BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig13357

Length=702
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_004242663.1|  PREDICTED: preprotein translocase subunit SC...    244   1e-73   Solanum lycopersicum
ref|XP_006343553.1|  PREDICTED: preprotein translocase subunit SC...    234   1e-69   Solanum tuberosum [potatoes]
ref|XP_010109386.1|  Preprotein translocase subunit SCY1                223   1e-66   
ref|XP_009774576.1|  PREDICTED: preprotein translocase subunit SC...    222   2e-65   Nicotiana sylvestris
ref|XP_006453462.1|  hypothetical protein CICLE_v10007941mg             223   2e-65   Citrus clementina [clementine]
ref|XP_009774575.1|  PREDICTED: preprotein translocase subunit SC...    223   2e-65   Nicotiana sylvestris
gb|KDO62389.1|  hypothetical protein CISIN_1g009193mg                   223   2e-65   Citrus sinensis [apfelsine]
gb|KJB53848.1|  hypothetical protein B456_009G007500                    218   3e-65   Gossypium raimondii
gb|KJB53847.1|  hypothetical protein B456_009G007500                    217   2e-64   Gossypium raimondii
gb|KJB53846.1|  hypothetical protein B456_009G007500                    219   9e-64   Gossypium raimondii
gb|KDO62390.1|  hypothetical protein CISIN_1g009193mg                   213   5e-62   Citrus sinensis [apfelsine]
ref|XP_010268356.1|  PREDICTED: preprotein translocase subunit SC...    213   8e-62   Nelumbo nucifera [Indian lotus]
ref|XP_008443797.1|  PREDICTED: preprotein translocase subunit SC...    213   9e-62   
emb|CDP02922.1|  unnamed protein product                                213   9e-62   Coffea canephora [robusta coffee]
ref|XP_007138413.1|  hypothetical protein PHAVU_009G206700g             212   2e-61   Phaseolus vulgaris [French bean]
ref|XP_007014009.1|  SECY isoform 2                                     208   3e-61   
ref|XP_008223538.1|  PREDICTED: preprotein translocase subunit SC...    212   3e-61   Prunus mume [ume]
ref|XP_011018127.1|  PREDICTED: preprotein translocase subunit SC...    211   3e-61   Populus euphratica
ref|XP_002262945.2|  PREDICTED: preprotein translocase subunit SC...    211   5e-61   Vitis vinifera
ref|XP_007223081.1|  hypothetical protein PRUPE_ppa003762mg             211   6e-61   Prunus persica
ref|XP_011018126.1|  PREDICTED: preprotein translocase subunit SC...    211   7e-61   Populus euphratica
ref|XP_002324497.2|  hypothetical protein POPTR_0018s10650g             211   8e-61   Populus trichocarpa [western balsam poplar]
ref|XP_010525749.1|  PREDICTED: preprotein translocase subunit SC...    210   1e-60   Tarenaya hassleriana [spider flower]
ref|XP_006372102.1|  hypothetical protein POPTR_0018s10650g             210   2e-60   
ref|XP_007138412.1|  hypothetical protein PHAVU_009G206700g             209   2e-60   Phaseolus vulgaris [French bean]
ref|XP_006582101.1|  PREDICTED: preprotein translocase subunit SC...    209   3e-60   Glycine max [soybeans]
ref|XP_003527188.1|  PREDICTED: preprotein translocase subunit SC...    209   3e-60   Glycine max [soybeans]
ref|XP_007014008.1|  SECY isoform 1                                     209   4e-60   
ref|XP_002533181.1|  protein translocase secy subunit, putative         209   5e-60   Ricinus communis
ref|NP_179461.1|  preprotein translocase subunit secY                   209   6e-60   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004296426.1|  PREDICTED: preprotein translocase subunit SC...    208   6e-60   Fragaria vesca subsp. vesca
gb|AAB60305.1|  SecY homolog; targetted to the thylakoid membrane...    209   6e-60   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004149897.2|  PREDICTED: preprotein translocase subunit SC...    207   1e-59   Cucumis sativus [cucumbers]
gb|KCW81069.1|  hypothetical protein EUGRSUZ_C02439                     203   2e-59   Eucalyptus grandis [rose gum]
gb|KCW81068.1|  hypothetical protein EUGRSUZ_C02439                     203   1e-58   Eucalyptus grandis [rose gum]
ref|XP_009600938.1|  PREDICTED: preprotein translocase subunit SE...    203   2e-58   Nicotiana tomentosiformis
ref|XP_010048699.1|  PREDICTED: preprotein translocase subunit SC...    204   3e-58   Eucalyptus grandis [rose gum]
ref|XP_010928618.1|  PREDICTED: preprotein translocase subunit SC...    204   5e-58   Elaeis guineensis
ref|XP_008789707.1|  PREDICTED: preprotein translocase subunit SE...    203   1e-57   Phoenix dactylifera
ref|XP_012077484.1|  PREDICTED: preprotein translocase subunit SC...    200   1e-57   Jatropha curcas
ref|XP_002309386.2|  hypothetical protein POPTR_0006s18970g             202   2e-57   Populus trichocarpa [western balsam poplar]
gb|KFK40258.1|  hypothetical protein AALP_AA3G350900                    201   3e-57   Arabis alpina [alpine rockcress]
ref|XP_012077483.1|  PREDICTED: preprotein translocase subunit SC...    201   6e-57   Jatropha curcas
emb|CBI24093.3|  unnamed protein product                                201   6e-57   Vitis vinifera
ref|XP_011010036.1|  PREDICTED: preprotein translocase subunit SC...    197   1e-55   Populus euphratica
ref|XP_011010034.1|  PREDICTED: preprotein translocase subunit SC...    197   2e-55   Populus euphratica
ref|XP_002886190.1|  hypothetical protein ARALYDRAFT_480774             197   2e-55   Arabidopsis lyrata subsp. lyrata
ref|XP_009102226.1|  PREDICTED: preprotein translocase subunit SC...    194   3e-54   Brassica rapa
ref|XP_009396241.1|  PREDICTED: preprotein translocase subunit SC...    194   3e-54   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDY49314.1|  BnaA07g01530D                                          193   3e-54   Brassica napus [oilseed rape]
emb|CDY13013.1|  BnaC07g03120D                                          191   2e-53   Brassica napus [oilseed rape]
ref|XP_010656720.1|  PREDICTED: preprotein translocase subunit SE...    190   2e-53   
ref|XP_006409121.1|  hypothetical protein EUTSA_v10022631mg             191   3e-53   Eutrema salsugineum [saltwater cress]
sp|P93690.1|SECY_SPIOL  RecName: Full=Preprotein translocase subu...    189   1e-52   Spinacia oleracea
ref|XP_010414595.1|  PREDICTED: preprotein translocase subunit SC...    189   1e-52   Camelina sativa [gold-of-pleasure]
ref|XP_010489581.1|  PREDICTED: preprotein translocase subunit SC...    189   1e-52   Camelina sativa [gold-of-pleasure]
ref|XP_010467702.1|  PREDICTED: preprotein translocase subunit SC...    189   2e-52   Camelina sativa [gold-of-pleasure]
ref|XP_010687713.1|  PREDICTED: preprotein translocase subunit SE...    187   7e-52   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004514142.1|  PREDICTED: preprotein translocase subunit SE...    185   1e-51   
ref|XP_004514141.1|  PREDICTED: preprotein translocase subunit SE...    185   2e-51   
ref|XP_004514140.1|  PREDICTED: preprotein translocase subunit SE...    185   2e-51   Cicer arietinum [garbanzo]
ref|XP_004514139.1|  PREDICTED: preprotein translocase subunit SE...    185   3e-51   
gb|EYU42460.1|  hypothetical protein MIMGU_mgv1a004013mg                182   4e-50   Erythranthe guttata [common monkey flower]
ref|XP_011069862.1|  PREDICTED: preprotein translocase subunit SC...    181   2e-49   Sesamum indicum [beniseed]
ref|XP_006659975.1|  PREDICTED: preprotein translocase subunit SE...    177   8e-48   
sp|Q9XQU4.1|SECY_PEA  RecName: Full=Preprotein translocase subuni...    174   3e-47   Pisum sativum [garden pea]
ref|XP_003573616.1|  PREDICTED: preprotein translocase subunit SE...    174   3e-47   Brachypodium distachyon [annual false brome]
gb|KEH38065.1|  preprotein translocase subunit SecY                     172   1e-46   Medicago truncatula
gb|EEC83207.1|  hypothetical protein OsI_28473                          174   9e-46   Oryza sativa Indica Group [Indian rice]
ref|XP_011623808.1|  PREDICTED: preprotein translocase subunit SC...    170   1e-45   Amborella trichopoda
gb|ERN07204.1|  hypothetical protein AMTR_s00019p00172430               169   2e-45   Amborella trichopoda
ref|NP_001061381.1|  Os08g0254500                                       169   3e-45   
ref|XP_002445291.1|  hypothetical protein SORBIDRAFT_07g007870          166   5e-44   Sorghum bicolor [broomcorn]
gb|AAB96657.1|  SecY homolog                                            158   2e-42   Zea mays [maize]
gb|EPS66347.1|  hypothetical protein M569_08427                         160   3e-42   Genlisea aurea
ref|NP_001105505.2|  preprotein translocase subunit SECY, chlorop...    159   2e-41   Zea mays [maize]
sp|O63066.1|SECY_MAIZE  RecName: Full=Preprotein translocase subu...    159   2e-41   Zea mays [maize]
gb|AFW56837.1|  chloroplast SecY-1                                      155   3e-40   
gb|KDO62391.1|  hypothetical protein CISIN_1g009193mg                   146   2e-37   Citrus sinensis [apfelsine]
gb|EMS49011.1|  Preprotein translocase subunit secY, chloroplastic      139   6e-35   Triticum urartu
gb|EMT21873.1|  Preprotein translocase subunit secY, chloroplastic      139   2e-34   
ref|XP_002993375.1|  hypothetical protein SELMODRAFT_187415             139   2e-34   
ref|XP_006297673.1|  hypothetical protein CARUB_v10013710mg             137   3e-34   
ref|XP_002972955.1|  hypothetical protein SELMODRAFT_98540              119   6e-28   
gb|EAZ06230.1|  hypothetical protein OsI_28472                          114   6e-27   Oryza sativa Indica Group [Indian rice]
ref|XP_001754986.1|  predicted protein                                  115   5e-26   
ref|XP_005649807.1|  pre protein translocase secY subunit             79.7    1e-13   Coccomyxa subellipsoidea C-169
ref|XP_007512827.1|  preprotein translocase subunit SecY              78.6    3e-13   Bathycoccus prasinos
ref|XP_003078812.1|  SecY homolog; targetted to the thylakoid mem...  78.2    4e-13   
ref|XP_002508181.1|  type II secretory pathway family                 77.4    5e-13   Micromonas commoda
emb|CEF97600.1|  SecY/SEC61-alpha family                              77.0    6e-13   Ostreococcus tauri
gb|AIA21530.1|  preprotein translocase subunit SecY                   76.6    8e-13   Pyropia fucicola
ref|YP_536977.1|  preprotein translocase subunit SecY                 76.6    8e-13   Pyropia yezoensis
gb|ABJ91302.1|  preprotein translocase subunit                        76.6    8e-13   Pyropia yezoensis
ref|XP_002508180.1|  SecY protein                                     77.0    9e-13   Micromonas commoda
gb|AFC39966.1|  preprotein translocase subunit SecY                   76.3    1e-12   Porphyra umbilicalis
ref|YP_007947826.1|  preprotein translocase subunit SecY              76.3    1e-12   Pyropia haitanensis
gb|AIA21324.1|  preprotein translocase subunit SecY                   75.9    1e-12   Pyropia kanakaensis
ref|XP_001417520.1|  IISP family transporter: preprotein transloc...  75.9    1e-12   Ostreococcus lucimarinus CCE9901
ref|YP_009027579.1|  preprotein translocase subunit SecY              75.9    1e-12   Pyropia perforata
ref|WP_015125761.1|  preprotein translocase subunit SecY              73.9    8e-12   Synechococcus sp. PCC 6312
ref|WP_026099036.1|  preprotein translocase subunit SecY              73.6    1e-11   Oscillatoria sp. PCC 10802
ref|WP_015186050.1|  preprotein translocase subunit SecY              73.6    1e-11   Microcoleus sp. PCC 7113
ref|XP_003057705.1|  type II secretory pathway family protein         73.2    1e-11   Micromonas pusilla CCMP1545
ref|WP_040943655.1|  preprotein translocase subunit SecY              73.2    2e-11   
ref|WP_015167576.1|  preprotein translocase subunit SecY              72.4    2e-11   Synechococcus sp. PCC 7502
ref|WP_039889180.1|  preprotein translocase subunit SecY              72.4    3e-11   Leptotrichia hofstadii
gb|EEX73182.1|  preprotein translocase, SecY subunit                  72.4    3e-11   Leptotrichia hofstadii F0254
ref|WP_026745844.1|  preprotein translocase subunit SecY              72.0    3e-11   Leptotrichia hofstadii
ref|WP_023174150.1|  preprotein translocase subunit SecY              72.0    3e-11   Gloeobacter kilaueensis
ref|WP_039901264.1|  preprotein translocase subunit SecY              72.0    3e-11   Leptotrichia sp. oral taxon 879
gb|KIY98619.1|  Preprotein translocase subunit secY                   72.0    3e-11   Monoraphidium neglectum
gb|ERK55426.1|  preprotein translocase, SecY subunit                  72.0    3e-11   Leptotrichia sp. oral taxon 879 str. F0557
