BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig13370

Length=1202
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009592672.1|  PREDICTED: uncharacterized protein LOC104089...    382   1e-119   Nicotiana tomentosiformis
ref|XP_009592673.1|  PREDICTED: uncharacterized protein LOC104089...    382   1e-119   Nicotiana tomentosiformis
ref|XP_009770277.1|  PREDICTED: uncharacterized protein LOC104221...    382   2e-119   Nicotiana sylvestris
ref|XP_009770284.1|  PREDICTED: uncharacterized protein LOC104221...    382   2e-119   Nicotiana sylvestris
ref|XP_006350289.1|  PREDICTED: uncharacterized protein LOC102583747    370   3e-115   Solanum tuberosum [potatoes]
ref|XP_010323076.1|  PREDICTED: uncharacterized protein LOC101266...    363   2e-112   
ref|XP_010323075.1|  PREDICTED: uncharacterized protein LOC101266...    363   2e-112   
ref|XP_010323074.1|  PREDICTED: uncharacterized protein LOC101266...    363   2e-112   
ref|XP_010323073.1|  PREDICTED: uncharacterized protein LOC101266...    363   2e-112   
ref|XP_009589098.1|  PREDICTED: uncharacterized protein LOC104086...    362   7e-112   Nicotiana tomentosiformis
ref|XP_006352720.1|  PREDICTED: uncharacterized protein LOC102578...    361   1e-111   
ref|XP_006352716.1|  PREDICTED: uncharacterized protein LOC102578...    363   2e-111   Solanum tuberosum [potatoes]
ref|XP_006352719.1|  PREDICTED: uncharacterized protein LOC102578...    363   2e-111   Solanum tuberosum [potatoes]
ref|XP_006352718.1|  PREDICTED: uncharacterized protein LOC102578...    363   2e-111   
ref|XP_006352717.1|  PREDICTED: uncharacterized protein LOC102578...    363   2e-111   Solanum tuberosum [potatoes]
ref|XP_010323077.1|  PREDICTED: uncharacterized protein LOC101266...    360   4e-111   Solanum lycopersicum
ref|XP_004247114.1|  PREDICTED: uncharacterized protein LOC101266...    358   1e-110   Solanum lycopersicum
ref|XP_009589097.1|  PREDICTED: uncharacterized protein LOC104086...    357   4e-110   Nicotiana tomentosiformis
ref|XP_009589093.1|  PREDICTED: uncharacterized protein LOC104086...    357   4e-110   Nicotiana tomentosiformis
ref|XP_009780624.1|  PREDICTED: uncharacterized protein LOC104229...    349   5e-107   Nicotiana sylvestris
ref|XP_009780627.1|  PREDICTED: uncharacterized protein LOC104229...    349   5e-107   Nicotiana sylvestris
ref|XP_002267519.1|  PREDICTED: uncharacterized protein LOC100241...    331   3e-100   Vitis vinifera
emb|CAN81514.1|  hypothetical protein VITISV_012030                     332   5e-100   Vitis vinifera
ref|XP_010091854.1|  hypothetical protein L484_015923                   329   2e-99    Morus notabilis
ref|XP_004292261.1|  PREDICTED: uncharacterized protein LOC101294433    323   3e-97    Fragaria vesca subsp. vesca
ref|XP_010652446.1|  PREDICTED: uncharacterized protein LOC100241...    318   1e-95    Vitis vinifera
ref|XP_007050069.1|  Uncharacterized protein isoform 1                  317   4e-95    
ref|XP_007050070.1|  Uncharacterized protein isoform 2                  317   5e-95    
gb|KDO65803.1|  hypothetical protein CISIN_1g001807mg                   317   1e-94    Citrus sinensis [apfelsine]
ref|XP_012085179.1|  PREDICTED: uncharacterized protein LOC105644441    315   1e-94    Jatropha curcas
gb|KDO65805.1|  hypothetical protein CISIN_1g001807mg                   315   4e-94    Citrus sinensis [apfelsine]
gb|KDO65804.1|  hypothetical protein CISIN_1g001807mg                   315   4e-94    Citrus sinensis [apfelsine]
emb|CDP03827.1|  unnamed protein product                                313   1e-93    Coffea canephora [robusta coffee]
ref|XP_011024525.1|  PREDICTED: uncharacterized protein LOC105125...    311   1e-92    Populus euphratica
ref|XP_006443684.1|  hypothetical protein CICLE_v10018694mg             310   3e-92    Citrus clementina [clementine]
ref|XP_009371010.1|  PREDICTED: uncharacterized protein LOC103960...    309   4e-92    Pyrus x bretschneideri [bai li]
ref|XP_008235543.1|  PREDICTED: uncharacterized protein LOC103334363    308   7e-92    Prunus mume [ume]
ref|XP_008372424.1|  PREDICTED: uncharacterized protein LOC103435...    307   3e-91    
ref|XP_007199004.1|  hypothetical protein PRUPE_ppa000852mg             306   5e-91    Prunus persica
ref|XP_009371001.1|  PREDICTED: uncharacterized protein LOC103960...    306   9e-91    Pyrus x bretschneideri [bai li]
ref|XP_008372423.1|  PREDICTED: uncharacterized protein LOC103435...    303   7e-90    
gb|EYU17961.1|  hypothetical protein MIMGU_mgv1a0013543mg               293   1e-89    Erythranthe guttata [common monkey flower]
emb|CBI37234.3|  unnamed protein product                                299   2e-89    Vitis vinifera
ref|XP_002521158.1|  conserved hypothetical protein                     301   6e-89    
ref|XP_002303096.2|  hypothetical protein POPTR_0002s25490g             300   9e-89    
ref|XP_008382666.1|  PREDICTED: uncharacterized protein LOC103445438    300   1e-88    
ref|XP_006386899.1|  hypothetical protein POPTR_0002s25490g             300   1e-88    
ref|XP_011024528.1|  PREDICTED: uncharacterized protein LOC105125...    299   2e-88    Populus euphratica
gb|KHG22481.1|  Viral inhibitor of RIP activation                       296   5e-87    Gossypium arboreum [tree cotton]
ref|XP_010243642.1|  PREDICTED: uncharacterized protein LOC104587...    294   2e-86    Nelumbo nucifera [Indian lotus]
ref|XP_010243641.1|  PREDICTED: uncharacterized protein LOC104587...    294   2e-86    Nelumbo nucifera [Indian lotus]
ref|XP_010243643.1|  PREDICTED: uncharacterized protein LOC104587...    293   6e-86    Nelumbo nucifera [Indian lotus]
gb|KJB10994.1|  hypothetical protein B456_001G235600                    283   3e-84    Gossypium raimondii
ref|XP_010684822.1|  PREDICTED: uncharacterized protein LOC104899...    287   5e-84    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010684824.1|  PREDICTED: uncharacterized protein LOC104899...    287   5e-84    Beta vulgaris subsp. vulgaris [field beet]
gb|KJB10997.1|  hypothetical protein B456_001G235600                    284   7e-83    Gossypium raimondii
gb|KJB10996.1|  hypothetical protein B456_001G235600                    282   3e-82    Gossypium raimondii
gb|KJB10995.1|  hypothetical protein B456_001G235600                    283   3e-82    Gossypium raimondii
ref|XP_011080145.1|  PREDICTED: uncharacterized protein LOC105163485    276   3e-80    Sesamum indicum [beniseed]
ref|XP_006604525.1|  PREDICTED: uncharacterized protein LOC100816...    276   6e-80    Glycine max [soybeans]
ref|XP_007162644.1|  hypothetical protein PHAVU_001G168100g             275   2e-79    Phaseolus vulgaris [French bean]
ref|XP_009770291.1|  PREDICTED: uncharacterized protein LOC104221...    272   1e-78    Nicotiana sylvestris
gb|KHN09408.1|  hypothetical protein glysoja_016507                     271   3e-78    Glycine soja [wild soybean]
ref|XP_006576977.1|  PREDICTED: uncharacterized protein LOC100793360    271   4e-78    Glycine max [soybeans]
ref|XP_011083092.1|  PREDICTED: uncharacterized protein LOC105165697    265   4e-76    Sesamum indicum [beniseed]
gb|KJB26066.1|  hypothetical protein B456_004G223300                    260   1e-75    Gossypium raimondii
gb|EYU46370.1|  hypothetical protein MIMGU_mgv1a000965mg                261   6e-75    Erythranthe guttata [common monkey flower]
ref|XP_010263991.1|  PREDICTED: uncharacterized protein LOC104602...    261   1e-74    Nelumbo nucifera [Indian lotus]
ref|XP_010263990.1|  PREDICTED: uncharacterized protein LOC104602...    261   2e-74    Nelumbo nucifera [Indian lotus]
ref|XP_010263989.1|  PREDICTED: uncharacterized protein LOC104602...    261   2e-74    
gb|KJB26068.1|  hypothetical protein B456_004G223300                    260   3e-74    Gossypium raimondii
gb|KJB26065.1|  hypothetical protein B456_004G223300                    259   7e-74    Gossypium raimondii
gb|KHG04276.1|  Methyl-coenzyme M reductase II subunit gamma            259   1e-73    Gossypium arboreum [tree cotton]
gb|KJB26067.1|  hypothetical protein B456_004G223300                    258   3e-73    Gossypium raimondii
gb|KDO65806.1|  hypothetical protein CISIN_1g001807mg                   256   9e-73    Citrus sinensis [apfelsine]
ref|XP_008447347.1|  PREDICTED: uncharacterized protein LOC103489819    252   2e-71    Cucumis melo [Oriental melon]
ref|XP_009780628.1|  PREDICTED: uncharacterized protein LOC104229...    251   3e-71    Nicotiana sylvestris
ref|XP_004493852.1|  PREDICTED: uro-adherence factor A-like isofo...    251   3e-71    Cicer arietinum [garbanzo]
ref|XP_009780629.1|  PREDICTED: uncharacterized protein LOC104229...    251   3e-71    Nicotiana sylvestris
ref|XP_004152072.2|  PREDICTED: uncharacterized protein LOC101204012    251   6e-71    Cucumis sativus [cucumbers]
ref|XP_009592675.1|  PREDICTED: uncharacterized protein LOC104089...    248   2e-70    Nicotiana tomentosiformis
ref|XP_008789491.1|  PREDICTED: uncharacterized protein LOC103706...    245   7e-69    Phoenix dactylifera
ref|XP_008789490.1|  PREDICTED: uncharacterized protein LOC103706...    245   8e-69    Phoenix dactylifera
ref|XP_008789489.1|  PREDICTED: uncharacterized protein LOC103706...    244   8e-69    Phoenix dactylifera
ref|XP_010069683.1|  PREDICTED: uncharacterized protein LOC104456566    241   1e-67    Eucalyptus grandis [rose gum]
ref|XP_010940679.1|  PREDICTED: uncharacterized protein LOC105059...    240   3e-67    Elaeis guineensis
ref|XP_010940678.1|  PREDICTED: uncharacterized protein LOC105059...    240   3e-67    Elaeis guineensis
ref|XP_003625464.1|  hypothetical protein MTR_7g099410                  240   4e-67    Medicago truncatula
ref|XP_010326332.1|  PREDICTED: uncharacterized protein LOC101266...    238   1e-66    
ref|XP_006412913.1|  hypothetical protein EUTSA_v10024350mg             235   2e-65    Eutrema salsugineum [saltwater cress]
ref|XP_002869475.1|  hypothetical protein ARALYDRAFT_491881             234   3e-65    
ref|XP_010447916.1|  PREDICTED: uncharacterized protein LOC104730...    233   1e-64    Camelina sativa [gold-of-pleasure]
ref|XP_006284953.1|  hypothetical protein CARUB_v10006255mg             233   1e-64    Capsella rubella
ref|XP_010438384.1|  PREDICTED: uncharacterized protein LOC104721...    232   3e-64    Camelina sativa [gold-of-pleasure]
ref|XP_006854321.1|  PREDICTED: uncharacterized protein LOC18444081     230   1e-63    Amborella trichopoda
ref|XP_010433164.1|  PREDICTED: uncharacterized protein LOC104717...    229   2e-63    Camelina sativa [gold-of-pleasure]
ref|XP_010556872.1|  PREDICTED: uncharacterized protein LOC104826058    228   4e-63    Tarenaya hassleriana [spider flower]
emb|CDY35217.1|  BnaA01g08140D                                          226   1e-62    Brassica napus [oilseed rape]
ref|XP_009129280.1|  PREDICTED: uncharacterized protein LOC103854122    226   2e-62    Brassica rapa
ref|XP_011024529.1|  PREDICTED: uncharacterized protein LOC105125...    225   5e-62    Populus euphratica
ref|NP_567819.1|  uncharacterized protein                               223   2e-61    Arabidopsis thaliana [mouse-ear cress]
emb|CDY06873.1|  BnaC01g09720D                                          223   2e-61    
dbj|BAH19995.1|  AT4G28760                                              223   2e-61    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010526471.1|  PREDICTED: uncharacterized protein LOC104804...    220   2e-60    Tarenaya hassleriana [spider flower]
ref|XP_008809664.1|  PREDICTED: uncharacterized protein LOC103721...    219   7e-60    
ref|XP_008809662.1|  PREDICTED: uncharacterized protein LOC103721...    219   8e-60    Phoenix dactylifera
ref|XP_008461986.1|  PREDICTED: uncharacterized protein LOC103500466    216   9e-59    Cucumis melo [Oriental melon]
ref|XP_010038329.1|  PREDICTED: uncharacterized protein LOC104426860    215   2e-58    Eucalyptus grandis [rose gum]
ref|XP_011024531.1|  PREDICTED: uncharacterized protein LOC105125...    214   2e-58    Populus euphratica
ref|XP_008809661.1|  PREDICTED: uncharacterized protein LOC103721...    214   9e-58    Phoenix dactylifera
ref|XP_008809663.1|  PREDICTED: uncharacterized protein LOC103721...    213   1e-57    Phoenix dactylifera
ref|XP_004139729.1|  PREDICTED: uncharacterized protein LOC101207165    213   1e-57    Cucumis sativus [cucumbers]
ref|XP_009411376.1|  PREDICTED: uncharacterized protein LOC103993144    210   8e-57    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006375643.1|  hypothetical protein POPTR_0014s18540g             209   2e-56    
ref|XP_010540953.1|  PREDICTED: uncharacterized protein LOC104814...    208   3e-56    Tarenaya hassleriana [spider flower]
ref|XP_010540945.1|  PREDICTED: uncharacterized protein LOC104814...    208   4e-56    Tarenaya hassleriana [spider flower]
ref|XP_010918845.1|  PREDICTED: uncharacterized protein LOC105043126    206   4e-55    Elaeis guineensis
ref|XP_010933203.1|  PREDICTED: uncharacterized protein LOC105053...    205   9e-55    Elaeis guineensis
ref|XP_010933202.1|  PREDICTED: uncharacterized protein LOC105053...    204   1e-54    
ref|XP_007050071.1|  Uncharacterized protein isoform 3                  203   3e-54    
gb|KJB10993.1|  hypothetical protein B456_001G235600                    202   4e-54    Gossypium raimondii
ref|XP_009418989.1|  PREDICTED: uncharacterized protein LOC103998...    194   3e-51    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009418765.1|  PREDICTED: uncharacterized protein LOC103998...    194   3e-51    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009407163.1|  PREDICTED: uncharacterized protein LOC103989929    194   5e-51    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009382176.1|  PREDICTED: uncharacterized protein LOC103970...    188   6e-49    
ref|XP_009410914.1|  PREDICTED: uncharacterized protein LOC103992...    186   2e-48    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009410963.1|  PREDICTED: uncharacterized protein LOC103992...    186   3e-48    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010441970.1|  PREDICTED: uncharacterized protein LOC104725...    181   6e-47    Camelina sativa [gold-of-pleasure]
ref|XP_010441972.1|  PREDICTED: uncharacterized protein LOC104725...    181   1e-46    Camelina sativa [gold-of-pleasure]
ref|XP_006403169.1|  hypothetical protein EUTSA_v10003146mg             179   5e-46    Eutrema salsugineum [saltwater cress]
ref|XP_009382188.1|  PREDICTED: uncharacterized protein LOC103970...    177   3e-45    
ref|XP_004976162.1|  PREDICTED: uncharacterized protein LOC101760...    176   9e-45    Setaria italica
ref|XP_010481809.1|  PREDICTED: uncharacterized protein LOC104760...    172   1e-43    Camelina sativa [gold-of-pleasure]
ref|XP_008646431.1|  PREDICTED: uncharacterized protein LOC103627...    172   4e-43    Zea mays [maize]
ref|XP_006279984.1|  hypothetical protein CARUB_v10025855mg             171   6e-43    
ref|XP_006279983.1|  hypothetical protein CARUB_v10025855mg             171   8e-43    Capsella rubella
ref|XP_008646424.1|  PREDICTED: uncharacterized protein LOC103627...    169   3e-42    Zea mays [maize]
ref|XP_008646430.1|  PREDICTED: uncharacterized protein LOC103627...    169   3e-42    Zea mays [maize]
ref|XP_002863627.1|  hypothetical protein ARALYDRAFT_494617             167   8e-42    
ref|XP_010933204.1|  PREDICTED: uncharacterized protein LOC105053...    168   8e-42    Elaeis guineensis
ref|XP_010494373.1|  PREDICTED: uncharacterized protein LOC104771...    167   9e-42    Camelina sativa [gold-of-pleasure]
ref|XP_010494375.1|  PREDICTED: uncharacterized protein LOC104771...    167   1e-41    Camelina sativa [gold-of-pleasure]
ref|XP_004954364.1|  PREDICTED: uncharacterized protein LOC101771...    167   1e-41    Setaria italica
tpg|DAA37016.1|  TPA: hypothetical protein ZEAMMB73_455266              162   3e-41    
ref|XP_008669190.1|  PREDICTED: uncharacterized protein LOC103646...    162   4e-41    
ref|NP_199201.1|  uncharacterized protein                               165   4e-41    Arabidopsis thaliana [mouse-ear cress]
emb|CDX94731.1|  BnaC07g17400D                                          165   4e-41    
ref|XP_008669189.1|  PREDICTED: uncharacterized protein LOC103646...    162   5e-41    
gb|KEH23986.1|  DUF3741 family protein                                  164   1e-40    Medicago truncatula
gb|KJB26069.1|  hypothetical protein B456_004G223300                    164   2e-40    Gossypium raimondii
ref|XP_006850705.1|  PREDICTED: uncharacterized protein LOC18440502     163   4e-40    Amborella trichopoda
ref|XP_010526475.1|  PREDICTED: uncharacterized protein LOC104804...    162   6e-40    
ref|XP_008679171.1|  PREDICTED: uncharacterized protein LOC103654...    162   1e-39    
ref|XP_008679173.1|  PREDICTED: uncharacterized protein LOC103654...    162   1e-39    Zea mays [maize]
ref|XP_006648110.1|  PREDICTED: uncharacterized protein LOC102717592    161   1e-39    Oryza brachyantha
ref|XP_003570390.1|  PREDICTED: uncharacterized protein LOC100830114    161   2e-39    Brachypodium distachyon [annual false brome]
gb|EMT03099.1|  hypothetical protein F775_52439                         160   4e-39    
dbj|BAK04299.1|  predicted protein                                      160   5e-39    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010438386.1|  PREDICTED: uncharacterized protein LOC104721...    159   5e-39    Camelina sativa [gold-of-pleasure]
ref|XP_008809665.1|  PREDICTED: uncharacterized protein LOC103721...    159   7e-39    Phoenix dactylifera
ref|XP_008679172.1|  PREDICTED: uncharacterized protein LOC103654...    159   7e-39    
ref|XP_008679165.1|  PREDICTED: uncharacterized protein LOC103654...    159   7e-39    Zea mays [maize]
ref|XP_010447918.1|  PREDICTED: uncharacterized protein LOC104730...    159   1e-38    Camelina sativa [gold-of-pleasure]
ref|XP_010433166.1|  PREDICTED: uncharacterized protein LOC104717...    158   2e-38    Camelina sativa [gold-of-pleasure]
gb|EMS54382.1|  hypothetical protein TRIUR3_15055                       156   1e-37    Triticum urartu
ref|XP_008796409.1|  PREDICTED: uncharacterized protein LOC103711875    155   1e-37    Phoenix dactylifera
ref|XP_010253351.1|  PREDICTED: uncharacterized protein LOC104594...    154   3e-37    Nelumbo nucifera [Indian lotus]
emb|CAH67333.1|  OSIGBa0157A06.2                                        155   3e-37    Oryza sativa [red rice]
gb|EEC77598.1|  hypothetical protein OsI_16564                          154   4e-37    Oryza sativa Indica Group [Indian rice]
gb|EEE61300.1|  hypothetical protein OsJ_15391                          154   4e-37    Oryza sativa Japonica Group [Japonica rice]
ref|XP_009382189.1|  PREDICTED: uncharacterized protein LOC103970...    154   5e-37    
emb|CAA22976.1|  putative protein                                       153   8e-37    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010253350.1|  PREDICTED: uncharacterized protein LOC104594...    153   1e-36    Nelumbo nucifera [Indian lotus]
ref|XP_010253348.1|  PREDICTED: uncharacterized protein LOC104594...    153   1e-36    Nelumbo nucifera [Indian lotus]
ref|XP_010253349.1|  PREDICTED: uncharacterized protein LOC104594...    153   1e-36    Nelumbo nucifera [Indian lotus]
ref|XP_002448137.1|  hypothetical protein SORBIDRAFT_06g021940          150   9e-36    Sorghum bicolor [broomcorn]
ref|XP_010260031.1|  PREDICTED: uncharacterized protein LOC104599262    150   9e-36    
gb|EEC74239.1|  hypothetical protein OsI_09439                          150   1e-35    Oryza sativa Indica Group [Indian rice]
ref|NP_001048512.1|  Os02g0816400                                       150   1e-35    
ref|XP_006652490.1|  PREDICTED: uncharacterized protein LOC102722...    150   1e-35    Oryza brachyantha
ref|XP_006652489.1|  PREDICTED: uncharacterized protein LOC102722...    150   1e-35    Oryza brachyantha
emb|CDY32928.1|  BnaA09g16650D                                          149   1e-35    Brassica napus [oilseed rape]
ref|XP_009113974.1|  PREDICTED: uncharacterized protein LOC103839223    148   3e-35    Brassica rapa
gb|EMS51091.1|  hypothetical protein TRIUR3_23853                       148   5e-35    Triticum urartu
ref|XP_007144434.1|  hypothetical protein PHAVU_007G155800g             147   1e-34    Phaseolus vulgaris [French bean]
gb|ACN40217.1|  unknown                                                 145   4e-34    Picea sitchensis
ref|XP_009405681.1|  PREDICTED: uncharacterized protein LOC103988772    142   4e-33    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010540954.1|  PREDICTED: uncharacterized protein LOC104814...    142   5e-33    Tarenaya hassleriana [spider flower]
gb|KHN48970.1|  hypothetical protein glysoja_025347                     141   1e-32    Glycine soja [wild soybean]
ref|XP_003541385.2|  PREDICTED: uncharacterized protein LOC100787955    141   1e-32    Glycine max [soybeans]
emb|CDY50812.1|  BnaCnng19760D                                          140   2e-32    Brassica napus [oilseed rape]
ref|XP_011094798.1|  PREDICTED: uncharacterized protein LOC105174...    139   4e-32    
ref|XP_011094799.1|  PREDICTED: uncharacterized protein LOC105174...    139   4e-32    Sesamum indicum [beniseed]
dbj|BAJ95378.1|  predicted protein                                      139   6e-32    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_003537148.1|  PREDICTED: uncharacterized protein LOC100814...    138   1e-31    Glycine max [soybeans]
ref|XP_008789169.1|  PREDICTED: uncharacterized protein LOC103706730    136   5e-31    
ref|XP_010097375.1|  hypothetical protein L484_008898                   136   7e-31    Morus notabilis
ref|XP_002274593.2|  PREDICTED: uncharacterized protein LOC100248303    135   9e-31    Vitis vinifera
ref|XP_006345669.1|  PREDICTED: uncharacterized protein LOC102591...    135   1e-30    Solanum tuberosum [potatoes]
ref|XP_006345668.1|  PREDICTED: uncharacterized protein LOC102591...    133   6e-30    Solanum tuberosum [potatoes]
ref|XP_008355663.1|  PREDICTED: uncharacterized protein LOC103419321    133   6e-30    
ref|XP_004246741.2|  PREDICTED: uncharacterized protein LOC101245690    132   8e-30    Solanum lycopersicum
ref|XP_009343058.1|  PREDICTED: uncharacterized protein LOC103935011    132   1e-29    Pyrus x bretschneideri [bai li]
gb|KHG20894.1|  Afadin                                                  132   1e-29    Gossypium arboreum [tree cotton]
gb|KJB16899.1|  hypothetical protein B456_002G253500                    131   1e-29    Gossypium raimondii
ref|XP_010937726.1|  PREDICTED: uncharacterized protein LOC105057004    132   1e-29    Elaeis guineensis
ref|XP_004305226.1|  PREDICTED: uncharacterized protein LOC101298051    132   1e-29    Fragaria vesca subsp. vesca
gb|KJB16898.1|  hypothetical protein B456_002G253500                    131   2e-29    Gossypium raimondii
ref|XP_007027126.1|  Uncharacterized protein isoform 2                  131   2e-29    
ref|XP_007027125.1|  Uncharacterized protein isoform 1                  131   3e-29    
gb|KJB16896.1|  hypothetical protein B456_002G253500                    130   3e-29    Gossypium raimondii
gb|KHG18163.1|  Transcription initiation factor TFIID subunit 1-B...    130   3e-29    Gossypium arboreum [tree cotton]
ref|XP_004985731.1|  PREDICTED: uncharacterized protein LOC101771...    130   4e-29    Setaria italica
gb|KJB16897.1|  hypothetical protein B456_002G253500                    130   5e-29    Gossypium raimondii
ref|XP_009781874.1|  PREDICTED: uncharacterized protein LOC104230...    130   6e-29    Nicotiana sylvestris
ref|XP_008241636.1|  PREDICTED: probable GPI-anchored adhesin-lik...    130   7e-29    Prunus mume [ume]
emb|CAB67661.1|  putative protein                                       129   7e-29    Arabidopsis thaliana [mouse-ear cress]
ref|NP_190922.3|  uncharacterized protein                               129   7e-29    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009781875.1|  PREDICTED: uncharacterized protein LOC104230...    129   7e-29    Nicotiana sylvestris
ref|XP_009609522.1|  PREDICTED: uncharacterized protein LOC104103...    129   9e-29    Nicotiana tomentosiformis
ref|XP_009609521.1|  PREDICTED: uncharacterized protein LOC104103...    129   1e-28    Nicotiana tomentosiformis
ref|XP_009609523.1|  PREDICTED: uncharacterized protein LOC104103...    129   1e-28    Nicotiana tomentosiformis
gb|KJB36775.1|  hypothetical protein B456_006G176300                    129   1e-28    Gossypium raimondii
gb|EMT13565.1|  hypothetical protein F775_11179                         129   2e-28    
ref|XP_009374691.1|  PREDICTED: uncharacterized protein LOC103963581    128   2e-28    
ref|XP_008666662.1|  PREDICTED: uncharacterized protein LOC103645377    124   3e-28    
ref|XP_009377131.1|  PREDICTED: uncharacterized protein LOC103965780    127   4e-28    
ref|XP_010529869.1|  PREDICTED: uncharacterized protein LOC104806591    127   6e-28    Tarenaya hassleriana [spider flower]
emb|CBI32667.3|  unnamed protein product                                127   6e-28    Vitis vinifera
ref|NP_001053260.1|  Os04g0506900                                       126   7e-28    
ref|XP_011019251.1|  PREDICTED: uncharacterized protein LOC105122046    127   7e-28    Populus euphratica
ref|XP_010240105.1|  PREDICTED: uncharacterized protein LOC100830...    126   1e-27    
ref|XP_010240102.1|  PREDICTED: uncharacterized protein LOC100830...    126   1e-27    Brachypodium distachyon [annual false brome]
ref|XP_010553305.1|  PREDICTED: uncharacterized protein LOC104823434    126   1e-27    Tarenaya hassleriana [spider flower]
ref|XP_002877924.1|  hypothetical protein ARALYDRAFT_906742             125   3e-27    Arabidopsis lyrata subsp. lyrata
ref|XP_006290587.1|  hypothetical protein CARUB_v10016676mg             124   3e-27    Capsella rubella
ref|XP_012074865.1|  PREDICTED: uncharacterized protein LOC105636...    124   5e-27    Jatropha curcas
ref|XP_012074864.1|  PREDICTED: uncharacterized protein LOC105636...    124   7e-27    Jatropha curcas
ref|XP_010684191.1|  PREDICTED: uncharacterized protein LOC104898782    124   7e-27    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010481813.1|  PREDICTED: uncharacterized protein LOC104760...    122   9e-27    Camelina sativa [gold-of-pleasure]
ref|XP_010235705.1|  PREDICTED: uncharacterized protein LOC100838495    123   1e-26    Brachypodium distachyon [annual false brome]
ref|XP_004953111.1|  PREDICTED: uncharacterized protein LOC101762...    122   1e-26    Setaria italica
ref|XP_004953110.1|  PREDICTED: uncharacterized protein LOC101762...    122   2e-26    Setaria italica
gb|KFK34605.1|  hypothetical protein AALP_AA5G167300                    122   2e-26    Arabis alpina [alpine rockcress]
ref|XP_008794407.1|  PREDICTED: uncharacterized protein LOC103710467    122   2e-26    Phoenix dactylifera
ref|XP_006480729.1|  PREDICTED: uncharacterized protein LOC102617097    122   2e-26    Citrus sinensis [apfelsine]
gb|KDO44111.1|  hypothetical protein CISIN_1g002351mg                   121   3e-26    Citrus sinensis [apfelsine]
emb|CAE04715.1|  OSJNBa0043L24.3                                        121   4e-26    Oryza sativa Japonica Group [Japonica rice]
emb|CDY30861.1|  BnaC04g27160D                                          121   4e-26    Brassica napus [oilseed rape]
ref|XP_010920736.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    121   4e-26    
ref|XP_003558830.1|  PREDICTED: uncharacterized protein LOC100833211    121   4e-26    Brachypodium distachyon [annual false brome]
ref|XP_009103867.1|  PREDICTED: uncharacterized protein LOC103829936    120   8e-26    Brassica rapa
emb|CDY52750.1|  BnaA07g37650D                                          120   8e-26    Brassica napus [oilseed rape]
ref|XP_009116048.1|  PREDICTED: uncharacterized protein LOC103841278    120   1e-25    Brassica rapa
emb|CDY67352.1|  BnaA09g54710D                                          120   1e-25    Brassica napus [oilseed rape]
ref|XP_006403676.1|  hypothetical protein EUTSA_v10010116mg             119   2e-25    
ref|XP_009398053.1|  PREDICTED: uncharacterized protein LOC103982764    119   2e-25    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004142212.1|  PREDICTED: uncharacterized protein LOC101208558    119   2e-25    Cucumis sativus [cucumbers]
ref|XP_010528279.1|  PREDICTED: uncharacterized protein LOC104805...    118   3e-25    Tarenaya hassleriana [spider flower]
ref|XP_009139395.1|  PREDICTED: uncharacterized protein LOC103863400    118   3e-25    Brassica rapa
ref|XP_010427005.1|  PREDICTED: uncharacterized protein LOC104711921    118   4e-25    Camelina sativa [gold-of-pleasure]
emb|CDX78186.1|  BnaA09g33810D                                          117   4e-25    
ref|XP_010528296.1|  PREDICTED: uncharacterized protein LOC104805...    117   5e-25    Tarenaya hassleriana [spider flower]
emb|CDY07582.1|  BnaC06g14820D                                          117   8e-25    Brassica napus [oilseed rape]
ref|NP_001048940.1|  Os03g0143700                                       117   8e-25    
ref|XP_006651030.1|  PREDICTED: uncharacterized protein LOC102706550    117   1e-24    
ref|XP_002534051.1|  conserved hypothetical protein                     116   1e-24    
gb|EAZ23822.1|  hypothetical protein OsJ_07535                          116   1e-24    Oryza sativa Japonica Group [Japonica rice]
ref|XP_008447461.1|  PREDICTED: probable GPI-anchored adhesin-lik...    116   2e-24    
ref|XP_008447453.1|  PREDICTED: probable GPI-anchored adhesin-lik...    116   2e-24    Cucumis melo [Oriental melon]
ref|XP_010504117.1|  PREDICTED: uncharacterized protein LOC104781...    116   2e-24    
gb|EAY86700.1|  hypothetical protein OsI_08082                          116   2e-24    Oryza sativa Indica Group [Indian rice]
gb|EAY88501.1|  hypothetical protein OsI_09972                          114   6e-24    Oryza sativa Indica Group [Indian rice]
gb|EYU41671.1|  hypothetical protein MIMGU_mgv1a001075mg                114   8e-24    Erythranthe guttata [common monkey flower]
ref|XP_006649387.1|  PREDICTED: uncharacterized protein LOC102700033    114   1e-23    Oryza brachyantha
emb|CDX76205.1|  BnaA04g04690D                                          113   1e-23    
ref|XP_011007324.1|  PREDICTED: uncharacterized protein LOC105113036    112   3e-23    Populus euphratica
emb|CDX73546.1|  BnaC08g24570D                                          112   3e-23    
ref|XP_011011582.1|  PREDICTED: uncharacterized protein LOC105116093    111   4e-23    Populus euphratica
ref|XP_004985732.1|  PREDICTED: uncharacterized protein LOC101771...    111   7e-23    
ref|XP_009380669.1|  PREDICTED: uncharacterized protein LOC103969001    111   8e-23    
gb|EMS57338.1|  hypothetical protein TRIUR3_10172                       110   1e-22    
ref|XP_002454174.1|  hypothetical protein SORBIDRAFT_04g026030          110   1e-22    
ref|XP_004984773.1|  PREDICTED: uncharacterized protein LOC101776...    110   1e-22    
ref|XP_004984772.1|  PREDICTED: uncharacterized protein LOC101776...    110   1e-22    
ref|XP_007207901.1|  hypothetical protein PRUPE_ppa020794mg             110   1e-22    
ref|XP_003541395.1|  PREDICTED: uncharacterized protein LOC100794...    110   2e-22    
ref|XP_006594084.1|  PREDICTED: uncharacterized protein LOC100794...    110   2e-22    
ref|XP_006408939.1|  hypothetical protein EUTSA_v10001917mg             109   2e-22    
gb|EMS67579.1|  hypothetical protein TRIUR3_06787                       109   3e-22    
ref|XP_010037879.1|  PREDICTED: uncharacterized protein LOC104426...    109   3e-22    
ref|XP_010515848.1|  PREDICTED: uncharacterized protein LOC104791620    108   4e-22    
gb|KHN49003.1|  hypothetical protein glysoja_025380                     108   4e-22    
gb|EMT32262.1|  hypothetical protein F775_21072                         108   4e-22    
gb|KHG11107.1|  5-methyltetrahydropteroyltriglutamate--homocystei...    108   4e-22    
gb|KEH42338.1|  DUF4378 domain protein                                  108   5e-22    
gb|EMT10669.1|  hypothetical protein F775_15662                         108   6e-22    
ref|XP_002308481.2|  hypothetical protein POPTR_0006s23020g             108   7e-22    
gb|AFW72333.1|  hypothetical protein ZEAMMB73_984204                    108   8e-22    
ref|XP_010037880.1|  PREDICTED: uncharacterized protein LOC104426...    108   8e-22    
ref|XP_010504119.1|  PREDICTED: uncharacterized protein LOC104781...    107   8e-22    
ref|XP_008658328.1|  PREDICTED: uncharacterized protein LOC100274...    107   1e-21    
ref|XP_006429000.1|  hypothetical protein CICLE_v10011022mg             107   1e-21    
ref|XP_008658327.1|  PREDICTED: uncharacterized protein LOC100274...    107   1e-21    
gb|AFW88783.1|  hypothetical protein ZEAMMB73_317949                    107   2e-21    
gb|ABF95302.1|  expressed protein                                       106   2e-21    
gb|KHN05936.1|  hypothetical protein glysoja_026524                     106   2e-21    
ref|XP_006588731.1|  PREDICTED: uncharacterized protein LOC100797...    106   2e-21    
ref|XP_003536963.1|  PREDICTED: uncharacterized protein LOC100797...    106   3e-21    
gb|KJB62567.1|  hypothetical protein B456_009G423300                    105   4e-21    
ref|XP_008666979.1|  PREDICTED: uncharacterized protein LOC100272...    105   4e-21    
gb|ACN35840.1|  unknown                                                 105   4e-21    
gb|KEH42420.1|  DUF3741 family protein                                  105   6e-21    
ref|XP_007144479.1|  hypothetical protein PHAVU_007G159500g             105   7e-21    
ref|XP_008666975.1|  PREDICTED: uncharacterized protein LOC100272...    104   8e-21    
gb|EPS67988.1|  hypothetical protein M569_06785                       95.9    8e-21    
ref|XP_010240106.1|  PREDICTED: uncharacterized protein LOC100830...    104   1e-20    
ref|XP_008679174.1|  PREDICTED: uncharacterized protein LOC103654...    103   2e-20    
gb|EEC74984.1|  hypothetical protein OsI_11027                          103   2e-20    
ref|XP_004494988.1|  PREDICTED: uncharacterized protein LOC101494666    103   2e-20    
ref|XP_004495031.1|  PREDICTED: uro-adherence factor A-like isofo...    103   2e-20    
ref|XP_006649871.1|  PREDICTED: uncharacterized protein LOC102720963    103   2e-20    
ref|XP_002468071.1|  hypothetical protein SORBIDRAFT_01g039070          103   3e-20    
gb|EMS63000.1|  hypothetical protein TRIUR3_15420                       103   3e-20    
gb|EEE58811.1|  hypothetical protein OsJ_10364                          103   3e-20    
gb|ABF95303.1|  expressed protein                                       102   4e-20    
ref|NP_001049738.2|  Os03g0280700                                       102   6e-20    
ref|XP_008643431.1|  PREDICTED: uncharacterized protein LOC100278...    101   8e-20    
gb|EMT29081.1|  hypothetical protein F775_09465                         101   1e-19    
gb|EPS72225.1|  hypothetical protein M569_02533                       94.4    3e-19    
ref|XP_009400142.1|  PREDICTED: uncharacterized protein LOC103984388    100   3e-19    
emb|CDP06662.1|  unnamed protein product                              99.8    4e-19    
ref|XP_006410922.1|  hypothetical protein EUTSA_v10016240mg           99.0    7e-19    
ref|XP_006576987.1|  PREDICTED: uncharacterized protein LOC100801...  98.6    9e-19    
ref|XP_010228781.1|  PREDICTED: uncharacterized protein LOC100846538  98.6    9e-19    
gb|KHN09443.1|  hypothetical protein glysoja_016542                   98.6    1e-18    
emb|CDX91359.1|  BnaC04g07910D                                        97.1    2e-18    
ref|XP_002322831.2|  hypothetical protein POPTR_0016s08100g           95.9    7e-18    
ref|XP_009143502.1|  PREDICTED: uncharacterized protein LOC103867201  95.5    8e-18    
gb|EPS67990.1|  hypothetical protein M569_06787                       87.8    2e-17    
emb|CDX74965.1|  BnaA05g07110D                                        94.4    2e-17    
ref|XP_006296647.1|  hypothetical protein CARUB_v10015415mg           94.0    3e-17    
ref|XP_010922427.1|  PREDICTED: uncharacterized protein LOC105045745  94.0    3e-17    
ref|XP_010489077.1|  PREDICTED: uncharacterized protein LOC104766813  93.2    5e-17    
ref|XP_006594085.1|  PREDICTED: uncharacterized protein LOC100794...  93.2    6e-17    
gb|AAY78688.1|  hypothetical protein At2g20240                        91.3    2e-16    
dbj|BAD43822.1|  unknown protein                                      91.3    2e-16    
gb|AAO37163.1|  hypothetical protein                                  91.3    2e-16    
ref|NP_179614.1|  uncharacterized protein                             91.3    2e-16    
ref|XP_006576988.1|  PREDICTED: uncharacterized protein LOC100801...  90.9    3e-16    
ref|XP_008788147.1|  PREDICTED: uncharacterized protein LOC103705996  90.9    3e-16    
ref|XP_007162683.1|  hypothetical protein PHAVU_001G171300g           90.5    5e-16    
ref|XP_006588732.1|  PREDICTED: uncharacterized protein LOC100797...  89.4    9e-16    
emb|CDY31985.1|  BnaA07g00100D                                        88.6    2e-15    
ref|XP_002883937.1|  hypothetical protein ARALYDRAFT_319541           86.3    1e-14    
ref|XP_010416091.1|  PREDICTED: uncharacterized protein LOC104701996  85.9    1e-14    
gb|EMT01715.1|  hypothetical protein F775_12317                       85.1    3e-14    
ref|XP_004958818.1|  PREDICTED: uncharacterized protein LOC101760770  84.3    5e-14    
dbj|BAJ95773.1|  predicted protein                                    83.2    1e-13    
ref|XP_009402340.1|  PREDICTED: uncharacterized protein LOC103986152  83.2    1e-13    
ref|XP_010495916.1|  PREDICTED: probable GPI-anchored adhesin-lik...  82.8    1e-13    
gb|EMS55919.1|  hypothetical protein TRIUR3_12733                     81.6    4e-13    
ref|XP_009412598.1|  PREDICTED: uncharacterized protein LOC103994056  79.7    2e-12    
gb|KDP35576.1|  hypothetical protein JCGZ_09014                       79.3    2e-12    
emb|CDY65848.1|  BnaCnng48860D                                        79.0    2e-12    
ref|XP_010918571.1|  PREDICTED: uncharacterized protein LOC105042903  75.1    4e-11    
gb|EAY88009.1|  hypothetical protein OsI_09433                        73.2    4e-11    
ref|XP_008367440.1|  PREDICTED: homeobox-leucine zipper protein H...  73.6    8e-11    
ref|XP_008442588.1|  PREDICTED: uncharacterized protein LOC103486415  74.3    9e-11    
ref|XP_009406956.1|  PREDICTED: uncharacterized protein LOC103989737  74.3    9e-11    
ref|NP_001054473.2|  Os05g0116700                                     73.6    9e-11    
gb|EEE62112.1|  hypothetical protein OsJ_16896                        73.6    1e-10    
gb|EEC78409.1|  hypothetical protein OsI_18207                        73.6    1e-10    
ref|XP_004137947.1|  PREDICTED: uncharacterized protein LOC101208303  73.2    2e-10    
ref|XP_010233471.1|  PREDICTED: uncharacterized protein LOC100837...  72.4    3e-10    
ref|XP_006654925.1|  PREDICTED: uncharacterized protein LOC102715858  71.6    6e-10    
ref|XP_010646805.1|  PREDICTED: uncharacterized protein LOC100248502  71.2    8e-10    
ref|XP_008666987.1|  PREDICTED: uncharacterized protein LOC100272...  67.0    2e-08    
ref|XP_010907357.1|  PREDICTED: uncharacterized protein LOC105034036  67.0    2e-08    
gb|EMS59395.1|  hypothetical protein TRIUR3_07024                     66.6    3e-08    
dbj|BAK06892.1|  predicted protein                                    66.2    3e-08    
ref|XP_011027099.1|  PREDICTED: uncharacterized protein LOC105127480  66.2    3e-08    
ref|XP_008232896.1|  PREDICTED: probable GPI-anchored adhesin-lik...  65.9    4e-08    
ref|XP_008232894.1|  PREDICTED: probable GPI-anchored adhesin-lik...  65.9    4e-08    
ref|XP_008232895.1|  PREDICTED: probable GPI-anchored adhesin-lik...  65.9    4e-08    
ref|XP_008811114.1|  PREDICTED: uncharacterized protein LOC103722359  65.1    6e-08    
ref|XP_010231773.1|  PREDICTED: uncharacterized protein LOC100838890  65.1    7e-08    
ref|XP_006855730.2|  PREDICTED: uncharacterized protein LOC18445531   64.7    9e-08    
ref|XP_009367848.1|  PREDICTED: uncharacterized protein LOC103957...  64.3    1e-07    
ref|XP_009367850.1|  PREDICTED: uncharacterized protein LOC103957...  63.9    1e-07    
ref|XP_011092426.1|  PREDICTED: uncharacterized protein LOC105172605  63.5    2e-07    
ref|XP_011077431.1|  PREDICTED: uncharacterized protein LOC105161...  63.5    2e-07    
ref|XP_011077421.1|  PREDICTED: uncharacterized protein LOC105161...  63.2    2e-07    
ref|XP_008338845.1|  PREDICTED: probable GPI-anchored adhesin-lik...  63.2    3e-07    
ref|XP_008804042.1|  PREDICTED: uncharacterized protein LOC103717439  62.8    4e-07    
ref|XP_007220269.1|  hypothetical protein PRUPE_ppa001030mg           62.8    4e-07    
ref|XP_011029290.1|  PREDICTED: uncharacterized protein LOC105129...  62.4    4e-07    
ref|XP_011029288.1|  PREDICTED: uncharacterized protein LOC105129...  62.4    5e-07    
ref|XP_009340102.1|  PREDICTED: uncharacterized protein LOC103932266  61.6    1e-06    
ref|XP_002315249.2|  hypothetical protein POPTR_0010s21850g           60.8    1e-06    
ref|XP_004300797.2|  PREDICTED: uncharacterized protein LOC101311...  60.8    2e-06    
ref|XP_010089097.1|  hypothetical protein L484_024270                 60.5    2e-06    
gb|KDP25428.1|  hypothetical protein JCGZ_20584                       60.1    2e-06    
ref|XP_012086890.1|  PREDICTED: uncharacterized protein LOC105645...  60.1    2e-06    
ref|XP_006439536.1|  hypothetical protein CICLE_v100188782mg          60.1    3e-06    
gb|KDO76234.1|  hypothetical protein CISIN_1g006216mg                 60.1    3e-06    
ref|XP_012086887.1|  PREDICTED: uncharacterized protein LOC105645...  60.1    3e-06    
ref|XP_004306781.1|  PREDICTED: uncharacterized protein LOC101299...  60.1    3e-06    
ref|XP_011469014.1|  PREDICTED: uncharacterized protein LOC101299...  60.1    3e-06    
emb|CBI34662.3|  unnamed protein product                              59.7    3e-06    
ref|XP_002270314.3|  PREDICTED: uncharacterized protein LOC100247977  59.3    4e-06    
ref|XP_002439168.1|  hypothetical protein SORBIDRAFT_09g001710        58.9    6e-06    
ref|XP_002298030.2|  hypothetical protein POPTR_0001s09470g           58.9    6e-06    
ref|XP_004960484.1|  PREDICTED: uncharacterized protein LOC101757525  58.9    7e-06    
ref|XP_003562389.2|  PREDICTED: uncharacterized protein LOC100837...  58.5    7e-06    
ref|XP_006846166.1|  PREDICTED: uncharacterized protein LOC18436077   58.5    8e-06    
ref|XP_006476555.1|  PREDICTED: uncharacterized protein LOC102630...  57.8    1e-05    
ref|XP_006476557.1|  PREDICTED: uncharacterized protein LOC102630...  57.8    1e-05    
ref|XP_009764606.1|  PREDICTED: uncharacterized protein LOC104216...  57.4    2e-05    
ref|XP_009764603.1|  PREDICTED: uncharacterized protein LOC104216...  57.4    2e-05    
ref|XP_009764607.1|  PREDICTED: uncharacterized protein LOC104216...  57.4    2e-05    
ref|XP_002509811.1|  conserved hypothetical protein                   57.4    2e-05    
ref|XP_010326450.1|  PREDICTED: uncharacterized protein LOC101249...  56.6    3e-05    
ref|XP_011463894.1|  PREDICTED: uncharacterized protein LOC101311...  56.6    3e-05    
ref|XP_010326453.1|  PREDICTED: uncharacterized protein LOC101249...  56.2    4e-05    
ref|NP_001167903.1|  uncharacterized protein LOC100381614             56.2    4e-05    
gb|AFW74882.1|  hypothetical protein ZEAMMB73_062297                  56.2    4e-05    
ref|XP_002320799.1|  hypothetical protein POPTR_0014s08030g           56.2    5e-05    
gb|ERN17197.1|  hypothetical protein AMTR_s00044p00156360             55.8    5e-05    
ref|XP_011461594.1|  PREDICTED: uncharacterized protein LOC101305...  55.8    5e-05    
ref|XP_009590313.1|  PREDICTED: uncharacterized protein LOC104087518  55.8    5e-05    
emb|CAN77499.1|  hypothetical protein VITISV_002404                   55.8    6e-05    
ref|XP_004245598.1|  PREDICTED: uncharacterized protein LOC101256207  55.5    7e-05    
ref|XP_008337914.1|  PREDICTED: uncharacterized protein LOC103400994  55.5    7e-05    
ref|XP_009359598.1|  PREDICTED: uncharacterized protein LOC103950164  55.5    8e-05    
ref|XP_006343974.1|  PREDICTED: uncharacterized protein LOC102596852  55.5    8e-05    
ref|XP_010326456.1|  PREDICTED: uncharacterized protein LOC101249...  54.7    1e-04    
ref|XP_009600062.1|  PREDICTED: uncharacterized protein LOC104095613  54.7    1e-04    
ref|XP_010326425.1|  PREDICTED: uncharacterized protein LOC101249...  54.7    1e-04    
ref|XP_008241934.1|  PREDICTED: uncharacterized protein LOC103340317  54.3    2e-04    
ref|XP_010241886.1|  PREDICTED: uncharacterized protein LOC104586...  54.3    2e-04    
ref|XP_010241883.1|  PREDICTED: uncharacterized protein LOC104586...  54.3    2e-04    
ref|XP_010241884.1|  PREDICTED: uncharacterized protein LOC104586...  54.3    2e-04    
ref|XP_009382352.1|  PREDICTED: uncharacterized protein LOC103970341  54.3    2e-04    
ref|XP_010105924.1|  hypothetical protein L484_017272                 54.3    2e-04    
ref|XP_007009560.1|  Uncharacterized protein isoform 1                53.9    2e-04    
ref|XP_011461587.1|  PREDICTED: uncharacterized protein LOC101305...  53.9    2e-04    
ref|XP_007046500.1|  RB1-inducible coiled-coil protein 1, putativ...  53.9    2e-04    
ref|XP_007009561.1|  Uncharacterized protein isoform 2                53.5    2e-04    
ref|XP_007040258.1|  Uncharacterized protein TCM_016267               53.5    3e-04    
ref|XP_009364933.1|  PREDICTED: uncharacterized protein LOC103954829  53.1    4e-04    
ref|XP_007204290.1|  hypothetical protein PRUPE_ppa001187mg           53.1    4e-04    
ref|XP_009799667.1|  PREDICTED: uncharacterized protein LOC104245709  53.1    4e-04    
ref|XP_010266199.1|  PREDICTED: uncharacterized protein LOC104603...  53.1    4e-04    
gb|EPS72227.1|  hypothetical protein M569_02535                       49.3    4e-04    
ref|XP_006339576.1|  PREDICTED: uncharacterized protein LOC102596...  52.8    5e-04    
gb|KHN35955.1|  hypothetical protein glysoja_003078                   52.4    6e-04    
gb|KHG23925.1|  Protein piccolo                                       52.4    6e-04    
gb|KJB52115.1|  hypothetical protein B456_008G247100                  52.4    7e-04    
ref|XP_006590752.1|  PREDICTED: uncharacterized protein LOC100779...  52.4    7e-04    
gb|KJB52114.1|  hypothetical protein B456_008G247100                  52.4    7e-04    
gb|KHG03285.1|  Histidine--tRNA ligase                                52.4    8e-04    
gb|KJB52117.1|  hypothetical protein B456_008G247100                  52.0    8e-04    
gb|KJB52113.1|  hypothetical protein B456_008G247100                  52.0    9e-04    
gb|KJB52116.1|  hypothetical protein B456_008G247100                  52.0    9e-04    



>ref|XP_009592672.1| PREDICTED: uncharacterized protein LOC104089467 isoform X1 [Nicotiana 
tomentosiformis]
Length=975

 Score =   382 bits (982),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 189/289 (65%), Positives = 229/289 (79%), Gaps = 2/289 (1%)
 Frame = +1

Query  334   MYAVQNGKNRGLEKPIPGCLGRMVNLFDLNGGVAGNRLLTDKPHRDGSLSRSQSDVARMS  513
             M   Q+GK+R  +KP PGCLGRMVNLFD+N GV GNRLLTDKPHRDG+L RSQSDV R+S
Sbjct  1     MNGFQSGKSRNHDKPSPGCLGRMVNLFDINSGVPGNRLLTDKPHRDGTLLRSQSDVVRLS  60

Query  514   PSEDQIEDKEIVSELRRNNSKMKANGTPMKMLIAEEMSKDMASKHNPPSVVAKLMGLDGF  693
             PSEDQ+E+K IVS+L+R +S  K+NGTP+KMLIA+EMSK++ S HNPPSVVAKLMGLD  
Sbjct  61    PSEDQVEEKNIVSDLKRTSSNRKSNGTPIKMLIAQEMSKEIDSSHNPPSVVAKLMGLDAL  120

Query  694   PSQLPVSTAQRNYSGRNAQSAKGTPLNNFHHRSGSLDTQMECEFYQYPEQNECKDVYEVW  873
             P+Q  +  A R++ G +++    +  +   H + SL  +M+ EF+QYPEQNE KDVYEVW
Sbjct  121   PTQKSI-PAIRSHFGGHSRCHTDSSFSYCQHENESLVDEMQQEFHQYPEQNEYKDVYEVW  179

Query  874   QNRHDMNSMRSKSPQMGRCNETSTD-KVAFVRQKFIEAKCLSLDEKCHHSRQFQDALEVL  1050
             Q+   MN +RSKSPQ  R NETS D K AFVRQKFIEAKCLS+DE+   S++F DAL+VL
Sbjct  180   QHSPKMNCVRSKSPQKARHNETSFDKKSAFVRQKFIEAKCLSIDEQLRQSKEFHDALDVL  239

Query  1051  SSNTDLVLKFLQEPKPMLSEHIYNLQSIPAPSETKRITVLKPSKMVDNC  1197
             SSNTDL LKFLQEP P  S+H+YNLQSIP P ETKRITVL+PSKMVD+C
Sbjct  240   SSNTDLFLKFLQEPNPKFSQHLYNLQSIPPPPETKRITVLRPSKMVDDC  288



>ref|XP_009592673.1| PREDICTED: uncharacterized protein LOC104089467 isoform X2 [Nicotiana 
tomentosiformis]
Length=974

 Score =   382 bits (982),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 189/289 (65%), Positives = 229/289 (79%), Gaps = 2/289 (1%)
 Frame = +1

Query  334   MYAVQNGKNRGLEKPIPGCLGRMVNLFDLNGGVAGNRLLTDKPHRDGSLSRSQSDVARMS  513
             M   Q+GK+R  +KP PGCLGRMVNLFD+N GV GNRLLTDKPHRDG+L RSQSDV R+S
Sbjct  1     MNGFQSGKSRNHDKPSPGCLGRMVNLFDINSGVPGNRLLTDKPHRDGTLLRSQSDVVRLS  60

Query  514   PSEDQIEDKEIVSELRRNNSKMKANGTPMKMLIAEEMSKDMASKHNPPSVVAKLMGLDGF  693
             PSEDQ+E+K IVS+L+R +S  K+NGTP+KMLIA+EMSK++ S HNPPSVVAKLMGLD  
Sbjct  61    PSEDQVEEKNIVSDLKRTSSNRKSNGTPIKMLIAQEMSKEIDSSHNPPSVVAKLMGLDAL  120

Query  694   PSQLPVSTAQRNYSGRNAQSAKGTPLNNFHHRSGSLDTQMECEFYQYPEQNECKDVYEVW  873
             P+Q  +  A R++ G +++    +  +   H + SL  +M+ EF+QYPEQNE KDVYEVW
Sbjct  121   PTQKSI-PAIRSHFGGHSRCHTDSSFSYCQHENESLVDEMQQEFHQYPEQNEYKDVYEVW  179

Query  874   QNRHDMNSMRSKSPQMGRCNETSTD-KVAFVRQKFIEAKCLSLDEKCHHSRQFQDALEVL  1050
             Q+   MN +RSKSPQ  R NETS D K AFVRQKFIEAKCLS+DE+   S++F DAL+VL
Sbjct  180   QHSPKMNCVRSKSPQKARHNETSFDKKSAFVRQKFIEAKCLSIDEQLRQSKEFHDALDVL  239

Query  1051  SSNTDLVLKFLQEPKPMLSEHIYNLQSIPAPSETKRITVLKPSKMVDNC  1197
             SSNTDL LKFLQEP P  S+H+YNLQSIP P ETKRITVL+PSKMVD+C
Sbjct  240   SSNTDLFLKFLQEPNPKFSQHLYNLQSIPPPPETKRITVLRPSKMVDDC  288



>ref|XP_009770277.1| PREDICTED: uncharacterized protein LOC104221001 isoform X1 [Nicotiana 
sylvestris]
Length=976

 Score =   382 bits (980),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 189/289 (65%), Positives = 231/289 (80%), Gaps = 2/289 (1%)
 Frame = +1

Query  334   MYAVQNGKNRGLEKPIPGCLGRMVNLFDLNGGVAGNRLLTDKPHRDGSLSRSQSDVARMS  513
             M   Q+GK+R  +KP PGCLGRMVNLFDLN GV GNRLLTDKPHRDGSL RSQSDV R+S
Sbjct  1     MNGFQSGKSRNHDKPSPGCLGRMVNLFDLNSGVPGNRLLTDKPHRDGSLLRSQSDVVRLS  60

Query  514   PSEDQIEDKEIVSELRRNNSKMKANGTPMKMLIAEEMSKDMASKHNPPSVVAKLMGLDGF  693
             PSEDQ+E+K IVS+L+R +S  K+NGTP+K+LIA+EMSK++ S HNPPSVVAKLMGLD  
Sbjct  61    PSEDQVEEKMIVSDLKRTSSNRKSNGTPIKLLIAQEMSKEIDSSHNPPSVVAKLMGLDAL  120

Query  694   PSQLPVSTAQRNYSGRNAQSAKGTPLNNFHHRSGSLDTQMECEFYQYPEQNECKDVYEVW  873
             P+Q  +  A R++ G +++    +  +   H + SL  +M+ EF+QYPEQNE +DVYEVW
Sbjct  121   PAQKSI-PAIRSHFGGHSRCHTDSSFSYCQHENESLVEEMQQEFHQYPEQNEYRDVYEVW  179

Query  874   QNRHDMNSMRSKSPQMGRCNETSTD-KVAFVRQKFIEAKCLSLDEKCHHSRQFQDALEVL  1050
             Q+   MN +RSKSPQ  R NETS + K AFVRQKFIEAKCLS+DE+   S++FQDA++VL
Sbjct  180   QHSPKMNCVRSKSPQKARHNETSFEKKSAFVRQKFIEAKCLSIDEQLRQSKEFQDAIDVL  239

Query  1051  SSNTDLVLKFLQEPKPMLSEHIYNLQSIPAPSETKRITVLKPSKMVDNC  1197
             SSNTDL LKFLQEP P LS+H+YNLQSIP P ETKRITVL+PSKMVD+C
Sbjct  240   SSNTDLFLKFLQEPNPKLSQHLYNLQSIPPPPETKRITVLRPSKMVDDC  288



>ref|XP_009770284.1| PREDICTED: uncharacterized protein LOC104221001 isoform X2 [Nicotiana 
sylvestris]
Length=975

 Score =   382 bits (980),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 189/289 (65%), Positives = 231/289 (80%), Gaps = 2/289 (1%)
 Frame = +1

Query  334   MYAVQNGKNRGLEKPIPGCLGRMVNLFDLNGGVAGNRLLTDKPHRDGSLSRSQSDVARMS  513
             M   Q+GK+R  +KP PGCLGRMVNLFDLN GV GNRLLTDKPHRDGSL RSQSDV R+S
Sbjct  1     MNGFQSGKSRNHDKPSPGCLGRMVNLFDLNSGVPGNRLLTDKPHRDGSLLRSQSDVVRLS  60

Query  514   PSEDQIEDKEIVSELRRNNSKMKANGTPMKMLIAEEMSKDMASKHNPPSVVAKLMGLDGF  693
             PSEDQ+E+K IVS+L+R +S  K+NGTP+K+LIA+EMSK++ S HNPPSVVAKLMGLD  
Sbjct  61    PSEDQVEEKMIVSDLKRTSSNRKSNGTPIKLLIAQEMSKEIDSSHNPPSVVAKLMGLDAL  120

Query  694   PSQLPVSTAQRNYSGRNAQSAKGTPLNNFHHRSGSLDTQMECEFYQYPEQNECKDVYEVW  873
             P+Q  +  A R++ G +++    +  +   H + SL  +M+ EF+QYPEQNE +DVYEVW
Sbjct  121   PAQKSI-PAIRSHFGGHSRCHTDSSFSYCQHENESLVEEMQQEFHQYPEQNEYRDVYEVW  179

Query  874   QNRHDMNSMRSKSPQMGRCNETSTD-KVAFVRQKFIEAKCLSLDEKCHHSRQFQDALEVL  1050
             Q+   MN +RSKSPQ  R NETS + K AFVRQKFIEAKCLS+DE+   S++FQDA++VL
Sbjct  180   QHSPKMNCVRSKSPQKARHNETSFEKKSAFVRQKFIEAKCLSIDEQLRQSKEFQDAIDVL  239

Query  1051  SSNTDLVLKFLQEPKPMLSEHIYNLQSIPAPSETKRITVLKPSKMVDNC  1197
             SSNTDL LKFLQEP P LS+H+YNLQSIP P ETKRITVL+PSKMVD+C
Sbjct  240   SSNTDLFLKFLQEPNPKLSQHLYNLQSIPPPPETKRITVLRPSKMVDDC  288



>ref|XP_006350289.1| PREDICTED: uncharacterized protein LOC102583747 [Solanum tuberosum]
Length=975

 Score =   370 bits (951),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 186/291 (64%), Positives = 230/291 (79%), Gaps = 6/291 (2%)
 Frame = +1

Query  334   MYAVQNGKNRGLEKPIPGCLGRMVNLFDLNGGVAGNRLLTDKPHRDGSLSRSQSDVARMS  513
             M  +QNG++R  +KP PGCLGRMVNLFDLN GVAGNRLLTDKPHRDGSLSRSQSD+ R+ 
Sbjct  1     MNGLQNGRSRTYDKPSPGCLGRMVNLFDLNSGVAGNRLLTDKPHRDGSLSRSQSDLVRLP  60

Query  514   PS-EDQIEDKEIVSELRRNNSKMKANGTPMKMLIAEEMSKDMASKHNPPSVVAKLMGLDG  690
             PS EDQ+E+K +VS L+R NS  K+NG PMKMLIA+EMSK++ S+HNPPSVVAKLMGLD 
Sbjct  61    PSSEDQVEEKMVVSGLKRTNSNRKSNGMPMKMLIAQEMSKEIDSRHNPPSVVAKLMGLDA  120

Query  691   FPSQ-LPVSTAQRNYSGRNAQSAKGTPLNNFHHRSGSLDTQMECEFYQYPEQNECKDVYE  867
              P + +P   A R++ G +++    +  +     + SL  +++ E +QYPEQNE KDVYE
Sbjct  121   LPQKSVP---AIRSHFGGHSRCHTDSSFSYCQDENESLTEELQQELHQYPEQNEYKDVYE  177

Query  868   VWQNRHDMNSMRSKSPQMGRCNETSTDK-VAFVRQKFIEAKCLSLDEKCHHSRQFQDALE  1044
             VWQ+   MNS+RSKSPQ  R +E S +K  AFVRQKFIEAKCLS+DE+   S++FQDAL+
Sbjct  178   VWQHPPKMNSVRSKSPQKARHDEISFEKKSAFVRQKFIEAKCLSIDEQLRQSKEFQDALD  237

Query  1045  VLSSNTDLVLKFLQEPKPMLSEHIYNLQSIPAPSETKRITVLKPSKMVDNC  1197
             VLSSNTDL LKFLQEP PM ++H+YNLQSIP P ETKRITVL+PSKM+D+C
Sbjct  238   VLSSNTDLFLKFLQEPNPMFTQHLYNLQSIPPPPETKRITVLRPSKMIDDC  288



>ref|XP_010323076.1| PREDICTED: uncharacterized protein LOC101266733 isoform X4 [Solanum 
lycopersicum]
Length=984

 Score =   363 bits (933),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 186/296 (63%), Positives = 226/296 (76%), Gaps = 4/296 (1%)
 Frame = +1

Query  310   FALLRHSEMYAVQNGKNRGLEKPIPGCLGRMVNLFDLNGGVAGNRLLTDKPHRDGSLSRS  489
             F  +   EM   QNGKN  L+KP PGCLGRMVNLFDLN GV GN+LLTDKPH  GSLSRS
Sbjct  18    FVCVSGGEMNGFQNGKNCNLDKPFPGCLGRMVNLFDLNSGVTGNKLLTDKPH--GSLSRS  75

Query  490   QSDVARMSPSEDQIEDKEIVSELRRNNSKMKANGTPMKMLIAEEMSKDMASKHNPPSVVA  669
             QSDV RM PS +QIE+K IVS+L+RN+S  K+NGTPMKMLIA+EMSK++ S  NPPS+VA
Sbjct  76    QSDVVRMYPSGNQIEEKMIVSDLKRNSSNRKSNGTPMKMLIAQEMSKEIDSSQNPPSLVA  135

Query  670   KLMGLDGFPSQLPVSTAQRNYSGRNAQSAKGTPLNNFHHRSGSLDTQMECEFYQYPEQNE  849
             KLMGLD FP++  VS  Q ++ G +++S   +  +   H +GSL  +M  EF+Q PE+NE
Sbjct  136   KLMGLDAFPTRKSVSATQSHFGG-HSRSHTDSSFSYCPHENGSLMEEMHQEFHQCPEENE  194

Query  850   CKDVYEVWQNRHDMNSMRSKSPQMGRCNETSTDK-VAFVRQKFIEAKCLSLDEKCHHSRQ  1026
              KDVYEVWQ    +N +RSKSPQ  R +ETS DK VAFVRQKFIEAKCLS+D     S++
Sbjct  195   YKDVYEVWQQPTKINCVRSKSPQKARHDETSIDKKVAFVRQKFIEAKCLSIDGNLRQSKE  254

Query  1027  FQDALEVLSSNTDLVLKFLQEPKPMLSEHIYNLQSIPAPSETKRITVLKPSKMVDN  1194
             FQ+AL+VLSSNTDL LKFLQEP PM S+ +  L+S+P P ETKRITVL+P+KMVDN
Sbjct  255   FQEALDVLSSNTDLFLKFLQEPNPMFSQQLQKLKSVPPPPETKRITVLRPTKMVDN  310



>ref|XP_010323075.1| PREDICTED: uncharacterized protein LOC101266733 isoform X3 [Solanum 
lycopersicum]
Length=985

 Score =   363 bits (933),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 186/296 (63%), Positives = 226/296 (76%), Gaps = 4/296 (1%)
 Frame = +1

Query  310   FALLRHSEMYAVQNGKNRGLEKPIPGCLGRMVNLFDLNGGVAGNRLLTDKPHRDGSLSRS  489
             F  +   EM   QNGKN  L+KP PGCLGRMVNLFDLN GV GN+LLTDKPH  GSLSRS
Sbjct  18    FVCVSGGEMNGFQNGKNCNLDKPFPGCLGRMVNLFDLNSGVTGNKLLTDKPH--GSLSRS  75

Query  490   QSDVARMSPSEDQIEDKEIVSELRRNNSKMKANGTPMKMLIAEEMSKDMASKHNPPSVVA  669
             QSDV RM PS +QIE+K IVS+L+RN+S  K+NGTPMKMLIA+EMSK++ S  NPPS+VA
Sbjct  76    QSDVVRMYPSGNQIEEKMIVSDLKRNSSNRKSNGTPMKMLIAQEMSKEIDSSQNPPSLVA  135

Query  670   KLMGLDGFPSQLPVSTAQRNYSGRNAQSAKGTPLNNFHHRSGSLDTQMECEFYQYPEQNE  849
             KLMGLD FP++  VS  Q ++ G +++S   +  +   H +GSL  +M  EF+Q PE+NE
Sbjct  136   KLMGLDAFPTRKSVSATQSHFGG-HSRSHTDSSFSYCPHENGSLMEEMHQEFHQCPEENE  194

Query  850   CKDVYEVWQNRHDMNSMRSKSPQMGRCNETSTDK-VAFVRQKFIEAKCLSLDEKCHHSRQ  1026
              KDVYEVWQ    +N +RSKSPQ  R +ETS DK VAFVRQKFIEAKCLS+D     S++
Sbjct  195   YKDVYEVWQQPTKINCVRSKSPQKARHDETSIDKKVAFVRQKFIEAKCLSIDGNLRQSKE  254

Query  1027  FQDALEVLSSNTDLVLKFLQEPKPMLSEHIYNLQSIPAPSETKRITVLKPSKMVDN  1194
             FQ+AL+VLSSNTDL LKFLQEP PM S+ +  L+S+P P ETKRITVL+P+KMVDN
Sbjct  255   FQEALDVLSSNTDLFLKFLQEPNPMFSQQLQKLKSVPPPPETKRITVLRPTKMVDN  310



>ref|XP_010323074.1| PREDICTED: uncharacterized protein LOC101266733 isoform X2 [Solanum 
lycopersicum]
Length=987

 Score =   363 bits (933),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 186/296 (63%), Positives = 226/296 (76%), Gaps = 4/296 (1%)
 Frame = +1

Query  310   FALLRHSEMYAVQNGKNRGLEKPIPGCLGRMVNLFDLNGGVAGNRLLTDKPHRDGSLSRS  489
             F  +   EM   QNGKN  L+KP PGCLGRMVNLFDLN GV GN+LLTDKPH  GSLSRS
Sbjct  18    FVCVSGGEMNGFQNGKNCNLDKPFPGCLGRMVNLFDLNSGVTGNKLLTDKPH--GSLSRS  75

Query  490   QSDVARMSPSEDQIEDKEIVSELRRNNSKMKANGTPMKMLIAEEMSKDMASKHNPPSVVA  669
             QSDV RM PS +QIE+K IVS+L+RN+S  K+NGTPMKMLIA+EMSK++ S  NPPS+VA
Sbjct  76    QSDVVRMYPSGNQIEEKMIVSDLKRNSSNRKSNGTPMKMLIAQEMSKEIDSSQNPPSLVA  135

Query  670   KLMGLDGFPSQLPVSTAQRNYSGRNAQSAKGTPLNNFHHRSGSLDTQMECEFYQYPEQNE  849
             KLMGLD FP++  VS  Q ++ G +++S   +  +   H +GSL  +M  EF+Q PE+NE
Sbjct  136   KLMGLDAFPTRKSVSATQSHFGG-HSRSHTDSSFSYCPHENGSLMEEMHQEFHQCPEENE  194

Query  850   CKDVYEVWQNRHDMNSMRSKSPQMGRCNETSTDK-VAFVRQKFIEAKCLSLDEKCHHSRQ  1026
              KDVYEVWQ    +N +RSKSPQ  R +ETS DK VAFVRQKFIEAKCLS+D     S++
Sbjct  195   YKDVYEVWQQPTKINCVRSKSPQKARHDETSIDKKVAFVRQKFIEAKCLSIDGNLRQSKE  254

Query  1027  FQDALEVLSSNTDLVLKFLQEPKPMLSEHIYNLQSIPAPSETKRITVLKPSKMVDN  1194
             FQ+AL+VLSSNTDL LKFLQEP PM S+ +  L+S+P P ETKRITVL+P+KMVDN
Sbjct  255   FQEALDVLSSNTDLFLKFLQEPNPMFSQQLQKLKSVPPPPETKRITVLRPTKMVDN  310



>ref|XP_010323073.1| PREDICTED: uncharacterized protein LOC101266733 isoform X1 [Solanum 
lycopersicum]
Length=988

 Score =   363 bits (933),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 186/296 (63%), Positives = 226/296 (76%), Gaps = 4/296 (1%)
 Frame = +1

Query  310   FALLRHSEMYAVQNGKNRGLEKPIPGCLGRMVNLFDLNGGVAGNRLLTDKPHRDGSLSRS  489
             F  +   EM   QNGKN  L+KP PGCLGRMVNLFDLN GV GN+LLTDKPH  GSLSRS
Sbjct  18    FVCVSGGEMNGFQNGKNCNLDKPFPGCLGRMVNLFDLNSGVTGNKLLTDKPH--GSLSRS  75

Query  490   QSDVARMSPSEDQIEDKEIVSELRRNNSKMKANGTPMKMLIAEEMSKDMASKHNPPSVVA  669
             QSDV RM PS +QIE+K IVS+L+RN+S  K+NGTPMKMLIA+EMSK++ S  NPPS+VA
Sbjct  76    QSDVVRMYPSGNQIEEKMIVSDLKRNSSNRKSNGTPMKMLIAQEMSKEIDSSQNPPSLVA  135

Query  670   KLMGLDGFPSQLPVSTAQRNYSGRNAQSAKGTPLNNFHHRSGSLDTQMECEFYQYPEQNE  849
             KLMGLD FP++  VS  Q ++ G +++S   +  +   H +GSL  +M  EF+Q PE+NE
Sbjct  136   KLMGLDAFPTRKSVSATQSHFGG-HSRSHTDSSFSYCPHENGSLMEEMHQEFHQCPEENE  194

Query  850   CKDVYEVWQNRHDMNSMRSKSPQMGRCNETSTDK-VAFVRQKFIEAKCLSLDEKCHHSRQ  1026
              KDVYEVWQ    +N +RSKSPQ  R +ETS DK VAFVRQKFIEAKCLS+D     S++
Sbjct  195   YKDVYEVWQQPTKINCVRSKSPQKARHDETSIDKKVAFVRQKFIEAKCLSIDGNLRQSKE  254

Query  1027  FQDALEVLSSNTDLVLKFLQEPKPMLSEHIYNLQSIPAPSETKRITVLKPSKMVDN  1194
             FQ+AL+VLSSNTDL LKFLQEP PM S+ +  L+S+P P ETKRITVL+P+KMVDN
Sbjct  255   FQEALDVLSSNTDLFLKFLQEPNPMFSQQLQKLKSVPPPPETKRITVLRPTKMVDN  310



>ref|XP_009589098.1| PREDICTED: uncharacterized protein LOC104086523 isoform X3 [Nicotiana 
tomentosiformis]
Length=972

 Score =   362 bits (928),  Expect = 7e-112, Method: Compositional matrix adjust.
 Identities = 189/288 (66%), Positives = 222/288 (77%), Gaps = 5/288 (2%)
 Frame = +1

Query  334   MYAVQNGKNRGLEKPIPGCLGRMVNLFDLNGGVAGNRLLTDKPHRDGSLSRSQSDVARMS  513
             M   QNGKN  L+KP PGCLGRMVNLFDLN GVAGNR+LTDKPH  GSLSRSQSDV R  
Sbjct  1     MNGFQNGKNSNLDKPFPGCLGRMVNLFDLNSGVAGNRMLTDKPH--GSLSRSQSDVVRAY  58

Query  514   PSEDQIEDKEIVSELRRNNSKMKANGTPMKMLIAEEMSKDMASKHNPPSVVAKLMGLDGF  693
             PSEDQIE K I S+L+RN+S  K+NGTPMK LIA+EMSK++ S  NPPSVVAKLMGLD F
Sbjct  59    PSEDQIEGKMIFSDLKRNSSNKKSNGTPMKKLIAQEMSKEINSCQNPPSVVAKLMGLDAF  118

Query  694   PSQLPVSTAQRNYSGRNAQSAKGTPLNNFHHRSGSLDTQMECEFYQYPEQNECKDVYEVW  873
             P +  VS A+ ++ G +++S   +  +   H +GSL  +M     QY EQNE KDVYEVW
Sbjct  119   PMRRSVSAARSHFGG-HSRSHTDSSFSYCQHENGSLMEEMH-NVNQYAEQNEYKDVYEVW  176

