEIYGEFRSGKTQLCHTLCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIA
Sbjct  120   GIETGSITEIYGEFRSGKTQLCHTLCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIA  179

Query  679   DRFGLNGADVLENVAYARAYNTDHQSRLLLEAASMMVETRFALMIVDSATALYRTDFSGR  858
             DRFGLNGADVLENVAYARAYNTDHQSRLLLEAASMMVETRFALMIVDSATALYRTDFSGR
Sbjct  180   DRFGLNGADVLENVAYARAYNTDHQSRLLLEAASMMVETRFALMIVDSATALYRTDFSGR  239

Query  859   GELSARQMHLAKFLRSLQKLADEFGVAVVITNQVVAQVDGSAIFAGPQIKPIGGNIMAHA  1038
             GELSARQMHLAKFLRSLQKLADEFGVAVVITNQVVAQVDGSA+FAGPQIKPIGGNIMAHA
Sbjct  240   GELSARQMHLAKFLRSLQKLADEFGVAVVITNQVVAQVDGSAVFAGPQIKPIGGNIMAHA  299

Query  1039  STTRLALRKGRGEERVCKVVSSPCLAEAEARFQISPEGVTDVKD  1170
             STTRLALRKGR EER+CKVVSSPCLAEAEARFQISPEGVTDVKD
Sbjct  300   STTRLALRKGRAEERICKVVSSPCLAEAEARFQISPEGVTDVKD  343



>ref|NP_001233788.1| DNA repair protein RAD51 homolog [Solanum lycopersicum]
 sp|Q40134.1|RAD51_SOLLC RecName: Full=DNA repair protein RAD51 homolog [Solanum lycopersicum]
 gb|AAC23700.1| LeRAD51 [Solanum lycopersicum]
Length=342

 Score =   661 bits (1705),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/344 (94%), Positives = 336/344 (98%), Gaps = 2/344 (1%)
 Frame = +1

Query  139   MEQQHRNQQKSVQERQQDEVEEIQHGPFPIEQLQESGISAIDVKKLKDAGLCTVESVVYS  318
             MEQQHRNQ KS+Q+ Q DE+E++QHGPFP+EQLQ SGI+A+DVKKLKDAGLCTVESVVY+
Sbjct  1     MEQQHRNQ-KSMQD-QNDEIEDVQHGPFPVEQLQASGIAALDVKKLKDAGLCTVESVVYA  58

Query  319   PRKDLLQIKGISEAKVDKIIEAASKLVPLGFTSASQLHAQRLEIIQITSGSKELDKVLEG  498
             PRK+LLQIKGISEAKVDKIIEAASKLVPLGFTSASQLHAQRLEIIQITSGSKELDK+LEG
Sbjct  59    PRKELLQIKGISEAKVDKIIEAASKLVPLGFTSASQLHAQRLEIIQITSGSKELDKILEG  118

Query  499   GIETGSITEIYGEFRSGKTQLCHTLCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIA  678
             GIETGSITEIYGEFR GKTQLCHTLCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIA
Sbjct  119   GIETGSITEIYGEFRCGKTQLCHTLCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIA  178

Query  679   DRFGLNGADVLENVAYARAYNTDHQSRLLLEAASMMVETRFALMIVDSATALYRTDFSGR  858
             DR+GLNG DVLENVAYARAYNTDHQSRLLLEAASMMVETRFALMIVDSATALYRTDFSGR
Sbjct  179   DRYGLNGPDVLENVAYARAYNTDHQSRLLLEAASMMVETRFALMIVDSATALYRTDFSGR  238

Query  859   GELSARQMHLAKFLRSLQKLADEFGVAVVITNQVVAQVDGSAIFAGPQIKPIGGNIMAHA  1038
             GELSARQMHLAKFLRSLQKLADEFGVAVVITNQVVAQVDGSA+FAGPQIKPIGGNIMAHA
Sbjct  239   GELSARQMHLAKFLRSLQKLADEFGVAVVITNQVVAQVDGSAVFAGPQIKPIGGNIMAHA  298

Query  1039  STTRLALRKGRGEERVCKVVSSPCLAEAEARFQISPEGVTDVKD  1170
             STTRLALRKGR EER+CKVVSSPCLAEAEARFQIS EGVTDVKD
Sbjct  299   STTRLALRKGRAEERICKVVSSPCLAEAEARFQISVEGVTDVKD  342



>ref|XP_009789565.1| PREDICTED: DNA repair protein RAD51 homolog [Nicotiana sylvestris]
Length=343

 Score =   660 bits (1704),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/344 (92%), Positives = 336/344 (98%), Gaps = 1/344 (0%)
 Frame = +1

Query  139   MEQQHRNQQKSVQERQQDEVEEIQHGPFPIEQLQESGISAIDVKKLKDAGLCTVESVVYS  318
             MEQQ RNQ K++Q+ Q +E++++QHGPFP+EQLQ SGI+A+DVKKLKDAG+CTVESV Y+
Sbjct  1     MEQQQRNQ-KTMQQDQNEELDDVQHGPFPVEQLQASGIAALDVKKLKDAGICTVESVCYA  59

Query  319   PRKDLLQIKGISEAKVDKIIEAASKLVPLGFTSASQLHAQRLEIIQITSGSKELDKVLEG  498
             PRK+LL IKGISEAKVDKIIEAASKLVPLGFTSASQLHAQRLEIIQITSGSKELDK+LEG
Sbjct  60    PRKELLHIKGISEAKVDKIIEAASKLVPLGFTSASQLHAQRLEIIQITSGSKELDKILEG  119

Query  499   GIETGSITEIYGEFRSGKTQLCHTLCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIA  678
             GIETGSITEIYGEFRSGKTQLCHTLCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIA
Sbjct  120   GIETGSITEIYGEFRSGKTQLCHTLCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIA  179

Query  679   DRFGLNGADVLENVAYARAYNTDHQSRLLLEAASMMVETRFALMIVDSATALYRTDFSGR  858
             DRFGLNGADVLENVAYARAYNTDHQSRLLLEAASMMVETRFALMIVDSATALYRTDFSGR
Sbjct  180   DRFGLNGADVLENVAYARAYNTDHQSRLLLEAASMMVETRFALMIVDSATALYRTDFSGR  239

Query  859   GELSARQMHLAKFLRSLQKLADEFGVAVVITNQVVAQVDGSAIFAGPQIKPIGGNIMAHA  1038
             GELSARQMHLAKFLRSLQKLADEFGVAVVITNQVVAQVDGSA+FAGPQIKPIGGNIMAHA
Sbjct  240   GELSARQMHLAKFLRSLQKLADEFGVAVVITNQVVAQVDGSAVFAGPQIKPIGGNIMAHA  299

Query  1039  STTRLALRKGRGEERVCKVVSSPCLAEAEARFQISPEGVTDVKD  1170
             STTRLA+RKGR EER+CKVVSSPCLAEAEARFQISPEGVTDVKD
Sbjct  300   STTRLAMRKGRAEERICKVVSSPCLAEAEARFQISPEGVTDVKD  343



>gb|ERM96041.1| hypothetical protein AMTR_s00129p00082230 [Amborella trichopoda]
Length=343

 Score =   656 bits (1692),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/344 (92%), Positives = 332/344 (97%), Gaps = 1/344 (0%)
 Frame = +1

Query  139   MEQQHRNQQKSVQERQQDEVEEIQHGPFPIEQLQESGISAIDVKKLKDAGLCTVESVVYS  318
             MEQ H+ QQK   E+Q DE E++QHGPFPIEQLQ SGI+++DVKKLKDAGLCTVESV YS
Sbjct  1     MEQMHQKQQK-FAEQQADETEDMQHGPFPIEQLQASGIASLDVKKLKDAGLCTVESVAYS  59

Query  319   PRKDLLQIKGISEAKVDKIIEAASKLVPLGFTSASQLHAQRLEIIQITSGSKELDKVLEG  498
             PRKDLLQIKGIS+AKVDKIIEAASKLVPLGFTSASQLHAQRLEIIQITSGS+ELDK+LEG
Sbjct  60    PRKDLLQIKGISDAKVDKIIEAASKLVPLGFTSASQLHAQRLEIIQITSGSRELDKILEG  119

Query  499   GIETGSITEIYGEFRSGKTQLCHTLCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIA  678
             GIETGSITEIYGEFRSGKTQLCHTLCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIA
Sbjct  120   GIETGSITEIYGEFRSGKTQLCHTLCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIA  179

Query  679   DRFGLNGADVLENVAYARAYNTDHQSRLLLEAASMMVETRFALMIVDSATALYRTDFSGR  858
             +RFGLNGADVLENVAYARAYNTDHQSRLLLEAASMMVE RFALMIVDSATALYRTDFSGR
Sbjct  180   ERFGLNGADVLENVAYARAYNTDHQSRLLLEAASMMVEARFALMIVDSATALYRTDFSGR  239

Query  859   GELSARQMHLAKFLRSLQKLADEFGVAVVITNQVVAQVDGSAIFAGPQIKPIGGNIMAHA  1038
             GELSARQMHLAKFLRSLQKLADEFGVAVV+TNQVVAQVDGSA+FAGPQIKPIGGNIMAHA
Sbjct  240   GELSARQMHLAKFLRSLQKLADEFGVAVVLTNQVVAQVDGSAMFAGPQIKPIGGNIMAHA  299

Query  1039  STTRLALRKGRGEERVCKVVSSPCLAEAEARFQISPEGVTDVKD  1170
             STTRLA RKGRGEER+CKV+SSPCLAEAEARFQISPEGV DVKD
Sbjct  300   STTRLAFRKGRGEERICKVISSPCLAEAEARFQISPEGVVDVKD  343



>ref|XP_007202345.1| hypothetical protein PRUPE_ppa008236mg [Prunus persica]
 ref|XP_008242148.1| PREDICTED: DNA repair protein RAD51 homolog [Prunus mume]
 gb|EMJ03544.1| hypothetical protein PRUPE_ppa008236mg [Prunus persica]
Length=340

 Score =   655 bits (1690),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/344 (93%), Positives = 334/344 (97%), Gaps = 4/344 (1%)
 Frame = +1

Query  139   MEQQHRNQQKSVQERQQDEVEEIQHGPFPIEQLQESGISAIDVKKLKDAGLCTVESVVYS  318
             MEQQ  + QK+ Q  QQDE EE+QHGP P+EQLQ SGI++IDVKKLKDAGLCTVE+V YS
Sbjct  1     MEQQ--SNQKTAQ--QQDEHEEMQHGPVPVEQLQTSGIASIDVKKLKDAGLCTVEAVAYS  56

Query  319   PRKDLLQIKGISEAKVDKIIEAASKLVPLGFTSASQLHAQRLEIIQITSGSKELDKVLEG  498
             PRKDLLQIKGISEAKVDKIIEAASKLVPLGFTSASQLHAQRLEIIQITSGS+ELDK+LEG
Sbjct  57    PRKDLLQIKGISEAKVDKIIEAASKLVPLGFTSASQLHAQRLEIIQITSGSRELDKILEG  116

Query  499   GIETGSITEIYGEFRSGKTQLCHTLCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIA  678
             GIETGSITEIYGEFRSGKTQLCHTLCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIA
Sbjct  117   GIETGSITEIYGEFRSGKTQLCHTLCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIA  176

Query  679   DRFGLNGADVLENVAYARAYNTDHQSRLLLEAASMMVETRFALMIVDSATALYRTDFSGR  858
             +RFGLNGADVLENVAYARAYNTDHQSRLLLEAASMMVETRFALMIVDSATALYRTDFSGR
Sbjct  177   ERFGLNGADVLENVAYARAYNTDHQSRLLLEAASMMVETRFALMIVDSATALYRTDFSGR  236

Query  859   GELSARQMHLAKFLRSLQKLADEFGVAVVITNQVVAQVDGSAIFAGPQIKPIGGNIMAHA  1038
             GELSARQMHLAKFLRSLQKLADEFGVAVVITNQVVAQVDGSAIFAGPQ+KPIGGNIMAHA
Sbjct  237   GELSARQMHLAKFLRSLQKLADEFGVAVVITNQVVAQVDGSAIFAGPQVKPIGGNIMAHA  296

Query  1039  STTRLALRKGRGEERVCKVVSSPCLAEAEARFQISPEGVTDVKD  1170
             STTRLA+RKGRGEER+CKV+SSPCLAEAEARFQISPEGVTDVKD
Sbjct  297   STTRLAVRKGRGEERICKVISSPCLAEAEARFQISPEGVTDVKD  340



>ref|XP_008800478.1| PREDICTED: DNA repair protein RAD51 homolog [Phoenix dactylifera]
Length=342

 Score =   654 bits (1688),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/344 (92%), Positives = 333/344 (97%), Gaps = 2/344 (1%)
 Frame = +1

Query  139   MEQQHRNQQKSVQERQQDEVEEIQHGPFPIEQLQESGISAIDVKKLKDAGLCTVESVVYS  318
             M  Q + +QK V+E+Q  E+E++QHGPFPIEQLQ SGI+A+DVKKLKDAGLCTVESV +S
Sbjct  1     MAAQQQRRQKMVEEQQ--EIEDMQHGPFPIEQLQASGIAALDVKKLKDAGLCTVESVAFS  58

Query  319   PRKDLLQIKGISEAKVDKIIEAASKLVPLGFTSASQLHAQRLEIIQITSGSKELDKVLEG  498
             PRKDLLQIKG+SEAKVDKIIEAASKLVPLGFTSASQLHAQRLEIIQITSGS +LDK+LEG
Sbjct  59    PRKDLLQIKGLSEAKVDKIIEAASKLVPLGFTSASQLHAQRLEIIQITSGSSDLDKILEG  118

Query  499   GIETGSITEIYGEFRSGKTQLCHTLCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIA  678
             GIETGSITEIYGEFRSGKTQLCHTLCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIA
Sbjct  119   GIETGSITEIYGEFRSGKTQLCHTLCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIA  178

Query  679   DRFGLNGADVLENVAYARAYNTDHQSRLLLEAASMMVETRFALMIVDSATALYRTDFSGR  858
             DRFGLNGADVLENVAYARAYNTDHQSRLLLEAASMMVETRFALMIVDSATALYRTDFSGR
Sbjct  179   DRFGLNGADVLENVAYARAYNTDHQSRLLLEAASMMVETRFALMIVDSATALYRTDFSGR  238

Query  859   GELSARQMHLAKFLRSLQKLADEFGVAVVITNQVVAQVDGSAIFAGPQIKPIGGNIMAHA  1038
             GELSARQMHLAKFLRSLQKLADEFGVAVVITNQVVAQVDGSAIFAGPQIKPIGGNIMAHA
Sbjct  239   GELSARQMHLAKFLRSLQKLADEFGVAVVITNQVVAQVDGSAIFAGPQIKPIGGNIMAHA  298

Query  1039  STTRLALRKGRGEERVCKVVSSPCLAEAEARFQISPEGVTDVKD  1170
             STTRLALRKGRGEER+CKV+SSPCLAEAEARFQIS EGVTDVKD
Sbjct  299   STTRLALRKGRGEERICKVISSPCLAEAEARFQISSEGVTDVKD  342



>ref|XP_010937252.1| PREDICTED: DNA repair protein RAD51 homolog [Elaeis guineensis]
Length=342

 Score =   653 bits (1685),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/344 (92%), Positives = 331/344 (96%), Gaps = 2/344 (1%)
 Frame = +1

Query  139   MEQQHRNQQKSVQERQQDEVEEIQHGPFPIEQLQESGISAIDVKKLKDAGLCTVESVVYS  318
             M  Q +  QK  +E+Q  E+E++QHGPFPIEQLQ SGI+A+DVKKLKDAGLCTVESV YS
Sbjct  1     MAAQQQRHQKMAEEQQ--EIEDMQHGPFPIEQLQASGIAALDVKKLKDAGLCTVESVAYS  58

Query  319   PRKDLLQIKGISEAKVDKIIEAASKLVPLGFTSASQLHAQRLEIIQITSGSKELDKVLEG  498
             PRKDLL IKGISEAKVDKIIEAASKLVPLGFTSASQLHAQRLEIIQITSGS+ELDK+LEG
Sbjct  59    PRKDLLHIKGISEAKVDKIIEAASKLVPLGFTSASQLHAQRLEIIQITSGSRELDKILEG  118

Query  499   GIETGSITEIYGEFRSGKTQLCHTLCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIA  678
             GIETGSITEIYGEFRSGKTQLCHTLCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIA
Sbjct  119   GIETGSITEIYGEFRSGKTQLCHTLCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIA  178

Query  679   DRFGLNGADVLENVAYARAYNTDHQSRLLLEAASMMVETRFALMIVDSATALYRTDFSGR  858
             DRFGLNGADVLENVAYARAYNTDHQSRLLLEAASMMVETRFALMIVDSATALYRTDFSGR
Sbjct  179   DRFGLNGADVLENVAYARAYNTDHQSRLLLEAASMMVETRFALMIVDSATALYRTDFSGR  238

Query  859   GELSARQMHLAKFLRSLQKLADEFGVAVVITNQVVAQVDGSAIFAGPQIKPIGGNIMAHA  1038
             GELSARQMHLAKFLRSLQKLADEFGVAVVITNQVVAQVDGSAIFAGPQIKPIGGNIMAHA
Sbjct  239   GELSARQMHLAKFLRSLQKLADEFGVAVVITNQVVAQVDGSAIFAGPQIKPIGGNIMAHA  298

Query  1039  STTRLALRKGRGEERVCKVVSSPCLAEAEARFQISPEGVTDVKD  1170
             STTRLALRKGRGEER+CKV+SSPCLAEAEARFQIS +GVTDVKD
Sbjct  299   STTRLALRKGRGEERICKVISSPCLAEAEARFQISSDGVTDVKD  342



>ref|XP_008783310.1| PREDICTED: DNA repair protein RAD51 homolog [Phoenix dactylifera]
Length=342

 Score =   652 bits (1683),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/342 (92%), Positives = 331/342 (97%), Gaps = 3/342 (1%)
 Frame = +1

Query  145   QQHRNQQKSVQERQQDEVEEIQHGPFPIEQLQESGISAIDVKKLKDAGLCTVESVVYSPR  324
             QQ R+Q+ +    QQ E+E++QHGPFP+EQLQ SGI+A+DVKKLKDAGLCTVESV YSPR
Sbjct  4     QQQRHQKMA---EQQQEMEDMQHGPFPVEQLQASGIAALDVKKLKDAGLCTVESVAYSPR  60

Query  325   KDLLQIKGISEAKVDKIIEAASKLVPLGFTSASQLHAQRLEIIQITSGSKELDKVLEGGI  504
             KDLLQIKGISEAKVDKIIEAASKLVPLGFTSASQLHAQRLEIIQITSGS+ELDK+LEGGI
Sbjct  61    KDLLQIKGISEAKVDKIIEAASKLVPLGFTSASQLHAQRLEIIQITSGSRELDKILEGGI  120

Query  505   ETGSITEIYGEFRSGKTQLCHTLCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIADR  684
             ETGSITEIYGEFRSGKTQLCHTLCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIADR
Sbjct  121   ETGSITEIYGEFRSGKTQLCHTLCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIADR  180

Query  685   FGLNGADVLENVAYARAYNTDHQSRLLLEAASMMVETRFALMIVDSATALYRTDFSGRGE  864
             FGLNGADVLENVAYARAYNTDHQSRLLLEAASMMVETRFALMIVDSATALYRTDFSGRGE
Sbjct  181   FGLNGADVLENVAYARAYNTDHQSRLLLEAASMMVETRFALMIVDSATALYRTDFSGRGE  240

Query  865   LSARQMHLAKFLRSLQKLADEFGVAVVITNQVVAQVDGSAIFAGPQIKPIGGNIMAHAST  1044
             LSARQMHLAKFLRSLQK+ADEFGVAVVITNQVVAQVDGSA FAGPQIKPIGGNIMAHAST
Sbjct  241   LSARQMHLAKFLRSLQKMADEFGVAVVITNQVVAQVDGSAFFAGPQIKPIGGNIMAHAST  300

Query  1045  TRLALRKGRGEERVCKVVSSPCLAEAEARFQISPEGVTDVKD  1170
             TRL+LRKGRGEER+CKV+SSPCLAEAEARFQIS EGVTDVKD
Sbjct  301   TRLSLRKGRGEERICKVISSPCLAEAEARFQISSEGVTDVKD  342



>dbj|BAF02935.1| RAD51 homolog [Populus nigra]
Length=342

 Score =   652 bits (1682),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/344 (92%), Positives = 335/344 (97%), Gaps = 2/344 (1%)
 Frame = +1

Query  139   MEQQHRNQQKSVQERQQDEVEEIQHGPFPIEQLQESGISAIDVKKLKDAGLCTVESVVYS  318
             MEQQ RNQ K+V ++Q ++ EE+QHGPFP+EQLQ SGI+++DVKKLKDAGLCTVESV +S
Sbjct  1     MEQQ-RNQ-KAVNQQQHEDHEEVQHGPFPVEQLQASGIASLDVKKLKDAGLCTVESVAFS  58

Query  319   PRKDLLQIKGISEAKVDKIIEAASKLVPLGFTSASQLHAQRLEIIQITSGSKELDKVLEG  498
             PRK+LLQIKGISEAKVDKIIEAASKLVPLGFTSASQLHAQR EIIQITSGS+ELDK+LEG
Sbjct  59    PRKELLQIKGISEAKVDKIIEAASKLVPLGFTSASQLHAQRQEIIQITSGSRELDKILEG  118

Query  499   GIETGSITEIYGEFRSGKTQLCHTLCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIA  678
             G+ETGSITE+YGEFRSGKTQLCHTLCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIA
Sbjct  119   GVETGSITEMYGEFRSGKTQLCHTLCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIA  178

Query  679   DRFGLNGADVLENVAYARAYNTDHQSRLLLEAASMMVETRFALMIVDSATALYRTDFSGR  858
             DRFGLNGADVLENVAYARAYNTDHQSRLLLEAASMMVETRFALMIVDSATALYRTDFSGR
Sbjct  179   DRFGLNGADVLENVAYARAYNTDHQSRLLLEAASMMVETRFALMIVDSATALYRTDFSGR  238

Query  859   GELSARQMHLAKFLRSLQKLADEFGVAVVITNQVVAQVDGSAIFAGPQIKPIGGNIMAHA  1038
             GELSARQMHLAKFLRSLQKLADEFGVAVVITNQVVAQVDGSAIFAGPQIKPIGGNIMAHA
Sbjct  239   GELSARQMHLAKFLRSLQKLADEFGVAVVITNQVVAQVDGSAIFAGPQIKPIGGNIMAHA  298

Query  1039  STTRLALRKGRGEERVCKVVSSPCLAEAEARFQISPEGVTDVKD  1170
             STTRLALRKGRGEER+CKV+SSPCLAEAEARFQIS EGVTDVKD
Sbjct  299   STTRLALRKGRGEERICKVISSPCLAEAEARFQISAEGVTDVKD  342



>ref|XP_010939852.1| PREDICTED: DNA repair protein RAD51 homolog [Elaeis guineensis]
Length=342

 Score =   652 bits (1681),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/344 (92%), Positives = 330/344 (96%), Gaps = 2/344 (1%)
 Frame = +1

Query  139   MEQQHRNQQKSVQERQQDEVEEIQHGPFPIEQLQESGISAIDVKKLKDAGLCTVESVVYS  318
             M  Q + +QK V+E Q  E+E++QHGPFPIEQLQ SGI+A+DVKKLKDAGLCTVESV YS
Sbjct  1     MAAQQQRRQKMVEEEQ--EIEDMQHGPFPIEQLQASGIAALDVKKLKDAGLCTVESVAYS  58

Query  319   PRKDLLQIKGISEAKVDKIIEAASKLVPLGFTSASQLHAQRLEIIQITSGSKELDKVLEG  498
             PRK LLQIKG+SEAKVDKIIEAASKLVPLGFTSASQLHAQ LEIIQITSGS ELDK+LEG
Sbjct  59    PRKGLLQIKGLSEAKVDKIIEAASKLVPLGFTSASQLHAQSLEIIQITSGSSELDKILEG  118

Query  499   GIETGSITEIYGEFRSGKTQLCHTLCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIA  678
             GIETGSITEIYGEFRSGKTQLCHTLCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIA
Sbjct  119   GIETGSITEIYGEFRSGKTQLCHTLCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIA  178

Query  679   DRFGLNGADVLENVAYARAYNTDHQSRLLLEAASMMVETRFALMIVDSATALYRTDFSGR  858
             DRFGLNGADVLENVAYARAYNTDHQSRLLLEAASMMVETRFALMIVDSATALYRTDFSGR
Sbjct  179   DRFGLNGADVLENVAYARAYNTDHQSRLLLEAASMMVETRFALMIVDSATALYRTDFSGR  238

Query  859   GELSARQMHLAKFLRSLQKLADEFGVAVVITNQVVAQVDGSAIFAGPQIKPIGGNIMAHA  1038
             GELSARQMHLAKFLRSLQKLADEFGVAVVITNQVVAQVDGSAIFAGPQIKPIGGNIMAHA
Sbjct  239   GELSARQMHLAKFLRSLQKLADEFGVAVVITNQVVAQVDGSAIFAGPQIKPIGGNIMAHA  298

Query  1039  STTRLALRKGRGEERVCKVVSSPCLAEAEARFQISPEGVTDVKD  1170
             STTRLALRKGRGEER+CKV+SSPCLAEAEARFQIS EGVTDVKD
Sbjct  299   STTRLALRKGRGEERICKVISSPCLAEAEARFQISSEGVTDVKD  342



>ref|XP_006344556.1| PREDICTED: DNA repair protein RAD51 homolog [Solanum tuberosum]
Length=343

 Score =   651 bits (1680),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/343 (92%), Positives = 333/343 (97%), Gaps = 2/343 (1%)
 Frame = +1

Query  142   EQQHRNQQKSVQERQQDEVEEIQHGPFPIEQLQESGISAIDVKKLKDAGLCTVESVVYSP  321
             +QQHRNQ KS+Q+ Q DE+E++QHGP P+EQLQ SGI+A+DVKKLKDAGLCTVESVVY+P
Sbjct  3     QQQHRNQ-KSMQD-QNDEIEDVQHGPSPVEQLQASGIAALDVKKLKDAGLCTVESVVYAP  60

Query  322   RKDLLQIKGISEAKVDKIIEAASKLVPLGFTSASQLHAQRLEIIQITSGSKELDKVLEGG  501
             RK+LL IKGISEAKVDKIIEAASKLVPLGFTSASQLHAQRLEIIQITSGSKELDK+LEGG
Sbjct  61    RKELLHIKGISEAKVDKIIEAASKLVPLGFTSASQLHAQRLEIIQITSGSKELDKILEGG  120

Query  502   IETGSITEIYGEFRSGKTQLCHTLCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIAD  681
             IETGSITEIYGEFR GKTQLCHTLCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIAD
Sbjct  121   IETGSITEIYGEFRCGKTQLCHTLCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIAD  180

Query  682   RFGLNGADVLENVAYARAYNTDHQSRLLLEAASMMVETRFALMIVDSATALYRTDFSGRG  861
             R+GLNG DVLENVAYARAYNTDHQSRLLLEAASMMVETRFALMIVDSATALYRTDFSGRG
Sbjct  181   RYGLNGPDVLENVAYARAYNTDHQSRLLLEAASMMVETRFALMIVDSATALYRTDFSGRG  240

Query  862   ELSARQMHLAKFLRSLQKLADEFGVAVVITNQVVAQVDGSAIFAGPQIKPIGGNIMAHAS  1041
             ELSARQMHLAKFLRSLQKLADEFGVAVVITNQVVAQVDGSA+F+GPQIKPIGGNIMAHAS
Sbjct  241   ELSARQMHLAKFLRSLQKLADEFGVAVVITNQVVAQVDGSAVFSGPQIKPIGGNIMAHAS  300

Query  1042  TTRLALRKGRGEERVCKVVSSPCLAEAEARFQISPEGVTDVKD  1170
             TTRLALRKGR EER+CKVVSSPCLAEAEARFQIS EGVTDVKD
Sbjct  301   TTRLALRKGRAEERICKVVSSPCLAEAEARFQISVEGVTDVKD  343



>ref|XP_011039902.1| PREDICTED: LOW QUALITY PROTEIN: DNA repair protein RAD51 homolog 
[Populus euphratica]
Length=343

 Score =   651 bits (1680),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/344 (91%), Positives = 334/344 (97%), Gaps = 1/344 (0%)
 Frame = +1

Query  139   MEQQHRNQQKSVQERQQDEVEEIQHGPFPIEQLQESGISAIDVKKLKDAGLCTVESVVYS  318
             MEQQ RNQ+   Q++Q +++EE+QHGPFP+EQLQ SGI+++DVKKLKDAGLCTVESV +S
Sbjct  1     MEQQ-RNQKAVNQQQQHEDLEEMQHGPFPVEQLQASGIASLDVKKLKDAGLCTVESVAFS  59

Query  319   PRKDLLQIKGISEAKVDKIIEAASKLVPLGFTSASQLHAQRLEIIQITSGSKELDKVLEG  498
             PRK+LLQIKGISEAKVDKIIEAASKLVPLGFTSASQLHAQR EIIQITSG +ELDK+LEG
Sbjct  60    PRKELLQIKGISEAKVDKIIEAASKLVPLGFTSASQLHAQRQEIIQITSGXRELDKILEG  119

Query  499   GIETGSITEIYGEFRSGKTQLCHTLCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIA  678
             G+ETGSITE+YGEFRSGKTQLCHTLCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRL+QIA
Sbjct  120   GVETGSITEMYGEFRSGKTQLCHTLCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLIQIA  179

Query  679   DRFGLNGADVLENVAYARAYNTDHQSRLLLEAASMMVETRFALMIVDSATALYRTDFSGR  858
             DRFGLNGADVLENVAYARAYNTDHQSRLLLEAASMMVETRFALMIVDSATALYRTDFSGR
Sbjct  180   DRFGLNGADVLENVAYARAYNTDHQSRLLLEAASMMVETRFALMIVDSATALYRTDFSGR  239

Query  859   GELSARQMHLAKFLRSLQKLADEFGVAVVITNQVVAQVDGSAIFAGPQIKPIGGNIMAHA  1038
             GELSARQMHLAKFLRSLQKLADEFGVAVVITNQVVAQVDGSAIFAGPQIKPIGGNIMAHA
Sbjct  240   GELSARQMHLAKFLRSLQKLADEFGVAVVITNQVVAQVDGSAIFAGPQIKPIGGNIMAHA  299

Query  1039  STTRLALRKGRGEERVCKVVSSPCLAEAEARFQISPEGVTDVKD  1170
             STTRLALRKGRGEER+CKV+SSPCLAEAEARFQIS EGVTDVKD
Sbjct  300   STTRLALRKGRGEERICKVISSPCLAEAEARFQISAEGVTDVKD  343



>ref|XP_004144057.1| PREDICTED: DNA repair protein RAD51 homolog [Cucumis sativus]
 ref|XP_008450977.1| PREDICTED: DNA repair protein RAD51 homolog [Cucumis melo]
 gb|KGN66336.1| hypothetical protein Csa_1G597830 [Cucumis sativus]
Length=340

 Score =   651 bits (1679),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/344 (92%), Positives = 333/344 (97%), Gaps = 4/344 (1%)
 Frame = +1

Query  139   MEQQHRNQQKSVQERQQDEVEEIQHGPFPIEQLQESGISAIDVKKLKDAGLCTVESVVYS  318
             ME+Q RNQ+ S    +Q+E +EIQHGPFP+EQLQ SGI+A+DVKKLKDAGLCTVESV YS
Sbjct  1     MERQ-RNQKPS---EEQEEADEIQHGPFPVEQLQASGIAAMDVKKLKDAGLCTVESVAYS  56

Query  319   PRKDLLQIKGISEAKVDKIIEAASKLVPLGFTSASQLHAQRLEIIQITSGSKELDKVLEG  498
             PRK+LLQIKGISEAKVDKIIEAASK+VPLGFTSA QLHAQRLEIIQ+TSGS+ELDK+LEG
Sbjct  57    PRKELLQIKGISEAKVDKIIEAASKIVPLGFTSAGQLHAQRLEIIQLTSGSRELDKILEG  116

Query  499   GIETGSITEIYGEFRSGKTQLCHTLCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIA  678
             GIETGSITEIYGEFRSGKTQLCHTLCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIA
Sbjct  117   GIETGSITEIYGEFRSGKTQLCHTLCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIA  176

Query  679   DRFGLNGADVLENVAYARAYNTDHQSRLLLEAASMMVETRFALMIVDSATALYRTDFSGR  858
             DRFGLNGADVLENVAYARAYNTDHQSRLLLEAASMMVETRFALMIVDSATALYRTDFSGR
Sbjct  177   DRFGLNGADVLENVAYARAYNTDHQSRLLLEAASMMVETRFALMIVDSATALYRTDFSGR  236

Query  859   GELSARQMHLAKFLRSLQKLADEFGVAVVITNQVVAQVDGSAIFAGPQIKPIGGNIMAHA  1038
             GELSARQMHLAKFLRSLQKLADEFGVAVVITNQVVAQVDGSAIFAGPQIKPIGGNIMAHA
Sbjct  237   GELSARQMHLAKFLRSLQKLADEFGVAVVITNQVVAQVDGSAIFAGPQIKPIGGNIMAHA  296

Query  1039  STTRLALRKGRGEERVCKVVSSPCLAEAEARFQISPEGVTDVKD  1170
             STTRLALRKGRGEER+CKV+SSPCLAEAEARFQIS EGVTDVKD
Sbjct  297   STTRLALRKGRGEERICKVISSPCLAEAEARFQISAEGVTDVKD  340



>ref|XP_004287679.1| PREDICTED: DNA repair protein RAD51 homolog 1 [Fragaria vesca 
subsp. vesca]
Length=337

 Score =   650 bits (1677),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/337 (93%), Positives = 330/337 (98%), Gaps = 2/337 (1%)
 Frame = +1

Query  160   QQKSVQERQQDEVEEIQHGPFPIEQLQESGISAIDVKKLKDAGLCTVESVVYSPRKDLLQ  339
             QQK+ Q  QQDE+EE+QHGP P+EQLQ SGI++IDVKKL+DAGLCTVE+V YSPRKDLLQ
Sbjct  3     QQKTAQ--QQDELEEMQHGPVPVEQLQASGIASIDVKKLRDAGLCTVEAVAYSPRKDLLQ  60

Query  340   IKGISEAKVDKIIEAASKLVPLGFTSASQLHAQRLEIIQITSGSKELDKVLEGGIETGSI  519
             IKGISEAKVDKIIEAASKLVPLGFTSASQLHAQRLEIIQITSGS+ELDK+LEGGIETGSI
Sbjct  61    IKGISEAKVDKIIEAASKLVPLGFTSASQLHAQRLEIIQITSGSRELDKILEGGIETGSI  120

Query  520   TEIYGEFRSGKTQLCHTLCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIADRFGLNG  699
             TE+YGEFRSGKTQLCHTLCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIA+RFGLNG
Sbjct  121   TELYGEFRSGKTQLCHTLCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIAERFGLNG  180

Query  700   ADVLENVAYARAYNTDHQSRLLLEAASMMVETRFALMIVDSATALYRTDFSGRGELSARQ  879
             ADVLENVAYARAYNTDHQSRLLLEAASMMVETRFALMIVDSATALYRTDFSGRGELSARQ
Sbjct  181   ADVLENVAYARAYNTDHQSRLLLEAASMMVETRFALMIVDSATALYRTDFSGRGELSARQ  240

Query  880   MHLAKFLRSLQKLADEFGVAVVITNQVVAQVDGSAIFAGPQIKPIGGNIMAHASTTRLAL  1059
             MHLAKFLRSLQKLADEFGVAVVITNQVVAQVDGSA+FAGPQIKPIGGNIMAHASTTRLA+
Sbjct  241   MHLAKFLRSLQKLADEFGVAVVITNQVVAQVDGSALFAGPQIKPIGGNIMAHASTTRLAV  300

Query  1060  RKGRGEERVCKVVSSPCLAEAEARFQISPEGVTDVKD  1170
             RKGRGEER+CKV+SSPCL EAEARFQISPEGVTDVKD
Sbjct  301   RKGRGEERICKVISSPCLPEAEARFQISPEGVTDVKD  337



>ref|XP_009413471.1| PREDICTED: DNA repair protein RAD51 homolog [Musa acuminata subsp. 
malaccensis]
Length=342

 Score =   650 bits (1676),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/328 (96%), Positives = 323/328 (98%), Gaps = 0/328 (0%)
 Frame = +1

Query  187   QDEVEEIQHGPFPIEQLQESGISAIDVKKLKDAGLCTVESVVYSPRKDLLQIKGISEAKV  366
             QDE E+IQHGPFPIE LQ SGI+AIDVKKLKDAGLCTVESVVYSPRKDLLQIKGISEAKV
Sbjct  15    QDEAEDIQHGPFPIEHLQTSGIAAIDVKKLKDAGLCTVESVVYSPRKDLLQIKGISEAKV  74

Query  367   DKIIEAASKLVPLGFTSASQLHAQRLEIIQITSGSKELDKVLEGGIETGSITEIYGEFRS  546
             DKIIEAASKLVPLGFTSASQLHAQRLEIIQITSG++ELDK+LEGGIETGSITEIYGEFR 
Sbjct  75    DKIIEAASKLVPLGFTSASQLHAQRLEIIQITSGARELDKILEGGIETGSITEIYGEFRC  134

Query  547   GKTQLCHTLCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIADRFGLNGADVLENVAY  726
             GKTQLCHTLCVTCQLPLDQGGGEGKA+YIDAEGTFRPQRLLQIA+RFGLNGADVLENVAY
Sbjct  135   GKTQLCHTLCVTCQLPLDQGGGEGKALYIDAEGTFRPQRLLQIAERFGLNGADVLENVAY  194

Query  727   ARAYNTDHQSRLLLEAASMMVETRFALMIVDSATALYRTDFSGRGELSARQMHLAKFLRS  906
             ARAYNTDHQSRLLLEAASMMVE RFALMIVDSATALYRTDFSGRGELSARQMHLAKFLRS
Sbjct  195   ARAYNTDHQSRLLLEAASMMVEARFALMIVDSATALYRTDFSGRGELSARQMHLAKFLRS  254

Query  907   LQKLADEFGVAVVITNQVVAQVDGSAIFAGPQIKPIGGNIMAHASTTRLALRKGRGEERV  1086
             LQKLADEFGVAVVITNQVVAQVDGSAIFAGPQIKPIGGNIMAHASTTRLALRKGRGEER+
Sbjct  255   LQKLADEFGVAVVITNQVVAQVDGSAIFAGPQIKPIGGNIMAHASTTRLALRKGRGEERI  314

Query  1087  CKVVSSPCLAEAEARFQISPEGVTDVKD  1170
             CKV+SSPCLAEAEARFQISPEGVTDVKD
Sbjct  315   CKVISSPCLAEAEARFQISPEGVTDVKD  342



>ref|XP_010261674.1| PREDICTED: DNA repair protein RAD51 homolog isoform X1 [Nelumbo 
nucifera]
 ref|XP_010261675.1| PREDICTED: DNA repair protein RAD51 homolog isoform X1 [Nelumbo 
nucifera]
 ref|XP_010261676.1| PREDICTED: DNA repair protein RAD51 homolog isoform X1 [Nelumbo 
nucifera]
Length=345

 Score =   650 bits (1676),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/344 (93%), Positives = 332/344 (97%), Gaps = 3/344 (1%)
 Frame = +1

Query  139   MEQQHRNQQKSVQERQQDEVEEIQHGPFPIEQLQESGISAIDVKKLKDAGLCTVESVVYS  318
             MEQQ R+Q+ + +  +    EEIQHGPFPIEQLQ SGI++IDVKKLKDAGLCTVESV YS
Sbjct  5     MEQQQRHQKMAEEHEEV---EEIQHGPFPIEQLQASGIASIDVKKLKDAGLCTVESVAYS  61

Query  319   PRKDLLQIKGISEAKVDKIIEAASKLVPLGFTSASQLHAQRLEIIQITSGSKELDKVLEG  498
             PRKDLLQIKGISEAKVDKIIEAASKLVPLGFTSASQLHAQRLEIIQITSGS+ELDK+LEG
Sbjct  62    PRKDLLQIKGISEAKVDKIIEAASKLVPLGFTSASQLHAQRLEIIQITSGSRELDKILEG  121

Query  499   GIETGSITEIYGEFRSGKTQLCHTLCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIA  678
             GIETGSITEIYGEFRSGKTQLCHTLCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIA
Sbjct  122   GIETGSITEIYGEFRSGKTQLCHTLCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIA  181

Query  679   DRFGLNGADVLENVAYARAYNTDHQSRLLLEAASMMVETRFALMIVDSATALYRTDFSGR  858
             DRFGLNGADVLENVAYARAYNTDHQSRLLLEAASMMVETRFA+MIVDSATALYRTDFSGR
Sbjct  182   DRFGLNGADVLENVAYARAYNTDHQSRLLLEAASMMVETRFAIMIVDSATALYRTDFSGR  241

Query  859   GELSARQMHLAKFLRSLQKLADEFGVAVVITNQVVAQVDGSAIFAGPQIKPIGGNIMAHA  1038
             GELSARQMHLAKFLRSLQKLADEFGVAVVITNQVVAQVDGSAIFAGPQIKPIGGNIMAHA
Sbjct  242   GELSARQMHLAKFLRSLQKLADEFGVAVVITNQVVAQVDGSAIFAGPQIKPIGGNIMAHA  301

Query  1039  STTRLALRKGRGEERVCKVVSSPCLAEAEARFQISPEGVTDVKD  1170
             STTRLALRKGRGEER+CKV+SSPCLAEAEARFQIS EGVTDVKD
Sbjct  302   STTRLALRKGRGEERICKVISSPCLAEAEARFQISAEGVTDVKD  345



>ref|XP_008337793.1| PREDICTED: LOW QUALITY PROTEIN: DNA repair protein RAD51 homolog 
[Malus domestica]
Length=340

 Score =   649 bits (1674),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/344 (92%), Positives = 333/344 (97%), Gaps = 4/344 (1%)
 Frame = +1

Query  139   MEQQHRNQQKSVQERQQDEVEEIQHGPFPIEQLQESGISAIDVKKLKDAGLCTVESVVYS  318
             MEQQ  + QK+ Q  QQDE++E+ HGP P++QLQ SGI++IDVKKLKDAGLCTVE+V YS
Sbjct  1     MEQQ--SNQKTAQ--QQDELQEMHHGPVPVDQLQASGIASIDVKKLKDAGLCTVEAVAYS  56

Query  319   PRKDLLQIKGISEAKVDKIIEAASKLVPLGFTSASQLHAQRLEIIQITSGSKELDKVLEG  498
             PRKDLLQIKGIS+AKVDKIIEAASKLVPLGFTSA QLHAQRLEIIQITSGS+ELDK+LEG
Sbjct  57    PRKDLLQIKGISDAKVDKIIEAASKLVPLGFTSAGQLHAQRLEIIQITSGSRELDKILEG  116

Query  499   GIETGSITEIYGEFRSGKTQLCHTLCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIA  678
             GIETGSITEIYGEFRSGKTQLCHTLCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIA
Sbjct  117   GIETGSITEIYGEFRSGKTQLCHTLCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIA  176

Query  679   DRFGLNGADVLENVAYARAYNTDHQSRLLLEAASMMVETRFALMIVDSATALYRTDFSGR  858
             +RFGLNGADVLENVAYARAYNTDHQSRLLLEAASMMVETRFALMIVDSATALYRTDFSGR
Sbjct  177   ERFGLNGADVLENVAYARAYNTDHQSRLLLEAASMMVETRFALMIVDSATALYRTDFSGR  236

Query  859   GELSARQMHLAKFLRSLQKLADEFGVAVVITNQVVAQVDGSAIFAGPQIKPIGGNIMAHA  1038
             GELSARQMHLAKFLRSLQKLADEFGVAVVITNQVVAQVDGSAIFAGPQIKPIGGNIMAHA
Sbjct  237   GELSARQMHLAKFLRSLQKLADEFGVAVVITNQVVAQVDGSAIFAGPQIKPIGGNIMAHA  296

Query  1039  STTRLALRKGRGEERVCKVVSSPCLAEAEARFQISPEGVTDVKD  1170
             STTRLA+RKGRGEER+CKV+SSPCLAEAEARFQISPEGVTDVKD
Sbjct  297   STTRLAVRKGRGEERICKVISSPCLAEAEARFQISPEGVTDVKD  340



>ref|XP_009359678.1| PREDICTED: DNA repair protein RAD51 homolog [Pyrus x bretschneideri]
Length=340

 Score =   647 bits (1670),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/344 (92%), Positives = 332/344 (97%), Gaps = 4/344 (1%)
 Frame = +1

Query  139   MEQQHRNQQKSVQERQQDEVEEIQHGPFPIEQLQESGISAIDVKKLKDAGLCTVESVVYS  318
             MEQQ    Q++ Q  QQDE++E+ HGP P++QLQ SGI++IDVKKLKDAGLCTVE+V YS
Sbjct  1     MEQQ--GNQRTAQ--QQDELQEMHHGPVPVDQLQASGIASIDVKKLKDAGLCTVEAVAYS  56

Query  319   PRKDLLQIKGISEAKVDKIIEAASKLVPLGFTSASQLHAQRLEIIQITSGSKELDKVLEG  498
             PRKDLLQIKGIS+AKVDKIIEAASKLVPLGFTSA QLHAQRLEIIQITSGS+ELDK+LEG
Sbjct  57    PRKDLLQIKGISDAKVDKIIEAASKLVPLGFTSAGQLHAQRLEIIQITSGSRELDKILEG  116

Query  499   GIETGSITEIYGEFRSGKTQLCHTLCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIA  678
             GIETGSITEIYGEFRSGKTQLCHTLCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIA
Sbjct  117   GIETGSITEIYGEFRSGKTQLCHTLCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIA  176

Query  679   DRFGLNGADVLENVAYARAYNTDHQSRLLLEAASMMVETRFALMIVDSATALYRTDFSGR  858
             +RFGLNGADVLENVAYARAYNTDHQSRLLLEAASMMVETRFALMIVDSATALYRTDFSGR
Sbjct  177   ERFGLNGADVLENVAYARAYNTDHQSRLLLEAASMMVETRFALMIVDSATALYRTDFSGR  236

Query  859   GELSARQMHLAKFLRSLQKLADEFGVAVVITNQVVAQVDGSAIFAGPQIKPIGGNIMAHA  1038
             GELSARQMHLAKFLRSLQKLADEFGVAVVITNQVVAQVDGSAIFAGPQIKPIGGNIMAHA
Sbjct  237   GELSARQMHLAKFLRSLQKLADEFGVAVVITNQVVAQVDGSAIFAGPQIKPIGGNIMAHA  296

Query  1039  STTRLALRKGRGEERVCKVVSSPCLAEAEARFQISPEGVTDVKD  1170
             STTRLA+RKGRGEER+CKV+SSPCLAEAEARFQISPEGVTDVKD
Sbjct  297   STTRLAVRKGRGEERICKVISSPCLAEAEARFQISPEGVTDVKD  340



>ref|XP_010687596.1| PREDICTED: DNA repair protein RAD51 homolog [Beta vulgaris subsp. 
vulgaris]
Length=342

 Score =   647 bits (1670),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/344 (91%), Positives = 331/344 (96%), Gaps = 2/344 (1%)
 Frame = +1

Query  139   MEQQHRNQQKSVQERQQDEVEEIQHGPFPIEQLQESGISAIDVKKLKDAGLCTVESVVYS  318
             MEQQ RN +   QE   ++VE++QHGP P+EQLQ +GI+A+DVKKLKDAGLCTVE+V YS
Sbjct  1     MEQQQRNSRVVAQE--SEDVEDMQHGPSPVEQLQAAGIAAMDVKKLKDAGLCTVEAVAYS  58

Query  319   PRKDLLQIKGISEAKVDKIIEAASKLVPLGFTSASQLHAQRLEIIQITSGSKELDKVLEG  498
             PRK+LL IKGISEAKVDKIIEAASKLVPLGFTSA+QLHAQRLEIIQITSGS+ELDK+LEG
Sbjct  59    PRKELLHIKGISEAKVDKIIEAASKLVPLGFTSATQLHAQRLEIIQITSGSRELDKILEG  118

Query  499   GIETGSITEIYGEFRSGKTQLCHTLCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIA  678
             G+ETGSITEIYGEFRSGKTQLCHTLCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIA
Sbjct  119   GVETGSITEIYGEFRSGKTQLCHTLCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIA  178

Query  679   DRFGLNGADVLENVAYARAYNTDHQSRLLLEAASMMVETRFALMIVDSATALYRTDFSGR  858
             +RFGLNGADVLENVAYARAYNTDHQSRLLLEAASMMVETRFALMIVDSATALYRTDFSGR
Sbjct  179   ERFGLNGADVLENVAYARAYNTDHQSRLLLEAASMMVETRFALMIVDSATALYRTDFSGR  238

Query  859   GELSARQMHLAKFLRSLQKLADEFGVAVVITNQVVAQVDGSAIFAGPQIKPIGGNIMAHA  1038
             GELSARQMHLAKFLRSLQKLADEFGVAVVITNQVVAQVDGSA+FAGPQIKPIGGNIMAHA
Sbjct  239   GELSARQMHLAKFLRSLQKLADEFGVAVVITNQVVAQVDGSALFAGPQIKPIGGNIMAHA  298

Query  1039  STTRLALRKGRGEERVCKVVSSPCLAEAEARFQISPEGVTDVKD  1170
             STTRLALRKGR EER+CKV+SSPCLAEAEARFQISPEGVTDVKD
Sbjct  299   STTRLALRKGRAEERICKVISSPCLAEAEARFQISPEGVTDVKD  342



>ref|XP_010047431.1| PREDICTED: DNA repair protein RAD51 homolog [Eucalyptus grandis]
 gb|KCW79342.1| hypothetical protein EUGRSUZ_C00762 [Eucalyptus grandis]
Length=341

 Score =   646 bits (1667),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/344 (92%), Positives = 332/344 (97%), Gaps = 3/344 (1%)
 Frame = +1

Query  139   MEQQHRNQQKSVQERQQDEVEEIQHGPFPIEQLQESGISAIDVKKLKDAGLCTVESVVYS  318
             MEQQ RN +  V E   +++EEIQHGPFP+EQLQ SGI++IDVKKLKDAGLCTVESVVYS
Sbjct  1     MEQQ-RNPK--VAEAAGEQIEEIQHGPFPVEQLQASGIASIDVKKLKDAGLCTVESVVYS  57

Query  319   PRKDLLQIKGISEAKVDKIIEAASKLVPLGFTSASQLHAQRLEIIQITSGSKELDKVLEG  498
             PRK+LLQIKGISEAKVDKIIEAASKLVPLGFTSASQLHAQRLEIIQITSGS+ELDK+LEG
Sbjct  58    PRKELLQIKGISEAKVDKIIEAASKLVPLGFTSASQLHAQRLEIIQITSGSRELDKILEG  117

Query  499   GIETGSITEIYGEFRSGKTQLCHTLCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIA  678
             GIETGSITEIYGEFRSGKTQLCHTLCVTCQLPLDQGGGEGKAMYIDAEG FRPQRLLQIA
Sbjct  118   GIETGSITEIYGEFRSGKTQLCHTLCVTCQLPLDQGGGEGKAMYIDAEGAFRPQRLLQIA  177

Query  679   DRFGLNGADVLENVAYARAYNTDHQSRLLLEAASMMVETRFALMIVDSATALYRTDFSGR  858
             +R+GLNGADVLENVAYARAYNTDHQSRLLLEAASMMVETRFALMIVDSATALYRTDFSGR
Sbjct  178   ERYGLNGADVLENVAYARAYNTDHQSRLLLEAASMMVETRFALMIVDSATALYRTDFSGR  237

Query  859   GELSARQMHLAKFLRSLQKLADEFGVAVVITNQVVAQVDGSAIFAGPQIKPIGGNIMAHA  1038
             GELSARQMHLAKFLRSLQK+ADEFGVAVVITNQVVAQVDGSA+FAGPQIKPIGGNIMAHA
Sbjct  238   GELSARQMHLAKFLRSLQKMADEFGVAVVITNQVVAQVDGSALFAGPQIKPIGGNIMAHA  297

Query  1039  STTRLALRKGRGEERVCKVVSSPCLAEAEARFQISPEGVTDVKD  1170
             STTRLALRKGRGEER+CKV+SSPCL EAEARFQIS EGVTDVKD
Sbjct  298   STTRLALRKGRGEERICKVISSPCLPEAEARFQISTEGVTDVKD  341



>gb|KJB65440.1| hypothetical protein B456_010G095300 [Gossypium raimondii]
Length=343

 Score =   646 bits (1667),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/344 (92%), Positives = 335/344 (97%), Gaps = 1/344 (0%)
 Frame = +1

Query  139   MEQQHRNQQKSVQERQQDEVEEIQHGPFPIEQLQESGISAIDVKKLKDAGLCTVESVVYS  318
             MEQQ RN + + Q++QQ+E++E+QHGPFP+EQLQ SGI+A+DVKKLKDAGLCTVESV Y+
Sbjct  1     MEQQ-RNPKMAQQQQQQEELDEMQHGPFPVEQLQASGIAALDVKKLKDAGLCTVESVAYT  59

Query  319   PRKDLLQIKGISEAKVDKIIEAASKLVPLGFTSASQLHAQRLEIIQITSGSKELDKVLEG  498
             PRKDLLQIKGISEAKVDKI+EAASKLVPLGFTSASQLHAQRLEIIQITSGS ELDK+LEG
Sbjct  60    PRKDLLQIKGISEAKVDKIMEAASKLVPLGFTSASQLHAQRLEIIQITSGSSELDKILEG  119

Query  499   GIETGSITEIYGEFRSGKTQLCHTLCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIA  678
             GIETGSITEIYGEFRSGKTQLCHTLCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIA
Sbjct  120   GIETGSITEIYGEFRSGKTQLCHTLCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIA  179

Query  679   DRFGLNGADVLENVAYARAYNTDHQSRLLLEAASMMVETRFALMIVDSATALYRTDFSGR  858
             +RFGLNGADVLENVAYARAYNTDHQSRLLLEAASMMVETRFALMIVDSATALYRTDF+GR
Sbjct  180   ERFGLNGADVLENVAYARAYNTDHQSRLLLEAASMMVETRFALMIVDSATALYRTDFTGR  239

Query  859   GELSARQMHLAKFLRSLQKLADEFGVAVVITNQVVAQVDGSAIFAGPQIKPIGGNIMAHA  1038
             GELSARQMHLAKFLRSLQKLADEFGVAVVITNQVVAQVDGSAIFAGPQIKPIGGNIMAHA
Sbjct  240   GELSARQMHLAKFLRSLQKLADEFGVAVVITNQVVAQVDGSAIFAGPQIKPIGGNIMAHA  299

Query  1039  STTRLALRKGRGEERVCKVVSSPCLAEAEARFQISPEGVTDVKD  1170
             STTRLA+RKGRGEER+CK++SSPCLAEAEARFQISP GV DVKD
Sbjct  300   STTRLAVRKGRGEERICKIISSPCLAEAEARFQISPGGVADVKD  343



>ref|XP_002273803.1| PREDICTED: DNA repair protein RAD51 homolog [Vitis vinifera]
 emb|CBI27743.3| unnamed protein product [Vitis vinifera]
Length=337

 Score =   646 bits (1666),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/337 (93%), Positives = 327/337 (97%), Gaps = 2/337 (1%)
 Frame = +1

Query  160   QQKSVQERQQDEVEEIQHGPFPIEQLQESGISAIDVKKLKDAGLCTVESVVYSPRKDLLQ  339
             QQK  Q    +EVE++QHGPFP+E LQ SGI+++D+KKLKDAGLCTVESV YSPRKDLLQ
Sbjct  3     QQKMAQA--HEEVEDMQHGPFPVEHLQASGIASLDIKKLKDAGLCTVESVAYSPRKDLLQ  60

Query  340   IKGISEAKVDKIIEAASKLVPLGFTSASQLHAQRLEIIQITSGSKELDKVLEGGIETGSI  519
             IKGISEAKVDKI+EAASKLVPLGFTSASQLHAQRLEIIQITSGS+ELDK+LEGG+ETGSI
Sbjct  61    IKGISEAKVDKIVEAASKLVPLGFTSASQLHAQRLEIIQITSGSRELDKILEGGLETGSI  120

Query  520   TEIYGEFRSGKTQLCHTLCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIADRFGLNG  699
             TEIYGEFRSGKTQLCHTLCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIADRFGLNG
Sbjct  121   TEIYGEFRSGKTQLCHTLCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIADRFGLNG  180

Query  700   ADVLENVAYARAYNTDHQSRLLLEAASMMVETRFALMIVDSATALYRTDFSGRGELSARQ  879
             ADVLENVAYARAYNTDHQSRLLLEAASMMVETRFALMIVDSATALYRTDFSGRGELSARQ
Sbjct  181   ADVLENVAYARAYNTDHQSRLLLEAASMMVETRFALMIVDSATALYRTDFSGRGELSARQ  240

Query  880   MHLAKFLRSLQKLADEFGVAVVITNQVVAQVDGSAIFAGPQIKPIGGNIMAHASTTRLAL  1059
             MHLAKFLRSLQKLADEFGVAVVITNQVVAQVDGSAIFAGPQIKPIGGNIMAHASTTRLAL
Sbjct  241   MHLAKFLRSLQKLADEFGVAVVITNQVVAQVDGSAIFAGPQIKPIGGNIMAHASTTRLAL  300

Query  1060  RKGRGEERVCKVVSSPCLAEAEARFQISPEGVTDVKD  1170
             RKGRGEER+CKV+SSPCLAEA+ARFQIS EGVTDVKD
Sbjct  301   RKGRGEERICKVISSPCLAEADARFQISAEGVTDVKD  337



>ref|XP_012077114.1| PREDICTED: DNA repair protein RAD51 homolog [Jatropha curcas]
 gb|KDP33966.1| hypothetical protein JCGZ_07537 [Jatropha curcas]
Length=343

 Score =   646 bits (1666),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/344 (93%), Positives = 337/344 (98%), Gaps = 1/344 (0%)
 Frame = +1

Query  139   MEQQHRNQQKSVQERQQDEVEEIQHGPFPIEQLQESGISAIDVKKLKDAGLCTVESVVYS  318
             MEQQ R+Q+   Q++Q +E+EE+QHGPFP+EQLQESGI+A+D+KKLKDAGLCTVESV YS
Sbjct  1     MEQQ-RHQKTVHQQQQHEELEEMQHGPFPVEQLQESGIAALDIKKLKDAGLCTVESVAYS  59

Query  319   PRKDLLQIKGISEAKVDKIIEAASKLVPLGFTSASQLHAQRLEIIQITSGSKELDKVLEG  498
             PRK+LLQIKGIS+AKVDKIIEAASKLVPLGFTSASQLHAQRLEIIQITSGS+ELDK+LEG
Sbjct  60    PRKELLQIKGISDAKVDKIIEAASKLVPLGFTSASQLHAQRLEIIQITSGSRELDKILEG  119

Query  499   GIETGSITEIYGEFRSGKTQLCHTLCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIA  678
             GIETGSITEIYGEFRSGKTQLCHTLCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIA
Sbjct  120   GIETGSITEIYGEFRSGKTQLCHTLCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIA  179

Query  679   DRFGLNGADVLENVAYARAYNTDHQSRLLLEAASMMVETRFALMIVDSATALYRTDFSGR  858
             DRFGLNGADVLENVAYARAYNTDHQSRLLLEAASMMVETRFALMIVDSATALYRTDFSGR
Sbjct  180   DRFGLNGADVLENVAYARAYNTDHQSRLLLEAASMMVETRFALMIVDSATALYRTDFSGR  239

Query  859   GELSARQMHLAKFLRSLQKLADEFGVAVVITNQVVAQVDGSAIFAGPQIKPIGGNIMAHA  1038
             GELSARQMHLAKFLRSLQKLADEFGVAVVITNQVVAQVDGSAIFAGPQIKPIGGNIMAHA
Sbjct  240   GELSARQMHLAKFLRSLQKLADEFGVAVVITNQVVAQVDGSAIFAGPQIKPIGGNIMAHA  299

Query  1039  STTRLALRKGRGEERVCKVVSSPCLAEAEARFQISPEGVTDVKD  1170
             STTRLALRKGRGEER+CKV+SSPCLAEAEARFQIS EGVTDVKD
Sbjct  300   STTRLALRKGRGEERICKVISSPCLAEAEARFQISAEGVTDVKD  343



>ref|XP_011628494.1| PREDICTED: LOW QUALITY PROTEIN: DNA repair protein RAD51 homolog 
[Amborella trichopoda]
Length=379

 Score =   641 bits (1654),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/379 (84%), Positives = 333/379 (88%), Gaps = 34/379 (9%)
 Frame = +1

Query  133   ATMEQQHRNQQKSVQERQQDEVEEIQHGPFPIEQLQESGISAIDVKKLKDAGLCTVESVV  312
             A MEQ H+ QQK   E+Q DE E++QHGPFPIEQLQ SGI+++DVKKLKDAGLCTVESV 
Sbjct  2     AAMEQMHQKQQK-FAEQQADETEDMQHGPFPIEQLQASGIASLDVKKLKDAGLCTVESVA  60

Query  313   YSPRKDLLQIKGISEAKVDKIIEA---------------------------------ASK  393
             YSPRKDLLQIKGIS+AKVDKIIEA                                 ASK
Sbjct  61    YSPRKDLLQIKGISDAKVDKIIEAGMFLLLVYLXFTTLFLXFVTVIYFFFCLKLILIASK  120

Query  394   LVPLGFTSASQLHAQRLEIIQITSGSKELDKVLEGGIETGSITEIYGEFRSGKTQLCHTL  573
             LVPLGFTSASQLHAQRLEIIQITSGS+ELDK+LEGGIETGSITEIYGEFRSGKTQLCHTL
Sbjct  121   LVPLGFTSASQLHAQRLEIIQITSGSRELDKILEGGIETGSITEIYGEFRSGKTQLCHTL  180

Query  574   CVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIADRFGLNGADVLENVAYARAYNTDHQ  753
             CVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIA+RFGLNGADVLENVAYARAYNTDHQ
Sbjct  181   CVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIAERFGLNGADVLENVAYARAYNTDHQ  240

Query  754   SRLLLEAASMMVETRFALMIVDSATALYRTDFSGRGELSARQMHLAKFLRSLQKLADEFG  933
             SRLLLEAASMMVE RFALMIVDSATALYRTDFSGRGELSARQMHLAKFLRSLQKLADEFG
Sbjct  241   SRLLLEAASMMVEARFALMIVDSATALYRTDFSGRGELSARQMHLAKFLRSLQKLADEFG  300

Query  934   VAVVITNQVVAQVDGSAIFAGPQIKPIGGNIMAHASTTRLALRKGRGEERVCKVVSSPCL  1113
             VAVV+TNQVVAQVDGSA+FAGPQIKPIGGNIMAHASTTRLA RKGRGEER+CKV+SSPCL
Sbjct  301   VAVVLTNQVVAQVDGSAMFAGPQIKPIGGNIMAHASTTRLAFRKGRGEERICKVISSPCL  360

Query  1114  AEAEARFQISPEGVTDVKD  1170
             AEAEARFQISPEGV DVKD
Sbjct  361   AEAEARFQISPEGVVDVKD  379



>ref|XP_006474560.1| PREDICTED: DNA repair protein RAD51 homolog [Citrus sinensis]
 gb|KDO73743.1| hypothetical protein CISIN_1g019381mg [Citrus sinensis]
Length=342

 Score =   639 bits (1649),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/344 (93%), Positives = 338/344 (98%), Gaps = 2/344 (1%)
 Frame = +1

Query  139   MEQQHRNQQKSVQERQQDEVEEIQHGPFPIEQLQESGISAIDVKKLKDAGLCTVESVVYS  318
             MEQQ RNQ K+VQ++QQ+E+EEIQHGPFP+EQLQ SGI+A+DVKKLKDAGLCTVESV YS
Sbjct  1     MEQQ-RNQ-KTVQQQQQEELEEIQHGPFPVEQLQASGIAALDVKKLKDAGLCTVESVAYS  58

Query  319   PRKDLLQIKGISEAKVDKIIEAASKLVPLGFTSASQLHAQRLEIIQITSGSKELDKVLEG  498
             PRK+LLQIKGISEAKVDKIIEAASKLVPLGFTSA+QLHAQRLEIIQITSGS+ELDK+LEG
Sbjct  59    PRKELLQIKGISEAKVDKIIEAASKLVPLGFTSATQLHAQRLEIIQITSGSRELDKILEG  118

Query  499   GIETGSITEIYGEFRSGKTQLCHTLCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIA  678
             G+ETGSITEIYGEFRSGKTQLCHTLCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIA
Sbjct  119   GVETGSITEIYGEFRSGKTQLCHTLCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIA  178

Query  679   DRFGLNGADVLENVAYARAYNTDHQSRLLLEAASMMVETRFALMIVDSATALYRTDFSGR  858
             DR+GLNGADVLENVAYARAYNTDHQSRLLLEAASMMVETRFALMIVDSATALYRTDFSGR
Sbjct  179   DRYGLNGADVLENVAYARAYNTDHQSRLLLEAASMMVETRFALMIVDSATALYRTDFSGR  238

Query  859   GELSARQMHLAKFLRSLQKLADEFGVAVVITNQVVAQVDGSAIFAGPQIKPIGGNIMAHA  1038
             GELSARQMHLAKFLRSLQKLADEFGVAVVITNQVVAQVDGSAIFAGPQIKPIGGNIMAHA
Sbjct  239   GELSARQMHLAKFLRSLQKLADEFGVAVVITNQVVAQVDGSAIFAGPQIKPIGGNIMAHA  298

Query  1039  STTRLALRKGRGEERVCKVVSSPCLAEAEARFQISPEGVTDVKD  1170
             STTRLALRKGRGEER+CKV+SSPCLAEAEARFQIS +GV DVKD
Sbjct  299   STTRLALRKGRGEERICKVISSPCLAEAEARFQISAQGVADVKD  342



>ref|XP_007154535.1| hypothetical protein PHAVU_003G126800g [Phaseolus vulgaris]
 gb|ESW26529.1| hypothetical protein PHAVU_003G126800g [Phaseolus vulgaris]
Length=344

 Score =   639 bits (1649),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/348 (89%), Positives = 330/348 (95%), Gaps = 4/348 (1%)
 Frame = +1

Query  127   FGATMEQQHRNQQKSVQERQQDEVEEIQHGPFPIEQLQESGISAIDVKKLKDAGLCTVES  306
               AT EQQ    Q++ Q  QQDE EEIQHGP P+EQLQ SGI+A DVKKLKDAG+CTVES
Sbjct  1     MSATAEQQRL--QRTPQ--QQDEAEEIQHGPLPVEQLQASGIAATDVKKLKDAGICTVES  56

Query  307   VVYSPRKDLLQIKGISEAKVDKIIEAASKLVPLGFTSASQLHAQRLEIIQITSGSKELDK  486
             V Y+PRKDLLQIKGISEAKVDKIIEAASKLVP+GFTSAS+LHAQR  IIQIT+GS+ELDK
Sbjct  57    VAYTPRKDLLQIKGISEAKVDKIIEAASKLVPMGFTSASELHAQRDAIIQITTGSRELDK  116

Query  487   VLEGGIETGSITEIYGEFRSGKTQLCHTLCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRL  666
             +LEGGIETGSITE+YGEFRSGKTQLCHTLCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRL
Sbjct  117   ILEGGIETGSITELYGEFRSGKTQLCHTLCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRL  176

Query  667   LQIADRFGLNGADVLENVAYARAYNTDHQSRLLLEAASMMVETRFALMIVDSATALYRTD  846
             LQIADRFGLNGADVLENVAYARAYNTDHQSRLLLEAASMMVETRFA+MIVDSATALYRTD
Sbjct  177   LQIADRFGLNGADVLENVAYARAYNTDHQSRLLLEAASMMVETRFAVMIVDSATALYRTD  236

Query  847   FSGRGELSARQMHLAKFLRSLQKLADEFGVAVVITNQVVAQVDGSAIFAGPQIKPIGGNI  1026
             FSGRGELSARQMHLAKFLRSLQKLADEFGVA+VITNQVV+QVDGSA+FAGPQ+KPIGGNI
Sbjct  237   FSGRGELSARQMHLAKFLRSLQKLADEFGVAIVITNQVVSQVDGSAVFAGPQVKPIGGNI  296

Query  1027  MAHASTTRLALRKGRGEERVCKVVSSPCLAEAEARFQISPEGVTDVKD  1170
             MAHA+TTRLALRKGRGEER+CKV+SSPCLAEAEARFQI PEGV+DVKD
Sbjct  297   MAHATTTRLALRKGRGEERICKVISSPCLAEAEARFQICPEGVSDVKD  344



>ref|XP_011078154.1| PREDICTED: DNA repair protein RAD51 homolog [Sesamum indicum]
Length=341

 Score =   637 bits (1643),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/320 (96%), Positives = 317/320 (99%), Gaps = 0/320 (0%)
 Frame = +1

Query  211   HGPFPIEQLQESGISAIDVKKLKDAGLCTVESVVYSPRKDLLQIKGISEAKVDKIIEAAS  390
             HGPFP+EQLQ SGISA+D+KKLKDAGLCTVESV YSPRK+LLQIKGIS+AKVDKIIEAAS
Sbjct  22    HGPFPVEQLQASGISALDIKKLKDAGLCTVESVAYSPRKELLQIKGISDAKVDKIIEAAS  81

Query  391   KLVPLGFTSASQLHAQRLEIIQITSGSKELDKVLEGGIETGSITEIYGEFRSGKTQLCHT  570
             KLVPLGFTSASQLHAQRLEIIQITSGSKELDK+LEGGIETGSITE+YGEFRSGKTQLCHT
Sbjct  82    KLVPLGFTSASQLHAQRLEIIQITSGSKELDKILEGGIETGSITELYGEFRSGKTQLCHT  141

Query  571   LCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIADRFGLNGADVLENVAYARAYNTDH  750
             LCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIADRFGLNGADVLENVAYARAYNTDH
Sbjct  142   LCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIADRFGLNGADVLENVAYARAYNTDH  201

Query  751   QSRLLLEAASMMVETRFALMIVDSATALYRTDFSGRGELSARQMHLAKFLRSLQKLADEF  930
             QSRLLLEAASMMVETRFALMIVDSATALYRTDFSGRGELSARQMHLAKFLRSLQKLADEF
Sbjct  202   QSRLLLEAASMMVETRFALMIVDSATALYRTDFSGRGELSARQMHLAKFLRSLQKLADEF  261

Query  931   GVAVVITNQVVAQVDGSAIFAGPQIKPIGGNIMAHASTTRLALRKGRGEERVCKVVSSPC  1110
             GVAVVITNQVVAQVDGSAIFAGPQIKPIGGNIMAHA+TTRLALRKGRGEER+CKV+SSPC
Sbjct  262   GVAVVITNQVVAQVDGSAIFAGPQIKPIGGNIMAHATTTRLALRKGRGEERICKVISSPC  321

Query  1111  LAEAEARFQISPEGVTDVKD  1170
             LAEAEARFQIS +GVTDVKD
Sbjct  322   LAEAEARFQISVDGVTDVKD  341



>ref|XP_004508049.1| PREDICTED: DNA repair protein RAD51 homolog 1-like [Cicer arietinum]
Length=340

 Score =   637 bits (1642),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/344 (90%), Positives = 328/344 (95%), Gaps = 4/344 (1%)
 Frame = +1

Query  139   MEQQHRNQQKSVQERQQDEVEEIQHGPFPIEQLQESGISAIDVKKLKDAGLCTVESVVYS  318
             MEQQ    +K+ Q  QQDE EEIQHGP PIEQLQ SGI+AIDVKKLKDAG+CTVESV Y+
Sbjct  1     MEQQRL--EKTAQ--QQDETEEIQHGPLPIEQLQASGIAAIDVKKLKDAGICTVESVAYT  56

Query  319   PRKDLLQIKGISEAKVDKIIEAASKLVPLGFTSASQLHAQRLEIIQITSGSKELDKVLEG  498
             PRKDLLQIKGISEAKVDKIIEAASKLVP+GFTSAS+LHAQR  IIQIT+GS+ELDK+LEG
Sbjct  57    PRKDLLQIKGISEAKVDKIIEAASKLVPMGFTSASELHAQRESIIQITTGSRELDKILEG  116

Query  499   GIETGSITEIYGEFRSGKTQLCHTLCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIA  678
             GIETGSITE+YGEFRSGKTQLCHTLCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIA
Sbjct  117   GIETGSITELYGEFRSGKTQLCHTLCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIA  176

Query  679   DRFGLNGADVLENVAYARAYNTDHQSRLLLEAASMMVETRFALMIVDSATALYRTDFSGR  858
             DRFGLNGADVLENVAYARAYNTDHQSRLLLEAASMMVETRFALMI+DSATALYRTDFSGR
Sbjct  177   DRFGLNGADVLENVAYARAYNTDHQSRLLLEAASMMVETRFALMIIDSATALYRTDFSGR  236

Query  859   GELSARQMHLAKFLRSLQKLADEFGVAVVITNQVVAQVDGSAIFAGPQIKPIGGNIMAHA  1038
             GELSARQMHLAKFLRSLQKLADEFGVAVV+TNQVV+QVDGSA+FAGPQ KPIGGNIMAHA
Sbjct  237   GELSARQMHLAKFLRSLQKLADEFGVAVVLTNQVVSQVDGSAMFAGPQTKPIGGNIMAHA  296

Query  1039  STTRLALRKGRGEERVCKVVSSPCLAEAEARFQISPEGVTDVKD  1170
             +TTRLALRKGRGEER+CKV+SSPCLAEAEARFQI  EGV+DVKD
Sbjct  297   TTTRLALRKGRGEERICKVISSPCLAEAEARFQILGEGVSDVKD  340



>ref|XP_003542386.1| PREDICTED: DNA repair protein RAD51 homolog 1-like [Glycine max]
Length=344

 Score =   635 bits (1637),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/348 (89%), Positives = 328/348 (94%), Gaps = 4/348 (1%)
 Frame = +1

Query  127   FGATMEQQHRNQQKSVQERQQDEVEEIQHGPFPIEQLQESGISAIDVKKLKDAGLCTVES  306
               ATMEQQ    QK+ Q  QQDE EEIQ GP P+EQLQ SGI+A DVKKLKDAG+CTVES
Sbjct  1     MSATMEQQR--HQKAPQ--QQDEAEEIQPGPLPVEQLQASGIAATDVKKLKDAGICTVES  56

Query  307   VVYSPRKDLLQIKGISEAKVDKIIEAASKLVPLGFTSASQLHAQRLEIIQITSGSKELDK  486
             V Y+PRKDLLQIKGISEAKVDKIIEAASKLVP+GFTSAS+LHAQR  IIQIT+GS+ELDK
Sbjct  57    VAYTPRKDLLQIKGISEAKVDKIIEAASKLVPMGFTSASELHAQRDAIIQITTGSRELDK  116

Query  487   VLEGGIETGSITEIYGEFRSGKTQLCHTLCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRL  666
             +LEGG+ETGSITE+YGEFRSGKTQLCHTLCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRL
Sbjct  117   ILEGGVETGSITELYGEFRSGKTQLCHTLCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRL  176

Query  667   LQIADRFGLNGADVLENVAYARAYNTDHQSRLLLEAASMMVETRFALMIVDSATALYRTD  846
             LQIADRFGLNG DVLENVAYARAYNTDHQSRLLLEAASMMVETRFA+MIVDSATALYRTD
Sbjct  177   LQIADRFGLNGVDVLENVAYARAYNTDHQSRLLLEAASMMVETRFAVMIVDSATALYRTD  236

Query  847   FSGRGELSARQMHLAKFLRSLQKLADEFGVAVVITNQVVAQVDGSAIFAGPQIKPIGGNI  1026
             FSGRGELSARQMHLAKFLRSLQKLADEFGVA+VITNQVV+QVDGSA+FAGPQIKPIGGNI
Sbjct  237   FSGRGELSARQMHLAKFLRSLQKLADEFGVAIVITNQVVSQVDGSAVFAGPQIKPIGGNI  296

Query  1027  MAHASTTRLALRKGRGEERVCKVVSSPCLAEAEARFQISPEGVTDVKD  1170
             MAHA+TTRLALRKGRGEER+CKV+SSPCLAEAEARFQI  EGV+DVKD
Sbjct  297   MAHATTTRLALRKGRGEERICKVISSPCLAEAEARFQICAEGVSDVKD  344



>ref|XP_006288113.1| hypothetical protein CARUB_v10001345mg [Capsella rubella]
 gb|EOA21011.1| hypothetical protein CARUB_v10001345mg [Capsella rubella]
Length=342

 Score =   634 bits (1636),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/345 (89%), Positives = 328/345 (95%), Gaps = 5/345 (1%)
 Frame = +1

Query  136   TMEQQHRNQQKSVQERQQDEVEEIQHGPFPIEQLQESGISAIDVKKLKDAGLCTVESVVY  315
             TMEQ  R  Q +VQ  QQD+ EEIQHGPFP+EQLQ +GI+++DVKKL+DAGLCTVE V Y
Sbjct  3     TMEQ--RRNQNAVQ--QQDD-EEIQHGPFPVEQLQAAGIASVDVKKLRDAGLCTVEGVAY  57

Query  316   SPRKDLLQIKGISEAKVDKIIEAASKLVPLGFTSASQLHAQRLEIIQITSGSKELDKVLE  495
             +PRKDLLQIKGIS+AKVDKI+EAASKLVPLGFTSASQLHAQR EIIQITSGS+ELDK+LE
Sbjct  58    TPRKDLLQIKGISDAKVDKIVEAASKLVPLGFTSASQLHAQRQEIIQITSGSRELDKILE  117

Query  496   GGIETGSITEIYGEFRSGKTQLCHTLCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQI  675
             GGIETGSITE+YGEFRSGKTQLCHTLCVTCQLP+DQGGGEGKAMYIDAEGTFRPQRLLQI
Sbjct  118   GGIETGSITELYGEFRSGKTQLCHTLCVTCQLPMDQGGGEGKAMYIDAEGTFRPQRLLQI  177

Query  676   ADRFGLNGADVLENVAYARAYNTDHQSRLLLEAASMMVETRFALMIVDSATALYRTDFSG  855
             ADRFGLNGADVLENVAYARAYNTDHQSRLLLEAASMM+ETRFALMIVDSATALYRTDFSG
Sbjct  178   ADRFGLNGADVLENVAYARAYNTDHQSRLLLEAASMMIETRFALMIVDSATALYRTDFSG  237

Query  856   RGELSARQMHLAKFLRSLQKLADEFGVAVVITNQVVAQVDGSAIFAGPQIKPIGGNIMAH  1035
             RGELSARQMHLAKFLRSLQKLADEFGVAVVITNQVVAQVDGSA+FAGPQ KPIGGNIMAH
Sbjct  238   RGELSARQMHLAKFLRSLQKLADEFGVAVVITNQVVAQVDGSALFAGPQFKPIGGNIMAH  297

Query  1036  ASTTRLALRKGRGEERVCKVVSSPCLAEAEARFQISPEGVTDVKD  1170
             A+TTRLALRKGR EER+CKV+SSPCL EAEARFQIS EGVTD KD
Sbjct  298   ATTTRLALRKGRAEERICKVISSPCLPEAEARFQISTEGVTDCKD  342



>ref|XP_009120764.1| PREDICTED: DNA repair protein RAD51 homolog 1-like [Brassica 
rapa]
Length=342

 Score =   634 bits (1636),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/345 (90%), Positives = 328/345 (95%), Gaps = 5/345 (1%)
 Frame = +1

Query  136   TMEQQHRNQQKSVQERQQDEVEEIQHGPFPIEQLQESGISAIDVKKLKDAGLCTVESVVY  315
             TMEQ  R  Q +VQ  QQD+ EEIQHGPFP+EQLQ +GI+++DVKKL+DAGLCTVE V Y
Sbjct  3     TMEQ--RRTQNAVQ--QQDD-EEIQHGPFPVEQLQAAGIASVDVKKLRDAGLCTVEGVAY  57

Query  316   SPRKDLLQIKGISEAKVDKIIEAASKLVPLGFTSASQLHAQRLEIIQITSGSKELDKVLE  495
             +PRKDLLQIKGIS+AKVDKI+EAASKLVPLGFTSASQLHAQR EIIQITSGS+ELDKVLE
Sbjct  58    TPRKDLLQIKGISDAKVDKIVEAASKLVPLGFTSASQLHAQRQEIIQITSGSRELDKVLE  117

Query  496   GGIETGSITEIYGEFRSGKTQLCHTLCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQI  675
             GGIETGSITE+YGEFRSGKTQLCHTLCVTCQLP+DQGGGEGKAMYIDAEGTFRPQRLLQI
Sbjct  118   GGIETGSITELYGEFRSGKTQLCHTLCVTCQLPMDQGGGEGKAMYIDAEGTFRPQRLLQI  177

Query  676   ADRFGLNGADVLENVAYARAYNTDHQSRLLLEAASMMVETRFALMIVDSATALYRTDFSG  855
             ADRFGLNGADVLENVAYARAYNTDHQSRLLLEAASMMVETRFALMIVDSATALYRTDFSG
Sbjct  178   ADRFGLNGADVLENVAYARAYNTDHQSRLLLEAASMMVETRFALMIVDSATALYRTDFSG  237

Query  856   RGELSARQMHLAKFLRSLQKLADEFGVAVVITNQVVAQVDGSAIFAGPQIKPIGGNIMAH  1035
             R ELSARQMHLAKFLRSLQKLADEFGVAVVITNQVVAQVDGSA+FAGPQ KPIGGNIMAH
Sbjct  238   RAELSARQMHLAKFLRSLQKLADEFGVAVVITNQVVAQVDGSALFAGPQFKPIGGNIMAH  297

Query  1036  ASTTRLALRKGRGEERVCKVVSSPCLAEAEARFQISPEGVTDVKD  1170
             A+TTRLA+RKGRGEER+CKV+SSPCL EAEARFQIS EGVTD KD
Sbjct  298   ATTTRLAMRKGRGEERICKVISSPCLPEAEARFQISTEGVTDCKD  342



>ref|XP_010420930.1| PREDICTED: DNA repair protein RAD51 homolog 1 [Camelina sativa]
 ref|XP_010454394.1| PREDICTED: DNA repair protein RAD51 homolog 1 [Camelina sativa]
Length=342

 Score =   634 bits (1635),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/345 (90%), Positives = 327/345 (95%), Gaps = 5/345 (1%)
 Frame = +1

Query  136   TMEQQHRNQQKSVQERQQDEVEEIQHGPFPIEQLQESGISAIDVKKLKDAGLCTVESVVY  315
             TMEQ  R  Q  VQ  QQD+ EEIQHGPFP+EQLQ +GI+++DVKKL+DAGLCTVE V Y
Sbjct  3     TMEQ--RRNQNVVQ--QQDD-EEIQHGPFPVEQLQAAGIASVDVKKLRDAGLCTVEGVAY  57

Query  316   SPRKDLLQIKGISEAKVDKIIEAASKLVPLGFTSASQLHAQRLEIIQITSGSKELDKVLE  495
             +PRKDLLQIKGIS+AKVDKI+EAASKLVPLGFTSASQLHAQR EIIQITSGS+ELDKVLE
Sbjct  58    TPRKDLLQIKGISDAKVDKIVEAASKLVPLGFTSASQLHAQRQEIIQITSGSRELDKVLE  117

Query  496   GGIETGSITEIYGEFRSGKTQLCHTLCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQI  675
             GGIETGSITE+YGEFRSGKTQLCHTLCVTCQLP+DQGGGEGKAMYIDAEGTFRPQRLLQI
Sbjct  118   GGIETGSITELYGEFRSGKTQLCHTLCVTCQLPMDQGGGEGKAMYIDAEGTFRPQRLLQI  177

Query  676   ADRFGLNGADVLENVAYARAYNTDHQSRLLLEAASMMVETRFALMIVDSATALYRTDFSG  855
             ADRFGLNGADVLENVAYARAYNTDHQSRLLLEAASMM+ETRFALMIVDSATALYRTDFSG
Sbjct  178   ADRFGLNGADVLENVAYARAYNTDHQSRLLLEAASMMIETRFALMIVDSATALYRTDFSG  237

Query  856   RGELSARQMHLAKFLRSLQKLADEFGVAVVITNQVVAQVDGSAIFAGPQIKPIGGNIMAH  1035
             RGELSARQMHLAKFLRSLQKLADEFGVAVVITNQVVAQVDGSA+FAGPQ KPIGGNIMAH
Sbjct  238   RGELSARQMHLAKFLRSLQKLADEFGVAVVITNQVVAQVDGSALFAGPQFKPIGGNIMAH  297

Query  1036  ASTTRLALRKGRGEERVCKVVSSPCLAEAEARFQISPEGVTDVKD  1170
             A+TTRLALRKGR EER+CKV+SSPCL EAEARFQIS EGVTD KD
Sbjct  298   ATTTRLALRKGRAEERICKVISSPCLPEAEARFQISTEGVTDCKD  342



>ref|XP_009131820.1| PREDICTED: DNA repair protein RAD51 homolog 1 [Brassica rapa]
Length=342

 Score =   634 bits (1634),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/345 (90%), Positives = 327/345 (95%), Gaps = 5/345 (1%)
 Frame = +1

Query  136   TMEQQHRNQQKSVQERQQDEVEEIQHGPFPIEQLQESGISAIDVKKLKDAGLCTVESVVY  315
             TMEQ  R  Q +VQ  QQD+ EE QHGPFP+EQLQ +GI+++DVKKL+DAGLCTVE V Y
Sbjct  3     TMEQ--RRNQNTVQ--QQDD-EETQHGPFPVEQLQAAGIASVDVKKLRDAGLCTVEGVAY  57

Query  316   SPRKDLLQIKGISEAKVDKIIEAASKLVPLGFTSASQLHAQRLEIIQITSGSKELDKVLE  495
             +PRKDLLQIKGIS+AKVDKI+EAASKLVPLGFTSASQLHAQR EIIQITSGS+ELDKVLE
Sbjct  58    TPRKDLLQIKGISDAKVDKIVEAASKLVPLGFTSASQLHAQRQEIIQITSGSRELDKVLE  117

Query  496   GGIETGSITEIYGEFRSGKTQLCHTLCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQI  675
             GGIETGSITE+YGEFRSGKTQLCHTLCVTCQLP+DQGGGEGKAMYIDAEGTFRPQRLLQI
Sbjct  118   GGIETGSITELYGEFRSGKTQLCHTLCVTCQLPMDQGGGEGKAMYIDAEGTFRPQRLLQI  177

Query  676   ADRFGLNGADVLENVAYARAYNTDHQSRLLLEAASMMVETRFALMIVDSATALYRTDFSG  855
             ADRFGLNGADVLENVAYARAYNTDHQSRLLLEAASMMVETRFALMIVDSATALYRTDFSG
Sbjct  178   ADRFGLNGADVLENVAYARAYNTDHQSRLLLEAASMMVETRFALMIVDSATALYRTDFSG  237