ref|WP_011055954.1|  preprotein translocase subunit SecY              72.0    3e-11   Thermosynechococcus
ref|WP_012626780.1|  preprotein translocase subunit SecY              72.0    4e-11   Cyanothece sp. PCC 7425
ref|WP_008275488.1|  preprotein translocase subunit SecY              71.6    5e-11   Cyanothece sp. CCY0110
ref|WP_007311595.1|  preprotein translocase subunit SecY              71.6    5e-11   Crocosphaera watsonii
ref|WP_009543879.1|  MULTISPECIES: preprotein translocase subunit...  71.2    5e-11   Cyanothece
ref|WP_044106041.1|  preprotein translocase subunit SecY              71.2    5e-11   cyanobacterium endosymbiont of Epithemia turgida
emb|CCQ60085.1|  Preprotein translocase secY subunit (TC 3.A.5.1.1)   71.2    5e-11   Crocosphaera watsonii WH 0401
gb|EAM49869.1|  SecY protein                                          71.2    6e-11   Crocosphaera watsonii WH 8501
ref|WP_017659048.1|  preprotein translocase subunit SecY              71.2    7e-11   Geitlerinema sp. PCC 7105
gb|KIJ83480.1|  preprotein translocase subunit SecY                   70.9    7e-11   Scytonema tolypothrichoides VB-61278
gb|ERK53800.1|  preprotein translocase, SecY subunit                  70.9    7e-11   Leptotrichia wadei F0279
ref|WP_009625472.1|  preprotein translocase subunit SecY              70.9    7e-11   Pseudanabaena biceps
ref|WP_018451274.1|  preprotein translocase subunit SecY              70.9    7e-11   Leptotrichia shahii
ref|WP_012806366.1|  preprotein translocase subunit SecY              70.9    7e-11   Leptotrichia buccalis
ref|WP_026079504.1|  preprotein translocase subunit SecY              70.9    7e-11   Spirulina subsalsa
ref|WP_018498266.1|  preprotein translocase subunit SecY              70.9    8e-11   Leptotrichia wadei
ref|WP_026748129.1|  preprotein translocase subunit SecY              70.9    8e-11   Leptotrichia trevisanii
ref|WP_036070397.1|  preprotein translocase subunit SecY              70.9    9e-11   Leptotrichia
gb|AJW30847.1|  Preprotein translocase secY subunit                   70.9    9e-11   Prochlorococcus marinus str. P0903-H212
ref|WP_038654328.1|  preprotein translocase subunit SecY              70.9    9e-11   Prochlorococcus sp. MIT 0801
sp|P38397.1|SECY_PYRSA  RecName: Full=Protein translocase subunit...  70.5    9e-11   Pyrenomonas salina
ref|XP_001691898.1|  preprotein translocase secY subunit              70.9    9e-11   Chlamydomonas reinhardtii
gb|ERL26976.1|  preprotein translocase, SecY subunit                  70.5    1e-10   Leptotrichia sp. oral taxon 225 str. F0581
ref|WP_017291208.1|  preprotein translocase subunit SecY              70.5    1e-10   Leptolyngbya boryana
ref|WP_006807202.1|  preprotein translocase subunit SecY              70.5    1e-10   Leptotrichia goodfellowii
gb|AJO68424.1|  preprotein translocase subunit SecY                   70.5    1e-10   Gracilariopsis lemaneiformis
ref|NP_053907.1|  preprotein translocase subunit SecY                 70.5    1e-10   Porphyra purpurea
ref|WP_024125576.1|  preprotein translocase subunit SecY              70.5    1e-10   Thermosynechococcus sp. NK55a
ref|WP_011141393.1|  preprotein translocase subunit SecY              70.5    1e-10   Gloeobacter violaceus
ref|WP_026101011.1|  preprotein translocase subunit SecY              70.5    1e-10   Synechococcus sp. PCC 7336
ref|WP_036904560.1|  preprotein translocase subunit SecY              70.5    1e-10   Prochlorococcus marinus
ref|WP_036485206.1|  preprotein translocase subunit SecY              70.1    1e-10   Myxosarcina sp. GI1
gb|AJW30821.1|  Preprotein translocase secY subunit                   70.1    1e-10   Prochlorococcus marinus str. P0902-H212
ref|WP_011824503.1|  preprotein translocase subunit SecY              70.1    1e-10   Prochlorococcus marinus
ref|WP_011295455.1|  preprotein translocase subunit SecY              70.1    2e-10   Prochlorococcus marinus
ref|WP_040054591.1|  preprotein translocase subunit SecY              70.1    2e-10   
ref|WP_012954407.1|  preprotein translocase subunit SecY              69.7    2e-10   Candidatus Atelocyanobacterium thalassa
ref|WP_044195108.1|  preprotein translocase subunit SecY              69.7    2e-10   Oscillatoria acuminata
gb|AFY82348.1|  protein translocase subunit secY/sec61 alpha          69.7    2e-10   Oscillatoria acuminata PCC 6304
ref|WP_009767980.1|  preprotein translocase subunit SecY              69.7    2e-10   Oscillatoriales cyanobacterium JSC-12
ref|WP_017314779.1|  preprotein translocase subunit SecY              69.7    2e-10   Mastigocladopsis repens
ref|WP_009782731.1|  MULTISPECIES: preprotein translocase subunit...  69.7    2e-10   Lyngbya
ref|WP_012196211.1|  preprotein translocase subunit SecY              69.3    2e-10   Prochlorococcus marinus
ref|WP_036912676.1|  MULTISPECIES: preprotein translocase subunit...  69.3    2e-10   Prochlorococcus
ref|WP_036900628.1|  preprotein translocase subunit SecY              69.3    2e-10   Prochlorococcus sp. MIT 0601
ref|WP_012593614.1|  preprotein translocase subunit SecY              69.3    3e-10   Cyanothece sp. PCC 8801
ref|WP_012796698.1|  preprotein translocase subunit SecY              69.3    3e-10   Cyanothece sp. PCC 8802
ref|WP_006634983.1|  preprotein translocase subunit SecY              69.3    3e-10   Microcoleus vaginatus
ref|XP_005850454.1|  hypothetical protein CHLNCDRAFT_59612            69.3    3e-10   Chlorella variabilis
ref|WP_009634238.1|  preprotein translocase subunit SecY              69.3    3e-10   Synechocystis sp. PCC 7509
ref|WP_010469295.1|  MULTISPECIES: preprotein translocase subunit...  68.9    3e-10   Acaryochloris
ref|WP_015152284.1|  MULTISPECIES: preprotein translocase subunit...  68.9    3e-10   Cyanobacteria [blue-green bacteria]
ref|WP_035156530.1|  preprotein translocase subunit SecY              68.9    3e-10   Calothrix sp. 336/3
ref|WP_015218380.1|  preprotein translocase subunit SecY              68.9    4e-10   Cyanobacterium aponinum
ref|WP_045054259.1|  preprotein translocase subunit SecY              68.9    4e-10   Aliterella atlantica
ref|YP_002049219.1|  preprotein translocase SecY                      68.9    4e-10   Paulinella chromatophora
ref|WP_007356152.1|  MULTISPECIES: preprotein translocase subunit...  68.6    4e-10   Kamptonema
ref|WP_015178720.1|  preprotein translocase subunit SecY              68.6    5e-10   Oscillatoria nigro-viridis
ref|WP_009455545.1|  MULTISPECIES: preprotein translocase subunit...  68.6    5e-10   Fischerella thermalis
ref|WP_006854810.1|  preprotein translocase subunit SecY              68.2    6e-10   Synechococcus sp. WH 8016
ref|WP_011618384.1|  preprotein translocase subunit SecY              68.2    6e-10   Synechococcus sp. CC9311
ref|WP_019500650.1|  preprotein translocase subunit SecY              68.2    7e-10   Pseudanabaena sp. PCC 6802
ref|WP_015195215.1|  preprotein translocase subunit SecY              68.2    7e-10   Stanieria cyanosphaera
ref|WP_016877824.1|  preprotein translocase subunit SecY              68.2    7e-10   Chlorogloeopsis fritschii
ref|WP_011125843.1|  MULTISPECIES: preprotein translocase subunit...  67.8    7e-10   Prochlorococcus
ref|WP_006618082.1|  preprotein translocase subunit SecY              67.8    8e-10   Arthrospira platensis
ref|WP_006621327.1|  preprotein translocase subunit SecY              67.8    8e-10   Arthrospira
ref|WP_006670293.1|  preprotein translocase subunit SecY              67.8    9e-10   Arthrospira
ref|WP_011131117.1|  preprotein translocase subunit SecY              67.8    9e-10   Prochlorococcus marinus
ref|WP_019508906.1|  preprotein translocase subunit SecY              67.8    9e-10   Pleurocapsa sp. PCC 7319
ref|WP_011826922.1|  preprotein translocase subunit SecY              67.8    1e-09   
ref|WP_011128943.1|  preprotein translocase subunit SecY              67.4    1e-09   Synechococcus sp. WH 8102
ref|WP_015200864.1|  preprotein translocase subunit SecY              67.4    1e-09   Calothrix parietina
ref|WP_019491988.1|  preprotein translocase subunit SecY              67.4    1e-09   Calothrix sp. PCC 7103
ref|WP_036919325.1|  MULTISPECIES: preprotein translocase subunit...  67.4    1e-09   Prochlorococcus
ref|WP_015223443.1|  preprotein translocase subunit SecY              67.0    1e-09   
ref|WP_041036060.1|  preprotein translocase subunit SecY              67.0    1e-09   Tolypothrix campylonemoides
ref|WP_016868075.1|  preprotein translocase subunit SecY              67.0    2e-09   Fischerella muscicola
ref|WP_017310476.1|  MULTISPECIES: preprotein translocase subunit...  67.0    2e-09   Hapalosiphonaceae
ref|WP_026722077.1|  preprotein translocase subunit SecY              66.6    2e-09   Hapalosiphonaceae
ref|WP_016859430.1|  preprotein translocase subunit SecY              66.6    2e-09   Fischerella muscicola
ref|WP_026732526.1|  preprotein translocase subunit SecY              66.6    2e-09   Fischerella sp. PCC 9605
ref|WP_038543118.1|  preprotein translocase subunit SecY              66.6    2e-09   Synechococcus sp. KORDI-100
ref|YP_001293597.1|  preprotein translocase subunit SecY              66.2    2e-09   Rhodomonas salina
ref|WP_015203282.1|  preprotein translocase subunit SecY              66.2    3e-09   Crinalium epipsammum
ref|YP_008144835.1|  protein translocase subunit SecY                 66.2    3e-09   Grateloupia taiwanensis
ref|WP_043694876.1|  preprotein translocase subunit SecY              66.2    3e-09   Synechococcus sp. KORDI-49
ref|WP_009788918.1|  preprotein translocase subunit SecY              66.2    3e-09   Synechococcus sp. BL107
ref|WP_029912331.1|  preprotein translocase subunit SecY              66.2    3e-09   Caulobacter sp. UNC358MFTsu5.1
ref|WP_037217669.1|  preprotein translocase subunit SecY              66.2    3e-09   
ref|WP_026786887.1|  MULTISPECIES: preprotein translocase subunit...  65.9    3e-09   Planktothrix
ref|WP_015129705.1|  preprotein translocase subunit SecY              65.9    3e-09   Calothrix sp. PCC 7507
ref|WP_038556630.1|  preprotein translocase subunit SecY              65.9    3e-09   Synechococcus sp. KORDI-52
gb|AII47686.1|  preprotein translocase subunit SecY                   65.9    3e-09   Synechococcus sp. KORDI-52
ref|WP_013191487.1|  preprotein translocase subunit SecY              65.9    4e-09   Trichormus azollae
ref|WP_012640191.1|  preprotein translocase subunit SecY              65.9    4e-09   Caulobacter vibrioides
ref|WP_006850514.1|  preprotein translocase subunit SecY              65.9    4e-09   Synechococcus sp. WH 8109
ref|WP_011363377.1|  preprotein translocase subunit SecY              65.9    4e-09   Synechococcus sp. CC9605
ref|WP_012285682.1|  preprotein translocase subunit SecY              65.9    4e-09   Caulobacter sp. K31
ref|WP_010919147.1|  preprotein translocase subunit SecY              65.9    4e-09   Caulobacter vibrioides
ref|WP_026222368.1|  preprotein translocase subunit SecY              65.9    4e-09   filamentous cyanobacterium ESFC-1
ref|WP_035080009.1|  preprotein translocase subunit SecY              65.9    4e-09   Caulobacter henricii
ref|WP_018061133.1|  MULTISPECIES: preprotein translocase subunit...  65.5    4e-09   Caulobacter sp. UNC279MFTsu5.1
ref|WP_011244193.1|  MULTISPECIES: protein translocase subunit SecY   65.5    4e-09   Synechococcus
ref|WP_008191183.1|  preprotein translocase subunit SecY              65.5    5e-09   Moorea producens
ref|WP_028041099.1|  preprotein translocase subunit SecY              65.5    5e-09   Caulobacter sp. URHA0033
ref|WP_011360727.1|  preprotein translocase subunit SecY              65.5    5e-09   Synechococcus sp. CC9902
ref|WP_029956127.1|  preprotein translocase subunit SecY              61.6    5e-09   
ref|WP_006512308.1|  preprotein translocase subunit SecY              65.5    6e-09   Xenococcus sp. PCC 7305
ref|WP_019477690.1|  preprotein translocase subunit SecY              65.1    6e-09   
ref|WP_010871961.1|  protein translocase subunit SecY                 65.1    6e-09   Synechocystis
ref|WP_036922394.1|  preprotein translocase subunit SecY              65.1    6e-09   
ref|WP_028947562.1|  preprotein translocase subunit SecY              65.1    6e-09   Synechocystis sp. PCC 6714
ref|WP_019477844.1|  preprotein translocase subunit SecY              65.1    6e-09   
ref|WP_013324971.1|  preprotein translocase subunit SecY              65.1    7e-09   Cyanothece sp. PCC 7822