Query  874   QNRHDMNSMRSKSPQMGRCNETSTDK-VAFVRQKFIEAKCLSLDEKCHHSRQFQDALEVL  1050
             Q    +N +RSKSPQ  + +ETS DK VAFVRQKFIEAKCLS+D K   S++FQ+ALEVL
Sbjct  177   QPPTKINCVRSKSPQKAKDDETSIDKKVAFVRQKFIEAKCLSIDGKLRQSKEFQEALEVL  236

Query  1051  SSNTDLVLKFLQEPKPMLSEHIYNLQSIPAPSETKRITVLKPSKMVDN  1194
             SSNTDL LKFLQEP PM S+H++NL+S+P P ETKRITVLKPSKMVDN
Sbjct  237   SSNTDLFLKFLQEPNPMFSQHLHNLKSVPPPPETKRITVLKPSKMVDN  284



>ref|XP_006352720.1| PREDICTED: uncharacterized protein LOC102578662 isoform X5 [Solanum 
tuberosum]
Length=963

 Score =   361 bits (927),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 184/288 (64%), Positives = 223/288 (77%), Gaps = 4/288 (1%)
 Frame = +1

Query  334   MYAVQNGKNRGLEKPIPGCLGRMVNLFDLNGGVAGNRLLTDKPHRDGSLSRSQSDVARMS  513
             M   QNGKN  L+KP PGCLGRMVNLFDLN GVAGN+LLTDKPH  GSLSRSQSDV RM 
Sbjct  1     MNGFQNGKNCNLDKPFPGCLGRMVNLFDLNSGVAGNKLLTDKPH--GSLSRSQSDVVRMY  58

Query  514   PSEDQIEDKEIVSELRRNNSKMKANGTPMKMLIAEEMSKDMASKHNPPSVVAKLMGLDGF  693
             PS DQIE+K IVS+L+RN+S  K+NGTPMKMLIA+EMSK++ S  NPPS+VAKLMGLD F
Sbjct  59    PSGDQIEEKMIVSDLKRNSSNRKSNGTPMKMLIAQEMSKEIDSSQNPPSLVAKLMGLDAF  118

Query  694   PSQLPVSTAQRNYSGRNAQSAKGTPLNNFHHRSGSLDTQMECEFYQYPEQNECKDVYEVW  873
             P++  VS  Q ++ G +++    +  +   H +GSL  +M  +F+Q PE+NE KDVYEVW
Sbjct  119   PTRRSVSATQSHFGG-HSRCHTDSSFSYCQHENGSLMEEMHQKFHQCPEENEYKDVYEVW  177

Query  874   QNRHDMNSMRSKSPQMGRCNETSTD-KVAFVRQKFIEAKCLSLDEKCHHSRQFQDALEVL  1050
             Q    +N +RSKSPQ  R +ETS D KVAFVRQKFIEAKCLS+D     S++FQ+AL+VL
Sbjct  178   QQPTKINCVRSKSPQKARHDETSIDKKVAFVRQKFIEAKCLSIDGNLRQSKEFQEALDVL  237

Query  1051  SSNTDLVLKFLQEPKPMLSEHIYNLQSIPAPSETKRITVLKPSKMVDN  1194
             SSNTDL LKFLQEP PM S+ +  L+S+P P ETKRITVL+P+KMVDN
Sbjct  238   SSNTDLFLKFLQEPNPMFSQQLQKLKSVPPPPETKRITVLRPTKMVDN  285



>ref|XP_006352716.1| PREDICTED: uncharacterized protein LOC102578662 isoform X1 [Solanum 
tuberosum]
Length=1089

 Score =   363 bits (931),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 185/289 (64%), Positives = 224/289 (78%), Gaps = 4/289 (1%)
 Frame = +1

Query  331   EMYAVQNGKNRGLEKPIPGCLGRMVNLFDLNGGVAGNRLLTDKPHRDGSLSRSQSDVARM  510
             EM   QNGKN  L+KP PGCLGRMVNLFDLN GVAGN+LLTDKPH  GSLSRSQSDV RM
Sbjct  126   EMNGFQNGKNCNLDKPFPGCLGRMVNLFDLNSGVAGNKLLTDKPH--GSLSRSQSDVVRM  183

Query  511   SPSEDQIEDKEIVSELRRNNSKMKANGTPMKMLIAEEMSKDMASKHNPPSVVAKLMGLDG  690
              PS DQIE+K IVS+L+RN+S  K+NGTPMKMLIA+EMSK++ S  NPPS+VAKLMGLD 
Sbjct  184   YPSGDQIEEKMIVSDLKRNSSNRKSNGTPMKMLIAQEMSKEIDSSQNPPSLVAKLMGLDA  243

Query  691   FPSQLPVSTAQRNYSGRNAQSAKGTPLNNFHHRSGSLDTQMECEFYQYPEQNECKDVYEV  870
             FP++  VS  Q ++ G +++    +  +   H +GSL  +M  +F+Q PE+NE KDVYEV
Sbjct  244   FPTRRSVSATQSHFGG-HSRCHTDSSFSYCQHENGSLMEEMHQKFHQCPEENEYKDVYEV  302

Query  871   WQNRHDMNSMRSKSPQMGRCNETSTD-KVAFVRQKFIEAKCLSLDEKCHHSRQFQDALEV  1047
             WQ    +N +RSKSPQ  R +ETS D KVAFVRQKFIEAKCLS+D     S++FQ+AL+V
Sbjct  303   WQQPTKINCVRSKSPQKARHDETSIDKKVAFVRQKFIEAKCLSIDGNLRQSKEFQEALDV  362

Query  1048  LSSNTDLVLKFLQEPKPMLSEHIYNLQSIPAPSETKRITVLKPSKMVDN  1194
             LSSNTDL LKFLQEP PM S+ +  L+S+P P ETKRITVL+P+KMVDN
Sbjct  363   LSSNTDLFLKFLQEPNPMFSQQLQKLKSVPPPPETKRITVLRPTKMVDN  411



>ref|XP_006352719.1| PREDICTED: uncharacterized protein LOC102578662 isoform X4 [Solanum 
tuberosum]
Length=1087

 Score =   363 bits (931),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 185/289 (64%), Positives = 224/289 (78%), Gaps = 4/289 (1%)
 Frame = +1

Query  331   EMYAVQNGKNRGLEKPIPGCLGRMVNLFDLNGGVAGNRLLTDKPHRDGSLSRSQSDVARM  510
             EM   QNGKN  L+KP PGCLGRMVNLFDLN GVAGN+LLTDKPH  GSLSRSQSDV RM
Sbjct  126   EMNGFQNGKNCNLDKPFPGCLGRMVNLFDLNSGVAGNKLLTDKPH--GSLSRSQSDVVRM  183

Query  511   SPSEDQIEDKEIVSELRRNNSKMKANGTPMKMLIAEEMSKDMASKHNPPSVVAKLMGLDG  690
              PS DQIE+K IVS+L+RN+S  K+NGTPMKMLIA+EMSK++ S  NPPS+VAKLMGLD 
Sbjct  184   YPSGDQIEEKMIVSDLKRNSSNRKSNGTPMKMLIAQEMSKEIDSSQNPPSLVAKLMGLDA  243

Query  691   FPSQLPVSTAQRNYSGRNAQSAKGTPLNNFHHRSGSLDTQMECEFYQYPEQNECKDVYEV  870
             FP++  VS  Q ++ G +++    +  +   H +GSL  +M  +F+Q PE+NE KDVYEV
Sbjct  244   FPTRRSVSATQSHFGG-HSRCHTDSSFSYCQHENGSLMEEMHQKFHQCPEENEYKDVYEV  302

Query  871   WQNRHDMNSMRSKSPQMGRCNETSTD-KVAFVRQKFIEAKCLSLDEKCHHSRQFQDALEV  1047
             WQ    +N +RSKSPQ  R +ETS D KVAFVRQKFIEAKCLS+D     S++FQ+AL+V
Sbjct  303   WQQPTKINCVRSKSPQKARHDETSIDKKVAFVRQKFIEAKCLSIDGNLRQSKEFQEALDV  362

Query  1048  LSSNTDLVLKFLQEPKPMLSEHIYNLQSIPAPSETKRITVLKPSKMVDN  1194
             LSSNTDL LKFLQEP PM S+ +  L+S+P P ETKRITVL+P+KMVDN
Sbjct  363   LSSNTDLFLKFLQEPNPMFSQQLQKLKSVPPPPETKRITVLRPTKMVDN  411



>ref|XP_006352718.1| PREDICTED: uncharacterized protein LOC102578662 isoform X3 [Solanum 
tuberosum]
Length=1088

 Score =   363 bits (931),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 185/289 (64%), Positives = 224/289 (78%), Gaps = 4/289 (1%)
 Frame = +1

Query  331   EMYAVQNGKNRGLEKPIPGCLGRMVNLFDLNGGVAGNRLLTDKPHRDGSLSRSQSDVARM  510
             EM   QNGKN  L+KP PGCLGRMVNLFDLN GVAGN+LLTDKPH  GSLSRSQSDV RM
Sbjct  126   EMNGFQNGKNCNLDKPFPGCLGRMVNLFDLNSGVAGNKLLTDKPH--GSLSRSQSDVVRM  183

Query  511   SPSEDQIEDKEIVSELRRNNSKMKANGTPMKMLIAEEMSKDMASKHNPPSVVAKLMGLDG  690
              PS DQIE+K IVS+L+RN+S  K+NGTPMKMLIA+EMSK++ S  NPPS+VAKLMGLD 
Sbjct  184   YPSGDQIEEKMIVSDLKRNSSNRKSNGTPMKMLIAQEMSKEIDSSQNPPSLVAKLMGLDA  243

Query  691   FPSQLPVSTAQRNYSGRNAQSAKGTPLNNFHHRSGSLDTQMECEFYQYPEQNECKDVYEV  870
             FP++  VS  Q ++ G +++    +  +   H +GSL  +M  +F+Q PE+NE KDVYEV
Sbjct  244   FPTRRSVSATQSHFGG-HSRCHTDSSFSYCQHENGSLMEEMHQKFHQCPEENEYKDVYEV  302

Query  871   WQNRHDMNSMRSKSPQMGRCNETSTD-KVAFVRQKFIEAKCLSLDEKCHHSRQFQDALEV  1047
             WQ    +N +RSKSPQ  R +ETS D KVAFVRQKFIEAKCLS+D     S++FQ+AL+V
Sbjct  303   WQQPTKINCVRSKSPQKARHDETSIDKKVAFVRQKFIEAKCLSIDGNLRQSKEFQEALDV  362

Query  1048  LSSNTDLVLKFLQEPKPMLSEHIYNLQSIPAPSETKRITVLKPSKMVDN  1194
             LSSNTDL LKFLQEP PM S+ +  L+S+P P ETKRITVL+P+KMVDN
Sbjct  363   LSSNTDLFLKFLQEPNPMFSQQLQKLKSVPPPPETKRITVLRPTKMVDN  411



>ref|XP_006352717.1| PREDICTED: uncharacterized protein LOC102578662 isoform X2 [Solanum 
tuberosum]
Length=1088

 Score =   363 bits (931),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 185/289 (64%), Positives = 224/289 (78%), Gaps = 4/289 (1%)
 Frame = +1

Query  331   EMYAVQNGKNRGLEKPIPGCLGRMVNLFDLNGGVAGNRLLTDKPHRDGSLSRSQSDVARM  510
             EM   QNGKN  L+KP PGCLGRMVNLFDLN GVAGN+LLTDKPH  GSLSRSQSDV RM
Sbjct  126   EMNGFQNGKNCNLDKPFPGCLGRMVNLFDLNSGVAGNKLLTDKPH--GSLSRSQSDVVRM  183

Query  511   SPSEDQIEDKEIVSELRRNNSKMKANGTPMKMLIAEEMSKDMASKHNPPSVVAKLMGLDG  690
              PS DQIE+K IVS+L+RN+S  K+NGTPMKMLIA+EMSK++ S  NPPS+VAKLMGLD 
Sbjct  184   YPSGDQIEEKMIVSDLKRNSSNRKSNGTPMKMLIAQEMSKEIDSSQNPPSLVAKLMGLDA  243

Query  691   FPSQLPVSTAQRNYSGRNAQSAKGTPLNNFHHRSGSLDTQMECEFYQYPEQNECKDVYEV  870
             FP++  VS  Q ++ G +++    +  +   H +GSL  +M  +F+Q PE+NE KDVYEV
Sbjct  244   FPTRRSVSATQSHFGG-HSRCHTDSSFSYCQHENGSLMEEMHQKFHQCPEENEYKDVYEV  302

Query  871   WQNRHDMNSMRSKSPQMGRCNETSTD-KVAFVRQKFIEAKCLSLDEKCHHSRQFQDALEV  1047
             WQ    +N +RSKSPQ  R +ETS D KVAFVRQKFIEAKCLS+D     S++FQ+AL+V
Sbjct  303   WQQPTKINCVRSKSPQKARHDETSIDKKVAFVRQKFIEAKCLSIDGNLRQSKEFQEALDV  362

Query  1048  LSSNTDLVLKFLQEPKPMLSEHIYNLQSIPAPSETKRITVLKPSKMVDN  1194
             LSSNTDL LKFLQEP PM S+ +  L+S+P P ETKRITVL+P+KMVDN
Sbjct  363   LSSNTDLFLKFLQEPNPMFSQQLQKLKSVPPPPETKRITVLRPTKMVDN  411



>ref|XP_010323077.1| PREDICTED: uncharacterized protein LOC101266733 isoform X5 [Solanum 
lycopersicum]
 ref|XP_010323078.1| PREDICTED: uncharacterized protein LOC101266733 isoform X5 [Solanum 
lycopersicum]
 ref|XP_010323079.1| PREDICTED: uncharacterized protein LOC101266733 isoform X5 [Solanum 
lycopersicum]
Length=963

 Score =   360 bits (923),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 184/288 (64%), Positives = 223/288 (77%), Gaps = 4/288 (1%)
 Frame = +1

Query  334   MYAVQNGKNRGLEKPIPGCLGRMVNLFDLNGGVAGNRLLTDKPHRDGSLSRSQSDVARMS  513
             M   QNGKN  L+KP PGCLGRMVNLFDLN GV GN+LLTDKPH  GSLSRSQSDV RM 
Sbjct  1     MNGFQNGKNCNLDKPFPGCLGRMVNLFDLNSGVTGNKLLTDKPH--GSLSRSQSDVVRMY  58

Query  514   PSEDQIEDKEIVSELRRNNSKMKANGTPMKMLIAEEMSKDMASKHNPPSVVAKLMGLDGF  693
             PS +QIE+K IVS+L+RN+S  K+NGTPMKMLIA+EMSK++ S  NPPS+VAKLMGLD F
Sbjct  59    PSGNQIEEKMIVSDLKRNSSNRKSNGTPMKMLIAQEMSKEIDSSQNPPSLVAKLMGLDAF  118

Query  694   PSQLPVSTAQRNYSGRNAQSAKGTPLNNFHHRSGSLDTQMECEFYQYPEQNECKDVYEVW  873
             P++  VS  Q ++ G +++S   +  +   H +GSL  +M  EF+Q PE+NE KDVYEVW
Sbjct  119   PTRKSVSATQSHFGG-HSRSHTDSSFSYCPHENGSLMEEMHQEFHQCPEENEYKDVYEVW  177

Query  874   QNRHDMNSMRSKSPQMGRCNETSTDK-VAFVRQKFIEAKCLSLDEKCHHSRQFQDALEVL  1050
             Q    +N +RSKSPQ  R +ETS DK VAFVRQKFIEAKCLS+D     S++FQ+AL+VL
Sbjct  178   QQPTKINCVRSKSPQKARHDETSIDKKVAFVRQKFIEAKCLSIDGNLRQSKEFQEALDVL  237

Query  1051  SSNTDLVLKFLQEPKPMLSEHIYNLQSIPAPSETKRITVLKPSKMVDN  1194
             SSNTDL LKFLQEP PM S+ +  L+S+P P ETKRITVL+P+KMVDN
Sbjct  238   SSNTDLFLKFLQEPNPMFSQQLQKLKSVPPPPETKRITVLRPTKMVDN  285



>ref|XP_004247114.1| PREDICTED: uncharacterized protein LOC101266067 isoform X1 [Solanum 
lycopersicum]
Length=981

 Score =   358 bits (920),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 181/292 (62%), Positives = 225/292 (77%), Gaps = 7/292 (2%)
 Frame = +1

Query  334   MYAVQNGKNRGLEKPIPGCLGRMVNLFDLNGGVAGNRLLTDKPHRDGSLSRSQSDVARMS  513
             M   QNG+    +KP PGCLGRMVNLFDLN GV GNRLLTDKPHRDGSLSRSQSD+ R+ 
Sbjct  1     MNGFQNGRIHTHDKPSPGCLGRMVNLFDLNSGVTGNRLLTDKPHRDGSLSRSQSDLVRLP  60

Query  514   PS-EDQIEDKEIVSELRRNNSKMKANGTPMKMLIAEEMSKDMASKHNPPSVVAKLMGLDG  690
             PS EDQ+E+K +VS+L+R NS  K+NG PMKMLIA+EMSK++ S HNPPSVVAKLMGLD 
Sbjct  61    PSSEDQVEEKMVVSDLKRTNSNRKSNGMPMKMLIAQEMSKEVGSGHNPPSVVAKLMGLDA  120

Query  691   FPSQ-LPVSTAQRNYSGRNAQSAKGTPLNNFHHRSGSLDTQMECEFYQYPEQNECKDVYE  867
             FP + +P   A RN+ G +++    +  +     + SL  +++ E +QYPEQNE KDVYE
Sbjct  121   FPQKSVP---AIRNHFGGHSRCHTDSSFSYCQEENESLTEELQQELHQYPEQNEYKDVYE  177

Query  868   VWQNRHDMNSMRSKSPQMGRCNETST--DKVAFVRQKFIEAKCLSLDEKCHHSRQFQDAL  1041
             VW++   MNS+RS+SPQ  R ++  +   K AFVRQKFIEAKCLS+DE+   S++FQDAL
Sbjct  178   VWRHPPKMNSVRSESPQKARHDDQISFEKKSAFVRQKFIEAKCLSIDEQLRQSKEFQDAL  237

Query  1042  EVLSSNTDLVLKFLQEPKPMLSEHIYNLQSIPAPSETKRITVLKPSKMVDNC  1197
             +VLSSNTDL LKFLQEP PM ++H+ NLQSIP P ETKRITVL+PSKM+D+C
Sbjct  238   DVLSSNTDLFLKFLQEPNPMFTQHLSNLQSIPPPPETKRITVLRPSKMIDDC  289



>ref|XP_009589097.1| PREDICTED: uncharacterized protein LOC104086523 isoform X2 [Nicotiana 
tomentosiformis]
Length=976

 Score =   357 bits (916),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 189/293 (65%), Positives = 223/293 (76%), Gaps = 10/293 (3%)
 Frame = +1

Query  334   MYAVQNGKNRGLEKPIPGCLGRMVNLFDLNGGVAGNRLLTDKPHRDGSLSRSQSDVARMS  513
             M   QNGKN  L+KP PGCLGRMVNLFDLN GVAGNR+LTDKPH  GSLSRSQSDV R  
Sbjct  1     MNGFQNGKNSNLDKPFPGCLGRMVNLFDLNSGVAGNRMLTDKPH--GSLSRSQSDVVRAY  58

Query  514   PSEDQIEDK-----EIVSELRRNNSKMKANGTPMKMLIAEEMSKDMASKHNPPSVVAKLM  678
             PSEDQIE K     +I S+L+RN+S  K+NGTPMK LIA+EMSK++ S  NPPSVVAKLM
Sbjct  59    PSEDQIEGKMIWCMQIFSDLKRNSSNKKSNGTPMKKLIAQEMSKEINSCQNPPSVVAKLM  118

Query  679   GLDGFPSQLPVSTAQRNYSGRNAQSAKGTPLNNFHHRSGSLDTQMECEFYQYPEQNECKD  858
             GLD FP +  VS A+ ++ G +++S   +  +   H +GSL  +M     QY EQNE KD
Sbjct  119   GLDAFPMRRSVSAARSHFGG-HSRSHTDSSFSYCQHENGSLMEEMH-NVNQYAEQNEYKD  176

Query  859   VYEVWQNRHDMNSMRSKSPQMGRCNETSTDK-VAFVRQKFIEAKCLSLDEKCHHSRQFQD  1035
             VYEVWQ    +N +RSKSPQ  + +ETS DK VAFVRQKFIEAKCLS+D K   S++FQ+
Sbjct  177   VYEVWQPPTKINCVRSKSPQKAKDDETSIDKKVAFVRQKFIEAKCLSIDGKLRQSKEFQE  236

Query  1036  ALEVLSSNTDLVLKFLQEPKPMLSEHIYNLQSIPAPSETKRITVLKPSKMVDN  1194
             ALEVLSSNTDL LKFLQEP PM S+H++NL+S+P P ETKRITVLKPSKMVDN
Sbjct  237   ALEVLSSNTDLFLKFLQEPNPMFSQHLHNLKSVPPPPETKRITVLKPSKMVDN  289



>ref|XP_009589093.1| PREDICTED: uncharacterized protein LOC104086523 isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009589095.1| PREDICTED: uncharacterized protein LOC104086523 isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009589096.1| PREDICTED: uncharacterized protein LOC104086523 isoform X1 [Nicotiana 
tomentosiformis]
Length=977

 Score =   357 bits (916),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 189/293 (65%), Positives = 223/293 (76%), Gaps = 10/293 (3%)
 Frame = +1

Query  334   MYAVQNGKNRGLEKPIPGCLGRMVNLFDLNGGVAGNRLLTDKPHRDGSLSRSQSDVARMS  513
             M   QNGKN  L+KP PGCLGRMVNLFDLN GVAGNR+LTDKPH  GSLSRSQSDV R  
Sbjct  1     MNGFQNGKNSNLDKPFPGCLGRMVNLFDLNSGVAGNRMLTDKPH--GSLSRSQSDVVRAY  58

Query  514   PSEDQIEDK-----EIVSELRRNNSKMKANGTPMKMLIAEEMSKDMASKHNPPSVVAKLM  678
             PSEDQIE K     +I S+L+RN+S  K+NGTPMK LIA+EMSK++ S  NPPSVVAKLM
Sbjct  59    PSEDQIEGKMIWCMQIFSDLKRNSSNKKSNGTPMKKLIAQEMSKEINSCQNPPSVVAKLM  118

Query  679   GLDGFPSQLPVSTAQRNYSGRNAQSAKGTPLNNFHHRSGSLDTQMECEFYQYPEQNECKD  858
             GLD FP +  VS A+ ++ G +++S   +  +   H +GSL  +M     QY EQNE KD
Sbjct  119   GLDAFPMRRSVSAARSHFGG-HSRSHTDSSFSYCQHENGSLMEEMH-NVNQYAEQNEYKD  176

Query  859   VYEVWQNRHDMNSMRSKSPQMGRCNETSTDK-VAFVRQKFIEAKCLSLDEKCHHSRQFQD  1035
             VYEVWQ    +N +RSKSPQ  + +ETS DK VAFVRQKFIEAKCLS+D K   S++FQ+
Sbjct  177   VYEVWQPPTKINCVRSKSPQKAKDDETSIDKKVAFVRQKFIEAKCLSIDGKLRQSKEFQE  236

Query  1036  ALEVLSSNTDLVLKFLQEPKPMLSEHIYNLQSIPAPSETKRITVLKPSKMVDN  1194
             ALEVLSSNTDL LKFLQEP PM S+H++NL+S+P P ETKRITVLKPSKMVDN
Sbjct  237   ALEVLSSNTDLFLKFLQEPNPMFSQHLHNLKSVPPPPETKRITVLKPSKMVDN  289



>ref|XP_009780624.1| PREDICTED: uncharacterized protein LOC104229654 isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009780625.1| PREDICTED: uncharacterized protein LOC104229654 isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009780626.1| PREDICTED: uncharacterized protein LOC104229654 isoform X1 [Nicotiana 
sylvestris]
Length=976

 Score =   349 bits (895),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 184/293 (63%), Positives = 222/293 (76%), Gaps = 10/293 (3%)
 Frame = +1

Query  334   MYAVQNGKNRGLEKPIPGCLGRMVNLFDLNGGVAGNRLLTDKPHRDGSLSRSQSDVARMS  513
             M   QNGKN  L+KP PGCLGRMVNLFDLN  VAGNR+LTDKPH  GSLSRSQSDV R  
Sbjct  1     MNGFQNGKNSNLDKPFPGCLGRMVNLFDLNSVVAGNRMLTDKPH--GSLSRSQSDVVRTY  58

Query  514   PSEDQIEDK-----EIVSELRRNNSKMKANGTPMKMLIAEEMSKDMASKHNPPSVVAKLM  678
             PSEDQIE+K     +I S+L+RN+S  K+NGTPMK LIA+EMSK++ +  NPPSVVAKLM
Sbjct  59    PSEDQIEEKMIWCMQIFSDLKRNSSNKKSNGTPMKKLIAQEMSKEINTCQNPPSVVAKLM  118

Query  679   GLDGFPSQLPVSTAQRNYSGRNAQSAKGTPLNNFHHRSGSLDTQMECEFYQYPEQNECKD  858
             GLD FP +   S A+ ++ G +++S   +  +   H +GSL  +M     QY EQNE KD
Sbjct  119   GLDAFPMRRSASAARSHFGG-HSRSHTDSSFSYCQHENGSLMEEMH-NANQYAEQNEYKD  176

Query  859   VYEVWQNRHDMNSMRSKSPQMGRCNETSTDK-VAFVRQKFIEAKCLSLDEKCHHSRQFQD  1035
             VYEVWQ    +N +RSKSPQ  + +ETS DK VAFVRQKFIEAKCLS+D K   S++FQ+
Sbjct  177   VYEVWQPPTKINCVRSKSPQKAKDDETSIDKKVAFVRQKFIEAKCLSIDGKLRQSKEFQE  236

Query  1036  ALEVLSSNTDLVLKFLQEPKPMLSEHIYNLQSIPAPSETKRITVLKPSKMVDN  1194
             AL+VLSSNTDL LKFLQEP PM S+H++NL+S+P P ETKRITVL+PSKMVDN
Sbjct  237   ALDVLSSNTDLFLKFLQEPNPMFSQHLHNLKSVPPPPETKRITVLRPSKMVDN  289



>ref|XP_009780627.1| PREDICTED: uncharacterized protein LOC104229654 isoform X2 [Nicotiana 
sylvestris]
Length=975

 Score =   349 bits (895),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 184/293 (63%), Positives = 222/293 (76%), Gaps = 10/293 (3%)
 Frame = +1

Query  334   MYAVQNGKNRGLEKPIPGCLGRMVNLFDLNGGVAGNRLLTDKPHRDGSLSRSQSDVARMS  513
             M   QNGKN  L+KP PGCLGRMVNLFDLN  VAGNR+LTDKPH  GSLSRSQSDV R  
Sbjct  1     MNGFQNGKNSNLDKPFPGCLGRMVNLFDLNSVVAGNRMLTDKPH--GSLSRSQSDVVRTY  58

Query  514   PSEDQIEDK-----EIVSELRRNNSKMKANGTPMKMLIAEEMSKDMASKHNPPSVVAKLM  678
             PSEDQIE+K     +I S+L+RN+S  K+NGTPMK LIA+EMSK++ +  NPPSVVAKLM
Sbjct  59    PSEDQIEEKMIWCMQIFSDLKRNSSNKKSNGTPMKKLIAQEMSKEINTCQNPPSVVAKLM  118

Query  679   GLDGFPSQLPVSTAQRNYSGRNAQSAKGTPLNNFHHRSGSLDTQMECEFYQYPEQNECKD  858
             GLD FP +   S A+ ++ G +++S   +  +   H +GSL  +M     QY EQNE KD
Sbjct  119   GLDAFPMRRSASAARSHFGG-HSRSHTDSSFSYCQHENGSLMEEMH-NANQYAEQNEYKD  176

Query  859   VYEVWQNRHDMNSMRSKSPQMGRCNETSTDK-VAFVRQKFIEAKCLSLDEKCHHSRQFQD  1035
             VYEVWQ    +N +RSKSPQ  + +ETS DK VAFVRQKFIEAKCLS+D K   S++FQ+
Sbjct  177   VYEVWQPPTKINCVRSKSPQKAKDDETSIDKKVAFVRQKFIEAKCLSIDGKLRQSKEFQE  236

Query  1036  ALEVLSSNTDLVLKFLQEPKPMLSEHIYNLQSIPAPSETKRITVLKPSKMVDN  1194
             AL+VLSSNTDL LKFLQEP PM S+H++NL+S+P P ETKRITVL+PSKMVDN
Sbjct  237   ALDVLSSNTDLFLKFLQEPNPMFSQHLHNLKSVPPPPETKRITVLRPSKMVDN  289



>ref|XP_002267519.1| PREDICTED: uncharacterized protein LOC100241277 isoform X1 [Vitis 
vinifera]
Length=991

 Score =   331 bits (849),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 170/293 (58%), Positives = 216/293 (74%), Gaps = 7/293 (2%)
 Frame = +1

Query  334   MYAVQNGKNRGLEKPIPGCLGRMVNLFDLNGGVAGNRLLTDKPHRDGS-LSRSQSDVARM  510
             M  + N K RG EKP PGCLGRMVNLFDLN G+ GNR+LTD+PH+DGS LSRS+SDVAR+
Sbjct  1     MSGIHNSKTRGFEKPFPGCLGRMVNLFDLNAGMPGNRMLTDRPHQDGSPLSRSRSDVARV  60

Query  511   S-PSEDQIEDKEIVSELRRNNSKMKANGTPMKMLIAEEMSKDMASKHNPPSVVAKLMGLD  687
             S P+ DQ+EDK +VSEL R +++ K+NGTP+KMLIA+EMSK++  KHNPP VVAKLMGLD
Sbjct  61    SSPTGDQVEDKPMVSELSRTSNR-KSNGTPVKMLIAQEMSKEVDLKHNPPGVVAKLMGLD  119

Query  688   GFPSQLPVSTAQRNYS---GRNAQSAKGTPLNNFHHRSGSLDTQMECEFYQYPEQNECKD  858
               P + P  + QR++S    RN  +  G PL  +    G  D QM+ + +   +QN+ KD
Sbjct  120   ALPGRQPDLSPQRSHSNGYSRNISTHSGIPLGCWQQEHGFFDKQMQNDGHCCQDQNDYKD  179

Query  859   VYEVWQNRHDMNSMRSKSPQMGRCNETSTDK-VAFVRQKFIEAKCLSLDEKCHHSRQFQD  1035
             V+E+WQ     N +R KSPQ GR  + + +K +A VRQKF EAK L+ DEK   S++FQD
Sbjct  180   VHEIWQQSQKTNYIRDKSPQKGRQGDNANEKKMALVRQKFNEAKSLATDEKLRQSKEFQD  239

Query  1036  ALEVLSSNTDLVLKFLQEPKPMLSEHIYNLQSIPAPSETKRITVLKPSKMVDN  1194
             ALEVLSSN DL LKFLQEP  + ++H+Y LQSIPAP +TKRITVLKPSK++DN
Sbjct  240   ALEVLSSNRDLFLKFLQEPNSLFTQHLYELQSIPAPPDTKRITVLKPSKVMDN  292



>emb|CAN81514.1| hypothetical protein VITISV_012030 [Vitis vinifera]
Length=1081

 Score =   332 bits (851),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 171/293 (58%), Positives = 216/293 (74%), Gaps = 7/293 (2%)
 Frame = +1

Query  334   MYAVQNGKNRGLEKPIPGCLGRMVNLFDLNGGVAGNRLLTDKPHRDGS-LSRSQSDVARM  510
             M  + N K RG EKP PGCLGRMVNLFDLN G+ GNR+LTD+PH+DGS LSRS+SDVAR+
Sbjct  1     MSGIHNSKTRGFEKPFPGCLGRMVNLFDLNAGMPGNRMLTDRPHQDGSPLSRSRSDVARV  60

Query  511   S-PSEDQIEDKEIVSELRRNNSKMKANGTPMKMLIAEEMSKDMASKHNPPSVVAKLMGLD  687
             S P+ DQ+EDK +VSEL R +++ K+NGTPMKMLIA+EMSK++  KHNPP VVAKLMGLD
Sbjct  61    SSPTGDQVEDKPMVSELSRTSNR-KSNGTPMKMLIAQEMSKEVDLKHNPPGVVAKLMGLD  119

Query  688   GFPSQLPVSTAQRNYS---GRNAQSAKGTPLNNFHHRSGSLDTQMECEFYQYPEQNECKD  858
               P + P  + QR++S    RN  +  G PL  +    G  D QM+ + +   +QN+ KD
Sbjct  120   ALPGRQPBLSPQRSHSNGYSRNISTHSGIPLGCWQQEHGFFDKQMQNDGHCCQDQNDYKD  179

Query  859   VYEVWQNRHDMNSMRSKSPQMGRCNETSTDK-VAFVRQKFIEAKCLSLDEKCHHSRQFQD  1035
             V+E+WQ     N +R KSPQ GR  + + +K +A VRQKF EAK L+ DEK   S++FQD
Sbjct  180   VHEIWQQSQKTNYIRDKSPQKGRQGDNANEKKMALVRQKFNEAKSLATDEKLRQSKEFQD  239

Query  1036  ALEVLSSNTDLVLKFLQEPKPMLSEHIYNLQSIPAPSETKRITVLKPSKMVDN  1194
             ALEVLSSN DL LKFLQEP  + ++H+Y LQSIPAP +TKRITVLKPSK++DN
Sbjct  240   ALEVLSSNRDLFLKFLQEPNSLFTQHLYELQSIPAPPDTKRITVLKPSKVMDN  292



>ref|XP_010091854.1| hypothetical protein L484_015923 [Morus notabilis]
 gb|EXB46062.1| hypothetical protein L484_015923 [Morus notabilis]
Length=981

 Score =   329 bits (843),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 176/293 (60%), Positives = 214/293 (73%), Gaps = 8/293 (3%)
 Frame = +1

Query  334   MYAVQNGKNRGLEKPIPGCLGRMVNLFDLNGGVAGNRLLTDKPHRDGS-LSRSQSDVARM  510
             M  +QN K    EKP PGCLGRMVNLFDL+ GVAGNR+LTD+PH DGS L+RSQSDV+RM
Sbjct  1     MNGIQNRKALNAEKPFPGCLGRMVNLFDLSTGVAGNRMLTDRPHHDGSSLARSQSDVSRM  60

Query  511   S-PSEDQIEDKEIVSELRRNNSKMKANGTPMKMLIAEEMSKDMASKHNPPSVVAKLMGLD  687
             S P  D+IEDK IVSE+RRN+S  KANGTPMKMLI +EMSK++  K+ PP+VVAKLMGLD
Sbjct  61    SSPFVDKIEDKLIVSEIRRNSSNRKANGTPMKMLIDQEMSKEIGLKNEPPNVVAKLMGLD  120

Query  688   GFPSQLPVSTAQRNYSGRNAQSA---KGTPLNNFHHRSGSLDTQMECEFYQYPEQNECKD  858
               P Q P S+ QR+ +   ++S     G  L ++    G  D +M+ +  Q PE+NE KD
Sbjct  121   ALPRQHPHSSLQRSNTDSYSRSTFGHSGMSLGSWQQE-GFSDNRMQFDVQQCPERNEYKD  179

Query  859   VYEVWQNRHDMNSMRSKSPQMGRCNETSTD-KVAFVRQKFIEAKCLSLDEKCHHSRQFQD  1035
             VYEVWQ   + N +R  SPQ  RCN  + D K+A VRQKF+EAK L+ DEK   S++FQD
Sbjct  180   VYEVWQQPQNTNYVRDGSPQKERCNAITNDRKMALVRQKFMEAKRLATDEKLRQSKEFQD  239

Query  1036  ALEVLSSNTDLVLKFLQEPKPMLSEHIYNLQSIPAPSETKRITVLKPSKMVDN  1194
             ALEVLSSN DL LKFLQEP  + S+H+Y LQS P P ETKRITVL+PSK+VDN
Sbjct  240   ALEVLSSNRDLFLKFLQEPNSLFSQHLYELQSTPPP-ETKRITVLRPSKIVDN  291



>ref|XP_004292261.1| PREDICTED: uncharacterized protein LOC101294433 [Fragaria vesca 
subsp. vesca]
 ref|XP_011458059.1| PREDICTED: uncharacterized protein LOC101294433 [Fragaria vesca 
subsp. vesca]
Length=987

 Score =   323 bits (828),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 170/294 (58%), Positives = 212/294 (72%), Gaps = 7/294 (2%)
 Frame = +1

Query  334   MYAVQNGKNRGLEKPIPGCLGRMVNLFDLNGGVAGNRLLTDKPHRDGS-LSRSQSDVARM  510
             M  V + K    EKPIPGCLGRMVNLFD++ GV+ N+LLTDKPH DGS LSRSQSDV  M
Sbjct  1     MKGVHSSKAHSAEKPIPGCLGRMVNLFDMSTGVSRNKLLTDKPHHDGSSLSRSQSDVVTM  60

Query  511   --SPSEDQIEDKEIVSELRRNNSKMKANGTPMKMLIAEEMSKDMASKHNPPSVVAKLMGL  684
               SP  DQIEDK IVSELRR++S  KANGTP+KML+ +EMSK++ +K NPP+VVAKLMGL
Sbjct  61    LGSPFGDQIEDKVIVSELRRSSSNNKANGTPIKMLLDQEMSKEVETKKNPPNVVAKLMGL  120

Query  685   DGFPSQLPVSTAQRNYSGRNAQ---SAKGTPLNNFHHRSGSLDTQMECEFYQYPEQNECK  855
             D FP Q P +  QR+ +   +Q   +    P   + H    LD +M+ E++Q PEQN+ K
Sbjct  121   DAFPRQQPDAAVQRSNASNYSQCTNTRSSVPSGCWQHEDEFLDKRMQHEYHQCPEQNDYK  180

Query  856   DVYEVWQNRHDMNSMRSKSPQMGRCNETSTDK-VAFVRQKFIEAKCLSLDEKCHHSRQFQ  1032
             DVYEVWQ     +  R+KSPQ GR N    +K +  VRQKF+EAK L+ DE+   S++F+
Sbjct  181   DVYEVWQQPPKTSYGRNKSPQKGRYNGKINEKQMDLVRQKFMEAKRLATDERLRQSKEFE  240

Query  1033  DALEVLSSNTDLVLKFLQEPKPMLSEHIYNLQSIPAPSETKRITVLKPSKMVDN  1194
             DALEVLSSN DL LKFLQEP  + S+H+Y LQS+P P+ETKRITVL+P+KMV N
Sbjct  241   DALEVLSSNKDLFLKFLQEPNSLFSQHLYELQSLPPPTETKRITVLRPTKMVSN  294



>ref|XP_010652446.1| PREDICTED: uncharacterized protein LOC100241277 isoform X2 [Vitis 
vinifera]
Length=986

 Score =   318 bits (816),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 167/293 (57%), Positives = 212/293 (72%), Gaps = 12/293 (4%)
 Frame = +1

Query  334   MYAVQNGKNRGLEKPIPGCLGRMVNLFDLNGGVAGNRLLTDKPHRDGS-LSRSQSDVARM  510
             M  + N K RG EKP PGCLGRMVNLFDLN G+ GNR+LTD+PH+DGS LSRS+SDVAR+
Sbjct  1     MSGIHNSKTRGFEKPFPGCLGRMVNLFDLNAGMPGNRMLTDRPHQDGSPLSRSRSDVARV  60

Query  511   S-PSEDQIEDKEIVSELRRNNSKMKANGTPMKMLIAEEMSKDMASKHNPPSVVAKLMGLD  687
             S P+ DQ+     VSEL R +++ K+NGTP+KMLIA+EMSK++  KHNPP VVAKLMGLD
Sbjct  61    SSPTGDQM-----VSELSRTSNR-KSNGTPVKMLIAQEMSKEVDLKHNPPGVVAKLMGLD  114

Query  688   GFPSQLPVSTAQRNYS---GRNAQSAKGTPLNNFHHRSGSLDTQMECEFYQYPEQNECKD  858
               P + P  + QR++S    RN  +  G PL  +    G  D QM+ + +   +QN+ KD
Sbjct  115   ALPGRQPDLSPQRSHSNGYSRNISTHSGIPLGCWQQEHGFFDKQMQNDGHCCQDQNDYKD  174

Query  859   VYEVWQNRHDMNSMRSKSPQMGRCNETSTDK-VAFVRQKFIEAKCLSLDEKCHHSRQFQD  1035
             V+E+WQ     N +R KSPQ GR  + + +K +A VRQKF EAK L+ DEK   S++FQD
Sbjct  175   VHEIWQQSQKTNYIRDKSPQKGRQGDNANEKKMALVRQKFNEAKSLATDEKLRQSKEFQD  234

Query  1036  ALEVLSSNTDLVLKFLQEPKPMLSEHIYNLQSIPAPSETKRITVLKPSKMVDN  1194
             ALEVLSSN DL LKFLQEP  + ++H+Y LQSIPAP +TKRITVLKPSK++DN
Sbjct  235   ALEVLSSNRDLFLKFLQEPNSLFTQHLYELQSIPAPPDTKRITVLKPSKVMDN  287



>ref|XP_007050069.1| Uncharacterized protein isoform 1 [Theobroma cacao]
 gb|EOX94226.1| Uncharacterized protein isoform 1 [Theobroma cacao]
Length=984

 Score =   317 bits (813),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 174/293 (59%), Positives = 207/293 (71%), Gaps = 8/293 (3%)
 Frame = +1

Query  334   MYAVQNGKNRGLEKPIPGCLGRMVNLFDLNGGVAGNRLLTDKPHRDGS-LSRSQSDVARM  510
             M  +QN K + +EK  PGCLGRMVNLFDLN G+ GNRLLTDKPH DGS LSRSQSDV RM
Sbjct  1     MNGIQNRKGQNIEK-FPGCLGRMVNLFDLNTGIPGNRLLTDKPHPDGSSLSRSQSDVVRM  59

Query  511   -SPS-EDQIEDKEIVSELRRNNSKMKANGTPMKMLIAEEMSKDMASKHNPPSVVAKLMGL  684
              SPS  DQIEDK +VSELRR  S  KANGTPMKMLIA+EMSK++ SKHNPP+VVAKLMGL
Sbjct  60    LSPSFGDQIEDKVVVSELRRTLSNKKANGTPMKMLIAQEMSKEVESKHNPPNVVAKLMGL  119

Query  685   DGFPSQLPVSTAQRNYS---GRNAQSAKGTPLNNFHHRSGSLDTQMECEFYQYPEQNECK  855
             D  P Q     AQR +S    R++ S    P+  +    G  + QM+ +     E N+ K
Sbjct  120   DALPRQQHNMAAQRRHSKGSSRHSLSHSEIPVEGWERDQGFSNKQMQSKVNLCQELNKYK  179

Query  856   DVYEVWQNRHDMNSMRSKSPQMGRCNETSTDK-VAFVRQKFIEAKCLSLDEKCHHSRQFQ  1032
             DVYE+WQ      + R  SPQ GR N+   +K +A VRQKF+EAK L  DEK   +++FQ
Sbjct  180   DVYEIWQQTPRTTNARDSSPQKGRYNDNGNEKKMALVRQKFMEAKHLVTDEKLRQTKEFQ  239

Query  1033  DALEVLSSNTDLVLKFLQEPKPMLSEHIYNLQSIPAPSETKRITVLKPSKMVD  1191
             DALEVLSSN +L LKFL+EP    S+H+YNLQS+P P ETKRITVL+PSKMVD
Sbjct  240   DALEVLSSNRELFLKFLEEPNSTFSQHLYNLQSLPLPPETKRITVLRPSKMVD  292



>ref|XP_007050070.1| Uncharacterized protein isoform 2 [Theobroma cacao]
 gb|EOX94227.1| Uncharacterized protein isoform 2 [Theobroma cacao]
Length=988

 Score =   317 bits (812),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 174/293 (59%), Positives = 207/293 (71%), Gaps = 8/293 (3%)
 Frame = +1

Query  334   MYAVQNGKNRGLEKPIPGCLGRMVNLFDLNGGVAGNRLLTDKPHRDGS-LSRSQSDVARM  510
             M  +QN K + +EK  PGCLGRMVNLFDLN G+ GNRLLTDKPH DGS LSRSQSDV RM
Sbjct  1     MNGIQNRKGQNIEK-FPGCLGRMVNLFDLNTGIPGNRLLTDKPHPDGSSLSRSQSDVVRM  59

Query  511   -SPS-EDQIEDKEIVSELRRNNSKMKANGTPMKMLIAEEMSKDMASKHNPPSVVAKLMGL  684
              SPS  DQIEDK +VSELRR  S  KANGTPMKMLIA+EMSK++ SKHNPP+VVAKLMGL
Sbjct  60    LSPSFGDQIEDKVVVSELRRTLSNKKANGTPMKMLIAQEMSKEVESKHNPPNVVAKLMGL  119

Query  685   DGFPSQLPVSTAQRNYS---GRNAQSAKGTPLNNFHHRSGSLDTQMECEFYQYPEQNECK  855
             D  P Q     AQR +S    R++ S    P+  +    G  + QM+ +     E N+ K
Sbjct  120   DALPRQQHNMAAQRRHSKGSSRHSLSHSEIPVEGWERDQGFSNKQMQSKVNLCQELNKYK  179

Query  856   DVYEVWQNRHDMNSMRSKSPQMGRCNETSTDK-VAFVRQKFIEAKCLSLDEKCHHSRQFQ  1032
             DVYE+WQ      + R  SPQ GR N+   +K +A VRQKF+EAK L  DEK   +++FQ
Sbjct  180   DVYEIWQQTPRTTNARDSSPQKGRYNDNGNEKKMALVRQKFMEAKHLVTDEKLRQTKEFQ  239

Query  1033  DALEVLSSNTDLVLKFLQEPKPMLSEHIYNLQSIPAPSETKRITVLKPSKMVD  1191
             DALEVLSSN +L LKFL+EP    S+H+YNLQS+P P ETKRITVL+PSKMVD
Sbjct  240   DALEVLSSNRELFLKFLEEPNSTFSQHLYNLQSLPLPPETKRITVLRPSKMVD  292



>gb|KDO65803.1| hypothetical protein CISIN_1g001807mg [Citrus sinensis]
Length=1010

 Score =   317 bits (811),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 170/297 (57%), Positives = 212/297 (71%), Gaps = 9/297 (3%)
 Frame = +1

Query  331   EMYAVQNGK--NRGLEKPIPGCLGRMVNLFDLNGGVAGNRLLTDKPHRDGS-LSRSQSDV  501
             EM  +Q+ K  N  ++K + GCLGRMVNLFDL+ G+ GNRLLTDKPHRDG+ LSRSQSDV
Sbjct  8     EMNGIQSTKAQNINVDKHVVGCLGRMVNLFDLSTGIPGNRLLTDKPHRDGAMLSRSQSDV  67

Query  502   ARM--SPSEDQIEDKEIVSELRRNNSKMKANGTPMKMLIAEEMSKDMASKHNPPSVVAKL  675
             AR+  SP  DQIEDK +VSELRR +S   ANGTPMK LIA+EMSK++ SKHN P+VVAKL
Sbjct  68    ARIVTSPHADQIEDKPVVSELRRTSSNKNANGTPMKTLIAQEMSKEVESKHNRPNVVAKL  127

Query  676   MGLDGFPSQLPVSTAQRNYS---GRNAQSAKGTPLNNFHHRSGSLDTQMECEFYQYPEQN  846
             MGLD  P     S AQR++S    R++ S    P++ +      LD + + E  +  EQN
Sbjct  128   MGLDTLPPLQSRSAAQRSHSKGYSRHSLSHSSIPVDCWEQDRVFLDNRTQSEVNKCQEQN  187

Query  847   ECKDVYEVWQNRHDMNSMRSKSPQMGRCNET-STDKVAFVRQKFIEAKCLSLDEKCHHSR  1023
             ECKDVYE+WQ     +  R  S Q GRCNE  S  K+A VRQKF+EAK L+ DEK   S+
Sbjct  188   ECKDVYEIWQQSQRTSYSRDSSMQKGRCNENISEAKMALVRQKFMEAKRLATDEKLRQSK  247

Query  1024  QFQDALEVLSSNTDLVLKFLQEPKPMLSEHIYNLQSIPAPSETKRITVLKPSKMVDN  1194
             +FQDALEVLS+N DL L+FLQEP  + S+ +Y+LQ+ P P ETKRITVL+PSK+VD+
Sbjct  248   EFQDALEVLSTNRDLFLRFLQEPNSLFSQQLYDLQTTPPPPETKRITVLRPSKVVDD  304



>ref|XP_012085179.1| PREDICTED: uncharacterized protein LOC105644441 [Jatropha curcas]
 ref|XP_012085180.1| PREDICTED: uncharacterized protein LOC105644441 [Jatropha curcas]
 gb|KDP26434.1| hypothetical protein JCGZ_17592 [Jatropha curcas]
Length=965

 Score =   315 bits (808),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 171/294 (58%), Positives = 210/294 (71%), Gaps = 9/294 (3%)
 Frame = +1

Query  334   MYAVQNGKNRGLEKPIPGCLGRMVNLFDLNGGVAGNRLLTDKPHRDG-SLSRSQSDVARM  510
             M  +Q  K + +EKP PGCLGRMV+LFDL  GV GNRLLTDKPH DG SLSRS+SDVARM
Sbjct  1     MNGIQGRKTQNVEKPFPGCLGRMVSLFDLANGVTGNRLLTDKPHHDGYSLSRSRSDVARM  60

Query  511   SPSE--DQIEDKEIVSELRRNNSKMKANGTPMKMLIAEEMSKDMASKHNPPSVVAKLMGL  684
               S   D +EDK IVSELRR++S  KANGTPMK LIA+EMSK++ S+HNPP+VVAKLMGL
Sbjct  61    KSSSFGDHVEDKMIVSELRRSSSNAKANGTPMKTLIAQEMSKEVDSRHNPPNVVAKLMGL  120

Query  685   DGFPSQLPVSTAQRNYS---GRNAQSAKGTPLNNFHHRSGSLDTQMECEFYQYPEQNECK  855
             D  P Q   S  +R++S    R + S  G  ++ +       D QM  E ++  EQNE K
Sbjct  121   DNLPHQQSNSATERSHSKCYSRRSLSHSGILVDCWEQDHSFPDKQMHSEGHRCEEQNEYK  180

Query  856   DVYEVWQNRHDMNSMRSKSPQMGRCNETSTD-KVAFVRQKFIEAKCLSLDEKCHHSRQFQ  1032
             DVYE+WQ     N+ R  SP  GR NE + + K+A VRQKF+EAK L+ DEK   SR+FQ
Sbjct  181   DVYEIWQQSQKTNA-RDSSPHKGRYNENANEKKMALVRQKFMEAKRLATDEKGCQSREFQ  239

Query  1033  DALEVLSSNTDLVLKFLQEPKPMLSEHIYNLQSIPAPSETKRITVLKPSKMVDN  1194
             DALEVLSSN DL+LKFL+EP  M S H+Y++Q IP P ETKRITVL+PSK+++N
Sbjct  240   DALEVLSSNRDLLLKFLEEPNSMFSPHLYDMQPIPPP-ETKRITVLRPSKVINN  292



>gb|KDO65805.1| hypothetical protein CISIN_1g001807mg [Citrus sinensis]
Length=1000

 Score =   315 bits (807),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 169/296 (57%), Positives = 211/296 (71%), Gaps = 9/296 (3%)
 Frame = +1

Query  334   MYAVQNGK--NRGLEKPIPGCLGRMVNLFDLNGGVAGNRLLTDKPHRDGS-LSRSQSDVA  504
             M  +Q+ K  N  ++K + GCLGRMVNLFDL+ G+ GNRLLTDKPHRDG+ LSRSQSDVA
Sbjct  1     MNGIQSTKAQNINVDKHVVGCLGRMVNLFDLSTGIPGNRLLTDKPHRDGAMLSRSQSDVA  60

Query  505   RM--SPSEDQIEDKEIVSELRRNNSKMKANGTPMKMLIAEEMSKDMASKHNPPSVVAKLM  678
             R+  SP  DQIEDK +VSELRR +S   ANGTPMK LIA+EMSK++ SKHN P+VVAKLM
Sbjct  61    RIVTSPHADQIEDKPVVSELRRTSSNKNANGTPMKTLIAQEMSKEVESKHNRPNVVAKLM  120

Query  679   GLDGFPSQLPVSTAQRNYS---GRNAQSAKGTPLNNFHHRSGSLDTQMECEFYQYPEQNE  849
             GLD  P     S AQR++S    R++ S    P++ +      LD + + E  +  EQNE
Sbjct  121   GLDTLPPLQSRSAAQRSHSKGYSRHSLSHSSIPVDCWEQDRVFLDNRTQSEVNKCQEQNE  180

Query  850   CKDVYEVWQNRHDMNSMRSKSPQMGRCNET-STDKVAFVRQKFIEAKCLSLDEKCHHSRQ  1026
             CKDVYE+WQ     +  R  S Q GRCNE  S  K+A VRQKF+EAK L+ DEK   S++
Sbjct  181   CKDVYEIWQQSQRTSYSRDSSMQKGRCNENISEAKMALVRQKFMEAKRLATDEKLRQSKE  240

Query  1027  FQDALEVLSSNTDLVLKFLQEPKPMLSEHIYNLQSIPAPSETKRITVLKPSKMVDN  1194
             FQDALEVLS+N DL L+FLQEP  + S+ +Y+LQ+ P P ETKRITVL+PSK+VD+
Sbjct  241   FQDALEVLSTNRDLFLRFLQEPNSLFSQQLYDLQTTPPPPETKRITVLRPSKVVDD  296



>gb|KDO65804.1| hypothetical protein CISIN_1g001807mg [Citrus sinensis]
Length=1002

 Score =   315 bits (807),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 169/296 (57%), Positives = 211/296 (71%), Gaps = 9/296 (3%)
 Frame = +1

Query  334   MYAVQNGK--NRGLEKPIPGCLGRMVNLFDLNGGVAGNRLLTDKPHRDGS-LSRSQSDVA  504
             M  +Q+ K  N  ++K + GCLGRMVNLFDL+ G+ GNRLLTDKPHRDG+ LSRSQSDVA
Sbjct  1     MNGIQSTKAQNINVDKHVVGCLGRMVNLFDLSTGIPGNRLLTDKPHRDGAMLSRSQSDVA  60

Query  505   RM--SPSEDQIEDKEIVSELRRNNSKMKANGTPMKMLIAEEMSKDMASKHNPPSVVAKLM  678
             R+  SP  DQIEDK +VSELRR +S   ANGTPMK LIA+EMSK++ SKHN P+VVAKLM
Sbjct  61    RIVTSPHADQIEDKPVVSELRRTSSNKNANGTPMKTLIAQEMSKEVESKHNRPNVVAKLM  120

Query  679   GLDGFPSQLPVSTAQRNYS---GRNAQSAKGTPLNNFHHRSGSLDTQMECEFYQYPEQNE  849
             GLD  P     S AQR++S    R++ S    P++ +      LD + + E  +  EQNE
Sbjct  121   GLDTLPPLQSRSAAQRSHSKGYSRHSLSHSSIPVDCWEQDRVFLDNRTQSEVNKCQEQNE  180

Query  850   CKDVYEVWQNRHDMNSMRSKSPQMGRCNET-STDKVAFVRQKFIEAKCLSLDEKCHHSRQ  1026
             CKDVYE+WQ     +  R  S Q GRCNE  S  K+A VRQKF+EAK L+ DEK   S++
Sbjct  181   CKDVYEIWQQSQRTSYSRDSSMQKGRCNENISEAKMALVRQKFMEAKRLATDEKLRQSKE  240

Query  1027  FQDALEVLSSNTDLVLKFLQEPKPMLSEHIYNLQSIPAPSETKRITVLKPSKMVDN  1194
             FQDALEVLS+N DL L+FLQEP  + S+ +Y+LQ+ P P ETKRITVL+PSK+VD+
Sbjct  241   FQDALEVLSTNRDLFLRFLQEPNSLFSQQLYDLQTTPPPPETKRITVLRPSKVVDD  296



>emb|CDP03827.1| unnamed protein product [Coffea canephora]
Length=962

 Score =   313 bits (801),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 170/289 (59%), Positives = 205/289 (71%), Gaps = 5/289 (2%)
 Frame = +1

Query  334   MYAVQNGKNRGLEKPIPGCLGRMVNLFDLNGGVAGNRLLTDKPHRDGS-LSR-SQSDVAR  507
             M     GKN  +E P PGCLG+MVNLFD++GG+AGNRLLTDKPHRDGS LSR SQSDV+R
Sbjct  1     MNGFHKGKNHNVEGPFPGCLGKMVNLFDMSGGMAGNRLLTDKPHRDGSPLSRRSQSDVSR  60

Query  508   MSPSEDQIEDKEIVSELRRNNSKMKANGTPMKMLIAEEMSKDMASKHNPPSVVAKLMGLD  687
             M   ED+IE+K ++SE  R     K++GTPMKMLIA+EMSK++ SKHN PSVVAKLMGLD
Sbjct  61    MGQFEDRIEEK-VMSEFSRTCPNRKSSGTPMKMLIAQEMSKEVDSKHNHPSVVAKLMGLD  119

Query  688   GFPSQLPVSTAQRNYSGRNAQSAKGTPLNNFHHRSGSLDTQMECEFYQYPEQNECKDVYE  867
               P Q P    +R++S   ++S     L+ + H  G  D  M+ E  + P+ NE KDVYE
Sbjct  120   ALPQQQPDQATERSHSRGYSRSQSDAQLSYWQHDKGFWDLPMQDE-TRDPQHNEYKDVYE  178

Query  868   VWQNRHDMNSMRSKSPQMGRCNETSTDK-VAFVRQKFIEAKCLSLDEKCHHSRQFQDALE  1044
             + +     N  R KSP  GRC+ET  DK +A VRQKFIEAK LS DEK   ++QFQDALE
Sbjct  179   IMRQSPKPNCTRDKSPHKGRCDETPNDKKMALVRQKFIEAKRLSTDEKLRQTQQFQDALE  238

Query  1045  VLSSNTDLVLKFLQEPKPMLSEHIYNLQSIPAPSETKRITVLKPSKMVD  1191
             VL+SN DL LKFLQEP  M S+H+ NLQSI  P ETKRITVL+P KMVD
Sbjct  239   VLNSNKDLFLKFLQEPNSMFSQHLINLQSISHPPETKRITVLRPCKMVD  287



>ref|XP_011024525.1| PREDICTED: uncharacterized protein LOC105125670 isoform X1 [Populus 
euphratica]
 ref|XP_011024526.1| PREDICTED: uncharacterized protein LOC105125670 isoform X1 [Populus 
euphratica]
 ref|XP_011024527.1| PREDICTED: uncharacterized protein LOC105125670 isoform X1 [Populus 
euphratica]
Length=996

 Score =   311 bits (797),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 173/295 (59%), Positives = 210/295 (71%), Gaps = 9/295 (3%)
 Frame = +1

Query  334   MYAVQNGKNRGLEKPIPGCLGRMVNLFDLNGGVAGNRLLTDKPHRDGS-LSRSQSDVARM  510
             M  +Q  K + +EKP PGCLGRMVNLFDLN GVAGNRLLTDKPH DGS +SRSQSDVARM
Sbjct  1     MNGMQYRKGQSIEKPFPGCLGRMVNLFDLNNGVAGNRLLTDKPHYDGSSISRSQSDVARM  60

Query  511   --SPSEDQIEDKEIVSELRRNNSKMKANGTPMKMLIAEEMSKDMASKHNPPSVVAKLMGL  684
                P  DQ+EDK IVSELRR++   KAN TPMK LIA+EMSK++ SKHNPP++VAKLMGL
Sbjct  61    LSVPFGDQVEDKMIVSELRRSSLNKKANATPMKTLIAQEMSKEVESKHNPPNLVAKLMGL  120

Query  685   DGFPSQLPVSTA-QRNYS---GRNAQSAKGTPLNNFHHRSGSLDTQMECEFYQYPEQNEC  852
             D  P Q PV+ A QR++S    R + S     + ++      LD QM  E +   E++E 
Sbjct  121   DTLPHQQPVAAAAQRSHSRGYSRRSLSHSEIFVESWDEDHSCLDKQMPSEGHPREERSEY  180

Query  853   KDVYEVWQNRHDMNSMRSKSPQMGRCNE-TSTDKVAFVRQKFIEAKCLSLDEKCHHSRQF  1029
             KDVYE+WQ       +R  SPQ    NE  +T K+A VRQKF+EAK LS DEK   SR+F
Sbjct  181   KDVYEIWQQSQK-TMVRHSSPQKRNHNENVNTKKMALVRQKFMEAKRLSTDEKGRQSREF  239

Query  1030  QDALEVLSSNTDLVLKFLQEPKPMLSEHIYNLQSIPAPSETKRITVLKPSKMVDN  1194
             QDALEVLSSN DL LKFLQEP  + S+H++++QS+P   ETK ITVL+PSK+VDN
Sbjct  240   QDALEVLSSNKDLFLKFLQEPNSLFSQHLHDMQSMPPSPETKHITVLRPSKVVDN  294



>ref|XP_006443684.1| hypothetical protein CICLE_v10018694mg [Citrus clementina]
 ref|XP_006480168.1| PREDICTED: uncharacterized protein LOC102618918 [Citrus sinensis]
 gb|ESR56924.1| hypothetical protein CICLE_v10018694mg [Citrus clementina]
Length=991

 Score =   310 bits (793),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 168/296 (57%), Positives = 211/296 (71%), Gaps = 10/296 (3%)
 Frame = +1

Query  334   MYAVQNGK--NRGLEKPIPGCLGRMVNLFDLNGGVAGNRLLTDKPHRDGS-LSRSQSDVA  504
             M  +Q+ K  N  ++K + GCLGRMVNLFDL+ G+ GNRLLTD+PHRDG+ LSRSQSDVA
Sbjct  1     MNGIQSTKAQNINVDKHVVGCLGRMVNLFDLSTGIPGNRLLTDEPHRDGAMLSRSQSDVA  60

Query  505   RM--SPSEDQIEDKEIVSELRRNNSKMKANGTPMKMLIAEEMSKDMASKHNPPSVVAKLM  678
             R+  SP  DQIEDK +VSELRR +S   ANGTPMK LIA+EMSK++ SKHN P+VVAKLM
Sbjct  61    RIVTSPHADQIEDKPVVSELRRTSSNKNANGTPMKTLIAQEMSKEVESKHNRPNVVAKLM  120

Query  679   GLDGFPSQLPVSTAQRNYS---GRNAQSAKGTPLNNFHHRSGSLDTQMECEFYQYPEQNE  849
             GLD  P     S AQR++S    R++ S    P++ +      LD + + E  +  EQNE
Sbjct  121   GLDTLPPLQSRSAAQRSHSKGYSRHSLSHSSIPVDCWEQDRVFLDNRTQSEVNKCQEQNE  180

Query  850   CKDVYEVWQNRHDMNSMRSKSPQMGRCNET-STDKVAFVRQKFIEAKCLSLDEKCHHSRQ  1026
             CKDVYE+WQ     +  R  S Q GRCNE  S  K+A VRQKF+EAK L+ DEK   S++
Sbjct  181   CKDVYEIWQQSQRTSYSRDSSMQKGRCNENISEAKMALVRQKFMEAKRLATDEKLRQSKE  240

Query  1027  FQDALEVLSSNTDLVLKFLQEPKPMLSEHIYNLQSIPAPSETKRITVLKPSKMVDN  1194
             FQDALEVLS+N DL L+FLQEP  + S+ +Y+LQ+ P P ETKRITVL+PSK+VD+
Sbjct  241   FQDALEVLSTNRDLFLRFLQEPNSLFSQQLYDLQTTPPP-ETKRITVLRPSKVVDD  295



>ref|XP_009371010.1| PREDICTED: uncharacterized protein LOC103960277 isoform X2 [Pyrus 
x bretschneideri]
Length=985

 Score =   309 bits (792),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 167/292 (57%), Positives = 209/292 (72%), Gaps = 7/292 (2%)
 Frame = +1

Query  334   MYAVQNGKNRGLEKPIPGCLGRMVNLFDLNGGVAGNRLLTDKPHRDGS-LSRSQSDVARM  510
             M  +Q GK    +KP PGCLGRMVNLFDL  GV+GN+LLTDKPHRDGS LSRSQSDVA M
Sbjct  1     MNGMQIGKALNADKPSPGCLGRMVNLFDLGNGVSGNKLLTDKPHRDGSSLSRSQSDVATM  60

Query  511   ---SPSEDQIEDKEIVSELRRNNSKMKANGTPMKMLIAEEMSKDMASKHNPPSVVAKLMG  681
                 P  D I+DK IVSELRR++S  KA+GTP+K+L+  EMSK++ SK NPP++VAKLMG
Sbjct  61    LGPPPFGDHIDDKVIVSELRRSSSNNKASGTPIKILLDREMSKEVVSKKNPPNLVAKLMG  120

Query  682   LDGFPSQLPVSTAQRNYSGRNAQSAKGT-PLNNFHHRSGSLDTQMECEFYQYPEQNECKD  858
             LD  P +   S +QR+++   +Q    + PL  +H   G LD  +  EF+Q  EQN+ KD
Sbjct  121   LDALPLEQSDSASQRSHTNSYSQGTNNSMPLGCWHQEDGFLDNGIPREFHQCSEQNDYKD  180

Query  859   VYEVWQNRHDMNSMRSKSPQMGRCNETSTD-KVAFVRQKFIEAKCLSLDEKCHHSRQFQD  1035
             VYEVWQ     N  R+ SPQ GR NE   + K+  VRQKF+EAK L+ DE+   S++FQD
Sbjct  181   VYEVWQQPQKANYGRNMSPQKGRYNEKVNEKKMTLVRQKFMEAKRLATDERLRQSKEFQD  240

Query  1036  ALEVLSSNTDLVLKFLQEPKPMLSEHIYNLQSI-PAPSETKRITVLKPSKMV  1188
             AL+VLSSN +L LKFLQEP  + S+H++ LQSI P P+ETKRITVL+PSKMV
Sbjct  241   ALDVLSSNRELFLKFLQEPNSLFSQHLHELQSIPPQPTETKRITVLRPSKMV  292



>ref|XP_008235543.1| PREDICTED: uncharacterized protein LOC103334363 [Prunus mume]
 ref|XP_008235544.1| PREDICTED: uncharacterized protein LOC103334363 [Prunus mume]
Length=981

 Score =   308 bits (790),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 172/293 (59%), Positives = 209/293 (71%), Gaps = 10/293 (3%)
 Frame = +1

Query  334   MYAVQNGKNRGLEKPIPGCLGRMVNLFDLNGGVAGNRLLTDKPHRDGS-LSRSQSDVARM  510
             M  +Q  K    +KP PGCLGRMVNLFDL+ GV+GN+LLT+KPH DGS +SRSQSDVA M
Sbjct  1     MNGMQISKAHNTDKPFPGCLGRMVNLFDLSTGVSGNKLLTEKPHHDGSSVSRSQSDVATM  60

Query  511   ---SPSEDQIEDKEIVSELRRNNSKMKANGTPMKMLIAEEMSKDMASKHNPPSVVAKLMG  681
                SP  D I+DK IV ELRR++S  K  GTP+KML+ +EMSK++ SK NPP+VVAKLMG
Sbjct  61    LGPSPFGDHIDDKLIVPELRRSSSNNKVCGTPIKMLLDQEMSKEVESKKNPPNVVAKLMG  120

Query  682   LDGFPSQLPVSTAQRNYSGRNAQSAKGTPLNNFHHRSGSLDTQMECEFYQYPEQNECKDV  861
             LD  P + P S +QR     N  SA   PL  +  + G LD  M  EF+Q  +QN+ KDV
Sbjct  121   LDSLPREQPDSASQRCSQCTNHSSA---PLGCW-QQDGFLDKGMLREFHQCSKQNDYKDV  176

Query  862   YEVWQNRHDMNSMRSKSPQMGRCNETSTD-KVAFVRQKFIEAKCLSLDEKCHHSRQFQDA  1038
             YEVWQ     N  R+KSPQ GRCNE   + K+A VRQKF+EAK L+ DE+   S++FQDA
Sbjct  177   YEVWQQPQKANYGRNKSPQKGRCNEEVNEKKMALVRQKFMEAKRLATDERLRQSKEFQDA  236

Query  1039  LEVLSSNTDLVLKFLQEPKPMLSEHIYNLQSIPA-PSETKRITVLKPSKMVDN  1194
             LEVLSSN DL LKFLQEP  + S+H+  LQSIP+ P+ETKRITVL+PSKMV N
Sbjct  237   LEVLSSNRDLFLKFLQEPNSLFSQHLNELQSIPSQPTETKRITVLRPSKMVSN  289



>ref|XP_008372424.1| PREDICTED: uncharacterized protein LOC103435787 isoform X2 [Malus 
domestica]
Length=985

 Score =   307 bits (786),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 166/292 (57%), Positives = 207/292 (71%), Gaps = 7/292 (2%)
 Frame = +1

Query  334   MYAVQNGKNRGLEKPIPGCLGRMVNLFDLNGGVAGNRLLTDKPHRDGS-LSRSQSDVARM  510
             M  +Q GK    +KP PGCLGRMVNLFDL  GV GN+LLTDKPHRDGS LSRSQSDVA M
Sbjct  1     MNGMQIGKAHNADKPSPGCLGRMVNLFDLGNGVPGNKLLTDKPHRDGSSLSRSQSDVATM  60

Query  511   ---SPSEDQIEDKEIVSELRRNNSKMKANGTPMKMLIAEEMSKDMASKHNPPSVVAKLMG  681
                 P  D I+DK IVSELRR++S  KA+GTP+K+L+  EMSK++ SK NPP++VAKLMG
Sbjct  61    LGPPPFGDHIDDKVIVSELRRSSSNNKASGTPIKILLDREMSKEVVSKKNPPNLVAKLMG  120

Query  682   LDGFPSQLPVSTAQRNYSGRNAQSAKGT-PLNNFHHRSGSLDTQMECEFYQYPEQNECKD  858
             LD  P +   S +QR+++   +Q    + PL  +    G L+  M CEF+Q  EQN+ KD
Sbjct  121   LDALPLEQSDSASQRSHTNCYSQGTNNSMPLGCWQQEDGFLENGMPCEFHQCSEQNDYKD  180

Query  859   VYEVWQNRHDMNSMRSKSPQMGRCNETSTD-KVAFVRQKFIEAKCLSLDEKCHHSRQFQD  1035
             VYEVWQ     N  R+  PQ GR NE   + K+  VRQKF+EAK L+ DE+   S++FQD
Sbjct  181   VYEVWQQPQKANYGRNMLPQKGRYNEKVNEKKMTLVRQKFMEAKRLATDERLRQSKEFQD  240

Query  1036  ALEVLSSNTDLVLKFLQEPKPMLSEHIYNLQSI-PAPSETKRITVLKPSKMV  1188
             AL+VLSSN +L LKFLQEP  + S+H++ LQSI P P+ETKRITVL+PSKMV
Sbjct  241   ALDVLSSNRELFLKFLQEPNSLFSQHLHELQSIPPQPTETKRITVLRPSKMV  292



>ref|XP_007199004.1| hypothetical protein PRUPE_ppa000852mg [Prunus persica]
 gb|EMJ00203.1| hypothetical protein PRUPE_ppa000852mg [Prunus persica]
Length=981

 Score =   306 bits (784),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 172/293 (59%), Positives = 208/293 (71%), Gaps = 9/293 (3%)
 Frame = +1

Query  334   MYAVQNGKNRGLEKPIPGCLGRMVNLFDLNGGVAGNRLLTDKPHRDGS-LSRSQSDVARM  510
             M  +Q  K    +KP PGCLGRMVNLFDL+ GV+GN+LLT+KPH DGS LSRSQSDVA M
Sbjct  1     MNGMQISKAHNTDKPFPGCLGRMVNLFDLSTGVSGNKLLTEKPHHDGSSLSRSQSDVATM  60

Query  511   ---SPSEDQIEDKEIVSELRRNNSKMKANGTPMKMLIAEEMSKDMASKHNPPSVVAKLMG  681
                 P  D I+DK IV ELRR++S  K  GTP+KML+ +EMSK++ SK NPP+VVAKLMG
Sbjct  61    LGPPPFGDHIDDKLIVPELRRSSSNNKVCGTPIKMLLDQEMSKEVESKKNPPNVVAKLMG  120

Query  682   LDGFPSQLPVSTAQRNYSGRNAQSAKGTPLNNFHHRSGSLDTQMECEFYQYPEQNECKDV  861
             LD  P + P S +QR  S     S+  TPL  +  + G LD  M  EF+Q  +QN+ KDV
Sbjct  121   LDSLPREQPDSASQRCCSQCTNHSS--TPLGCW-QQDGFLDKGMLREFHQCSKQNDYKDV  177

Query  862   YEVWQNRHDMNSMRSKSPQMGRCNETSTD-KVAFVRQKFIEAKCLSLDEKCHHSRQFQDA  1038
             YEVWQ     N  R+KSPQ GRCNE   + K+A VRQKF+EAK L+ DE+   S++FQDA
Sbjct  178   YEVWQQPQKANYGRNKSPQKGRCNEKVNEKKMALVRQKFMEAKRLATDERLRQSKEFQDA  237

Query  1039  LEVLSSNTDLVLKFLQEPKPMLSEHIYNLQSI-PAPSETKRITVLKPSKMVDN  1194
             LEVLSSN DL LKFLQEP  + S+H+  LQSI P P+ETKRITVL+PSKMV N
Sbjct  238   LEVLSSNRDLFLKFLQEPNSLFSQHLNELQSIPPQPTETKRITVLRPSKMVSN  290



>ref|XP_009371001.1| PREDICTED: uncharacterized protein LOC103960277 isoform X1 [Pyrus 
x bretschneideri]
Length=988

 Score =   306 bits (783),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 166/295 (56%), Positives = 208/295 (71%), Gaps = 10/295 (3%)
 Frame = +1

Query  334   MYAVQNGKNRGLEKPIPGCLGRMVNLFDLNGGVAGNRLLTDKPHRD----GSLSRSQSDV  501
             M  +Q GK    +KP PGCLGRMVNLFDL  GV+GN+LLTDKPHRD     SLSRSQSDV
Sbjct  1     MNGMQIGKALNADKPSPGCLGRMVNLFDLGNGVSGNKLLTDKPHRDVLVGSSLSRSQSDV  60

Query  502   ARM---SPSEDQIEDKEIVSELRRNNSKMKANGTPMKMLIAEEMSKDMASKHNPPSVVAK  672
             A M    P  D I+DK IVSELRR++S  KA+GTP+K+L+  EMSK++ SK NPP++VAK
Sbjct  61    ATMLGPPPFGDHIDDKVIVSELRRSSSNNKASGTPIKILLDREMSKEVVSKKNPPNLVAK  120

Query  673   LMGLDGFPSQLPVSTAQRNYSGRNAQSAKGT-PLNNFHHRSGSLDTQMECEFYQYPEQNE  849
             LMGLD  P +   S +QR+++   +Q    + PL  +H   G LD  +  EF+Q  EQN+
Sbjct  121   LMGLDALPLEQSDSASQRSHTNSYSQGTNNSMPLGCWHQEDGFLDNGIPREFHQCSEQND  180

Query  850   CKDVYEVWQNRHDMNSMRSKSPQMGRCNETSTD-KVAFVRQKFIEAKCLSLDEKCHHSRQ  1026
              KDVYEVWQ     N  R+ SPQ GR NE   + K+  VRQKF+EAK L+ DE+   S++
Sbjct  181   YKDVYEVWQQPQKANYGRNMSPQKGRYNEKVNEKKMTLVRQKFMEAKRLATDERLRQSKE  240

Query  1027  FQDALEVLSSNTDLVLKFLQEPKPMLSEHIYNLQSI-PAPSETKRITVLKPSKMV  1188
             FQDAL+VLSSN +L LKFLQEP  + S+H++ LQSI P P+ETKRITVL+PSKMV
Sbjct  241   FQDALDVLSSNRELFLKFLQEPNSLFSQHLHELQSIPPQPTETKRITVLRPSKMV  295