Query  856   RGELSARQMHLAKFLRSLQKLADEFGVAVVITNQVVAQVDGSAIFAGPQIKPIGGNIMAH  1035
             RGELSARQMHLAKFLRSLQKLADEFGVAVVITNQVVAQVDGSA+FAGPQ KPIGGNIMAH
Sbjct  238   RGELSARQMHLAKFLRSLQKLADEFGVAVVITNQVVAQVDGSALFAGPQFKPIGGNIMAH  297

Query  1036  ASTTRLALRKGRGEERVCKVVSSPCLAEAEARFQISPEGVTDVKD  1170
             A+TTRLALRKGR EER+CKV+SSPCL EAEARFQIS EGVTD KD
Sbjct  298   ATTTRLALRKGRAEERICKVISSPCLPEAEARFQISTEGVTDCKD  342



>ref|XP_010541679.1| PREDICTED: DNA repair protein RAD51 homolog 1 [Tarenaya hassleriana]
Length=339

 Score =   633 bits (1633),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/337 (91%), Positives = 323/337 (96%), Gaps = 0/337 (0%)
 Frame = +1

Query  160   QQKSVQERQQDEVEEIQHGPFPIEQLQESGISAIDVKKLKDAGLCTVESVVYSPRKDLLQ  339
             QQ++ +  QQ E EEI HGP P+EQLQ SGI++IDVKKLKDAGLCTVE+V Y+PRKDLLQ
Sbjct  3     QQRNPKAVQQQEEEEIHHGPLPVEQLQASGIASIDVKKLKDAGLCTVEAVAYTPRKDLLQ  62

Query  340   IKGISEAKVDKIIEAASKLVPLGFTSASQLHAQRLEIIQITSGSKELDKVLEGGIETGSI  519
             IKGIS+AKVDKIIEAASKLVP+GFTSASQLHAQRLEI+QI++GS+ELDK+LEGGIETGSI
Sbjct  63    IKGISDAKVDKIIEAASKLVPVGFTSASQLHAQRLEIVQISTGSRELDKILEGGIETGSI  122

Query  520   TEIYGEFRSGKTQLCHTLCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIADRFGLNG  699
             TEIYGEFR GKTQLCHTLCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIADRFGLNG
Sbjct  123   TEIYGEFRCGKTQLCHTLCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIADRFGLNG  182

Query  700   ADVLENVAYARAYNTDHQSRLLLEAASMMVETRFALMIVDSATALYRTDFSGRGELSARQ  879
              DVLENVAYARAYNTDHQSRLLLEAASMMVETRFALMIVDSATALYRTDFSGRGELSARQ
Sbjct  183   PDVLENVAYARAYNTDHQSRLLLEAASMMVETRFALMIVDSATALYRTDFSGRGELSARQ  242

Query  880   MHLAKFLRSLQKLADEFGVAVVITNQVVAQVDGSAIFAGPQIKPIGGNIMAHASTTRLAL  1059
             MHLAKFLRSLQKLADEFGVAVVITNQVVAQVDGSA+FAGPQIKPIGGNIMAHASTTRLAL
Sbjct  243   MHLAKFLRSLQKLADEFGVAVVITNQVVAQVDGSALFAGPQIKPIGGNIMAHASTTRLAL  302

Query  1060  RKGRGEERVCKVVSSPCLAEAEARFQISPEGVTDVKD  1170
             RKGR EER+CKV+SSPCLAEAEARFQIS EGVTD KD
Sbjct  303   RKGRAEERICKVISSPCLAEAEARFQISGEGVTDCKD  339



>ref|XP_006400650.1| hypothetical protein EUTSA_v10014015mg [Eutrema salsugineum]
 gb|ESQ42103.1| hypothetical protein EUTSA_v10014015mg [Eutrema salsugineum]
Length=342

 Score =   633 bits (1633),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/345 (89%), Positives = 327/345 (95%), Gaps = 5/345 (1%)
 Frame = +1

Query  136   TMEQQHRNQQKSVQERQQDEVEEIQHGPFPIEQLQESGISAIDVKKLKDAGLCTVESVVY  315
             TMEQ  R  Q +VQ   Q +VEEIQHGPFP+EQLQ +GI+++DVKKL+DAGLC+VE V Y
Sbjct  3     TMEQ--RRNQNAVQ---QQDVEEIQHGPFPVEQLQAAGIASVDVKKLRDAGLCSVEGVAY  57

Query  316   SPRKDLLQIKGISEAKVDKIIEAASKLVPLGFTSASQLHAQRLEIIQITSGSKELDKVLE  495
             +PRKDLLQIKGIS+AKVDKI+EAASKLVPLGFTSASQLHAQR EIIQITSGS+ELDKVLE
Sbjct  58    TPRKDLLQIKGISDAKVDKIVEAASKLVPLGFTSASQLHAQRQEIIQITSGSRELDKVLE  117

Query  496   GGIETGSITEIYGEFRSGKTQLCHTLCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQI  675
             GGIETGSITE+YGEFRSGKTQLCHTLCVTCQLP+DQGGGEGKAMYIDAEGTFRPQRLLQI
Sbjct  118   GGIETGSITELYGEFRSGKTQLCHTLCVTCQLPMDQGGGEGKAMYIDAEGTFRPQRLLQI  177

Query  676   ADRFGLNGADVLENVAYARAYNTDHQSRLLLEAASMMVETRFALMIVDSATALYRTDFSG  855
             ADRFGLNGADVLENVAYARAYNTDHQSRLLLEAASMMVETRFAL+IVDSATALYRTDFSG
Sbjct  178   ADRFGLNGADVLENVAYARAYNTDHQSRLLLEAASMMVETRFALVIVDSATALYRTDFSG  237

Query  856   RGELSARQMHLAKFLRSLQKLADEFGVAVVITNQVVAQVDGSAIFAGPQIKPIGGNIMAH  1035
             RGELSARQMHLAKFLRSLQKLADEFGVAVVITNQVVAQVDGSA+FAGPQ KPIGGNIMAH
Sbjct  238   RGELSARQMHLAKFLRSLQKLADEFGVAVVITNQVVAQVDGSALFAGPQFKPIGGNIMAH  297

Query  1036  ASTTRLALRKGRGEERVCKVVSSPCLAEAEARFQISPEGVTDVKD  1170
             A+TTRLALRKGR EER+CKV+SSPCL EAEARFQIS EGVTD KD
Sbjct  298   ATTTRLALRKGRAEERICKVISSPCLPEAEARFQISTEGVTDCKD  342



>gb|KFK26297.1| hypothetical protein AALP_AA8G229700 [Arabis alpina]
Length=342

 Score =   633 bits (1632),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/345 (89%), Positives = 328/345 (95%), Gaps = 5/345 (1%)
 Frame = +1

Query  136   TMEQQHRNQQKSVQERQQDEVEEIQHGPFPIEQLQESGISAIDVKKLKDAGLCTVESVVY  315
             TMEQ  R  Q +VQ  QQD+ EEIQHGPFP+EQLQ +GI+++DVKKL+DAGLCTVE V Y
Sbjct  3     TMEQ--RRNQNTVQ--QQDD-EEIQHGPFPVEQLQAAGIASVDVKKLRDAGLCTVEGVAY  57

Query  316   SPRKDLLQIKGISEAKVDKIIEAASKLVPLGFTSASQLHAQRLEIIQITSGSKELDKVLE  495
             +PRKDLLQIKGIS+AKVDKI+EAASKLVPLGFTSASQLHAQR EIIQITSGS+ELDKVLE
Sbjct  58    TPRKDLLQIKGISDAKVDKIVEAASKLVPLGFTSASQLHAQRQEIIQITSGSRELDKVLE  117

Query  496   GGIETGSITEIYGEFRSGKTQLCHTLCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQI  675
             GGIETGSITE+YGEFRSGKTQLCHTLCVTCQLP+DQGGGEGKAMYIDAEGTFRPQRLLQI
Sbjct  118   GGIETGSITELYGEFRSGKTQLCHTLCVTCQLPMDQGGGEGKAMYIDAEGTFRPQRLLQI  177

Query  676   ADRFGLNGADVLENVAYARAYNTDHQSRLLLEAASMMVETRFALMIVDSATALYRTDFSG  855
             ADRFGLNGADVLENVAYARAYNTDHQSRLLLEAASMM+ETRFAL+IVDSATALYRTDFSG
Sbjct  178   ADRFGLNGADVLENVAYARAYNTDHQSRLLLEAASMMIETRFALVIVDSATALYRTDFSG  237

Query  856   RGELSARQMHLAKFLRSLQKLADEFGVAVVITNQVVAQVDGSAIFAGPQIKPIGGNIMAH  1035
             RGELSARQMHLAKFLRSLQKLADEFGVAVVITNQVVAQVDGSA+FAGPQ KPIGGNIMAH
Sbjct  238   RGELSARQMHLAKFLRSLQKLADEFGVAVVITNQVVAQVDGSALFAGPQFKPIGGNIMAH  297

Query  1036  ASTTRLALRKGRGEERVCKVVSSPCLAEAEARFQISPEGVTDVKD  1170
             A+TTRLALRKGR EER+CKV+SSPCL EAEARFQIS EGVTD KD
Sbjct  298   ATTTRLALRKGRAEERICKVISSPCLPEAEARFQISTEGVTDCKD  342



>ref|XP_010493197.1| PREDICTED: DNA repair protein RAD51 homolog 1-like [Camelina 
sativa]
Length=342

 Score =   632 bits (1631),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/345 (89%), Positives = 327/345 (95%), Gaps = 5/345 (1%)
 Frame = +1

Query  136   TMEQQHRNQQKSVQERQQDEVEEIQHGPFPIEQLQESGISAIDVKKLKDAGLCTVESVVY  315
             TMEQ  R  Q  VQE  QD+ EEIQHGPFP+EQLQ +GI+++DVKKL+DAGLCTVE V Y
Sbjct  3     TMEQ--RRNQNVVQE--QDD-EEIQHGPFPVEQLQAAGIASVDVKKLRDAGLCTVEGVAY  57

Query  316   SPRKDLLQIKGISEAKVDKIIEAASKLVPLGFTSASQLHAQRLEIIQITSGSKELDKVLE  495
             +PRKDLLQIKGIS+AKVDKI+EAASKLVPLGFTSA+QLHAQR EIIQITSGS+ELDKVLE
Sbjct  58    TPRKDLLQIKGISDAKVDKIVEAASKLVPLGFTSATQLHAQRQEIIQITSGSRELDKVLE  117

Query  496   GGIETGSITEIYGEFRSGKTQLCHTLCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQI  675
             GGIETGSITE+YGEFRSGKTQLCHTLCVTCQLP+DQGGGEGKAMYIDAEGTFRPQRLLQI
Sbjct  118   GGIETGSITELYGEFRSGKTQLCHTLCVTCQLPMDQGGGEGKAMYIDAEGTFRPQRLLQI  177

Query  676   ADRFGLNGADVLENVAYARAYNTDHQSRLLLEAASMMVETRFALMIVDSATALYRTDFSG  855
             ADRFGLNGADVLENVAYARAYNTDHQSRLLLEAASMM+ETRFALMIVDSATALYRTDFSG
Sbjct  178   ADRFGLNGADVLENVAYARAYNTDHQSRLLLEAASMMIETRFALMIVDSATALYRTDFSG  237

Query  856   RGELSARQMHLAKFLRSLQKLADEFGVAVVITNQVVAQVDGSAIFAGPQIKPIGGNIMAH  1035
             RGELSARQMHLAKFLRSLQKLADEFGVAVVITNQVVAQVDGSA+FAGPQ KPIGGNIMAH
Sbjct  238   RGELSARQMHLAKFLRSLQKLADEFGVAVVITNQVVAQVDGSALFAGPQFKPIGGNIMAH  297

Query  1036  ASTTRLALRKGRGEERVCKVVSSPCLAEAEARFQISPEGVTDVKD  1170
             A+TTRLALRKGR EER+CKV+SSPCL EAEARFQIS EGVTD KD
Sbjct  298   ATTTRLALRKGRAEERICKVISSPCLPEAEARFQISTEGVTDCKD  342



>ref|NP_568402.1| DNA repair protein RAD51-like 1 [Arabidopsis thaliana]
 sp|P94102.1|RAD51_ARATH RecName: Full=DNA repair protein RAD51 homolog 1; AltName: Full=Rad51-like 
protein 1; Short=AtRAD51 [Arabidopsis thaliana]
 gb|AAB37762.1| RAD51 homolog [Arabidopsis thaliana]
 gb|AAC49555.1| AtRAD51 [Arabidopsis thaliana]
 emb|CAA04529.1| Rad51-like protein [Arabidopsis thaliana]
 gb|AED92897.1| DNA repair protein RAD51-like 1 [Arabidopsis thaliana]
Length=342

 Score =   632 bits (1629),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/345 (89%), Positives = 327/345 (95%), Gaps = 5/345 (1%)
 Frame = +1

Query  136   TMEQQHRNQQKSVQERQQDEVEEIQHGPFPIEQLQESGISAIDVKKLKDAGLCTVESVVY  315
             TMEQ  R  Q +VQ  QQD+ EE QHGPFP+EQLQ +GI+++DVKKL+DAGLCTVE V Y
Sbjct  3     TMEQ--RRNQNAVQ--QQDD-EETQHGPFPVEQLQAAGIASVDVKKLRDAGLCTVEGVAY  57

Query  316   SPRKDLLQIKGISEAKVDKIIEAASKLVPLGFTSASQLHAQRLEIIQITSGSKELDKVLE  495
             +PRKDLLQIKGIS+AKVDKI+EAASKLVPLGFTSASQLHAQR EIIQITSGS+ELDKVLE
Sbjct  58    TPRKDLLQIKGISDAKVDKIVEAASKLVPLGFTSASQLHAQRQEIIQITSGSRELDKVLE  117

Query  496   GGIETGSITEIYGEFRSGKTQLCHTLCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQI  675
             GGIETGSITE+YGEFRSGKTQLCHTLCVTCQLP+DQGGGEGKAMYIDAEGTFRPQRLLQI
Sbjct  118   GGIETGSITELYGEFRSGKTQLCHTLCVTCQLPMDQGGGEGKAMYIDAEGTFRPQRLLQI  177

Query  676   ADRFGLNGADVLENVAYARAYNTDHQSRLLLEAASMMVETRFALMIVDSATALYRTDFSG  855
             ADRFGLNGADVLENVAYARAYNTDHQSRLLLEAASMM+ETRFAL+IVDSATALYRTDFSG
Sbjct  178   ADRFGLNGADVLENVAYARAYNTDHQSRLLLEAASMMIETRFALLIVDSATALYRTDFSG  237

Query  856   RGELSARQMHLAKFLRSLQKLADEFGVAVVITNQVVAQVDGSAIFAGPQIKPIGGNIMAH  1035
             RGELSARQMHLAKFLRSLQKLADEFGVAVVITNQVVAQVDGSA+FAGPQ KPIGGNIMAH
Sbjct  238   RGELSARQMHLAKFLRSLQKLADEFGVAVVITNQVVAQVDGSALFAGPQFKPIGGNIMAH  297

Query  1036  ASTTRLALRKGRGEERVCKVVSSPCLAEAEARFQISPEGVTDVKD  1170
             A+TTRLALRKGR EER+CKV+SSPCL EAEARFQIS EGVTD KD
Sbjct  298   ATTTRLALRKGRAEERICKVISSPCLPEAEARFQISTEGVTDCKD  342



>gb|KJB54560.1| hypothetical protein B456_009G038800 [Gossypium raimondii]
Length=344

 Score =   632 bits (1629),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/322 (94%), Positives = 316/322 (98%), Gaps = 0/322 (0%)
 Frame = +1

Query  205   IQHGPFPIEQLQESGISAIDVKKLKDAGLCTVESVVYSPRKDLLQIKGISEAKVDKIIEA  384
             + HGPFP+EQLQE GI+++DVKKLKDAGLCTVES+ Y+PRKDLLQIKGISEAKVDKI+EA
Sbjct  23    MHHGPFPVEQLQELGIASLDVKKLKDAGLCTVESIAYAPRKDLLQIKGISEAKVDKIMEA  82

Query  385   ASKLVPLGFTSASQLHAQRLEIIQITSGSKELDKVLEGGIETGSITEIYGEFRSGKTQLC  564
             ASKLVPLGFTSASQLHAQRLEIIQITSGS ELDK+LEGGIETGSITEIYGEFRSGKTQLC
Sbjct  83    ASKLVPLGFTSASQLHAQRLEIIQITSGSSELDKILEGGIETGSITEIYGEFRSGKTQLC  142

Query  565   HTLCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIADRFGLNGADVLENVAYARAYNT  744
             HTLCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIA+RFGLNGADVLENVAYARAYNT
Sbjct  143   HTLCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIAERFGLNGADVLENVAYARAYNT  202

Query  745   DHQSRLLLEAASMMVETRFALMIVDSATALYRTDFSGRGELSARQMHLAKFLRSLQKLAD  924
             DHQSRLLLEAASMMVETRFALMIVDSATALYRTDF+GRGELSARQMHLAKFLRSLQKLAD
Sbjct  203   DHQSRLLLEAASMMVETRFALMIVDSATALYRTDFTGRGELSARQMHLAKFLRSLQKLAD  262

Query  925   EFGVAVVITNQVVAQVDGSAIFAGPQIKPIGGNIMAHASTTRLALRKGRGEERVCKVVSS  1104
             EFGVAVVITNQVVAQVDGSAIFAGPQIKPIGGNIMAHASTTRLALRKGR EER+CKV+SS
Sbjct  263   EFGVAVVITNQVVAQVDGSAIFAGPQIKPIGGNIMAHASTTRLALRKGRAEERICKVISS  322

Query  1105  PCLAEAEARFQISPEGVTDVKD  1170
             PCLAEAEARFQISP GV+DVKD
Sbjct  323   PCLAEAEARFQISPGGVSDVKD  344



>ref|XP_003577363.1| PREDICTED: DNA repair protein RAD51 homolog A [Brachypodium distachyon]
Length=340

 Score =   631 bits (1628),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/326 (92%), Positives = 320/326 (98%), Gaps = 0/326 (0%)
 Frame = +1

Query  193   EVEEIQHGPFPIEQLQESGISAIDVKKLKDAGLCTVESVVYSPRKDLLQIKGISEAKVDK  372
             E EE++HGPFPIEQLQ +GI+A+DVKKLKDAG+ TVESV Y+PRKDLLQIKGISEAKVDK
Sbjct  15    EQEEVEHGPFPIEQLQAAGIAALDVKKLKDAGMHTVESVAYTPRKDLLQIKGISEAKVDK  74

Query  373   IIEAASKLVPLGFTSASQLHAQRLEIIQITSGSKELDKVLEGGIETGSITEIYGEFRSGK  552
             IIEAASKLVPLGFTSASQLHAQRLEIIQ+T+GS+ELDK+LEGGIETGSITE+YGEFRSGK
Sbjct  75    IIEAASKLVPLGFTSASQLHAQRLEIIQVTTGSRELDKILEGGIETGSITELYGEFRSGK  134

Query  553   TQLCHTLCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIADRFGLNGADVLENVAYAR  732
             TQLCHTLCVTCQLPLDQGGGEGKA+YIDAEGTFRPQRLLQIADRFGLNGADVLENVAYAR
Sbjct  135   TQLCHTLCVTCQLPLDQGGGEGKALYIDAEGTFRPQRLLQIADRFGLNGADVLENVAYAR  194

Query  733   AYNTDHQSRLLLEAASMMVETRFALMIVDSATALYRTDFSGRGELSARQMHLAKFLRSLQ  912
             AYNTDHQSRLLLEAASMM+ETRFALMIVDSATALYRTDFSGRGELSARQMH+AKFLRSLQ
Sbjct  195   AYNTDHQSRLLLEAASMMIETRFALMIVDSATALYRTDFSGRGELSARQMHMAKFLRSLQ  254

Query  913   KLADEFGVAVVITNQVVAQVDGSAIFAGPQIKPIGGNIMAHASTTRLALRKGRGEERVCK  1092
             KLADEFGVAVVITNQVVAQVDGSA+FAGPQIKPIGGNIMAHASTTRLALRKGRGEER+CK
Sbjct  255   KLADEFGVAVVITNQVVAQVDGSAMFAGPQIKPIGGNIMAHASTTRLALRKGRGEERICK  314

Query  1093  VVSSPCLAEAEARFQISPEGVTDVKD  1170
             V+SSPCLAEAEARFQ+S EGV DVKD
Sbjct  315   VISSPCLAEAEARFQLSSEGVADVKD  340



>gb|KHN45044.1| DNA repair protein RAD51 like 1 [Glycine soja]
Length=340

 Score =   630 bits (1626),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/344 (89%), Positives = 326/344 (95%), Gaps = 4/344 (1%)
 Frame = +1

Query  139   MEQQHRNQQKSVQERQQDEVEEIQHGPFPIEQLQESGISAIDVKKLKDAGLCTVESVVYS  318
             MEQQ    QK+ Q  QQDE EEIQ GP P+EQLQ SGI+A DVKKLKDAG+CTVESV Y+
Sbjct  1     MEQQR--HQKAPQ--QQDEAEEIQPGPLPVEQLQASGIAATDVKKLKDAGICTVESVAYT  56

Query  319   PRKDLLQIKGISEAKVDKIIEAASKLVPLGFTSASQLHAQRLEIIQITSGSKELDKVLEG  498
             PRKDLLQIKGISEAKVDKIIEAASKLVP+GFTSAS+LHAQR  IIQIT+GS+ELDK+LEG
Sbjct  57    PRKDLLQIKGISEAKVDKIIEAASKLVPMGFTSASELHAQRDAIIQITTGSRELDKILEG  116

Query  499   GIETGSITEIYGEFRSGKTQLCHTLCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIA  678
             G+ETGSITE+YGEFRSGKTQLCHTLCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIA
Sbjct  117   GVETGSITELYGEFRSGKTQLCHTLCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIA  176

Query  679   DRFGLNGADVLENVAYARAYNTDHQSRLLLEAASMMVETRFALMIVDSATALYRTDFSGR  858
             DRFGLNG DVLENVAYARAYNTDHQSRLLLEAASMMVETRFA+MIVDSATALYRTDFSGR
Sbjct  177   DRFGLNGVDVLENVAYARAYNTDHQSRLLLEAASMMVETRFAVMIVDSATALYRTDFSGR  236

Query  859   GELSARQMHLAKFLRSLQKLADEFGVAVVITNQVVAQVDGSAIFAGPQIKPIGGNIMAHA  1038
             GELSARQMHLAKFLRSLQKLADEFGVA+VITNQVV+QVDGSA+FAGPQIKPIGGNIMAHA
Sbjct  237   GELSARQMHLAKFLRSLQKLADEFGVAIVITNQVVSQVDGSAVFAGPQIKPIGGNIMAHA  296

Query  1039  STTRLALRKGRGEERVCKVVSSPCLAEAEARFQISPEGVTDVKD  1170
             +TTRLALRKGRGEER+CKV+SSPCLAEAEARFQI  EGV+DVKD
Sbjct  297   TTTRLALRKGRGEERICKVISSPCLAEAEARFQICAEGVSDVKD  340



>ref|XP_003551035.1| PREDICTED: DNA repair protein RAD51 homolog [Glycine max]
Length=343

 Score =   630 bits (1626),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/327 (91%), Positives = 317/327 (97%), Gaps = 0/327 (0%)
 Frame = +1

Query  190   DEVEEIQHGPFPIEQLQESGISAIDVKKLKDAGLCTVESVVYSPRKDLLQIKGISEAKVD  369
             DE EEIQHGP P+EQLQ SGI+A DVKKLKDAG+CTVESV Y+PRKDLLQIKGISEAKVD
Sbjct  17    DEAEEIQHGPLPVEQLQASGIAATDVKKLKDAGICTVESVAYTPRKDLLQIKGISEAKVD  76

Query  370   KIIEAASKLVPLGFTSASQLHAQRLEIIQITSGSKELDKVLEGGIETGSITEIYGEFRSG  549
             KIIEAASKLVP+GFTSAS+LHAQR  IIQIT+GS ELDK+LEGG+ETGSITE+YGEFRSG
Sbjct  77    KIIEAASKLVPMGFTSASELHAQRDAIIQITTGSTELDKILEGGVETGSITELYGEFRSG  136

Query  550   KTQLCHTLCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIADRFGLNGADVLENVAYA  729
             KTQLCHTLCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIADRFGLNGADVLENVAYA
Sbjct  137   KTQLCHTLCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIADRFGLNGADVLENVAYA  196

Query  730   RAYNTDHQSRLLLEAASMMVETRFALMIVDSATALYRTDFSGRGELSARQMHLAKFLRSL  909
             RAYNTDHQSRLLLEAASMMVETRFA+MIVDSATALYRTDFSGRGELSARQMHLAKFLRSL
Sbjct  197   RAYNTDHQSRLLLEAASMMVETRFAVMIVDSATALYRTDFSGRGELSARQMHLAKFLRSL  256

Query  910   QKLADEFGVAVVITNQVVAQVDGSAIFAGPQIKPIGGNIMAHASTTRLALRKGRGEERVC  1089
             QKLADEFGVA+VITNQVV+QVDGSA+FAGPQIKPIGGNIMAHA+TTRLALRKGRGEER+C
Sbjct  257   QKLADEFGVAIVITNQVVSQVDGSAVFAGPQIKPIGGNIMAHATTTRLALRKGRGEERIC  316

Query  1090  KVVSSPCLAEAEARFQISPEGVTDVKD  1170
             KV+SSPCLAEAEARFQI  EGV+DVKD
Sbjct  317   KVISSPCLAEAEARFQICAEGVSDVKD  343



>ref|NP_001104919.1| DNA repair protein RAD51 homolog B [Zea mays]
 sp|Q9XED7.1|R51A2_MAIZE RecName: Full=DNA repair protein RAD51 homolog B; AltName: Full=Rad51-like 
protein B; Short=RAD51B; AltName: Full=ZmRAD51b 
[Zea mays]
 gb|AAD32030.1|AF079429_1 RAD51 homolog RAD51B [Zea mays]
 gb|ACN26655.1| unknown [Zea mays]
 tpg|DAA55409.1| TPA: DNA repair protein RAD51-like protein B [Zea mays]
Length=340

 Score =   630 bits (1625),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/326 (93%), Positives = 319/326 (98%), Gaps = 0/326 (0%)
 Frame = +1

Query  193   EVEEIQHGPFPIEQLQESGISAIDVKKLKDAGLCTVESVVYSPRKDLLQIKGISEAKVDK  372
             E E  +HGPFPIEQLQ SGI+A+DVKKLKDAGLCTVESV YSPRKDLLQIKGISEAKVDK
Sbjct  15    EEEATEHGPFPIEQLQASGIAALDVKKLKDAGLCTVESVAYSPRKDLLQIKGISEAKVDK  74

Query  373   IIEAASKLVPLGFTSASQLHAQRLEIIQITSGSKELDKVLEGGIETGSITEIYGEFRSGK  552
             IIEAASKLVPLGFTSASQLHAQRLEIIQ+T+GS+ELD++L+GGIETGSITE+YGEFRSGK
Sbjct  75    IIEAASKLVPLGFTSASQLHAQRLEIIQLTTGSRELDQILDGGIETGSITEMYGEFRSGK  134

Query  553   TQLCHTLCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIADRFGLNGADVLENVAYAR  732
             TQLCHTLCVTCQLPLDQGGGEGKA+YIDAEGTFRPQR+LQIADRFGLNGADVLENVAYAR
Sbjct  135   TQLCHTLCVTCQLPLDQGGGEGKALYIDAEGTFRPQRILQIADRFGLNGADVLENVAYAR  194

Query  733   AYNTDHQSRLLLEAASMMVETRFALMIVDSATALYRTDFSGRGELSARQMHLAKFLRSLQ  912
             AYNTDHQSRLLLEAASMMVETRFALM+VDSATALYRTDFSGRGELSARQMHLAKFLRSLQ
Sbjct  195   AYNTDHQSRLLLEAASMMVETRFALMVVDSATALYRTDFSGRGELSARQMHLAKFLRSLQ  254

Query  913   KLADEFGVAVVITNQVVAQVDGSAIFAGPQIKPIGGNIMAHASTTRLALRKGRGEERVCK  1092
             KLADEFGVAVVITNQVVAQVDG+A+FAGPQIKPIGGNIMAHASTTRL LRKGRGEER+CK
Sbjct  255   KLADEFGVAVVITNQVVAQVDGAAMFAGPQIKPIGGNIMAHASTTRLFLRKGRGEERICK  314

Query  1093  VVSSPCLAEAEARFQISPEGVTDVKD  1170
             V+SSPCLAEAEARFQIS EGVTDVKD
Sbjct  315   VISSPCLAEAEARFQISSEGVTDVKD  340



>ref|XP_006663048.1| PREDICTED: DNA repair protein RAD51 homolog A-like [Oryza brachyantha]
Length=342

 Score =   630 bits (1625),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/324 (94%), Positives = 318/324 (98%), Gaps = 0/324 (0%)
 Frame = +1

Query  199   EEIQHGPFPIEQLQESGISAIDVKKLKDAGLCTVESVVYSPRKDLLQIKGISEAKVDKII  378
             EE +HGPFPIEQLQ SGI+A+DVKKLKDAGL TVESV Y+PRKDLLQIKGISEAKVDKII
Sbjct  19    EEGEHGPFPIEQLQASGIAALDVKKLKDAGLHTVESVSYTPRKDLLQIKGISEAKVDKII  78

Query  379   EAASKLVPLGFTSASQLHAQRLEIIQITSGSKELDKVLEGGIETGSITEIYGEFRSGKTQ  558
             EAASKLVPLGFTSASQLHAQRLEIIQ+T+GS+ELDK+LEGGIETGSITEIYGEFRSGKTQ
Sbjct  79    EAASKLVPLGFTSASQLHAQRLEIIQVTTGSRELDKILEGGIETGSITEIYGEFRSGKTQ  138

Query  559   LCHTLCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIADRFGLNGADVLENVAYARAY  738
             LCHTLCVTCQLPLDQGGGEGKA+YIDAEGTFRPQRLLQIADRFGLNGADVLENVAYARAY
Sbjct  139   LCHTLCVTCQLPLDQGGGEGKALYIDAEGTFRPQRLLQIADRFGLNGADVLENVAYARAY  198

Query  739   NTDHQSRLLLEAASMMVETRFALMIVDSATALYRTDFSGRGELSARQMHLAKFLRSLQKL  918
             NTDHQSRLLLEAASMM+ETRFALMIVDSATALYRTDFSGRGELSARQMH+AKFLRSLQKL
Sbjct  199   NTDHQSRLLLEAASMMIETRFALMIVDSATALYRTDFSGRGELSARQMHMAKFLRSLQKL  258

Query  919   ADEFGVAVVITNQVVAQVDGSAIFAGPQIKPIGGNIMAHASTTRLALRKGRGEERVCKVV  1098
             ADEFGVAVVITNQVVAQVDGSA+FAGPQIKPIGGNIMAHASTTRLALRKGRGEER+CKVV
Sbjct  259   ADEFGVAVVITNQVVAQVDGSAMFAGPQIKPIGGNIMAHASTTRLALRKGRGEERICKVV  318

Query  1099  SSPCLAEAEARFQISPEGVTDVKD  1170
             SSPCLAEAEARFQ++ EGV DVKD
Sbjct  319   SSPCLAEAEARFQVASEGVADVKD  342



>gb|ACH42252.1| RAD51A recombination protein [Triticum aestivum]
 gb|ACM47240.1| RAD51 recombination protein [Triticum aestivum]
Length=342

 Score =   629 bits (1623),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/320 (94%), Positives = 315/320 (98%), Gaps = 0/320 (0%)
 Frame = +1

Query  211   HGPFPIEQLQESGISAIDVKKLKDAGLCTVESVVYSPRKDLLQIKGISEAKVDKIIEAAS  390
             HGPFPIEQLQ SGI+A+DVKKLKDAGLCTVESV YSPRKDLLQIKGISEAKVDKIIEAAS
Sbjct  23    HGPFPIEQLQASGIAAVDVKKLKDAGLCTVESVAYSPRKDLLQIKGISEAKVDKIIEAAS  82

Query  391   KLVPLGFTSASQLHAQRLEIIQITSGSKELDKVLEGGIETGSITEIYGEFRSGKTQLCHT  570
             KLVPLGFTSA+QLHAQRLEIIQ+T+GS+ELDK+LEGGIETGSITE+YGEFRSGKTQLCHT
Sbjct  83    KLVPLGFTSATQLHAQRLEIIQVTTGSRELDKILEGGIETGSITELYGEFRSGKTQLCHT  142

Query  571   LCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIADRFGLNGADVLENVAYARAYNTDH  750
             LCVTCQLPLDQGGGEGKA+YIDAEGTFRPQRLLQIADRFGLNGADVLENVAYARAYNTDH
Sbjct  143   LCVTCQLPLDQGGGEGKALYIDAEGTFRPQRLLQIADRFGLNGADVLENVAYARAYNTDH  202

Query  751   QSRLLLEAASMMVETRFALMIVDSATALYRTDFSGRGELSARQMHLAKFLRSLQKLADEF  930
             QSRLLLEAASMMVETRFALM++DSATALYRTDFSGRGELSARQMHLAKFLRSLQKLADEF
Sbjct  203   QSRLLLEAASMMVETRFALMVIDSATALYRTDFSGRGELSARQMHLAKFLRSLQKLADEF  262

Query  931   GVAVVITNQVVAQVDGSAIFAGPQIKPIGGNIMAHASTTRLALRKGRGEERVCKVVSSPC  1110
             GVAVVI+NQVVAQVDG A+FAGPQIKPIGGNIMAHASTTRL LRKGR EER+CKVVSSPC
Sbjct  263   GVAVVISNQVVAQVDGGAMFAGPQIKPIGGNIMAHASTTRLYLRKGRAEERICKVVSSPC  322

Query  1111  LAEAEARFQISPEGVTDVKD  1170
             LAEAEARFQISPEGVTDVKD
Sbjct  323   LAEAEARFQISPEGVTDVKD  342



>gb|ACM47238.1| RAD51 recombination protein [Triticum aestivum]
Length=343

 Score =   629 bits (1623),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/320 (94%), Positives = 314/320 (98%), Gaps = 0/320 (0%)
 Frame = +1

Query  211   HGPFPIEQLQESGISAIDVKKLKDAGLCTVESVVYSPRKDLLQIKGISEAKVDKIIEAAS  390
             HGPFPIE LQ SGI+A+DVKKLKDAGLCTVESV YSPRKDLLQIKGISEAKVDKIIEAAS
Sbjct  24    HGPFPIEHLQASGIAAVDVKKLKDAGLCTVESVAYSPRKDLLQIKGISEAKVDKIIEAAS  83

Query  391   KLVPLGFTSASQLHAQRLEIIQITSGSKELDKVLEGGIETGSITEIYGEFRSGKTQLCHT  570
             KLVPLGFTSA+QLHAQRLEIIQ+T+GS+ELDK+LEGGIETGSITE+YGEFRSGKTQLCHT
Sbjct  84    KLVPLGFTSATQLHAQRLEIIQVTTGSRELDKILEGGIETGSITELYGEFRSGKTQLCHT  143

Query  571   LCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIADRFGLNGADVLENVAYARAYNTDH  750
             LCVTCQLPLDQGGGEGKA+YIDAEGTFRPQRLLQIADRFGLNGADVLENVAYARAYNTDH
Sbjct  144   LCVTCQLPLDQGGGEGKALYIDAEGTFRPQRLLQIADRFGLNGADVLENVAYARAYNTDH  203

Query  751   QSRLLLEAASMMVETRFALMIVDSATALYRTDFSGRGELSARQMHLAKFLRSLQKLADEF  930
             QSRLLLEAASMMVETRFALM++DSATALYRTDFSGRGELSARQMHLAKFLRSLQKLADEF
Sbjct  204   QSRLLLEAASMMVETRFALMVIDSATALYRTDFSGRGELSARQMHLAKFLRSLQKLADEF  263

Query  931   GVAVVITNQVVAQVDGSAIFAGPQIKPIGGNIMAHASTTRLALRKGRGEERVCKVVSSPC  1110
             GVAVVI+NQVVAQVDG A+FAGPQIKPIGGNIMAHASTTRL LRKGR EER+CKVVSSPC
Sbjct  264   GVAVVISNQVVAQVDGGAMFAGPQIKPIGGNIMAHASTTRLYLRKGRAEERICKVVSSPC  323

Query  1111  LAEAEARFQISPEGVTDVKD  1170
             LAEAEARFQISPEGVTDVKD
Sbjct  324   LAEAEARFQISPEGVTDVKD  343



>dbj|BAE99388.1| RAD51 homolog [Arabidopsis thaliana]
Length=342

 Score =   628 bits (1620),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/345 (89%), Positives = 326/345 (94%), Gaps = 5/345 (1%)
 Frame = +1

Query  136   TMEQQHRNQQKSVQERQQDEVEEIQHGPFPIEQLQESGISAIDVKKLKDAGLCTVESVVY  315
             TMEQ  R  Q +VQ  QQD+ EE QHGPFP+EQLQ +GI+++DVKKL+DAGLCTVE V Y
Sbjct  3     TMEQ--RRNQNAVQ--QQDD-EETQHGPFPVEQLQAAGIASVDVKKLRDAGLCTVEGVAY  57

Query  316   SPRKDLLQIKGISEAKVDKIIEAASKLVPLGFTSASQLHAQRLEIIQITSGSKELDKVLE  495
             +PRKDLLQIKGIS+AKVDKI+EAASKLVPLGFTSASQLHAQR EIIQITSGS+ELDKVLE
Sbjct  58    TPRKDLLQIKGISDAKVDKIVEAASKLVPLGFTSASQLHAQRQEIIQITSGSRELDKVLE  117

Query  496   GGIETGSITEIYGEFRSGKTQLCHTLCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQI  675
             GGIETGSITE+YGEFRSGKTQLCHTLCVTCQLP+DQGGGEGKAMYI AEGTFRPQRLLQI
Sbjct  118   GGIETGSITELYGEFRSGKTQLCHTLCVTCQLPMDQGGGEGKAMYIGAEGTFRPQRLLQI  177

Query  676   ADRFGLNGADVLENVAYARAYNTDHQSRLLLEAASMMVETRFALMIVDSATALYRTDFSG  855
             ADRFGLNGADVLENVAYARAYNTDHQSRLLLEAASMM+ETRFAL+IVDSATALYRTDFSG
Sbjct  178   ADRFGLNGADVLENVAYARAYNTDHQSRLLLEAASMMIETRFALLIVDSATALYRTDFSG  237

Query  856   RGELSARQMHLAKFLRSLQKLADEFGVAVVITNQVVAQVDGSAIFAGPQIKPIGGNIMAH  1035
             RGELSARQMHLAKFLRSLQKLADEFGVAVVITNQVVAQVDGSA+FAGPQ KPIGGNIMAH
Sbjct  238   RGELSARQMHLAKFLRSLQKLADEFGVAVVITNQVVAQVDGSALFAGPQFKPIGGNIMAH  297

Query  1036  ASTTRLALRKGRGEERVCKVVSSPCLAEAEARFQISPEGVTDVKD  1170
             A+TTRLALRKGR EER+CKV+SSPCL EAEARFQIS EGVTD KD
Sbjct  298   ATTTRLALRKGRAEERICKVISSPCLPEAEARFQISTEGVTDCKD  342



>ref|XP_002443207.1| hypothetical protein SORBIDRAFT_08g015360 [Sorghum bicolor]
 gb|EES17045.1| hypothetical protein SORBIDRAFT_08g015360 [Sorghum bicolor]
Length=342

 Score =   627 bits (1618),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/326 (93%), Positives = 318/326 (98%), Gaps = 0/326 (0%)
 Frame = +1

Query  193   EVEEIQHGPFPIEQLQESGISAIDVKKLKDAGLCTVESVVYSPRKDLLQIKGISEAKVDK  372
             E E  +HGPFPIEQLQ SGI+A+DVKKLKDAGLCTVESV YSPRKDLLQIKGISEAKVDK
Sbjct  17    EEEAPEHGPFPIEQLQASGIAALDVKKLKDAGLCTVESVAYSPRKDLLQIKGISEAKVDK  76

Query  373   IIEAASKLVPLGFTSASQLHAQRLEIIQITSGSKELDKVLEGGIETGSITEIYGEFRSGK  552
             IIEAASKLVPLGFTSASQLHAQRLEIIQ+T+GS+ELD++L+GGIETGSITEIYGEFRSGK
Sbjct  77    IIEAASKLVPLGFTSASQLHAQRLEIIQLTTGSRELDQILDGGIETGSITEIYGEFRSGK  136

Query  553   TQLCHTLCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIADRFGLNGADVLENVAYAR  732
             TQLCHTLCVTCQLPLDQGGGEGKA+YIDAEGTFRP+RLLQIADRFGLNGADVLENVAYAR
Sbjct  137   TQLCHTLCVTCQLPLDQGGGEGKALYIDAEGTFRPERLLQIADRFGLNGADVLENVAYAR  196

Query  733   AYNTDHQSRLLLEAASMMVETRFALMIVDSATALYRTDFSGRGELSARQMHLAKFLRSLQ  912
             AYNTDHQSRLLLEAASMMVETRFALM+VDSATALYRTDFSGRGELSARQMHLAKFLRSLQ
Sbjct  197   AYNTDHQSRLLLEAASMMVETRFALMVVDSATALYRTDFSGRGELSARQMHLAKFLRSLQ  256

Query  913   KLADEFGVAVVITNQVVAQVDGSAIFAGPQIKPIGGNIMAHASTTRLALRKGRGEERVCK  1092
             KLADEFGVAVVITNQVVAQVDG+A+FAGPQIKPIGGNIMAHASTTRL LRKGR EER+CK
Sbjct  257   KLADEFGVAVVITNQVVAQVDGAAVFAGPQIKPIGGNIMAHASTTRLFLRKGRREERICK  316

Query  1093  VVSSPCLAEAEARFQISPEGVTDVKD  1170
             VVSSPCLAEAEARFQIS EGVTDVKD
Sbjct  317   VVSSPCLAEAEARFQISSEGVTDVKD  342



>gb|ACM47239.1| RAD51 recombination protein [Triticum aestivum]
Length=343

 Score =   627 bits (1618),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/320 (93%), Positives = 314/320 (98%), Gaps = 0/320 (0%)
 Frame = +1

Query  211   HGPFPIEQLQESGISAIDVKKLKDAGLCTVESVVYSPRKDLLQIKGISEAKVDKIIEAAS  390
             HGPFPIE LQ SGI+A+DVKKLKDAGLCTVESV YSPRKDLLQIKGISEAKVDKIIEAAS
Sbjct  24    HGPFPIEHLQASGIAAVDVKKLKDAGLCTVESVAYSPRKDLLQIKGISEAKVDKIIEAAS  83

Query  391   KLVPLGFTSASQLHAQRLEIIQITSGSKELDKVLEGGIETGSITEIYGEFRSGKTQLCHT  570
             KLVPLGFTSA+QLHAQRLEIIQ+T+GS+ELD++LEGGIETGSITE+YGEFRSGKTQLCHT
Sbjct  84    KLVPLGFTSATQLHAQRLEIIQVTTGSRELDRILEGGIETGSITELYGEFRSGKTQLCHT  143

Query  571   LCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIADRFGLNGADVLENVAYARAYNTDH  750
             LCVTCQLPLDQGGGEGKA+YIDAEGTFRPQRLLQIADRFGLNGADVLENVAYARAYNTDH
Sbjct  144   LCVTCQLPLDQGGGEGKALYIDAEGTFRPQRLLQIADRFGLNGADVLENVAYARAYNTDH  203

Query  751   QSRLLLEAASMMVETRFALMIVDSATALYRTDFSGRGELSARQMHLAKFLRSLQKLADEF  930
             QSRLLLEAASMMVETRFALM++DSATALYRTDFSGRGELSARQMHLAKFLRSLQKLADEF
Sbjct  204   QSRLLLEAASMMVETRFALMVIDSATALYRTDFSGRGELSARQMHLAKFLRSLQKLADEF  263

Query  931   GVAVVITNQVVAQVDGSAIFAGPQIKPIGGNIMAHASTTRLALRKGRGEERVCKVVSSPC  1110
             GVAVVI+NQVVAQVDG A+FAGPQIKPIGGNIMAHASTTRL LRKGR EER+CKVVSSPC
Sbjct  264   GVAVVISNQVVAQVDGGAMFAGPQIKPIGGNIMAHASTTRLYLRKGRAEERICKVVSSPC  323

Query  1111  LAEAEARFQISPEGVTDVKD  1170
             LAEAEARFQISPEGVTDVKD
Sbjct  324   LAEAEARFQISPEGVTDVKD  343



>ref|XP_003575503.1| PREDICTED: DNA repair protein RAD51 homolog B-like [Brachypodium 
distachyon]
Length=346

 Score =   627 bits (1617),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/319 (94%), Positives = 315/319 (99%), Gaps = 0/319 (0%)
 Frame = +1

Query  214   GPFPIEQLQESGISAIDVKKLKDAGLCTVESVVYSPRKDLLQIKGISEAKVDKIIEAASK  393
             GP+PIEQLQ SGI+A+DVKKLKDAGLCTVESVVYSPRKDLLQIKGISEAKVDKIIEAASK
Sbjct  28    GPYPIEQLQASGIAAVDVKKLKDAGLCTVESVVYSPRKDLLQIKGISEAKVDKIIEAASK  87

Query  394   LVPLGFTSASQLHAQRLEIIQITSGSKELDKVLEGGIETGSITEIYGEFRSGKTQLCHTL  573
             LVPLGFTSA+QLHAQRLEIIQ+T+GS+ELD++LEGGIETGSITE+YGEFRSGKTQLCHTL
Sbjct  88    LVPLGFTSATQLHAQRLEIIQVTTGSRELDRILEGGIETGSITELYGEFRSGKTQLCHTL  147

Query  574   CVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIADRFGLNGADVLENVAYARAYNTDHQ  753
             CVTCQLPLDQGGGEGKA+YIDAEGTFRPQRLLQIADRFGLNGADVLENVAYARAYNTDHQ
Sbjct  148   CVTCQLPLDQGGGEGKALYIDAEGTFRPQRLLQIADRFGLNGADVLENVAYARAYNTDHQ  207

Query  754   SRLLLEAASMMVETRFALMIVDSATALYRTDFSGRGELSARQMHLAKFLRSLQKLADEFG  933
             SRLLLEAASMMVETRFALM+VDSATALYRTDFSGRGELSARQMHLAKFLRSLQKLADEFG
Sbjct  208   SRLLLEAASMMVETRFALMVVDSATALYRTDFSGRGELSARQMHLAKFLRSLQKLADEFG  267

Query  934   VAVVITNQVVAQVDGSAIFAGPQIKPIGGNIMAHASTTRLALRKGRGEERVCKVVSSPCL  1113
             VAVVI+NQVVAQVDG A+FAGPQIKPIGGNIMAHASTTRL LRKGR EER+CKVVSSPCL
Sbjct  268   VAVVISNQVVAQVDGGAMFAGPQIKPIGGNIMAHASTTRLYLRKGRAEERICKVVSSPCL  327

Query  1114  AEAEARFQISPEGVTDVKD  1170
             AEAEARFQISPEGVTDVKD
Sbjct  328   AEAEARFQISPEGVTDVKD  346



>gb|AJF11726.1| RAD51 [Chrysanthemum indicum]
Length=345

 Score =   626 bits (1615),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/320 (94%), Positives = 313/320 (98%), Gaps = 0/320 (0%)
 Frame = +1

Query  211   HGPFPIEQLQESGISAIDVKKLKDAGLCTVESVVYSPRKDLLQIKGISEAKVDKIIEAAS  390
             HGPFPIEQLQ SGI+AIDVKKLKDAGLCTVESV YSPRK+LLQIKGISEAKVDKIIEAAS
Sbjct  26    HGPFPIEQLQASGIAAIDVKKLKDAGLCTVESVAYSPRKELLQIKGISEAKVDKIIEAAS  85

Query  391   KLVPLGFTSASQLHAQRLEIIQITSGSKELDKVLEGGIETGSITEIYGEFRSGKTQLCHT  570
             KLVPLGFTSA QLHAQR EIIQI+SGS+ELDK+L+GGIETGSITE+YGEFRSGKTQLCHT
Sbjct  86    KLVPLGFTSAGQLHAQRQEIIQISSGSRELDKILDGGIETGSITELYGEFRSGKTQLCHT  145

Query  571   LCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIADRFGLNGADVLENVAYARAYNTDH  750
             LCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIADRFGLNG DVLENVAYARAYNTDH
Sbjct  146   LCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIADRFGLNGPDVLENVAYARAYNTDH  205

Query  751   QSRLLLEAASMMVETRFALMIVDSATALYRTDFSGRGELSARQMHLAKFLRSLQKLADEF  930
             QSRLLLEAASMMVETRFALMIVDSATALYRTDFSGRGELSARQMHLAKFLRSLQKLADEF
Sbjct  206   QSRLLLEAASMMVETRFALMIVDSATALYRTDFSGRGELSARQMHLAKFLRSLQKLADEF  265

Query  931   GVAVVITNQVVAQVDGSAIFAGPQIKPIGGNIMAHASTTRLALRKGRGEERVCKVVSSPC  1110
             GVAVVITNQVVAQVDGSA+F+GPQIKPIGGNIMAHASTTRLALRKGRGEER+CKV+SSPC
Sbjct  266   GVAVVITNQVVAQVDGSAMFSGPQIKPIGGNIMAHASTTRLALRKGRGEERICKVISSPC  325

Query  1111  LAEAEARFQISPEGVTDVKD  1170
             LAEAEARFQIS EGV DVKD
Sbjct  326   LAEAEARFQISTEGVNDVKD  345



>ref|XP_007012510.1| RAS associated with diabetes protein 51 [Theobroma cacao]
 gb|EOY30129.1| RAS associated with diabetes protein 51 [Theobroma cacao]
Length=361

 Score =   627 bits (1616),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/360 (87%), Positives = 331/360 (92%), Gaps = 18/360 (5%)
 Frame = +1

Query  145   QQHRNQQKSVQERQQDEVEEIQ----HGPFPIEQLQ--------------ESGISAIDVK  270
             +QHRNQ+ + Q++QQ + +E      HGPFP+EQLQ               SGI+++DVK
Sbjct  2     EQHRNQKMAQQQQQQQQQQEELEEMQHGPFPVEQLQLWISLSSFLYLQSKSSGIASLDVK  61

Query  271   KLKDAGLCTVESVVYSPRKDLLQIKGISEAKVDKIIEAASKLVPLGFTSASQLHAQRLEI  450
             KLKDAGLCTVESV Y+PRKDLLQIKGISEAKVDKI+EAASKLVPLGFTSASQLHAQRLEI
Sbjct  62    KLKDAGLCTVESVAYTPRKDLLQIKGISEAKVDKIMEAASKLVPLGFTSASQLHAQRLEI  121

Query  451   IQITSGSKELDKVLEGGIETGSITEIYGEFRSGKTQLCHTLCVTCQLPLDQGGGEGKAMY  630
             IQITSGS ELDK+LEGGIETGSITEIYGEFRSGKTQLCHTLCVTCQLPLDQGGGEGKAMY
Sbjct  122   IQITSGSSELDKILEGGIETGSITEIYGEFRSGKTQLCHTLCVTCQLPLDQGGGEGKAMY  181

Query  631   IDAEGTFRPQRLLQIADRFGLNGADVLENVAYARAYNTDHQSRLLLEAASMMVETRFALM  810
             IDAEGTFRPQRLLQIA+RFGLNGADVLENVAYARAYNTDHQSRLLLEAASMMVETRFALM
Sbjct  182   IDAEGTFRPQRLLQIAERFGLNGADVLENVAYARAYNTDHQSRLLLEAASMMVETRFALM  241

Query  811   IVDSATALYRTDFSGRGELSARQMHLAKFLRSLQKLADEFGVAVVITNQVVAQVDGSAIF  990
             IVDSATALYRTDF+GRGELSARQMHLAKFLRSLQKLADEFGVAVVITNQVVAQVDGSAIF
Sbjct  242   IVDSATALYRTDFNGRGELSARQMHLAKFLRSLQKLADEFGVAVVITNQVVAQVDGSAIF  301

Query  991   AGPQIKPIGGNIMAHASTTRLALRKGRGEERVCKVVSSPCLAEAEARFQISPEGVTDVKD  1170
             AGPQIKPIGGNIMAHASTTRLALRKGRGEER+CKV+SSPCLAEAEARFQISP GV DVKD
Sbjct  302   AGPQIKPIGGNIMAHASTTRLALRKGRGEERICKVISSPCLAEAEARFQISPGGVADVKD  361



>ref|XP_003609937.1| DNA repair protein RAD51-like protein [Medicago truncatula]
 gb|AES92134.1| DNA repair RAD51-like protein [Medicago truncatula]
Length=341

 Score =   626 bits (1614),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/344 (88%), Positives = 326/344 (95%), Gaps = 3/344 (1%)
 Frame = +1

Query  139   MEQQHRNQQKSVQERQQDEVEEIQHGPFPIEQLQESGISAIDVKKLKDAGLCTVESVVYS  318
             MEQQ    +K+ Q+  Q E EEIQHGP P+EQLQ SGI+A+D+KKLKDAG+CTVESV Y+
Sbjct  1     MEQQRL--EKTAQQHDQ-ETEEIQHGPLPVEQLQASGIAALDIKKLKDAGICTVESVAYT  57

Query  319   PRKDLLQIKGISEAKVDKIIEAASKLVPLGFTSASQLHAQRLEIIQITSGSKELDKVLEG  498
             PRKDLLQIKGIS+AKVDKIIEAA KLVP+GFTSAS+LHAQR  IIQIT+GS+ELDK+LEG
Sbjct  58    PRKDLLQIKGISDAKVDKIIEAAGKLVPMGFTSASELHAQRESIIQITTGSRELDKILEG  117

Query  499   GIETGSITEIYGEFRSGKTQLCHTLCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIA  678
             GIETGSITE+YGEFRSGKTQLCHTLCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIA
Sbjct  118   GIETGSITELYGEFRSGKTQLCHTLCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIA  177

Query  679   DRFGLNGADVLENVAYARAYNTDHQSRLLLEAASMMVETRFALMIVDSATALYRTDFSGR  858
             DRFGLNG DVLENVAYARAYNTDHQSRLLLEAASMMVETRFALMI+DSATALYRTDFSGR
Sbjct  178   DRFGLNGPDVLENVAYARAYNTDHQSRLLLEAASMMVETRFALMIIDSATALYRTDFSGR  237

Query  859   GELSARQMHLAKFLRSLQKLADEFGVAVVITNQVVAQVDGSAIFAGPQIKPIGGNIMAHA  1038
             GELSARQMHLAKFLRSLQKLADEFGVAVV+TNQVV+QVDGSA+FAGPQIKPIGGNIMAHA
Sbjct  238   GELSARQMHLAKFLRSLQKLADEFGVAVVLTNQVVSQVDGSAMFAGPQIKPIGGNIMAHA  297

Query  1039  STTRLALRKGRGEERVCKVVSSPCLAEAEARFQISPEGVTDVKD  1170
             +TTRLALRKGRGEER+CKV+SSPCLAEAEARFQI  EGV+DVKD
Sbjct  298   TTTRLALRKGRGEERICKVISSPCLAEAEARFQILGEGVSDVKD  341



>ref|NP_001066806.1| Os12g0497300 [Oryza sativa Japonica Group]
 dbj|BAB85492.1| Rad51 [Oryza sativa Japonica Group]
 dbj|BAB85493.1| Rad51 [Oryza sativa Japonica Group]
 gb|ABA98592.2| DNA repair protein RAD51, putative, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF29825.1| Os12g0497300 [Oryza sativa Japonica Group]
Length=341

 Score =   626 bits (1614),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/320 (95%), Positives = 315/320 (98%), Gaps = 1/320 (0%)
 Frame = +1

Query  211   HGPFPIEQLQESGISAIDVKKLKDAGLCTVESVVYSPRKDLLQIKGISEAKVDKIIEAAS  390
             HGPFPIEQLQ SGI+A+DVKKLKDAGLCTVESVVYSPRKDLLQIKGISEAKVDKIIE AS
Sbjct  23    HGPFPIEQLQASGIAALDVKKLKDAGLCTVESVVYSPRKDLLQIKGISEAKVDKIIEGAS  82

Query  391   KLVPLGFTSASQLHAQRLEIIQITSGSKELDKVLEGGIETGSITEIYGEFRSGKTQLCHT  570
             KLVPLGFTSASQLHAQRLEIIQ+T+GS+ELDK+L+GGIETGSITEIYGEFRSGKTQLCHT
Sbjct  83    KLVPLGFTSASQLHAQRLEIIQVTTGSRELDKILDGGIETGSITEIYGEFRSGKTQLCHT  142

Query  571   LCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIADRFGLNGADVLENVAYARAYNTDH  750
             LCVTCQLPLDQGGGEGKA+YIDAEGTFRPQRLLQIADRFGLNGADVLENVAYARAYNTDH
Sbjct  143   LCVTCQLPLDQGGGEGKALYIDAEGTFRPQRLLQIADRFGLNGADVLENVAYARAYNTDH  202

Query  751   QSRLLLEAASMMVETRFALMIVDSATALYRTDFSGRGELSARQMHLAKFLRSLQKLADEF  930
             QSRLLLEAASMMVETRFA+MIVDSATALYRTDFSGRGELSARQMHLAKFLRSLQKLADEF
Sbjct  203   QSRLLLEAASMMVETRFAIMIVDSATALYRTDFSGRGELSARQMHLAKFLRSLQKLADEF  262

Query  931   GVAVVITNQVVAQVDGSAIFAGPQIKPIGGNIMAHASTTRLALRKGRGEERVCKVVSSPC  1110
             GVAVVITNQVVAQVDG+A+F GPQIKPIGGNIMAHASTTRL LRKGR EER+CKVVSSPC
Sbjct  263   GVAVVITNQVVAQVDGAAMF-GPQIKPIGGNIMAHASTTRLFLRKGRAEERICKVVSSPC  321

Query  1111  LAEAEARFQISPEGVTDVKD  1170
             LAEAEARFQISPEGVTDVKD
Sbjct  322   LAEAEARFQISPEGVTDVKD  341



>dbj|BAB85491.1| Rad51 [Oryza sativa Japonica Group]
 gb|EEC68525.1| hypothetical protein OsI_36814 [Oryza sativa Indica Group]
Length=339

 Score =   625 bits (1613),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/321 (93%), Positives = 316/321 (98%), Gaps = 0/321 (0%)
 Frame = +1

Query  208   QHGPFPIEQLQESGISAIDVKKLKDAGLCTVESVVYSPRKDLLQIKGISEAKVDKIIEAA  387
             +HGPFPIEQLQ SGI+A+DVKKLKD+GL TVESV Y+PRKDLLQIKGISEAKVDKI+EAA
Sbjct  19    EHGPFPIEQLQASGIAALDVKKLKDSGLYTVESVAYTPRKDLLQIKGISEAKVDKIVEAA  78

Query  388   SKLVPLGFTSASQLHAQRLEIIQITSGSKELDKVLEGGIETGSITEIYGEFRSGKTQLCH  567
             SKLVPLGFTSASQLHAQRLEIIQ+T+GS+ELDK+L+GGIETGSITEIYGEFRSGKTQLCH
Sbjct  79    SKLVPLGFTSASQLHAQRLEIIQVTTGSRELDKILDGGIETGSITEIYGEFRSGKTQLCH  138

Query  568   TLCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIADRFGLNGADVLENVAYARAYNTD  747
             TLCVTCQLPLDQGGGEGKA+YIDAEGTFRPQRLLQIADRFGLNGADVLENVAYARAYNTD
Sbjct  139   TLCVTCQLPLDQGGGEGKALYIDAEGTFRPQRLLQIADRFGLNGADVLENVAYARAYNTD  198

Query  748   HQSRLLLEAASMMVETRFALMIVDSATALYRTDFSGRGELSARQMHLAKFLRSLQKLADE  927
             HQSRLLLEAASMM+ETRFALMIVDSATALYRTDFSGRGELSARQMH+AKFLRSLQKLADE
Sbjct  199   HQSRLLLEAASMMIETRFALMIVDSATALYRTDFSGRGELSARQMHMAKFLRSLQKLADE  258

Query  928   FGVAVVITNQVVAQVDGSAIFAGPQIKPIGGNIMAHASTTRLALRKGRGEERVCKVVSSP  1107
             FGVAVVITNQVVAQVDGSA+FAGPQIKPIGGNIMAHASTTRLALRKGRGEER+CKV+SSP
Sbjct  259   FGVAVVITNQVVAQVDGSAMFAGPQIKPIGGNIMAHASTTRLALRKGRGEERICKVISSP  318

Query  1108  CLAEAEARFQISPEGVTDVKD  1170
             CLAEAEARFQI+ EGV DVKD
Sbjct  319   CLAEAEARFQIASEGVADVKD  339



>ref|XP_002463076.1| hypothetical protein SORBIDRAFT_02g037320 [Sorghum bicolor]
 gb|EER99597.1| hypothetical protein SORBIDRAFT_02g037320 [Sorghum bicolor]
Length=344

 Score =   626 bits (1614),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/326 (91%), Positives = 319/326 (98%), Gaps = 0/326 (0%)
 Frame = +1

Query  193   EVEEIQHGPFPIEQLQESGISAIDVKKLKDAGLCTVESVVYSPRKDLLQIKGISEAKVDK  372
             E EE++HGPFPIEQLQ SGI+A+DVKKLKD+GL TVE+V Y+PRKDL+QIKGISEAKVDK
Sbjct  19    EQEEVEHGPFPIEQLQASGIAALDVKKLKDSGLHTVEAVAYTPRKDLVQIKGISEAKVDK  78

Query  373   IIEAASKLVPLGFTSASQLHAQRLEIIQITSGSKELDKVLEGGIETGSITEIYGEFRSGK  552
             IIEAASK+VPLGFTSASQLHAQRLEIIQ+T+GS+ELDK+LEGGIETGSITEIYGEFRSGK
Sbjct  79    IIEAASKIVPLGFTSASQLHAQRLEIIQVTTGSRELDKILEGGIETGSITEIYGEFRSGK  138

Query  553   TQLCHTLCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIADRFGLNGADVLENVAYAR  732
             TQLCHTLCVTCQLPLDQGGGEGKA+YIDAEGTFRPQRLLQIADRFGLNGADVLENVAYAR
Sbjct  139   TQLCHTLCVTCQLPLDQGGGEGKALYIDAEGTFRPQRLLQIADRFGLNGADVLENVAYAR  198

Query  733   AYNTDHQSRLLLEAASMMVETRFALMIVDSATALYRTDFSGRGELSARQMHLAKFLRSLQ  912
             AYNTDHQSRLLLEAASMM+ETRFALM+VDSATALYRTDFSGRGELSARQMH+AKFLRSLQ
Sbjct  199   AYNTDHQSRLLLEAASMMIETRFALMVVDSATALYRTDFSGRGELSARQMHMAKFLRSLQ  258

Query  913   KLADEFGVAVVITNQVVAQVDGSAIFAGPQIKPIGGNIMAHASTTRLALRKGRGEERVCK  1092
             KLADEFGVAVVITNQVVAQVDGSA+FAGPQ KPIGGNIMAHASTTRLALRKGRGEER+CK
Sbjct  259   KLADEFGVAVVITNQVVAQVDGSAMFAGPQFKPIGGNIMAHASTTRLALRKGRGEERICK  318

Query  1093  VVSSPCLAEAEARFQISPEGVTDVKD  1170
             V+SSPCLAEAEARFQ++ EGV DVKD
Sbjct  319   VISSPCLAEAEARFQLASEGVADVKD  344



>emb|CDP03024.1| unnamed protein product [Coffea canephora]
Length=332

 Score =   625 bits (1612),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/344 (90%), Positives = 323/344 (94%), Gaps = 12/344 (3%)
 Frame = +1

Query  139   MEQQHRNQQKSVQERQQDEVEEIQHGPFPIEQLQESGISAIDVKKLKDAGLCTVESVVYS  318
             MEQQ +  QK VQE Q DE++++QHGPFP+EQLQ SGI+A+D+KKLKDAGLCTVESV YS
Sbjct  1     MEQQRK--QKMVQE-QHDELDDVQHGPFPVEQLQASGIAALDIKKLKDAGLCTVESVAYS  57

Query  319   PRKDLLQIKGISEAKVDKIIEAASKLVPLGFTSASQLHAQRLEIIQITSGSKELDKVLEG  498
             PRK+LLQIKGISEAKVDKIIEA           ASQLHAQRLEIIQI +GSKELDK+LEG
Sbjct  58    PRKELLQIKGISEAKVDKIIEAGI---------ASQLHAQRLEIIQIATGSKELDKILEG  108

Query  499   GIETGSITEIYGEFRSGKTQLCHTLCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIA  678
             GIETGSITEIYGEFRSGKTQLCHTLCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIA
Sbjct  109   GIETGSITEIYGEFRSGKTQLCHTLCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIA  168

Query  679   DRFGLNGADVLENVAYARAYNTDHQSRLLLEAASMMVETRFALMIVDSATALYRTDFSGR  858
             DRFGLNGADVLENVAYARAYNTDHQSRLLLEAASMMVETRFALMIVDSATALYRTDFSGR
Sbjct  169   DRFGLNGADVLENVAYARAYNTDHQSRLLLEAASMMVETRFALMIVDSATALYRTDFSGR  228

Query  859   GELSARQMHLAKFLRSLQKLADEFGVAVVITNQVVAQVDGSAIFAGPQIKPIGGNIMAHA  1038
             GELSARQMHLAKFLRSLQKLADEFGVAVVITNQVVAQVDGSAIFAGPQIKPIGGNIMAHA
Sbjct  229   GELSARQMHLAKFLRSLQKLADEFGVAVVITNQVVAQVDGSAIFAGPQIKPIGGNIMAHA  288

Query  1039  STTRLALRKGRGEERVCKVVSSPCLAEAEARFQISPEGVTDVKD  1170
             +TTRLALRKGR EER+CKV+SSPCLAEAEARFQISPEGVTDVKD
Sbjct  289   TTTRLALRKGRAEERICKVISSPCLAEAEARFQISPEGVTDVKD  332



>gb|KHN17763.1| DNA repair protein RAD51 like [Glycine soja]
Length=338

 Score =   625 bits (1612),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/327 (91%), Positives = 316/327 (97%), Gaps = 0/327 (0%)
 Frame = +1

Query  190   DEVEEIQHGPFPIEQLQESGISAIDVKKLKDAGLCTVESVVYSPRKDLLQIKGISEAKVD  369
             DE EEIQHGP P+EQLQ SGI+A DVKKLKDAG+CTVESV Y+PRKDLLQIKGISEAKVD
Sbjct  12    DEAEEIQHGPLPVEQLQASGIAATDVKKLKDAGICTVESVAYTPRKDLLQIKGISEAKVD  71

Query  370   KIIEAASKLVPLGFTSASQLHAQRLEIIQITSGSKELDKVLEGGIETGSITEIYGEFRSG  549
             KIIEAASKLVP+GFTSAS+LHAQR  IIQIT+GS ELDK+LEGG+ETGSITE+YGEFRSG
Sbjct  72    KIIEAASKLVPMGFTSASELHAQRDAIIQITTGSTELDKILEGGVETGSITELYGEFRSG  131

Query  550   KTQLCHTLCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIADRFGLNGADVLENVAYA  729
             KTQLCHTLCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIADRFGLNGADVLENVAYA
Sbjct  132   KTQLCHTLCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIADRFGLNGADVLENVAYA  191

Query  730   RAYNTDHQSRLLLEAASMMVETRFALMIVDSATALYRTDFSGRGELSARQMHLAKFLRSL  909
             RAYNTDHQSRLLLEAASMMVETRFA+MIVDSATALYRTDFSGRGELSARQMHL +FLRSL
Sbjct  192   RAYNTDHQSRLLLEAASMMVETRFAVMIVDSATALYRTDFSGRGELSARQMHLPRFLRSL  251

Query  910   QKLADEFGVAVVITNQVVAQVDGSAIFAGPQIKPIGGNIMAHASTTRLALRKGRGEERVC  1089
             QKLADEFGVA+VITNQVV+QVDGSA+FAGPQIKPIGGNIMAHA+TTRLALRKGRGEER+C
Sbjct  252   QKLADEFGVAIVITNQVVSQVDGSAVFAGPQIKPIGGNIMAHATTTRLALRKGRGEERIC  311

Query  1090  KVVSSPCLAEAEARFQISPEGVTDVKD  1170
             KV+SSPCLAEAEARFQI  EGV+DVKD
Sbjct  312   KVISSPCLAEAEARFQICAEGVSDVKD  338



>ref|NP_001068279.1| Os11g0615800 [Oryza sativa Japonica Group]
 dbj|BAB85490.1| Rad51 [Oryza sativa Japonica Group]
 gb|ABA94698.1| DNA repair protein RAD51, putative, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF28642.1| Os11g0615800 [Oryza sativa Japonica Group]
 gb|EEC75794.1| hypothetical protein OsI_12723 [Oryza sativa Indica Group]
 gb|EEE52465.1| hypothetical protein OsJ_34631 [Oryza sativa Japonica Group]
Length=339

 Score =   625 bits (1612),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/321 (93%), Positives = 316/321 (98%), Gaps = 0/321 (0%)
 Frame = +1

Query  208   QHGPFPIEQLQESGISAIDVKKLKDAGLCTVESVVYSPRKDLLQIKGISEAKVDKIIEAA  387
             +HGPFPIEQLQ SGI+A+DVKKLKD+GL TVESV Y+PRKDLLQIKGISEAKVDKI+EAA
Sbjct  19    EHGPFPIEQLQASGIAALDVKKLKDSGLYTVESVAYTPRKDLLQIKGISEAKVDKIVEAA  78

Query  388   SKLVPLGFTSASQLHAQRLEIIQITSGSKELDKVLEGGIETGSITEIYGEFRSGKTQLCH  567
             SKLVPLGFTSASQLHAQRLEIIQ+T+GS+ELDK+L+GGIETGSITEIYGEFRSGKTQLCH
Sbjct  79    SKLVPLGFTSASQLHAQRLEIIQVTTGSRELDKILDGGIETGSITEIYGEFRSGKTQLCH  138

Query  568   TLCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIADRFGLNGADVLENVAYARAYNTD  747
             TLCVTCQLPLDQGGGEGKA+YIDAEGTFRPQRLLQIADRFGLNGADVLENVAYARAYNTD
Sbjct  139   TLCVTCQLPLDQGGGEGKALYIDAEGTFRPQRLLQIADRFGLNGADVLENVAYARAYNTD  198

Query  748   HQSRLLLEAASMMVETRFALMIVDSATALYRTDFSGRGELSARQMHLAKFLRSLQKLADE  927
             HQSRLLLEAASMM+ETRFALMIVDSATALYRTDFSGRGELSARQMH+AKFLRSLQKLADE
Sbjct  199   HQSRLLLEAASMMIETRFALMIVDSATALYRTDFSGRGELSARQMHMAKFLRSLQKLADE  258

Query  928   FGVAVVITNQVVAQVDGSAIFAGPQIKPIGGNIMAHASTTRLALRKGRGEERVCKVVSSP  1107
             FGVAVVITNQVVAQVDGSA+FAGPQIKPIGGNIMAHASTTRLALRKGRGEER+CKV+SSP
Sbjct  259   FGVAVVITNQVVAQVDGSAMFAGPQIKPIGGNIMAHASTTRLALRKGRGEERICKVISSP  318

Query  1108  CLAEAEARFQISPEGVTDVKD  1170
             CLAEAEARFQI+ EGV DVKD
Sbjct  319   CLAEAEARFQIASEGVADVKD  339



>ref|XP_004979726.1| PREDICTED: DNA repair protein RAD51 homolog A-like [Setaria italica]
Length=340

 Score =   625 bits (1612),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/322 (92%), Positives = 317/322 (98%), Gaps = 0/322 (0%)
 Frame = +1

Query  205   IQHGPFPIEQLQESGISAIDVKKLKDAGLCTVESVVYSPRKDLLQIKGISEAKVDKIIEA  384
             ++HGPFPIEQLQ SGI+A+DVKKLKD+GL TVE+V Y+PRKDLLQIKGISEAKVDKI+EA
Sbjct  19    VEHGPFPIEQLQASGIAALDVKKLKDSGLHTVEAVAYTPRKDLLQIKGISEAKVDKIVEA  78

Query  385   ASKLVPLGFTSASQLHAQRLEIIQITSGSKELDKVLEGGIETGSITEIYGEFRSGKTQLC  564
             ASK+VPLGFTSASQLHAQRLEIIQ+T+GS+ELDK+LEGGIETGSITEIYGEFRSGKTQLC
Sbjct  79    ASKIVPLGFTSASQLHAQRLEIIQVTTGSRELDKILEGGIETGSITEIYGEFRSGKTQLC  138

Query  565   HTLCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIADRFGLNGADVLENVAYARAYNT  744
             HTLCVTCQLPLDQGGGEGKA+YIDAEGTFRPQRLLQIADRFGLNGADVLENVAYARAYNT
Sbjct  139   HTLCVTCQLPLDQGGGEGKALYIDAEGTFRPQRLLQIADRFGLNGADVLENVAYARAYNT  198

Query  745   DHQSRLLLEAASMMVETRFALMIVDSATALYRTDFSGRGELSARQMHLAKFLRSLQKLAD  924
             DHQSRLLLEAASMM+ETRFALM+VDSATALYRTDFSGRGELSARQMH+AKFLRSLQKLAD
Sbjct  199   DHQSRLLLEAASMMIETRFALMVVDSATALYRTDFSGRGELSARQMHMAKFLRSLQKLAD  258

Query  925   EFGVAVVITNQVVAQVDGSAIFAGPQIKPIGGNIMAHASTTRLALRKGRGEERVCKVVSS  1104
             EFGVAVVITNQVVAQVDGSA+FAGPQIKPIGGNIMAHASTTRLALRKGRGEER+CKV+SS
Sbjct  259   EFGVAVVITNQVVAQVDGSAMFAGPQIKPIGGNIMAHASTTRLALRKGRGEERICKVISS  318

Query  1105  PCLAEAEARFQISPEGVTDVKD  1170
             PCLAEAEARFQI+ EGV DVKD
Sbjct  319   PCLAEAEARFQIASEGVADVKD  340



>gb|AFP73608.1| DNA repair protein RAD51 [Hordeum vulgare subsp. vulgare]
Length=343

 Score =   622 bits (1605),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/320 (93%), Positives = 313/320 (98%), Gaps = 0/320 (0%)
 Frame = +1

Query  211   HGPFPIEQLQESGISAIDVKKLKDAGLCTVESVVYSPRKDLLQIKGISEAKVDKIIEAAS  390
             HGPFPIE LQ SGI+A+DVKKLKDAGLCTVESV YSPRKDLLQIKGISEAKVDKI+EAAS
Sbjct  24    HGPFPIEHLQASGIAAVDVKKLKDAGLCTVESVAYSPRKDLLQIKGISEAKVDKIMEAAS  83

Query  391   KLVPLGFTSASQLHAQRLEIIQITSGSKELDKVLEGGIETGSITEIYGEFRSGKTQLCHT  570
             KLVPLGFTSA+QLHAQRLEIIQ+T+GS+ELD++L+GGIETGSITE+YGEFR GKTQLCHT
Sbjct  84    KLVPLGFTSATQLHAQRLEIIQVTTGSRELDRILDGGIETGSITELYGEFRCGKTQLCHT  143

Query  571   LCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIADRFGLNGADVLENVAYARAYNTDH  750
             LCVTCQLPLDQGGGEGKA+YIDAEGTFRPQRLLQIADRFGLNGADVLENVAYARAYNTDH
Sbjct  144   LCVTCQLPLDQGGGEGKALYIDAEGTFRPQRLLQIADRFGLNGADVLENVAYARAYNTDH  203

Query  751   QSRLLLEAASMMVETRFALMIVDSATALYRTDFSGRGELSARQMHLAKFLRSLQKLADEF  930
             QSRLLLEAASMMVETRFALM++DSATALYRTDFSGRGELSARQMHLAKFLRSLQKLADEF
Sbjct  204   QSRLLLEAASMMVETRFALMVIDSATALYRTDFSGRGELSARQMHLAKFLRSLQKLADEF  263

Query  931   GVAVVITNQVVAQVDGSAIFAGPQIKPIGGNIMAHASTTRLALRKGRGEERVCKVVSSPC  1110
             GVAVVI+NQVVAQVDG A+FAGPQIKPIGGNIMAHASTTRL LRKGR EER+CKVVSSPC
Sbjct  264   GVAVVISNQVVAQVDGGAMFAGPQIKPIGGNIMAHASTTRLYLRKGRAEERICKVVSSPC  323

Query  1111  LAEAEARFQISPEGVTDVKD  1170
             LAEAEARFQISPEGVTDVKD
Sbjct  324   LAEAEARFQISPEGVTDVKD  343



>gb|ACF79638.1| unknown [Zea mays]
 gb|ACG31865.1| DNA repair protein RAD51 [Zea mays]
 tpg|DAA63288.1| TPA: DNA repair protein RAD51-like protein A [Zea mays]
Length=340

 Score =   621 bits (1601),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/322 (91%), Positives = 315/322 (98%), Gaps = 0/322 (0%)
 Frame = +1

Query  205   IQHGPFPIEQLQESGISAIDVKKLKDAGLCTVESVVYSPRKDLLQIKGISEAKVDKIIEA  384
             ++HGPFPIEQLQ SGI+A+DVKKLKD+GL TVE+V Y+PRKDLLQIKGISEAK DKIIEA
Sbjct  19    VEHGPFPIEQLQASGIAALDVKKLKDSGLHTVEAVAYTPRKDLLQIKGISEAKADKIIEA  78

Query  385   ASKLVPLGFTSASQLHAQRLEIIQITSGSKELDKVLEGGIETGSITEIYGEFRSGKTQLC  564
             ASK+VPLGFTSASQLHAQRLEIIQ+T+GS+ELDK+LEGGIETGSITEIYGEFRSGKTQLC
Sbjct  79    ASKIVPLGFTSASQLHAQRLEIIQVTTGSRELDKILEGGIETGSITEIYGEFRSGKTQLC  138

Query  565   HTLCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIADRFGLNGADVLENVAYARAYNT  744
             HTLCVTCQLPLDQGGGEGKA+YIDAEGTFRPQRLLQIADRFGLNGADVLENVAYARAYNT
Sbjct  139   HTLCVTCQLPLDQGGGEGKALYIDAEGTFRPQRLLQIADRFGLNGADVLENVAYARAYNT  198

Query  745   DHQSRLLLEAASMMVETRFALMIVDSATALYRTDFSGRGELSARQMHLAKFLRSLQKLAD  924
             DHQSRLLLEAASMM+ETRFALM+VDSATALYRTDFSGRGELSARQMH+AKFLRSLQKLAD
Sbjct  199   DHQSRLLLEAASMMIETRFALMVVDSATALYRTDFSGRGELSARQMHMAKFLRSLQKLAD  258

Query  925   EFGVAVVITNQVVAQVDGSAIFAGPQIKPIGGNIMAHASTTRLALRKGRGEERVCKVVSS  1104
             EFGVAVVITNQVVAQVDGSA+FAGPQ KPIGGNIMAHASTTRLALRKGRGEER+CKV+SS
Sbjct  259   EFGVAVVITNQVVAQVDGSAMFAGPQFKPIGGNIMAHASTTRLALRKGRGEERICKVISS  318

Query  1105  PCLAEAEARFQISPEGVTDVKD  1170
             PCLAEAEARFQ++ EG+ DVKD
Sbjct  319   PCLAEAEARFQLASEGIADVKD  340



>ref|XP_002449862.1| hypothetical protein SORBIDRAFT_05g024565 [Sorghum bicolor]
 gb|EES08850.1| hypothetical protein SORBIDRAFT_05g024565, partial [Sorghum bicolor]
Length=340

 Score =   621 bits (1601),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/323 (92%), Positives = 316/323 (98%), Gaps = 0/323 (0%)
 Frame = +1

Query  202   EIQHGPFPIEQLQESGISAIDVKKLKDAGLCTVESVVYSPRKDLLQIKGISEAKVDKIIE  381
             E +HG FPIEQLQ SGI+A+DVKKLKD+GL TVE+V Y+PRKDL+QIKGISEAKVDKIIE
Sbjct  15    EGEHGAFPIEQLQASGIAALDVKKLKDSGLHTVEAVAYTPRKDLVQIKGISEAKVDKIIE  74

Query  382   AASKLVPLGFTSASQLHAQRLEIIQITSGSKELDKVLEGGIETGSITEIYGEFRSGKTQL  561
             AASK+VPLGFTSASQLHAQRLEIIQ+T+GS+ELDK+LEGGIETGSITEIYGEFRSGKTQL
Sbjct  75    AASKIVPLGFTSASQLHAQRLEIIQVTTGSRELDKILEGGIETGSITEIYGEFRSGKTQL  134

Query  562   CHTLCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIADRFGLNGADVLENVAYARAYN  741
             CHTLCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIADRFGLNGADVLENVAYARAYN
Sbjct  135   CHTLCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIADRFGLNGADVLENVAYARAYN  194

Query  742   TDHQSRLLLEAASMMVETRFALMIVDSATALYRTDFSGRGELSARQMHLAKFLRSLQKLA  921
             TDHQSRLLLEAASMM+ETRFALM+VDSATALYRTDFSGRGELSARQMH+AKFLRSLQKLA
Sbjct  195   TDHQSRLLLEAASMMIETRFALMVVDSATALYRTDFSGRGELSARQMHMAKFLRSLQKLA  254

Query  922   DEFGVAVVITNQVVAQVDGSAIFAGPQIKPIGGNIMAHASTTRLALRKGRGEERVCKVVS  1101
             DEFGVAVVITNQVVAQVDGSA+FAGPQIKPIGGNIMAHASTTRLALRKGRGEER+CKV+S
Sbjct  255   DEFGVAVVITNQVVAQVDGSAMFAGPQIKPIGGNIMAHASTTRLALRKGRGEERICKVIS  314

Query  1102  SPCLAEAEARFQISPEGVTDVKD  1170
             SPCLAEAEARFQI+ EGV DVKD
Sbjct  315   SPCLAEAEARFQIASEGVADVKD  337



>gb|ABI58231.1| Rad51 protein [Oryza sativa Indica Group]
Length=332

 Score =   619 bits (1597),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/321 (93%), Positives = 313/321 (98%), Gaps = 1/321 (0%)
 Frame = +1

Query  208   QHGPFPIEQLQESGISAIDVKKLKDAGLCTVESVVYSPRKDLLQIKGISEAKVDKIIEAA  387
             +HGPFPIEQLQ  GI+A+DVKKLKDAGLCTVESVVYSPRKDLLQIKGISEAKVDKIIEAA
Sbjct  13    EHGPFPIEQLQAPGIAAVDVKKLKDAGLCTVESVVYSPRKDLLQIKGISEAKVDKIIEAA  72

Query  388   SKLVPLGFTSASQLHAQRLEIIQITSGSKELDKVLEGGIETGSITEIYGEFRSGKTQLCH  567
             SKLVPLGFTSASQLHAQRLEIIQ+T+GS+ELDK+L+GGIETGSITEIYGEFRSGKTQLCH
Sbjct  73    SKLVPLGFTSASQLHAQRLEIIQVTTGSRELDKILDGGIETGSITEIYGEFRSGKTQLCH  132

Query  568   TLCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIADRFGLNGADVLENVAYARAYNTD  747
             TLCVTCQLPLD GGGEGKA+YIDAEGTFRPQR LQIADRFGLNGADVLENVAYARAYNTD
Sbjct  133   TLCVTCQLPLDHGGGEGKALYIDAEGTFRPQRFLQIADRFGLNGADVLENVAYARAYNTD  192

Query  748   HQSRLLLEAASMMVETRFALMIVDSATALYRTDFSGRGELSARQMHLAKFLRSLQKLADE  927
             HQSRLLL AASMMVETRFA+MIVDSATALYRTDFSGRGELSARQMHLAKFLRSLQKLADE
Sbjct  193   HQSRLLLGAASMMVETRFAIMIVDSATALYRTDFSGRGELSARQMHLAKFLRSLQKLADE  252

Query  928   FGVAVVITNQVVAQVDGSAIFAGPQIKPIGGNIMAHASTTRLALRKGRGEERVCKVVSSP  1107
             FGVAVVITNQVVAQVDG+A+F GPQIKPIGGNIMAHASTTRL LRKGR EER+CKVVSSP
Sbjct  253   FGVAVVITNQVVAQVDGAAMF-GPQIKPIGGNIMAHASTTRLFLRKGRAEERICKVVSSP  311

Query  1108  CLAEAEARFQISPEGVTDVKD  1170
             CLAEAEARFQISPEGVTDVKD
Sbjct  312   CLAEAEARFQISPEGVTDVKD  332



>ref|NP_001104918.1| DNA repair protein RAD51 homolog A [Zea mays]
 sp|Q67EU8.2|R51A1_MAIZE RecName: Full=DNA repair protein RAD51 homolog A; AltName: Full=Rad51-like 
protein A; Short=RAD51A; AltName: Full=ZmRAD51a 
[Zea mays]
 gb|AAD32029.1|AF079428_1 RAD51 homolog RAD51A [Zea mays]
Length=340

 Score =   618 bits (1594),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/322 (91%), Positives = 314/322 (98%), Gaps = 0/322 (0%)
 Frame = +1

Query  205   IQHGPFPIEQLQESGISAIDVKKLKDAGLCTVESVVYSPRKDLLQIKGISEAKVDKIIEA  384
             ++HGPFPIEQLQ SGI+A+DVKKLKD+GL TVE+V Y+PRKDLLQIKGISEAK DKIIEA
Sbjct  19    VEHGPFPIEQLQASGIAALDVKKLKDSGLHTVEAVAYTPRKDLLQIKGISEAKADKIIEA  78

Query  385   ASKLVPLGFTSASQLHAQRLEIIQITSGSKELDKVLEGGIETGSITEIYGEFRSGKTQLC  564
             ASK+VPLGFTSASQLHAQRLEIIQ+T+GS+ELDK+LEGGIETGSITEIYGEFRSGKTQLC
Sbjct  79    ASKIVPLGFTSASQLHAQRLEIIQVTTGSRELDKILEGGIETGSITEIYGEFRSGKTQLC  138

Query  565   HTLCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIADRFGLNGADVLENVAYARAYNT  744
             HT CVTCQLPLDQGGGEGKA+YIDAEGTFRPQRLLQIADRFGLNGADVLENVAYARAYNT
Sbjct  139   HTPCVTCQLPLDQGGGEGKALYIDAEGTFRPQRLLQIADRFGLNGADVLENVAYARAYNT  198

Query  745   DHQSRLLLEAASMMVETRFALMIVDSATALYRTDFSGRGELSARQMHLAKFLRSLQKLAD  924
             DHQSRLLLEAASMM+ETRFALM+VDSATALYRTDFSGRGELSARQMH+AKFLRSLQKLAD
Sbjct  199   DHQSRLLLEAASMMIETRFALMVVDSATALYRTDFSGRGELSARQMHMAKFLRSLQKLAD  258