ref|WP_029635490.1|  preprotein translocase subunit SecY [            65.1    7e-09   [Scytonema hofmanni] UTEX B 1581
ref|WP_006276972.1|  preprotein translocase subunit SecY              65.1    7e-09   Cylindrospermopsis
ref|WP_015208454.1|  preprotein translocase subunit SecY              64.7    8e-09   Cylindrospermum stagnale
ref|WP_008225915.1|  preprotein translocase subunit SecY              64.7    8e-09   Richelia intracellularis
ref|WP_015118733.1|  preprotein translocase subunit SecY              64.7    9e-09   Rivularia sp. PCC 7116
gb|AHF23510.1|  preprotein translocase SecY                           64.7    1e-08   uncultured Phormidium sp.
ref|NP_050786.1|  preprotein translocase subunit SecY                 64.7    1e-08   Guillardia theta
ref|WP_025947011.1|  preprotein translocase subunit SecY              64.7    1e-08   
ref|WP_015215929.1|  preprotein translocase subunit SecY              64.3    1e-08   Anabaena cylindrica
ref|WP_028085243.1|  preprotein translocase subunit SecY              64.3    1e-08   Dolichospermum circinale
ref|WP_027402089.1|  preprotein translocase subunit SecY              64.3    1e-08   Nostocales
ref|WP_016953009.1|  preprotein translocase subunit SecY              63.9    1e-08   Anabaena sp. PCC 7108
ref|WP_026797654.1|  MULTISPECIES: preprotein translocase subunit...  63.9    1e-08   Planktothrix
ref|WP_009452516.1|  preprotein translocase subunit SecY              63.9    2e-08   Nitratireductor indicus
ref|XP_002949456.1|  hypothetical protein VOLCADRAFT_104339           63.9    2e-08   Volvox carteri f. nagariensis
ref|WP_015079195.1|  preprotein translocase subunit SecY              63.9    2e-08   Anabaena sp. 90
ref|WP_029087824.1|  preprotein translocase subunit SecY              63.9    2e-08   Brevundimonas aveniformis
ref|WP_013909573.1|  preprotein translocase subunit SecY              63.5    2e-08   Thermodesulfobacterium geofontis
ref|WP_028953619.1|  preprotein translocase subunit SecY              63.5    2e-08   Synechococcus sp. CC9616
ref|WP_039754631.1|  preprotein translocase subunit SecY              63.5    2e-08   
ref|WP_045870357.1|  preprotein translocase subunit SecY              63.5    2e-08   Nostocales
ref|WP_006515897.1|  preprotein translocase subunit SecY              63.5    2e-08   Leptolyngbya sp. PCC 7375
ref|WP_023071146.1|  preprotein translocase subunit SecY              63.5    2e-08   Leptolyngbya sp. Heron Island J
ref|WP_015187424.1|  preprotein translocase subunit SecY              63.5    2e-08   Gloeocapsa sp. PCC 7428
ref|WP_007662711.1|  preprotein translocase subunit SecY              63.5    2e-08   Caulobacter sp. AP07
ref|WP_027843047.1|  preprotein translocase subunit SecY              63.5    2e-08   Mastigocoleus testarum
ref|WP_007066383.1|  preprotein translocase subunit SecY              63.5    2e-08   Fulvimarina pelagi
ref|WP_009344496.1|  preprotein translocase subunit SecY              63.5    2e-08   Aphanizomenonaceae
ref|WP_028089022.1|  preprotein translocase subunit SecY              63.2    3e-08   Dolichospermum circinale
ref|YP_007878212.1|  preprotein translocase subunit SecY              63.2    3e-08   Calliarthron tuberculosum
ref|WP_015170866.1|  preprotein translocase subunit SecY              63.2    3e-08   Geitlerinema sp. PCC 7407
ref|WP_024351698.1|  preprotein translocase subunit SecY              63.2    3e-08   Aurantimonas coralicida
ref|WP_038055026.1|  preprotein translocase subunit SecY              63.2    3e-08   Thermodesulfobacterium hydrogeniphilum
ref|WP_009209716.1|  preprotein translocase subunit SecY              63.2    3e-08   Aurantimonas manganoxydans
gb|ACZ01718.1|  preprotein translocase, SecY subunit                  63.2    3e-08   Streptobacillus moniliformis DSM 12112
ref|WP_041794572.1|  preprotein translocase subunit SecY              63.2    3e-08   
ref|WP_011434170.1|  preprotein translocase subunit SecY              63.2    3e-08   Synechococcus sp. JA-2-3B'a(2-13)
ref|WP_015141081.1|  preprotein translocase subunit SecY              63.2    3e-08   Nostoc sp. PCC 7524
ref|WP_036002390.1|  preprotein translocase subunit SecY              62.8    3e-08   [Leptolyngbya] sp. JSC-1
ref|WP_011932335.1|  preprotein translocase subunit SecY              62.8    3e-08   Synechococcus sp. WH 7803
ref|WP_028841360.1|  preprotein translocase subunit SecY              62.8    3e-08   Thermodesulfobacterium hveragerdense
ref|WP_006042223.1|  preprotein translocase subunit SecY              62.8    4e-08   Synechococcus sp. WH 7805
ref|WP_029978677.1|  preprotein translocase subunit SecY              62.0    4e-08   
ref|WP_013078661.1|  preprotein translocase subunit SecY              62.8    4e-08   Caulobacter segnis
ref|WP_043920688.1|  preprotein translocase subunit SecY              62.8    4e-08   Jannaschia aquimarina
gb|EKE02274.1|  hypothetical protein ACD_20C00402G0004                62.8    4e-08   uncultured bacterium
ref|WP_038062556.1|  preprotein translocase subunit SecY              62.8    4e-08   Thermodesulfobacterium commune
ref|WP_012410707.1|  preprotein translocase subunit SecY              62.8    4e-08   Nostoc punctiforme
ref|WP_024353164.1|  preprotein translocase subunit SecY              62.8    5e-08   Brevundimonas
ref|WP_025974776.1|  preprotein translocase subunit SecY              62.8    5e-08   
ref|WP_035285405.1|  preprotein translocase subunit SecY              62.8    5e-08   Brevundimonas diminuta
ref|WP_025938704.1|  preprotein translocase subunit SecY              62.4    5e-08   
ref|WP_011863646.1|  preprotein translocase subunit SecY              62.4    5e-08   
ref|WP_013908087.1|  preprotein translocase subunit SecY              62.4    5e-08   
ref|WP_022854358.1|  preprotein translocase subunit SecY              62.4    5e-08   
ref|WP_032525063.1|  preprotein translocase subunit SecY              62.4    5e-08   
ref|WP_025942578.1|  MULTISPECIES: preprotein translocase subunit...  62.4    5e-08   
ref|WP_025978147.1|  preprotein translocase subunit SecY              62.4    5e-08   
ref|WP_032516064.1|  preprotein translocase subunit SecY              62.4    5e-08   
ref|WP_025962652.1|  preprotein translocase subunit SecY              62.4    5e-08   
ref|WP_025923600.1|  preprotein translocase subunit SecY              62.4    5e-08   
ref|WP_025975158.1|  preprotein translocase subunit SecY              62.4    5e-08   
ref|WP_025946456.1|  preprotein translocase subunit SecY              62.4    5e-08   
ref|WP_025944904.1|  preprotein translocase subunit SecY              62.4    5e-08   
ref|WP_025934031.1|  MULTISPECIES: preprotein translocase subunit...  62.4    5e-08   
ref|WP_029075453.1|  preprotein translocase subunit SecY              62.4    5e-08   
ref|WP_032522000.1|  preprotein translocase subunit SecY              62.4    5e-08   
ref|WP_042851081.1|  preprotein translocase subunit SecY              62.4    5e-08   
ref|WP_025968327.1|  preprotein translocase subunit SecY              62.4    5e-08   
ref|WP_025965033.1|  preprotein translocase subunit SecY              62.4    5e-08   
ref|WP_002806005.1|  preprotein translocase subunit SecY              62.4    5e-08   
ref|WP_018184924.1|  preprotein translocase subunit SecY              62.4    5e-08   
ref|WP_025956994.1|  MULTISPECIES: preprotein translocase subunit...  62.4    5e-08   
gb|EHO16366.1|  hypothetical protein HMPREF9466_02992                 59.7    5e-08   
ref|WP_032513765.1|  preprotein translocase subunit SecY              62.4    5e-08   
ref|WP_025960085.1|  MULTISPECIES: preprotein translocase subunit...  62.4    5e-08   
ref|WP_025889479.1|  MULTISPECIES: preprotein translocase subunit...  62.4    5e-08   
gb|EKY30127.1|  preprotein translocase, SecY subunit                  62.4    5e-08   
ref|WP_003164387.1|  preprotein translocase subunit SecY              62.4    5e-08   
ref|WP_011377175.1|  preprotein translocase subunit SecY              62.4    5e-08   
ref|WP_025963954.1|  preprotein translocase subunit SecY              62.4    5e-08   
ref|WP_011821020.1|  preprotein translocase subunit SecY              62.4    5e-08   
ref|WP_025961536.1|  preprotein translocase subunit SecY              62.4    5e-08   
ref|WP_025981090.1|  preprotein translocase subunit SecY              62.4    5e-08   
ref|WP_025942061.1|  preprotein translocase subunit SecY              62.4    5e-08   
ref|WP_025930932.1|  preprotein translocase subunit SecY              62.4    5e-08   
ref|WP_025915145.1|  preprotein translocase subunit SecY              62.4    5e-08   
ref|WP_017651211.1|  preprotein translocase subunit SecY              62.4    5e-08   
ref|WP_032520072.1|  preprotein translocase subunit SecY              62.4    5e-08   
ref|WP_025932669.1|  preprotein translocase subunit SecY              62.4    5e-08   
ref|WP_032526259.1|  preprotein translocase subunit SecY              62.4    5e-08   
ref|WP_011133168.1|  preprotein translocase subunit SecY              62.4    5e-08   
ref|WP_025960620.1|  preprotein translocase subunit SecY              62.4    6e-08   
ref|WP_015161731.1|  preprotein translocase subunit SecY              62.4    6e-08   
ref|WP_017506043.1|  preprotein translocase subunit SecY              62.4    6e-08   
ref|WP_032517865.1|  preprotein translocase subunit SecY              62.4    6e-08   
gb|EAT11896.1|  preprotein translocase SecY                           58.9    6e-08   
ref|YP_007627371.1|  preprotein translocase subunit SecY              62.0    6e-08   
ref|WP_015113413.1|  preprotein translocase subunit SecY              62.4    6e-08   
ref|WP_005982434.1|  preprotein translocase subunit SecY              62.0    6e-08   
ref|WP_026381016.1|  preprotein translocase subunit SecY              62.4    6e-08   
ref|WP_025943053.1|  preprotein translocase subunit SecY              62.0    6e-08   
ref|WP_005950338.1|  preprotein translocase subunit SecY              62.0    7e-08   
ref|WP_029965541.1|  preprotein translocase subunit SecY              62.0    7e-08   
ref|WP_011580996.1|  preprotein translocase subunit SecY              62.0    7e-08   
ref|WP_026791930.1|  preprotein translocase subunit SecY              62.0    7e-08   
ref|WP_008262163.1|  MULTISPECIES: preprotein translocase subunit...  62.0    7e-08   
ref|WP_026782404.1|  preprotein translocase subunit SecY              62.0    7e-08   
ref|WP_010998335.1|  preprotein translocase subunit SecY              62.0    8e-08   
ref|WP_036099558.1|  preprotein translocase subunit SecY              62.0    8e-08   
ref|WP_010314968.1|  preprotein translocase subunit SecY              62.0    8e-08   
ref|WP_019171208.1|  preprotein translocase subunit SecY              62.0    8e-08   
gb|ERK68745.1|  preprotein translocase, SecY subunit                  62.0    8e-08   
ref|WP_007808184.1|  preprotein translocase subunit SecY              62.0    8e-08   
ref|WP_011317573.1|  preprotein translocase subunit SecY              62.0    8e-08   
ref|WP_007100634.1|  preprotein translocase subunit SecY              62.0    8e-08   
dbj|BAM06606.1|  preprotein translocase subunit                       61.6    8e-08   
ref|WP_041774805.1|  preprotein translocase subunit SecY              61.6    8e-08   
ref|WP_008597540.1|  preprotein translocase subunit SecY              61.6    9e-08   
ref|WP_008435465.1|  preprotein translocase subunit SecY              61.6    9e-08   
ref|WP_008197232.1|  preprotein translocase subunit SecY              61.6    9e-08   
ref|WP_014315971.1|  preprotein translocase subunit SecY              61.6    9e-08   
ref|WP_006168368.1|  MULTISPECIES: preprotein translocase subunit...  61.6    9e-08   
ref|WP_006186810.1|  MULTISPECIES: preprotein translocase subunit...  61.6    9e-08   
ref|WP_027493646.1|  preprotein translocase subunit SecY              61.6    1e-07   
ref|WP_035032336.1|  MULTISPECIES: preprotein translocase subunit...  61.6    1e-07   
ref|WP_036402170.1|  preprotein translocase subunit SecY              61.6    1e-07   
ref|WP_028035657.1|  preprotein translocase subunit SecY              61.6    1e-07   
ref|WP_004683919.1|  MULTISPECIES: preprotein translocase subunit...  61.6    1e-07   
ref|WP_013268940.1|  preprotein translocase subunit SecY              61.6    1e-07   