>ref|XP_008372423.1| PREDICTED: uncharacterized protein LOC103435787 isoform X1 [Malus 
domestica]
Length=988

 Score =   303 bits (776),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 165/295 (56%), Positives = 206/295 (70%), Gaps = 10/295 (3%)
 Frame = +1

Query  334   MYAVQNGKNRGLEKPIPGCLGRMVNLFDLNGGVAGNRLLTDKPHRD----GSLSRSQSDV  501
             M  +Q GK    +KP PGCLGRMVNLFDL  GV GN+LLTDKPHRD     SLSRSQSDV
Sbjct  1     MNGMQIGKAHNADKPSPGCLGRMVNLFDLGNGVPGNKLLTDKPHRDVLVGSSLSRSQSDV  60

Query  502   ARM---SPSEDQIEDKEIVSELRRNNSKMKANGTPMKMLIAEEMSKDMASKHNPPSVVAK  672
             A M    P  D I+DK IVSELRR++S  KA+GTP+K+L+  EMSK++ SK NPP++VAK
Sbjct  61    ATMLGPPPFGDHIDDKVIVSELRRSSSNNKASGTPIKILLDREMSKEVVSKKNPPNLVAK  120

Query  673   LMGLDGFPSQLPVSTAQRNYSGRNAQSAKGT-PLNNFHHRSGSLDTQMECEFYQYPEQNE  849
             LMGLD  P +   S +QR+++   +Q    + PL  +    G L+  M CEF+Q  EQN+
Sbjct  121   LMGLDALPLEQSDSASQRSHTNCYSQGTNNSMPLGCWQQEDGFLENGMPCEFHQCSEQND  180

Query  850   CKDVYEVWQNRHDMNSMRSKSPQMGRCNETSTD-KVAFVRQKFIEAKCLSLDEKCHHSRQ  1026
              KDVYEVWQ     N  R+  PQ GR NE   + K+  VRQKF+EAK L+ DE+   S++
Sbjct  181   YKDVYEVWQQPQKANYGRNMLPQKGRYNEKVNEKKMTLVRQKFMEAKRLATDERLRQSKE  240

Query  1027  FQDALEVLSSNTDLVLKFLQEPKPMLSEHIYNLQSI-PAPSETKRITVLKPSKMV  1188
             FQDAL+VLSSN +L LKFLQEP  + S+H++ LQSI P P+ETKRITVL+PSKMV
Sbjct  241   FQDALDVLSSNRELFLKFLQEPNSLFSQHLHELQSIPPQPTETKRITVLRPSKMV  295



>gb|EYU17961.1| hypothetical protein MIMGU_mgv1a0013543mg, partial [Erythranthe 
guttata]
Length=558

 Score =   293 bits (751),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 158/286 (55%), Positives = 197/286 (69%), Gaps = 19/286 (7%)
 Frame = +1

Query  346   QNGKNRGLEKPIPGCLGRMVNLFDLNGGVAGNRLLTDKPHRDGS-LSRSQSDVARMSPSE  522
             +NGK    EK  PGCLGRMVNLF++N GV+ N+LLTDKPHRDGS +SRS+SDV R SPS 
Sbjct  6     RNGKTSDFEKTYPGCLGRMVNLFEMNIGVSANKLLTDKPHRDGSPVSRSRSDVTRTSPSH  65

Query  523   DQIEDKEIVSELRRNNSKMKANGTPMKMLIAEEMSKDMASKHNPPSVVAKLMGLDGFPSQ  702
             DQI++K IVSELR  +S+ K N TPMKMLIA+EMSK++  + +PP++VAKLMGLD  P Q
Sbjct  66    DQIQEKAIVSELRNTSSQRKLNVTPMKMLIAQEMSKEVDMRRSPPNLVAKLMGLDSLPPQ  125

Query  703   LPVSTAQRNYSGRNAQSAKGTPLNNFHHRSGSLDTQMECEFYQYPEQNECKDVYEVWQNR  882
              P    QR++S  + +S    P+ N+   +G         F  Y E NE KDVYE+WQ  
Sbjct  126   EPDRAVQRSHSKGHPRSQSEIPMGNWEQHNG---------FVHYVEPNEYKDVYEIWQQS  176

Query  883   HDMNSMRSKSPQMGRC-NETSTD-KVAFVRQKFIEAKCLSLDEKCHHSRQFQDALEVLSS  1056
                     K    GR  NET++D K+A VRQKF+EAK LS+D K   S+QFQDALEVL+S
Sbjct  177   Q-------KVTHKGRQHNETASDKKMALVRQKFVEAKRLSMDAKLRQSKQFQDALEVLNS  229

Query  1057  NTDLVLKFLQEPKPMLSEHIYNLQSIPAPSETKRITVLKPSKMVDN  1194
             N DL L+ LQEP    S+ +YN+QSI  P ETKRITVL+PSK+ DN
Sbjct  230   NKDLFLRCLQEPTSGFSQQLYNVQSIAPPPETKRITVLRPSKVADN  275



>emb|CBI37234.3| unnamed protein product [Vitis vinifera]
Length=809

 Score =   299 bits (765),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 158/290 (54%), Positives = 197/290 (68%), Gaps = 43/290 (15%)
 Frame = +1

Query  334   MYAVQNGKNRGLEKPIPGCLGRMVNLFDLNGGVAGNRLLTDKPHRDGS-LSRSQSDVARM  510
             M  + N K RG EKP PGCLGRMVNLFDLN G+ GNR+LTD+PH+DGS LSRS+SDVAR+
Sbjct  1     MSGIHNSKTRGFEKPFPGCLGRMVNLFDLNAGMPGNRMLTDRPHQDGSPLSRSRSDVARV  60

Query  511   -SPSEDQIEDKEIVSELRRNNSKMKANGTPMKMLIAEEMSKDMASKHNPPSVVAKLMGLD  687
              SP+ DQ+EDK +VSEL R +++ K+NGTP+KMLIA+EMSK++  KHNPP VVAKLMGLD
Sbjct  61    SSPTGDQVEDKPMVSELSRTSNR-KSNGTPVKMLIAQEMSKEVDLKHNPPGVVAKLMGLD  119

Query  688   GFPSQLPVSTAQRNYSGRNAQSAKGTPLNNFHHRSGSLDTQMECEFYQYPEQNECKDVYE  867
               P + P  + QR++S                                        DV+E
Sbjct  120   ALPGRQPDLSPQRSHSN---------------------------------------DVHE  140

Query  868   VWQNRHDMNSMRSKSPQMGRCNETSTD-KVAFVRQKFIEAKCLSLDEKCHHSRQFQDALE  1044
             +WQ     N +R KSPQ GR  + + + K+A VRQKF EAK L+ DEK   S++FQDALE
Sbjct  141   IWQQSQKTNYIRDKSPQKGRQGDNANEKKMALVRQKFNEAKSLATDEKLRQSKEFQDALE  200

Query  1045  VLSSNTDLVLKFLQEPKPMLSEHIYNLQSIPAPSETKRITVLKPSKMVDN  1194
             VLSSN DL LKFLQEP  + ++H+Y LQSIPAP +TKRITVLKPSK++DN
Sbjct  201   VLSSNRDLFLKFLQEPNSLFTQHLYELQSIPAPPDTKRITVLKPSKVMDN  250



>ref|XP_002521158.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF41309.1| conserved hypothetical protein [Ricinus communis]
Length=990

 Score =   301 bits (770),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 168/294 (57%), Positives = 214/294 (73%), Gaps = 9/294 (3%)
 Frame = +1

Query  334   MYAVQNGKNRGLEKPIPGCLGRMVNLFDLNGGVAGNRLLTDKPHRDGS-LSRSQSDVARM  510
             M  +Q+ + + +EK  PGCLGRMVNLFDL+ G   N+LLTDKPHRD S LSRS+SDVARM
Sbjct  1     MNGIQSTRAQKIEKQFPGCLGRMVNLFDLSNGATENKLLTDKPHRDASSLSRSRSDVARM  60

Query  511   --SPSEDQIEDKEIVSELRRNNSKMKANGTPMKMLIAEEMSKDMASKHNPPSVVAKLMGL  684
               +P  DQIEDK IVSELRR++S  K+NGTPMK LIA EMSK++ S+ NPP+VVAKLMGL
Sbjct  61    MNAPFGDQIEDKMIVSELRRSSSSKKSNGTPMKTLIAREMSKEVDSRCNPPNVVAKLMGL  120

Query  685   DGFPSQLPVSTAQRNYS---GRNAQSAKGTPLNNFHHRSGSLDTQMECEFYQYPEQNECK  855
             D  P Q P S A+R++S    R + S  G  +  +   +  LD +M+CE ++  EQNE +
Sbjct  121   DTLPYQQPNSAAERSHSKGYSRRSLSHSGIVMECWEQDNSFLDERMQCEGHRCEEQNEYR  180

Query  856   DVYEVWQNRHDMNSMRSKSPQMGRCNETSTD-KVAFVRQKFIEAKCLSLDEKCHHSRQFQ  1032
             DVYE+WQ   + N+ R  SPQ GR +E+  + K+  VRQKF+EAK L+ DEK   S++FQ
Sbjct  181   DVYEIWQQSQNTNA-RGSSPQKGRHHESPNERKMTLVRQKFMEAKRLATDEKGRQSKEFQ  239

Query  1033  DALEVLSSNTDLVLKFLQEPKPMLSEHIYNLQSIPAPSETKRITVLKPSKMVDN  1194
             DALEVLSSN DL LKFLQEP  M S H+Y++QS  +P ETKRITVL+PSK++DN
Sbjct  240   DALEVLSSNRDLFLKFLQEPNSMFSPHLYDMQST-SPPETKRITVLRPSKVIDN  292



>ref|XP_002303096.2| hypothetical protein POPTR_0002s25490g [Populus trichocarpa]
 gb|EEE82369.2| hypothetical protein POPTR_0002s25490g [Populus trichocarpa]
Length=940

 Score =   300 bits (767),  Expect = 9e-89, Method: Compositional matrix adjust.
 Identities = 170/292 (58%), Positives = 207/292 (71%), Gaps = 17/292 (6%)
 Frame = +1

Query  334   MYAVQNGKNRGLEKPIPGCLGRMVNLFDLNGGVAGNRLLTDKPHRDGS-LSRSQSDVARM  510
             M  +Q  K + +EKP PGCLGRMVNLFDL+ GVAGNRLLTDKPH DGS +SRSQSDVARM
Sbjct  1     MNGMQYRKGQKIEKPFPGCLGRMVNLFDLSNGVAGNRLLTDKPHHDGSSISRSQSDVARM  60

Query  511   --SPSEDQIEDKEIVSELRRNNSKMKANGTPMKMLIAEEMSKDMASKHNPPSVVAKLMGL  684
                P  DQ+EDK IVSEL+R++   KAN TPMK LIA+EMSK++ SKHNPP++VAKLMGL
Sbjct  61    LSVPFGDQVEDKMIVSELKRSSLNKKANATPMKTLIAQEMSKEVESKHNPPNLVAKLMGL  120

Query  685   DGFPSQLPVST-AQRNYSGRNAQSAKGTPLNNFHHRSGSLDTQMECEFYQYPEQNECKDV  861
             D  P Q PV+  AQR++S       +G    +  H SG     M  E +   EQ+E KDV
Sbjct  121   DSLPHQQPVAADAQRSHS-------RGYSRRSLSH-SGIF---MPSEGHVCQEQSEYKDV  169

Query  862   YEVWQNRHDMNSMRSKSPQMGRCNE-TSTDKVAFVRQKFIEAKCLSLDEKCHHSRQFQDA  1038
             YE+WQ       +R  SPQ    NE  +T K+A VRQKF+EAK LS DEK   S++FQDA
Sbjct  170   YEIWQQSQK-TMVRHSSPQKRNHNENVNTKKMALVRQKFMEAKRLSTDEKGRQSKEFQDA  228

Query  1039  LEVLSSNTDLVLKFLQEPKPMLSEHIYNLQSIPAPSETKRITVLKPSKMVDN  1194
             LEVLSSN DL LKFLQEP  + S+H++++QS+P   ETK ITVL+PSK+VDN
Sbjct  229   LEVLSSNKDLFLKFLQEPNSLFSQHLHDMQSMPPSPETKHITVLRPSKVVDN  280



>ref|XP_008382666.1| PREDICTED: uncharacterized protein LOC103445438 [Malus domestica]
Length=983

 Score =   300 bits (768),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 167/294 (57%), Positives = 207/294 (70%), Gaps = 9/294 (3%)
 Frame = +1

Query  334   MYAVQNGKNRGLEKPIPGCLGRMVNLFDLNGGVAGNRLLTDKPHRDGS-LSRSQSDVARM  510
             M  +Q GK    +K  PGCLGRMVNLFDL  GV+GN+LLTDKPHRDGS LSRSQSDVA M
Sbjct  1     MNEMQIGKAHDADKAFPGCLGRMVNLFDLGNGVSGNKLLTDKPHRDGSSLSRSQSDVATM  60

Query  511   --SPS-EDQIEDKEIVSELRRNNSKMKANGTPMKMLIAEEMSKDMASKHNPPSVVAKLMG  681
                PS  D ++DK IVSELRR++S  KA+GTP+K+L+  EMSK++ SK NPP++VAKLMG
Sbjct  61    LGPPSFGDHVDDKPIVSELRRSSSNNKASGTPIKILLDREMSKEVESKKNPPNLVAKLMG  120

Query  682   LDGFPSQLPVSTAQRNYSGRNAQSA---KGTPLNNFHHRSGSLDTQMECEFYQYPEQNEC  852
             LD  P +   S +QR+++   +Q        PL  +  + G LD  M  EF+Q  EQN+ 
Sbjct  121   LDALPLEKSDSASQRSHTNSYSQCTNNHSSMPLECWQQQDGFLDKGMLREFHQCSEQNDY  180

Query  853   KDVYEVWQNRHDMNSMRSKSPQMGRCNETSTD-KVAFVRQKFIEAKCLSLDEKCHHSRQF  1029
             KDVYEVWQ        R+KSPQ GR NE   + K+A VRQKF+EAK L+ DE+   S++F
Sbjct  181   KDVYEVWQQPQKAGYGRNKSPQKGRNNEKVNEKKMALVRQKFMEAKRLATDERLRQSKEF  240

Query  1030  QDALEVLSSNTDLVLKFLQEPKPMLSEHIYNLQSIPAPS-ETKRITVLKPSKMV  1188
             QDAL+VLSSN DL L FLQEP  + S+H++ LQSIP  S ETKRITVL+PSKMV
Sbjct  241   QDALDVLSSNRDLFLTFLQEPNSLFSQHLHELQSIPPQSTETKRITVLRPSKMV  294



>ref|XP_006386899.1| hypothetical protein POPTR_0002s25490g [Populus trichocarpa]
 gb|ERP64696.1| hypothetical protein POPTR_0002s25490g [Populus trichocarpa]
Length=968

 Score =   300 bits (767),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 170/292 (58%), Positives = 207/292 (71%), Gaps = 17/292 (6%)
 Frame = +1

Query  334   MYAVQNGKNRGLEKPIPGCLGRMVNLFDLNGGVAGNRLLTDKPHRDGS-LSRSQSDVARM  510
             M  +Q  K + +EKP PGCLGRMVNLFDL+ GVAGNRLLTDKPH DGS +SRSQSDVARM
Sbjct  1     MNGMQYRKGQKIEKPFPGCLGRMVNLFDLSNGVAGNRLLTDKPHHDGSSISRSQSDVARM  60

Query  511   --SPSEDQIEDKEIVSELRRNNSKMKANGTPMKMLIAEEMSKDMASKHNPPSVVAKLMGL  684
                P  DQ+EDK IVSEL+R++   KAN TPMK LIA+EMSK++ SKHNPP++VAKLMGL
Sbjct  61    LSVPFGDQVEDKMIVSELKRSSLNKKANATPMKTLIAQEMSKEVESKHNPPNLVAKLMGL  120

Query  685   DGFPSQLPVST-AQRNYSGRNAQSAKGTPLNNFHHRSGSLDTQMECEFYQYPEQNECKDV  861
             D  P Q PV+  AQR++S       +G    +  H SG     M  E +   EQ+E KDV
Sbjct  121   DSLPHQQPVAADAQRSHS-------RGYSRRSLSH-SGIF---MPSEGHVCQEQSEYKDV  169

Query  862   YEVWQNRHDMNSMRSKSPQMGRCNE-TSTDKVAFVRQKFIEAKCLSLDEKCHHSRQFQDA  1038
             YE+WQ       +R  SPQ    NE  +T K+A VRQKF+EAK LS DEK   S++FQDA
Sbjct  170   YEIWQQSQK-TMVRHSSPQKRNHNENVNTKKMALVRQKFMEAKRLSTDEKGRQSKEFQDA  228

Query  1039  LEVLSSNTDLVLKFLQEPKPMLSEHIYNLQSIPAPSETKRITVLKPSKMVDN  1194
             LEVLSSN DL LKFLQEP  + S+H++++QS+P   ETK ITVL+PSK+VDN
Sbjct  229   LEVLSSNKDLFLKFLQEPNSLFSQHLHDMQSMPPSPETKHITVLRPSKVVDN  280



>ref|XP_011024528.1| PREDICTED: uncharacterized protein LOC105125670 isoform X2 [Populus 
euphratica]
Length=991

 Score =   299 bits (766),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 170/295 (58%), Positives = 206/295 (70%), Gaps = 14/295 (5%)
 Frame = +1

Query  334   MYAVQNGKNRGLEKPIPGCLGRMVNLFDLNGGVAGNRLLTDKPHRDGS-LSRSQSDVARM  510
             M  +Q  K + +EKP PGCLGRMVNLFDLN GVAGNRLLTDKPH DGS +SRSQSDVARM
Sbjct  1     MNGMQYRKGQSIEKPFPGCLGRMVNLFDLNNGVAGNRLLTDKPHYDGSSISRSQSDVARM  60

Query  511   --SPSEDQIEDKEIVSELRRNNSKMKANGTPMKMLIAEEMSKDMASKHNPPSVVAKLMGL  684
                P  DQI     VSELRR++   KAN TPMK LIA+EMSK++ SKHNPP++VAKLMGL
Sbjct  61    LSVPFGDQI-----VSELRRSSLNKKANATPMKTLIAQEMSKEVESKHNPPNLVAKLMGL  115

Query  685   DGFPSQLPVSTA-QRNYS---GRNAQSAKGTPLNNFHHRSGSLDTQMECEFYQYPEQNEC  852
             D  P Q PV+ A QR++S    R + S     + ++      LD QM  E +   E++E 
Sbjct  116   DTLPHQQPVAAAAQRSHSRGYSRRSLSHSEIFVESWDEDHSCLDKQMPSEGHPREERSEY  175

Query  853   KDVYEVWQNRHDMNSMRSKSPQMGRCNE-TSTDKVAFVRQKFIEAKCLSLDEKCHHSRQF  1029
             KDVYE+WQ       +R  SPQ    NE  +T K+A VRQKF+EAK LS DEK   SR+F
Sbjct  176   KDVYEIWQQSQK-TMVRHSSPQKRNHNENVNTKKMALVRQKFMEAKRLSTDEKGRQSREF  234

Query  1030  QDALEVLSSNTDLVLKFLQEPKPMLSEHIYNLQSIPAPSETKRITVLKPSKMVDN  1194
             QDALEVLSSN DL LKFLQEP  + S+H++++QS+P   ETK ITVL+PSK+VDN
Sbjct  235   QDALEVLSSNKDLFLKFLQEPNSLFSQHLHDMQSMPPSPETKHITVLRPSKVVDN  289



>gb|KHG22481.1| Viral inhibitor of RIP activation [Gossypium arboreum]
Length=1004

 Score =   296 bits (757),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 169/295 (57%), Positives = 205/295 (69%), Gaps = 9/295 (3%)
 Frame = +1

Query  331   EMYAVQNGKNRGLEKPIPGCLGRMVNLFDLNGGVAGNRLLTDKPHRDGS-LSRSQSDVAR  507
             EM  +Q+ K + +EK  PGCLGRMVNLFDLN GV GNRLLTDKPHRDGS LSRSQSDV R
Sbjct  11    EMNGIQHKKGQNIEK-FPGCLGRMVNLFDLNSGVPGNRLLTDKPHRDGSSLSRSQSDVVR  69

Query  508   M-SPS-EDQIEDKEIVSELRRNNSKMKANGTPMKMLIAEEMSKDMASKHNPPSVVAKLMG  681
             M SP+  DQIEDK IVSELR  ++K K N TPMKML+A+EMSKD+ SK NPP+VVAKLMG
Sbjct  70    MPSPTFGDQIEDKVIVSELRTFSNK-KGNVTPMKMLLAQEMSKDVESKCNPPNVVAKLMG  128

Query  682   LDGFPSQLPVSTAQR-NYSG--RNAQSAKGTPLNNFHHRSGSLDTQMECEFYQYPEQNEC  852
             LD  P Q   S+AQR  + G  R++      P+ ++       D QM+CE   Y   N+ 
Sbjct  129   LDALPRQQHNSSAQRCRFKGPSRHSSCHSEIPVESWEQDQSFPDEQMQCEVSPYEVPNKY  188

Query  853   KDVYEVWQNRHDMNSMRSKSPQMGRCNETSTD-KVAFVRQKFIEAKCLSLDEKCHHSRQF  1029
             KDVYE+WQ        R  SPQ GR ++ + + K+A VRQKF+EAK L  DEK   S++F
Sbjct  189   KDVYEIWQQSPRTTYSRDSSPQKGRYSDNANENKMALVRQKFMEAKHLVTDEKLRQSKEF  248

Query  1030  QDALEVLSSNTDLVLKFLQEPKPMLSEHIYNLQSIPAPSETKRITVLKPSKMVDN  1194
             QDALEVLSSN +L LKFL+EP    S+H+ N +    P +TKRITVL+PSKMVDN
Sbjct  249   QDALEVLSSNRELFLKFLEEPNSTFSQHLNNFRCSSLPPQTKRITVLRPSKMVDN  303



>ref|XP_010243642.1| PREDICTED: uncharacterized protein LOC104587645 isoform X2 [Nelumbo 
nucifera]
Length=996

 Score =   294 bits (752),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 163/306 (53%), Positives = 204/306 (67%), Gaps = 23/306 (8%)
 Frame = +1

Query  319   LRHSEMY--AVQNGKNRGLEKPIPGCLGRMVNLFDLNGGVAGNRLLTDKPHRDGS-LSRS  489
             +R +EM+   +Q  +   L+KP PGC+GRMVN  DL+ GVAGN+LLT+KPHRD S L RS
Sbjct  1     MRSTEMHMNGMQQRRAHDLDKPFPGCMGRMVNFLDLSTGVAGNKLLTEKPHRDCSFLPRS  60

Query  490   QSDVARMSPSEDQIEDKEIVSELRRNNSKMKANGTPMKMLIAEEMSKDMASKHNPPSVVA  669
             QS+  +  P  DQ+++K I  ELRR  S  K++GTPMKMLIA+EMSK+  SK  PP VVA
Sbjct  61    QSE--KSDPIRDQMDNKPIGYELRRAYSSKKSSGTPMKMLIAQEMSKETESKQKPPGVVA  118

Query  670   KLMGLDGFPSQLPVSTAQRNYSGRNAQSAKGTPLNNF----------HHRSGSLDTQMEC  819
             KLMGL+  P   P ST QR          KG  LN+F          H  S   D +M+C
Sbjct  119   KLMGLEALPGHHPDSTGQR-------IQQKGCLLNSFTEPEAIFRYQHQESDISDREMQC  171

Query  820   EFYQYPEQNECKDVYEVWQNRHDMNSMRSKSPQMGRCNETSTDK-VAFVRQKFIEAKCLS  996
             E +   E  E KDVYEVWQ     N  + KSPQ GR NE   +K +AFVRQKF EAK L+
Sbjct  172   EIHPVLEHKEYKDVYEVWQKSPKGNHTKDKSPQKGRQNENLNEKKMAFVRQKFTEAKRLA  231

Query  997   LDEKCHHSRQFQDALEVLSSNTDLVLKFLQEPKPMLSEHIYNLQSIPAPSETKRITVLKP  1176
              DEK H S++FQDALEVL+SNT+L LKFLQEP P+ S+H++ L+SI  P++TKRITVLKP
Sbjct  232   TDEKLHQSKEFQDALEVLNSNTELFLKFLQEPNPLFSQHLFELRSIXPPTQTKRITVLKP  291

Query  1177  SKMVDN  1194
             SK ++N
Sbjct  292   SKNLEN  297



>ref|XP_010243641.1| PREDICTED: uncharacterized protein LOC104587645 isoform X1 [Nelumbo 
nucifera]
Length=997

 Score =   294 bits (752),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 163/306 (53%), Positives = 204/306 (67%), Gaps = 23/306 (8%)
 Frame = +1

Query  319   LRHSEMY--AVQNGKNRGLEKPIPGCLGRMVNLFDLNGGVAGNRLLTDKPHRDGS-LSRS  489
             +R +EM+   +Q  +   L+KP PGC+GRMVN  DL+ GVAGN+LLT+KPHRD S L RS
Sbjct  1     MRSTEMHMNGMQQRRAHDLDKPFPGCMGRMVNFLDLSTGVAGNKLLTEKPHRDCSFLPRS  60

Query  490   QSDVARMSPSEDQIEDKEIVSELRRNNSKMKANGTPMKMLIAEEMSKDMASKHNPPSVVA  669
             QS+  +  P  DQ+++K I  ELRR  S  K++GTPMKMLIA+EMSK+  SK  PP VVA
Sbjct  61    QSE--KSDPIRDQMDNKPIGYELRRAYSSKKSSGTPMKMLIAQEMSKETESKQKPPGVVA  118

Query  670   KLMGLDGFPSQLPVSTAQRNYSGRNAQSAKGTPLNNF----------HHRSGSLDTQMEC  819
             KLMGL+  P   P ST QR          KG  LN+F          H  S   D +M+C
Sbjct  119   KLMGLEALPGHHPDSTGQR-------IQQKGCLLNSFTEPEAIFRYQHQESDISDREMQC  171

Query  820   EFYQYPEQNECKDVYEVWQNRHDMNSMRSKSPQMGRCNETSTDK-VAFVRQKFIEAKCLS  996
             E +   E  E KDVYEVWQ     N  + KSPQ GR NE   +K +AFVRQKF EAK L+
Sbjct  172   EIHPVLEHKEYKDVYEVWQKSPKGNHTKDKSPQKGRQNENLNEKKMAFVRQKFTEAKRLA  231

Query  997   LDEKCHHSRQFQDALEVLSSNTDLVLKFLQEPKPMLSEHIYNLQSIPAPSETKRITVLKP  1176
              DEK H S++FQDALEVL+SNT+L LKFLQEP P+ S+H++ L+SI  P++TKRITVLKP
Sbjct  232   TDEKLHQSKEFQDALEVLNSNTELFLKFLQEPNPLFSQHLFELRSIXPPTQTKRITVLKP  291

Query  1177  SKMVDN  1194
             SK ++N
Sbjct  292   SKNLEN  297



>ref|XP_010243643.1| PREDICTED: uncharacterized protein LOC104587645 isoform X3 [Nelumbo 
nucifera]
 ref|XP_010243644.1| PREDICTED: uncharacterized protein LOC104587645 isoform X3 [Nelumbo 
nucifera]
Length=992

 Score =   293 bits (749),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 161/299 (54%), Positives = 199/299 (67%), Gaps = 21/299 (7%)
 Frame = +1

Query  334   MYAVQNGKNRGLEKPIPGCLGRMVNLFDLNGGVAGNRLLTDKPHRDGS-LSRSQSDVARM  510
             M  +Q  +   L+KP PGC+GRMVN  DL+ GVAGN+LLT+KPHRD S L RSQS+  + 
Sbjct  3     MNGMQQRRAHDLDKPFPGCMGRMVNFLDLSTGVAGNKLLTEKPHRDCSFLPRSQSE--KS  60

Query  511   SPSEDQIEDKEIVSELRRNNSKMKANGTPMKMLIAEEMSKDMASKHNPPSVVAKLMGLDG  690
              P  DQ+++K I  ELRR  S  K++GTPMKMLIA+EMSK+  SK  PP VVAKLMGL+ 
Sbjct  61    DPIRDQMDNKPIGYELRRAYSSKKSSGTPMKMLIAQEMSKETESKQKPPGVVAKLMGLEA  120

Query  691   FPSQLPVSTAQRNYSGRNAQSAKGTPLNNF----------HHRSGSLDTQMECEFYQYPE  840
              P   P ST QR          KG  LN+F          H  S   D +M+CE +   E
Sbjct  121   LPGHHPDSTGQR-------IQQKGCLLNSFTEPEAIFRYQHQESDISDREMQCEIHPVLE  173

Query  841   QNECKDVYEVWQNRHDMNSMRSKSPQMGRCNETSTDK-VAFVRQKFIEAKCLSLDEKCHH  1017
               E KDVYEVWQ     N  + KSPQ GR NE   +K +AFVRQKF EAK L+ DEK H 
Sbjct  174   HKEYKDVYEVWQKSPKGNHTKDKSPQKGRQNENLNEKKMAFVRQKFTEAKRLATDEKLHQ  233

Query  1018  SRQFQDALEVLSSNTDLVLKFLQEPKPMLSEHIYNLQSIPAPSETKRITVLKPSKMVDN  1194
             S++FQDALEVL+SNT+L LKFLQEP P+ S+H++ L+SI  P++TKRITVLKPSK ++N
Sbjct  234   SKEFQDALEVLNSNTELFLKFLQEPNPLFSQHLFELRSIXPPTQTKRITVLKPSKNLEN  292



>gb|KJB10994.1| hypothetical protein B456_001G235600 [Gossypium raimondii]
Length=701

 Score =   283 bits (724),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 164/294 (56%), Positives = 200/294 (68%), Gaps = 9/294 (3%)
 Frame = +1

Query  334   MYAVQNGKNRGLEKPIPGCLGRMVNLFDLNGGVAGNRLLTDKPHRDGS-LSRSQSDVARM  510
             M  +Q+ K   +EK  PGCLGRMVNLFDLN GV GNRLLTDKPHRDGS LSRSQSDV RM
Sbjct  1     MNGIQHKKGHNIEK-FPGCLGRMVNLFDLNSGVPGNRLLTDKPHRDGSSLSRSQSDVVRM  59

Query  511   -SPS-EDQIEDKEIVSELRRNNSKMKANGTPMKMLIAEEMSKDMASKHNPPSVVAKLMGL  684
              SP+  DQIEDK IVSELR  ++K K N TPMKML+A+EMSKD+ SK NPP+VVAKLMGL
Sbjct  60    PSPTFGDQIEDKVIVSELRTFSNK-KGNVTPMKMLLAQEMSKDVESKCNPPNVVAKLMGL  118

Query  685   DGFPSQLPVSTAQR---NYSGRNAQSAKGTPLNNFHHRSGSLDTQMECEFYQYPEQNECK  855
             D  P +   S+AQR     S R++      P+ ++       D QM+CE       N+ K
Sbjct  119   DALPRRQHNSSAQRCRFKGSSRHSSCHSEIPVESWEQDQSFPDEQMQCEVSPCEVLNKYK  178

Query  856   DVYEVWQNRHDMNSMRSKSPQMGRCNETSTD-KVAFVRQKFIEAKCLSLDEKCHHSRQFQ  1032
             DVYE+WQ        R  SP+ GR ++ + + K+A VRQKF+EAK L  DEK   S++FQ
Sbjct  179   DVYEIWQQSPRTTYSRDSSPKKGRYSDNANENKMALVRQKFMEAKHLVTDEKLRQSKEFQ  238

Query  1033  DALEVLSSNTDLVLKFLQEPKPMLSEHIYNLQSIPAPSETKRITVLKPSKMVDN  1194
             DALEVLSSN +L LKFL+EP    S+H+ N +      +TKRITVL+PSKMVDN
Sbjct  239   DALEVLSSNRELFLKFLEEPNSTFSQHLNNFRCSSLLPQTKRITVLRPSKMVDN  292



>ref|XP_010684822.1| PREDICTED: uncharacterized protein LOC104899346 isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=993

 Score =   287 bits (735),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 160/297 (54%), Positives = 205/297 (69%), Gaps = 12/297 (4%)
 Frame = +1

Query  328   SEMYAVQ-NGKNRGLEKPIPGCLGRMVNLFDLNGGVAGNRLLTDKPHRDGS-LSRSQSDV  501
             S+M  +  NGK RG EKP+PGCLGRMVNLFDL+  ++GNRLL+DKP+ DGS LSRS+SDV
Sbjct  11    SQMNGIHLNGKTRGSEKPVPGCLGRMVNLFDLS--ISGNRLLSDKPYNDGSSLSRSRSDV  68

Query  502   ARMSP-SEDQIEDKEIVSELRRNNSKMKANGTPMKMLIAEEMSKDMASKHNPPSVVAKLM  678
             +RMS  + D++EDK +VSELRR++S  K NGTP+KML+A+EMSKD+ SK  PP+VVAKLM
Sbjct  69    SRMSSIAVDEMEDKVMVSELRRSSSNRKPNGTPVKMLMAQEMSKDLESKQRPPNVVAKLM  128

Query  679   GLDGFPSQL-PVSTAQRNYS---GRNAQSAKGTPLNNFHHRSGSLDTQMECEFYQYPEQN  846
             GLD  P Q  P   AQR  S    RN  S    P+  +         Q++ E + + +QN
Sbjct  129   GLDVIPQQQQPDFAAQRIQSRVYSRNCHSE--IPIGYWQQEQDFFSKQIDSEVHPHQDQN  186

Query  847   ECKDVYEVWQNRHDMNSMRSKSPQMGRCNETSTDK-VAFVRQKFIEAKCLSLDEKCHHSR  1023
             E KD+YE+WQ     N  R  SPQ GR NE   +K +A +RQKF+EAK L+ DEK   ++
Sbjct  187   EYKDIYEIWQQSQRTNCRRDNSPQKGRFNENMNEKKLALIRQKFMEAKRLATDEKLRQTK  246

Query  1024  QFQDALEVLSSNTDLVLKFLQEPKPMLSEHIYNLQSIPAPSETKRITVLKPSKMVDN  1194
             +FQDAL+VLSSN DL LK LQEP  + S+ IY   S+    ETKRITVL+PSK+V +
Sbjct  247   EFQDALDVLSSNGDLFLKVLQEPNSLFSQQIYVGDSVSPSPETKRITVLRPSKVVSD  303



>ref|XP_010684824.1| PREDICTED: uncharacterized protein LOC104899346 isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=981

 Score =   287 bits (735),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 158/289 (55%), Positives = 201/289 (70%), Gaps = 11/289 (4%)
 Frame = +1

Query  349   NGKNRGLEKPIPGCLGRMVNLFDLNGGVAGNRLLTDKPHRDGS-LSRSQSDVARMSP-SE  522
             NGK RG EKP+PGCLGRMVNLFDL+  ++GNRLL+DKP+ DGS LSRS+SDV+RMS  + 
Sbjct  7     NGKTRGSEKPVPGCLGRMVNLFDLS--ISGNRLLSDKPYNDGSSLSRSRSDVSRMSSIAV  64

Query  523   DQIEDKEIVSELRRNNSKMKANGTPMKMLIAEEMSKDMASKHNPPSVVAKLMGLDGFPSQ  702
             D++EDK +VSELRR++S  K NGTP+KML+A+EMSKD+ SK  PP+VVAKLMGLD  P Q
Sbjct  65    DEMEDKVMVSELRRSSSNRKPNGTPVKMLMAQEMSKDLESKQRPPNVVAKLMGLDVIPQQ  124

Query  703   L-PVSTAQRNYS---GRNAQSAKGTPLNNFHHRSGSLDTQMECEFYQYPEQNECKDVYEV  870
               P   AQR  S    RN  S    P+  +         Q++ E + + +QNE KD+YE+
Sbjct  125   QQPDFAAQRIQSRVYSRNCHSE--IPIGYWQQEQDFFSKQIDSEVHPHQDQNEYKDIYEI  182

Query  871   WQNRHDMNSMRSKSPQMGRCNETSTDK-VAFVRQKFIEAKCLSLDEKCHHSRQFQDALEV  1047
             WQ     N  R  SPQ GR NE   +K +A +RQKF+EAK L+ DEK   +++FQDAL+V
Sbjct  183   WQQSQRTNCRRDNSPQKGRFNENMNEKKLALIRQKFMEAKRLATDEKLRQTKEFQDALDV  242

Query  1048  LSSNTDLVLKFLQEPKPMLSEHIYNLQSIPAPSETKRITVLKPSKMVDN  1194
             LSSN DL LK LQEP  + S+ IY   S+    ETKRITVL+PSK+V +
Sbjct  243   LSSNGDLFLKVLQEPNSLFSQQIYVGDSVSPSPETKRITVLRPSKVVSD  291



>gb|KJB10997.1| hypothetical protein B456_001G235600 [Gossypium raimondii]
Length=999

 Score =   284 bits (727),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 165/295 (56%), Positives = 201/295 (68%), Gaps = 9/295 (3%)
 Frame = +1

Query  331   EMYAVQNGKNRGLEKPIPGCLGRMVNLFDLNGGVAGNRLLTDKPHRDGS-LSRSQSDVAR  507
             EM  +Q+ K   +EK  PGCLGRMVNLFDLN GV GNRLLTDKPHRDGS LSRSQSDV R
Sbjct  11    EMNGIQHKKGHNIEK-FPGCLGRMVNLFDLNSGVPGNRLLTDKPHRDGSSLSRSQSDVVR  69

Query  508   M-SPS-EDQIEDKEIVSELRRNNSKMKANGTPMKMLIAEEMSKDMASKHNPPSVVAKLMG  681
             M SP+  DQIEDK IVSELR  ++K K N TPMKML+A+EMSKD+ SK NPP+VVAKLMG
Sbjct  70    MPSPTFGDQIEDKVIVSELRTFSNK-KGNVTPMKMLLAQEMSKDVESKCNPPNVVAKLMG  128

Query  682   LDGFPSQLPVSTAQR---NYSGRNAQSAKGTPLNNFHHRSGSLDTQMECEFYQYPEQNEC  852
             LD  P +   S+AQR     S R++      P+ ++       D QM+CE       N+ 
Sbjct  129   LDALPRRQHNSSAQRCRFKGSSRHSSCHSEIPVESWEQDQSFPDEQMQCEVSPCEVLNKY  188

Query  853   KDVYEVWQNRHDMNSMRSKSPQMGRCNETSTD-KVAFVRQKFIEAKCLSLDEKCHHSRQF  1029
             KDVYE+WQ        R  SP+ GR ++ + + K+A VRQKF+EAK L  DEK   S++F
Sbjct  189   KDVYEIWQQSPRTTYSRDSSPKKGRYSDNANENKMALVRQKFMEAKHLVTDEKLRQSKEF  248

Query  1030  QDALEVLSSNTDLVLKFLQEPKPMLSEHIYNLQSIPAPSETKRITVLKPSKMVDN  1194
             QDALEVLSSN +L LKFL+EP    S+H+ N +      +TKRITVL+PSKMVDN
Sbjct  249   QDALEVLSSNRELFLKFLEEPNSTFSQHLNNFRCSSLLPQTKRITVLRPSKMVDN  303



>gb|KJB10996.1| hypothetical protein B456_001G235600 [Gossypium raimondii]
Length=962

 Score =   282 bits (722),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 164/294 (56%), Positives = 200/294 (68%), Gaps = 9/294 (3%)
 Frame = +1

Query  334   MYAVQNGKNRGLEKPIPGCLGRMVNLFDLNGGVAGNRLLTDKPHRDGS-LSRSQSDVARM  510
             M  +Q+ K   +EK  PGCLGRMVNLFDLN GV GNRLLTDKPHRDGS LSRSQSDV RM
Sbjct  1     MNGIQHKKGHNIEK-FPGCLGRMVNLFDLNSGVPGNRLLTDKPHRDGSSLSRSQSDVVRM  59

Query  511   -SPS-EDQIEDKEIVSELRRNNSKMKANGTPMKMLIAEEMSKDMASKHNPPSVVAKLMGL  684
              SP+  DQIEDK IVSELR  ++K K N TPMKML+A+EMSKD+ SK NPP+VVAKLMGL
Sbjct  60    PSPTFGDQIEDKVIVSELRTFSNK-KGNVTPMKMLLAQEMSKDVESKCNPPNVVAKLMGL  118

Query  685   DGFPSQLPVSTAQR---NYSGRNAQSAKGTPLNNFHHRSGSLDTQMECEFYQYPEQNECK  855
             D  P +   S+AQR     S R++      P+ ++       D QM+CE       N+ K
Sbjct  119   DALPRRQHNSSAQRCRFKGSSRHSSCHSEIPVESWEQDQSFPDEQMQCEVSPCEVLNKYK  178

Query  856   DVYEVWQNRHDMNSMRSKSPQMGRCNETSTD-KVAFVRQKFIEAKCLSLDEKCHHSRQFQ  1032
             DVYE+WQ        R  SP+ GR ++ + + K+A VRQKF+EAK L  DEK   S++FQ
Sbjct  179   DVYEIWQQSPRTTYSRDSSPKKGRYSDNANENKMALVRQKFMEAKHLVTDEKLRQSKEFQ  238

Query  1033  DALEVLSSNTDLVLKFLQEPKPMLSEHIYNLQSIPAPSETKRITVLKPSKMVDN  1194
             DALEVLSSN +L LKFL+EP    S+H+ N +      +TKRITVL+PSKMVDN
Sbjct  239   DALEVLSSNRELFLKFLEEPNSTFSQHLNNFRCSSLLPQTKRITVLRPSKMVDN  292



>gb|KJB10995.1| hypothetical protein B456_001G235600 [Gossypium raimondii]
 gb|KJB10998.1| hypothetical protein B456_001G235600 [Gossypium raimondii]
Length=988

 Score =   283 bits (723),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 164/294 (56%), Positives = 200/294 (68%), Gaps = 9/294 (3%)
 Frame = +1

Query  334   MYAVQNGKNRGLEKPIPGCLGRMVNLFDLNGGVAGNRLLTDKPHRDGS-LSRSQSDVARM  510
             M  +Q+ K   +EK  PGCLGRMVNLFDLN GV GNRLLTDKPHRDGS LSRSQSDV RM
Sbjct  1     MNGIQHKKGHNIEK-FPGCLGRMVNLFDLNSGVPGNRLLTDKPHRDGSSLSRSQSDVVRM  59

Query  511   -SPS-EDQIEDKEIVSELRRNNSKMKANGTPMKMLIAEEMSKDMASKHNPPSVVAKLMGL  684
              SP+  DQIEDK IVSELR  ++K K N TPMKML+A+EMSKD+ SK NPP+VVAKLMGL
Sbjct  60    PSPTFGDQIEDKVIVSELRTFSNK-KGNVTPMKMLLAQEMSKDVESKCNPPNVVAKLMGL  118

Query  685   DGFPSQLPVSTAQR---NYSGRNAQSAKGTPLNNFHHRSGSLDTQMECEFYQYPEQNECK  855
             D  P +   S+AQR     S R++      P+ ++       D QM+CE       N+ K
Sbjct  119   DALPRRQHNSSAQRCRFKGSSRHSSCHSEIPVESWEQDQSFPDEQMQCEVSPCEVLNKYK  178

Query  856   DVYEVWQNRHDMNSMRSKSPQMGRCNETSTD-KVAFVRQKFIEAKCLSLDEKCHHSRQFQ  1032
             DVYE+WQ        R  SP+ GR ++ + + K+A VRQKF+EAK L  DEK   S++FQ
Sbjct  179   DVYEIWQQSPRTTYSRDSSPKKGRYSDNANENKMALVRQKFMEAKHLVTDEKLRQSKEFQ  238

Query  1033  DALEVLSSNTDLVLKFLQEPKPMLSEHIYNLQSIPAPSETKRITVLKPSKMVDN  1194
             DALEVLSSN +L LKFL+EP    S+H+ N +      +TKRITVL+PSKMVDN
Sbjct  239   DALEVLSSNRELFLKFLEEPNSTFSQHLNNFRCSSLLPQTKRITVLRPSKMVDN  292



>ref|XP_011080145.1| PREDICTED: uncharacterized protein LOC105163485 [Sesamum indicum]
 ref|XP_011080146.1| PREDICTED: uncharacterized protein LOC105163485 [Sesamum indicum]
Length=957

 Score =   276 bits (707),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 151/284 (53%), Positives = 191/284 (67%), Gaps = 18/284 (6%)
 Frame = +1

Query  346   QNGKNRGLEKPIPGCLGRMVNLFDLNGGVAGNRLLTDKPHRDGSL-SRSQSDVARMSPSE  522
             QN KNR  +K  PGCLGRMVNLF+LN GV+ NRLL DKPHRDGSL SRS+SDV+RMS S 
Sbjct  6     QNDKNRNFKKTYPGCLGRMVNLFELNVGVSTNRLLADKPHRDGSLLSRSRSDVSRMSSSG  65

Query  523   DQIEDKEIVSELRRNNSKMKANGTPMKMLIAEEMSKDMASKHNPPSVVAKLMGLDGFPSQ  702
             DQIE+K    E + +    K+NGTPMKMLIA+EMSK++ S+ +PP++VAKLMGLD  P Q
Sbjct  66    DQIEEKVTAPEFKSSFPNRKSNGTPMKMLIAQEMSKEVDSRRDPPNLVAKLMGLDALPRQ  125

Query  703   LPVSTAQRNYSGRNAQSAKGTPLNNFHHRSGSLDTQMECEFYQYPEQNECKDVYEVWQNR  882
                ST QR++S    +S    P++ +  + G         F+ + E NE +DVYE+WQ  
Sbjct  126   EAESTTQRSHSRGRPRSHSDIPISCWEQQKG---------FFHHVEPNEYRDVYEIWQQS  176

Query  883   HDMNSMRSKSPQMGRCNETSTD-KVAFVRQKFIEAKCLSLDEKCHHSRQFQDALEVLSSN  1059
                     KS    R  ET  D K+  VRQKF+EAK LS+DE+   S+QFQDALEVL+SN
Sbjct  177   Q-------KSQDEERYEETINDNKMDLVRQKFVEAKRLSMDERLRKSKQFQDALEVLNSN  229

Query  1060  TDLVLKFLQEPKPMLSEHIYNLQSIPAPSETKRITVLKPSKMVD  1191
              DL LK LQEP  + S+ +Y+ QS+  P  TKRITVL+PSK+ D
Sbjct  230   KDLFLKCLQEPNSIFSQQLYSQQSVSPPMGTKRITVLRPSKIAD  273



>ref|XP_006604525.1| PREDICTED: uncharacterized protein LOC100816611 isoform X1 [Glycine 
max]
 ref|XP_006604526.1| PREDICTED: uncharacterized protein LOC100816611 isoform X2 [Glycine 
max]
 gb|KHN02438.1| hypothetical protein glysoja_002462 [Glycine soja]
Length=982

 Score =   276 bits (706),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 157/295 (53%), Positives = 204/295 (69%), Gaps = 16/295 (5%)
 Frame = +1

Query  334   MYAVQNGKNRGLEKPIPGCLGRMVNLFDLNGGVAGNRLLTDKPHRDG-SLSRSQSDVAR-  507
             M  VQN +   +EKP PGCLGRMVNLFDL G V GN+LLTD+PHRD  SLSRSQSDVAR 
Sbjct  1     MNGVQNRRVHNVEKPFPGCLGRMVNLFDLTGDVNGNKLLTDRPHRDASSLSRSQSDVARI  60

Query  508   MSPS-EDQIEDKEIVSELRRNNSKMKANGTPMKMLIAEEMSKDMASKHN-PPSVVAKLMG  681
             MSP+  DQIEDK IVS+  R  +K K NGTP+KMLI +EMSK++ SKHN PP+VVAKLMG
Sbjct  61    MSPTLGDQIEDKLIVSDSMRATNK-KINGTPIKMLIDQEMSKEVVSKHNSPPNVVAKLMG  119

Query  682   LDGFPSQLPVSTAQRNYSGRNAQ---SAKGTPLNNFHHRSGSLDTQMECEFYQYPEQNEC  852
             L+ FP   P  + +R++ G  +Q      GTP N++H     +D +M  E +   EQ   
Sbjct  120   LEAFPQGEPNLSVERSHRGDYSQHMCGQSGTPFNHWHLEDRFMDKEMLHEVHPNTEQIAY  179

Query  853   KDVYEVWQNRHDMNSMRSKSPQMGRCNE-TSTDKVAFVRQKFIEAKCLSLDEKCHHSRQF  1029
             KD+YE+W      +++R K+P+  +  E  +  K+A +RQKF+EAK LS DE+   S++F
Sbjct  180   KDIYEIWLQSQRTSNVRDKTPEREKWTEDVNGKKMALIRQKFMEAKRLSTDERLRQSKEF  239

Query  1030  QDALEVLSSNTDLVLKFLQEPKPMLSEHIYNLQSIPAPSETKRITVLKPSKMVDN  1194
             ++ALEVLSSN DL+++ L       S+++Y LQS P  +ETKRITVLKPSKMVDN
Sbjct  240   EEALEVLSSNNDLLVRLLD------SQNLYELQSTPV-AETKRITVLKPSKMVDN  287



>ref|XP_007162644.1| hypothetical protein PHAVU_001G168100g [Phaseolus vulgaris]
 gb|ESW34638.1| hypothetical protein PHAVU_001G168100g [Phaseolus vulgaris]
Length=971

 Score =   275 bits (702),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 157/295 (53%), Positives = 198/295 (67%), Gaps = 15/295 (5%)
 Frame = +1

Query  334   MYAVQNGKNRGLEKPIPGCLGRMVNLFDLNGGVAGNRLLTDKPHRDG-SLSRSQSDVARM  510
             M   QN K   +EKP PGCLGRMVNLFDL GGV GN+LLTD+PHRD  SLSRSQSDVAR+
Sbjct  1     MNGAQNRKVHNIEKPFPGCLGRMVNLFDLTGGVNGNKLLTDRPHRDASSLSRSQSDVARI  60

Query  511   -SPS-EDQIEDKEIVSELRRNNSKMKANGTPMKMLIAEEMSKDMASKHN-PPSVVAKLMG  681
              SP+  DQIEDK IVS+  R  S  K NGTP+KMLI +EMSK++ SKHN PP+VVAKLMG
Sbjct  61    TSPTLGDQIEDKLIVSDSMRALSNKKINGTPIKMLIDQEMSKEVVSKHNPPPNVVAKLMG  120

Query  682   LDGFPSQLPVSTAQRNYSGRNAQ---SAKGTPLNNFHHRSGSLDTQMECEFYQYPEQNEC  852
             L+  P   P  + +RN+ G  +Q      GTP  ++      +D +M  E +   EQ   
Sbjct  121   LEALPRGDPNLSVERNHRGDYSQHMCDHSGTPFKHWQMDDRFMDKEMLHEVHLNTEQIAY  180

Query  853   KDVYEVWQNRHDMNSMRSKSPQMGRCNETSTD-KVAFVRQKFIEAKCLSLDEKCHHSRQF  1029
             KD+YE+W       ++R K+P+  R  E +   K+A +RQKF+EAK LS DE+   S++F
Sbjct  181   KDIYEIWLQSQRTGNVRDKTPERERWTEDANGKKMALIRQKFMEAKRLSTDERLRQSKEF  240

Query  1030  QDALEVLSSNTDLVLKFLQEPKPMLSEHIYNLQSIPAPSETKRITVLKPSKMVDN  1194
              DALEVLSSN DL+++ L       S+++Y LQS P  +ETKRITVLKPSKMVDN
Sbjct  241   DDALEVLSSNNDLLIRLLD------SQNLYELQSTPV-AETKRITVLKPSKMVDN  288



>ref|XP_009770291.1| PREDICTED: uncharacterized protein LOC104221001 isoform X3 [Nicotiana 
sylvestris]
Length=907

 Score =   272 bits (695),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 136/219 (62%), Positives = 172/219 (79%), Gaps = 2/219 (1%)
 Frame = +1

Query  544   IVSELRRNNSKMKANGTPMKMLIAEEMSKDMASKHNPPSVVAKLMGLDGFPSQLPVSTAQ  723
             IVS+L+R +S  K+NGTP+K+LIA+EMSK++ S HNPPSVVAKLMGLD  P+Q  +  A 
Sbjct  2     IVSDLKRTSSNRKSNGTPIKLLIAQEMSKEIDSSHNPPSVVAKLMGLDALPAQKSI-PAI  60

Query  724   RNYSGRNAQSAKGTPLNNFHHRSGSLDTQMECEFYQYPEQNECKDVYEVWQNRHDMNSMR  903
             R++ G +++    +  +   H + SL  +M+ EF+QYPEQNE +DVYEVWQ+   MN +R
Sbjct  61    RSHFGGHSRCHTDSSFSYCQHENESLVEEMQQEFHQYPEQNEYRDVYEVWQHSPKMNCVR  120

Query  904   SKSPQMGRCNETSTDK-VAFVRQKFIEAKCLSLDEKCHHSRQFQDALEVLSSNTDLVLKF  1080
             SKSPQ  R NETS +K  AFVRQKFIEAKCLS+DE+   S++FQDA++VLSSNTDL LKF
Sbjct  121   SKSPQKARHNETSFEKKSAFVRQKFIEAKCLSIDEQLRQSKEFQDAIDVLSSNTDLFLKF  180

Query  1081  LQEPKPMLSEHIYNLQSIPAPSETKRITVLKPSKMVDNC  1197
             LQEP P LS+H+YNLQSIP P ETKRITVL+PSKMVD+C
Sbjct  181   LQEPNPKLSQHLYNLQSIPPPPETKRITVLRPSKMVDDC  219



>gb|KHN09408.1| hypothetical protein glysoja_016507 [Glycine soja]
Length=979

 Score =   271 bits (693),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 155/293 (53%), Positives = 202/293 (69%), Gaps = 14/293 (5%)
 Frame = +1

Query  334   MYAVQNGKNRGLEKPIPGCLGRMVNLFDLNGGVAGNRLLTDKPHRDG-SLSRSQSDVAR-  507
             M  VQN +   +EKP PGCLGR+VNLFDL GGV GN+LLTD+PHRD  SLSRSQSDVAR 
Sbjct  1     MNGVQNRRVHNVEKPFPGCLGRVVNLFDLTGGVNGNKLLTDRPHRDASSLSRSQSDVARI  60

Query  508   MSPS-EDQIEDKEIVSELRRNNSKMKANGTPMKMLIAEEMSKDMASKHN-PPSVVAKLMG  681
             MSP+  DQIEDK IVS+  R  +K K NGTP+KMLI +EMSK++ SKHN PP+VVAKLMG
Sbjct  61    MSPTLGDQIEDKLIVSDSMRATNK-KINGTPIKMLIDQEMSKEVVSKHNSPPNVVAKLMG  119

Query  682   LDGFP-SQLPVSTAQRNYSGRNAQSAKGTPLNNFHHRSGSLDTQMECEFYQYPEQNECKD  858
             L+  P  +L V  + R    ++     GTP N+++     +D +M  E +   EQ   KD
Sbjct  120   LEALPQGELSVERSHRGDYSQHMCGHSGTPFNHWNLEDRFMDKEMLHEVHPNTEQIAYKD  179

Query  859   VYEVWQNRHDMNSMRSKSPQMGRCNE-TSTDKVAFVRQKFIEAKCLSLDEKCHHSRQFQD  1035
             +YE+W      +++R K+P+  +  E  +  K+A +RQKF+EAK LS DE+   S++F+D
Sbjct  180   IYEIWLQSQRTSNVRDKTPEREKWTEDVNGKKMALIRQKFMEAKRLSTDERLRQSKEFED  239

Query  1036  ALEVLSSNTDLVLKFLQEPKPMLSEHIYNLQSIPAPSETKRITVLKPSKMVDN  1194
             ALEVLSSN DL+++ L       S+++Y LQS P  +ETKRITVLKPSKMVDN
Sbjct  240   ALEVLSSNNDLLVRLLD------SQNLYELQSTPV-AETKRITVLKPSKMVDN  285



>ref|XP_006576977.1| PREDICTED: uncharacterized protein LOC100793360 [Glycine max]
Length=979

 Score =   271 bits (693),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 155/293 (53%), Positives = 202/293 (69%), Gaps = 14/293 (5%)
 Frame = +1

Query  334   MYAVQNGKNRGLEKPIPGCLGRMVNLFDLNGGVAGNRLLTDKPHRDG-SLSRSQSDVAR-  507
             M  VQN +   +EKP PGCLGR+VNLFDL GGV GN+LLTD+PHRD  SLSRSQSDVAR 
Sbjct  1     MNGVQNRRVHNVEKPFPGCLGRVVNLFDLTGGVNGNKLLTDRPHRDASSLSRSQSDVARI  60

Query  508   MSPS-EDQIEDKEIVSELRRNNSKMKANGTPMKMLIAEEMSKDMASKHN-PPSVVAKLMG  681
             MSP+  DQIEDK IVS+  R  +K K NGTP+KMLI +EMSK++ SKHN PP+VVAKLMG
Sbjct  61    MSPTLGDQIEDKLIVSDSMRATNK-KINGTPIKMLIDQEMSKEVVSKHNPPPNVVAKLMG  119

Query  682   LDGFP-SQLPVSTAQRNYSGRNAQSAKGTPLNNFHHRSGSLDTQMECEFYQYPEQNECKD  858
             L+  P  +L V  + R    ++     GTP N+++     +D +M  E +   EQ   KD
Sbjct  120   LEALPQGELSVERSHRGDYSQHMCGHSGTPFNHWNLEDRFMDKEMLHEVHPNTEQIAYKD  179

Query  859   VYEVWQNRHDMNSMRSKSPQMGRCNE-TSTDKVAFVRQKFIEAKCLSLDEKCHHSRQFQD  1035
             +YE+W      +++R K+P+  +  E  +  K+A +RQKF+EAK LS DE+   S++F+D
Sbjct  180   IYEIWLQSQRTSNVRDKTPEREKWTEDVNGKKMALIRQKFMEAKRLSTDERLRQSKEFED  239

Query  1036  ALEVLSSNTDLVLKFLQEPKPMLSEHIYNLQSIPAPSETKRITVLKPSKMVDN  1194
             ALEVLSSN DL+++ L       S+++Y LQS P  +ETKRITVLKPSKMVDN
Sbjct  240   ALEVLSSNNDLLVRLLD------SQNLYELQSTPV-AETKRITVLKPSKMVDN  285



>ref|XP_011083092.1| PREDICTED: uncharacterized protein LOC105165697 [Sesamum indicum]
Length=958

 Score =   265 bits (678),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 154/285 (54%), Positives = 188/285 (66%), Gaps = 21/285 (7%)
 Frame = +1

Query  346   QNGKNRGLEKPIPGCLGRMVNLFDLNGGVAGNRLLTDKPHRDGS--LSRSQSDVARMSPS  519
             +NGKN   +K  PGCLGRMVNLF+LN GV  N+LLTDKP  DGS          +  SPS
Sbjct  6     RNGKNCNFDKTYPGCLGRMVNLFELNIGVPANKLLTDKPRSDGSPVSRSRSDVSSLSSPS  65

Query  520   EDQIEDKEIVSELRRNNSKMKANGTPMKMLIAEEMSKDMASKHNPPSVVAKLMGLDGFPS  699
              DQIEDK IVSE R  +S  K+N TPMKMLIA+EMSK++ S+ +PP++VAKLMGLD FP 
Sbjct  66    VDQIEDKVIVSEFRNTSSNRKSNVTPMKMLIAQEMSKEVDSRRSPPNLVAKLMGLDAFPQ  125

Query  700   QLPVSTAQR-NYSGRNAQSAKGTPLNNFHHRSGSLDTQMECEFYQYPEQNECKDVYEVWQ  876
             Q P S  QR N+ G +   ++  P +N+  ++G         F+ Y E NE KDVYE+WQ
Sbjct  126   QEPDSGMQRSNFKGHHGFHSE-IPTSNWEQKNG---------FFHYVEPNEYKDVYEIWQ  175

Query  877   NRHDMNSMRSKSPQMGRCNETSTD-KVAFVRQKFIEAKCLSLDEKCHHSRQFQDALEVLS  1053
                       K    GR +ET+ D K+A VRQKF EAK LS+DEK   S+QFQDALEVL+
Sbjct  176   RSQ-------KFTHKGRYDETAHDEKMALVRQKFFEAKRLSMDEKLRQSKQFQDALEVLN  228

Query  1054  SNTDLVLKFLQEPKPMLSEHIYNLQSIPAPSETKRITVLKPSKMV  1188
             SN DL LK LQEP  + S+ ++NLQSIP P E KRITVLKPSK  
Sbjct  229   SNKDLFLKCLQEPTSVFSQQLHNLQSIPPPPEAKRITVLKPSKTT  273



>gb|KJB26066.1| hypothetical protein B456_004G223300 [Gossypium raimondii]
Length=716

 Score =   260 bits (664),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 155/296 (52%), Positives = 192/296 (65%), Gaps = 13/296 (4%)
 Frame = +1

Query  331   EMYAVQNGKNRGLEKPIPGCLGRMVNLFDLNGGVAGNRLLTDKPHRDGSLSRSQSDVAR-  507
             EM   ++ + + +EK  PGCLGRMVNLFDLN  V GNRLLTDK H   SLSRSQSDVAR 
Sbjct  10    EMNGFESRRGQNIEK-FPGCLGRMVNLFDLNTNVPGNRLLTDKQHDGSSLSRSQSDVART  68

Query  508   MSPS----EDQIEDKEIVSELRRNNSKMKANGTPMKMLIAEEMSKDMASKHNPPSVVAKL  675
             + P+      QIEDK I+SELRR  S  K N TP+KML+A+EMSK+MAS+HNPP+VVAKL
Sbjct  69    LRPTFGDQNHQIEDKVIISELRRAFSNKKGNKTPIKMLMAQEMSKEMASRHNPPNVVAKL  128

Query  676   MGLDGFPSQLPVSTAQRNYSGRNAQSAKGTP---LNNFHHRSGSLDTQMECEFYQYPEQN  846
             MGLD  P Q    +AQR +S  +++ +          +    G  D +M  E     E +
Sbjct  129   MGLDALPRQQHNLSAQRCHSKGSSRQSSSHSHILAEGWEQDQGFADKEMLSEVNPCQELD  188

Query  847   ECKDVYEVWQNRHDMNSMRSKSPQMGRCNETSTD-KVAFVRQKFIEAKCLSLDEKCHHSR  1023
             + KDVYE+WQ        R  SPQ GR  +   + K+A VRQKF+EAK L  DEK   ++
Sbjct  189   KYKDVYEIWQQSPRATYSRDSSPQKGRYKDNVNEKKMALVRQKFMEAKHLVTDEKLRQTK  248

Query  1024  QFQDALEVLSSNTDLVLKFLQEPKPMLSEHIYNLQSIPAPSETKRITVLKPSKMVD  1191
             +FQDALEVLSSN +L LKFL+EP    S+H  + QS+P P E KRITVLKP KMVD
Sbjct  249   EFQDALEVLSSNRELFLKFLEEPNSNFSQH--DFQSLPQPPEKKRITVLKP-KMVD  301



>gb|EYU46370.1| hypothetical protein MIMGU_mgv1a000965mg [Erythranthe guttata]
Length=929

 Score =   261 bits (668),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 154/286 (54%), Positives = 190/286 (66%), Gaps = 20/286 (7%)
 Frame = +1

Query  346   QNGKNRGLEKPIPGCLGRMVNLFDLNGGVAGNRLLTDKPHRDGS-LSRSQSDVARMSPSE  522
              NGKN  LEK   GCLGRMVNLF+LN  +  NRLL DKPH DGS LSRS+SDV+RMS S 
Sbjct  6     HNGKNSNLEKKYAGCLGRMVNLFELNTEMPANRLLQDKPHADGSSLSRSRSDVSRMSLSG  65

Query  523   DQIEDKEIVSELRRNNSKMKANGTPMKMLIAEEMSKDMASKHNPPSVVAKLMGLDGFPSQ  702
             D  E+K  VSE + ++S  K+NGTPMKMLIA+EMSK++ S+ +PP++VAKLMGLD  P Q
Sbjct  66    DSAEEKVTVSEFKSSSSNRKSNGTPMKMLIAQEMSKEIESRRDPPNLVAKLMGLDALPRQ  125

Query  703   LPVSTAQRNYSGRNAQSAKGTPLNNFHHRSGSLDTQMECEFYQYPEQNECKDVYEVWQNR  882
              P S  QR +S  + +S    PL+ +  ++G         F+ Y +  E KDV       
Sbjct  126   EPDSAIQRRHSRGHPRSHSEIPLSYWEQQNG---------FFHYVDPKEYKDV-------  169

Query  883   HDMNSMRS-KSPQMGRCNETSTDK-VAFVRQKFIEAKCLSLDEKCHHSRQFQDALEVLSS  1056
              D N  +S K P  G   ET  DK +A VRQKFIEAK LS+DEK   S+QF DALEVLSS
Sbjct  170   -DGNLQQSQKPPHKGIYEETVIDKKMALVRQKFIEAKRLSMDEKLRQSKQFHDALEVLSS  228

Query  1057  NTDLVLKFLQEPKPMLSEHIYNLQSIPAPSETKRITVLKPSKMVDN  1194
             N DL L+ LQEP    SEH+Y  +S+P P ET+RITVL+PSKM D+
Sbjct  229   NKDLFLECLQEPDSFFSEHLYGRESVPPPRETRRITVLRPSKMADD  274



>ref|XP_010263991.1| PREDICTED: uncharacterized protein LOC104602116 isoform X3 [Nelumbo 
nucifera]
Length=993

 Score =   261 bits (667),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 151/292 (52%), Positives = 190/292 (65%), Gaps = 12/292 (4%)
 Frame = +1

Query  334   MYAVQNGKNRGLEKPIPGCLGRMVNLFDLNGGVAGNRLLTDKPHRDGS-LSRSQSDVARM  510
             M  +QN + R L+KP PGC+GRMVN FDL+ G+ GN+LLT+K HRDG  L RS+S+  + 
Sbjct  3     MNGMQNRRARDLDKPFPGCMGRMVNFFDLSAGIPGNKLLTEKAHRDGYFLPRSRSE--KS  60

Query  511   SPSEDQIEDKEIVSELRRNNSKMKANGTPMKMLIAEEMSKDMASKHNPPSVVAKLMGLDG  690
              P  DQ+ED  I  EL R +S  K+ GTPMKMLIA+EMSK+  SK  PP VVAKLMGLD 
Sbjct  61    DPIRDQMEDNLIGYELSRTSSSKKSRGTPMKMLIAQEMSKETESKEKPPGVVAKLMGLDA  120

Query  691   FPSQLPVSTAQRNYSGR---NAQSAKGTPLNNFHHRSGSLDTQMECEFYQYPEQNECKDV  861
              P   P ST +R+ +     N+ +  GT L   H      + Q++ E     EQ E KDV
Sbjct  121   LPGNHPDSTVERSRAKGYLPNSFTQPGTMLKYQHQ-----ERQIQHETRLVQEQKEYKDV  175

Query  862   YEVWQNRHDMNSMRSKSPQMGRCNETSTDK-VAFVRQKFIEAKCLSLDEKCHHSRQFQDA  1038
             YEVWQ      +   KSPQ GR NE   +K +  VRQKFIEAK L+ DE    S++FQDA
Sbjct  176   YEVWQQSPKGKNTMDKSPQKGRYNENLNEKKMDLVRQKFIEAKRLATDENLRQSKEFQDA  235

Query  1039  LEVLSSNTDLVLKFLQEPKPMLSEHIYNLQSIPAPSETKRITVLKPSKMVDN  1194
             LEVLS+N +L LKFLQEP  + ++ +  LQSIP P ETKRITVL+PSK ++N
Sbjct  236   LEVLSANKELFLKFLQEPNSLFAQRLCELQSIPPPPETKRITVLRPSKTLEN  287



>ref|XP_010263990.1| PREDICTED: uncharacterized protein LOC104602116 isoform X2 [Nelumbo 
nucifera]
Length=1013

 Score =   261 bits (666),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 151/292 (52%), Positives = 190/292 (65%), Gaps = 12/292 (4%)
 Frame = +1

Query  334   MYAVQNGKNRGLEKPIPGCLGRMVNLFDLNGGVAGNRLLTDKPHRDGS-LSRSQSDVARM  510
             M  +QN + R L+KP PGC+GRMVN FDL+ G+ GN+LLT+K HRDG  L RS+S+  + 
Sbjct  23    MNGMQNRRARDLDKPFPGCMGRMVNFFDLSAGIPGNKLLTEKAHRDGYFLPRSRSE--KS  80

Query  511   SPSEDQIEDKEIVSELRRNNSKMKANGTPMKMLIAEEMSKDMASKHNPPSVVAKLMGLDG  690
              P  DQ+ED  I  EL R +S  K+ GTPMKMLIA+EMSK+  SK  PP VVAKLMGLD 
Sbjct  81    DPIRDQMEDNLIGYELSRTSSSKKSRGTPMKMLIAQEMSKETESKEKPPGVVAKLMGLDA  140

Query  691   FPSQLPVSTAQRNYSGR---NAQSAKGTPLNNFHHRSGSLDTQMECEFYQYPEQNECKDV  861
              P   P ST +R+ +     N+ +  GT L   H      + Q++ E     EQ E KDV
Sbjct  141   LPGNHPDSTVERSRAKGYLPNSFTQPGTMLKYQHQ-----ERQIQHETRLVQEQKEYKDV  195

Query  862   YEVWQNRHDMNSMRSKSPQMGRCNETSTDK-VAFVRQKFIEAKCLSLDEKCHHSRQFQDA  1038
             YEVWQ      +   KSPQ GR NE   +K +  VRQKFIEAK L+ DE    S++FQDA
Sbjct  196   YEVWQQSPKGKNTMDKSPQKGRYNENLNEKKMDLVRQKFIEAKRLATDENLRQSKEFQDA  255

Query  1039  LEVLSSNTDLVLKFLQEPKPMLSEHIYNLQSIPAPSETKRITVLKPSKMVDN  1194
             LEVLS+N +L LKFLQEP  + ++ +  LQSIP P ETKRITVL+PSK ++N
Sbjct  256   LEVLSANKELFLKFLQEPNSLFAQRLCELQSIPPPPETKRITVLRPSKTLEN  307



>ref|XP_010263989.1| PREDICTED: uncharacterized protein LOC104602116 isoform X1 [Nelumbo 
nucifera]
Length=1017

 Score =   261 bits (666),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 151/292 (52%), Positives = 190/292 (65%), Gaps = 12/292 (4%)
 Frame = +1

Query  334   MYAVQNGKNRGLEKPIPGCLGRMVNLFDLNGGVAGNRLLTDKPHRDGS-LSRSQSDVARM  510
             M  +QN + R L+KP PGC+GRMVN FDL+ G+ GN+LLT+K HRDG  L RS+S+  + 
Sbjct  27    MNGMQNRRARDLDKPFPGCMGRMVNFFDLSAGIPGNKLLTEKAHRDGYFLPRSRSE--KS  84

Query  511   SPSEDQIEDKEIVSELRRNNSKMKANGTPMKMLIAEEMSKDMASKHNPPSVVAKLMGLDG  690
              P  DQ+ED  I  EL R +S  K+ GTPMKMLIA+EMSK+  SK  PP VVAKLMGLD 
Sbjct  85    DPIRDQMEDNLIGYELSRTSSSKKSRGTPMKMLIAQEMSKETESKEKPPGVVAKLMGLDA  144

Query  691   FPSQLPVSTAQRNYSGR---NAQSAKGTPLNNFHHRSGSLDTQMECEFYQYPEQNECKDV  861
              P   P ST +R+ +     N+ +  GT L   H      + Q++ E     EQ E KDV
Sbjct  145   LPGNHPDSTVERSRAKGYLPNSFTQPGTMLKYQHQ-----ERQIQHETRLVQEQKEYKDV  199

Query  862   YEVWQNRHDMNSMRSKSPQMGRCNETSTDK-VAFVRQKFIEAKCLSLDEKCHHSRQFQDA  1038
             YEVWQ      +   KSPQ GR NE   +K +  VRQKFIEAK L+ DE    S++FQDA
Sbjct  200   YEVWQQSPKGKNTMDKSPQKGRYNENLNEKKMDLVRQKFIEAKRLATDENLRQSKEFQDA  259

Query  1039  LEVLSSNTDLVLKFLQEPKPMLSEHIYNLQSIPAPSETKRITVLKPSKMVDN  1194
             LEVLS+N +L LKFLQEP  + ++ +  LQSIP P ETKRITVL+PSK ++N
Sbjct  260   LEVLSANKELFLKFLQEPNSLFAQRLCELQSIPPPPETKRITVLRPSKTLEN  311



>gb|KJB26068.1| hypothetical protein B456_004G223300 [Gossypium raimondii]
Length=998

 Score =   260 bits (665),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 156/301 (52%), Positives = 194/301 (64%), Gaps = 13/301 (4%)
 Frame = +1

Query  316   LLRHSEMYAVQNGKNRGLEKPIPGCLGRMVNLFDLNGGVAGNRLLTDKPHRDGSLSRSQS  495
             +L   EM   ++ + + +EK  PGCLGRMVNLFDLN  V GNRLLTDK H   SLSRSQS
Sbjct  1     MLTGVEMNGFESRRGQNIEK-FPGCLGRMVNLFDLNTNVPGNRLLTDKQHDGSSLSRSQS  59

Query  496   DVAR-MSPS----EDQIEDKEIVSELRRNNSKMKANGTPMKMLIAEEMSKDMASKHNPPS  660
             DVAR + P+      QIEDK I+SELRR  S  K N TP+KML+A+EMSK+MAS+HNPP+
Sbjct  60    DVARTLRPTFGDQNHQIEDKVIISELRRAFSNKKGNKTPIKMLMAQEMSKEMASRHNPPN  119

Query  661   VVAKLMGLDGFPSQLPVSTAQRNYSGRNAQSAKGTP---LNNFHHRSGSLDTQMECEFYQ  831
             VVAKLMGLD  P Q    +AQR +S  +++ +          +    G  D +M  E   
Sbjct  120   VVAKLMGLDALPRQQHNLSAQRCHSKGSSRQSSSHSHILAEGWEQDQGFADKEMLSEVNP  179

Query  832   YPEQNECKDVYEVWQNRHDMNSMRSKSPQMGRCNETSTD-KVAFVRQKFIEAKCLSLDEK  1008
               E ++ KDVYE+WQ        R  SPQ GR  +   + K+A VRQKF+EAK L  DEK
Sbjct  180   CQELDKYKDVYEIWQQSPRATYSRDSSPQKGRYKDNVNEKKMALVRQKFMEAKHLVTDEK  239

Query  1009  CHHSRQFQDALEVLSSNTDLVLKFLQEPKPMLSEHIYNLQSIPAPSETKRITVLKPSKMV  1188
                +++FQDALEVLSSN +L LKFL+EP    S+H  + QS+P P E KRITVLKP KMV
Sbjct  240   LRQTKEFQDALEVLSSNRELFLKFLEEPNSNFSQH--DFQSLPQPPEKKRITVLKP-KMV  296

Query  1189  D  1191
             D
Sbjct  297   D  297



>gb|KJB26065.1| hypothetical protein B456_004G223300 [Gossypium raimondii]
Length=1002

 Score =   259 bits (662),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 155/296 (52%), Positives = 192/296 (65%), Gaps = 13/296 (4%)
 Frame = +1

Query  331   EMYAVQNGKNRGLEKPIPGCLGRMVNLFDLNGGVAGNRLLTDKPHRDGSLSRSQSDVAR-  507
             EM   ++ + + +EK  PGCLGRMVNLFDLN  V GNRLLTDK H   SLSRSQSDVAR 
Sbjct  10    EMNGFESRRGQNIEK-FPGCLGRMVNLFDLNTNVPGNRLLTDKQHDGSSLSRSQSDVART  68