Query  925   EFGVAVVITNQVVAQVDGSAIFAGPQIKPIGGNIMAHASTTRLALRKGRGEERVCKVVSS  1104
             EFGVAVVITNQVVAQVDGSA+FAGPQ KPIGGNIMAHASTTRLALRKGRGEER+CKV+SS
Sbjct  259   EFGVAVVITNQVVAQVDGSAMFAGPQFKPIGGNIMAHASTTRLALRKGRGEERICKVISS  318

Query  1105  PCLAEAEARFQISPEGVTDVKD  1170
             PCLAEAEARFQ++ EG+ DVKD
Sbjct  319   PCLAEAEARFQLASEGIADVKD  340



>gb|EYU28293.1| hypothetical protein MIMGU_mgv1a020539mg [Erythranthe guttata]
Length=341

 Score =   617 bits (1591),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/321 (92%), Positives = 310/321 (97%), Gaps = 0/321 (0%)
 Frame = +1

Query  208   QHGPFPIEQLQESGISAIDVKKLKDAGLCTVESVVYSPRKDLLQIKGISEAKVDKIIEAA  387
              HGP P+EQLQ SGI+A+D+KKLKDAGLCTVESV YSPRK+LL IKGIS+AKVDKIIEAA
Sbjct  21    HHGPIPVEQLQASGIAAVDIKKLKDAGLCTVESVAYSPRKELLLIKGISDAKVDKIIEAA  80

Query  388   SKLVPLGFTSASQLHAQRLEIIQITSGSKELDKVLEGGIETGSITEIYGEFRSGKTQLCH  567
             SKLVPLGFTSA Q HAQR++IIQITSGSKELDK+LEGGIETGSITE+YGEFRSGKTQLCH
Sbjct  81    SKLVPLGFTSAGQFHAQRVDIIQITSGSKELDKILEGGIETGSITELYGEFRSGKTQLCH  140

Query  568   TLCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIADRFGLNGADVLENVAYARAYNTD  747
             TLCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIADRFGLNG DVLENVAYARAYNTD
Sbjct  141   TLCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIADRFGLNGPDVLENVAYARAYNTD  200

Query  748   HQSRLLLEAASMMVETRFALMIVDSATALYRTDFSGRGELSARQMHLAKFLRSLQKLADE  927
             HQSRLLLEAASMMVETRFALMIVDSATALYRTDFSGRGELSARQMHLAKFLRSLQKLADE
Sbjct  201   HQSRLLLEAASMMVETRFALMIVDSATALYRTDFSGRGELSARQMHLAKFLRSLQKLADE  260

Query  928   FGVAVVITNQVVAQVDGSAIFAGPQIKPIGGNIMAHASTTRLALRKGRGEERVCKVVSSP  1107
             FGVAVVITNQVVAQVDGSA+FAGPQ KPIGGNIMAHA+TTRLA+RKGRGEER+CKVVSSP
Sbjct  261   FGVAVVITNQVVAQVDGSAMFAGPQFKPIGGNIMAHATTTRLAMRKGRGEERICKVVSSP  320

Query  1108  CLAEAEARFQISPEGVTDVKD  1170
             CLAEAEARFQIS EGV DVKD
Sbjct  321   CLAEAEARFQISVEGVIDVKD  341



>ref|XP_006452910.1| hypothetical protein CICLE_v10010591mg, partial [Citrus clementina]
 gb|ESR66150.1| hypothetical protein CICLE_v10010591mg, partial [Citrus clementina]
Length=310

 Score =   613 bits (1582),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/309 (96%), Positives = 306/309 (99%), Gaps = 0/309 (0%)
 Frame = +1

Query  244   SGISAIDVKKLKDAGLCTVESVVYSPRKDLLQIKGISEAKVDKIIEAASKLVPLGFTSAS  423
             SGI+A+DVKKLKDAGLCTVESV YSPRK+LLQIKGISEAKVDKIIEAASKLVPLGFTSA+
Sbjct  2     SGIAALDVKKLKDAGLCTVESVAYSPRKELLQIKGISEAKVDKIIEAASKLVPLGFTSAT  61

Query  424   QLHAQRLEIIQITSGSKELDKVLEGGIETGSITEIYGEFRSGKTQLCHTLCVTCQLPLDQ  603
             QLHAQRLEIIQITSGS+ELDK+LEGGIETGSITEIYGEFRSGKTQLCHTLCVTCQLPLDQ
Sbjct  62    QLHAQRLEIIQITSGSRELDKILEGGIETGSITEIYGEFRSGKTQLCHTLCVTCQLPLDQ  121

Query  604   GGGEGKAMYIDAEGTFRPQRLLQIADRFGLNGADVLENVAYARAYNTDHQSRLLLEAASM  783
             GGGEGKAMYIDAEGTFRPQRLLQIADR+GLNGADVLENVAYARAYNTDHQSRLLLEAASM
Sbjct  122   GGGEGKAMYIDAEGTFRPQRLLQIADRYGLNGADVLENVAYARAYNTDHQSRLLLEAASM  181

Query  784   MVETRFALMIVDSATALYRTDFSGRGELSARQMHLAKFLRSLQKLADEFGVAVVITNQVV  963
             MVETRFALMIVDSATALYRTDFSGRGELSARQMHLAKFLRSLQKLADEFGVAVVITNQVV
Sbjct  182   MVETRFALMIVDSATALYRTDFSGRGELSARQMHLAKFLRSLQKLADEFGVAVVITNQVV  241

Query  964   AQVDGSAIFAGPQIKPIGGNIMAHASTTRLALRKGRGEERVCKVVSSPCLAEAEARFQIS  1143
             AQVDGSAIFAGPQIKPIGGNIMAHASTTRLALRKGRGEERVCKV+SSPCLAEAEARFQIS
Sbjct  242   AQVDGSAIFAGPQIKPIGGNIMAHASTTRLALRKGRGEERVCKVISSPCLAEAEARFQIS  301

Query  1144  PEGVTDVKD  1170
              EGV DVKD
Sbjct  302   AEGVADVKD  310



>ref|XP_006664568.1| PREDICTED: DNA repair protein RAD51 homolog B-like [Oryza brachyantha]
Length=315

 Score =   613 bits (1582),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/309 (96%), Positives = 307/309 (99%), Gaps = 0/309 (0%)
 Frame = +1

Query  244   SGISAIDVKKLKDAGLCTVESVVYSPRKDLLQIKGISEAKVDKIIEAASKLVPLGFTSAS  423
             SGI+A+DVKKLKDAGLCTVESVVYSPRKDLLQIKGISEAKVDKIIEAASKLVPLGFTSAS
Sbjct  7     SGIAALDVKKLKDAGLCTVESVVYSPRKDLLQIKGISEAKVDKIIEAASKLVPLGFTSAS  66

Query  424   QLHAQRLEIIQITSGSKELDKVLEGGIETGSITEIYGEFRSGKTQLCHTLCVTCQLPLDQ  603
             QLHAQRLEIIQ+T+GS+ELDK+LEGGIETGSITEIYGEFRSGKTQLCHTLCVTCQLPLDQ
Sbjct  67    QLHAQRLEIIQVTTGSRELDKILEGGIETGSITEIYGEFRSGKTQLCHTLCVTCQLPLDQ  126

Query  604   GGGEGKAMYIDAEGTFRPQRLLQIADRFGLNGADVLENVAYARAYNTDHQSRLLLEAASM  783
             GGGEGKA+YIDAEGTFRPQRLLQIADRFGLNGADVLENVAYARAYNTDHQSRLLLEAASM
Sbjct  127   GGGEGKALYIDAEGTFRPQRLLQIADRFGLNGADVLENVAYARAYNTDHQSRLLLEAASM  186

Query  784   MVETRFALMIVDSATALYRTDFSGRGELSARQMHLAKFLRSLQKLADEFGVAVVITNQVV  963
             MVETRFALMIVDSATALYRTDFSGRGELSARQMHLAKFLRSLQKLADEFGVAVVITNQVV
Sbjct  187   MVETRFALMIVDSATALYRTDFSGRGELSARQMHLAKFLRSLQKLADEFGVAVVITNQVV  246

Query  964   AQVDGSAIFAGPQIKPIGGNIMAHASTTRLALRKGRGEERVCKVVSSPCLAEAEARFQIS  1143
             AQVDG+A+FAGPQIKPIGGNIMAHASTTRL LRKGR EER+CKV+SSPCLAEAEARFQIS
Sbjct  247   AQVDGAAMFAGPQIKPIGGNIMAHASTTRLFLRKGRAEERICKVISSPCLAEAEARFQIS  306

Query  1144  PEGVTDVKD  1170
             PEGVTDVKD
Sbjct  307   PEGVTDVKD  315



>gb|EMT30060.1| DNA repair RAD51-B-like protein [Aegilops tauschii]
Length=369

 Score =   615 bits (1586),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/347 (87%), Positives = 315/347 (91%), Gaps = 27/347 (8%)
 Frame = +1

Query  211   HGPFPIEQLQESGISAIDVKKLKDAGLCTVESVVYSPRKDLLQIKGISEAKVDKIIEA--  384
             HGPFPIEQLQ SGI+A+DVKKLKDAGLCTVESV YSPRKDLLQIKGISEAKVDKIIEA  
Sbjct  23    HGPFPIEQLQASGIAAVDVKKLKDAGLCTVESVAYSPRKDLLQIKGISEAKVDKIIEAGK  82

Query  385   -------------------------ASKLVPLGFTSASQLHAQRLEIIQITSGSKELDKV  489
                                      ASKLVPLGFTSA+QLHAQRLEIIQ+T+GS+ELDK+
Sbjct  83    NIVCIASYTKEFPHAKVLNVDKHLTASKLVPLGFTSATQLHAQRLEIIQVTTGSRELDKI  142

Query  490   LEGGIETGSITEIYGEFRSGKTQLCHTLCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLL  669
             LEGGIETGSITE+YGEFRSGKTQLCHTLCVTCQLPLDQGGGEGKA+YIDAEGTFRPQRLL
Sbjct  143   LEGGIETGSITELYGEFRSGKTQLCHTLCVTCQLPLDQGGGEGKALYIDAEGTFRPQRLL  202

Query  670   QIADRFGLNGADVLENVAYARAYNTDHQSRLLLEAASMMVETRFALMIVDSATALYRTDF  849
             QIADRFGLNGADVLENVAYARAYNTDHQSRLLLEAASMMVETRFALM++DSATALYRTDF
Sbjct  203   QIADRFGLNGADVLENVAYARAYNTDHQSRLLLEAASMMVETRFALMVIDSATALYRTDF  262

Query  850   SGRGELSARQMHLAKFLRSLQKLADEFGVAVVITNQVVAQVDGSAIFAGPQIKPIGGNIM  1029
             SGRGELSARQMHLAKFLRSLQKLADEFGVAVVI+NQVVAQVDG A+FAGPQIKPIGGNIM
Sbjct  263   SGRGELSARQMHLAKFLRSLQKLADEFGVAVVISNQVVAQVDGGAMFAGPQIKPIGGNIM  322

Query  1030  AHASTTRLALRKGRGEERVCKVVSSPCLAEAEARFQISPEGVTDVKD  1170
             AHASTTRL LRKGR EER+CKVVSSPCLAEAEARFQISPEGVTDVKD
Sbjct  323   AHASTTRLYLRKGRAEERICKVVSSPCLAEAEARFQISPEGVTDVKD  369



>ref|XP_010107088.1| DNA repair protein RAD51-like protein [Morus notabilis]
 gb|EXC13609.1| DNA repair protein RAD51-like protein [Morus notabilis]
Length=364

 Score =   606 bits (1563),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/366 (84%), Positives = 323/366 (88%), Gaps = 26/366 (7%)
 Frame = +1

Query  139   MEQQHRNQQKSVQERQQDEVEEIQHGPFPIEQLQESGISAIDVKKLKDAGLCTVESVVYS  318
             MEQQ RNQ++  +  + +E    QHGP P+EQLQ SGI++IDVKKLKDAGLCTVESV YS
Sbjct  3     MEQQ-RNQKEVQEHEELEEA---QHGPSPVEQLQASGIASIDVKKLKDAGLCTVESVAYS  58

Query  319   PRKDLLQIKGISEAKVDKIIEAASK-LVPLGFTSASQLHAQRLEIIQITSGSKELDKVLE  495
             PRKDLL IKGISEAKVDKIIEA    LVPLGFTSASQLHAQRLEIIQITSGS+ELDK+LE
Sbjct  59    PRKDLLHIKGISEAKVDKIIEAGMPILVPLGFTSASQLHAQRLEIIQITSGSRELDKILE  118

Query  496   GGIETGSITEIYGEFRSGKTQLCHTLCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQI  675
             GGIETGSITE+YGEFRSGKTQLCHTLCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQI
Sbjct  119   GGIETGSITELYGEFRSGKTQLCHTLCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQI  178

Query  676   ADRFGLNGADVLENVAYARAYNTDHQSRLLLEAASMM---------------------VE  792
             ADRFGLNGADVLENVAYARAYNTDHQSRLLLEAASMM                       
Sbjct  179   ADRFGLNGADVLENVAYARAYNTDHQSRLLLEAASMMSCINCGYNNASKSKTNEFEWIWL  238

Query  793   TRFALMIVDSATALYRTDFSGRGELSARQMHLAKFLRSLQKLADEFGVAVVITNQVVAQV  972
              RFALMIVDSATALYRTDFSGRGELSARQMHLAKFLRSLQKLADEFGVAVVITNQVVAQV
Sbjct  239   YRFALMIVDSATALYRTDFSGRGELSARQMHLAKFLRSLQKLADEFGVAVVITNQVVAQV  298

Query  973   DGSAIFAGPQIKPIGGNIMAHASTTRLALRKGRGEERVCKVVSSPCLAEAEARFQISPEG  1152
             DGSAIFAGPQ+KPIGGNIMAHASTTRLALRKGRGEER+CKV+SSPCLAEAEARFQI+ EG
Sbjct  299   DGSAIFAGPQVKPIGGNIMAHASTTRLALRKGRGEERICKVISSPCLAEAEARFQIAGEG  358

Query  1153  VTDVKD  1170
             VTDVKD
Sbjct  359   VTDVKD  364



>ref|XP_006381549.1| hypothetical protein POPTR_0006s13750g [Populus trichocarpa]
 gb|ERP59346.1| hypothetical protein POPTR_0006s13750g [Populus trichocarpa]
Length=348

 Score =   605 bits (1561),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/359 (85%), Positives = 322/359 (90%), Gaps = 26/359 (7%)
 Frame = +1

Query  139   MEQQHRNQQKSVQERQQDEVEEIQHGPFPIEQLQESGISAIDVKKLKDAGLCTVESVVYS  318
             MEQQ RNQ K+V ++Q ++ EE+QHGPFP+EQLQ SGI+++DVKKLKDAGLCTVESV +S
Sbjct  1     MEQQ-RNQ-KAVNQQQHEDHEEVQHGPFPVEQLQASGIASLDVKKLKDAGLCTVESVAFS  58

Query  319   PRKDLLQIKGISEAKVDKIIEAASKLVPLGFTSASQLHAQRLEIIQITSGSKELDKVLEG  498
             PRK+LLQIKGISEAKVDKIIEA           ASQLHAQR EIIQITSGS+ELDK+LEG
Sbjct  59    PRKELLQIKGISEAKVDKIIEAGI---------ASQLHAQRQEIIQITSGSRELDKILEG  109

Query  499   GIE---------------TGSITEIYGEFRSGKTQLCHTLCVTCQLPLDQGGGEGKAMYI  633
               +               TGSITE+YGEFRSGKTQLCHTLCVTCQLPLDQGGGEGKAMYI
Sbjct  110   KYQRFLSTLNNDPITLDSTGSITEMYGEFRSGKTQLCHTLCVTCQLPLDQGGGEGKAMYI  169

Query  634   DAEGTFRPQRLLQIADRFGLNGADVLENVAYARAYNTDHQSRLLLEAASMMVETRFALMI  813
             DAEGTFRPQRLLQIADRFGLNGADVLENVAYARAYNTDHQSRLLLEAASMMVETRFALMI
Sbjct  170   DAEGTFRPQRLLQIADRFGLNGADVLENVAYARAYNTDHQSRLLLEAASMMVETRFALMI  229

Query  814   VDSATALYRTDFSGRGELSARQMHLAKFLRSLQKLADEFGVAVVITNQVVAQVDGSAIFA  993
             VDSATALYRTDFSGRGELSARQMHLAKFLRSLQKLADEFGVAVVITNQVVAQVDGSAIFA
Sbjct  230   VDSATALYRTDFSGRGELSARQMHLAKFLRSLQKLADEFGVAVVITNQVVAQVDGSAIFA  289

Query  994   GPQIKPIGGNIMAHASTTRLALRKGRGEERVCKVVSSPCLAEAEARFQISPEGVTDVKD  1170
             GPQIKPIGGNIMAHASTTRLALRKGRGEER+CKV+SSPCLAEAEARFQIS EGVTDVKD
Sbjct  290   GPQIKPIGGNIMAHASTTRLALRKGRGEERICKVISSPCLAEAEARFQISAEGVTDVKD  348



>ref|XP_004962956.1| PREDICTED: LOW QUALITY PROTEIN: DNA repair protein RAD51 homolog 
B-like [Setaria italica]
Length=342

 Score =   605 bits (1560),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/322 (91%), Positives = 307/322 (95%), Gaps = 0/322 (0%)
 Frame = +1

Query  205   IQHGPFPIEQLQESGISAIDVKKLKDAGLCTVESVVYSPRKDLLQIKGISEAKVDKIIEA  384
             + HGP PIEQLQ + I  +  KKL DAGLCTVESV YSPRKDLLQIKGISEAKVDKIIEA
Sbjct  21    VDHGPLPIEQLQATDILHLMXKKLTDAGLCTVESVAYSPRKDLLQIKGISEAKVDKIIEA  80

Query  385   ASKLVPLGFTSASQLHAQRLEIIQITSGSKELDKVLEGGIETGSITEIYGEFRSGKTQLC  564
             ASKLVPLGFTSASQLHA RLEIIQIT+GS+ELD++L+GGIETGSITEIYGEFRSGKTQL 
Sbjct  81    ASKLVPLGFTSASQLHALRLEIIQITTGSRELDQILDGGIETGSITEIYGEFRSGKTQLS  140

Query  565   HTLCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIADRFGLNGADVLENVAYARAYNT  744
             HTLCVTCQLPLDQGGGEGKA+YIDAEG FRPQRLLQIADRFGLNGADVLENVAYARAYNT
Sbjct  141   HTLCVTCQLPLDQGGGEGKALYIDAEGKFRPQRLLQIADRFGLNGADVLENVAYARAYNT  200

Query  745   DHQSRLLLEAASMMVETRFALMIVDSATALYRTDFSGRGELSARQMHLAKFLRSLQKLAD  924
             DHQSRLLLEAASMMVETRFALM+VDSATALYRTDFSGRGELSARQMHLAKFLRSLQKLAD
Sbjct  201   DHQSRLLLEAASMMVETRFALMVVDSATALYRTDFSGRGELSARQMHLAKFLRSLQKLAD  260

Query  925   EFGVAVVITNQVVAQVDGSAIFAGPQIKPIGGNIMAHASTTRLALRKGRGEERVCKVVSS  1104
             EFGVAVVITNQVVAQVDG+A+FAGPQIKPIGGNIMAHASTTRL LRKGRGEER+CKVVSS
Sbjct  261   EFGVAVVITNQVVAQVDGAAMFAGPQIKPIGGNIMAHASTTRLFLRKGRGEERICKVVSS  320

Query  1105  PCLAEAEARFQISPEGVTDVKD  1170
             PCLAEAEARFQIS EGVTDVKD
Sbjct  321   PCLAEAEARFQISSEGVTDVKD  342



>emb|CDX88837.1| BnaA03g08120D [Brassica napus]
 emb|CDX70947.1| BnaC03g10310D [Brassica napus]
Length=324

 Score =   580 bits (1494),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/345 (83%), Positives = 307/345 (89%), Gaps = 23/345 (7%)
 Frame = +1

Query  136   TMEQQHRNQQKSVQERQQDEVEEIQHGPFPIEQLQESGISAIDVKKLKDAGLCTVESVVY  315
             TMEQ  R  Q +VQ  QQD+ EE QHGPFP+EQLQ +GI+++DVKKL+DAGLCTVE +  
Sbjct  3     TMEQ--RRNQNTVQ--QQDD-EETQHGPFPVEQLQAAGIASVDVKKLRDAGLCTVEGLTK  57

Query  316   SPRKDLLQIKGISEAKVDKIIEAASKLVPLGFTSASQLHAQRLEIIQITSGSKELDKVLE  495
             S                  + +A+SKLVPLGFTSASQLHAQR EIIQITSGS+ELDKVLE
Sbjct  58    S------------------LKQASSKLVPLGFTSASQLHAQRQEIIQITSGSRELDKVLE  99

Query  496   GGIETGSITEIYGEFRSGKTQLCHTLCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQI  675
             GGIETGSITE+YGEFRSGKTQLCHTLCVTCQLP+DQGGGEGKAMYIDAEGTFRPQRLLQI
Sbjct  100   GGIETGSITELYGEFRSGKTQLCHTLCVTCQLPMDQGGGEGKAMYIDAEGTFRPQRLLQI  159

Query  676   ADRFGLNGADVLENVAYARAYNTDHQSRLLLEAASMMVETRFALMIVDSATALYRTDFSG  855
             ADRFGLNGADVLENVAYARAYNTDHQSRLLLEAASMMVETRFALMIVDSATALYRTDFSG
Sbjct  160   ADRFGLNGADVLENVAYARAYNTDHQSRLLLEAASMMVETRFALMIVDSATALYRTDFSG  219

Query  856   RGELSARQMHLAKFLRSLQKLADEFGVAVVITNQVVAQVDGSAIFAGPQIKPIGGNIMAH  1035
             RGELSARQMHLAKFLRSLQKLADEFGVAVVITNQVVAQVDGSA+FAGPQ KPIGGNIMAH
Sbjct  220   RGELSARQMHLAKFLRSLQKLADEFGVAVVITNQVVAQVDGSALFAGPQFKPIGGNIMAH  279

Query  1036  ASTTRLALRKGRGEERVCKVVSSPCLAEAEARFQISPEGVTDVKD  1170
             A+TTRLALRKGR EER+CKV+SSPCL EAEARFQIS EGVTD KD
Sbjct  280   ATTTRLALRKGRAEERICKVISSPCLPEAEARFQISTEGVTDCKD  324



>emb|CDX92430.1| BnaA10g14690D [Brassica napus]
Length=319

 Score =   578 bits (1489),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/345 (83%), Positives = 306/345 (89%), Gaps = 28/345 (8%)
 Frame = +1

Query  136   TMEQQHRNQQKSVQERQQDEVEEIQHGPFPIEQLQESGISAIDVKKLKDAGLCTVESVVY  315
             TMEQ  R  Q +VQ  QQD+ EEIQHGPFP+EQLQ +GI+++DVKKL+DAGLCTVE    
Sbjct  3     TMEQ--RRTQNAVQ--QQDD-EEIQHGPFPVEQLQAAGIASVDVKKLRDAGLCTVEGK--  55

Query  316   SPRKDLLQIKGISEAKVDKIIEAASKLVPLGFTSASQLHAQRLEIIQITSGSKELDKVLE  495
                                  +A+SKLVPLGFTSASQLHAQR EIIQITSGS+ELDKVLE
Sbjct  56    ---------------------QASSKLVPLGFTSASQLHAQRQEIIQITSGSRELDKVLE  94

Query  496   GGIETGSITEIYGEFRSGKTQLCHTLCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQI  675
             GGIETGSITE+YGEFRSGKTQLCHTLCVTCQLP+DQGGGEGKAMYIDAEGTFRPQRLLQI
Sbjct  95    GGIETGSITELYGEFRSGKTQLCHTLCVTCQLPMDQGGGEGKAMYIDAEGTFRPQRLLQI  154

Query  676   ADRFGLNGADVLENVAYARAYNTDHQSRLLLEAASMMVETRFALMIVDSATALYRTDFSG  855
             ADRFGLNGADVLENVAYARAYNTDHQSRLLLEAASMMVETRFALMIVDSATALYRTDFSG
Sbjct  155   ADRFGLNGADVLENVAYARAYNTDHQSRLLLEAASMMVETRFALMIVDSATALYRTDFSG  214

Query  856   RGELSARQMHLAKFLRSLQKLADEFGVAVVITNQVVAQVDGSAIFAGPQIKPIGGNIMAH  1035
             RGELSARQMHLAKFLRSLQKLADEFGVAVVITNQVVAQVDGSA+FAGPQ KPIGGNIMAH
Sbjct  215   RGELSARQMHLAKFLRSLQKLADEFGVAVVITNQVVAQVDGSALFAGPQFKPIGGNIMAH  274

Query  1036  ASTTRLALRKGRGEERVCKVVSSPCLAEAEARFQISPEGVTDVKD  1170
             A+TTRLA+RKGRGEER+CKV+SSPCL EAEARFQIS EGVTD KD
Sbjct  275   ATTTRLAMRKGRGEERICKVISSPCLPEAEARFQISTEGVTDCKD  319



>ref|XP_010261678.1| PREDICTED: DNA repair protein RAD51 homolog isoform X2 [Nelumbo 
nucifera]
 ref|XP_010261679.1| PREDICTED: DNA repair protein RAD51 homolog isoform X2 [Nelumbo 
nucifera]
 ref|XP_010261680.1| PREDICTED: DNA repair protein RAD51 homolog isoform X2 [Nelumbo 
nucifera]
Length=318

 Score =   573 bits (1477),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/304 (93%), Positives = 293/304 (96%), Gaps = 3/304 (1%)
 Frame = +1

Query  139   MEQQHRNQQKSVQERQQDEVEEIQHGPFPIEQLQESGISAIDVKKLKDAGLCTVESVVYS  318
             MEQQ R+Q+ + +  +    EEIQHGPFPIEQLQ SGI++IDVKKLKDAGLCTVESV YS
Sbjct  5     MEQQQRHQKMAEEHEEV---EEIQHGPFPIEQLQASGIASIDVKKLKDAGLCTVESVAYS  61

Query  319   PRKDLLQIKGISEAKVDKIIEAASKLVPLGFTSASQLHAQRLEIIQITSGSKELDKVLEG  498
             PRKDLLQIKGISEAKVDKIIEAASKLVPLGFTSASQLHAQRLEIIQITSGS+ELDK+LEG
Sbjct  62    PRKDLLQIKGISEAKVDKIIEAASKLVPLGFTSASQLHAQRLEIIQITSGSRELDKILEG  121

Query  499   GIETGSITEIYGEFRSGKTQLCHTLCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIA  678
             GIETGSITEIYGEFRSGKTQLCHTLCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIA
Sbjct  122   GIETGSITEIYGEFRSGKTQLCHTLCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIA  181

Query  679   DRFGLNGADVLENVAYARAYNTDHQSRLLLEAASMMVETRFALMIVDSATALYRTDFSGR  858
             DRFGLNGADVLENVAYARAYNTDHQSRLLLEAASMMVETRFA+MIVDSATALYRTDFSGR
Sbjct  182   DRFGLNGADVLENVAYARAYNTDHQSRLLLEAASMMVETRFAIMIVDSATALYRTDFSGR  241

Query  859   GELSARQMHLAKFLRSLQKLADEFGVAVVITNQVVAQVDGSAIFAGPQIKPIGGNIMAHA  1038
             GELSARQMHLAKFLRSLQKLADEFGVAVVITNQVVAQVDGSAIFAGPQIKPIGGNIMAHA
Sbjct  242   GELSARQMHLAKFLRSLQKLADEFGVAVVITNQVVAQVDGSAIFAGPQIKPIGGNIMAHA  301

Query  1039  STTR  1050
             STTR
Sbjct  302   STTR  305



>emb|CAC86604.1| Rad51B protein [Physcomitrella patens]
 emb|CAC82997.1| Rad51B protein [Physcomitrella patens]
Length=342

 Score =   564 bits (1454),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/324 (81%), Positives = 298/324 (92%), Gaps = 0/324 (0%)
 Frame = +1

Query  199   EEIQHGPFPIEQLQESGISAIDVKKLKDAGLCTVESVVYSPRKDLLQIKGISEAKVDKII  378
             EEI HGP+ +E LQ  GISA+D+KKLKDAG CTVE+V YS +KDL+ IKG+S+AKVDKII
Sbjct  19    EEIHHGPYLVEHLQSCGISALDLKKLKDAGYCTVEAVAYSAKKDLVNIKGLSDAKVDKII  78

Query  379   EAASKLVPLGFTSASQLHAQRLEIIQITSGSKELDKVLEGGIETGSITEIYGEFRSGKTQ  558
             EAA KLVP+GFTSA Q+H QR E+IQIT+GSKE D +LEGGIETGSITEIYGEFRSGK+Q
Sbjct  79    EAAGKLVPMGFTSAKQMHEQRAELIQITTGSKEFDSILEGGIETGSITEIYGEFRSGKSQ  138

Query  559   LCHTLCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIADRFGLNGADVLENVAYARAY  738
             +CHTLCVTCQLPLDQGGGEGKA+YIDAEGTFRPQRLLQIA+++GLNG DVL+NVAYARAY
Sbjct  139   ICHTLCVTCQLPLDQGGGEGKALYIDAEGTFRPQRLLQIAEKYGLNGQDVLDNVAYARAY  198

Query  739   NTDHQSRLLLEAASMMVETRFALMIVDSATALYRTDFSGRGELSARQMHLAKFLRSLQKL  918
             NTDHQ++LL+EAASMM ETRFALM+VDSATALYRTD+SGRGEL+ARQ HLAKFLR  QK+
Sbjct  199   NTDHQTKLLVEAASMMAETRFALMVVDSATALYRTDYSGRGELAARQFHLAKFLRGCQKM  258

Query  919   ADEFGVAVVITNQVVAQVDGSAIFAGPQIKPIGGNIMAHASTTRLALRKGRGEERVCKVV  1098
             ADEFG+AVV+TNQVVAQVDGSA+F GPQ KPIGGNI+AHASTTRL++RKGRGEERV KVV
Sbjct  259   ADEFGIAVVVTNQVVAQVDGSAMFNGPQFKPIGGNIIAHASTTRLSVRKGRGEERVIKVV  318

Query  1099  SSPCLAEAEARFQISPEGVTDVKD  1170
             +SPCLAE EARFQI+ EGV DVK+
Sbjct  319   ASPCLAEQEARFQITNEGVVDVKE  342



>gb|ACH42253.1| RAD51A recombination protein [Triticum aestivum]
Length=316

 Score =   561 bits (1445),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/288 (93%), Positives = 282/288 (98%), Gaps = 0/288 (0%)
 Frame = +1

Query  211   HGPFPIEQLQESGISAIDVKKLKDAGLCTVESVVYSPRKDLLQIKGISEAKVDKIIEAAS  390
             HGPFPIE LQ SGI+A+DVKKLKDAGLCTVESV YSPRKDLLQIKGISEAKVDKIIEAAS
Sbjct  24    HGPFPIEHLQASGIAAVDVKKLKDAGLCTVESVAYSPRKDLLQIKGISEAKVDKIIEAAS  83

Query  391   KLVPLGFTSASQLHAQRLEIIQITSGSKELDKVLEGGIETGSITEIYGEFRSGKTQLCHT  570
             KLVPLGFTSA+QLHAQRLEIIQ+T+GS+ELDK+LEGGIETGSITE+YGEFRSGKTQLCHT
Sbjct  84    KLVPLGFTSATQLHAQRLEIIQVTTGSRELDKILEGGIETGSITELYGEFRSGKTQLCHT  143

Query  571   LCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIADRFGLNGADVLENVAYARAYNTDH  750
             LCVTCQLPLDQGGGEGKA+YIDAEGTFRPQRLLQIADRFGL GADVLENVAYARAYNTDH
Sbjct  144   LCVTCQLPLDQGGGEGKALYIDAEGTFRPQRLLQIADRFGLYGADVLENVAYARAYNTDH  203

Query  751   QSRLLLEAASMMVETRFALMIVDSATALYRTDFSGRGELSARQMHLAKFLRSLQKLADEF  930
             QSRLLLEAASMMVETRFALM++DSATALYRTDFSGRGELSARQMHLAKFLRSLQKLADEF
Sbjct  204   QSRLLLEAASMMVETRFALMVIDSATALYRTDFSGRGELSARQMHLAKFLRSLQKLADEF  263

Query  931   GVAVVITNQVVAQVDGSAIFAGPQIKPIGGNIMAHASTTRLALRKGRG  1074
             GVAVVI+NQVVAQVDG A+FAGPQIKPIGGNIMAHASTTRL LRKG+G
Sbjct  264   GVAVVISNQVVAQVDGGAMFAGPQIKPIGGNIMAHASTTRLYLRKGKG  311



>emb|CAC86603.1| Rad51A protein [Physcomitrella patens]
 emb|CAC82996.1| Rad51A protein [Physcomitrella patens]
Length=342

 Score =   560 bits (1443),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 259/324 (80%), Positives = 299/324 (92%), Gaps = 0/324 (0%)
 Frame = +1

Query  199   EEIQHGPFPIEQLQESGISAIDVKKLKDAGLCTVESVVYSPRKDLLQIKGISEAKVDKII  378
             EE+ HGP+ +EQLQ  GIS++D+KKLKDAG CTVESV YS +KDL+ IKG+S+AKVDKII
Sbjct  19    EEVHHGPYLVEQLQNCGISSLDLKKLKDAGFCTVESVAYSAKKDLVLIKGLSDAKVDKII  78

Query  379   EAASKLVPLGFTSASQLHAQRLEIIQITSGSKELDKVLEGGIETGSITEIYGEFRSGKTQ  558
             EAA+KLVP+GFTSA Q+H QR E+IQIT+G+KE D +LEGGIETGSITEIYGEFRSGK+Q
Sbjct  79    EAATKLVPMGFTSAKQMHEQRAELIQITTGAKEFDNILEGGIETGSITEIYGEFRSGKSQ  138

Query  559   LCHTLCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIADRFGLNGADVLENVAYARAY  738
             +CHTLCVTCQLPLDQGGGEGKA+YIDAEGTFRPQRLLQIA+++GLNG DVL+NVAYARAY
Sbjct  139   ICHTLCVTCQLPLDQGGGEGKALYIDAEGTFRPQRLLQIAEKYGLNGQDVLDNVAYARAY  198

Query  739   NTDHQSRLLLEAASMMVETRFALMIVDSATALYRTDFSGRGELSARQMHLAKFLRSLQKL  918
             NTDHQ +LL+EAASMM ETRFALM+VDS+TALYRTD+SGRGEL+ARQ+HLAKFLR  QK+
Sbjct  199   NTDHQMKLLVEAASMMAETRFALMVVDSSTALYRTDYSGRGELAARQVHLAKFLRGCQKI  258

Query  919   ADEFGVAVVITNQVVAQVDGSAIFAGPQIKPIGGNIMAHASTTRLALRKGRGEERVCKVV  1098
             ADEFG+AVVITNQVVAQVDGSA+F GPQ KPIGGNI+AHASTTRL++RKGRGEERV KVV
Sbjct  259   ADEFGIAVVITNQVVAQVDGSAMFNGPQHKPIGGNIIAHASTTRLSVRKGRGEERVIKVV  318

Query  1099  SSPCLAEAEARFQISPEGVTDVKD  1170
             +SPCLAE EARFQI+ EG  DVK+
Sbjct  319   ASPCLAEQEARFQITNEGAVDVKE  342



>gb|EPS57838.1| hypothetical protein M569_16980 [Genlisea aurea]
Length=309

 Score =   558 bits (1439),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/344 (81%), Positives = 299/344 (87%), Gaps = 35/344 (10%)
 Frame = +1

Query  139   MEQQHRNQQKSVQERQQDEVEEIQHGPFPIEQLQESGISAIDVKKLKDAGLCTVESVVYS  318
             MEQQ RN  K VQ+ Q +EV+++QHGP PIEQLQ SGI+A+DVK                
Sbjct  1     MEQQ-RNL-KLVQQEQIEEVDDVQHGPLPIEQLQASGIAAVDVK----------------  42

Query  319   PRKDLLQIKGISEAKVDKIIEAASKLVPLGFTSASQLHAQRLEIIQITSGSKELDKVLEG  498
                              K+ +AASKLVPLGFTSA+QLHAQRLEIIQIT+GSKELD+VLEG
Sbjct  43    -----------------KLRDAASKLVPLGFTSATQLHAQRLEIIQITTGSKELDRVLEG  85

Query  499   GIETGSITEIYGEFRSGKTQLCHTLCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIA  678
             GIETGSITE+YGEFR GKTQLCHTLCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIA
Sbjct  86    GIETGSITELYGEFRCGKTQLCHTLCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIA  145

Query  679   DRFGLNGADVLENVAYARAYNTDHQSRLLLEAASMMVETRFALMIVDSATALYRTDFSGR  858
             DRFGLNGADVLENVAYARAYNTDHQSRLLLEAASMMVETRFA+MIVDSATALYRTDFSGR
Sbjct  146   DRFGLNGADVLENVAYARAYNTDHQSRLLLEAASMMVETRFAVMIVDSATALYRTDFSGR  205

Query  859   GELSARQMHLAKFLRSLQKLADEFGVAVVITNQVVAQVDGSAIFAGPQIKPIGGNIMAHA  1038
             GELSARQMHLAKFLRSLQKLADEFGVAVVITNQVVAQVDGSA+FAGPQIKPIGGNIMAHA
Sbjct  206   GELSARQMHLAKFLRSLQKLADEFGVAVVITNQVVAQVDGSAVFAGPQIKPIGGNIMAHA  265

Query  1039  STTRLALRKGRGEERVCKVVSSPCLAEAEARFQISPEGVTDVKD  1170
             +TTRL+LRKGRGEER+CKVVSSPCLAEAEARFQIS +GVTD KD
Sbjct  266   TTTRLSLRKGRGEERICKVVSSPCLAEAEARFQISADGVTDAKD  309



>emb|CDY16571.1| BnaC09g37020D [Brassica napus]
Length=319

 Score =   558 bits (1439),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/319 (85%), Positives = 288/319 (90%), Gaps = 23/319 (7%)
 Frame = +1

Query  214   GPFPIEQLQESGISAIDVKKLKDAGLCTVESVVYSPRKDLLQIKGISEAKVDKIIEAASK  393
             GPFP+EQLQ +GI+++DVKKL+DAGLCTVE                         +A+SK
Sbjct  24    GPFPVEQLQAAGIASVDVKKLRDAGLCTVEGK-----------------------QASSK  60

Query  394   LVPLGFTSASQLHAQRLEIIQITSGSKELDKVLEGGIETGSITEIYGEFRSGKTQLCHTL  573
             LVPLGFTSA+QLHAQR EIIQITSGS+ELDKVLEGGIETGSITE+YGEFRSGKTQLCHTL
Sbjct  61    LVPLGFTSATQLHAQRQEIIQITSGSRELDKVLEGGIETGSITELYGEFRSGKTQLCHTL  120

Query  574   CVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIADRFGLNGADVLENVAYARAYNTDHQ  753
             CVTCQLP+DQGGGEGKAMYIDAEGTFRPQRLLQIADRFGLNGADVLENVAYARAYNTDHQ
Sbjct  121   CVTCQLPMDQGGGEGKAMYIDAEGTFRPQRLLQIADRFGLNGADVLENVAYARAYNTDHQ  180

Query  754   SRLLLEAASMMVETRFALMIVDSATALYRTDFSGRGELSARQMHLAKFLRSLQKLADEFG  933
             SRLLLEAASMMVETRFALMIVDSATALYRTDFSGRGELSARQMHLAKFLRSLQKLADEFG
Sbjct  181   SRLLLEAASMMVETRFALMIVDSATALYRTDFSGRGELSARQMHLAKFLRSLQKLADEFG  240

Query  934   VAVVITNQVVAQVDGSAIFAGPQIKPIGGNIMAHASTTRLALRKGRGEERVCKVVSSPCL  1113
             VAVVITNQVVAQVDGSA+FAGPQ KPIGGNIMAHA+TTRLA+RKGRGEER+CKV+SSPCL
Sbjct  241   VAVVITNQVVAQVDGSALFAGPQFKPIGGNIMAHATTTRLAMRKGRGEERICKVISSPCL  300

Query  1114  AEAEARFQISPEGVTDVKD  1170
              EAEARFQIS EGVTD KD
Sbjct  301   PEAEARFQISTEGVTDCKD  319



>gb|AEW90638.1| RAD51-like protein [Pinus sylvestris]
Length=323

 Score =   543 bits (1399),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/307 (87%), Positives = 298/307 (97%), Gaps = 0/307 (0%)
 Frame = +1

Query  184   QQDEVEEIQHGPFPIEQLQESGISAIDVKKLKDAGLCTVESVVYSPRKDLLQIKGISEAK  363
             + + VEE QHGP+PIEQLQ  GISA+D+KKLKDAG CTVE+V YSP+K+L+QIKG+S+AK
Sbjct  14    EDENVEEQQHGPYPIEQLQACGISAVDIKKLKDAGHCTVEAVAYSPKKELVQIKGLSDAK  73

Query  364   VDKIIEAASKLVPLGFTSASQLHAQRLEIIQITSGSKELDKVLEGGIETGSITEIYGEFR  543
             VDKIIEAASKLVP+GFTSASQLHAQRLEIIQI+SGS+ELDK+LEGG+ETGSITEIYGEFR
Sbjct  74    VDKIIEAASKLVPMGFTSASQLHAQRLEIIQISSGSRELDKLLEGGVETGSITEIYGEFR  133

Query  544   SGKTQLCHTLCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIADRFGLNGADVLENVA  723
             +GKTQLCHTLC+TCQLPLDQGGGEGKA++IDAEGTFRPQRLLQIA+RFGLNGADVLENVA
Sbjct  134   TGKTQLCHTLCITCQLPLDQGGGEGKALFIDAEGTFRPQRLLQIAERFGLNGADVLENVA  193

Query  724   YARAYNTDHQSRLLLEAASMMVETRFALMIVDSATALYRTDFSGRGELSARQMHLAKFLR  903
             YARAYNTDHQSRLLLEAASMM ETRFALMIVDSAT+LYRTDF GRGELSARQMHLAKFLR
Sbjct  194   YARAYNTDHQSRLLLEAASMMAETRFALMIVDSATSLYRTDFIGRGELSARQMHLAKFLR  253

Query  904   SLQKLADEFGVAVVITNQVVAQVDGSAIFAGPQIKPIGGNIMAHASTTRLALRKGRGEER  1083
             SLQK+ADEFGVAVV+TNQVVAQVDGSA+FAGPQ+KPIGGNI+AHASTTRL+LRKGRGEER
Sbjct  254   SLQKMADEFGVAVVVTNQVVAQVDGSAMFAGPQVKPIGGNIIAHASTTRLSLRKGRGEER  313

Query  1084  VCKVVSS  1104
             +CKV+SS
Sbjct  314   ICKVISS  320



>ref|XP_002516197.1| DNA repair protein rad51, putative [Ricinus communis]
 gb|EEF46199.1| DNA repair protein rad51, putative [Ricinus communis]
Length=294

 Score =   530 bits (1366),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 265/326 (81%), Positives = 276/326 (85%), Gaps = 47/326 (14%)
 Frame = +1

Query  193   EVEEIQHGPFPIEQLQESGISAIDVKKLKDAGLCTVESVVYSPRKDLLQIKGISEAKVDK  372
             E++E+QHGPFP+EQLQESGI+A+DVKKLKDAGLCTVESV YSPRK+LLQIKGISEAKVDK
Sbjct  16    ELDEMQHGPFPVEQLQESGIAALDVKKLKDAGLCTVESVAYSPRKELLQIKGISEAKVDK  75

Query  373   IIEAASKLVPLGFTSASQLHAQRLEIIQITSGSKELDKVLEGGIETGSITEIYGEFRSGK  552
             IIEAASKLVPLGFTSASQLHAQRLEIIQITSGS+ELDK+LEGGIETGSITEIYGEFRSGK
Sbjct  76    IIEAASKLVPLGFTSASQLHAQRLEIIQITSGSRELDKILEGGIETGSITEIYGEFRSGK  135

Query  553   TQLCHTLCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIADRFGLNGADVLENVAYAR  732
             TQLCHTLCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIADRFGLNGADVLENVAYAR
Sbjct  136   TQLCHTLCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIADRFGLNGADVLENVAYAR  195

Query  733   AYNTDHQSRLLLEAASMMVETRFALMIVDSATALYRTDFSGRGELSARQMHLAKFLRSLQ  912
             AYNTDHQSRLLLEAASMM                                          
Sbjct  196   AYNTDHQSRLLLEAASMM------------------------------------------  213

Query  913   KLADEFGVAVVITNQVVAQVDGSAIFAGPQIKPIGGNIMAHASTTRLALRKGRGEERVCK  1092
                  FGVAVVITNQVVAQVDGSAIFAGPQIKPIGGNIMAHASTTRLALRKGRGEER+CK
Sbjct  214   -----FGVAVVITNQVVAQVDGSAIFAGPQIKPIGGNIMAHASTTRLALRKGRGEERICK  268

Query  1093  VVSSPCLAEAEARFQISPEGVTDVKD  1170
             V+SSPCLAEAEARFQIS EGVTD KD
Sbjct  269   VISSPCLAEAEARFQISAEGVTDAKD  294



>gb|KCW79343.1| hypothetical protein EUGRSUZ_C00762 [Eucalyptus grandis]
Length=298

 Score =   529 bits (1362),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 255/285 (89%), Positives = 273/285 (96%), Gaps = 1/285 (0%)
 Frame = +1

Query  319   PRKDLLQIKGISEAKVDKII-EAASKLVPLGFTSASQLHAQRLEIIQITSGSKELDKVLE  495
             P ++  ++K + + K+ K + +A+SKLVPLGFTSASQLHAQRLEIIQITSGS+ELDK+LE
Sbjct  14    PERNCFKLKELVKPKLTKSLKQASSKLVPLGFTSASQLHAQRLEIIQITSGSRELDKILE  73

Query  496   GGIETGSITEIYGEFRSGKTQLCHTLCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQI  675
             GGIETGSITEIYGEFRSGKTQLCHTLCVTCQLPLDQGGGEGKAMYIDAEG FRPQRLLQI
Sbjct  74    GGIETGSITEIYGEFRSGKTQLCHTLCVTCQLPLDQGGGEGKAMYIDAEGAFRPQRLLQI  133

Query  676   ADRFGLNGADVLENVAYARAYNTDHQSRLLLEAASMMVETRFALMIVDSATALYRTDFSG  855
             A+R+GLNGADVLENVAYARAYNTDHQSRLLLEAASMMVETRFALMIVDSATALYRTDFSG
Sbjct  134   AERYGLNGADVLENVAYARAYNTDHQSRLLLEAASMMVETRFALMIVDSATALYRTDFSG  193

Query  856   RGELSARQMHLAKFLRSLQKLADEFGVAVVITNQVVAQVDGSAIFAGPQIKPIGGNIMAH  1035
             RGELSARQMHLAKFLRSLQK+ADEFGVAVVITNQVVAQVDGSA+FAGPQIKPIGGNIMAH
Sbjct  194   RGELSARQMHLAKFLRSLQKMADEFGVAVVITNQVVAQVDGSALFAGPQIKPIGGNIMAH  253

Query  1036  ASTTRLALRKGRGEERVCKVVSSPCLAEAEARFQISPEGVTDVKD  1170
             ASTTRLALRKGRGEER+CKV+SSPCL EAEARFQIS EGVTDVKD
Sbjct  254   ASTTRLALRKGRGEERICKVISSPCLPEAEARFQISTEGVTDVKD  298



>ref|XP_011433321.1| PREDICTED: DNA repair protein RAD51 homolog 1 isoform X1 [Crassostrea 
gigas]
 ref|XP_011433322.1| PREDICTED: DNA repair protein RAD51 homolog 1 isoform X1 [Crassostrea 
gigas]
 ref|XP_011433323.1| PREDICTED: DNA repair protein RAD51 homolog 1 isoform X2 [Crassostrea 
gigas]
Length=338

 Score =   507 bits (1306),  Expect = 7e-176, Method: Compositional matrix adjust.
 Identities = 235/326 (72%), Positives = 286/326 (88%), Gaps = 0/326 (0%)
 Frame = +1

Query  193   EVEEIQHGPFPIEQLQESGISAIDVKKLKDAGLCTVESVVYSPRKDLLQIKGISEAKVDK  372
             EVE+   GP P+ +L+ +GISA DVKK+++AG  TVE+V Y+P+K LL IKGISEAK DK
Sbjct  13    EVEDETFGPMPLNRLEANGISAADVKKMEEAGYFTVEAVAYAPKKSLLAIKGISEAKADK  72

Query  373   IIEAASKLVPLGFTSASQLHAQRLEIIQITSGSKELDKVLEGGIETGSITEIYGEFRSGK  552
             I+  A+KLVP+GFT+A++ H +R EIIQ+TSGSKELDK+L+GGIETGSITEI+GEFR+GK
Sbjct  73    ILAEAAKLVPMGFTTATEFHQKRSEIIQVTSGSKELDKLLQGGIETGSITEIFGEFRTGK  132

Query  553   TQLCHTLCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIADRFGLNGADVLENVAYAR  732
             TQLCHTL VTCQLP+D GGGEGKAMYID EGTFRP+RLL +A+R+GL+G+DVL+NVAYAR
Sbjct  133   TQLCHTLAVTCQLPIDMGGGEGKAMYIDTEGTFRPERLLAVAERYGLSGSDVLDNVAYAR  192

Query  733   AYNTDHQSRLLLEAASMMVETRFALMIVDSATALYRTDFSGRGELSARQMHLAKFLRSLQ  912
             AYN+DHQS+LL++AA+MM E+R+AL+IVDSATALYRTD+SGRGELSARQMHLA+FLR L 
Sbjct  193   AYNSDHQSQLLIQAAAMMAESRYALLIVDSATALYRTDYSGRGELSARQMHLARFLRMLL  252

Query  913   KLADEFGVAVVITNQVVAQVDGSAIFAGPQIKPIGGNIMAHASTTRLALRKGRGEERVCK  1092
             +LADE+GVAVVITNQVVAQVDG+A+F     KPIGGNI+AHASTTRL LRKGRGE R+CK
Sbjct  253   RLADEYGVAVVITNQVVAQVDGAAMFTADPKKPIGGNIIAHASTTRLYLRKGRGETRICK  312

Query  1093  VVSSPCLAEAEARFQISPEGVTDVKD  1170
             +  SPCL EAEA F I+ +G+ D KD
Sbjct  313   IYDSPCLPEAEAMFAINADGIGDAKD  338



>gb|AAV38510.1| RAD51 homolog (RecA homolog, E. coli) (S. cerevisiae) [synthetic 
construct]
Length=340

 Score =   506 bits (1304),  Expect = 1e-175, Method: Compositional matrix adjust.
 Identities = 237/336 (71%), Positives = 291/336 (87%), Gaps = 0/336 (0%)
 Frame = +1

Query  163   QKSVQERQQDEVEEIQHGPFPIEQLQESGISAIDVKKLKDAGLCTVESVVYSPRKDLLQI  342
             Q  ++      VEE   GP PI +L++ GI+A DVKKL++AG  TVE+V Y+P+K+L+ I
Sbjct  4     QMQLEANADTSVEEESFGPQPISRLEQCGINANDVKKLEEAGFHTVEAVAYAPKKELINI  63

Query  343   KGISEAKVDKIIEAASKLVPLGFTSASQLHAQRLEIIQITSGSKELDKVLEGGIETGSIT  522
             KGISEAK DKI+  A+KLVP+GFT+A++ H +R EIIQIT+GSKELDK+L+GGIETGSIT
Sbjct  64    KGISEAKADKILAEAAKLVPMGFTTATEFHQRRSEIIQITTGSKELDKLLQGGIETGSIT  123

Query  523   EIYGEFRSGKTQLCHTLCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIADRFGLNGA  702
             E++GEFR+GKTQ+CHTL VTCQLP+DQGGGEGKAMYID EGTFRP+RLL +A+R+GL+G+
Sbjct  124   EMFGEFRTGKTQICHTLAVTCQLPIDQGGGEGKAMYIDTEGTFRPERLLAVAERYGLSGS  183

Query  703   DVLENVAYARAYNTDHQSRLLLEAASMMVETRFALMIVDSATALYRTDFSGRGELSARQM  882
             DVL+NVAYARA+NTDHQ++LL +A++MMVE+R+AL+IVDSATALYRTD+SGRGELSARQM
Sbjct  184   DVLDNVAYARAFNTDHQTQLLYQASAMMVESRYALLIVDSATALYRTDYSGRGELSARQM  243

Query  883   HLAKFLRSLQKLADEFGVAVVITNQVVAQVDGSAIFAGPQIKPIGGNIMAHASTTRLALR  1062
             HLA+FLR L +LADEFGVAVVITNQVVAQVDG+A+FA    KPIGGNI+AHASTTRL LR
Sbjct  244   HLARFLRMLLRLADEFGVAVVITNQVVAQVDGAAMFAADPKKPIGGNIIAHASTTRLYLR  303

Query  1063  KGRGEERVCKVVSSPCLAEAEARFQISPEGVTDVKD  1170
             KGRGE R+CK+  SPCL EAEA F I+ +GV D KD
Sbjct  304   KGRGETRICKIYDSPCLPEAEAMFAINADGVGDAKD  339



>dbj|BAA78377.1| Rad51 [Cynops pyrrhogaster]
Length=337

 Score =   506 bits (1303),  Expect = 2e-175, Method: Compositional matrix adjust.
 Identities = 237/333 (71%), Positives = 289/333 (87%), Gaps = 0/333 (0%)
 Frame = +1

Query  172   VQERQQDEVEEIQHGPFPIEQLQESGISAIDVKKLKDAGLCTVESVVYSPRKDLLQIKGI  351
             VQ       EE   GP PI +L++ GI+A DVKKL++AG  TVE+V Y+P+K+LL IKGI
Sbjct  5     VQYEASSATEEESLGPQPIARLEQCGINANDVKKLEEAGFHTVEAVAYAPKKELLNIKGI  64

Query  352   SEAKVDKIIEAASKLVPLGFTSASQLHAQRLEIIQITSGSKELDKVLEGGIETGSITEIY  531
             SEAK DKI+  A+KLVP+GFT+A++ H +R EIIQ+T+GSKELDK+L+GGIETGSITE++
Sbjct  65    SEAKADKILAEAAKLVPMGFTTATEFHQRRSEIIQVTTGSKELDKLLQGGIETGSITEMF  124

Query  532   GEFRSGKTQLCHTLCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIADRFGLNGADVL  711
             GEFR+GKTQLCHTL VTCQLP+D+GGGEGKAMYID EGTFRP+RLL +A+R+GL+G+DVL
Sbjct  125   GEFRTGKTQLCHTLAVTCQLPIDRGGGEGKAMYIDTEGTFRPERLLAVAERYGLSGSDVL  184

Query  712   ENVAYARAYNTDHQSRLLLEAASMMVETRFALMIVDSATALYRTDFSGRGELSARQMHLA  891
             +NVAYARA+NTDHQ++LL +A++MM E+R+AL+IVDSATALYRTD+SGRGELSARQMHLA
Sbjct  185   DNVAYARAFNTDHQTQLLYQASAMMAESRYALLIVDSATALYRTDYSGRGELSARQMHLA  244

Query  892   KFLRSLQKLADEFGVAVVITNQVVAQVDGSAIFAGPQIKPIGGNIMAHASTTRLALRKGR  1071
             +FLR L +LADEFGVAVVITNQVVAQVDG+A+FA    KPIGGNI+AHASTTRL LRKGR
Sbjct  245   RFLRMLLRLADEFGVAVVITNQVVAQVDGAAMFAADPKKPIGGNIIAHASTTRLYLRKGR  304

Query  1072  GEERVCKVVSSPCLAEAEARFQISPEGVTDVKD  1170
             GE R+CK+  SPCL EAEA F I+P+GV D KD
Sbjct  305   GETRICKIYDSPCLPEAEAMFAINPDGVGDAKD  337



>ref|NP_002866.2| DNA repair protein RAD51 homolog 1 isoform 1 [Homo sapiens]
 ref|XP_001144621.1| PREDICTED: DNA repair protein RAD51 homolog 1 isoform X1 [Pan 
troglodytes]
 ref|XP_002825350.1| PREDICTED: DNA repair protein RAD51 homolog 1 [Pongo abelii]
 ref|XP_003266786.1| PREDICTED: DNA repair protein RAD51 homolog 1 isoform 1 [Nomascus 
leucogenys]
 ref|XP_003826633.1| PREDICTED: DNA repair protein RAD51 homolog 1 isoform X1 [Pan 
paniscus]
 ref|XP_005559254.1| PREDICTED: DNA repair protein RAD51 homolog 1 isoform X1 [Macaca 
fascicularis]
 ref|XP_005559255.1| PREDICTED: DNA repair protein RAD51 homolog 1 isoform X2 [Macaca 
fascicularis]
 ref|XP_005559256.1| PREDICTED: DNA repair protein RAD51 homolog 1 isoform X3 [Macaca 
fascicularis]
 ref|XP_006720689.1| PREDICTED: DNA repair protein RAD51 homolog 1 isoform X1 [Homo 
sapiens]
 ref|XP_008015187.1| PREDICTED: DNA repair protein RAD51 homolog 1 isoform X1 [Chlorocebus 
sabaeus]
 ref|XP_008015188.1| PREDICTED: DNA repair protein RAD51 homolog 1 isoform X1 [Chlorocebus 
sabaeus]
 ref|XP_009208216.1| PREDICTED: DNA repair protein RAD51 homolog 1 isoform X1 [Papio 
anubis]
 ref|XP_010386841.1| PREDICTED: DNA repair protein RAD51 homolog 1 isoform X1 [Rhinopithecus 
roxellana]
 ref|XP_011520159.1| PREDICTED: DNA repair protein RAD51 homolog 1 isoform X1 [Homo 
sapiens]
 ref|XP_011520160.1| PREDICTED: DNA repair protein RAD51 homolog 1 isoform X1 [Homo 
sapiens]
 ref|XP_011520161.1| PREDICTED: DNA repair protein RAD51 homolog 1 isoform X1 [Homo 
sapiens]
 ref|XP_011520162.1| PREDICTED: DNA repair protein RAD51 homolog 1 isoform X1 [Homo 
sapiens]
 sp|Q06609.1|RAD51_HUMAN RecName: Full=DNA repair protein RAD51 homolog 1; Short=HsRAD51; 
Short=hRAD51; AltName: Full=RAD51 homolog A [Homo sapiens]
 dbj|BAA03189.1| RAD51 [Homo sapiens]
 gb|AAD49705.1| Rad51 [Homo sapiens]
 gb|AAF69145.1| RAD51 [Homo sapiens]
 gb|AAN87149.1| RAD51 homolog (RecA homolog, E. coli) (S. cerevisiae) [Homo sapiens]
 emb|CAG38796.1| RAD51 [Homo sapiens]
 gb|AAX36441.1| RAD51-like [synthetic construct]
 gb|AAX41640.1| RAD51-like [synthetic construct]
 gb|EAW92434.1| RAD51 homolog (RecA homolog, E. coli) (S. cerevisiae), isoform 
CRA_d [Homo sapiens]
 dbj|BAG36283.1| unnamed protein product [Homo sapiens]
 dbj|BAI46804.1| RAD51 homolog [synthetic construct]
 gb|EHH27216.1| hypothetical protein EGK_17369 [Macaca mulatta]
Length=339

 Score =   505 bits (1301),  Expect = 4e-175, Method: Compositional matrix adjust.
 Identities = 236/336 (70%), Positives = 291/336 (87%), Gaps = 0/336 (0%)
 Frame = +1

Query  163   QKSVQERQQDEVEEIQHGPFPIEQLQESGISAIDVKKLKDAGLCTVESVVYSPRKDLLQI  342
             Q  ++      VEE   GP PI +L++ GI+A DVKKL++AG  TVE+V Y+P+K+L+ I
Sbjct  4     QMQLEANADTSVEEESFGPQPISRLEQCGINANDVKKLEEAGFHTVEAVAYAPKKELINI  63

Query  343   KGISEAKVDKIIEAASKLVPLGFTSASQLHAQRLEIIQITSGSKELDKVLEGGIETGSIT  522
             KGISEAK DKI+  A+KLVP+GFT+A++ H +R EIIQIT+GSKELDK+L+GGIETGSIT
Sbjct  64    KGISEAKADKILAEAAKLVPMGFTTATEFHQRRSEIIQITTGSKELDKLLQGGIETGSIT  123

Query  523   EIYGEFRSGKTQLCHTLCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIADRFGLNGA  702
             E++GEFR+GKTQ+CHTL VTCQLP+D+GGGEGKAMYID EGTFRP+RLL +A+R+GL+G+
Sbjct  124   EMFGEFRTGKTQICHTLAVTCQLPIDRGGGEGKAMYIDTEGTFRPERLLAVAERYGLSGS  183

Query  703   DVLENVAYARAYNTDHQSRLLLEAASMMVETRFALMIVDSATALYRTDFSGRGELSARQM  882
             DVL+NVAYARA+NTDHQ++LL +A++MMVE+R+AL+IVDSATALYRTD+SGRGELSARQM
Sbjct  184   DVLDNVAYARAFNTDHQTQLLYQASAMMVESRYALLIVDSATALYRTDYSGRGELSARQM  243

Query  883   HLAKFLRSLQKLADEFGVAVVITNQVVAQVDGSAIFAGPQIKPIGGNIMAHASTTRLALR  1062
             HLA+FLR L +LADEFGVAVVITNQVVAQVDG+A+FA    KPIGGNI+AHASTTRL LR
Sbjct  244   HLARFLRMLLRLADEFGVAVVITNQVVAQVDGAAMFAADPKKPIGGNIIAHASTTRLYLR  303

Query  1063  KGRGEERVCKVVSSPCLAEAEARFQISPEGVTDVKD  1170
             KGRGE R+CK+  SPCL EAEA F I+ +GV D KD
Sbjct  304   KGRGETRICKIYDSPCLPEAEAMFAINADGVGDAKD  339



>ref|XP_006831828.1| PREDICTED: DNA repair protein RAD51 homolog 1 [Chrysochloris 
asiatica]
Length=339

 Score =   505 bits (1301),  Expect = 5e-175, Method: Compositional matrix adjust.
 Identities = 236/336 (70%), Positives = 290/336 (86%), Gaps = 0/336 (0%)
 Frame = +1

Query  163   QKSVQERQQDEVEEIQHGPFPIEQLQESGISAIDVKKLKDAGLCTVESVVYSPRKDLLQI  342
             Q  ++      VEE   GP PI +L++ GI+A DVKKL+DAG  TVE+V Y+P+K+L+ I
Sbjct  4     QMQLEANADTSVEEESFGPQPISRLEQCGINANDVKKLEDAGFHTVEAVAYAPKKELINI  63

Query  343   KGISEAKVDKIIEAASKLVPLGFTSASQLHAQRLEIIQITSGSKELDKVLEGGIETGSIT  522
             KGISEAK DKI+  A+KLVP+GFT+A++ H +R EIIQIT+GSKELDK+L+GGIETGSIT
Sbjct  64    KGISEAKADKILTEAAKLVPMGFTTATEFHQRRSEIIQITTGSKELDKLLQGGIETGSIT  123

Query  523   EIYGEFRSGKTQLCHTLCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIADRFGLNGA  702
             E++GEFR+GKTQ+CHTL VTCQLP+D+GGGEGKAMYID EGTFRP+RLL +A+R+GL+G+
Sbjct  124   EMFGEFRTGKTQICHTLAVTCQLPIDRGGGEGKAMYIDTEGTFRPERLLAVAERYGLSGS  183

Query  703   DVLENVAYARAYNTDHQSRLLLEAASMMVETRFALMIVDSATALYRTDFSGRGELSARQM  882
             DVL+NVAYAR +NTDHQ++LL +A++MMVE+R+AL+IVDSATALYRTD+SGRGELSARQM
Sbjct  184   DVLDNVAYARGFNTDHQTQLLYQASAMMVESRYALLIVDSATALYRTDYSGRGELSARQM  243

Query  883   HLAKFLRSLQKLADEFGVAVVITNQVVAQVDGSAIFAGPQIKPIGGNIMAHASTTRLALR  1062
             HLA+FLR L +LADEFGVAVVITNQVVAQVDG+A+FA    KPIGGNI+AHASTTRL LR
Sbjct  244   HLARFLRMLLRLADEFGVAVVITNQVVAQVDGAAMFAADPKKPIGGNIIAHASTTRLYLR  303

Query  1063  KGRGEERVCKVVSSPCLAEAEARFQISPEGVTDVKD  1170
             KGRGE R+CK+  SPCL EAEA F I+ +GV D KD
Sbjct  304   KGRGETRICKIYDSPCLPEAEAMFAINADGVGDAKD  339



>ref|NP_001116653.1| DNA repair protein RAD51 homolog 1 [Sus scrofa]
 gb|ABZ89107.1| Rad51 [Sus scrofa]
 dbj|BAG09486.1| DNA repair protein RAD51 [Sus scrofa]
Length=339

 Score =   505 bits (1301),  Expect = 5e-175, Method: Compositional matrix adjust.
 Identities = 235/336 (70%), Positives = 291/336 (87%), Gaps = 0/336 (0%)
 Frame = +1

Query  163   QKSVQERQQDEVEEIQHGPFPIEQLQESGISAIDVKKLKDAGLCTVESVVYSPRKDLLQI  342
             Q  ++      VEE   GP PI +L++ GI+A DVKKL++AG  TVE+V Y+P+K+L+ I
Sbjct  4     QMQLESNADTSVEEESFGPQPISRLEQCGINANDVKKLEEAGFHTVEAVAYAPKKELINI  63

Query  343   KGISEAKVDKIIEAASKLVPLGFTSASQLHAQRLEIIQITSGSKELDKVLEGGIETGSIT  522
             KGISEAK DKI+  A+KLVP+GFT+A++ H +R EIIQIT+GSKELDK+L+GGIETGSIT
Sbjct  64    KGISEAKADKILTEAAKLVPMGFTTATEFHQRRSEIIQITTGSKELDKLLQGGIETGSIT  123

Query  523   EIYGEFRSGKTQLCHTLCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIADRFGLNGA  702
             E++GEFR+GKTQ+CHTL VTCQLP+D+GGGEGKAMYID EGTFRP+RLL +A+R+GL+G+
Sbjct  124   EMFGEFRTGKTQICHTLAVTCQLPIDRGGGEGKAMYIDTEGTFRPERLLAVAERYGLSGS  183

Query  703   DVLENVAYARAYNTDHQSRLLLEAASMMVETRFALMIVDSATALYRTDFSGRGELSARQM  882
             DVL+NVAYARA+NTDHQ++LL +A++MMVE+R+AL+I+DSATALYRTD+SGRGELSARQM
Sbjct  184   DVLDNVAYARAFNTDHQTQLLYQASAMMVESRYALLIIDSATALYRTDYSGRGELSARQM  243

Query  883   HLAKFLRSLQKLADEFGVAVVITNQVVAQVDGSAIFAGPQIKPIGGNIMAHASTTRLALR  1062
             HLA+FLR L +LADEFGVAVVITNQVVAQVDG+A+FA    KPIGGNI+AHASTTRL LR
Sbjct  244   HLARFLRMLLRLADEFGVAVVITNQVVAQVDGAAMFAADPKKPIGGNIIAHASTTRLYLR  303

Query  1063  KGRGEERVCKVVSSPCLAEAEARFQISPEGVTDVKD  1170
             KGRGE R+CK+  SPCL EAEA F I+ +GV D KD
Sbjct  304   KGRGETRICKIYDSPCLPEAEAMFAINADGVGDAKD  339



>gb|AAX36891.1| RAD51-like [synthetic construct]
 gb|AAX43285.1| RAD51-like, partial [synthetic construct]
Length=340

 Score =   505 bits (1300),  Expect = 6e-175, Method: Compositional matrix adjust.
 Identities = 236/336 (70%), Positives = 291/336 (87%), Gaps = 0/336 (0%)
 Frame = +1

Query  163   QKSVQERQQDEVEEIQHGPFPIEQLQESGISAIDVKKLKDAGLCTVESVVYSPRKDLLQI  342
             Q  ++      VEE   GP PI +L++ GI+A DVKKL++AG  TVE+V Y+P+K+L+ I
Sbjct  4     QMQLEANADTSVEEESFGPQPISRLEQCGINANDVKKLEEAGFHTVEAVAYAPKKELINI  63

Query  343   KGISEAKVDKIIEAASKLVPLGFTSASQLHAQRLEIIQITSGSKELDKVLEGGIETGSIT  522
             KGISEAK DKI+  A+KLVP+GFT+A++ H +R EIIQIT+GSKELDK+L+GGIETGSIT
Sbjct  64    KGISEAKADKILAEAAKLVPMGFTTATEFHQRRSEIIQITTGSKELDKLLQGGIETGSIT  123

Query  523   EIYGEFRSGKTQLCHTLCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIADRFGLNGA  702
             E++GEFR+GKTQ+CHTL VTCQLP+D+GGGEGKAMYID EGTFRP+RLL +A+R+GL+G+
Sbjct  124   EMFGEFRTGKTQICHTLAVTCQLPIDRGGGEGKAMYIDTEGTFRPERLLAVAERYGLSGS  183

Query  703   DVLENVAYARAYNTDHQSRLLLEAASMMVETRFALMIVDSATALYRTDFSGRGELSARQM  882
             DVL+NVAYARA+NTDHQ++LL +A++MMVE+R+AL+IVDSATALYRTD+SGRGELSARQM
Sbjct  184   DVLDNVAYARAFNTDHQTQLLYQASAMMVESRYALLIVDSATALYRTDYSGRGELSARQM  243

Query  883   HLAKFLRSLQKLADEFGVAVVITNQVVAQVDGSAIFAGPQIKPIGGNIMAHASTTRLALR  1062
             HLA+FLR L +LADEFGVAVVITNQVVAQVDG+A+FA    KPIGGNI+AHASTTRL LR
Sbjct  244   HLARFLRMLLRLADEFGVAVVITNQVVAQVDGAAMFAADPKKPIGGNIIAHASTTRLYLR  303

Query  1063  KGRGEERVCKVVSSPCLAEAEARFQISPEGVTDVKD  1170
             KGRGE R+CK+  SPCL EAEA F I+ +GV D KD
Sbjct  304   KGRGETRICKIYDSPCLPEAEAMFAINADGVGDAKD  339



>ref|XP_007069443.1| PREDICTED: DNA repair protein RAD51 homolog 1 [Chelonia mydas]
Length=339

 Score =   504 bits (1299),  Expect = 8e-175, Method: Compositional matrix adjust.
 Identities = 236/336 (70%), Positives = 289/336 (86%), Gaps = 0/336 (0%)
 Frame = +1

Query  163   QKSVQERQQDEVEEIQHGPFPIEQLQESGISAIDVKKLKDAGLCTVESVVYSPRKDLLQI  342
             Q   +   +   EE   GP PI +L++ GI+A DVKKL++AG  TVE+V Y+P+K+LL I
Sbjct  4     QMQYEANAETSTEEESLGPQPISRLEQCGINANDVKKLEEAGFHTVEAVAYAPKKELLNI  63

Query  343   KGISEAKVDKIIEAASKLVPLGFTSASQLHAQRLEIIQITSGSKELDKVLEGGIETGSIT  522
             KGISEAK DKI+  A+KL+P+GFT+A++ H +R EIIQIT+GSKELDK+L+GGIETGSIT
Sbjct  64    KGISEAKADKILAEAAKLIPMGFTTATEFHQRRSEIIQITTGSKELDKLLQGGIETGSIT  123

Query  523   EIYGEFRSGKTQLCHTLCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIADRFGLNGA  702
             E++GEFR+GKTQLCHTL VTCQLP+D+GGGEGKAMYID EGTFRP+RLL +A+R+GL+G+
Sbjct  124   EMFGEFRTGKTQLCHTLAVTCQLPIDRGGGEGKAMYIDTEGTFRPERLLAVAERYGLSGS  183

Query  703   DVLENVAYARAYNTDHQSRLLLEAASMMVETRFALMIVDSATALYRTDFSGRGELSARQM  882
             DVL+NVAYARAYNTDHQ++LL +A++MM E+R+AL+IVDSATALYRTD+SGRGELSARQM
Sbjct  184   DVLDNVAYARAYNTDHQTQLLYQASAMMAESRYALLIVDSATALYRTDYSGRGELSARQM  243

Query  883   HLAKFLRSLQKLADEFGVAVVITNQVVAQVDGSAIFAGPQIKPIGGNIMAHASTTRLALR  1062
             HLA+FLR L +LADEFGVAVVITNQVVAQVDG+A+FA    KPIGGNI+AHASTTRL LR
Sbjct  244   HLARFLRMLLRLADEFGVAVVITNQVVAQVDGAAMFAADPKKPIGGNIIAHASTTRLYLR  303

Query  1063  KGRGEERVCKVVSSPCLAEAEARFQISPEGVTDVKD  1170
             KGRGE R+CK+  SPCL EAEA F I+ +GV D KD
Sbjct  304   KGRGETRICKIYDSPCLPEAEAMFAINADGVGDAKD  339



>ref|XP_011844675.1| PREDICTED: DNA repair protein RAD51 homolog 1 isoform X2 [Mandrillus 
leucophaeus]
Length=339

 Score =   504 bits (1298),  Expect = 1e-174, Method: Compositional matrix adjust.
 Identities = 236/336 (70%), Positives = 291/336 (87%), Gaps = 0/336 (0%)
 Frame = +1

Query  163   QKSVQERQQDEVEEIQHGPFPIEQLQESGISAIDVKKLKDAGLCTVESVVYSPRKDLLQI  342
             Q  ++      VEE   GP PI +L++ GI+A DVKKL++AG  TVE+V Y+P+K+L+ I
Sbjct  4     QMQLEANADTSVEEESFGPQPILRLEQCGINANDVKKLEEAGFHTVEAVAYAPKKELINI  63

Query  343   KGISEAKVDKIIEAASKLVPLGFTSASQLHAQRLEIIQITSGSKELDKVLEGGIETGSIT  522
             KGISEAK DKI+  A+KLVP+GFT+A++ H +R EIIQIT+GSKELDK+L+GGIETGSIT
Sbjct  64    KGISEAKADKILAEAAKLVPMGFTTATEFHQRRSEIIQITTGSKELDKLLQGGIETGSIT  123

Query  523   EIYGEFRSGKTQLCHTLCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIADRFGLNGA  702
             E++GEFR+GKTQ+CHTL VTCQLP+D+GGGEGKAMYID EGTFRP+RLL +A+R+GL+G+
Sbjct  124   EMFGEFRTGKTQICHTLAVTCQLPIDRGGGEGKAMYIDTEGTFRPERLLAVAERYGLSGS  183

Query  703   DVLENVAYARAYNTDHQSRLLLEAASMMVETRFALMIVDSATALYRTDFSGRGELSARQM  882
             DVL+NVAYARA+NTDHQ++LL +A++MMVE+R+AL+IVDSATALYRTD+SGRGELSARQM
Sbjct  184   DVLDNVAYARAFNTDHQTQLLYQASAMMVESRYALLIVDSATALYRTDYSGRGELSARQM  243

Query  883   HLAKFLRSLQKLADEFGVAVVITNQVVAQVDGSAIFAGPQIKPIGGNIMAHASTTRLALR  1062
             HLA+FLR L +LADEFGVAVVITNQVVAQVDG+A+FA    KPIGGNI+AHASTTRL LR
Sbjct  244   HLARFLRMLLRLADEFGVAVVITNQVVAQVDGAAMFAADPKKPIGGNIIAHASTTRLYLR  303

Query  1063  KGRGEERVCKVVSSPCLAEAEARFQISPEGVTDVKD  1170
             KGRGE R+CK+  SPCL EAEA F I+ +GV D KD
Sbjct  304   KGRGETRICKIYDSPCLPEAEAMFAINADGVGDAKD  339



>dbj|BAA02962.1| HsRad51 [Homo sapiens]
Length=339

 Score =   504 bits (1297),  Expect = 2e-174, Method: Compositional matrix adjust.
 Identities = 235/336 (70%), Positives = 291/336 (87%), Gaps = 0/336 (0%)
 Frame = +1

Query  163   QKSVQERQQDEVEEIQHGPFPIEQLQESGISAIDVKKLKDAGLCTVESVVYSPRKDLLQI  342
             Q  ++      VEE   GP PI +L++ GI+A DVKKL++AG  TVE+V Y+P+K+L+ I
Sbjct  4     QMQLEANADTSVEEESFGPQPISRLEQCGINANDVKKLEEAGFHTVEAVAYAPKKELINI  63

Query  343   KGISEAKVDKIIEAASKLVPLGFTSASQLHAQRLEIIQITSGSKELDKVLEGGIETGSIT  522
             KGISEAK DKI+  A+KLVP+GFT+A++ H +R EIIQIT+GSKELDK+L+GGIETGSIT
Sbjct  64    KGISEAKADKILAEAAKLVPMGFTTATEFHQRRSEIIQITTGSKELDKLLQGGIETGSIT  123

Query  523   EIYGEFRSGKTQLCHTLCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIADRFGLNGA  702
             E++GEFR+GKTQ+CHTL VTCQLP+D+GGGEGKAMYID EGTFRP+RLL +A+R+GL+G+
Sbjct  124   EMFGEFRTGKTQICHTLAVTCQLPIDRGGGEGKAMYIDTEGTFRPERLLAVAERYGLSGS  183

Query  703   DVLENVAYARAYNTDHQSRLLLEAASMMVETRFALMIVDSATALYRTDFSGRGELSARQM  882
             DVL+NVAYARA+NTDHQ++LL +A++MMVE+R+AL+IVDSATALYRTD+SGRGELSARQM
Sbjct  184   DVLDNVAYARAFNTDHQTQLLYQASAMMVESRYALLIVDSATALYRTDYSGRGELSARQM  243

Query  883   HLAKFLRSLQKLADEFGVAVVITNQVVAQVDGSAIFAGPQIKPIGGNIMAHASTTRLALR  1062
             HLA+FLR L +LADEFGVAVVITNQVVAQVDG+A+FA    KPIGGNI+AHASTTRL LR
Sbjct  244   HLARFLRMLLRLADEFGVAVVITNQVVAQVDGAAMFAADPKKPIGGNIIAHASTTRLYLR  303

Query  1063  KGRGEERVCKVVSSPCLAEAEARFQISPEGVTDVKD  1170
             KGRGE R+C++  SPCL EAEA F I+ +GV D KD
Sbjct  304   KGRGETRICQIYDSPCLPEAEAMFAINADGVGDAKD  339



>ref|NP_001233686.1| DNA repair protein RAD51 homolog 1 [Cricetulus griseus]
 ref|XP_007647132.1| PREDICTED: DNA repair protein RAD51 homolog 1 isoform X1 [Cricetulus 
griseus]
 sp|P70099.1|RAD51_CRIGR RecName: Full=DNA repair protein RAD51 homolog 1 [Cricetulus 
griseus]
 emb|CAA69384.1| rad51 [Cricetulus griseus]
 gb|EGW09314.1| DNA repair protein RAD51-like 1 [Cricetulus griseus]
Length=339

 Score =   504 bits (1297),  Expect = 2e-174, Method: Compositional matrix adjust.
 Identities = 236/336 (70%), Positives = 289/336 (86%), Gaps = 0/336 (0%)
 Frame = +1

Query  163   QKSVQERQQDEVEEIQHGPFPIEQLQESGISAIDVKKLKDAGLCTVESVVYSPRKDLLQI  342
             Q  ++      VEE   GP PI +L++ GISA DVKKL++AG  TVE+V Y+P+K+L+ I
Sbjct  4     QMQLEANADTSVEEESFGPQPISRLEQCGISANDVKKLEEAGFHTVEAVAYAPKKELINI  63

Query  343   KGISEAKVDKIIEAASKLVPLGFTSASQLHAQRLEIIQITSGSKELDKVLEGGIETGSIT  522
             KGISEAK DKI+  A+KLVP+GFT+A++ H +R EIIQIT+GSKELDK+L+GGIETGSIT
Sbjct  64    KGISEAKADKILAEAAKLVPMGFTTATEFHQRRSEIIQITTGSKELDKLLQGGIETGSIT  123

Query  523   EIYGEFRSGKTQLCHTLCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIADRFGLNGA  702
             E++GEFR+GKTQ+CHTL VTCQLP+D+GGGEGKAMYID EGTFRP+RLL +A+R+GL+G+
Sbjct  124   EMFGEFRTGKTQICHTLAVTCQLPIDRGGGEGKAMYIDTEGTFRPERLLAVAERYGLSGS  183

Query  703   DVLENVAYARAYNTDHQSRLLLEAASMMVETRFALMIVDSATALYRTDFSGRGELSARQM  882
             DVL+NVAYAR +NTDHQ++LL +A++MMVE+R+AL+IVDSATALYRTD+SGRGELSARQM
Sbjct  184   DVLDNVAYARGFNTDHQTQLLYQASAMMVESRYALLIVDSATALYRTDYSGRGELSARQM  243

Query  883   HLAKFLRSLQKLADEFGVAVVITNQVVAQVDGSAIFAGPQIKPIGGNIMAHASTTRLALR  1062
             HLA+FLR L +LADEFGVAVVITNQVVAQVDG+A+F     KPIGGNI+AHASTTRL LR
Sbjct  244   HLARFLRMLLRLADEFGVAVVITNQVVAQVDGAAMFTADPKKPIGGNIIAHASTTRLYLR  303

Query  1063  KGRGEERVCKVVSSPCLAEAEARFQISPEGVTDVKD  1170
             KGRGE R+CKV  SPCL EAEA F I+ +GV D KD
Sbjct  304   KGRGETRICKVYDSPCLPEAEAMFAINADGVGDAKD  339



>ref|XP_003418703.1| PREDICTED: DNA repair protein RAD51 homolog 1 [Loxodonta africana]
 ref|XP_006158751.1| PREDICTED: DNA repair protein RAD51 homolog 1 isoform X1 [Tupaia 
chinensis]
 ref|XP_006158752.1| PREDICTED: DNA repair protein RAD51 homolog 1 isoform X2 [Tupaia 
chinensis]
 ref|XP_006158753.1| PREDICTED: DNA repair protein RAD51 homolog 1 isoform X3 [Tupaia 
chinensis]
 ref|XP_006158754.1| PREDICTED: DNA repair protein RAD51 homolog 1 isoform X4 [Tupaia 
chinensis]
 ref|XP_007938634.1| PREDICTED: DNA repair protein RAD51 homolog 1 isoform X1 [Orycteropus 
afer afer]
 ref|XP_008070915.1| PREDICTED: DNA repair protein RAD51 homolog 1 [Tarsius syrichta]
 ref|XP_008568457.1| PREDICTED: DNA repair protein RAD51 homolog 1 isoform X1 [Galeopterus 
variegatus]
 ref|XP_008844990.1| PREDICTED: DNA repair protein RAD51 homolog 1 [Nannospalax galili]
Length=339

 Score =   504 bits (1297),  Expect = 2e-174, Method: Compositional matrix adjust.
 Identities = 235/336 (70%), Positives = 290/336 (86%), Gaps = 0/336 (0%)
 Frame = +1

Query  163   QKSVQERQQDEVEEIQHGPFPIEQLQESGISAIDVKKLKDAGLCTVESVVYSPRKDLLQI  342
             Q  ++      VEE   GP PI +L++ GI+A DVKKL++AG  TVE+V Y+P+K+L+ I
Sbjct  4     QMQLEANADTSVEEESFGPQPISRLEQCGINANDVKKLEEAGFHTVEAVAYAPKKELINI  63

Query  343   KGISEAKVDKIIEAASKLVPLGFTSASQLHAQRLEIIQITSGSKELDKVLEGGIETGSIT  522
             KGISEAK DKI+  A+KLVP+GFT+A++ H +R EIIQIT+GSKELDK+L+GGIETGSIT
Sbjct  64    KGISEAKADKILAEAAKLVPMGFTTATEFHQRRSEIIQITTGSKELDKLLQGGIETGSIT  123

Query  523   EIYGEFRSGKTQLCHTLCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIADRFGLNGA  702
             E++GEFR+GKTQ+CHTL VTCQLP+D+GGGEGKAMYID EGTFRP+RLL +A+R+GL+G+
Sbjct  124   EMFGEFRTGKTQICHTLAVTCQLPIDRGGGEGKAMYIDTEGTFRPERLLAVAERYGLSGS  183

Query  703   DVLENVAYARAYNTDHQSRLLLEAASMMVETRFALMIVDSATALYRTDFSGRGELSARQM  882
             DVL+NVAYAR +NTDHQ++LL +A++MMVE+R+AL+IVDSATALYRTD+SGRGELSARQM
Sbjct  184   DVLDNVAYARGFNTDHQTQLLYQASAMMVESRYALLIVDSATALYRTDYSGRGELSARQM  243

Query  883   HLAKFLRSLQKLADEFGVAVVITNQVVAQVDGSAIFAGPQIKPIGGNIMAHASTTRLALR  1062
             HLA+FLR L +LADEFGVAVVITNQVVAQVDG+A+FA    KPIGGNI+AHASTTRL LR
Sbjct  244   HLARFLRMLLRLADEFGVAVVITNQVVAQVDGAAMFAADPKKPIGGNIIAHASTTRLYLR  303

Query  1063  KGRGEERVCKVVSSPCLAEAEARFQISPEGVTDVKD  1170
             KGRGE R+CK+  SPCL EAEA F I+ +GV D KD
Sbjct  304   KGRGETRICKIYDSPCLPEAEAMFAINADGVGDAKD  339