ref|WP_024970394.1|  preprotein translocase subunit SecY              61.6    1e-07   
ref|WP_002753894.1|  preprotein translocase subunit SecY              61.6    1e-07   
ref|WP_006070952.1|  preprotein translocase subunit SecY              61.6    1e-07   
ref|WP_006109920.1|  preprotein translocase subunit SecY              61.6    1e-07   
ref|WP_004689763.1|  preprotein translocase subunit SecY              61.6    1e-07   
ref|WP_006012773.1|  preprotein translocase subunit SecY              61.6    1e-07   
ref|WP_002794625.1|  preprotein translocase subunit SecY              61.6    1e-07   
ref|WP_004688457.1|  preprotein translocase subunit SecY              61.6    1e-07   
ref|WP_007513379.1|  MULTISPECIES: preprotein translocase subunit...  61.6    1e-07   
ref|WP_002964342.1|  MULTISPECIES: preprotein translocase subunit...  61.6    1e-07   
ref|WP_006467005.1|  MULTISPECIES: preprotein translocase subunit...  61.6    1e-07   
ref|WP_010659926.1|  MULTISPECIES: preprotein translocase subunit...  61.6    1e-07   
ref|WP_002801926.1|  preprotein translocase subunit SecY              61.6    1e-07   
ref|WP_015447082.1|  MULTISPECIES: preprotein translocase subunit...  61.6    1e-07   
ref|WP_025935457.1|  MULTISPECIES: preprotein translocase subunit...  61.2    1e-07   
ref|WP_025923886.1|  preprotein translocase subunit SecY              61.2    1e-07   
ref|WP_015164367.1|  preprotein translocase subunit SecY              61.2    1e-07   
ref|WP_022855900.1|  preprotein translocase subunit SecY              61.2    1e-07   
gb|ELP55840.1|  preprotein translocase, SecY subunit                  61.2    1e-07   
ref|WP_009148332.1|  preprotein translocase subunit SecY              61.2    1e-07   
ref|WP_036480326.1|  preprotein translocase subunit SecY              61.2    1e-07   
ref|WP_031231516.1|  preprotein translocase subunit SecY              61.2    1e-07   
ref|WP_040493999.1|  preprotein translocase subunit SecY              61.2    1e-07   
gb|ELS46365.1|  preprotein translocase, SecY subunit                  61.2    1e-07   
ref|WP_018427860.1|  preprotein translocase subunit SecY              61.2    1e-07   
ref|WP_007875310.1|  preprotein translocase subunit SecY              61.2    1e-07   
ref|WP_006196726.1|  preprotein translocase subunit SecY              61.2    1e-07   
ref|WP_007099871.1|  preprotein translocase subunit SecY              61.2    1e-07   
ref|WP_025895056.1|  MULTISPECIES: preprotein translocase subunit...  61.2    1e-07   
ref|WP_028096600.1|  preprotein translocase subunit SecY              61.2    1e-07   
gb|EEO36790.2|  preprotein translocase, SecY subunit                  60.8    1e-07   
gb|ESQ77397.1|  preprotein translocase subunit SecY                   61.2    1e-07   
ref|WP_008039946.1|  preprotein translocase subunit SecY              60.8    2e-07   
ref|WP_024585443.1|  preprotein translocase subunit SecY              60.8    2e-07   
ref|WP_027128114.1|  preprotein translocase subunit SecY              60.8    2e-07   
ref|WP_022998250.1|  MULTISPECIES: preprotein translocase subunit...  60.8    2e-07   
ref|WP_025030951.1|  preprotein translocase subunit SecY              60.8    2e-07   
ref|WP_023675130.1|  preprotein translocase subunit SecY              60.8    2e-07   
ref|WP_021698696.1|  preprotein translocase subunit SecY              60.8    2e-07   
ref|WP_010909287.1|  preprotein translocase subunit SecY              60.8    2e-07   
ref|WP_002796420.1|  preprotein translocase subunit SecY              60.8    2e-07   
gb|EDZ39176.1|  Preprotein translocase subunit (SecY)                 60.8    2e-07   
ref|WP_040970388.1|  preprotein translocase subunit SecY              60.8    2e-07   
ref|WP_027051779.1|  preprotein translocase subunit SecY              60.8    2e-07   
ref|WP_013895692.1|  MULTISPECIES: preprotein translocase subunit...  60.8    2e-07   
ref|WP_023757970.1|  preprotein translocase subunit SecY              60.8    2e-07   
ref|WP_027057013.1|  preprotein translocase subunit SecY              60.8    2e-07   
ref|WP_019857971.1|  MULTISPECIES: preprotein translocase subunit...  60.8    2e-07   
ref|WP_015317976.1|  MULTISPECIES: preprotein translocase subunit...  60.8    2e-07   
ref|WP_027044982.1|  preprotein translocase subunit SecY              60.8    2e-07   
ref|WP_027028845.1|  preprotein translocase subunit SecY              60.8    2e-07   
ref|WP_036084228.1|  preprotein translocase subunit SecY              60.8    2e-07   
gb|EAY55936.1|  Preprotein translocase subunit (SecY)                 60.8    2e-07   
ref|WP_027026968.1|  preprotein translocase subunit SecY              60.8    2e-07   
ref|WP_006936431.1|  preprotein translocase subunit SecY              60.5    2e-07   
ref|WP_023799282.1|  preprotein translocase subunit SecY              60.5    2e-07   
ref|WP_013531435.1|  MULTISPECIES: preprotein translocase subunit...  60.5    2e-07   
ref|WP_027038734.1|  preprotein translocase subunit SecY              60.5    2e-07   
ref|WP_038507175.1|  MULTISPECIES: preprotein translocase subunit...  60.5    2e-07   
ref|WP_023717523.1|  preprotein translocase subunit SecY              60.5    2e-07   
ref|WP_027145578.1|  preprotein translocase subunit SecY              60.5    2e-07   
ref|WP_023812083.1|  preprotein translocase subunit SecY              60.5    2e-07   
ref|WP_027154036.1|  preprotein translocase subunit SecY              60.5    2e-07   
ref|WP_027170353.1|  preprotein translocase subunit SecY              60.5    2e-07   
ref|WP_011430029.1|  preprotein translocase subunit SecY              60.5    2e-07   
ref|WP_020880437.1|  preprotein translocase subunit SecY              60.5    2e-07   
ref|WP_042642212.1|  preprotein translocase subunit SecY              60.5    2e-07   
ref|WP_008837733.1|  preprotein translocase subunit SecY              60.5    2e-07   
ref|WP_008739999.1|  preprotein translocase subunit SecY              60.5    2e-07   
gb|KIE08714.1|  preprotein translocase subunit SecY                   60.5    2e-07   
ref|WP_043237085.1|  preprotein translocase subunit SecY              60.5    2e-07   
ref|WP_040994636.1|  preprotein translocase subunit SecY              60.5    2e-07   
ref|WP_020886435.1|  preprotein translocase subunit SecY              60.5    2e-07   
ref|WP_006205447.1|  preprotein translocase subunit SecY              60.5    3e-07   
ref|WP_039204352.1|  preprotein translocase subunit SecY              56.6    3e-07   
ref|WP_031234436.1|  preprotein translocase subunit SecY              57.0    3e-07   
ref|WP_029417733.1|  preprotein translocase subunit SecY              60.5    3e-07   
ref|WP_040983006.1|  preprotein translocase subunit SecY              60.5    3e-07   
ref|WP_011612504.1|  preprotein translocase subunit SecY              60.5    3e-07   
ref|XP_005973532.1|  PREDICTED: protein translocase subunit SecY-...  60.5    3e-07   
ref|WP_028489215.1|  preprotein translocase subunit SecY              60.5    3e-07   
ref|WP_041064746.1|  preprotein translocase subunit SecY              60.5    3e-07   
ref|WP_015488523.1|  preprotein translocase subunit SecY              60.1    3e-07   
ref|WP_012547188.1|  preprotein translocase subunit SecY              60.1    3e-07   
ref|WP_022710958.1|  preprotein translocase subunit SecY              60.1    3e-07   
ref|WP_014402157.1|  preprotein translocase subunit SecY              60.1    3e-07   
ref|WP_014030013.1|  preprotein translocase subunit SecY              60.1    3e-07   
ref|WP_043645055.1|  preprotein translocase subunit SecY              60.1    3e-07   
ref|WP_010639671.1|  preprotein translocase subunit SecY              60.1    3e-07   
gb|EKD94114.1|  preprotein translocase subunit SecY                   60.1    3e-07   
ref|WP_035193416.1|  preprotein translocase subunit SecY              60.1    3e-07   
ref|WP_037133556.1|  preprotein translocase subunit SecY              60.1    3e-07   
ref|WP_006528335.1|  preprotein translocase subunit SecY              60.1    3e-07   
ref|WP_035049385.1|  preprotein translocase subunit SecY              60.1    3e-07   
ref|WP_027371004.1|  preprotein translocase subunit SecY              60.1    3e-07   
ref|WP_023825602.1|  preprotein translocase subunit SecY              60.1    4e-07   
ref|WP_022605582.1|  preprotein translocase subunit SecY              60.1    4e-07   
ref|XP_005705009.1|  [pt] translocation protein, Sec family           60.1    4e-07   
ref|WP_011819154.1|  preprotein translocase subunit SecY              60.1    4e-07   
ref|WP_012306672.1|  MULTISPECIES: preprotein translocase subunit...  60.1    4e-07   
ref|WP_024897025.1|  preprotein translocase subunit SecY              60.1    4e-07   
ref|WP_035991888.1|  preprotein translocase subunit SecY              59.7    4e-07   
ref|WP_011975185.1|  MULTISPECIES: preprotein translocase subunit...  59.7    4e-07   
dbj|GAF53724.1|  LOW QUALITY PROTEIN: preprotein translocase SecY...  59.7    4e-07   
ref|WP_011399900.1|  preprotein translocase subunit SecY              59.7    4e-07   
gb|AGI73630.1|  preprotein translocase subunit SecY                   59.7    4e-07   
ref|WP_028000165.1|  preprotein translocase subunit SecY              59.7    4e-07   
ref|WP_016923801.1|  preprotein translocase subunit SecY              59.7    4e-07   
ref|WP_002780096.1|  preprotein translocase subunit SecY              59.7    4e-07   
ref|YP_009051059.1|  preprotein translocase subunit SecY              59.7    4e-07   
ref|WP_018099556.1|  preprotein translocase subunit SecY              59.7    4e-07   
ref|WP_023672761.1|  MULTISPECIES: preprotein translocase subunit...  59.7    4e-07   
ref|WP_012583364.1|  preprotein translocase subunit SecY              59.7    4e-07   
ref|WP_038365424.1|  preprotein translocase subunit SecY              59.7    4e-07   
ref|WP_015955695.1|  preprotein translocase subunit SecY              59.7    4e-07   
ref|WP_017748887.1|  preprotein translocase subunit SecY              59.7    4e-07   
ref|WP_003536503.1|  preprotein translocase subunit SecY              59.7    4e-07   
ref|WP_044038566.1|  preprotein translocase subunit SecY              59.7    4e-07   
ref|WP_038046808.1|  preprotein translocase subunit SecY              59.7    4e-07   
ref|WP_029894013.1|  preprotein translocase subunit SecY              59.7    4e-07   
ref|WP_029964940.1|  preprotein translocase subunit SecY              59.7    4e-07   
ref|WP_010206881.1|  preprotein translocase subunit SecY              56.6    4e-07   
ref|WP_012139788.1|  preprotein translocase subunit SecY              59.7    5e-07   
ref|WP_036219842.1|  preprotein translocase subunit SecY              59.7    5e-07   
ref|WP_011784261.1|  MULTISPECIES: preprotein translocase subunit...  59.7    5e-07   
ref|WP_025426683.1|  preprotein translocase subunit SecY              59.7    5e-07   
ref|WP_007191138.1|  preprotein translocase subunit SecY              59.7    5e-07   
ref|WP_005224343.1|  preprotein translocase subunit SecY              59.7    5e-07   
ref|WP_023411521.1|  preprotein translocase subunit SecY              59.3    5e-07   
ref|WP_024924778.1|  MULTISPECIES: preprotein translocase subunit...  59.7    5e-07   
ref|WP_024546076.1|  preprotein translocase subunit SecY              59.3    5e-07   
gb|ERP90447.1|  preprotein translocase subunit SecY                   59.3    5e-07   
gb|KID50106.1|  preprotein translocase subunit SecY                   59.3    5e-07   
ref|WP_013755891.1|  preprotein translocase subunit SecY              59.3    5e-07   
ref|WP_037031070.1|  preprotein translocase subunit SecY              57.0    5e-07   
ref|WP_015851086.1|  preprotein translocase subunit SecY              59.3    5e-07   
ref|WP_039192596.1|  preprotein translocase subunit SecY              59.3    5e-07   
ref|WP_026481661.1|  preprotein translocase subunit SecY              59.3    6e-07   
ref|WP_006333398.1|  preprotein translocase subunit SecY              59.3    6e-07   
ref|WP_027312021.1|  preprotein translocase subunit SecY              59.3    6e-07   
ref|WP_012536096.1|  preprotein translocase subunit SecY              59.3    6e-07   
ref|WP_028293132.1|  preprotein translocase subunit SecY              59.3    6e-07   