Query  508   MSPS----EDQIEDKEIVSELRRNNSKMKANGTPMKMLIAEEMSKDMASKHNPPSVVAKL  675
             + P+      QIEDK I+SELRR  S  K N TP+KML+A+EMSK+MAS+HNPP+VVAKL
Sbjct  69    LRPTFGDQNHQIEDKVIISELRRAFSNKKGNKTPIKMLMAQEMSKEMASRHNPPNVVAKL  128

Query  676   MGLDGFPSQLPVSTAQRNYSGRNAQSAKGTP---LNNFHHRSGSLDTQMECEFYQYPEQN  846
             MGLD  P Q    +AQR +S  +++ +          +    G  D +M  E     E +
Sbjct  129   MGLDALPRQQHNLSAQRCHSKGSSRQSSSHSHILAEGWEQDQGFADKEMLSEVNPCQELD  188

Query  847   ECKDVYEVWQNRHDMNSMRSKSPQMGRCNETSTD-KVAFVRQKFIEAKCLSLDEKCHHSR  1023
             + KDVYE+WQ        R  SPQ GR  +   + K+A VRQKF+EAK L  DEK   ++
Sbjct  189   KYKDVYEIWQQSPRATYSRDSSPQKGRYKDNVNEKKMALVRQKFMEAKHLVTDEKLRQTK  248

Query  1024  QFQDALEVLSSNTDLVLKFLQEPKPMLSEHIYNLQSIPAPSETKRITVLKPSKMVD  1191
             +FQDALEVLSSN +L LKFL+EP    S+H  + QS+P P E KRITVLKP KMVD
Sbjct  249   EFQDALEVLSSNRELFLKFLEEPNSNFSQH--DFQSLPQPPEKKRITVLKP-KMVD  301



>gb|KHG04276.1| Methyl-coenzyme M reductase II subunit gamma [Gossypium arboreum]
Length=1005

 Score =   259 bits (661),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 158/302 (52%), Positives = 197/302 (65%), Gaps = 24/302 (8%)
 Frame = +1

Query  331   EMYAVQNGKNRGLEKPIPGCLGRMVNLFDLNGGVAGNRLLTDKPHRDGS-LSRSQSDVAR  507
             EM   ++ + + +EK  PGCLGRMVNLFDLN  V GNRLL  K  +DGS LSRSQSDVAR
Sbjct  10    EMNGFESRRGQNIEK-FPGCLGRMVNLFDLNTNVTGNRLL--KIKQDGSSLSRSQSDVAR  66

Query  508   -MSPS----EDQIEDKEIVSELRRNNSKMKANGTPMKMLIAEEMSKDMASKHNPPSVVAK  672
              + P+      QIEDK I+SELRR  S  K N TP+KML+A+EMSK+MAS+HNPP+VVAK
Sbjct  67    TLRPTFGDQNHQIEDKVIISELRRAFSNKKGNKTPIKMLMAQEMSKEMASRHNPPNVVAK  126

Query  673   LMGLDGFPSQLPVSTAQRNYSGRNAQ--------SAKGTPLNNFHHRSGSLDTQMECEFY  828
             LMGLD  P Q    +AQR +S  +++        SA+G     +    G  D +M  E  
Sbjct  127   LMGLDALPRQQHNLSAQRCHSKGSSRQSSSHSDISAEG-----WEQDQGFADKEMLSEVN  181

Query  829   QYPEQNECKDVYEVWQNRHDMNSMRSKSPQMGRCNETSTDK-VAFVRQKFIEAKCLSLDE  1005
                E ++ KDVYE+WQ        R  SPQ GR  +   +K +A VRQKF+EAK L  DE
Sbjct  182   PCQELDKYKDVYEIWQQSPRATYSRDSSPQKGRYKDNVNEKKMALVRQKFMEAKHLVTDE  241

Query  1006  KCHHSRQFQDALEVLSSNTDLVLKFLQEPKPMLSEHIYNLQSIPAPSETKRITVLKPSKM  1185
             K   +++FQDALEVLSSN +L LKFL+EP    S+H+Y+ QS+P P E KRITVLKP KM
Sbjct  242   KLRQTKEFQDALEVLSSNRELFLKFLEEPNSNFSQHLYDFQSLPQPPEKKRITVLKP-KM  300

Query  1186  VD  1191
             VD
Sbjct  301   VD  302



>gb|KJB26067.1| hypothetical protein B456_004G223300 [Gossypium raimondii]
Length=992

 Score =   258 bits (658),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 154/295 (52%), Positives = 191/295 (65%), Gaps = 13/295 (4%)
 Frame = +1

Query  334   MYAVQNGKNRGLEKPIPGCLGRMVNLFDLNGGVAGNRLLTDKPHRDGSLSRSQSDVAR-M  510
             M   ++ + + +EK  PGCLGRMVNLFDLN  V GNRLLTDK H   SLSRSQSDVAR +
Sbjct  1     MNGFESRRGQNIEK-FPGCLGRMVNLFDLNTNVPGNRLLTDKQHDGSSLSRSQSDVARTL  59

Query  511   SPS----EDQIEDKEIVSELRRNNSKMKANGTPMKMLIAEEMSKDMASKHNPPSVVAKLM  678
              P+      QIEDK I+SELRR  S  K N TP+KML+A+EMSK+MAS+HNPP+VVAKLM
Sbjct  60    RPTFGDQNHQIEDKVIISELRRAFSNKKGNKTPIKMLMAQEMSKEMASRHNPPNVVAKLM  119

Query  679   GLDGFPSQLPVSTAQRNYSGRNAQSAKGTP---LNNFHHRSGSLDTQMECEFYQYPEQNE  849
             GLD  P Q    +AQR +S  +++ +          +    G  D +M  E     E ++
Sbjct  120   GLDALPRQQHNLSAQRCHSKGSSRQSSSHSHILAEGWEQDQGFADKEMLSEVNPCQELDK  179

Query  850   CKDVYEVWQNRHDMNSMRSKSPQMGRCNETSTD-KVAFVRQKFIEAKCLSLDEKCHHSRQ  1026
              KDVYE+WQ        R  SPQ GR  +   + K+A VRQKF+EAK L  DEK   +++
Sbjct  180   YKDVYEIWQQSPRATYSRDSSPQKGRYKDNVNEKKMALVRQKFMEAKHLVTDEKLRQTKE  239

Query  1027  FQDALEVLSSNTDLVLKFLQEPKPMLSEHIYNLQSIPAPSETKRITVLKPSKMVD  1191
             FQDALEVLSSN +L LKFL+EP    S+H  + QS+P P E KRITVLKP KMVD
Sbjct  240   FQDALEVLSSNRELFLKFLEEPNSNFSQH--DFQSLPQPPEKKRITVLKP-KMVD  291



>gb|KDO65806.1| hypothetical protein CISIN_1g001807mg [Citrus sinensis]
Length=952

 Score =   256 bits (653),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 138/245 (56%), Positives = 172/245 (70%), Gaps = 6/245 (2%)
 Frame = +1

Query  478   LSRSQSDVARM--SPSEDQIEDKEIVSELRRNNSKMKANGTPMKMLIAEEMSKDMASKHN  651
             LSRSQSDVAR+  SP  DQIEDK +VSELRR +S   ANGTPMK LIA+EMSK++ SKHN
Sbjct  2     LSRSQSDVARIVTSPHADQIEDKPVVSELRRTSSNKNANGTPMKTLIAQEMSKEVESKHN  61

Query  652   PPSVVAKLMGLDGFPSQLPVSTAQRNYS---GRNAQSAKGTPLNNFHHRSGSLDTQMECE  822
              P+VVAKLMGLD  P     S AQR++S    R++ S    P++ +      LD + + E
Sbjct  62    RPNVVAKLMGLDTLPPLQSRSAAQRSHSKGYSRHSLSHSSIPVDCWEQDRVFLDNRTQSE  121

Query  823   FYQYPEQNECKDVYEVWQNRHDMNSMRSKSPQMGRCNET-STDKVAFVRQKFIEAKCLSL  999
               +  EQNECKDVYE+WQ     +  R  S Q GRCNE  S  K+A VRQKF+EAK L+ 
Sbjct  122   VNKCQEQNECKDVYEIWQQSQRTSYSRDSSMQKGRCNENISEAKMALVRQKFMEAKRLAT  181

Query  1000  DEKCHHSRQFQDALEVLSSNTDLVLKFLQEPKPMLSEHIYNLQSIPAPSETKRITVLKPS  1179
             DEK   S++FQDALEVLS+N DL L+FLQEP  + S+ +Y+LQ+ P P ETKRITVL+PS
Sbjct  182   DEKLRQSKEFQDALEVLSTNRDLFLRFLQEPNSLFSQQLYDLQTTPPPPETKRITVLRPS  241

Query  1180  KMVDN  1194
             K+VD+
Sbjct  242   KVVDD  246



>ref|XP_008447347.1| PREDICTED: uncharacterized protein LOC103489819 [Cucumis melo]
 ref|XP_008447348.1| PREDICTED: uncharacterized protein LOC103489819 [Cucumis melo]
Length=971

 Score =   252 bits (644),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 146/297 (49%), Positives = 195/297 (66%), Gaps = 16/297 (5%)
 Frame = +1

Query  334   MYAVQNGKNRGLEKPIPGCLGRMVNLFDLNGGVAGNRLLTDKPHRDG-SLSRSQSDVARM  510
             M  +Q  K    EKP PGCLGRMVNLFDL+ G++ N+LLTD PHR+G +LSR+Q+DVARM
Sbjct  1     MNGIQRRKVGNDEKPFPGCLGRMVNLFDLSTGISRNKLLTDAPHREGPTLSRNQADVARM  60

Query  511   -SPSEDQIEDK--EIVSELRRNNSKMKANGTPMKMLIAEEMSKDMASKHNPPSVVAKLMG  681
              + S +Q ED   + V EL+R ++K +A+GTP+KMLI +EMS +M S HNPP+VVAKLMG
Sbjct  61    FNHSTNQSEDNLSQTVPELQRASNK-RASGTPVKMLIDQEMS-EMESTHNPPNVVAKLMG  118

Query  682   LDGFPSQLPVSTAQRNYSGRNAQSAKGTPLNNF------HHRSGSLDTQMECEFYQYPEQ  843
             L+  P Q   S+ QRN    N ++   + + N          S  L+  M+ +  +  EQ
Sbjct  119   LETLPHQFSGSSVQRN----NVRTCPKSRIENHGVLLGCREHSDFLEEGMKYQVDECSEQ  174

Query  844   NECKDVYEVWQNRHDMNSMRSKSPQMGRCNETSTDKVAFVRQKFIEAKCLSLDEKCHHSR  1023
              E KDVYE+WQ     N ++ K P+       +  K+A VRQKF+EAK L+ DEK   S+
Sbjct  175   KEYKDVYEIWQRSPQTNYIKEKLPKGMESEVVNDRKMALVRQKFVEAKRLATDEKLRQSK  234

Query  1024  QFQDALEVLSSNTDLVLKFLQEPKPMLSEHIYNLQSIPAPSETKRITVLKPSKMVDN  1194
             +FQ+ALEVLSSN DL +KFLQEP  + ++H+   QSIP   ETKRITVL+PSK+  N
Sbjct  235   EFQEALEVLSSNKDLFVKFLQEPNSLFTQHLNEFQSIPPSPETKRITVLRPSKVSRN  291



>ref|XP_009780628.1| PREDICTED: uncharacterized protein LOC104229654 isoform X3 [Nicotiana 
sylvestris]
Length=909

 Score =   251 bits (641),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 131/219 (60%), Positives = 166/219 (76%), Gaps = 3/219 (1%)
 Frame = +1

Query  541   EIVSELRRNNSKMKANGTPMKMLIAEEMSKDMASKHNPPSVVAKLMGLDGFPSQLPVSTA  720
             +I S+L+RN+S  K+NGTPMK LIA+EMSK++ +  NPPSVVAKLMGLD FP +   S A
Sbjct  6     QIFSDLKRNSSNKKSNGTPMKKLIAQEMSKEINTCQNPPSVVAKLMGLDAFPMRRSASAA  65

Query  721   QRNYSGRNAQSAKGTPLNNFHHRSGSLDTQMECEFYQYPEQNECKDVYEVWQNRHDMNSM  900
             + ++ G +++S   +  +   H +GSL  +M     QY EQNE KDVYEVWQ    +N +
Sbjct  66    RSHFGG-HSRSHTDSSFSYCQHENGSLMEEMH-NANQYAEQNEYKDVYEVWQPPTKINCV  123

Query  901   RSKSPQMGRCNETSTDK-VAFVRQKFIEAKCLSLDEKCHHSRQFQDALEVLSSNTDLVLK  1077
             RSKSPQ  + +ETS DK VAFVRQKFIEAKCLS+D K   S++FQ+AL+VLSSNTDL LK
Sbjct  124   RSKSPQKAKDDETSIDKKVAFVRQKFIEAKCLSIDGKLRQSKEFQEALDVLSSNTDLFLK  183

Query  1078  FLQEPKPMLSEHIYNLQSIPAPSETKRITVLKPSKMVDN  1194
             FLQEP PM S+H++NL+S+P P ETKRITVL+PSKMVDN
Sbjct  184   FLQEPNPMFSQHLHNLKSVPPPPETKRITVLRPSKMVDN  222



>ref|XP_004493852.1| PREDICTED: uro-adherence factor A-like isoform X1 [Cicer arietinum]
 ref|XP_004493853.1| PREDICTED: uro-adherence factor A-like isoform X2 [Cicer arietinum]
Length=984

 Score =   251 bits (642),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 151/298 (51%), Positives = 194/298 (65%), Gaps = 18/298 (6%)
 Frame = +1

Query  334   MYAVQNGKNRGLEKPIPGCLGRMVNLFDLNG-GVAGNRLLTDKPHRDG----SLSRSQSD  498
             M  VQN +    +KP PGCLGRMVNLFDL    V GN+LLTDKPHRD     SLSRSQSD
Sbjct  1     MNDVQNRRVHNDDKPFPGCLGRMVNLFDLTVVTVNGNKLLTDKPHRDHHHAPSLSRSQSD  60

Query  499   VARM-SPS-EDQIEDKEIVSELRRNNSKMKANGTPMKMLIAEEMSKDMASKHNPPSVVAK  672
             V+R+ SPS  D+IEDK IVS+  R  S  K NGTP+KMLI +EMSK++ SKH+PP+VVAK
Sbjct  61    VSRIASPSFGDRIEDKPIVSDSMRAFSNKKVNGTPIKMLIDQEMSKEVVSKHSPPNVVAK  120

Query  673   LMGLDGFPSQLPVSTAQRNYSGRNAQ---SAKGTPLNNFHHRSGSLDTQMECEFYQYPEQ  843
             LMGL+  P +      +R+  G  +Q      GTP N +      +D +M  E +   EQ
Sbjct  121   LMGLEALPRREHSLAVERSPGGDCSQHMCGHSGTPFNRWQLEDRFMDKEMLHEGHPSREQ  180

Query  844   NECKDVYEVWQNRHDMNSMRSKSPQMGRCNETSTD-KVAFVRQKFIEAKCLSLDEKCHHS  1020
                KD+YE+W       +++ K+P+  +  E   + K+A +RQKF+EAK LS DEK   S
Sbjct  181   IAYKDIYEIWLQSQRTGNVKDKTPERQKWAEDVNEKKMALIRQKFMEAKRLSTDEKLRQS  240

Query  1021  RQFQDALEVLSSNTDLVLKFLQEPKPMLSEHIYNLQSIPAPSETKRITVLKPSKMVDN  1194
             ++F DALEVLSSN DL+++ L       S+++Y LQS P  +ETKRITVLKPSKMVDN
Sbjct  241   KEFDDALEVLSSNNDLLIRLLD------SQNLYELQSTPL-AETKRITVLKPSKMVDN  291



>ref|XP_009780629.1| PREDICTED: uncharacterized protein LOC104229654 isoform X4 [Nicotiana 
sylvestris]
Length=904

 Score =   251 bits (641),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 131/218 (60%), Positives = 165/218 (76%), Gaps = 3/218 (1%)
 Frame = +1

Query  544   IVSELRRNNSKMKANGTPMKMLIAEEMSKDMASKHNPPSVVAKLMGLDGFPSQLPVSTAQ  723
             I S+L+RN+S  K+NGTPMK LIA+EMSK++ +  NPPSVVAKLMGLD FP +   S A+
Sbjct  2     IFSDLKRNSSNKKSNGTPMKKLIAQEMSKEINTCQNPPSVVAKLMGLDAFPMRRSASAAR  61

Query  724   RNYSGRNAQSAKGTPLNNFHHRSGSLDTQMECEFYQYPEQNECKDVYEVWQNRHDMNSMR  903
              ++ G +++S   +  +   H +GSL  +M     QY EQNE KDVYEVWQ    +N +R
Sbjct  62    SHFGG-HSRSHTDSSFSYCQHENGSLMEEMH-NANQYAEQNEYKDVYEVWQPPTKINCVR  119

Query  904   SKSPQMGRCNETSTDK-VAFVRQKFIEAKCLSLDEKCHHSRQFQDALEVLSSNTDLVLKF  1080
             SKSPQ  + +ETS DK VAFVRQKFIEAKCLS+D K   S++FQ+AL+VLSSNTDL LKF
Sbjct  120   SKSPQKAKDDETSIDKKVAFVRQKFIEAKCLSIDGKLRQSKEFQEALDVLSSNTDLFLKF  179

Query  1081  LQEPKPMLSEHIYNLQSIPAPSETKRITVLKPSKMVDN  1194
             LQEP PM S+H++NL+S+P P ETKRITVL+PSKMVDN
Sbjct  180   LQEPNPMFSQHLHNLKSVPPPPETKRITVLRPSKMVDN  217



>ref|XP_004152072.2| PREDICTED: uncharacterized protein LOC101204012 [Cucumis sativus]
 ref|XP_011651630.1| PREDICTED: uncharacterized protein LOC101204012 [Cucumis sativus]
 gb|KGN58324.1| hypothetical protein Csa_3G622430 [Cucumis sativus]
Length=963

 Score =   251 bits (640),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 144/288 (50%), Positives = 192/288 (67%), Gaps = 13/288 (5%)
 Frame = +1

Query  334   MYAVQNGKNRGLEKPIPGCLGRMVNLFDLNGGVAGNRLLTDKPHRDGS-LSRSQSDVARM  510
             M  +Q  K    EKP PGCLGRMVNLFDL+ GV+ N+LLTD PHR+G  LSR+Q+DVARM
Sbjct  1     MNGIQRRKVGNNEKPFPGCLGRMVNLFDLSTGVSRNKLLTDAPHREGPILSRNQADVARM  60

Query  511   -SPSEDQIEDK--EIVSELRRNNSKMKANGTPMKMLIAEEMSKDMASKHNPPSVVAKLMG  681
              + S +Q ED   + V ELRR ++K +A+GTP+KMLI +EMS +M S  +PP+VVAKLMG
Sbjct  61    FNHSINQSEDNLSQTVPELRRASNK-RASGTPVKMLIDQEMS-EMESTQSPPNVVAKLMG  118

Query  682   LDGFPSQLPVSTAQRNYSGRNAQSAKGTPLNNFHHRSGSLDTQMECEFYQYPEQNECKDV  861
             L+  P Q   S+ QRN       + +  P +   + S  L+  M+ +  +  EQ E KDV
Sbjct  119   LETLPHQFSGSSVQRN-------NVRTCPKSRIQNHSDFLEEGMKYQVDECSEQKEYKDV  171

Query  862   YEVWQNRHDMNSMRSKSPQMGRCNETSTDKVAFVRQKFIEAKCLSLDEKCHHSRQFQDAL  1041
             YE+WQ     N ++ K P+       +  K+A VRQKF+EAK L+ DEK   S++FQ+AL
Sbjct  172   YEIWQRSPQTNYIKEKLPKGMESEVVNDRKMALVRQKFVEAKRLAPDEKMRQSKEFQEAL  231

Query  1042  EVLSSNTDLVLKFLQEPKPMLSEHIYNLQSIPAPSETKRITVLKPSKM  1185
             EVLSSN DL++KFLQEP  + ++H+   QSIP   ETKRITVL+PSK+
Sbjct  232   EVLSSNKDLLVKFLQEPNSLFTQHLNEFQSIPPSPETKRITVLRPSKV  279



>ref|XP_009592675.1| PREDICTED: uncharacterized protein LOC104089467 isoform X3 [Nicotiana 
tomentosiformis]
Length=885

 Score =   248 bits (634),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 126/199 (63%), Positives = 153/199 (77%), Gaps = 2/199 (1%)
 Frame = +1

Query  604   MLIAEEMSKDMASKHNPPSVVAKLMGLDGFPSQLPVSTAQRNYSGRNAQSAKGTPLNNFH  783
             MLIA+EMSK++ S HNPPSVVAKLMGLD  P+Q  +  A R++ G +++    +  +   
Sbjct  1     MLIAQEMSKEIDSSHNPPSVVAKLMGLDALPTQKSI-PAIRSHFGGHSRCHTDSSFSYCQ  59

Query  784   HRSGSLDTQMECEFYQYPEQNECKDVYEVWQNRHDMNSMRSKSPQMGRCNETSTDK-VAF  960
             H + SL  +M+ EF+QYPEQNE KDVYEVWQ+   MN +RSKSPQ  R NETS DK  AF
Sbjct  60    HENESLVDEMQQEFHQYPEQNEYKDVYEVWQHSPKMNCVRSKSPQKARHNETSFDKKSAF  119

Query  961   VRQKFIEAKCLSLDEKCHHSRQFQDALEVLSSNTDLVLKFLQEPKPMLSEHIYNLQSIPA  1140
             VRQKFIEAKCLS+DE+   S++F DAL+VLSSNTDL LKFLQEP P  S+H+YNLQSIP 
Sbjct  120   VRQKFIEAKCLSIDEQLRQSKEFHDALDVLSSNTDLFLKFLQEPNPKFSQHLYNLQSIPP  179

Query  1141  PSETKRITVLKPSKMVDNC  1197
             P ETKRITVL+PSKMVD+C
Sbjct  180   PPETKRITVLRPSKMVDDC  198



>ref|XP_008789491.1| PREDICTED: uncharacterized protein LOC103706972 isoform X3 [Phoenix 
dactylifera]
Length=944

 Score =   245 bits (625),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 132/282 (47%), Positives = 184/282 (65%), Gaps = 6/282 (2%)
 Frame = +1

Query  349   NGKNRGLEKPIPGCLGRMVNLFDLNGGVAGNRLLTDKPHRDG-SLSRSQSDVARM--SPS  519
             N + + L+KP  GC+GRM+N+ DL+ G+AG +LL DK HRDG  +S++QSDV +    P 
Sbjct  3     NRRGQTLQKPSLGCMGRMINILDLSTGMAGTKLLADKAHRDGYPISKNQSDVVKKPRDPI  62

Query  520   EDQIEDKEIVSELRRNNSKMKANGTPMKMLIAEEMSKDMASKHNPPSVVAKLMGLDGFPS  699
                +EDK+I  ELR++ S   + GTPM+MLI +EM K+   K  PP+VVA+LMGLD  P 
Sbjct  63    LFPVEDKQITHELRKSASNKNSGGTPMRMLIHQEMWKEAELKQKPPNVVARLMGLDALPV  122

Query  700   QLPVSTAQRNYSGRNAQSAKGTPLNNFHHRSGSLDTQMECEFYQYPEQNECKDVYEVWQN  879
             Q  V ++Q++     + S  G                ++CE     E++E KDVYE+W+ 
Sbjct  123   QQSVLSSQKSSQEGYSHSLAGAFRGYQQQEDEYFHKPIQCEIPH--EKHEYKDVYEIWKK  180

Query  880   RHDMNSMRSKSPQMGRCNETSTDK-VAFVRQKFIEAKCLSLDEKCHHSRQFQDALEVLSS  1056
                ++ ++ + PQ GR +E S +K +  VRQ FIEAKCL+ DEK   S++FQDALEVLSS
Sbjct  181   PSKISHIKDQPPQKGRYDENSYEKRMTLVRQNFIEAKCLATDEKLLQSKEFQDALEVLSS  240

Query  1057  NTDLVLKFLQEPKPMLSEHIYNLQSIPAPSETKRITVLKPSK  1182
             N DL LKFL+EP  +LS+H++ LQ+I  PS+TK ITVLKPSK
Sbjct  241   NRDLFLKFLEEPNSLLSKHLHELQAISPPSQTKHITVLKPSK  282



>ref|XP_008789490.1| PREDICTED: uncharacterized protein LOC103706972 isoform X2 [Phoenix 
dactylifera]
Length=962

 Score =   245 bits (625),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 132/284 (46%), Positives = 185/284 (65%), Gaps = 6/284 (2%)
 Frame = +1

Query  343   VQNGKNRGLEKPIPGCLGRMVNLFDLNGGVAGNRLLTDKPHRDG-SLSRSQSDVARM--S  513
             + N + + L+KP  GC+GRM+N+ DL+ G+AG +LL DK HRDG  +S++QSDV +    
Sbjct  1     MNNRRGQTLQKPSLGCMGRMINILDLSTGMAGTKLLADKAHRDGYPISKNQSDVVKKPRD  60

Query  514   PSEDQIEDKEIVSELRRNNSKMKANGTPMKMLIAEEMSKDMASKHNPPSVVAKLMGLDGF  693
             P    +EDK+I  ELR++ S   + GTPM+MLI +EM K+   K  PP+VVA+LMGLD  
Sbjct  61    PILFPVEDKQITHELRKSASNKNSGGTPMRMLIHQEMWKEAELKQKPPNVVARLMGLDAL  120

Query  694   PSQLPVSTAQRNYSGRNAQSAKGTPLNNFHHRSGSLDTQMECEFYQYPEQNECKDVYEVW  873
             P Q  V ++Q++     + S  G                ++CE     E++E KDVYE+W
Sbjct  121   PVQQSVLSSQKSSQEGYSHSLAGAFRGYQQQEDEYFHKPIQCEIPH--EKHEYKDVYEIW  178

Query  874   QNRHDMNSMRSKSPQMGRCNETSTDK-VAFVRQKFIEAKCLSLDEKCHHSRQFQDALEVL  1050
             +    ++ ++ + PQ GR +E S +K +  VRQ FIEAKCL+ DEK   S++FQDALEVL
Sbjct  179   KKPSKISHIKDQPPQKGRYDENSYEKRMTLVRQNFIEAKCLATDEKLLQSKEFQDALEVL  238

Query  1051  SSNTDLVLKFLQEPKPMLSEHIYNLQSIPAPSETKRITVLKPSK  1182
             SSN DL LKFL+EP  +LS+H++ LQ+I  PS+TK ITVLKPSK
Sbjct  239   SSNRDLFLKFLEEPNSLLSKHLHELQAISPPSQTKHITVLKPSK  282



>ref|XP_008789489.1| PREDICTED: uncharacterized protein LOC103706972 isoform X1 [Phoenix 
dactylifera]
Length=963

 Score =   244 bits (624),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 132/284 (46%), Positives = 185/284 (65%), Gaps = 6/284 (2%)
 Frame = +1

Query  343   VQNGKNRGLEKPIPGCLGRMVNLFDLNGGVAGNRLLTDKPHRDG-SLSRSQSDVARM--S  513
             + N + + L+KP  GC+GRM+N+ DL+ G+AG +LL DK HRDG  +S++QSDV +    
Sbjct  1     MNNRRGQTLQKPSLGCMGRMINILDLSTGMAGTKLLADKAHRDGYPISKNQSDVVKKPRD  60

Query  514   PSEDQIEDKEIVSELRRNNSKMKANGTPMKMLIAEEMSKDMASKHNPPSVVAKLMGLDGF  693
             P    +EDK+I  ELR++ S   + GTPM+MLI +EM K+   K  PP+VVA+LMGLD  
Sbjct  61    PILFPVEDKQITHELRKSASNKNSGGTPMRMLIHQEMWKEAELKQKPPNVVARLMGLDAL  120

Query  694   PSQLPVSTAQRNYSGRNAQSAKGTPLNNFHHRSGSLDTQMECEFYQYPEQNECKDVYEVW  873
             P Q  V ++Q++     + S  G                ++CE     E++E KDVYE+W
Sbjct  121   PVQQSVLSSQKSSQEGYSHSLAGAFRGYQQQEDEYFHKPIQCEIPH--EKHEYKDVYEIW  178

Query  874   QNRHDMNSMRSKSPQMGRCNETSTDK-VAFVRQKFIEAKCLSLDEKCHHSRQFQDALEVL  1050
             +    ++ ++ + PQ GR +E S +K +  VRQ FIEAKCL+ DEK   S++FQDALEVL
Sbjct  179   KKPSKISHIKDQPPQKGRYDENSYEKRMTLVRQNFIEAKCLATDEKLLQSKEFQDALEVL  238

Query  1051  SSNTDLVLKFLQEPKPMLSEHIYNLQSIPAPSETKRITVLKPSK  1182
             SSN DL LKFL+EP  +LS+H++ LQ+I  PS+TK ITVLKPSK
Sbjct  239   SSNRDLFLKFLEEPNSLLSKHLHELQAISPPSQTKHITVLKPSK  282



>ref|XP_010069683.1| PREDICTED: uncharacterized protein LOC104456566 [Eucalyptus grandis]
 gb|KCW58104.1| hypothetical protein EUGRSUZ_H00827 [Eucalyptus grandis]
Length=971

 Score =   241 bits (616),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 138/294 (47%), Positives = 187/294 (64%), Gaps = 7/294 (2%)
 Frame = +1

Query  334   MYAVQNGKNRGLEKPIPGCLGRMVNLFDLNGGVAGNRLLTDKPHRDG-SLSRSQSDVAR-  507
             M   +N K +G ++  PGCLGRMVNLFDL+ G A  +LLT KPH D  SL+RSQ DV R 
Sbjct  1     MDRARNNKAQGTKEQFPGCLGRMVNLFDLSTGAASKKLLTYKPHYDDPSLTRSQPDVPRI  60

Query  508   MSPS-EDQIEDKEIVSELRRNNSKMKANGTPMKMLIAEEMSKDMASKHNPPSVVAKLMGL  684
             +SPS  + IEDK I S  RR++   ++N  PMKMLIA+EMS+++ SKH  P+VVAKLMG 
Sbjct  61    LSPSCRNDIEDKMITSNSRRSSPNRQSNSMPMKMLIAQEMSREVESKHGSPNVVAKLMGF  120

Query  685   DGFPSQLPVSTAQRNYSGRNAQSA---KGTPLNNFHHRSGSLDTQMECEFYQYPEQNECK  855
             DG P Q PVS    + S  ++      K  P  ++      +  QM+   ++Y E ++ K
Sbjct  121   DGLPRQSPVSVVDVSPSTNHSSPCLIPKDVPCQSWLQGDTFVHEQMKDASFKYREIDDYK  180

Query  856   DVYEVWQNRHDMNSMRSKSPQMGRCNETSTDK-VAFVRQKFIEAKCLSLDEKCHHSRQFQ  1032
             D+YEV +     NS R  SPQM R      +K    ++QKF+EAKC   DEK + S++ Q
Sbjct  181   DIYEVEKISQKTNSAREISPQMERYGGKGREKRKTVIQQKFMEAKCQETDEKLNQSKELQ  240

Query  1033  DALEVLSSNTDLVLKFLQEPKPMLSEHIYNLQSIPAPSETKRITVLKPSKMVDN  1194
             DALEV +S  + +L+F++EP  + S+H+  L+S  AP ETKRITVL+PSKMVDN
Sbjct  241   DALEVFNSKREFLLEFIKEPNILFSKHLRELESTCAPPETKRITVLRPSKMVDN  294



>ref|XP_010940679.1| PREDICTED: uncharacterized protein LOC105059154 isoform X2 [Elaeis 
guineensis]
Length=954

 Score =   240 bits (613),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 134/285 (47%), Positives = 184/285 (65%), Gaps = 8/285 (3%)
 Frame = +1

Query  343   VQNGKNRGLEKPIPGCLGRMVNLFDLNGGVAGNRLLTDKPHRDGS-LSRSQSDVARM--S  513
             + N + +  + P  GC+GRM+N+FDL+ GVAG +LLTDK HRDGS +S++QSD  +    
Sbjct  1     MNNRRGQNFQNPSLGCMGRMINIFDLSTGVAGTKLLTDKAHRDGSPISKNQSDALKKPRD  60

Query  514   PSEDQIEDKEIVSELRRNNSKMKANGTPMKMLIAEEMSKDMASKHNPPSVVAKLMGLDGF  693
             PS   +EDK+I  E R++ S   + GTPMKMLI  EM K+   K  PP+VVA+LMGLD  
Sbjct  61    PSLVPVEDKQITRESRKSASNKNSGGTPMKMLIHREMWKEAELKQKPPNVVARLMGLDTL  120

Query  694   PSQLPVSTAQRNYSGRNAQSAKGTPLNNFH-HRSGSLDTQMECEFYQYPEQNECKDVYEV  870
             P    V +A+++     + S  G  L  +H          ++CE     E++E KDVYE+
Sbjct  121   PVHQSVLSAKKSSQDGYSHSLAGA-LRGYHLQEDDYFHKPVQCEIPH--EKHEYKDVYEI  177

Query  871   WQNRHDMNSMRSKSPQMGRCNETSTDK-VAFVRQKFIEAKCLSLDEKCHHSRQFQDALEV  1047
             WQ    ++ ++ + PQ GR +E S +K +  VRQKFIEAK L+ DEK   S++FQDALEV
Sbjct  178   WQKPSKISHIKDQHPQNGRYDENSYEKRMTLVRQKFIEAKRLATDEKLLQSKEFQDALEV  237

Query  1048  LSSNTDLVLKFLQEPKPMLSEHIYNLQSIPAPSETKRITVLKPSK  1182
             LSSN DL LKFL+EP  + S+H++  Q+I  PS+TK ITVLKPSK
Sbjct  238   LSSNRDLFLKFLEEPNSLFSKHLHEHQAISPPSQTKHITVLKPSK  282



>ref|XP_010940678.1| PREDICTED: uncharacterized protein LOC105059154 isoform X1 [Elaeis 
guineensis]
Length=955

 Score =   240 bits (613),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 134/285 (47%), Positives = 184/285 (65%), Gaps = 8/285 (3%)
 Frame = +1

Query  343   VQNGKNRGLEKPIPGCLGRMVNLFDLNGGVAGNRLLTDKPHRDGS-LSRSQSDVARM--S  513
             + N + +  + P  GC+GRM+N+FDL+ GVAG +LLTDK HRDGS +S++QSD  +    
Sbjct  1     MNNRRGQNFQNPSLGCMGRMINIFDLSTGVAGTKLLTDKAHRDGSPISKNQSDALKKPRD  60

Query  514   PSEDQIEDKEIVSELRRNNSKMKANGTPMKMLIAEEMSKDMASKHNPPSVVAKLMGLDGF  693
             PS   +EDK+I  E R++ S   + GTPMKMLI  EM K+   K  PP+VVA+LMGLD  
Sbjct  61    PSLVPVEDKQITRESRKSASNKNSGGTPMKMLIHREMWKEAELKQKPPNVVARLMGLDTL  120

Query  694   PSQLPVSTAQRNYSGRNAQSAKGTPLNNFH-HRSGSLDTQMECEFYQYPEQNECKDVYEV  870
             P    V +A+++     + S  G  L  +H          ++CE     E++E KDVYE+
Sbjct  121   PVHQSVLSAKKSSQDGYSHSLAGA-LRGYHLQEDDYFHKPVQCEIPH--EKHEYKDVYEI  177

Query  871   WQNRHDMNSMRSKSPQMGRCNETSTDK-VAFVRQKFIEAKCLSLDEKCHHSRQFQDALEV  1047
             WQ    ++ ++ + PQ GR +E S +K +  VRQKFIEAK L+ DEK   S++FQDALEV
Sbjct  178   WQKPSKISHIKDQHPQNGRYDENSYEKRMTLVRQKFIEAKRLATDEKLLQSKEFQDALEV  237

Query  1048  LSSNTDLVLKFLQEPKPMLSEHIYNLQSIPAPSETKRITVLKPSK  1182
             LSSN DL LKFL+EP  + S+H++  Q+I  PS+TK ITVLKPSK
Sbjct  238   LSSNRDLFLKFLEEPNSLFSKHLHEHQAISPPSQTKHITVLKPSK  282



>ref|XP_003625464.1| hypothetical protein MTR_7g099410 [Medicago truncatula]
 gb|AES81682.1| DUF3741 family protein [Medicago truncatula]
Length=982

 Score =   240 bits (612),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 142/284 (50%), Positives = 187/284 (66%), Gaps = 16/284 (6%)
 Frame = +1

Query  370   EKPIPGCLGRMVNLFDLN-GGVAGNRLLTDKPHRD--GSLSRSQSDVARM-SPS-EDQIE  534
             +KP PGCLGRMVNLFDL    V  N+LLTDKPHRD   SLSRSQSDV+R  SPS  D+IE
Sbjct  14    DKPFPGCLGRMVNLFDLTPSTVNANKLLTDKPHRDHHASLSRSQSDVSRTASPSFGDRIE  73

Query  535   DKEIVSELRRNNSKMKANGTPMKMLIAEEMSKDMASKHNPPSVVAKLMGLDGFPSQLPVS  714
             DK IVS+  R +S  K NGTP+KML+ +EMSK++ SKH+PP+VVAKLMGL+  P      
Sbjct  74    DKPIVSDSMRASSNKKVNGTPIKMLMDQEMSKEIVSKHSPPNVVAKLMGLEALPRGEHSL  133

Query  715   TAQRNYSGRNAQ---SAKGTPLNNFHHRSGSLDTQMECEFYQYPEQNECKDVYEVWQNRH  885
               +R+  G  +Q   S   T  N++      +D +M  E +   EQ   KD+YE+W    
Sbjct  134   AVERSPGGDCSQHMCSHSATSFNHWQLEDRFMDKEMLHEVHPSREQVAYKDIYEIWLQSQ  193

Query  886   DMNSMRSKSPQMGRCNETSTD-KVAFVRQKFIEAKCLSLDEKCHHSRQFQDALEVLSSNT  1062
               +++R K+P+  +  E   + K+A +RQKF+EAK LS DE+   S++F++ LEVLSSN 
Sbjct  194   RTSNVRDKTPERRKWVEDVNEKKMALIRQKFMEAKRLSTDERLRQSKEFEETLEVLSSNN  253

Query  1063  DLVLKFLQEPKPMLSEHIYNLQSIPAPSETKRITVLKPSKMVDN  1194
             DL++K L       S+++Y  QS P  +ETKRITVLKPSKMVDN
Sbjct  254   DLLIKLLD------SQNLYERQSTPL-AETKRITVLKPSKMVDN  290



>ref|XP_010326332.1| PREDICTED: uncharacterized protein LOC101266067 isoform X2 [Solanum 
lycopersicum]
Length=894

 Score =   238 bits (608),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 121/204 (59%), Positives = 155/204 (76%), Gaps = 6/204 (3%)
 Frame = +1

Query  595   PMKMLIAEEMSKDMASKHNPPSVVAKLMGLDGFPSQ-LPVSTAQRNYSGRNAQSAKGTPL  771
             PMKMLIA+EMSK++ S HNPPSVVAKLMGLD FP + +P   A RN+ G +++    +  
Sbjct  2     PMKMLIAQEMSKEVGSGHNPPSVVAKLMGLDAFPQKSVP---AIRNHFGGHSRCHTDSSF  58

Query  772   NNFHHRSGSLDTQMECEFYQYPEQNECKDVYEVWQNRHDMNSMRSKSPQMGRCNETST--  945
             +     + SL  +++ E +QYPEQNE KDVYEVW++   MNS+RS+SPQ  R ++  +  
Sbjct  59    SYCQEENESLTEELQQELHQYPEQNEYKDVYEVWRHPPKMNSVRSESPQKARHDDQISFE  118

Query  946   DKVAFVRQKFIEAKCLSLDEKCHHSRQFQDALEVLSSNTDLVLKFLQEPKPMLSEHIYNL  1125
              K AFVRQKFIEAKCLS+DE+   S++FQDAL+VLSSNTDL LKFLQEP PM ++H+ NL
Sbjct  119   KKSAFVRQKFIEAKCLSIDEQLRQSKEFQDALDVLSSNTDLFLKFLQEPNPMFTQHLSNL  178

Query  1126  QSIPAPSETKRITVLKPSKMVDNC  1197
             QSIP P ETKRITVL+PSKM+D+C
Sbjct  179   QSIPPPPETKRITVLRPSKMIDDC  202



>ref|XP_006412913.1| hypothetical protein EUTSA_v10024350mg [Eutrema salsugineum]
 gb|ESQ54366.1| hypothetical protein EUTSA_v10024350mg [Eutrema salsugineum]
Length=913

 Score =   235 bits (600),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 144/290 (50%), Positives = 184/290 (63%), Gaps = 19/290 (7%)
 Frame = +1

Query  334   MYAVQNGKNRGLEKPIPGCLGRMVNLFDLNGGVAGNRLLTDKPHRDG-SLSRSQSDVARM  510
             M  ++  K + +E PIPGCLGRMVNLFDL   V GN+LLTDKPHRDG SLSRS+SDV RM
Sbjct  1     MNEIRGRKVQKVESPIPGCLGRMVNLFDLGTAVNGNKLLTDKPHRDGSSLSRSRSDVTRM  60

Query  511   -SPS-EDQIEDKEIVSELRRNNSKMKANGTPMKMLIAEEMSKDMASKHNPPSVVAKLMGL  684
              SPS +   E + I+S+LRR+ S    +GTPMK LIA EMSK++  K +P +VVAKLMGL
Sbjct  61    PSPSYKGHSEAELIMSDLRRSASS-NVSGTPMKKLIAREMSKEVEPKQSPTNVVAKLMGL  119

Query  685   DGFPSQLPVSTAQRNYSGRNAQSAKGTPLNNFHHRSGSLDTQMECEFYQYPE-QNECKDV  861
             +  P     S  QR  S  N+ S+   P+           T  + E   Y E   E KDV
Sbjct  120   ETLPQLHLESPTQRGKSRSNSYSSLNHPV-----------TSRDNEVRNYQELSREFKDV  168

Query  862   YEVWQNRHDMNSMRSKSPQMGRCNETSTDKVAFVRQKFIEAKCLSLDEKCHHSRQFQDAL  1041
             YE WQ+   ++  R  SP+ GR +++ T+K   VRQK  EAK L  D+  H S++FQDAL
Sbjct  169   YETWQSPQKVSRSRDSSPRKGRYDDSITEK--LVRQKLAEAKRLVTDDSLHQSKEFQDAL  226

Query  1042  EVLSSNTDLVLKFLQEPKPMLSEHIYNLQSIPAPSETKRITVLKPSKMVD  1191
             EVLSSN DL +K L+E     S+H+ +LQ +P  SE KRITVL+PSK V+
Sbjct  227   EVLSSNKDLFVKLLEESN-AFSQHLSDLQPVPPHSEAKRITVLRPSKAVE  275



>ref|XP_002869475.1| hypothetical protein ARALYDRAFT_491881 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH45734.1| hypothetical protein ARALYDRAFT_491881 [Arabidopsis lyrata subsp. 
lyrata]
Length=924

 Score =   234 bits (597),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 141/291 (48%), Positives = 188/291 (65%), Gaps = 15/291 (5%)
 Frame = +1

Query  334   MYAVQNGKNRGLEKPIPGCLGRMVNLFDLNGGVAGNRLLTDKPHRDGS-LSRSQSDVARM  510
             M  V+  K + +E P+PGCLG+MVNLFDL   V GN+LLTDKPH  GS LSRS+SDV RM
Sbjct  1     MNEVRGRKAQKIESPVPGCLGKMVNLFDLGTAVNGNKLLTDKPHLYGSSLSRSRSDVTRM  60

Query  511   -SPS-EDQIEDKEIVSELRRNNSKMKANGTPMKMLIAEEMSKDMASKHNPPSVVAKLMGL  684
              SPS +   E + I+S+LRR+ S  K +GTPMK LIA EMSK++  K +P +VVAKLMGL
Sbjct  61    PSPSYKGHSEAELIMSDLRRSASS-KVSGTPMKKLIAREMSKEVEHKQSPTNVVAKLMGL  119

Query  685   DGFPSQLPVSTAQRNYSGRNAQSAKGTPLNNFHHRSGSLDTQMECEFYQYPEQNECKDVY  864
             +  P   P +  QR+ S  N+ S+    + +  +     D Q   EF +     E KDVY
Sbjct  120   ETLPQTYPETATQRSKSRSNSHSSLNHSVTSIDN-----DVQKYQEFSR-----EFKDVY  169

Query  865   EVWQNRHDMNSMRSKSPQMGRCNETSTDK-VAFVRQKFIEAKCLSLDEKCHHSRQFQDAL  1041
             E WQ+   ++  R  SP+ GR +E++T+K +A VRQKF EAK L  D+  H S++FQDAL
Sbjct  170   ETWQSPQKVSRSRDSSPRKGRYDESTTEKQMALVRQKFSEAKRLVTDDSLHQSKEFQDAL  229

Query  1042  EVLSSNTDLVLKFLQEPKPMLSEHIYNLQSIPAPSETKRITVLKPSKMVDN  1194
             EVLSSN DL ++FLQE      +++ +   +P  SE KRITVL+PSK V+ 
Sbjct  230   EVLSSNKDLFVQFLQESNSFSQQNLSDFHHVPPHSEAKRITVLRPSKAVET  280



>ref|XP_010447916.1| PREDICTED: uncharacterized protein LOC104730452 isoform X1 [Camelina 
sativa]
 ref|XP_010447917.1| PREDICTED: uncharacterized protein LOC104730452 isoform X1 [Camelina 
sativa]
Length=919

 Score =   233 bits (593),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 142/290 (49%), Positives = 191/290 (66%), Gaps = 14/290 (5%)
 Frame = +1

Query  334   MYAVQNGKNRGLEKPIPGCLGRMVNLFDLNGGVAGNRLLTDKPHRDGS-LSRSQSDVARM  510
             M  ++  K + +E PIPGCLG+MVNLFDL   V GN+LLTDKPHRDGS LSRS+SDV RM
Sbjct  1     MNELRGRKVQNIESPIPGCLGKMVNLFDLGTAVNGNKLLTDKPHRDGSSLSRSRSDVTRM  60

Query  511   -SPS-EDQIEDKEIVSELRRNNSKMKANGTPMKMLIAEEMSKDMASKHNPPSVVAKLMGL  684
              SPS +   E + I+ +LRR+ S  K +GTPMK LIA EMSKD+  K +P +VVAKLMGL
Sbjct  61    PSPSYKGHSEAELIMCDLRRSASN-KVSGTPMKKLIAREMSKDVEHKQSPTNVVAKLMGL  119

Query  685   DGFPSQLPVSTAQRNYSGRNAQSAKGTPLNNFHHRSGSLDTQMECEFYQYPEQNECKDVY  864
             +  P Q+ + TA    S   + S   +P    +H   S+D   E + YQ   + E KDVY
Sbjct  120   ETLP-QMHLETAATQRSKSRSYSY-ASP----NHSVSSMDN--EVQKYQDLSR-EFKDVY  170

Query  865   EVWQNRHDMNSMRSKSPQMGRCNETSTDK-VAFVRQKFIEAKCLSLDEKCHHSRQFQDAL  1041
             E+WQ+   ++  R  SP+ GR +E++T+K +A VRQKF EAK L  D+  H S++FQDAL
Sbjct  171   EMWQSPQKVSRSRDSSPRKGRFDESTTEKQMALVRQKFTEAKRLVTDDNLHQSKEFQDAL  230

Query  1042  EVLSSNTDLVLKFLQEPKPMLSEHIYNLQSIPAPSETKRITVLKPSKMVD  1191
             E LSSN DL ++FLQE      +++ +   +P+  + KRITVL+PSK V+
Sbjct  231   EFLSSNKDLFVEFLQESNSFSQQNLSDFHHVPSHPDAKRITVLRPSKAVE  280



>ref|XP_006284953.1| hypothetical protein CARUB_v10006255mg [Capsella rubella]
 gb|EOA17851.1| hypothetical protein CARUB_v10006255mg [Capsella rubella]
Length=925

 Score =   233 bits (593),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 140/291 (48%), Positives = 189/291 (65%), Gaps = 17/291 (6%)
 Frame = +1

Query  334   MYAVQNGKNRGLEKPIPGCLGRMVNLFDLNGGVAGNRLLTDKPHRDG-SLSRSQSDVARM  510
             M  ++  K + +E P+PGCLG+MVNLFDL   V GN+LLTDKPHRDG SLSRS+SDV RM
Sbjct  1     MNELRGRKGQNIESPVPGCLGKMVNLFDLGTAVNGNKLLTDKPHRDGYSLSRSRSDVTRM  60

Query  511   -SPS-EDQIEDKEIVSELRRNNSKMKANGTPMKMLIAEEMSKDMASKHNPPSVVAKLMGL  684
              SPS +   E + I+ +LRR  S  K NGTPMK LIA EMSK++  K +P +VVAKLMGL
Sbjct  61    PSPSYKGHSEAELIMCDLRRTASS-KVNGTPMKKLIAREMSKEVEHKQSPTNVVAKLMGL  119

Query  685   DGFPSQLPVSTAQRNYSGRNAQSAKGTPLNNFHHRSGSLDTQMECEFYQYPEQN-ECKDV  861
             +  P   P +  QR+ S   + S+        +H   S+D +++    +Y + N E KDV
Sbjct  120   ETLPQMHPETATQRSNSRSYSYSSP-------NHSVSSMDNEVQ----KYEDLNREFKDV  168

Query  862   YEVWQNRHDMNSMRSKSPQMGRCNETSTDK-VAFVRQKFIEAKCLSLDEKCHHSRQFQDA  1038
             YE+WQ+   ++  R  SP+ GR +E++T+K +A VRQKF EAK L  D     S++FQDA
Sbjct  169   YEMWQSPQKVSRSRDSSPRKGRYDESTTEKQMALVRQKFTEAKRLVTDNNLQQSKEFQDA  228

Query  1039  LEVLSSNTDLVLKFLQEPKPMLSEHIYNLQSIPAPSETKRITVLKPSKMVD  1191
             LE LSSN DL ++FLQE      +++     +P+ SE KRITVL+PSK V+
Sbjct  229   LEFLSSNKDLFVEFLQESNSFSQQNLSGFHPVPSHSEAKRITVLRPSKAVE  279



>ref|XP_010438384.1| PREDICTED: uncharacterized protein LOC104721992 isoform X1 [Camelina 
sativa]
 ref|XP_010438385.1| PREDICTED: uncharacterized protein LOC104721992 isoform X1 [Camelina 
sativa]
Length=916

 Score =   232 bits (591),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 141/285 (49%), Positives = 186/285 (65%), Gaps = 14/285 (5%)
 Frame = +1

Query  352   GKN-RGLEKPIPGCLGRMVNLFDLNGGVAGNRLLTDKPHRDGS-LSRSQSDVARM-SPS-  519
             G+N + +E PIPGCLG+MVNLFDL   V GN+LLTD PHRDGS LSRS+SDV RM SPS 
Sbjct  6     GRNVQNIESPIPGCLGKMVNLFDLGTAVTGNKLLTDIPHRDGSSLSRSRSDVTRMPSPSY  65

Query  520   EDQIEDKEIVSELRRNNSKMKANGTPMKMLIAEEMSKDMASKHNPPSVVAKLMGLDGFPS  699
             +   E + I+ +LRR+ S  K +GTPMK LIA EMSKD+  K +PP+VVAKLMGL+  P 
Sbjct  66    KGHSEAELIMCDLRRSASN-KVSGTPMKKLIAREMSKDVEHKQSPPNVVAKLMGLETLPQ  124

Query  700   QLPVSTAQRNYSGRNAQSAKGTPLNNFHHRSGSLDTQMECEFYQYPEQNECKDVYEVWQN  879
                + TA    S   + S         +H   S+D   E + YQ   + E KDVYE+WQ+
Sbjct  125   MNHLETAATQRSKSRSYSYSSP-----NHSVSSMDN--EVQKYQDLSR-EFKDVYEMWQS  176

Query  880   RHDMNSMRSKSPQMGRCNETSTDK-VAFVRQKFIEAKCLSLDEKCHHSRQFQDALEVLSS  1056
                ++  R  SP+ GR  E +T+K +A VRQKF EAK L  D+  H S++FQDALE LSS
Sbjct  177   PQKVSRSRDSSPRKGRYEENTTEKQMALVRQKFTEAKRLVTDDNLHQSKEFQDALEFLSS  236

Query  1057  NTDLVLKFLQEPKPMLSEHIYNLQSIPAPSETKRITVLKPSKMVD  1191
             N DL ++FLQE      +++ +  ++P+ S+ KRITVL+PSK V+
Sbjct  237   NKDLFVEFLQESNSFSRQNLSDFHTVPSHSDAKRITVLRPSKAVE  281



>ref|XP_006854321.1| PREDICTED: uncharacterized protein LOC18444081 [Amborella trichopoda]
 gb|ERN15788.1| hypothetical protein AMTR_s00039p00119340 [Amborella trichopoda]
Length=1073

 Score =   230 bits (587),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 141/312 (45%), Positives = 187/312 (60%), Gaps = 46/312 (15%)
 Frame = +1

Query  370   EKPIPGCLGRMVNLFDLNGGVAGNRLLTDKPHRDGS-LSRSQSDVARMSP------SEDQ  528
             EK  PGC+GRMVNL DL+ G+  NR+LTDK   +GS L RS  DV   +P      + + 
Sbjct  13    EKRYPGCMGRMVNLLDLSSGLNVNRMLTDKAQFNGSALPRSHHDVPMKTPPRHNAYTGEY  72

Query  529   IEDKEIVSELRRNNSKMKANGTPMKMLIAEEMSKDMASKHNPPSVVAKLMGLDGFPSQLP  708
             +  K I  ELRR+ S+ K NGTPMKMLIA+EMSK+  +K  PPSVVA+LMGL+  P+Q P
Sbjct  73    VAQKPIDHELRRSFSEKKGNGTPMKMLIAQEMSKEFDTKQKPPSVVARLMGLETLPAQQP  132

Query  709   VSTAQRN---------YSGRNAQSAKGTPL-NNFHHRSGSLDTQMECEFYQYPEQNEC--  852
             +ST QR+           GR  Q     P+ +N +  SG+ +T M     Q  +Q E   
Sbjct  133   ISTWQRSSPEVSPWNPTVGR--QDRHHLPVHSNMYSHSGTTNTYMHSGAIQRNQQQEVGL  190

Query  853   ----------------------KDVYEVWQNRHDMNSMRSKSPQMGRCNETSTDKVAFVR  966
                                   KDVYEVWQ    ++++   + Q  R  ++  +K+A VR
Sbjct  191   EVEHLPHKRCSPETYFRGQEGYKDVYEVWQKTEKLDAV---NLQKDRYEKSLDEKMALVR  247

Query  967   QKFIEAKCLSLDEKCHHSRQFQDALEVLSSNTDLVLKFLQEPKPMLSEHIYNLQSIPAPS  1146
             QKF++AK L+ DEK   S++FQDALEVLSSN DL LKFLQEP  + S+HI +LQSIP P 
Sbjct  248   QKFMDAKRLATDEKLRQSKEFQDALEVLSSNKDLFLKFLQEPNSLFSKHILDLQSIPPPP  307

Query  1147  ETKRITVLKPSK  1182
             +++RITVL+PSK
Sbjct  308   QSRRITVLRPSK  319



>ref|XP_010433164.1| PREDICTED: uncharacterized protein LOC104717316 isoform X1 [Camelina 
sativa]
 ref|XP_010433165.1| PREDICTED: uncharacterized protein LOC104717316 isoform X1 [Camelina 
sativa]
Length=915

 Score =   229 bits (584),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 141/290 (49%), Positives = 189/290 (65%), Gaps = 14/290 (5%)
 Frame = +1

Query  334   MYAVQNGKNRGLEKPIPGCLGRMVNLFDLNGGVAGNRLLTDKPHRDGS-LSRSQSDVARM  510
             M  ++  K + +E PI GCLG+MVNLFDL   V GN+LLTDKPHRDGS LSRS+SDV RM
Sbjct  1     MNELRGRKVQNIESPISGCLGKMVNLFDLGTAVNGNKLLTDKPHRDGSSLSRSRSDVTRM  60

Query  511   -SPS-EDQIEDKEIVSELRRNNSKMKANGTPMKMLIAEEMSKDMASKHNPPSVVAKLMGL  684
              SPS +   E + I+ +LRR++S  K +GTPMK LIA EMSKD+  K +P +VVAKLMGL
Sbjct  61    PSPSYKGHSEAELIMCDLRRSDSN-KVSGTPMKKLIAREMSKDVEHKQSPTNVVAKLMGL  119

Query  685   DGFPSQLPVSTAQRNYSGRNAQSAKGTPLNNFHHRSGSLDTQMECEFYQYPEQNECKDVY  864
             +  P Q+ + TA    S   + S         +H   S+D   E + YQ   + E KDVY
Sbjct  120   ETLP-QMHLETAATQRSKSRSYSYSSP-----NHSVSSMDN--EVQKYQDLSR-EFKDVY  170

Query  865   EVWQNRHDMNSMRSKSPQMGRCNETSTDK-VAFVRQKFIEAKCLSLDEKCHHSRQFQDAL  1041
             E+WQ+   ++  R  SP+ GR  E +T+K +A VRQKF EAK L  D+  H S++FQDAL
Sbjct  171   EMWQSPQKVSRSRDSSPRKGRYEENTTEKQMALVRQKFTEAKRLVTDDNLHQSKEFQDAL  230

Query  1042  EVLSSNTDLVLKFLQEPKPMLSEHIYNLQSIPAPSETKRITVLKPSKMVD  1191
             E LSSN DL ++FLQE      +++ +  ++P+ S+ KRITVL+PSK V+
Sbjct  231   EFLSSNKDLFVEFLQESNSFSRQNLSDFHTVPSHSDAKRITVLRPSKAVE  280



>ref|XP_010556872.1| PREDICTED: uncharacterized protein LOC104826058 [Tarenaya hassleriana]
Length=937

 Score =   228 bits (582),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 135/282 (48%), Positives = 179/282 (63%), Gaps = 13/282 (5%)
 Frame = +1

Query  358   NRGLEKPIPGCLGRMVNLFDLNGGVAGNRLLTDKPHRDGS-LSRSQSDV-ARMSPS-EDQ  528
             ++G+ + IPGCLGRMVNLFDL     GN++LTDKPH DGS LSRS+S V +R SP   D 
Sbjct  9     DQGMGRQIPGCLGRMVNLFDLAANGGGNKMLTDKPHYDGSSLSRSRSAVPSRPSPPMGDY  68

Query  529   IEDKEIVSELRRNNSKMKANGTPMKMLIAEEMSKDMASKHNPPSVVAKLMGLDGFPSQLP  708
             IED+ +VSE+R  ++  + NGTPMK LIA+EMSK+M  K +P +VVAKLMGLD  P   P
Sbjct  69    IEDEVVVSEIR--STANRVNGTPMKKLIAQEMSKEMDYKLSPTNVVAKLMGLDSLPQ--P  124

Query  709   VSTAQRNYSGRNAQSAKGTPLNNFHHRSGSLDTQMECEFYQYPEQNECKDVYEVWQNRHD  888
              S A    S   +Q  +         RS   D         + +  E KDVYE+W +  +
Sbjct  125   QSNASAPRSNSKSQLRRSLSHEGIAARSWERDFN-----NAFQDHGEYKDVYEIWHHPGE  179

Query  889   MNSMRSKSPQMGRCNET-STDKVAFVRQKFIEAKCLSLDEKCHHSRQFQDALEVLSSNTD  1065
             +N+ R         +E  S  K+  +R+KFIEAK L  DEK  HS++FQDA+EVLSSN +
Sbjct  180   LNNSRKSVADNESYSENLSKKKMDVIREKFIEAKRLVTDEKLRHSKEFQDAMEVLSSNKE  239

Query  1066  LVLKFLQEPKPMLSEHIYNLQSIPAPSETKRITVLKPSKMVD  1191
             L L+FLQE     SEH+++ QS+P+  ETKRIT+LKPSK+ +
Sbjct  240   LFLEFLQESNNFFSEHLHDFQSVPSTPETKRITILKPSKVTE  281



>emb|CDY35217.1| BnaA01g08140D [Brassica napus]
Length=837

 Score =   226 bits (576),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 141/292 (48%), Positives = 183/292 (63%), Gaps = 36/292 (12%)
 Frame = +1

Query  334   MYAVQNGKNRGLEKPIPGCLGRMVNLFDLNGGVAGNRLLTDKPHRDG-SLSRSQSDVARM  510
             M  ++  K + +E P+PGCLGRMVNLFDL   V GN++LTDKPHRDG SLSRS+SDV+RM
Sbjct  1     MNELRGRKVQKIESPVPGCLGRMVNLFDLGTAVNGNKMLTDKPHRDGSSLSRSRSDVSRM  60

Query  511   -SPS-EDQIEDKEIVSELRRNNSKMKANGTPMKMLIAEEMSKDMASKHNPPSVVAKLMGL  684
              SPS +   E   I+S+LRR  S  KA+GTPMK LIA EMS+++  K +P +VVAKLMGL
Sbjct  61    PSPSYKGHSEPDLIMSDLRRTASS-KASGTPMKKLIAREMSREVEPKQSPTNVVAKLMGL  119

Query  685   DGFPSQLPVSTAQRNYSGRNAQSAKGTPLNNFHHRSGSLDTQMECEFYQYPE-QNECKDV  861
             +  P      +  R YS                H S      M+ E  +Y E   E KDV
Sbjct  120   ETLPQTATQRSKSRGYS----------------HSS------MDDEVQKYQELSREYKDV  157

Query  862   YEVWQNRHDMNSMRSKSPQMGRCNETSTDKVAFVRQKFIEAKCLSLDEKCHHSRQFQDAL  1041
             YE WQ+   ++S R  SP+ GR +E++T+K   VRQKF EAK L  D+  H S++FQ+AL
Sbjct  158   YETWQSPQKVSSSRDSSPRKGRYDESATEK--LVRQKFAEAKRLVTDDSLHQSKEFQEAL  215

Query  1042  EVLSSNTDLVLKFLQEPKPMLSEHIYNLQSIPA-PSETKRITVLKPSKMVDN  1194
             EVLSS+ DL +K LQE       + ++ QS+P   SE KRITVL+PSK V+ 
Sbjct  216   EVLSSHKDLFVKLLQE------SNSFSQQSVPTHQSEAKRITVLRPSKAVET  261



>ref|XP_009129280.1| PREDICTED: uncharacterized protein LOC103854122 [Brassica rapa]
 ref|XP_009129285.1| PREDICTED: uncharacterized protein LOC103854122 [Brassica rapa]
Length=837

 Score =   226 bits (575),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 141/292 (48%), Positives = 183/292 (63%), Gaps = 36/292 (12%)
 Frame = +1

Query  334   MYAVQNGKNRGLEKPIPGCLGRMVNLFDLNGGVAGNRLLTDKPHRDG-SLSRSQSDVARM  510
             M  ++  K + +E P+PGCLGRMVNLFDL   V GN++LTDKPHRDG SLSRS+SDV+RM
Sbjct  1     MNELRGRKVQKIESPVPGCLGRMVNLFDLGTAVNGNKMLTDKPHRDGSSLSRSRSDVSRM  60

Query  511   -SPS-EDQIEDKEIVSELRRNNSKMKANGTPMKMLIAEEMSKDMASKHNPPSVVAKLMGL  684
              SPS +   E   I+S+LRR  S  KA+GTPMK LIA EMS+++  K +P +VVAKLMGL
Sbjct  61    PSPSYKGHSEPDLIMSDLRRTASS-KASGTPMKKLIAREMSREVEPKQSPTNVVAKLMGL  119

Query  685   DGFPSQLPVSTAQRNYSGRNAQSAKGTPLNNFHHRSGSLDTQMECEFYQYPE-QNECKDV  861
             +  P      +  R YS                H S      M+ E  +Y E   E KDV
Sbjct  120   ETLPQTATQRSKSRGYS----------------HSS------MDDEVQKYQELSREYKDV  157

Query  862   YEVWQNRHDMNSMRSKSPQMGRCNETSTDKVAFVRQKFIEAKCLSLDEKCHHSRQFQDAL  1041
             YE WQ+   ++S R  SP+ GR +E++T+K   VRQKF EAK L  D+  H S++FQ+AL
Sbjct  158   YETWQSPQKVSSSRDSSPRKGRYDESATEK--LVRQKFAEAKRLVTDDSLHQSKEFQEAL  215

Query  1042  EVLSSNTDLVLKFLQEPKPMLSEHIYNLQSIPA-PSETKRITVLKPSKMVDN  1194
             EVLSS+ DL +K LQE       + ++ QS+P   SE KRITVL+PSK V+ 
Sbjct  216   EVLSSHKDLFVKLLQE------SNSFSQQSVPTHQSEAKRITVLRPSKAVET  261



>ref|XP_011024529.1| PREDICTED: uncharacterized protein LOC105125670 isoform X3 [Populus 
euphratica]
 ref|XP_011024530.1| PREDICTED: uncharacterized protein LOC105125670 isoform X3 [Populus 
euphratica]
Length=937

 Score =   225 bits (574),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 127/232 (55%), Positives = 160/232 (69%), Gaps = 6/232 (3%)
 Frame = +1

Query  514   PSEDQIEDKEIVSELRRNNSKMKANGTPMKMLIAEEMSKDMASKHNPPSVVAKLMGLDGF  693
             P  DQ+EDK IVSELRR++   KAN TPMK LIA+EMSK++ SKHNPP++VAKLMGLD  
Sbjct  5     PFGDQVEDKMIVSELRRSSLNKKANATPMKTLIAQEMSKEVESKHNPPNLVAKLMGLDTL  64

Query  694   PSQLPVSTA-QRNYS---GRNAQSAKGTPLNNFHHRSGSLDTQMECEFYQYPEQNECKDV  861
             P Q PV+ A QR++S    R + S     + ++      LD QM  E +   E++E KDV
Sbjct  65    PHQQPVAAAAQRSHSRGYSRRSLSHSEIFVESWDEDHSCLDKQMPSEGHPREERSEYKDV  124

Query  862   YEVWQNRHDMNSMRSKSPQMGRCNE-TSTDKVAFVRQKFIEAKCLSLDEKCHHSRQFQDA  1038
             YE+WQ       +R  SPQ    NE  +T K+A VRQKF+EAK LS DEK   SR+FQDA
Sbjct  125   YEIWQQSQK-TMVRHSSPQKRNHNENVNTKKMALVRQKFMEAKRLSTDEKGRQSREFQDA  183

Query  1039  LEVLSSNTDLVLKFLQEPKPMLSEHIYNLQSIPAPSETKRITVLKPSKMVDN  1194
             LEVLSSN DL LKFLQEP  + S+H++++QS+P   ETK ITVL+PSK+VDN
Sbjct  184   LEVLSSNKDLFLKFLQEPNSLFSQHLHDMQSMPPSPETKHITVLRPSKVVDN  235



>ref|NP_567819.1| uncharacterized protein [Arabidopsis thaliana]
 ref|NP_974633.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AAK93687.1| unknown protein [Arabidopsis thaliana]
 gb|AAM44897.1| unknown protein [Arabidopsis thaliana]
 gb|AEE85538.1| uncharacterized protein AT4G28760 [Arabidopsis thaliana]
 gb|AEE85539.1| uncharacterized protein AT4G28760 [Arabidopsis thaliana]
Length=924

 Score =   223 bits (569),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 138/287 (48%), Positives = 185/287 (64%), Gaps = 15/287 (5%)
 Frame = +1

Query  334   MYAVQNGKNRGLEKPIPGCLGRMVNLFDLNGGVAGNRLLTDKPHRDGS-LSRSQSDVARM  510
             M  ++  K + +E P+PGCLG+MVNLFDL   V GN+LLTDKPH DGS LSRS+SDV RM
Sbjct  1     MNELRGRKAQKIESPVPGCLGKMVNLFDLGIAVNGNKLLTDKPHLDGSSLSRSRSDVTRM  60

Query  511   -SPS-EDQIEDKEIVSELRRNNSKMKANGTPMKMLIAEEMSKDMASKHNPPSVVAKLMGL  684
               PS +   E + I+S+LRR+ S  K +GTPMK LIA EMSK++  K +P +VVAKLMGL
Sbjct  61    PGPSYKGHSEAELIMSDLRRSASS-KLSGTPMKKLIAREMSKEVEHKQSPTNVVAKLMGL  119

Query  685   DGFPSQLPVSTAQRNYSGRNAQSAKGTPLNNFHHRSGSLDTQMECEFYQYPEQNECKDVY  864
             +  P     +  QR+ S  N+ S+    + +         T  E + YQ   + E KDVY
Sbjct  120   ETLPQTHQETATQRSKSRSNSHSSLNHSMTS---------TDNEVQKYQDFSR-EFKDVY  169

Query  865   EVWQNRHDMNSMRSKSPQMGRCNETSTDK-VAFVRQKFIEAKCLSLDEKCHHSRQFQDAL  1041
             E WQ+   ++  R  SP+ GR +E++T+K +A VRQKF EAK L  D+  H S++FQDAL
Sbjct  170   ETWQSPQKVSRSRDCSPRKGRYDESTTEKQMALVRQKFSEAKRLVTDDSLHQSKEFQDAL  229

Query  1042  EVLSSNTDLVLKFLQEPKPMLSEHIYNLQSIPAPSETKRITVLKPSK  1182
             EVLSSN DL ++FLQE      +++ +   +P  SE KRITVL+PSK
Sbjct  230   EVLSSNKDLFVQFLQESNSFSQQNLSDFHHVPPHSEAKRITVLRPSK  276



>emb|CDY06873.1| BnaC01g09720D [Brassica napus]
Length=845

 Score =   223 bits (568),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 140/292 (48%), Positives = 181/292 (62%), Gaps = 36/292 (12%)
 Frame = +1

Query  334   MYAVQNGKNRGLEKPIPGCLGRMVNLFDLNGGVAGNRLLTDKPHRDG-SLSRSQSDVARM  510
             M  ++  K + +E P+PGCLGRMVNLFDL   V GN++LTDKPHRDG SLSRS+SDV+RM
Sbjct  1     MNELRGRKVQKIESPVPGCLGRMVNLFDLGTAVNGNKMLTDKPHRDGSSLSRSRSDVSRM  60

Query  511   S-PS-EDQIEDKEIVSELRRNNSKMKANGTPMKMLIAEEMSKDMASKHNPPSVVAKLMGL  684
               PS +   E + I+S+LRR  S  KA+GTPMK LIA EMSK++  K +P +VVAKLMGL
Sbjct  61    PIPSYKGHSEPELIMSDLRRTASS-KASGTPMKKLIAREMSKEVEPKQSPTNVVAKLMGL  119

Query  685   DGFPSQLPVSTAQRNYSGRNAQSAKGTPLNNFHHRSGSLDTQMECEFYQYPE-QNECKDV  861
             +  P      +  R YS                H S      M+ E  +Y E   E KDV
Sbjct  120   ETLPQTATQRSKSRGYS----------------HSS------MDDEIQKYQELSREYKDV  157

Query  862   YEVWQNRHDMNSMRSKSPQMGRCNETSTDKVAFVRQKFIEAKCLSLDEKCHHSRQFQDAL  1041
             YE WQ    ++S R   P+ GR +E++T+K   VRQKF EAK L  D+  H S++FQ+AL
Sbjct  158   YETWQLPQKVSSSRDSPPRKGRYDESATEK--LVRQKFAEAKRLVTDDSLHQSKEFQEAL  215

Query  1042  EVLSSNTDLVLKFLQEPKPMLSEHIYNLQSIPA-PSETKRITVLKPSKMVDN  1194
             EVLSSN DL +K LQE       + ++ Q++P   SE KRITVL+PSK V+ 
Sbjct  216   EVLSSNKDLFVKLLQE------SNSFSQQTVPTHQSEAKRITVLRPSKAVET  261



>dbj|BAH19995.1| AT4G28760 [Arabidopsis thaliana]
Length=924

 Score =   223 bits (569),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 138/287 (48%), Positives = 185/287 (64%), Gaps = 15/287 (5%)
 Frame = +1

Query  334   MYAVQNGKNRGLEKPIPGCLGRMVNLFDLNGGVAGNRLLTDKPHRDGS-LSRSQSDVARM  510
             M  ++  K + +E P+PGCLG+MVNLFDL   V GN+LLTDKPH DGS LSRS+SDV RM
Sbjct  1     MNELRGRKAQKIESPVPGCLGKMVNLFDLGIAVNGNKLLTDKPHLDGSSLSRSRSDVTRM  60

Query  511   -SPS-EDQIEDKEIVSELRRNNSKMKANGTPMKMLIAEEMSKDMASKHNPPSVVAKLMGL  684
               PS +   E + I+S+LRR+ S  K +GTPMK LIA EMSK++  K +P +VVAKLMGL
Sbjct  61    PGPSYKGHSEAELIMSDLRRSASS-KLSGTPMKKLIAREMSKEVEHKQSPTNVVAKLMGL  119

Query  685   DGFPSQLPVSTAQRNYSGRNAQSAKGTPLNNFHHRSGSLDTQMECEFYQYPEQNECKDVY  864
             +  P     +  QR+ S  N+ S+    + +         T  E + YQ   + E KDVY
Sbjct  120   ETLPQTHQETATQRSKSRSNSHSSLNHSMTS---------TDNEVQKYQDFSR-EFKDVY  169

Query  865   EVWQNRHDMNSMRSKSPQMGRCNETSTDK-VAFVRQKFIEAKCLSLDEKCHHSRQFQDAL  1041
             E WQ+   ++  R  SP+ GR +E++T+K +A VRQKF EAK L  D+  H S++FQDAL
Sbjct  170   ETWQSPQKVSRSRDCSPRKGRYDESTTEKQMALVRQKFSEAKRLVTDDSLHQSKEFQDAL  229

Query  1042  EVLSSNTDLVLKFLQEPKPMLSEHIYNLQSIPAPSETKRITVLKPSK  1182
             EVLSSN DL ++FLQE      +++ +   +P  SE KRITVL+PSK
Sbjct  230   EVLSSNKDLFVQFLQESNSFSQQNLSDFHHVPPHSEAKRITVLRPSK  276



>ref|XP_010526471.1| PREDICTED: uncharacterized protein LOC104804028 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010526472.1| PREDICTED: uncharacterized protein LOC104804028 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010526473.1| PREDICTED: uncharacterized protein LOC104804028 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010526474.1| PREDICTED: uncharacterized protein LOC104804028 isoform X1 [Tarenaya 
hassleriana]
Length=882

 Score =   220 bits (561),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 133/286 (47%), Positives = 170/286 (59%), Gaps = 46/286 (16%)
 Frame = +1

Query  355   KNRGLEKPIPGCLGRMVNLFDLNGGVAGNRLLTDKPHRDGS-LSRSQSDVARM-SPS-ED  525
             K + +E P+PGCLG MVNLF L+    GN+ LTDKPH D S LSRS+SDV +M SPS  D
Sbjct  7     KVQNMESPVPGCLGSMVNLFVLDATARGNKFLTDKPHNDASSLSRSRSDVVQMLSPSFGD  66

Query  526   QIEDKEIVSELRRNNSKMKANGTPMKMLIAEEMSKDMASKHNPPSVVAKLMGLDGFPS-Q  702
               E + ++S LRR+ S  + NGTPMK LIA EMSK++  K NP +VVAKLMGLD  P  Q
Sbjct  67    HTEAELVLSNLRRSASD-EVNGTPMKKLIAREMSKEVERKQNPTNVVAKLMGLDTLPQLQ  125

Query  703   LPVSTAQRNYSGRNAQSAKGTPLNNFHHRSGSLDTQMECEFYQYPEQNECKDVYEVWQNR  882
             L  + +Q++Y                                        +D YE+WQ  
Sbjct  126   LDNTASQQSY----------------------------------------EDAYEMWQPP  145