>ref|NP_001039644.1| DNA repair protein RAD51 homolog 1 [Bos taurus]
 ref|XP_002913265.1| PREDICTED: DNA repair protein RAD51 homolog 1 isoform X1 [Ailuropoda 
melanoleuca]
 ref|XP_003987322.1| PREDICTED: DNA repair protein RAD51 homolog 1 [Felis catus]
 ref|XP_004010496.1| PREDICTED: DNA repair protein RAD51 homolog 1 [Ovis aries]
 ref|XP_004380691.1| PREDICTED: DNA repair protein RAD51 homolog 1 [Trichechus manatus 
latirostris]
 ref|XP_004400484.1| PREDICTED: DNA repair protein RAD51 homolog 1 [Odobenus rosmarus 
divergens]
 ref|XP_004421477.1| PREDICTED: DNA repair protein RAD51 homolog 1 isoform 1 [Ceratotherium 
simum simum]
 ref|XP_004455044.1| PREDICTED: DNA repair protein RAD51 homolog 1 [Dasypus novemcinctus]
 ref|XP_004609628.1| PREDICTED: DNA repair protein RAD51 homolog 1 isoform X1 [Sorex 
araneus]
 ref|XP_004796526.1| PREDICTED: DNA repair protein RAD51 homolog 1 [Mustela putorius 
furo]
 ref|XP_005685546.1| PREDICTED: DNA repair protein RAD51 homolog 1 isoform X1 [Capra 
hircus]
 ref|XP_005685547.1| PREDICTED: DNA repair protein RAD51 homolog 1 isoform X2 [Capra 
hircus]
 ref|XP_005860310.1| PREDICTED: DNA repair protein RAD51 homolog 1 [Myotis brandtii]
 ref|XP_005889008.1| PREDICTED: DNA repair protein RAD51 homolog 1 [Bos mutus]
 ref|XP_006093088.1| PREDICTED: DNA repair protein RAD51 homolog 1 [Myotis lucifugus]
 ref|XP_006176677.1| PREDICTED: DNA repair protein RAD51 homolog 1 isoform X1 [Camelus 
ferus]
 ref|XP_006932702.1| PREDICTED: DNA repair protein RAD51 homolog 1 [Felis catus]
 ref|XP_007081726.1| PREDICTED: DNA repair protein RAD51 homolog 1 isoform X1 [Panthera 
tigris altaica]
 ref|XP_007081727.1| PREDICTED: DNA repair protein RAD51 homolog 1 isoform X2 [Panthera 
tigris altaica]
 ref|XP_006073116.1| PREDICTED: DNA repair protein RAD51 homolog 1 isoform X1 [Bubalus 
bubalis]
 ref|XP_007180464.1| PREDICTED: DNA repair protein RAD51 homolog 1 [Balaenoptera acutorostrata 
scammoni]
 ref|XP_008700467.1| PREDICTED: DNA repair protein RAD51 homolog 1 isoform X1 [Ursus 
maritimus]
 ref|XP_008700468.1| PREDICTED: DNA repair protein RAD51 homolog 1 isoform X1 [Ursus 
maritimus]
 ref|XP_010846254.1| PREDICTED: DNA repair protein RAD51 homolog 1 [Bison bison bison]
 ref|XP_010963453.1| PREDICTED: DNA repair protein RAD51 homolog 1 [Camelus bactrianus]
 ref|XP_010987612.1| PREDICTED: DNA repair protein RAD51 homolog 1 [Camelus dromedarius]
 ref|XP_011226334.1| PREDICTED: DNA repair protein RAD51 homolog 1 isoform X1 [Ailuropoda 
melanoleuca]
 ref|XP_012036602.1| PREDICTED: DNA repair protein RAD51 homolog 1 [Ovis aries]
 ref|XP_012036603.1| PREDICTED: DNA repair protein RAD51 homolog 1 [Ovis aries]
 ref|XP_011987363.1| PREDICTED: DNA repair protein RAD51 homolog 1 [Ovis aries musimon]
 ref|XP_011987364.1| PREDICTED: DNA repair protein RAD51 homolog 1 [Ovis aries musimon]
 ref|XP_011987365.1| PREDICTED: DNA repair protein RAD51 homolog 1 [Ovis aries musimon]
 sp|Q2KJ94.1|RAD51_BOVIN RecName: Full=DNA repair protein RAD51 homolog 1 [Bos taurus]
 gb|AAI05459.1| RAD51 homolog (RecA homolog, E. coli) (S. cerevisiae) [Bos taurus]
 tpg|DAA25435.1| TPA: DNA repair protein RAD51 homolog 1 [Bos taurus]
 gb|ELR61319.1| DNA repair protein RAD51-like protein 1 [Bos mutus]
 gb|EPQ03973.1| DNA repair protein RAD51 like protein 1 [Myotis brandtii]
Length=339

 Score =   503 bits (1296),  Expect = 2e-174, Method: Compositional matrix adjust.
 Identities = 235/336 (70%), Positives = 290/336 (86%), Gaps = 0/336 (0%)
 Frame = +1

Query  163   QKSVQERQQDEVEEIQHGPFPIEQLQESGISAIDVKKLKDAGLCTVESVVYSPRKDLLQI  342
             Q  ++      VEE   GP PI +L++ GI+A DVKKL++AG  TVE+V Y+P+K+L+ I
Sbjct  4     QMQLEANADTSVEEESFGPQPISRLEQCGINANDVKKLEEAGFHTVEAVAYAPKKELINI  63

Query  343   KGISEAKVDKIIEAASKLVPLGFTSASQLHAQRLEIIQITSGSKELDKVLEGGIETGSIT  522
             KGISEAK DKI+  A+KLVP+GFT+A++ H +R EIIQIT+GSKELDK+L+GGIETGSIT
Sbjct  64    KGISEAKADKILTEAAKLVPMGFTTATEFHQRRSEIIQITTGSKELDKLLQGGIETGSIT  123

Query  523   EIYGEFRSGKTQLCHTLCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIADRFGLNGA  702
             E++GEFR+GKTQ+CHTL VTCQLP+D+GGGEGKAMYID EGTFRP+RLL +A+R+GL+G+
Sbjct  124   EMFGEFRTGKTQICHTLAVTCQLPIDRGGGEGKAMYIDTEGTFRPERLLAVAERYGLSGS  183

Query  703   DVLENVAYARAYNTDHQSRLLLEAASMMVETRFALMIVDSATALYRTDFSGRGELSARQM  882
             DVL+NVAYAR +NTDHQ++LL +A++MMVE+R+AL+IVDSATALYRTD+SGRGELSARQM
Sbjct  184   DVLDNVAYARGFNTDHQTQLLYQASAMMVESRYALLIVDSATALYRTDYSGRGELSARQM  243

Query  883   HLAKFLRSLQKLADEFGVAVVITNQVVAQVDGSAIFAGPQIKPIGGNIMAHASTTRLALR  1062
             HLA+FLR L +LADEFGVAVVITNQVVAQVDG+A+FA    KPIGGNI+AHASTTRL LR
Sbjct  244   HLARFLRMLLRLADEFGVAVVITNQVVAQVDGAAMFAADPKKPIGGNIIAHASTTRLYLR  303

Query  1063  KGRGEERVCKVVSSPCLAEAEARFQISPEGVTDVKD  1170
             KGRGE R+CK+  SPCL EAEA F I+ +GV D KD
Sbjct  304   KGRGETRICKIYDSPCLPEAEAMFAINADGVGDAKD  339



>ref|XP_006201713.1| PREDICTED: DNA repair protein RAD51 homolog 1 isoform X1 [Vicugna 
pacos]
Length=339

 Score =   503 bits (1296),  Expect = 3e-174, Method: Compositional matrix adjust.
 Identities = 235/336 (70%), Positives = 290/336 (86%), Gaps = 0/336 (0%)
 Frame = +1

Query  163   QKSVQERQQDEVEEIQHGPFPIEQLQESGISAIDVKKLKDAGLCTVESVVYSPRKDLLQI  342
             Q  ++      VEE   GP PI +L++ GI+A DVKKL++AG  TVE+V Y+P+K+L+ I
Sbjct  4     QMQLEANADTSVEEESFGPQPISRLEQCGINANDVKKLEEAGFHTVEAVAYAPKKELVNI  63

Query  343   KGISEAKVDKIIEAASKLVPLGFTSASQLHAQRLEIIQITSGSKELDKVLEGGIETGSIT  522
             KGISEAK DKI+  A+KLVP+GFT+A++ H +R EIIQIT+GSKELDK+L+GGIETGSIT
Sbjct  64    KGISEAKADKILTEAAKLVPMGFTTATEFHQRRSEIIQITTGSKELDKLLQGGIETGSIT  123

Query  523   EIYGEFRSGKTQLCHTLCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIADRFGLNGA  702
             E++GEFR+GKTQ+CHTL VTCQLP+D+GGGEGKAMYID EGTFRP+RLL +A+R+GL+G+
Sbjct  124   EMFGEFRTGKTQICHTLAVTCQLPIDRGGGEGKAMYIDTEGTFRPERLLAVAERYGLSGS  183

Query  703   DVLENVAYARAYNTDHQSRLLLEAASMMVETRFALMIVDSATALYRTDFSGRGELSARQM  882
             DVL+NVAYAR +NTDHQ++LL +A++MMVE+R+AL+IVDSATALYRTD+SGRGELSARQM
Sbjct  184   DVLDNVAYARGFNTDHQTQLLYQASAMMVESRYALLIVDSATALYRTDYSGRGELSARQM  243

Query  883   HLAKFLRSLQKLADEFGVAVVITNQVVAQVDGSAIFAGPQIKPIGGNIMAHASTTRLALR  1062
             HLA+FLR L +LADEFGVAVVITNQVVAQVDG+A+FA    KPIGGNI+AHASTTRL LR
Sbjct  244   HLARFLRMLLRLADEFGVAVVITNQVVAQVDGAAMFAADPKKPIGGNIIAHASTTRLYLR  303

Query  1063  KGRGEERVCKVVSSPCLAEAEARFQISPEGVTDVKD  1170
             KGRGE R+CK+  SPCL EAEA F I+ +GV D KD
Sbjct  304   KGRGETRICKIYDSPCLPEAEAMFAINADGVGDAKD  339



>ref|XP_010622996.1| PREDICTED: DNA repair protein RAD51 homolog 1 [Fukomys damarensis]
Length=339

 Score =   503 bits (1296),  Expect = 3e-174, Method: Compositional matrix adjust.
 Identities = 234/325 (72%), Positives = 287/325 (88%), Gaps = 0/325 (0%)
 Frame = +1

Query  196   VEEIQHGPFPIEQLQESGISAIDVKKLKDAGLCTVESVVYSPRKDLLQIKGISEAKVDKI  375
             VEE   GP PI +L++ GI+A DVKKL++AG  TVE+V Y+P+K+L+ IKGISEAK DKI
Sbjct  15    VEEESFGPQPISRLEQCGINANDVKKLEEAGFHTVEAVAYAPKKELINIKGISEAKADKI  74

Query  376   IEAASKLVPLGFTSASQLHAQRLEIIQITSGSKELDKVLEGGIETGSITEIYGEFRSGKT  555
             +  A+KLVP+GFT+A++ H +R EIIQIT+GSKELDK+L+GGIETGSITE++GEFR+GKT
Sbjct  75    LAEAAKLVPMGFTTATEFHQRRSEIIQITTGSKELDKLLQGGIETGSITEMFGEFRTGKT  134

Query  556   QLCHTLCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIADRFGLNGADVLENVAYARA  735
             Q+CHTL VTCQLP+D+GGGEGKAMYID EGTFRP+RLL +A+R+GL+G+DVL+NVAYAR 
Sbjct  135   QICHTLAVTCQLPIDRGGGEGKAMYIDTEGTFRPERLLAVAERYGLSGSDVLDNVAYARG  194

Query  736   YNTDHQSRLLLEAASMMVETRFALMIVDSATALYRTDFSGRGELSARQMHLAKFLRSLQK  915
             +NTDHQ++LL +A++MMVE+R+AL+IVDSATALYRTD+SGRGELSARQMHLA+FLR L +
Sbjct  195   FNTDHQTQLLYQASAMMVESRYALLIVDSATALYRTDYSGRGELSARQMHLARFLRMLLR  254

Query  916   LADEFGVAVVITNQVVAQVDGSAIFAGPQIKPIGGNIMAHASTTRLALRKGRGEERVCKV  1095
             LADEFGVAVVITNQVVAQVDG+A+FA    KPIGGNI+AHASTTRL LRKGRGE R+CK+
Sbjct  255   LADEFGVAVVITNQVVAQVDGAAMFAADPKKPIGGNIIAHASTTRLYLRKGRGETRICKI  314

Query  1096  VSSPCLAEAEARFQISPEGVTDVKD  1170
               SPCL EAEA F I+ +GV D KD
Sbjct  315   YDSPCLPEAEAMFAINADGVGDAKD  339



>ref|NP_001003043.1| DNA repair protein RAD51 homolog 1 [Canis lupus familiaris]
 ref|XP_005638226.1| PREDICTED: DNA repair protein RAD51 homolog 1 isoform X1 [Canis 
lupus familiaris]
 sp|Q8MKI8.1|RAD51_CANFA RecName: Full=DNA repair protein RAD51 homolog 1; AltName: Full=cRad51 
[Canis lupus familiaris]
 dbj|BAB91246.1| Rad51 [Canis lupus familiaris]
Length=339

 Score =   503 bits (1296),  Expect = 3e-174, Method: Compositional matrix adjust.
 Identities = 235/336 (70%), Positives = 290/336 (86%), Gaps = 0/336 (0%)
 Frame = +1

Query  163   QKSVQERQQDEVEEIQHGPFPIEQLQESGISAIDVKKLKDAGLCTVESVVYSPRKDLLQI  342
             Q  ++      VEE   GP PI +L++ GI+A DVKKL++AG  TVE+V Y+P+K+L+ I
Sbjct  4     QMQLEANADTSVEEESFGPQPISRLEQCGINANDVKKLEEAGFHTVEAVAYAPKKELISI  63

Query  343   KGISEAKVDKIIEAASKLVPLGFTSASQLHAQRLEIIQITSGSKELDKVLEGGIETGSIT  522
             KGISEAK DKI+  A+KLVP+GFT+A++ H +R EIIQIT+GSKELDK+L+GGIETGSIT
Sbjct  64    KGISEAKADKILTEAAKLVPMGFTTATEFHQRRSEIIQITTGSKELDKLLQGGIETGSIT  123

Query  523   EIYGEFRSGKTQLCHTLCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIADRFGLNGA  702
             E++GEFR+GKTQ+CHTL VTCQLP+D+GGGEGKAMYID EGTFRP+RLL +A+R+GL+G+
Sbjct  124   EMFGEFRTGKTQICHTLAVTCQLPIDRGGGEGKAMYIDTEGTFRPERLLAVAERYGLSGS  183

Query  703   DVLENVAYARAYNTDHQSRLLLEAASMMVETRFALMIVDSATALYRTDFSGRGELSARQM  882
             DVL+NVAYAR +NTDHQ++LL +A++MMVE+R+AL+IVDSATALYRTD+SGRGELSARQM
Sbjct  184   DVLDNVAYARGFNTDHQTQLLYQASAMMVESRYALLIVDSATALYRTDYSGRGELSARQM  243

Query  883   HLAKFLRSLQKLADEFGVAVVITNQVVAQVDGSAIFAGPQIKPIGGNIMAHASTTRLALR  1062
             HLA+FLR L +LADEFGVAVVITNQVVAQVDG+A+FA    KPIGGNI+AHASTTRL LR
Sbjct  244   HLARFLRMLLRLADEFGVAVVITNQVVAQVDGAAMFAADPKKPIGGNIIAHASTTRLYLR  303

Query  1063  KGRGEERVCKVVSSPCLAEAEARFQISPEGVTDVKD  1170
             KGRGE R+CK+  SPCL EAEA F I+ +GV D KD
Sbjct  304   KGRGETRICKIYDSPCLPEAEAMFAINADGVGDAKD  339



>gb|ERE70754.1| putative DNA repair protein RAD51 [Cricetulus griseus]
Length=341

 Score =   503 bits (1296),  Expect = 3e-174, Method: Compositional matrix adjust.
 Identities = 236/336 (70%), Positives = 289/336 (86%), Gaps = 0/336 (0%)
 Frame = +1

Query  163   QKSVQERQQDEVEEIQHGPFPIEQLQESGISAIDVKKLKDAGLCTVESVVYSPRKDLLQI  342
             Q  ++      VEE   GP PI +L++ GISA DVKKL++AG  TVE+V Y+P+K+L+ I
Sbjct  6     QMQLEANADTSVEEESFGPQPISRLEQCGISANDVKKLEEAGFHTVEAVAYAPKKELINI  65

Query  343   KGISEAKVDKIIEAASKLVPLGFTSASQLHAQRLEIIQITSGSKELDKVLEGGIETGSIT  522
             KGISEAK DKI+  A+KLVP+GFT+A++ H +R EIIQIT+GSKELDK+L+GGIETGSIT
Sbjct  66    KGISEAKADKILAEAAKLVPMGFTTATEFHQRRSEIIQITTGSKELDKLLQGGIETGSIT  125

Query  523   EIYGEFRSGKTQLCHTLCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIADRFGLNGA  702
             E++GEFR+GKTQ+CHTL VTCQLP+D+GGGEGKAMYID EGTFRP+RLL +A+R+GL+G+
Sbjct  126   EMFGEFRTGKTQICHTLAVTCQLPIDRGGGEGKAMYIDTEGTFRPERLLAVAERYGLSGS  185

Query  703   DVLENVAYARAYNTDHQSRLLLEAASMMVETRFALMIVDSATALYRTDFSGRGELSARQM  882
             DVL+NVAYAR +NTDHQ++LL +A++MMVE+R+AL+IVDSATALYRTD+SGRGELSARQM
Sbjct  186   DVLDNVAYARGFNTDHQTQLLYQASAMMVESRYALLIVDSATALYRTDYSGRGELSARQM  245

Query  883   HLAKFLRSLQKLADEFGVAVVITNQVVAQVDGSAIFAGPQIKPIGGNIMAHASTTRLALR  1062
             HLA+FLR L +LADEFGVAVVITNQVVAQVDG+A+F     KPIGGNI+AHASTTRL LR
Sbjct  246   HLARFLRMLLRLADEFGVAVVITNQVVAQVDGAAMFTADPKKPIGGNIIAHASTTRLYLR  305

Query  1063  KGRGEERVCKVVSSPCLAEAEARFQISPEGVTDVKD  1170
             KGRGE R+CKV  SPCL EAEA F I+ +GV D KD
Sbjct  306   KGRGETRICKVYDSPCLPEAEAMFAINADGVGDAKD  341



>ref|XP_005381310.1| PREDICTED: DNA repair protein RAD51 homolog 1 isoform X1 [Chinchilla 
lanigera]
 ref|XP_005381311.1| PREDICTED: DNA repair protein RAD51 homolog 1 isoform X2 [Chinchilla 
lanigera]
Length=339

 Score =   503 bits (1296),  Expect = 3e-174, Method: Compositional matrix adjust.
 Identities = 234/325 (72%), Positives = 287/325 (88%), Gaps = 0/325 (0%)
 Frame = +1

Query  196   VEEIQHGPFPIEQLQESGISAIDVKKLKDAGLCTVESVVYSPRKDLLQIKGISEAKVDKI  375
             VEE   GP PI +L++ GI+A DVKKL++AG  TVE+V Y+P+K+L+ IKGISEAK DKI
Sbjct  15    VEEESFGPQPISRLEQCGINANDVKKLEEAGFHTVEAVAYAPKKELINIKGISEAKADKI  74

Query  376   IEAASKLVPLGFTSASQLHAQRLEIIQITSGSKELDKVLEGGIETGSITEIYGEFRSGKT  555
             +  A+KLVP+GFT+A++ H +R EIIQIT+GSKELDK+L+GGIETGSITE++GEFR+GKT
Sbjct  75    LTEAAKLVPMGFTTATEFHQRRSEIIQITTGSKELDKLLQGGIETGSITEMFGEFRTGKT  134

Query  556   QLCHTLCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIADRFGLNGADVLENVAYARA  735
             Q+CHTL VTCQLP+D+GGGEGKAMYID EGTFRP+RLL +A+R+GL+G+DVL+NVAYAR 
Sbjct  135   QICHTLAVTCQLPIDRGGGEGKAMYIDTEGTFRPERLLAVAERYGLSGSDVLDNVAYARG  194

Query  736   YNTDHQSRLLLEAASMMVETRFALMIVDSATALYRTDFSGRGELSARQMHLAKFLRSLQK  915
             +NTDHQ++LL +A++MMVE+R+AL+IVDSATALYRTD+SGRGELSARQMHLA+FLR L +
Sbjct  195   FNTDHQTQLLYQASAMMVESRYALLIVDSATALYRTDYSGRGELSARQMHLARFLRMLLR  254

Query  916   LADEFGVAVVITNQVVAQVDGSAIFAGPQIKPIGGNIMAHASTTRLALRKGRGEERVCKV  1095
             LADEFGVAVVITNQVVAQVDG+A+FA    KPIGGNI+AHASTTRL LRKGRGE R+CK+
Sbjct  255   LADEFGVAVVITNQVVAQVDGAAMFAADPKKPIGGNIIAHASTTRLYLRKGRGETRICKI  314

Query  1096  VSSPCLAEAEARFQISPEGVTDVKD  1170
               SPCL EAEA F I+ +GV D KD
Sbjct  315   YDSPCLPEAEAMFAINADGVGDAKD  339



>ref|XP_004660844.1| PREDICTED: DNA repair protein RAD51 homolog 1 [Jaculus jaculus]
Length=339

 Score =   503 bits (1295),  Expect = 3e-174, Method: Compositional matrix adjust.
 Identities = 234/325 (72%), Positives = 287/325 (88%), Gaps = 0/325 (0%)
 Frame = +1

Query  196   VEEIQHGPFPIEQLQESGISAIDVKKLKDAGLCTVESVVYSPRKDLLQIKGISEAKVDKI  375
             VEE   GP PI +L++ GI+A DVKKL++AG  TVE+V Y+P+K+L+ IKGISEAK DKI
Sbjct  15    VEEESFGPQPISRLEQCGINANDVKKLEEAGFHTVEAVAYAPKKELINIKGISEAKADKI  74

Query  376   IEAASKLVPLGFTSASQLHAQRLEIIQITSGSKELDKVLEGGIETGSITEIYGEFRSGKT  555
             +  A+KLVP+GFT+A++ H +R EIIQIT+GSKELDK+L+GGIETGSITE++GEFR+GKT
Sbjct  75    LAEAAKLVPMGFTTATEFHQRRSEIIQITTGSKELDKLLQGGIETGSITEMFGEFRTGKT  134

Query  556   QLCHTLCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIADRFGLNGADVLENVAYARA  735
             Q+CHTL VTCQLP+D+GGGEGKAMYID EGTFRP+RLL +A+R+GL+G+DVL+NVAYAR 
Sbjct  135   QICHTLAVTCQLPIDRGGGEGKAMYIDTEGTFRPERLLAVAERYGLSGSDVLDNVAYARG  194

Query  736   YNTDHQSRLLLEAASMMVETRFALMIVDSATALYRTDFSGRGELSARQMHLAKFLRSLQK  915
             +NTDHQ++LL +A++MMVE+R+AL+IVDSATALYRTD+SGRGELSARQMHLA+FLR L +
Sbjct  195   FNTDHQTQLLYQASAMMVESRYALLIVDSATALYRTDYSGRGELSARQMHLARFLRMLLR  254

Query  916   LADEFGVAVVITNQVVAQVDGSAIFAGPQIKPIGGNIMAHASTTRLALRKGRGEERVCKV  1095
             LADEFGVAVVITNQVVAQVDG+A+FA    KPIGGNI+AHASTTRL LRKGRGE R+CK+
Sbjct  255   LADEFGVAVVITNQVVAQVDGAAMFAADPKKPIGGNIIAHASTTRLYLRKGRGETRICKI  314

Query  1096  VSSPCLAEAEARFQISPEGVTDVKD  1170
               SPCL EAEA F I+ +GV D KD
Sbjct  315   YDSPCLPEAEAMFAINADGVGDAKD  339



>ref|XP_001503572.1| PREDICTED: DNA repair protein RAD51 homolog 1 isoform 1 [Equus 
caballus]
 ref|XP_008141227.1| PREDICTED: DNA repair protein RAD51 homolog 1 isoform X1 [Eptesicus 
fuscus]
 ref|XP_008538853.1| PREDICTED: DNA repair protein RAD51 homolog 1 [Equus przewalskii]
Length=339

 Score =   503 bits (1295),  Expect = 4e-174, Method: Compositional matrix adjust.
 Identities = 234/336 (70%), Positives = 290/336 (86%), Gaps = 0/336 (0%)
 Frame = +1

Query  163   QKSVQERQQDEVEEIQHGPFPIEQLQESGISAIDVKKLKDAGLCTVESVVYSPRKDLLQI  342
             Q  ++      VEE   GP P+ +L++ GI+A DVKKL++AG  TVE+V Y+P+K+L+ I
Sbjct  4     QMQLEANADTSVEEESFGPQPVSRLEQCGINANDVKKLEEAGFHTVEAVAYAPKKELINI  63

Query  343   KGISEAKVDKIIEAASKLVPLGFTSASQLHAQRLEIIQITSGSKELDKVLEGGIETGSIT  522
             KGISEAK DKI+  A+KLVP+GFT+A++ H +R EIIQIT+GSKELDK+L+GGIETGSIT
Sbjct  64    KGISEAKADKILTEAAKLVPMGFTTATEFHQRRSEIIQITTGSKELDKLLQGGIETGSIT  123

Query  523   EIYGEFRSGKTQLCHTLCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIADRFGLNGA  702
             E++GEFR+GKTQ+CHTL VTCQLP+D+GGGEGKAMYID EGTFRP+RLL +A+R+GL+G+
Sbjct  124   EMFGEFRTGKTQICHTLAVTCQLPIDRGGGEGKAMYIDTEGTFRPERLLAVAERYGLSGS  183

Query  703   DVLENVAYARAYNTDHQSRLLLEAASMMVETRFALMIVDSATALYRTDFSGRGELSARQM  882
             DVL+NVAYAR +NTDHQ++LL +A++MMVE+R+AL+IVDSATALYRTD+SGRGELSARQM
Sbjct  184   DVLDNVAYARGFNTDHQTQLLYQASAMMVESRYALLIVDSATALYRTDYSGRGELSARQM  243

Query  883   HLAKFLRSLQKLADEFGVAVVITNQVVAQVDGSAIFAGPQIKPIGGNIMAHASTTRLALR  1062
             HLA+FLR L +LADEFGVAVVITNQVVAQVDG+A+FA    KPIGGNI+AHASTTRL LR
Sbjct  244   HLARFLRMLLRLADEFGVAVVITNQVVAQVDGAAMFAADPKKPIGGNIIAHASTTRLYLR  303

Query  1063  KGRGEERVCKVVSSPCLAEAEARFQISPEGVTDVKD  1170
             KGRGE R+CK+  SPCL EAEA F I+ +GV D KD
Sbjct  304   KGRGETRICKIYDSPCLPEAEAMFAINADGVGDAKD  339



>ref|NP_001102674.1| DNA repair protein RAD51 homolog 1 [Rattus norvegicus]
 ref|XP_006234846.1| PREDICTED: DNA repair protein RAD51 homolog 1 isoform X1 [Rattus 
norvegicus]
 gb|EDL79891.1| similar to DNA repair protein RAD51 homolog 1 (predicted) [Rattus 
norvegicus]
 gb|AAI68875.1| RAD51 homolog (RecA homolog, E. coli) (S. cerevisiae) [Rattus 
norvegicus]
Length=339

 Score =   503 bits (1295),  Expect = 4e-174, Method: Compositional matrix adjust.
 Identities = 235/336 (70%), Positives = 290/336 (86%), Gaps = 0/336 (0%)
 Frame = +1

Query  163   QKSVQERQQDEVEEIQHGPFPIEQLQESGISAIDVKKLKDAGLCTVESVVYSPRKDLLQI  342
             Q  ++      VEE   GP PI +L++ GI+A DVKKL++AG  TVE+V Y+P+K+L+ I
Sbjct  4     QMQLEANADTSVEEESFGPQPISRLEQCGINANDVKKLEEAGYHTVEAVAYAPKKELINI  63

Query  343   KGISEAKVDKIIEAASKLVPLGFTSASQLHAQRLEIIQITSGSKELDKVLEGGIETGSIT  522
             KGISEAK DKI+  A+KLVP+GFT+A++ H +R EIIQIT+GSKELDK+L+GGIETGSIT
Sbjct  64    KGISEAKADKILAEAAKLVPMGFTTATEFHQRRSEIIQITTGSKELDKLLQGGIETGSIT  123

Query  523   EIYGEFRSGKTQLCHTLCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIADRFGLNGA  702
             E++GEFR+GKTQ+CHTL VTCQLP+D+GGGEGKAMYID EGTFRP+RLL +A+R+GL+G+
Sbjct  124   EMFGEFRTGKTQICHTLAVTCQLPIDRGGGEGKAMYIDTEGTFRPERLLAVAERYGLSGS  183

Query  703   DVLENVAYARAYNTDHQSRLLLEAASMMVETRFALMIVDSATALYRTDFSGRGELSARQM  882
             DVL+NVAYAR +NTDHQ++LL +A++MMVE+R+AL+IVDSATALYRTD+SGRGELSARQM
Sbjct  184   DVLDNVAYARGFNTDHQTQLLYQASAMMVESRYALLIVDSATALYRTDYSGRGELSARQM  243

Query  883   HLAKFLRSLQKLADEFGVAVVITNQVVAQVDGSAIFAGPQIKPIGGNIMAHASTTRLALR  1062
             HLA+FLR L +LADEFGVAVVITNQVVAQVDG+A+FA    KPIGGNI+AHASTTRL LR
Sbjct  244   HLARFLRMLLRLADEFGVAVVITNQVVAQVDGAAMFAADPKKPIGGNIIAHASTTRLYLR  303

Query  1063  KGRGEERVCKVVSSPCLAEAEARFQISPEGVTDVKD  1170
             KGRGE R+CK+  SPCL EAEA F I+ +GV D KD
Sbjct  304   KGRGETRICKIYDSPCLPEAEAMFAINADGVGDAKD  339



>ref|XP_007537825.1| PREDICTED: DNA repair protein RAD51 homolog 1 isoform X1 [Erinaceus 
europaeus]
Length=339

 Score =   503 bits (1294),  Expect = 5e-174, Method: Compositional matrix adjust.
 Identities = 233/325 (72%), Positives = 287/325 (88%), Gaps = 0/325 (0%)
 Frame = +1

Query  196   VEEIQHGPFPIEQLQESGISAIDVKKLKDAGLCTVESVVYSPRKDLLQIKGISEAKVDKI  375
             VEE   GP P+ +L++ GI+A DVKKL++AG  TVE+V Y+P+K+L+ IKGISEAK DKI
Sbjct  15    VEEESFGPQPVSRLEQCGINANDVKKLEEAGFHTVEAVAYAPKKELINIKGISEAKADKI  74

Query  376   IEAASKLVPLGFTSASQLHAQRLEIIQITSGSKELDKVLEGGIETGSITEIYGEFRSGKT  555
             +  A+KLVP+GFT+A++ H +R EIIQIT+GSKELDK+L+GGIETGSITE++GEFR+GKT
Sbjct  75    LTEAAKLVPMGFTTATEFHQRRSEIIQITTGSKELDKLLQGGIETGSITEMFGEFRTGKT  134

Query  556   QLCHTLCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIADRFGLNGADVLENVAYARA  735
             Q+CHTL VTCQLP+D+GGGEGKAMYID EGTFRP+RLL +A+R+GL+G+DVL+NVAYAR 
Sbjct  135   QICHTLAVTCQLPIDRGGGEGKAMYIDTEGTFRPERLLAVAERYGLSGSDVLDNVAYARG  194

Query  736   YNTDHQSRLLLEAASMMVETRFALMIVDSATALYRTDFSGRGELSARQMHLAKFLRSLQK  915
             +NTDHQ++LL +A++MMVE+R+AL+IVDSATALYRTD+SGRGELSARQMHLA+FLR L +
Sbjct  195   FNTDHQTQLLYQASAMMVESRYALLIVDSATALYRTDYSGRGELSARQMHLARFLRMLLR  254

Query  916   LADEFGVAVVITNQVVAQVDGSAIFAGPQIKPIGGNIMAHASTTRLALRKGRGEERVCKV  1095
             LADEFGVAVVITNQVVAQVDG+A+FA    KPIGGNI+AHASTTRL LRKGRGE R+CK+
Sbjct  255   LADEFGVAVVITNQVVAQVDGAAMFAADPKKPIGGNIIAHASTTRLYLRKGRGETRICKI  314

Query  1096  VSSPCLAEAEARFQISPEGVTDVKD  1170
               SPCL EAEA F I+ +GV D KD
Sbjct  315   YDSPCLPEAEAMFAINADGVGDAKD  339



>ref|NP_035364.1| DNA repair protein RAD51 homolog 1 [Mus musculus]
 sp|Q08297.1|RAD51_MOUSE RecName: Full=DNA repair protein RAD51 homolog 1; AltName: Full=RAD51 
homolog A [Mus musculus]
 dbj|BAA02961.1| MmRad51 [Mus musculus]
 dbj|BAA02718.1| Rad51 protein [Mus musculus]
 dbj|BAB27489.1| unnamed protein product [Mus musculus]
 gb|AAH27384.1| RAD51 homolog (S. cerevisiae) [Mus musculus]
 dbj|BAC36357.1| unnamed protein product [Mus musculus]
 dbj|BAE30162.1| unnamed protein product [Mus musculus]
 dbj|BAE30179.1| unnamed protein product [Mus musculus]
 gb|EDL27936.1| RAD51 homolog (S. cerevisiae), isoform CRA_b [Mus musculus]
 prf||2102359A RAD51-like protein
Length=339

 Score =   503 bits (1294),  Expect = 5e-174, Method: Compositional matrix adjust.
 Identities = 234/325 (72%), Positives = 287/325 (88%), Gaps = 0/325 (0%)
 Frame = +1

Query  196   VEEIQHGPFPIEQLQESGISAIDVKKLKDAGLCTVESVVYSPRKDLLQIKGISEAKVDKI  375
             VEE   GP PI +L++ GI+A DVKKL++AG  TVE+V Y+P+K+L+ IKGISEAK DKI
Sbjct  15    VEEESFGPQPISRLEQCGINANDVKKLEEAGYHTVEAVAYAPKKELINIKGISEAKADKI  74

Query  376   IEAASKLVPLGFTSASQLHAQRLEIIQITSGSKELDKVLEGGIETGSITEIYGEFRSGKT  555
             +  A+KLVP+GFT+A++ H +R EIIQIT+GSKELDK+L+GGIETGSITE++GEFR+GKT
Sbjct  75    LTEAAKLVPMGFTTATEFHQRRSEIIQITTGSKELDKLLQGGIETGSITEMFGEFRTGKT  134

Query  556   QLCHTLCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIADRFGLNGADVLENVAYARA  735
             Q+CHTL VTCQLP+D+GGGEGKAMYID EGTFRP+RLL +A+R+GL+G+DVL+NVAYAR 
Sbjct  135   QICHTLAVTCQLPIDRGGGEGKAMYIDTEGTFRPERLLAVAERYGLSGSDVLDNVAYARG  194

Query  736   YNTDHQSRLLLEAASMMVETRFALMIVDSATALYRTDFSGRGELSARQMHLAKFLRSLQK  915
             +NTDHQ++LL +A++MMVE+R+AL+IVDSATALYRTD+SGRGELSARQMHLA+FLR L +
Sbjct  195   FNTDHQTQLLYQASAMMVESRYALLIVDSATALYRTDYSGRGELSARQMHLARFLRMLLR  254

Query  916   LADEFGVAVVITNQVVAQVDGSAIFAGPQIKPIGGNIMAHASTTRLALRKGRGEERVCKV  1095
             LADEFGVAVVITNQVVAQVDG+A+FA    KPIGGNI+AHASTTRL LRKGRGE R+CK+
Sbjct  255   LADEFGVAVVITNQVVAQVDGAAMFAADPKKPIGGNIIAHASTTRLYLRKGRGETRICKI  314

Query  1096  VSSPCLAEAEARFQISPEGVTDVKD  1170
               SPCL EAEA F I+ +GV D KD
Sbjct  315   YDSPCLPEAEAMFAINADGVGDAKD  339



>ref|XP_004274040.1| PREDICTED: DNA repair protein RAD51 homolog 1 isoform 1 [Orcinus 
orca]
 ref|XP_004274041.1| PREDICTED: DNA repair protein RAD51 homolog 1 isoform 2 [Orcinus 
orca]
 ref|XP_007460235.1| PREDICTED: DNA repair protein RAD51 homolog 1 [Lipotes vexillifer]
Length=339

 Score =   503 bits (1294),  Expect = 5e-174, Method: Compositional matrix adjust.
 Identities = 235/336 (70%), Positives = 289/336 (86%), Gaps = 0/336 (0%)
 Frame = +1

Query  163   QKSVQERQQDEVEEIQHGPFPIEQLQESGISAIDVKKLKDAGLCTVESVVYSPRKDLLQI  342
             Q  ++      VEE   GP PI +L++ GI A DVKKL++AG  TVE+V Y+P+K+L+ I
Sbjct  4     QMQLEANADTSVEEESFGPQPISRLEQCGIHANDVKKLEEAGFHTVEAVAYAPKKELINI  63

Query  343   KGISEAKVDKIIEAASKLVPLGFTSASQLHAQRLEIIQITSGSKELDKVLEGGIETGSIT  522
             KGISEAK DKI+  A+KLVP+GFT+A++ H +R EIIQIT+GSKELDK+L+GGIETGSIT
Sbjct  64    KGISEAKADKILTEAAKLVPMGFTTATEFHQRRSEIIQITTGSKELDKLLQGGIETGSIT  123

Query  523   EIYGEFRSGKTQLCHTLCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIADRFGLNGA  702
             E++GEFR+GKTQ+CHTL VTCQLP+D+GGGEGKAMYID EGTFRP+RLL +A+R+GL+G+
Sbjct  124   EMFGEFRTGKTQICHTLAVTCQLPIDRGGGEGKAMYIDTEGTFRPERLLAVAERYGLSGS  183

Query  703   DVLENVAYARAYNTDHQSRLLLEAASMMVETRFALMIVDSATALYRTDFSGRGELSARQM  882
             DVL+NVAYAR +NTDHQ++LL +A++MMVE+R+AL+IVDSATALYRTD+SGRGELSARQM
Sbjct  184   DVLDNVAYARGFNTDHQTQLLYQASAMMVESRYALLIVDSATALYRTDYSGRGELSARQM  243

Query  883   HLAKFLRSLQKLADEFGVAVVITNQVVAQVDGSAIFAGPQIKPIGGNIMAHASTTRLALR  1062
             HLA+FLR L +LADEFGVAVVITNQVVAQVDG+A+FA    KPIGGNI+AHASTTRL LR
Sbjct  244   HLARFLRMLLRLADEFGVAVVITNQVVAQVDGAAMFAADPKKPIGGNIIAHASTTRLYLR  303

Query  1063  KGRGEERVCKVVSSPCLAEAEARFQISPEGVTDVKD  1170
             KGRGE R+CK+  SPCL EAEA F I+ +GV D KD
Sbjct  304   KGRGETRICKIYDSPCLPEAEAMFAINADGVGDAKD  339



>ref|XP_006883075.1| PREDICTED: DNA repair protein RAD51 homolog 1 isoform X1 [Elephantulus 
edwardii]
Length=339

 Score =   503 bits (1294),  Expect = 6e-174, Method: Compositional matrix adjust.
 Identities = 233/325 (72%), Positives = 287/325 (88%), Gaps = 0/325 (0%)
 Frame = +1

Query  196   VEEIQHGPFPIEQLQESGISAIDVKKLKDAGLCTVESVVYSPRKDLLQIKGISEAKVDKI  375
             VEE   GP PI +L++ GI+A D+KKL++AG  TVE+V Y+P+K+L+ IKGISEAK DKI
Sbjct  15    VEEENFGPQPISRLEQCGINANDIKKLEEAGFHTVEAVAYAPKKELINIKGISEAKADKI  74

Query  376   IEAASKLVPLGFTSASQLHAQRLEIIQITSGSKELDKVLEGGIETGSITEIYGEFRSGKT  555
             +  A+KLVP+GFT+A++ H +R EIIQIT+GSKELDK+L+GGIETGSITE++GEFR+GKT
Sbjct  75    LAEAAKLVPMGFTTATEFHQRRSEIIQITTGSKELDKLLQGGIETGSITEMFGEFRTGKT  134

Query  556   QLCHTLCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIADRFGLNGADVLENVAYARA  735
             Q+CHTL VTCQLP+D+GGGEGKAMYID EGTFRP+RLL +A+R+GL+G+DVL+NVAYAR 
Sbjct  135   QICHTLAVTCQLPIDRGGGEGKAMYIDTEGTFRPERLLAVAERYGLSGSDVLDNVAYARG  194

Query  736   YNTDHQSRLLLEAASMMVETRFALMIVDSATALYRTDFSGRGELSARQMHLAKFLRSLQK  915
             +NTDHQ++LL +A++MMVE+R+AL+IVDSATALYRTD+SGRGELSARQMHLA+FLR L +
Sbjct  195   FNTDHQTQLLYQASAMMVESRYALLIVDSATALYRTDYSGRGELSARQMHLARFLRMLLR  254

Query  916   LADEFGVAVVITNQVVAQVDGSAIFAGPQIKPIGGNIMAHASTTRLALRKGRGEERVCKV  1095
             LADEFGVAVVITNQVVAQVDG+A+FA    KPIGGNI+AHASTTRL LRKGRGE R+CK+
Sbjct  255   LADEFGVAVVITNQVVAQVDGAAMFAADPKKPIGGNIIAHASTTRLYLRKGRGETRICKI  314

Query  1096  VSSPCLAEAEARFQISPEGVTDVKD  1170
               SPCL EAEA F I+ +GV D KD
Sbjct  315   YDSPCLPEAEAMFAINADGVGDAKD  339



>ref|XP_006883076.1| PREDICTED: DNA repair protein RAD51 homolog 1 isoform X2 [Elephantulus 
edwardii]
Length=339

 Score =   502 bits (1293),  Expect = 6e-174, Method: Compositional matrix adjust.
 Identities = 233/325 (72%), Positives = 287/325 (88%), Gaps = 0/325 (0%)
 Frame = +1

Query  196   VEEIQHGPFPIEQLQESGISAIDVKKLKDAGLCTVESVVYSPRKDLLQIKGISEAKVDKI  375
             VEE   GP PI +L++ GI+A D+KKL++AG  TVE+V Y+P+K+L+ IKGISEAK DKI
Sbjct  15    VEEENFGPQPISRLEQCGINANDIKKLEEAGFHTVEAVAYAPKKELINIKGISEAKADKI  74

Query  376   IEAASKLVPLGFTSASQLHAQRLEIIQITSGSKELDKVLEGGIETGSITEIYGEFRSGKT  555
             +  A+KLVP+GFT+A++ H +R EIIQIT+GSKELDK+L+GGIETGSITE++GEFR+GKT
Sbjct  75    LTEAAKLVPMGFTTATEFHQRRSEIIQITTGSKELDKLLQGGIETGSITEMFGEFRTGKT  134

Query  556   QLCHTLCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIADRFGLNGADVLENVAYARA  735
             Q+CHTL VTCQLP+D+GGGEGKAMYID EGTFRP+RLL +A+R+GL+G+DVL+NVAYAR 
Sbjct  135   QICHTLAVTCQLPIDRGGGEGKAMYIDTEGTFRPERLLAVAERYGLSGSDVLDNVAYARG  194

Query  736   YNTDHQSRLLLEAASMMVETRFALMIVDSATALYRTDFSGRGELSARQMHLAKFLRSLQK  915
             +NTDHQ++LL +A++MMVE+R+AL+IVDSATALYRTD+SGRGELSARQMHLA+FLR L +
Sbjct  195   FNTDHQTQLLYQASAMMVESRYALLIVDSATALYRTDYSGRGELSARQMHLARFLRMLLR  254

Query  916   LADEFGVAVVITNQVVAQVDGSAIFAGPQIKPIGGNIMAHASTTRLALRKGRGEERVCKV  1095
             LADEFGVAVVITNQVVAQVDG+A+FA    KPIGGNI+AHASTTRL LRKGRGE R+CK+
Sbjct  255   LADEFGVAVVITNQVVAQVDGAAMFAADPKKPIGGNIIAHASTTRLYLRKGRGETRICKI  314

Query  1096  VSSPCLAEAEARFQISPEGVTDVKD  1170
               SPCL EAEA F I+ +GV D KD
Sbjct  315   YDSPCLPEAEAMFAINADGVGDAKD  339



>ref|XP_003475741.1| PREDICTED: DNA repair protein RAD51 homolog 1 isoform 1 [Cavia 
porcellus]
Length=339

 Score =   502 bits (1293),  Expect = 8e-174, Method: Compositional matrix adjust.
 Identities = 234/336 (70%), Positives = 290/336 (86%), Gaps = 0/336 (0%)
 Frame = +1

Query  163   QKSVQERQQDEVEEIQHGPFPIEQLQESGISAIDVKKLKDAGLCTVESVVYSPRKDLLQI  342
             Q  ++      V+E   GP PI +L++ GI+A DVKKL++AG  TVE+V Y+P+K+L+ I
Sbjct  4     QMQLEASADTSVDEESFGPQPISRLEQCGINANDVKKLEEAGFHTVEAVAYAPKKELINI  63

Query  343   KGISEAKVDKIIEAASKLVPLGFTSASQLHAQRLEIIQITSGSKELDKVLEGGIETGSIT  522
             KGISEAK DKI+  A+KLVP+GFT+A++ H +R EIIQIT+GSKELDK+L+GGIETGSIT
Sbjct  64    KGISEAKADKILAEAAKLVPMGFTTATEFHQRRSEIIQITTGSKELDKLLQGGIETGSIT  123

Query  523   EIYGEFRSGKTQLCHTLCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIADRFGLNGA  702
             E++GEFR+GKTQ+CHTL VTCQLP+D+GGGEGKAMYID EGTFRP+RLL +A+R+GL+G+
Sbjct  124   EMFGEFRTGKTQICHTLAVTCQLPIDRGGGEGKAMYIDTEGTFRPERLLAVAERYGLSGS  183

Query  703   DVLENVAYARAYNTDHQSRLLLEAASMMVETRFALMIVDSATALYRTDFSGRGELSARQM  882
             DVL+NVAYAR +NTDHQ++LL +A++MMVE+R+AL+IVDSATALYRTD+SGRGELSARQM
Sbjct  184   DVLDNVAYARGFNTDHQTQLLYQASAMMVESRYALLIVDSATALYRTDYSGRGELSARQM  243

Query  883   HLAKFLRSLQKLADEFGVAVVITNQVVAQVDGSAIFAGPQIKPIGGNIMAHASTTRLALR  1062
             HLA+FLR L +LADEFGVAVVITNQVVAQVDG+A+FA    KPIGGNI+AHASTTRL LR
Sbjct  244   HLARFLRMLLRLADEFGVAVVITNQVVAQVDGAAMFAADPKKPIGGNIIAHASTTRLYLR  303

Query  1063  KGRGEERVCKVVSSPCLAEAEARFQISPEGVTDVKD  1170
             KGRGE R+CK+  SPCL EAEA F I+ +GV D KD
Sbjct  304   KGRGETRICKIYDSPCLPEAEAMFAINADGVGDAKD  339



>ref|XP_006778150.1| PREDICTED: DNA repair protein RAD51 homolog 1 isoform X2 [Myotis 
davidii]
Length=339

 Score =   502 bits (1292),  Expect = 9e-174, Method: Compositional matrix adjust.
 Identities = 234/336 (70%), Positives = 290/336 (86%), Gaps = 0/336 (0%)
 Frame = +1

Query  163   QKSVQERQQDEVEEIQHGPFPIEQLQESGISAIDVKKLKDAGLCTVESVVYSPRKDLLQI  342
             Q  ++      VE+   GP PI +L++ GI+A DVKKL++AG  TVE+V Y+P+K+L+ I
Sbjct  4     QMQLEANADTSVEDESFGPQPISRLEQCGINANDVKKLEEAGFHTVEAVAYAPKKELINI  63

Query  343   KGISEAKVDKIIEAASKLVPLGFTSASQLHAQRLEIIQITSGSKELDKVLEGGIETGSIT  522
             KGISEAK DKI+  A+KLVP+GFT+A++ H +R EIIQIT+GSKELDK+L+GGIETGSIT
Sbjct  64    KGISEAKADKILTEAAKLVPMGFTTATEFHQRRSEIIQITTGSKELDKLLQGGIETGSIT  123

Query  523   EIYGEFRSGKTQLCHTLCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIADRFGLNGA  702
             E++GEFR+GKTQ+CHTL VTCQLP+D+GGGEGKAMYID EGTFRP+RLL +A+R+GL+G+
Sbjct  124   EMFGEFRTGKTQICHTLAVTCQLPIDRGGGEGKAMYIDTEGTFRPERLLAVAERYGLSGS  183

Query  703   DVLENVAYARAYNTDHQSRLLLEAASMMVETRFALMIVDSATALYRTDFSGRGELSARQM  882
             DVL+NVAYAR +NTDHQ++LL +A++MMVE+R+AL+IVDSATALYRTD+SGRGELSARQM
Sbjct  184   DVLDNVAYARGFNTDHQTQLLYQASAMMVESRYALLIVDSATALYRTDYSGRGELSARQM  243

Query  883   HLAKFLRSLQKLADEFGVAVVITNQVVAQVDGSAIFAGPQIKPIGGNIMAHASTTRLALR  1062
             HLA+FLR L +LADEFGVAVVITNQVVAQVDG+A+FA    KPIGGNI+AHASTTRL LR
Sbjct  244   HLARFLRMLLRLADEFGVAVVITNQVVAQVDGAAMFAADPKKPIGGNIIAHASTTRLYLR  303

Query  1063  KGRGEERVCKVVSSPCLAEAEARFQISPEGVTDVKD  1170
             KGRGE R+CK+  SPCL EAEA F I+ +GV D KD
Sbjct  304   KGRGETRICKIYDSPCLPEAEAMFAINADGVGDAKD  339



>ref|XP_004578230.1| PREDICTED: DNA repair protein RAD51 homolog 1 [Ochotona princeps]
Length=339

 Score =   502 bits (1292),  Expect = 9e-174, Method: Compositional matrix adjust.
 Identities = 234/336 (70%), Positives = 289/336 (86%), Gaps = 0/336 (0%)
 Frame = +1

Query  163   QKSVQERQQDEVEEIQHGPFPIEQLQESGISAIDVKKLKDAGLCTVESVVYSPRKDLLQI  342
             Q  ++      VEE   GP PI +L++ GI+A DVKKL++AG  TVE+V Y+P+K+L+ I
Sbjct  4     QMQLEANADTSVEEESFGPQPISRLEQCGINANDVKKLEEAGFHTVEAVAYAPKKELINI  63

Query  343   KGISEAKVDKIIEAASKLVPLGFTSASQLHAQRLEIIQITSGSKELDKVLEGGIETGSIT  522
             KGISEAK DKI+  A+KLVP+GFT+A++ H +R EIIQIT+GSKELDK+L+GGIETGSIT
Sbjct  64    KGISEAKADKILAEAAKLVPMGFTTATEFHQRRSEIIQITTGSKELDKLLQGGIETGSIT  123

Query  523   EIYGEFRSGKTQLCHTLCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIADRFGLNGA  702
             E++GEFR+GKTQ+CHTL VTCQLP+D+GGGEGKAMYID EGTFRP+RLL +A+R+GL+G+
Sbjct  124   EMFGEFRTGKTQICHTLAVTCQLPIDRGGGEGKAMYIDTEGTFRPERLLAVAERYGLSGS  183

Query  703   DVLENVAYARAYNTDHQSRLLLEAASMMVETRFALMIVDSATALYRTDFSGRGELSARQM  882
             DVL+NVAYAR +NTDHQ++LL +A++MM E+R+AL+IVDSATALYRTD+SGRGELSARQM
Sbjct  184   DVLDNVAYARGFNTDHQTQLLYQASAMMAESRYALLIVDSATALYRTDYSGRGELSARQM  243

Query  883   HLAKFLRSLQKLADEFGVAVVITNQVVAQVDGSAIFAGPQIKPIGGNIMAHASTTRLALR  1062
             HLA+FLR L +LADEFGVAVVITNQVVAQVDG+A+FA    KPIGGNI+AHASTTRL LR
Sbjct  244   HLARFLRMLLRLADEFGVAVVITNQVVAQVDGAAMFAADPKKPIGGNIIAHASTTRLYLR  303

Query  1063  KGRGEERVCKVVSSPCLAEAEARFQISPEGVTDVKD  1170
             KGRGE R+CK+  SPCL EAEA F I+ +GV D KD
Sbjct  304   KGRGETRICKIYDSPCLPEAEAMFAINADGVGDAKD  339



>gb|AAV38511.1| RAD51 homolog (RecA homolog, E. coli) (S. cerevisiae) [Homo sapiens]
Length=339

 Score =   502 bits (1292),  Expect = 1e-173, Method: Compositional matrix adjust.
 Identities = 235/336 (70%), Positives = 290/336 (86%), Gaps = 0/336 (0%)
 Frame = +1

Query  163   QKSVQERQQDEVEEIQHGPFPIEQLQESGISAIDVKKLKDAGLCTVESVVYSPRKDLLQI  342
             Q  ++      VEE   GP PI +L++ GI+A DVKKL++AG  TVE+V Y+P+K+L+ I
Sbjct  4     QMQLEANADTSVEEESFGPQPISRLEQCGINANDVKKLEEAGFHTVEAVAYAPKKELINI  63

Query  343   KGISEAKVDKIIEAASKLVPLGFTSASQLHAQRLEIIQITSGSKELDKVLEGGIETGSIT  522
             KGISEAK DKI+  A+KLVP+GFT+A++ H +R EIIQIT+GSKELDK+L+GGIETGSIT
Sbjct  64    KGISEAKADKILAEAAKLVPMGFTTATEFHQRRSEIIQITTGSKELDKLLQGGIETGSIT  123

Query  523   EIYGEFRSGKTQLCHTLCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIADRFGLNGA  702
             E++GEFR+GKTQ+CHTL VTCQLP+D+G GEGKAMYID EGTFRP+RLL +A+R+GL+G+
Sbjct  124   EMFGEFRTGKTQICHTLAVTCQLPIDRGEGEGKAMYIDTEGTFRPERLLAVAERYGLSGS  183

Query  703   DVLENVAYARAYNTDHQSRLLLEAASMMVETRFALMIVDSATALYRTDFSGRGELSARQM  882
             DVL+NVAYARA+NTDHQ++LL +A++MMVE+R+AL+IVDSATALYRTD+SGRGELSARQM
Sbjct  184   DVLDNVAYARAFNTDHQTQLLYQASAMMVESRYALLIVDSATALYRTDYSGRGELSARQM  243

Query  883   HLAKFLRSLQKLADEFGVAVVITNQVVAQVDGSAIFAGPQIKPIGGNIMAHASTTRLALR  1062
             HLA+FLR L +LADEFGVAVVITNQVVAQVDG+A+FA    KPIGGNI+AHASTTRL LR
Sbjct  244   HLARFLRMLLRLADEFGVAVVITNQVVAQVDGAAMFAADPKKPIGGNIIAHASTTRLYLR  303

Query  1063  KGRGEERVCKVVSSPCLAEAEARFQISPEGVTDVKD  1170
             KGRGE R+CK+  SPCL EAEA F I+ +GV D KD
Sbjct  304   KGRGETRICKIYDSPCLPEAEAMFAINADGVGDAKD  339



>ref|XP_005095899.1| PREDICTED: DNA repair protein RAD51 homolog 1-like isoform X1 
[Aplysia californica]
Length=355

 Score =   502 bits (1293),  Expect = 1e-173, Method: Compositional matrix adjust.
 Identities = 235/353 (67%), Positives = 293/353 (83%), Gaps = 5/353 (1%)
 Frame = +1

Query  127   FGATMEQQHRNQQKSVQERQQ-----DEVEEIQHGPFPIEQLQESGISAIDVKKLKDAGL  291
             F   + +  R    ++Q R++        E+   GP P+ +L+ +GISA DVKKL++AG 
Sbjct  3     FSLILNRLQRTMASAMQAREEGGEEITSTEDETFGPMPLAKLEGNGISAGDVKKLEEAGF  62

Query  292   CTVESVVYSPRKDLLQIKGISEAKVDKIIEAASKLVPLGFTSASQLHAQRLEIIQITSGS  471
              TVESV ++P+K LL IKGISE K DKI+  A+KLVP+GFT+A++ H +R EIIQ+T+GS
Sbjct  63    FTVESVAFAPKKMLLSIKGISEVKADKIVAEAAKLVPMGFTTATEFHQKRSEIIQVTTGS  122

Query  472   KELDKVLEGGIETGSITEIYGEFRSGKTQLCHTLCVTCQLPLDQGGGEGKAMYIDAEGTF  651
             KELDK+L+GGIETGSITEI+GEFR+GKTQLCHTL VTCQLP+D GGGEGKAMYID EGTF
Sbjct  123   KELDKLLQGGIETGSITEIFGEFRTGKTQLCHTLAVTCQLPIDMGGGEGKAMYIDTEGTF  182

Query  652   RPQRLLQIADRFGLNGADVLENVAYARAYNTDHQSRLLLEAASMMVETRFALMIVDSATA  831
             RP+RLL +ADR+GL+G+DVL+NVAYARAYN+DHQS+LL++AA+MM E+R+AL+IVDSATA
Sbjct  183   RPERLLAVADRYGLSGSDVLDNVAYARAYNSDHQSQLLIQAAAMMAESRYALLIVDSATA  242

Query  832   LYRTDFSGRGELSARQMHLAKFLRSLQKLADEFGVAVVITNQVVAQVDGSAIFAGPQIKP  1011
             LYRTD++GRGELSARQMHLA+FLR L +LADEFGVAVVI+NQVVAQVDG+++F     KP
Sbjct  243   LYRTDYAGRGELSARQMHLARFLRMLLRLADEFGVAVVISNQVVAQVDGASMFTADPKKP  302

Query  1012  IGGNIMAHASTTRLALRKGRGEERVCKVVSSPCLAEAEARFQISPEGVTDVKD  1170
             IGGNI+AHASTTRL LRKGRGE R+CK+  SPCL EAEA F I+ +G+ D KD
Sbjct  303   IGGNIIAHASTTRLYLRKGRGETRICKIYDSPCLPEAEAMFAINADGIGDAKD  355



>ref|XP_005978507.1| PREDICTED: DNA repair protein RAD51 homolog 1 isoform X1 [Pantholops 
hodgsonii]
 ref|XP_005978508.1| PREDICTED: DNA repair protein RAD51 homolog 1 isoform X2 [Pantholops 
hodgsonii]
Length=339

 Score =   501 bits (1291),  Expect = 1e-173, Method: Compositional matrix adjust.
 Identities = 234/336 (70%), Positives = 289/336 (86%), Gaps = 0/336 (0%)
 Frame = +1

Query  163   QKSVQERQQDEVEEIQHGPFPIEQLQESGISAIDVKKLKDAGLCTVESVVYSPRKDLLQI  342
             Q  ++      VEE   GP PI +L++ GI+A DVKKL++AG  TVE+V Y+P+K+L+ I
Sbjct  4     QMQLEANADTSVEEESFGPQPISRLEQCGINANDVKKLEEAGFHTVEAVAYAPKKELINI  63

Query  343   KGISEAKVDKIIEAASKLVPLGFTSASQLHAQRLEIIQITSGSKELDKVLEGGIETGSIT  522
             KGISEAK DKI+  A+KLVP+GFT+A++ H +R EIIQIT+GSKELDK+L+GGIETGSIT
Sbjct  64    KGISEAKADKILTEAAKLVPMGFTTATEFHQRRSEIIQITTGSKELDKLLQGGIETGSIT  123

Query  523   EIYGEFRSGKTQLCHTLCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIADRFGLNGA  702
             E++GEFR+GKTQ+CHTL VTCQLP+D+GGGEGKAMY D EGTFRP+RLL +A+R+GL+G+
Sbjct  124   EMFGEFRTGKTQICHTLAVTCQLPIDRGGGEGKAMYTDTEGTFRPERLLAVAERYGLSGS  183

Query  703   DVLENVAYARAYNTDHQSRLLLEAASMMVETRFALMIVDSATALYRTDFSGRGELSARQM  882
             DVL+NVAYAR +NTDHQ++LL +A++MMVE+R+AL+IVDSATALYRTD+SGRGELSARQM
Sbjct  184   DVLDNVAYARGFNTDHQTQLLYQASAMMVESRYALLIVDSATALYRTDYSGRGELSARQM  243

Query  883   HLAKFLRSLQKLADEFGVAVVITNQVVAQVDGSAIFAGPQIKPIGGNIMAHASTTRLALR  1062
             HLA+FLR L +LADEFGVAVVITNQVVAQVDG+A+FA    KPIGGNI+AHASTTRL LR
Sbjct  244   HLARFLRMLLRLADEFGVAVVITNQVVAQVDGAAMFAADPKKPIGGNIIAHASTTRLYLR  303

Query  1063  KGRGEERVCKVVSSPCLAEAEARFQISPEGVTDVKD  1170
             KGRGE R+CK+  SPCL EAEA F I+ +GV D KD
Sbjct  304   KGRGETRICKIYDSPCLPEAEAMFAINADGVGDAKD  339



>ref|XP_006128732.1| PREDICTED: DNA repair protein RAD51 homolog 1 [Pelodiscus sinensis]
Length=339

 Score =   501 bits (1290),  Expect = 2e-173, Method: Compositional matrix adjust.
 Identities = 235/336 (70%), Positives = 287/336 (85%), Gaps = 0/336 (0%)
 Frame = +1

Query  163   QKSVQERQQDEVEEIQHGPFPIEQLQESGISAIDVKKLKDAGLCTVESVVYSPRKDLLQI  342
             Q   +   +   EE   GP PI +L++ GI+A DVKKL++AG  TVE+V Y+P+K+LL I
Sbjct  4     QMQYEANAETSTEEESFGPQPISRLEQCGINANDVKKLEEAGFHTVEAVAYAPKKELLNI  63

Query  343   KGISEAKVDKIIEAASKLVPLGFTSASQLHAQRLEIIQITSGSKELDKVLEGGIETGSIT  522
             KGISEAK DKI+  A+KLVP+GFT+A++ H +R EIIQIT+GSKELDK+L+GG ETGSIT
Sbjct  64    KGISEAKADKILAEAAKLVPMGFTTATEFHQRRSEIIQITTGSKELDKLLQGGPETGSIT  123

Query  523   EIYGEFRSGKTQLCHTLCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIADRFGLNGA  702
             E++GEFR+GKTQLCHTL VTCQLP+DQGGGEGKAMYID EGTFRP+RLL +A+R+ L+G+
Sbjct  124   EMFGEFRTGKTQLCHTLAVTCQLPIDQGGGEGKAMYIDTEGTFRPERLLAVAERYSLSGS  183

Query  703   DVLENVAYARAYNTDHQSRLLLEAASMMVETRFALMIVDSATALYRTDFSGRGELSARQM  882
             DVL+NVAYARA+NTDHQ++LL +A++MM E+R+AL+IVDSATALYRTD+SGRGELSARQM
Sbjct  184   DVLDNVAYARAFNTDHQTQLLYQASAMMAESRYALLIVDSATALYRTDYSGRGELSARQM  243

Query  883   HLAKFLRSLQKLADEFGVAVVITNQVVAQVDGSAIFAGPQIKPIGGNIMAHASTTRLALR  1062
             HLA+FLR L +LADEFGVAVVITNQVVAQVDG+A+FA    KPIGGNI+AHASTTRL LR
Sbjct  244   HLARFLRMLLRLADEFGVAVVITNQVVAQVDGAAMFAADPKKPIGGNIIAHASTTRLYLR  303

Query  1063  KGRGEERVCKVVSSPCLAEAEARFQISPEGVTDVKD  1170
             KGRGE R+CK+  SPCL EAEA F I+ +GV D KD
Sbjct  304   KGRGETRICKIYDSPCLPEAEAMFAINADGVGDAKD  339



>ref|XP_006920548.1| PREDICTED: DNA repair protein RAD51 homolog 1 [Pteropus alecto]
 ref|XP_011353217.1| PREDICTED: DNA repair protein RAD51 homolog 1 isoform X1 [Pteropus 
vampyrus]
 ref|XP_011353218.1| PREDICTED: DNA repair protein RAD51 homolog 1 isoform X2 [Pteropus 
vampyrus]
 gb|ELK05537.1| DNA repair protein RAD51 like protein 1 [Pteropus alecto]
Length=339

 Score =   501 bits (1290),  Expect = 2e-173, Method: Compositional matrix adjust.
 Identities = 234/336 (70%), Positives = 290/336 (86%), Gaps = 0/336 (0%)
 Frame = +1

Query  163   QKSVQERQQDEVEEIQHGPFPIEQLQESGISAIDVKKLKDAGLCTVESVVYSPRKDLLQI  342
             Q  ++      +EE   GP PI +L++ GI+A DVKKL++AG  TVE+V Y+P+K+L+ I
Sbjct  4     QMQLEANADTSLEEESFGPQPISRLEQCGINANDVKKLEEAGFHTVEAVAYAPKKELINI  63

Query  343   KGISEAKVDKIIEAASKLVPLGFTSASQLHAQRLEIIQITSGSKELDKVLEGGIETGSIT  522
             KGISEAK DKI+  A+KLVP+GFT+A++ H +R EIIQIT+GSKELDK+L+GGIETGSIT
Sbjct  64    KGISEAKADKILTEAAKLVPMGFTTATEFHQRRSEIIQITTGSKELDKLLQGGIETGSIT  123

Query  523   EIYGEFRSGKTQLCHTLCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIADRFGLNGA  702
             E++GEFR+GKTQ+CHTL VTCQLP+D+GGGEGKAMYID EGTFRP+RLL +A+R+GL+G+
Sbjct  124   EMFGEFRTGKTQICHTLAVTCQLPIDRGGGEGKAMYIDTEGTFRPERLLAVAERYGLSGS  183

Query  703   DVLENVAYARAYNTDHQSRLLLEAASMMVETRFALMIVDSATALYRTDFSGRGELSARQM  882
             DVL+NVAYAR +NTDHQ++LL +A++MMVE+R+AL+IVDSATALYRTD+SGRGELSARQM
Sbjct  184   DVLDNVAYARGFNTDHQTQLLYQASAMMVESRYALLIVDSATALYRTDYSGRGELSARQM  243

Query  883   HLAKFLRSLQKLADEFGVAVVITNQVVAQVDGSAIFAGPQIKPIGGNIMAHASTTRLALR  1062
             HLA+FLR L +LADEFGVAVVITNQVVAQVDG+A+FA    KPIGGNI+AHASTTRL LR
Sbjct  244   HLARFLRMLLRLADEFGVAVVITNQVVAQVDGAAMFAADPKKPIGGNIIAHASTTRLYLR  303

Query  1063  KGRGEERVCKVVSSPCLAEAEARFQISPEGVTDVKD  1170
             KGRGE R+CK+  SPCL EAEA F I+ +GV D KD
Sbjct  304   KGRGETRICKIYDSPCLPEAEAIFAINADGVGDAKD  339



>ref|XP_008267004.1| PREDICTED: DNA repair protein RAD51 homolog 1 isoform X1 [Oryctolagus 
cuniculus]
Length=339

 Score =   501 bits (1290),  Expect = 2e-173, Method: Compositional matrix adjust.
 Identities = 233/336 (69%), Positives = 290/336 (86%), Gaps = 0/336 (0%)
 Frame = +1

Query  163   QKSVQERQQDEVEEIQHGPFPIEQLQESGISAIDVKKLKDAGLCTVESVVYSPRKDLLQI  342
             Q  ++      VEE   GP P+ +L++ GI+A DVKKL++AG  TVE+V Y+P+K+L+ I
Sbjct  4     QMQLEANADTSVEEESFGPQPVSRLEQCGINANDVKKLEEAGFHTVEAVAYAPKKELINI  63

Query  343   KGISEAKVDKIIEAASKLVPLGFTSASQLHAQRLEIIQITSGSKELDKVLEGGIETGSIT  522
             KGISEAK DKI+  A+KLVP+GFT+A++ H +R EIIQIT+GSKELDK+L+GGIETGSIT
Sbjct  64    KGISEAKADKILTEAAKLVPMGFTTATEFHQRRSEIIQITTGSKELDKLLQGGIETGSIT  123

Query  523   EIYGEFRSGKTQLCHTLCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIADRFGLNGA  702
             E++GEFR+GKTQ+CHTL VTCQLP+D+GGGEGKAMYID EGTFRP+RLL +A+R+GL+G+
Sbjct  124   EMFGEFRTGKTQICHTLAVTCQLPIDRGGGEGKAMYIDTEGTFRPERLLAVAERYGLSGS  183

Query  703   DVLENVAYARAYNTDHQSRLLLEAASMMVETRFALMIVDSATALYRTDFSGRGELSARQM  882
             DVL+NVAYAR +NTDHQ++LL +A++MMVE+R+AL+IVDSATALYRTD+SGRGELSARQM
Sbjct  184   DVLDNVAYARGFNTDHQTQLLYQASAMMVESRYALLIVDSATALYRTDYSGRGELSARQM  243

Query  883   HLAKFLRSLQKLADEFGVAVVITNQVVAQVDGSAIFAGPQIKPIGGNIMAHASTTRLALR  1062
             HLA+FLR L +LADEFGVAVVITNQVVAQVDG+A+FA    KPIGGNI+AHASTTRL LR
Sbjct  244   HLARFLRMLLRLADEFGVAVVITNQVVAQVDGAAMFAADPKKPIGGNIIAHASTTRLYLR  303

Query  1063  KGRGEERVCKVVSSPCLAEAEARFQISPEGVTDVKD  1170
             KGRGE R+CK+  SPCL EAEA F I+ +GV D K+
Sbjct  304   KGRGETRICKIYDSPCLPEAEAMFAINADGVGDAKE  339



>ref|XP_001370830.1| PREDICTED: DNA repair protein RAD51 homolog 1 isoform X1 [Monodelphis 
domestica]
 ref|XP_007480119.1| PREDICTED: DNA repair protein RAD51 homolog 1 isoform X2 [Monodelphis 
domestica]
 ref|XP_007480120.1| PREDICTED: DNA repair protein RAD51 homolog 1 isoform X3 [Monodelphis 
domestica]
 ref|XP_007480121.1| PREDICTED: DNA repair protein RAD51 homolog 1 isoform X4 [Monodelphis 
domestica]
Length=339

 Score =   501 bits (1290),  Expect = 2e-173, Method: Compositional matrix adjust.
 Identities = 233/325 (72%), Positives = 287/325 (88%), Gaps = 0/325 (0%)
 Frame = +1

Query  196   VEEIQHGPFPIEQLQESGISAIDVKKLKDAGLCTVESVVYSPRKDLLQIKGISEAKVDKI  375
             VEE   GP PI +L++ GI+A D+KKL++AG  TVE+V Y+P+K+L+ +KGISEAK DKI
Sbjct  15    VEEENIGPQPISRLEQCGINANDLKKLEEAGYHTVEAVAYAPKKELINVKGISEAKADKI  74

Query  376   IEAASKLVPLGFTSASQLHAQRLEIIQITSGSKELDKVLEGGIETGSITEIYGEFRSGKT  555
             +  A+KLVP+GFT+A++ H QR EIIQIT+GSKELDK+L+GGIETGSITEI+GEFR+GKT
Sbjct  75    LAEAAKLVPMGFTTATEFHQQRSEIIQITTGSKELDKLLQGGIETGSITEIFGEFRTGKT  134

Query  556   QLCHTLCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIADRFGLNGADVLENVAYARA  735
             Q+CHTL VTCQLP+D+GGGEGKAMYID EGTFRP+RLL +A+R+GL+G+DVL+NVAYAR 
Sbjct  135   QICHTLAVTCQLPIDRGGGEGKAMYIDTEGTFRPERLLAVAERYGLSGSDVLDNVAYARG  194

Query  736   YNTDHQSRLLLEAASMMVETRFALMIVDSATALYRTDFSGRGELSARQMHLAKFLRSLQK  915
             +NTDHQ++LL +A++MMVE+R+AL+IVDS+TALYRTD+SGRGELSARQMHLA+FLR L +
Sbjct  195   FNTDHQTQLLYQASAMMVESRYALLIVDSSTALYRTDYSGRGELSARQMHLARFLRMLLR  254

Query  916   LADEFGVAVVITNQVVAQVDGSAIFAGPQIKPIGGNIMAHASTTRLALRKGRGEERVCKV  1095
             LADEFGVAVVITNQVVAQVDG+A+FA    KPIGGNI+AHASTTRL LRKGRGE R+CK+
Sbjct  255   LADEFGVAVVITNQVVAQVDGAAMFAADPKKPIGGNIIAHASTTRLYLRKGRGETRICKI  314

Query  1096  VSSPCLAEAEARFQISPEGVTDVKD  1170
               SPCL EAEA F I+ +GV D KD
Sbjct  315   YDSPCLPEAEAVFAINADGVGDAKD  339



>ref|XP_004896159.1| PREDICTED: DNA repair protein RAD51 homolog 1 [Heterocephalus 
glaber]
 ref|XP_004861626.1| PREDICTED: DNA repair protein RAD51 homolog 1 [Heterocephalus 
glaber]
Length=339

 Score =   501 bits (1289),  Expect = 3e-173, Method: Compositional matrix adjust.
 Identities = 233/325 (72%), Positives = 286/325 (88%), Gaps = 0/325 (0%)
 Frame = +1

Query  196   VEEIQHGPFPIEQLQESGISAIDVKKLKDAGLCTVESVVYSPRKDLLQIKGISEAKVDKI  375
             VEE   GP PI +L++ GI+A DVKKL++AG  TVE+V Y+P+K+L  IKGISEAK DKI
Sbjct  15    VEEESFGPQPISRLEQCGINANDVKKLEEAGFHTVEAVAYAPKKELTNIKGISEAKADKI  74

Query  376   IEAASKLVPLGFTSASQLHAQRLEIIQITSGSKELDKVLEGGIETGSITEIYGEFRSGKT  555
             +  A+KLVP+GFT+A++ H +R EIIQIT+GSKELDK+L+GGIETGSITE++GEFR+GKT
Sbjct  75    LAEAAKLVPMGFTTATEFHQRRSEIIQITTGSKELDKLLQGGIETGSITEMFGEFRTGKT  134

Query  556   QLCHTLCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIADRFGLNGADVLENVAYARA  735
             Q+CHTL VTCQLP+D+GGGEGKAMYID EGTFRP+RLL +A+R+GL+G+DVL+NVAYAR 
Sbjct  135   QICHTLAVTCQLPIDRGGGEGKAMYIDTEGTFRPERLLAVAERYGLSGSDVLDNVAYARG  194

Query  736   YNTDHQSRLLLEAASMMVETRFALMIVDSATALYRTDFSGRGELSARQMHLAKFLRSLQK  915
             +NTDHQ++LL +A++MMVE+R+AL+IVDSATALYRTD+SGRGELSARQMHLA+FLR L +
Sbjct  195   FNTDHQTQLLYQASAMMVESRYALLIVDSATALYRTDYSGRGELSARQMHLARFLRMLLR  254

Query  916   LADEFGVAVVITNQVVAQVDGSAIFAGPQIKPIGGNIMAHASTTRLALRKGRGEERVCKV  1095
             LADEFGVAVVITNQVVAQVDG+A+F+    KPIGGNI+AHASTTRL LRKGRGE R+CK+
Sbjct  255   LADEFGVAVVITNQVVAQVDGAAMFSADPKKPIGGNIIAHASTTRLYLRKGRGETRICKI  314

Query  1096  VSSPCLAEAEARFQISPEGVTDVKD  1170
               SPCL EAEA F I+ +GV D KD
Sbjct  315   YDSPCLPEAEAMFAINADGVGDAKD  339



>ref|XP_006979273.1| PREDICTED: DNA repair protein RAD51 homolog 1 [Peromyscus maniculatus 
bairdii]
Length=339

 Score =   501 bits (1289),  Expect = 3e-173, Method: Compositional matrix adjust.
 Identities = 232/325 (71%), Positives = 287/325 (88%), Gaps = 0/325 (0%)
 Frame = +1

Query  196   VEEIQHGPFPIEQLQESGISAIDVKKLKDAGLCTVESVVYSPRKDLLQIKGISEAKVDKI  375
             VEE   GP PI +L++ G++A DVKKL++AG  TVE+V Y+P+K+L+ IKGISEAK +KI
Sbjct  15    VEEESFGPQPISRLEQCGVNANDVKKLEEAGFHTVEAVAYAPKKELINIKGISEAKAEKI  74

Query  376   IEAASKLVPLGFTSASQLHAQRLEIIQITSGSKELDKVLEGGIETGSITEIYGEFRSGKT  555
             +  A+KLVP+GFT+A++ H +R EIIQIT+GSKELDK+L+GGIETGSITE++GEFR+GKT
Sbjct  75    LTEAAKLVPMGFTTATEFHQRRSEIIQITTGSKELDKLLQGGIETGSITEMFGEFRTGKT  134

Query  556   QLCHTLCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIADRFGLNGADVLENVAYARA  735
             Q+CHTL VTCQLP+D+GGGEGKAMYID EGTFRP+RLL +A+R+GL+G+DVL+NVAYAR 
Sbjct  135   QICHTLAVTCQLPIDRGGGEGKAMYIDTEGTFRPERLLAVAERYGLSGSDVLDNVAYARG  194

Query  736   YNTDHQSRLLLEAASMMVETRFALMIVDSATALYRTDFSGRGELSARQMHLAKFLRSLQK  915
             +NTDHQ++LL +A++MMVE+R+AL+IVDSATALYRTD+SGRGELSARQMHLA+FLR L +
Sbjct  195   FNTDHQTQLLYQASAMMVESRYALLIVDSATALYRTDYSGRGELSARQMHLARFLRMLLR  254

Query  916   LADEFGVAVVITNQVVAQVDGSAIFAGPQIKPIGGNIMAHASTTRLALRKGRGEERVCKV  1095
             LADEFGVAVVITNQVVAQVDG+A+FA    KPIGGNI+AHASTTRL LRKGRGE R+CK+
Sbjct  255   LADEFGVAVVITNQVVAQVDGAAMFAADPKKPIGGNIIAHASTTRLYLRKGRGETRICKI  314

Query  1096  VSSPCLAEAEARFQISPEGVTDVKD  1170
               SPCL EAEA F I+ +GV D KD
Sbjct  315   YDSPCLPEAEAMFAINADGVGDAKD  339



>ref|XP_005364315.1| PREDICTED: DNA repair protein RAD51 homolog 1 [Microtus ochrogaster]
Length=339

 Score =   501 bits (1289),  Expect = 3e-173, Method: Compositional matrix adjust.
 Identities = 232/325 (71%), Positives = 287/325 (88%), Gaps = 0/325 (0%)
 Frame = +1

Query  196   VEEIQHGPFPIEQLQESGISAIDVKKLKDAGLCTVESVVYSPRKDLLQIKGISEAKVDKI  375
             VEE   GP PI +L++ GI+A DVKKL++AG  TVE+V Y+P+K+L+ IKGISEAK DKI
Sbjct  15    VEEESFGPQPISRLEQCGINANDVKKLEEAGFHTVEAVAYAPKKELINIKGISEAKADKI  74

Query  376   IEAASKLVPLGFTSASQLHAQRLEIIQITSGSKELDKVLEGGIETGSITEIYGEFRSGKT  555
             +  A+KLVP+GFT+A++ H +R EIIQIT+GSKELDK+L+GGIETGSITE++GEFR+GKT
Sbjct  75    LTEAAKLVPMGFTTATEFHQRRSEIIQITTGSKELDKLLQGGIETGSITEMFGEFRTGKT  134

Query  556   QLCHTLCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIADRFGLNGADVLENVAYARA  735
             Q+CHTL VTCQLP+D+GGGEGKAMYID EGTFRP+RLL +A+R+GL+G+DVL+NVAYAR 
Sbjct  135   QICHTLAVTCQLPIDRGGGEGKAMYIDTEGTFRPERLLAVAERYGLSGSDVLDNVAYARG  194

Query  736   YNTDHQSRLLLEAASMMVETRFALMIVDSATALYRTDFSGRGELSARQMHLAKFLRSLQK  915
             +NTDHQ++LL +A++MMVE+R+AL+I+DSATALYRTD+SGRGEL+ARQMHLA+FLR L +
Sbjct  195   FNTDHQTQLLYQASAMMVESRYALLIIDSATALYRTDYSGRGELAARQMHLARFLRMLLR  254

Query  916   LADEFGVAVVITNQVVAQVDGSAIFAGPQIKPIGGNIMAHASTTRLALRKGRGEERVCKV  1095
             LADEFGVAVVITNQVVAQVDG+A+FA    KPIGGNI+AH+STTRL LRKGRGE R+CKV
Sbjct  255   LADEFGVAVVITNQVVAQVDGAAMFAADPKKPIGGNIIAHSSTTRLYLRKGRGETRICKV  314

Query  1096  VSSPCLAEAEARFQISPEGVTDVKD  1170
               SPCL EAEA F I+ +GV D KD
Sbjct  315   YDSPCLPEAEAMFAINADGVGDAKD  339



>ref|XP_003224823.1| PREDICTED: DNA repair protein RAD51 homolog 1 [Anolis carolinensis]
Length=339

 Score =   499 bits (1286),  Expect = 8e-173, Method: Compositional matrix adjust.
 Identities = 234/325 (72%), Positives = 285/325 (88%), Gaps = 0/325 (0%)
 Frame = +1

Query  196   VEEIQHGPFPIEQLQESGISAIDVKKLKDAGLCTVESVVYSPRKDLLQIKGISEAKVDKI  375
              EE   GP  I +L++ GI+A DVKKL++AG  TVE+V Y+P+K+LL IKGISEAK DKI
Sbjct  15    TEEESFGPQQISRLEQCGINANDVKKLEEAGFHTVEAVAYAPKKELLNIKGISEAKADKI  74

Query  376   IEAASKLVPLGFTSASQLHAQRLEIIQITSGSKELDKVLEGGIETGSITEIYGEFRSGKT  555
             +  A+KLVP+GFT+A++ H +R EIIQIT+GSKELDK+L+GGIETGSITE++GEFR+GKT
Sbjct  75    LAEAAKLVPMGFTTATEFHQRRSEIIQITTGSKELDKLLQGGIETGSITEMFGEFRTGKT  134

Query  556   QLCHTLCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIADRFGLNGADVLENVAYARA  735
             QLCHTL VTCQLP+D+GGGEGKAMYID EGTFRP+RLL +A+R+GL+G+DVL+NVAYARA
Sbjct  135   QLCHTLAVTCQLPIDRGGGEGKAMYIDTEGTFRPERLLAVAERYGLSGSDVLDNVAYARA  194

Query  736   YNTDHQSRLLLEAASMMVETRFALMIVDSATALYRTDFSGRGELSARQMHLAKFLRSLQK  915
             +NTDHQ++LL +A++MM E+R+AL+IVDSATALYRTD+SGRGELSARQMHLA+FLR L +
Sbjct  195   FNTDHQTQLLYQASAMMTESRYALLIVDSATALYRTDYSGRGELSARQMHLARFLRMLLR  254

Query  916   LADEFGVAVVITNQVVAQVDGSAIFAGPQIKPIGGNIMAHASTTRLALRKGRGEERVCKV  1095
             LADEFGVAVVITNQVVAQVDG+A+FA    KPIGGNI+AHASTTRL LRKGRGE R+CK+
Sbjct  255   LADEFGVAVVITNQVVAQVDGAAMFAADPKKPIGGNIIAHASTTRLYLRKGRGETRICKI  314

Query  1096  VSSPCLAEAEARFQISPEGVTDVKD  1170
               SPCL EAEA F I+ +GV D KD
Sbjct  315   YDSPCLPEAEAMFAINADGVGDAKD  339



>ref|XP_007446679.1| PREDICTED: DNA repair protein RAD51 homolog 1-like [Lipotes vexillifer]
Length=339

 Score =   499 bits (1284),  Expect = 1e-172, Method: Compositional matrix adjust.
 Identities = 234/336 (70%), Positives = 288/336 (86%), Gaps = 0/336 (0%)
 Frame = +1

Query  163   QKSVQERQQDEVEEIQHGPFPIEQLQESGISAIDVKKLKDAGLCTVESVVYSPRKDLLQI  342
             Q  ++      VEE   GP PI +L++ GI A DVKKL++AG  TVE+V Y+P+K+L+ I
Sbjct  4     QMQLEANADTSVEEESFGPQPISRLEQCGIHANDVKKLEEAGFHTVEAVAYAPKKELINI  63

Query  343   KGISEAKVDKIIEAASKLVPLGFTSASQLHAQRLEIIQITSGSKELDKVLEGGIETGSIT  522
             KGISEAK DKI+  A+KLVP+GFT+A++ H +R EIIQIT+GSKELDK+L+GGIETGSIT
Sbjct  64    KGISEAKADKILTEAAKLVPMGFTTATEFHQRRSEIIQITTGSKELDKLLQGGIETGSIT  123

Query  523   EIYGEFRSGKTQLCHTLCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIADRFGLNGA  702
             E++GEFR+GKTQ+CHTL VTCQLP+D+GGGEGKAMYID EGTFRP+RLL +A+R+GL+G+
Sbjct  124   EMFGEFRTGKTQICHTLAVTCQLPIDRGGGEGKAMYIDTEGTFRPERLLAVAERYGLSGS  183

Query  703   DVLENVAYARAYNTDHQSRLLLEAASMMVETRFALMIVDSATALYRTDFSGRGELSARQM  882
             DVL+NVAYAR +NTDHQ++LL +A++MMVE+R+AL+IVDSATALYRTD+SGRGELSARQM
Sbjct  184   DVLDNVAYARGFNTDHQTQLLYQASAMMVESRYALLIVDSATALYRTDYSGRGELSARQM  243

Query  883   HLAKFLRSLQKLADEFGVAVVITNQVVAQVDGSAIFAGPQIKPIGGNIMAHASTTRLALR  1062
             HLA+FLR L +LADEFGVAVVITNQVVAQVDG+A+FA    KPIGGNI+AHASTTRL LR
Sbjct  244   HLARFLRMLLRLADEFGVAVVITNQVVAQVDGAAMFAADPKKPIGGNIIAHASTTRLYLR  303

Query  1063  KGRGEERVCKVVSSPCLAEAEARFQISPEGVTDVKD  1170
             KGRGE R+ K+  SPCL EAEA F I+ +GV D KD
Sbjct  304   KGRGETRISKIYDSPCLPEAEAMFAINADGVGDAKD  339



>ref|XP_009555142.1| PREDICTED: DNA repair protein RAD51 homolog 1 [Cuculus canorus]
 gb|KFO73187.1| DNA repair protein RAD51 1 [Cuculus canorus]
Length=339

 Score =   498 bits (1283),  Expect = 2e-172, Method: Compositional matrix adjust.
 Identities = 234/325 (72%), Positives = 285/325 (88%), Gaps = 0/325 (0%)
 Frame = +1

Query  196   VEEIQHGPFPIEQLQESGISAIDVKKLKDAGLCTVESVVYSPRKDLLQIKGISEAKVDKI  375
             VEE   GP  I +L++ GI+A DVKKL++AG  TVE+V Y+P+K+LL IKGISEAK DKI
Sbjct  15    VEEESLGPQLISRLEQCGINANDVKKLEEAGFHTVEAVAYAPKKELLNIKGISEAKADKI  74

Query  376   IEAASKLVPLGFTSASQLHAQRLEIIQITSGSKELDKVLEGGIETGSITEIYGEFRSGKT  555
             +  A+KLVP+GFT+A++ H +R EIIQIT+GSKELDK+L+GGIETGSITE++GEFR+GKT
Sbjct  75    LAEAAKLVPMGFTTATEFHQRRSEIIQITTGSKELDKLLQGGIETGSITELFGEFRTGKT  134