>ref|XP_004242663.1| PREDICTED: preprotein translocase subunit SCY1, chloroplastic 
[Solanum lycopersicum]
Length=536

 Score =   244 bits (623),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 149/210 (71%), Positives = 166/210 (79%), Gaps = 14/210 (7%)
 Frame = +2

Query  92   MLITVREVSSLSHCF--AAFNTPRTNRNTLICRASSVRLHGNPSLTHQSWN-----PITS  250
            MLITVRE+SS S CF     ++ + NR T IC+ASS+  H     T  SWN        S
Sbjct  1    MLITVREISSSSLCFNSKQLHSLKVNRVTPICKASSLSFHKKS--TAPSWNLGLFESTNS  58

Query  251  SDNSVFDPLGINSSRSSHLNTAWESAVGFVLKAFESTSGTRKEKNSSARRVAAAIEDTSI  430
             DNSVFDPLG NS +SS     W++ V  + + FES+S TRKEKNSSAR +AAAIEDTSI
Sbjct  59   CDNSVFDPLGTNSGKSS-----WDNLVSLLSQTFESSSNTRKEKNSSARGLAAAIEDTSI  113

Query  431  DFGDffkgplpgkflkllgYLALSRVGIYVPLGGVNRDAFVGNLDENSILSTLDSFSGGG  610
            DFGDFFKGPLPGKFLKLLG+LALSR+GIY+PLGGVNR+AFVGNLDENSILSTLDSFSGGG
Sbjct  114  DFGDFFKGPLPGKFLKLLGFLALSRLGIYIPLGGVNREAFVGNLDENSILSTLDSFSGGG  173

Query  611  IGRLGICSLGIVPFINAQIVFQLLGQIYPK  700
            IGRLGICSLGIVPFINAQIVFQLL QIYPK
Sbjct  174  IGRLGICSLGIVPFINAQIVFQLLAQIYPK  203