Query  883   HDMNSMRSKSPQMGRCNETSTDK-VAFVRQKFIEAKCLSLDEKCHHSRQFQDALEVLSSN  1059
               +N  R  S + G+ +E   +K +A VR+KF+EAK L  DEK H S++FQDALEVLSSN
Sbjct  146   QKVNRSRDSSSRKGKNDEAMREKQIALVREKFMEAKRLVTDEKLHQSKEFQDALEVLSSN  205

Query  1060  TDLVLKFLQEPKPMLSEHIYNLQSIPAPSETKRITVLKPSKMVDNC  1197
              DL +KFLQE    LS+H+ + Q +P   ETKRITVL+PSK VD  
Sbjct  206   KDLFVKFLQESNSFLSQHLSDYQPVPPHLETKRITVLRPSKAVDTA  251



>ref|XP_008809664.1| PREDICTED: uncharacterized protein LOC103721293 isoform X4 [Phoenix 
dactylifera]
Length=986

 Score =   219 bits (559),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 131/293 (45%), Positives = 184/293 (63%), Gaps = 9/293 (3%)
 Frame = +1

Query  334   MYAVQNGKNRGLEKPIPGCLGRMVNLFDLNG-GVAGNRLLTDKPHRDGS-LSRSQSDVAR  507
             M   Q  K + L+KP P C+GRM+N+FDL+  G+AG +LLTDK HRDGS + R+Q DV +
Sbjct  1     MSGFQQRKVQDLQKPFPSCMGRMINIFDLSSTGMAGTKLLTDKAHRDGSPVHRNQPDVKK  60

Query  508   -MSPSEDQIEDKEIVSELRRNNSKMKANGTPMKMLIAEEMSKDMASKHNPPSVVAKLMGL  684
              + P+   ++ K+I S+LR+++S  K+ GT +KMLIA+EMSK       PPSVVA+LMGL
Sbjct  61    ALHPAGLYVDGKQIASDLRKSSSIKKSGGTLVKMLIAQEMSKQTELNRKPPSVVARLMGL  120

Query  685   DG-FPSQLPVSTA-QRNYSGRNAQSAKGTPLNNFHHRSGS-LDTQMECEFYQYPEQNECK  855
             D   P+  PV  A +RN     +++    P      +     +  M CE     E+ E +
Sbjct  121   DDDLPATKPVLVANKRNTQEGYSRTTLTGPFQGHKQQEDVYFNKPMPCENAH--EKMEYR  178

Query  856   DVYEVWQNRHDMNSMRSKSPQMGRCNETSTDK-VAFVRQKFIEAKCLSLDEKCHHSRQFQ  1032
             DV+EVWQ     N ++ +  Q GR N+   +K +A VRQKF+EAK L+ DE+   S++FQ
Sbjct  179   DVFEVWQQPSRTNRIKDQPLQKGRYNKDQNEKRMALVRQKFMEAKRLATDERLLQSKEFQ  238

Query  1033  DALEVLSSNTDLVLKFLQEPKPMLSEHIYNLQSIPAPSETKRITVLKPSKMVD  1191
             DALEVLSSN DL +KFL+EP  + S+ I  L  +P   +T+ ITVLKPSK V+
Sbjct  239   DALEVLSSNKDLFIKFLEEPNSLFSKQIRELYMVPPAPQTQCITVLKPSKTVE  291



>ref|XP_008809662.1| PREDICTED: uncharacterized protein LOC103721293 isoform X2 [Phoenix 
dactylifera]
Length=1003

 Score =   219 bits (559),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 131/302 (43%), Positives = 187/302 (62%), Gaps = 9/302 (3%)
 Frame = +1

Query  310   FALLRHSEMYAVQNGKNRGLEKPIPGCLGRMVNLFDLNG-GVAGNRLLTDKPHRDGS-LS  483
             + +   + M   Q  K + L+KP P C+GRM+N+FDL+  G+AG +LLTDK HRDGS + 
Sbjct  10    WGIKEGAVMSGFQQRKVQDLQKPFPSCMGRMINIFDLSSTGMAGTKLLTDKAHRDGSPVH  69

Query  484   RSQSDVAR-MSPSEDQIEDKEIVSELRRNNSKMKANGTPMKMLIAEEMSKDMASKHNPPS  660
             R+Q DV + + P+   ++ K+I S+LR+++S  K+ GT +KMLIA+EMSK       PPS
Sbjct  70    RNQPDVKKALHPAGLYVDGKQIASDLRKSSSIKKSGGTLVKMLIAQEMSKQTELNRKPPS  129

Query  661   VVAKLMGLDG-FPSQLPVSTA-QRNYSGRNAQSAKGTPLNNFHHRSGS-LDTQMECEFYQ  831
             VVA+LMGLD   P+  PV  A +RN     +++    P      +     +  M CE   
Sbjct  130   VVARLMGLDDDLPATKPVLVANKRNTQEGYSRTTLTGPFQGHKQQEDVYFNKPMPCENAH  189

Query  832   YPEQNECKDVYEVWQNRHDMNSMRSKSPQMGRCNETSTDK-VAFVRQKFIEAKCLSLDEK  1008
               E+ E +DV+EVWQ     N ++ +  Q GR N+   +K +A VRQKF+EAK L+ DE+
Sbjct  190   --EKMEYRDVFEVWQQPSRTNRIKDQPLQKGRYNKDQNEKRMALVRQKFMEAKRLATDER  247

Query  1009  CHHSRQFQDALEVLSSNTDLVLKFLQEPKPMLSEHIYNLQSIPAPSETKRITVLKPSKMV  1188
                S++FQDALEVLSSN DL +KFL+EP  + S+ I  L  +P   +T+ ITVLKPSK V
Sbjct  248   LLQSKEFQDALEVLSSNKDLFIKFLEEPNSLFSKQIRELYMVPPAPQTQCITVLKPSKTV  307

Query  1189  DN  1194
             + 
Sbjct  308   ET  309



>ref|XP_008461986.1| PREDICTED: uncharacterized protein LOC103500466 [Cucumis melo]
 ref|XP_008461987.1| PREDICTED: uncharacterized protein LOC103500466 [Cucumis melo]
Length=970

 Score =   216 bits (550),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 143/305 (47%), Positives = 174/305 (57%), Gaps = 56/305 (18%)
 Frame = +1

Query  370   EKPIPGCLGRMVNLFDLNGGVAGNRLLTDKPHRDGSL-SRSQSDVARMS-PSED-QIEDK  540
             EKP PGCLGRMVNLFDL+ GV+ N+LLTDKPHRD SL  RS SD A +S PS D QIED 
Sbjct  14    EKPFPGCLGRMVNLFDLSAGVSRNKLLTDKPHRDVSLLRRSHSDAAIISSPSHDSQIEDG  73

Query  541   EIVSELRRNNSKMKANGTPMKMLIAEEMSKDMASKHNPPSVVAKLMGLDGFPSQLPVSTA  720
                      +S  +AN TPMKMLI  EMSKD  SK  PP+VVAKLMGLD  P Q+     
Sbjct  74    -------LEHSIGQANRTPMKMLIDHEMSKDAESKIAPPNVVAKLMGLDTLPEQV-----  121

Query  721   QRNYSGRNAQSAKGTPLNNFHH------RSGSLDTQME--------------------CE  822
                       +A  TP  N +H        GSL T  E                    C+
Sbjct  122   --------GSAANKTPSPNGYHLVPPIPSRGSLSTAKESRLPLECTEPVDNRLEKGALCQ  173

Query  823   FYQYPEQNECKDVYEVWQNRHDMNSMRSKSPQMGRCNETSTDK-VAFVRQKFIEAKCLSL  999
              +Q        DVY +WQ     N+ R K  Q G  ++   +K +A VRQKF EAK L+ 
Sbjct  174   IHQ-----SSVDVYGIWQQCLKTNNDREKV-QYGSFDKNFDEKKMALVRQKFTEAKRLAT  227

Query  1000  DEKCHHSRQFQDALEVLSSNTDLVLKFLQEPKPMLSEHIYNLQSIPAPSETKRITVLKPS  1179
             DEK   S++FQDALEVLSSN +L +KFLQEP  + S+H + L+S+P   E K IT+L+PS
Sbjct  228   DEKLRQSKEFQDALEVLSSNKELFVKFLQEPNSLFSQHSFQLRSLPTSPEKKCITILRPS  287

Query  1180  KMVDN  1194
             K+V N
Sbjct  288   KLVGN  292



>ref|XP_010038329.1| PREDICTED: uncharacterized protein LOC104426860 [Eucalyptus grandis]
 ref|XP_010038330.1| PREDICTED: uncharacterized protein LOC104426860 [Eucalyptus grandis]
 ref|XP_010038331.1| PREDICTED: uncharacterized protein LOC104426860 [Eucalyptus grandis]
 ref|XP_010038332.1| PREDICTED: uncharacterized protein LOC104426860 [Eucalyptus grandis]
 ref|XP_010038333.1| PREDICTED: uncharacterized protein LOC104426860 [Eucalyptus grandis]
 ref|XP_010038334.1| PREDICTED: uncharacterized protein LOC104426860 [Eucalyptus grandis]
 gb|KCW50152.1| hypothetical protein EUGRSUZ_K03587 [Eucalyptus grandis]
Length=974

 Score =   215 bits (548),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 145/300 (48%), Positives = 183/300 (61%), Gaps = 26/300 (9%)
 Frame = +1

Query  334   MYAVQNGKNRGLEKPIPGCLGRMVNLFDLNGGVAGNRLLTDKPHRDGS-LSRSQSDVARM  510
             MY+ QN K    EK  PGCLGR+VNLFDL+ GV  NRLLTDKPH  GS +SRS SD+A M
Sbjct  1     MYSSQNRKVHNFEKQFPGCLGRVVNLFDLSAGVTSNRLLTDKPHPYGSSISRSLSDMATM  60

Query  511   -SPS-EDQIEDKEIVSELRRNNSKMKANGTPMKMLIAEEMSKDMASKHNPPSVVAKLMGL  684
              +P+  DQ E+K IV   RR +S   + GTPMKMLIAEEMSK++ SKH PP+V+AKLMGL
Sbjct  61    LAPTFGDQTEEKGIVLNSRRISSSRNSMGTPMKMLIAEEMSKEVGSKHCPPNVIAKLMGL  120

Query  685   DGFPSQLPVSTAQRNYSGRNAQSAKGTPLNN-------FHHRSGSLDTQMECEFYQYPEQ  843
             D  P Q P S  +R+ S  + Q      L N       +    G LD Q++ E  +Y E+
Sbjct  121   DALPEQQPHSVNRRSQSEGSMQHR----LENLEITAEYWQRDRGFLDKQLQHEVLKY-EE  175

Query  844   NECKDVYEVWQNRHDMNSMRSKSPQMGRCNE-TSTDKVAFVRQKFIEAKCLSLDEKCHHS  1020
              + KD YE+   +   NS+  K  Q GR  + T+  K+A VRQ F E K L+ DE    S
Sbjct  176   TDYKDFYEL-SPQSKKNSVSGKQQQKGRYRDCTNEKKMAIVRQNFKELKRLATDENLWES  234

Query  1021  RQFQDALEVL--SSNTDLVLKFLQEPKPMLSEHIYNLQSIPAPSETKRITVLKPSKMVDN  1194
             ++F +ALEVL  SSN DL  K        LS H+  LQ I  P ETKRIT+L+PS M+D+
Sbjct  235   KEFHNALEVLSSSSNKDLFYK-------CLSNHLDELQHISMPLETKRITILRPSNMIDD  287



>ref|XP_011024531.1| PREDICTED: uncharacterized protein LOC105125670 isoform X4 [Populus 
euphratica]
 ref|XP_011024532.1| PREDICTED: uncharacterized protein LOC105125670 isoform X4 [Populus 
euphratica]
Length=932

 Score =   214 bits (546),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 121/223 (54%), Positives = 154/223 (69%), Gaps = 6/223 (3%)
 Frame = +1

Query  541   EIVSELRRNNSKMKANGTPMKMLIAEEMSKDMASKHNPPSVVAKLMGLDGFPSQLPVSTA  720
             +IVSELRR++   KAN TPMK LIA+EMSK++ SKHNPP++VAKLMGLD  P Q PV+ A
Sbjct  9     QIVSELRRSSLNKKANATPMKTLIAQEMSKEVESKHNPPNLVAKLMGLDTLPHQQPVAAA  68

Query  721   -QRNYS---GRNAQSAKGTPLNNFHHRSGSLDTQMECEFYQYPEQNECKDVYEVWQNRHD  888
              QR++S    R + S     + ++      LD QM  E +   E++E KDVYE+WQ    
Sbjct  69    AQRSHSRGYSRRSLSHSEIFVESWDEDHSCLDKQMPSEGHPREERSEYKDVYEIWQQSQK  128

Query  889   MNSMRSKSPQMGRCNE-TSTDKVAFVRQKFIEAKCLSLDEKCHHSRQFQDALEVLSSNTD  1065
                +R  SPQ    NE  +T K+A VRQKF+EAK LS DEK   SR+FQDALEVLSSN D
Sbjct  129   -TMVRHSSPQKRNHNENVNTKKMALVRQKFMEAKRLSTDEKGRQSREFQDALEVLSSNKD  187

Query  1066  LVLKFLQEPKPMLSEHIYNLQSIPAPSETKRITVLKPSKMVDN  1194
             L LKFLQEP  + S+H++++QS+P   ETK ITVL+PSK+VDN
Sbjct  188   LFLKFLQEPNSLFSQHLHDMQSMPPSPETKHITVLRPSKVVDN  230



>ref|XP_008809661.1| PREDICTED: uncharacterized protein LOC103721293 isoform X1 [Phoenix 
dactylifera]
Length=1007

 Score =   214 bits (544),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 131/306 (43%), Positives = 187/306 (61%), Gaps = 13/306 (4%)
 Frame = +1

Query  310   FALLRHSEMYAVQNGKNRGLEKPIPGCLGRMVNLFDLNG-GVAGNRLLTDKPHRDGS-LS  483
             + +   + M   Q  K + L+KP P C+GRM+N+FDL+  G+AG +LLTDK HRDGS + 
Sbjct  10    WGIKEGAVMSGFQQRKVQDLQKPFPSCMGRMINIFDLSSTGMAGTKLLTDKAHRDGSPVH  69

Query  484   RSQSDVAR-MSPSEDQIEDKE----IVSELRRNNSKMKANGTPMKMLIAEEMSKDMASKH  648
             R+Q DV + + P+   ++ K+    I S+LR+++S  K+ GT +KMLIA+EMSK      
Sbjct  70    RNQPDVKKALHPAGLYVDGKQTSVQIASDLRKSSSIKKSGGTLVKMLIAQEMSKQTELNR  129

Query  649   NPPSVVAKLMGLDG-FPSQLPVSTA-QRNYSGRNAQSAKGTPLNNFHHRSGS-LDTQMEC  819
              PPSVVA+LMGLD   P+  PV  A +RN     +++    P      +     +  M C
Sbjct  130   KPPSVVARLMGLDDDLPATKPVLVANKRNTQEGYSRTTLTGPFQGHKQQEDVYFNKPMPC  189

Query  820   EFYQYPEQNECKDVYEVWQNRHDMNSMRSKSPQMGRCNETSTDK-VAFVRQKFIEAKCLS  996
             E     E+ E +DV+EVWQ     N ++ +  Q GR N+   +K +A VRQKF+EAK L+
Sbjct  190   ENAH--EKMEYRDVFEVWQQPSRTNRIKDQPLQKGRYNKDQNEKRMALVRQKFMEAKRLA  247

Query  997   LDEKCHHSRQFQDALEVLSSNTDLVLKFLQEPKPMLSEHIYNLQSIPAPSETKRITVLKP  1176
              DE+   S++FQDALEVLSSN DL +KFL+EP  + S+ I  L  +P   +T+ ITVLKP
Sbjct  248   TDERLLQSKEFQDALEVLSSNKDLFIKFLEEPNSLFSKQIRELYMVPPAPQTQCITVLKP  307

Query  1177  SKMVDN  1194
             SK V+ 
Sbjct  308   SKTVET  313



>ref|XP_008809663.1| PREDICTED: uncharacterized protein LOC103721293 isoform X3 [Phoenix 
dactylifera]
Length=990

 Score =   213 bits (543),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 131/297 (44%), Positives = 184/297 (62%), Gaps = 13/297 (4%)
 Frame = +1

Query  334   MYAVQNGKNRGLEKPIPGCLGRMVNLFDLNG-GVAGNRLLTDKPHRDGS-LSRSQSDVAR  507
             M   Q  K + L+KP P C+GRM+N+FDL+  G+AG +LLTDK HRDGS + R+Q DV +
Sbjct  1     MSGFQQRKVQDLQKPFPSCMGRMINIFDLSSTGMAGTKLLTDKAHRDGSPVHRNQPDVKK  60

Query  508   -MSPSEDQIEDKE----IVSELRRNNSKMKANGTPMKMLIAEEMSKDMASKHNPPSVVAK  672
              + P+   ++ K+    I S+LR+++S  K+ GT +KMLIA+EMSK       PPSVVA+
Sbjct  61    ALHPAGLYVDGKQTSVQIASDLRKSSSIKKSGGTLVKMLIAQEMSKQTELNRKPPSVVAR  120

Query  673   LMGLDG-FPSQLPVSTA-QRNYSGRNAQSAKGTPLNNFHHRSGS-LDTQMECEFYQYPEQ  843
             LMGLD   P+  PV  A +RN     +++    P      +     +  M CE     E+
Sbjct  121   LMGLDDDLPATKPVLVANKRNTQEGYSRTTLTGPFQGHKQQEDVYFNKPMPCENAH--EK  178

Query  844   NECKDVYEVWQNRHDMNSMRSKSPQMGRCNETSTDK-VAFVRQKFIEAKCLSLDEKCHHS  1020
              E +DV+EVWQ     N ++ +  Q GR N+   +K +A VRQKF+EAK L+ DE+   S
Sbjct  179   MEYRDVFEVWQQPSRTNRIKDQPLQKGRYNKDQNEKRMALVRQKFMEAKRLATDERLLQS  238

Query  1021  RQFQDALEVLSSNTDLVLKFLQEPKPMLSEHIYNLQSIPAPSETKRITVLKPSKMVD  1191
             ++FQDALEVLSSN DL +KFL+EP  + S+ I  L  +P   +T+ ITVLKPSK V+
Sbjct  239   KEFQDALEVLSSNKDLFIKFLEEPNSLFSKQIRELYMVPPAPQTQCITVLKPSKTVE  295



>ref|XP_004139729.1| PREDICTED: uncharacterized protein LOC101207165 [Cucumis sativus]
 gb|KGN44553.1| hypothetical protein Csa_7G329380 [Cucumis sativus]
Length=960

 Score =   213 bits (542),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 142/296 (48%), Positives = 175/296 (59%), Gaps = 29/296 (10%)
 Frame = +1

Query  334   MYAVQNGKNRG-LEKPIPGCLGRMVNLFDLNGGVAGNRLLTDKPHRDGSL-SRSQSDVAR  507
             M  +Q  K R   EKP PGCLGRMVNLFDL+ GV+ N+LLTDKPHRD SL  RS SD A 
Sbjct  1     MKEIQRRKVRSNTEKPFPGCLGRMVNLFDLSAGVSRNKLLTDKPHRDVSLLPRSHSDAAI  60

Query  508   MS-PSED-QIEDKEIVSELRRNNSKMKANGTPMKMLIAEEMSKDMASKHNPPSVVAKLMG  681
             +S PS D Q+ED          +S  +AN TPMKMLI  EMSKD  SK  PP+VVAKLMG
Sbjct  61    ISSPSHDSQLEDG-------LEHSIGQANRTPMKMLIDHEMSKDAESKIAPPNVVAKLMG  113

Query  682   LDGFPSQLPVSTAQRNYSGRNAQSAKG-------TPLNNFHHRSGSLDTQMECEFYQYPE  840
             LD  P Q+  S A +  S  +  +AK        T L +     GSL     C+ +Q   
Sbjct  114   LDTLPEQVG-SAANKTPSRASLSTAKESRLALECTELVDNRLEKGSL-----CQIHQ---  164

Query  841   QNECKDVYEVWQNRHDMNSMRSKSPQMGRCNETSTDKVAFVRQKFIEAKCLSLDEKCHHS  1020
                  DVY +WQ     ++ R K             K+A VRQKF EAK L+ DEK   S
Sbjct  165   --SSVDVYGMWQQCLKTDNDREKLHYGSFDKNFDEKKMALVRQKFTEAKRLATDEKLRQS  222

Query  1021  RQFQDALEVLSSNTDLVLKFLQEPKPMLSEHIYNLQSIPAPSETKRITVLKPSKMV  1188
             ++FQDALEVLSSN +L +KFLQEP  + S+H + L+S+P   E K IT+L+PSK+V
Sbjct  223   KEFQDALEVLSSNKELFVKFLQEPNSLFSQHSFQLRSLPTSPEKKCITILRPSKLV  278



>ref|XP_009411376.1| PREDICTED: uncharacterized protein LOC103993144 [Musa acuminata 
subsp. malaccensis]
Length=932

 Score =   210 bits (535),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 127/275 (46%), Positives = 178/275 (65%), Gaps = 25/275 (9%)
 Frame = +1

Query  400   MVNLFDLNGGVAGNRLLTDKPHRDG-SLSRSQSDVAR-MSPSEDQIEDKEIVSELRRNNS  573
             M+N+FD + GVAGN++LT++PHRDG  ++R++ D  +  +PS  + +DK+I ++L++N S
Sbjct  1     MINIFDFSAGVAGNKMLTERPHRDGFPVNRNKHDARKATTPSGTKADDKQIANDLKQNLS  60

Query  574   KMKANGTPMKMLIAEEMSKDMASKHNPPSVVAKLMGLD----GFPSQLPVSTAQRNYSGR  741
               KA+GTPMKMLIA+EMSK+  S   PPSVVA+LMGLD    G P   P+S+ ++   G 
Sbjct  61    SKKASGTPMKMLIAQEMSKETESIRKPPSVVARLMGLDDDLTGQP--FPMSSQRKLLEGY  118

Query  742   NAQSAKGTPLNNFHHRSGSLDTQMECEFYQYP----EQNECKDVYEVWQNRHDMNSMRSK  909
               ++  G    N  HR    D   +   YQ+     E+ E +DV +VWQ        +  
Sbjct  119   PQRATAGV---NRDHRQRQ-DVFNKAVPYQHHRHDHEKMEHRDVRKVWQ--------QPS  166

Query  910   SPQMGRCNETSTD-KVAFVRQKFIEAKCLSLDEKCHHSRQFQDALEVLSSNTDLVLKFLQ  1086
               + GRC E  T+ ++A VRQKF+EAK L+  E   H+++FQDALEVLSSN DL LKFL+
Sbjct  167   WSRNGRCGENQTELRMALVRQKFMEAKRLAAHENLLHTKEFQDALEVLSSNRDLFLKFLE  226

Query  1087  EPKPMLSEHIYNLQSIPAPSETKRITVLKPSKMVD  1191
             EP  +LS+   +L SIP P +TKRITVLKPSK V+
Sbjct  227   EPNSLLSKQTSDLHSIPPPPQTKRITVLKPSKKVE  261



>ref|XP_006375643.1| hypothetical protein POPTR_0014s18540g [Populus trichocarpa]
 gb|ERP53440.1| hypothetical protein POPTR_0014s18540g [Populus trichocarpa]
Length=951

 Score =   209 bits (533),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 129/273 (47%), Positives = 168/273 (62%), Gaps = 28/273 (10%)
 Frame = +1

Query  379   IPGCLGRMVNLFDLNGGVAGNRLLTDKPHRDGSLSRSQSDVARMSPS--EDQIEDKEIVS  552
              PGCLGRMVNLF L+ GVAGNRLL            SQSDVARM  +    + EDK IVS
Sbjct  10    FPGCLGRMVNLFYLSNGVAGNRLLKS--------VYSQSDVARMLSALFGGKTEDKMIVS  61

Query  553   ELRRNNSKMKANGTPMKMLIAEEMSKDMASKHNPPSVVAKLMGLDGFPSQLPVSTAQRNY  732
             ELRR++S  KANGTP+K L A+E+SK++ SKHN P +            Q P++  +R++
Sbjct  62    ELRRSSSNKKANGTPVKTLTAQELSKEVESKHNSPQLGC----------QQPIAATRRSH  111

Query  733   S---GRNAQSAKGTPLNNFHHRSGSLDTQMECEFYQYPEQNECKDVYEVWQNRHDMNSMR  903
             S    R + S  G  + ++      LD Q  CE +   EQ+E KDVY++WQ   +   +R
Sbjct  112   SRGYSRCSLSHSGILVESWDEDHSFLDKQRPCEGHLCQEQSEYKDVYKIWQQSKN-TILR  170

Query  904   SKSPQMGRCNETSTDKVAFVRQKFIEAKCLSLDEKCHHSRQFQDALEVLSSNTDLVLKFL  1083
               SPQ G  N   +  +A VR KF+EAK LS DEK   S++FQDALE   SN DL LKFL
Sbjct  171   DSSPQKG--NHNGSKMMALVRLKFMEAKRLSTDEKGCQSKEFQDALE--GSNKDLFLKFL  226

Query  1084  QEPKPMLSEHIYNLQSIPAPSETKRITVLKPSK  1182
             QEP  + S+H+++LQ +P   ET+RITVL+PSK
Sbjct  227   QEPNSLFSQHLHDLQCMPPSPETRRITVLRPSK  259



>ref|XP_010540953.1| PREDICTED: uncharacterized protein LOC104814547 isoform X2 [Tarenaya 
hassleriana]
Length=834

 Score =   208 bits (529),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 133/279 (48%), Positives = 164/279 (59%), Gaps = 34/279 (12%)
 Frame = +1

Query  367   LEKPIPGCLGRMVNLFDLNGGVAGNRLLTDKPHR-DGSLSRSQSDVARMS--PSEDQIED  537
             +E P+PGCLGRMVNLFDL    +GN+LLTDKPHR   SLSRSQSDVA+M   PS D  ED
Sbjct  12    MENPVPGCLGRMVNLFDLGTAGSGNKLLTDKPHRYASSLSRSQSDVAQMPSPPSGDHTED  71

Query  538   KEIVSELRRNNSKMKANGTPMKMLIAEEMSKDMASKHNPPSVVAKLMGLDGFPSQLPVST  717
             + I+S LRR+ S    NGTPMK LIA+EMSK+   K +P +VVAKLMGLD FP QL +  
Sbjct  72    ELIMSNLRRSAS----NGTPMKKLIAQEMSKE-EHKQSPTNVVAKLMGLDTFP-QLQLDN  125

Query  718   AQRNYSGRNAQSAKGTPLNNFHHRSGSLDTQMECEFYQYPEQNECKDVYEVWQNRHDMNS  897
                              ++     S                  E KDV E+WQ   + N 
Sbjct  126   T----------------ISQSSKSSSYSRYSPSNSGSSLESSRELKDVCEMWQLPQNANR  169

Query  898   MRSKSPQMGRCNETSTDKV-AFVRQKFIEAKCLSLDEKCHHSRQFQDALEVLSSNTDLVL  1074
              R         +E  T+K    VR+KF+E K L  DEK H S++FQDA+EVLSSN DL +
Sbjct  170   SRD--------DEIMTEKQRDIVRKKFMEGKRLVTDEKLHQSKEFQDAVEVLSSNKDLFV  221

Query  1075  KFLQEPKPMLSEHIYNLQSIPAPSETKRITVLKPSKMVD  1191
             KFLQE     S+H+ + Q +P   ETKRITVL+PSK +D
Sbjct  222   KFLQESNSFFSQHLSDFQPLPPHPETKRITVLRPSKAID  260



>ref|XP_010540945.1| PREDICTED: uncharacterized protein LOC104814547 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010540947.1| PREDICTED: uncharacterized protein LOC104814547 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010540948.1| PREDICTED: uncharacterized protein LOC104814547 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010540949.1| PREDICTED: uncharacterized protein LOC104814547 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010540950.1| PREDICTED: uncharacterized protein LOC104814547 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010540951.1| PREDICTED: uncharacterized protein LOC104814547 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010540952.1| PREDICTED: uncharacterized protein LOC104814547 isoform X1 [Tarenaya 
hassleriana]
Length=863

 Score =   208 bits (529),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 133/279 (48%), Positives = 164/279 (59%), Gaps = 34/279 (12%)
 Frame = +1

Query  367   LEKPIPGCLGRMVNLFDLNGGVAGNRLLTDKPHR-DGSLSRSQSDVARMS--PSEDQIED  537
             +E P+PGCLGRMVNLFDL    +GN+LLTDKPHR   SLSRSQSDVA+M   PS D  ED
Sbjct  12    MENPVPGCLGRMVNLFDLGTAGSGNKLLTDKPHRYASSLSRSQSDVAQMPSPPSGDHTED  71

Query  538   KEIVSELRRNNSKMKANGTPMKMLIAEEMSKDMASKHNPPSVVAKLMGLDGFPSQLPVST  717
             + I+S LRR+ S    NGTPMK LIA+EMSK+   K +P +VVAKLMGLD FP QL +  
Sbjct  72    ELIMSNLRRSAS----NGTPMKKLIAQEMSKE-EHKQSPTNVVAKLMGLDTFP-QLQLDN  125

Query  718   AQRNYSGRNAQSAKGTPLNNFHHRSGSLDTQMECEFYQYPEQNECKDVYEVWQNRHDMNS  897
                              ++     S                  E KDV E+WQ   + N 
Sbjct  126   T----------------ISQSSKSSSYSRYSPSNSGSSLESSRELKDVCEMWQLPQNANR  169

Query  898   MRSKSPQMGRCNETSTDKV-AFVRQKFIEAKCLSLDEKCHHSRQFQDALEVLSSNTDLVL  1074
              R         +E  T+K    VR+KF+E K L  DEK H S++FQDA+EVLSSN DL +
Sbjct  170   SRD--------DEIMTEKQRDIVRKKFMEGKRLVTDEKLHQSKEFQDAVEVLSSNKDLFV  221

Query  1075  KFLQEPKPMLSEHIYNLQSIPAPSETKRITVLKPSKMVD  1191
             KFLQE     S+H+ + Q +P   ETKRITVL+PSK +D
Sbjct  222   KFLQESNSFFSQHLSDFQPLPPHPETKRITVLRPSKAID  260



>ref|XP_010918845.1| PREDICTED: uncharacterized protein LOC105043126 [Elaeis guineensis]
Length=993

 Score =   206 bits (524),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 126/297 (42%), Positives = 178/297 (60%), Gaps = 13/297 (4%)
 Frame = +1

Query  334   MYAVQNGKNRGLEKPIPGCLGRMVNLFDLNGGVAGNRLLTDKPHRDGS-LSRSQSDVAR-  507
             M   Q    + L+KP PGC+GRM+N+FDLN  +AG +LLTD+ HR GS + R+Q DV + 
Sbjct  1     MSGFQKRNVQDLQKPFPGCMGRMINIFDLNMAMAGTKLLTDEAHRGGSPVRRNQPDVKKE  60

Query  508   -MSPSEDQIEDKE----IVSELRRNNSKMKANGTPMKMLIAEEMSKDMASKHNPPSVVAK  672
              M P+   ++ K+    I S+L +++S  K+ GT +KMLIA+EMSK+      PP VVA+
Sbjct  61    AMDPAGRFVDGKQTSLQIASDLWKSSSIKKSGGTSVKMLIAQEMSKETELNRKPPGVVAR  120

Query  673   LMGLDG-FPSQLPVSTAQRNYS--GRNAQSAKGTPLNNFHHRSGSLDTQMECEFYQYPEQ  843
             LMGLD   P+  PV  A +  +  G +  +  G             +  M CE     E+
Sbjct  121   LMGLDDDLPATKPVLFANKRVTQEGYSRTTLTGPFQGRRQQEDVYFNKPMSCESDH--ER  178

Query  844   NECKDVYEVWQNRHDMNSMRSKSPQMGRCNETSTDK-VAFVRQKFIEAKCLSLDEKCHHS  1020
              E +DV+EV Q     + +R +  Q GR N+   +K +A VRQKF+EAK L+ DE+   S
Sbjct  179   MEYRDVFEVRQQPSRTSYIRDQPLQKGRYNKDQNEKRMALVRQKFMEAKRLATDERLLQS  238

Query  1021  RQFQDALEVLSSNTDLVLKFLQEPKPMLSEHIYNLQSIPAPSETKRITVLKPSKMVD  1191
             ++FQDALEVLSSN DL +KFL+EP  + S+ I  L  +P   +T+RITVLKPS  V+
Sbjct  239   KEFQDALEVLSSNKDLFIKFLEEPNSLFSKQIRELYMVPPTPQTQRITVLKPSNTVE  295



>ref|XP_010933203.1| PREDICTED: uncharacterized protein LOC105053649 isoform X2 [Elaeis 
guineensis]
Length=965

 Score =   205 bits (521),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 125/277 (45%), Positives = 180/277 (65%), Gaps = 22/277 (8%)
 Frame = +1

Query  400   MVNLFDLNGGVAGNRLLTDKPHRDGSLSRS-QSDVAR-MSPSEDQIEDKEIVSELRRNNS  573
             M+N+ DLN G+AG +LLTDK H DGS  RS QSDV + M+ +   ++DK+I  +LR+++S
Sbjct  1     MINMLDLNAGMAGTKLLTDKAHGDGSPVRSNQSDVKKAMNLNGVYVDDKQIACDLRKSSS  60

Query  574   KMKANGTPMKMLIAEEMSKDMASKHNPPSVVAKLMGLDG-FPSQLPVSTAQRNYSGRNAQ  750
               ++ GTP+K+L+A+EM K+  +K  PPSVVA+LMGLD   P+Q  V  A +    RN+Q
Sbjct  61    SKRSGGTPVKVLMAQEMLKETETKRKPPSVVARLMGLDDDLPAQKHVLVANK----RNSQ  116

Query  751   SAKGTPLNNFHHRSGSLD--TQMECEFYQYP-------EQNECKDVYEVWQNRHDMNSMR  903
                    +     +GS+    Q+E +++  P        + ECKDVY+VWQ    M+ ++
Sbjct  117   DGYSNTTS-----TGSIWGCQQLEDDYFNKPMPCESANGKMECKDVYKVWQQPSRMSYIK  171

Query  904   SKSPQMGRCNETSTDK-VAFVRQKFIEAKCLSLDEKCHHSRQFQDALEVLSSNTDLVLKF  1080
              +  Q GRCN+   +K +A VRQKF+EAK L+ DEK   S++FQDALEVLSSN DL +KF
Sbjct  172   DQHQQKGRCNKDQNEKQIALVRQKFMEAKRLATDEKLLQSKEFQDALEVLSSNKDLFIKF  231

Query  1081  LQEPKPMLSEHIYNLQSIPAPSETKRITVLKPSKMVD  1191
             L+EP  + S+ I  L ++P   +TKRIT+LKP K V+
Sbjct  232   LEEPNSLFSKKIRKLYTVPPAPQTKRITILKPLKTVE  268



>ref|XP_010933202.1| PREDICTED: uncharacterized protein LOC105053649 isoform X1 [Elaeis 
guineensis]
Length=963

 Score =   204 bits (520),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 125/277 (45%), Positives = 180/277 (65%), Gaps = 22/277 (8%)
 Frame = +1

Query  400   MVNLFDLNGGVAGNRLLTDKPHRDGSLSRS-QSDVAR-MSPSEDQIEDKEIVSELRRNNS  573
             M+N+ DLN G+AG +LLTDK H DGS  RS QSDV + M+ +   ++DK+I  +LR+++S
Sbjct  1     MINMLDLNAGMAGTKLLTDKAHGDGSPVRSNQSDVKKAMNLNGVYVDDKQIACDLRKSSS  60

Query  574   KMKANGTPMKMLIAEEMSKDMASKHNPPSVVAKLMGLDG-FPSQLPVSTAQRNYSGRNAQ  750
               ++ GTP+K+L+A+EM K+  +K  PPSVVA+LMGLD   P+Q  V  A +    RN+Q
Sbjct  61    SKRSGGTPVKVLMAQEMLKETETKRKPPSVVARLMGLDDDLPAQKHVLVANK----RNSQ  116

Query  751   SAKGTPLNNFHHRSGSLD--TQMECEFYQYP-------EQNECKDVYEVWQNRHDMNSMR  903
                    +     +GS+    Q+E +++  P        + ECKDVY+VWQ    M+ ++
Sbjct  117   DGYSNTTS-----TGSIWGCQQLEDDYFNKPMPCESANGKMECKDVYKVWQQPSRMSYIK  171

Query  904   SKSPQMGRCNETSTDK-VAFVRQKFIEAKCLSLDEKCHHSRQFQDALEVLSSNTDLVLKF  1080
              +  Q GRCN+   +K +A VRQKF+EAK L+ DEK   S++FQDALEVLSSN DL +KF
Sbjct  172   DQHQQKGRCNKDQNEKQIALVRQKFMEAKRLATDEKLLQSKEFQDALEVLSSNKDLFIKF  231

Query  1081  LQEPKPMLSEHIYNLQSIPAPSETKRITVLKPSKMVD  1191
             L+EP  + S+ I  L ++P   +TKRIT+LKP K V+
Sbjct  232   LEEPNSLFSKKIRKLYTVPPAPQTKRITILKPLKTVE  268



>ref|XP_007050071.1| Uncharacterized protein isoform 3 [Theobroma cacao]
 gb|EOX94228.1| Uncharacterized protein isoform 3 [Theobroma cacao]
Length=894

 Score =   203 bits (516),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 108/202 (53%), Positives = 136/202 (67%), Gaps = 4/202 (2%)
 Frame = +1

Query  598   MKMLIAEEMSKDMASKHNPPSVVAKLMGLDGFPSQLPVSTAQRNYS---GRNAQSAKGTP  768
             MKMLIA+EMSK++ SKHNPP+VVAKLMGLD  P Q     AQR +S    R++ S    P
Sbjct  1     MKMLIAQEMSKEVESKHNPPNVVAKLMGLDALPRQQHNMAAQRRHSKGSSRHSLSHSEIP  60

Query  769   LNNFHHRSGSLDTQMECEFYQYPEQNECKDVYEVWQNRHDMNSMRSKSPQMGRCNETSTD  948
             +  +    G  + QM+ +     E N+ KDVYE+WQ      + R  SPQ GR N+   +
Sbjct  61    VEGWERDQGFSNKQMQSKVNLCQELNKYKDVYEIWQQTPRTTNARDSSPQKGRYNDNGNE  120

Query  949   K-VAFVRQKFIEAKCLSLDEKCHHSRQFQDALEVLSSNTDLVLKFLQEPKPMLSEHIYNL  1125
             K +A VRQKF+EAK L  DEK   +++FQDALEVLSSN +L LKFL+EP    S+H+YNL
Sbjct  121   KKMALVRQKFMEAKHLVTDEKLRQTKEFQDALEVLSSNRELFLKFLEEPNSTFSQHLYNL  180

Query  1126  QSIPAPSETKRITVLKPSKMVD  1191
             QS+P P ETKRITVL+PSKMVD
Sbjct  181   QSLPLPPETKRITVLRPSKMVD  202



>gb|KJB10993.1| hypothetical protein B456_001G235600 [Gossypium raimondii]
Length=930

 Score =   202 bits (515),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 117/228 (51%), Positives = 149/228 (65%), Gaps = 5/228 (2%)
 Frame = +1

Query  523   DQIEDKEIVSELRRNNSKMKANGTPMKMLIAEEMSKDMASKHNPPSVVAKLMGLDGFPSQ  702
             DQIEDK IVSELR  ++K K N TPMKML+A+EMSKD+ SK NPP+VVAKLMGLD  P +
Sbjct  8     DQIEDKVIVSELRTFSNK-KGNVTPMKMLLAQEMSKDVESKCNPPNVVAKLMGLDALPRR  66

Query  703   LPVSTAQR---NYSGRNAQSAKGTPLNNFHHRSGSLDTQMECEFYQYPEQNECKDVYEVW  873
                S+AQR     S R++      P+ ++       D QM+CE       N+ KDVYE+W
Sbjct  67    QHNSSAQRCRFKGSSRHSSCHSEIPVESWEQDQSFPDEQMQCEVSPCEVLNKYKDVYEIW  126

Query  874   QNRHDMNSMRSKSPQMGRCNETSTD-KVAFVRQKFIEAKCLSLDEKCHHSRQFQDALEVL  1050
             Q        R  SP+ GR ++ + + K+A VRQKF+EAK L  DEK   S++FQDALEVL
Sbjct  127   QQSPRTTYSRDSSPKKGRYSDNANENKMALVRQKFMEAKHLVTDEKLRQSKEFQDALEVL  186

Query  1051  SSNTDLVLKFLQEPKPMLSEHIYNLQSIPAPSETKRITVLKPSKMVDN  1194
             SSN +L LKFL+EP    S+H+ N +      +TKRITVL+PSKMVDN
Sbjct  187   SSNRELFLKFLEEPNSTFSQHLNNFRCSSLLPQTKRITVLRPSKMVDN  234



>ref|XP_009418989.1| PREDICTED: uncharacterized protein LOC103998847 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=900

 Score =   194 bits (494),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 108/268 (40%), Positives = 160/268 (60%), Gaps = 9/268 (3%)
 Frame = +1

Query  391   LGRMVNLFDLNGGVAGNRLLTDKPHRDGSLSRSQSDVARMSPSEDQIEDKEIVSELRRNN  570
             +GRM+N FDL+ G+  ++LL ++P RD   + S      + P E +IE K+I+SE R ++
Sbjct  1     MGRMINTFDLSAGMDRSKLLAERPQRDVIRNCSHVVTKPIYPVEMEIEGKQIISEQRISS  60

Query  571   SKMKANGTPMKMLIAEEMSKDMASKHNPPSVVAKLMGLDGFPSQLPVSTAQRNYSGRNAQ  750
                K+ GT +KML+A+E+  D  S+HNPPSVVA+LMGLD  P Q  V+   +    RN  
Sbjct  61    PNKKSGGTTIKMLMAQEIYDDTESRHNPPSVVARLMGLDSTPFQQSVTVDGKI---RNND  117

Query  751   SAKGTPLNNFHHRSGSLDTQMECEFYQYPEQNECKDVYEVWQNRHDMNSMRSKSPQMGRC  930
                      F H       Q ECE   +  + +C+DVYEVWQ       ++ +SPQ  + 
Sbjct  118   YLCNGLTGEFQHHQ-----QQECEIRSFSHEKDCRDVYEVWQQPSKNILVKEQSPQKVKY  172

Query  931   NETSTD-KVAFVRQKFIEAKCLSLDEKCHHSRQFQDALEVLSSNTDLVLKFLQEPKPMLS  1107
             +E S   ++  V++KF++AK L+ D K   S++FQDA+EVL+SN DL LKFL++P  +  
Sbjct  173   DENSYQRRMTLVQKKFMQAKQLATDGKLLDSKEFQDAVEVLNSNRDLFLKFLEKPNSLFK  232

Query  1108  EHIYNLQSIPAPSETKRITVLKPSKMVD  1191
             +H++  QS P PS T  +TVLKPS   +
Sbjct  233   KHLFEHQSFPLPSPTTSVTVLKPSNTTE  260



>ref|XP_009418765.1| PREDICTED: uncharacterized protein LOC103998847 isoform X1 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009418843.1| PREDICTED: uncharacterized protein LOC103998847 isoform X1 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009418912.1| PREDICTED: uncharacterized protein LOC103998847 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=922

 Score =   194 bits (494),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 108/268 (40%), Positives = 160/268 (60%), Gaps = 9/268 (3%)
 Frame = +1

Query  391   LGRMVNLFDLNGGVAGNRLLTDKPHRDGSLSRSQSDVARMSPSEDQIEDKEIVSELRRNN  570
             +GRM+N FDL+ G+  ++LL ++P RD   + S      + P E +IE K+I+SE R ++
Sbjct  1     MGRMINTFDLSAGMDRSKLLAERPQRDVIRNCSHVVTKPIYPVEMEIEGKQIISEQRISS  60

Query  571   SKMKANGTPMKMLIAEEMSKDMASKHNPPSVVAKLMGLDGFPSQLPVSTAQRNYSGRNAQ  750
                K+ GT +KML+A+E+  D  S+HNPPSVVA+LMGLD  P Q  V+   +    RN  
Sbjct  61    PNKKSGGTTIKMLMAQEIYDDTESRHNPPSVVARLMGLDSTPFQQSVTVDGKI---RNND  117

Query  751   SAKGTPLNNFHHRSGSLDTQMECEFYQYPEQNECKDVYEVWQNRHDMNSMRSKSPQMGRC  930
                      F H       Q ECE   +  + +C+DVYEVWQ       ++ +SPQ  + 
Sbjct  118   YLCNGLTGEFQHHQ-----QQECEIRSFSHEKDCRDVYEVWQQPSKNILVKEQSPQKVKY  172

Query  931   NETSTD-KVAFVRQKFIEAKCLSLDEKCHHSRQFQDALEVLSSNTDLVLKFLQEPKPMLS  1107
             +E S   ++  V++KF++AK L+ D K   S++FQDA+EVL+SN DL LKFL++P  +  
Sbjct  173   DENSYQRRMTLVQKKFMQAKQLATDGKLLDSKEFQDAVEVLNSNRDLFLKFLEKPNSLFK  232

Query  1108  EHIYNLQSIPAPSETKRITVLKPSKMVD  1191
             +H++  QS P PS T  +TVLKPS   +
Sbjct  233   KHLFEHQSFPLPSPTTSVTVLKPSNTTE  260



>ref|XP_009407163.1| PREDICTED: uncharacterized protein LOC103989929 [Musa acuminata 
subsp. malaccensis]
Length=943

 Score =   194 bits (493),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 117/282 (41%), Positives = 170/282 (60%), Gaps = 14/282 (5%)
 Frame = +1

Query  367   LEKPIPGCLGRMVNLFDLNGGVAGNRLLTDKPHRDGSLSRSQSDVAR--MSPSEDQIEDK  540
             L    PGC+GRM++LFDL+ G+A  +LLT++PH D  + R+ SDV +    P+  + E K
Sbjct  3     LADSFPGCMGRMMSLFDLSAGMAKTKLLTERPHSD--VVRNCSDVVKKPTYPAVAKTEGK  60

Query  541   EIVSELRRNNSKMKANGTPMKMLIAEEMSKDMASKHNPPSVVAKLMGLDGFPSQLPVSTA  720
             ++V+E R ++   K+  TP+K LI++EM  D  S  NPPSVVA+LMGLD  P Q  V T 
Sbjct  61    QMVNEQRSSSPNKKSGRTPIKSLISQEMWDDTESIQNPPSVVARLMGLDSLPVQQSVKT-  119

Query  721   QRNYSGRNAQSAKGTPLNNFHHRSGS-LDTQMECE--FYQYPEQNECKDVYEVWQNRHDM  891
                   +N+ ++    L ++  + G  LD    CE  F+ + E  + +DVYEV Q   + 
Sbjct  120   ----DIKNSDNSLTGELRHYRQQEGDYLDESSACEGQFFTH-ENKDYRDVYEVQQQPSEN  174

Query  892   NSMRSKSPQMGRCNETSTD-KVAFVRQKFIEAKCLSLDEKCHHSRQFQDALEVLSSNTDL  1068
               ++ +SP   R  E S   ++A VRQKF EAK L+ DEK   S++FQDA+EVL+SN DL
Sbjct  175   VRVKDQSPPKVRYEEKSYQMRMALVRQKFTEAKRLATDEKLLDSKEFQDAVEVLNSNRDL  234

Query  1069  VLKFLQEPKPMLSEHIYNLQSIPAPSETKRITVLKPSKMVDN  1194
              +KFL+EP    + H++ LQS+P       ITVLKPS  ++ 
Sbjct  235   FIKFLEEPNSFFTNHLFELQSVPLRPAKTCITVLKPSSTMET  276



>ref|XP_009382176.1| PREDICTED: uncharacterized protein LOC103970221 isoform X1 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009382177.1| PREDICTED: uncharacterized protein LOC103970221 isoform X1 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009382178.1| PREDICTED: uncharacterized protein LOC103970221 isoform X1 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009382179.1| PREDICTED: uncharacterized protein LOC103970221 isoform X1 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009382180.1| PREDICTED: uncharacterized protein LOC103970221 isoform X1 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009382181.1| PREDICTED: uncharacterized protein LOC103970221 isoform X1 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009382182.1| PREDICTED: uncharacterized protein LOC103970221 isoform X1 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009382183.1| PREDICTED: uncharacterized protein LOC103970221 isoform X1 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009382184.1| PREDICTED: uncharacterized protein LOC103970221 isoform X1 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009382185.1| PREDICTED: uncharacterized protein LOC103970221 isoform X1 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009382186.1| PREDICTED: uncharacterized protein LOC103970221 isoform X1 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009382187.1| PREDICTED: uncharacterized protein LOC103970221 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=925

 Score =   188 bits (478),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 119/275 (43%), Positives = 173/275 (63%), Gaps = 25/275 (9%)
 Frame = +1

Query  400   MVNLFDLNGGVAGNRLLTDKPHRDGS-LSRSQSDVARM-SPSEDQIEDKEIVSELRRNNS  573
             M+N+FDL+ G+AG ++L ++ HR+GS + R+  +V    +PS    ++K+I S L +N+S
Sbjct  1     MINIFDLSAGMAGTKMLPERDHRNGSPVHRNNPNVNEAATPSATNTDNKQITSVLYQNSS  60

Query  574   KMKANGTPMKMLIAEEMSKDMASKHNPPSVVAKLMGLDG-FPSQL-PVSTAQRNYSGRNA  747
             K K+ GTPMKMLIA+EMSK+  SK  P SVVA+LMGLD    +QL PV++ ++   G   
Sbjct  61    KKKSGGTPMKMLIAQEMSKETKSKRKPHSVVARLMGLDDDLTTQLSPVASQRKLLEGYPQ  120

Query  748   QSAKGTPLNNFHHRSGSLD-----TQMECEFYQYP-EQNECKDVYEVWQNRHDMNSMRSK  909
              ++ G       HR    D      ++ CE +Q+   + E + V EVW+     +  RS+
Sbjct  121   TASAGV------HRGHLQDDVFCNKEVPCELHQHDCLKMERRYVSEVWKQP---SQSRSR  171

Query  910   SPQMGRCNETSTD-KVAFVRQKFIEAKCLSLDEKCHHSRQFQDALEVLSSNTDLVLKFLQ  1086
                  RC ET  D ++A VRQKF+EAK L+ DE   HS++FQDALEVL+ N DL LKFL+
Sbjct  172   -----RCGETQNDLRMALVRQKFMEAKHLATDENLIHSKEFQDALEVLNLNRDLFLKFLE  226

Query  1087  EPKPMLSEHIYNLQSIPAPSETKRITVLKPSKMVD  1191
             EP  + S+  ++L+S+P P +   ITVLKPSK V+
Sbjct  227   EPNSLFSKQTFDLRSVPPPPQPNHITVLKPSKKVE  261



>ref|XP_009410914.1| PREDICTED: uncharacterized protein LOC103992789 isoform X1 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009410921.1| PREDICTED: uncharacterized protein LOC103992789 isoform X1 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009410929.1| PREDICTED: uncharacterized protein LOC103992789 isoform X1 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009410937.1| PREDICTED: uncharacterized protein LOC103992789 isoform X1 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009410945.1| PREDICTED: uncharacterized protein LOC103992789 isoform X1 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009410954.1| PREDICTED: uncharacterized protein LOC103992789 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=938

 Score =   186 bits (473),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 113/282 (40%), Positives = 172/282 (61%), Gaps = 13/282 (5%)
 Frame = +1

Query  379   IPGCLGRMVNLFDLNGGVAGNRLLTDKPHRDGSLS----RSQSDVAR--MSPSEDQIEDK  540
             +PGC+GRM+ LFDL  G+   +LLT+KPH D +L     R+ SD  +  + P+  + +DK
Sbjct  7     LPGCMGRMIGLFDLTAGMTKTKLLTEKPHMDAALGSAVGRNCSDAVKKPIYPAVAETQDK  66

Query  541   EIVSELRRNNSKMKANG-TPMKMLIAEEMSKDMASKHNPPSVVAKLMGLDGFPSQLPVST  717
             +++   +R+ S  K +G TP+KML+++EM  D   +  PPSVVA+LMGL+ FP Q  V+T
Sbjct  67    QLIVNEQRSGSSNKNSGRTPIKMLLSQEMQGDAEPRQKPPSVVARLMGLESFPVQRSVAT  126

Query  718   AQRNYSGRNAQSAKGTPLNNFHHRSGSLDTQMECEFYQYP-EQNECKDVYEVWQNRHDMN  894
             +++  S    + +    L   H +   +D  M  E   +  E+ + +DVYE+ Q      
Sbjct  127   SRKIRSKGGLRDSSTGELR--HLKDDFVDHSMAYESRSFAHEKKDYRDVYEIQQQPSKNV  184

Query  895   SMRSKSPQMGRCNETSTDK-VAFVRQKFIEAKCLSLDEKCHHSRQFQDALEVLSSNTDLV  1071
              ++ +SP   R +E S  K +  VRQKF EAK L+ DEK   S++FQDA+EVL+SN DL 
Sbjct  185   WVKDQSPVKARHDENSYQKRMDLVRQKFTEAKRLATDEKLLDSKEFQDAVEVLNSNRDLF  244

Query  1072  LKFLQEPKPMLS-EHIYNLQSIPAPS-ETKRITVLKPSKMVD  1191
             L+FL EP  + + + +++LQSI  PS +  RITVLKPS  ++
Sbjct  245   LQFLDEPNSLFTKQRLFDLQSISLPSPQRTRITVLKPSTAME  286



>ref|XP_009410963.1| PREDICTED: uncharacterized protein LOC103992789 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=932

 Score =   186 bits (473),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 113/282 (40%), Positives = 172/282 (61%), Gaps = 13/282 (5%)
 Frame = +1

Query  379   IPGCLGRMVNLFDLNGGVAGNRLLTDKPHRDGSLS----RSQSDVAR--MSPSEDQIEDK  540
             +PGC+GRM+ LFDL  G+   +LLT+KPH D +L     R+ SD  +  + P+  + +DK
Sbjct  7     LPGCMGRMIGLFDLTAGMTKTKLLTEKPHMDAALGSAVGRNCSDAVKKPIYPAVAETQDK  66

Query  541   EIVSELRRNNSKMKANG-TPMKMLIAEEMSKDMASKHNPPSVVAKLMGLDGFPSQLPVST  717
             +++   +R+ S  K +G TP+KML+++EM  D   +  PPSVVA+LMGL+ FP Q  V+T
Sbjct  67    QLIVNEQRSGSSNKNSGRTPIKMLLSQEMQGDAEPRQKPPSVVARLMGLESFPVQRSVAT  126

Query  718   AQRNYSGRNAQSAKGTPLNNFHHRSGSLDTQMECEFYQYP-EQNECKDVYEVWQNRHDMN  894
             +++  S    + +    L   H +   +D  M  E   +  E+ + +DVYE+ Q      
Sbjct  127   SRKIRSKGGLRDSSTGELR--HLKDDFVDHSMAYESRSFAHEKKDYRDVYEIQQQPSKNV  184

Query  895   SMRSKSPQMGRCNETSTDK-VAFVRQKFIEAKCLSLDEKCHHSRQFQDALEVLSSNTDLV  1071
              ++ +SP   R +E S  K +  VRQKF EAK L+ DEK   S++FQDA+EVL+SN DL 
Sbjct  185   WVKDQSPVKARHDENSYQKRMDLVRQKFTEAKRLATDEKLLDSKEFQDAVEVLNSNRDLF  244

Query  1072  LKFLQEPKPMLS-EHIYNLQSIPAPS-ETKRITVLKPSKMVD  1191
             L+FL EP  + + + +++LQSI  PS +  RITVLKPS  ++
Sbjct  245   LQFLDEPNSLFTKQRLFDLQSISLPSPQRTRITVLKPSTAME  286



>ref|XP_010441970.1| PREDICTED: uncharacterized protein LOC104725068 isoform X1 [Camelina 
sativa]
 ref|XP_010441971.1| PREDICTED: uncharacterized protein LOC104725068 isoform X1 [Camelina 
sativa]
Length=827

 Score =   181 bits (460),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 117/284 (41%), Positives = 155/284 (55%), Gaps = 59/284 (21%)
 Frame = +1

Query  346   QNGKNRGLEKPIPGCLGRMVNLFDLNGGVAGNRLLTDKPH-RDGSLSRSQSDVARMSPSE  522
             +N +  G+ + IPGCLGRMVNLFD      G +LLT+KPH R+GS+ R+Q D        
Sbjct  7     RNVQGHGVGRQIPGCLGRMVNLFDFGTVGNGKKLLTEKPHFRNGSIRRTQLD--------  58

Query  523   DQIEDKEIVSELRRNNSKMKANGTPMKMLIAEEMSKDMASKHNPPSVVAKLMGLDGFPSQ  702
              QIEDK  V+          ANGT MKMLI +EMSK+M  K +  ++VAKLMGLD FP  
Sbjct  59    -QIEDKVDVT-------NGGANGTRMKMLIEQEMSKEMDIKLSSTNLVAKLMGLDSFPQT  110

Query  703   LPVSTAQRNYSGRNAQSAKGTPLNNFHHRSGSLDTQMECEFYQYPEQNECKDVYEVWQNR  882
              P            + S+K     +  H                    E KDVYE+WQ  
Sbjct  111   QPAP---------RSNSSKPRLKRSLSH-------------------GEYKDVYEIWQK-  141

Query  883   HDMNSMRSKSPQMGRCNETSTDKVAFVRQKFIEAKCLSLDEKCHHSRQFQDALEVLSSNT  1062
                       P  G     S   +  VR+KF+EAK L  D+K  HS++FQ+A+EVLSSN 
Sbjct  142   ----------PSNG-VEGLSKKHMDIVREKFLEAKRLVTDDKLRHSKEFQEAMEVLSSNK  190

Query  1063  DLVLKFLQEPKPMLSEHIYNLQSI--PAPSETKRITVLKPSKMV  1188
             +L L+FLQE   + S H++N +SI  P P ++KRIT+LKPSK++
Sbjct  191   ELFLEFLQESNNLFSHHLHNFESIVPPTPEKSKRITILKPSKII  234



>ref|XP_010441972.1| PREDICTED: uncharacterized protein LOC104725068 isoform X2 [Camelina 
sativa]
Length=832

 Score =   181 bits (459),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 117/284 (41%), Positives = 156/284 (55%), Gaps = 54/284 (19%)
 Frame = +1

Query  346   QNGKNRGLEKPIPGCLGRMVNLFDLNGGVAGNRLLTDKPH-RDGSLSRSQSDVARMSPSE  522
             +N +  G+ + IPGCLGRMVNLFD      G +LLT+KPH R+GS+ R+Q D        
Sbjct  7     RNVQGHGVGRQIPGCLGRMVNLFDFGTVGNGKKLLTEKPHFRNGSIRRTQLD--------  58

Query  523   DQIEDKEIVSELRRNNSKMKANGTPMKMLIAEEMSKDMASKHNPPSVVAKLMGLDGFPSQ  702
              QIEDK  V+          ANGT MKMLI +EMSK+M  K +  ++VAKLMGLD FP  
Sbjct  59    -QIEDKVDVT-------NGGANGTRMKMLIEQEMSKEMDIKLSSTNLVAKLMGLDSFPQT  110

Query  703   LPVSTAQRNYSGRNAQSAKGTPLNNFHHRSGSLDTQMECEFYQYPEQNECKDVYEVWQNR  882
              P            + S+K     +  H                    E KDVYE+WQ  
Sbjct  111   QPAP---------RSNSSKPRLKRSLSH-------------------GEYKDVYEIWQKP  142

Query  883   HDMNSMRSKSPQMGRCNETSTDKVAFVRQKFIEAKCLSLDEKCHHSRQFQDALEVLSSNT  1062
              +        P  G     S   +  VR+KF+EAK L  D+K  HS++FQ+A+EVLSSN 
Sbjct  143   SN------GKPSNG-VEGLSKKHMDIVREKFLEAKRLVTDDKLRHSKEFQEAMEVLSSNK  195

Query  1063  DLVLKFLQEPKPMLSEHIYNLQSI--PAPSETKRITVLKPSKMV  1188
             +L L+FLQE   + S H++N +SI  P P ++KRIT+LKPSK++
Sbjct  196   ELFLEFLQESNNLFSHHLHNFESIVPPTPEKSKRITILKPSKII  239



>ref|XP_006403169.1| hypothetical protein EUTSA_v10003146mg [Eutrema salsugineum]
 gb|ESQ44622.1| hypothetical protein EUTSA_v10003146mg [Eutrema salsugineum]
Length=845

 Score =   179 bits (454),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 114/281 (41%), Positives = 152/281 (54%), Gaps = 55/281 (20%)
 Frame = +1

Query  364   GLEKPIPGCLGRMVNLFDLNGGVAGNRLLTDKPH-RDGSLSRSQSDVARMSPSEDQIEDK  540
             G+ + IPGCLGRMVNLFD      G +LLTDKP+  DGS+ R+Q D         QIED 
Sbjct  14    GVGRQIPGCLGRMVNLFDFGTVGNGKKLLTDKPYFDDGSIKRNQFD---------QIEDN  64

Query  541   EIVSELRRNNSKMKANGTPMKMLIAEEMSKDMASKHNPPSVVAKLMGLDGFPSQLPVSTA  720
               +    RN+     NGTPMK L+ EEMSK++  K    ++VAKLMGLD FP Q P    
Sbjct  65    VAL----RNDCTFGVNGTPMKKLLEEEMSKEIEFKLGSTNLVAKLMGLDSFP-QTPQP--  117

Query  721   QRNYSGRNAQSAKGTPLNNFHHRSGSLDTQMECEFYQYPEQNECKDVYEVWQNRHDMNSM  900
                              N    RS S  ++++        Q E KDVYE+WQ   +    
Sbjct  118   -----------------NGIAQRSNSSKSRLKRSL----SQGEYKDVYEIWQKPGE----  152

Query  901   RSKSPQMGRCNETSTDKVAFVRQKFIEAKCLSLDEKCHHSRQFQDALEVLSSNTDLVLKF  1080
                        + S  K+  VR+KF+EAK L  D+K  HS++FQ+A+E LSSN +L L+F
Sbjct  153   -----------DLSKKKMDLVREKFLEAKRLVTDDKLRHSKEFQEAMEYLSSNKELFLEF  201

Query  1081  LQEPKPMLSEHIYNLQSI--PAPSETKRITVLKPSKMVDNC  1197
             LQE     S H+ + +S   P P ++KRIT+LKPSK +D+ 
Sbjct  202   LQESNNFFSHHLQSFKSKAPPTPEKSKRITILKPSKFIDDA  242



>ref|XP_009382188.1| PREDICTED: uncharacterized protein LOC103970221 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=918

 Score =   177 bits (450),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 116/275 (42%), Positives = 169/275 (61%), Gaps = 32/275 (12%)
 Frame = +1

Query  400   MVNLFDLNGGVAGNRLLTDKPHRDGS-LSRSQSDVARM-SPSEDQIEDKEIVSELRRNNS  573
             M+N+FDL+ G+AG ++L ++ HR+GS + R+  +V    +PS    ++K+       N+S
Sbjct  1     MINIFDLSAGMAGTKMLPERDHRNGSPVHRNNPNVNEAATPSATNTDNKQ-------NSS  53

Query  574   KMKANGTPMKMLIAEEMSKDMASKHNPPSVVAKLMGLDG-FPSQL-PVSTAQRNYSGRNA  747
             K K+ GTPMKMLIA+EMSK+  SK  P SVVA+LMGLD    +QL PV++ ++   G   
Sbjct  54    KKKSGGTPMKMLIAQEMSKETKSKRKPHSVVARLMGLDDDLTTQLSPVASQRKLLEGYPQ  113

Query  748   QSAKGTPLNNFHHRSGSLD-----TQMECEFYQYP-EQNECKDVYEVWQNRHDMNSMRSK  909
              ++ G       HR    D      ++ CE +Q+   + E + V EVW+     +  RS+
Sbjct  114   TASAGV------HRGHLQDDVFCNKEVPCELHQHDCLKMERRYVSEVWKQP---SQSRSR  164

Query  910   SPQMGRCNETSTD-KVAFVRQKFIEAKCLSLDEKCHHSRQFQDALEVLSSNTDLVLKFLQ  1086
                  RC ET  D ++A VRQKF+EAK L+ DE   HS++FQDALEVL+ N DL LKFL+
Sbjct  165   -----RCGETQNDLRMALVRQKFMEAKHLATDENLIHSKEFQDALEVLNLNRDLFLKFLE  219

Query  1087  EPKPMLSEHIYNLQSIPAPSETKRITVLKPSKMVD  1191
             EP  + S+  ++L+S+P P +   ITVLKPSK V+
Sbjct  220   EPNSLFSKQTFDLRSVPPPPQPNHITVLKPSKKVE  254



>ref|XP_004976162.1| PREDICTED: uncharacterized protein LOC101760628 isoform X1 [Setaria 
italica]
 ref|XP_004976163.1| PREDICTED: uncharacterized protein LOC101760628 isoform X2 [Setaria 
italica]
Length=946

 Score =   176 bits (447),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 115/272 (42%), Positives = 168/272 (62%), Gaps = 10/272 (4%)
 Frame = +1

Query  400   MVNLFDLNGGVAGNRLLTDKPHRDGSLS-RSQSDVAR-MSPSEDQIEDKEIVSELRRNNS  573
             M+NLFD   G++ + +LTD+P RDGS + RS+ DV R + P++   EDK   S    +++
Sbjct  13    MINLFDRGLGMSNSNMLTDRPRRDGSPACRSRQDVKRTIDPAKVYAEDKLGASNW--SST  70

Query  574   KMKANGTPMKMLIAEEMSKDMASKHNPPSVVAKLMGL-DGFPSQ-LPVSTAQRNY--SGR  741
               K+N +P+ +++A+EMSK++ SK  PPSVVA+LMGL D  P Q   + +A+RN   S  
Sbjct  71    SNKSNASPLNVVLAKEMSKELESKKKPPSVVARLMGLEDDLPGQGATLQSAKRNLKKSHL  130

Query  742   NAQSAKGTPLNNFHHRSGSLDTQMECEFYQYPEQNECKDVYEVWQNRHDMNSMRSKSPQM  921
             N+ SA+   L+    +  S  T  +     + E  + KDVYEV +       ++ ++   
Sbjct  131   NSNSAERNSLHQHQEQYSSTMTTRDIHI-GHKETVQFKDVYEVSEEPIRTYHLQDQTFPS  189

Query  922   GRCNETSTD-KVAFVRQKFIEAKCLSLDEKCHHSRQFQDALEVLSSNTDLVLKFLQEPKP  1098
             G  + +  D ++  VRQKF+EAK L+ +EK  HS++FQDALEVLSSN DL LKFL+EP  
Sbjct  190   GASSRSKRDIRMEIVRQKFMEAKRLATNEKLLHSKEFQDALEVLSSNRDLFLKFLEEPNS  249

Query  1099  MLSEHIYNLQSIPAPSETKRITVLKPSKMVDN  1194
               S+ +  L   P+P  TKRITVLKP+K VDN
Sbjct  250   TFSKQLAGLHKSPSPPHTKRITVLKPNKSVDN  281



>ref|XP_010481809.1| PREDICTED: uncharacterized protein LOC104760567 isoform X1 [Camelina 
sativa]
 ref|XP_010481810.1| PREDICTED: uncharacterized protein LOC104760567 isoform X1 [Camelina 
sativa]
Length=829

 Score =   172 bits (437),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 113/284 (40%), Positives = 155/284 (55%), Gaps = 59/284 (21%)
 Frame = +1

Query  346   QNGKNRGLEKPIPGCLGRMVNLFDLNGGVAGNRLLTDKPH-RDGSLSRSQSDVARMSPSE  522
             +N +  G+ + IPGCLGR+VNLFD      G +LLT+KPH  +GS+ R+Q D        
Sbjct  7     RNVQGHGVGRQIPGCLGRVVNLFDFGTVGNGKKLLTEKPHFVNGSIRRNQLD--------  58

Query  523   DQIEDKEIVSELRRNNSKMKANGTPMKMLIAEEMSKDMASKHNPPSVVAKLMGLDGFPSQ  702
              QI+DK  V    RN      +GTPMKML+ +EMSK++  K +  ++VAKLMGLD FP  
Sbjct  59    -QIKDKVDV----RNGG---VSGTPMKMLLEQEMSKEVDIKLSSTNLVAKLMGLDSFPQT  110

Query  703   LPVSTAQRNYSGRNAQSAKGTPLNNFHHRSGSLDTQMECEFYQYPEQNECKDVYEVWQNR  882
              P            + S+K     +  H                    E KDVYE+WQ  
Sbjct  111   QPAP---------RSNSSKPRLKRSLSH-------------------GEYKDVYEIWQK-  141

Query  883   HDMNSMRSKSPQMGRCNETSTDKVAFVRQKFIEAKCLSLDEKCHHSRQFQDALEVLSSNT  1062
                       P  G     S   +  VR+KF+EAK L  D+K  HS++FQ+A+EVLSSN 
Sbjct  142   ----------PSNG-VEGLSKKHMDIVREKFLEAKRLVTDDKLRHSKEFQEAMEVLSSNK  190

Query  1063  DLVLKFLQEPKPMLSEHIYNLQSI--PAPSETKRITVLKPSKMV  1188
             +L L+FLQE   + S H++N +SI  P P ++KRIT+LKPSK++
Sbjct  191   ELFLEFLQESNNLFSHHLHNFESIAPPTPEKSKRITILKPSKII  234



>ref|XP_008646431.1| PREDICTED: uncharacterized protein LOC103627892 isoform X3 [Zea 
mays]
 gb|AFW74025.1| hypothetical protein ZEAMMB73_702258 [Zea mays]
Length=932

 Score =   172 bits (435),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 115/281 (41%), Positives = 158/281 (56%), Gaps = 24/281 (9%)
 Frame = +1

Query  376   PIPGCLGRMVNLFDLNGGVAGNRLLTDKPHRDGS-LSRSQSDVARMS---PSEDQIEDKE  543
             P PGCLGRM+N+ DL+ GV   ++LT+K HRD S   + +S+  +M+   P+  Q EDK+
Sbjct  20    PFPGCLGRMINMLDLSNGVVATKMLTEKAHRDVSPAGKDRSNTFKMAINPPA--QTEDKQ  77

Query  544   IVSELRRN------NSKMKANGT-PMKMLIAEEMSKDMASKHNPPSVVAKLMGLDGFPSQ  702
               S+ RRN      NS  K  G  P+KML+ ++M K+      P +VVA+LMGL   P Q
Sbjct  78    RDSQTRRNFPTKRSNSPTKRTGAMPVKMLMEQDMWKERRPDEEPLNVVARLMGLHEPPGQ  137

Query  703   LPVSTAQRNYS-GRNAQSAKGTPLNNFHHRSGSLDTQMECEFYQYPEQNECKDVYEVWQN  879
                   Q N+  GR  Q  K      F     +L ++ E + +Q   Q         W  
Sbjct  138   ------QSNFPLGR--QLDKKYQCGGFEENYWNLKSKKESKCHQ--NQKAGPRHQHTWNG  187

Query  880   RHDMNSMRSKSPQMGRCNETSTDKVAFVRQKFIEAKCLSLDEKCHHSRQFQDALEVLSSN  1059
               D  S  S S  M + NET   +++ VR+KF EAK L+ DEK  HS++FQDAL+ LSSN
Sbjct  188   SGDQPSRISSSQSMHQENETCEKRMSIVREKFAEAKRLATDEKLLHSKEFQDALQFLSSN  247

Query  1060  TDLVLKFLQEPKPMLSEHIYNLQSIPAPSETKRITVLKPSK  1182
              DL L+FL EP P+LS + Y  Q +  PSE K+IT+LKPS+
Sbjct  248   RDLFLEFLDEPNPLLSSNRYEFQPVAPPSEVKQITILKPSE  288



>ref|XP_006279984.1| hypothetical protein CARUB_v10025855mg [Capsella rubella]
 gb|EOA12882.1| hypothetical protein CARUB_v10025855mg [Capsella rubella]
Length=838

 Score =   171 bits (432),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 114/284 (40%), Positives = 152/284 (54%), Gaps = 57/284 (20%)
 Frame = +1

Query  346   QNGKNRGLEKPIPGCLGRMVNLFDLNGGVAGNRLLTDKPHRD-GSLSRSQSDVARMSPSE  522
             +N +  G+ + IPGCLGRMVNLFD      G +LLT+KPH D GS+ R+Q D        
Sbjct  7     RNVQAHGVGRQIPGCLGRMVNLFDFGTVGNGKKLLTEKPHFDNGSIRRNQLD--------  58

Query  523   DQIEDKEIVSELRRNNSKMKANGTPMKMLIAEEMSKDMASKHNPPSVVAKLMGLDGFPSQ  702
              QIE   +             NGTPMKML+ +EMSK+M  K +  ++VAKLMGLD FP  
Sbjct  59    -QIEVDVM---------NGGVNGTPMKMLLEQEMSKEMEFKLSSTNLVAKLMGLDSFPQI  108

Query  703   LPVSTAQRNYSGRNAQSAKGTPLNNFHHRSGSLDTQMECEFYQYPEQNECKDVYEVWQNR  882
              P   AQR      + S+K     +  H                    E KDVYE+WQ  
Sbjct  109   QP---AQR------SNSSKPRLKRSLSH-------------------GEYKDVYEIWQKP  140

Query  883   HDMNSMRSKSPQMGRCNETSTDKVAFVRQKFIEAKCLSLDEKCHHSRQFQDALEVLSSNT  1062
               +NS              S  K+  VR+KF+EAK L  D+K  HS++FQ+A+EVLS N 
Sbjct  141   GGLNS--------DGVEGLSKKKMDAVREKFLEAKRLVADDKLRHSKEFQEAMEVLSDNK  192

Query  1063  DLVLKFLQEPKPMLSEHIYNLQSIPAPS--ETKRITVLKPSKMV  1188
             +L L+FLQE     S H+++ QS   P+  ++KRIT+LKPSK +
Sbjct  193   ELFLEFLQESNSFFSHHLHSFQSTAPPTSEKSKRITILKPSKTI  236



>ref|XP_006279983.1| hypothetical protein CARUB_v10025855mg [Capsella rubella]
 gb|EOA12881.1| hypothetical protein CARUB_v10025855mg [Capsella rubella]
Length=893

 Score =   171 bits (432),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 114/284 (40%), Positives = 152/284 (54%), Gaps = 57/284 (20%)
 Frame = +1

Query  346   QNGKNRGLEKPIPGCLGRMVNLFDLNGGVAGNRLLTDKPHRD-GSLSRSQSDVARMSPSE  522
             +N +  G+ + IPGCLGRMVNLFD      G +LLT+KPH D GS+ R+Q D        
Sbjct  62    RNVQAHGVGRQIPGCLGRMVNLFDFGTVGNGKKLLTEKPHFDNGSIRRNQLD--------  113

Query  523   DQIEDKEIVSELRRNNSKMKANGTPMKMLIAEEMSKDMASKHNPPSVVAKLMGLDGFPSQ  702
              QIE   +             NGTPMKML+ +EMSK+M  K +  ++VAKLMGLD FP  
Sbjct  114   -QIEVDVM---------NGGVNGTPMKMLLEQEMSKEMEFKLSSTNLVAKLMGLDSFPQI  163

Query  703   LPVSTAQRNYSGRNAQSAKGTPLNNFHHRSGSLDTQMECEFYQYPEQNECKDVYEVWQNR  882
              P   AQR      + S+K     +  H                    E KDVYE+WQ  
Sbjct  164   QP---AQR------SNSSKPRLKRSLSH-------------------GEYKDVYEIWQKP  195

Query  883   HDMNSMRSKSPQMGRCNETSTDKVAFVRQKFIEAKCLSLDEKCHHSRQFQDALEVLSSNT  1062
               +NS              S  K+  VR+KF+EAK L  D+K  HS++FQ+A+EVLS N 
Sbjct  196   GGLNS--------DGVEGLSKKKMDAVREKFLEAKRLVADDKLRHSKEFQEAMEVLSDNK  247