Query  556   QLCHTLCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIADRFGLNGADVLENVAYARA  735
             QLCHTL VTCQLP+D+GGGEGKAMYID EGTFRP+RLL +A+R+GL+G+DVL+NVAYAR 
Sbjct  135   QLCHTLAVTCQLPIDRGGGEGKAMYIDTEGTFRPERLLAVAERYGLSGSDVLDNVAYARG  194

Query  736   YNTDHQSRLLLEAASMMVETRFALMIVDSATALYRTDFSGRGELSARQMHLAKFLRSLQK  915
             +NTDHQ++LL +A++MM E+R+AL+IVDSATALYRTD+SGRGELSARQMHLA+FLR L +
Sbjct  195   FNTDHQTQLLYQASAMMAESRYALLIVDSATALYRTDYSGRGELSARQMHLARFLRMLLR  254

Query  916   LADEFGVAVVITNQVVAQVDGSAIFAGPQIKPIGGNIMAHASTTRLALRKGRGEERVCKV  1095
             LADEFGVAVVITNQVVAQVDG+A+FA    KPIGGNI+AHASTTRL LRKGRGE R+CK+
Sbjct  255   LADEFGVAVVITNQVVAQVDGAAMFAADPKKPIGGNIIAHASTTRLYLRKGRGETRICKI  314

Query  1096  VSSPCLAEAEARFQISPEGVTDVKD  1170
               SPCL EAEA F I+ +GV D KD
Sbjct  315   YDSPCLPEAEAMFAINADGVGDAKD  339



>ref|NP_001080559.1| DNA repair protein RAD51 homolog B [Xenopus laevis]
 sp|Q91917.1|RA51B_XENLA RecName: Full=DNA repair protein RAD51 homolog B; Short=xRAD51.2 
[Xenopus laevis]
 dbj|BAA07500.1| XRad51.2 [Xenopus laevis]
 gb|AAH46650.1| Rad51 protein [Xenopus laevis]
 gb|AAI08487.1| Rad51 protein [Xenopus laevis]
Length=336

 Score =   498 bits (1283),  Expect = 2e-172, Method: Compositional matrix adjust.
 Identities = 234/329 (71%), Positives = 286/329 (87%), Gaps = 0/329 (0%)
 Frame = +1

Query  184   QQDEVEEIQHGPFPIEQLQESGISAIDVKKLKDAGLCTVESVVYSPRKDLLQIKGISEAK  363
             Q +  EE   GP  I +L++ GI+A DVKKL+DAG  TVE+V Y+P+K+LL IKGISEAK
Sbjct  8     QAEATEEENFGPQAITRLEQCGINANDVKKLEDAGFHTVEAVAYAPKKELLNIKGISEAK  67

Query  364   VDKIIEAASKLVPLGFTSASQLHAQRLEIIQITSGSKELDKVLEGGIETGSITEIYGEFR  543
              +KI+  A+KLVP+GFT+A++ H +R EIIQI +GSKELDK+L+GGIETGSITE++GEFR
Sbjct  68    AEKILAEAAKLVPMGFTTATEFHQRRSEIIQIGTGSKELDKLLQGGIETGSITEMFGEFR  127

Query  544   SGKTQLCHTLCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIADRFGLNGADVLENVA  723
             +GKTQLCHTL VTCQLP+D+GGGEGKAMYID EGTFRP+RLL +A+R+GL+G+DVL+NVA
Sbjct  128   TGKTQLCHTLAVTCQLPIDRGGGEGKAMYIDTEGTFRPERLLAVAERYGLSGSDVLDNVA  187

Query  724   YARAYNTDHQSRLLLEAASMMVETRFALMIVDSATALYRTDFSGRGELSARQMHLAKFLR  903
             YARA+NTDHQ++LL +A++MM E+R+AL+IVDSATALYRTD+SGRGELSARQMHLA+FLR
Sbjct  188   YARAFNTDHQTQLLYQASAMMAESRYALLIVDSATALYRTDYSGRGELSARQMHLARFLR  247

Query  904   SLQKLADEFGVAVVITNQVVAQVDGSAIFAGPQIKPIGGNIMAHASTTRLALRKGRGEER  1083
              L +LADEFGVAVVITNQVVAQVDG+A+FA    KPIGGNI+AHASTTRL LRKGRGE R
Sbjct  248   MLLRLADEFGVAVVITNQVVAQVDGAAMFAADPKKPIGGNIIAHASTTRLYLRKGRGETR  307

Query  1084  VCKVVSSPCLAEAEARFQISPEGVTDVKD  1170
             +CK+  SPCL EAEA F I+ +GV D KD
Sbjct  308   ICKIYDSPCLPEAEAMFAINADGVGDAKD  336



>ref|XP_009890722.1| PREDICTED: DNA repair protein RAD51 homolog 1 isoform X1 [Charadrius 
vociferus]
 gb|KGL99192.1| DNA repair protein RAD51 1 [Charadrius vociferus]
Length=339

 Score =   498 bits (1283),  Expect = 2e-172, Method: Compositional matrix adjust.
 Identities = 234/336 (70%), Positives = 287/336 (85%), Gaps = 0/336 (0%)
 Frame = +1

Query  163   QKSVQERQQDEVEEIQHGPFPIEQLQESGISAIDVKKLKDAGLCTVESVVYSPRKDLLQI  342
             Q  ++       EE   GP  I +L++ GI+A DVKKL++AG  TVE+V Y+P+K+LL I
Sbjct  4     QAQLEANADTSAEEESFGPQLISRLEQCGINANDVKKLEEAGFHTVEAVAYAPKKELLNI  63

Query  343   KGISEAKVDKIIEAASKLVPLGFTSASQLHAQRLEIIQITSGSKELDKVLEGGIETGSIT  522
             KGISEAK DKI+  A+KLVP+GFT+A++ H +R EIIQIT+GSKELDK+L+GGIETGSIT
Sbjct  64    KGISEAKADKILAEAAKLVPMGFTTATEFHQRRSEIIQITTGSKELDKLLQGGIETGSIT  123

Query  523   EIYGEFRSGKTQLCHTLCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIADRFGLNGA  702
             E++GEFR+GKTQLCHTL VTCQLP+D+GGGEGKAMYID EGTFRP+RLL +A+R+GL+G+
Sbjct  124   ELFGEFRTGKTQLCHTLAVTCQLPIDRGGGEGKAMYIDTEGTFRPERLLAVAERYGLSGS  183

Query  703   DVLENVAYARAYNTDHQSRLLLEAASMMVETRFALMIVDSATALYRTDFSGRGELSARQM  882
             DVL+NVAYAR +NTDHQ++LL +A++MM E+R+AL+IVDSATALYRTD+SGRGELSARQM
Sbjct  184   DVLDNVAYARGFNTDHQTQLLYQASAMMAESRYALLIVDSATALYRTDYSGRGELSARQM  243

Query  883   HLAKFLRSLQKLADEFGVAVVITNQVVAQVDGSAIFAGPQIKPIGGNIMAHASTTRLALR  1062
             HLA+FLR L +LADEFGVAVVITNQVVAQVDG+A+FA    KPIGGNI+AHASTTRL LR
Sbjct  244   HLARFLRMLLRLADEFGVAVVITNQVVAQVDGAAMFAADPKKPIGGNIIAHASTTRLYLR  303

Query  1063  KGRGEERVCKVVSSPCLAEAEARFQISPEGVTDVKD  1170
             KGRGE R+CK+  SPCL EAEA F I+ +GV D KD
Sbjct  304   KGRGETRICKIYDSPCLPEAEAMFAINADGVGDAKD  339



>ref|XP_003206184.1| PREDICTED: DNA repair protein RAD51 homolog 1 [Meleagris gallopavo]
Length=339

 Score =   498 bits (1283),  Expect = 2e-172, Method: Compositional matrix adjust.
 Identities = 233/324 (72%), Positives = 285/324 (88%), Gaps = 0/324 (0%)
 Frame = +1

Query  199   EEIQHGPFPIEQLQESGISAIDVKKLKDAGLCTVESVVYSPRKDLLQIKGISEAKVDKII  378
             EE   GP PI +L++ GI+A DVKKL++AG  TVESV ++P+K+LL IKGISEAK DKI+
Sbjct  16    EEESFGPEPISRLEQCGINANDVKKLEEAGYHTVESVAHAPKKELLNIKGISEAKADKIL  75

Query  379   EAASKLVPLGFTSASQLHAQRLEIIQITSGSKELDKVLEGGIETGSITEIYGEFRSGKTQ  558
               A+KLVP+GFT+A++ H +R EIIQIT+GSKELDK+L+GGIETGSITE++GEFR+GKTQ
Sbjct  76    AEAAKLVPMGFTTATEFHQRRSEIIQITTGSKELDKLLQGGIETGSITELFGEFRTGKTQ  135

Query  559   LCHTLCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIADRFGLNGADVLENVAYARAY  738
             LCHTL VTCQLP+D+GGGEGKAMYID EGTFRP+RLL +A+R+GL+G+DVL+NVAYAR +
Sbjct  136   LCHTLAVTCQLPIDRGGGEGKAMYIDTEGTFRPERLLAVAERYGLSGSDVLDNVAYARGF  195

Query  739   NTDHQSRLLLEAASMMVETRFALMIVDSATALYRTDFSGRGELSARQMHLAKFLRSLQKL  918
             NTDHQ++LL +A++MM E+R+AL+IVDSATALYRTD+SGRGELSARQMHLA+FLR L +L
Sbjct  196   NTDHQTQLLYQASAMMAESRYALLIVDSATALYRTDYSGRGELSARQMHLARFLRMLLRL  255

Query  919   ADEFGVAVVITNQVVAQVDGSAIFAGPQIKPIGGNIMAHASTTRLALRKGRGEERVCKVV  1098
             ADEFGVAVVITNQVVAQVDG+A+FA    KPIGGNI+AHASTTRL LRKGRGE R+CK+ 
Sbjct  256   ADEFGVAVVITNQVVAQVDGAAMFAADPKKPIGGNIIAHASTTRLYLRKGRGETRICKIY  315

Query  1099  SSPCLAEAEARFQISPEGVTDVKD  1170
              SPCL EAEA F I+ +GV D K+
Sbjct  316   DSPCLPEAEAMFAINADGVGDAKE  339



>ref|XP_009472226.1| PREDICTED: DNA repair protein RAD51 homolog 1 isoform X1 [Nipponia 
nippon]
 ref|XP_010174205.1| PREDICTED: DNA repair protein RAD51 homolog 1 isoform X1 [Caprimulgus 
carolinensis]
 gb|KFR07492.1| DNA repair protein RAD51 1 [Nipponia nippon]
 gb|KFZ51145.1| DNA repair protein RAD51 1 [Caprimulgus carolinensis]
Length=339

 Score =   498 bits (1283),  Expect = 2e-172, Method: Compositional matrix adjust.
 Identities = 234/336 (70%), Positives = 287/336 (85%), Gaps = 0/336 (0%)
 Frame = +1

Query  163   QKSVQERQQDEVEEIQHGPFPIEQLQESGISAIDVKKLKDAGLCTVESVVYSPRKDLLQI  342
             Q  ++       EE   GP  I +L++ GI+A DVKKL++AG  TVE+V Y+P+K+LL I
Sbjct  4     QMQLEANADTSAEEESFGPQLISRLEQCGINANDVKKLEEAGFHTVEAVAYAPKKELLNI  63

Query  343   KGISEAKVDKIIEAASKLVPLGFTSASQLHAQRLEIIQITSGSKELDKVLEGGIETGSIT  522
             KGISEAK DKI+  A+KLVP+GFT+A++ H +R EIIQIT+GSKELDK+L+GGIETGSIT
Sbjct  64    KGISEAKADKILAEAAKLVPMGFTTATEFHQRRSEIIQITTGSKELDKLLQGGIETGSIT  123

Query  523   EIYGEFRSGKTQLCHTLCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIADRFGLNGA  702
             E++GEFR+GKTQLCHTL VTCQLP+D+GGGEGKAMYID EGTFRP+RLL +A+R+GL+G+
Sbjct  124   ELFGEFRTGKTQLCHTLAVTCQLPIDRGGGEGKAMYIDTEGTFRPERLLAVAERYGLSGS  183

Query  703   DVLENVAYARAYNTDHQSRLLLEAASMMVETRFALMIVDSATALYRTDFSGRGELSARQM  882
             DVL+NVAYAR +NTDHQ++LL +A++MM E+R+AL+IVDSATALYRTD+SGRGELSARQM
Sbjct  184   DVLDNVAYARGFNTDHQTQLLYQASAMMAESRYALLIVDSATALYRTDYSGRGELSARQM  243

Query  883   HLAKFLRSLQKLADEFGVAVVITNQVVAQVDGSAIFAGPQIKPIGGNIMAHASTTRLALR  1062
             HLA+FLR L +LADEFGVAVVITNQVVAQVDG+A+FA    KPIGGNI+AHASTTRL LR
Sbjct  244   HLARFLRMLLRLADEFGVAVVITNQVVAQVDGAAMFAADPKKPIGGNIIAHASTTRLYLR  303

Query  1063  KGRGEERVCKVVSSPCLAEAEARFQISPEGVTDVKD  1170
             KGRGE R+CK+  SPCL EAEA F I+ +GV D KD
Sbjct  304   KGRGETRICKIYDSPCLPEAEAMFAINADGVGDAKD  339



>ref|XP_009073633.1| PREDICTED: DNA repair protein RAD51 homolog 1 isoform X1 [Acanthisitta 
chloris]
 gb|KFP80619.1| DNA repair protein RAD51 1 [Acanthisitta chloris]
Length=339

 Score =   498 bits (1283),  Expect = 3e-172, Method: Compositional matrix adjust.
 Identities = 234/336 (70%), Positives = 287/336 (85%), Gaps = 0/336 (0%)
 Frame = +1

Query  163   QKSVQERQQDEVEEIQHGPFPIEQLQESGISAIDVKKLKDAGLCTVESVVYSPRKDLLQI  342
             Q  ++       EE   GP  I +L++ GI+A DVKKL++AG  TVE+V Y+P+K+LL I
Sbjct  4     QMPLEANADTSAEEENFGPQLISRLEQCGINANDVKKLEEAGFHTVEAVAYAPKKELLNI  63

Query  343   KGISEAKVDKIIEAASKLVPLGFTSASQLHAQRLEIIQITSGSKELDKVLEGGIETGSIT  522
             KGISEAK DKI+  A+KLVP+GFT+A++ H +R EIIQIT+GSKELDK+L+GGIETGSIT
Sbjct  64    KGISEAKADKILAEAAKLVPMGFTTATEFHQRRSEIIQITTGSKELDKLLQGGIETGSIT  123

Query  523   EIYGEFRSGKTQLCHTLCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIADRFGLNGA  702
             E++GEFR+GKTQLCHTL VTCQLP+D+GGGEGKAMYID EGTFRP+RLL +A+R+GL+G+
Sbjct  124   ELFGEFRTGKTQLCHTLAVTCQLPIDRGGGEGKAMYIDTEGTFRPERLLAVAERYGLSGS  183

Query  703   DVLENVAYARAYNTDHQSRLLLEAASMMVETRFALMIVDSATALYRTDFSGRGELSARQM  882
             DVL+NVAYAR +NTDHQ++LL +A++MM E+R+AL+IVDSATALYRTD+SGRGELSARQM
Sbjct  184   DVLDNVAYARGFNTDHQTQLLYQASAMMTESRYALLIVDSATALYRTDYSGRGELSARQM  243

Query  883   HLAKFLRSLQKLADEFGVAVVITNQVVAQVDGSAIFAGPQIKPIGGNIMAHASTTRLALR  1062
             HLA+FLR L +LADEFGVAVVITNQVVAQVDG+A+FA    KPIGGNI+AHASTTRL LR
Sbjct  244   HLARFLRMLLRLADEFGVAVVITNQVVAQVDGAAMFAADPKKPIGGNIIAHASTTRLYLR  303

Query  1063  KGRGEERVCKVVSSPCLAEAEARFQISPEGVTDVKD  1170
             KGRGE R+CK+  SPCL EAEA F I+ +GV D KD
Sbjct  304   KGRGETRICKIYDSPCLPEAEAMFAINADGVGDAKD  339



>ref|XP_002196004.1| PREDICTED: DNA repair protein RAD51 homolog 1 [Taeniopygia guttata]
Length=339

 Score =   498 bits (1283),  Expect = 3e-172, Method: Compositional matrix adjust.
 Identities = 234/336 (70%), Positives = 287/336 (85%), Gaps = 0/336 (0%)
 Frame = +1

Query  163   QKSVQERQQDEVEEIQHGPFPIEQLQESGISAIDVKKLKDAGLCTVESVVYSPRKDLLQI  342
             Q  ++       EE   GP  I +L++ GI+A DVKKL++AG  TVE+V Y+P+K+LL I
Sbjct  4     QMQLETSADSSAEEESFGPQLISRLEQCGINANDVKKLEEAGFHTVEAVAYAPKKELLNI  63

Query  343   KGISEAKVDKIIEAASKLVPLGFTSASQLHAQRLEIIQITSGSKELDKVLEGGIETGSIT  522
             KGISEAK DKI+  A+KLVP+GFT+A++ H +R EIIQIT+GSKELDK+L+GGIETGSIT
Sbjct  64    KGISEAKADKILAEAAKLVPMGFTTATEFHQRRSEIIQITTGSKELDKLLQGGIETGSIT  123

Query  523   EIYGEFRSGKTQLCHTLCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIADRFGLNGA  702
             E++GEFR+GKTQLCHTL VTCQLP+D+GGGEGKAMYID EGTFRP+RLL +A+R+GL+G+
Sbjct  124   ELFGEFRTGKTQLCHTLAVTCQLPIDRGGGEGKAMYIDTEGTFRPERLLAVAERYGLSGS  183

Query  703   DVLENVAYARAYNTDHQSRLLLEAASMMVETRFALMIVDSATALYRTDFSGRGELSARQM  882
             DVL+NVAYAR +NTDHQ++LL +A++MM E+R+AL+IVDSATALYRTD+SGRGELSARQM
Sbjct  184   DVLDNVAYARGFNTDHQTQLLYQASAMMAESRYALLIVDSATALYRTDYSGRGELSARQM  243

Query  883   HLAKFLRSLQKLADEFGVAVVITNQVVAQVDGSAIFAGPQIKPIGGNIMAHASTTRLALR  1062
             HLA+FLR L +LADEFGVAVVITNQVVAQVDG+A+FA    KPIGGNI+AHASTTRL LR
Sbjct  244   HLARFLRMLLRLADEFGVAVVITNQVVAQVDGAAMFAADPKKPIGGNIIAHASTTRLYLR  303

Query  1063  KGRGEERVCKVVSSPCLAEAEARFQISPEGVTDVKD  1170
             KGRGE R+CK+  SPCL EAEA F I+ +GV D KD
Sbjct  304   KGRGETRICKIYDSPCLPEAEAMFAINADGVGDAKD  339



>ref|XP_009973165.1| PREDICTED: DNA repair protein RAD51 homolog 1 isoform X1 [Tyto 
alba]
 gb|KFV60869.1| DNA repair protein RAD51 1 [Tyto alba]
Length=339

 Score =   498 bits (1283),  Expect = 3e-172, Method: Compositional matrix adjust.
 Identities = 234/336 (70%), Positives = 287/336 (85%), Gaps = 0/336 (0%)
 Frame = +1

Query  163   QKSVQERQQDEVEEIQHGPFPIEQLQESGISAIDVKKLKDAGLCTVESVVYSPRKDLLQI  342
             Q  ++       EE   GP  I +L++ GI+A DVKKL++AG  TVE+V Y+P+K+LL I
Sbjct  4     QMQLEANADTSAEEESFGPQLISRLEQCGINANDVKKLEEAGFHTVEAVAYAPKKELLNI  63

Query  343   KGISEAKVDKIIEAASKLVPLGFTSASQLHAQRLEIIQITSGSKELDKVLEGGIETGSIT  522
             KGISEAK DKI+  A+KLVP+GFT+A++ H +R EIIQIT+GSKELDK+L+GGIETGSIT
Sbjct  64    KGISEAKADKILAEAAKLVPMGFTTATEFHQRRSEIIQITTGSKELDKLLQGGIETGSIT  123

Query  523   EIYGEFRSGKTQLCHTLCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIADRFGLNGA  702
             E++GEFR+GKTQLCHTL VTCQLP+D+GGGEGKAMYID EGTFRP+RLL +A+R+GL+G+
Sbjct  124   ELFGEFRTGKTQLCHTLAVTCQLPIDRGGGEGKAMYIDTEGTFRPERLLAVAERYGLSGS  183

Query  703   DVLENVAYARAYNTDHQSRLLLEAASMMVETRFALMIVDSATALYRTDFSGRGELSARQM  882
             DVL+NVAYAR +NTDHQ++LL +A++MM E+R+AL+IVDSATALYRTD+SGRGELSARQM
Sbjct  184   DVLDNVAYARGFNTDHQTQLLYQASAMMAESRYALLIVDSATALYRTDYSGRGELSARQM  243

Query  883   HLAKFLRSLQKLADEFGVAVVITNQVVAQVDGSAIFAGPQIKPIGGNIMAHASTTRLALR  1062
             HLA+FLR L +LADEFGVAVVITNQVVAQVDG+A+FA    KPIGGNI+AHASTTRL LR
Sbjct  244   HLARFLRMLLRLADEFGVAVVITNQVVAQVDGAAMFAADPKKPIGGNIIAHASTTRLYLR  303

Query  1063  KGRGEERVCKVVSSPCLAEAEARFQISPEGVTDVKD  1170
             KGRGE R+CK+  SPCL EAEA F I+ +GV D KD
Sbjct  304   KGRGETRICKIYDSPCLPEAEAMFAINADGVGDAKD  339



>ref|NP_001075493.1| DNA repair protein RAD51 homolog 1 [Oryctolagus cuniculus]
 sp|O77507.1|RAD51_RABIT RecName: Full=DNA repair protein RAD51 homolog 1 [Oryctolagus 
cuniculus]
 gb|AAC28561.1| Rad51 [Oryctolagus cuniculus]
Length=339

 Score =   498 bits (1283),  Expect = 3e-172, Method: Compositional matrix adjust.
 Identities = 232/336 (69%), Positives = 288/336 (86%), Gaps = 0/336 (0%)
 Frame = +1

Query  163   QKSVQERQQDEVEEIQHGPFPIEQLQESGISAIDVKKLKDAGLCTVESVVYSPRKDLLQI  342
             Q  ++      VEE   GP P+ +L++ GI+A DVKKL++AG  T E+V Y+P+K+L+ I
Sbjct  4     QMQLEANADTSVEEESFGPQPVSRLEQCGINANDVKKLEEAGFHTEEAVAYAPKKELINI  63

Query  343   KGISEAKVDKIIEAASKLVPLGFTSASQLHAQRLEIIQITSGSKELDKVLEGGIETGSIT  522
             KGISEAK DKI+  A+KLVP+GFT+A++ H +R EIIQIT+GSKELDK+L+GGIETGSIT
Sbjct  64    KGISEAKADKILTEAAKLVPMGFTTATEFHQRRSEIIQITTGSKELDKLLQGGIETGSIT  123

Query  523   EIYGEFRSGKTQLCHTLCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIADRFGLNGA  702
             E++GEFR+GKTQ+CHTL VTCQLP+D+GGGEGKAMYID EGTFRP+RLL +A+R+GL+G+
Sbjct  124   EMFGEFRTGKTQICHTLAVTCQLPIDRGGGEGKAMYIDTEGTFRPERLLAVAERYGLSGS  183

Query  703   DVLENVAYARAYNTDHQSRLLLEAASMMVETRFALMIVDSATALYRTDFSGRGELSARQM  882
             DVL+NVAYAR +NTDHQ++LL +A++MMVE+R+AL+IVDSATALYRTD+SGRGELSARQM
Sbjct  184   DVLDNVAYARGFNTDHQTQLLYQASAMMVESRYALLIVDSATALYRTDYSGRGELSARQM  243

Query  883   HLAKFLRSLQKLADEFGVAVVITNQVVAQVDGSAIFAGPQIKPIGGNIMAHASTTRLALR  1062
             HLA+FLR L +LADEFGV VVITNQVVAQVDG+A+FA    KPIGGNI+AHASTTRL LR
Sbjct  244   HLARFLRMLLRLADEFGVTVVITNQVVAQVDGAAMFAADPKKPIGGNIIAHASTTRLYLR  303

Query  1063  KGRGEERVCKVVSSPCLAEAEARFQISPEGVTDVKD  1170
             KGRGE R+CK+  SPCL EAEA F I+ +GV D KD
Sbjct  304   KGRGETRICKIYDSPCLPEAEAMFAINADGVGDAKD  339



>gb|KFV13426.1| DNA repair protein RAD51 1, partial [Pterocles gutturalis]
Length=338

 Score =   498 bits (1282),  Expect = 3e-172, Method: Compositional matrix adjust.
 Identities = 233/324 (72%), Positives = 284/324 (88%), Gaps = 0/324 (0%)
 Frame = +1

Query  199   EEIQHGPFPIEQLQESGISAIDVKKLKDAGLCTVESVVYSPRKDLLQIKGISEAKVDKII  378
             EE   GP  I +L++ GI+A DVKKL++AG  TVE+V Y+P+K+LL IKGISEAK DKI+
Sbjct  15    EEESFGPQLISRLEQCGINANDVKKLEEAGFHTVEAVAYAPKKELLNIKGISEAKADKIL  74

Query  379   EAASKLVPLGFTSASQLHAQRLEIIQITSGSKELDKVLEGGIETGSITEIYGEFRSGKTQ  558
               A+KLVP+GFT+A++ H +R EIIQIT+GSKELDK+L+GGIETGSITE++GEFR+GKTQ
Sbjct  75    AEAAKLVPMGFTTATEFHQRRSEIIQITTGSKELDKLLQGGIETGSITELFGEFRTGKTQ  134

Query  559   LCHTLCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIADRFGLNGADVLENVAYARAY  738
             LCHTL VTCQLP+D+GGGEGKAMYID EGTFRP+RLL +A+R+GL+G+DVL+NVAYAR +
Sbjct  135   LCHTLAVTCQLPIDRGGGEGKAMYIDTEGTFRPERLLAVAERYGLSGSDVLDNVAYARGF  194

Query  739   NTDHQSRLLLEAASMMVETRFALMIVDSATALYRTDFSGRGELSARQMHLAKFLRSLQKL  918
             NTDHQ++LL +A++MM E+R+AL+IVDSATALYRTD+SGRGELSARQMHLA+FLR L +L
Sbjct  195   NTDHQTQLLYQASAMMAESRYALLIVDSATALYRTDYSGRGELSARQMHLARFLRMLLRL  254

Query  919   ADEFGVAVVITNQVVAQVDGSAIFAGPQIKPIGGNIMAHASTTRLALRKGRGEERVCKVV  1098
             ADEFGVAVVITNQVVAQVDG+A+FA    KPIGGNI+AHASTTRL LRKGRGE R+CK+ 
Sbjct  255   ADEFGVAVVITNQVVAQVDGAAMFAADPKKPIGGNIIAHASTTRLYLRKGRGETRICKIY  314

Query  1099  SSPCLAEAEARFQISPEGVTDVKD  1170
              SPCL EAEA F I+ +GV D KD
Sbjct  315   DSPCLPEAEAMFAINADGVGDAKD  338



>ref|XP_009482596.1| PREDICTED: DNA repair protein RAD51 homolog 1 isoform X1 [Pelecanus 
crispus]
 gb|KFQ61948.1| DNA repair protein RAD51 1 [Pelecanus crispus]
Length=339

 Score =   498 bits (1282),  Expect = 3e-172, Method: Compositional matrix adjust.
 Identities = 233/324 (72%), Positives = 284/324 (88%), Gaps = 0/324 (0%)
 Frame = +1

Query  199   EEIQHGPFPIEQLQESGISAIDVKKLKDAGLCTVESVVYSPRKDLLQIKGISEAKVDKII  378
             EE   GP  I +L++ GI+A DVKKL++AG  TVE+V Y+P+K+LL IKGISEAK DKI+
Sbjct  16    EEESFGPQLISRLEQCGINANDVKKLEEAGFHTVEAVAYAPKKELLNIKGISEAKADKIL  75

Query  379   EAASKLVPLGFTSASQLHAQRLEIIQITSGSKELDKVLEGGIETGSITEIYGEFRSGKTQ  558
               A+KLVP+GFT+A++ H +R EIIQIT+GSKELDK+L+GGIETGSITE++GEFR+GKTQ
Sbjct  76    AEAAKLVPMGFTTATEFHQRRSEIIQITTGSKELDKLLQGGIETGSITELFGEFRTGKTQ  135

Query  559   LCHTLCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIADRFGLNGADVLENVAYARAY  738
             LCHTL VTCQLP+D+GGGEGKAMYID EGTFRP+RLL +A+R+GL+G+DVL+NVAYAR +
Sbjct  136   LCHTLAVTCQLPIDRGGGEGKAMYIDTEGTFRPERLLAVAERYGLSGSDVLDNVAYARGF  195

Query  739   NTDHQSRLLLEAASMMVETRFALMIVDSATALYRTDFSGRGELSARQMHLAKFLRSLQKL  918
             NTDHQ++LL +A++MM E+R+AL+IVDSATALYRTD+SGRGELSARQMHLA+FLR L +L
Sbjct  196   NTDHQTQLLYQASAMMAESRYALLIVDSATALYRTDYSGRGELSARQMHLARFLRMLLRL  255

Query  919   ADEFGVAVVITNQVVAQVDGSAIFAGPQIKPIGGNIMAHASTTRLALRKGRGEERVCKVV  1098
             ADEFGVAVVITNQVVAQVDG+A+FA    KPIGGNI+AHASTTRL LRKGRGE R+CK+ 
Sbjct  256   ADEFGVAVVITNQVVAQVDGAAMFAADPKKPIGGNIIAHASTTRLYLRKGRGETRICKIY  315

Query  1099  SSPCLAEAEARFQISPEGVTDVKD  1170
              SPCL EAEA F I+ +GV D KD
Sbjct  316   DSPCLPEAEAMFAINADGVGDAKD  339



>ref|XP_009948515.1| PREDICTED: DNA repair protein RAD51 homolog 1 isoform X1 [Leptosomus 
discolor]
 gb|KFQ10381.1| DNA repair protein RAD51 1 [Leptosomus discolor]
Length=339

 Score =   498 bits (1282),  Expect = 4e-172, Method: Compositional matrix adjust.
 Identities = 234/336 (70%), Positives = 286/336 (85%), Gaps = 0/336 (0%)
 Frame = +1

Query  163   QKSVQERQQDEVEEIQHGPFPIEQLQESGISAIDVKKLKDAGLCTVESVVYSPRKDLLQI  342
             Q   +       EE   GP  I +L++ GI+A DVKKL++AG  TVE+V Y+P+K+LL I
Sbjct  4     QAQFEANADTSAEEESFGPQLIARLEQCGINANDVKKLEEAGFHTVEAVAYAPKKELLNI  63

Query  343   KGISEAKVDKIIEAASKLVPLGFTSASQLHAQRLEIIQITSGSKELDKVLEGGIETGSIT  522
             KGISEAK DKI+  A+KLVP+GFT+A++ H +R EIIQIT+GSKELDK+L+GGIETGSIT
Sbjct  64    KGISEAKADKILAEAAKLVPMGFTTATEFHQRRSEIIQITTGSKELDKLLQGGIETGSIT  123

Query  523   EIYGEFRSGKTQLCHTLCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIADRFGLNGA  702
             E++GEFR+GKTQLCHTL VTCQLP+D+GGGEGKAMYID EGTFRP+RLL +A+R+GL+G+
Sbjct  124   ELFGEFRTGKTQLCHTLAVTCQLPIDRGGGEGKAMYIDTEGTFRPERLLAVAERYGLSGS  183

Query  703   DVLENVAYARAYNTDHQSRLLLEAASMMVETRFALMIVDSATALYRTDFSGRGELSARQM  882
             DVL+NVAYAR +NTDHQ++LL +A++MM E+R+AL+IVDSATALYRTD+SGRGELSARQM
Sbjct  184   DVLDNVAYARGFNTDHQTQLLYQASAMMAESRYALLIVDSATALYRTDYSGRGELSARQM  243

Query  883   HLAKFLRSLQKLADEFGVAVVITNQVVAQVDGSAIFAGPQIKPIGGNIMAHASTTRLALR  1062
             HLA+FLR L +LADEFGVAVVITNQVVAQVDG+A+FA    KPIGGNI+AHASTTRL LR
Sbjct  244   HLARFLRMLLRLADEFGVAVVITNQVVAQVDGAAMFAADPKKPIGGNIIAHASTTRLYLR  303

Query  1063  KGRGEERVCKVVSSPCLAEAEARFQISPEGVTDVKD  1170
             KGRGE R+CK+  SPCL EAEA F I+ +GV D KD
Sbjct  304   KGRGETRICKIYDSPCLPEAEAMFAINADGVGDAKD  339



>ref|XP_009095390.1| PREDICTED: DNA repair protein RAD51 homolog 1 [Serinus canaria]
Length=339

 Score =   498 bits (1282),  Expect = 4e-172, Method: Compositional matrix adjust.
 Identities = 234/336 (70%), Positives = 287/336 (85%), Gaps = 0/336 (0%)
 Frame = +1

Query  163   QKSVQERQQDEVEEIQHGPFPIEQLQESGISAIDVKKLKDAGLCTVESVVYSPRKDLLQI  342
             Q  ++       EE   GP  I +L++ GI+A DVKKL++AG  TVE+V Y+P+K+LL I
Sbjct  4     QMQLEASTDTSAEEESFGPQLISRLEQCGINANDVKKLEEAGFHTVEAVAYAPKKELLNI  63

Query  343   KGISEAKVDKIIEAASKLVPLGFTSASQLHAQRLEIIQITSGSKELDKVLEGGIETGSIT  522
             KGISEAK DKI+  A+KLVP+GFT+A++ H +R EIIQIT+GSKELDK+L+GGIETGSIT
Sbjct  64    KGISEAKADKILAEAAKLVPMGFTTATEFHQRRSEIIQITTGSKELDKLLQGGIETGSIT  123

Query  523   EIYGEFRSGKTQLCHTLCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIADRFGLNGA  702
             E++GEFR+GKTQLCHTL VTCQLP+D+GGGEGKAMYID EGTFRP+RLL +A+R+GL+G+
Sbjct  124   ELFGEFRTGKTQLCHTLAVTCQLPIDRGGGEGKAMYIDTEGTFRPERLLAVAERYGLSGS  183

Query  703   DVLENVAYARAYNTDHQSRLLLEAASMMVETRFALMIVDSATALYRTDFSGRGELSARQM  882
             DVL+NVAYAR +NTDHQ++LL +A++MM E+R+AL+IVDSATALYRTD+SGRGELSARQM
Sbjct  184   DVLDNVAYARGFNTDHQTQLLYQASAMMAESRYALLIVDSATALYRTDYSGRGELSARQM  243

Query  883   HLAKFLRSLQKLADEFGVAVVITNQVVAQVDGSAIFAGPQIKPIGGNIMAHASTTRLALR  1062
             HLA+FLR L +LADEFGVAVVITNQVVAQVDG+A+FA    KPIGGNI+AHASTTRL LR
Sbjct  244   HLARFLRMLLRLADEFGVAVVITNQVVAQVDGAAMFAADPKKPIGGNIIAHASTTRLYLR  303

Query  1063  KGRGEERVCKVVSSPCLAEAEARFQISPEGVTDVKD  1170
             KGRGE R+CK+  SPCL EAEA F I+ +GV D KD
Sbjct  304   KGRGETRICKIYDSPCLPEAEAMFAINADGVGDAKD  339



>ref|XP_005243393.1| PREDICTED: DNA repair protein RAD51 homolog 1 [Falco peregrinus]
 ref|XP_005438381.1| PREDICTED: DNA repair protein RAD51 homolog 1 [Falco cherrug]
 ref|XP_009281964.1| PREDICTED: DNA repair protein RAD51 homolog 1 isoform X1 [Aptenodytes 
forsteri]
 ref|XP_009581632.1| PREDICTED: DNA repair protein RAD51 homolog 1 [Fulmarus glacialis]
 ref|XP_009702561.1| PREDICTED: DNA repair protein RAD51 homolog 1 isoform X1 [Cariama 
cristata]
 ref|XP_010122372.1| PREDICTED: DNA repair protein RAD51 homolog 1 isoform X1 [Chlamydotis 
macqueenii]
 gb|KFM10503.1| DNA repair protein RAD51 1 [Aptenodytes forsteri]
 gb|KFP43715.1| DNA repair protein RAD51 1 [Chlamydotis macqueenii]
 gb|KFP60542.1| DNA repair protein RAD51 1 [Cariama cristata]
 gb|KFV94817.1| DNA repair protein RAD51 1 [Fulmarus glacialis]
Length=339

 Score =   498 bits (1282),  Expect = 4e-172, Method: Compositional matrix adjust.
 Identities = 233/324 (72%), Positives = 284/324 (88%), Gaps = 0/324 (0%)
 Frame = +1

Query  199   EEIQHGPFPIEQLQESGISAIDVKKLKDAGLCTVESVVYSPRKDLLQIKGISEAKVDKII  378
             EE   GP  I +L++ GI+A DVKKL++AG  TVE+V Y+P+K+LL IKGISEAK DKI+
Sbjct  16    EEESFGPQLISRLEQCGINANDVKKLEEAGFHTVEAVAYAPKKELLNIKGISEAKADKIL  75

Query  379   EAASKLVPLGFTSASQLHAQRLEIIQITSGSKELDKVLEGGIETGSITEIYGEFRSGKTQ  558
               A+KLVP+GFT+A++ H +R EIIQIT+GSKELDK+L+GGIETGSITE++GEFR+GKTQ
Sbjct  76    AEAAKLVPMGFTTATEFHQRRSEIIQITTGSKELDKLLQGGIETGSITELFGEFRTGKTQ  135

Query  559   LCHTLCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIADRFGLNGADVLENVAYARAY  738
             LCHTL VTCQLP+D+GGGEGKAMYID EGTFRP+RLL +A+R+GL+G+DVL+NVAYAR +
Sbjct  136   LCHTLAVTCQLPIDRGGGEGKAMYIDTEGTFRPERLLAVAERYGLSGSDVLDNVAYARGF  195

Query  739   NTDHQSRLLLEAASMMVETRFALMIVDSATALYRTDFSGRGELSARQMHLAKFLRSLQKL  918
             NTDHQ++LL +A++MM E+R+AL+IVDSATALYRTD+SGRGELSARQMHLA+FLR L +L
Sbjct  196   NTDHQTQLLYQASAMMAESRYALLIVDSATALYRTDYSGRGELSARQMHLARFLRMLLRL  255

Query  919   ADEFGVAVVITNQVVAQVDGSAIFAGPQIKPIGGNIMAHASTTRLALRKGRGEERVCKVV  1098
             ADEFGVAVVITNQVVAQVDG+A+FA    KPIGGNI+AHASTTRL LRKGRGE R+CK+ 
Sbjct  256   ADEFGVAVVITNQVVAQVDGAAMFAADPKKPIGGNIIAHASTTRLYLRKGRGETRICKIY  315

Query  1099  SSPCLAEAEARFQISPEGVTDVKD  1170
              SPCL EAEA F I+ +GV D KD
Sbjct  316   DSPCLPEAEAMFAINADGVGDAKD  339



>ref|XP_009669095.1| PREDICTED: DNA repair protein RAD51 homolog 1 [Struthio camelus 
australis]
 ref|XP_009669096.1| PREDICTED: DNA repair protein RAD51 homolog 1 [Struthio camelus 
australis]
 ref|XP_009669097.1| PREDICTED: DNA repair protein RAD51 homolog 1 [Struthio camelus 
australis]
 gb|KFV79183.1| DNA repair protein RAD51 1 [Struthio camelus australis]
Length=339

 Score =   498 bits (1282),  Expect = 4e-172, Method: Compositional matrix adjust.
 Identities = 233/324 (72%), Positives = 284/324 (88%), Gaps = 0/324 (0%)
 Frame = +1

Query  199   EEIQHGPFPIEQLQESGISAIDVKKLKDAGLCTVESVVYSPRKDLLQIKGISEAKVDKII  378
             EE   GP  I +L++ GI+A DVKKL++AG  TVE+V Y+P+K+LL IKGISEAK DKI+
Sbjct  16    EEESFGPQLISRLEQCGINANDVKKLEEAGFHTVEAVAYAPKKELLNIKGISEAKADKIL  75

Query  379   EAASKLVPLGFTSASQLHAQRLEIIQITSGSKELDKVLEGGIETGSITEIYGEFRSGKTQ  558
               A+KLVP+GFT+A++ H +R EIIQIT+GSKELDK+L+GGIETGSITE++GEFR+GKTQ
Sbjct  76    AEAAKLVPMGFTTATEFHQRRSEIIQITTGSKELDKLLQGGIETGSITELFGEFRTGKTQ  135

Query  559   LCHTLCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIADRFGLNGADVLENVAYARAY  738
             LCHTL VTCQLP+D+GGGEGKAMYID EGTFRP+RLL +A+R+GL+G+DVL+NVAYAR +
Sbjct  136   LCHTLAVTCQLPIDRGGGEGKAMYIDTEGTFRPERLLAVAERYGLSGSDVLDNVAYARGF  195

Query  739   NTDHQSRLLLEAASMMVETRFALMIVDSATALYRTDFSGRGELSARQMHLAKFLRSLQKL  918
             NTDHQ++LL +A++MM E+R+AL+IVDSATALYRTD+SGRGELSARQMHLA+FLR L +L
Sbjct  196   NTDHQTQLLYQASAMMAESRYALLIVDSATALYRTDYSGRGELSARQMHLARFLRMLLRL  255

Query  919   ADEFGVAVVITNQVVAQVDGSAIFAGPQIKPIGGNIMAHASTTRLALRKGRGEERVCKVV  1098
             ADEFGVAVVITNQVVAQVDG+A+FA    KPIGGNI+AHASTTRL LRKGRGE R+CK+ 
Sbjct  256   ADEFGVAVVITNQVVAQVDGAAMFAADPKKPIGGNIIAHASTTRLYLRKGRGETRICKIY  315

Query  1099  SSPCLAEAEARFQISPEGVTDVKD  1170
              SPCL EAEA F I+ +GV D KD
Sbjct  316   DSPCLPEAEAMFAINADGVGDAKD  339



>ref|XP_010151121.1| PREDICTED: DNA repair protein RAD51 homolog 1 isoform X1 [Eurypyga 
helias]
 gb|KFV93620.1| DNA repair protein RAD51 1 [Eurypyga helias]
Length=339

 Score =   498 bits (1282),  Expect = 4e-172, Method: Compositional matrix adjust.
 Identities = 233/324 (72%), Positives = 284/324 (88%), Gaps = 0/324 (0%)
 Frame = +1

Query  199   EEIQHGPFPIEQLQESGISAIDVKKLKDAGLCTVESVVYSPRKDLLQIKGISEAKVDKII  378
             EE   GP  I +L++ GI+A DVKKL++AG  TVE+V Y+P+K+LL IKGISEAK DKI+
Sbjct  16    EEESFGPQLISRLEQCGINANDVKKLEEAGFHTVEAVAYAPKKELLNIKGISEAKADKIL  75

Query  379   EAASKLVPLGFTSASQLHAQRLEIIQITSGSKELDKVLEGGIETGSITEIYGEFRSGKTQ  558
               A+KLVP+GFT+A++ H +R EIIQIT+GSKELDK+L+GGIETGSITE++GEFR+GKTQ
Sbjct  76    AEAAKLVPMGFTTATEFHQRRSEIIQITTGSKELDKLLQGGIETGSITELFGEFRTGKTQ  135

Query  559   LCHTLCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIADRFGLNGADVLENVAYARAY  738
             LCHTL VTCQLP+D+GGGEGKAMYID EGTFRP+RLL +A+R+GL+G+DVL+NVAYAR +
Sbjct  136   LCHTLAVTCQLPIDRGGGEGKAMYIDTEGTFRPERLLAVAERYGLSGSDVLDNVAYARGF  195

Query  739   NTDHQSRLLLEAASMMVETRFALMIVDSATALYRTDFSGRGELSARQMHLAKFLRSLQKL  918
             NTDHQ++LL +A++MM E+R+AL+IVDSATALYRTD+SGRGELSARQMHLA+FLR L +L
Sbjct  196   NTDHQTQLLYQASAMMAESRYALLIVDSATALYRTDYSGRGELSARQMHLARFLRMLLRL  255

Query  919   ADEFGVAVVITNQVVAQVDGSAIFAGPQIKPIGGNIMAHASTTRLALRKGRGEERVCKVV  1098
             ADEFGVAVVITNQVVAQVDG+A+FA    KPIGGNI+AHASTTRL LRKGRGE R+CK+ 
Sbjct  256   ADEFGVAVVITNQVVAQVDGAAMFAADPKKPIGGNIIAHASTTRLYLRKGRGETRICKIY  315

Query  1099  SSPCLAEAEARFQISPEGVTDVKD  1170
              SPCL EAEA F I+ +GV D KD
Sbjct  316   DSPCLPEAEAMFAINADGVGDAKD  339



>ref|XP_009916366.1| PREDICTED: DNA repair protein RAD51 homolog 1 isoform X1 [Haliaeetus 
albicilla]
 ref|XP_010188313.1| PREDICTED: DNA repair protein RAD51 homolog 1 [Mesitornis unicolor]
 ref|XP_010562641.1| PREDICTED: DNA repair protein RAD51 homolog 1 [Haliaeetus leucocephalus]
 ref|XP_011595823.1| PREDICTED: DNA repair protein RAD51 homolog 1 [Aquila chrysaetos 
canadensis]
 gb|KFQ03265.1| DNA repair protein RAD51 1 [Haliaeetus albicilla]
 gb|KFQ39425.1| DNA repair protein RAD51 1 [Mesitornis unicolor]
Length=339

 Score =   498 bits (1282),  Expect = 4e-172, Method: Compositional matrix adjust.
 Identities = 233/324 (72%), Positives = 284/324 (88%), Gaps = 0/324 (0%)
 Frame = +1

Query  199   EEIQHGPFPIEQLQESGISAIDVKKLKDAGLCTVESVVYSPRKDLLQIKGISEAKVDKII  378
             EE   GP  I +L++ GI+A DVKKL++AG  TVE+V Y+P+K+LL IKGISEAK DKI+
Sbjct  16    EEESFGPQLISRLEQCGINANDVKKLEEAGFHTVEAVAYAPKKELLNIKGISEAKADKIL  75

Query  379   EAASKLVPLGFTSASQLHAQRLEIIQITSGSKELDKVLEGGIETGSITEIYGEFRSGKTQ  558
               A+KLVP+GFT+A++ H +R EIIQIT+GSKELDK+L+GGIETGSITE++GEFR+GKTQ
Sbjct  76    AEAAKLVPMGFTTATEFHQRRSEIIQITTGSKELDKLLQGGIETGSITELFGEFRTGKTQ  135

Query  559   LCHTLCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIADRFGLNGADVLENVAYARAY  738
             LCHTL VTCQLP+D+GGGEGKAMYID EGTFRP+RLL +A+R+GL+G+DVL+NVAYAR +
Sbjct  136   LCHTLAVTCQLPIDRGGGEGKAMYIDTEGTFRPERLLAVAERYGLSGSDVLDNVAYARGF  195

Query  739   NTDHQSRLLLEAASMMVETRFALMIVDSATALYRTDFSGRGELSARQMHLAKFLRSLQKL  918
             NTDHQ++LL +A++MM E+R+AL+IVDSATALYRTD+SGRGELSARQMHLA+FLR L +L
Sbjct  196   NTDHQTQLLYQASAMMAESRYALLIVDSATALYRTDYSGRGELSARQMHLARFLRMLLRL  255

Query  919   ADEFGVAVVITNQVVAQVDGSAIFAGPQIKPIGGNIMAHASTTRLALRKGRGEERVCKVV  1098
             ADEFGVAVVITNQVVAQVDG+A+FA    KPIGGNI+AHASTTRL LRKGRGE R+CK+ 
Sbjct  256   ADEFGVAVVITNQVVAQVDGAAMFAADPKKPIGGNIIAHASTTRLYLRKGRGETRICKIY  315

Query  1099  SSPCLAEAEARFQISPEGVTDVKD  1170
              SPCL EAEA F I+ +GV D KD
Sbjct  316   DSPCLPEAEAMFAINADGVGDAKD  339



>ref|XP_009641358.1| PREDICTED: DNA repair protein RAD51 homolog 1 isoform X1 [Egretta 
garzetta]
 gb|KFP19469.1| DNA repair protein RAD51 1 [Egretta garzetta]
Length=339

 Score =   498 bits (1282),  Expect = 4e-172, Method: Compositional matrix adjust.
 Identities = 233/324 (72%), Positives = 284/324 (88%), Gaps = 0/324 (0%)
 Frame = +1

Query  199   EEIQHGPFPIEQLQESGISAIDVKKLKDAGLCTVESVVYSPRKDLLQIKGISEAKVDKII  378
             EE   GP  I +L++ GI+A DVKKL++AG  TVE+V Y+P+K+LL IKGISEAK DKI+
Sbjct  16    EEESFGPQLISRLEQCGINANDVKKLEEAGFHTVEAVAYAPKKELLNIKGISEAKADKIL  75

Query  379   EAASKLVPLGFTSASQLHAQRLEIIQITSGSKELDKVLEGGIETGSITEIYGEFRSGKTQ  558
               A+KLVP+GFT+A++ H +R EIIQIT+GSKELDK+L+GGIETGSITE++GEFR+GKTQ
Sbjct  76    AEAAKLVPMGFTTATEFHQRRSEIIQITTGSKELDKLLQGGIETGSITELFGEFRTGKTQ  135

Query  559   LCHTLCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIADRFGLNGADVLENVAYARAY  738
             LCHTL VTCQLP+D+GGGEGKAMYID EGTFRP+RLL +A+R+GL+G+DVL+NVAYAR +
Sbjct  136   LCHTLAVTCQLPIDRGGGEGKAMYIDTEGTFRPERLLAVAERYGLSGSDVLDNVAYARGF  195

Query  739   NTDHQSRLLLEAASMMVETRFALMIVDSATALYRTDFSGRGELSARQMHLAKFLRSLQKL  918
             NTDHQ++LL +A++MM E+R+AL+IVDSATALYRTD+SGRGELSARQMHLA+FLR L +L
Sbjct  196   NTDHQTQLLYQASAMMAESRYALLIVDSATALYRTDYSGRGELSARQMHLARFLRMLLRL  255

Query  919   ADEFGVAVVITNQVVAQVDGSAIFAGPQIKPIGGNIMAHASTTRLALRKGRGEERVCKVV  1098
             ADEFGVAVVITNQVVAQVDG+A+FA    KPIGGNI+AHASTTRL LRKGRGE R+CK+ 
Sbjct  256   ADEFGVAVVITNQVVAQVDGAAMFAADPKKPIGGNIIAHASTTRLYLRKGRGETRICKIY  315

Query  1099  SSPCLAEAEARFQISPEGVTDVKD  1170
              SPCL EAEA F I+ +GV D KD
Sbjct  316   DSPCLPEAEAMFAINADGVGDAKD  339



>ref|XP_005529119.1| PREDICTED: DNA repair protein RAD51 homolog 1 [Pseudopodoces 
humilis]
 ref|XP_008642264.1| PREDICTED: DNA repair protein RAD51 homolog 1 isoform X1 [Corvus 
brachyrhynchos]
 gb|KFO54462.1| DNA repair protein RAD51 1 [Corvus brachyrhynchos]
Length=339

 Score =   498 bits (1282),  Expect = 4e-172, Method: Compositional matrix adjust.
 Identities = 233/324 (72%), Positives = 284/324 (88%), Gaps = 0/324 (0%)
 Frame = +1

Query  199   EEIQHGPFPIEQLQESGISAIDVKKLKDAGLCTVESVVYSPRKDLLQIKGISEAKVDKII  378
             EE   GP  I +L++ GI+A DVKKL++AG  TVE+V Y+P+K+LL IKGISEAK DKI+
Sbjct  16    EEESFGPQLISRLEQCGINANDVKKLEEAGFHTVEAVAYAPKKELLNIKGISEAKADKIL  75

Query  379   EAASKLVPLGFTSASQLHAQRLEIIQITSGSKELDKVLEGGIETGSITEIYGEFRSGKTQ  558
               A+KLVP+GFT+A++ H +R EIIQIT+GSKELDK+L+GGIETGSITE++GEFR+GKTQ
Sbjct  76    AEAAKLVPMGFTTATEFHQRRSEIIQITTGSKELDKLLQGGIETGSITELFGEFRTGKTQ  135

Query  559   LCHTLCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIADRFGLNGADVLENVAYARAY  738
             LCHTL VTCQLP+D+GGGEGKAMYID EGTFRP+RLL +A+R+GL+G+DVL+NVAYAR +
Sbjct  136   LCHTLAVTCQLPIDRGGGEGKAMYIDTEGTFRPERLLAVAERYGLSGSDVLDNVAYARGF  195

Query  739   NTDHQSRLLLEAASMMVETRFALMIVDSATALYRTDFSGRGELSARQMHLAKFLRSLQKL  918
             NTDHQ++LL +A++MM E+R+AL+IVDSATALYRTD+SGRGELSARQMHLA+FLR L +L
Sbjct  196   NTDHQTQLLYQASAMMAESRYALLIVDSATALYRTDYSGRGELSARQMHLARFLRMLLRL  255

Query  919   ADEFGVAVVITNQVVAQVDGSAIFAGPQIKPIGGNIMAHASTTRLALRKGRGEERVCKVV  1098
             ADEFGVAVVITNQVVAQVDG+A+FA    KPIGGNI+AHASTTRL LRKGRGE R+CK+ 
Sbjct  256   ADEFGVAVVITNQVVAQVDGAAMFAADPKKPIGGNIIAHASTTRLYLRKGRGETRICKIY  315

Query  1099  SSPCLAEAEARFQISPEGVTDVKD  1170
              SPCL EAEA F I+ +GV D KD
Sbjct  316   DSPCLPEAEAMFAINADGVGDAKD  339



>ref|XP_005426533.1| PREDICTED: DNA repair protein RAD51 homolog 1 [Geospiza fortis]
Length=339

 Score =   498 bits (1282),  Expect = 4e-172, Method: Compositional matrix adjust.
 Identities = 233/324 (72%), Positives = 284/324 (88%), Gaps = 0/324 (0%)
 Frame = +1

Query  199   EEIQHGPFPIEQLQESGISAIDVKKLKDAGLCTVESVVYSPRKDLLQIKGISEAKVDKII  378
             EE   GP  I +L++ GI+A DVKKL++AG  TVE+V Y+P+K+LL IKGISEAK DKI+
Sbjct  16    EEESFGPQLISRLEQCGINANDVKKLEEAGFHTVEAVAYAPKKELLNIKGISEAKADKIL  75

Query  379   EAASKLVPLGFTSASQLHAQRLEIIQITSGSKELDKVLEGGIETGSITEIYGEFRSGKTQ  558
               A+KLVP+GFT+A++ H +R EIIQIT+GSKELDK+L+GGIETGSITE++GEFR+GKTQ
Sbjct  76    AEAAKLVPMGFTTATEFHQRRSEIIQITTGSKELDKLLQGGIETGSITELFGEFRTGKTQ  135

Query  559   LCHTLCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIADRFGLNGADVLENVAYARAY  738
             LCHTL VTCQLP+D+GGGEGKAMYID EGTFRP+RLL +A+R+GL+G+DVL+NVAYAR +
Sbjct  136   LCHTLAVTCQLPIDRGGGEGKAMYIDTEGTFRPERLLAVAERYGLSGSDVLDNVAYARGF  195

Query  739   NTDHQSRLLLEAASMMVETRFALMIVDSATALYRTDFSGRGELSARQMHLAKFLRSLQKL  918
             NTDHQ++LL +A++MM E+R+AL+IVDSATALYRTD+SGRGELSARQMHLA+FLR L +L
Sbjct  196   NTDHQTQLLYQASAMMAESRYALLIVDSATALYRTDYSGRGELSARQMHLARFLRMLLRL  255

Query  919   ADEFGVAVVITNQVVAQVDGSAIFAGPQIKPIGGNIMAHASTTRLALRKGRGEERVCKVV  1098
             ADEFGVAVVITNQVVAQVDG+A+FA    KPIGGNI+AHASTTRL LRKGRGE R+CK+ 
Sbjct  256   ADEFGVAVVITNQVVAQVDGAAMFAADPKKPIGGNIIAHASTTRLYLRKGRGETRICKIY  315

Query  1099  SSPCLAEAEARFQISPEGVTDVKD  1170
              SPCL EAEA F I+ +GV D KD
Sbjct  316   DSPCLPEAEAMFAINADGVGDAKD  339



>ref|XP_005494864.1| PREDICTED: DNA repair protein RAD51 homolog 1 [Zonotrichia albicollis]
Length=339

 Score =   498 bits (1282),  Expect = 4e-172, Method: Compositional matrix adjust.
 Identities = 234/336 (70%), Positives = 287/336 (85%), Gaps = 0/336 (0%)
 Frame = +1

Query  163   QKSVQERQQDEVEEIQHGPFPIEQLQESGISAIDVKKLKDAGLCTVESVVYSPRKDLLQI  342
             Q  ++       EE   GP  I +L++ GI+A DVKKL++AG  TVE+V Y+P+K+LL I
Sbjct  4     QMQLETSADTSAEEESFGPQLISRLEQCGINANDVKKLEEAGFHTVEAVAYAPKKELLNI  63

Query  343   KGISEAKVDKIIEAASKLVPLGFTSASQLHAQRLEIIQITSGSKELDKVLEGGIETGSIT  522
             KGISEAK DKI+  A+KLVP+GFT+A++ H +R EIIQIT+GSKELDK+L+GGIETGSIT
Sbjct  64    KGISEAKADKILAEAAKLVPMGFTTATEFHQRRSEIIQITTGSKELDKLLQGGIETGSIT  123

Query  523   EIYGEFRSGKTQLCHTLCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIADRFGLNGA  702
             E++GEFR+GKTQLCHTL VTCQLP+D+GGGEGKAMYID EGTFRP+RLL +A+R+GL+G+
Sbjct  124   ELFGEFRTGKTQLCHTLAVTCQLPIDRGGGEGKAMYIDTEGTFRPERLLAVAERYGLSGS  183

Query  703   DVLENVAYARAYNTDHQSRLLLEAASMMVETRFALMIVDSATALYRTDFSGRGELSARQM  882
             DVL+NVAYAR +NTDHQ++LL +A++MM E+R+AL+IVDSATALYRTD+SGRGELSARQM
Sbjct  184   DVLDNVAYARGFNTDHQTQLLYQASAMMAESRYALLIVDSATALYRTDYSGRGELSARQM  243

Query  883   HLAKFLRSLQKLADEFGVAVVITNQVVAQVDGSAIFAGPQIKPIGGNIMAHASTTRLALR  1062
             HLA+FLR L +LADEFGVAVVITNQVVAQVDG+A+FA    KPIGGNI+AHASTTRL LR
Sbjct  244   HLARFLRMLLRLADEFGVAVVITNQVVAQVDGAAMFAADPKKPIGGNIIAHASTTRLYLR  303

Query  1063  KGRGEERVCKVVSSPCLAEAEARFQISPEGVTDVKD  1170
             KGRGE R+CK+  SPCL EAEA F I+ +GV D KD
Sbjct  304   KGRGETRICKIYDSPCLPEAEAMFAINADGVGDAKD  339



>ref|XP_010079559.1| PREDICTED: DNA repair protein RAD51 homolog 1 [Pterocles gutturalis]
Length=337

 Score =   498 bits (1281),  Expect = 4e-172, Method: Compositional matrix adjust.
 Identities = 233/324 (72%), Positives = 284/324 (88%), Gaps = 0/324 (0%)
 Frame = +1

Query  199   EEIQHGPFPIEQLQESGISAIDVKKLKDAGLCTVESVVYSPRKDLLQIKGISEAKVDKII  378
             EE   GP  I +L++ GI+A DVKKL++AG  TVE+V Y+P+K+LL IKGISEAK DKI+
Sbjct  14    EEESFGPQLISRLEQCGINANDVKKLEEAGFHTVEAVAYAPKKELLNIKGISEAKADKIL  73

Query  379   EAASKLVPLGFTSASQLHAQRLEIIQITSGSKELDKVLEGGIETGSITEIYGEFRSGKTQ  558
               A+KLVP+GFT+A++ H +R EIIQIT+GSKELDK+L+GGIETGSITE++GEFR+GKTQ
Sbjct  74    AEAAKLVPMGFTTATEFHQRRSEIIQITTGSKELDKLLQGGIETGSITELFGEFRTGKTQ  133

Query  559   LCHTLCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIADRFGLNGADVLENVAYARAY  738
             LCHTL VTCQLP+D+GGGEGKAMYID EGTFRP+RLL +A+R+GL+G+DVL+NVAYAR +
Sbjct  134   LCHTLAVTCQLPIDRGGGEGKAMYIDTEGTFRPERLLAVAERYGLSGSDVLDNVAYARGF  193

Query  739   NTDHQSRLLLEAASMMVETRFALMIVDSATALYRTDFSGRGELSARQMHLAKFLRSLQKL  918
             NTDHQ++LL +A++MM E+R+AL+IVDSATALYRTD+SGRGELSARQMHLA+FLR L +L
Sbjct  194   NTDHQTQLLYQASAMMAESRYALLIVDSATALYRTDYSGRGELSARQMHLARFLRMLLRL  253

Query  919   ADEFGVAVVITNQVVAQVDGSAIFAGPQIKPIGGNIMAHASTTRLALRKGRGEERVCKVV  1098
             ADEFGVAVVITNQVVAQVDG+A+FA    KPIGGNI+AHASTTRL LRKGRGE R+CK+ 
Sbjct  254   ADEFGVAVVITNQVVAQVDGAAMFAADPKKPIGGNIIAHASTTRLYLRKGRGETRICKIY  313

Query  1099  SSPCLAEAEARFQISPEGVTDVKD  1170
              SPCL EAEA F I+ +GV D KD
Sbjct  314   DSPCLPEAEAMFAINADGVGDAKD  337



>ref|XP_005095900.1| PREDICTED: DNA repair protein RAD51 homolog 1-like isoform X2 
[Aplysia californica]
Length=342

 Score =   498 bits (1282),  Expect = 4e-172, Method: Compositional matrix adjust.
 Identities = 231/325 (71%), Positives = 283/325 (87%), Gaps = 0/325 (0%)
 Frame = +1

Query  196   VEEIQHGPFPIEQLQESGISAIDVKKLKDAGLCTVESVVYSPRKDLLQIKGISEAKVDKI  375
              E+   GP P+ +L+ +GISA DVKKL++AG  TVESV ++P+K LL IKGISE K DKI
Sbjct  18    TEDETFGPMPLAKLEGNGISAGDVKKLEEAGFFTVESVAFAPKKMLLSIKGISEVKADKI  77

Query  376   IEAASKLVPLGFTSASQLHAQRLEIIQITSGSKELDKVLEGGIETGSITEIYGEFRSGKT  555
             +  A+KLVP+GFT+A++ H +R EIIQ+T+GSKELDK+L+GGIETGSITEI+GEFR+GKT
Sbjct  78    VAEAAKLVPMGFTTATEFHQKRSEIIQVTTGSKELDKLLQGGIETGSITEIFGEFRTGKT  137

Query  556   QLCHTLCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIADRFGLNGADVLENVAYARA  735
             QLCHTL VTCQLP+D GGGEGKAMYID EGTFRP+RLL +ADR+GL+G+DVL+NVAYARA
Sbjct  138   QLCHTLAVTCQLPIDMGGGEGKAMYIDTEGTFRPERLLAVADRYGLSGSDVLDNVAYARA  197

Query  736   YNTDHQSRLLLEAASMMVETRFALMIVDSATALYRTDFSGRGELSARQMHLAKFLRSLQK  915
             YN+DHQS+LL++AA+MM E+R+AL+IVDSATALYRTD++GRGELSARQMHLA+FLR L +
Sbjct  198   YNSDHQSQLLIQAAAMMAESRYALLIVDSATALYRTDYAGRGELSARQMHLARFLRMLLR  257

Query  916   LADEFGVAVVITNQVVAQVDGSAIFAGPQIKPIGGNIMAHASTTRLALRKGRGEERVCKV  1095
             LADEFGVAVVI+NQVVAQVDG+++F     KPIGGNI+AHASTTRL LRKGRGE R+CK+
Sbjct  258   LADEFGVAVVISNQVVAQVDGASMFTADPKKPIGGNIIAHASTTRLYLRKGRGETRICKI  317

Query  1096  VSSPCLAEAEARFQISPEGVTDVKD  1170
               SPCL EAEA F I+ +G+ D KD
Sbjct  318   YDSPCLPEAEAMFAINADGIGDAKD  342



>ref|XP_005284727.1| PREDICTED: DNA repair protein RAD51 homolog 1 [Chrysemys picta 
bellii]
Length=339

 Score =   498 bits (1282),  Expect = 4e-172, Method: Compositional matrix adjust.
 Identities = 232/336 (69%), Positives = 289/336 (86%), Gaps = 0/336 (0%)
 Frame = +1

Query  163   QKSVQERQQDEVEEIQHGPFPIEQLQESGISAIDVKKLKDAGLCTVESVVYSPRKDLLQI  342
             Q   +   +   EE   GP PI +L++ GI+A DVKKL++AG  TV++V Y+P+K+LL I
Sbjct  4     QMQYEANAETSAEEESLGPQPISRLEQCGINANDVKKLEEAGFHTVDAVAYAPKKELLNI  63

Query  343   KGISEAKVDKIIEAASKLVPLGFTSASQLHAQRLEIIQITSGSKELDKVLEGGIETGSIT  522
             KGISEAK DKI+  A+K++P+GF +A++ H +R EIIQIT+GSKELDK+L+GGIETGSIT
Sbjct  64    KGISEAKADKILAEAAKVIPMGFITATEFHQRRSEIIQITTGSKELDKLLQGGIETGSIT  123

Query  523   EIYGEFRSGKTQLCHTLCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIADRFGLNGA  702
             E++GEFR+GKTQLCHTL VTCQLP+DQGGGEGKAMYID EGTFRP+RLL +A+R+GL+G+
Sbjct  124   EMFGEFRTGKTQLCHTLAVTCQLPIDQGGGEGKAMYIDTEGTFRPERLLAVAERYGLSGS  183

Query  703   DVLENVAYARAYNTDHQSRLLLEAASMMVETRFALMIVDSATALYRTDFSGRGELSARQM  882
             DVL++VAYARA+NTDHQ++LL +A++MMVE+R+AL+IVDSATALYRTD+SGRGELSARQM
Sbjct  184   DVLDHVAYARAFNTDHQTQLLYQASAMMVESRYALLIVDSATALYRTDYSGRGELSARQM  243

Query  883   HLAKFLRSLQKLADEFGVAVVITNQVVAQVDGSAIFAGPQIKPIGGNIMAHASTTRLALR  1062
             HLA+FLR L +LADEFGVAVVITNQVVAQVDG+A+F+    KPIGGNI+AHASTTRL LR
Sbjct  244   HLARFLRMLLRLADEFGVAVVITNQVVAQVDGAAMFSADPKKPIGGNIIAHASTTRLYLR  303

Query  1063  KGRGEERVCKVVSSPCLAEAEARFQISPEGVTDVKD  1170
             KGRGE R+CK+  SPCL EAEA F I+ +GV D KD
Sbjct  304   KGRGETRICKIYDSPCLPEAEAMFAINADGVGDAKD  339



>ref|XP_008310877.1| PREDICTED: DNA repair protein RAD51 homolog 1 [Cynoglossus semilaevis]
 ref|XP_008310878.1| PREDICTED: DNA repair protein RAD51 homolog 1 [Cynoglossus semilaevis]
Length=338

 Score =   498 bits (1281),  Expect = 5e-172, Method: Compositional matrix adjust.
 Identities = 229/321 (71%), Positives = 283/321 (88%), Gaps = 0/321 (0%)
 Frame = +1

Query  208   QHGPFPIEQLQESGISAIDVKKLKDAGLCTVESVVYSPRKDLLQIKGISEAKVDKIIEAA  387
              +GP P+ +L++SG+SA D+KKL+DAG  T+E+V Y+P+K+LL IKGISEAK DKI+  A
Sbjct  18    NYGPQPLRRLEQSGVSASDIKKLEDAGFHTIEAVAYAPKKELLNIKGISEAKADKILAEA  77

Query  388   SKLVPLGFTSASQLHAQRLEIIQITSGSKELDKVLEGGIETGSITEIYGEFRSGKTQLCH  567
             +KLVP+GFT+A++ H +R EIIQI++GSKELDK+L+GGIETGSITE++GEFR+GKTQLCH
Sbjct  78    AKLVPMGFTTATEFHQRRAEIIQISTGSKELDKLLQGGIETGSITEMFGEFRTGKTQLCH  137

Query  568   TLCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIADRFGLNGADVLENVAYARAYNTD  747
             TL VTCQLP+DQGGGEGKAMYID EGTFRP+RLL +A+RFGL G+DVL+NVAYARA+NTD
Sbjct  138   TLAVTCQLPIDQGGGEGKAMYIDTEGTFRPERLLAVAERFGLVGSDVLDNVAYARAFNTD  197

Query  748   HQSRLLLEAASMMVETRFALMIVDSATALYRTDFSGRGELSARQMHLAKFLRSLQKLADE  927
             HQ++LL +A++MM E+R+AL+IVDSATALYRTD+SGRGELSARQ HL +FLR L +LADE
Sbjct  198   HQTQLLYQASAMMTESRYALLIVDSATALYRTDYSGRGELSARQGHLGRFLRMLLRLADE  257

Query  928   FGVAVVITNQVVAQVDGSAIFAGPQIKPIGGNIMAHASTTRLALRKGRGEERVCKVVSSP  1107
             FGVAVVI+NQVVAQVDG+A+F+    KPIGGNI+AHASTTRL LRKGRGE R+CK+  SP
Sbjct  258   FGVAVVISNQVVAQVDGAAMFSADPKKPIGGNILAHASTTRLYLRKGRGETRICKIYDSP  317

Query  1108  CLAEAEARFQISPEGVTDVKD  1170
             CL EAEA F I+ +GV D KD
Sbjct  318   CLPEAEAMFAINADGVGDAKD  338



>gb|KFP51963.1| DNA repair protein RAD51 1 [Cathartes aura]
Length=339

 Score =   498 bits (1281),  Expect = 5e-172, Method: Compositional matrix adjust.
 Identities = 233/324 (72%), Positives = 284/324 (88%), Gaps = 0/324 (0%)
 Frame = +1

Query  199   EEIQHGPFPIEQLQESGISAIDVKKLKDAGLCTVESVVYSPRKDLLQIKGISEAKVDKII  378
             EE   GP  I +L++ GI+A DVKKL++AG  TVE+V Y+P+K+LL IKGISEAK DKI+
Sbjct  16    EEESFGPQLISRLEQCGINANDVKKLEEAGFHTVEAVAYAPKKELLSIKGISEAKADKIL  75

Query  379   EAASKLVPLGFTSASQLHAQRLEIIQITSGSKELDKVLEGGIETGSITEIYGEFRSGKTQ  558
               A+KLVP+GFT+A++ H +R EIIQIT+GSKELDK+L+GGIETGSITE++GEFR+GKTQ
Sbjct  76    AEAAKLVPMGFTTATEFHQRRSEIIQITTGSKELDKLLQGGIETGSITELFGEFRTGKTQ  135

Query  559   LCHTLCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIADRFGLNGADVLENVAYARAY  738
             LCHTL VTCQLP+D+GGGEGKAMYID EGTFRP+RLL +A+R+GL+G+DVL+NVAYAR +
Sbjct  136   LCHTLAVTCQLPIDRGGGEGKAMYIDTEGTFRPERLLAVAERYGLSGSDVLDNVAYARGF  195

Query  739   NTDHQSRLLLEAASMMVETRFALMIVDSATALYRTDFSGRGELSARQMHLAKFLRSLQKL  918
             NTDHQ++LL +A++MM E+R+AL+IVDSATALYRTD+SGRGELSARQMHLA+FLR L +L
Sbjct  196   NTDHQTQLLYQASAMMAESRYALLIVDSATALYRTDYSGRGELSARQMHLARFLRMLLRL  255

Query  919   ADEFGVAVVITNQVVAQVDGSAIFAGPQIKPIGGNIMAHASTTRLALRKGRGEERVCKVV  1098
             ADEFGVAVVITNQVVAQVDG+A+FA    KPIGGNI+AHASTTRL LRKGRGE R+CK+ 
Sbjct  256   ADEFGVAVVITNQVVAQVDGAAMFAADPKKPIGGNIIAHASTTRLYLRKGRGETRICKIY  315

Query  1099  SSPCLAEAEARFQISPEGVTDVKD  1170
              SPCL EAEA F I+ +GV D KD
Sbjct  316   DSPCLPEAEAMFAINADGVGDAKD  339



>ref|XP_010208816.1| PREDICTED: DNA repair protein RAD51 homolog 1 isoform X1 [Colius 
striatus]
 gb|KFP24049.1| DNA repair protein RAD51 1 [Colius striatus]
Length=339

 Score =   498 bits (1281),  Expect = 5e-172, Method: Compositional matrix adjust.
 Identities = 233/324 (72%), Positives = 284/324 (88%), Gaps = 0/324 (0%)
 Frame = +1

Query  199   EEIQHGPFPIEQLQESGISAIDVKKLKDAGLCTVESVVYSPRKDLLQIKGISEAKVDKII  378
             EE   GP  I +L++ GI+A DVKKL++AG  TVE+V Y+P+K+LL IKGISEAK DKI+
Sbjct  16    EEESFGPQLISRLEQCGINANDVKKLEEAGFHTVEAVAYAPKKELLNIKGISEAKADKIL  75

Query  379   EAASKLVPLGFTSASQLHAQRLEIIQITSGSKELDKVLEGGIETGSITEIYGEFRSGKTQ  558
               A+KLVP+GFT+A++ H +R EIIQIT+GSKELDK+L+GGIETGSITE++GEFR+GKTQ
Sbjct  76    AEAAKLVPMGFTTATEFHQRRSEIIQITTGSKELDKLLQGGIETGSITELFGEFRTGKTQ  135

Query  559   LCHTLCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIADRFGLNGADVLENVAYARAY  738
             LCHTL VTCQLP+D+GGGEGKAMYID EGTFRP+RLL +A+R+GL+G+DVL+NVAYAR +
Sbjct  136   LCHTLAVTCQLPIDRGGGEGKAMYIDTEGTFRPERLLAVAERYGLSGSDVLDNVAYARGF  195

Query  739   NTDHQSRLLLEAASMMVETRFALMIVDSATALYRTDFSGRGELSARQMHLAKFLRSLQKL  918
             NTDHQ++LL +A++MM E+R+AL+IVDSATALYRTD+SGRGELSARQMHLA+FLR L +L
Sbjct  196   NTDHQTQLLYQASAMMAESRYALLIVDSATALYRTDYSGRGELSARQMHLARFLRMLLRL  255

Query  919   ADEFGVAVVITNQVVAQVDGSAIFAGPQIKPIGGNIMAHASTTRLALRKGRGEERVCKVV  1098
             ADEFGVAVVITNQVVAQVDG+A+FA    KPIGGNI+AHASTTRL LRKGRGE R+CK+ 
Sbjct  256   ADEFGVAVVITNQVVAQVDGAAMFAADPKKPIGGNIIAHASTTRLYLRKGRGETRICKIY  315

Query  1099  SSPCLAEAEARFQISPEGVTDVKD  1170
              SPCL EAEA F I+ +GV D KD
Sbjct  316   DSPCLPEAEAMFAINADGVGDAKD  339



>ref|NP_990504.1| DNA repair protein RAD51 homolog 1 [Gallus gallus]
 sp|P37383.1|RAD51_CHICK RecName: Full=DNA repair protein RAD51 homolog 1 [Gallus gallus]
 gb|AAB26354.1| homolog to S.cerevisiae [Gallus gallus]
Length=339

 Score =   498 bits (1281),  Expect = 5e-172, Method: Compositional matrix adjust.
 Identities = 233/324 (72%), Positives = 285/324 (88%), Gaps = 0/324 (0%)
 Frame = +1

Query  199   EEIQHGPFPIEQLQESGISAIDVKKLKDAGLCTVESVVYSPRKDLLQIKGISEAKVDKII  378
             EE   GP PI +L++ GI+A DVKKL++AG  TVESV ++P+K+LL IKGISEAK DKI+
Sbjct  16    EEESFGPEPISRLEQCGINANDVKKLEEAGYHTVESVAHAPKKELLNIKGISEAKADKIL  75

Query  379   EAASKLVPLGFTSASQLHAQRLEIIQITSGSKELDKVLEGGIETGSITEIYGEFRSGKTQ  558
               A+KLVP+GFT+A++ H +R EIIQIT+GSKELDK+L+GGIETGSITE++GEFR+GKTQ
Sbjct  76    AEAAKLVPMGFTTATEFHQRRSEIIQITTGSKELDKLLQGGIETGSITELFGEFRTGKTQ  135

Query  559   LCHTLCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIADRFGLNGADVLENVAYARAY  738
             LCHTL VTCQLP+D+GGGEGKAMYID EGTFRP+RLL +A+R+GL+G+DVL+NVAYAR +
Sbjct  136   LCHTLAVTCQLPIDRGGGEGKAMYIDTEGTFRPERLLAVAERYGLSGSDVLDNVAYARGF  195

Query  739   NTDHQSRLLLEAASMMVETRFALMIVDSATALYRTDFSGRGELSARQMHLAKFLRSLQKL  918
             NTDHQ++LL +A++MM E+R+AL+IVDSATALYRTD+SGRGELSARQMHLA+FLR L +L
Sbjct  196   NTDHQTQLLYQASAMMAESRYALLIVDSATALYRTDYSGRGELSARQMHLARFLRMLLRL  255

Query  919   ADEFGVAVVITNQVVAQVDGSAIFAGPQIKPIGGNIMAHASTTRLALRKGRGEERVCKVV  1098
             ADEFGVAVVITNQVVAQVDG+A+FA    KPIGGNI+AHASTTRL LRKGRGE R+CK+ 
Sbjct  256   ADEFGVAVVITNQVVAQVDGAAMFAADPKKPIGGNIIAHASTTRLYLRKGRGETRICKIY  315

Query  1099  SSPCLAEAEARFQISPEGVTDVKD  1170
              SPCL EAEA F I+ +GV D K+
Sbjct  316   DSPCLPEAEAMFAINADGVGDAKE  339



>gb|KFZ66192.1| DNA repair protein RAD51 1 [Podiceps cristatus]
Length=339

 Score =   498 bits (1281),  Expect = 6e-172, Method: Compositional matrix adjust.
 Identities = 232/324 (72%), Positives = 284/324 (88%), Gaps = 0/324 (0%)
 Frame = +1

Query  199   EEIQHGPFPIEQLQESGISAIDVKKLKDAGLCTVESVVYSPRKDLLQIKGISEAKVDKII  378
             EE   GP  I +L++ GI+A DVKKL++AG  TVE+V Y+P+K+LL IKGISEAK DKI+
Sbjct  16    EEESFGPQLISRLEQCGINANDVKKLEEAGFHTVEAVAYAPKKELLNIKGISEAKADKIL  75

Query  379   EAASKLVPLGFTSASQLHAQRLEIIQITSGSKELDKVLEGGIETGSITEIYGEFRSGKTQ  558
               A+KLVP+GFT+A++ H +R EIIQIT+GSKELDK+L+GG+ETGSITE++GEFR+GKTQ
Sbjct  76    AEAAKLVPMGFTTATEFHQRRSEIIQITTGSKELDKLLQGGVETGSITELFGEFRTGKTQ  135

Query  559   LCHTLCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIADRFGLNGADVLENVAYARAY  738
             LCHTL VTCQLP+D+GGGEGKAMYID EGTFRP+RLL +A+R+GL+G+DVL+NVAYAR +
Sbjct  136   LCHTLAVTCQLPIDRGGGEGKAMYIDTEGTFRPERLLAVAERYGLSGSDVLDNVAYARGF  195

Query  739   NTDHQSRLLLEAASMMVETRFALMIVDSATALYRTDFSGRGELSARQMHLAKFLRSLQKL  918
             NTDHQ++LL +A++MM E+R+AL+IVDSATALYRTD+SGRGELSARQMHLA+FLR L +L
Sbjct  196   NTDHQTQLLYQASAMMAESRYALLIVDSATALYRTDYSGRGELSARQMHLARFLRMLLRL  255

Query  919   ADEFGVAVVITNQVVAQVDGSAIFAGPQIKPIGGNIMAHASTTRLALRKGRGEERVCKVV  1098
             ADEFGVAVVITNQVVAQVDG+A+FA    KPIGGNI+AHASTTRL LRKGRGE R+CK+ 
Sbjct  256   ADEFGVAVVITNQVVAQVDGAAMFAADPKKPIGGNIIAHASTTRLYLRKGRGETRICKIY  315

Query  1099  SSPCLAEAEARFQISPEGVTDVKD  1170
              SPCL EAEA F I+ +GV D KD
Sbjct  316   DSPCLPEAEAMFAINADGVGDAKD  339



>ref|XP_010291170.1| PREDICTED: DNA repair protein RAD51 homolog 1 isoform X1 [Phaethon 
lepturus]
 gb|KFQ80658.1| DNA repair protein RAD51 1 [Phaethon lepturus]
Length=339

 Score =   498 bits (1281),  Expect = 6e-172, Method: Compositional matrix adjust.
 Identities = 233/324 (72%), Positives = 284/324 (88%), Gaps = 0/324 (0%)
 Frame = +1

Query  199   EEIQHGPFPIEQLQESGISAIDVKKLKDAGLCTVESVVYSPRKDLLQIKGISEAKVDKII  378
             EE   GP  I +L++ GI+A DVKKL++AG  TVE+V Y+P+K+LL IKGISEAK DKI+
Sbjct  16    EEESFGPQLIARLEQCGINANDVKKLEEAGFHTVEAVAYAPKKELLNIKGISEAKADKIL  75

Query  379   EAASKLVPLGFTSASQLHAQRLEIIQITSGSKELDKVLEGGIETGSITEIYGEFRSGKTQ  558
               A+KLVP+GFT+A++ H +R EIIQIT+GSKELDK+L+GGIETGSITE++GEFR+GKTQ
Sbjct  76    AEAAKLVPMGFTTATEFHQRRSEIIQITTGSKELDKLLQGGIETGSITELFGEFRTGKTQ  135

Query  559   LCHTLCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIADRFGLNGADVLENVAYARAY  738
             LCHTL VTCQLP+D+GGGEGKAMYID EGTFRP+RLL +A+R+GL+G+DVL+NVAYAR +
Sbjct  136   LCHTLAVTCQLPIDRGGGEGKAMYIDTEGTFRPERLLAVAERYGLSGSDVLDNVAYARGF  195

Query  739   NTDHQSRLLLEAASMMVETRFALMIVDSATALYRTDFSGRGELSARQMHLAKFLRSLQKL  918
             NTDHQ++LL +A++MM E+R+AL+IVDSATALYRTD+SGRGELSARQMHLA+FLR L +L
Sbjct  196   NTDHQTQLLYQASAMMAESRYALLIVDSATALYRTDYSGRGELSARQMHLARFLRMLLRL  255

Query  919   ADEFGVAVVITNQVVAQVDGSAIFAGPQIKPIGGNIMAHASTTRLALRKGRGEERVCKVV  1098
             ADEFGVAVVITNQVVAQVDG+A+FA    KPIGGNI+AHASTTRL LRKGRGE R+CK+ 
Sbjct  256   ADEFGVAVVITNQVVAQVDGAAMFAADPKKPIGGNIIAHASTTRLYLRKGRGETRICKIY  315

Query  1099  SSPCLAEAEARFQISPEGVTDVKD  1170
              SPCL EAEA F I+ +GV D KD
Sbjct  316   DSPCLPEAEAMFAINADGVGDAKD  339



>ref|XP_009820227.1| PREDICTED: DNA repair protein RAD51 homolog 1 [Gavia stellata]
 gb|KFV40613.1| DNA repair protein RAD51 1 [Gavia stellata]
Length=339

 Score =   498 bits (1281),  Expect = 6e-172, Method: Compositional matrix adjust.
 Identities = 233/324 (72%), Positives = 284/324 (88%), Gaps = 0/324 (0%)
 Frame = +1

Query  199   EEIQHGPFPIEQLQESGISAIDVKKLKDAGLCTVESVVYSPRKDLLQIKGISEAKVDKII  378
             EE   GP  I +L++ GI+A DVKKL++AG  TVE+V Y+P+K+LL IKGISEAK DKI+
Sbjct  16    EEESFGPQLISRLEQCGINANDVKKLEEAGFHTVEAVAYAPKKELLNIKGISEAKADKIL  75

Query  379   EAASKLVPLGFTSASQLHAQRLEIIQITSGSKELDKVLEGGIETGSITEIYGEFRSGKTQ  558
               A+KLVP+GFT+A++ H +R EIIQIT+GSKELDK+L+GGIETGSITE++GEFR+GKTQ
Sbjct  76    AEAAKLVPMGFTTATEFHQRRSEIIQITTGSKELDKLLQGGIETGSITELFGEFRTGKTQ  135

Query  559   LCHTLCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIADRFGLNGADVLENVAYARAY  738
             LCHTL VTCQLP+D+GGGEGKAMYID EGTFRP+RLL +A+R+GL+G+DVL+NVAYAR +
Sbjct  136   LCHTLAVTCQLPIDRGGGEGKAMYIDTEGTFRPERLLAVAERYGLSGSDVLDNVAYARGF  195

Query  739   NTDHQSRLLLEAASMMVETRFALMIVDSATALYRTDFSGRGELSARQMHLAKFLRSLQKL  918
             NTDHQ++LL +A++MM E+R+AL+IVDSATALYRTD+SGRGELSARQMHLA+FLR L +L
Sbjct  196   NTDHQTQLLYQASAMMAESRYALLIVDSATALYRTDYSGRGELSARQMHLARFLRMLLRL  255

Query  919   ADEFGVAVVITNQVVAQVDGSAIFAGPQIKPIGGNIMAHASTTRLALRKGRGEERVCKVV  1098
             ADEFGVAVVITNQVVAQVDG+A+FA    KPIGGNI+AHASTTRL LRKGRGE R+CK+ 
Sbjct  256   ADEFGVAVVITNQVVAQVDGAAMFAADPKKPIGGNIIAHASTTRLYLRKGRGETRICKIY  315

Query  1099  SSPCLAEAEARFQISPEGVTDVKD  1170
              SPCL EAEA F I+ +GV D KD
Sbjct  316   DSPCLPEAEAMFAINADGVGDAKD  339



>ref|XP_008504228.1| PREDICTED: DNA repair protein RAD51 homolog 1 [Calypte anna]
 gb|KFO97753.1| DNA repair protein RAD51 1 [Calypte anna]
Length=339

 Score =   497 bits (1280),  Expect = 6e-172, Method: Compositional matrix adjust.
 Identities = 233/336 (69%), Positives = 287/336 (85%), Gaps = 0/336 (0%)
 Frame = +1