>ref|XP_006343553.1| PREDICTED: preprotein translocase subunit SCY1, chloroplastic-like 
[Solanum tuberosum]
Length=538

 Score =   234 bits (597),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 148/212 (70%), Positives = 166/212 (78%), Gaps = 16/212 (8%)
 Frame = +2

Query  92   MLITVREVSSLSH--CF--AAFNTPRTNRNTLICRASSVRLHGNPSLTHQSWN-----PI  244
            MLITVRE+SS S   CF     ++ + NR   IC+ASS+  H     T  SWN       
Sbjct  1    MLITVREISSSSSSLCFNSKQLHSLKVNRVAPICKASSLSFHKKS--TAPSWNLGLFQST  58

Query  245  TSSDNSVFDPLGINSSRSSHLNTAWESAVGFVLKAFESTSGTRKEKNSSARRVAAAIEDT  424
             S D+SVFDPLGINS +SS     W++ V  + + FES+S TRKEKNSSAR +AAAIEDT
Sbjct  59   NSCDSSVFDPLGINSGKSS-----WDNLVSLLSQTFESSSNTRKEKNSSARGLAAAIEDT  113

Query  425  SIDFGDffkgplpgkflkllgYLALSRVGIYVPLGGVNRDAFVGNLDENSILSTLDSFSG  604
            SIDFGDFFKGPLPGKFLKLLG+LALSR+GIY+PLGGVNR+AFVGNLDENSILSTLDSFSG
Sbjct  114  SIDFGDFFKGPLPGKFLKLLGFLALSRLGIYIPLGGVNREAFVGNLDENSILSTLDSFSG  173

Query  605  GGIGRLGICSLGIVPFINAQIVFQLLGQIYPK  700
            GGIGRLGICSLGIVPFINAQIVFQLL QIYPK
Sbjct  174  GGIGRLGICSLGIVPFINAQIVFQLLAQIYPK  205



>ref|XP_010109386.1| Preprotein translocase subunit SCY1 [Morus notabilis]
 gb|EXC22224.1| Preprotein translocase subunit SCY1 [Morus notabilis]
Length=422

 Score =   223 bits (569),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 148/214 (69%), Positives = 166/214 (78%), Gaps = 17/214 (8%)
 Frame = +2

Query  92   MLITVREVSS--------LSHCFAAFNTPRTNRNTLICRASSVRLHGNPSLTHQSWNP--  241
            MLITVRE SS        +SH     ++PR    T +CRAS + +   P L+ +SWN   
Sbjct  1    MLITVREASSSSPLCFSSISHVNPK-SSPRLK--TSLCRAS-LSVQRKP-LSAKSWNLGL  55

Query  242  -ITSSDNSVFDPLGINSSRSSHLNTAWESAVGFVLKAFESTSGTRKEKNSSARRVAAAIE  418
               SS+ SVFDPLGINS  SS L+  WES +G   + FES SGTR EK SSAR VAA+IE
Sbjct  56   LSHSSEGSVFDPLGINSDVSSGLSATWESFIGLFSQTFESASGTRNEK-SSARGVAASIE  114

Query  419  DTSIDFGDffkgplpgkflkllgYLALSRVGIYVPLGGVNRDAFVGNLDENSILSTLDSF  598
            D+SIDFGDFFKGPLPGKFLKLLGYLALSR+GIY+PLGGVNRDAFVGNLD+NS+LSTLDSF
Sbjct  115  DSSIDFGDFFKGPLPGKFLKLLGYLALSRLGIYIPLGGVNRDAFVGNLDQNSLLSTLDSF  174

Query  599  SGGGIGRLGICSLGIVPFINAQIVFQLLGQIYPK  700
            SGGGIGRLGICSLGIVPFINAQIVFQLL QIYPK
Sbjct  175  SGGGIGRLGICSLGIVPFINAQIVFQLLAQIYPK  208



>ref|XP_009774576.1| PREDICTED: preprotein translocase subunit SCY1, chloroplastic-like 
isoform X2 [Nicotiana sylvestris]
Length=503

 Score =   222 bits (566),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 145/221 (66%), Positives = 164/221 (74%), Gaps = 23/221 (10%)
 Frame = +2

Query  92   MLITVREVSSLSH-CF-----------AAFNTPRTNRNTLICRASSVRLH-GNPSLTHQS  232
            MLITVRE+SS S  CF              ++ + NR T IC+ASS+  +  N + T  S
Sbjct  1    MLITVREISSSSSLCFNSLISNTNNNSKQLHSLKVNRFTPICKASSLSFNRKNSNTTAPS  60

Query  233  WN-----PITSSDNSVFDPLGINSSRSSHLNTAWESAVGFVLKAFESTSGTRKEKNSSAR  397
            WN        S D+S FDPLGINS +SS     W++ V    + FES+S  RK+K SSAR
Sbjct  61   WNLGLNHSTNSCDSSEFDPLGINSGKSS-----WDNLVSLFFQTFESSSNARKDKTSSAR  115

Query  398  RVAAAIEDTSIDFGDffkgplpgkflkllgYLALSRVGIYVPLGGVNRDAFVGNLDENSI  577
              AAAIEDTSIDFGDFFKGPLPGKFLKLLG+LALSR+GIY+PLGGVNR+AFVGNLDENSI
Sbjct  116  GFAAAIEDTSIDFGDFFKGPLPGKFLKLLGFLALSRLGIYIPLGGVNREAFVGNLDENSI  175

Query  578  LSTLDSFSGGGIGRLGICSLGIVPFINAQIVFQLLGQIYPK  700
            LSTLDSFSGGGIGRLGICSLGIVPFINAQIVFQLL QIYPK
Sbjct  176  LSTLDSFSGGGIGRLGICSLGIVPFINAQIVFQLLAQIYPK  216



>ref|XP_006453462.1| hypothetical protein CICLE_v10007941mg [Citrus clementina]
 ref|XP_006474121.1| PREDICTED: preprotein translocase subunit SCY1, chloroplastic-like 
[Citrus sinensis]
 gb|ESR66702.1| hypothetical protein CICLE_v10007941mg [Citrus clementina]
Length=540

 Score =   223 bits (569),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 139/208 (67%), Positives = 161/208 (77%), Gaps = 6/208 (3%)
 Frame = +2

Query  92   MLITVREVSS-LSHCF----AAFNTPRTNRNTLICRASSVRLHGNPSLTHQSWNPITSSD  256
            M+I+VRE+SS    CF    +   T    RN+ ICRAS        +    S +  +S +
Sbjct  1    MVISVREISSSWPLCFNPSTSRIKTSPRLRNS-ICRASFSVQRQPTNAISTSTSKFSSCE  59

Query  257  NSVFDPLGINSSRSSHLNTAWESAVGFVLKAFESTSGTRKEKNSSARRVAAAIEDTSIDF  436
             SVFDPLGIN    SHLN+ WES +  +   FESTSGT++EK+SSAR VAAA+ED+SIDF
Sbjct  60   GSVFDPLGINPDVCSHLNSTWESFLSLLSPTFESTSGTKREKSSSARGVAAAMEDSSIDF  119

Query  437  GDffkgplpgkflkllgYLALSRVGIYVPLGGVNRDAFVGNLDENSILSTLDSFSGGGIG  616
            GDFFKGPLPGKFLKLLGYLALSR+GIY+PLGGVNR+AFVGNLD+NS+LSTLDSFSGGGIG
Sbjct  120  GDFFKGPLPGKFLKLLGYLALSRLGIYIPLGGVNREAFVGNLDQNSLLSTLDSFSGGGIG  179

Query  617  RLGICSLGIVPFINAQIVFQLLGQIYPK  700
            RLGICSLGIVPFINAQIVFQLL QI PK
Sbjct  180  RLGICSLGIVPFINAQIVFQLLAQINPK  207



>ref|XP_009774575.1| PREDICTED: preprotein translocase subunit SCY1, chloroplastic-like 
isoform X1 [Nicotiana sylvestris]
Length=549

 Score =   223 bits (569),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 145/221 (66%), Positives = 164/221 (74%), Gaps = 23/221 (10%)
 Frame = +2

Query  92   MLITVREVSSLSH-CF-----------AAFNTPRTNRNTLICRASSVRLH-GNPSLTHQS  232
            MLITVRE+SS S  CF              ++ + NR T IC+ASS+  +  N + T  S
Sbjct  1    MLITVREISSSSSLCFNSLISNTNNNSKQLHSLKVNRFTPICKASSLSFNRKNSNTTAPS  60

Query  233  WN-----PITSSDNSVFDPLGINSSRSSHLNTAWESAVGFVLKAFESTSGTRKEKNSSAR  397
            WN        S D+S FDPLGINS +SS     W++ V    + FES+S  RK+K SSAR
Sbjct  61   WNLGLNHSTNSCDSSEFDPLGINSGKSS-----WDNLVSLFFQTFESSSNARKDKTSSAR  115

Query  398  RVAAAIEDTSIDFGDffkgplpgkflkllgYLALSRVGIYVPLGGVNRDAFVGNLDENSI  577
              AAAIEDTSIDFGDFFKGPLPGKFLKLLG+LALSR+GIY+PLGGVNR+AFVGNLDENSI
Sbjct  116  GFAAAIEDTSIDFGDFFKGPLPGKFLKLLGFLALSRLGIYIPLGGVNREAFVGNLDENSI  175

Query  578  LSTLDSFSGGGIGRLGICSLGIVPFINAQIVFQLLGQIYPK  700
            LSTLDSFSGGGIGRLGICSLGIVPFINAQIVFQLL QIYPK
Sbjct  176  LSTLDSFSGGGIGRLGICSLGIVPFINAQIVFQLLAQIYPK  216



>gb|KDO62389.1| hypothetical protein CISIN_1g009193mg [Citrus sinensis]
Length=540

 Score =   223 bits (568),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 139/208 (67%), Positives = 160/208 (77%), Gaps = 6/208 (3%)
 Frame = +2

Query  92   MLITVREVSS-LSHCF----AAFNTPRTNRNTLICRASSVRLHGNPSLTHQSWNPITSSD  256
            M+I+VRE+SS    CF    +   T    RN+ ICRAS        +    S +   S +
Sbjct  1    MVISVREISSSWPLCFNPSTSKIKTSPRLRNS-ICRASFSVQRQPTNAISTSTSKFNSCE  59

Query  257  NSVFDPLGINSSRSSHLNTAWESAVGFVLKAFESTSGTRKEKNSSARRVAAAIEDTSIDF  436
             SVFDPLGIN    SHLN+ WES +  +   FESTSGT++EK+SSAR VAAA+ED+SIDF
Sbjct  60   GSVFDPLGINPDVCSHLNSTWESFLSLLSPTFESTSGTKREKSSSARGVAAAMEDSSIDF  119

Query  437  GDffkgplpgkflkllgYLALSRVGIYVPLGGVNRDAFVGNLDENSILSTLDSFSGGGIG  616
            GDFFKGPLPGKFLKLLGYLALSR+GIY+PLGGVNR+AFVGNLD+NS+LSTLDSFSGGGIG
Sbjct  120  GDFFKGPLPGKFLKLLGYLALSRLGIYIPLGGVNREAFVGNLDQNSLLSTLDSFSGGGIG  179