Query  1063  DLVLKFLQEPKPMLSEHIYNLQSIPAPS--ETKRITVLKPSKMV  1188
             +L L+FLQE     S H+++ QS   P+  ++KRIT+LKPSK +
Sbjct  248   ELFLEFLQESNSFFSHHLHSFQSTAPPTSEKSKRITILKPSKTI  291



>ref|XP_008646424.1| PREDICTED: uncharacterized protein LOC103627892 isoform X1 [Zea 
mays]
 ref|XP_008646425.1| PREDICTED: uncharacterized protein LOC103627892 isoform X1 [Zea 
mays]
 ref|XP_008646426.1| PREDICTED: uncharacterized protein LOC103627892 isoform X1 [Zea 
mays]
 ref|XP_008646428.1| PREDICTED: uncharacterized protein LOC103627892 isoform X1 [Zea 
mays]
 ref|XP_008646429.1| PREDICTED: uncharacterized protein LOC103627892 isoform X1 [Zea 
mays]
Length=937

 Score =   169 bits (428),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 114/286 (40%), Positives = 157/286 (55%), Gaps = 29/286 (10%)
 Frame = +1

Query  376   PIPGCLGRMVNLFDLNGGVAGNRLLTDKPHRDG------SLSRSQSDVARMS---PSEDQ  528
             P PGCLGRM+N+ DL+ GV   ++LT+K HRD          + +S+  +M+   P+  Q
Sbjct  20    PFPGCLGRMINMLDLSNGVVATKMLTEKAHRDAYAFAVSPAGKDRSNTFKMAINPPA--Q  77

Query  529   IEDKEIVSELRRN------NSKMKANGT-PMKMLIAEEMSKDMASKHNPPSVVAKLMGLD  687
              EDK+  S+ RRN      NS  K  G  P+KML+ ++M K+      P +VVA+LMGL 
Sbjct  78    TEDKQRDSQTRRNFPTKRSNSPTKRTGAMPVKMLMEQDMWKERRPDEEPLNVVARLMGLH  137

Query  688   GFPSQLPVSTAQRNYS-GRNAQSAKGTPLNNFHHRSGSLDTQMECEFYQYPEQNECKDVY  864
               P Q      Q N+  GR  Q  K      F     +L ++ E + +Q   Q       
Sbjct  138   EPPGQ------QSNFPLGR--QLDKKYQCGGFEENYWNLKSKKESKCHQ--NQKAGPRHQ  187

Query  865   EVWQNRHDMNSMRSKSPQMGRCNETSTDKVAFVRQKFIEAKCLSLDEKCHHSRQFQDALE  1044
               W    D  S  S S  M + NET   +++ VR+KF EAK L+ DEK  HS++FQDAL+
Sbjct  188   HTWNGSGDQPSRISSSQSMHQENETCEKRMSIVREKFAEAKRLATDEKLLHSKEFQDALQ  247

Query  1045  VLSSNTDLVLKFLQEPKPMLSEHIYNLQSIPAPSETKRITVLKPSK  1182
              LSSN DL L+FL EP P+LS + Y  Q +  PSE K+IT+LKPS+
Sbjct  248   FLSSNRDLFLEFLDEPNPLLSSNRYEFQPVAPPSEVKQITILKPSE  293



>ref|XP_008646430.1| PREDICTED: uncharacterized protein LOC103627892 isoform X2 [Zea 
mays]
Length=936

 Score =   169 bits (428),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 114/286 (40%), Positives = 157/286 (55%), Gaps = 29/286 (10%)
 Frame = +1

Query  376   PIPGCLGRMVNLFDLNGGVAGNRLLTDKPHRDG------SLSRSQSDVARMS---PSEDQ  528
             P PGCLGRM+N+ DL+ GV   ++LT+K HRD          + +S+  +M+   P+  Q
Sbjct  20    PFPGCLGRMINMLDLSNGVVATKMLTEKAHRDAYAFAVSPAGKDRSNTFKMAINPPA--Q  77

Query  529   IEDKEIVSELRRN------NSKMKANGT-PMKMLIAEEMSKDMASKHNPPSVVAKLMGLD  687
              EDK+  S+ RRN      NS  K  G  P+KML+ ++M K+      P +VVA+LMGL 
Sbjct  78    TEDKQRDSQTRRNFPTKRSNSPTKRTGAMPVKMLMEQDMWKERRPDEEPLNVVARLMGLH  137

Query  688   GFPSQLPVSTAQRNYS-GRNAQSAKGTPLNNFHHRSGSLDTQMECEFYQYPEQNECKDVY  864
               P Q      Q N+  GR  Q  K      F     +L ++ E + +Q   Q       
Sbjct  138   EPPGQ------QSNFPLGR--QLDKKYQCGGFEENYWNLKSKKESKCHQ--NQKAGPRHQ  187

Query  865   EVWQNRHDMNSMRSKSPQMGRCNETSTDKVAFVRQKFIEAKCLSLDEKCHHSRQFQDALE  1044
               W    D  S  S S  M + NET   +++ VR+KF EAK L+ DEK  HS++FQDAL+
Sbjct  188   HTWNGSGDQPSRISSSQSMHQENETCEKRMSIVREKFAEAKRLATDEKLLHSKEFQDALQ  247

Query  1045  VLSSNTDLVLKFLQEPKPMLSEHIYNLQSIPAPSETKRITVLKPSK  1182
              LSSN DL L+FL EP P+LS + Y  Q +  PSE K+IT+LKPS+
Sbjct  248   FLSSNRDLFLEFLDEPNPLLSSNRYEFQPVAPPSEVKQITILKPSE  293



>ref|XP_002863627.1| hypothetical protein ARALYDRAFT_494617 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH39886.1| hypothetical protein ARALYDRAFT_494617 [Arabidopsis lyrata subsp. 
lyrata]
Length=833

 Score =   167 bits (423),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 112/272 (41%), Positives = 149/272 (55%), Gaps = 55/272 (20%)
 Frame = +1

Query  385   GCLGRMVNLFDLNGGVAGNRLLTDKPHRD-GSLSRSQSDVARMSPSEDQIEDKEIVSELR  561
             GCLGRMVNLFD      G +LL++KP+ D GS+ R+Q D         QIEDK  V    
Sbjct  13    GCLGRMVNLFDFGTVGNGKKLLSEKPYFDHGSIKRNQFD---------QIEDKVDV----  59

Query  562   RNNSKMKANGTPMKMLIAEEMSKDMASKHNPPSVVAKLMGLDGFPSQLPVSTAQRNYSGR  741
             RN      NGTPMKML+ +EMSK+M  K +  ++VAKLMGLD FP     ST++ N    
Sbjct  60    RNGG---VNGTPMKMLLEQEMSKEMEFKLSSTNLVAKLMGLDSFPQT--QSTSRSN----  110

Query  742   NAQSAKGTPLNNFHHRSGSLDTQMECEFYQYPEQNECKDVYEVWQNRHDMNSMRSKSPQM  921
                S+K     +  H                    E KDVYE+WQ   +++S        
Sbjct  111   ---SSKPRLKRSLSH-------------------GEYKDVYEIWQKPGELSS--------  140

Query  922   GRCNETSTDKVAFVRQKFIEAKCLSLDEKCHHSRQFQDALEVLSSNTDLVLKFLQEPKPM  1101
                   S  K+  VRQKF++AK L  D+K  HS++FQ+A+EVLSSN +L L+FLQE    
Sbjct  141   NGVEGLSKKKMDIVRQKFLDAKRLVTDDKLRHSKEFQEAMEVLSSNKELFLEFLQESNTF  200

Query  1102  LSEHIYNLQSI--PAPSETKRITVLKPSKMVD  1191
              S H+++ Q    P   ++KRIT+LKPSK +D
Sbjct  201   FSHHLHSFQPTDPPTSEKSKRITILKPSKTID  232



>ref|XP_010933204.1| PREDICTED: uncharacterized protein LOC105053649 isoform X3 [Elaeis 
guineensis]
Length=927

 Score =   168 bits (425),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 101/233 (43%), Positives = 149/233 (64%), Gaps = 20/233 (9%)
 Frame = +1

Query  529   IEDKEIVSELRRNNSKMKANGTPMKMLIAEEMSKDMASKHNPPSVVAKLMGLDG-FPSQL  705
             ++DK+I  +LR+++S  ++ GTP+K+L+A+EM K+  +K  PPSVVA+LMGLD   P+Q 
Sbjct  8     VDDKQIACDLRKSSSSKRSGGTPVKVLMAQEMLKETETKRKPPSVVARLMGLDDDLPAQK  67

Query  706   PVSTAQRNYSGRNAQSAKGTPLNNFHHRSGSLD--TQMECEFYQYP-------EQNECKD  858
              V  A +    RN+Q       +     +GS+    Q+E +++  P        + ECKD
Sbjct  68    HVLVANK----RNSQDGYSNTTS-----TGSIWGCQQLEDDYFNKPMPCESANGKMECKD  118

Query  859   VYEVWQNRHDMNSMRSKSPQMGRCNETSTDK-VAFVRQKFIEAKCLSLDEKCHHSRQFQD  1035
             VY+VWQ    M+ ++ +  Q GRCN+   +K +A VRQKF+EAK L+ DEK   S++FQD
Sbjct  119   VYKVWQQPSRMSYIKDQHQQKGRCNKDQNEKQIALVRQKFMEAKRLATDEKLLQSKEFQD  178

Query  1036  ALEVLSSNTDLVLKFLQEPKPMLSEHIYNLQSIPAPSETKRITVLKPSKMVDN  1194
             ALEVLSSN DL +KFL+EP  + S+ I  L ++P   +TKRIT+LKP K V+ 
Sbjct  179   ALEVLSSNKDLFIKFLEEPNSLFSKKIRKLYTVPPAPQTKRITILKPLKTVET  231



>ref|XP_010494373.1| PREDICTED: uncharacterized protein LOC104771538 isoform X1 [Camelina 
sativa]
 ref|XP_010494374.1| PREDICTED: uncharacterized protein LOC104771538 isoform X1 [Camelina 
sativa]
Length=837

 Score =   167 bits (423),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 114/284 (40%), Positives = 153/284 (54%), Gaps = 59/284 (21%)
 Frame = +1

Query  346   QNGKNRGLEKPIPGCLGRMVNLFDLNGGVAGNRLLTDKPH-RDGSLSRSQSDVARMSPSE  522
             +N +  G  + IPGCLGRMVNLFD      G +LLT+KPH  +GS+ R++ D        
Sbjct  7     RNVQGHGTGRQIPGCLGRMVNLFDFGTVGNGKKLLTEKPHFGNGSIRRNRLD--------  58

Query  523   DQIEDKEIVSELRRNNSKMKANGTPMKMLIAEEMSKDMASKHNPPSVVAKLMGLDGFPSQ  702
               I+DK  V    RN      NGTPMKML+ +EMSKDM  K +  ++VAKLMGLD F   
Sbjct  59    -HIKDKVDV----RNGG---VNGTPMKMLLEQEMSKDMDIKLSSTNLVAKLMGLDSFHQT  110

Query  703   LPVSTAQRNYSGRNAQSAKGTPLNNFHHRSGSLDTQMECEFYQYPEQNECKDVYEVWQNR  882
              P                  +P      RS S   +++          E KDVYE+WQ  
Sbjct  111   QP------------------SP------RSNSSKPRLKRSL----SHGEYKDVYEIWQK-  141

Query  883   HDMNSMRSKSPQMGRCNETSTDKVAFVRQKFIEAKCLSLDEKCHHSRQFQDALEVLSSNT  1062
                       P  G     S   +  VR+KF+EAK L  D+K  HS++FQ+A+EVLSSN 
Sbjct  142   ----------PSNG-VEGLSKKHMDIVREKFLEAKRLVTDDKLRHSKEFQEAMEVLSSNK  190

Query  1063  DLVLKFLQEPKPMLSEHIYNLQSI--PAPSETKRITVLKPSKMV  1188
             +L L+FLQE   + S  ++N +SI  P P ++KRIT+LKPSK++
Sbjct  191   ELFLEFLQESNNLFSHRLHNFESIAPPTPEKSKRITILKPSKII  234



>ref|XP_010494375.1| PREDICTED: uncharacterized protein LOC104771538 isoform X2 [Camelina 
sativa]
Length=835

 Score =   167 bits (422),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 114/283 (40%), Positives = 152/283 (54%), Gaps = 59/283 (21%)
 Frame = +1

Query  346   QNGKNRGLEKPIPGCLGRMVNLFDLNGGVAGNRLLTDKPHRDGSLSRSQSDVARMSPSED  525
             +N +  G  + IPGCLGRMVNLFD      G +LLT+KPH  GS+ R++ D         
Sbjct  7     RNVQGHGTGRQIPGCLGRMVNLFDFGTVGNGKKLLTEKPHF-GSIRRNRLD---------  56

Query  526   QIEDKEIVSELRRNNSKMKANGTPMKMLIAEEMSKDMASKHNPPSVVAKLMGLDGFPSQL  705
              I+DK  V    RN      NGTPMKML+ +EMSKDM  K +  ++VAKLMGLD F    
Sbjct  57    HIKDKVDV----RNGG---VNGTPMKMLLEQEMSKDMDIKLSSTNLVAKLMGLDSFHQTQ  109

Query  706   PVSTAQRNYSGRNAQSAKGTPLNNFHHRSGSLDTQMECEFYQYPEQNECKDVYEVWQNRH  885
             P                  +P      RS S   +++          E KDVYE+WQ   
Sbjct  110   P------------------SP------RSNSSKPRLKRSL----SHGEYKDVYEIWQK--  139

Query  886   DMNSMRSKSPQMGRCNETSTDKVAFVRQKFIEAKCLSLDEKCHHSRQFQDALEVLSSNTD  1065
                      P  G     S   +  VR+KF+EAK L  D+K  HS++FQ+A+EVLSSN +
Sbjct  140   ---------PSNG-VEGLSKKHMDIVREKFLEAKRLVTDDKLRHSKEFQEAMEVLSSNKE  189

Query  1066  LVLKFLQEPKPMLSEHIYNLQSI--PAPSETKRITVLKPSKMV  1188
             L L+FLQE   + S  ++N +SI  P P ++KRIT+LKPSK++
Sbjct  190   LFLEFLQESNNLFSHRLHNFESIAPPTPEKSKRITILKPSKII  232



>ref|XP_004954364.1| PREDICTED: uncharacterized protein LOC101771268 isoform X1 [Setaria 
italica]
 ref|XP_004954365.1| PREDICTED: uncharacterized protein LOC101771268 isoform X2 [Setaria 
italica]
 ref|XP_004954366.1| PREDICTED: uncharacterized protein LOC101771268 isoform X3 [Setaria 
italica]
 ref|XP_004954367.1| PREDICTED: uncharacterized protein LOC101771268 isoform X4 [Setaria 
italica]
 ref|XP_004954368.1| PREDICTED: uncharacterized protein LOC101771268 isoform X5 [Setaria 
italica]
Length=915

 Score =   167 bits (423),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 111/278 (40%), Positives = 158/278 (57%), Gaps = 32/278 (12%)
 Frame = +1

Query  376   PIPGCLGRMVNLFDLNGGVAGNRLLTDKPHRDGS-LSRSQSDVARMSPSED-QIEDKEIV  549
             P PGCLGRM+N+FDL+ GV   ++LTDK HRD S   R +S+  +M+ +   Q EDK+  
Sbjct  20    PFPGCLGRMINMFDLSNGVVATKMLTDKAHRDVSPAGRDRSNTFKMAINPPVQTEDKQRD  79

Query  550   SELRRNNSKMKAN-------GTPMKMLIAEEMSKDMASKHNPPSVVAKLMGLDGFPSQLP  708
             S+ RRN+   ++N       GTP+KML+ ++M K+      P +VVA+LMGL   P Q  
Sbjct  80    SQARRNSPTKRSNSPTKRSGGTPVKMLMEQDMWKEGMPNEEPLNVVARLMGLHDAPVQ--  137

Query  709   VSTAQRNYSGRNAQSAKGTPLNNFHHRSGSLDTQMECEFYQYPEQNECKDVYEVWQNRHD  888
              S  + NY  RN +  K +  +  + ++G         F   P +               
Sbjct  138   SSGFEENY--RNIKLKKESKCHQ-NQKAGLRHQHTWNGFSDQPSR---------------  179

Query  889   MNSMRSKSPQMGRCNETSTDKVAFVRQKFIEAKCLSLDEKCHHSRQFQDALEVLSSNTDL  1068
             +NS +SK   +  C E    +++ VR+KF EAK L+ DEK  HS++FQDAL+ LSSN DL
Sbjct  180   INSSQSKYQGIEPCCEK---RMSLVREKFAEAKRLATDEKLLHSKEFQDALQFLSSNRDL  236

Query  1069  VLKFLQEPKPMLSEHIYNLQSIPAPSETKRITVLKPSK  1182
              L+FL EP P+LS + Y  Q    PSE K+IT+LKPS+
Sbjct  237   FLEFLDEPNPLLSSNRYEFQPAAPPSEVKQITILKPSE  274



>tpg|DAA37016.1| TPA: hypothetical protein ZEAMMB73_455266 [Zea mays]
Length=437

 Score =   162 bits (409),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 111/280 (40%), Positives = 165/280 (59%), Gaps = 26/280 (9%)
 Frame = +1

Query  400   MVNLFDLNGGVAGNRLLTDKPHRDGSLS-RSQSDVAR-MSPSEDQIEDKEIVSELRRNNS  573
             M+NLFDL+ G++   +LTD+   DGS + RS+ D  R + P++    DK  V     ++S
Sbjct  1     MINLFDLSAGMSSTNMLTDRARIDGSPACRSRQDAKRTVDPAKVYTNDK--VGASNWSSS  58

Query  574   KMKANGTPMKMLIAEEMSKDMASKHNPPSVVAKLMGLD-GFPSQLP-VSTAQRNYSGRNA  747
             + K+N +P+ + + +EMSK++ SK   PSVVA+LMGL+   P Q P + + +RN   R+ 
Sbjct  59    RNKSNVSPLNVALEKEMSKELESKKKSPSVVARLMGLEEDLPGQEPALPSTKRNLKKRHL  118

Query  748   QSAKGTPLNNFH-HRSGSLDTQMECEFYQYPEQN-ECKDVYEV---------WQNRHDMN  894
              +      NN H H+     +   C+ +  P++  E KDVYEV         +Q++    
Sbjct  119   -NGNLVKTNNLHRHQEQYHSSMTTCDKHIGPKETVEFKDVYEVSEEPLRTYHFQDQTFPR  177

Query  895   SMRSKSPQMGRCNETSTDKVAFVRQKFIEAKCLSLDEKCHHSRQFQDALEVLSSNTDLVL  1074
              M S+S +  R        +  VRQKF+EAK L+ DEK  HS++FQ+ALEVLSSN DL L
Sbjct  178   EMSSRSKRDIR--------MEIVRQKFMEAKRLATDEKLLHSKEFQEALEVLSSNRDLFL  229

Query  1075  KFLQEPKPMLSEHIYNLQSIPAPSETKRITVLKPSKMVDN  1194
             KFL+EP    S+ +  L   P+P +TKRITVLKP+K V++
Sbjct  230   KFLEEPNSTFSKQLAGLHRSPSPPQTKRITVLKPTKFVES  269



>ref|XP_008669190.1| PREDICTED: uncharacterized protein LOC103646241 isoform X2 [Zea 
mays]
 tpg|DAA37017.1| TPA: hypothetical protein ZEAMMB73_455266 [Zea mays]
Length=450

 Score =   162 bits (409),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 111/280 (40%), Positives = 165/280 (59%), Gaps = 26/280 (9%)
 Frame = +1

Query  400   MVNLFDLNGGVAGNRLLTDKPHRDGSLS-RSQSDVAR-MSPSEDQIEDKEIVSELRRNNS  573
             M+NLFDL+ G++   +LTD+   DGS + RS+ D  R + P++    DK  V     ++S
Sbjct  14    MINLFDLSAGMSSTNMLTDRARIDGSPACRSRQDAKRTVDPAKVYTNDK--VGASNWSSS  71

Query  574   KMKANGTPMKMLIAEEMSKDMASKHNPPSVVAKLMGLD-GFPSQLP-VSTAQRNYSGRNA  747
             + K+N +P+ + + +EMSK++ SK   PSVVA+LMGL+   P Q P + + +RN   R+ 
Sbjct  72    RNKSNVSPLNVALEKEMSKELESKKKSPSVVARLMGLEEDLPGQEPALPSTKRNLKKRHL  131

Query  748   QSAKGTPLNNFH-HRSGSLDTQMECEFYQYPEQN-ECKDVYEV---------WQNRHDMN  894
              +      NN H H+     +   C+ +  P++  E KDVYEV         +Q++    
Sbjct  132   -NGNLVKTNNLHRHQEQYHSSMTTCDKHIGPKETVEFKDVYEVSEEPLRTYHFQDQTFPR  190

Query  895   SMRSKSPQMGRCNETSTDKVAFVRQKFIEAKCLSLDEKCHHSRQFQDALEVLSSNTDLVL  1074
              M S+S +  R        +  VRQKF+EAK L+ DEK  HS++FQ+ALEVLSSN DL L
Sbjct  191   EMSSRSKRDIR--------MEIVRQKFMEAKRLATDEKLLHSKEFQEALEVLSSNRDLFL  242

Query  1075  KFLQEPKPMLSEHIYNLQSIPAPSETKRITVLKPSKMVDN  1194
             KFL+EP    S+ +  L   P+P +TKRITVLKP+K V++
Sbjct  243   KFLEEPNSTFSKQLAGLHRSPSPPQTKRITVLKPTKFVES  282



>ref|NP_199201.1| uncharacterized protein [Arabidopsis thaliana]
 dbj|BAA98068.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAM91604.1| putative protein [Arabidopsis thaliana]
 gb|AED95020.1| uncharacterized protein AT5G43880 [Arabidopsis thaliana]
Length=836

 Score =   165 bits (418),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 111/271 (41%), Positives = 147/271 (54%), Gaps = 55/271 (20%)
 Frame = +1

Query  385   GCLGRMVNLFDLNGGVAGNRLLTDKPHRD-GSLSRSQSDVARMSPSEDQIEDKEIVSELR  561
             GCL RMVNLFD      G +LLT+KPH D GS+  +Q D         QIEDK  V    
Sbjct  13    GCLARMVNLFDFGTVGNGKKLLTEKPHFDHGSIKGNQFD---------QIEDKVDV----  59

Query  562   RNNSKMKANGTPMKMLIAEEMSKDMASKHNPPSVVAKLMGLDGFPSQLPVSTAQRNYSGR  741
             RN      NGTPMKML+ +EMSK+M  K +  ++VAKLMGLD FP      +A R+YS  
Sbjct  60    RNGG---VNGTPMKMLLEQEMSKEMEVKLSSTNLVAKLMGLDSFPQ---TQSAPRSYS--  111

Query  742   NAQSAKGTPLNNFHHRSGSLDTQMECEFYQYPEQNECKDVYEVWQNRHDMNSMRSKSPQM  921
                 +K     +  H                    E K+VYE+WQ   +++S        
Sbjct  112   ----SKPRLKRSLSH-------------------GEYKNVYEIWQKEGELSS--------  140

Query  922   GRCNETSTDKVAFVRQKFIEAKCLSLDEKCHHSRQFQDALEVLSSNTDLVLKFLQEPKPM  1101
                   S  K+  VR+KF+EAK L  D++  HS++FQ+A+EVLSSN +L L+FLQE    
Sbjct  141   NGVEGLSKKKMDIVREKFLEAKRLVTDDELRHSKEFQEAMEVLSSNKELFLEFLQESNNF  200

Query  1102  LSEHIYNLQSI--PAPSETKRITVLKPSKMV  1188
              S H+++ QS   P   ++KRIT+LKPSK V
Sbjct  201   FSHHLHSFQSTDPPTSEKSKRITILKPSKTV  231



>emb|CDX94731.1| BnaC07g17400D [Brassica napus]
Length=794

 Score =   165 bits (417),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 107/273 (39%), Positives = 143/273 (52%), Gaps = 53/273 (19%)
 Frame = +1

Query  379   IPGCLGRMVNLFDLNGGVAGNRLLTDKPHRDGSLSRSQSDVARMSPSEDQIEDKEIVSEL  558
             + GCLGRMVNLFD     +G +LL DKP+ D        D    S   D+IEDK +    
Sbjct  12    VQGCLGRMVNLFDFGTVGSGKKLLDDKPYFD-------DDWFIKSKQFDEIEDKVV----  60

Query  559   RRNNSKMKANGTPMKMLIAEEMSKDMASKHNPPSVVAKLMGLDGFPSQLPVSTAQRNYSG  738
              RN   +  NGTPMKML+AEEM KDM       ++VAKLMGLD FP   P +   ++   
Sbjct  61    -RNGFTVGVNGTPMKMLLAEEMFKDMELNLGSTNLVAKLMGLDSFPQTQPDAIVPKS---  116

Query  739   RNAQSAKGTPLNNFHHRSGSLDTQMECEFYQYPEQNECKDVYEVWQNRHDMNSMRSKSPQ  918
                        NN   R             +     ECK+VYE+W+            P 
Sbjct  117   -----------NNSKPR-----------LKRSLSHGECKNVYEIWEK-----------PV  143

Query  919   MGRCNETSTDKVAFVRQKFIEAKCLSLDEKCHHSRQFQDALEVLSSNTDLVLKFLQEPKP  1098
              G     S  K+  VR+KF+EAK L  D+K  HS++FQ+A+EVLSSN +L L+FLQE   
Sbjct  144   EG----LSKKKMDIVREKFLEAKRLVTDDKLRHSKEFQEAMEVLSSNKELFLEFLQESNN  199

Query  1099  MLSEHIYNLQSIPAPSET-KRITVLKPSKMVDN  1194
               S H+ +  + P P ++ KRIT+LKPSK +++
Sbjct  200   FFSHHLQSSTAPPTPEKSPKRITILKPSKSIES  232



>ref|XP_008669189.1| PREDICTED: uncharacterized protein LOC103646241 isoform X1 [Zea 
mays]
Length=507

 Score =   162 bits (410),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 107/272 (39%), Positives = 162/272 (60%), Gaps = 10/272 (4%)
 Frame = +1

Query  400   MVNLFDLNGGVAGNRLLTDKPHRDGSLS-RSQSDVAR-MSPSEDQIEDKEIVSELRRNNS  573
             M+NLFDL+ G++   +LTD+   DGS + RS+ D  R + P++    DK  V     ++S
Sbjct  71    MINLFDLSAGMSSTNMLTDRARIDGSPACRSRQDAKRTVDPAKVYTNDK--VGASNWSSS  128

Query  574   KMKANGTPMKMLIAEEMSKDMASKHNPPSVVAKLMGLD-GFPSQLP-VSTAQRNYSGRNA  747
             + K+N +P+ + + +EMSK++ SK   PSVVA+LMGL+   P Q P + + +RN   R+ 
Sbjct  129   RNKSNVSPLNVALEKEMSKELESKKKSPSVVARLMGLEEDLPGQEPALPSTKRNLKKRHL  188

Query  748   QSAKGTPLNNFH-HRSGSLDTQMECEFYQYPEQN-ECKDVYEVWQNRHDMNSMRSKS-PQ  918
              +      NN H H+     +   C+ +  P++  E KDVYEV +        + ++ P+
Sbjct  189   -NGNLVKTNNLHRHQEQYHSSMTTCDKHIGPKETVEFKDVYEVSEEPLRTYHFQDQTFPR  247

Query  919   MGRCNETSTDKVAFVRQKFIEAKCLSLDEKCHHSRQFQDALEVLSSNTDLVLKFLQEPKP  1098
                       ++  VRQKF+EAK L+ DEK  HS++FQ+ALEVLSSN DL LKFL+EP  
Sbjct  248   EMSSRSKRDIRMEIVRQKFMEAKRLATDEKLLHSKEFQEALEVLSSNRDLFLKFLEEPNS  307

Query  1099  MLSEHIYNLQSIPAPSETKRITVLKPSKMVDN  1194
               S+ +  L   P+P +TKRITVLKP+K V++
Sbjct  308   TFSKQLAGLHRSPSPPQTKRITVLKPTKFVES  339



>gb|KEH23986.1| DUF3741 family protein [Medicago truncatula]
Length=901

 Score =   164 bits (416),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 95/215 (44%), Positives = 135/215 (63%), Gaps = 11/215 (5%)
 Frame = +1

Query  562   RNNSKMKANGTPMKMLIAEEMSKDMASKHNPPSVVAKLMGLDGFPSQLPVSTAQRNYSGR  741
             R +S  K NGTP+KML+ +EMSK++ SKH+PP+VVAKLMGL+  P        +R+  G 
Sbjct  2     RASSNKKVNGTPIKMLMDQEMSKEIVSKHSPPNVVAKLMGLEALPRGEHSLAVERSPGGD  61

Query  742   NAQ---SAKGTPLNNFHHRSGSLDTQMECEFYQYPEQNECKDVYEVWQNRHDMNSMRSKS  912
              +Q   S   T  N++      +D +M  E +   EQ   KD+YE+W      +++R K+
Sbjct  62    CSQHMCSHSATSFNHWQLEDRFMDKEMLHEVHPSREQVAYKDIYEIWLQSQRTSNVRDKT  121

Query  913   PQMGRCNETSTD-KVAFVRQKFIEAKCLSLDEKCHHSRQFQDALEVLSSNTDLVLKFLQE  1089
             P+  +  E   + K+A +RQKF+EAK LS DE+   S++F++ LEVLSSN DL++K L  
Sbjct  122   PERRKWVEDVNEKKMALIRQKFMEAKRLSTDERLRQSKEFEETLEVLSSNNDLLIKLLD-  180

Query  1090  PKPMLSEHIYNLQSIPAPSETKRITVLKPSKMVDN  1194
                  S+++Y  QS P  +ETKRITVLKPSKMVDN
Sbjct  181   -----SQNLYERQSTPL-AETKRITVLKPSKMVDN  209



>gb|KJB26069.1| hypothetical protein B456_004G223300 [Gossypium raimondii]
Length=898

 Score =   164 bits (414),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 98/200 (49%), Positives = 126/200 (63%), Gaps = 7/200 (4%)
 Frame = +1

Query  604   MLIAEEMSKDMASKHNPPSVVAKLMGLDGFPSQLPVSTAQRNYSGRNAQSAKGTP---LN  774
             ML+A+EMSK+MAS+HNPP+VVAKLMGLD  P Q    +AQR +S  +++ +         
Sbjct  1     MLMAQEMSKEMASRHNPPNVVAKLMGLDALPRQQHNLSAQRCHSKGSSRQSSSHSHILAE  60

Query  775   NFHHRSGSLDTQMECEFYQYPEQNECKDVYEVWQNRHDMNSMRSKSPQMGRCNETSTDK-  951
              +    G  D +M  E     E ++ KDVYE+WQ        R  SPQ GR  +   +K 
Sbjct  61    GWEQDQGFADKEMLSEVNPCQELDKYKDVYEIWQQSPRATYSRDSSPQKGRYKDNVNEKK  120

Query  952   VAFVRQKFIEAKCLSLDEKCHHSRQFQDALEVLSSNTDLVLKFLQEPKPMLSEHIYNLQS  1131
             +A VRQKF+EAK L  DEK   +++FQDALEVLSSN +L LKFL+EP    S+H  + QS
Sbjct  121   MALVRQKFMEAKHLVTDEKLRQTKEFQDALEVLSSNRELFLKFLEEPNSNFSQH--DFQS  178

Query  1132  IPAPSETKRITVLKPSKMVD  1191
             +P P E KRITVLKP KMVD
Sbjct  179   LPQPPEKKRITVLKP-KMVD  197



>ref|XP_006850705.1| PREDICTED: uncharacterized protein LOC18440502 [Amborella trichopoda]
 gb|ERN12286.1| hypothetical protein AMTR_s00034p00242520 [Amborella trichopoda]
Length=1048

 Score =   163 bits (413),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 105/272 (39%), Positives = 149/272 (55%), Gaps = 31/272 (11%)
 Frame = +1

Query  433   AGNRLLTDKPHRDG-SLSRSQSDVARMS-----PSEDQIEDKEIVSELRRNNSKMKANGT  594
              G   +++  H D   ++R    V +M        +  +E+     ELRR++S  + +G 
Sbjct  11    GGGSFVSENAHEDVIGIARKTMGVTKMGMYSGWSCDGYLEESSFEHELRRSSS-ARGSGI  69

Query  595   PMKMLIAEEMSKDMASKHNPPSVVAKLMGLDGFPSQLPVSTAQRNYSGRNAQSAKGTPL-  771
             PMKML+AEEMSKD  SK  PPSV+A+LMGLD  P+Q  +S   ++Y   + + A   PL 
Sbjct  70    PMKMLLAEEMSKDTESKRRPPSVIARLMGLDALPTQQSIS---KHYKKNSEKQALDMPLM  126

Query  772   ---------NNFHHRSGSL--DTQMECEFYQY----PEQNECKDVYEVWQNRHDMNSMRS  906
                        +HHR  S+  D  M  E + +     EQ E KDV+EVW+      S   
Sbjct  127   KPQKKPFCHQGYHHRQESVCPDEFMSKETHSFRNHATEQQEFKDVFEVWET-----SDAG  181

Query  907   KSPQMGRCNETSTDKVAFVRQKFIEAKCLSLDEKCHHSRQFQDALEVLSSNTDLVLKFLQ  1086
             K  +     + S  K+  +RQKF++AK LS +EK   S++F DALEVL SN DL LKFLQ
Sbjct  182   KVSKQSIHTKHSEKKMELIRQKFMDAKRLSTNEKLRQSKEFHDALEVLDSNKDLFLKFLQ  241

Query  1087  EPKPMLSEHIYNLQSIPAPSETKRITVLKPSK  1182
             EP  + ++H+++LQS P P     IT+LK SK
Sbjct  242   EPDSLFTKHLHDLQSAPEPHWPSHITLLKSSK  273



>ref|XP_010526475.1| PREDICTED: uncharacterized protein LOC104804028 isoform X2 [Tarenaya 
hassleriana]
Length=824

 Score =   162 bits (409),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 101/233 (43%), Positives = 132/233 (57%), Gaps = 44/233 (19%)
 Frame = +1

Query  508   MSPS-EDQIEDKEIVSELRRNNSKMKANGTPMKMLIAEEMSKDMASKHNPPSVVAKLMGL  684
             +SPS  D  E + ++S LRR+ S  + NGTPMK LIA EMSK++  K NP +VVAKLMGL
Sbjct  2     LSPSFGDHTEAELVLSNLRRSASD-EVNGTPMKKLIAREMSKEVERKQNPTNVVAKLMGL  60

Query  685   DGFPS-QLPVSTAQRNYSGRNAQSAKGTPLNNFHHRSGSLDTQMECEFYQYPEQNECKDV  861
             D  P  QL  + +Q++Y                                        +D 
Sbjct  61    DTLPQLQLDNTASQQSY----------------------------------------EDA  80

Query  862   YEVWQNRHDMNSMRSKSPQMGRCNETSTDK-VAFVRQKFIEAKCLSLDEKCHHSRQFQDA  1038
             YE+WQ    +N  R  S + G+ +E   +K +A VR+KF+EAK L  DEK H S++FQDA
Sbjct  81    YEMWQPPQKVNRSRDSSSRKGKNDEAMREKQIALVREKFMEAKRLVTDEKLHQSKEFQDA  140

Query  1039  LEVLSSNTDLVLKFLQEPKPMLSEHIYNLQSIPAPSETKRITVLKPSKMVDNC  1197
             LEVLSSN DL +KFLQE    LS+H+ + Q +P   ETKRITVL+PSK VD  
Sbjct  141   LEVLSSNKDLFVKFLQESNSFLSQHLSDYQPVPPHLETKRITVLRPSKAVDTA  193



>ref|XP_008679171.1| PREDICTED: uncharacterized protein LOC103654120 isoform X2 [Zea 
mays]
Length=932

 Score =   162 bits (409),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 108/286 (38%), Positives = 159/286 (56%), Gaps = 33/286 (12%)
 Frame = +1

Query  376   PIPGCLGRMVNLFDLNGGVAGNRLLTDKPHRDGS-LSRSQSDVARMS---PSEDQIEDKE  543
             P PGCLGRM+++FDL+ GV   ++LT+K HRD S   + +S+  +M+   P+  Q EDK+
Sbjct  20    PFPGCLGRMIDMFDLSNGVVATKMLTEKAHRDVSPAGKDRSNTFKMAIIPPA--QTEDKQ  77

Query  544   IVSELRRN------NSKMKANGT-PMKMLIAEEMSKDMASKHNPPSVVAKLMGLDGFPSQ  702
             I S+ RRN      NS  K +G  P+KM++ + M K+      P +VVA+LMGL   P Q
Sbjct  78    IDSQTRRNSPTKRSNSPTKRSGAAPVKMIMEQGMWKEGMPDEEPLNVVARLMGLHDAPVQ  137

Query  703   LPVSTAQRNYSGRNAQSAKGTPLNNFHHRSGSLDTQMECEFYQYPEQNECKDVYEVWQNR  882
                   Q N+            L+  + R G  +     +  +  + ++ +     W   
Sbjct  138   ------QSNFH-------LARQLDKEYQRGGFEENYRNLKPNKESKCHQNQKAGHTWNGS  184

Query  883   HD----MNSMRSKSPQMGRCNETSTDKVAFVRQKFIEAKCLSLDEKCHHSRQFQDALEVL  1050
              D    +NS RSK      C E    +++ VR+KF EAK L+ DEK  HS++FQDAL+ L
Sbjct  185   GDQPSRINSSRSKHQGNEPCCEK---RMSLVREKFAEAKRLATDEKLLHSKEFQDALQFL  241

Query  1051  SSNTDLVLKFLQEPKPMLSEHIYNLQSIPAPSETKRITVLKPSKMV  1188
             SSN DL L+FL EP P+LS + Y  Q +  PS+ K+IT+LKPS++ 
Sbjct  242   SSNRDLFLEFLDEPNPLLSSNRYEFQPVAPPSQAKQITILKPSELA  287



>ref|XP_008679173.1| PREDICTED: uncharacterized protein LOC103654120 isoform X4 [Zea 
mays]
 gb|AFW64006.1| hypothetical protein ZEAMMB73_603433 [Zea mays]
Length=926

 Score =   162 bits (409),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 108/286 (38%), Positives = 159/286 (56%), Gaps = 33/286 (12%)
 Frame = +1

Query  376   PIPGCLGRMVNLFDLNGGVAGNRLLTDKPHRDGS-LSRSQSDVARMS---PSEDQIEDKE  543
             P PGCLGRM+++FDL+ GV   ++LT+K HRD S   + +S+  +M+   P+  Q EDK+
Sbjct  20    PFPGCLGRMIDMFDLSNGVVATKMLTEKAHRDVSPAGKDRSNTFKMAIIPPA--QTEDKQ  77

Query  544   IVSELRRN------NSKMKANGT-PMKMLIAEEMSKDMASKHNPPSVVAKLMGLDGFPSQ  702
             I S+ RRN      NS  K +G  P+KM++ + M K+      P +VVA+LMGL   P Q
Sbjct  78    IDSQTRRNSPTKRSNSPTKRSGAAPVKMIMEQGMWKEGMPDEEPLNVVARLMGLHDAPVQ  137

Query  703   LPVSTAQRNYSGRNAQSAKGTPLNNFHHRSGSLDTQMECEFYQYPEQNECKDVYEVWQNR  882
                   Q N+            L+  + R G  +     +  +  + ++ +     W   
Sbjct  138   ------QSNFH-------LARQLDKEYQRGGFEENYRNLKPNKESKCHQNQKAGHTWNGS  184

Query  883   HD----MNSMRSKSPQMGRCNETSTDKVAFVRQKFIEAKCLSLDEKCHHSRQFQDALEVL  1050
              D    +NS RSK      C E    +++ VR+KF EAK L+ DEK  HS++FQDAL+ L
Sbjct  185   GDQPSRINSSRSKHQGNEPCCEK---RMSLVREKFAEAKRLATDEKLLHSKEFQDALQFL  241

Query  1051  SSNTDLVLKFLQEPKPMLSEHIYNLQSIPAPSETKRITVLKPSKMV  1188
             SSN DL L+FL EP P+LS + Y  Q +  PS+ K+IT+LKPS++ 
Sbjct  242   SSNRDLFLEFLDEPNPLLSSNRYEFQPVAPPSQAKQITILKPSELA  287



>ref|XP_006648110.1| PREDICTED: uncharacterized protein LOC102717592 [Oryza brachyantha]
Length=927

 Score =   161 bits (408),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 111/283 (39%), Positives = 161/283 (57%), Gaps = 29/283 (10%)
 Frame = +1

Query  376   PIPGCLGRMVNLFDLNGGVAGNRLLTDKPHRDGS-LSRSQSDVARMS--PSEDQIEDKEI  546
             P PGCLGRM+N+FDL+ GV   ++LT+K HRD S   + + +  +M+  P   QIEDK+ 
Sbjct  20    PFPGCLGRMINMFDLSNGVVATKMLTEKAHRDVSPAGKDRGNAFKMAIGPFSSQIEDKKR  79

Query  547   VSELR------RNNSKMKANG-TPMKMLIAEEMSKDMASKHNPPSVVAKLMGL-DGFPSQ  702
              S+ R      R +S  K +G TP+KMLI ++M K+  S   P +VVA+LMGL D    Q
Sbjct  80    DSQTRKQSPTKRLSSPTKRSGETPVKMLIEQDMWKEGMSGEEPLNVVARLMGLNDAAVHQ  139

Query  703   LPVSTAQRNYSGRNAQSAKGTPLNNFHHRSGSLDTQMECEFYQYPEQNECKDVYE-VWQN  879
               + + +R+    N +   G     F   S +L  + E + +Q  E   C  + +   + 
Sbjct  140   SDLKSGKRS----NKEYRSG----GFDEHSRNLRPKKESKTHQKSEP--CGGLNDQTLRM  189

Query  880   RHDMNSMRSKSPQMGRCNETSTDKVAFVRQKFIEAKCLSLDEKCHHSRQFQDALEVLSSN  1059
                 N  + K P    C +    ++  VR+KF EAK L+ DEK  H+++FQ+AL+ LSSN
Sbjct  190   NISSNKYQGKEPS---CEK----RMTLVREKFAEAKRLATDEKLLHTKEFQEALQFLSSN  242

Query  1060  TDLVLKFLQEPKPMLSEHIYNLQSIPAPSETKRITVLKPSKMV  1188
              DL LKFL EP P+LS + Y  Q +  PSETK+IT+LKPS  +
Sbjct  243   KDLFLKFLDEPNPLLSNNNYEFQPVTPPSETKQITILKPSDSI  285



>ref|XP_003570390.1| PREDICTED: uncharacterized protein LOC100830114 [Brachypodium 
distachyon]
Length=931

 Score =   161 bits (407),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 106/282 (38%), Positives = 164/282 (58%), Gaps = 23/282 (8%)
 Frame = +1

Query  376   PIPGCLGRMVNLFDLNGGVAGNRLLTDKPHRDGS-LSRSQSDVARMSPSE--DQIEDKEI  546
             P PGCLGR++N+FDL  GV   ++LT+K HRD S + + +S   +M+ ++   QIEDK+ 
Sbjct  20    PFPGCLGRVINMFDLGNGVVATKMLTEKAHRDVSPVGKDRSGTFKMASNQFPAQIEDKQR  79

Query  547   VSELRRNNSKMKANG-------TPMKMLIAEEMSKDMASKHNPP-SVVAKLMGLDGFPSQ  702
              S+LRRN+   ++N        +P+KML+ ++M K+ A   + P +VVA+LMGL+  P  
Sbjct  80    DSQLRRNSPTKRSNSPTNRFGMSPVKMLMEQDMWKEGAVPDDEPLNVVARLMGLNDAP--  137

Query  703   LPVSTAQRNY-SGRNAQSAKGTPLNNFHHRSGSLDTQMECEFYQYPEQNECKDVYEVWQN  879
                   Q ++ SGR     K      F   + ++  + E + +Q  +     D   +W  
Sbjct  138   ----VHQSDFISGRRPN--KEYQSCGFEENNRNVKPKKEIKCFQNQKAGTRHD--HIWGG  189

Query  880   RHDMNSMRSKSPQMGRCNETSTDK-VAFVRQKFIEAKCLSLDEKCHHSRQFQDALEVLSS  1056
               D     + S    +  E+S +K ++ VR+KF EAK L+ DEK  HS++FQ+AL+ LSS
Sbjct  190   LSDQPLKVNSSKNNHQGKESSCEKRMSLVREKFAEAKRLATDEKLLHSKEFQEALQFLSS  249

Query  1057  NTDLVLKFLQEPKPMLSEHIYNLQSIPAPSETKRITVLKPSK  1182
             N D+ LKFL EP P+LS   Y+ Q +  PSE K+IT+LKP++
Sbjct  250   NKDMFLKFLDEPSPLLSSSNYDFQPVTPPSELKQITILKPAE  291



>gb|EMT03099.1| hypothetical protein F775_52439 [Aegilops tauschii]
Length=939

 Score =   160 bits (405),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 103/286 (36%), Positives = 164/286 (57%), Gaps = 34/286 (12%)
 Frame = +1

Query  376   PIPGCLGRMVNLFDLNGGVAGNRLLTDKPHRDGS-LSRSQSDVARMSPSE--DQIEDKEI  546
             P PGCLGR++N+FDL+ GV   ++LTDK HRD S   + +S   +M+ ++   Q+EDK  
Sbjct  20    PFPGCLGRVINMFDLSNGVVATKMLTDKAHRDVSPAGKDRSGSFKMASNQFPAQMEDKHR  79

Query  547   VSELRRNNSKMKANG-------TPMKMLIAEEMSKDMASKHNPPSVVAKLMGLDGFPS--  699
              S+ RR++   ++N        +P+KML+ ++M ++      P +VVA+LMGL+  P+  
Sbjct  80    DSQQRRSSPTKRSNSPTNRSGVSPVKMLMEQDMWREGVPDDEPLNVVARLMGLNDAPAVR  139

Query  700   QLPVSTAQR---NYSGRNAQSAKGTPLNNFHHRSGSLDTQMECEFYQYPEQNECKDVYEV  870
             Q  +++ +R      GRN +  K +  +  + ++G+   +        P + +       
Sbjct  140   QSDLASGRRFSMEDDGRNVKPKKESKCHQ-NQKAGTRHEETWSSLRDQPSKIDSS-----  193

Query  871   WQNRHDMNSMRSKSPQMGRCNETSTDKVAFVRQKFIEAKCLSLDEKCHHSRQFQDALEVL  1050
              +NRH     + K P   R       +++ VR+KF EAK L+ DEK  HS++FQ+AL+ L
Sbjct  194   -KNRH-----QGKDPSCER-------RMSLVREKFAEAKRLATDEKLLHSKEFQEALQFL  240

Query  1051  SSNTDLVLKFLQEPKPMLSEHIYNLQSIPAPSETKRITVLKPSKMV  1188
             SSN DL LKFL EP P+LS + Y  + +  PSE K+IT+LKPS+ V
Sbjct  241   SSNKDLFLKFLDEPTPLLSNNHYGFEPVAPPSEIKQITILKPSESV  286



>dbj|BAK04299.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=922

 Score =   160 bits (404),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 105/271 (39%), Positives = 161/271 (59%), Gaps = 8/271 (3%)
 Frame = +1

Query  400   MVNLFDLNGGVAGNRLLTDKPHRDGS-LSRSQSDVAR-MSPSEDQIEDKEIVSELRRNNS  573
             M+NLFDL+ G+A  + L D+ HR+ S + R ++D+ R + P +  IEDK  +    R++ 
Sbjct  13    MINLFDLSTGMASTKALADRTHREDSPVRRGRTDIKRTVDPDKVCIEDK--LEASTRSSL  70

Query  574   KMKANGTPMKMLIAEEMSKDMASKHNPPSVVAKLMGL-DGFPSQ-LPVSTAQRNYSGRNA  747
               K++ +PMK L+A E++K++ SK  PPSVVA+LMGL D  P+Q   + + +RN      
Sbjct  71    SSKSDASPMKKLLANEIAKEVESKRKPPSVVARLMGLEDDLPAQEQALHSPKRNLRRSQL  130

Query  748   QSAKGTPLNNFHHRSGSLDTQMECEFYQYPEQN-ECKDVYEVWQNRHDMNSMRSKSPQMG  924
                          +   L  +     +  P++  E KDVY V +     + ++ ++   G
Sbjct  131   YDDYAATKRTLQQQEQRLYNKTTRGKHIGPKETVEFKDVYAVCEEPLRTHHLQDQTSSGG  190

Query  925   RCNETSTD-KVAFVRQKFIEAKCLSLDEKCHHSRQFQDALEVLSSNTDLVLKFLQEPKPM  1101
             R ++  +D ++  VRQKFI+AK L+ DE   HS++FQ+ALEVLSSN DL LKFL+EP  +
Sbjct  191   RSSQHKSDARIEVVRQKFIQAKRLATDENFLHSKEFQEALEVLSSNKDLFLKFLEEPSSV  250

Query  1102  LSEHIYNLQSIPAPSETKRITVLKPSKMVDN  1194
              S  +Y   ++PAP +TKRITVLKP K  +N
Sbjct  251   FSNPLYGQNTMPAPPQTKRITVLKPFKSAEN  281



>ref|XP_010438386.1| PREDICTED: uncharacterized protein LOC104721992 isoform X2 [Camelina 
sativa]
Length=857

 Score =   159 bits (403),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 98/217 (45%), Positives = 135/217 (62%), Gaps = 10/217 (5%)
 Frame = +1

Query  544   IVSELRRNNSKMKANGTPMKMLIAEEMSKDMASKHNPPSVVAKLMGLDGFPSQLPVSTAQ  723
             I+ +LRR+ S  K +GTPMK LIA EMSKD+  K +PP+VVAKLMGL+  P    + TA 
Sbjct  15    IMCDLRRSASN-KVSGTPMKKLIAREMSKDVEHKQSPPNVVAKLMGLETLPQMNHLETAA  73

Query  724   RNYSGRNAQSAKGTPLNNFHHRSGSLDTQMECEFYQYPEQNECKDVYEVWQNRHDMNSMR  903
                S   + S         +H   S+D   E + YQ   + E KDVYE+WQ+   ++  R
Sbjct  74    TQRSKSRSYSYSSP-----NHSVSSMDN--EVQKYQDLSR-EFKDVYEMWQSPQKVSRSR  125

Query  904   SKSPQMGRCNETSTDK-VAFVRQKFIEAKCLSLDEKCHHSRQFQDALEVLSSNTDLVLKF  1080
               SP+ GR  E +T+K +A VRQKF EAK L  D+  H S++FQDALE LSSN DL ++F
Sbjct  126   DSSPRKGRYEENTTEKQMALVRQKFTEAKRLVTDDNLHQSKEFQDALEFLSSNKDLFVEF  185

Query  1081  LQEPKPMLSEHIYNLQSIPAPSETKRITVLKPSKMVD  1191
             LQE      +++ +  ++P+ S+ KRITVL+PSK V+
Sbjct  186   LQESNSFSRQNLSDFHTVPSHSDAKRITVLRPSKAVE  222



>ref|XP_008809665.1| PREDICTED: uncharacterized protein LOC103721293 isoform X5 [Phoenix 
dactylifera]
Length=915

 Score =   159 bits (403),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 97/221 (44%), Positives = 135/221 (61%), Gaps = 6/221 (3%)
 Frame = +1

Query  541   EIVSELRRNNSKMKANGTPMKMLIAEEMSKDMASKHNPPSVVAKLMGLDG-FPSQLPVST  717
             +I S+LR+++S  K+ GT +KMLIA+EMSK       PPSVVA+LMGLD   P+  PV  
Sbjct  2     QIASDLRKSSSIKKSGGTLVKMLIAQEMSKQTELNRKPPSVVARLMGLDDDLPATKPVLV  61

Query  718   A-QRNYSGRNAQSAKGTPLNNFHHRSGS-LDTQMECEFYQYPEQNECKDVYEVWQNRHDM  891
             A +RN     +++    P      +     +  M CE     E+ E +DV+EVWQ     
Sbjct  62    ANKRNTQEGYSRTTLTGPFQGHKQQEDVYFNKPMPCENAH--EKMEYRDVFEVWQQPSRT  119

Query  892   NSMRSKSPQMGRCNETSTDK-VAFVRQKFIEAKCLSLDEKCHHSRQFQDALEVLSSNTDL  1068
             N ++ +  Q GR N+   +K +A VRQKF+EAK L+ DE+   S++FQDALEVLSSN DL
Sbjct  120   NRIKDQPLQKGRYNKDQNEKRMALVRQKFMEAKRLATDERLLQSKEFQDALEVLSSNKDL  179

Query  1069  VLKFLQEPKPMLSEHIYNLQSIPAPSETKRITVLKPSKMVD  1191
              +KFL+EP  + S+ I  L  +P   +T+ ITVLKPSK V+
Sbjct  180   FIKFLEEPNSLFSKQIRELYMVPPAPQTQCITVLKPSKTVE  220



>ref|XP_008679172.1| PREDICTED: uncharacterized protein LOC103654120 isoform X3 [Zea 
mays]
Length=930

 Score =   159 bits (403),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 107/290 (37%), Positives = 159/290 (55%), Gaps = 37/290 (13%)
 Frame = +1

Query  376   PIPGCLGRMVNLFDLNGGVAGNRLLTDKPHRDGSLS-----RSQSDVARMS---PSEDQI  531
             P PGCLGRM+++FDL+ GV   ++LT+K HRD   +     + +S+  +M+   P+  Q 
Sbjct  20    PFPGCLGRMIDMFDLSNGVVATKMLTEKAHRDVCFAVSPAGKDRSNTFKMAIIPPA--QT  77

Query  532   EDKEIVSELRRN------NSKMKANGT-PMKMLIAEEMSKDMASKHNPPSVVAKLMGLDG  690
             EDK+I S+ RRN      NS  K +G  P+KM++ + M K+      P +VVA+LMGL  
Sbjct  78    EDKQIDSQTRRNSPTKRSNSPTKRSGAAPVKMIMEQGMWKEGMPDEEPLNVVARLMGLHD  137

Query  691   FPSQLPVSTAQRNYSGRNAQSAKGTPLNNFHHRSGSLDTQMECEFYQYPEQNECKDVYEV  870
              P Q      Q N+            L+  + R G  +     +  +  + ++ +     
Sbjct  138   APVQ------QSNFH-------LARQLDKEYQRGGFEENYRNLKPNKESKCHQNQKAGHT  184

Query  871   WQNRHD----MNSMRSKSPQMGRCNETSTDKVAFVRQKFIEAKCLSLDEKCHHSRQFQDA  1038
             W    D    +NS RSK      C E    +++ VR+KF EAK L+ DEK  HS++FQDA
Sbjct  185   WNGSGDQPSRINSSRSKHQGNEPCCEK---RMSLVREKFAEAKRLATDEKLLHSKEFQDA  241

Query  1039  LEVLSSNTDLVLKFLQEPKPMLSEHIYNLQSIPAPSETKRITVLKPSKMV  1188
             L+ LSSN DL L+FL EP P+LS + Y  Q +  PS+ K+IT+LKPS++ 
Sbjct  242   LQFLSSNRDLFLEFLDEPNPLLSSNRYEFQPVAPPSQAKQITILKPSELA  291



>ref|XP_008679165.1| PREDICTED: uncharacterized protein LOC103654120 isoform X1 [Zea 
mays]
 ref|XP_008679166.1| PREDICTED: uncharacterized protein LOC103654120 isoform X1 [Zea 
mays]
 ref|XP_008679167.1| PREDICTED: uncharacterized protein LOC103654120 isoform X1 [Zea 
mays]
 ref|XP_008679168.1| PREDICTED: uncharacterized protein LOC103654120 isoform X1 [Zea 
mays]
 ref|XP_008679169.1| PREDICTED: uncharacterized protein LOC103654120 isoform X1 [Zea 
mays]
 ref|XP_008679170.1| PREDICTED: uncharacterized protein LOC103654120 isoform X1 [Zea 
mays]
Length=936

 Score =   159 bits (403),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 107/290 (37%), Positives = 159/290 (55%), Gaps = 37/290 (13%)
 Frame = +1

Query  376   PIPGCLGRMVNLFDLNGGVAGNRLLTDKPHRDGSLS-----RSQSDVARMS---PSEDQI  531
             P PGCLGRM+++FDL+ GV   ++LT+K HRD   +     + +S+  +M+   P+  Q 
Sbjct  20    PFPGCLGRMIDMFDLSNGVVATKMLTEKAHRDVCFAVSPAGKDRSNTFKMAIIPPA--QT  77

Query  532   EDKEIVSELRRN------NSKMKANGT-PMKMLIAEEMSKDMASKHNPPSVVAKLMGLDG  690
             EDK+I S+ RRN      NS  K +G  P+KM++ + M K+      P +VVA+LMGL  
Sbjct  78    EDKQIDSQTRRNSPTKRSNSPTKRSGAAPVKMIMEQGMWKEGMPDEEPLNVVARLMGLHD  137

Query  691   FPSQLPVSTAQRNYSGRNAQSAKGTPLNNFHHRSGSLDTQMECEFYQYPEQNECKDVYEV  870
              P Q      Q N+            L+  + R G  +     +  +  + ++ +     
Sbjct  138   APVQ------QSNFH-------LARQLDKEYQRGGFEENYRNLKPNKESKCHQNQKAGHT  184

Query  871   WQNRHD----MNSMRSKSPQMGRCNETSTDKVAFVRQKFIEAKCLSLDEKCHHSRQFQDA  1038
             W    D    +NS RSK      C E    +++ VR+KF EAK L+ DEK  HS++FQDA
Sbjct  185   WNGSGDQPSRINSSRSKHQGNEPCCEK---RMSLVREKFAEAKRLATDEKLLHSKEFQDA  241

Query  1039  LEVLSSNTDLVLKFLQEPKPMLSEHIYNLQSIPAPSETKRITVLKPSKMV  1188
             L+ LSSN DL L+FL EP P+LS + Y  Q +  PS+ K+IT+LKPS++ 
Sbjct  242   LQFLSSNRDLFLEFLDEPNPLLSSNRYEFQPVAPPSQAKQITILKPSELA  291



>ref|XP_010447918.1| PREDICTED: uncharacterized protein LOC104730452 isoform X2 [Camelina 
sativa]
Length=860

 Score =   159 bits (401),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 98/217 (45%), Positives = 138/217 (64%), Gaps = 11/217 (5%)
 Frame = +1

Query  544   IVSELRRNNSKMKANGTPMKMLIAEEMSKDMASKHNPPSVVAKLMGLDGFPSQLPVSTAQ  723
             I+ +LRR+ S  K +GTPMK LIA EMSKD+  K +P +VVAKLMGL+  P Q+ + TA 
Sbjct  15    IMCDLRRSASN-KVSGTPMKKLIAREMSKDVEHKQSPTNVVAKLMGLETLP-QMHLETAA  72

Query  724   RNYSGRNAQSAKGTPLNNFHHRSGSLDTQMECEFYQYPEQNECKDVYEVWQNRHDMNSMR  903
                S   + S   +P    +H   S+D   E + YQ   + E KDVYE+WQ+   ++  R
Sbjct  73    TQRSKSRSYSY-ASP----NHSVSSMDN--EVQKYQDLSR-EFKDVYEMWQSPQKVSRSR  124

Query  904   SKSPQMGRCNETSTDK-VAFVRQKFIEAKCLSLDEKCHHSRQFQDALEVLSSNTDLVLKF  1080
               SP+ GR +E++T+K +A VRQKF EAK L  D+  H S++FQDALE LSSN DL ++F
Sbjct  125   DSSPRKGRFDESTTEKQMALVRQKFTEAKRLVTDDNLHQSKEFQDALEFLSSNKDLFVEF  184

Query  1081  LQEPKPMLSEHIYNLQSIPAPSETKRITVLKPSKMVD  1191
             LQE      +++ +   +P+  + KRITVL+PSK V+
Sbjct  185   LQESNSFSQQNLSDFHHVPSHPDAKRITVLRPSKAVE  221



>ref|XP_010433166.1| PREDICTED: uncharacterized protein LOC104717316 isoform X2 [Camelina 
sativa]
Length=856

 Score =   158 bits (399),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 98/217 (45%), Positives = 137/217 (63%), Gaps = 11/217 (5%)
 Frame = +1

Query  544   IVSELRRNNSKMKANGTPMKMLIAEEMSKDMASKHNPPSVVAKLMGLDGFPSQLPVSTAQ  723
             I+ +LRR++S  K +GTPMK LIA EMSKD+  K +P +VVAKLMGL+  P Q+ + TA 
Sbjct  15    IMCDLRRSDSN-KVSGTPMKKLIAREMSKDVEHKQSPTNVVAKLMGLETLP-QMHLETAA  72

Query  724   RNYSGRNAQSAKGTPLNNFHHRSGSLDTQMECEFYQYPEQNECKDVYEVWQNRHDMNSMR  903
                S   + S         +H   S+D   E + YQ   + E KDVYE+WQ+   ++  R
Sbjct  73    TQRSKSRSYSYSSP-----NHSVSSMDN--EVQKYQDLSR-EFKDVYEMWQSPQKVSRSR  124

Query  904   SKSPQMGRCNETSTDK-VAFVRQKFIEAKCLSLDEKCHHSRQFQDALEVLSSNTDLVLKF  1080
               SP+ GR  E +T+K +A VRQKF EAK L  D+  H S++FQDALE LSSN DL ++F
Sbjct  125   DSSPRKGRYEENTTEKQMALVRQKFTEAKRLVTDDNLHQSKEFQDALEFLSSNKDLFVEF  184

Query  1081  LQEPKPMLSEHIYNLQSIPAPSETKRITVLKPSKMVD  1191
             LQE      +++ +  ++P+ S+ KRITVL+PSK V+
Sbjct  185   LQESNSFSRQNLSDFHTVPSHSDAKRITVLRPSKAVE  221



>gb|EMS54382.1| hypothetical protein TRIUR3_15055 [Triticum urartu]
Length=1009

 Score =   156 bits (395),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 106/287 (37%), Positives = 161/287 (56%), Gaps = 38/287 (13%)
 Frame = +1

Query  376   PIPGCLGRMVNLFDLNGGVAGNRLLTDKPHRDGS-LSRSQSDVARMSPSE--DQIEDKEI  546
             P PGCLGR++N+FDL+ GV   ++LTDK HRD S   + +S   +M+ ++   Q+EDK  
Sbjct  98    PFPGCLGRVINMFDLSNGVVATKMLTDKAHRDVSPAGKDRSGSFKMASNQFPAQMEDKHR  157

Query  547   VSELRRNNSKMKANG-------TPMKMLIAEEMSKDMASKHNPPSVVAKLMGLDGFPS--  699
              S+ RR++   ++N        +P+KML+ ++M ++      P +VVA+LMGL+  PS  
Sbjct  158   DSQQRRSSPTKRSNSPTNRSGVSPVKMLMEQDMWREGVPDDEPLNVVARLMGLNDAPSVH  217

Query  700   QLPVSTAQR---NYSGRNAQSAKGTPLNNFHHRSGSLDTQMECEFYQYPEQNECKDVYEV  870
             Q  + + +R      GRN +  K     +  H++    T+ E                E 
Sbjct  218   QSDLGSGRRFSKEDDGRNVKPKK----ESRCHQNQKAGTRHE----------------ET  257

Query  871   WQNRHDMNSMRSKSPQMGRCNETSTDK-VAFVRQKFIEAKCLSLDEKCHHSRQFQDALEV  1047
             W  R D  S    S    + N+ S ++ ++ VR+KF EAK L+ DEK  HS++FQ+AL+ 
Sbjct  258   W--RRDQPSKIDSSKNRHQGNDPSCERRMSLVREKFAEAKRLATDEKLLHSKEFQEALQF  315

Query  1048  LSSNTDLVLKFLQEPKPMLSEHIYNLQSIPAPSETKRITVLKPSKMV  1188
             LSSN DL LKFL EP P+LS + Y    +  PSE K+IT+LKP++ V
Sbjct  316   LSSNKDLFLKFLDEPTPLLSNNHYGFDPVAPPSEIKQITILKPAESV  362



>ref|XP_008796409.1| PREDICTED: uncharacterized protein LOC103711875 [Phoenix dactylifera]
Length=879

 Score =   155 bits (393),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 96/207 (46%), Positives = 126/207 (61%), Gaps = 26/207 (13%)
 Frame = +1

Query  598   MKMLIAEEMSKDMASKHNPPSVVAKLMGLDGFPSQLPVSTA----QRNYSGRNAQSAKGT  765
             MKMLI EEM K+   K  PP+VVA+LMGLD  P Q    T     Q +YS R A + +G 
Sbjct  1     MKMLIQEEMWKETELKQKPPNVVARLMGLDSLPVQPSFLTVKKSFQEDYSHRMAGALRG-  59

Query  766   PLNNFHHRSGSLDTQMECEFYQYP-------EQNECKDVYEVWQNRHDMNSMRSKSPQMG  924
                   HR        + E++  P       E+NE KDVYEV Q    ++ ++ + PQ G
Sbjct  60    ------HR------WQQDEYFHNPVRCEIPHEKNEYKDVYEVRQQPSKISHIKDQRPQKG  107

Query  925   RCNETSTDK-VAFVRQKFIEAKCLSLDEKCHHSRQFQDALEVLSSNTDLVLKFLQEPKPM  1101
             R +E S +K +  VRQKFIEAK L+ DE    +++FQ ALEVLSSN D+ LKFL+EP  +
Sbjct  108   RYDENSYEKRMTLVRQKFIEAKRLATDENLIQTKEFQGALEVLSSNRDVFLKFLEEPNSL  167

Query  1102  LSEHIYNLQSIPAPSETKRITVLKPSK  1182
              S+HI+ LQ I +P +TKRIT+LKPSK
Sbjct  168   FSKHIHKLQ-IISPPQTKRITILKPSK  193



>ref|XP_010253351.1| PREDICTED: uncharacterized protein LOC104594654 isoform X4 [Nelumbo 
nucifera]
Length=803

 Score =   154 bits (389),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 106/299 (35%), Positives = 162/299 (54%), Gaps = 36/299 (12%)
 Frame = +1

Query  334   MYAVQNGKNRGLEKPIPGCLGRMVNLFDLNGGVAGNRLLTDKPHRDGSLSRSQS----DV  501
             M   Q+ ++ G EKP  GC  ++ +  D N G     +LT++    G++   +      V
Sbjct  1     MERFQHKRSLGKEKPYHGCSAKIRSFSDQNPGTY--LVLTERVLNQGNVQNEKLVDTLKV  58

Query  502   ARMSPSEDQIEDKEIVSELR-RNNSKMKANGTPMKMLIAEEMSKDMASKHNPPSVVAKLM  678
             A  S S   +  +E +  L  R NS  +A GTPMK L+AEE+SK++ S+   PSV+A+LM
Sbjct  59    ASDSSSCSSVLLEEGLHALELRCNSLKQAGGTPMKKLLAEELSKEVESRRRTPSVIARLM  118

Query  679   GLDGFPSQLPVSTAQRNYSGRNAQSAKGTPLNNFHHRSGSLDTQMECEFYQYP-------  837
             GLD  PS  PV   Q+ +S              +  R  S+ +  +   Y+ P       
Sbjct  119   GLDALPSPHPVHKQQKKFS------------QTYLQRRASIGSNEKTPPYEAPSLRLGTN  166

Query  838   EQNECKDVYEVWQ-----NRHDMNSMRSKSPQMGRCNETSTDKVAFVRQKFIEAKCLSLD  1002
             +Q E KDV+EV +      + ++   + K+    R      +K+A +R+ F++AK LS D
Sbjct  167   DQQEFKDVFEVLEASKVAKKTNLIFQKEKAHVKQR-----DEKMALIRENFMDAKRLSTD  221

Query  1003  EKCHHSRQFQDALEVLSSNTDLVLKFLQEPKPMLSEHIYNLQSIPAPSETKRITVLKPS  1179
             EK  HS +FQDALEVL SN DL+LKFLQEP  + ++H+++LQS+P    +  +T+LKPS
Sbjct  222   EKLQHSMEFQDALEVLDSNKDLLLKFLQEPDSLFTKHLHDLQSVPPAQLSAHVTILKPS  280



>emb|CAH67333.1| OSIGBa0157A06.2 [Oryza sativa Indica Group]
Length=938

 Score =   155 bits (391),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 106/257 (41%), Positives = 148/257 (58%), Gaps = 10/257 (4%)
 Frame = +1

Query  445   LLTDKPHRDGS-LSRSQSDVAR-MSPSEDQIEDKEIVSELRRNNSKMKANGTPMKMLIAE  618
             +LTD+ HRDGS + +S+ DV R + P    +EDK +V+  R N+S  K+  +PM  L+A 
Sbjct  6     VLTDRTHRDGSRVHKSRQDVNRTVDPKIGCVEDKLVVASTR-NSSSNKSTISPMNRLVAM  64

Query  619   EMSKDMASKHNPPSVVAKLMGLDG-FPSQLPVSTAQRNYSGRNAQSAKGTPLNNFHHRSG  795
             EMSK + SK  PPSVVA+LMGLD   P++ P   + R    R+         N    +  
Sbjct  65    EMSKGVESKRKPPSVVARLMGLDDDLPAKEPALQSSRRNLRRSHSLDNLAATNRPQQQQE  124

Query  796   SLDTQMECEFYQYPEQN-ECKDVYEVWQN---RHDMNSMRSKSPQMGRCNETSTDKVAFV  963
                ++     +  P++  E KDVYEV ++   RH +  +    P        S  ++  V
Sbjct  125   QHYSRTTPNIHIGPKETVEFKDVYEVSEDPLKRHHI--LGQNFPWERSSGNKSDTRIEAV  182

Query  964   RQKFIEAKCLSLDEKCHHSRQFQDALEVLSSNTDLVLKFLQEPKPMLSEHIYNLQSIPAP  1143
             RQKF+EAK L+ +E   HS+QFQ+ALEVLSSN +L LKFL+EP P   + +  L + PAP
Sbjct  183   RQKFMEAKRLATNENLIHSKQFQEALEVLSSNRELFLKFLEEPSPAFLKQLDGLDTTPAP  242

Query  1144  SETKRITVLKPSKMVDN  1194
               TKRITVLKP K V+N
Sbjct  243   PPTKRITVLKPIKSVEN  259



>gb|EEC77598.1| hypothetical protein OsI_16564 [Oryza sativa Indica Group]
Length=939

 Score =   154 bits (390),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 106/257 (41%), Positives = 146/257 (57%), Gaps = 9/257 (4%)
 Frame = +1

Query  445   LLTDKPHRDGS-LSRSQSDVAR-MSPSEDQIEDKEIVSELRRNNSKMKANGTPMKMLIAE  618
             +LTD+ HRDGS + +S+ DV R + P    +EDK  V    RN+S  K+  +PM  L+A 
Sbjct  6     VLTDRTHRDGSRVHKSRQDVNRTVDPKIGCVEDKLQVVASTRNSSSNKSTISPMNRLVAM  65

Query  619   EMSKDMASKHNPPSVVAKLMGLDG-FPSQLPVSTAQRNYSGRNAQSAKGTPLNNFHHRSG  795
             EMSK + SK  PPSVVA+LMGLD   P++ P   + R    R+         N    +  
Sbjct  66    EMSKGVESKRKPPSVVARLMGLDDDLPAKEPALQSSRRNLRRSHSLDNLAATNRPQQQQE  125

Query  796   SLDTQMECEFYQYPEQN-ECKDVYEVWQN---RHDMNSMRSKSPQMGRCNETSTDKVAFV  963
                ++     +  P++  E KDVYEV ++   RH +  +    P        S  ++  V
Sbjct  126   QHYSRTTPNIHIGPKETVEFKDVYEVSEDPLKRHHI--LGQNFPWERSSGNKSDTRIEAV  183

Query  964   RQKFIEAKCLSLDEKCHHSRQFQDALEVLSSNTDLVLKFLQEPKPMLSEHIYNLQSIPAP  1143
             RQKF+EAK L+ +E   HS+QFQ+ALEVLSSN +L LKFL+EP P   + +  L + PAP
Sbjct  184   RQKFMEAKRLATNENLIHSKQFQEALEVLSSNRELFLKFLEEPSPAFLKQLDGLDTTPAP  243

Query  1144  SETKRITVLKPSKMVDN  1194
               TKRITVLKP K V+N
Sbjct  244   PPTKRITVLKPIKSVEN  260



>gb|EEE61300.1| hypothetical protein OsJ_15391 [Oryza sativa Japonica Group]
Length=939

 Score =   154 bits (390),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 106/257 (41%), Positives = 146/257 (57%), Gaps = 9/257 (4%)
 Frame = +1

Query  445   LLTDKPHRDGS-LSRSQSDVAR-MSPSEDQIEDKEIVSELRRNNSKMKANGTPMKMLIAE  618
             +LTD+ HRDGS + +S+ DV R + P    +EDK  V    RN+S  K+  +PM  L+A 
Sbjct  6     VLTDRTHRDGSRVHKSRQDVNRTVDPKIGCVEDKLQVVASTRNSSSNKSTISPMNRLVAM  65

Query  619   EMSKDMASKHNPPSVVAKLMGLDG-FPSQLPVSTAQRNYSGRNAQSAKGTPLNNFHHRSG  795
             EMSK + SK  PPSVVA+LMGLD   P++ P   + R    R+         N    +  
Sbjct  66    EMSKGVESKRKPPSVVARLMGLDDDLPAKEPALQSSRRNLRRSHSLDNLAATNRPQQQQE  125

Query  796   SLDTQMECEFYQYPEQN-ECKDVYEVWQN---RHDMNSMRSKSPQMGRCNETSTDKVAFV  963
                ++     +  P++  E KDVYEV ++   RH +  +    P        S  ++  V
Sbjct  126   QHYSRTTPNIHIGPKETVEFKDVYEVSEDPLKRHHI--LGQNFPWERSSGNKSDTRIEAV  183

Query  964   RQKFIEAKCLSLDEKCHHSRQFQDALEVLSSNTDLVLKFLQEPKPMLSEHIYNLQSIPAP  1143
             RQKF+EAK L+ +E   HS+QFQ+ALEVLSSN +L LKFL+EP P   + +  L + PAP
Sbjct  184   RQKFMEAKRLATNENLIHSKQFQEALEVLSSNRELFLKFLEEPSPAFLKQLDGLDTTPAP  243

Query  1144  SETKRITVLKPSKMVDN  1194
               TKRITVLKP K V+N
Sbjct  244   PPTKRITVLKPIKSVEN  260



>ref|XP_009382189.1| PREDICTED: uncharacterized protein LOC103970221 isoform X3 [Musa 
acuminata subsp. malaccensis]
Length=899

 Score =   154 bits (388),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 99/222 (45%), Positives = 137/222 (62%), Gaps = 23/222 (10%)
 Frame = +1

Query  556   LRRNNSKMKANGTPMKMLIAEEMSKDMASKHNPPSVVAKLMGLDG-FPSQL-PVSTAQRN  729
             L +N+SK K+ GTPMKMLIA+EMSK+  SK  P SVVA+LMGLD    +QL PV++ ++ 
Sbjct  29    LYQNSSKKKSGGTPMKMLIAQEMSKETKSKRKPHSVVARLMGLDDDLTTQLSPVASQRKL  88

Query  730   YSGRNAQSAKGTPLNNFHHRSGSLD-----TQMECEFYQYP-EQNECKDVYEVWQNRHDM  891
               G    ++ G       HR    D      ++ CE +Q+   + E + V EVW+     
Sbjct  89    LEGYPQTASAGV------HRGHLQDDVFCNKEVPCELHQHDCLKMERRYVSEVWKQP---  139

Query  892   NSMRSKSPQMGRCNETSTD-KVAFVRQKFIEAKCLSLDEKCHHSRQFQDALEVLSSNTDL  1068
             +  RS+     RC ET  D ++A VRQKF+EAK L+ DE   HS++FQDALEVL+ N DL
Sbjct  140   SQSRSR-----RCGETQNDLRMALVRQKFMEAKHLATDENLIHSKEFQDALEVLNLNRDL  194