Query  163   QKSVQERQQDEVEEIQHGPFPIEQLQESGISAIDVKKLKDAGLCTVESVVYSPRKDLLQI  342
             Q  ++       EE   GP  I +L++ GI+A DVKKL++AG  TVE+V Y+P+K+LL I
Sbjct  4     QMQLEANADTSAEEESFGPQLISRLEQCGINANDVKKLEEAGFHTVEAVAYAPKKELLSI  63

Query  343   KGISEAKVDKIIEAASKLVPLGFTSASQLHAQRLEIIQITSGSKELDKVLEGGIETGSIT  522
             KGISEAK DKI+  A+KLVP+GFT+A++ H +R EIIQIT+GSKELDK+L+GG+ETGSIT
Sbjct  64    KGISEAKADKILAEAAKLVPMGFTTATEFHQRRSEIIQITTGSKELDKLLQGGVETGSIT  123

Query  523   EIYGEFRSGKTQLCHTLCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIADRFGLNGA  702
             E++GEFR+GKTQLCHTL VTCQLP+D+GGGEGKAMYID EGTFRP+RLL +A+R+GL+G+
Sbjct  124   ELFGEFRTGKTQLCHTLAVTCQLPIDRGGGEGKAMYIDTEGTFRPERLLAVAERYGLSGS  183

Query  703   DVLENVAYARAYNTDHQSRLLLEAASMMVETRFALMIVDSATALYRTDFSGRGELSARQM  882
             DVL+NVAYAR +NTDHQ++LL +A++MM E+R+AL+IVDSATALYRTD+SGRGELSARQM
Sbjct  184   DVLDNVAYARGFNTDHQTQLLYQASAMMAESRYALLIVDSATALYRTDYSGRGELSARQM  243

Query  883   HLAKFLRSLQKLADEFGVAVVITNQVVAQVDGSAIFAGPQIKPIGGNIMAHASTTRLALR  1062
             HLA+FLR L +LADEFGVAVVITNQVVAQVDG+A+FA    KPIGGNI+AHASTTRL LR
Sbjct  244   HLARFLRMLLRLADEFGVAVVITNQVVAQVDGAAMFAADPKKPIGGNIIAHASTTRLYLR  303

Query  1063  KGRGEERVCKVVSSPCLAEAEARFQISPEGVTDVKD  1170
             KGRGE R+CK+  SPCL EAEA F I+ +GV D KD
Sbjct  304   KGRGETRICKIYDSPCLPEAEAMFAINADGVGDAKD  339



>ref|XP_009983436.1| PREDICTED: DNA repair protein RAD51 homolog 1 isoform X1 [Tauraco 
erythrolophus]
 gb|KFV17340.1| DNA repair protein RAD51 1 [Tauraco erythrolophus]
Length=339

 Score =   497 bits (1280),  Expect = 7e-172, Method: Compositional matrix adjust.
 Identities = 233/324 (72%), Positives = 284/324 (88%), Gaps = 0/324 (0%)
 Frame = +1

Query  199   EEIQHGPFPIEQLQESGISAIDVKKLKDAGLCTVESVVYSPRKDLLQIKGISEAKVDKII  378
             EE   GP  I +L++ GI+A DVKKL++AG  TVE+V Y+P+K+LL IKGISEAK DKI+
Sbjct  16    EEESFGPQLIARLEQCGINANDVKKLEEAGFHTVEAVAYAPKKELLNIKGISEAKADKIL  75

Query  379   EAASKLVPLGFTSASQLHAQRLEIIQITSGSKELDKVLEGGIETGSITEIYGEFRSGKTQ  558
               A+KLVP+GFT+A++ H +R EIIQIT+GSKELDK+L+GGIETGSITE++GEFR+GKTQ
Sbjct  76    AEAAKLVPMGFTTATEFHQRRSEIIQITTGSKELDKLLQGGIETGSITELFGEFRTGKTQ  135

Query  559   LCHTLCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIADRFGLNGADVLENVAYARAY  738
             LCHTL VTCQLP+D+GGGEGKAMYID EGTFRP+RLL +A+R+GL+G+DVL+NVAYAR +
Sbjct  136   LCHTLAVTCQLPIDRGGGEGKAMYIDTEGTFRPERLLAVAERYGLSGSDVLDNVAYARGF  195

Query  739   NTDHQSRLLLEAASMMVETRFALMIVDSATALYRTDFSGRGELSARQMHLAKFLRSLQKL  918
             NTDHQ++LL +A++MM E+R+AL+IVDSATALYRTD+SGRGELSARQMHLA+FLR L +L
Sbjct  196   NTDHQTQLLYQASAMMAESRYALLIVDSATALYRTDYSGRGELSARQMHLARFLRMLLRL  255

Query  919   ADEFGVAVVITNQVVAQVDGSAIFAGPQIKPIGGNIMAHASTTRLALRKGRGEERVCKVV  1098
             ADEFGVAVVITNQVVAQVDG+A+FA    KPIGGNI+AHASTTRL LRKGRGE R+CK+ 
Sbjct  256   ADEFGVAVVITNQVVAQVDGAAMFAADPKKPIGGNIIAHASTTRLYLRKGRGETRICKIY  315

Query  1099  SSPCLAEAEARFQISPEGVTDVKD  1170
              SPCL EAEA F I+ +GV D KD
Sbjct  316   DSPCLPEAEAMFAINADGVGDAKD  339



>ref|XP_009502502.1| PREDICTED: DNA repair protein RAD51 homolog 1 isoform X1 [Phalacrocorax 
carbo]
 gb|KFW90735.1| DNA repair protein RAD51 1 [Phalacrocorax carbo]
Length=339

 Score =   497 bits (1280),  Expect = 7e-172, Method: Compositional matrix adjust.
 Identities = 233/324 (72%), Positives = 284/324 (88%), Gaps = 0/324 (0%)
 Frame = +1

Query  199   EEIQHGPFPIEQLQESGISAIDVKKLKDAGLCTVESVVYSPRKDLLQIKGISEAKVDKII  378
             EE   GP  I +L++ GI+A DVKKL++AG  TVE+V Y+P+K+LL IKGISEAK DKI+
Sbjct  16    EEESFGPQLISRLEQCGINANDVKKLEEAGFHTVEAVAYAPKKELLSIKGISEAKADKIL  75

Query  379   EAASKLVPLGFTSASQLHAQRLEIIQITSGSKELDKVLEGGIETGSITEIYGEFRSGKTQ  558
               A+KLVP+GFT+A++ H +R EIIQIT+GSKELDK+L+GGIETGSITE++GEFR+GKTQ
Sbjct  76    AEAAKLVPMGFTTATEFHQRRSEIIQITTGSKELDKLLQGGIETGSITELFGEFRTGKTQ  135

Query  559   LCHTLCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIADRFGLNGADVLENVAYARAY  738
             LCHTL VTCQLP+D+GGGEGKAMYID EGTFRP+RLL +A+R+GL+G+DVL+NVAYAR +
Sbjct  136   LCHTLAVTCQLPIDRGGGEGKAMYIDTEGTFRPERLLAVAERYGLSGSDVLDNVAYARGF  195

Query  739   NTDHQSRLLLEAASMMVETRFALMIVDSATALYRTDFSGRGELSARQMHLAKFLRSLQKL  918
             NTDHQ++LL +A++MM E+R+AL+IVDSATALYRTD+SGRGELSARQMHLA+FLR L +L
Sbjct  196   NTDHQTQLLYQASAMMAESRYALLIVDSATALYRTDYSGRGELSARQMHLARFLRMLLRL  255

Query  919   ADEFGVAVVITNQVVAQVDGSAIFAGPQIKPIGGNIMAHASTTRLALRKGRGEERVCKVV  1098
             ADEFGVAVVITNQVVAQVDG+A+FA    KPIGGNI+AHASTTRL LRKGRGE R+CK+ 
Sbjct  256   ADEFGVAVVITNQVVAQVDGAAMFAADPKKPIGGNIIAHASTTRLYLRKGRGETRICKIY  315

Query  1099  SSPCLAEAEARFQISPEGVTDVKD  1170
              SPCL EAEA F I+ +GV D KD
Sbjct  316   DSPCLPEAEAMFAINADGVGDAKD  339



>ref|NP_001081236.1| DNA repair protein RAD51 homolog A [Xenopus laevis]
 sp|Q91918.1|RA51A_XENLA RecName: Full=DNA repair protein RAD51 homolog A; Short=xRAD51.1 
[Xenopus laevis]
 dbj|BAA07501.1| XRad51.1 [Xenopus laevis]
 gb|AAH88930.1| LOC397726 protein [Xenopus laevis]
Length=336

 Score =   497 bits (1279),  Expect = 7e-172, Method: Compositional matrix adjust.
 Identities = 233/335 (70%), Positives = 291/335 (87%), Gaps = 1/335 (0%)
 Frame = +1

Query  169   SVQERQQDEVEEIQH-GPFPIEQLQESGISAIDVKKLKDAGLCTVESVVYSPRKDLLQIK  345
             ++Q   + E  E +H GP  I +L++ GI+A DVKKL++AG  TVE+V Y+P+K+LL IK
Sbjct  2     AMQAHYEAEATEEEHFGPQAISRLEQCGINANDVKKLEEAGFHTVEAVAYAPKKELLNIK  61

Query  346   GISEAKVDKIIEAASKLVPLGFTSASQLHAQRLEIIQITSGSKELDKVLEGGIETGSITE  525
             GISEAK +KI+  A+KLVP+GFT+A++ H +R EIIQI++GSKELDK+L+GG+ETGSITE
Sbjct  62    GISEAKAEKILAEAAKLVPMGFTTATEFHQRRSEIIQISTGSKELDKLLQGGVETGSITE  121

Query  526   IYGEFRSGKTQLCHTLCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIADRFGLNGAD  705
             ++GEFR+GKTQLCHTL VTCQLP+D+GGGEGKAMYID EGTFRP+RLL +A+R+GL+G+D
Sbjct  122   MFGEFRTGKTQLCHTLAVTCQLPIDRGGGEGKAMYIDTEGTFRPERLLAVAERYGLSGSD  181

Query  706   VLENVAYARAYNTDHQSRLLLEAASMMVETRFALMIVDSATALYRTDFSGRGELSARQMH  885
             VL+NVAYARA+NTDHQ++LL +A++MM E+R+AL+IVDSATALYRTD+SGRGELSARQMH
Sbjct  182   VLDNVAYARAFNTDHQTQLLYQASAMMAESRYALLIVDSATALYRTDYSGRGELSARQMH  241

Query  886   LAKFLRSLQKLADEFGVAVVITNQVVAQVDGSAIFAGPQIKPIGGNIMAHASTTRLALRK  1065
             LA+FLR L +LADEFGVAVVITNQVVAQVDG+A+FA    KPIGGNI+AHASTTRL LRK
Sbjct  242   LARFLRMLLRLADEFGVAVVITNQVVAQVDGAAMFAADPKKPIGGNIIAHASTTRLYLRK  301

Query  1066  GRGEERVCKVVSSPCLAEAEARFQISPEGVTDVKD  1170
             GRGE R+CK+  SPCL EAEA F I+ +GV D KD
Sbjct  302   GRGETRICKIYDSPCLPEAEAMFAINADGVGDAKD  336



>ref|XP_007430136.1| PREDICTED: DNA repair protein RAD51 homolog 1 [Python bivittatus]
Length=339

 Score =   497 bits (1279),  Expect = 8e-172, Method: Compositional matrix adjust.
 Identities = 231/325 (71%), Positives = 284/325 (87%), Gaps = 0/325 (0%)
 Frame = +1

Query  196   VEEIQHGPFPIEQLQESGISAIDVKKLKDAGLCTVESVVYSPRKDLLQIKGISEAKVDKI  375
              EE   GP PI +L++ GI+A DVKKL++AG  TVE+V Y+P+K+L+ IKGISEAK DKI
Sbjct  15    TEEESFGPQPISRLEQCGINANDVKKLEEAGFHTVEAVAYAPKKELINIKGISEAKADKI  74

Query  376   IEAASKLVPLGFTSASQLHAQRLEIIQITSGSKELDKVLEGGIETGSITEIYGEFRSGKT  555
             +  A+KLVP+GFT+A++ H +R EIIQIT+GSKELDK+L+GGIETGSITE++GEFR+GKT
Sbjct  75    LAEAAKLVPMGFTTATEFHQRRSEIIQITTGSKELDKLLQGGIETGSITEMFGEFRTGKT  134

Query  556   QLCHTLCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIADRFGLNGADVLENVAYARA  735
             QLCH L VTCQLP+D+GGGEGKAMYID EGTFRP+RLL +A+R+GL+G+DVL+NVAYAR 
Sbjct  135   QLCHMLAVTCQLPIDRGGGEGKAMYIDTEGTFRPERLLAVAERYGLSGSDVLDNVAYARG  194

Query  736   YNTDHQSRLLLEAASMMVETRFALMIVDSATALYRTDFSGRGELSARQMHLAKFLRSLQK  915
             +NTDHQ++LL +A++MM E+R+AL+IVDSATALYRTD+SGRGELSARQMHLA+FLR L +
Sbjct  195   FNTDHQTQLLYQASAMMTESRYALLIVDSATALYRTDYSGRGELSARQMHLARFLRMLLR  254

Query  916   LADEFGVAVVITNQVVAQVDGSAIFAGPQIKPIGGNIMAHASTTRLALRKGRGEERVCKV  1095
             LADEFGVAVVITNQVVAQVDG+A+FA    KPIGGNI+AHASTTRL LRKGRGE R+CK+
Sbjct  255   LADEFGVAVVITNQVVAQVDGAAMFAADPKKPIGGNIIAHASTTRLYLRKGRGETRICKI  314

Query  1096  VSSPCLAEAEARFQISPEGVTDVKD  1170
               SPCL EAEA F I+ +G+ D KD
Sbjct  315   YDSPCLPEAEAMFAINADGIGDAKD  339



>gb|KFQ85490.1| DNA repair protein RAD51 1 [Phoenicopterus ruber ruber]
Length=339

 Score =   497 bits (1279),  Expect = 9e-172, Method: Compositional matrix adjust.
 Identities = 233/336 (69%), Positives = 286/336 (85%), Gaps = 0/336 (0%)
 Frame = +1

Query  163   QKSVQERQQDEVEEIQHGPFPIEQLQESGISAIDVKKLKDAGLCTVESVVYSPRKDLLQI  342
             Q   +       EE   GP  I +L++ GI+A DVKKL++AG  TVE+V Y+P+K+LL I
Sbjct  4     QTQFEANADTSAEEESFGPQLISRLEQCGINANDVKKLEEAGFHTVEAVAYAPKKELLNI  63

Query  343   KGISEAKVDKIIEAASKLVPLGFTSASQLHAQRLEIIQITSGSKELDKVLEGGIETGSIT  522
             KGISEAK DKI+  A+KLVP+GFT+A++ H +R EIIQIT+GSKELDK+L+GGIETGSIT
Sbjct  64    KGISEAKADKILAEAAKLVPMGFTTATEFHQRRSEIIQITTGSKELDKLLQGGIETGSIT  123

Query  523   EIYGEFRSGKTQLCHTLCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIADRFGLNGA  702
             E++GEFR+GKTQLCHTL VTCQLP+D+GGGEGKAMYID EGTFRP+RLL +A+R+GL+G+
Sbjct  124   ELFGEFRTGKTQLCHTLAVTCQLPIDRGGGEGKAMYIDTEGTFRPERLLAVAERYGLSGS  183

Query  703   DVLENVAYARAYNTDHQSRLLLEAASMMVETRFALMIVDSATALYRTDFSGRGELSARQM  882
             DVL+NVAYAR +NTDHQ++LL +A++MM E+R+AL+IVDSATALYRTD+SGRGEL+ARQM
Sbjct  184   DVLDNVAYARGFNTDHQTQLLYQASAMMAESRYALLIVDSATALYRTDYSGRGELAARQM  243

Query  883   HLAKFLRSLQKLADEFGVAVVITNQVVAQVDGSAIFAGPQIKPIGGNIMAHASTTRLALR  1062
             HLA+FLR L +LADEFGVAVVITNQVVAQVDG+A+FA    KPIGGNI+AHASTTRL LR
Sbjct  244   HLARFLRMLLRLADEFGVAVVITNQVVAQVDGAAMFAADPKKPIGGNIIAHASTTRLYLR  303

Query  1063  KGRGEERVCKVVSSPCLAEAEARFQISPEGVTDVKD  1170
             KGRGE R+CK+  SPCL EAEA F I+ +GV D KD
Sbjct  304   KGRGETRICKIYDSPCLPEAEAMFAINADGVGDAKD  339



>ref|XP_010022645.1| PREDICTED: DNA repair protein RAD51 homolog 1 [Nestor notabilis]
 gb|KFQ45446.1| DNA repair protein RAD51 1 [Nestor notabilis]
Length=339

 Score =   497 bits (1279),  Expect = 9e-172, Method: Compositional matrix adjust.
 Identities = 233/336 (69%), Positives = 287/336 (85%), Gaps = 0/336 (0%)
 Frame = +1

Query  163   QKSVQERQQDEVEEIQHGPFPIEQLQESGISAIDVKKLKDAGLCTVESVVYSPRKDLLQI  342
             Q  ++       EE   GP  I +L++ GI+A DVKKL++AG  TVE+V Y+P+K+LL I
Sbjct  4     QMPLEANADTSAEEESFGPQLIARLEQCGINANDVKKLEEAGFHTVEAVAYAPKKELLNI  63

Query  343   KGISEAKVDKIIEAASKLVPLGFTSASQLHAQRLEIIQITSGSKELDKVLEGGIETGSIT  522
             KGISEAK DKI+  A+KLVP+GFT+A++ H +R EIIQIT+GSKELDK+L+GGIETGSIT
Sbjct  64    KGISEAKADKILAEAAKLVPMGFTTATEFHQRRSEIIQITTGSKELDKLLQGGIETGSIT  123

Query  523   EIYGEFRSGKTQLCHTLCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIADRFGLNGA  702
             E++GEFR+GKTQLCHTL VTCQLP+D+GGGEGKAMYID EGTFRP+RLL +A+R+GL+G+
Sbjct  124   ELFGEFRTGKTQLCHTLAVTCQLPIDRGGGEGKAMYIDTEGTFRPERLLAVAERYGLSGS  183

Query  703   DVLENVAYARAYNTDHQSRLLLEAASMMVETRFALMIVDSATALYRTDFSGRGELSARQM  882
             DVL+NVAYAR +NTDHQ++LL +A++MM E+R+AL++VDSATALYRTD+SGRGELSARQM
Sbjct  184   DVLDNVAYARGFNTDHQTQLLYQASAMMAESRYALLVVDSATALYRTDYSGRGELSARQM  243

Query  883   HLAKFLRSLQKLADEFGVAVVITNQVVAQVDGSAIFAGPQIKPIGGNIMAHASTTRLALR  1062
             HLA+FLR L +LADEFGVAVVITNQVVAQVDG+A+FA    KPIGGNI+AHASTTRL LR
Sbjct  244   HLARFLRMLLRLADEFGVAVVITNQVVAQVDGAAMFAADPKKPIGGNIIAHASTTRLYLR  303

Query  1063  KGRGEERVCKVVSSPCLAEAEARFQISPEGVTDVKD  1170
             KGRGE R+CK+  SPCL EAEA F I+ +GV D KD
Sbjct  304   KGRGETRICKIYDSPCLPEAEAMFAINADGVGDAKD  339



>ref|XP_010213910.1| PREDICTED: DNA repair protein RAD51 homolog 1 [Tinamus guttatus]
 gb|KGL77915.1| DNA repair protein RAD51 1 [Tinamus guttatus]
Length=339

 Score =   497 bits (1279),  Expect = 9e-172, Method: Compositional matrix adjust.
 Identities = 233/325 (72%), Positives = 284/325 (87%), Gaps = 0/325 (0%)
 Frame = +1

Query  196   VEEIQHGPFPIEQLQESGISAIDVKKLKDAGLCTVESVVYSPRKDLLQIKGISEAKVDKI  375
              EE   GP  I +L++ GI+A DVKKL++AG  TVE+V Y+P+K+LL IKGISEAK DKI
Sbjct  15    TEEESLGPQLISRLEQCGINANDVKKLEEAGFHTVEAVAYAPKKELLNIKGISEAKADKI  74

Query  376   IEAASKLVPLGFTSASQLHAQRLEIIQITSGSKELDKVLEGGIETGSITEIYGEFRSGKT  555
             +  A+KLVP+GFT+A++ H +R EIIQIT+GSKELDK+L+GGIETGSITE++GEFR+GKT
Sbjct  75    LAEAAKLVPMGFTTATEFHQRRSEIIQITTGSKELDKLLQGGIETGSITELFGEFRTGKT  134

Query  556   QLCHTLCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIADRFGLNGADVLENVAYARA  735
             QLCHTL VTCQLP+D+GGGEGKAMYID EGTFRP+RLL +A+R+GL+G+DVL+NVAYAR 
Sbjct  135   QLCHTLAVTCQLPIDRGGGEGKAMYIDTEGTFRPERLLAVAERYGLSGSDVLDNVAYARG  194

Query  736   YNTDHQSRLLLEAASMMVETRFALMIVDSATALYRTDFSGRGELSARQMHLAKFLRSLQK  915
             +NTDHQ++LL +A++MM E+R+AL+IVDSATALYRTD+SGRGELSARQMHLA+FLR L +
Sbjct  195   FNTDHQTQLLYQASAMMAESRYALLIVDSATALYRTDYSGRGELSARQMHLARFLRMLLR  254

Query  916   LADEFGVAVVITNQVVAQVDGSAIFAGPQIKPIGGNIMAHASTTRLALRKGRGEERVCKV  1095
             LADEFGVAVVITNQVVAQVDG+A+FA    KPIGGNI+AHASTTRL LRKGRGE R+CK+
Sbjct  255   LADEFGVAVVITNQVVAQVDGAAMFAADPKKPIGGNIIAHASTTRLYLRKGRGETRICKI  314

Query  1096  VSSPCLAEAEARFQISPEGVTDVKD  1170
               SPCL EAEA F I+ +GV D KD
Sbjct  315   YDSPCLPEAEAMFAINADGVGDAKD  339



>ref|XP_003977354.1| PREDICTED: DNA repair protein RAD51 homolog 1 [Takifugu rubripes]
Length=340

 Score =   497 bits (1279),  Expect = 1e-171, Method: Compositional matrix adjust.
 Identities = 234/335 (70%), Positives = 289/335 (86%), Gaps = 1/335 (0%)
 Frame = +1

Query  169   SVQERQQDEVEEIQ-HGPFPIEQLQESGISAIDVKKLKDAGLCTVESVVYSPRKDLLQIK  345
             + + R Q EVEE +  GP P+ +L++ GIS  D+KKL+DAG  T+E+V Y+P+K+LL IK
Sbjct  6     ATEARLQTEVEEEESFGPQPLCRLEQCGISTSDIKKLEDAGFHTIEAVAYAPKKELLNIK  65

Query  346   GISEAKVDKIIEAASKLVPLGFTSASQLHAQRLEIIQITSGSKELDKVLEGGIETGSITE  525
             GISEAK DKI+  A+KLVP+GFT+A++ H +R EIIQI++GSKELDK+L+GGIETGSITE
Sbjct  66    GISEAKADKILTEAAKLVPMGFTTATEFHQRRAEIIQISTGSKELDKLLQGGIETGSITE  125

Query  526   IYGEFRSGKTQLCHTLCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIADRFGLNGAD  705
             ++GEFR+GKTQLCHTL VTCQLP+DQGGGEGKAMYID EGTFRP+RLL +A+R+GL G+D
Sbjct  126   MFGEFRTGKTQLCHTLAVTCQLPIDQGGGEGKAMYIDTEGTFRPERLLAVAERYGLVGSD  185

Query  706   VLENVAYARAYNTDHQSRLLLEAASMMVETRFALMIVDSATALYRTDFSGRGELSARQMH  885
             VL+NVAYARA+NTDHQ++LL +A++MM E+R+AL+IVDSATALYRTD+SGRGELSARQ H
Sbjct  186   VLDNVAYARAFNTDHQTQLLYQASAMMAESRYALLIVDSATALYRTDYSGRGELSARQGH  245

Query  886   LAKFLRSLQKLADEFGVAVVITNQVVAQVDGSAIFAGPQIKPIGGNIMAHASTTRLALRK  1065
             L +FLR L +LADEFGVAVVITNQVVAQVDG+A+F+    KPIGGNI+AHASTTRL LRK
Sbjct  246   LGRFLRMLLRLADEFGVAVVITNQVVAQVDGAAMFSADPKKPIGGNILAHASTTRLYLRK  305

Query  1066  GRGEERVCKVVSSPCLAEAEARFQISPEGVTDVKD  1170
             GRGE R+CK+  SPCL EAEA F I+ +GV D KD
Sbjct  306   GRGETRICKIYDSPCLPEAEAMFAINADGVGDAKD  340



>ref|XP_010306237.1| PREDICTED: DNA repair protein RAD51 homolog 1 isoform X1 [Balearica 
regulorum gibbericeps]
 gb|KFO13604.1| DNA repair protein RAD51 1 [Balearica regulorum gibbericeps]
Length=339

 Score =   497 bits (1279),  Expect = 1e-171, Method: Compositional matrix adjust.
 Identities = 232/324 (72%), Positives = 284/324 (88%), Gaps = 0/324 (0%)
 Frame = +1

Query  199   EEIQHGPFPIEQLQESGISAIDVKKLKDAGLCTVESVVYSPRKDLLQIKGISEAKVDKII  378
             E+   GP  I +L++ GI+A DVKKL++AG  TVE+V Y+P+K+LL IKGISEAK DKI+
Sbjct  16    EDESFGPQLISRLEQCGINANDVKKLEEAGFHTVEAVAYAPKKELLNIKGISEAKADKIL  75

Query  379   EAASKLVPLGFTSASQLHAQRLEIIQITSGSKELDKVLEGGIETGSITEIYGEFRSGKTQ  558
               A+KLVP+GFT+A++ H +R EIIQIT+GSKELDK+L+GGIETGSITE++GEFR+GKTQ
Sbjct  76    AEAAKLVPMGFTTATEFHQRRSEIIQITTGSKELDKLLQGGIETGSITELFGEFRTGKTQ  135

Query  559   LCHTLCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIADRFGLNGADVLENVAYARAY  738
             LCHTL VTCQLP+D+GGGEGKAMYID EGTFRP+RLL +A+R+GL+G+DVL+NVAYAR +
Sbjct  136   LCHTLAVTCQLPIDRGGGEGKAMYIDTEGTFRPERLLAVAERYGLSGSDVLDNVAYARGF  195

Query  739   NTDHQSRLLLEAASMMVETRFALMIVDSATALYRTDFSGRGELSARQMHLAKFLRSLQKL  918
             NTDHQ++LL +A++MM E+R+AL+IVDSATALYRTD+SGRGELSARQMHLA+FLR L +L
Sbjct  196   NTDHQTQLLYQASAMMAESRYALLIVDSATALYRTDYSGRGELSARQMHLARFLRMLLRL  255

Query  919   ADEFGVAVVITNQVVAQVDGSAIFAGPQIKPIGGNIMAHASTTRLALRKGRGEERVCKVV  1098
             ADEFGVAVVITNQVVAQVDG+A+FA    KPIGGNI+AHASTTRL LRKGRGE R+CK+ 
Sbjct  256   ADEFGVAVVITNQVVAQVDGAAMFAADPKKPIGGNIIAHASTTRLYLRKGRGETRICKIY  315

Query  1099  SSPCLAEAEARFQISPEGVTDVKD  1170
              SPCL EAEA F I+ +GV D KD
Sbjct  316   DSPCLPEAEAMFAINADGVGDAKD  339



>ref|XP_009929806.1| PREDICTED: DNA repair protein RAD51 homolog 1 [Opisthocomus hoazin]
 gb|KFR06501.1| DNA repair protein RAD51 1 [Opisthocomus hoazin]
Length=339

 Score =   496 bits (1278),  Expect = 1e-171, Method: Compositional matrix adjust.
 Identities = 232/324 (72%), Positives = 284/324 (88%), Gaps = 0/324 (0%)
 Frame = +1

Query  199   EEIQHGPFPIEQLQESGISAIDVKKLKDAGLCTVESVVYSPRKDLLQIKGISEAKVDKII  378
             EE   GP  I +L++ GI+A DVKKL++AG  TVE+V Y+P+K+LL IKGISEAK DKI+
Sbjct  16    EEESFGPQLISRLEQCGINANDVKKLEEAGFHTVEAVAYAPKKELLNIKGISEAKADKIL  75

Query  379   EAASKLVPLGFTSASQLHAQRLEIIQITSGSKELDKVLEGGIETGSITEIYGEFRSGKTQ  558
               A+KLVP+GFT+A++ H +R EIIQIT+GSKELDK+L+GGIETGSITE++GEFR+GKTQ
Sbjct  76    AEAAKLVPMGFTTATEFHQRRSEIIQITTGSKELDKLLQGGIETGSITELFGEFRTGKTQ  135

Query  559   LCHTLCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIADRFGLNGADVLENVAYARAY  738
             LCHTL VTCQLP+D+GGGEGKAMYID EGTFRP+RLL +A+R+GL+G+DVL+NVAYAR +
Sbjct  136   LCHTLAVTCQLPIDRGGGEGKAMYIDTEGTFRPERLLAVAERYGLSGSDVLDNVAYARGF  195

Query  739   NTDHQSRLLLEAASMMVETRFALMIVDSATALYRTDFSGRGELSARQMHLAKFLRSLQKL  918
             NTDHQ++LL +A++MM E+R+AL+IVDSATALYRTD+SGRGEL+ARQMHLA+FLR L +L
Sbjct  196   NTDHQTQLLYQASAMMAESRYALLIVDSATALYRTDYSGRGELAARQMHLARFLRMLLRL  255

Query  919   ADEFGVAVVITNQVVAQVDGSAIFAGPQIKPIGGNIMAHASTTRLALRKGRGEERVCKVV  1098
             ADEFGVAVVITNQVVAQVDG+A+FA    KPIGGNI+AHASTTRL LRKGRGE R+CK+ 
Sbjct  256   ADEFGVAVVITNQVVAQVDGAAMFAADPKKPIGGNIIAHASTTRLYLRKGRGETRICKIY  315

Query  1099  SSPCLAEAEARFQISPEGVTDVKD  1170
              SPCL EAEA F I+ +GV D KD
Sbjct  316   DSPCLPEAEAMFAINADGVGDAKD  339



>ref|XP_008924708.1| PREDICTED: DNA repair protein RAD51 homolog 1 isoform X1 [Manacus 
vitellinus]
 gb|KFW83089.1| DNA repair protein RAD51 1 [Manacus vitellinus]
Length=339

 Score =   496 bits (1277),  Expect = 2e-171, Method: Compositional matrix adjust.
 Identities = 232/324 (72%), Positives = 284/324 (88%), Gaps = 0/324 (0%)
 Frame = +1

Query  199   EEIQHGPFPIEQLQESGISAIDVKKLKDAGLCTVESVVYSPRKDLLQIKGISEAKVDKII  378
             EE   GP  I +L++ GI+A DVKKL++AG  TVE+V Y+P+K+LL IKGISEAK DKI+
Sbjct  16    EEESFGPQLISRLEQCGINANDVKKLEEAGFHTVEAVAYAPKKELLNIKGISEAKADKIL  75

Query  379   EAASKLVPLGFTSASQLHAQRLEIIQITSGSKELDKVLEGGIETGSITEIYGEFRSGKTQ  558
               A+KLVP+GFT+A++ H +R EIIQIT+GSKELDK+L+GGIETGSITE++GEFR+GKTQ
Sbjct  76    AEAAKLVPMGFTTATEFHQRRSEIIQITTGSKELDKLLQGGIETGSITELFGEFRTGKTQ  135

Query  559   LCHTLCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIADRFGLNGADVLENVAYARAY  738
             LCHTL VTCQLP+D+GGGEGKAMYID EGTFRP+RLL +A+R+GL+G+DVL+NVAYAR +
Sbjct  136   LCHTLAVTCQLPIDRGGGEGKAMYIDTEGTFRPERLLAVAERYGLSGSDVLDNVAYARGF  195

Query  739   NTDHQSRLLLEAASMMVETRFALMIVDSATALYRTDFSGRGELSARQMHLAKFLRSLQKL  918
             NTDHQ++LL +A++MM E+R+AL+IVDSATALYRTD+SGRGELSARQMHLA+FLR L +L
Sbjct  196   NTDHQTQLLYQASAMMAESRYALLIVDSATALYRTDYSGRGELSARQMHLARFLRMLLRL  255

Query  919   ADEFGVAVVITNQVVAQVDGSAIFAGPQIKPIGGNIMAHASTTRLALRKGRGEERVCKVV  1098
             ADEFGVAVVITNQVVAQVDG+A+FA    KPIGGNI+AHASTTRL LRKGRGE R+CK+ 
Sbjct  256   ADEFGVAVVITNQVVAQVDGAAMFAADPKKPIGGNIIAHASTTRLYLRKGRGETRICKIY  315

Query  1099  SSPCLAEAEARFQISPEGVTDVKD  1170
              SPCL EAEA F I+ +GV D K+
Sbjct  316   DSPCLPEAEAMFAINADGVGDAKE  339



>ref|XP_006024651.1| PREDICTED: DNA repair protein RAD51 homolog 1 isoform X1 [Alligator 
sinensis]
 ref|XP_006024652.1| PREDICTED: DNA repair protein RAD51 homolog 1 isoform X2 [Alligator 
sinensis]
 ref|XP_006277280.1| PREDICTED: DNA repair protein RAD51 homolog 1 isoform X1 [Alligator 
mississippiensis]
 ref|XP_006277281.1| PREDICTED: DNA repair protein RAD51 homolog 1 isoform X2 [Alligator 
mississippiensis]
 ref|XP_006277282.1| PREDICTED: DNA repair protein RAD51 homolog 1 isoform X3 [Alligator 
mississippiensis]
Length=339

 Score =   496 bits (1277),  Expect = 2e-171, Method: Compositional matrix adjust.
 Identities = 233/324 (72%), Positives = 282/324 (87%), Gaps = 0/324 (0%)
 Frame = +1

Query  199   EEIQHGPFPIEQLQESGISAIDVKKLKDAGLCTVESVVYSPRKDLLQIKGISEAKVDKII  378
             EE   GP  I +L++ GI A DVKKL++AG  TVE+V Y+P+K+LL IKGISEAK DKI+
Sbjct  16    EEESFGPQLISRLEQCGIHANDVKKLEEAGFHTVEAVAYAPKKELLNIKGISEAKADKIL  75

Query  379   EAASKLVPLGFTSASQLHAQRLEIIQITSGSKELDKVLEGGIETGSITEIYGEFRSGKTQ  558
               A+KLVP+GFT+A+  H +R EIIQIT+GSKELDK+L+GGIETGSITE++GEFR+GKTQ
Sbjct  76    AEAAKLVPMGFTTATAFHQRRSEIIQITTGSKELDKLLQGGIETGSITELFGEFRTGKTQ  135

Query  559   LCHTLCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIADRFGLNGADVLENVAYARAY  738
             LCHTL VTCQLP+D+GGGEGKAMYID EGTFRP+RLL +A+R+GL+G+DVL+NVAYAR +
Sbjct  136   LCHTLAVTCQLPIDRGGGEGKAMYIDTEGTFRPERLLAVAERYGLSGSDVLDNVAYARGF  195

Query  739   NTDHQSRLLLEAASMMVETRFALMIVDSATALYRTDFSGRGELSARQMHLAKFLRSLQKL  918
             NTDHQ++LL +A++MM E+R+AL+IVDSATALYRTD+SGRGELSARQMHLA+FLR L +L
Sbjct  196   NTDHQTQLLYQASAMMAESRYALLIVDSATALYRTDYSGRGELSARQMHLARFLRMLLRL  255

Query  919   ADEFGVAVVITNQVVAQVDGSAIFAGPQIKPIGGNIMAHASTTRLALRKGRGEERVCKVV  1098
             ADEFGVAVVITNQVVAQVDG+A+FA    KPIGGNI+AHASTTRL LRKGRGE R+CK+ 
Sbjct  256   ADEFGVAVVITNQVVAQVDGAAMFAADPKKPIGGNIIAHASTTRLYLRKGRGETRICKIY  315

Query  1099  SSPCLAEAEARFQISPEGVTDVKD  1170
              SPCL EAEA F I+ +GV D KD
Sbjct  316   DSPCLPEAEAMFAINADGVGDAKD  339



>ref|NP_001016393.1| RAD51 recombinase [Xenopus (Silurana) tropicalis]
 gb|AAI35426.1| hypothetical protein LOC549147 [Xenopus (Silurana) tropicalis]
Length=336

 Score =   496 bits (1277),  Expect = 2e-171, Method: Compositional matrix adjust.
 Identities = 231/329 (70%), Positives = 287/329 (87%), Gaps = 0/329 (0%)
 Frame = +1

Query  184   QQDEVEEIQHGPFPIEQLQESGISAIDVKKLKDAGLCTVESVVYSPRKDLLQIKGISEAK  363
             + +  EE   GP  I +L++ GI+A DVKKL++AG  TVE+V Y+P+K+L+ IKGISEAK
Sbjct  8     EAEATEEENFGPQAISRLEQCGINANDVKKLEEAGFHTVEAVAYAPKKELINIKGISEAK  67

Query  364   VDKIIEAASKLVPLGFTSASQLHAQRLEIIQITSGSKELDKVLEGGIETGSITEIYGEFR  543
              +KI+  A+KLVP+GFT+A++ H +R EIIQI++GSKELDK+L+GGIETGSITE++GEFR
Sbjct  68    AEKILAEAAKLVPMGFTTATEFHQRRSEIIQISTGSKELDKLLQGGIETGSITEMFGEFR  127

Query  544   SGKTQLCHTLCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIADRFGLNGADVLENVA  723
             +GKTQLCHTL VTCQLP+D+GGGEGKAMYID EGTFRP+RLL +A+R+GL+G+DVL+NVA
Sbjct  128   TGKTQLCHTLAVTCQLPIDRGGGEGKAMYIDTEGTFRPERLLAVAERYGLSGSDVLDNVA  187

Query  724   YARAYNTDHQSRLLLEAASMMVETRFALMIVDSATALYRTDFSGRGELSARQMHLAKFLR  903
             YARA+NTDHQ++LL +A++MM E+R+AL+IVDSATALYRTD+SGRGELSARQMHLA+FLR
Sbjct  188   YARAFNTDHQTQLLYQASAMMAESRYALLIVDSATALYRTDYSGRGELSARQMHLARFLR  247

Query  904   SLQKLADEFGVAVVITNQVVAQVDGSAIFAGPQIKPIGGNIMAHASTTRLALRKGRGEER  1083
              L +LADEFGVAVVITNQVVAQVDG+A+FA    KPIGGNI+AHASTTRL LRKGRGE R
Sbjct  248   MLLRLADEFGVAVVITNQVVAQVDGAAMFAADPKKPIGGNIIAHASTTRLYLRKGRGETR  307

Query  1084  VCKVVSSPCLAEAEARFQISPEGVTDVKD  1170
             +CK+  SPCL EAEA F I+ +GV D KD
Sbjct  308   ICKIYDSPCLPEAEAMFAINADGVGDAKD  336



>ref|XP_009896751.1| PREDICTED: DNA repair protein RAD51 homolog 1 [Picoides pubescens]
 gb|KFV65755.1| DNA repair protein RAD51 1 [Picoides pubescens]
Length=339

 Score =   496 bits (1277),  Expect = 2e-171, Method: Compositional matrix adjust.
 Identities = 231/336 (69%), Positives = 287/336 (85%), Gaps = 0/336 (0%)
 Frame = +1

Query  163   QKSVQERQQDEVEEIQHGPFPIEQLQESGISAIDVKKLKDAGLCTVESVVYSPRKDLLQI  342
             Q  ++       EE   GP  I +L++ GI+A DVKKL++AG  TVE+V Y+P+K+LL I
Sbjct  4     QMQLEANADTSAEEESFGPQLISRLEQCGINANDVKKLEEAGFHTVEAVAYAPKKELLNI  63

Query  343   KGISEAKVDKIIEAASKLVPLGFTSASQLHAQRLEIIQITSGSKELDKVLEGGIETGSIT  522
             KGISEAK DKI+  A+KLVP+GFT+A++ H +R EIIQIT+GSKELDK+L+GG+ETGSIT
Sbjct  64    KGISEAKADKILAEAAKLVPMGFTTATEFHQRRSEIIQITTGSKELDKLLQGGVETGSIT  123

Query  523   EIYGEFRSGKTQLCHTLCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIADRFGLNGA  702
             E++GEFR+GKTQLCHTL VTCQLP+D+GGGEGKAMYID EGTFRP+RLL +A+R+GL+G+
Sbjct  124   ELFGEFRTGKTQLCHTLAVTCQLPIDRGGGEGKAMYIDTEGTFRPERLLAVAERYGLSGS  183

Query  703   DVLENVAYARAYNTDHQSRLLLEAASMMVETRFALMIVDSATALYRTDFSGRGELSARQM  882
             DVL+NVAYAR +NTDHQ++LL +A++MM E+R+AL++VDSATALYRTD++GRGEL+ARQM
Sbjct  184   DVLDNVAYARGFNTDHQTQLLYQASAMMAESRYALLVVDSATALYRTDYAGRGELAARQM  243

Query  883   HLAKFLRSLQKLADEFGVAVVITNQVVAQVDGSAIFAGPQIKPIGGNIMAHASTTRLALR  1062
             HLA+FLR L +LADEFGVAVVITNQVVAQVDG+A+FA    KPIGGNI+AHASTTRL LR
Sbjct  244   HLARFLRMLLRLADEFGVAVVITNQVVAQVDGAAMFAADPKKPIGGNIIAHASTTRLYLR  303

Query  1063  KGRGEERVCKVVSSPCLAEAEARFQISPEGVTDVKD  1170
             KGRGE R+CK+  SPCL EAEA F IS +GV D KD
Sbjct  304   KGRGETRICKIYDSPCLPEAEAMFAISADGVGDAKD  339



>ref|XP_006632511.1| PREDICTED: DNA repair protein RAD51 homolog A-like [Lepisosteus 
oculatus]
Length=336

 Score =   496 bits (1276),  Expect = 2e-171, Method: Compositional matrix adjust.
 Identities = 233/330 (71%), Positives = 288/330 (87%), Gaps = 1/330 (0%)
 Frame = +1

Query  181   RQQDEVEEIQHGPFPIEQLQESGISAIDVKKLKDAGLCTVESVVYSPRKDLLQIKGISEA  360
             R++ EVEE   GP P+ +L++ GISA D+KKL++AG  TVE+V Y+P+K+LL IKGISEA
Sbjct  8     REEVEVEE-NFGPQPLSRLEQCGISASDIKKLEEAGFHTVEAVAYAPKKELLNIKGISEA  66

Query  361   KVDKIIEAASKLVPLGFTSASQLHAQRLEIIQITSGSKELDKVLEGGIETGSITEIYGEF  540
             K +K++  A+K VP+GFT+A++ H +R EIIQIT+GSKELDK+L+GGIETGSITE++GEF
Sbjct  67    KAEKLLAEAAKQVPMGFTTATEFHQRRAEIIQITTGSKELDKLLQGGIETGSITEMFGEF  126

Query  541   RSGKTQLCHTLCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIADRFGLNGADVLENV  720
             R+GKTQLCHTL VTCQLP+DQGGGEGKAMYID EGTFRP+RLL +ADR+GL G+DVL+NV
Sbjct  127   RTGKTQLCHTLAVTCQLPIDQGGGEGKAMYIDTEGTFRPERLLAVADRYGLVGSDVLDNV  186

Query  721   AYARAYNTDHQSRLLLEAASMMVETRFALMIVDSATALYRTDFSGRGELSARQMHLAKFL  900
             AYARA+NTDHQ++LL +A++MM E+R+AL+IVDSATALYRTD+SGRGELSARQ HL +FL
Sbjct  187   AYARAFNTDHQTQLLYQASAMMSESRYALLIVDSATALYRTDYSGRGELSARQCHLGRFL  246

Query  901   RSLQKLADEFGVAVVITNQVVAQVDGSAIFAGPQIKPIGGNIMAHASTTRLALRKGRGEE  1080
             R L +LADEFGVAVVI+NQVVAQVDG+A+F+    KPIGGNI+AHASTTRL LRKGRGE 
Sbjct  247   RMLLRLADEFGVAVVISNQVVAQVDGAAMFSADPKKPIGGNILAHASTTRLYLRKGRGET  306

Query  1081  RVCKVVSSPCLAEAEARFQISPEGVTDVKD  1170
             R+CK+  SPCL EAEA F I+P+GV D KD
Sbjct  307   RICKIYDSPCLPEAEAMFAINPDGVGDAKD  336



>ref|XP_007570669.1| PREDICTED: DNA repair protein RAD51 homolog 1 [Poecilia formosa]
 ref|XP_007570670.1| PREDICTED: DNA repair protein RAD51 homolog 1 [Poecilia formosa]
Length=338

 Score =   496 bits (1276),  Expect = 2e-171, Method: Compositional matrix adjust.
 Identities = 229/321 (71%), Positives = 281/321 (88%), Gaps = 0/321 (0%)
 Frame = +1

Query  208   QHGPFPIEQLQESGISAIDVKKLKDAGLCTVESVVYSPRKDLLQIKGISEAKVDKIIEAA  387
              +GP P+ +L+  GISA D+KKL+DAG  T+E+V Y+P+K+LL IKGISEAK DK++  A
Sbjct  18    NYGPQPLSRLEHCGISASDIKKLEDAGFHTIEAVAYAPKKELLNIKGISEAKADKVLAEA  77

Query  388   SKLVPLGFTSASQLHAQRLEIIQITSGSKELDKVLEGGIETGSITEIYGEFRSGKTQLCH  567
             +KLVP+GFT+A++ H +R EIIQI++GSKELDK+L+GGIETGSITE++GEFR+GKTQLCH
Sbjct  78    AKLVPMGFTTATEFHQRRAEIIQISTGSKELDKLLQGGIETGSITEMFGEFRTGKTQLCH  137

Query  568   TLCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIADRFGLNGADVLENVAYARAYNTD  747
             TL VTCQLP+DQGGGEGKAMYID EGTFRP+RLL +ADR+GL G+DVL+NVAYARA+NTD
Sbjct  138   TLAVTCQLPIDQGGGEGKAMYIDTEGTFRPERLLAVADRYGLVGSDVLDNVAYARAFNTD  197

Query  748   HQSRLLLEAASMMVETRFALMIVDSATALYRTDFSGRGELSARQMHLAKFLRSLQKLADE  927
             HQ++LL +A++MM E+R+AL+IVDSATALYRTD+SGRGELSARQ HL +FLR L +LADE
Sbjct  198   HQTQLLYQASAMMAESRYALLIVDSATALYRTDYSGRGELSARQGHLGRFLRMLLRLADE  257

Query  928   FGVAVVITNQVVAQVDGSAIFAGPQIKPIGGNIMAHASTTRLALRKGRGEERVCKVVSSP  1107
             FGVAVVITNQVVAQVDG+A+F+    KPIGGNI+AHASTTRL LRKGRGE R+CK+  SP
Sbjct  258   FGVAVVITNQVVAQVDGAAMFSADPKKPIGGNILAHASTTRLYLRKGRGETRICKIYDSP  317

Query  1108  CLAEAEARFQISPEGVTDVKD  1170
             CL EAEA F I+ +GV D KD
Sbjct  318   CLPEAEAMFAINADGVGDAKD  338



>gb|EUB57641.1| DNA repair protein RAD51 [Echinococcus granulosus]
 emb|CDJ02833.1| dna repair protein rad51 1 [Echinococcus multilocularis]
 emb|CDS15286.1| dna repair protein rad51 1 [Echinococcus granulosus]
 emb|CDS40115.1| dna repair protein rad51 1 [Echinococcus multilocularis]
Length=342

 Score =   496 bits (1277),  Expect = 2e-171, Method: Compositional matrix adjust.
 Identities = 232/325 (71%), Positives = 281/325 (86%), Gaps = 0/325 (0%)
 Frame = +1

Query  196   VEEIQHGPFPIEQLQESGISAIDVKKLKDAGLCTVESVVYSPRKDLLQIKGISEAKVDKI  375
             V+E   GP PI++L+ SGISA DVKKL++AG  +VES+ + P+K LL IKGISE K DKI
Sbjct  18    VDEETAGPIPIQKLEGSGISAADVKKLQEAGFYSVESIQFVPKKALLGIKGISEMKADKI  77

Query  376   IEAASKLVPLGFTSASQLHAQRLEIIQITSGSKELDKVLEGGIETGSITEIYGEFRSGKT  555
             ++AA KLVP GFT+A++ H +R EIIQ+T+GSKELDK+L+GGIETGSITE++GEFR+GKT
Sbjct  78    LDAAKKLVPFGFTTATEFHQKRSEIIQLTTGSKELDKLLQGGIETGSITELFGEFRTGKT  137

Query  556   QLCHTLCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIADRFGLNGADVLENVAYARA  735
             Q+CHTL VTCQLP+D GGGEGK +YID EGTFRP+RLL +A+R+GL+G+DVL+NVAYARA
Sbjct  138   QICHTLAVTCQLPVDMGGGEGKCLYIDTEGTFRPERLLAVAERYGLSGSDVLDNVAYARA  197

Query  736   YNTDHQSRLLLEAASMMVETRFALMIVDSATALYRTDFSGRGELSARQMHLAKFLRSLQK  915
             YNTDHQ  LL+ AA+MM E+R+AL+IVDSATALYRTD+SGRGELSARQMHLA+FLR+L +
Sbjct  198   YNTDHQMELLINAAAMMSESRYALLIVDSATALYRTDYSGRGELSARQMHLARFLRTLLR  257

Query  916   LADEFGVAVVITNQVVAQVDGSAIFAGPQIKPIGGNIMAHASTTRLALRKGRGEERVCKV  1095
             LADEFGVAVVITNQVVAQVDG+A+F+    KPIGGNIM HASTTRL LRKGRGE RVCK+
Sbjct  258   LADEFGVAVVITNQVVAQVDGAAMFSADPKKPIGGNIMGHASTTRLYLRKGRGETRVCKI  317

Query  1096  VSSPCLAEAEARFQISPEGVTDVKD  1170
               SPCL EAEA + I P+G+ D KD
Sbjct  318   YDSPCLPEAEAMYAILPDGIGDAKD  342



>ref|XP_004564786.1| PREDICTED: DNA repair protein RAD51 homolog B-like [Maylandia 
zebra]
 ref|XP_005747836.1| PREDICTED: DNA repair protein RAD51 homolog B-like isoform X1 
[Pundamilia nyererei]
 ref|XP_005747837.1| PREDICTED: DNA repair protein RAD51 homolog B-like isoform X2 
[Pundamilia nyererei]
 ref|XP_005942151.1| PREDICTED: DNA repair protein RAD51 homolog B-like [Haplochromis 
burtoni]
 ref|XP_006796329.1| PREDICTED: DNA repair protein RAD51 homolog B-like isoform X1 
[Neolamprologus brichardi]
 ref|XP_006796330.1| PREDICTED: DNA repair protein RAD51 homolog B-like isoform X2 
[Neolamprologus brichardi]
Length=336

 Score =   496 bits (1276),  Expect = 2e-171, Method: Compositional matrix adjust.
 Identities = 229/321 (71%), Positives = 282/321 (88%), Gaps = 0/321 (0%)
 Frame = +1

Query  208   QHGPFPIEQLQESGISAIDVKKLKDAGLCTVESVVYSPRKDLLQIKGISEAKVDKIIEAA  387
              +GP P+ +L++ GISA D+KKL+DAG  T+E+V Y+P+K+LL IKGISEAK DKI+  A
Sbjct  16    NYGPQPLSRLEQCGISASDIKKLEDAGFHTIEAVAYAPKKELLNIKGISEAKADKILTEA  75

Query  388   SKLVPLGFTSASQLHAQRLEIIQITSGSKELDKVLEGGIETGSITEIYGEFRSGKTQLCH  567
             +KLVP+GFT+A++ H +R EIIQI++GSKELDK+L+GGIETGSITE++GEFR+GKTQLCH
Sbjct  76    AKLVPMGFTTATEFHQRRAEIIQISTGSKELDKLLQGGIETGSITEMFGEFRTGKTQLCH  135

Query  568   TLCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIADRFGLNGADVLENVAYARAYNTD  747
             TL VTCQLP+DQGGGEGKAMYID EGTFRP+RLL +A+R+GL G+DVL+NVAYARA+NTD
Sbjct  136   TLAVTCQLPIDQGGGEGKAMYIDTEGTFRPERLLAVAERYGLVGSDVLDNVAYARAFNTD  195

Query  748   HQSRLLLEAASMMVETRFALMIVDSATALYRTDFSGRGELSARQMHLAKFLRSLQKLADE  927
             HQ++LL +A++MM E+R+AL+IVDSATALYRTD+SGRGELSARQ HL +FLR L +LADE
Sbjct  196   HQTQLLYQASAMMAESRYALLIVDSATALYRTDYSGRGELSARQGHLGRFLRMLLRLADE  255

Query  928   FGVAVVITNQVVAQVDGSAIFAGPQIKPIGGNIMAHASTTRLALRKGRGEERVCKVVSSP  1107
             FGVAVVITNQVVAQVDG+A+F+    KPIGGNI+AHASTTRL LRKGRGE R+CK+  SP
Sbjct  256   FGVAVVITNQVVAQVDGAAMFSADPKKPIGGNILAHASTTRLYLRKGRGETRICKIYDSP  315

Query  1108  CLAEAEARFQISPEGVTDVKD  1170
             CL EAEA F I+ +GV D KD
Sbjct  316   CLPEAEAMFAINADGVGDAKD  336



>emb|CDQ56831.1| unnamed protein product [Oncorhynchus mykiss]
Length=335

 Score =   495 bits (1275),  Expect = 3e-171, Method: Compositional matrix adjust.
 Identities = 229/326 (70%), Positives = 284/326 (87%), Gaps = 0/326 (0%)
 Frame = +1

Query  193   EVEEIQHGPFPIEQLQESGISAIDVKKLKDAGLCTVESVVYSPRKDLLQIKGISEAKVDK  372
             EVEE   GP P+ +L++ GISA D+KKL+DAG  T+E+V Y+P+K+LL IKGISEAK DK
Sbjct  10    EVEEESFGPQPLSRLEQCGISASDLKKLEDAGFHTIEAVAYAPKKELLNIKGISEAKADK  69

Query  373   IIEAASKLVPLGFTSASQLHAQRLEIIQITSGSKELDKVLEGGIETGSITEIYGEFRSGK  552
             ++  A+KLVP+GFT+A++ H +R EIIQI++GSKELDK+L+GGIETGSITE++GEFR+GK
Sbjct  70    VLAEAAKLVPMGFTTATEFHQRRAEIIQISTGSKELDKLLQGGIETGSITEMFGEFRTGK  129

Query  553   TQLCHTLCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIADRFGLNGADVLENVAYAR  732
             TQLCHTL VTCQLP+DQGGGEGKAMYID EGTFRP+RLL +A+R+GL G+DVL+NVAYAR
Sbjct  130   TQLCHTLAVTCQLPIDQGGGEGKAMYIDTEGTFRPERLLAVAERYGLVGSDVLDNVAYAR  189

Query  733   AYNTDHQSRLLLEAASMMVETRFALMIVDSATALYRTDFSGRGELSARQMHLAKFLRSLQ  912
             A+NTDHQ++LL +A++MM E+R+A++IVDSA ALYRTD+SGRGEL+ARQ HL +FLR L 
Sbjct  190   AFNTDHQTQLLYQASAMMAESRYAMLIVDSAMALYRTDYSGRGELAARQGHLGRFLRMLL  249

Query  913   KLADEFGVAVVITNQVVAQVDGSAIFAGPQIKPIGGNIMAHASTTRLALRKGRGEERVCK  1092
             +LADEFGVAVVITNQVVAQVDG+A+F+    KPIGGNIMAHASTTRL LRKGRGE R+CK
Sbjct  250   RLADEFGVAVVITNQVVAQVDGAAMFSADPKKPIGGNIMAHASTTRLYLRKGRGETRICK  309

Query  1093  VVSSPCLAEAEARFQISPEGVTDVKD  1170
             +  SPCL E+EA F I+ +GV D KD
Sbjct  310   IYDSPCLPESEAMFAINADGVGDAKD  335



>dbj|GAA50958.1| DNA repair protein RAD51 [Clonorchis sinensis]
Length=341

 Score =   496 bits (1276),  Expect = 3e-171, Method: Compositional matrix adjust.
 Identities = 229/337 (68%), Positives = 285/337 (85%), Gaps = 0/337 (0%)
 Frame = +1

Query  160   QQKSVQERQQDEVEEIQHGPFPIEQLQESGISAIDVKKLKDAGLCTVESVVYSPRKDLLQ  339
             Q++ +     D V++   GP PI++L+ +G++A D+KKL++AG  +VES+ + P+K LL 
Sbjct  5     QERPLSGAAGDVVDDENCGPVPIQKLESAGVAAADIKKLREAGFHSVESIQFVPKKALLA  64

Query  340   IKGISEAKVDKIIEAASKLVPLGFTSASQLHAQRLEIIQITSGSKELDKVLEGGIETGSI  519
             IKGISEAK DKI EAA KLVP GFT+A++ H +R EIIQ+T+GSKELDK+L+GGIETGSI
Sbjct  65    IKGISEAKADKITEAAQKLVPFGFTTATEFHQKRSEIIQLTTGSKELDKLLQGGIETGSI  124

Query  520   TEIYGEFRSGKTQLCHTLCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIADRFGLNG  699
             TE++GEFR+GKTQ+CHTL VTCQLP+D GGGEGK +YID EGTFRP+RLL +A+R+GL+G
Sbjct  125   TELFGEFRTGKTQICHTLAVTCQLPIDMGGGEGKCLYIDTEGTFRPERLLAVAERYGLSG  184

Query  700   ADVLENVAYARAYNTDHQSRLLLEAASMMVETRFALMIVDSATALYRTDFSGRGELSARQ  879
             +DVL+NVAYARAYNTDHQ  LL+ AA+MM E+R+AL++VDSATALYRTD+SGRGELSARQ
Sbjct  185   SDVLDNVAYARAYNTDHQMELLINAAAMMSESRYALLVVDSATALYRTDYSGRGELSARQ  244

Query  880   MHLAKFLRSLQKLADEFGVAVVITNQVVAQVDGSAIFAGPQIKPIGGNIMAHASTTRLAL  1059
             MHLA+FLR+L +LADEFGVAVVITNQVVAQVDG+A+F     KPIGGNIM HASTTRL L
Sbjct  245   MHLARFLRTLLRLADEFGVAVVITNQVVAQVDGAAMFTADPKKPIGGNIMGHASTTRLYL  304

Query  1060  RKGRGEERVCKVVSSPCLAEAEARFQISPEGVTDVKD  1170
             RKGRGE R+CK+  SPCL EAEA + I P+G+ D KD
Sbjct  305   RKGRGETRICKIYDSPCLPEAEAMYAILPDGIGDAKD  341



>ref|XP_009999752.1| PREDICTED: DNA repair protein RAD51 homolog 1 [Chaetura pelagica]
 gb|KFU92492.1| DNA repair protein RAD51 1 [Chaetura pelagica]
Length=339

 Score =   495 bits (1275),  Expect = 4e-171, Method: Compositional matrix adjust.
 Identities = 231/336 (69%), Positives = 286/336 (85%), Gaps = 0/336 (0%)
 Frame = +1

Query  163   QKSVQERQQDEVEEIQHGPFPIEQLQESGISAIDVKKLKDAGLCTVESVVYSPRKDLLQI  342
             Q  ++       E+   GP  I +L++ GI+A DVKKL++AG  TVE+V Y+P+K+LL I
Sbjct  4     QMQLEANADTSAEDESFGPQLISRLEQCGINANDVKKLEEAGFHTVEAVAYAPKKELLNI  63

Query  343   KGISEAKVDKIIEAASKLVPLGFTSASQLHAQRLEIIQITSGSKELDKVLEGGIETGSIT  522
             KGISEAK DKI+  A+KLVP+GFT+A++ H +R EIIQIT+GSKELDK+L+GGIETGSIT
Sbjct  64    KGISEAKADKILAEAAKLVPMGFTTATEFHQRRSEIIQITTGSKELDKLLQGGIETGSIT  123

Query  523   EIYGEFRSGKTQLCHTLCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIADRFGLNGA  702
             E++GEFR+GKTQLCHTL VTCQLP+D+GGGEGKAMYID EGTFRP+RLL +A+R+GL+G+
Sbjct  124   ELFGEFRTGKTQLCHTLAVTCQLPIDRGGGEGKAMYIDTEGTFRPERLLAVAERYGLSGS  183

Query  703   DVLENVAYARAYNTDHQSRLLLEAASMMVETRFALMIVDSATALYRTDFSGRGELSARQM  882
             DVL+NVAYAR +NTDHQ++LL +A++MM E+R+AL++VDSAT LYRTD+SGRGELSARQM
Sbjct  184   DVLDNVAYARGFNTDHQTQLLFQASAMMAESRYALLVVDSATGLYRTDYSGRGELSARQM  243

Query  883   HLAKFLRSLQKLADEFGVAVVITNQVVAQVDGSAIFAGPQIKPIGGNIMAHASTTRLALR  1062
             HLA+FLR L +LADEFGVAVVITNQVVAQVDG+A+FA    KPIGGNI+AHASTTRL LR
Sbjct  244   HLARFLRMLLRLADEFGVAVVITNQVVAQVDGAAMFAADPKKPIGGNIIAHASTTRLYLR  303

Query  1063  KGRGEERVCKVVSSPCLAEAEARFQISPEGVTDVKD  1170
             KGRGE R+CK+  SPCL EAEA F I+ +GV D KD
Sbjct  304   KGRGETRICKIYDSPCLPEAEAMFAINADGVGDAKD  339



>ref|XP_008396713.1| PREDICTED: DNA repair protein RAD51 homolog 1 [Poecilia reticulata]
 ref|XP_008396714.1| PREDICTED: DNA repair protein RAD51 homolog 1 [Poecilia reticulata]
 ref|XP_008396715.1| PREDICTED: DNA repair protein RAD51 homolog 1 [Poecilia reticulata]
 ref|XP_008396716.1| PREDICTED: DNA repair protein RAD51 homolog 1 [Poecilia reticulata]
Length=338

 Score =   495 bits (1275),  Expect = 4e-171, Method: Compositional matrix adjust.
 Identities = 229/319 (72%), Positives = 280/319 (88%), Gaps = 0/319 (0%)
 Frame = +1

Query  214   GPFPIEQLQESGISAIDVKKLKDAGLCTVESVVYSPRKDLLQIKGISEAKVDKIIEAASK  393
             GP P+ +L+  GISA D+KKL+DAG  T+E+V Y+P+K+LL IKGISEAK DK++  A+K
Sbjct  20    GPQPLSRLEHCGISASDIKKLEDAGFHTIEAVAYAPKKELLNIKGISEAKADKVLAEAAK  79

Query  394   LVPLGFTSASQLHAQRLEIIQITSGSKELDKVLEGGIETGSITEIYGEFRSGKTQLCHTL  573
             LVP+GFT+A++ H +R EIIQI++GSKELDK+L+GGIETGSITE++GEFR+GKTQLCHTL
Sbjct  80    LVPMGFTTATEFHQRRAEIIQISTGSKELDKLLQGGIETGSITEMFGEFRTGKTQLCHTL  139

Query  574   CVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIADRFGLNGADVLENVAYARAYNTDHQ  753
              VTCQLP+DQGGGEGKAMYID EGTFRP+RLL +ADR+GL G+DVL+NVAYARA+NTDHQ
Sbjct  140   AVTCQLPIDQGGGEGKAMYIDTEGTFRPERLLAVADRYGLVGSDVLDNVAYARAFNTDHQ  199

Query  754   SRLLLEAASMMVETRFALMIVDSATALYRTDFSGRGELSARQMHLAKFLRSLQKLADEFG  933
             ++LL +A++MM E+R+AL+IVDSATALYRTD+SGRGELSARQ HL +FLR L +LADEFG
Sbjct  200   TQLLYQASAMMAESRYALLIVDSATALYRTDYSGRGELSARQGHLGRFLRMLLRLADEFG  259

Query  934   VAVVITNQVVAQVDGSAIFAGPQIKPIGGNIMAHASTTRLALRKGRGEERVCKVVSSPCL  1113
             VAVVITNQVVAQVDG+A+F+    KPIGGNI+AHASTTRL LRKGRGE R+CK+  SPCL
Sbjct  260   VAVVITNQVVAQVDGAAMFSADPKKPIGGNILAHASTTRLYLRKGRGETRICKIYDSPCL  319

Query  1114  AEAEARFQISPEGVTDVKD  1170
              EAEA F I+ +GV D KD
Sbjct  320   PEAEAMFAINADGVGDAKD  338



>ref|XP_007905234.1| PREDICTED: DNA repair protein RAD51 homolog 1 isoform X1 [Callorhinchus 
milii]
 ref|XP_007905235.1| PREDICTED: DNA repair protein RAD51 homolog 1 isoform X1 [Callorhinchus 
milii]
Length=337

 Score =   495 bits (1274),  Expect = 5e-171, Method: Compositional matrix adjust.
 Identities = 230/319 (72%), Positives = 282/319 (88%), Gaps = 0/319 (0%)
 Frame = +1

Query  214   GPFPIEQLQESGISAIDVKKLKDAGLCTVESVVYSPRKDLLQIKGISEAKVDKIIEAASK  393
             GP  I +L++ GISA DVKKL++AG  TVE+V Y+P+K+LL IKGISEAK +KI+  A+K
Sbjct  19    GPQAISRLEQGGISANDVKKLEEAGYHTVEAVAYAPKKELLNIKGISEAKAEKILAEAAK  78

Query  394   LVPLGFTSASQLHAQRLEIIQITSGSKELDKVLEGGIETGSITEIYGEFRSGKTQLCHTL  573
             LVP+GFT+A++ H +R EIIQIT+GSKELDK+L+GGIETGSITE++GEFR+GKTQLCHTL
Sbjct  79    LVPMGFTTATEFHQRRSEIIQITTGSKELDKLLQGGIETGSITEMFGEFRTGKTQLCHTL  138

Query  574   CVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIADRFGLNGADVLENVAYARAYNTDHQ  753
               TCQLP+D+GGGEGKAMYID EGTFRP+RLL +A+R+ L+G+DVL+NVAYARA+NTDHQ
Sbjct  139   AATCQLPIDRGGGEGKAMYIDTEGTFRPERLLAVAERYNLSGSDVLDNVAYARAFNTDHQ  198

Query  754   SRLLLEAASMMVETRFALMIVDSATALYRTDFSGRGELSARQMHLAKFLRSLQKLADEFG  933
             ++LL +A++MM E+R+AL+IVDSATALYRTD+SGRGELSARQMHLA+FLR L +LADEFG
Sbjct  199   TQLLYQASAMMTESRYALLIVDSATALYRTDYSGRGELSARQMHLARFLRMLLRLADEFG  258

Query  934   VAVVITNQVVAQVDGSAIFAGPQIKPIGGNIMAHASTTRLALRKGRGEERVCKVVSSPCL  1113
             VAVVITNQVVAQVDG+A+FA    KPIGGNI+AHASTTRL+LRKGRGE R+CK+  SPCL
Sbjct  259   VAVVITNQVVAQVDGAAMFAADPKKPIGGNIIAHASTTRLSLRKGRGETRICKIYDSPCL  318

Query  1114  AEAEARFQISPEGVTDVKD  1170
              EAEA F I+ +GV D KD
Sbjct  319   PEAEAMFAINADGVGDAKD  337



>ref|XP_010403652.1| PREDICTED: DNA repair protein RAD51 homolog 1 [Corvus cornix 
cornix]
Length=389

 Score =   497 bits (1279),  Expect = 6e-171, Method: Compositional matrix adjust.
 Identities = 233/336 (69%), Positives = 287/336 (85%), Gaps = 0/336 (0%)
 Frame = +1

Query  163   QKSVQERQQDEVEEIQHGPFPIEQLQESGISAIDVKKLKDAGLCTVESVVYSPRKDLLQI  342
             Q  ++       EE   GP  I +L++ GI+A DVKKL++AG  TVE+V Y+P+K+LL I
Sbjct  54    QMQLEASADTSAEEESFGPQLISRLEQCGINANDVKKLEEAGFHTVEAVAYAPKKELLNI  113

Query  343   KGISEAKVDKIIEAASKLVPLGFTSASQLHAQRLEIIQITSGSKELDKVLEGGIETGSIT  522
             KGISEAK DKI+  A+KLVP+GFT+A++ H +R EIIQIT+GSKELDK+L+GGIETGSIT
Sbjct  114   KGISEAKADKILAEAAKLVPMGFTTATEFHQRRSEIIQITTGSKELDKLLQGGIETGSIT  173

Query  523   EIYGEFRSGKTQLCHTLCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIADRFGLNGA  702
             E++GEFR+GKTQLCHTL VTCQLP+D+GGGEGKAMYID EGTFRP+RLL +A+R+GL+G+
Sbjct  174   ELFGEFRTGKTQLCHTLAVTCQLPIDRGGGEGKAMYIDTEGTFRPERLLAVAERYGLSGS  233

Query  703   DVLENVAYARAYNTDHQSRLLLEAASMMVETRFALMIVDSATALYRTDFSGRGELSARQM  882
             DVL+NVAYAR +NTDHQ++LL +A++MM E+R+AL+IVDSATALYRTD+SGRGELSARQM
Sbjct  234   DVLDNVAYARGFNTDHQTQLLYQASAMMAESRYALLIVDSATALYRTDYSGRGELSARQM  293

Query  883   HLAKFLRSLQKLADEFGVAVVITNQVVAQVDGSAIFAGPQIKPIGGNIMAHASTTRLALR  1062
             HLA+FLR L +LA+EFGVAVVITNQVVAQVDG+A+FA    KPIGGNI+AHASTTRL LR
Sbjct  294   HLARFLRMLLRLAEEFGVAVVITNQVVAQVDGAAMFAADPKKPIGGNIIAHASTTRLYLR  353

Query  1063  KGRGEERVCKVVSSPCLAEAEARFQISPEGVTDVKD  1170
             KGRGE R+CK+  SPCL EAEA F I+ +GV D KD
Sbjct  354   KGRGETRICKIYDSPCLPEAEAMFAINADGVGDAKD  389



>ref|XP_010880620.1| PREDICTED: DNA repair protein RAD51 homolog 1 [Esox lucius]
Length=338

 Score =   494 bits (1273),  Expect = 7e-171, Method: Compositional matrix adjust.
 Identities = 228/319 (71%), Positives = 281/319 (88%), Gaps = 0/319 (0%)
 Frame = +1

Query  214   GPFPIEQLQESGISAIDVKKLKDAGLCTVESVVYSPRKDLLQIKGISEAKVDKIIEAASK  393
             GP P+ +L++ GISA D+KKL+DAG  T+E+V Y+P+K+LL IKGISEAK DK++  A+K
Sbjct  20    GPQPLSRLEQCGISAGDIKKLEDAGFHTIEAVAYAPKKELLNIKGISEAKADKVLAEAAK  79

Query  394   LVPLGFTSASQLHAQRLEIIQITSGSKELDKVLEGGIETGSITEIYGEFRSGKTQLCHTL  573
             LVP+GFT+A++ H +R EIIQI++GSKELDK+L+GGIETGSITE++GEFR+GKTQLCHTL
Sbjct  80    LVPMGFTTATEFHQRRAEIIQISTGSKELDKLLQGGIETGSITEMFGEFRTGKTQLCHTL  139

Query  574   CVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIADRFGLNGADVLENVAYARAYNTDHQ  753
              VTCQLP+DQGGGEGKAMYID EGTFRP+RLL +A+R+GL G+DVL+NVAYARA+NTDHQ
Sbjct  140   AVTCQLPIDQGGGEGKAMYIDTEGTFRPERLLAVAERYGLVGSDVLDNVAYARAFNTDHQ  199

Query  754   SRLLLEAASMMVETRFALMIVDSATALYRTDFSGRGELSARQMHLAKFLRSLQKLADEFG  933
             ++LL +A++MM E+R+AL+IVDSA ALYRTD+SGRGELSARQ HL +FLR L +LADEFG
Sbjct  200   TQLLYQASAMMAESRYALLIVDSAMALYRTDYSGRGELSARQGHLGRFLRMLLRLADEFG  259

Query  934   VAVVITNQVVAQVDGSAIFAGPQIKPIGGNIMAHASTTRLALRKGRGEERVCKVVSSPCL  1113
             VAVVITNQVVAQVDG+A+F+    KPIGGNIMAHASTTRL LRKGRGE R+CK+  SPCL
Sbjct  260   VAVVITNQVVAQVDGAAMFSADPKKPIGGNIMAHASTTRLYLRKGRGETRICKIYDSPCL  319

Query  1114  AEAEARFQISPEGVTDVKD  1170
              E+EA F I+P+GV D KD
Sbjct  320   PESEAMFAINPDGVGDAKD  338



>ref|NP_998371.2| DNA repair protein RAD51 homolog 1 [Danio rerio]
Length=340

 Score =   494 bits (1273),  Expect = 8e-171, Method: Compositional matrix adjust.
 Identities = 228/319 (71%), Positives = 281/319 (88%), Gaps = 0/319 (0%)
 Frame = +1

Query  214   GPFPIEQLQESGISAIDVKKLKDAGLCTVESVVYSPRKDLLQIKGISEAKVDKIIEAASK  393
             GP P+ +L++SGIS+ D+KKL+D G  TVE+V Y+P+K+LL IKGISEAK DKI+  A+K
Sbjct  22    GPQPVSRLEQSGISSSDIKKLEDGGFHTVEAVAYAPKKELLNIKGISEAKADKILTEAAK  81

Query  394   LVPLGFTSASQLHAQRLEIIQITSGSKELDKVLEGGIETGSITEIYGEFRSGKTQLCHTL  573
             +VP+GFT+A++ H +R EIIQI++GSKELDK+L+GGIETGSITE++GEFR+GKTQLCHTL
Sbjct  82    MVPMGFTTATEFHQRRAEIIQISTGSKELDKLLQGGIETGSITEMFGEFRTGKTQLCHTL  141

Query  574   CVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIADRFGLNGADVLENVAYARAYNTDHQ  753
              VTCQLP+DQGGGEGKAMYID EGTFRP+RLL +A+R+GL G+DVL+NVAYARA+NTDHQ
Sbjct  142   AVTCQLPIDQGGGEGKAMYIDTEGTFRPERLLAVAERYGLVGSDVLDNVAYARAFNTDHQ  201

Query  754   SRLLLEAASMMVETRFALMIVDSATALYRTDFSGRGELSARQMHLAKFLRSLQKLADEFG  933
             ++LL +A++MM E+R+AL+IVDSATALYRTD+SGRGELSARQ HL +FLR L +LADEFG
Sbjct  202   TQLLYQASAMMTESRYALLIVDSATALYRTDYSGRGELSARQGHLGRFLRMLLRLADEFG  261

Query  934   VAVVITNQVVAQVDGSAIFAGPQIKPIGGNIMAHASTTRLALRKGRGEERVCKVVSSPCL  1113
             VAVVITNQVVAQVDG+A+F+    KPIGGNI+AHASTTRL LRKGRGE R+CK+  SPCL
Sbjct  262   VAVVITNQVVAQVDGAAMFSADPKKPIGGNILAHASTTRLYLRKGRGETRICKIYDSPCL  321

Query  1114  AEAEARFQISPEGVTDVKD  1170
              EAEA F I+ +GV D KD
Sbjct  322   PEAEAMFAINADGVGDAKD  340



>ref|XP_005509908.1| PREDICTED: DNA repair protein RAD51 homolog 1 [Columba livia]
Length=337

 Score =   494 bits (1273),  Expect = 9e-171, Method: Compositional matrix adjust.
 Identities = 230/324 (71%), Positives = 284/324 (88%), Gaps = 0/324 (0%)
 Frame = +1

Query  199   EEIQHGPFPIEQLQESGISAIDVKKLKDAGLCTVESVVYSPRKDLLQIKGISEAKVDKII  378
             E+   GP  + +L++ GI+A DVKKL++AG  TVE+V Y+P+K+LL IKGISEAK DKI+
Sbjct  14    EDESFGPQLVSRLEQCGINANDVKKLEEAGFHTVEAVAYAPKKELLNIKGISEAKADKIL  73

Query  379   EAASKLVPLGFTSASQLHAQRLEIIQITSGSKELDKVLEGGIETGSITEIYGEFRSGKTQ  558
               A+KLVP+GFT+A++ H +R EIIQIT+GSKELDK+L+GGIETGSITE++GEFR+GKTQ
Sbjct  74    AEAAKLVPMGFTTATEFHQRRSEIIQITTGSKELDKLLQGGIETGSITELFGEFRTGKTQ  133

Query  559   LCHTLCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIADRFGLNGADVLENVAYARAY  738
             LCHTL VTCQLP+D+GGGEGKAMYID EGTFRP+RLL +A+R+GL+G+DVL+NVAYAR +
Sbjct  134   LCHTLAVTCQLPIDRGGGEGKAMYIDTEGTFRPERLLAVAERYGLSGSDVLDNVAYARGF  193

Query  739   NTDHQSRLLLEAASMMVETRFALMIVDSATALYRTDFSGRGELSARQMHLAKFLRSLQKL  918
             NTDHQ++LL +A++MM E+R+AL+IVDSATALYRTD+SGRGEL+ARQMHLA+FLR L +L
Sbjct  194   NTDHQTQLLYQASAMMAESRYALLIVDSATALYRTDYSGRGELAARQMHLARFLRMLLRL  253

Query  919   ADEFGVAVVITNQVVAQVDGSAIFAGPQIKPIGGNIMAHASTTRLALRKGRGEERVCKVV  1098
             ADEFGVAVVITNQVVAQVDG+A+FA    KPIGGNI+AHASTTRL LRKGRGE R+CK+ 
Sbjct  254   ADEFGVAVVITNQVVAQVDGAAMFAADPKKPIGGNIIAHASTTRLYLRKGRGETRICKIY  313

Query  1099  SSPCLAEAEARFQISPEGVTDVKD  1170
              SPCL EAEA F I+ +GV D KD
Sbjct  314   DSPCLPEAEAMFAINADGVGDAKD  337



>gb|AAH62849.1| RAD51 homolog (RecA homolog, E. coli) (S. cerevisiae) [Danio 
rerio]
Length=338

 Score =   494 bits (1272),  Expect = 1e-170, Method: Compositional matrix adjust.
 Identities = 228/319 (71%), Positives = 281/319 (88%), Gaps = 0/319 (0%)
 Frame = +1

Query  214   GPFPIEQLQESGISAIDVKKLKDAGLCTVESVVYSPRKDLLQIKGISEAKVDKIIEAASK  393
             GP P+ +L++SGIS+ D+KKL+D G  TVE+V Y+P+K+LL IKGISEAK DKI+  A+K
Sbjct  20    GPQPVSRLEQSGISSSDIKKLEDGGFHTVEAVAYAPKKELLNIKGISEAKADKILTEAAK  79

Query  394   LVPLGFTSASQLHAQRLEIIQITSGSKELDKVLEGGIETGSITEIYGEFRSGKTQLCHTL  573
             +VP+GFT+A++ H +R EIIQI++GSKELDK+L+GGIETGSITE++GEFR+GKTQLCHTL
Sbjct  80    MVPMGFTTATEFHQRRAEIIQISTGSKELDKLLQGGIETGSITEMFGEFRTGKTQLCHTL  139

Query  574   CVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIADRFGLNGADVLENVAYARAYNTDHQ  753
              VTCQLP+DQGGGEGKAMYID EGTFRP+RLL +A+R+GL G+DVL+NVAYARA+NTDHQ
Sbjct  140   AVTCQLPIDQGGGEGKAMYIDTEGTFRPERLLAVAERYGLVGSDVLDNVAYARAFNTDHQ  199

Query  754   SRLLLEAASMMVETRFALMIVDSATALYRTDFSGRGELSARQMHLAKFLRSLQKLADEFG  933
             ++LL +A++MM E+R+AL+IVDSATALYRTD+SGRGELSARQ HL +FLR L +LADEFG
Sbjct  200   TQLLYQASAMMTESRYALLIVDSATALYRTDYSGRGELSARQGHLGRFLRMLLRLADEFG  259

Query  934   VAVVITNQVVAQVDGSAIFAGPQIKPIGGNIMAHASTTRLALRKGRGEERVCKVVSSPCL  1113
             VAVVITNQVVAQVDG+A+F+    KPIGGNI+AHASTTRL LRKGRGE R+CK+  SPCL
Sbjct  260   VAVVITNQVVAQVDGAAMFSADPKKPIGGNILAHASTTRLYLRKGRGETRICKIYDSPCL  319

Query  1114  AEAEARFQISPEGVTDVKD  1170
              EAEA F I+ +GV D KD
Sbjct  320   PEAEAMFAINADGVGDAKD  338



>gb|EMC82304.1| DNA repair protein RAD51 like protein 1, partial [Columba livia]
Length=338

 Score =   494 bits (1272),  Expect = 1e-170, Method: Compositional matrix adjust.
 Identities = 230/324 (71%), Positives = 284/324 (88%), Gaps = 0/324 (0%)
 Frame = +1

Query  199   EEIQHGPFPIEQLQESGISAIDVKKLKDAGLCTVESVVYSPRKDLLQIKGISEAKVDKII  378
             E+   GP  + +L++ GI+A DVKKL++AG  TVE+V Y+P+K+LL IKGISEAK DKI+
Sbjct  15    EDESFGPQLVSRLEQCGINANDVKKLEEAGFHTVEAVAYAPKKELLNIKGISEAKADKIL  74

Query  379   EAASKLVPLGFTSASQLHAQRLEIIQITSGSKELDKVLEGGIETGSITEIYGEFRSGKTQ  558
               A+KLVP+GFT+A++ H +R EIIQIT+GSKELDK+L+GGIETGSITE++GEFR+GKTQ
Sbjct  75    AEAAKLVPMGFTTATEFHQRRSEIIQITTGSKELDKLLQGGIETGSITELFGEFRTGKTQ  134

Query  559   LCHTLCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIADRFGLNGADVLENVAYARAY  738
             LCHTL VTCQLP+D+GGGEGKAMYID EGTFRP+RLL +A+R+GL+G+DVL+NVAYAR +
Sbjct  135   LCHTLAVTCQLPIDRGGGEGKAMYIDTEGTFRPERLLAVAERYGLSGSDVLDNVAYARGF  194

Query  739   NTDHQSRLLLEAASMMVETRFALMIVDSATALYRTDFSGRGELSARQMHLAKFLRSLQKL  918
             NTDHQ++LL +A++MM E+R+AL+IVDSATALYRTD+SGRGEL+ARQMHLA+FLR L +L
Sbjct  195   NTDHQTQLLYQASAMMAESRYALLIVDSATALYRTDYSGRGELAARQMHLARFLRMLLRL  254

Query  919   ADEFGVAVVITNQVVAQVDGSAIFAGPQIKPIGGNIMAHASTTRLALRKGRGEERVCKVV  1098
             ADEFGVAVVITNQVVAQVDG+A+FA    KPIGGNI+AHASTTRL LRKGRGE R+CK+ 
Sbjct  255   ADEFGVAVVITNQVVAQVDGAAMFAADPKKPIGGNIIAHASTTRLYLRKGRGETRICKIY  314

Query  1099  SSPCLAEAEARFQISPEGVTDVKD  1170
              SPCL EAEA F I+ +GV D KD
Sbjct  315   DSPCLPEAEAMFAINADGVGDAKD  338



>ref|XP_005814492.1| PREDICTED: DNA repair protein RAD51 homolog B-like [Xiphophorus 
maculatus]
Length=338

 Score =   494 bits (1272),  Expect = 1e-170, Method: Compositional matrix adjust.
 Identities = 228/321 (71%), Positives = 281/321 (88%), Gaps = 0/321 (0%)
 Frame = +1

Query  208   QHGPFPIEQLQESGISAIDVKKLKDAGLCTVESVVYSPRKDLLQIKGISEAKVDKIIEAA  387
              +GP P+ +L+  GISA D+KKL+DAG  T+E+V Y+P+K+LL IKGISEAK DK++  A
Sbjct  18    NYGPQPLSRLEHCGISASDIKKLEDAGFHTIEAVAYAPKKELLNIKGISEAKADKVLAEA  77

Query  388   SKLVPLGFTSASQLHAQRLEIIQITSGSKELDKVLEGGIETGSITEIYGEFRSGKTQLCH  567
             +KLVP+GFT+A++ H +R EIIQI++GSKELDK+L+GGIETGSITE++GEFR+GKTQLCH
Sbjct  78    AKLVPMGFTTATEFHQRRAEIIQISTGSKELDKLLQGGIETGSITEMFGEFRTGKTQLCH  137

Query  568   TLCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIADRFGLNGADVLENVAYARAYNTD  747
             TL VTCQLP+DQGGGEGKAMYID EGTFRP+RLL +A+R+GL G+DVL+NVAYARA+NTD
Sbjct  138   TLAVTCQLPIDQGGGEGKAMYIDTEGTFRPERLLAVAERYGLVGSDVLDNVAYARAFNTD  197

Query  748   HQSRLLLEAASMMVETRFALMIVDSATALYRTDFSGRGELSARQMHLAKFLRSLQKLADE  927
             HQ++LL +A++MM E+R+AL+IVDSATALYRTD+SGRGELSARQ HL +FLR L +LADE
Sbjct  198   HQTQLLYQASAMMAESRYALLIVDSATALYRTDYSGRGELSARQGHLGRFLRMLLRLADE  257

Query  928   FGVAVVITNQVVAQVDGSAIFAGPQIKPIGGNIMAHASTTRLALRKGRGEERVCKVVSSP  1107
             FGVAVVITNQVVAQVDG+A+F+    KPIGGNI+AHASTTRL LRKGRGE R+CK+  SP
Sbjct  258   FGVAVVITNQVVAQVDGAAMFSADPKKPIGGNILAHASTTRLYLRKGRGETRICKIYDSP  317

Query  1108  CLAEAEARFQISPEGVTDVKD  1170
             CL EAEA F I+ +GV D KD
Sbjct  318   CLPEAEAMFAINADGVGDAKD  338



>ref|XP_010753928.1| PREDICTED: DNA repair protein RAD51 homolog 1 [Larimichthys crocea]
Length=338

 Score =   494 bits (1272),  Expect = 1e-170, Method: Compositional matrix adjust.
 Identities = 230/319 (72%), Positives = 281/319 (88%), Gaps = 0/319 (0%)
 Frame = +1

Query  214   GPFPIEQLQESGISAIDVKKLKDAGLCTVESVVYSPRKDLLQIKGISEAKVDKIIEAASK  393
             GP P+ +L++ GISA D+KKL+DAG  T+E+V Y+P+K+LL IKGISEAK DKI+  A+K
Sbjct  20    GPQPLCRLEQCGISASDIKKLEDAGFHTIEAVAYAPKKELLNIKGISEAKADKILTEAAK  79