Query  617  RLGICSLGIVPFINAQIVFQLLGQIYPK  700
            RLGICSLGIVPFINAQIVFQLL QI PK
Sbjct  180  RLGICSLGIVPFINAQIVFQLLAQINPK  207



>gb|KJB53848.1| hypothetical protein B456_009G007500 [Gossypium raimondii]
Length=371

 Score =   218 bits (555),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 137/210 (65%), Positives = 159/210 (76%), Gaps = 8/210 (4%)
 Frame = +2

Query  92   MLITVREVSSLSHCFAAFNTPRTNRNTL----ICRASSVRLHGNPSLTHQSWNPI---TS  250
            MLITVRE S     F   +      + +    +CRAS + +H  P+   QSW+      S
Sbjct  1    MLITVREASFWPLTFNLSSFSSPKPSPILKNSVCRAS-LSVHPKPTSNSQSWDLSLLSNS  59

Query  251  SDNSVFDPLGINSSRSSHLNTAWESAVGFVLKAFESTSGTRKEKNSSARRVAAAIEDTSI  430
               SVFDPLGIN   SS LN  W+S +  +   FESTSGTRKEK+SSAR VAAAIED+SI
Sbjct  60   QKGSVFDPLGINPDESSGLNGVWDSFLSLLTPTFESTSGTRKEKSSSARGVAAAIEDSSI  119

Query  431  DFGDffkgplpgkflkllgYLALSRVGIYVPLGGVNRDAFVGNLDENSILSTLDSFSGGG  610
            +FGDFFKGPLPGKFLKLL +LALSR+G+Y+PLGGVNR+AFVGNLD+NS+LSTLDSFSGGG
Sbjct  120  EFGDFFKGPLPGKFLKLLAFLALSRLGVYIPLGGVNREAFVGNLDQNSLLSTLDSFSGGG  179

Query  611  IGRLGICSLGIVPFINAQIVFQLLGQIYPK  700
            IGRLGICSLGIVPFINAQIVFQLL Q+YPK
Sbjct  180  IGRLGICSLGIVPFINAQIVFQLLAQVYPK  209



>gb|KJB53847.1| hypothetical protein B456_009G007500 [Gossypium raimondii]
Length=423

 Score =   217 bits (553),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 137/210 (65%), Positives = 159/210 (76%), Gaps = 8/210 (4%)
 Frame = +2

Query  92   MLITVREVSSLSHCFAAFNTPRTNRNTL----ICRASSVRLHGNPSLTHQSWNPI---TS  250
            MLITVRE S     F   +      + +    +CRAS + +H  P+   QSW+      S
Sbjct  1    MLITVREASFWPLTFNLSSFSSPKPSPILKNSVCRAS-LSVHPKPTSNSQSWDLSLLSNS  59

Query  251  SDNSVFDPLGINSSRSSHLNTAWESAVGFVLKAFESTSGTRKEKNSSARRVAAAIEDTSI  430
               SVFDPLGIN   SS LN  W+S +  +   FESTSGTRKEK+SSAR VAAAIED+SI
Sbjct  60   QKGSVFDPLGINPDESSGLNGVWDSFLSLLTPTFESTSGTRKEKSSSARGVAAAIEDSSI  119

Query  431  DFGDffkgplpgkflkllgYLALSRVGIYVPLGGVNRDAFVGNLDENSILSTLDSFSGGG  610
            +FGDFFKGPLPGKFLKLL +LALSR+G+Y+PLGGVNR+AFVGNLD+NS+LSTLDSFSGGG
Sbjct  120  EFGDFFKGPLPGKFLKLLAFLALSRLGVYIPLGGVNREAFVGNLDQNSLLSTLDSFSGGG  179

Query  611  IGRLGICSLGIVPFINAQIVFQLLGQIYPK  700
            IGRLGICSLGIVPFINAQIVFQLL Q+YPK
Sbjct  180  IGRLGICSLGIVPFINAQIVFQLLAQVYPK  209



>gb|KJB53846.1| hypothetical protein B456_009G007500 [Gossypium raimondii]
Length=542

 Score =   219 bits (557),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 137/210 (65%), Positives = 159/210 (76%), Gaps = 8/210 (4%)
 Frame = +2

Query  92   MLITVREVSSLSHCFAAFNTPRTNRNTL----ICRASSVRLHGNPSLTHQSWNPI---TS  250
            MLITVRE S     F   +      + +    +CRAS + +H  P+   QSW+      S
Sbjct  1    MLITVREASFWPLTFNLSSFSSPKPSPILKNSVCRAS-LSVHPKPTSNSQSWDLSLLSNS  59

Query  251  SDNSVFDPLGINSSRSSHLNTAWESAVGFVLKAFESTSGTRKEKNSSARRVAAAIEDTSI  430
               SVFDPLGIN   SS LN  W+S +  +   FESTSGTRKEK+SSAR VAAAIED+SI
Sbjct  60   QKGSVFDPLGINPDESSGLNGVWDSFLSLLTPTFESTSGTRKEKSSSARGVAAAIEDSSI  119

Query  431  DFGDffkgplpgkflkllgYLALSRVGIYVPLGGVNRDAFVGNLDENSILSTLDSFSGGG  610
            +FGDFFKGPLPGKFLKLL +LALSR+G+Y+PLGGVNR+AFVGNLD+NS+LSTLDSFSGGG
Sbjct  120  EFGDFFKGPLPGKFLKLLAFLALSRLGVYIPLGGVNREAFVGNLDQNSLLSTLDSFSGGG  179

Query  611  IGRLGICSLGIVPFINAQIVFQLLGQIYPK  700
            IGRLGICSLGIVPFINAQIVFQLL Q+YPK
Sbjct  180  IGRLGICSLGIVPFINAQIVFQLLAQVYPK  209



>gb|KDO62390.1| hypothetical protein CISIN_1g009193mg [Citrus sinensis]
Length=499

 Score =   213 bits (543),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 124/161 (77%), Positives = 139/161 (86%), Gaps = 5/161 (3%)
 Frame = +2

Query  233  WNPITSS-----DNSVFDPLGINSSRSSHLNTAWESAVGFVLKAFESTSGTRKEKNSSAR  397
            WN I+ S     + SVFDPLGIN    SHLN+ WES +  +   FESTSGT++EK+SSAR
Sbjct  6    WNKISLSLQQNCEGSVFDPLGINPDVCSHLNSTWESFLSLLSPTFESTSGTKREKSSSAR  65

Query  398  RVAAAIEDTSIDFGDffkgplpgkflkllgYLALSRVGIYVPLGGVNRDAFVGNLDENSI  577
             VAAA+ED+SIDFGDFFKGPLPGKFLKLLGYLALSR+GIY+PLGGVNR+AFVGNLD+NS+
Sbjct  66   GVAAAMEDSSIDFGDFFKGPLPGKFLKLLGYLALSRLGIYIPLGGVNREAFVGNLDQNSL  125

Query  578  LSTLDSFSGGGIGRLGICSLGIVPFINAQIVFQLLGQIYPK  700
            LSTLDSFSGGGIGRLGICSLGIVPFINAQIVFQLL QI PK
Sbjct  126  LSTLDSFSGGGIGRLGICSLGIVPFINAQIVFQLLAQINPK  166



>ref|XP_010268356.1| PREDICTED: preprotein translocase subunit SCY1, chloroplastic 
[Nelumbo nucifera]
Length=542

 Score =   213 bits (543),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 140/213 (66%), Positives = 157/213 (74%), Gaps = 15/213 (7%)
 Frame = +2

Query  92   MLITVREVSS-------LSHCFAAFNTPRTNRNTLICRASSVRLHGNPSLTHQSWN---P  241
            ML+TV E SS       LS    A   P+  R+  +CRAS   ++  P   HQ W    P
Sbjct  1    MLLTVSEASSVIFNLCTLSRSPKASPKPKPWRS--VCRAS-FAVNRKPK-NHQ-WKLDLP  55

Query  242  ITSSDNSVFDPLGINSSRSSHLNTAWESAVGFVLKAFESTSGTRKEKNSSARRVAAAIED  421
                D++VFDPL I+   S      WES     L+  ESTSGTRKEK+SSAR VAAAIED
Sbjct  56   FNGCDSTVFDPLRIHPDASPGFIAPWESFQDLFLQRSESTSGTRKEKSSSARGVAAAIED  115

Query  422  TSIDFGDffkgplpgkflkllgYLALSRVGIYVPLGGVNRDAFVGNLDENSILSTLDSFS  601
            +SIDFGDFFKGPLPGKFLKLLGYLALSR+GIYVPLGGVNR+AF+GNLD+NS+LSTLDSFS
Sbjct  116  SSIDFGDFFKGPLPGKFLKLLGYLALSRLGIYVPLGGVNREAFIGNLDQNSLLSTLDSFS  175

Query  602  GGGIGRLGICSLGIVPFINAQIVFQLLGQIYPK  700
            GGGIGRLGICSLGIVPFINAQIVFQLL QIYPK
Sbjct  176  GGGIGRLGICSLGIVPFINAQIVFQLLTQIYPK  208



>ref|XP_008443797.1| PREDICTED: preprotein translocase subunit SCY1, chloroplastic 
[Cucumis melo]
Length=547

 Score =   213 bits (543),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 135/215 (63%), Positives = 163/215 (76%), Gaps = 13/215 (6%)
 Frame = +2

Query  92   MLITVREVSSLSH----CF-----AAFNTPRTNRNTLICRASSVRLHGNPSLTHQSWNP-  241
            MLIT RE ++ S     CF     +  N+ R  R  +    +S  + G PS + +SWN  
Sbjct  1    MLITFREAAAASSSSPLCFTLSTRSLTNSKRFPRPRISLARASFSVPGKPS-SIKSWNLG  59

Query  242  --ITSSDNSVFDPLGINSSRSSHLNTAWESAVGFVLKAFESTSGTRKEKNSSARRVAAAI  415
                SS++SVFDPLGI+   SS L++ WES +G+  + F S S T+K+K+ SAR +AAAI
Sbjct  60   LISNSSESSVFDPLGIHPDLSSELSSTWESFLGYFGQTFNSASSTKKDKSPSARGLAAAI  119

Query  416  EDTSIDFGDffkgplpgkflkllgYLALSRVGIYVPLGGVNRDAFVGNLDENSILSTLDS  595
            ED+SID GDFFKGPLPGKFL+LLGYLALSR+GIY+PLGGVNR+AFVGNLD+NS+LSTLDS
Sbjct  120  EDSSIDIGDFFKGPLPGKFLQLLGYLALSRLGIYIPLGGVNREAFVGNLDQNSLLSTLDS  179

Query  596  FSGGGIGRLGICSLGIVPFINAQIVFQLLGQIYPK  700
            FSGGGIGRLGICSLGIVPFINAQIVFQLL QIYPK
Sbjct  180  FSGGGIGRLGICSLGIVPFINAQIVFQLLAQIYPK  214



>emb|CDP02922.1| unnamed protein product [Coffea canephora]
Length=552

 Score =   213 bits (543),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 138/225 (61%), Positives = 168/225 (75%), Gaps = 26/225 (12%)
 Frame = +2