Query  1069  VLKFLQEPKPMLSEHIYNLQSIPAPSETKRITVLKPSKMVDN  1194
              LKFL+EP  + S+  ++L+S+P P +   ITVLKPSK V+ 
Sbjct  195   FLKFLEEPNSLFSKQTFDLRSVPPPPQPNHITVLKPSKKVET  236



>emb|CAA22976.1| putative protein [Arabidopsis thaliana]
 emb|CAB81464.1| putative protein [Arabidopsis thaliana]
Length=880

 Score =   153 bits (387),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 96/213 (45%), Positives = 133/213 (62%), Gaps = 12/213 (6%)
 Frame = +1

Query  547   VSELRRNNSKMKANGTPMKMLIAEEMSKDMASKHNPPSVVAKLMGLDGFPSQLPVSTAQR  726
             +S+LRR+ S  K +GTPMK LIA EMSK++  K +P +VVAKLMGL+  P     +  QR
Sbjct  1     MSDLRRSASS-KLSGTPMKKLIAREMSKEVEHKQSPTNVVAKLMGLETLPQTHQETATQR  59

Query  727   NYSGRNAQSAKGTPLNNFHHRSGSLDTQMECEFYQYPEQNECKDVYEVWQNRHDMNSMRS  906
             + S  N+ S+    + +         T  E + YQ   + E KDVYE WQ+   ++  R 
Sbjct  60    SKSRSNSHSSLNHSMTS---------TDNEVQKYQDFSR-EFKDVYETWQSPQKVSRSRD  109

Query  907   KSPQMGRCNETSTDK-VAFVRQKFIEAKCLSLDEKCHHSRQFQDALEVLSSNTDLVLKFL  1083
              SP+ GR +E++T+K +A VRQKF EAK L  D+  H S++FQDALEVLSSN DL ++FL
Sbjct  110   CSPRKGRYDESTTEKQMALVRQKFSEAKRLVTDDSLHQSKEFQDALEVLSSNKDLFVQFL  169

Query  1084  QEPKPMLSEHIYNLQSIPAPSETKRITVLKPSK  1182
             QE      +++ +   +P  SE KRITVL+PSK
Sbjct  170   QESNSFSQQNLSDFHHVPPHSEAKRITVLRPSK  202



>ref|XP_010253350.1| PREDICTED: uncharacterized protein LOC104594654 isoform X3 [Nelumbo 
nucifera]
Length=1007

 Score =   153 bits (387),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 106/299 (35%), Positives = 162/299 (54%), Gaps = 36/299 (12%)
 Frame = +1

Query  334   MYAVQNGKNRGLEKPIPGCLGRMVNLFDLNGGVAGNRLLTDKPHRDGSLSRSQS----DV  501
             M   Q+ ++ G EKP  GC  ++ +  D N G     +LT++    G++   +      V
Sbjct  1     MERFQHKRSLGKEKPYHGCSAKIRSFSDQNPGTY--LVLTERVLNQGNVQNEKLVDTLKV  58

Query  502   ARMSPSEDQIEDKEIVSELR-RNNSKMKANGTPMKMLIAEEMSKDMASKHNPPSVVAKLM  678
             A  S S   +  +E +  L  R NS  +A GTPMK L+AEE+SK++ S+   PSV+A+LM
Sbjct  59    ASDSSSCSSVLLEEGLHALELRCNSLKQAGGTPMKKLLAEELSKEVESRRRTPSVIARLM  118

Query  679   GLDGFPSQLPVSTAQRNYSGRNAQSAKGTPLNNFHHRSGSLDTQMECEFYQYP-------  837
             GLD  PS  PV   Q+ +S              +  R  S+ +  +   Y+ P       
Sbjct  119   GLDALPSPHPVHKQQKKFS------------QTYLQRRASIGSNEKTPPYEAPSLRLGTN  166

Query  838   EQNECKDVYEVWQ-----NRHDMNSMRSKSPQMGRCNETSTDKVAFVRQKFIEAKCLSLD  1002
             +Q E KDV+EV +      + ++   + K+    R      +K+A +R+ F++AK LS D
Sbjct  167   DQQEFKDVFEVLEASKVAKKTNLIFQKEKAHVKQR-----DEKMALIRENFMDAKRLSTD  221

Query  1003  EKCHHSRQFQDALEVLSSNTDLVLKFLQEPKPMLSEHIYNLQSIPAPSETKRITVLKPS  1179
             EK  HS +FQDALEVL SN DL+LKFLQEP  + ++H+++LQS+P    +  +T+LKPS
Sbjct  222   EKLQHSMEFQDALEVLDSNKDLLLKFLQEPDSLFTKHLHDLQSVPPAQLSAHVTILKPS  280



>ref|XP_010253348.1| PREDICTED: uncharacterized protein LOC104594654 isoform X1 [Nelumbo 
nucifera]
Length=1018

 Score =   153 bits (386),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 106/299 (35%), Positives = 162/299 (54%), Gaps = 36/299 (12%)
 Frame = +1

Query  334   MYAVQNGKNRGLEKPIPGCLGRMVNLFDLNGGVAGNRLLTDKPHRDGSLSRSQS----DV  501
             M   Q+ ++ G EKP  GC  ++ +  D N G     +LT++    G++   +      V
Sbjct  1     MERFQHKRSLGKEKPYHGCSAKIRSFSDQNPGTY--LVLTERVLNQGNVQNEKLVDTLKV  58

Query  502   ARMSPSEDQIEDKEIVSELR-RNNSKMKANGTPMKMLIAEEMSKDMASKHNPPSVVAKLM  678
             A  S S   +  +E +  L  R NS  +A GTPMK L+AEE+SK++ S+   PSV+A+LM
Sbjct  59    ASDSSSCSSVLLEEGLHALELRCNSLKQAGGTPMKKLLAEELSKEVESRRRTPSVIARLM  118

Query  679   GLDGFPSQLPVSTAQRNYSGRNAQSAKGTPLNNFHHRSGSLDTQMECEFYQYP-------  837
             GLD  PS  PV   Q+ +S              +  R  S+ +  +   Y+ P       
Sbjct  119   GLDALPSPHPVHKQQKKFS------------QTYLQRRASIGSNEKTPPYEAPSLRLGTN  166

Query  838   EQNECKDVYEVWQ-----NRHDMNSMRSKSPQMGRCNETSTDKVAFVRQKFIEAKCLSLD  1002
             +Q E KDV+EV +      + ++   + K+    R      +K+A +R+ F++AK LS D
Sbjct  167   DQQEFKDVFEVLEASKVAKKTNLIFQKEKAHVKQR-----DEKMALIRENFMDAKRLSTD  221

Query  1003  EKCHHSRQFQDALEVLSSNTDLVLKFLQEPKPMLSEHIYNLQSIPAPSETKRITVLKPS  1179
             EK  HS +FQDALEVL SN DL+LKFLQEP  + ++H+++LQS+P    +  +T+LKPS
Sbjct  222   EKLQHSMEFQDALEVLDSNKDLLLKFLQEPDSLFTKHLHDLQSVPPAQLSAHVTILKPS  280



>ref|XP_010253349.1| PREDICTED: uncharacterized protein LOC104594654 isoform X2 [Nelumbo 
nucifera]
Length=1017

 Score =   153 bits (386),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 106/299 (35%), Positives = 162/299 (54%), Gaps = 36/299 (12%)
 Frame = +1

Query  334   MYAVQNGKNRGLEKPIPGCLGRMVNLFDLNGGVAGNRLLTDKPHRDGSLSRSQS----DV  501
             M   Q+ ++ G EKP  GC  ++ +  D N G     +LT++    G++   +      V
Sbjct  1     MERFQHKRSLGKEKPYHGCSAKIRSFSDQNPGTY--LVLTERVLNQGNVQNEKLVDTLKV  58

Query  502   ARMSPSEDQIEDKEIVSELR-RNNSKMKANGTPMKMLIAEEMSKDMASKHNPPSVVAKLM  678
             A  S S   +  +E +  L  R NS  +A GTPMK L+AEE+SK++ S+   PSV+A+LM
Sbjct  59    ASDSSSCSSVLLEEGLHALELRCNSLKQAGGTPMKKLLAEELSKEVESRRRTPSVIARLM  118

Query  679   GLDGFPSQLPVSTAQRNYSGRNAQSAKGTPLNNFHHRSGSLDTQMECEFYQYP-------  837
             GLD  PS  PV   Q+ +S              +  R  S+ +  +   Y+ P       
Sbjct  119   GLDALPSPHPVHKQQKKFS------------QTYLQRRASIGSNEKTPPYEAPSLRLGTN  166

Query  838   EQNECKDVYEVWQ-----NRHDMNSMRSKSPQMGRCNETSTDKVAFVRQKFIEAKCLSLD  1002
             +Q E KDV+EV +      + ++   + K+    R      +K+A +R+ F++AK LS D
Sbjct  167   DQQEFKDVFEVLEASKVAKKTNLIFQKEKAHVKQR-----DEKMALIRENFMDAKRLSTD  221

Query  1003  EKCHHSRQFQDALEVLSSNTDLVLKFLQEPKPMLSEHIYNLQSIPAPSETKRITVLKPS  1179
             EK  HS +FQDALEVL SN DL+LKFLQEP  + ++H+++LQS+P    +  +T+LKPS
Sbjct  222   EKLQHSMEFQDALEVLDSNKDLLLKFLQEPDSLFTKHLHDLQSVPPAQLSAHVTILKPS  280



>ref|XP_002448137.1| hypothetical protein SORBIDRAFT_06g021940 [Sorghum bicolor]
 gb|EES12465.1| hypothetical protein SORBIDRAFT_06g021940 [Sorghum bicolor]
Length=940

 Score =   150 bits (379),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 101/271 (37%), Positives = 161/271 (59%), Gaps = 9/271 (3%)
 Frame = +1

Query  400   MVNLFDLNGGVAGNRLLTDKPHRDGSLS-RSQSDVARMSPSEDQIEDKEIVSELRRNNSK  576
             M+NLFDL+ G++   +LTD+   DGS + R++  V R   S     D ++ +    ++S+
Sbjct  13    MINLFDLSAGMSSTNVLTDRARTDGSPACRNKQAVKRTVDSAKVYADDKVGAS-NWSSSR  71

Query  577   MKANGTPMKMLIAEEMSKDMASKHNPPSVVAKLMGLD-GFPSQLP-VSTAQRNYSGRNAQ  750
              K+N +P+ + + +EMSK++ +K +P SVVA+LMGL+   P Q P +   +RN   R+  
Sbjct  72    NKSNASPLNVALEKEMSKELEAKKSP-SVVARLMGLEEDLPGQEPTLHFPKRNVKKRHL-  129

Query  751   SAKGTPLNNFH-HRSGSLDTQMECEFYQYP-EQNECKDVYEVWQNRHDMNSMRSKS-PQM  921
             +      NN H H+     +   C+ +  P E  E KDVYEV +       ++ ++ P+ 
Sbjct  130   NGNLVETNNLHQHQEQYHSSMTTCDKHIGPNETVEFKDVYEVSEEPLRTYHLQDQTFPRE  189

Query  922   GRCNETSTDKVAFVRQKFIEAKCLSLDEKCHHSRQFQDALEVLSSNTDLVLKFLQEPKPM  1101
                      ++  VRQKF+EAK L+ +EK  HS++FQ+A+E+LSSN DL LKFL+EP   
Sbjct  190   MSSRSKRDIRMEIVRQKFMEAKRLATNEKLLHSKEFQEAVEILSSNRDLFLKFLEEPNST  249

Query  1102  LSEHIYNLQSIPAPSETKRITVLKPSKMVDN  1194
              S+ +  L   P+P +TKRITVLKP+K+V++
Sbjct  250   FSKQLAGLHRSPSPPQTKRITVLKPTKLVES  280



>ref|XP_010260031.1| PREDICTED: uncharacterized protein LOC104599262 [Nelumbo nucifera]
 ref|XP_010260032.1| PREDICTED: uncharacterized protein LOC104599262 [Nelumbo nucifera]
Length=1027

 Score =   150 bits (380),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 103/294 (35%), Positives = 156/294 (53%), Gaps = 16/294 (5%)
 Frame = +1

Query  334   MYAVQNGKNRGLEKPIPGCLGRMVNLFDLNGG---VAGNRLLTDKPHRDGSLSRSQSDVA  504
             M   Q  ++ G  KP  GC   + N+ D       V   R+L +   ++  L  +    +
Sbjct  1     MEGFQQKRSFGKGKPYHGCAVTLRNISDQKSDINLVLTERVLNEANVQNQKLVDTLKAAS  60

Query  505   RMSPSEDQIEDKEIVSELRRNNSKMKANGTPMKMLIAEEMSKDMASKHNPPSVVAKLMGL  684
               S     + ++ +     R  S  ++ GTP+K L+A+E+SK+M S+  PPSV+A+LMGL
Sbjct  61    DSSSCSSDLSEQGLYGLELRKGSLKQSGGTPIKKLLADELSKEMESRRRPPSVIARLMGL  120

Query  685   DGFPSQLPVSTAQRNYSGRNAQSAKGTPLNNFHHRSGSLDTQ---MECEFYQYPEQNECK  855
             D  PS  PV   Q+ +S    Q      L   H +S   + Q   M+       +Q+E K
Sbjct  121   DAMPSPQPVRKQQKKFSENYLQKTASIGL---HEKSPPYNVQSFRMDSN-----KQHEFK  172

Query  856   DVYEVWQNRHDMNSMRSKSPQMGRCNETSTD-KVAFVRQKFIEAKCLSLDEKCHHSRQFQ  1032
             DV+EV +    M+   + + Q G+ N   TD K+A +R+KF++AK LS +EK  HS++F 
Sbjct  173   DVFEVLETSK-MSKKSNPTVQKGKANFKQTDEKMALIREKFMDAKRLSTNEKLQHSKEFH  231

Query  1033  DALEVLSSNTDLVLKFLQEPKPMLSEHIYNLQSIPAPSETKRITVLKPSKMVDN  1194
             DALEVL SN DL LKFLQEP  + ++H+++L+ +P       ITVLK S    N
Sbjct  232   DALEVLDSNKDLFLKFLQEPDSLFTKHLHDLKGVPHTLPAGHITVLKSSNAPKN  285



>gb|EEC74239.1| hypothetical protein OsI_09439 [Oryza sativa Indica Group]
Length=934

 Score =   150 bits (379),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 109/293 (37%), Positives = 157/293 (54%), Gaps = 43/293 (15%)
 Frame = +1

Query  376   PIPGCLGRMVNLFDLNGGVAGNRLLTDKPHRDGS-LSRSQSDVARMS--PSEDQIEDKEI  546
             P PGCLGRM+N+FDL+ GV   ++LT+K HRD S   + + +  +M+  P   QIEDK+ 
Sbjct  20    PFPGCLGRMINMFDLSNGVVATKMLTEKAHRDVSPAGKDRGNAFKMAIGPFSSQIEDKKR  79

Query  547   VSELR------RNNSKMKANG-TPMKMLIAEEMSKDMASKHNPPSVVAKLMGLDGFPSQL  705
              S+ R      R +S  K +G  P+K+L+ ++M K+  S   P +VVA+LMGL       
Sbjct  80    DSQPRKQSPTKRLSSPTKRSGEAPVKLLMEQDMWKEGMSGEEPLNVVARLMGL-------  132

Query  706   PVSTAQRNYSGRNAQSAKGTPLNNFHHRSGSLDTQM-----ECEFYQYPEQNE------C  852
                    N +  +    K    ++  +RSG  D        + +   +P Q        C
Sbjct  133   -------NDAAGHQSDLKSGKRSDKEYRSGGFDENSRNLRPKKDSKGHPNQKAGTHSEPC  185

Query  853   KDVYEVWQNRHDMNSMRSKSPQMGRCNETSTDK-VAFVRQKFIEAKCLSLDEKCHHSRQF  1029
                 +       MNS R+K     +  E S +K +  VR+KF EAK L+ DEK  H+++F
Sbjct  186   SGFSD---QTLRMNSSRNKH----QGKEPSCEKRMTLVREKFAEAKRLATDEKLLHTKEF  238

Query  1030  QDALEVLSSNTDLVLKFLQEPKPMLSEHIYNLQSIPAPSETKRITVLKPSKMV  1188
             Q+AL+ LSSN DL LKFL EP P+LS + Y  Q    PSETK+IT+LKPS  +
Sbjct  239   QEALQFLSSNKDLFLKFLDEPNPLLSHNNYEFQPDTPPSETKQITILKPSDSI  291



>ref|NP_001048512.1| Os02g0816400 [Oryza sativa Japonica Group]
 dbj|BAD22010.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF10426.1| Os02g0816400 [Oryza sativa Japonica Group]
 dbj|BAG94939.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE58041.1| hypothetical protein OsJ_08870 [Oryza sativa Japonica Group]
Length=934

 Score =   150 bits (378),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 109/293 (37%), Positives = 157/293 (54%), Gaps = 43/293 (15%)
 Frame = +1

Query  376   PIPGCLGRMVNLFDLNGGVAGNRLLTDKPHRDGS-LSRSQSDVARMS--PSEDQIEDKEI  546
             P PGCLGRM+N+FDL+ GV   ++LT+K HRD S   + + +  +M+  P   QIEDK+ 
Sbjct  20    PFPGCLGRMINMFDLSNGVVATKMLTEKAHRDVSPAGKDRGNAFKMAIGPFSSQIEDKKR  79

Query  547   VSELR------RNNSKMKANG-TPMKMLIAEEMSKDMASKHNPPSVVAKLMGLDGFPSQL  705
              S+ R      R +S  K +G  P+K+L+ ++M K+  S   P +VVA+LMGL       
Sbjct  80    DSQPRKQSPTKRLSSPTKRSGEAPVKLLMEQDMWKEGMSGEEPLNVVARLMGL-------  132

Query  706   PVSTAQRNYSGRNAQSAKGTPLNNFHHRSGSLDTQM-----ECEFYQYPEQNE------C  852
                    N +  +    K    ++  +RSG  D        + +   +P Q        C
Sbjct  133   -------NDAAGHQSDLKSGKRSDKEYRSGGFDENSRNLRPKKDSKGHPNQKAGTHSEPC  185

Query  853   KDVYEVWQNRHDMNSMRSKSPQMGRCNETSTDK-VAFVRQKFIEAKCLSLDEKCHHSRQF  1029
                 +       MNS R+K     +  E S +K +  VR+KF EAK L+ DEK  H+++F
Sbjct  186   SGFSD---QTLRMNSSRNKH----QGKEPSCEKRMTLVREKFAEAKRLATDEKLLHTKEF  238

Query  1030  QDALEVLSSNTDLVLKFLQEPKPMLSEHIYNLQSIPAPSETKRITVLKPSKMV  1188
             Q+AL+ LSSN DL LKFL EP P+LS + Y  Q    PSETK+IT+LKPS  +
Sbjct  239   QEALQFLSSNKDLFLKFLDEPNPLLSHNNYEFQPDTPPSETKQITILKPSDSI  291



>ref|XP_006652490.1| PREDICTED: uncharacterized protein LOC102722484 isoform X2 [Oryza 
brachyantha]
Length=979

 Score =   150 bits (378),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 106/279 (38%), Positives = 152/279 (54%), Gaps = 24/279 (9%)
 Frame = +1

Query  400   MVNLFDLNGGVAGNRLLTDKPHRDGS-LSRSQSDVAR-MSPSEDQIEDKEIVSELRRNNS  573
             M+NLFDL+ G+A   +L  +  RDGS + + + DV R   P+   +EDK + S    +++
Sbjct  38    MINLFDLSTGMASTDVLMGRTRRDGSQVRKGRQDVNRAFGPTIGCVEDKLVASTRSSSSN  97

Query  574   KMKANGTPMKMLIAEEMSKDMASKHNPPSVVAKLMGLDGFPSQLPVSTAQRNYSGRNAQS  753
             +     + +K L+A ++SK++ SK  PPSVVA+LMGLD  P     +      + R + S
Sbjct  98    RSNV--SEIKRLVATDISKEVESKRKPPSVVARLMGLDDDPPAKEPTLHSSRTNLRKSHS  155

Query  754   AKGTPLNNFHHRSGSLDTQMECEFYQYPEQN---------ECKDVYEVWQN---RHDMNS  897
                    N   +      Q E   Y     N         E KDVYEV ++   RH +  
Sbjct  156   LDNLAATNIRWQ------QQELRHYSSTAPNVHISPKETVEFKDVYEVSEDPSRRHHI--  207

Query  898   MRSKSPQMGRCNETSTDKVAFVRQKFIEAKCLSLDEKCHHSRQFQDALEVLSSNTDLVLK  1077
             +    P+       S  K+  VRQKF+EAK L+ DE   HS+QFQ+ALEVLSSN +L LK
Sbjct  208   LGQTFPRERSSGNKSDIKIEVVRQKFMEAKRLATDENLLHSKQFQEALEVLSSNRELFLK  267

Query  1078  FLQEPKPMLSEHIYNLQSIPAPSETKRITVLKPSKMVDN  1194
             FL+EP P+  + +  L+++ AP  TKRITVLKP K V+N
Sbjct  268   FLEEPNPVFLKQLNGLETMSAPPPTKRITVLKPIKSVEN  306



>ref|XP_006652489.1| PREDICTED: uncharacterized protein LOC102722484 isoform X1 [Oryza 
brachyantha]
Length=980

 Score =   150 bits (378),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 108/279 (39%), Positives = 152/279 (54%), Gaps = 23/279 (8%)
 Frame = +1

Query  400   MVNLFDLNGGVAGNRLLTDKPHRDGS-LSRSQSDVAR-MSPSEDQIEDKEIVSELRRNNS  573
             M+NLFDL+ G+A   +L  +  RDGS + + + DV R   P+   +EDK  V+  R ++S
Sbjct  38    MINLFDLSTGMASTDVLMGRTRRDGSQVRKGRQDVNRAFGPTIGCVEDKLQVASTRSSSS  97

Query  574   KMKANGTPMKMLIAEEMSKDMASKHNPPSVVAKLMGLDGFPSQLPVSTAQRNYSGRNAQS  753
                   + +K L+A ++SK++ SK  PPSVVA+LMGLD  P     +      + R + S
Sbjct  98    NRSNV-SEIKRLVATDISKEVESKRKPPSVVARLMGLDDDPPAKEPTLHSSRTNLRKSHS  156

Query  754   AKGTPLNNFHHRSGSLDTQMECEFYQYPEQN---------ECKDVYEVWQN---RHDMNS  897
                    N   +      Q E   Y     N         E KDVYEV ++   RH +  
Sbjct  157   LDNLAATNIRWQ------QQELRHYSSTAPNVHISPKETVEFKDVYEVSEDPSRRHHI--  208

Query  898   MRSKSPQMGRCNETSTDKVAFVRQKFIEAKCLSLDEKCHHSRQFQDALEVLSSNTDLVLK  1077
             +    P+       S  K+  VRQKF+EAK L+ DE   HS+QFQ+ALEVLSSN +L LK
Sbjct  209   LGQTFPRERSSGNKSDIKIEVVRQKFMEAKRLATDENLLHSKQFQEALEVLSSNRELFLK  268

Query  1078  FLQEPKPMLSEHIYNLQSIPAPSETKRITVLKPSKMVDN  1194
             FL+EP P+  + +  L+++ AP  TKRITVLKP K V+N
Sbjct  269   FLEEPNPVFLKQLNGLETMSAPPPTKRITVLKPIKSVEN  307



>emb|CDY32928.1| BnaA09g16650D [Brassica napus]
Length=755

 Score =   149 bits (375),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 102/281 (36%), Positives = 141/281 (50%), Gaps = 84/281 (30%)
 Frame = +1

Query  355   KNRGLEKPIPGCLGRMVNLFDLNGGVAGNRLLTDKPH-RDGSLSRSQSDVARMSPSEDQI  531
             + R +++P  GCLGRMVNLFD     +G +LLTDKP+  DGS+ R+Q D+      ED++
Sbjct  5     RRRNVQQP-HGCLGRMVNLFDFGTVASGKKLLTDKPYFDDGSIKRNQLDLL-----EDKV  58

Query  532   EDKEIVSELRRNNSKMKANGTPMKMLIAEEMSKDMASKHNPPSVVAKLMGLDGFPSQLPV  711
             +              +  NGTP+K L+ EEMSK+M       ++VAKLMGLD FP     
Sbjct  59    D-------------TVAVNGTPIKKLLEEEMSKEMELTVGSTNLVAKLMGLDSFP-----  100

Query  712   STAQRNYSGRNAQSAKGTPLNNFHHRSGSLDTQMECEFYQYPEQNECKDVYEVWQNRHDM  891
                       +A S+K     +  H                    EC+DV+E+       
Sbjct  101   ----------HANSSKPRLRRSLSH-------------------GECRDVFEILDK----  127

Query  892   NSMRSKSPQMGRCNETSTDKVAFVRQKFIEAKCLSLDEKCHHSRQFQDALEVLSSNTDLV  1071
                    P M             VR+KF+EAK L  DEK  HS +FQ+A++VLSSN +L 
Sbjct  128   -------PGMD-----------IVREKFLEAKRLVTDEKLRHSEEFQEAMKVLSSNKELF  169

Query  1072  LKFLQEPKPMLSEHIYNLQSIPAPSETKRITVLKPSKMVDN  1194
             LKFLQE     S H+        P ++KRIT+LKPSK++D+
Sbjct  170   LKFLQESNNFFSHHL--------PEKSKRITILKPSKIIDD  202



>ref|XP_009113974.1| PREDICTED: uncharacterized protein LOC103839223 [Brassica rapa]
 ref|XP_009113975.1| PREDICTED: uncharacterized protein LOC103839223 [Brassica rapa]
 ref|XP_009113976.1| PREDICTED: uncharacterized protein LOC103839223 [Brassica rapa]
Length=757

 Score =   148 bits (373),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 102/281 (36%), Positives = 140/281 (50%), Gaps = 84/281 (30%)
 Frame = +1

Query  355   KNRGLEKPIPGCLGRMVNLFDLNGGVAGNRLLTDKPH-RDGSLSRSQSDVARMSPSEDQI  531
             + R +++P  GCLGRMVNLFD     +G +LLTDKP+  DGS+ R+Q D+      ED++
Sbjct  5     RRRNVQQP-HGCLGRMVNLFDFGTVASGKKLLTDKPYFDDGSIKRNQLDLL-----EDKV  58

Query  532   EDKEIVSELRRNNSKMKANGTPMKMLIAEEMSKDMASKHNPPSVVAKLMGLDGFPSQLPV  711
             +              +  NGTP+K L+ EEMSK+M       ++VAKLMGLD FP     
Sbjct  59    D-------------TVAVNGTPIKKLLEEEMSKEMELTVGSTNLVAKLMGLDSFP-----  100

Query  712   STAQRNYSGRNAQSAKGTPLNNFHHRSGSLDTQMECEFYQYPEQNECKDVYEVWQNRHDM  891
                       +A S+K     +  H                    EC+DVYE+       
Sbjct  101   ----------HANSSKPRLRRSLSH-------------------GECRDVYEILDK----  127

Query  892   NSMRSKSPQMGRCNETSTDKVAFVRQKFIEAKCLSLDEKCHHSRQFQDALEVLSSNTDLV  1071
                    P M             VR+KF+EAK L  DEK  HS +FQ+A++VLSSN +L 
Sbjct  128   -------PGMD-----------IVREKFLEAKRLVTDEKLRHSEEFQEAMKVLSSNKELF  169

Query  1072  LKFLQEPKPMLSEHIYNLQSIPAPSETKRITVLKPSKMVDN  1194
             L+FLQE     S H+        P ++KRIT+LKPSK +D+
Sbjct  170   LEFLQESNNFFSHHL--------PEKSKRITILKPSKTIDD  202



>gb|EMS51091.1| hypothetical protein TRIUR3_23853 [Triticum urartu]
Length=996

 Score =   148 bits (374),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 104/275 (38%), Positives = 161/275 (59%), Gaps = 16/275 (6%)
 Frame = +1

Query  400   MVNLFDLNGGVAGNRLLTDKPHRDGS-LSRSQSDVAR-MSPSEDQIEDKEIVSELRRNNS  573
             M+NLFDL+ G+A  + L+D+  R+ S + R ++D+ R + P++  IEDK  +    R++ 
Sbjct  46    MINLFDLSTGMANTKALSDRAQREDSPVRRGRTDIKRTVDPAKVCIEDK--LETSTRSSL  103

Query  574   KMKANGTPMKMLIAEEMSKDMASKHNPPSVVAKLMGL-DGFPSQ-----LPVSTAQRNYS  735
               K++ +PMK L+A E++K+M SK  PPSVVA+LMGL D  P+Q      P    +R++S
Sbjct  104   SSKSDASPMKKLLANEIAKEMESKRKPPSVVARLMGLEDDLPAQEQALHSPKRNLRRSHS  163

Query  736   GRNAQSAKGTPLNNFHHRSGSLDTQMECEFYQYPEQN-ECKDVYEVWQNRHDMNSMRSKS  912
               N  + K         +   L  +     +  P++  E KDVY V +     + ++ ++
Sbjct  164   HDNYAATKKA----LQQQELRLYNKTTRGKHTGPKETVEFKDVYAVCEEPLRTHHLQDQT  219

Query  913   PQMGRCNETSTD-KVAFVRQKFIEAKCLSLDEKCHHSRQFQDALEVLSSNTDLVLKFLQE  1089
                 R ++   D ++  VRQKFI+AK L+ DE   HS++F +ALEVLSSN DL LKFL+E
Sbjct  220   SSGVRSSQNKRDERIEVVRQKFIQAKRLATDENFLHSKEFHEALEVLSSNKDLFLKFLEE  279

Query  1090  PKPMLSEHIYNLQSIPAPSETKRITVLKPSKMVDN  1194
             P  + S  +Y   ++PA  +TK ITVLKP K  +N
Sbjct  280   PSSVFSNPLYGQHTMPASPQTKHITVLKPFKSPEN  314



>ref|XP_007144434.1| hypothetical protein PHAVU_007G155800g [Phaseolus vulgaris]
 gb|ESW16428.1| hypothetical protein PHAVU_007G155800g [Phaseolus vulgaris]
Length=887

 Score =   147 bits (370),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 87/203 (43%), Positives = 118/203 (58%), Gaps = 11/203 (5%)
 Frame = +1

Query  598   MKMLIAEEMSKDMASKHNPPSVVAKLMGLDGFPSQLPVSTAQRNYSGRNAQSAKG---TP  768
             M+MLI +EMSK   SKH  P+VVAKLMGL+  P   P    +R Y    +Q   G    P
Sbjct  1     MQMLIDKEMSKQKDSKHYLPNVVAKLMGLETLPRGEPNLPMERKYRSDYSQQMHGPVGLP  60

Query  769   LNNFHHRSGSLDTQMECEFYQYPEQNECKDVYEVWQNRHDMNSMRSKSPQMGRCNETSTD  948
               ++      +D +M  E +   EQ   KD+YE+WQ     +    K P  GR +E    
Sbjct  61    FRHWQQEDRFMDRKMFHEVHPSTEQVAYKDMYEIWQQSQRTSHASGKVPDRGRWSEDVDG  120

Query  949   K-VAFVRQKFIEAKCLSLDEKCHHSRQFQDALEVLSSNTDLVLKFLQEPKPMLSEHIYNL  1125
             K +A +RQKFIEAK LS DE+   S+QF+DALEVLSSN+DL+++ L       S+++Y  
Sbjct  121   KRMALIRQKFIEAKLLSTDERLRQSKQFKDALEVLSSNSDLLMRLLD------SQNVYEF  174

Query  1126  QSIPAPSETKRITVLKPSKMVDN  1194
              S P  ++T RIT++KP KMVDN
Sbjct  175   YSTPR-TDTNRITLIKPLKMVDN  196



>gb|ACN40217.1| unknown [Picea sitchensis]
Length=894

 Score =   145 bits (366),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 104/321 (32%), Positives = 154/321 (48%), Gaps = 50/321 (16%)
 Frame = +1

Query  373   KPIPGCLGRMVNLFDLNGGVAGNRLLTDKPHRDG-SLSRSQSDVARMSPSEDQIEDKEIV  549
             K  PGC+G ++NLFD N    G RLLT+K H DG    R+  DV+  +P   ++++++I 
Sbjct  15    KDFPGCMGGLLNLFDFNQAHNGRRLLTEKRHGDGLEAPRNSLDVSLETPPSREVKNEDIP  74

Query  550   SELRRN---NSKMKANGTPMKMLIAEEMSKDMASKHNPPSVVAKLMGLDGFPSQ----LP  708
                  N    ++ K +G PMK LIA+EMSK+  SK   PSV+A+LMGLD  P++      
Sbjct  75    YAYEMNKVPTTRKKVSGMPMKTLIAQEMSKEKGSKRRTPSVIARLMGLDAMPAESMSVQH  134

Query  709   VSTA----QRNYSGRNAQSAKGTPLNNFHHRSGSLDTQMECEFYQYPEQN----------  846
             +  A    Q+N SG   Q  K      F  +   + T    + Y  P+ +          
Sbjct  135   IKAAEIHPQKNNSGNQKQWPKSPRDAQFFQKHLEVPTSKPAKEYSLPKPDEQPIDHTDQK  194

Query  847   ------------------ECKDVYEVWQNRHDMNSMRSKSP----------QMGRCNETS  942
                               E K  +  WQ     +  +S  P          QM  C + +
Sbjct  195   NSYGTLPFRDHPQEKQLQEFKKQFAAWQASKIQDHSKSIQPDELKMQLAEKQMLVCEKLN  254

Query  943   TDKVAFVRQKFIEAKCLSLDEKCHHSRQFQDALEVLSSNTDLVLKFLQEPKPMLSEHIYN  1122
               K+A V + FI+A+ L+ DEK   S++F +ALEVL SN DL LKFLQEP  +L++H  +
Sbjct  255   EAKMALVHENFIDAQHLATDEKLQSSKEFLNALEVLQSNKDLFLKFLQEPNSLLAKHPQD  314

Query  1123  LQSIPAPSETKRITVLKPSKM  1185
             +QS     E +   +  P+ M
Sbjct  315   IQSTSETREKQLQKMKSPNPM  335



>ref|XP_009405681.1| PREDICTED: uncharacterized protein LOC103988772 [Musa acuminata 
subsp. malaccensis]
Length=931

 Score =   142 bits (359),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 103/275 (37%), Positives = 148/275 (54%), Gaps = 25/275 (9%)
 Frame = +1

Query  400   MVNLFDLNGGVAGNRLLTDKPHRDGSLS-RSQSDV--ARMSPSEDQIEDKEIVSELRRNN  570
             M+N+FDL+  + G + L + PHRD  ++  + SD+   R+  +  Q E K +  E R++ 
Sbjct  1     MINMFDLSAHMNGIKQLAENPHRDDLMAVGNHSDMLKKRVDSNAVQREGKHVTCEHRKSP  60

Query  571   SKMKANGTPMKMLIAEEMSKDMASKHNPPSVVAKLMGLDGFPSQLPVSTAQRNYSGRNAQ  750
             S  K++GTPMKMLIAEEM K+  S   PPSVVA+LMGLD  P Q  V   + +       
Sbjct  61    SGKKSSGTPMKMLIAEEMCKETESLQKPPSVVARLMGLDSLPVQQAVLIDKCDIQ-----  115

Query  751   SAKGTPLNNFHHRSGSLDTQMECEFYQYP--------EQNECKDVYEVWQNRHDMNSMRS  906
               +G   N+          + +  F + P        E+ + KDVYE  Q     + +  
Sbjct  116   --EGYECNSLSGAQKRCQWKEDEYFEKMPWSLRSCTHEKKKNKDVYEACQQPARNSLVND  173

Query  907   KSPQMGRCNETSTDK-VAFVRQKFIEAKCLSLDEKCHHSRQFQDALEVLSSNTDLVLKFL  1083
                  G+ +E    +  AFVRQK  EA+ L+ D+K   S++FQDA+EVLSSN DL L+FL
Sbjct  174   HISWNGKFDENLYQRTTAFVRQKSTEAEHLATDDKFLKSKEFQDAIEVLSSNRDLFLRFL  233

Query  1084  QEPKPMLSEHIYNLQSIPAPSETKRITVLKPSKMV  1188
              EPK      I    ++P P + K ITVLKPS ++
Sbjct  234   DEPK-----QICQFHNVPPP-QKKCITVLKPSNVI  262



>ref|XP_010540954.1| PREDICTED: uncharacterized protein LOC104814547 isoform X3 [Tarenaya 
hassleriana]
Length=804

 Score =   142 bits (357),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 97/227 (43%), Positives = 123/227 (54%), Gaps = 31/227 (14%)
 Frame = +1

Query  514   PSEDQIEDKEIVSELRRNNSKMKANGTPMKMLIAEEMSKDMASKHNPPSVVAKLMGLDGF  693
             PS D  ED+ I+S LRR+ S    NGTPMK LIA+EMSK+   K +P +VVAKLMGLD F
Sbjct  5     PSGDHTEDELIMSNLRRSAS----NGTPMKKLIAQEMSKE-EHKQSPTNVVAKLMGLDTF  59

Query  694   PSQLPVSTAQRNYSGRNAQSAKGTPLNNFHHRSGSLDTQMECEFYQYPEQNECKDVYEVW  873
             P QL +                   ++     S                  E KDV E+W
Sbjct  60    P-QLQLDNT----------------ISQSSKSSSYSRYSPSNSGSSLESSRELKDVCEMW  102

Query  874   QNRHDMNSMRSKSPQMGRCNETSTDKV-AFVRQKFIEAKCLSLDEKCHHSRQFQDALEVL  1050
             Q   + N  R         +E  T+K    VR+KF+E K L  DEK H S++FQDA+EVL
Sbjct  103   QLPQNANRSRD--------DEIMTEKQRDIVRKKFMEGKRLVTDEKLHQSKEFQDAVEVL  154

Query  1051  SSNTDLVLKFLQEPKPMLSEHIYNLQSIPAPSETKRITVLKPSKMVD  1191
             SSN DL +KFLQE     S+H+ + Q +P   ETKRITVL+PSK +D
Sbjct  155   SSNKDLFVKFLQESNSFFSQHLSDFQPLPPHPETKRITVLRPSKAID  201



>gb|KHN48970.1| hypothetical protein glysoja_025347 [Glycine soja]
Length=900

 Score =   141 bits (355),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 84/202 (42%), Positives = 121/202 (60%), Gaps = 15/202 (7%)
 Frame = +1

Query  598   MKMLIAEEMSKDMASKHNPPSVVAKLMGLDGFPSQLPVSTAQRNYSGRNAQSAKG---TP  768
             M+MLI +EMSK   SKH  P+VVAKLMGL+  P   P  + +R++    +Q   G    P
Sbjct  1     MQMLIDKEMSKKKDSKHTLPNVVAKLMGLEALPRGEPHLSMERSHRRDYSQQMYGPVGLP  60

Query  769   LNNFHHRSGSLDTQMECEFYQYPEQNECKDVYEVWQNRHDMNSMRSKSPQMGRCNETSTD  948
               ++      +D +M  E +   EQ   KD+YE+WQ      S R+   +     +    
Sbjct  61    FKHWQQEDRFMDREMLHEVHPSTEQVAYKDMYEIWQQ-----SQRASHDRGKWSEDVDEK  115

Query  949   KVAFVRQKFIEAKCLSLDEKCHHSRQFQDALEVLSSNTDLVLKFLQEPKPMLSEHIYNLQ  1128
             ++A +RQKF+EAK LS DE+ H S QF+DALEVLSSN+DL+++ L       S+++ +L 
Sbjct  116   RMALIRQKFMEAKRLSTDERLHQSEQFKDALEVLSSNSDLLIRLLD------SQNVSDLY  169

Query  1129  SIPAPSETKRITVLKPSKMVDN  1194
             S  +P+ETKRIT++KP KMVDN
Sbjct  170   ST-SPNETKRITLIKPLKMVDN  190



>ref|XP_003541385.2| PREDICTED: uncharacterized protein LOC100787955 [Glycine max]
Length=900

 Score =   141 bits (355),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 84/202 (42%), Positives = 121/202 (60%), Gaps = 15/202 (7%)
 Frame = +1

Query  598   MKMLIAEEMSKDMASKHNPPSVVAKLMGLDGFPSQLPVSTAQRNYSGRNAQSAKG---TP  768
             M+MLI +EMSK   SKH  P+VVAKLMGL+  P   P  + +R++    +Q   G    P
Sbjct  1     MQMLIDKEMSKKKDSKHTLPNVVAKLMGLEALPRGEPHLSMERSHRRDYSQQMYGPVGLP  60

Query  769   LNNFHHRSGSLDTQMECEFYQYPEQNECKDVYEVWQNRHDMNSMRSKSPQMGRCNETSTD  948
               ++      +D +M  E +   EQ   KD+YE+WQ      S R+   +     +    
Sbjct  61    FKHWQQEDRFMDREMLHEVHPSTEQVAYKDMYEIWQQ-----SQRASHDRGKWSEDVDEK  115

Query  949   KVAFVRQKFIEAKCLSLDEKCHHSRQFQDALEVLSSNTDLVLKFLQEPKPMLSEHIYNLQ  1128
             ++A +RQKF+EAK LS DE+ H S QF+DALEVLSSN+DL+++ L       S+++ +L 
Sbjct  116   RMALIRQKFMEAKRLSTDERLHQSEQFKDALEVLSSNSDLLIRLLD------SQNVSDLY  169

Query  1129  SIPAPSETKRITVLKPSKMVDN  1194
             S  +P+ETKRIT++KP KMVDN
Sbjct  170   ST-SPNETKRITLIKPLKMVDN  190



>emb|CDY50812.1| BnaCnng19760D [Brassica napus]
Length=750

 Score =   140 bits (352),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 99/271 (37%), Positives = 131/271 (48%), Gaps = 83/271 (31%)
 Frame = +1

Query  385   GCLGRMVNLFDLNGGVAGNRLLTDKPH-RDGSLSRSQSDVARMSPSEDQIEDKEIVSELR  561
             GCLGRMVNLFD     +G +LLTDKP+  DG + R+Q D+         IEDK       
Sbjct  14    GCLGRMVNLFDFGTVGSGKKLLTDKPYFDDGCIKRNQLDL---------IEDKV------  58

Query  562   RNNSKMKANGTPMKMLIAEEMSKDMASKHNPPSVVAKLMGLDGFPSQLPVSTAQRNYSGR  741
                  +  NGTP+K L+ EEMSK+M       ++VAKLMGLD FP               
Sbjct  59    ---DTIAVNGTPIKKLLEEEMSKEMELTVGSTNLVAKLMGLDSFP---------------  100

Query  742   NAQSAKGTPLNNFHHRSGSLDTQMECEFYQYPEQNECKDVYEVWQNRHDMNSMRSKSPQM  921
             +A S+K     +  H                    EC+DV+E+              P M
Sbjct  101   HANSSKPRLRRSLSH-------------------GECRDVFEILDK-----------PGM  130

Query  922   GRCNETSTDKVAFVRQKFIEAKCLSLDEKCHHSRQFQDALEVLSSNTDLVLKFLQEPKPM  1101
                          VR+KF+EAK L  DEK  HS +FQ+A++VLSSN +L L+FLQE    
Sbjct  131   D-----------IVREKFLEAKRLVTDEKLRHSEEFQEAMKVLSSNKELFLEFLQESNNF  179

Query  1102  LSEHIYNLQSIPAPSETKRITVLKPSKMVDN  1194
              S H+          ++KRIT+LKPSK +D+
Sbjct  180   FSHHL--------TEKSKRITILKPSKTIDD  202



>ref|XP_011094798.1| PREDICTED: uncharacterized protein LOC105174401 isoform X1 [Sesamum 
indicum]
Length=974

 Score =   139 bits (351),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 82/207 (40%), Positives = 117/207 (57%), Gaps = 21/207 (10%)
 Frame = +1

Query  580   KANGTPMKMLIAEEMSKDMASKHNPPSVVAKLMGLDGFPSQLPVSTAQRNYSGRNAQSAK  759
             +A G PMK L+AEEMSK++ SK   PSV+A+LMGLDG PS   V   Q+ Y+        
Sbjct  58    RATGIPMKKLLAEEMSKEVESKKRSPSVIARLMGLDGLPSPRHVHRQQKRYT--------  109

Query  760   GTPLNNFHHRSGSLDTQMECEFYQ-------YPEQNECKDVYEVWQNRHDMNSMRSKSPQ  918
                 +++ H+  S++ Q   + Y          +  E KDVYE  +  H +N  R  S +
Sbjct  110   ----DSYQHQDASVNVQRNSQLYDGRSNRRSSLDHQEFKDVYEDLEASHVVN--RRCSSR  163

Query  919   MGRCNETSTDKVAFVRQKFIEAKCLSLDEKCHHSRQFQDALEVLSSNTDLVLKFLQEPKP  1098
                 +  +  ++A +RQKFI+AK LS DE    S++  D LE+L SN DL+LKFLQ+P  
Sbjct  164   WSASSILTKPEMALIRQKFIDAKRLSADEMLQDSKELDDTLEMLDSNKDLLLKFLQQPDS  223

Query  1099  MLSEHIYNLQSIPAPSETKRITVLKPS  1179
             +  +H+++LQ  P  S   RI VLKPS
Sbjct  224   LFVKHLHDLQVDPGSSLGSRIAVLKPS  250



>ref|XP_011094799.1| PREDICTED: uncharacterized protein LOC105174401 isoform X2 [Sesamum 
indicum]
Length=929

 Score =   139 bits (351),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 82/207 (40%), Positives = 117/207 (57%), Gaps = 21/207 (10%)
 Frame = +1

Query  580   KANGTPMKMLIAEEMSKDMASKHNPPSVVAKLMGLDGFPSQLPVSTAQRNYSGRNAQSAK  759
             +A G PMK L+AEEMSK++ SK   PSV+A+LMGLDG PS   V   Q+ Y+        
Sbjct  13    RATGIPMKKLLAEEMSKEVESKKRSPSVIARLMGLDGLPSPRHVHRQQKRYT--------  64

Query  760   GTPLNNFHHRSGSLDTQMECEFYQ-------YPEQNECKDVYEVWQNRHDMNSMRSKSPQ  918
                 +++ H+  S++ Q   + Y          +  E KDVYE  +  H +N  R  S +
Sbjct  65    ----DSYQHQDASVNVQRNSQLYDGRSNRRSSLDHQEFKDVYEDLEASHVVN--RRCSSR  118

Query  919   MGRCNETSTDKVAFVRQKFIEAKCLSLDEKCHHSRQFQDALEVLSSNTDLVLKFLQEPKP  1098
                 +  +  ++A +RQKFI+AK LS DE    S++  D LE+L SN DL+LKFLQ+P  
Sbjct  119   WSASSILTKPEMALIRQKFIDAKRLSADEMLQDSKELDDTLEMLDSNKDLLLKFLQQPDS  178

Query  1099  MLSEHIYNLQSIPAPSETKRITVLKPS  1179
             +  +H+++LQ  P  S   RI VLKPS
Sbjct  179   LFVKHLHDLQVDPGSSLGSRIAVLKPS  205



>dbj|BAJ95378.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=896

 Score =   139 bits (349),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 104/272 (38%), Positives = 144/272 (53%), Gaps = 33/272 (12%)
 Frame = +1

Query  400   MVNLFDLNGGVAGNRLLTDKPHRDGSLSR-SQSDVARMSPSEDQIEDKEIVSELRRNNSK  576
             M+NLFDL+ G A  R+ T    RDGS  R +QSD       ++  + K +   + R++S 
Sbjct  1     MINLFDLSAG-ASARVAT----RDGSPVRGTQSD------RKEYADLKTVTGSMGRSSSD  49

Query  577   MKANGTPMKMLIAEEMSKDMASKHNPPSVVAKLMGLD---GFPSQLPVSTAQRNYSGRNA  747
               A GTPMK LIA+EM+K+  +     +V+A+LMGLD    FP   PV  + R  S    
Sbjct  50    RSAGGTPMKTLIAQEMAKEGDTNQKNTNVIARLMGLDQGVAFPK--PVQPSSRRRSPEGH  107

Query  748   QSAKGTPLNN---FHHRSGSLDTQMECEFYQYPEQNECKDVYEVWQNRHDMNSMRSKSPQ  918
              S+    +NN   F   +GS+            E  E KDVYEV         + + S Q
Sbjct  108   LSSTMARVNNQMSFDKHAGSV------------ENVEYKDVYEVGYQPQRCEHLSNDSSQ  155

Query  919   MGRCNETSTDK-VAFVRQKFIEAKCLSLDEKCHHSRQFQDALEVLSSNTDLVLKFLQEPK  1095
              GR +E    K +  VRQKF+EAK L+  E    S++F DALE L+SN DL LKFL+EP 
Sbjct  156   RGRPHEDHDQKRMDLVRQKFVEAKQLASHENLLQSKEFHDALETLNSNRDLFLKFLEEPN  215

Query  1096  PMLSEHIYNLQSIPAPSETKRITVLKPSKMVD  1191
              + ++      S P   + K+ITVLKP+K V+
Sbjct  216   SLFAKQSGEFHSAPTSPQRKQITVLKPAKSVE  247



>ref|XP_003537148.1| PREDICTED: uncharacterized protein LOC100814302 isoform X1 [Glycine 
max]
 ref|XP_006588715.1| PREDICTED: uncharacterized protein LOC100814302 isoform X2 [Glycine 
max]
Length=898

 Score =   138 bits (347),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 87/203 (43%), Positives = 120/203 (59%), Gaps = 22/203 (11%)
 Frame = +1

Query  598   MKMLIAEEMSKDMASKHNPPSVVAKLMGLDGFPSQLPVSTAQRNYSGRNAQSAKG---TP  768
             M+MLI +EMSK   SKHN P+VVAKLMGL+  P   P  + +R++    +Q   G    P
Sbjct  1     MQMLIDKEMSKQKDSKHNLPNVVAKLMGLEALPKGEPNLSMERSHRRDYSQQMYGPIGLP  60

Query  769   LNNFHHRSGSLDTQMECEFYQYPEQNECKDVYEVWQNRHDMNSMRSKSPQMGRCNETSTD  948
               ++      +D +M  E +   E    KD+YE+WQ             Q GR +E    
Sbjct  61    FKHWQQEDRFMDREMLHEVHPSTEHVADKDMYEIWQQT-----------QRGRFSEDVDG  109

Query  949   K-VAFVRQKFIEAKCLSLDEKCHHSRQFQDALEVLSSNTDLVLKFLQEPKPMLSEHIYNL  1125
             K +A +RQKF+EAK LS DE+   S QF+DALEVLSSN+DL++K L       S+++ +L
Sbjct  110   KRMALIRQKFMEAKRLSTDERMRQSEQFKDALEVLSSNSDLLIKLLD------SQNVCDL  163

Query  1126  QSIPAPSETKRITVLKPSKMVDN  1194
              S  +P+ETKRIT++KP KMVDN
Sbjct  164   YST-SPNETKRITLIKPLKMVDN  185



>ref|XP_008789169.1| PREDICTED: uncharacterized protein LOC103706730 [Phoenix dactylifera]
Length=1010

 Score =   136 bits (343),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 93/234 (40%), Positives = 134/234 (57%), Gaps = 12/234 (5%)
 Frame = +1

Query  484   RSQSDVARMSPSEDQIEDKEIVSELRRNNSKMKANGTPMKMLIAEEMSKDMASKHNPPSV  663
             +S  D +R S S   +E+  +  E  R++SK K NGTPM+MLI EE+SKDM ++H+ PSV
Sbjct  47    KSALDFSRRSGS--SMEENSVAHEFWRSSSK-KVNGTPMRMLIDEEVSKDMETRHSSPSV  103

Query  664   VAKLMGLDGFPSQLPVSTAQRNYSGRNAQSAKGTPLNNFHHRSGSLDTQMECEFYQYPEQ  843
             +A+LMGLD  P  + V   Q+N   R  Q+A       F  +  S  ++         E 
Sbjct  104   IARLMGLDTLPPMM-VHEQQKNMGSR-FQTASSV---GFQEKYAS--SEDHSHRSSTDEH  156

Query  844   NECKDVYEVWQNRHDMNSMRSKSPQMGRCN-ETSTDKVAFVRQKFIEAKCLSLDEKCHHS  1020
              E KDV+EV +    + S ++K  + G  + E +   +  +RQKF+EAK LS DE   +S
Sbjct  157   QEFKDVFEVIEPSK-VKSQKNKPVRKGMVSSEQNEADMDLIRQKFMEAKRLSTDEVLQNS  215

Query  1021  RQFQDALEVLSSNTDLVLKFLQEPKPMLSEHIYNLQSIPAPSETKRITVLKPSK  1182
              +F DALEVL SN DL L+FLQ P  + + H+++L+  P  S    ITVL+ SK
Sbjct  216   NEFNDALEVLDSNKDLFLEFLQGPDSLFTMHLHDLKCAPPSSHASHITVLESSK  269



>ref|XP_010097375.1| hypothetical protein L484_008898 [Morus notabilis]
 gb|EXB67881.1| hypothetical protein L484_008898 [Morus notabilis]
Length=997

 Score =   136 bits (342),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 84/213 (39%), Positives = 116/213 (54%), Gaps = 25/213 (12%)
 Frame = +1

Query  571   SKMKANGTPMKMLIAEEMSKDMASKHNPPSVVAKLMGLDGFPSQLPVSTAQRNYSGRNAQ  750
             S  +  GTPMK L+A+EMSK+  SK   PSV+AKLMGLDG P+QLP    ++  S     
Sbjct  71    SSKRGIGTPMKKLLAKEMSKETESKRRSPSVIAKLMGLDGLPTQLPAYKEEKGMS-----  125

Query  751   SAKGTPLNNFHHRSGSLDT-QMECEFYQYP--------EQNECKDVYEVWQNRHDMNSMR  903
                     N+   SGS +  Q     Y Y         ++ E KDV+EV +         
Sbjct  126   -------ENYLQTSGSAEKGQRSSRHYDYRSSSRKSSKDEQEFKDVFEVLETS---KVAS  175

Query  904   SKSPQMGRCNETSTD-KVAFVRQKFIEAKCLSLDEKCHHSRQFQDALEVLSSNTDLVLKF  1080
                P  G  N   TD ++AF++QKF++AK LS DEK   S++F DALE+L SN DL+LKF
Sbjct  176   CSYPSQGVVNSNLTDAEIAFIKQKFMDAKRLSTDEKLQSSKEFHDALEILDSNKDLLLKF  235

Query  1081  LQEPKPMLSEHIYNLQSIPAPSETKRITVLKPS  1179
             LQ+P  + ++H+++LQ         RI  +K S
Sbjct  236   LQQPDLLFTKHLHDLQGSAPQLLCGRIEAMKAS  268



>ref|XP_002274593.2| PREDICTED: uncharacterized protein LOC100248303 [Vitis vinifera]
Length=984

 Score =   135 bits (341),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 89/228 (39%), Positives = 122/228 (54%), Gaps = 26/228 (11%)
 Frame = +1

Query  529   IEDKEIVSELRRNNSKMKANGTPMKMLIAEEMSKDMASKHNPPSVVAKLMGLDGFPSQLP  708
              E+     EL  ++SK +A GTPMK L+A+EMSK+   K   PSV+A+LMGLDG P Q P
Sbjct  50    TEEDSFTIELGPSSSK-QAIGTPMKKLLAKEMSKEAEPKKRSPSVIARLMGLDGLPPQQP  108

Query  709   VSTAQR----NYSGRNAQSAKGTPLNNFH----HRSGSLDTQMECEFYQYPEQNECKDVY  864
             +   Q+    N+  R     +      F+    HR                EQ E KDV+
Sbjct  109   IHKQQKKLMENHQQRTETVERAEGGGTFYGPQLHRK-----------KNSKEQEEFKDVF  157

Query  865   EVW---QNRHDMNSMRSKSPQMGRCNETSTDKVAFVRQKFIEAKCLSLDEKCHHSRQFQD  1035
             EV    +   D   +  +     +  E    + AF+RQKF++AK LS DEK   S++F D
Sbjct  158   EVLVAPKGESDCYQVEGQGTTNSKLTEA---EKAFIRQKFMDAKRLSTDEKLQDSQEFHD  214

Query  1036  ALEVLSSNTDLVLKFLQEPKPMLSEHIYNLQSIPAPSETKRITVLKPS  1179
             ALEVL SN DL+LKFLQEP  + ++H+ +LQ +P     +RITV K S
Sbjct  215   ALEVLDSNKDLLLKFLQEPDSLFTKHLQDLQGVPPQPHCRRITVSKSS  262



>ref|XP_006345669.1| PREDICTED: uncharacterized protein LOC102591321 isoform X2 [Solanum 
tuberosum]
Length=974

 Score =   135 bits (340),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 92/247 (37%), Positives = 136/247 (55%), Gaps = 29/247 (12%)
 Frame = +1

Query  481   SRSQSDVARMSP-SEDQIEDKEIVSELRRNNSKMKANGTPMKMLIAEEMSKDMASKHNPP  657
             SRS S +   S   + Q+   +I+ +L + +SK +  GTP+K L+AEEM+K+  SK  P 
Sbjct  9     SRSASGIMEGSKLGKKQVATPKIMHDLGKISSK-RVTGTPIKNLLAEEMAKEGESKKRPT  67

Query  658   SVVAKLMGLDGFPSQLPVSTAQRNYSGRNAQSAKGTPLNNFHHRSGSLDTQMECEFYQYP  837
             S+VA+LMGL+G PS   +   QR +S            ++  HR+  +D++   + +   
Sbjct  68    SIVARLMGLEGMPSPQHIGRQQRRFS------------DSCQHRNEQIDSRRRKQLFDEQ  115

Query  838   -------EQNECKDVYEVWQNRHDMNSMRSKSPQMGRCNET---STDKVAFVRQKFIEAK  987
                    E  E KDVYE  +  H  N   S      R NET   +T  +A ++QKF++AK
Sbjct  116   SSKRSSMEHQEFKDVYEDLEASHVGNRRHS-----SRWNETGRFATPDMALIQQKFMDAK  170

Query  988   CLSLDEKCHHSRQFQDALEVLSSNTDLVLKFLQEPKPMLSEHIYNLQSIPAPSETKRITV  1167
              LS DE+  +S++F D LE L SN +L+LK+LQEP  +  +H+ +LQ   A S   RI V
Sbjct  171   RLSTDERFQNSKEFNDTLEALDSNKELLLKYLQEPDSLFVKHLQDLQVESASSTCSRIAV  230

Query  1168  LKPSKMV  1188
             LKPS  V
Sbjct  231   LKPSNSV  237



>ref|XP_006345668.1| PREDICTED: uncharacterized protein LOC102591321 isoform X1 [Solanum 
tuberosum]
Length=991

 Score =   133 bits (334),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 86/225 (38%), Positives = 126/225 (56%), Gaps = 28/225 (12%)
 Frame = +1

Query  544   IVSELRRNNSKMKANGTPMKMLIAEEMSKDMASKHNPPSVVAKLMGLDGFPSQLPVSTAQ  723
             I+ +L + +SK +  GTP+K L+AEEM+K+  SK  P S+VA+LMGL+G PS   +   Q
Sbjct  48    IMHDLGKISSK-RVTGTPIKNLLAEEMAKEGESKKRPTSIVARLMGLEGMPSPQHIGRQQ  106

Query  724   RNYSGRNAQSAKGTPLNNFHHRSGSLDTQMECEFYQYP-------EQNECKDVYEVWQNR  882
             R +S            ++  HR+  +D++   + +          E  E KDVYE  +  
Sbjct  107   RRFS------------DSCQHRNEQIDSRRRKQLFDEQSSKRSSMEHQEFKDVYEDLEAS  154

Query  883   HDMNSMRSKSPQMGRCNET---STDKVAFVRQKFIEAKCLSLDEKCHHSRQFQDALEVLS  1053
             H  N   S      R NET   +T  +A ++QKF++AK LS DE+  +S++F D LE L 
Sbjct  155   HVGNRRHS-----SRWNETGRFATPDMALIQQKFMDAKRLSTDERFQNSKEFNDTLEALD  209

Query  1054  SNTDLVLKFLQEPKPMLSEHIYNLQSIPAPSETKRITVLKPSKMV  1188
             SN +L+LK+LQEP  +  +H+ +LQ   A S   RI VLKPS  V
Sbjct  210   SNKELLLKYLQEPDSLFVKHLQDLQVESASSTCSRIAVLKPSNSV  254



>ref|XP_008355663.1| PREDICTED: uncharacterized protein LOC103419321 [Malus domestica]
Length=984

 Score =   133 bits (334),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 78/209 (37%), Positives = 122/209 (58%), Gaps = 21/209 (10%)
 Frame = +1

Query  571   SKMKANGTPMKMLIAEEMSKDMASKHNPPSVVAKLMGLDGFPSQLPVSTAQRNYSGRNAQ  750
             S  +A GTP+K L+AEEM +++  +   PSV+AKLMGLDG P Q P     +  S    Q
Sbjct  71    SSQQAVGTPIKKLLAEEMVREIEPRRRSPSVIAKLMGLDGLPPQQPAHRQPKGISENYFQ  130

Query  751   SAKGTPLNN-----FHHRSGSLDTQMECEFYQYPEQNECKDVYEVWQNRHDMNSMRSKSP  915
              ++     +     +  RS   +++++ EF         KDV+EV++     +S  + +P
Sbjct  131   KSRSEETEHRNSMSYERRSSRKNSRVQQEF---------KDVFEVYETSKGYSSRGTANP  181

Query  916   QMGRCNETSTDKVAFVRQKFIEAKCLSLDEKCHHSRQFQDALEVLSSNTDLVLKFLQEPK  1095
             ++      S  ++AFVRQKF++AK LS DE+   S++F DALEVL SN DL+LKFLQ+P 
Sbjct  182   KL------SDAEMAFVRQKFMDAKRLSTDERLQDSKEFHDALEVLESNKDLLLKFLQQPD  235

Query  1096  PMLSEHIYNLQSIPAPSETKRITVLKPSK  1182
              + ++H+++L  +P  S   RI  +K S+
Sbjct  236   SLFAKHLHDLHGVPQ-SRCGRIASMKSSE  263



>ref|XP_004246741.2| PREDICTED: uncharacterized protein LOC101245690 [Solanum lycopersicum]
Length=990

 Score =   132 bits (333),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 84/225 (37%), Positives = 127/225 (56%), Gaps = 28/225 (12%)
 Frame = +1

Query  544   IVSELRRNNSKMKANGTPMKMLIAEEMSKDMASKHNPPSVVAKLMGLDGFPSQLPVSTAQ  723
             I+ +  +++SK +  GTP+K L+AEEM+++  SK  P S+VA+LMGL+G PS   +   Q
Sbjct  48    IMHDFGKSSSK-RVTGTPIKNLLAEEMAREGESKKRPTSIVARLMGLEGMPSPQHIGRQQ  106

Query  724   RNYSGRNAQSAKGTPLNNFHHRSGSLDTQMECEFYQYP-------EQNECKDVYEVWQNR  882
             R +S            ++  HR+  +D++   + +          E  E KDVYE  +  
Sbjct  107   RRFS------------DSCQHRNEHIDSRRRKQLFDEQSSKRSSMEHQEFKDVYEDLEAS  154

Query  883   HDMNSMRSKSPQMGRCNET---STDKVAFVRQKFIEAKCLSLDEKCHHSRQFQDALEVLS  1053
             H  N   S      R NET   +T  +A ++QKF++AK LS DE+  +S++F D LE L 
Sbjct  155   HVGNRRHS-----SRWNETGRFATPDMALIQQKFMDAKRLSTDERFQNSKEFNDTLEALD  209

Query  1054  SNTDLVLKFLQEPKPMLSEHIYNLQSIPAPSETKRITVLKPSKMV  1188
             SN +L+LK+LQEP  +  +H+ +LQ   A S+  RI VLKPS  V
Sbjct  210   SNKELLLKYLQEPDSLFVKHLQDLQVESASSKCSRIAVLKPSNSV  254



>ref|XP_009343058.1| PREDICTED: uncharacterized protein LOC103935011 [Pyrus x bretschneideri]
Length=983

 Score =   132 bits (332),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 81/209 (39%), Positives = 121/209 (58%), Gaps = 21/209 (10%)
 Frame = +1

Query  571   SKMKANGTPMKMLIAEEMSKDMASKHNPPSVVAKLMGLDGFPSQLPVSTAQRNYSGRNAQ  750
             S  +  GTP+K L+AEEM ++   +   PSV+AKLMGLDG P Q P     +  S    Q
Sbjct  72    SSQQGVGTPIKKLLAEEMVRETEPRRRSPSVIAKLMGLDGLPPQQPADRQSKGISENYLQ  131

Query  751   SAKGTPLNN----FHHRSGSL-DTQMECEFYQYPEQNECKDVYEVWQNRHDMNSMRSKSP  915
               +     +    FH R  S  +++++ EF         KDV+EV++     +S  S +P
Sbjct  132   KTRSVEKEHRSSMFHDRHSSRKNSRVQQEF---------KDVFEVYEPSRSYSSRGSANP  182

Query  916   QMGRCNETSTDKVAFVRQKFIEAKCLSLDEKCHHSRQFQDALEVLSSNTDLVLKFLQEPK  1095
             ++      S  ++AFVRQKF++AK LS DE+   S++F DALEVL SN D++LKFLQ+P 
Sbjct  183   KL------SDAEMAFVRQKFMDAKRLSTDERLQDSKEFHDALEVLESNKDILLKFLQQPD  236

Query  1096  PMLSEHIYNLQSIPAPSETKRITVLKPSK  1182
              + ++H+++LQ  P  S   RI  +KPS+
Sbjct  237   SLFAKHLHDLQGGPQ-SLCGRIASMKPSE  264



>gb|KHG20894.1| Afadin [Gossypium arboreum]
Length=899

 Score =   132 bits (332),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 86/230 (37%), Positives = 133/230 (58%), Gaps = 34/230 (15%)
 Frame = +1

Query  508   MSPSEDQIEDKEIVSELRRNNSKMKANGTPMKMLIAEEMSKDMASKHNPPSVVAKLMGLD  687
             +S S+DQ    +++ EL   +SK +++G PMK L+A EMSK++ S+    SV+A+LMGLD
Sbjct  51    ISNSKDQ---DQLMFELGLRSSK-QSSGIPMKKLLAREMSKEIESRRRSSSVIARLMGLD  106

Query  688   GFPSQLPVSTAQRNYSGRNAQSAKGTPLNNFHHRSGSLDTQMECEFYQYPEQNECKDVYE  867
             G P +               + A+G     ++ RS   + + E EF         KDV+E
Sbjct  107   GLPPE--------------QKRAEGAGF--YNRRSSRRNLKEEPEF---------KDVFE  141

Query  868   VWQNRHDMNSMRSKSPQMGRCNETSTD-KVAFVRQKFIEAKCLSLDEKCHHSRQFQDALE  1044
             V      M         +G  N   +D +VAF++QKF+EAK  S DEK   S +F D LE
Sbjct  142   V----SKMERSGGGYSSLGTVNSKLSDAEVAFIQQKFMEAKRFSTDEKLRDSEEFDDTLE  197

Query  1045  VLSSNTDLVLKFLQEPKPMLSEHIYNLQSIPAPSETKRITVLKPSKMVDN  1194
             VL+SNTDL+LKFL++P  + ++H+++LQ +P+ S   RI+V+K S+ ++N
Sbjct  198   VLNSNTDLLLKFLEQPDSLFAKHLHDLQGVPSQSHCGRISVMKSSRTLNN  247



>gb|KJB16899.1| hypothetical protein B456_002G253500 [Gossypium raimondii]
Length=681

 Score =   131 bits (329),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 87/233 (37%), Positives = 135/233 (58%), Gaps = 34/233 (15%)
 Frame = +1

Query  499   VARMSPSEDQIEDKEIVSELRRNNSKMKANGTPMKMLIAEEMSKDMASKHNPPSVVAKLM  678
             V+ +S ++DQ    +++ EL   +SK +++G PMK L+A EMSK++ S+    SV+A+LM
Sbjct  48    VSSISNNKDQ---DQLMFELGLRSSK-QSSGIPMKKLLAREMSKEIESRRRSSSVIARLM  103

Query  679   GLDGFPSQLPVSTAQRNYSGRNAQSAKGTPLNNFHHRSGSLDTQMECEFYQYPEQNECKD  858
             GLDG P +               + A+G   N    RS   +++ E EF         KD
Sbjct  104   GLDGLPPE--------------QKRAEGAGFNG--RRSSRRNSKEEPEF---------KD  138

Query  859   VYEVWQNRHDMNSMRSKSPQMGRCNETSTD-KVAFVRQKFIEAKCLSLDEKCHHSRQFQD  1035
             V+EV +         S    +G  N   +D +VAF++QKF+EAK  S DEK   S +F D
Sbjct  139   VFEVSKMERSGGGYSS----LGTVNLKLSDAEVAFIQQKFMEAKRFSTDEKLRDSEEFDD  194

Query  1036  ALEVLSSNTDLVLKFLQEPKPMLSEHIYNLQSIPAPSETKRITVLKPSKMVDN  1194
              LEVL+SNTDL+LKFL++P  + ++H+++LQ + + S   RI+VLK S+ ++N
Sbjct  195   TLEVLNSNTDLLLKFLEQPDSLFAKHLHDLQGVSSQSHCGRISVLKSSRTLNN  247



>ref|XP_010937726.1| PREDICTED: uncharacterized protein LOC105057004 [Elaeis guineensis]
Length=1010

 Score =   132 bits (332),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 106/290 (37%), Positives = 151/290 (52%), Gaps = 28/290 (10%)
 Frame = +1

Query  334   MYAVQNGKNRGLEKP-IPGCLGRMVNLFDLNGGVAGNRLLTDKPHRDGSLSRSQSDVARM  510
             MY  ++ ++RG EKP  PG  G  +   DL   V+ +R    +  +  S S+S  D +  
Sbjct  1     MY--RSSRSRGREKPHRPG--GGAIGASDLKP-VSADREGNAQLKKRSSASKSALDSSCR  55

Query  511   SPSEDQIEDKEIVSELRRNNSKMKANGTPMKMLIAEEMSKDMASKHNPPSVVAKLMGLDG  690
             S S   IE+  +  E RR++SK KANGTPM+MLI EE+SK+M ++ + PSV+A+LMGLD 
Sbjct  56    SGS--SIEETSVALEFRRSSSK-KANGTPMRMLIDEEVSKEMETRRSSPSVIARLMGLDT  112

Query  691   FPSQLPVSTAQRNY-SGRNAQSAKG-----TPLNNFHHRSGSLDTQMECEFYQYPEQNEC  852
              P  L V   Q+N  SG    S+ G         +  HRS +             E  E 
Sbjct  113   LPP-LVVHKKQKNMGSGFQTPSSVGFQDKYASSEDHSHRSNT------------DEHLEF  159

Query  853   KDVYEVWQNRHDMNSMRSKSPQMGRCNETSTDKVAFVRQKFIEAKCLSLDEKCHHSRQFQ  1032
             KDV+EV +     N       +    ++     +  +RQKF+EAK L+ DE    S +  
Sbjct  160   KDVFEVMETSKVKNQKNKPVLKGMLSSKQKEADMDLIRQKFMEAKRLTTDEVLQKSNELD  219

Query  1033  DALEVLSSNTDLVLKFLQEPKPMLSEHIYNLQSIPAPSETKRITVLKPSK  1182
             DALEVL SN DL L+FLQ P  + + H+++L+  P  S    IT+LK  K
Sbjct  220   DALEVLDSNKDLFLEFLQAPDSLFTMHLHDLKCAPPSSHASHITILKSLK  269



>ref|XP_004305226.1| PREDICTED: uncharacterized protein LOC101298051 [Fragaria vesca 
subsp. vesca]
Length=988

 Score =   132 bits (332),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 85/212 (40%), Positives = 121/212 (57%), Gaps = 22/212 (10%)
 Frame = +1

Query  571   SKMKANGTPMKMLIAEEMSKDMASKHNPPSVVAKLMGLDGFPSQLPVSTAQRNYSGRNAQ  750
             S  +A G P+K L+AEEM ++  S+   PSV+AKLMGLDG P Q P++  Q+        
Sbjct  69    SSKQAGGAPIKKLLAEEMLRETESRRRSPSVIAKLMGLDGMPPQQPIAHKQQ--------  120

Query  751   SAKGTPLNNFHHRSGSLDTQMECEF-YQY-------PEQNECKDVYEVWQNRHDMNSMRS  906
               KG P  N H R+ S + +      Y +        EQ E KDV+EV +     +   S
Sbjct  121   --KGIP-ENRHQRTRSAEKEHRSGVCYDHRSSRKNSKEQQEFKDVFEVLETSKVESC--S  175

Query  907   KSPQMGRCNETSTDKVAFVRQKFIEAKCLSLDEKCHHSRQFQDALEVLSSNTDLVLKFLQ  1086
              S +     + S  ++AFVRQKF++AK LS DEK   S++F DALEVL SN DL+LKFLQ
Sbjct  176   YSSRAAANTKLSDAEMAFVRQKFMDAKRLSTDEKLQDSKEFHDALEVLDSNKDLLLKFLQ  235

Query  1087  EPKPMLSEHIYNLQSIPAPSETKRITVLKPSK  1182
             +P  + ++H+++L S P  S   R+  +K S+
Sbjct  236   QPDSLFTKHLHDLHSGPQ-SHCGRVASMKSSE  266



>gb|KJB16898.1| hypothetical protein B456_002G253500 [Gossypium raimondii]
Length=892

 Score =   131 bits (329),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 87/233 (37%), Positives = 134/233 (58%), Gaps = 34/233 (15%)
 Frame = +1

Query  499   VARMSPSEDQIEDKEIVSELRRNNSKMKANGTPMKMLIAEEMSKDMASKHNPPSVVAKLM  678
             V+ +S ++DQ    +++ EL   +SK +++G PMK L+A EMSK++ S+    SV+A+LM
Sbjct  48    VSSISNNKDQ---DQLMFELGLRSSK-QSSGIPMKKLLAREMSKEIESRRRSSSVIARLM  103

Query  679   GLDGFPSQLPVSTAQRNYSGRNAQSAKGTPLNNFHHRSGSLDTQMECEFYQYPEQNECKD  858
             GLDG P +               + A+G   N    RS   +++ E EF         KD
Sbjct  104   GLDGLPPE--------------QKRAEGAGFNG--RRSSRRNSKEEPEF---------KD  138

Query  859   VYEVWQNRHDMNSMRSKSPQMGRCNETSTD-KVAFVRQKFIEAKCLSLDEKCHHSRQFQD  1035
             V+EV      M         +G  N   +D +VAF++QKF+EAK  S DEK   S +F D
Sbjct  139   VFEV----SKMERSGGGYSSLGTVNLKLSDAEVAFIQQKFMEAKRFSTDEKLRDSEEFDD  194

Query  1036  ALEVLSSNTDLVLKFLQEPKPMLSEHIYNLQSIPAPSETKRITVLKPSKMVDN  1194
              LEVL+SNTDL+LKFL++P  + ++H+++LQ + + S   RI+VLK S+ ++N
Sbjct  195   TLEVLNSNTDLLLKFLEQPDSLFAKHLHDLQGVSSQSHCGRISVLKSSRTLNN  247



>ref|XP_007027126.1| Uncharacterized protein isoform 2 [Theobroma cacao]
 gb|EOY07628.1| Uncharacterized protein isoform 2 [Theobroma cacao]
Length=991

 Score =   131 bits (329),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 100/261 (38%), Positives = 138/261 (53%), Gaps = 31/261 (12%)
 Frame = +1

Query  436   GNRLLTDKPHRDGSLSRSQSDVARMSPSEDQIEDKEIVSELRRNNSKMKANGTPMKMLIA  615
             GNR L  K  +   L+   S     S  EDQ+       EL   +SK ++ GTPMK L+A
Sbjct  30    GNRQL-QKQRKFSKLASDSSSCGTDSTDEDQL-----TFELSWRSSK-QSTGTPMKKLLA  82