Query  394   LVPLGFTSASQLHAQRLEIIQITSGSKELDKVLEGGIETGSITEIYGEFRSGKTQLCHTL  573
             LVP+GFT+A++ H +R EIIQI++GSKELDK+L+GGIETGSITE++GEFR+GKTQLCHTL
Sbjct  80    LVPMGFTTATEFHQRRAEIIQISTGSKELDKLLQGGIETGSITEMFGEFRTGKTQLCHTL  139

Query  574   CVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIADRFGLNGADVLENVAYARAYNTDHQ  753
              VTCQLP+DQGGGEGKAMYID EGTFRP+RLL +A+R+GL G+DVL+NVAYARA+NTDHQ
Sbjct  140   AVTCQLPIDQGGGEGKAMYIDTEGTFRPERLLAVAERYGLVGSDVLDNVAYARAFNTDHQ  199

Query  754   SRLLLEAASMMVETRFALMIVDSATALYRTDFSGRGELSARQMHLAKFLRSLQKLADEFG  933
             ++LL +A++MM E+R+AL+IVDSATALYRTD+SGRGELSARQ HL +FLR L +LADEFG
Sbjct  200   TQLLYQASAMMAESRYALLIVDSATALYRTDYSGRGELSARQGHLGRFLRMLLRLADEFG  259

Query  934   VAVVITNQVVAQVDGSAIFAGPQIKPIGGNIMAHASTTRLALRKGRGEERVCKVVSSPCL  1113
             VAVVITNQVVAQVDG+A+F+    KPIGGNIMAHASTTRL LRKGRGE R+CK+  SPCL
Sbjct  260   VAVVITNQVVAQVDGAAMFSADPKKPIGGNIMAHASTTRLYLRKGRGETRICKIYDSPCL  319

Query  1114  AEAEARFQISPEGVTDVKD  1170
              EAEA F I+ +GV D KD
Sbjct  320   PEAEAMFAINADGVGDAKD  338



>ref|NP_001266379.1| RecA homolog Rad51 [Oreochromis niloticus]
 ref|XP_005475161.1| PREDICTED: RecA homolog Rad51 isoform X1 [Oreochromis niloticus]
 dbj|BAD98461.1| RecA homolog Rad51 [Oreochromis niloticus]
Length=336

 Score =   494 bits (1271),  Expect = 2e-170, Method: Compositional matrix adjust.
 Identities = 229/321 (71%), Positives = 282/321 (88%), Gaps = 0/321 (0%)
 Frame = +1

Query  208   QHGPFPIEQLQESGISAIDVKKLKDAGLCTVESVVYSPRKDLLQIKGISEAKVDKIIEAA  387
              +GP P+ +L++ GISA D+KKL+DAG  T+E+V Y+P+K+LL IKGISEAK DKI+  A
Sbjct  16    NYGPQPLCRLEQCGISASDIKKLEDAGFHTIEAVAYAPKKELLNIKGISEAKADKILTEA  75

Query  388   SKLVPLGFTSASQLHAQRLEIIQITSGSKELDKVLEGGIETGSITEIYGEFRSGKTQLCH  567
             +KLVP+GFT+A++ H +R EIIQI++GSKELDK+L+GGIETGSITE++GEFR+GKTQLCH
Sbjct  76    AKLVPMGFTTATEFHQRRAEIIQISTGSKELDKLLQGGIETGSITEMFGEFRTGKTQLCH  135

Query  568   TLCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIADRFGLNGADVLENVAYARAYNTD  747
             TL VTCQLP+DQGGGEGKAMYID EGTFRP+RLL +A+R+GL G+DVL+NVAYARA+NTD
Sbjct  136   TLAVTCQLPIDQGGGEGKAMYIDTEGTFRPERLLAVAERYGLVGSDVLDNVAYARAFNTD  195

Query  748   HQSRLLLEAASMMVETRFALMIVDSATALYRTDFSGRGELSARQMHLAKFLRSLQKLADE  927
             HQ++LL +A++MM E+R+AL+IVDSATALYRTD+SGRGELSARQ HL +FLR L +LADE
Sbjct  196   HQTQLLYQASAMMAESRYALLIVDSATALYRTDYSGRGELSARQGHLGRFLRMLLRLADE  255

Query  928   FGVAVVITNQVVAQVDGSAIFAGPQIKPIGGNIMAHASTTRLALRKGRGEERVCKVVSSP  1107
             FGVAVVITNQVVAQVDG+A+F+    KPIGGNI+AHASTTRL LRKGRGE R+CK+  SP
Sbjct  256   FGVAVVITNQVVAQVDGAAMFSADPKKPIGGNILAHASTTRLYLRKGRGETRICKIYDSP  315

Query  1108  CLAEAEARFQISPEGVTDVKD  1170
             CL EAEA F I+ +GV D KD
Sbjct  316   CLPEAEAMFAINADGVGDAKD  336



>ref|XP_008275455.1| PREDICTED: DNA repair protein RAD51 homolog 1 [Stegastes partitus]
Length=338

 Score =   494 bits (1271),  Expect = 2e-170, Method: Compositional matrix adjust.
 Identities = 229/319 (72%), Positives = 281/319 (88%), Gaps = 0/319 (0%)
 Frame = +1

Query  214   GPFPIEQLQESGISAIDVKKLKDAGLCTVESVVYSPRKDLLQIKGISEAKVDKIIEAASK  393
             GP P+ +L++ GISA D+KKL+DAG  T+E+V Y+P+K+LL IKGISEAK DKI+  A+K
Sbjct  20    GPQPLCRLEQCGISASDIKKLEDAGFHTIEAVAYAPKKELLNIKGISEAKADKILTEAAK  79

Query  394   LVPLGFTSASQLHAQRLEIIQITSGSKELDKVLEGGIETGSITEIYGEFRSGKTQLCHTL  573
             LVP+GFT+A++ H +R EIIQ+++GSKELDK+L+GGIETGSITE++GEFR+GKTQLCHTL
Sbjct  80    LVPMGFTTATEFHQRRAEIIQVSTGSKELDKLLQGGIETGSITEMFGEFRTGKTQLCHTL  139

Query  574   CVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIADRFGLNGADVLENVAYARAYNTDHQ  753
              VTCQLP+DQGGGEGKAMYID EGTFRP+RLL +A+R+GL G+DVL+NVAYARA+NTDHQ
Sbjct  140   AVTCQLPIDQGGGEGKAMYIDTEGTFRPERLLAVAERYGLVGSDVLDNVAYARAFNTDHQ  199

Query  754   SRLLLEAASMMVETRFALMIVDSATALYRTDFSGRGELSARQMHLAKFLRSLQKLADEFG  933
             ++LL +A++MM E+R+AL+IVDSATALYRTD+SGRGELSARQ HL +FLR L +LADEFG
Sbjct  200   TQLLYQASAMMAESRYALLIVDSATALYRTDYSGRGELSARQGHLGRFLRMLLRLADEFG  259

Query  934   VAVVITNQVVAQVDGSAIFAGPQIKPIGGNIMAHASTTRLALRKGRGEERVCKVVSSPCL  1113
             VAVVITNQVVAQVDG+A+F+    KPIGGNIMAHASTTRL LRKGRGE R+CK+  SPCL
Sbjct  260   VAVVITNQVVAQVDGAAMFSADPKKPIGGNIMAHASTTRLYLRKGRGETRICKIYDSPCL  319

Query  1114  AEAEARFQISPEGVTDVKD  1170
              EAEA F I+ +GV D KD
Sbjct  320   PEAEAMFAINADGVGDAKD  338



>gb|KII75020.1| DNA repair protein RAD51 1 [Thelohanellus kitauei]
Length=345

 Score =   494 bits (1271),  Expect = 2e-170, Method: Compositional matrix adjust.
 Identities = 231/332 (70%), Positives = 281/332 (85%), Gaps = 1/332 (0%)
 Frame = +1

Query  175   QERQQDEVEEIQHGPFPIEQLQESGISAIDVKKLKDAGLCTVESVVYSPRKDLLQIKGIS  354
              +   DE +E   GP  I +L+  GISA+D+KKL++AG  TVE+V ++P+K LL IKGIS
Sbjct  15    NKENMDEDDE-NLGPLQISKLENHGISAVDIKKLEEAGFNTVEAVAFTPKKVLLNIKGIS  73

Query  355   EAKVDKIIEAASKLVPLGFTSASQLHAQRLEIIQITSGSKELDKVLEGGIETGSITEIYG  534
             EAK DKI   A KLVP+GF++A++ H +R E+IQIT+GSKELDK+L GGIETGSITEI+G
Sbjct  74    EAKADKIQAEAIKLVPMGFSTATEYHLKRSELIQITTGSKELDKLLNGGIETGSITEIFG  133

Query  535   EFRSGKTQLCHTLCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIADRFGLNGADVLE  714
             EFR+GKTQLCH LCVTCQLP+D GG EGKA+YID EGTFRP+RLL IA+R+ LNG  VL+
Sbjct  134   EFRTGKTQLCHQLCVTCQLPIDNGGAEGKAIYIDTEGTFRPERLLAIAERYNLNGQQVLD  193

Query  715   NVAYARAYNTDHQSRLLLEAASMMVETRFALMIVDSATALYRTDFSGRGELSARQMHLAK  894
             NVAYARAYNTDHQ+ LL++A+SMM+ETR+A+MIVDSAT LYRTD+SGRGELSARQMHLA+
Sbjct  194   NVAYARAYNTDHQNSLLVQASSMMIETRYAVMIVDSATGLYRTDYSGRGELSARQMHLAR  253

Query  895   FLRSLQKLADEFGVAVVITNQVVAQVDGSAIFAGPQIKPIGGNIMAHASTTRLALRKGRG  1074
             FLR+L ++ADEFGVAVV+TNQVVAQVDGSA+FAG   KPIGG+IMAH+STTRL LRKGRG
Sbjct  254   FLRTLLRIADEFGVAVVLTNQVVAQVDGSAMFAGDTKKPIGGHIMAHSSTTRLYLRKGRG  313

Query  1075  EERVCKVVSSPCLAEAEARFQISPEGVTDVKD  1170
             E R+CK+  SPCL E+EA F I+ +GV D KD
Sbjct  314   ETRICKIYDSPCLPESEAMFSINADGVGDAKD  345



>ref|XP_007259922.1| PREDICTED: DNA repair protein RAD51 homolog 1 isoform X1 [Astyanax 
mexicanus]
 ref|XP_007259923.1| PREDICTED: DNA repair protein RAD51 homolog 1 isoform X2 [Astyanax 
mexicanus]
Length=340

 Score =   493 bits (1270),  Expect = 2e-170, Method: Compositional matrix adjust.
 Identities = 228/319 (71%), Positives = 281/319 (88%), Gaps = 0/319 (0%)
 Frame = +1

Query  214   GPFPIEQLQESGISAIDVKKLKDAGLCTVESVVYSPRKDLLQIKGISEAKVDKIIEAASK  393
             GP P+ +L++ GISA D+KKL+DAG  T+E+V Y+P+K+L+ IKGISEAK DKI+  A+K
Sbjct  22    GPQPLNRLEQCGISASDLKKLEDAGFHTIEAVAYAPKKELINIKGISEAKADKILAEAAK  81

Query  394   LVPLGFTSASQLHAQRLEIIQITSGSKELDKVLEGGIETGSITEIYGEFRSGKTQLCHTL  573
             LVP+GFT+A++ H +R EIIQI++GSKELDK+L+GGIETGSITE++GEFR+GKTQLCHTL
Sbjct  82    LVPMGFTTATEFHQRRAEIIQISTGSKELDKLLQGGIETGSITEMFGEFRTGKTQLCHTL  141

Query  574   CVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIADRFGLNGADVLENVAYARAYNTDHQ  753
              VTCQLP+DQGGGEGKAMYID EGTFRP+RLL +A+R+GL G+DVL+NVAYARA+NTDHQ
Sbjct  142   AVTCQLPIDQGGGEGKAMYIDTEGTFRPERLLAVAERYGLVGSDVLDNVAYARAFNTDHQ  201

Query  754   SRLLLEAASMMVETRFALMIVDSATALYRTDFSGRGELSARQMHLAKFLRSLQKLADEFG  933
             ++LL +A++MM E+R+AL+IVDSATALYRTD+SGRGELSARQ HL +FLR L +LADEFG
Sbjct  202   TQLLYQASAMMAESRYALLIVDSATALYRTDYSGRGELSARQGHLGRFLRMLLRLADEFG  261

Query  934   VAVVITNQVVAQVDGSAIFAGPQIKPIGGNIMAHASTTRLALRKGRGEERVCKVVSSPCL  1113
             VAVVITNQVVAQVDG+A+F+    KPIGGNI+AHASTTRL LRKGRGE R+CK+  SPCL
Sbjct  262   VAVVITNQVVAQVDGAAMFSADPKKPIGGNILAHASTTRLYLRKGRGETRICKIYDSPCL  321

Query  1114  AEAEARFQISPEGVTDVKD  1170
              EAEA F I+ +GV D KD
Sbjct  322   PEAEAMFAINADGVGDAKD  340



>ref|XP_788683.2| PREDICTED: DNA repair protein RAD51 homolog 1 [Strongylocentrotus 
purpuratus]
Length=335

 Score =   493 bits (1269),  Expect = 2e-170, Method: Compositional matrix adjust.
 Identities = 232/344 (67%), Positives = 287/344 (83%), Gaps = 9/344 (3%)
 Frame = +1

Query  139   MEQQHRNQQKSVQERQQDEVEEIQHGPFPIEQLQESGISAIDVKKLKDAGLCTVESVVYS  318
             M  Q  N ++ V E         + GP  I +L+ SGIS+ DVKKL++AG+ TVESV YS
Sbjct  1     MAMQMHNAEQEVSE---------EFGPLGISRLEASGISSNDVKKLEEAGMHTVESVAYS  51

Query  319   PRKDLLQIKGISEAKVDKIIEAASKLVPLGFTSASQLHAQRLEIIQITSGSKELDKVLEG  498
              +K+L  +KGISEAK DKI+  A KLVP+GFT+A+Q H QR EIIQ+T+GSKELDK+L+G
Sbjct  52    TKKELCAVKGISEAKADKILTEAQKLVPMGFTTATQFHQQRSEIIQVTTGSKELDKLLQG  111

Query  499   GIETGSITEIYGEFRSGKTQLCHTLCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIA  678
             GIETGSITEI+GEFR+GKTQLCHT+ VTCQLP+D GGGEGK +YID EGTFRP+RL+ +A
Sbjct  112   GIETGSITEIFGEFRTGKTQLCHTMAVTCQLPIDNGGGEGKCLYIDTEGTFRPERLIAVA  171

Query  679   DRFGLNGADVLENVAYARAYNTDHQSRLLLEAASMMVETRFALMIVDSATALYRTDFSGR  858
             DR+ L+G+DVL+NVAYARA+N+DHQS+LLL+A++MM E+R+AL+IVDSATALYRTD+SGR
Sbjct  172   DRYNLSGSDVLDNVAYARAHNSDHQSQLLLQASAMMAESRYALLIVDSATALYRTDYSGR  231

Query  859   GELSARQMHLAKFLRSLQKLADEFGVAVVITNQVVAQVDGSAIFAGPQIKPIGGNIMAHA  1038
             GEL++RQMHL +FLR+L +LADE+GVAVVITNQVVAQVDG+A+F     KPIGG+IMAHA
Sbjct  232   GELASRQMHLGRFLRTLLRLADEYGVAVVITNQVVAQVDGAAMFTSDPKKPIGGHIMAHA  291

Query  1039  STTRLALRKGRGEERVCKVVSSPCLAEAEARFQISPEGVTDVKD  1170
             STTRL LRKGRGE R+CK+  SPCL EAEA F I+P+GV D KD
Sbjct  292   STTRLYLRKGRGETRICKIYDSPCLPEAEAMFAINPDGVGDAKD  335



>emb|CCD74763.1| putative DNA repair protein RAD51 [Schistosoma mansoni]
Length=338

 Score =   493 bits (1269),  Expect = 3e-170, Method: Compositional matrix adjust.
 Identities = 233/337 (69%), Positives = 285/337 (85%), Gaps = 3/337 (1%)
 Frame = +1

Query  169   SVQERQ---QDEVEEIQHGPFPIEQLQESGISAIDVKKLKDAGLCTVESVVYSPRKDLLQ  339
             +VQE      D V++   GP  I++L+ +GI+A DVKKL++AG  TVES+ + P+K LL 
Sbjct  2     AVQESNCAVDDRVDDENCGPLLIQKLESAGIAAADVKKLREAGFHTVESIQFVPKKTLLA  61

Query  340   IKGISEAKVDKIIEAASKLVPLGFTSASQLHAQRLEIIQITSGSKELDKVLEGGIETGSI  519
             +KGISEAK DKIIEAA KLVP GFT+A++ H +R EIIQ+T+GSKELDK+L+GGIETGSI
Sbjct  62    VKGISEAKADKIIEAAQKLVPFGFTTATEFHQKRSEIIQLTTGSKELDKLLQGGIETGSI  121

Query  520   TEIYGEFRSGKTQLCHTLCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIADRFGLNG  699
             TE++GEFR+GKTQ+CHTL VTCQLP+D GGGEGK +YID EGTFRP+RLL +A+R+GL+G
Sbjct  122   TELFGEFRTGKTQICHTLAVTCQLPIDMGGGEGKCLYIDTEGTFRPERLLAVAERYGLSG  181

Query  700   ADVLENVAYARAYNTDHQSRLLLEAASMMVETRFALMIVDSATALYRTDFSGRGELSARQ  879
             +DVL+NVAYARAYNTDHQ  LL+ AA+MM E+R+AL+IVDSATALYRTD+SGRGELSARQ
Sbjct  182   SDVLDNVAYARAYNTDHQMELLINAAAMMSESRYALLIVDSATALYRTDYSGRGELSARQ  241

Query  880   MHLAKFLRSLQKLADEFGVAVVITNQVVAQVDGSAIFAGPQIKPIGGNIMAHASTTRLAL  1059
             MHLA+FLR+L +LADEFGVAVVITNQVVAQVDG+A+F+    KPIGGNIM HASTTRL L
Sbjct  242   MHLARFLRTLLRLADEFGVAVVITNQVVAQVDGAAMFSADPKKPIGGNIMGHASTTRLYL  301

Query  1060  RKGRGEERVCKVVSSPCLAEAEARFQISPEGVTDVKD  1170
             RKGRGE R+CK+  SPCL EAEA + I  +G+ D KD
Sbjct  302   RKGRGETRICKIYDSPCLPEAEAMYAILADGIGDAKD  338



>ref|XP_003386534.1| PREDICTED: DNA repair protein RAD51 homolog B [Amphimedon queenslandica]
Length=345

 Score =   493 bits (1268),  Expect = 5e-170, Method: Compositional matrix adjust.
 Identities = 239/345 (69%), Positives = 287/345 (83%), Gaps = 1/345 (0%)
 Frame = +1

Query  139   MEQQHRNQQKSVQERQQDEVEEIQHGPFPIEQLQESGISAIDVKKLKDAGLCTVESVVYS  318
             ME    +   +    Q+   EE   GP PI +L+ SGISA DVKKL +AG  TVESV Y+
Sbjct  1     MESSAVSSIAASINHQEALTEEENIGPQPIVKLEGSGISANDVKKLSEAGYHTVESVAYA  60

Query  319   PRKDLLQIKGISEAKVDKIIEAASKLVPLGFTSASQLHAQRLEIIQITSGSKELDKVLEG  498
             P+K LL IKGISEAK DKI   A+KLVP+GFT+A++ H +R EIIQIT+GSKELD +L+G
Sbjct  61    PKKALLVIKGISEAKADKIQNEAAKLVPMGFTTATEFHRRRSEIIQITTGSKELDTLLKG  120

Query  499   GIETGSITEIYGEFRSGKTQLCHTLCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIA  678
             GIETGSITEI+GEFR+GKTQLCH L VTCQLP+D GGGEGK +YID+EGTFRP+RLL +A
Sbjct  121   GIETGSITEIFGEFRTGKTQLCHMLAVTCQLPIDNGGGEGKCLYIDSEGTFRPERLLAVA  180

Query  679   DRFGLNGADVLENVAYARAYNTDHQSRLLLEAASMMVETRFALMIVDSATALYRTDFSGR  858
             +R+ L+GADVL+NVAYARAYNTDHQS+LLL+AA+MM ETR+AL++VDSATALYRTD+SGR
Sbjct  181   ERYNLSGADVLDNVAYARAYNTDHQSQLLLQAAAMMSETRYALLVVDSATALYRTDYSGR  240

Query  859   GELSARQMHLAKFLRSLQKLADEFGVAVVITNQVVAQVDG-SAIFAGPQIKPIGGNIMAH  1035
             GELSARQMHLA+FLR+L +L+DEFGVAVVITNQVVAQVDG +A+F+    KPIGGNI+AH
Sbjct  241   GELSARQMHLARFLRTLLRLSDEFGVAVVITNQVVAQVDGAAAMFSADPKKPIGGNIIAH  300

Query  1036  ASTTRLALRKGRGEERVCKVVSSPCLAEAEARFQISPEGVTDVKD  1170
             ASTTRL LRKGRGE R+CK+  SPCL EAEA F I+ +G+ D KD
Sbjct  301   ASTTRLYLRKGRGETRICKIYDSPCLPEAEAMFAINADGIGDAKD  345



>gb|KGB35409.1| DNA repair protein RAD51 1 [Schistosoma haematobium]
Length=338

 Score =   492 bits (1267),  Expect = 5e-170, Method: Compositional matrix adjust.
 Identities = 229/327 (70%), Positives = 281/327 (86%), Gaps = 0/327 (0%)
 Frame = +1

Query  190   DEVEEIQHGPFPIEQLQESGISAIDVKKLKDAGLCTVESVVYSPRKDLLQIKGISEAKVD  369
             D V++   GP  I++L+ +GI+A DVKKL++AG  T+ES+ + P+K LL +KGISEAK D
Sbjct  12    DRVDDENCGPLLIQKLESAGIAAADVKKLREAGFHTIESIQFVPKKTLLAVKGISEAKAD  71

Query  370   KIIEAASKLVPLGFTSASQLHAQRLEIIQITSGSKELDKVLEGGIETGSITEIYGEFRSG  549
             KIIEAA KLVP GFT+A++ H +R EIIQ+T+GSKELDK+L+GGIETGSITE++GEFR+G
Sbjct  72    KIIEAAQKLVPFGFTTATEFHQKRSEIIQLTTGSKELDKLLQGGIETGSITELFGEFRTG  131

Query  550   KTQLCHTLCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIADRFGLNGADVLENVAYA  729
             KTQ+CHTL VTCQLP+D GGGEGK +YID EGTFRP+RLL +A+R+GL+G+DVL+NVAYA
Sbjct  132   KTQICHTLAVTCQLPIDMGGGEGKCLYIDTEGTFRPERLLAVAERYGLSGSDVLDNVAYA  191

Query  730   RAYNTDHQSRLLLEAASMMVETRFALMIVDSATALYRTDFSGRGELSARQMHLAKFLRSL  909
             RAYNTDHQ  LL+ AA+MM E+R+AL+IVDSATALYRTD+SGRGELSARQMHLA+FLR+L
Sbjct  192   RAYNTDHQMELLINAAAMMSESRYALLIVDSATALYRTDYSGRGELSARQMHLARFLRTL  251

Query  910   QKLADEFGVAVVITNQVVAQVDGSAIFAGPQIKPIGGNIMAHASTTRLALRKGRGEERVC  1089
              +LADEFGVAVVITNQVVAQVDG+A+F+    KPIGGNIM HASTTRL LRKGRGE R+C
Sbjct  252   LRLADEFGVAVVITNQVVAQVDGAAMFSADPKKPIGGNIMGHASTTRLYLRKGRGETRIC  311

Query  1090  KVVSSPCLAEAEARFQISPEGVTDVKD  1170
             K+  SPCL EAEA + I  +G+ D KD
Sbjct  312   KIYDSPCLPEAEAMYAILADGIGDAKD  338



>ref|XP_004083949.1| PREDICTED: DNA repair protein RAD51 homolog 1 [Oryzias latipes]
 ref|XP_011490342.1| PREDICTED: DNA repair protein RAD51 homolog 1 [Oryzias latipes]
Length=340

 Score =   492 bits (1267),  Expect = 7e-170, Method: Compositional matrix adjust.
 Identities = 228/319 (71%), Positives = 281/319 (88%), Gaps = 0/319 (0%)
 Frame = +1

Query  214   GPFPIEQLQESGISAIDVKKLKDAGLCTVESVVYSPRKDLLQIKGISEAKVDKIIEAASK  393
             GP P+ +L++ GIS+ D+KKL+DAG  T+E+V Y+P+K+LL IKGISEAK DKI+  A+K
Sbjct  22    GPQPLSRLEQCGISSSDIKKLEDAGFHTIEAVAYAPKKELLNIKGISEAKADKILTEAAK  81

Query  394   LVPLGFTSASQLHAQRLEIIQITSGSKELDKVLEGGIETGSITEIYGEFRSGKTQLCHTL  573
             LVP+GFT+A++ H +R EIIQI++GSKELDK+L+GGIETGSITE++GEFR+GKTQLCHTL
Sbjct  82    LVPMGFTTATEFHQRRSEIIQISTGSKELDKLLQGGIETGSITEMFGEFRTGKTQLCHTL  141

Query  574   CVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIADRFGLNGADVLENVAYARAYNTDHQ  753
              VTCQLP+DQGGGEGKAMYID EGTFRP+RLL +A+R+GL G+DVL+NVAYARA+NTDHQ
Sbjct  142   AVTCQLPIDQGGGEGKAMYIDTEGTFRPERLLAVAERYGLVGSDVLDNVAYARAFNTDHQ  201

Query  754   SRLLLEAASMMVETRFALMIVDSATALYRTDFSGRGELSARQMHLAKFLRSLQKLADEFG  933
             ++LL +A++MM E+R+AL+IVDSATALYRTD+SGRGELSARQ HL +FLR L +LADEFG
Sbjct  202   TQLLYQASAMMAESRYALLIVDSATALYRTDYSGRGELSARQGHLGRFLRMLLRLADEFG  261

Query  934   VAVVITNQVVAQVDGSAIFAGPQIKPIGGNIMAHASTTRLALRKGRGEERVCKVVSSPCL  1113
             VAVVITNQVVAQVDG+A+F+    KPIGGNI+AHASTTRL LRKGRGE R+CK+  SPCL
Sbjct  262   VAVVITNQVVAQVDGAAMFSADPKKPIGGNILAHASTTRLYLRKGRGETRICKIYDSPCL  321

Query  1114  AEAEARFQISPEGVTDVKD  1170
              EAEA F I+ +GV D KD
Sbjct  322   PEAEAMFAINADGVGDAKD  340



>ref|XP_010140464.1| PREDICTED: DNA repair protein RAD51 homolog 1 isoform X1 [Buceros 
rhinoceros silvestris]
Length=339

 Score =   492 bits (1267),  Expect = 7e-170, Method: Compositional matrix adjust.
 Identities = 231/336 (69%), Positives = 285/336 (85%), Gaps = 0/336 (0%)
 Frame = +1

Query  163   QKSVQERQQDEVEEIQHGPFPIEQLQESGISAIDVKKLKDAGLCTVESVVYSPRKDLLQI  342
             Q  ++      VEE   GP  I +L++ GI+A DVKKL++AG  TVE+V Y+P+K+LL I
Sbjct  4     QMQLEANADSSVEEESFGPQLIARLEQCGINANDVKKLEEAGFHTVEAVAYAPKKELLNI  63

Query  343   KGISEAKVDKIIEAASKLVPLGFTSASQLHAQRLEIIQITSGSKELDKVLEGGIETGSIT  522
             KGISEAK DKI+  A+KLVP+GFT+A++ H +R EIIQIT+GSKELDK+L+GGIETGSIT
Sbjct  64    KGISEAKADKILAEAAKLVPMGFTTATEFHQRRSEIIQITTGSKELDKLLQGGIETGSIT  123

Query  523   EIYGEFRSGKTQLCHTLCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIADRFGLNGA  702
             E++GEFR+GKTQLCHTL VTCQLP+D+GGGEGKAMYID EGTFRP+RLL +A+R+GL+G+
Sbjct  124   ELFGEFRTGKTQLCHTLAVTCQLPIDRGGGEGKAMYIDTEGTFRPERLLAVAERYGLSGS  183

Query  703   DVLENVAYARAYNTDHQSRLLLEAASMMVETRFALMIVDSATALYRTDFSGRGELSARQM  882
             DVL+NVAYAR +NTDHQ++LL +A++MM E+R+AL+IVDSATALYRTD+SGRGEL+ARQM
Sbjct  184   DVLDNVAYARGFNTDHQTQLLYQASAMMAESRYALLIVDSATALYRTDYSGRGELAARQM  243

Query  883   HLAKFLRSLQKLADEFGVAVVITNQVVAQVDGSAIFAGPQIKPIGGNIMAHASTTRLALR  1062
             HLA+FLR L +LADEFGVAV+ITNQVVAQVD   +FA    KPIGGNI+AHASTTRL LR
Sbjct  244   HLARFLRMLLRLADEFGVAVLITNQVVAQVDXXXMFAADPKKPIGGNIIAHASTTRLYLR  303

Query  1063  KGRGEERVCKVVSSPCLAEAEARFQISPEGVTDVKD  1170
             KGRGE R+CK+  SPCL EAEA F I+ +GV D KD
Sbjct  304   KGRGETRICKIYDSPCLPEAEAMFAINADGVGDAKD  339



>ref|XP_009331968.1| PREDICTED: DNA repair protein RAD51 homolog 1 isoform X1 [Pygoscelis 
adeliae]
 gb|KFW60770.1| DNA repair protein RAD51 1 [Pygoscelis adeliae]
Length=339

 Score =   491 bits (1264),  Expect = 2e-169, Method: Compositional matrix adjust.
 Identities = 231/324 (71%), Positives = 280/324 (86%), Gaps = 0/324 (0%)
 Frame = +1

Query  199   EEIQHGPFPIEQLQESGISAIDVKKLKDAGLCTVESVVYSPRKDLLQIKGISEAKVDKII  378
             EE   GP  I +L++ GI+A DVKKL++AG  TVE+V Y+P+K+LL IKGISEAK DKI+
Sbjct  16    EEESFGPQLISRLEQCGINANDVKKLEEAGFHTVEAVAYAPKKELLNIKGISEAKADKIL  75

Query  379   EAASKLVPLGFTSASQLHAQRLEIIQITSGSKELDKVLEGGIETGSITEIYGEFRSGKTQ  558
               A+KLVP+GFT+A++ H +R EIIQIT+GSKELDK+L+GGIETGSITE++GEFR+GKTQ
Sbjct  76    AEAAKLVPMGFTTATEFHQRRSEIIQITTGSKELDKLLQGGIETGSITELFGEFRTGKTQ  135

Query  559   LCHTLCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIADRFGLNGADVLENVAYARAY  738
             LCHTL VTCQLP+D+GGGEGKAMYID EGTFRP+RLL +A+R+G    DVL+NVAYAR +
Sbjct  136   LCHTLAVTCQLPIDRGGGEGKAMYIDTEGTFRPERLLAVAERYGFFFGDVLDNVAYARGF  195

Query  739   NTDHQSRLLLEAASMMVETRFALMIVDSATALYRTDFSGRGELSARQMHLAKFLRSLQKL  918
             NTDHQ++LL +A++MM E+R+AL+IVDSATALYRTD+SGRGELSARQMHLA+FLR L +L
Sbjct  196   NTDHQTQLLYQASAMMAESRYALLIVDSATALYRTDYSGRGELSARQMHLARFLRMLLRL  255

Query  919   ADEFGVAVVITNQVVAQVDGSAIFAGPQIKPIGGNIMAHASTTRLALRKGRGEERVCKVV  1098
             ADEFGVAVVITNQVVAQVDG+A+FA    KPIGGNI+AHASTTRL LRKGRGE R+CK+ 
Sbjct  256   ADEFGVAVVITNQVVAQVDGAAMFAADPKKPIGGNIIAHASTTRLYLRKGRGETRICKIY  315

Query  1099  SSPCLAEAEARFQISPEGVTDVKD  1170
              SPCL EAEA F I+ +GV D KD
Sbjct  316   DSPCLPEAEAMFAINADGVGDAKD  339



>ref|XP_010344595.1| PREDICTED: DNA repair protein RAD51 homolog 1 [Saimiri boliviensis 
boliviensis]
Length=318

 Score =   490 bits (1262),  Expect = 2e-169, Method: Compositional matrix adjust.
 Identities = 229/315 (73%), Positives = 281/315 (89%), Gaps = 0/315 (0%)
 Frame = +1

Query  226   IEQLQESGISAIDVKKLKDAGLCTVESVVYSPRKDLLQIKGISEAKVDKIIEAASKLVPL  405
             IE+  + GI+A DVKKL++AG  TVE+V Y+P+K+L+ IKGISEAK DKI+  A+KLVP+
Sbjct  4     IEESAQCGINANDVKKLEEAGFHTVEAVAYAPKKELINIKGISEAKADKILAEAAKLVPM  63

Query  406   GFTSASQLHAQRLEIIQITSGSKELDKVLEGGIETGSITEIYGEFRSGKTQLCHTLCVTC  585
             GFT+A++ H +R EIIQIT+GSKELDK+L+GGIETGSITE++GEFR+GKTQ+CHTL VTC
Sbjct  64    GFTTATEFHQRRSEIIQITTGSKELDKLLQGGIETGSITEMFGEFRTGKTQICHTLAVTC  123

Query  586   QLPLDQGGGEGKAMYIDAEGTFRPQRLLQIADRFGLNGADVLENVAYARAYNTDHQSRLL  765
             QLP+D+GGGEGKAMYID EGTFRP+RLL +A+R+GL+G+DVL+NVAYARA+NTDHQ++LL
Sbjct  124   QLPIDRGGGEGKAMYIDTEGTFRPERLLAVAERYGLSGSDVLDNVAYARAFNTDHQTQLL  183

Query  766   LEAASMMVETRFALMIVDSATALYRTDFSGRGELSARQMHLAKFLRSLQKLADEFGVAVV  945
              +A++MMVE+R+AL+IVDSATALYRTD+SGRGELSARQMHLA+FLR L +LADEFGVAVV
Sbjct  184   YQASAMMVESRYALLIVDSATALYRTDYSGRGELSARQMHLARFLRMLLRLADEFGVAVV  243

Query  946   ITNQVVAQVDGSAIFAGPQIKPIGGNIMAHASTTRLALRKGRGEERVCKVVSSPCLAEAE  1125
             ITNQVVAQVDG+A+FA    KPIGGNI+AHASTTRL LRKGRGE R+CK+  SPCL EAE
Sbjct  244   ITNQVVAQVDGAAMFAADPKKPIGGNIIAHASTTRLYLRKGRGETRICKIYDSPCLPEAE  303

Query  1126  ARFQISPEGVTDVKD  1170
             A F I+ +GV D KD
Sbjct  304   AIFAINADGVGDAKD  318



>ref|XP_004341892.1| DNA repair protein RAD51, putative [Acanthamoeba castellanii 
str. Neff]
 gb|ELR19797.1| DNA repair protein RAD51, putative [Acanthamoeba castellanii 
str. Neff]
Length=342

 Score =   490 bits (1262),  Expect = 5e-169, Method: Compositional matrix adjust.
 Identities = 229/320 (72%), Positives = 277/320 (87%), Gaps = 1/320 (0%)
 Frame = +1

Query  214   GPFPIEQLQESGISAIDVKKLKDAGLCTVESVVYSPRKDLLQIKGISEAKVDKIIEAASK  393
             GP PI +L++ GISA+DVKKL+ AG  TVESV +S +K L+ +KG+S+ K DKI+  A+K
Sbjct  23    GPIPITKLEQHGISAVDVKKLQGAGFYTVESVAFSTKKALIAVKGVSDTKADKILAEAAK  82

Query  394   LVPLGFTSASQLHAQRLEIIQITSGSKELDKVLEGGIETGSITEIYGEFRSGKTQLCHTL  573
             LVP+GFT+A++   QR EIIQ+T+GSKELDK+LE GIETGSITEI+GEFR+GKTQLCH L
Sbjct  83    LVPMGFTTATEFQKQRAEIIQVTTGSKELDKLLENGIETGSITEIFGEFRTGKTQLCHQL  142

Query  574   CVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIADRFGLNGADVLENVAYARAYNTDHQ  753
             CVTCQLPLDQGGGEGKA+Y+D EGTFRPQRLL IA+R+GLNG DVL+NVAYARAYN+DHQ
Sbjct  143   CVTCQLPLDQGGGEGKALYVDTEGTFRPQRLLAIAERYGLNGDDVLDNVAYARAYNSDHQ  202

Query  754   SRLLLEAASMMVETRFALMIVDSATALYRTDFSGRGELSARQMHLAKFLRSLQKLADEFG  933
              +LL +A++MM E+R+A++IVDSATALYRTD+SGRGELSARQMHLA+FLR+LQ+LADEFG
Sbjct  203   MQLLAQASAMMSESRYAMLIVDSATALYRTDYSGRGELSARQMHLARFLRTLQRLADEFG  262

Query  934   VAVVITNQVVAQVDGS-AIFAGPQIKPIGGNIMAHASTTRLALRKGRGEERVCKVVSSPC  1110
             VAVVITNQVVAQVDG+ A+F     KPIGGNIMAHASTTRL LRKGR E R+CK+  SPC
Sbjct  263   VAVVITNQVVAQVDGNAAMFGADPKKPIGGNIMAHASTTRLYLRKGRAETRICKIYDSPC  322

Query  1111  LAEAEARFQISPEGVTDVKD  1170
             L EAEA F I+ +G+ D K+
Sbjct  323   LPEAEAVFAINADGIGDPKE  342



>gb|KDR10565.1| DNA repair protein RAD51-like protein 1 [Zootermopsis nevadensis]
Length=338

 Score =   490 bits (1261),  Expect = 5e-169, Method: Compositional matrix adjust.
 Identities = 229/330 (69%), Positives = 287/330 (87%), Gaps = 2/330 (1%)
 Frame = +1

Query  181   RQQDEVEEIQHGPFPIEQLQESGISAIDVKKLKDAGLCTVESVVYSPRKDLLQIKGISEA  360
             ++QD+V+E   GP  I +LQ  GISA D+KKL++AG  TVE+V ++P+K L+ IKGISEA
Sbjct  11    QKQDDVDEF--GPQLISKLQSQGISAADIKKLEEAGYHTVEAVAFAPKKYLIAIKGISEA  68

Query  361   KVDKIIEAASKLVPLGFTSASQLHAQRLEIIQITSGSKELDKVLEGGIETGSITEIYGEF  540
             K DK++  ASKLVP+GFT+A++ H +R EIIQ+T+GS+ELD++L GGIETGSITEI+GEF
Sbjct  69    KADKLLAEASKLVPMGFTTATEFHQKRSEIIQLTTGSRELDRLLGGGIETGSITEIFGEF  128

Query  541   RSGKTQLCHTLCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIADRFGLNGADVLENV  720
             R+GKTQLCHTL VTCQLP+DQ GGEGK++YID+EGTFRP+RLL +ADR+ L+G DVL+NV
Sbjct  129   RTGKTQLCHTLAVTCQLPIDQNGGEGKSLYIDSEGTFRPERLLAVADRYKLSGNDVLDNV  188

Query  721   AYARAYNTDHQSRLLLEAASMMVETRFALMIVDSATALYRTDFSGRGELSARQMHLAKFL  900
             AYARAYNTDHQ++LL++A++MM E+R+AL+IVDSAT+LYRTDFSGRGELSARQMHLA+FL
Sbjct  189   AYARAYNTDHQTQLLIQASAMMAESRYALLIVDSATSLYRTDFSGRGELSARQMHLARFL  248

Query  901   RSLQKLADEFGVAVVITNQVVAQVDGSAIFAGPQIKPIGGNIMAHASTTRLALRKGRGEE  1080
             R L +LADEFGVAVVITNQVVAQVDG+A+FA    KPIGGNI+AHASTTRL LRKGRGE 
Sbjct  249   RMLLRLADEFGVAVVITNQVVAQVDGAALFAADPKKPIGGNIIAHASTTRLYLRKGRGET  308

Query  1081  RVCKVVSSPCLAEAEARFQISPEGVTDVKD  1170
             R+CK+  SPCL E+EA F I+ +G+ D K+
Sbjct  309   RICKIYDSPCLPESEAMFAINADGIGDAKE  338



>gb|AIL94182.1| Rad51 [Brachionus sp. 'koreanus']
Length=338

 Score =   489 bits (1259),  Expect = 9e-169, Method: Compositional matrix adjust.
 Identities = 229/326 (70%), Positives = 280/326 (86%), Gaps = 0/326 (0%)
 Frame = +1

Query  193   EVEEIQHGPFPIEQLQESGISAIDVKKLKDAGLCTVESVVYSPRKDLLQIKGISEAKVDK  372
             E +  Q GP  I +L+ +GI+  D+KKL++AGL T+E+V Y P+K LL IKGISE K +K
Sbjct  13    ETQSEQFGPISITKLEVNGITGADIKKLQEAGLHTIEAVAYVPKKLLLSIKGISEQKAEK  72

Query  373   IIEAASKLVPLGFTSASQLHAQRLEIIQITSGSKELDKVLEGGIETGSITEIYGEFRSGK  552
             I+  A KL+P+GFT+AS+ H +R EIIQ+TSGSKELDK+L+GGIETGSITE++GEFR+GK
Sbjct  73    ILMEAYKLIPMGFTTASEFHLKRSEIIQLTSGSKELDKLLQGGIETGSITEMFGEFRTGK  132

Query  553   TQLCHTLCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIADRFGLNGADVLENVAYAR  732
             TQLCH L VTCQLP+D GGGEGKA+YID EGTFRP+RLL IA+R+GLNG+DVL+NVAYAR
Sbjct  133   TQLCHQLAVTCQLPIDMGGGEGKALYIDTEGTFRPERLLAIAERYGLNGSDVLDNVAYAR  192

Query  733   AYNTDHQSRLLLEAASMMVETRFALMIVDSATALYRTDFSGRGELSARQMHLAKFLRSLQ  912
             AYN+DHQ++LLL+A++MM ETR+AL+IVDSATALYRTD+SGRGELS RQMH+AKFLR+LQ
Sbjct  193   AYNSDHQTQLLLQASAMMTETRYALIIVDSATALYRTDYSGRGELSERQMHMAKFLRTLQ  252

Query  913   KLADEFGVAVVITNQVVAQVDGSAIFAGPQIKPIGGNIMAHASTTRLALRKGRGEERVCK  1092
             ++ADEFGVAVVITNQVVAQVDG+++F     KPIGGNIMAHASTTRL LRKGRG+ RVCK
Sbjct  253   RIADEFGVAVVITNQVVAQVDGASMFQADPKKPIGGNIMAHASTTRLYLRKGRGDSRVCK  312

Query  1093  VVSSPCLAEAEARFQISPEGVTDVKD  1170
             V  SP L E+EA F IS EG+ D K+
Sbjct  313   VYDSPSLPESEAVFAISTEGIIDSKE  338



>ref|NP_001134027.1| DNA repair protein RAD51 homolog A [Salmo salar]
 gb|ACI34337.1| DNA repair protein RAD51 homolog A [Salmo salar]
 emb|CDQ71381.1| unnamed protein product [Oncorhynchus mykiss]
Length=338

 Score =   489 bits (1258),  Expect = 1e-168, Method: Compositional matrix adjust.
 Identities = 226/319 (71%), Positives = 280/319 (88%), Gaps = 0/319 (0%)
 Frame = +1

Query  214   GPFPIEQLQESGISAIDVKKLKDAGLCTVESVVYSPRKDLLQIKGISEAKVDKIIEAASK  393
             GP  + +L++ GISA D+KKL+DAG  T+E+V Y+P+K+LL IKGISEAK DK++  A+K
Sbjct  20    GPQLLSRLEQCGISASDIKKLEDAGFHTIEAVAYAPKKELLNIKGISEAKADKVLAEAAK  79

Query  394   LVPLGFTSASQLHAQRLEIIQITSGSKELDKVLEGGIETGSITEIYGEFRSGKTQLCHTL  573
             LVP+GFT+A++ H +R EIIQI++GSKELDK+L+GGIETGSITE++GEFR+GKTQLCHTL
Sbjct  80    LVPMGFTTATEFHQRRAEIIQISTGSKELDKLLQGGIETGSITEMFGEFRTGKTQLCHTL  139

Query  574   CVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIADRFGLNGADVLENVAYARAYNTDHQ  753
              VTCQLP+DQGGGEGKAMYID EGTFRP+RLL +A+R+GL G+DVL+NVAYARA+NTDHQ
Sbjct  140   AVTCQLPIDQGGGEGKAMYIDTEGTFRPERLLAVAERYGLVGSDVLDNVAYARAFNTDHQ  199

Query  754   SRLLLEAASMMVETRFALMIVDSATALYRTDFSGRGELSARQMHLAKFLRSLQKLADEFG  933
             ++LL +A++MM E+R+AL+IVDSATALYRTD+SGRGEL+ARQ HL +FLR L +LADEFG
Sbjct  200   TQLLYQASAMMAESRYALLIVDSATALYRTDYSGRGELAARQGHLGRFLRMLLRLADEFG  259

Query  934   VAVVITNQVVAQVDGSAIFAGPQIKPIGGNIMAHASTTRLALRKGRGEERVCKVVSSPCL  1113
             VAVVITNQVVAQVDG+A+F+    KPIGGNIMAHASTTRL LRKGRGE R+CK+  SPCL
Sbjct  260   VAVVITNQVVAQVDGAAMFSADPKKPIGGNIMAHASTTRLYLRKGRGETRICKIYDSPCL  319

Query  1114  AEAEARFQISPEGVTDVKD  1170
              E+EA F I+ +GV D KD
Sbjct  320   PESEAMFAINADGVGDAKD  338



>gb|AIW60888.1| RAD51 [Schmidtea mediterranea]
Length=337

 Score =   489 bits (1258),  Expect = 2e-168, Method: Compositional matrix adjust.
 Identities = 226/324 (70%), Positives = 281/324 (87%), Gaps = 0/324 (0%)
 Frame = +1

Query  199   EEIQHGPFPIEQLQESGISAIDVKKLKDAGLCTVESVVYSPRKDLLQIKGISEAKVDKII  378
             EE   GP P+++L+ +GISA D+KKL +AG  ++ES+ Y P+K L  IKG+SE KVDKI+
Sbjct  14    EEECMGPLPLKKLEGAGISAQDIKKLIEAGYHSIESIQYVPKKTLASIKGLSEPKVDKIV  73

Query  379   EAASKLVPLGFTSASQLHAQRLEIIQITSGSKELDKVLEGGIETGSITEIYGEFRSGKTQ  558
             EAASKLVPLGFT+A++ H +R EIIQ+T+GSKE DK+L+GG+ETGSITEI+GEFR+GKTQ
Sbjct  74    EAASKLVPLGFTTAAEFHQKRSEIIQLTTGSKEFDKLLQGGVETGSITEIFGEFRTGKTQ  133

Query  559   LCHTLCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIADRFGLNGADVLENVAYARAY  738
             +CH+L VTCQLP+D GGGEGK +YID EGTFRP+RLL +A+R+GL+G +VLENVAYARAY
Sbjct  134   ICHSLAVTCQLPVDLGGGEGKCLYIDTEGTFRPERLLAVAERYGLSGTEVLENVAYARAY  193

Query  739   NTDHQSRLLLEAASMMVETRFALMIVDSATALYRTDFSGRGELSARQMHLAKFLRSLQKL  918
             NTDHQ+ LL++AA+MM E+R+AL++VDSATALYRTD+SGRGELSARQMHLA+FLR+L +L
Sbjct  194   NTDHQNELLVQAAAMMSESRYALLVVDSATALYRTDYSGRGELSARQMHLARFLRALLRL  253

Query  919   ADEFGVAVVITNQVVAQVDGSAIFAGPQIKPIGGNIMAHASTTRLALRKGRGEERVCKVV  1098
             ADEFGVAVVITNQVVAQVDG+++F     KPIGGNIMAHASTTRL LRKGRGE R+CK+ 
Sbjct  254   ADEFGVAVVITNQVVAQVDGASMFTADPKKPIGGNIMAHASTTRLYLRKGRGETRICKIY  313

Query  1099  SSPCLAEAEARFQISPEGVTDVKD  1170
              SPCL E+EA F I P+G+ D K+
Sbjct  314   DSPCLPESEAMFAILPDGIGDAKE  337



>ref|XP_010807474.1| PREDICTED: DNA repair protein RAD51 homolog 1 isoform X1 [Bos 
taurus]
Length=327

 Score =   487 bits (1254),  Expect = 5e-168, Method: Compositional matrix adjust.
 Identities = 226/311 (73%), Positives = 278/311 (89%), Gaps = 0/311 (0%)
 Frame = +1

Query  238   QESGISAIDVKKLKDAGLCTVESVVYSPRKDLLQIKGISEAKVDKIIEAASKLVPLGFTS  417
             ++ GI+A DVKKL++AG  TVE+V Y+P+K+L+ IKGISEAK DKI+  A+KLVP+GFT+
Sbjct  17    RQCGINANDVKKLEEAGFHTVEAVAYAPKKELINIKGISEAKADKILTEAAKLVPMGFTT  76

Query  418   ASQLHAQRLEIIQITSGSKELDKVLEGGIETGSITEIYGEFRSGKTQLCHTLCVTCQLPL  597
             A++ H +R EIIQIT+GSKELDK+L+GGIETGSITE++GEFR+GKTQ+CHTL VTCQLP+
Sbjct  77    ATEFHQRRSEIIQITTGSKELDKLLQGGIETGSITEMFGEFRTGKTQICHTLAVTCQLPI  136

Query  598   DQGGGEGKAMYIDAEGTFRPQRLLQIADRFGLNGADVLENVAYARAYNTDHQSRLLLEAA  777
             D+GGGEGKAMYID EGTFRP+RLL +A+R+GL+G+DVL+NVAYAR +NTDHQ++LL +A+
Sbjct  137   DRGGGEGKAMYIDTEGTFRPERLLAVAERYGLSGSDVLDNVAYARGFNTDHQTQLLYQAS  196

Query  778   SMMVETRFALMIVDSATALYRTDFSGRGELSARQMHLAKFLRSLQKLADEFGVAVVITNQ  957
             +MMVE+R+AL+IVDSATALYRTD+SGRGELSARQMHLA+FLR L +LADEFGVAVVITNQ
Sbjct  197   AMMVESRYALLIVDSATALYRTDYSGRGELSARQMHLARFLRMLLRLADEFGVAVVITNQ  256

Query  958   VVAQVDGSAIFAGPQIKPIGGNIMAHASTTRLALRKGRGEERVCKVVSSPCLAEAEARFQ  1137
             VVAQVDG+A+FA    KPIGGNI+AHASTTRL LRKGRGE R+CK+  SPCL EAEA F 
Sbjct  257   VVAQVDGAAMFAADPKKPIGGNIIAHASTTRLYLRKGRGETRICKIYDSPCLPEAEAMFA  316

Query  1138  ISPEGVTDVKD  1170
             I+ +GV D KD
Sbjct  317   INADGVGDAKD  327



>ref|XP_002169171.1| PREDICTED: DNA repair protein RAD51 homolog A-like [Hydra vulgaris]
Length=336

 Score =   487 bits (1253),  Expect = 8e-168, Method: Compositional matrix adjust.
 Identities = 225/329 (68%), Positives = 279/329 (85%), Gaps = 0/329 (0%)
 Frame = +1

Query  184   QQDEVEEIQHGPFPIEQLQESGISAIDVKKLKDAGLCTVESVVYSPRKDLLQIKGISEAK  363
             Q +E +    GP  + +L++ GISA D+KKL +AG  TVES+ Y+P+K LL +KGISEAK
Sbjct  8     QHEEEDTDDGGPILVSKLEQHGISASDIKKLSEAGFYTVESLAYTPKKTLLAVKGISEAK  67

Query  364   VDKIIEAASKLVPLGFTSASQLHAQRLEIIQITSGSKELDKVLEGGIETGSITEIYGEFR  543
              DKI+    KLVP+GFT+A++ H +R EIIQI+SGSKELDK+L+GG ETGSITEI+GEFR
Sbjct  68    ADKILSEVIKLVPMGFTTATEFHQKRSEIIQISSGSKELDKLLQGGFETGSITEIFGEFR  127

Query  544   SGKTQLCHTLCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIADRFGLNGADVLENVA  723
             +GKTQLCH LCVTCQLP+D GG EGKAMY+D EGTFRP+R L +A+R+GLNG +VL+NVA
Sbjct  128   TGKTQLCHQLCVTCQLPVDCGGAEGKAMYVDTEGTFRPERCLAVAERYGLNGQEVLDNVA  187

Query  724   YARAYNTDHQSRLLLEAASMMVETRFALMIVDSATALYRTDFSGRGELSARQMHLAKFLR  903
             YARAYN+DHQ++LL+ A++MM E R+AL+IVDSATALYRTD+SGRGELSARQMHLA+FLR
Sbjct  188   YARAYNSDHQTQLLIHASAMMSEARYALLIVDSATALYRTDYSGRGELSARQMHLARFLR  247

Query  904   SLQKLADEFGVAVVITNQVVAQVDGSAIFAGPQIKPIGGNIMAHASTTRLALRKGRGEER  1083
             +L +LADEFGVAVVITNQVVAQVDG+++F     KPIGGNIMAHASTTRL+LRKGRGE R
Sbjct  248   TLLRLADEFGVAVVITNQVVAQVDGASMFQTDPKKPIGGNIMAHASTTRLSLRKGRGETR  307

Query  1084  VCKVVSSPCLAEAEARFQISPEGVTDVKD  1170
             +CK+  SPCL E+EA F I+P+G+ D K+
Sbjct  308   ICKIYDSPCLPESEAMFTINPDGIGDAKE  336



>gb|KFO32940.1| DNA repair protein RAD51 like protein 1 [Fukomys damarensis]
Length=333

 Score =   486 bits (1251),  Expect = 1e-167, Method: Compositional matrix adjust.
 Identities = 230/325 (71%), Positives = 281/325 (86%), Gaps = 6/325 (2%)
 Frame = +1

Query  196   VEEIQHGPFPIEQLQESGISAIDVKKLKDAGLCTVESVVYSPRKDLLQIKGISEAKVDKI  375
             VEE   GP PI +L++ GI+A DVKKL++AG  TVE+V Y+P+K+L+ IKGISEAK DKI
Sbjct  15    VEEESFGPQPISRLEQCGINANDVKKLEEAGFHTVEAVAYAPKKELINIKGISEAKADKI  74

Query  376   IEAASKLVPLGFTSASQLHAQRLEIIQITSGSKELDKVLEGGIETGSITEIYGEFRSGKT  555
             +  A+KLVP+GFT+A++ H +R EIIQIT+GSKELDK+L+GGIETGSITE++GEFR+GKT
Sbjct  75    LAEAAKLVPMGFTTATEFHQRRSEIIQITTGSKELDKLLQGGIETGSITEMFGEFRTGKT  134

Query  556   QLCHTLCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIADRFGLNGADVLENVAYARA  735
             Q+CHTL VTCQLP+D+GGGEGKAMYID EGTFRP+RLL +A+      +DVL+NVAYAR 
Sbjct  135   QICHTLAVTCQLPIDRGGGEGKAMYIDTEGTFRPERLLAVAE------SDVLDNVAYARG  188

Query  736   YNTDHQSRLLLEAASMMVETRFALMIVDSATALYRTDFSGRGELSARQMHLAKFLRSLQK  915
             +NTDHQ++LL +A++MMVE+R+AL+IVDSATALYRTD+SGRGELSARQMHLA+FLR L +
Sbjct  189   FNTDHQTQLLYQASAMMVESRYALLIVDSATALYRTDYSGRGELSARQMHLARFLRMLLR  248

Query  916   LADEFGVAVVITNQVVAQVDGSAIFAGPQIKPIGGNIMAHASTTRLALRKGRGEERVCKV  1095
             LADEFGVAVVITNQVVAQVDG+A+FA    KPIGGNI+AHASTTRL LRKGRGE R+CK+
Sbjct  249   LADEFGVAVVITNQVVAQVDGAAMFAADPKKPIGGNIIAHASTTRLYLRKGRGETRICKI  308

Query  1096  VSSPCLAEAEARFQISPEGVTDVKD  1170
               SPCL EAEA F I+ +GV D KD
Sbjct  309   YDSPCLPEAEAMFAINADGVGDAKD  333



>ref|XP_002126934.1| PREDICTED: DNA repair protein RAD51 homolog 1-like [Ciona intestinalis]
Length=338

 Score =   486 bits (1251),  Expect = 2e-167, Method: Compositional matrix adjust.
 Identities = 224/319 (70%), Positives = 279/319 (87%), Gaps = 0/319 (0%)
 Frame = +1

Query  214   GPFPIEQLQESGISAIDVKKLKDAGLCTVESVVYSPRKDLLQIKGISEAKVDKIIEAASK  393
             GP  I +L++SGISA D+KKLK+ G  TVE++ Y+P+K+L+ +KGISEAK DKII  A+K
Sbjct  20    GPLLINKLEQSGISAGDIKKLKEHGYHTVEALAYAPKKELIGVKGISEAKADKIIIEAAK  79

Query  394   LVPLGFTSASQLHAQRLEIIQITSGSKELDKVLEGGIETGSITEIYGEFRSGKTQLCHTL  573
             LVP+GFT+A++ H +R EIIQIT+GSKELDK+L+GGIETGSITEI+GEFR+GKTQ+CHT+
Sbjct  80    LVPMGFTTATEFHQRRSEIIQITTGSKELDKLLQGGIETGSITEIFGEFRTGKTQICHTI  139

Query  574   CVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIADRFGLNGADVLENVAYARAYNTDHQ  753
               TCQLP++QGGGEGK +YID EGTFRP+RLL +A+R+GLNGADVL+NVAYARAYNTDHQ
Sbjct  140   AATCQLPIEQGGGEGKCLYIDTEGTFRPERLLAVAERYGLNGADVLDNVAYARAYNTDHQ  199

Query  754   SRLLLEAASMMVETRFALMIVDSATALYRTDFSGRGELSARQMHLAKFLRSLQKLADEFG  933
             S+LL++AA+MM ETR+A+++VDSATALYRTD+SGRGELSARQMHL +FLR+L +LADEFG
Sbjct  200   SQLLIQAAAMMSETRYAVIVVDSATALYRTDYSGRGELSARQMHLGRFLRTLLRLADEFG  259

Query  934   VAVVITNQVVAQVDGSAIFAGPQIKPIGGNIMAHASTTRLALRKGRGEERVCKVVSSPCL  1113
             VAV+ITNQVVAQVDG A+F     KPIGG+IMAHASTTRL LRKGRG+ R+CK+  SPCL
Sbjct  260   VAVIITNQVVAQVDGGAMFCADPKKPIGGHIMAHASTTRLYLRKGRGDTRICKIYDSPCL  319

Query  1114  AEAEARFQISPEGVTDVKD  1170
              E+E  F I+ +G+ D KD
Sbjct  320   PESEVMFCINSDGIGDTKD  338



>gb|AGH55904.1| Rad51 [Brachionus manjavacas]
Length=340

 Score =   486 bits (1251),  Expect = 2e-167, Method: Compositional matrix adjust.
 Identities = 227/326 (70%), Positives = 279/326 (86%), Gaps = 0/326 (0%)
 Frame = +1

Query  193   EVEEIQHGPFPIEQLQESGISAIDVKKLKDAGLCTVESVVYSPRKDLLQIKGISEAKVDK  372
             E +  Q GP  I +L+ +GI+  D+KKL++AGL T+E+V Y P+K LL IKGISE K +K
Sbjct  15    ETQSDQFGPTSITKLEVNGITGADIKKLQEAGLHTIEAVAYVPKKLLLSIKGISEQKAEK  74

Query  373   IIEAASKLVPLGFTSASQLHAQRLEIIQITSGSKELDKVLEGGIETGSITEIYGEFRSGK  552
             I+  A KL+P+GFT+AS+ H +R EIIQ+T+GSKELDK+L+GG ETGSITE++GEFR+GK
Sbjct  75    ILMEAYKLIPMGFTTASEFHLKRSEIIQLTTGSKELDKLLQGGFETGSITEMFGEFRTGK  134

Query  553   TQLCHTLCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIADRFGLNGADVLENVAYAR  732
             TQLCH L VTCQLP+D GGGEGKA+YID EGTFRP+RLL IA+R+GLNG+DVL+NVAYAR
Sbjct  135   TQLCHQLAVTCQLPIDMGGGEGKALYIDTEGTFRPERLLAIAERYGLNGSDVLDNVAYAR  194

Query  733   AYNTDHQSRLLLEAASMMVETRFALMIVDSATALYRTDFSGRGELSARQMHLAKFLRSLQ  912
             AYN+DHQ++LLL+A++MM ETR+AL+IVDSATALYRTD+SGRGELS RQMH+AKFLR+LQ
Sbjct  195   AYNSDHQTQLLLQASAMMTETRYALIIVDSATALYRTDYSGRGELSERQMHMAKFLRTLQ  254

Query  913   KLADEFGVAVVITNQVVAQVDGSAIFAGPQIKPIGGNIMAHASTTRLALRKGRGEERVCK  1092
             ++ADEFGVAVVITNQVVAQVDG+++F     KPIGGNIMAHASTTRL LRKGRG+ RVCK
Sbjct  255   RIADEFGVAVVITNQVVAQVDGASMFQADPKKPIGGNIMAHASTTRLYLRKGRGDSRVCK  314

Query  1093  VVSSPCLAEAEARFQISPEGVTDVKD  1170
             V  SP L E+EA F IS EG+ D K+
Sbjct  315   VYDSPSLPESEAVFAISTEGIIDSKE  340



>ref|XP_002405184.1| DNA repair protein RAD51/RHP55, putative [Ixodes scapularis]
 gb|EEC01352.1| DNA repair protein RAD51/RHP55, putative, partial [Ixodes scapularis]
Length=352

 Score =   486 bits (1251),  Expect = 3e-167, Method: Compositional matrix adjust.
 Identities = 223/334 (67%), Positives = 286/334 (86%), Gaps = 0/334 (0%)
 Frame = +1

Query  169   SVQERQQDEVEEIQHGPFPIEQLQESGISAIDVKKLKDAGLCTVESVVYSPRKDLLQIKG  348
             ++ E  Q+EV +  +GP  I++L+ +GI A D+KKL++AG  TVE+V Y+P+K LL IKG
Sbjct  19    TMTEVAQEEVLDENYGPVRIQKLEGNGIGAADIKKLEEAGFHTVEAVAYAPKKQLLTIKG  78

Query  349   ISEAKVDKIIEAASKLVPLGFTSASQLHAQRLEIIQITSGSKELDKVLEGGIETGSITEI  528
             ISEAK DK++  A+KLVPLGFT+A+++H +R +I+QIT+GS ELDK+L GGIETGSITE+
Sbjct  79    ISEAKADKLLAEAAKLVPLGFTTATEIHQKRSDIVQITTGSTELDKLLGGGIETGSITEV  138

Query  529   YGEFRSGKTQLCHTLCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIADRFGLNGADV  708
             +GEFR+GKTQLCH + VTCQLP++  GGEGK +YID EGTFRP+RLL  A+++GL+G DV
Sbjct  139   FGEFRTGKTQLCHMMAVTCQLPIEHSGGEGKCLYIDTEGTFRPERLLAAAEKYGLSGPDV  198

Query  709   LENVAYARAYNTDHQSRLLLEAASMMVETRFALMIVDSATALYRTDFSGRGELSARQMHL  888
             L+NVAYARAYN+DHQ++LL++A++MM ETR+AL++VDSA ALYRTD+SGRGELSARQMHL
Sbjct  199   LDNVAYARAYNSDHQTQLLIQASAMMAETRYALLVVDSAMALYRTDYSGRGELSARQMHL  258

Query  889   AKFLRSLQKLADEFGVAVVITNQVVAQVDGSAIFAGPQIKPIGGNIMAHASTTRLALRKG  1068
             A+FLR L +LADEFGVAV+ITNQVVAQVDG+++FA    KPIGGNIMAHASTTRL LRKG
Sbjct  259   ARFLRMLLRLADEFGVAVLITNQVVAQVDGASMFAADPKKPIGGNIMAHASTTRLYLRKG  318

Query  1069  RGEERVCKVVSSPCLAEAEARFQISPEGVTDVKD  1170
             RGE R+CK+  SPCL EAEA F I+P+G+ DV+D
Sbjct  319   RGETRICKIYDSPCLPEAEAMFAITPQGIADVRD  352



>ref|XP_003378865.1| DNA repair and recombination protein RadA [Trichinella spiralis]
 gb|EFV61540.1| DNA repair and recombination protein RadA [Trichinella spiralis]
Length=364

 Score =   485 bits (1248),  Expect = 1e-166, Method: Compositional matrix adjust.
 Identities = 230/329 (70%), Positives = 280/329 (85%), Gaps = 2/329 (1%)
 Frame = +1

Query  187   QDEVEEIQHGPFPIEQLQESGISAIDVKKLKDAGLCTVESVVYSPRKDLLQIKGISEAKV  366
             Q+E+EE   GP PI +L++ GI  +D+KKL++AG  T+ESV ++P+K L+ IKGISEAK 
Sbjct  37    QEEMEE-NFGPQPISRLEQFGIPNVDIKKLEEAGFYTIESVAFTPKKVLIDIKGISEAKA  95

Query  367   DKIIEAASKLVPLGFTSASQLHAQRLEIIQITSGSKELDKVLEGGIETGSITEIYGEFRS  546
             DKI+  ASKLVP+GFT+A+  H +R EIIQIT+GSKELDK+L+GGIETGSITE++GEFR+
Sbjct  96    DKILSEASKLVPMGFTTATDFHQKRSEIIQITTGSKELDKLLQGGIETGSITEVFGEFRT  155

Query  547   GKTQLCHTLCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIADRFGLNGADVLENVAY  726
             GKTQLCHTL VTCQLP+D GGGEGK +YID EGTFRP+RLL +ADRF L+G DVL+NVAY
Sbjct  156   GKTQLCHTLAVTCQLPVDMGGGEGKCLYIDTEGTFRPERLLSVADRFQLSGPDVLDNVAY  215

Query  727   ARAYNTDHQSRLLLEAASMMVETRFALMIVDSATALYRTDFSGRGELSARQMHLAKFLRS  906
             ARAYNTDHQS+LL++A++MM E+R+AL+IVDSATALYRTD+SGRGELSARQMHL +FLR 
Sbjct  216   ARAYNTDHQSQLLIQASAMMSESRYALLIVDSATALYRTDYSGRGELSARQMHLGRFLRY  275

Query  907   LQKLADEFGVAVVITNQVVAQVD-GSAIFAGPQIKPIGGNIMAHASTTRLALRKGRGEER  1083
             L +LADEFGVAV+ITNQVVAQVD G+A+F     KPIGGNIMAHASTTRL LRKGRGE R
Sbjct  276   LLRLADEFGVAVLITNQVVAQVDGGTAMFQADPKKPIGGNIMAHASTTRLYLRKGRGESR  335

Query  1084  VCKVVSSPCLAEAEARFQISPEGVTDVKD  1170
             +CK+  SPCL E+EA F I   G+ D K+
Sbjct  336   ICKIYDSPCLPESEAVFAILSSGIGDAKE  364



>gb|ADD24297.1| DNA repair protein RAD51 homolog 1 [Lepeophtheirus salmonis]
Length=350

 Score =   483 bits (1244),  Expect = 3e-166, Method: Compositional matrix adjust.
 Identities = 222/319 (70%), Positives = 274/319 (86%), Gaps = 0/319 (0%)
 Frame = +1

Query  214   GPFPIEQLQESGISAIDVKKLKDAGLCTVESVVYSPRKDLLQIKGISEAKVDKIIEAASK  393
             GP PI  L++ GISA DVKKL + G  TVES+VY+P+K LL IKGISEAK DK++    K
Sbjct  32    GPMPISVLEQHGISASDVKKLSEVGYHTVESIVYAPKKSLLAIKGISEAKADKLLAEGQK  91

Query  394   LVPLGFTSASQLHAQRLEIIQITSGSKELDKVLEGGIETGSITEIYGEFRSGKTQLCHTL  573
             L+P GFT+A+++H +R +IIQIT+GSKELDK+L+GGIETGSITE++GEFR+GK+QLCHTL
Sbjct  92    LIPTGFTTATEMHIRRSQIIQITTGSKELDKLLKGGIETGSITELFGEFRTGKSQLCHTL  151

Query  574   CVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIADRFGLNGADVLENVAYARAYNTDHQ  753
              VTCQLP+D GG EGK +YID EGTFRP+RLL +A+R+ L+G DVL+NVAYARAYN+DHQ
Sbjct  152   AVTCQLPIDHGGAEGKCLYIDTEGTFRPERLLAVAERYNLSGNDVLDNVAYARAYNSDHQ  211

Query  754   SRLLLEAASMMVETRFALMIVDSATALYRTDFSGRGELSARQMHLAKFLRSLQKLADEFG  933
             S+LL++A++MM E+R+AL+IVDS+TALYRTD+SGRGELS RQMHLA+FLR L +LADEFG
Sbjct  212   SQLLIQASAMMAESRYALIIVDSSTALYRTDYSGRGELSTRQMHLARFLRMLLRLADEFG  271

Query  934   VAVVITNQVVAQVDGSAIFAGPQIKPIGGNIMAHASTTRLALRKGRGEERVCKVVSSPCL  1113
             V VVITNQVVAQVDG+A+F+    KPIGGNIMAHASTTRL LRKGRGE+R+CK+  SPCL
Sbjct  272   VGVVITNQVVAQVDGAAMFSADPKKPIGGNIMAHASTTRLYLRKGRGEQRICKIYDSPCL  331

Query  1114  AEAEARFQISPEGVTDVKD  1170
             AE EA F I+ +G+ D KD
Sbjct  332   AEGEAIFAITADGIGDSKD  350



>ref|XP_004346233.1| DNA repair protein RAD51 1 [Capsaspora owczarzaki ATCC 30864]
 gb|KJE95065.1| DNA repair protein RAD51 1 [Capsaspora owczarzaki ATCC 30864]
Length=337

 Score =   483 bits (1242),  Expect = 4e-166, Method: Compositional matrix adjust.
 Identities = 225/319 (71%), Positives = 271/319 (85%), Gaps = 0/319 (0%)
 Frame = +1

Query  214   GPFPIEQLQESGISAIDVKKLKDAGLCTVESVVYSPRKDLLQIKGISEAKVDKIIEAASK  393
             GP  + +L++ GISA D KKL +AG  TVESVVY+PRK LL +KGISEAK DKII  A+K
Sbjct  19    GPMLVSRLEQHGISAADTKKLMEAGYNTVESVVYTPRKTLLTVKGISEAKADKIIGEATK  78

Query  394   LVPLGFTSASQLHAQRLEIIQITSGSKELDKVLEGGIETGSITEIYGEFRSGKTQLCHTL  573
             LVP+GFT+AS+ H +R +++ +TSGSKELDK+L+GG ETG+ITEI+GEFR+GKTQ+CHTL
Sbjct  79    LVPMGFTTASEFHQRRSDLVTLTSGSKELDKLLQGGFETGAITEIFGEFRTGKTQICHTL  138

Query  574   CVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIADRFGLNGADVLENVAYARAYNTDHQ  753
              VTCQLP  QGGGEGK +YID EGTFRP+RLL  A+R+GL+G DVL+NVAYARAYNTDHQ
Sbjct  139   AVTCQLPTSQGGGEGKCLYIDTEGTFRPERLLAAAERYGLSGPDVLDNVAYARAYNTDHQ  198

Query  754   SRLLLEAASMMVETRFALMIVDSATALYRTDFSGRGELSARQMHLAKFLRSLQKLADEFG  933
               LL++A++MM E+R+AL+IVDSATALYRTD+SGRGELSARQMHLAKF+RSL +LADEFG
Sbjct  199   LALLMQASAMMAESRYALLIVDSATALYRTDYSGRGELSARQMHLAKFMRSLLRLADEFG  258

Query  934   VAVVITNQVVAQVDGSAIFAGPQIKPIGGNIMAHASTTRLALRKGRGEERVCKVVSSPCL  1113
             +AVV+TNQVVAQVDG A+FA    KPIGGNIMAHASTTRL LRKGR E R+CK+  SP L
Sbjct  259   IAVVVTNQVVAQVDGGAMFAADPKKPIGGNIMAHASTTRLYLRKGRAETRICKIYDSPSL  318

Query  1114  AEAEARFQISPEGVTDVKD  1170
              EAEA F I+ +G+ D KD
Sbjct  319   PEAEAVFAINADGIGDAKD  337



>gb|ACO14764.1| DNA repair protein RAD51 homolog 1 [Caligus clemensi]
Length=346

 Score =   483 bits (1242),  Expect = 4e-166, Method: Compositional matrix adjust.
 Identities = 221/319 (69%), Positives = 276/319 (87%), Gaps = 0/319 (0%)
 Frame = +1

Query  214   GPFPIEQLQESGISAIDVKKLKDAGLCTVESVVYSPRKDLLQIKGISEAKVDKIIEAASK  393
             GP P+  L++ GISA D+KKL +AG  TVES+VY+P+K+LL IKGISEAK DK++  + K
Sbjct  28    GPMPLSVLEQHGISAGDMKKLSEAGYHTVESIVYAPKKNLLAIKGISEAKADKLLAESQK  87

Query  394   LVPLGFTSASQLHAQRLEIIQITSGSKELDKVLEGGIETGSITEIYGEFRSGKTQLCHTL  573
             L+P GFT+A+++H +R +IIQIT+GSKELDK+L+GGIETGSITE++GEFR+GK+QLCHTL
Sbjct  88    LIPTGFTTATEMHMRRSQIIQITTGSKELDKLLKGGIETGSITELFGEFRTGKSQLCHTL  147

Query  574   CVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIADRFGLNGADVLENVAYARAYNTDHQ  753
              VTCQLP+D GG EGK +YID EGTFRP+RLL +A+R+ L+G DVL+NVAYARAYN+DHQ
Sbjct  148   AVTCQLPIDHGGAEGKCLYIDTEGTFRPERLLAVAERYSLSGNDVLDNVAYARAYNSDHQ  207

Query  754   SRLLLEAASMMVETRFALMIVDSATALYRTDFSGRGELSARQMHLAKFLRSLQKLADEFG  933
             S+LL++A++MM E+R+AL+IVDS+TALYRTD+SGRGELS RQMHLA+FLR L +LADEFG
Sbjct  208   SQLLIQASAMMAESRYALIIVDSSTALYRTDYSGRGELSTRQMHLARFLRMLLRLADEFG  267

Query  934   VAVVITNQVVAQVDGSAIFAGPQIKPIGGNIMAHASTTRLALRKGRGEERVCKVVSSPCL  1113
             V VVITNQVVAQVDG+A+FA    KPIGGNIMAHASTTRL  RKGRGE+R+CK+  SPCL
Sbjct  268   VGVVITNQVVAQVDGAAMFAADPKKPIGGNIMAHASTTRLYFRKGRGEQRICKIYDSPCL  327

Query  1114  AEAEARFQISPEGVTDVKD  1170
             AE EA F I+ +G+ D KD
Sbjct  328   AEGEAVFAINADGIGDAKD  346



>gb|KFO93471.1| DNA repair protein RAD51 1 [Buceros rhinoceros silvestris]
Length=332

 Score =   482 bits (1240),  Expect = 6e-166, Method: Compositional matrix adjust.
 Identities = 230/336 (68%), Positives = 284/336 (85%), Gaps = 7/336 (2%)
 Frame = +1

Query  163   QKSVQERQQDEVEEIQHGPFPIEQLQESGISAIDVKKLKDAGLCTVESVVYSPRKDLLQI  342
             Q  ++      VEE   GP  I +L++ GI+A DVKKL++AG  TVE+V Y+P+K+LL I
Sbjct  4     QMQLEANADSSVEEESFGPQLIARLEQCGINANDVKKLEEAGFHTVEAVAYAPKKELLNI  63

Query  343   KGISEAKVDKIIEAASKLVPLGFTSASQLHAQRLEIIQITSGSKELDKVLEGGIETGSIT  522
             KGISEAK DKI+  A+KLVP+GFT+A++ H +R EIIQIT+GSKELDK+L+GGIETGSIT
Sbjct  64    KGISEAKADKILAEAAKLVPMGFTTATEFHQRRSEIIQITTGSKELDKLLQGGIETGSIT  123

Query  523   EIYGEFRSGKTQLCHTLCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIADRFGLNGA  702
             E++GEFR+GKTQLCHTL VTCQLP+D+GGGEGKAMYID EGTFRP+RLL +A+R+GL+G+
Sbjct  124   ELFGEFRTGKTQLCHTLAVTCQLPIDRGGGEGKAMYIDTEGTFRPERLLAVAERYGLSGS  183

Query  703   DVLENVAYARAYNTDHQSRLLLEAASMMVETRFALMIVDSATALYRTDFSGRGELSARQM  882
             DVL+NVAYAR +NTDHQ++LL +A++MM E+R+AL+IVDSATALYRTD+SGRGEL+ARQM
Sbjct  184   DVLDNVAYARGFNTDHQTQLLYQASAMMAESRYALLIVDSATALYRTDYSGRGELAARQM  243

Query  883   HLAKFLRSLQKLADEFGVAVVITNQVVAQVDGSAIFAGPQIKPIGGNIMAHASTTRLALR  1062
             HLA+FLR L +LADEFGVAV+ITNQVVAQVD       P+ KPIGGNI+AHASTTRL LR
Sbjct  244   HLARFLRMLLRLADEFGVAVLITNQVVAQVD------DPK-KPIGGNIIAHASTTRLYLR  296

Query  1063  KGRGEERVCKVVSSPCLAEAEARFQISPEGVTDVKD  1170
             KGRGE R+CK+  SPCL EAEA F I+ +GV D KD
Sbjct  297   KGRGETRICKIYDSPCLPEAEAMFAINADGVGDAKD  332



>ref|XP_004993801.1| rad51 protein [Salpingoeca rosetta]
 gb|EGD73519.1| rad51 protein [Salpingoeca rosetta]
Length=332

 Score =   481 bits (1239),  Expect = 8e-166, Method: Compositional matrix adjust.
 Identities = 227/319 (71%), Positives = 271/319 (85%), Gaps = 0/319 (0%)
 Frame = +1

Query  214   GPFPIEQLQESGISAIDVKKLKDAGLCTVESVVYSPRKDLLQIKGISEAKVDKIIEAASK  393
             GP PI +L+  GISA D +KL DAG  TVESV Y P+K LL +KGISEAK DKII  ASK
Sbjct  14    GPIPINRLEGQGISANDCRKLTDAGYHTVESVAYVPKKQLLGVKGISEAKADKIINEASK  73

Query  394   LVPLGFTSASQLHAQRLEIIQITSGSKELDKVLEGGIETGSITEIYGEFRSGKTQLCHTL  573
             L+P+GFT+AS+ H +R EI+ I+ GSKELD +L+GGIETGSITE++GEFR+GKTQLCHTL
Sbjct  74    LLPMGFTTASEFHQRRQEIVNISCGSKELDTLLQGGIETGSITEMFGEFRTGKTQLCHTL  133

Query  574   CVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIADRFGLNGADVLENVAYARAYNTDHQ  753
              VTCQLP+DQGG EGK +YID EGTFRP+RLL +A+R+GL+G DVL+NVAYARAYN+DHQ
Sbjct  134   AVTCQLPIDQGGAEGKCLYIDTEGTFRPERLLAVAERYGLSGEDVLDNVAYARAYNSDHQ  193

Query  754   SRLLLEAASMMVETRFALMIVDSATALYRTDFSGRGELSARQMHLAKFLRSLQKLADEFG  933
               LL +A++MM E+R+ALM+VDSATAL+RTD+SGRGELSARQM LA+FLR+L +LADEFG
Sbjct  194   MHLLQQASAMMAESRYALMVVDSATALFRTDYSGRGELSARQMALAQFLRTLMRLADEFG  253

Query  934   VAVVITNQVVAQVDGSAIFAGPQIKPIGGNIMAHASTTRLALRKGRGEERVCKVVSSPCL  1113
             +AVVITNQVVAQVDG+A+FA    KPIGGNIMAHASTTRL LRKGRGE RVCKV  SPCL
Sbjct  254   IAVVITNQVVAQVDGAAMFAADPKKPIGGNIMAHASTTRLYLRKGRGETRVCKVYDSPCL  313

Query  1114  AEAEARFQISPEGVTDVKD  1170
              E+EA F I+ +G+ D KD
Sbjct  314   PESEAVFAINADGIGDAKD  332



>gb|ACO13181.1| DNA repair protein RAD51 homolog 1 [Lepeophtheirus salmonis]
Length=350

 Score =   481 bits (1237),  Expect = 4e-165, Method: Compositional matrix adjust.
 Identities = 221/319 (69%), Positives = 272/319 (85%), Gaps = 0/319 (0%)
 Frame = +1

Query  214   GPFPIEQLQESGISAIDVKKLKDAGLCTVESVVYSPRKDLLQIKGISEAKVDKIIEAASK  393
             GP PI  L++ GISA DVKKL + G  TVES+VY+P+K LL IKGISEAK DK++    K
Sbjct  32    GPMPISVLEQHGISASDVKKLSEVGYHTVESIVYAPKKSLLAIKGISEAKADKLLAEGQK  91

Query  394   LVPLGFTSASQLHAQRLEIIQITSGSKELDKVLEGGIETGSITEIYGEFRSGKTQLCHTL  573
             L+P GFT+ +++H +R +IIQIT+GSKELDK+L+GGIETGSITE++GEFR+GK+QLCHTL
Sbjct  92    LIPTGFTTVTEMHIRRSQIIQITTGSKELDKLLKGGIETGSITELFGEFRTGKSQLCHTL  151

Query  574   CVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIADRFGLNGADVLENVAYARAYNTDHQ  753
              VTCQLP+D GG EGK +YID EGTFRP+RLL +A+R+ L+G DVL+NVAYARAYN+DHQ
Sbjct  152   AVTCQLPIDHGGAEGKCLYIDTEGTFRPERLLAVAERYNLSGNDVLDNVAYARAYNSDHQ  211

Query  754   SRLLLEAASMMVETRFALMIVDSATALYRTDFSGRGELSARQMHLAKFLRSLQKLADEFG  933
             S+LL++A++MM E R+AL+IVDS+TALYRTD+SGRGELS RQMHLA+FLR L +LADEFG
Sbjct  212   SQLLIQASAMMAELRYALIIVDSSTALYRTDYSGRGELSTRQMHLARFLRMLLRLADEFG  271

Query  934   VAVVITNQVVAQVDGSAIFAGPQIKPIGGNIMAHASTTRLALRKGRGEERVCKVVSSPCL  1113
             V VVITNQVVAQVDG+A+F+    KPIGGNIMAHASTTRL LRKGRGE+R+CK+  SPCL
Sbjct  272   VGVVITNQVVAQVDGAAMFSADPKKPIGGNIMAHASTTRLYLRKGRGEQRICKIYDSPCL  331

Query  1114  AEAEARFQISPEGVTDVKD  1170
             AE EA F I+ +G+ D KD
Sbjct  332   AEGEAIFAITADGIGDSKD  350



>ref|XP_009163242.1| hypothetical protein T265_01035 [Opisthorchis viverrini]
 gb|KER32942.1| hypothetical protein T265_01035 [Opisthorchis viverrini]
Length=365

 Score =   478 bits (1231),  Expect = 4e-164, Method: Compositional matrix adjust.
 Identities = 222/316 (70%), Positives = 272/316 (86%), Gaps = 1/316 (0%)
 Frame = +1

Query  223   PIEQLQESGISAIDVKKLKDAGLCTVESVVYSPRKDLLQIKGISEAKVDKIIEAASKLVP  402
             P+ Q   +G++A D+KKL++AG  +VES+ + P+K LL IKGISEAK DKI EAA KLVP
Sbjct  51    PVYQ-SSAGVAAADIKKLREAGFHSVESIQFVPKKALLAIKGISEAKADKITEAAQKLVP  109

Query  403   LGFTSASQLHAQRLEIIQITSGSKELDKVLEGGIETGSITEIYGEFRSGKTQLCHTLCVT  582
              GFT+A++ H +R EIIQ+T+GSKELDK+L+GGIETGSITE++GEFR+GKTQ+CHTL VT
Sbjct  110   FGFTTATEFHQKRSEIIQLTTGSKELDKLLQGGIETGSITELFGEFRTGKTQICHTLAVT  169

Query  583   CQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIADRFGLNGADVLENVAYARAYNTDHQSRL  762
             CQLP+D GGGEGK +YID EGTFRP+RLL +A+R+GL+G+DVL+NVAYARAYNTDHQ  L
Sbjct  170   CQLPIDMGGGEGKCLYIDTEGTFRPERLLAVAERYGLSGSDVLDNVAYARAYNTDHQMEL  229

Query  763   LLEAASMMVETRFALMIVDSATALYRTDFSGRGELSARQMHLAKFLRSLQKLADEFGVAV  942
             L+ AA+MM E+R+AL++VDS+TALYRTD+SGRGELSARQMHLA+FLR+L +LADEFGVAV
Sbjct  230   LINAAAMMSESRYALLVVDSSTALYRTDYSGRGELSARQMHLARFLRTLLRLADEFGVAV  289

Query  943   VITNQVVAQVDGSAIFAGPQIKPIGGNIMAHASTTRLALRKGRGEERVCKVVSSPCLAEA  1122
             VITNQVVAQVDG+A+F     KPIGGNIM HASTTRL LRKGRGE R+CK+  SPCL EA
Sbjct  290   VITNQVVAQVDGAAMFTADPKKPIGGNIMGHASTTRLYLRKGRGETRICKIYDSPCLPEA  349

Query  1123  EARFQISPEGVTDVKD  1170
             EA + I P+G+ D KD
Sbjct  350   EAMYAILPDGIGDAKD  365



>emb|CDW53316.1| DNA repair protein RAD51 1 [Trichuris trichiura]
Length=361

 Score =   478 bits (1230),  Expect = 6e-164, Method: Compositional matrix adjust.
 Identities = 228/330 (69%), Positives = 277/330 (84%), Gaps = 3/330 (1%)
 Frame = +1

Query  184   QQDEVEEIQHGPFPIEQLQESGISAIDVKKLKDAGLCTVESVVYSPRKDLLQIKGISEAK  363
             QQD  E    GP PI  L++ GI   D+KKL +AG  TVESV ++P+K LL+IKGIS+AK
Sbjct  34    QQDAEESF--GPKPISHLEQFGIPTGDIKKLSEAGFYTVESVAFTPKKVLLEIKGISDAK  91

Query  364   VDKIIEAASKLVPLGFTSASQLHAQRLEIIQITSGSKELDKVLEGGIETGSITEIYGEFR  543
              DKI+  ASKLVP+GFT+AS  H +R EIIQIT+GSKELDK+L+GGIETGSITE++GEFR
Sbjct  92    ADKILVEASKLVPMGFTTASDFHQKRSEIIQITTGSKELDKLLQGGIETGSITEVFGEFR  151

Query  544   SGKTQLCHTLCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIADRFGLNGADVLENVA  723
             +GKTQ+CHTL V CQLP+D GGGEGK +YID EGTFRP+RLL +A+RF L+G DVL+NVA
Sbjct  152   TGKTQICHTLAVCCQLPVDMGGGEGKCLYIDTEGTFRPERLLPVAERFQLSGPDVLDNVA  211

Query  724   YARAYNTDHQSRLLLEAASMMVETRFALMIVDSATALYRTDFSGRGELSARQMHLAKFLR  903
             YARAYNTDHQ++LL++A++MM E+R+AL++VDSATALYRTD+SGRGELSARQMHLA+FLR
Sbjct  212   YARAYNTDHQTQLLIQASAMMSESRYALLVVDSATALYRTDYSGRGELSARQMHLARFLR  271

Query  904   SLQKLADEFGVAVVITNQVVAQVDGS-AIFAGPQIKPIGGNIMAHASTTRLALRKGRGEE  1080
              L +LADEFGVAVVITNQVVAQVD S A+F     KP+GGNIMAHASTTRL LRKGRG+ 
Sbjct  272   YLLRLADEFGVAVVITNQVVAQVDNSMAMFQADPKKPVGGNIMAHASTTRLYLRKGRGDT  331

Query  1081  RVCKVVSSPCLAEAEARFQISPEGVTDVKD  1170
             R+CK+  SPCL E+EA F I P+G+ D K+
Sbjct  332   RICKIYDSPCLPESEAMFAILPDGIGDAKE  361



>ref|XP_003436320.1| AGAP013412-PA [Anopheles gambiae str. PEST]
 gb|EGK96693.1| AGAP013412-PA [Anopheles gambiae str. PEST]
Length=339

 Score =   477 bits (1227),  Expect = 8e-164, Method: Compositional matrix adjust.
 Identities = 228/336 (68%), Positives = 280/336 (83%), Gaps = 1/336 (0%)
 Frame = +1

Query  163   QKSVQERQQDEVEEIQHGPFPIEQLQESGISAIDVKKLKDAGLCTVESVVYSPRKDLLQI  342
             +KS+Q     E EE  +GP  I +L+ +GI+  D+KKL +AG  TVE+V Y+P+K LL I
Sbjct  5     EKSLQSASTVEEEE-DYGPLLIGKLEGNGITNGDIKKLAEAGFHTVEAVAYAPKKQLLAI  63

Query  343   KGISEAKVDKIIEAASKLVPLGFTSASQLHAQRLEIIQITSGSKELDKVLEGGIETGSIT  522
             KGISEAK DKI++ A+K VP+GFT+A++ H +R EIIQ+T+GSKELDK+L GGIETGSIT
Sbjct  64    KGISEAKADKILQEATKHVPMGFTTATEYHQKRSEIIQLTTGSKELDKLLGGGIETGSIT  123

Query  523   EIYGEFRSGKTQLCHTLCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIADRFGLNGA  702
             EI+GEFR+GKTQLCHTL VTCQLP+ Q GGEGK +YID EGTFRP+RLL  A+R+ L GA
Sbjct  124   EIFGEFRTGKTQLCHTLAVTCQLPVSQNGGEGKCLYIDTEGTFRPERLLATAERYKLVGA  183

Query  703   DVLENVAYARAYNTDHQSRLLLEAASMMVETRFALMIVDSATALYRTDFSGRGELSARQM  882
             DVL+NVAYARAYNTDHQ  LL+ A++MM E+R+AL+IVDSAT+LYRTD+SGRGEL+ARQ 
Sbjct  184   DVLDNVAYARAYNTDHQMHLLMVASAMMAESRYALIIVDSATSLYRTDYSGRGELAARQT  243

Query  883   HLAKFLRSLQKLADEFGVAVVITNQVVAQVDGSAIFAGPQIKPIGGNIMAHASTTRLALR  1062
             HLAKFLR L +LADEFGVAV+ITNQVVAQVDG+A+F     KPIGGNI+AHASTTRL +R
Sbjct  244   HLAKFLRMLLRLADEFGVAVLITNQVVAQVDGAAMFNPDPKKPIGGNIIAHASTTRLYMR  303

Query  1063  KGRGEERVCKVVSSPCLAEAEARFQISPEGVTDVKD  1170
             KGRGE R+CK+  SPCLAE EA F I+P+G+ DVK+
Sbjct  304   KGRGESRICKIYDSPCLAEGEATFAINPDGIGDVKE  339



>ref|NP_593882.1| RecA family recombinase Rhp51 [Schizosaccharomyces pombe 972h-]
 dbj|BAA02963.1| SpRad51 [Schizosaccharomyces pombe]
 emb|CAB90141.1| RecA family recombinase Rhp51 [Schizosaccharomyces pombe]
Length=365

 Score =   477 bits (1228),  Expect = 1e-163, Method: Compositional matrix adjust.
 Identities = 226/363 (62%), Positives = 291/363 (80%), Gaps = 4/363 (1%)
 Frame = +1

Query  100   CESEIHPH*FGATMEQQHRNQQKSVQERQ---QDEVEEIQHGPFPIEQLQESGISAIDVK  270
              ++E+      A M      Q +S  E     QDE +E   GP P++ L+ +GI+A D+K
Sbjct  2     ADTEVEMQVSAADMNNNENGQAQSNYEYDVNVQDEEDEAAAGPMPLQMLEGNGITASDIK  61

Query  271   KLKDAGLCTVESVVYSPRKDLLQIKGISEAKVDKIIEAASKLVPLGFTSASQLHAQRLEI  450
             K+ +AG  TVES+ Y+P++ LL IKGISEAK DK++  ASKLVP+GFT+A++ H +R E+
Sbjct  62    KIHEAGYYTVESIAYTPKRQLLLIKGISEAKADKLLGEASKLVPMGFTTATEYHIRRSEL  121

Query  451   IQITSGSKELDKVLEGGIETGSITEIYGEFRSGKTQLCHTLCVTCQLPLDQGGGEGKAMY  630
             I IT+GSK+LD +L+GG+ETGSITE++GEFR+GK+Q+CHTL VTCQLP+D GGGEGK +Y
Sbjct  122   ITITTGSKQLDTLLQGGVETGSITELFGEFRTGKSQICHTLAVTCQLPIDMGGGEGKCLY  181

Query  631   IDAEGTFRPQRLLQIADRFGLNGADVLENVAYARAYNTDHQSRLLLEAASMMVETRFALM  810
             ID EGTFRP RLL +ADR+GLNG +VL+NVAYARAYN DHQ  LL +AA+MM E+RF+L+
Sbjct  182   IDTEGTFRPVRLLAVADRYGLNGEEVLDNVAYARAYNADHQLELLQQAANMMSESRFSLL  241

Query  811   IVDSATALYRTDFSGRGELSARQMHLAKFLRSLQKLADEFGVAVVITNQVVAQVDGSAIF  990
             +VDS TALYRTDFSGRGELSARQMHLA+F+R+LQ+LADEFG+AVVITNQVVAQVDG +  
Sbjct  242   VVDSCTALYRTDFSGRGELSARQMHLARFMRTLQRLADEFGIAVVITNQVVAQVDGISFN  301

Query  991   AGPQIKPIGGNIMAHASTTRLALRKGRGEERVCKVVSSPCLAEAEARFQISPEGVTDVKD  1170
               P+ KPIGGNI+AH+STTRL+LRKGRGE+R+CK+  SPCL E+EA F I+ +GV D K+
Sbjct  302   PDPK-KPIGGNILAHSSTTRLSLRKGRGEQRICKIYDSPCLPESEAIFAINSDGVGDPKE  360

Query  1171  *LA  1179
              +A
Sbjct  361   IIA  363



>emb|CCF52005.1| probable DNA repair protein RAD51 [Ustilago hordei]
Length=339

 Score =   476 bits (1224),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 221/334 (66%), Positives = 277/334 (83%), Gaps = 2/334 (1%)
 Frame = +1

Query  175   QERQQDEVEEI--QHGPFPIEQLQESGISAIDVKKLKDAGLCTVESVVYSPRKDLLQIKG  348
             Q+  Q+  EE+    GP P+ +L++ GIS+ D KKL +AG  TVE++ ++P+K+LL +KG
Sbjct  6     QDPAQNGEEEMGEAFGPLPVNKLEDFGISSSDCKKLAEAGYNTVEAIAFTPKKNLLLVKG  65

Query  349   ISEAKVDKIIEAASKLVPLGFTSASQLHAQRLEIIQITSGSKELDKVLEGGIETGSITEI  528
             ISEAK DKI+  A+KLVP+GFT+A++ HA+R E+I IT+GSK LD +L GG+ETGSITE+
Sbjct  66    ISEAKADKILVEAAKLVPMGFTTATEFHARRNELISITTGSKNLDAILGGGMETGSITEL  125

Query  529   YGEFRSGKTQLCHTLCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIADRFGLNGADV  708
             YGEFR+GK+QLCHTL VTCQLP+D GGGEGK +YID EGTFRP RLL +A+R+GLNG +V
Sbjct  126   YGEFRTGKSQLCHTLAVTCQLPVDMGGGEGKCLYIDTEGTFRPVRLLAVAERYGLNGEEV  185

Query  709   LENVAYARAYNTDHQSRLLLEAASMMVETRFALMIVDSATALYRTDFSGRGELSARQMHL  888
             L+NVAYARAYN DHQ +LL++A++MM E+RF+L+IVDS T+LYRTDFSGRGELSARQMHL
Sbjct  186   LDNVAYARAYNADHQLQLLMQASAMMAESRFSLLIVDSLTSLYRTDFSGRGELSARQMHL  245

Query  889   AKFLRSLQKLADEFGVAVVITNQVVAQVDGSAIFAGPQIKPIGGNIMAHASTTRLALRKG  1068
             AKFLR L +LADEFGVAVVITNQVVAQVDG+  F     KPIGGNI+AHASTTRL+LRKG
Sbjct  246   AKFLRGLMRLADEFGVAVVITNQVVAQVDGATAFTADAKKPIGGNIVAHASTTRLSLRKG  305

Query  1069  RGEERVCKVVSSPCLAEAEARFQISPEGVTDVKD  1170
             RG +R+C++  SPCL EA+A F I PEG+ D  D
Sbjct  306   RGNQRICRIADSPCLPEADAVFSIGPEGIIDPVD  339



>emb|CBQ73697.1| DNA repair protein RAD51 [Sporisorium reilianum SRZ2]
Length=354

 Score =   476 bits (1225),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 222/334 (66%), Positives = 277/334 (83%), Gaps = 2/334 (1%)
 Frame = +1

Query  166   KSVQERQQDEVEEI--QHGPFPIEQLQESGISAIDVKKLKDAGLCTVESVVYSPRKDLLQ  339
             +SVQ+  Q   E++    GP P+ +L++ GIS+ D KKL +AG  TVES+ ++P+K LL 
Sbjct  3     QSVQDPAQMGEEDMGEAFGPLPVSKLEDFGISSSDCKKLAEAGYNTVESIAFTPKKSLLL  62

Query  340   IKGISEAKVDKIIEAASKLVPLGFTSASQLHAQRLEIIQITSGSKELDKVLEGGIETGSI  519
             +KGISEAK DKI+  A+KLVP+GFT+A++ HA+R E+I IT+GSK LD +L GG+ETGSI
Sbjct  63    VKGISEAKADKILAEAAKLVPMGFTTATEFHARRNELISITTGSKNLDAILGGGMETGSI  122

Query  520   TEIYGEFRSGKTQLCHTLCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIADRFGLNG  699
             TE+YGEFR+GK+QLCHTL VTCQLP+D GGGEGK +YID EGTFRP RLL +A+R+GLNG
Sbjct  123   TELYGEFRTGKSQLCHTLAVTCQLPVDMGGGEGKCLYIDTEGTFRPVRLLAVAERYGLNG  182

Query  700   ADVLENVAYARAYNTDHQSRLLLEAASMMVETRFALMIVDSATALYRTDFSGRGELSARQ  879
              +VL+NVAYARAYN DHQ +LL++A++MM E+RF+L+IVDS T+LYRTDFSGRGELSARQ
Sbjct  183   EEVLDNVAYARAYNADHQLQLLMQASAMMAESRFSLLIVDSLTSLYRTDFSGRGELSARQ  242

Query  880   MHLAKFLRSLQKLADEFGVAVVITNQVVAQVDGSAIFAGPQIKPIGGNIMAHASTTRLAL  1059
             MHLAKFLR L +LADEFGVAVVITNQVVAQVDG+  F     KPIGGNI+AHASTTRL+L
Sbjct  243   MHLAKFLRGLMRLADEFGVAVVITNQVVAQVDGATAFTADAKKPIGGNIVAHASTTRLSL  302

Query  1060  RKGRGEERVCKVVSSPCLAEAEARFQISPEGVTD  1161
             RKGRG +R+C++  SPCL EA+A F I PEG+ D
Sbjct  303   RKGRGNQRICRIADSPCLPEADAVFSIGPEGIID  336



>gb|ETS59968.1| dna repair protein rad51 [Pseudozyma aphidis DSM 70725]
Length=339

 Score =   475 bits (1222),  Expect = 4e-163, Method: Compositional matrix adjust.
 Identities = 223/337 (66%), Positives = 278/337 (82%), Gaps = 2/337 (1%)
 Frame = +1

Query  166   KSVQERQQDEVEEIQHG--PFPIEQLQESGISAIDVKKLKDAGLCTVESVVYSPRKDLLQ  339
             +SVQ+  Q   E++  G  P P+ +L++ GIS+ D KKL +AG  TVES+ ++P+K+LL 
Sbjct  3     QSVQDPAQLGEEDMGEGFGPLPVSKLEDFGISSSDCKKLAEAGYNTVESIAFTPKKNLLL  62

Query  340   IKGISEAKVDKIIEAASKLVPLGFTSASQLHAQRLEIIQITSGSKELDKVLEGGIETGSI  519
             +KGISEAK DKI+  A+KLVP+GFT+A++ HA+R E+I IT+GSK LD +L GG+ETGSI
Sbjct  63    VKGISEAKADKILAEAAKLVPMGFTTATEFHARRNELISITTGSKNLDAILGGGMETGSI  122

Query  520   TEIYGEFRSGKTQLCHTLCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIADRFGLNG  699
             TE+YGEFR+GK+QLCHTL VTCQLP+D GGGEGK +YID EGTFRP RLL +A+R+GLNG
Sbjct  123   TELYGEFRTGKSQLCHTLAVTCQLPVDMGGGEGKCLYIDTEGTFRPTRLLAVAERYGLNG  182

Query  700   ADVLENVAYARAYNTDHQSRLLLEAASMMVETRFALMIVDSATALYRTDFSGRGELSARQ  879
              +VL+NVAYARAYN DHQ +LL++A++MM E+RF+L+IVDS T+LYRTDFSGRGELSARQ
Sbjct  183   EEVLDNVAYARAYNADHQLQLLMQASAMMAESRFSLLIVDSLTSLYRTDFSGRGELSARQ  242

Query  880   MHLAKFLRSLQKLADEFGVAVVITNQVVAQVDGSAIFAGPQIKPIGGNIMAHASTTRLAL  1059
             MHLAKFLR L +LADEFGVAVVITNQVVAQVDG+  F     KPIGGNI+AHASTTRL+L
Sbjct  243   MHLAKFLRGLMRLADEFGVAVVITNQVVAQVDGATAFTADAKKPIGGNIVAHASTTRLSL  302

Query  1060  RKGRGEERVCKVVSSPCLAEAEARFQISPEGVTDVKD  1170
             RKGRG +R+C+V  SPCL EA+A F I  EG+ D  D
Sbjct  303   RKGRGNQRICRVADSPCLPEADAVFAIGAEGIIDPTD  339



>gb|ABI97150.1| Rad51 [Pneumocystis carinii]
 gb|ABI97151.1| Rad51 [Pneumocystis carinii]
Length=343

 Score =   475 bits (1223),  Expect = 4e-163, Method: Compositional matrix adjust.
 Identities = 226/338 (67%), Positives = 283/338 (84%), Gaps = 2/338 (1%)
 Frame = +1

Query  163   QKSVQERQQDEVEE-IQHGPFPIEQLQESGISAIDVKKLKDAGLCTVESVVYSPRKDLLQ  339
             ++  +E  QD  EE I  GP P+ +L+ +GISA D+KK+ +AG  TVE++ Y+P++ +L 
Sbjct  5     EEPAEESTQDMNEEDIICGPTPLSKLEGNGISASDIKKIIEAGYNTVEAIAYTPKRAILL  64

Query  340   IKGISEAKVDKIIEAASKLVPLGFTSASQLHAQRLEIIQITSGSKELDKVLEGGIETGSI  519
             IKGISEAK DK+I  ASKLVP+GFT+A++ H +R E+I IT+GSK+LD +L GGIETGSI
Sbjct  65    IKGISEAKADKLISEASKLVPMGFTTATEFHQRRCELISITTGSKQLDTLLAGGIETGSI  124

Query  520   TEIYGEFRSGKTQLCHTLCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIADRFGLNG  699
             TEI+GEFR+GK+Q+CHTL VTCQLP+D GGGEGK +YID EGTFRP RLL +ADR+GLNG
Sbjct  125   TEIFGEFRTGKSQICHTLAVTCQLPIDMGGGEGKCLYIDTEGTFRPTRLLAVADRYGLNG  184

Query  700   ADVLENVAYARAYNTDHQSRLLLEAASMMVETRFALMIVDSATALYRTDFSGRGELSARQ  879
              +VL+NVAYARAYN DHQ +LL +AA+MM E+RF+L+IVDSAT+LYRTDF+GRGELSARQ
Sbjct  185   EEVLDNVAYARAYNADHQLQLLGQAANMMAESRFSLLIVDSATSLYRTDFAGRGELSARQ  244

Query  880   MHLAKFLRSLQKLADEFGVAVVITNQVVAQVDGSAIFAGPQI-KPIGGNIMAHASTTRLA  1056
             MHLAKFLR+LQ+LADE+G+AVVITNQVVAQVDG+A    P   KPIGGNI+AH+STTRL+
Sbjct  245   MHLAKFLRTLQRLADEYGIAVVITNQVVAQVDGNASMFNPDPKKPIGGNIIAHSSTTRLS  304

Query  1057  LRKGRGEERVCKVVSSPCLAEAEARFQISPEGVTDVKD  1170
             LRKGRGE+R+CK+  SPCLAEA+A F I+  GV D  D
Sbjct  305   LRKGRGEQRICKIYDSPCLAEADAVFAITNGGVDDPVD  342



>gb|KFD50713.1| hypothetical protein M513_08369 [Trichuris suis]
 gb|KFD63180.1| hypothetical protein M514_08369 [Trichuris suis]
 gb|KHJ41279.1| DNA repair protein RAD51 [Trichuris suis]
Length=361

 Score =   476 bits (1224),  Expect = 5e-163, Method: Compositional matrix adjust.
 Identities = 227/330 (69%), Positives = 277/330 (84%), Gaps = 3/330 (1%)
 Frame = +1

Query  184   QQDEVEEIQHGPFPIEQLQESGISAIDVKKLKDAGLCTVESVVYSPRKDLLQIKGISEAK  363
             QQD  E    GP PI  L++ GI   D+KKL +AG  TVESV ++P+K LL+IKGIS+AK
Sbjct  34    QQDAEESF--GPKPISHLEQFGIPIGDIKKLSEAGFYTVESVAFTPKKVLLEIKGISDAK  91

Query  364   VDKIIEAASKLVPLGFTSASQLHAQRLEIIQITSGSKELDKVLEGGIETGSITEIYGEFR  543
              DKI+  ASKLVP+GFT+A+  H +R EIIQIT+GSKELDK+L+GGIETGSITE++GEFR
Sbjct  92    ADKILVEASKLVPMGFTTATDFHQKRSEIIQITTGSKELDKLLQGGIETGSITEVFGEFR  151

Query  544   SGKTQLCHTLCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIADRFGLNGADVLENVA  723
             +GKTQ+CHTL V CQLP+D GGGEGK +YID EGTFRP+RLL +A+RF L+G DVL+NVA
Sbjct  152   TGKTQICHTLAVCCQLPVDMGGGEGKCLYIDTEGTFRPERLLPVAERFQLSGPDVLDNVA  211

Query  724   YARAYNTDHQSRLLLEAASMMVETRFALMIVDSATALYRTDFSGRGELSARQMHLAKFLR  903
             YARAYNTDHQ++LL++A++MM E+R+AL++VDSATALYRTD+SGRGELSARQMHLA+FLR
Sbjct  212   YARAYNTDHQTQLLIQASAMMSESRYALLVVDSATALYRTDYSGRGELSARQMHLARFLR  271

Query  904   SLQKLADEFGVAVVITNQVVAQVDGS-AIFAGPQIKPIGGNIMAHASTTRLALRKGRGEE  1080
              L +LADEFGVAVVITNQVVAQVD S A+F     KP+GGNIMAHASTTRL LRKGRG+ 
Sbjct  272   YLLRLADEFGVAVVITNQVVAQVDNSMAMFQADPKKPVGGNIMAHASTTRLYLRKGRGDT  331

Query  1081  RVCKVVSSPCLAEAEARFQISPEGVTDVKD  1170
             R+CK+  SPCL E+EA F I P+G+ D K+
Sbjct  332   RICKIYDSPCLPESEAMFAILPDGIGDAKE  361



>dbj|GAK64692.1| DNA repair protein RAD51 [Pseudozyma antarctica]
Length=339

 Score =   475 bits (1222),  Expect = 5e-163, Method: Compositional matrix adjust.
 Identities = 223/337 (66%), Positives = 278/337 (82%), Gaps = 2/337 (1%)
 Frame = +1

Query  166   KSVQERQQDEVEEI--QHGPFPIEQLQESGISAIDVKKLKDAGLCTVESVVYSPRKDLLQ  339
             +SVQ+  Q   E++    GP P+ +L++ GIS+ D KKL +AG  TVES+ ++P+K+LL 
Sbjct  3     QSVQDPAQLGEEDMCEGFGPLPVSKLEDFGISSSDCKKLAEAGYNTVESIAFTPKKNLLL  62

Query  340   IKGISEAKVDKIIEAASKLVPLGFTSASQLHAQRLEIIQITSGSKELDKVLEGGIETGSI  519
             +KGISEAK DKI+  A+KLVP+GFT+A++ HA+R E+I IT+GSK LD +L GG+ETGSI
Sbjct  63    VKGISEAKADKILAEAAKLVPMGFTTATEFHARRNELISITTGSKNLDAILGGGMETGSI  122

Query  520   TEIYGEFRSGKTQLCHTLCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIADRFGLNG  699
             TE+YGEFR+GK+QLCHTL VTCQLP+D GGGEGK +YID EGTFRP RLL +A+R+GLNG
Sbjct  123   TELYGEFRTGKSQLCHTLAVTCQLPVDMGGGEGKCLYIDTEGTFRPTRLLAVAERYGLNG  182

Query  700   ADVLENVAYARAYNTDHQSRLLLEAASMMVETRFALMIVDSATALYRTDFSGRGELSARQ  879
              +VL+NVAYARAYN DHQ +LL++A++MM E+RF+L+IVDS T+LYRTDFSGRGELSARQ
Sbjct  183   EEVLDNVAYARAYNADHQLQLLMQASAMMAESRFSLLIVDSLTSLYRTDFSGRGELSARQ  242

Query  880   MHLAKFLRSLQKLADEFGVAVVITNQVVAQVDGSAIFAGPQIKPIGGNIMAHASTTRLAL  1059
             MHLAKFLR L +LADEFGVAVVITNQVVAQVDG+  F     KPIGGNI+AHASTTRL+L
Sbjct  243   MHLAKFLRGLMRLADEFGVAVVITNQVVAQVDGATAFTADAKKPIGGNIVAHASTTRLSL  302

Query  1060  RKGRGEERVCKVVSSPCLAEAEARFQISPEGVTDVKD  1170
             RKGRG +R+C+V  SPCL EA+A F I  EG+ D  D
Sbjct  303   RKGRGNQRICRVADSPCLPEADAVFAIGAEGIIDPTD  339



>ref|XP_007875500.1| DNA repair protein RAD51 [Pneumocystis murina B123]
 gb|ABI97152.1| Rad51 [Pneumocystis murina]
 gb|ABI97153.1| Rad51 [Pneumocystis murina]
 gb|EMR08247.1| DNA repair protein RAD51 [Pneumocystis murina B123]
Length=343

 Score =   475 bits (1222),  Expect = 6e-163, Method: Compositional matrix adjust.
 Identities = 226/334 (68%), Positives = 281/334 (84%), Gaps = 2/334 (1%)
 Frame = +1

Query  175   QERQQDEVEE-IQHGPFPIEQLQESGISAIDVKKLKDAGLCTVESVVYSPRKDLLQIKGI  351
             +E  QD  EE I  GP P+ +L+ +GISA D+KK+ +AG  TVE++ Y+P++ +L IKGI
Sbjct  9     EETAQDMNEEDIICGPTPLSKLEGNGISASDIKKIIEAGYNTVEAIAYTPKRAILLIKGI  68

Query  352   SEAKVDKIIEAASKLVPLGFTSASQLHAQRLEIIQITSGSKELDKVLEGGIETGSITEIY  531
             SEAK DK+I  ASKLVP+GFT+A++ H +R E+I IT+GSK+LD +L GGIETGSITEI+
Sbjct  69    SEAKADKLISEASKLVPMGFTTATEFHQRRCELISITTGSKQLDTLLAGGIETGSITEIF  128

Query  532   GEFRSGKTQLCHTLCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIADRFGLNGADVL  711
             GEFR+GK+Q+CHTL VTCQLP+D GGGEGK +YID EGTFRP RLL +ADR+GLNG +VL
Sbjct  129   GEFRTGKSQICHTLAVTCQLPIDMGGGEGKCLYIDTEGTFRPTRLLAVADRYGLNGEEVL  188

Query  712   ENVAYARAYNTDHQSRLLLEAASMMVETRFALMIVDSATALYRTDFSGRGELSARQMHLA  891
             +NVAYARAYN DHQ +LL +AA+MM E+RF+L+IVDSAT+LYRTDF+GRGELSARQMHLA
Sbjct  189   DNVAYARAYNADHQLQLLGQAANMMAESRFSLLIVDSATSLYRTDFAGRGELSARQMHLA  248

Query  892   KFLRSLQKLADEFGVAVVITNQVVAQVDGSAIFAGPQI-KPIGGNIMAHASTTRLALRKG  1068
             KFLR+LQ+LADE+G+AVVITNQVVAQVDG+A    P   KPIGGNI+AH+STTRL+LRKG
Sbjct  249   KFLRTLQRLADEYGIAVVITNQVVAQVDGNASMFNPDPKKPIGGNIIAHSSTTRLSLRKG  308

Query  1069  RGEERVCKVVSSPCLAEAEARFQISPEGVTDVKD  1170
             RGE+R+CK+  SPCLAEA+A F I+  GV D  D
Sbjct  309   RGEQRICKIYDSPCLAEADAVFAITNGGVDDPVD  342



>emb|CAA80878.1| RecA-like protein [Schizosaccharomyces pombe]
Length=358

 Score =   475 bits (1222),  Expect = 7e-163, Method: Compositional matrix adjust.
 Identities = 220/331 (66%), Positives = 281/331 (85%), Gaps = 1/331 (0%)
 Frame = +1

Query  187   QDEVEEIQHGPFPIEQLQESGISAIDVKKLKDAGLCTVESVVYSPRKDLLQIKGISEAKV  366
             QDE +E   GP P++ L+ +GI+A D+KK+ +AG  TVES+ Y+P++ LL IKGISEAK 
Sbjct  27    QDEEDEAAAGPMPLQMLEGNGITASDIKKIHEAGYYTVESIAYTPKRQLLLIKGISEAKA  86

Query  367   DKIIEAASKLVPLGFTSASQLHAQRLEIIQITSGSKELDKVLEGGIETGSITEIYGEFRS  546
             DK++  ASKLVP+GFT+A++ H +R E+I IT+GSK+LD +L+GG+ETGSITE++GEFR+
Sbjct  87    DKLLGEASKLVPMGFTTATEYHIRRSELITITTGSKQLDTLLQGGVETGSITELFGEFRT  146

Query  547   GKTQLCHTLCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIADRFGLNGADVLENVAY  726
             GK+Q+CHTL VTCQLP+D GGGEGK +YID EGTFRP RLL +ADR+GLNG +VL+NVAY
Sbjct  147   GKSQICHTLAVTCQLPIDMGGGEGKCLYIDTEGTFRPVRLLAVADRYGLNGEEVLDNVAY  206

Query  727   ARAYNTDHQSRLLLEAASMMVETRFALMIVDSATALYRTDFSGRGELSARQMHLAKFLRS  906
             ARAYN DHQ  LL +AA+MM E+RF+L++VDS TALYRTDFSGRGELSARQMHLA+F+R+
Sbjct  207   ARAYNADHQLELLQQAANMMSESRFSLLVVDSCTALYRTDFSGRGELSARQMHLARFMRT  266

Query  907   LQKLADEFGVAVVITNQVVAQVDGSAIFAGPQIKPIGGNIMAHASTTRLALRKGRGEERV  1086
             LQ+LADEFG+AVVITNQVVAQVDG +    P+ KPIGGNI+AH+STTRL+LRKGRGE+R+
Sbjct  267   LQRLADEFGIAVVITNQVVAQVDGISFNPDPK-KPIGGNILAHSSTTRLSLRKGRGEQRI  325

Query  1087  CKVVSSPCLAEAEARFQISPEGVTDVKD*LA  1179
             CK+  SPCL E+EA F I+ +GV D K+ +A
Sbjct  326   CKIYDSPCLPESEAIFAINSDGVGDPKEIIA  356



>dbj|GAC99057.1| DNA repair protein RAD51 [Pseudozyma hubeiensis SY62]
Length=339

 Score =   474 bits (1220),  Expect = 8e-163, Method: Compositional matrix adjust.
 Identities = 221/328 (67%), Positives = 274/328 (84%), Gaps = 1/328 (0%)
 Frame = +1

Query  187   QDEVEEIQHGPFPIEQLQESGISAIDVKKLKDAGLCTVESVVYSPRKDLLQIKGISEAKV  366
             +D+V E   GP P+ +L++ GIS+ D KKL +AG  TVES+ ++P+K LL +KGISEAK 
Sbjct  13    EDDVGE-AFGPLPVGKLEDFGISSSDCKKLAEAGYNTVESIAFTPKKQLLLVKGISEAKA  71

Query  367   DKIIEAASKLVPLGFTSASQLHAQRLEIIQITSGSKELDKVLEGGIETGSITEIYGEFRS  546
             DKI+  A+KLVP+GFT+A++ HA+R E+I IT+GSK LD +L GG+ETGSITE+YGEFR+
Sbjct  72    DKILAEAAKLVPMGFTTATEFHARRNELISITTGSKNLDAILGGGMETGSITELYGEFRT  131

Query  547   GKTQLCHTLCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIADRFGLNGADVLENVAY  726
             GK+QLCHTL VTCQLP+D GGGEGK +YID EGTFRP RLL +A+R+GLNG +VL+NVAY
Sbjct  132   GKSQLCHTLAVTCQLPVDMGGGEGKCLYIDTEGTFRPVRLLAVAERYGLNGEEVLDNVAY  191

Query  727   ARAYNTDHQSRLLLEAASMMVETRFALMIVDSATALYRTDFSGRGELSARQMHLAKFLRS  906
             ARAYN DHQ +LL++A++MM E+RF+L+IVDS T+LYRTDFSGRGELSARQMHLAKFLR 
Sbjct  192   ARAYNADHQLQLLMQASAMMAESRFSLLIVDSLTSLYRTDFSGRGELSARQMHLAKFLRG  251

Query  907   LQKLADEFGVAVVITNQVVAQVDGSAIFAGPQIKPIGGNIMAHASTTRLALRKGRGEERV  1086
             L +LADEFGVAVVITNQVVAQVDG+  F     KPIGGNI+AHASTTRL+LRKGRG +R+
Sbjct  252   LMRLADEFGVAVVITNQVVAQVDGATAFTADAKKPIGGNIVAHASTTRLSLRKGRGNQRI  311

Query  1087  CKVVSSPCLAEAEARFQISPEGVTDVKD  1170
             C++  SPCL EA+A F I PEG+ D  D
Sbjct  312   CRIADSPCLPEADAVFSIGPEGIIDPVD  339



>sp|P36601.1|RAD51_SCHPO RecName: Full=DNA repair protein rhp51; AltName: Full=RAD51 homolog 
[Schizosaccharomyces pombe 972h-]
 emb|CAA80399.1| Rec A-like Protein [Schizosaccharomyces pombe]
 emb|CAA80879.1| Rad51-like protein [Schizosaccharomyces pombe]
Length=365

 Score =   475 bits (1223),  Expect = 8e-163, Method: Compositional matrix adjust.
 Identities = 220/331 (66%), Positives = 281/331 (85%), Gaps = 1/331 (0%)
 Frame = +1

Query  187   QDEVEEIQHGPFPIEQLQESGISAIDVKKLKDAGLCTVESVVYSPRKDLLQIKGISEAKV  366
             QDE +E   GP P++ L+ +GI+A D+KK+ +AG  TVES+ Y+P++ LL IKGISEAK 
Sbjct  34    QDEEDEAAAGPMPLQMLEGNGITASDIKKIHEAGYYTVESIAYTPKRQLLLIKGISEAKA  93

Query  367   DKIIEAASKLVPLGFTSASQLHAQRLEIIQITSGSKELDKVLEGGIETGSITEIYGEFRS  546
             DK++  ASKLVP+GFT+A++ H +R E+I IT+GSK+LD +L+GG+ETGSITE++GEFR+
Sbjct  94    DKLLGEASKLVPMGFTTATEYHIRRSELITITTGSKQLDTLLQGGVETGSITELFGEFRT  153

Query  547   GKTQLCHTLCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIADRFGLNGADVLENVAY  726
             GK+Q+CHTL VTCQLP+D GGGEGK +YID EGTFRP RLL +ADR+GLNG +VL+NVAY
Sbjct  154   GKSQICHTLAVTCQLPIDMGGGEGKCLYIDTEGTFRPVRLLAVADRYGLNGEEVLDNVAY  213

Query  727   ARAYNTDHQSRLLLEAASMMVETRFALMIVDSATALYRTDFSGRGELSARQMHLAKFLRS  906
             ARAYN DHQ  LL +AA+MM E+RF+L++VDS TALYRTDFSGRGELSARQMHLA+F+R+
Sbjct  214   ARAYNADHQLELLQQAANMMSESRFSLLVVDSCTALYRTDFSGRGELSARQMHLARFMRT  273

Query  907   LQKLADEFGVAVVITNQVVAQVDGSAIFAGPQIKPIGGNIMAHASTTRLALRKGRGEERV  1086
             LQ+LADEFG+AVVITNQVVAQVDG +    P+ KPIGGNI+AH+STTRL+LRKGRGE+R+
Sbjct  274   LQRLADEFGIAVVITNQVVAQVDGISFNPDPK-KPIGGNILAHSSTTRLSLRKGRGEQRI  332

Query  1087  CKVVSSPCLAEAEARFQISPEGVTDVKD*LA  1179
             CK+  SPCL E+EA F I+ +GV D K+ +A
Sbjct  333   CKIYDSPCLPESEAIFAINSDGVGDPKEIIA  363



>ref|XP_011389700.1| recombinase RAD51 [Ustilago maydis 521]
 sp|Q99133.1|RAD51_USTMA RecName: Full=DNA repair protein RAD51 [Ustilago maydis 521]
 gb|AAC61878.1| Rad51 [Ustilago maydis]
 gb|KIS68723.1| recombinase RAD51 [Ustilago maydis 521]
Length=339

 Score =   474 bits (1220),  Expect = 1e-162, Method: Compositional matrix adjust.
 Identities = 221/339 (65%), Positives = 275/339 (81%), Gaps = 2/339 (1%)
 Frame = +1

Query  154   RNQQKSVQERQQDEVEEIQHGPFPIEQLQESGISAIDVKKLKDAGLCTVESVVYSPRKDL  333
             +N Q   Q  + D  E    GP P+ +L+E GIS+ D KKL ++G  TVES+ ++P+K L
Sbjct  3     QNAQDPAQIGEDDMGEAF--GPLPVSKLEEFGISSSDCKKLAESGYNTVESIAFTPKKQL  60

Query  334   LQIKGISEAKVDKIIEAASKLVPLGFTSASQLHAQRLEIIQITSGSKELDKVLEGGIETG  513
             L +KG+SEAK DKI+  A++LVP+GFT+A++ HA+R E+I IT+GSK LD +L GG+ETG
Sbjct  61    LLVKGVSEAKADKILAEAARLVPMGFTTATEFHARRNELISITTGSKNLDAILGGGMETG  120

Query  514   SITEIYGEFRSGKTQLCHTLCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIADRFGL  693
             SITE+YGEFR+GK+QLCHTL VTCQLP+D GGGEGK +YID E TFRP RLL +A+RFGL
Sbjct  121   SITELYGEFRTGKSQLCHTLAVTCQLPVDMGGGEGKCLYIDTENTFRPTRLLAVAERFGL  180

Query  694   NGADVLENVAYARAYNTDHQSRLLLEAASMMVETRFALMIVDSATALYRTDFSGRGELSA  873
             NG +VL+NVAYARAYN DHQ +LL++A++MM E+RF+L+IVDS T+LYRTDFSGRGELSA
Sbjct  181   NGEEVLDNVAYARAYNADHQLQLLMQASAMMAESRFSLLIVDSLTSLYRTDFSGRGELSA  240

Query  874   RQMHLAKFLRSLQKLADEFGVAVVITNQVVAQVDGSAIFAGPQIKPIGGNIMAHASTTRL  1053
             RQMHLAKFLR L +LADEFGVAVVITNQVVAQVDG+  F     KPIGGNI+AHASTTRL
Sbjct  241   RQMHLAKFLRGLMRLADEFGVAVVITNQVVAQVDGATAFTADAKKPIGGNIVAHASTTRL  300

Query  1054  ALRKGRGEERVCKVVSSPCLAEAEARFQISPEGVTDVKD  1170
             +LRKGRG +R+C++  SPCL EA+A F I PEG+ D  D
Sbjct  301   SLRKGRGNQRICRIADSPCLPEADAVFAIGPEGIIDPVD  339



>emb|CDI54117.1| DNA repair protein RAD51 [Melanopsichium pennsylvanicum 4]
Length=374

 Score =   474 bits (1221),  Expect = 2e-162, Method: Compositional matrix adjust.
 Identities = 221/335 (66%), Positives = 280/335 (84%), Gaps = 4/335 (1%)
 Frame = +1

Query  166   KSVQERQQ---DEVEEIQHGPFPIEQLQESGISAIDVKKLKDAGLCTVESVVYSPRKDLL  336
             +SVQ+  Q   D++ E   GP P+ +L++ GIS+ D KKL +AG  TVES+ ++P+K+LL
Sbjct  4     QSVQDPAQMGEDDMGE-SFGPLPVSKLEDFGISSSDCKKLAEAGYNTVESIAFTPKKNLL  62

Query  337   QIKGISEAKVDKIIEAASKLVPLGFTSASQLHAQRLEIIQITSGSKELDKVLEGGIETGS  516
              +KGISEAK DK++  A+KLVP+GFT+A++ HA+R E+I IT+GSK LD +L GG+ETGS
Sbjct  63    LVKGISEAKADKVLAEAAKLVPMGFTTATEFHARRNELISITTGSKNLDAILGGGMETGS  122

Query  517   ITEIYGEFRSGKTQLCHTLCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIADRFGLN  696
             ITE+YGEFR+GK+QLCHTL VTCQLP+D GGGEGK ++ID EGTFRP RLL +A+R+GLN
Sbjct  123   ITELYGEFRTGKSQLCHTLAVTCQLPVDMGGGEGKCLFIDTEGTFRPVRLLAVAERYGLN  182

Query  697   GADVLENVAYARAYNTDHQSRLLLEAASMMVETRFALMIVDSATALYRTDFSGRGELSAR  876
             G +VL+NVAYARAYN+DHQ +LL++A++MM E+RF+L+IVDS T+LYRTDFSGRGELSAR
Sbjct  183   GEEVLDNVAYARAYNSDHQLQLLMQASAMMAESRFSLLIVDSLTSLYRTDFSGRGELSAR  242

Query  877   QMHLAKFLRSLQKLADEFGVAVVITNQVVAQVDGSAIFAGPQIKPIGGNIMAHASTTRLA  1056
             QMHLAKFLR L +LADEFGVAVVITNQVVAQVDG+  F     KPIGGNI+AHASTTRL+
Sbjct  243   QMHLAKFLRGLMRLADEFGVAVVITNQVVAQVDGATAFTADAKKPIGGNIVAHASTTRLS  302

Query  1057  LRKGRGEERVCKVVSSPCLAEAEARFQISPEGVTD  1161
             LRKGRG +R+C++  SPCL EA+A F I PEG+ D
Sbjct  303   LRKGRGNQRICRIADSPCLPEADAVFSIGPEGIID  337



>emb|CCJ30383.1| unnamed protein product [Pneumocystis jirovecii]
Length=347

 Score =   473 bits (1218),  Expect = 2e-162, Method: Compositional matrix adjust.
 Identities = 226/342 (66%), Positives = 286/342 (84%), Gaps = 6/342 (2%)
 Frame = +1

Query  163   QKSVQERQQDEVEE-IQHGPFPIEQLQESGISAIDVKKLKDAGLCTVESVVYSPRKDLLQ  339
             + SV++  QDEVEE +  GP P+ +L+ +GISA D+K++ +AG  TVE++ Y+P++ +L 
Sbjct  5     EASVEDNIQDEVEEDVVCGPTPLSKLEGNGISASDIKRIIEAGYNTVEAIAYTPKRAILL  64

Query  340   IKGISEAKVDKIIE----AASKLVPLGFTSASQLHAQRLEIIQITSGSKELDKVLEGGIE  507
             IKGISEAK DK++      ASKLVP+GFT+A++ H +R E+I IT+GSK+LD +L GGIE
Sbjct  65    IKGISEAKADKLLSEGTYKASKLVPMGFTTATEFHQRRSELISITTGSKQLDTLLAGGIE  124

Query  508   TGSITEIYGEFRSGKTQLCHTLCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIADRF  687
             TGSITEI+GEFR+GK+Q+CHTL VTCQLP+D GGGEGK +YID EGTFRP RLL +ADR+
Sbjct  125   TGSITEIFGEFRTGKSQICHTLAVTCQLPIDMGGGEGKCLYIDTEGTFRPTRLLAVADRY  184

Query  688   GLNGADVLENVAYARAYNTDHQSRLLLEAASMMVETRFALMIVDSATALYRTDFSGRGEL  867
             GLNG +VL+NVAYARAYN DHQ +LL +AA+MM E+RF+L+IVDSAT+LYRTDF+GRGEL
Sbjct  185   GLNGEEVLDNVAYARAYNADHQLQLLGQAANMMAESRFSLLIVDSATSLYRTDFAGRGEL  244

Query  868   SARQMHLAKFLRSLQKLADEFGVAVVITNQVVAQVDGSAIFAGPQI-KPIGGNIMAHAST  1044
             SARQMHLAKFLR+LQ+LADE+G+AVVITNQVVAQVDG+A    P   KPIGGNI+AH+ST
Sbjct  245   SARQMHLAKFLRTLQRLADEYGIAVVITNQVVAQVDGNASMFNPDPKKPIGGNIIAHSST  304

Query  1045  TRLALRKGRGEERVCKVVSSPCLAEAEARFQISPEGVTDVKD  1170
             TRL+LRKGRGE+R+CK+  SPCLAEA+A F I+  GV D  D
Sbjct  305   TRLSLRKGRGEQRICKIYDSPCLAEADAVFAITNGGVDDPID  346



>gb|EST04967.1| DNA repair protein RAD51 [Pseudozyma brasiliensis GHG001]
Length=339

 Score =   473 bits (1217),  Expect = 2e-162, Method: Compositional matrix adjust.
 Identities = 219/339 (65%), Positives = 276/339 (81%), Gaps = 2/339 (1%)
 Frame = +1

Query  154   RNQQKSVQERQQDEVEEIQHGPFPIEQLQESGISAIDVKKLKDAGLCTVESVVYSPRKDL  333
             +N Q   Q  +++  E    GP P+ +L++ GIS  D KKL +AG  TVES+ ++P+K+L
Sbjct  3     QNAQNPSQMGEEEMSEAF--GPLPVSKLEDFGISGSDCKKLAEAGYNTVESIAFTPKKNL  60

Query  334   LQIKGISEAKVDKIIEAASKLVPLGFTSASQLHAQRLEIIQITSGSKELDKVLEGGIETG  513
             L +KGISEAK DK++  A+KLVP+GFT+A++ HA+R E+I IT+GSK LD +L GG+ETG
Sbjct  61    LLVKGISEAKADKVLAEAAKLVPMGFTTATEFHARRNELISITTGSKNLDAILGGGMETG  120

Query  514   SITEIYGEFRSGKTQLCHTLCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIADRFGL  693
             SITE+YGEFR+GK+QLCHTL VTCQLP+D GGGEGK +YID EGTFRP RLL +A+R+GL
Sbjct  121   SITELYGEFRTGKSQLCHTLAVTCQLPVDMGGGEGKCLYIDTEGTFRPVRLLAVAERYGL  180

Query  694   NGADVLENVAYARAYNTDHQSRLLLEAASMMVETRFALMIVDSATALYRTDFSGRGELSA  873
             +G +VL+NVAYARAYN DHQ +LL++A++MM E+RF+L+IVDS T+LYRTDFSGRGELSA
Sbjct  181   DGNEVLDNVAYARAYNADHQLQLLMQASAMMAESRFSLLIVDSLTSLYRTDFSGRGELSA  240

Query  874   RQMHLAKFLRSLQKLADEFGVAVVITNQVVAQVDGSAIFAGPQIKPIGGNIMAHASTTRL  1053
             RQMHLAKFLR L +L DEFGVAVVITNQVVAQVDG+  F     KPIGGNI+AHASTTRL
Sbjct  241   RQMHLAKFLRGLMRLTDEFGVAVVITNQVVAQVDGATAFTADAKKPIGGNIVAHASTTRL  300

Query  1054  ALRKGRGEERVCKVVSSPCLAEAEARFQISPEGVTDVKD  1170
             +LRKGRG +R+C++  SPCL EA+A F I PEG+ D  D
Sbjct  301   SLRKGRGNQRICRIADSPCLPEADAVFSIGPEGIIDPVD  339



>gb|EFX82820.1| hypothetical protein DAPPUDRAFT_299714 [Daphnia pulex]
Length=341

 Score =   471 bits (1212),  Expect = 1e-161, Method: Compositional matrix adjust.
 Identities = 219/315 (70%), Positives = 272/315 (86%), Gaps = 0/315 (0%)
 Frame = +1

Query  226   IEQLQESGISAIDVKKLKDAGLCTVESVVYSPRKDLLQIKGISEAKVDKIIEAASKLVPL  405
             I +L+ +GIS  D+KKL++AG  TVESV Y P+K L+ IKG+SEAK DKII  A K+VP+
Sbjct  27    ISKLEGNGISGADIKKLQEAGYHTVESVAYVPKKTLITIKGVSEAKADKIIAEAQKMVPM  86

Query  406   GFTSASQLHAQRLEIIQITSGSKELDKVLEGGIETGSITEIYGEFRSGKTQLCHTLCVTC  585
             GF++A++ H +R E++Q+T+GSKELDK+L GGIETGSITEI+GEFR+GKTQLC TL VTC
Sbjct  87    GFSTATEYHQKRAELVQVTTGSKELDKLLGGGIETGSITEIFGEFRTGKTQLCLTLAVTC  146

Query  586   QLPLDQGGGEGKAMYIDAEGTFRPQRLLQIADRFGLNGADVLENVAYARAYNTDHQSRLL  765
             QLP+D GG EGK +YID EGTFRP+RLL +A+R+GL+G+DVL+NVA ARA+NTDHQS+LL
Sbjct  147   QLPIDSGGAEGKCLYIDTEGTFRPERLLAVAERYGLSGSDVLDNVACARAFNTDHQSQLL  206

Query  766   LEAASMMVETRFALMIVDSATALYRTDFSGRGELSARQMHLAKFLRSLQKLADEFGVAVV  945
             ++A++MM ++R+AL+IVDSATALYRTD+SGRGELSARQMHLA+FLR L +LADEFGVAVV
Sbjct  207   IQASAMMADSRYALLIVDSATALYRTDYSGRGELSARQMHLARFLRMLLRLADEFGVAVV  266

Query  946   ITNQVVAQVDGSAIFAGPQIKPIGGNIMAHASTTRLALRKGRGEERVCKVVSSPCLAEAE  1125
             ITNQVVAQVDG+A+FA    KPIGGNIMAHASTTRL LRKGRGE R+CK+  SPCL E+E
Sbjct  267   ITNQVVAQVDGAAMFAADPKKPIGGNIMAHASTTRLYLRKGRGETRICKIYDSPCLPESE  326

Query  1126  ARFQISPEGVTDVKD  1170
             A F I P+G+ D K+
Sbjct  327   AMFAILPDGIGDSKE  341



>gb|ETN58581.1| DNA repair protein RAD51 [Anopheles darlingi]
Length=339

 Score =   471 bits (1212),  Expect = 1e-161, Method: Compositional matrix adjust.
 Identities = 223/336 (66%), Positives = 281/336 (84%), Gaps = 1/336 (0%)
 Frame = +1

Query  163   QKSVQERQQDEVEEIQHGPFPIEQLQESGISAIDVKKLKDAGLCTVESVVYSPRKDLLQI  342
             +KS+Q     E +E Q+GP  I +L+ +GI++ D+KKL +AG  T+ESV ++P+K LL I
Sbjct  5     EKSIQSASTVEDDE-QYGPLLIGKLEGNGITSGDIKKLAEAGFHTIESVAFAPKKQLLTI  63

Query  343   KGISEAKVDKIIEAASKLVPLGFTSASQLHAQRLEIIQITSGSKELDKVLEGGIETGSIT  522
             KGISEAK DKI++ A+K VP+GFT+A++ H +R EIIQ+T+GSKELDK+L GGIETGSIT
Sbjct  64    KGISEAKADKILQEATKHVPMGFTTATEWHQKRSEIIQLTTGSKELDKLLGGGIETGSIT  123

Query  523   EIYGEFRSGKTQLCHTLCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIADRFGLNGA  702
             E++GEFR+GKTQLCHTL VTCQLP+ Q GGEGK +YID EGTFRP+RLL  A+R+ L G 
Sbjct  124   EMFGEFRTGKTQLCHTLAVTCQLPVSQNGGEGKCLYIDTEGTFRPERLLATAERYKLVGT  183

Query  703   DVLENVAYARAYNTDHQSRLLLEAASMMVETRFALMIVDSATALYRTDFSGRGELSARQM  882
             DVL+NVAYARAYNTDHQ +LL+ A++MMVE+R+AL+IVDSAT+LYRTD+ GRGEL+ARQ 
Sbjct  184   DVLDNVAYARAYNTDHQMQLLMLASAMMVESRYALIIVDSATSLYRTDYCGRGELAARQG  243

Query  883   HLAKFLRSLQKLADEFGVAVVITNQVVAQVDGSAIFAGPQIKPIGGNIMAHASTTRLALR  1062
             H+AKFLR L +LADEFGVAV+ITNQVVAQVDG+A+F     KP+GGNI+ HASTTRL LR
Sbjct  244   HMAKFLRMLLRLADEFGVAVIITNQVVAQVDGAAMFNPDPKKPVGGNIIGHASTTRLYLR  303

Query  1063  KGRGEERVCKVVSSPCLAEAEARFQISPEGVTDVKD  1170
             KGRGE R+CK+  SPCL E+EA F I+P+GV DVK+
Sbjct  304   KGRGETRICKIYDSPCLPESEATFAINPDGVGDVKE  339



>gb|ELW48160.1| Protein CASC5 [Tupaia chinensis]
Length=1640

 Score =   508 bits (1307),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 234/325 (72%), Positives = 287/325 (88%), Gaps = 0/325 (0%)
 Frame = +1

Query  196   VEEIQHGPFPIEQLQESGISAIDVKKLKDAGLCTVESVVYSPRKDLLQIKGISEAKVDKI  375
             VEE   GP PI +L++ GI+A DVKKL++AG  TVE+V Y+P+K+L+ IKGISEAK DKI
Sbjct  1316  VEEESFGPQPISRLEQCGINANDVKKLEEAGFHTVEAVAYAPKKELINIKGISEAKADKI  1375

Query  376   IEAASKLVPLGFTSASQLHAQRLEIIQITSGSKELDKVLEGGIETGSITEIYGEFRSGKT  555
             +  A+KLVP+GFT+A++ H +R EIIQIT+GSKELDK+L+GGIETGSITE++GEFR+GKT
Sbjct  1376  LAEAAKLVPMGFTTATEFHQRRSEIIQITTGSKELDKLLQGGIETGSITEMFGEFRTGKT  1435

Query  556   QLCHTLCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIADRFGLNGADVLENVAYARA  735
             Q+CHTL VTCQLP+D+GGGEGKAMYID EGTFRP+RLL +A+R+GL+G+DVL+NVAYAR 
Sbjct  1436  QICHTLAVTCQLPIDRGGGEGKAMYIDTEGTFRPERLLAVAERYGLSGSDVLDNVAYARG  1495

Query  736   YNTDHQSRLLLEAASMMVETRFALMIVDSATALYRTDFSGRGELSARQMHLAKFLRSLQK  915
             +NTDHQ++LL +A++MMVE+R+AL+IVDSATALYRTD+SGRGELSARQMHLA+FLR L +
Sbjct  1496  FNTDHQTQLLYQASAMMVESRYALLIVDSATALYRTDYSGRGELSARQMHLARFLRMLLR  1555

Query  916   LADEFGVAVVITNQVVAQVDGSAIFAGPQIKPIGGNIMAHASTTRLALRKGRGEERVCKV  1095
             LADEFGVAVVITNQVVAQVDG+A+FA    KPIGGNI+AHASTTRL LRKGRGE R+CK+
Sbjct  1556  LADEFGVAVVITNQVVAQVDGAAMFAADPKKPIGGNIIAHASTTRLYLRKGRGETRICKI  1615

Query  1096  VSSPCLAEAEARFQISPEGVTDVKD  1170
               SPCL EAEA F I+ +GV D KD
Sbjct  1616  YDSPCLPEAEAMFAINADGVGDAKD  1640



>ref|XP_007882252.1| hypothetical protein PFL1_06516 [Pseudozyma flocculosa PF-1]
 gb|EPQ25841.1| hypothetical protein PFL1_06516 [Pseudozyma flocculosa PF-1]
Length=340

 Score =   470 bits (1210),  Expect = 3e-161, Method: Compositional matrix adjust.
 Identities = 219/319 (69%), Positives = 269/319 (84%), Gaps = 0/319 (0%)
 Frame = +1

Query  214   GPFPIEQLQESGISAIDVKKLKDAGLCTVESVVYSPRKDLLQIKGISEAKVDKIIEAASK  393
             GP  I +L+E GIS  D KKL +AG  T+ESV ++P+K+LL +KGISEAK DKI+  A K
Sbjct  22    GPLLINKLEEFGISGSDCKKLAEAGYHTIESVAFTPKKNLLLVKGISEAKADKILAEAGK  81

Query  394   LVPLGFTSASQLHAQRLEIIQITSGSKELDKVLEGGIETGSITEIYGEFRSGKTQLCHTL  573
             LVP+GFT+A++ HA+R E+I IT+GSK LD +L GG+ETGSITE+YGEFR+GK+QLCHTL
Sbjct  82    LVPMGFTTATEFHARRNELITITTGSKNLDAILGGGMETGSITELYGEFRTGKSQLCHTL  141

Query  574   CVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIADRFGLNGADVLENVAYARAYNTDHQ  753
              VTCQLP+D GGGEGK +YID EGTFRP RLL +A+R+GLNG +VL+NVAYARAYN DHQ
Sbjct  142   AVTCQLPVDMGGGEGKCLYIDTEGTFRPVRLLAVAERYGLNGEEVLDNVAYARAYNADHQ  201

Query  754   SRLLLEAASMMVETRFALMIVDSATALYRTDFSGRGELSARQMHLAKFLRSLQKLADEFG  933
              +LLL+A++MM E+RF+L+IVDS T+LYRTDFSGRGELSARQ HLAKFLR L +LADEFG
Sbjct  202   LQLLLQASAMMAESRFSLLIVDSLTSLYRTDFSGRGELSARQTHLAKFLRVLMRLADEFG  261

Query  934   VAVVITNQVVAQVDGSAIFAGPQIKPIGGNIMAHASTTRLALRKGRGEERVCKVVSSPCL  1113
             VAVVITNQVVAQVDG++ F+    KPIGGNI+AHASTTRL+LRKGRG +R+C++  SPCL
Sbjct  262   VAVVITNQVVAQVDGASAFSADAKKPIGGNIVAHASTTRLSLRKGRGNQRICRIADSPCL  321

Query  1114  AEAEARFQISPEGVTDVKD  1170
              EA+A F I+PEG+ D  D
Sbjct  322   PEADAVFAIAPEGIVDPVD  340



>gb|KFB52705.1| AGAP013412-PA-like protein [Anopheles sinensis]
Length=339

 Score =   468 bits (1205),  Expect = 1e-160, Method: Compositional matrix adjust.
 Identities = 226/335 (67%), Positives = 279/335 (83%), Gaps = 1/335 (0%)
 Frame = +1

Query  166   KSVQERQQDEVEEIQHGPFPIEQLQESGISAIDVKKLKDAGLCTVESVVYSPRKDLLQIK  345
             KS+Q     E EE   GP  I +L+ +GI+  D+KKL +AG  TVE+V ++P+K LL IK
Sbjct  6     KSLQSVSTVEEEE-DCGPLLIGKLEGNGITNGDIKKLAEAGFHTVEAVAFAPKKQLLAIK  64

Query  346   GISEAKVDKIIEAASKLVPLGFTSASQLHAQRLEIIQITSGSKELDKVLEGGIETGSITE  525
             GISEAK DKI++ A+K VP+GFT+A++ H +R EIIQ+T+GSKELDK+L GGIETGSITE
Sbjct  65    GISEAKADKILQEATKHVPMGFTTATEYHQKRSEIIQLTTGSKELDKLLGGGIETGSITE  124

Query  526   IYGEFRSGKTQLCHTLCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIADRFGLNGAD  705
             I+GEFR+GKTQLCHTL VTCQLP+ Q GGEGK +YID EGTFRP+RLL  A+R+ L GAD
Sbjct  125   IFGEFRTGKTQLCHTLAVTCQLPVSQNGGEGKCLYIDTEGTFRPERLLATAERYKLVGAD  184

Query  706   VLENVAYARAYNTDHQSRLLLEAASMMVETRFALMIVDSATALYRTDFSGRGELSARQMH  885
             VL+NVAYARAYNTDHQ +LL+ A++MMVE+R+AL+IVDSAT+LYRTD+ GRGEL+ARQ H
Sbjct  185   VLDNVAYARAYNTDHQMQLLMMASAMMVESRYALIIVDSATSLYRTDYCGRGELAARQGH  244

Query  886   LAKFLRSLQKLADEFGVAVVITNQVVAQVDGSAIFAGPQIKPIGGNIMAHASTTRLALRK  1065
             +AKFLR L +LADEFGVAV+ITNQVVAQVDG+A+F     KPIGGNI+AHASTTRL LRK
Sbjct  245   MAKFLRMLLRLADEFGVAVLITNQVVAQVDGAAMFNPDPKKPIGGNIIAHASTTRLYLRK  304

Query  1066  GRGEERVCKVVSSPCLAEAEARFQISPEGVTDVKD  1170
             GRGE R+CK+  SPCLAE+EA F I+P+G+ D K+
Sbjct  305   GRGETRICKIYDSPCLAESEATFAINPDGIGDAKE  339



>gb|KFH66657.1| DNA repair protein rhp51 [Mortierella verticillata NRRL 6337]
Length=341

 Score =   468 bits (1203),  Expect = 3e-160, Method: Compositional matrix adjust.
 Identities = 226/345 (66%), Positives = 277/345 (80%), Gaps = 9/345 (3%)
 Frame = +1

Query  139   MEQQHRNQQKSVQERQQDEVEEIQHGPFPIEQLQESGISAIDVKKLKDAGLCTVESVVYS  318
             +E QH       QE   DE EE   G    E+L+E GI A DVKKL+DAG  TVES+ ++
Sbjct  4     LEMQH-------QEEVMDE-EEAVAGHMLTEKLEECGILAADVKKLRDAGYYTVESIAFT  55

Query  319   PRKDLLQIKGISEAKVDKIIEAASKLVPLGFTSASQLHAQRLEIIQITSGSKELDKVLEG  498
             P+K LL IKGIS+ K DKI+  AS+LVP+GFT+A++ H +R E+IQIT+GS +LDK+L G
Sbjct  56    PKKQLLTIKGISDTKADKILSEASRLVPMGFTTATEFHQRRSELIQITTGSSDLDKLLGG  115

Query  499   GIETGSITEIYGEFRSGKTQLCHTLCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIA  678
             G+ETGSITE++GEFR+GK+Q+CH L VTCQLP+   GGEGK +YID EGTFRP+RLL IA
Sbjct  116   GLETGSITELFGEFRTGKSQICHMLAVTCQLPVAMNGGEGKCLYIDTEGTFRPERLLSIA  175

Query  679   DRFGLNGADVLENVAYARAYNTDHQSRLLLEAASMMVETRFALMIVDSATALYRTDFSGR  858
             +R+ L+G +VL+NVAYARAYNTDHQ +LL++AA+MM E+RFAL++VDSAT+LYRTDFSGR
Sbjct  176   ERYNLSGEEVLDNVAYARAYNTDHQMQLLVQAAAMMSESRFALLVVDSATSLYRTDFSGR  235

Query  859   GELSARQMHLAKFLRSLQKLADEFGVAVVITNQVVAQVDGSA-IFAGPQIKPIGGNIMAH  1035
             GELSARQMH+A+FLR+LQ+LADEFGVAVVITNQVVAQVDG A +F     KPIGGNIMAH
Sbjct  236   GELSARQMHMARFLRNLQRLADEFGVAVVITNQVVAQVDGGASMFNADPKKPIGGNIMAH  295

Query  1036  ASTTRLALRKGRGEERVCKVVSSPCLAEAEARFQISPEGVTDVKD  1170
             +STTRL+LRKGRGE R+CKV  SPCL E EA F I   G+ D  D
Sbjct  296   SSTTRLSLRKGRGENRICKVYDSPCLPELEAMFSIGGHGIADAVD  340



>gb|EPX72876.1| recombinase Rhp51 [Schizosaccharomyces octosporus yFS286]
Length=368

 Score =   468 bits (1205),  Expect = 4e-160, Method: Compositional matrix adjust.
 Identities = 217/327 (66%), Positives = 278/327 (85%), Gaps = 1/327 (0%)
 Frame = +1

Query  199   EEIQHGPFPIEQLQESGISAIDVKKLKDAGLCTVESVVYSPRKDLLQIKGISEAKVDKII  378
             EE   GP P++ L+ +GI++ D+KK+ +AG  TVES+ Y+P++ LL IKGISEAK DK++
Sbjct  41    EEGVAGPMPLQMLEGNGITSTDIKKIHEAGYYTVESIAYTPKRQLLLIKGISEAKADKLL  100

Query  379   EAASKLVPLGFTSASQLHAQRLEIIQITSGSKELDKVLEGGIETGSITEIYGEFRSGKTQ  558
               ASKLVP+GFT+A++ H +R E+I IT+GSK+LD +L+GG+ETGSITE++GEFR+GK+Q
Sbjct  101   GEASKLVPMGFTTATEYHIRRSELITITTGSKQLDTLLQGGVETGSITELFGEFRTGKSQ  160

Query  559   LCHTLCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIADRFGLNGADVLENVAYARAY  738
             +CHTL VTCQLP+D GGGEGK +YID EGTFRP RLL +ADR+GLNG +VL+NVAYARAY
Sbjct  161   ICHTLAVTCQLPIDMGGGEGKCLYIDTEGTFRPVRLLAVADRYGLNGEEVLDNVAYARAY  220

Query  739   NTDHQSRLLLEAASMMVETRFALMIVDSATALYRTDFSGRGELSARQMHLAKFLRSLQKL  918
             N DHQ  LL +AA+MM E+RF++++VDS TALYRTDFSGRGELSARQMHLA+F+R+LQ+L
Sbjct  221   NADHQLELLQQAANMMSESRFSMLVVDSCTALYRTDFSGRGELSARQMHLARFMRTLQRL  280

Query  919   ADEFGVAVVITNQVVAQVDGSAIFAGPQIKPIGGNIMAHASTTRLALRKGRGEERVCKVV  1098
             ADEFG+AVVITNQVVAQVDG +    P+ KPIGGNI+AH+STTRL+LRKGRGE+R+CK+ 
Sbjct  281   ADEFGIAVVITNQVVAQVDGISFNPDPK-KPIGGNILAHSSTTRLSLRKGRGEQRICKIY  339

Query  1099  SSPCLAEAEARFQISPEGVTDVKD*LA  1179
              SPCL E+EA F I+ +GV D K+ LA
Sbjct  340   DSPCLPESEAIFAINADGVGDPKEILA  366



>ref|NP_001037484.1| Rad51 homolog [Bombyx mori]
 gb|AAB53330.1| Rad51 homolog [Bombyx mori]
Length=338

 Score =   467 bits (1201),  Expect = 5e-160, Method: Compositional matrix adjust.
 Identities = 217/319 (68%), Positives = 271/319 (85%), Gaps = 0/319 (0%)
 Frame = +1

Query  214   GPFPIEQLQESGISAIDVKKLKDAGLCTVESVVYSPRKDLLQIKGISEAKVDKIIEAASK  393
             GP  I +L+ +GI++ D+KKL++AG  TVESV Y+P+K L+ IKGISEAK DKI+  ASK
Sbjct  20    GPQLISKLEGNGITSGDIKKLEEAGYHTVESVAYAPKKWLITIKGISEAKADKILAEASK  79

Query  394   LVPLGFTSASQLHAQRLEIIQITSGSKELDKVLEGGIETGSITEIYGEFRSGKTQLCHTL  573
             LVP+GFT+A++ H +R EIIQ+T+GSKELD++L GGIETGSITEI+GEFR+GKTQLCHTL
Sbjct  80    LVPMGFTTATEFHQKRAEIIQLTTGSKELDRLLGGGIETGSITEIFGEFRTGKTQLCHTL  139

Query  574   CVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIADRFGLNGADVLENVAYARAYNTDHQ  753
              VTCQLP++Q GGEGK MYID EGTFRP+RLL +A R+G+ GA VL+NVAYARAYNTDHQ
Sbjct  140   AVTCQLPIEQSGGEGKCMYIDTEGTFRPERLLAVAQRYGMEGAAVLDNVAYARAYNTDHQ  199

Query  754   SRLLLEAASMMVETRFALMIVDSATALYRTDFSGRGELSARQMHLAKFLRSLQKLADEFG  933
             ++LL++A +MM E+R++L+IVDSATALYRTD+SGRGEL++RQ+HL +F+R L +LADEFG
Sbjct  200   TQLLVQACAMMAESRYSLIIVDSATALYRTDYSGRGELNSRQLHLGRFMRMLLRLADEFG  259

Query  934   VAVVITNQVVAQVDGSAIFAGPQIKPIGGNIMAHASTTRLALRKGRGEERVCKVVSSPCL  1113
             VAV+ITNQVVAQVD   +F     KPIGG+I+AHASTTRL LRKGRG+ RVCK+  SPCL
Sbjct  260   VAVIITNQVVAQVDSVGVFNADTKKPIGGHIIAHASTTRLYLRKGRGDNRVCKIYDSPCL  319

Query  1114  AEAEARFQISPEGVTDVKD  1170
              E EA F IS EG+TD K+
Sbjct  320   PETEAMFAISAEGITDAKE  338



>emb|CDW75503.1| dna repair protein rad51 homolog 1 [Stylonychia lemnae]
Length=339

 Score =   466 bits (1200),  Expect = 8e-160, Method: Compositional matrix adjust.
 Identities = 216/319 (68%), Positives = 271/319 (85%), Gaps = 0/319 (0%)
 Frame = +1

Query  214   GPFPIEQLQESGISAIDVKKLKDAGLCTVESVVYSPRKDLLQIKGISEAKVDKIIEAASK  393
             GP PI+ L+E GI+A D+KKL++AG  TVE+V ++P+K L+ +KG+SEAKVDKI+EAA K
Sbjct  21    GPTPIKALEEKGINAGDIKKLEEAGYHTVEAVAFTPKKMLINVKGLSEAKVDKIVEAAQK  80

Query  394   LVPLGFTSASQLHAQRLEIIQITSGSKELDKVLEGGIETGSITEIYGEFRSGKTQLCHTL  573
             +V LGF +AS    +R  ++ +TSGS  LD++L GGIETGSITEI+GEFR+GKTQ+CHTL
Sbjct  81    IVNLGFQTASTYFEKRQSMVHLTSGSSSLDQLLGGGIETGSITEIFGEFRTGKTQICHTL  140

Query  574   CVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIADRFGLNGADVLENVAYARAYNTDHQ  753
             CVTCQLP+ +GGGEG AMY+D EGTFRP+RL+ IA RFGL+   VL+NVAYARA+NTD Q
Sbjct  141   CVTCQLPISKGGGEGMAMYVDTEGTFRPERLIPIAKRFGLDEQQVLDNVAYARAHNTDQQ  200

Query  754   SRLLLEAASMMVETRFALMIVDSATALYRTDFSGRGELSARQMHLAKFLRSLQKLADEFG  933
             ++LL++AA++M E RFAL+++DSATALYRTD+SGRGELSARQMHLAKFLR+LQ++ADEFG
Sbjct  201   NKLLIQAAALMAENRFALLVIDSATALYRTDYSGRGELSARQMHLAKFLRTLQRIADEFG  260

Query  934   VAVVITNQVVAQVDGSAIFAGPQIKPIGGNIMAHASTTRLALRKGRGEERVCKVVSSPCL  1113
             VAVVITNQVVAQVDGSA+FA    KPIGG+I+AHAS TRL+LRKGR E RVCK+  SPCL
Sbjct  261   VAVVITNQVVAQVDGSAMFAADSKKPIGGHIIAHASCTRLSLRKGRNESRVCKIYDSPCL  320

Query  1114  AEAEARFQISPEGVTDVKD  1170
              EAEA + I+ +G+ D KD
Sbjct  321   PEAEAMYAITNDGIDDYKD  339



>ref|XP_011560505.1| PREDICTED: DNA repair protein RAD51 homolog 1-like [Plutella 
xylostella]
 ref|XP_011562932.1| PREDICTED: DNA repair protein RAD51 homolog 1-like [Plutella 
xylostella]
 ref|XP_011567460.1| PREDICTED: DNA repair protein RAD51 homolog 1-like [Plutella 
xylostella]
Length=338

 Score =   466 bits (1198),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 215/319 (67%), Positives = 270/319 (85%), Gaps = 0/319 (0%)
 Frame = +1

Query  214   GPFPIEQLQESGISAIDVKKLKDAGLCTVESVVYSPRKDLLQIKGISEAKVDKIIEAASK  393
             GP  I +L+ +GI++ D+KKL++AG  TVESV Y+P+K L+ IKGISEAK DKI+  ASK
Sbjct  20    GPQLITKLEGNGITSGDIKKLEEAGYHTVESVAYAPKKWLITIKGISEAKADKILSEASK  79

Query  394   LVPLGFTSASQLHAQRLEIIQITSGSKELDKVLEGGIETGSITEIYGEFRSGKTQLCHTL  573
             LVP+GFT+A++ H +R EIIQ+T+GSKELD++L GGIETGSITEI+GEFR+GKTQ+CHTL
Sbjct  80    LVPMGFTTATEFHQKRAEIIQLTTGSKELDRLLGGGIETGSITEIFGEFRTGKTQICHTL  139

Query  574   CVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIADRFGLNGADVLENVAYARAYNTDHQ  753
              VTCQLP++Q GGEGK MYID EGTFRP+RLL +A R+G+ GA VL+NVAYARAYNTDHQ
Sbjct  140   AVTCQLPIEQSGGEGKCMYIDTEGTFRPERLLAVAQRYGMEGAAVLDNVAYARAYNTDHQ  199

Query  754   SRLLLEAASMMVETRFALMIVDSATALYRTDFSGRGELSARQMHLAKFLRSLQKLADEFG  933
             ++LL++A +MM E+R++L+IVDSATALYRTD+SGRGEL++RQ+HL +F+R L +LADEFG
Sbjct  200   TQLLVQACAMMAESRYSLIIVDSATALYRTDYSGRGELNSRQLHLGRFMRMLLRLADEFG  259

Query  934   VAVVITNQVVAQVDGSAIFAGPQIKPIGGNIMAHASTTRLALRKGRGEERVCKVVSSPCL  1113
             VAV+ITNQVVA VD   +F     KP+GG+IMAHASTTRL LRKGRG+ RVCK+  SPCL
Sbjct  260   VAVIITNQVVANVDNVGVFNADTKKPVGGHIMAHASTTRLYLRKGRGDNRVCKIYDSPCL  319

Query  1114  AEAEARFQISPEGVTDVKD  1170
              E EA F IS EG+TD K+
Sbjct  320   PETEAMFAISTEGITDAKE  338



>gb|EHJ70106.1| Rad51-like protein [Danaus plexippus]
Length=338

 Score =   465 bits (1197),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 216/319 (68%), Positives = 270/319 (85%), Gaps = 0/319 (0%)
 Frame = +1

Query  214   GPFPIEQLQESGISAIDVKKLKDAGLCTVESVVYSPRKDLLQIKGISEAKVDKIIEAASK  393
             GP  I +L+ +GI++ D+KKL++AG  TVESV Y+P+K L+ IKGISEAK DKI+  ASK
Sbjct  20    GPQLITKLEGNGITSGDIKKLEEAGYHTVESVAYAPKKWLITIKGISEAKADKILSEASK  79

Query  394   LVPLGFTSASQLHAQRLEIIQITSGSKELDKVLEGGIETGSITEIYGEFRSGKTQLCHTL  573
             LVP+GFT+A++ H +R EIIQ+T+GSKELD++L GGIETGSITEI+GEFR+GKTQLCHTL
Sbjct  80    LVPMGFTTATEFHQKRAEIIQLTTGSKELDRLLGGGIETGSITEIFGEFRTGKTQLCHTL  139

Query  574   CVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIADRFGLNGADVLENVAYARAYNTDHQ  753
              VTCQLP++Q GGEGK MYID EGTFRP+RLL +A R+G+  A VL+NVAYARAYNTDHQ
Sbjct  140   AVTCQLPIEQSGGEGKCMYIDTEGTFRPERLLAVAQRYGMESAAVLDNVAYARAYNTDHQ  199

Query  754   SRLLLEAASMMVETRFALMIVDSATALYRTDFSGRGELSARQMHLAKFLRSLQKLADEFG  933
             ++LL++A +MM E+R++L+IVDSATALYRTD+SGRGEL++RQ+HL +F+R L +LADEFG
Sbjct  200   TQLLVQACAMMAESRYSLLIVDSATALYRTDYSGRGELNSRQLHLGRFMRMLLRLADEFG  259

Query  934   VAVVITNQVVAQVDGSAIFAGPQIKPIGGNIMAHASTTRLALRKGRGEERVCKVVSSPCL  1113
             VAV+ITNQVVAQVD   +F     KPIGG+I+AHASTTRL LRKGRG+ RVCK+  SPCL
Sbjct  260   VAVIITNQVVAQVDSVGVFNADTKKPIGGHIIAHASTTRLYLRKGRGDNRVCKIYDSPCL  319

Query  1114  AEAEARFQISPEGVTDVKD  1170
              E EA F IS EG+TD K+
Sbjct  320   PETEAMFAISTEGITDAKE  338



>ref|XP_001948893.1| PREDICTED: DNA repair protein RAD51 homolog A [Acyrthosiphon 
pisum]
Length=340

 Score =   464 bits (1195),  Expect = 5e-159, Method: Compositional matrix adjust.
 Identities = 219/337 (65%), Positives = 279/337 (83%), Gaps = 6/337 (2%)
 Frame = +1

Query  160   QQKSVQERQQDEVEEIQHGPFPIEQLQESGISAIDVKKLKDAGLCTVESVVYSPRKDLLQ  339
             ++  V++ ++D+      GP  I +L+  GI++ D+KKL++AG  T+ES+ ++ +K L+ 
Sbjct  10    EESVVEDHEEDD------GPLLIAKLEGQGITSGDIKKLQEAGYHTIESIAFATKKHLIT  63

Query  340   IKGISEAKVDKIIEAASKLVPLGFTSASQLHAQRLEIIQITSGSKELDKVLEGGIETGSI  519
             IKGISEAK DKI+  ASK+VPLGFTSA+  H +R EIIQ+T+GSKELD++L GGIETGSI
Sbjct  64    IKGISEAKADKILAEASKMVPLGFTSATIFHLKRSEIIQLTTGSKELDRLLGGGIETGSI  123

Query  520   TEIYGEFRSGKTQLCHTLCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIADRFGLNG  699
             TEI+GEFR+GKTQLCHTL VTCQLP+ Q GGEGK +YID EGTFRP+RLL +A+R+ L G
Sbjct  124   TEIFGEFRTGKTQLCHTLAVTCQLPIGQNGGEGKCLYIDTEGTFRPERLLSVAERYQLVG  183

Query  700   ADVLENVAYARAYNTDHQSRLLLEAASMMVETRFALMIVDSATALYRTDFSGRGELSARQ  879
             +DVL+N+A ARAYNTDHQ++LLL+A +MM E+R+AL+IVDSA ALYRTD+SGRGELSARQ
Sbjct  184   SDVLDNIACARAYNTDHQTQLLLQAGAMMAESRYALLIVDSAMALYRTDYSGRGELSARQ  243

Query  880   MHLAKFLRSLQKLADEFGVAVVITNQVVAQVDGSAIFAGPQIKPIGGNIMAHASTTRLAL  1059
              HLA+FLR L +LADEFGVAVVITNQVVAQVDG+++FA    KP+GGNIMAHASTTRL L
Sbjct  244   NHLARFLRMLLRLADEFGVAVVITNQVVAQVDGASMFAADPKKPVGGNIMAHASTTRLYL  303

Query  1060  RKGRGEERVCKVVSSPCLAEAEARFQISPEGVTDVKD  1170
             RKGRGE R+CK+  SPCL E+EA F I+ +G+ D K+
Sbjct  304   RKGRGETRICKIYDSPCLPESEAMFAINADGIGDAKE  340



>gb|EJY72106.1| hypothetical protein OXYTRI_06896 [Oxytricha trifallax]
Length=339

 Score =   464 bits (1195),  Expect = 5e-159, Method: Compositional matrix adjust.
 Identities = 217/329 (66%), Positives = 276/329 (84%), Gaps = 0/329 (0%)
 Frame = +1

Query  184   QQDEVEEIQHGPFPIEQLQESGISAIDVKKLKDAGLCTVESVVYSPRKDLLQIKGISEAK  363
             QQ+E E    GP PI+ L+E GI+A D+KKL++AG  TVE+V ++P+K L+ +KG+SEAK
Sbjct  11    QQEEEEVELEGPTPIKALEEKGINAGDIKKLEEAGYHTVEAVAFTPKKMLINVKGLSEAK  70

Query  364   VDKIIEAASKLVPLGFTSASQLHAQRLEIIQITSGSKELDKVLEGGIETGSITEIYGEFR  543
             VDKI+EAA K+V LGF +AS    +R  ++ +T+GS  LD++L GGIETGSITEI+GEFR
Sbjct  71    VDKIVEAAQKIVNLGFQTASTYFEKRQSMVHLTTGSSSLDQLLGGGIETGSITEIFGEFR  130

Query  544   SGKTQLCHTLCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIADRFGLNGADVLENVA  723
             +GKTQ+CHTLCVTCQLP+ +GGGEG AMY+D EGTFRP+RL+ +A RFGL+   VL+NVA
Sbjct  131   TGKTQICHTLCVTCQLPISKGGGEGMAMYVDTEGTFRPERLIPVAKRFGLDEQQVLDNVA  190

Query  724   YARAYNTDHQSRLLLEAASMMVETRFALMIVDSATALYRTDFSGRGELSARQMHLAKFLR  903
             YARA+NTD Q++LL++AA++M E RFAL+++DSATALYRTD+SGRGELSARQMHLAKFLR
Sbjct  191   YARAHNTDQQNKLLIQAAALMAENRFALLVIDSATALYRTDYSGRGELSARQMHLAKFLR  250

Query  904   SLQKLADEFGVAVVITNQVVAQVDGSAIFAGPQIKPIGGNIMAHASTTRLALRKGRGEER  1083
             +LQ++ADEFGVAVVITNQVVAQVDGSA+FA    KPIGG+I+AHAS TRL+LRKGR E R
Sbjct  251   TLQRIADEFGVAVVITNQVVAQVDGSAMFAADSKKPIGGHIIAHASCTRLSLRKGRNESR  310

Query  1084  VCKVVSSPCLAEAEARFQISPEGVTDVKD  1170
             VCK+  SPCL E+EA + I+ +G+ D KD
Sbjct  311   VCKIYDSPCLPESEAMYAITNDGIDDYKD  339



>ref|XP_002429975.1| DNA repair protein rad51, putative [Pediculus humanus corporis]
 gb|EEB17237.1| DNA repair protein rad51, putative [Pediculus humanus corporis]
Length=339

 Score =   464 bits (1194),  Expect = 6e-159, Method: Compositional matrix adjust.
 Identities = 217/326 (67%), Positives = 275/326 (84%), Gaps = 0/326 (0%)
 Frame = +1

Query  193   EVEEIQHGPFPIEQLQESGISAIDVKKLKDAGLCTVESVVYSPRKDLLQIKGISEAKVDK  372
             E E   +GP  I++L+  GI++ D+KKL++AG  TVE+V ++P+K L QIKGISEAKV+K
Sbjct  14    EEESEDYGPSSIKKLEGQGITSGDIKKLEEAGYYTVEAVAFAPKKSLAQIKGISEAKVEK  73

Query  373   IIEAASKLVPLGFTSASQLHAQRLEIIQITSGSKELDKVLEGGIETGSITEIYGEFRSGK  552
             II  A KLVP+GFT+A++ H +R E+I +T+GSKELDK+L GGIETGSITEI+GEFR+GK
Sbjct  74    IISEAYKLVPMGFTTATEFHQKRAELILLTTGSKELDKLLGGGIETGSITEIFGEFRTGK  133

Query  553   TQLCHTLCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIADRFGLNGADVLENVAYAR  732
             TQLCHTL VTCQLP+DQ GGEGK +YID EGTFRP+RL+ +A+RF L+ +DVL+NVA AR
Sbjct  134   TQLCHTLAVTCQLPIDQNGGEGKCLYIDTEGTFRPERLIAVAERFKLSLSDVLDNVAVAR  193

Query  733   AYNTDHQSRLLLEAASMMVETRFALMIVDSATALYRTDFSGRGELSARQMHLAKFLRSLQ  912
             AYNTDHQ++LLL A++MM E+R+AL+I+DSATALYRTD+SGRGELSARQMHLA+FLR   
Sbjct  194   AYNTDHQTQLLLMASAMMSESRYALLIIDSATALYRTDYSGRGELSARQMHLARFLRMCL  253

Query  913   KLADEFGVAVVITNQVVAQVDGSAIFAGPQIKPIGGNIMAHASTTRLALRKGRGEERVCK  1092
             +LADEFGVAV++TNQVVAQVD + +FA    KP+GGNIMAH+STTRL LRKGRGE R+CK
Sbjct  254   RLADEFGVAVILTNQVVAQVDCATMFAADPKKPVGGNIMAHSSTTRLYLRKGRGETRICK  313

Query  1093  VVSSPCLAEAEARFQISPEGVTDVKD  1170
             +  SPCL E+EA F I+ +G+ D K+
Sbjct  314   IYDSPCLPESEAMFAINSDGIGDAKE  339



>ref|XP_002172658.1| recombinase Rhp51 [Schizosaccharomyces japonicus yFS275]
 gb|EEB06365.1| recombinase Rhp51 [Schizosaccharomyces japonicus yFS275]
Length=370

 Score =   465 bits (1196),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 213/319 (67%), Positives = 272/319 (85%), Gaps = 1/319 (0%)
 Frame = +1

Query  214   GPFPIEQLQESGISAIDVKKLKDAGLCTVESVVYSPRKDLLQIKGISEAKVDKIIEAASK  393
             GP P++ L  +GI+  D+KK+ +AG  TVES+ Y+P++ LL IKGISEAK DK++  ASK
Sbjct  47    GPMPLQLLVGNGITTGDLKKVHEAGYYTVESIAYTPKRQLLNIKGISEAKADKLLSEASK  106

Query  394   LVPLGFTSASQLHAQRLEIIQITSGSKELDKVLEGGIETGSITEIYGEFRSGKTQLCHTL  573
             LVP+GFT+A++ H +R E+I IT+GSK+LD +L+GG+ETGSITE++GEFR+GK+Q+CHTL
Sbjct  107   LVPMGFTTATEYHIRRSELITITTGSKQLDTLLQGGVETGSITELFGEFRTGKSQICHTL  166

Query  574   CVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIADRFGLNGADVLENVAYARAYNTDHQ  753
              VTCQLP+D GGGEGK +YID EGTFRP RLL +A+R+GLNG +VL+NVAYARAYN DHQ
Sbjct  167   AVTCQLPIDMGGGEGKCLYIDTEGTFRPVRLLAVAERYGLNGEEVLDNVAYARAYNADHQ  226

Query  754   SRLLLEAASMMVETRFALMIVDSATALYRTDFSGRGELSARQMHLAKFLRSLQKLADEFG  933
               LL +AA+MM E+RF+L++VDS TALYRTDFSGRGELSARQMHLA+F+R+LQ+LADEFG
Sbjct  227   LELLQQAANMMAESRFSLLVVDSCTALYRTDFSGRGELSARQMHLARFMRTLQRLADEFG  286

Query  934   VAVVITNQVVAQVDGSAIFAGPQIKPIGGNIMAHASTTRLALRKGRGEERVCKVVSSPCL  1113
             +AVVITNQVVAQVDG +    P+ KPIGGNI+AH+STTRL+LRKGRGE+R+CKV  SPCL
Sbjct  287   IAVVITNQVVAQVDGISFNPDPK-KPIGGNILAHSSTTRLSLRKGRGEQRICKVYDSPCL  345

Query  1114  AEAEARFQISPEGVTDVKD  1170
              E+EA F I+ +G+ D K+
Sbjct  346   PESEAIFAINSDGIGDPKE  364



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3646169840416