Query  616   EEMSKDMASKHNPPSVVAKLMGLDGFPSQLPVSTAQRNYSGRNAQSAKGTPLNNFHHRSG  795
             +EMSK+  S+   PSV+A+LMGLDG P Q P    Q+    +      G+    F+ R  
Sbjct  83    QEMSKENESRRRQPSVIARLMGLDGLPPQQPGHKQQKRTESKEKVQKGGS----FYSRRS  138

Query  796   SLDTQMECEFYQYPEQNECKDVYEVWQNRHDMNSMRSKS-PQMGRCNETSTD-KVAFVRQ  969
             S  +  E        + E KDV+EV     D + + + S    G  N   +D +VAFV+Q
Sbjct  139   SRKSSKE--------EQEFKDVFEVL----DASKVETGSYSSQGTANSKLSDAEVAFVQQ  186

Query  970   KFIEAKCLSLDEKCHHSRQFQDALEVLSSNTDLVLKFLQEPKPMLSEHI------YNLQS  1131
             KF+EAK LS DEK   S +F DALEVL SNTDL+LKFLQ+P  + ++H+      ++LQ 
Sbjct  187   KFMEAKRLSTDEKLQDSEEFNDALEVLDSNTDLLLKFLQQPDSLFTKHLHDLQGAHDLQG  246

Query  1132  IPAPSETKRITVLKPSKMVDN  1194
                 S   RI+ +K S  + N
Sbjct  247   AQPQSRCGRISAMKSSHTLTN  267



>ref|XP_007027125.1| Uncharacterized protein isoform 1 [Theobroma cacao]
 gb|EOY07627.1| Uncharacterized protein isoform 1 [Theobroma cacao]
Length=1023

 Score =   131 bits (329),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 100/261 (38%), Positives = 138/261 (53%), Gaps = 31/261 (12%)
 Frame = +1

Query  436   GNRLLTDKPHRDGSLSRSQSDVARMSPSEDQIEDKEIVSELRRNNSKMKANGTPMKMLIA  615
             GNR L  K  +   L+   S     S  EDQ+       EL   +SK ++ GTPMK L+A
Sbjct  62    GNRQL-QKQRKFSKLASDSSSCGTDSTDEDQL-----TFELSWRSSK-QSTGTPMKKLLA  114

Query  616   EEMSKDMASKHNPPSVVAKLMGLDGFPSQLPVSTAQRNYSGRNAQSAKGTPLNNFHHRSG  795
             +EMSK+  S+   PSV+A+LMGLDG P Q P    Q+    +      G+    F+ R  
Sbjct  115   QEMSKENESRRRQPSVIARLMGLDGLPPQQPGHKQQKRTESKEKVQKGGS----FYSRRS  170

Query  796   SLDTQMECEFYQYPEQNECKDVYEVWQNRHDMNSMRSKS-PQMGRCNETSTD-KVAFVRQ  969
             S  +  E        + E KDV+EV     D + + + S    G  N   +D +VAFV+Q
Sbjct  171   SRKSSKE--------EQEFKDVFEVL----DASKVETGSYSSQGTANSKLSDAEVAFVQQ  218

Query  970   KFIEAKCLSLDEKCHHSRQFQDALEVLSSNTDLVLKFLQEPKPMLSEHI------YNLQS  1131
             KF+EAK LS DEK   S +F DALEVL SNTDL+LKFLQ+P  + ++H+      ++LQ 
Sbjct  219   KFMEAKRLSTDEKLQDSEEFNDALEVLDSNTDLLLKFLQQPDSLFTKHLHDLQGAHDLQG  278

Query  1132  IPAPSETKRITVLKPSKMVDN  1194
                 S   RI+ +K S  + N
Sbjct  279   AQPQSRCGRISAMKSSHTLTN  299



>gb|KJB16896.1| hypothetical protein B456_002G253500 [Gossypium raimondii]
Length=899

 Score =   130 bits (328),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 87/233 (37%), Positives = 134/233 (58%), Gaps = 34/233 (15%)
 Frame = +1

Query  499   VARMSPSEDQIEDKEIVSELRRNNSKMKANGTPMKMLIAEEMSKDMASKHNPPSVVAKLM  678
             V+ +S ++DQ    +++ EL   +SK +++G PMK L+A EMSK++ S+    SV+A+LM
Sbjct  48    VSSISNNKDQ---DQLMFELGLRSSK-QSSGIPMKKLLAREMSKEIESRRRSSSVIARLM  103

Query  679   GLDGFPSQLPVSTAQRNYSGRNAQSAKGTPLNNFHHRSGSLDTQMECEFYQYPEQNECKD  858
             GLDG P +               + A+G   N    RS   +++ E EF         KD
Sbjct  104   GLDGLPPE--------------QKRAEGAGFNG--RRSSRRNSKEEPEF---------KD  138

Query  859   VYEVWQNRHDMNSMRSKSPQMGRCNETSTD-KVAFVRQKFIEAKCLSLDEKCHHSRQFQD  1035
             V+EV      M         +G  N   +D +VAF++QKF+EAK  S DEK   S +F D
Sbjct  139   VFEV----SKMERSGGGYSSLGTVNLKLSDAEVAFIQQKFMEAKRFSTDEKLRDSEEFDD  194

Query  1036  ALEVLSSNTDLVLKFLQEPKPMLSEHIYNLQSIPAPSETKRITVLKPSKMVDN  1194
              LEVL+SNTDL+LKFL++P  + ++H+++LQ + + S   RI+VLK S+ ++N
Sbjct  195   TLEVLNSNTDLLLKFLEQPDSLFAKHLHDLQGVSSQSHCGRISVLKSSRTLNN  247



>gb|KHG18163.1| Transcription initiation factor TFIID subunit 1-B -like protein 
[Gossypium arboreum]
Length=991

 Score =   130 bits (328),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 81/223 (36%), Positives = 131/223 (59%), Gaps = 17/223 (8%)
 Frame = +1

Query  529   IEDKEIVSELRRNNSKMKANGTPMKMLIAEEMSKDMASKHNPPSVVAKLMGLDGFPSQLP  708
              E+ ++  EL   +SK ++  TPMK L+A+EM+K+  S+   PSV+A+LMGLDG P Q P
Sbjct  59    TEEDQLTFELTCRSSK-QSTATPMKKLLAKEMTKENESRRRAPSVIARLMGLDGLPPQQP  117

Query  709   VSTAQRNYSGRNAQSAKGTPLNNFHHRSGSLDTQMECEFYQYPEQNECKDVYEVWQN-RH  885
                 Q+     + +  +G+   ++  +S    ++ E EF         KDV+EV    + 
Sbjct  118   GHKQQKRNENSHEKVQRGS--TSYSWQSSRKSSKDEQEF---------KDVFEVLDALKM  166

Query  886   DMNSMRSKSPQMGRCNETSTDKVAFVRQKFIEAKCLSLDEKCHHSRQFQDALEVLSSNTD  1065
             +  S  S+ P   + ++T   +VAF+R KF+EAK LS DEK   S +F D LEVL+SNTD
Sbjct  167   EGASFSSQGPVKSKLSDT---EVAFIRHKFMEAKRLSTDEKLQDSEEFNDTLEVLNSNTD  223

Query  1066  LVLKFLQEPKPMLSEHIYNLQSIPAPSETKRITVLKPSKMVDN  1194
             L+L + Q+P  + ++H+++L+ +P  S   R+T +K S  ++N
Sbjct  224   LLLNYFQQPNSLFTKHLHDLR-VPPQSHCGRVTAMKSSHTLNN  265



>ref|XP_004985731.1| PREDICTED: uncharacterized protein LOC101771093 isoform X1 [Setaria 
italica]
Length=884

 Score =   130 bits (327),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 104/273 (38%), Positives = 142/273 (52%), Gaps = 37/273 (14%)
 Frame = +1

Query  400   MVNLFDLNGGVAGNRLLTDKPHRDGSLSR-SQSDVARMSPSEDQIEDKEIVSELRRNNSK  576
             M+NLFDL+ G +          RDGS  R +QS+    + S+        V+   R +S 
Sbjct  1     MINLFDLSVGASAK-----VASRDGSPVRGTQSERKEYAGSK-------TVTGCTRRSSS  48

Query  577   MKANGTPMKMLIAEEMSKDMASKHNPPSVVAKLMGLDG---FPSQLPVSTAQRNYSGRNA  747
              ++ GTPMKMLIA+EM+K+  +     +VVA+LMGLD     P  LP   + R       
Sbjct  49    DRSGGTPMKMLIAQEMAKEGDANQKTTNVVARLMGLDDNADLPKPLP---SNRRTFPDGH  105

Query  748   QSAKGTPLNN---FHHRSGSLDTQMECEFYQYPEQNECKDVYEVWQNRHDMNSMRSKSPQ  918
              SA    +NN   F  R+ S+            E  E KDVYEV         + ++SP+
Sbjct  106   LSATLARVNNQMSFEKRASSM------------EDVEYKDVYEVGYQPPRGECLSNESPR  153

Query  919   MGRCNET-STDKVAFVRQKFIEAKCLSLDEKCHHSRQFQDALEVLSSNTDLVLKFLQEPK  1095
               R NE     ++  VRQKF+EAK L+  +    S++F DALEVL+SN DL LKFL+EP 
Sbjct  154   --RPNEDHDKRRMDLVRQKFVEAKQLASHDNLLQSKEFHDALEVLNSNKDLFLKFLEEPN  211

Query  1096  PMLSEHIYNLQSIPAPSETKRITVLKPSKMVDN  1194
              + ++    L S P   + KRITVLKPSK VD 
Sbjct  212   SLFAKQSGELHSAPTSPQRKRITVLKPSKSVDT  244



>gb|KJB16897.1| hypothetical protein B456_002G253500 [Gossypium raimondii]
Length=839

 Score =   130 bits (326),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 80/209 (38%), Positives = 119/209 (57%), Gaps = 30/209 (14%)
 Frame = +1

Query  571   SKMKANGTPMKMLIAEEMSKDMASKHNPPSVVAKLMGLDGFPSQLPVSTAQRNYSGRNAQ  750
             S  +++G PMK L+A EMSK++ S+    SV+A+LMGLDG P +               +
Sbjct  8     SSKQSSGIPMKKLLAREMSKEIESRRRSSSVIARLMGLDGLPPE--------------QK  53

Query  751   SAKGTPLNNFHHRSGSLDTQMECEFYQYPEQNECKDVYEVWQNRHDMNSMRSKSPQMGRC  930
              A+G   N    RS   +++ E EF         KDV+EV      M         +G  
Sbjct  54    RAEGAGFNG--RRSSRRNSKEEPEF---------KDVFEV----SKMERSGGGYSSLGTV  98

Query  931   NETSTD-KVAFVRQKFIEAKCLSLDEKCHHSRQFQDALEVLSSNTDLVLKFLQEPKPMLS  1107
             N   +D +VAF++QKF+EAK  S DEK   S +F D LEVL+SNTDL+LKFL++P  + +
Sbjct  99    NLKLSDAEVAFIQQKFMEAKRFSTDEKLRDSEEFDDTLEVLNSNTDLLLKFLEQPDSLFA  158

Query  1108  EHIYNLQSIPAPSETKRITVLKPSKMVDN  1194
             +H+++LQ + + S   RI+VLK S+ ++N
Sbjct  159   KHLHDLQGVSSQSHCGRISVLKSSRTLNN  187



>ref|XP_009781874.1| PREDICTED: uncharacterized protein LOC104230705 isoform X1 [Nicotiana 
sylvestris]
Length=971

 Score =   130 bits (326),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 85/222 (38%), Positives = 123/222 (55%), Gaps = 22/222 (10%)
 Frame = +1

Query  544   IVSELRRNNSKMKANGTPMKMLIAEEMSKDMA-SKHNPPSVVAKLMGLDGFPSQLPVSTA  720
             I+ +LR+++SK    GTP+K L+AEEM+K+   SK  PPS+VA+LMGL+G PS   V   
Sbjct  48    IMLDLRKSSSK-GVTGTPIKKLLAEEMAKEEGESKRRPPSIVARLMGLEGMPSPQHVGRQ  106

Query  721   QRNYSGRNAQSAKGTPLNNFHHRSGSLDTQMECEFYQYP------EQNECKDVYEVWQNR  882
             QR  S            ++  HR+  +D +    F +        E  E KDVYE  +  
Sbjct  107   QRRLS------------DSCQHRNEQIDHRRRQLFDEQSSKRSSMEHQEFKDVYEDLEAS  154

Query  883   HDMNSMRSKSPQMGRCNETSTDKVAFVRQKFIEAKCLSLDEKCHHSRQFQDALEVLSSNT  1062
             H  N  R  S +       +T  +A ++QKF++AK LS DE+  +S++F D LE L SN 
Sbjct  155   HVAN--RRHSSRWSETGRFATPDMALIQQKFMDAKRLSTDERFQNSKEFDDTLEALESNK  212

Query  1063  DLVLKFLQEPKPMLSEHIYNLQSIPAPSETKRITVLKPSKMV  1188
             +L++K+LQ P P+  +H+ +LQ   A S    I VLKPS  V
Sbjct  213   ELLIKYLQGPDPLFVKHLQDLQVDTASSMCSHIAVLKPSNSV  254



>ref|XP_008241636.1| PREDICTED: probable GPI-anchored adhesin-like protein PGA55 [Prunus 
mume]
Length=996

 Score =   130 bits (326),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 87/221 (39%), Positives = 125/221 (57%), Gaps = 18/221 (8%)
 Frame = +1

Query  535   DKEIVSELRRNNSKMKANGTPMKMLIAEEMSKDMASKHNPPSVVAKLMGLDGFPSQLPVS  714
             D     EL R +SK +  GTP+K L+AEEM K+   +   PSV+AKLMGLDG P Q P  
Sbjct  60    DDSFTFELGRRSSK-QVVGTPIKKLLAEEMLKETEPRRRSPSVIAKLMGLDGLPPQQPAH  118

Query  715   TAQRNYSGRNAQSAKGTPLNN-----FHHRSGSLDTQMECEFYQYPEQNECKDVYEVWQN  879
               Q++ S    Q  +           +  RS   +++         EQ E KDV+EV++ 
Sbjct  119   RQQKSISENCLQRTRLVEKEEKSSMCYDRRSSRKNSK---------EQQEFKDVFEVFEA  169

Query  880   RHDMNSMRSKSPQMGRCNETSTDKVAFVRQKFIEAKCLSLDEKCHHSRQFQDALEVLSSN  1059
              +     RS S +    ++ S  ++AFVRQKF++AK LS DE+   S++F DALEVL SN
Sbjct  170   SNVEG--RSYSSRGNANSKLSDAEMAFVRQKFMDAKRLSTDERLQDSKEFHDALEVLDSN  227

Query  1060  TDLVLKFLQEPKPMLSEHIYNLQSIPAPSETKRITVLKPSK  1182
              DL+LKFLQ+P  + ++H+++LQ  P  S   RI  +K S+
Sbjct  228   KDLLLKFLQQPDSLFAKHLHDLQGGPH-SRCGRIASMKSSE  267



>emb|CAB67661.1| putative protein [Arabidopsis thaliana]
Length=932

 Score =   129 bits (325),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 75/185 (41%), Positives = 103/185 (56%), Gaps = 17/185 (9%)
 Frame = +1

Query  586   NGTPMKMLIAEEMSKDMASKHNPPSVVAKLMGLDGFPSQLPVSTAQRNYSGRNAQSAKGT  765
              G PMK L+A+EMSK   SK   PS++A+LMGLD  PSQ      Q++   +  +S  GT
Sbjct  52    TGVPMKSLLAQEMSKQKESKKRSPSIIARLMGLDVLPSQSSSHKQQKSMENQQGRSGGGT  111

Query  766   PLNNFHHRSGSLDTQMECEFYQYPEQNECKDVYEVWQNRHDMNSMRSKSPQMGRCNETST  945
                +   RS                + + KDV+EV   +  M          GR N   T
Sbjct  112   SYKSLGKRSKG--------------EQKFKDVFEVLDAK--MAESNRNLYHQGRVNANLT  155

Query  946   D-KVAFVRQKFIEAKCLSLDEKCHHSRQFQDALEVLSSNTDLVLKFLQEPKPMLSEHIYN  1122
               ++AF+RQKF+EAK LS D+K  HS++F DALE L SN DL+LKFLQ P  + ++H+++
Sbjct  156   QAEMAFIRQKFMEAKRLSTDDKLRHSKEFNDALEALDSNKDLLLKFLQHPDSLFTKHLHD  215

Query  1123  LQSIP  1137
             LQS P
Sbjct  216   LQSTP  220



>ref|NP_190922.3| uncharacterized protein [Arabidopsis thaliana]
 gb|AEE79106.1| uncharacterized protein AT3G53540 [Arabidopsis thaliana]
Length=924

 Score =   129 bits (325),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 75/185 (41%), Positives = 103/185 (56%), Gaps = 17/185 (9%)
 Frame = +1

Query  586   NGTPMKMLIAEEMSKDMASKHNPPSVVAKLMGLDGFPSQLPVSTAQRNYSGRNAQSAKGT  765
              G PMK L+A+EMSK   SK   PS++A+LMGLD  PSQ      Q++   +  +S  GT
Sbjct  60    TGVPMKSLLAQEMSKQKESKKRSPSIIARLMGLDVLPSQSSSHKQQKSMENQQGRSGGGT  119

Query  766   PLNNFHHRSGSLDTQMECEFYQYPEQNECKDVYEVWQNRHDMNSMRSKSPQMGRCNETST  945
                +   RS                + + KDV+EV   +  M          GR N   T
Sbjct  120   SYKSLGKRSKG--------------EQKFKDVFEVLDAK--MAESNRNLYHQGRVNANLT  163

Query  946   D-KVAFVRQKFIEAKCLSLDEKCHHSRQFQDALEVLSSNTDLVLKFLQEPKPMLSEHIYN  1122
               ++AF+RQKF+EAK LS D+K  HS++F DALE L SN DL+LKFLQ P  + ++H+++
Sbjct  164   QAEMAFIRQKFMEAKRLSTDDKLRHSKEFNDALEALDSNKDLLLKFLQHPDSLFTKHLHD  223

Query  1123  LQSIP  1137
             LQS P
Sbjct  224   LQSTP  228



>ref|XP_009781875.1| PREDICTED: uncharacterized protein LOC104230705 isoform X2 [Nicotiana 
sylvestris]
Length=925

 Score =   129 bits (325),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 85/222 (38%), Positives = 123/222 (55%), Gaps = 22/222 (10%)
 Frame = +1

Query  544   IVSELRRNNSKMKANGTPMKMLIAEEMSKDMA-SKHNPPSVVAKLMGLDGFPSQLPVSTA  720
             I+ +LR+++SK    GTP+K L+AEEM+K+   SK  PPS+VA+LMGL+G PS   V   
Sbjct  2     IMLDLRKSSSK-GVTGTPIKKLLAEEMAKEEGESKRRPPSIVARLMGLEGMPSPQHVGRQ  60

Query  721   QRNYSGRNAQSAKGTPLNNFHHRSGSLDTQMECEFYQYP------EQNECKDVYEVWQNR  882
             QR  S            ++  HR+  +D +    F +        E  E KDVYE  +  
Sbjct  61    QRRLS------------DSCQHRNEQIDHRRRQLFDEQSSKRSSMEHQEFKDVYEDLEAS  108

Query  883   HDMNSMRSKSPQMGRCNETSTDKVAFVRQKFIEAKCLSLDEKCHHSRQFQDALEVLSSNT  1062
             H  N  R  S +       +T  +A ++QKF++AK LS DE+  +S++F D LE L SN 
Sbjct  109   HVAN--RRHSSRWSETGRFATPDMALIQQKFMDAKRLSTDERFQNSKEFDDTLEALESNK  166

Query  1063  DLVLKFLQEPKPMLSEHIYNLQSIPAPSETKRITVLKPSKMV  1188
             +L++K+LQ P P+  +H+ +LQ   A S    I VLKPS  V
Sbjct  167   ELLIKYLQGPDPLFVKHLQDLQVDTASSMCSHIAVLKPSNSV  208



>ref|XP_009609522.1| PREDICTED: uncharacterized protein LOC104103330 isoform X2 [Nicotiana 
tomentosiformis]
Length=969

 Score =   129 bits (325),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 82/223 (37%), Positives = 123/223 (55%), Gaps = 23/223 (10%)
 Frame = +1

Query  544   IVSELRRNNSKMKANGTPMKMLIAEEMSKD-MASKHNPPSVVAKLMGLDGFPSQLPVSTA  720
             I+ +L +++SK +  GTP+K L+AEEM+K+ + SK  PPS+VA+LMG +G PS   +   
Sbjct  48    IMLDLEKSSSK-RVTGTPIKKLLAEEMAKEEVESKRRPPSIVARLMGFEGMPSPQHIGRQ  106

Query  721   QRNYSGRNAQSAKGTPLNNFHHRSGSLDTQMECEFYQYP-------EQNECKDVYEVWQN  879
             QR  S            +N  HR+  +D +   + +          E  E KDVYE  + 
Sbjct  107   QRRLS------------DNCQHRNEQVDPRRRRQLFNEQSSKRSSMEHQEFKDVYEDLEA  154

Query  880   RHDMNSMRSKSPQMGRCNETSTDKVAFVRQKFIEAKCLSLDEKCHHSRQFQDALEVLSSN  1059
              H  N  R  S +       +T  +A ++QKF++AK LS DE+  +S++F D LE L SN
Sbjct  155   SHVAN--RRHSSRWTETGRFATPDMALIQQKFMDAKRLSTDERFQNSKEFHDTLEALESN  212

Query  1060  TDLVLKFLQEPKPMLSEHIYNLQSIPAPSETKRITVLKPSKMV  1188
              +L++K+LQ P P+  +H+ +LQ   A S    I VLKPS  V
Sbjct  213   KELLIKYLQGPDPLFVKHLQDLQVDTASSMCSHIAVLKPSNSV  255



>ref|XP_009609521.1| PREDICTED: uncharacterized protein LOC104103330 isoform X1 [Nicotiana 
tomentosiformis]
Length=973

 Score =   129 bits (324),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 82/223 (37%), Positives = 123/223 (55%), Gaps = 23/223 (10%)
 Frame = +1

Query  544   IVSELRRNNSKMKANGTPMKMLIAEEMSKD-MASKHNPPSVVAKLMGLDGFPSQLPVSTA  720
             I+ +L +++SK +  GTP+K L+AEEM+K+ + SK  PPS+VA+LMG +G PS   +   
Sbjct  52    IMLDLEKSSSK-RVTGTPIKKLLAEEMAKEEVESKRRPPSIVARLMGFEGMPSPQHIGRQ  110

Query  721   QRNYSGRNAQSAKGTPLNNFHHRSGSLDTQMECEFYQYP-------EQNECKDVYEVWQN  879
             QR  S            +N  HR+  +D +   + +          E  E KDVYE  + 
Sbjct  111   QRRLS------------DNCQHRNEQVDPRRRRQLFNEQSSKRSSMEHQEFKDVYEDLEA  158

Query  880   RHDMNSMRSKSPQMGRCNETSTDKVAFVRQKFIEAKCLSLDEKCHHSRQFQDALEVLSSN  1059
              H  N  R  S +       +T  +A ++QKF++AK LS DE+  +S++F D LE L SN
Sbjct  159   SHVAN--RRHSSRWTETGRFATPDMALIQQKFMDAKRLSTDERFQNSKEFHDTLEALESN  216

Query  1060  TDLVLKFLQEPKPMLSEHIYNLQSIPAPSETKRITVLKPSKMV  1188
              +L++K+LQ P P+  +H+ +LQ   A S    I VLKPS  V
Sbjct  217   KELLIKYLQGPDPLFVKHLQDLQVDTASSMCSHIAVLKPSNSV  259



>ref|XP_009609523.1| PREDICTED: uncharacterized protein LOC104103330 isoform X3 [Nicotiana 
tomentosiformis]
Length=927

 Score =   129 bits (324),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 82/223 (37%), Positives = 123/223 (55%), Gaps = 23/223 (10%)
 Frame = +1

Query  544   IVSELRRNNSKMKANGTPMKMLIAEEMSKD-MASKHNPPSVVAKLMGLDGFPSQLPVSTA  720
             I+ +L +++SK +  GTP+K L+AEEM+K+ + SK  PPS+VA+LMG +G PS   +   
Sbjct  6     IMLDLEKSSSK-RVTGTPIKKLLAEEMAKEEVESKRRPPSIVARLMGFEGMPSPQHIGRQ  64

Query  721   QRNYSGRNAQSAKGTPLNNFHHRSGSLDTQMECEFYQYP-------EQNECKDVYEVWQN  879
             QR  S            +N  HR+  +D +   + +          E  E KDVYE  + 
Sbjct  65    QRRLS------------DNCQHRNEQVDPRRRRQLFNEQSSKRSSMEHQEFKDVYEDLEA  112

Query  880   RHDMNSMRSKSPQMGRCNETSTDKVAFVRQKFIEAKCLSLDEKCHHSRQFQDALEVLSSN  1059
              H  N  R  S +       +T  +A ++QKF++AK LS DE+  +S++F D LE L SN
Sbjct  113   SHVAN--RRHSSRWTETGRFATPDMALIQQKFMDAKRLSTDERFQNSKEFHDTLEALESN  170

Query  1060  TDLVLKFLQEPKPMLSEHIYNLQSIPAPSETKRITVLKPSKMV  1188
              +L++K+LQ P P+  +H+ +LQ   A S    I VLKPS  V
Sbjct  171   KELLIKYLQGPDPLFVKHLQDLQVDTASSMCSHIAVLKPSNSV  213



>gb|KJB36775.1| hypothetical protein B456_006G176300 [Gossypium raimondii]
Length=995

 Score =   129 bits (323),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 81/223 (36%), Positives = 131/223 (59%), Gaps = 17/223 (8%)
 Frame = +1

Query  529   IEDKEIVSELRRNNSKMKANGTPMKMLIAEEMSKDMASKHNPPSVVAKLMGLDGFPSQLP  708
              E+ ++  EL   +SK ++ GTPMK L+A+EM+K+  S+  PPSV+A+LMGLDG P Q  
Sbjct  61    TEEDQLTFELTCRSSK-QSTGTPMKKLLAKEMTKENESRRRPPSVIARLMGLDGLPPQQR  119

Query  709   VSTAQRNYSGRNAQSAKGTPLNNFHHRSGSLDTQMECEFYQYPEQNECKDVYEVWQN-RH  885
                 Q+     + +  KG+   ++  +S    ++ E EF         KDV+EV    + 
Sbjct  120   GHKQQKRNENSHEKVQKGS--TSYSWQSSRKSSKDEQEF---------KDVFEVLDALKM  168

Query  886   DMNSMRSKSPQMGRCNETSTDKVAFVRQKFIEAKCLSLDEKCHHSRQFQDALEVLSSNTD  1065
             +  S  S+     + ++T   +VAF+R KF+EAK LS DEK   S +F D LEVL+SNTD
Sbjct  169   EGASFSSQGTVKSKLSDT---EVAFIRHKFMEAKRLSTDEKLQDSEEFNDTLEVLNSNTD  225

Query  1066  LVLKFLQEPKPMLSEHIYNLQSIPAPSETKRITVLKPSKMVDN  1194
             L+L + Q+P  + ++H+++L+ +P  S   R++ +K S  ++N
Sbjct  226   LLLNYFQQPNSLFTKHLHDLR-VPPQSHCGRVSAMKSSHTLNN  267



>gb|EMT13565.1| hypothetical protein F775_11179 [Aegilops tauschii]
Length=1048

 Score =   129 bits (323),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 92/255 (36%), Positives = 146/255 (57%), Gaps = 12/255 (5%)
 Frame = +1

Query  445   LLTDKPHRDGSLSRSQSDVAR-MSPSEDQIEDKEIVSELRRNNSKMKANGTPMKMLIAEE  621
             +L D P R     R ++D+ R + P++  IEDK  +    R++   K++ +PMK L+A +
Sbjct  124   VLGDSPVR-----RGRTDIKRTVDPAKVCIEDK--LETSTRSSLSSKSDASPMKKLLANQ  176

Query  622   MSKDMASKHNPPSVVAKLMGL-DGFPSQ-LPVSTAQRNYSGRNAQSAKGTPLNNFHHRSG  795
             ++K++ SK  PPSVVA+LMGL D  P+Q   + +A+ N    ++             +  
Sbjct  177   IAKEVESKRKPPSVVARLMGLEDDLPAQEQALHSAKSNLRRSHSHDKYAATKRALQQQEQ  236

Query  796   SLDTQMECEFYQYPEQN-ECKDVYEVWQNRHDMNSMRSKSPQMGRCNETSTD-KVAFVRQ  969
              L ++     +  P++  E KDVY V +     + ++ ++    R ++   D ++  VRQ
Sbjct  237   HLYSKTTRGKHTGPKETVEFKDVYAVCEEPLRTHHLQDQTSSGLRSSQNKRDERIEVVRQ  296

Query  970   KFIEAKCLSLDEKCHHSRQFQDALEVLSSNTDLVLKFLQEPKPMLSEHIYNLQSIPAPSE  1149
             KFI+AK L+ DE   HS++F +ALEVLSSN DL LKFL+EP  + S  +Y   ++ AP +
Sbjct  297   KFIQAKRLATDENFLHSKEFHEALEVLSSNKDLFLKFLEEPSSVFSNPLYGQHTMAAPPQ  356

Query  1150  TKRITVLKPSKMVDN  1194
             TKRITVLKP K  +N
Sbjct  357   TKRITVLKPFKSAEN  371



>ref|XP_009374691.1| PREDICTED: uncharacterized protein LOC103963581 [Pyrus x bretschneideri]
Length=989

 Score =   128 bits (322),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 81/208 (39%), Positives = 116/208 (56%), Gaps = 19/208 (9%)
 Frame = +1

Query  571   SKMKANGTPMKMLIAEEMSKDMASKHNPPSVVAKLMGLDGFPSQLPVSTAQRNYSGRNAQ  750
             S  +  GTP+K L+AEEM ++   +   PSV+AKLMGLDG P Q P     +  S    Q
Sbjct  78    SSQQGVGTPIKKLLAEEMVRETEPRRRSPSVIAKLMGLDGLPPQQPADRQSKGISENYLQ  137

Query  751   SAKGTPLNN----FHHRSGSLDTQMECEFYQYPEQNECKDVYEVWQNRHDMNSMRSKSPQ  918
               +     +    FH R  S              Q+E KDV+EV+      +S  S +P+
Sbjct  138   KTRSVEKEHRSSMFHDRHSSRKNSRV--------QHEFKDVFEVYDPSRSSSSRGSANPK  189

Query  919   MGRCNETSTDKVAFVRQKFIEAKCLSLDEKCHHSRQFQDALEVLSSNTDLVLKFLQEPKP  1098
             +      S  ++AFVRQKF++AK LS DE+   S++F DALEVL SN D++LKFLQ+P  
Sbjct  190   L------SDAEMAFVRQKFMDAKRLSTDERLQDSKEFHDALEVLESNKDILLKFLQQPDS  243

Query  1099  MLSEHIYNLQSIPAPSETKRITVLKPSK  1182
             + ++H+++LQ  P  S   RI  +KPS+
Sbjct  244   LFAKHLHDLQGGPQ-SLCGRIASMKPSE  270



>ref|XP_008666662.1| PREDICTED: uncharacterized protein LOC103645377 [Zea mays]
Length=384

 Score =   124 bits (311),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 86/225 (38%), Positives = 120/225 (53%), Gaps = 18/225 (8%)
 Frame = +1

Query  526   QIEDKEIVSELRRNNSKMKANG-------TPMKMLIAEEMSKDMASKHNPPSVVAKLMGL  684
             Q EDK+  S+ RRN    ++N        TP+KML+ ++M K+      P +VVA+LMGL
Sbjct  24    QTEDKQRDSQTRRNFPTKRSNSPTKMTHVTPVKMLMEQDMWKERRPDEEPLNVVARLMGL  83

Query  685   DGFPSQLPVSTAQRNYS-GRNAQSAKGTPLNNFHHRSGSLDTQMECEFYQYPEQNECKDV  861
                P Q P      N+  GR  Q  K      F     +L ++ E + +Q   Q   +  
Sbjct  84    HEPPGQQP------NFPLGR--QLDKKYQCGGFEENYWNLKSKKESKCHQ--NQKAGRRH  133

Query  862   YEVWQNRHDMNSMRSKSPQMGRCNETSTDKVAFVRQKFIEAKCLSLDEKCHHSRQFQDAL  1041
                W    D  S  S S  M + NET   +++ V +KF EAK L+ DEK  H ++FQDAL
Sbjct  134   QHTWNGSGDQPSRISSSQSMHQGNETCEKRMSIVHEKFAEAKRLATDEKLLHLKEFQDAL  193

Query  1042  EVLSSNTDLVLKFLQEPKPMLSEHIYNLQSIPAPSETKRITVLKP  1176
             + LSSN DL L+FL EP P+LS + Y  + +  PSE K+IT+LKP
Sbjct  194   QFLSSNRDLFLEFLDEPNPLLSSNHYEFRPVALPSELKQITILKP  238



>ref|XP_009377131.1| PREDICTED: uncharacterized protein LOC103965780 [Pyrus x bretschneideri]
Length=972

 Score =   127 bits (320),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 76/202 (38%), Positives = 115/202 (57%), Gaps = 26/202 (13%)
 Frame = +1

Query  571   SKMKANGTPMKMLIAEEMSKDMASKHNPPSVVAKLMGLDGFPSQLPVSTAQRNYSGRNAQ  750
             S  +A GTP+K L+AEEM +++  +   PSV+AKLMGLDG P Q P     +    RN+ 
Sbjct  72    SSQQAVGTPIKKLLAEEMVREIEPRRRSPSVIAKLMGLDGLPPQQPTHRQPKETEHRNSM  131

Query  751   SAKGTPLNNFHHRSGSLDTQMECEFYQYPEQNECKDVYEVWQNRHDMNSMRSKSPQMGRC  930
             S        +  R    +++++ EF         KDV+EV++     +S        G  
Sbjct  132   S--------YERRLSRKNSRVQQEF---------KDVFEVYETSKGYSSR-------GTA  167

Query  931   NETSTD-KVAFVRQKFIEAKCLSLDEKCHHSRQFQDALEVLSSNTDLVLKFLQEPKPMLS  1107
             N   +D ++AF+RQKF++AK LS DE+   S++F D LEVL SN DL+LKFLQ+P  + +
Sbjct  168   NTKLSDAEMAFIRQKFMDAKRLSTDERLQDSKEFHDVLEVLESNKDLLLKFLQQPDSLFA  227

Query  1108  EHIYNLQSIPAPSETKRITVLK  1173
             +H+++L  +P  S   RI  +K
Sbjct  228   KHLHDLHGVPQ-SHCGRIASMK  248



>ref|XP_010529869.1| PREDICTED: uncharacterized protein LOC104806591 [Tarenaya hassleriana]
Length=946

 Score =   127 bits (318),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 84/194 (43%), Positives = 113/194 (58%), Gaps = 31/194 (16%)
 Frame = +1

Query  589   GTPMKMLIAEEMSKDMASKHNPPSVVAKLMGLDGFPSQLPVSTAQR----NYSGRNAQSA  756
             G PMK L+A+EMSK   SK   PS++A+LMGLDG PSQ   S  QR    N   R   S 
Sbjct  68    GKPMKSLLAQEMSKQNESKRKSPSIIARLMGLDGLPSQ-SSSHKQRKPMENQQCRTRASE  126

Query  757   K---GTPLN-NFHHRSGSLDTQMECEFYQYPEQNECKDVYEVWQNRHDMNSMRSKSPQ--  918
             K   G+  N +   R GS             E+ E KDV+EV      ++S + +S +  
Sbjct  127   KDLGGSAYNGDRSFRKGS------------KEEGEFKDVFEV------LDSKKVESGRNL  168

Query  919   -MGRCNETSTD-KVAFVRQKFIEAKCLSLDEKCHHSRQFQDALEVLSSNTDLVLKFLQEP  1092
               GR N + T+ ++ F+RQKF+EAK LS DEK  HS++F DA+E L SN DL+LKFLQ P
Sbjct  169   YQGRSNSSLTEAEMVFIRQKFMEAKRLSTDEKLRHSKEFNDAIEALDSNKDLLLKFLQHP  228

Query  1093  KPMLSEHIYNLQSI  1134
               + + H+++LQSI
Sbjct  229   DSLFTRHLHDLQSI  242



>emb|CBI32667.3| unnamed protein product [Vitis vinifera]
Length=867

 Score =   127 bits (318),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 80/205 (39%), Positives = 110/205 (54%), Gaps = 25/205 (12%)
 Frame = +1

Query  598   MKMLIAEEMSKDMASKHNPPSVVAKLMGLDGFPSQLPVSTAQR----NYSGRNAQSAKGT  765
             MK L+A+EMSK+   K   PSV+A+LMGLDG P Q P+   Q+    N+  R     +  
Sbjct  1     MKKLLAKEMSKEAEPKKRSPSVIARLMGLDGLPPQQPIHKQQKKLMENHQQRTETVERAE  60

Query  766   PLNNFH----HRSGSLDTQMECEFYQYPEQNECKDVYEVW---QNRHDMNSMRSKSPQMG  924
                 F+    HR  +             EQ E KDV+EV    +   D   +  +     
Sbjct  61    GGGTFYGPQLHRKKN-----------SKEQEEFKDVFEVLVAPKGESDCYQVEGQGTTNS  109

Query  925   RCNETSTDKVAFVRQKFIEAKCLSLDEKCHHSRQFQDALEVLSSNTDLVLKFLQEPKPML  1104
             +  E    + AF+RQKF++AK LS DEK   S++F DALEVL SN DL+LKFLQEP  + 
Sbjct  110   KLTEA---EKAFIRQKFMDAKRLSTDEKLQDSQEFHDALEVLDSNKDLLLKFLQEPDSLF  166

Query  1105  SEHIYNLQSIPAPSETKRITVLKPS  1179
             ++H+ +LQ +P     +RITV K S
Sbjct  167   TKHLQDLQGVPPQPHCRRITVSKSS  191



>ref|NP_001053260.1| Os04g0506900 [Oryza sativa Japonica Group]
 dbj|BAF15174.1| Os04g0506900 [Oryza sativa Japonica Group]
Length=881

 Score =   126 bits (317),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 84/204 (41%), Positives = 114/204 (56%), Gaps = 7/204 (3%)
 Frame = +1

Query  598   MKMLIAEEMSKDMASKHNPPSVVAKLMGLDG-FPSQLPVSTAQRNYSGRNAQSAKGTPLN  774
             M  L+A EMSK + SK  PPSVVA+LMGLD   P++ P   + R    R+         N
Sbjct  1     MNRLVAMEMSKGVESKRKPPSVVARLMGLDDDLPAKEPALQSSRRNLRRSHSLDNLAATN  60

Query  775   NFHHRSGSLDTQMECEFYQYPEQN-ECKDVYEVWQN---RHDMNSMRSKSPQMGRCNETS  942
                 +     ++     +  P++  E KDVYEV ++   RH +  +    P        S
Sbjct  61    RPQQQQEQHYSRTTPNIHIGPKETVEFKDVYEVSEDPLKRHHI--LGQNFPWERSSGNKS  118

Query  943   TDKVAFVRQKFIEAKCLSLDEKCHHSRQFQDALEVLSSNTDLVLKFLQEPKPMLSEHIYN  1122
               ++  VRQKF+EAK L+ +E   HS+QFQ+ALEVLSSN +L LKFL+EP P   + +  
Sbjct  119   DTRIEAVRQKFMEAKRLATNENLIHSKQFQEALEVLSSNRELFLKFLEEPSPAFLKQLDG  178

Query  1123  LQSIPAPSETKRITVLKPSKMVDN  1194
             L + PAP  TKRITVLKP K V+N
Sbjct  179   LDTTPAPPPTKRITVLKPIKSVEN  202



>ref|XP_011019251.1| PREDICTED: uncharacterized protein LOC105122046 [Populus euphratica]
Length=983

 Score =   127 bits (318),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 86/217 (40%), Positives = 127/217 (59%), Gaps = 21/217 (10%)
 Frame = +1

Query  553   ELRRNNSKMKANGTPMKMLIAEEMSKDMASKHNPPSVVAKLMGLDGFPSQLPVSTAQR--  726
             EL R + K +A GTP+K L+ EEMS+   SK   PSV+A+LMGLDG P Q      Q+  
Sbjct  55    ELGRRSPK-QAAGTPIKKLLEEEMSRKSDSKRRSPSVIARLMGLDGLPPQQSSHKQQKKS  113

Query  727   --NYSGRNAQSAKGTPLN-NFHHRSGSLDTQMECEFYQYPEQNECKDVYEVWQ-NRHDMN  894
               NY+ R   + K    N ++  RS    ++ E EF         KDV+EV   ++ D +
Sbjct  114   LENYTQRMVLTEKAQRNNASYGRRSSRKSSKDEQEF---------KDVFEVLDPSKIDSS  164

Query  895   SMRSKSPQMGRCNETSTDKVAFVRQKFIEAKCLSLDEKCHHSRQFQDALEVLSSNTDLVL  1074
             S  S+     +    S  ++AF++QKF++AK LS DEK  +SR+F DA+E L SN DL+L
Sbjct  165   SYSSRGTAHSKL---SAAEMAFIQQKFMDAKRLSTDEKLQNSREFHDAIEDLDSNKDLLL  221

Query  1075  KFLQEPKPMLSEHIYNLQSIPAPSE--TKRITVLKPS  1179
             K+LQ+P  + ++H+++LQ +P  S     RI+ +KPS
Sbjct  222   KYLQQPDSLFTKHLHDLQGVPTQSHCGQTRISAMKPS  258



>ref|XP_010240105.1| PREDICTED: uncharacterized protein LOC100830890 isoform X2 [Brachypodium 
distachyon]
Length=914

 Score =   126 bits (316),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 104/285 (36%), Positives = 156/285 (55%), Gaps = 51/285 (18%)
 Frame = +1

Query  400   MVNLFDLNGGVAGNRLLTDKPHRDGS-LSRSQSDVARMSPSEDQIEDKEIVSELRRNNSK  576
             M+NLFDL+ G+   ++LTD+ +RDGS + R   D    +P++   E+K  +    RN+S 
Sbjct  1     MINLFDLSTGMTSTKVLTDRAYRDGSPVRRIWQDT---NPAKVCAENK--LGANSRNSSN  55

Query  577   MKANGTPMKMLIAEEMSKDMASKHNPPSVVAKLMGL-DGFPSQLP--VSTAQRNYSGRNA  747
              K++  PMKML+  E+ K+  S+  PPSVVA+LMGL D  P+Q P  + + +RN   ++ 
Sbjct  56    NKSDAPPMKMLLVREIFKEAESRKKPPSVVARLMGLEDDLPAQEPALLHSVKRNLRSQSH  115

Query  748   QSAKGT--PL----------NNFHHRSGSLDTQMECEFYQYPEQNECKDVYEVWQNRHDM  891
              +   T  PL          +  HH   + +  +    + +P+Q                
Sbjct  116   ANLAATNRPLLQQERHCYGKSTHHHVDAAREEPLRVRTHHHPDQT---------------  160

Query  892   NSMRSKSPQMGRCNETSTDKVAFVRQKFIEAKCLSLDEKCHHSRQFQDALEVLSSNTDLV  1071
                 S      + ++T T+    VR+KF+EAK L+ DE   HS++FQ+ALEVLSSN DL 
Sbjct  161   ---LSSGRSSRKKSDTRTE---VVRKKFMEAKLLANDENFLHSKEFQEALEVLSSNKDLF  214

Query  1072  LKFLQEP----KPMLSEHIYNLQSIPAPSETKRITVLKPSKMVDN  1194
             LKFL+EP    KP  +EH    Q++PAP + K IT+LKP K V+N
Sbjct  215   LKFLEEPSSVSKPQ-NEH----QTMPAPLQKKCITLLKPLKSVEN  254



>ref|XP_010240102.1| PREDICTED: uncharacterized protein LOC100830890 isoform X1 [Brachypodium 
distachyon]
 ref|XP_010240103.1| PREDICTED: uncharacterized protein LOC100830890 isoform X1 [Brachypodium 
distachyon]
 ref|XP_010240104.1| PREDICTED: uncharacterized protein LOC100830890 isoform X1 [Brachypodium 
distachyon]
Length=915

 Score =   126 bits (316),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 104/285 (36%), Positives = 156/285 (55%), Gaps = 51/285 (18%)
 Frame = +1

Query  400   MVNLFDLNGGVAGNRLLTDKPHRDGS-LSRSQSDVARMSPSEDQIEDKEIVSELRRNNSK  576
             M+NLFDL+ G+   ++LTD+ +RDGS + R   D    +P++   E+K  +    RN+S 
Sbjct  1     MINLFDLSTGMTSTKVLTDRAYRDGSPVRRIWQDT---NPAKVCAENK--LGANSRNSSN  55

Query  577   MKANGTPMKMLIAEEMSKDMASKHNPPSVVAKLMGL-DGFPSQLP--VSTAQRNYSGRNA  747
              K++  PMKML+  E+ K+  S+  PPSVVA+LMGL D  P+Q P  + + +RN   ++ 
Sbjct  56    NKSDAPPMKMLLVREIFKEAESRKKPPSVVARLMGLEDDLPAQEPALLHSVKRNLRSQSH  115

Query  748   QSAKGT--PL----------NNFHHRSGSLDTQMECEFYQYPEQNECKDVYEVWQNRHDM  891
              +   T  PL          +  HH   + +  +    + +P+Q                
Sbjct  116   ANLAATNRPLLQQERHCYGKSTHHHVDAAREEPLRVRTHHHPDQT---------------  160

Query  892   NSMRSKSPQMGRCNETSTDKVAFVRQKFIEAKCLSLDEKCHHSRQFQDALEVLSSNTDLV  1071
                 S      + ++T T+    VR+KF+EAK L+ DE   HS++FQ+ALEVLSSN DL 
Sbjct  161   ---LSSGRSSRKKSDTRTE---VVRKKFMEAKLLANDENFLHSKEFQEALEVLSSNKDLF  214

Query  1072  LKFLQEP----KPMLSEHIYNLQSIPAPSETKRITVLKPSKMVDN  1194
             LKFL+EP    KP  +EH    Q++PAP + K IT+LKP K V+N
Sbjct  215   LKFLEEPSSVSKPQ-NEH----QTMPAPLQKKCITLLKPLKSVEN  254



>ref|XP_010553305.1| PREDICTED: uncharacterized protein LOC104823434 [Tarenaya hassleriana]
Length=928

 Score =   126 bits (316),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 91/235 (39%), Positives = 125/235 (53%), Gaps = 27/235 (11%)
 Frame = +1

Query  523   DQIEDKEIVSELRRNNSKMKANGTPMKMLIAEEMSKDMASKHNPPSVVAKLMGLDGFPSQ  702
             D + +  +  ELR   S  +  G P+K L+A+EMSK    K   PS++AKLMGLDG P Q
Sbjct  47    DSLGEDTLAFELRWK-SAHQIVGMPVKSLLAQEMSKQNECKRRSPSIIAKLMGLDGLPPQ  105

Query  703   LPVSTAQR---NYSGRNAQSAK---GTPLN-NFHHRSGSLDTQMECEFYQYPEQNECKDV  861
             +      +   N  GR   S K   G+  N +   R GS D Q            E KDV
Sbjct  106   ISSHKQHKSVENQQGRTRASEKAHGGSAHNADRSFRRGSKDEQ------------EFKDV  153

Query  862   YEVWQNRHDMNSMRSKSPQMGRCNETSTD-KVAFVRQKFIEAKCLSLDEKCHHSRQFQDA  1038
             +EV   +    +  S++   GR N   T  ++AF+RQKF+EAK LS DEK  HS++F DA
Sbjct  154   FEVLDAK---KAESSRNLYRGRGNANLTKAEMAFIRQKFMEAKRLSTDEKLRHSKEFSDA  210

Query  1039  LEVLSSNTDLVLKFLQEPKPMLSEHIYNLQSIPAPSETKRITVLKPS---KMVDN  1194
             LE L SN DL+LKFLQ P  + ++H+++LQ         ++  LK S   K VD+
Sbjct  211   LEALDSNKDLLLKFLQHPDSLFTKHLHDLQGTAPKRHYSQVPSLKSSNCPKYVDS  265



>ref|XP_002877924.1| hypothetical protein ARALYDRAFT_906742 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH54183.1| hypothetical protein ARALYDRAFT_906742 [Arabidopsis lyrata subsp. 
lyrata]
Length=928

 Score =   125 bits (313),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 80/210 (38%), Positives = 113/210 (54%), Gaps = 14/210 (7%)
 Frame = +1

Query  547   VSELRRNNSKMKANGTPMKMLIAEEMSKDMASKHNPPSVVAKLMGLDGFPSQLPVSTAQR  726
             +SE    N +    G PMK L+A+EMSK   SK   PS++A+LMGLD  PSQ      Q+
Sbjct  47    LSEALSENKQDFHTGVPMKSLLAQEMSKHKESKKRSPSIIARLMGLDVLPSQSSPHRQQK  106

Query  727   NYSGRNAQSAKGTPLNNFHHRSGSLDTQMECEFYQYPEQNECKDVYEVWQNRHDMNSMRS  906
             +   +  +S  G+          S D      +    EQ + KDV+EV   +  M     
Sbjct  107   SMESQQGRSGGGS----------SYDGNKSLGWRSKGEQ-KFKDVFEVLDAK--MAESNR  153

Query  907   KSPQMGRCNETSTD-KVAFVRQKFIEAKCLSLDEKCHHSRQFQDALEVLSSNTDLVLKFL  1083
                  GR N   T  ++AF+R KF+EAK LS D+K  HS++F DALE L SN DL+LKFL
Sbjct  154   NLYHQGRVNANLTQAEMAFIRHKFMEAKRLSTDDKLRHSKEFNDALEALDSNKDLLLKFL  213

Query  1084  QEPKPMLSEHIYNLQSIPAPSETKRITVLK  1173
             Q P  + ++H+++LQS P   + ++   LK
Sbjct  214   QHPDSLFTKHLHDLQSTPHKPQYRQAPSLK  243



>ref|XP_006290587.1| hypothetical protein CARUB_v10016676mg [Capsella rubella]
 gb|EOA23485.1| hypothetical protein CARUB_v10016676mg [Capsella rubella]
Length=864

 Score =   124 bits (312),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 78/184 (42%), Positives = 107/184 (58%), Gaps = 18/184 (10%)
 Frame = +1

Query  598   MKMLIAEEMSKDMASKHNPPSVVAKLMGLDGFPSQLPVSTAQR---NYSGRNAQSAKGTP  768
             MK L+A+EMSK   SK   PS++A+LMGLD  P+Q      Q+   N  GR+   +   P
Sbjct  1     MKSLLAQEMSKQKESKKRSPSIIARLMGLDVLPAQSSSYRQQKSMENLQGRSGGGSSHDP  60

Query  769   LNNFHHRSGSLDTQMECEFYQYPEQNECKDVYEVWQNRHDMNSMRSKSPQMGRCNETSTD  948
              N    RS    ++ E +F         KDV+EV   +   +  RS   Q GR N   T 
Sbjct  61    YNKSLRRS----SKGEQKF---------KDVFEVLDAKMAESKNRSLYHQ-GRVNANLTQ  106

Query  949   -KVAFVRQKFIEAKCLSLDEKCHHSRQFQDALEVLSSNTDLVLKFLQEPKPMLSEHIYNL  1125
              ++AF+RQKF+EAK LS D+K  HS++F DALE L SN DL+LKFLQ P  + ++H+ +L
Sbjct  107   AEMAFIRQKFMEAKRLSTDDKLRHSKEFNDALEALDSNKDLLLKFLQHPDSLFTKHLQDL  166

Query  1126  QSIP  1137
             Q+IP
Sbjct  167   QTIP  170



>ref|XP_012074865.1| PREDICTED: uncharacterized protein LOC105636246 isoform X2 [Jatropha 
curcas]
Length=932

 Score =   124 bits (311),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 80/223 (36%), Positives = 130/223 (58%), Gaps = 12/223 (5%)
 Frame = +1

Query  529   IEDKEIVSELRRNNSKMKANGTPMKMLIAEEMSKDMASKHNPPSVVAKLMGLDGFPSQLP  708
             ++ ++  SEL   +S  +A GTP+K L+AEEMS+++  K    SV+A+LMGLDG P+Q  
Sbjct  7     VDPEKFTSELGWRSSN-QAAGTPIKKLLAEEMSREIEPKKRSLSVIARLMGLDGLPTQ-Q  64

Query  709   VSTAQRNYSGRNAQSAKGTPLNNFHHRSGSLDTQMECEFYQYPEQNECKDVYEVWQNRHD  888
             +S  Q+  S  N Q    T       +  S             E+ E KDV+EV     D
Sbjct  65    LSQKQQKRSSENVQRIALTE----KGQRSSTSCSRRSSRKSSKEEQEFKDVFEV----SD  116

Query  889   MNSMRSKSPQM-GRCNETSTD-KVAFVRQKFIEAKCLSLDEKCHHSRQFQDALEVLSSNT  1062
              + M + S  + G  N   TD ++AF++QKF++A+ LS DEK H  ++F D ++ L SN 
Sbjct  117   TSKMENSSHSLQGSANSKLTDAEMAFIQQKFMDARRLSADEKFHDLKEFHDVIDDLESNK  176

Query  1063  DLVLKFLQEPKPMLSEHIYNLQSIPAPSETKRITVLKPSKMVD  1191
             DL+LKFL++P  + ++H+++LQ+  + S  + I+ +KPS+ ++
Sbjct  177   DLLLKFLEQPDSLFTKHLHDLQTTTSQSHCRHISDMKPSRALE  219



>ref|XP_012074864.1| PREDICTED: uncharacterized protein LOC105636246 isoform X1 [Jatropha 
curcas]
Length=975

 Score =   124 bits (310),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 77/209 (37%), Positives = 122/209 (58%), Gaps = 11/209 (5%)
 Frame = +1

Query  571   SKMKANGTPMKMLIAEEMSKDMASKHNPPSVVAKLMGLDGFPSQLPVSTAQRNYSGRNAQ  750
             S  +A GTP+K L+AEEMS+++  K    SV+A+LMGLDG P+Q  +S  Q+  S  N Q
Sbjct  63    SSNQAAGTPIKKLLAEEMSREIEPKKRSLSVIARLMGLDGLPTQ-QLSQKQQKRSSENVQ  121

Query  751   SAKGTPLNNFHHRSGSLDTQMECEFYQYPEQNECKDVYEVWQNRHDMNSMRSKSPQM-GR  927
                 T       +  S             E+ E KDV+EV     D + M + S  + G 
Sbjct  122   RIALTE----KGQRSSTSCSRRSSRKSSKEEQEFKDVFEV----SDTSKMENSSHSLQGS  173

Query  928   CNETSTD-KVAFVRQKFIEAKCLSLDEKCHHSRQFQDALEVLSSNTDLVLKFLQEPKPML  1104
              N   TD ++AF++QKF++A+ LS DEK H  ++F D ++ L SN DL+LKFL++P  + 
Sbjct  174   ANSKLTDAEMAFIQQKFMDARRLSADEKFHDLKEFHDVIDDLESNKDLLLKFLEQPDSLF  233

Query  1105  SEHIYNLQSIPAPSETKRITVLKPSKMVD  1191
             ++H+++LQ+  + S  + I+ +KPS+ ++
Sbjct  234   TKHLHDLQTTTSQSHCRHISDMKPSRALE  262



>ref|XP_010684191.1| PREDICTED: uncharacterized protein LOC104898782 [Beta vulgaris 
subsp. vulgaris]
Length=988

 Score =   124 bits (310),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 73/210 (35%), Positives = 122/210 (58%), Gaps = 22/210 (10%)
 Frame = +1

Query  529   IEDKEIVSELRRNNSKMKANGTPMKMLIAEEMSKDMASKHNPPSVVAKLMGLDGFPSQLP  708
              E+ ++  +L R+++++++ G  MK L+A+EM+K+  S    PS++A+LMGLDG P+ L 
Sbjct  64    FEENQLPFDLGRSSAELQS-GITMKKLLADEMTKETESGRRSPSIIARLMGLDGLPAPLN  122

Query  709   VSTAQRNYSGRNAQSAKGT-------PLNNFHHRSGSLDTQMECEFYQYPEQNECKDVYE  867
              +  Q+  S  + + +  +       P +N  HR                 Q + KDVYE
Sbjct  123   TNKKQKRLSDSHQRGSSSSGFQKNIKPHDNRSHRKNGTG------------QQQFKDVYE  170

Query  868   VWQNRHDMNSMRSKSPQMGRCNETSTDKVAFVRQKFIEAKCLSLDEKCHHSRQFQDALEV  1047
             V   R ++ + R+ +        +S D++ F+RQKF++ K  S DEK  HS++F DA+E+
Sbjct  171   V-VGRSNVET-RNNTSHSSSNRISSEDEIRFIRQKFMDVKRFSTDEKLQHSKEFHDAIEL  228

Query  1048  LSSNTDLVLKFLQEPKPMLSEHIYNLQSIP  1137
             L SN DL+LKFLQEP  M S+H+++L ++P
Sbjct  229   LDSNRDLLLKFLQEPDSMFSKHLHDLHNVP  258



>ref|XP_010481813.1| PREDICTED: uncharacterized protein LOC104760567 isoform X2 [Camelina 
sativa]
Length=754

 Score =   122 bits (307),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 77/199 (39%), Positives = 107/199 (54%), Gaps = 42/199 (21%)
 Frame = +1

Query  598   MKMLIAEEMSKDMASKHNPPSVVAKLMGLDGFPSQLPVSTAQRNYSGRNAQSAKGTPLNN  777
             MKML+ +EMSK++  K +  ++VAKLMGLD FP   P            + S+K     +
Sbjct  1     MKMLLEQEMSKEVDIKLSSTNLVAKLMGLDSFPQTQPAP---------RSNSSKPRLKRS  51

Query  778   FHHRSGSLDTQMECEFYQYPEQNECKDVYEVWQNRHDMNSMRSKSPQMGRCNETSTDKVA  957
               H                    E KDVYE+WQ            P  G     S   + 
Sbjct  52    LSH-------------------GEYKDVYEIWQK-----------PSNG-VEGLSKKHMD  80

Query  958   FVRQKFIEAKCLSLDEKCHHSRQFQDALEVLSSNTDLVLKFLQEPKPMLSEHIYNLQSI-  1134
              VR+KF+EAK L  D+K  HS++FQ+A+EVLSSN +L L+FLQE   + S H++N +SI 
Sbjct  81    IVREKFLEAKRLVTDDKLRHSKEFQEAMEVLSSNKELFLEFLQESNNLFSHHLHNFESIA  140

Query  1135  -PAPSETKRITVLKPSKMV  1188
              P P ++KRIT+LKPSK++
Sbjct  141   PPTPEKSKRITILKPSKII  159



>ref|XP_010235705.1| PREDICTED: uncharacterized protein LOC100838495 [Brachypodium 
distachyon]
Length=896

 Score =   123 bits (308),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 81/211 (38%), Positives = 122/211 (58%), Gaps = 4/211 (2%)
 Frame = +1

Query  565   NNSKMKANGTPMKMLIAEEMSKDMASKHNPPSVVAKLMGLD-GFPSQLPV-STAQRNYSG  738
             N S  K+N T +KML+A+E SK++ SK NP SVVA+LMGL+  FP++ PV   A+R++  
Sbjct  35    NFSSTKSNTTSLKMLLAKETSKEVESKSNPRSVVARLMGLEEDFPAKEPVLHHAKRDFR-  93

Query  739   RNAQSAKGTPLNNFHHRSGSLDTQMECEFYQYPEQNECKDVYEVWQNRHDMNSMRSKSPQ  918
             R+  S +         +  S+ + M+   +   E  EC  VYE  + +  M+  + +S Q
Sbjct  94    RSKSSNRLKETKKALQQHDSIQSVMKV-IHPSCETIECNGVYEGCEEKARMSLFQDQSSQ  152

Query  919   MGRCNETSTDKVAFVRQKFIEAKCLSLDEKCHHSRQFQDALEVLSSNTDLVLKFLQEPKP  1098
              GR +E  +  +  V +KF E KCL+ +E   HS   Q++LEV+SS  DL L+F  E   
Sbjct  153   RGRYSENRSGTMNIVPEKFREGKCLATEENLLHSGGLQESLEVVSSEKDLFLRFRDERNF  212

Query  1099  MLSEHIYNLQSIPAPSETKRITVLKPSKMVD  1191
             +L   +  L + PA  +TKRITVLKP + V+
Sbjct  213   ILQRRMSGLHTTPASPQTKRITVLKPMRSVE  243



>ref|XP_004953111.1| PREDICTED: uncharacterized protein LOC101762070 isoform X2 [Setaria 
italica]
Length=913

 Score =   122 bits (307),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 75/210 (36%), Positives = 121/210 (58%), Gaps = 4/210 (2%)
 Frame = +1

Query  565   NNSKMKANGTPMKMLIAEEMSKDMASKHNPPSVVAKLMGLD-GFPSQLPVSTAQRNYSGR  741
             ++S  K+N T +KML+ +EM+K++ SK  PPSV+ +LMGL+   P++ P+    +    R
Sbjct  41    SSSSRKSNATSLKMLLEKEMAKEVESKRRPPSVIGRLMGLEEDLPTEEPIVCHTKIDLTR  100

Query  742   NAQSAKGTPLNNFHHRSGSLDTQMECEFYQYPEQNECKDVYEVWQNRHDMNSMRSKSPQM  921
             +  ++  T     H +S  L TQ   +     E  E  DVYEV ++R   +  + ++   
Sbjct  101   DLNASNKTLHGKEHRQSIRLKTQ---DHQSRDETIEYNDVYEVSEHRSGTSCFQDQTSLK  157

Query  922   GRCNETSTDKVAFVRQKFIEAKCLSLDEKCHHSRQFQDALEVLSSNTDLVLKFLQEPKPM  1101
             G  +ET + +   V++KFI+ KC +++EK  H+++ Q+ALEV  SN DL L+  +E    
Sbjct  158   GWPSETKSKQFDIVQEKFIKPKCFAMEEKLLHTKELQEALEVPHSNKDLFLQNPEEHNSS  217

Query  1102  LSEHIYNLQSIPAPSETKRITVLKPSKMVD  1191
              S  +  L +  AP +TKRITVLKP K V+
Sbjct  218   FSRQLNGLHTSQAPPQTKRITVLKPIKSVE  247



>ref|XP_004953110.1| PREDICTED: uncharacterized protein LOC101762070 isoform X1 [Setaria 
italica]
Length=914

 Score =   122 bits (307),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 75/210 (36%), Positives = 121/210 (58%), Gaps = 4/210 (2%)
 Frame = +1

Query  565   NNSKMKANGTPMKMLIAEEMSKDMASKHNPPSVVAKLMGLD-GFPSQLPVSTAQRNYSGR  741
             ++S  K+N T +KML+ +EM+K++ SK  PPSV+ +LMGL+   P++ P+    +    R
Sbjct  41    SSSSRKSNATSLKMLLEKEMAKEVESKRRPPSVIGRLMGLEEDLPTEEPIVCHTKIDLTR  100

Query  742   NAQSAKGTPLNNFHHRSGSLDTQMECEFYQYPEQNECKDVYEVWQNRHDMNSMRSKSPQM  921
             +  ++  T     H +S  L TQ   +     E  E  DVYEV ++R   +  + ++   
Sbjct  101   DLNASNKTLHGKEHRQSIRLKTQ---DHQSRDETIEYNDVYEVSEHRSGTSCFQDQTSLK  157

Query  922   GRCNETSTDKVAFVRQKFIEAKCLSLDEKCHHSRQFQDALEVLSSNTDLVLKFLQEPKPM  1101
             G  +ET + +   V++KFI+ KC +++EK  H+++ Q+ALEV  SN DL L+  +E    
Sbjct  158   GWPSETKSKQFDIVQEKFIKPKCFAMEEKLLHTKELQEALEVPHSNKDLFLQNPEEHNSS  217

Query  1102  LSEHIYNLQSIPAPSETKRITVLKPSKMVD  1191
              S  +  L +  AP +TKRITVLKP K V+
Sbjct  218   FSRQLNGLHTSQAPPQTKRITVLKPIKSVE  247



>gb|KFK34605.1| hypothetical protein AALP_AA5G167300 [Arabis alpina]
Length=913

 Score =   122 bits (306),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 77/190 (41%), Positives = 112/190 (59%), Gaps = 18/190 (9%)
 Frame = +1

Query  583   ANGTPMKMLIAEEMSKDMASKHNPPSVVAKLMGLDGFPSQLPVSTA--QRNYSGRNAQSA  756
             + G PMK L+A+EMSK   SK   PS++A+LMGLD  P   P+S++  Q+N S  N Q  
Sbjct  51    STGVPMKSLLAQEMSKQKESKKRSPSIIARLMGLDVLP---PLSSSHRQQNKSVENHQGR  107

Query  757   KGTPLNNFHHRSGSLDTQMECEFYQYPEQNECKDVYEVWQNRHDMNSMRSKS-PQMGRCN  933
              G    ++     SL    + E        + KDV+EV   +    + R+++    GR N
Sbjct  108   SGGGGCSYDGNKSSLRRSSKNE-------EKFKDVFEVLDAK---KAERNRNLYHQGRVN  157

Query  934   ET--STDKVAFVRQKFIEAKCLSLDEKCHHSRQFQDALEVLSSNTDLVLKFLQEPKPMLS  1107
                 +  ++AF+RQKF+EAK LS DE+  HS++F DALE L SN DL+LKFLQ P  + +
Sbjct  158   AANLTQAEMAFIRQKFMEAKRLSTDERFRHSKEFNDALEALDSNKDLLLKFLQHPDSLFT  217

Query  1108  EHIYNLQSIP  1137
             +H+++LQS P
Sbjct  218   KHLHDLQSTP  227



>ref|XP_008794407.1| PREDICTED: uncharacterized protein LOC103710467 [Phoenix dactylifera]
Length=1013

 Score =   122 bits (306),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 80/220 (36%), Positives = 116/220 (53%), Gaps = 11/220 (5%)
 Frame = +1

Query  529   IEDKEIVSELRRNNSKMKANGTPMKMLIAEEMSKDMASKHNPPSVVAKLMGLDGFPSQLP  708
             IE+  +  E RR++   K N TPMKML+ EEMSK++ ++H  PSV+A+LMGLD  P    
Sbjct  64    IEENSVALEFRRSSCN-KDNSTPMKMLLDEEMSKEIETRHPSPSVIARLMGLDTLPPPQI  122

Query  709   VSTAQRNYSG--RNAQSAKGTPLNNFHHRSGSLDTQMECEFYQYPEQNECKDVYEVWQNR  882
             V   ++N  G  R A S        F  +    +    C   +  E  E KDV+EV +  
Sbjct  123   VHKQKKNMDGCFRTASSV------GFQEKCACSEDH-SCR-NRTDEHQEFKDVFEVMETS  174

Query  883   HDMNSMRSKSPQMGRCNETSTDKVAFVRQKFIEAKCLSLDEKCHHSRQFQDALEVLSSNT  1062
                       P+    +  S   +  +RQKF++AK LS DE   +S++F DALEVL SN 
Sbjct  175   KVKRHKNQPVPKRMVSSNRSDADLDLIRQKFMDAKRLSTDEVLQNSKEFNDALEVLDSNK  234

Query  1063  DLVLKFLQEPKPMLSEHIYNLQSIPAPSETKRITVLKPSK  1182
             DL L+FLQ P  + ++H+++L      S    IT+L+  K
Sbjct  235   DLFLEFLQGPDSLFTKHLHDLNCALPSSHASHITILRSCK  274



>ref|XP_006480729.1| PREDICTED: uncharacterized protein LOC102617097 [Citrus sinensis]
Length=989

 Score =   122 bits (306),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 76/203 (37%), Positives = 117/203 (58%), Gaps = 9/203 (4%)
 Frame = +1

Query  571   SKMKANGTPMKMLIAEEMSKDMASKHNPPSVVAKLMGLDGFPSQLPVSTAQRNYSGRNAQ  750
             S  +A  TPMK L+A+EMS++  SK   PSV+A+LMG DG    LP + A      R+A+
Sbjct  64    SSKQAVRTPMKKLLAKEMSRETESKRRSPSVIARLMGFDG----LPATQAAHKQHKRSAE  119

Query  751   SAKGTPLNNFHHRSGSLDTQMECEFYQYPEQNECKDVYEVWQNRHDMNSMRSKSPQMGRC  930
             + +    +    +  +  +          E+ E KDV+EV     D + M + S Q    
Sbjct  120   NNQPWTASAEKAQRSTTSSGRRSFRKSSKEEQEFKDVFEVL----DASKMETCSKQESTN  175

Query  931   NETSTDKVAFVRQKFIEAKCLSLDEKCHHSRQFQDALEVLSSNTDLVLKFLQEPKPMLSE  1110
             ++ S  ++ F+RQKF+EAK LS DE+   S++FQDALEVL SN DL+LKFLQ+P  + ++
Sbjct  176   SKLSEAEMVFIRQKFMEAKRLSTDERFQDSKEFQDALEVLDSNKDLLLKFLQQPDSLFTK  235

Query  1111  HIYNLQSIPAPSETKRITVLKPS  1179
             H+++L +  + S    I+ + PS
Sbjct  236   HLHDLGA-SSQSHCGHISAMTPS  257



>gb|KDO44111.1| hypothetical protein CISIN_1g002351mg [Citrus sinensis]
Length=932

 Score =   121 bits (304),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 72/185 (39%), Positives = 109/185 (59%), Gaps = 8/185 (4%)
 Frame = +1

Query  571   SKMKANGTPMKMLIAEEMSKDMASKHNPPSVVAKLMGLDGFPSQLPVSTAQRNYSGRNAQ  750
             S  +A  TPMK L+A+EMS++  SK   PSV+A+LMG DG    LP + A      R+A+
Sbjct  8     SSKQAVRTPMKKLLAKEMSRETESKRRSPSVIARLMGFDG----LPATQAAHKQHKRSAE  63

Query  751   SAKGTPLNNFHHRSGSLDTQMECEFYQYPEQNECKDVYEVWQNRHDMNSMRSKSPQMGRC  930
             + +    +    +  +  +          E+ E KDV+EV     D + M + S Q    
Sbjct  64    NNQPWTASAEKAQRSTTSSGRRSFRKSSKEEQEFKDVFEVL----DASKMETCSKQESTN  119

Query  931   NETSTDKVAFVRQKFIEAKCLSLDEKCHHSRQFQDALEVLSSNTDLVLKFLQEPKPMLSE  1110
             ++ S  ++ F+RQKF+EAK LS DE+   S++FQDALEVL SN DL+LKFLQ+P  + ++
Sbjct  120   SKLSEAEMVFIRQKFMEAKRLSTDERFQDSKEFQDALEVLDSNKDLLLKFLQQPDSLFTK  179

Query  1111  HIYNL  1125
             H+++L
Sbjct  180   HLHDL  184



>emb|CAE04715.1| OSJNBa0043L24.3 [Oryza sativa Japonica Group]
 emb|CAE05684.1| OSJNBb0002J11.11 [Oryza sativa Japonica Group]
Length=875

 Score =   121 bits (303),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 81/197 (41%), Positives = 110/197 (56%), Gaps = 7/197 (4%)
 Frame = +1

Query  619   EMSKDMASKHNPPSVVAKLMGLDG-FPSQLPVSTAQRNYSGRNAQSAKGTPLNNFHHRSG  795
             EMSK + SK  PPSVVA+LMGLD   P++ P   + R    R+         N    +  
Sbjct  2     EMSKGVESKRKPPSVVARLMGLDDDLPAKEPALQSSRRNLRRSHSLDNLAATNRPQQQQE  61

Query  796   SLDTQMECEFYQYPEQN-ECKDVYEVWQN---RHDMNSMRSKSPQMGRCNETSTDKVAFV  963
                ++     +  P++  E KDVYEV ++   RH +  +    P        S  ++  V
Sbjct  62    QHYSRTTPNIHIGPKETVEFKDVYEVSEDPLKRHHI--LGQNFPWERSSGNKSDTRIEAV  119

Query  964   RQKFIEAKCLSLDEKCHHSRQFQDALEVLSSNTDLVLKFLQEPKPMLSEHIYNLQSIPAP  1143
             RQKF+EAK L+ +E   HS+QFQ+ALEVLSSN +L LKFL+EP P   + +  L + PAP
Sbjct  120   RQKFMEAKRLATNENLIHSKQFQEALEVLSSNRELFLKFLEEPSPAFLKQLDGLDTTPAP  179

Query  1144  SETKRITVLKPSKMVDN  1194
               TKRITVLKP K V+N
Sbjct  180   PPTKRITVLKPIKSVEN  196



>emb|CDY30861.1| BnaC04g27160D [Brassica napus]
Length=877

 Score =   121 bits (303),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 73/192 (38%), Positives = 110/192 (57%), Gaps = 22/192 (11%)
 Frame = +1

Query  580   KANGTPMKMLIAEEMSKDMASKHNPPSVVAKLMGLDGFPSQLPVSTAQRNYSGRNAQSAK  759
             +  G PMK L+A+EMSK   SK   PS++A+LMGLD  PS  P S++ R +     Q  +
Sbjct  60    QGTGIPMKSLLAQEMSKQKESKKRSPSIIARLMGLDVLPS--PQSSSHRQHKSVENQKKQ  117

Query  760   GTPLNNFHHRSGSLDTQMECEFYQYPEQNECKDVYEVWQNRHDMNSMRSKSPQ----MGR  927
             G        RSG   +           + + KDV+EV      +++ +S S +     G+
Sbjct  118   G--------RSGEGSSYKSLARSSKGGEPKFKDVFEV------LDAKKSASNRNLYHQGK  163

Query  928   CNET--STDKVAFVRQKFIEAKCLSLDEKCHHSRQFQDALEVLSSNTDLVLKFLQEPKPM  1101
              N    +  ++ F+RQKF+EAK LS D+K  HS++F DALE L SN DL+LKFLQ+P  +
Sbjct  164   VNAANLTQAEMGFIRQKFMEAKRLSTDDKLRHSKEFNDALEALDSNKDLLLKFLQQPDSL  223

Query  1102  LSEHIYNLQSIP  1137
              ++H+++LQ+ P
Sbjct  224   FTKHLHDLQTTP  235



>ref|XP_010920736.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC105044504 
[Elaeis guineensis]
Length=1012

 Score =   121 bits (304),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 84/225 (37%), Positives = 119/225 (53%), Gaps = 24/225 (11%)
 Frame = +1

Query  532   EDKEIVSELRRNNSKMKANGTPMKMLIAEEMSKDMASKHNPPSVVAKLMGLDGFPSQLPV  711
             E+  +  E R+++ K KAN TPMK LI E+MSK+M ++H  PSV+A+LMGLD  P Q+  
Sbjct  65    EENSVALEFRQSSCK-KANSTPMKTLIDEDMSKEMETRHPSPSVIARLMGLDTLPPQMVH  123

Query  712   STAQRNYSGRNAQSAKG----TPLNNFHHRSGSLDTQMECEFYQYPEQNECKDVYEVWQN  879
                +   S     S+ G       +  H    S+D           E  E KDV+EV   
Sbjct  124   KQKKNKDSCFETASSVGFQEKCACSEDHSCXNSID-----------EHQEFKDVFEVMDT  172

Query  880   ----RHDMNSMRSKSPQMGRCNETSTDKVAFVRQKFIEAKCLSLDEKCHHSRQFQDALEV  1047
                 RH    +R +   M     +  D +  +RQKF++AK LS DE   +S++F DALEV
Sbjct  173   SKVKRHKNQPVRKR---MVSSKGSDAD-MDLIRQKFMDAKRLSTDEVLQNSKEFNDALEV  228

Query  1048  LSSNTDLVLKFLQEPKPMLSEHIYNLQSIPAPSETKRITVLKPSK  1182
             L SN DL L+FLQ P  + ++H+++L      S    IT+LK SK
Sbjct  229   LDSNKDLFLEFLQGPDSLFTKHLHDLNHALPSSHASHITILKSSK  273



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3340643513752