Query  92   MLITVREVSSLS--------------------HCFAAFNTPRTNRNTLI--CRASSVRLH  205
            MLITVREVSSLS                    +C+  + T    +N+ I  CRA+ + + 
Sbjct  1    MLITVREVSSLSFNRTLIPFGFSKQNFSKPNSYCYDCYRTKDQKKNSSISVCRAA-LTVP  59

Query  206  GNPSLTHQSWNPITSSDNSVFDPLGINSSRSSHLNTAWESAVGFVLKAFESTSGTRKEKN  385
              P +  +S +  +S + S FDPLGI+S R S L  AW++ +GF+ + FES+SGTRK++ 
Sbjct  60   TKPGVPTKSSS--SSCEISSFDPLGISSDRLSELYAAWDNVLGFLSQTFESSSGTRKDR-  116

Query  386  SSARRVAAAIEDTSIDFGDffkgplpgkflkllgYLALSRVGIYVPLGGVNRDAFVGNLD  565
            +S + VAAAIEDTSIDFGDFFKGPLPGKFLKLLG+LALSR+GIY+PLGGVN++AFVGNLD
Sbjct  117  ASPKGVAAAIEDTSIDFGDFFKGPLPGKFLKLLGFLALSRLGIYIPLGGVNQEAFVGNLD  176

Query  566  ENSILSTLDSFSGGGIGRLGICSLGIVPFINAQIVFQLLGQIYPK  700
            +NS LSTLDSFSGGGIGRLGICSLGIVPFINAQIVFQLL QIYPK
Sbjct  177  QNSFLSTLDSFSGGGIGRLGICSLGIVPFINAQIVFQLLTQIYPK  221



>ref|XP_007138413.1| hypothetical protein PHAVU_009G206700g [Phaseolus vulgaris]
 gb|ESW10407.1| hypothetical protein PHAVU_009G206700g [Phaseolus vulgaris]
Length=537

 Score =   212 bits (540),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 133/207 (64%), Positives = 155/207 (75%), Gaps = 5/207 (2%)
 Frame = +2

Query  92   MLITVREVSSLSHCFAAFN----TPRTNRNTLICRASSVRLHGNPSLTHQSWNPITSSDN  259
            MLITVRE S  S      N     P     T IC+AS   +   P+ +  +    TSSD 
Sbjct  1    MLITVREASCSSPLNFWLNRFKPKPSKPFKTSICQAS-FSVQRRPTHSLNTGYLSTSSDE  59

Query  260  SVFDPLGINSSRSSHLNTAWESAVGFVLKAFESTSGTRKEKNSSARRVAAAIEDTSIDFG  439
            + FDPLGINS   S LN+ WE+ +    + FESTS T K K +S++ VAAAIED+SIDFG
Sbjct  60   AHFDPLGINSDLPSTLNSTWENLLCLFTQTFESTSSTEKGKPNSSQGVAAAIEDSSIDFG  119

Query  440  DffkgplpgkflkllgYLALSRVGIYVPLGGVNRDAFVGNLDENSILSTLDSFSGGGIGR  619
            DFFKGPLPGKFLKLLG+LALSR+G+Y+PLGGVNR+AFVGNLD+NS+LSTLDSFSGGGIGR
Sbjct  120  DFFKGPLPGKFLKLLGFLALSRLGVYIPLGGVNREAFVGNLDQNSLLSTLDSFSGGGIGR  179

Query  620  LGICSLGIVPFINAQIVFQLLGQIYPK  700
            LG+CSLGIVPFINAQIVFQLL QIYPK
Sbjct  180  LGVCSLGIVPFINAQIVFQLLAQIYPK  206



>ref|XP_007014009.1| SECY isoform 2 [Theobroma cacao]
 gb|EOY31628.1| SECY isoform 2 [Theobroma cacao]
Length=373

 Score =   208 bits (529),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 140/212 (66%), Positives = 160/212 (75%), Gaps = 12/212 (6%)
 Frame = +2

Query  92   MLITVREVSS--LSHCFAAFNTPRTNRNTL----ICRASSVRLHGNPSLTHQSWNPITSS  253
            MLITVRE SS  LS      + P    + L    +CRAS + +H  PS ++QSW     S
Sbjct  1    MLITVREASSWPLSFNLCTLSHPNPKPSPLFKNYVCRAS-LTVHRKPS-SNQSWKLGLLS  58

Query  254  DN---SVFDPLGINSSRSSHLNTAWESAVGFVLKAFESTSGTRKEKNSSARRVAAAIEDT  424
            +    SVFDPLGIN   S  LN  WES +  +   FESTSGT+K K+SSAR  AAAIED+
Sbjct  59   NGHKGSVFDPLGINPDVSG-LNGVWESFLALLTPTFESTSGTKKGKSSSARGAAAAIEDS  117

Query  425  SIDFGDffkgplpgkflkllgYLALSRVGIYVPLGGVNRDAFVGNLDENSILSTLDSFSG  604
            SIDFGDFFKG LPGKFLKLL YLALSR+G+Y+PLGGVNR+AFVGNLD+NS+LSTLDSFSG
Sbjct  118  SIDFGDFFKGELPGKFLKLLAYLALSRLGVYIPLGGVNREAFVGNLDQNSLLSTLDSFSG  177

Query  605  GGIGRLGICSLGIVPFINAQIVFQLLGQIYPK  700
            GGIGRLGICSLGIVPFINAQIVFQLL Q+YPK
Sbjct  178  GGIGRLGICSLGIVPFINAQIVFQLLAQVYPK  209



>ref|XP_008223538.1| PREDICTED: preprotein translocase subunit SCY1, chloroplastic 
[Prunus mume]
Length=550

 Score =   212 bits (540),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 137/219 (63%), Positives = 164/219 (75%), Gaps = 19/219 (9%)
 Frame = +2

Query  92   MLITVR-EVSSLSHCFA-----AFN------TPRTNRNTLICRAS-SVRLHGNPSLTHQS  232
            MLITVR   SS   CF+     +F+      +PR  R+  +C+AS SV+   N + T  S
Sbjct  1    MLITVRGAFSSSPLCFSNPHSHSFSYLTSKASPRLKRS--VCKASFSVQRKPNTNST-TS  57

Query  233  WNPITSSDNS---VFDPLGINSSRSSHLNTAWESAVGFVLKAFESTSGTRKEKNSSARRV  403
            W     S+ +   VFDPLGINS  +S LN  WES +G + +  ES S ++K+K +SAR +
Sbjct  58   WKLGVLSNRTEAPVFDPLGINSDCNSGLNATWESFLGLLSQKLESASSSKKDKPTSARGL  117

Query  404  AAAIEDTSIDFGDffkgplpgkflkllgYLALSRVGIYVPLGGVNRDAFVGNLDENSILS  583
            AAAIED+SIDFGDFF+GPLPGKFL LL YLALSR+GIY+PLGGVNR+AFVGNLD+NS+LS
Sbjct  118  AAAIEDSSIDFGDFFRGPLPGKFLMLLAYLALSRLGIYIPLGGVNREAFVGNLDQNSLLS  177

Query  584  TLDSFSGGGIGRLGICSLGIVPFINAQIVFQLLGQIYPK  700
            TLDSFSGGGIGRLGICSLGIVPFINAQIVFQLL QIYPK
Sbjct  178  TLDSFSGGGIGRLGICSLGIVPFINAQIVFQLLAQIYPK  216



>ref|XP_011018127.1| PREDICTED: preprotein translocase subunit SCY1, chloroplastic-like 
isoform X2 [Populus euphratica]
Length=479

 Score =   211 bits (536),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 133/208 (64%), Positives = 157/208 (75%), Gaps = 14/208 (7%)
 Frame = +2

Query  92   MLITVREV---SSLSHCFAAFNTPRTNRN--TLICRASSVRLHGNPSLTHQSWNPITSSD  256
            ML+TVRE    S +S  F+  N  R ++   T +CRAS       P    +SWN  T+ +
Sbjct  1    MLLTVREACPCSPISFNFSRINPTRASQRLRTSVCRAS---FSVQPKPNTKSWN--TTFN  55

Query  257  NSVFDPLGINSSRSSHLNTAWESAVGFVLKAFESTSGTRKEKNSSARRVAAAIEDTSIDF  436
               FDPLGINS+  S L+ +WES + F+   FES S T+K+K    R VAAAIED+SIDF
Sbjct  56   AKSFDPLGINSNVPSSLSASWESLLAFLSPIFESASSTKKDK----RGVAAAIEDSSIDF  111

Query  437  GDffkgplpgkflkllgYLALSRVGIYVPLGGVNRDAFVGNLDENSILSTLDSFSGGGIG  616
            GDFFKGPLPGKFLKLLG+LALSR+GIY+PLGGVN++AF GNLD+NS+LSTLDSFSGGGIG
Sbjct  112  GDFFKGPLPGKFLKLLGFLALSRLGIYIPLGGVNQEAFAGNLDQNSLLSTLDSFSGGGIG  171

Query  617  RLGICSLGIVPFINAQIVFQLLGQIYPK  700
            RLGICSLGIVPFINAQIVFQLL QIYPK
Sbjct  172  RLGICSLGIVPFINAQIVFQLLAQIYPK  199



>ref|XP_002262945.2| PREDICTED: preprotein translocase subunit SCY1, chloroplastic 
isoform X1 [Vitis vinifera]
Length=546

 Score =   211 bits (538),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 140/216 (65%), Positives = 165/216 (76%), Gaps = 16/216 (7%)
 Frame = +2

Query  92   MLITVREVSSLSHCF----------AAFNTPRTNRNTLICRASSVRLHGNPSLTHQSWNP  241
            M+ITVRE SS + CF          A+  +PR  RN+ + RAS   +H  P+ T  SWN 
Sbjct  1    MMITVREASSSALCFNLNLSRSSHPASTASPRL-RNS-VSRAS-FAVHTKPNSTPNSWNL  57

Query  242  ---ITSSDNSVFDPLGINSSRSSHLNTAWESAVGFVLKAFESTSGTRKEKNSSARRVAAA  412
                 S    VFDPLGI+S +S  LN  WESA+G + + F STS T+K+K++S + VAAA
Sbjct  58   ALFCNSCKGPVFDPLGIDSDKSLGLNATWESALGLLSQTFGSTSSTKKDKSASGQGVAAA  117

Query  413  IEDTSIDFGDffkgplpgkflkllgYLALSRVGIYVPLGGVNRDAFVGNLDENSILSTLD  592
            IED+SIDFGDFFKGPLPGKFLKLLG LALSR+G+YVPLGGVNR+AFVGNLD+NS+L+TLD
Sbjct  118  IEDSSIDFGDFFKGPLPGKFLKLLGLLALSRLGVYVPLGGVNREAFVGNLDQNSLLTTLD  177

Query  593  SFSGGGIGRLGICSLGIVPFINAQIVFQLLGQIYPK  700
            SFSGGGIGRLGICSLGIVPFINAQIVFQLL QIYPK
Sbjct  178  SFSGGGIGRLGICSLGIVPFINAQIVFQLLTQIYPK  213



>ref|XP_007223081.1| hypothetical protein PRUPE_ppa003762mg [Prunus persica]
 gb|EMJ24280.1| hypothetical protein PRUPE_ppa003762mg [Prunus persica]
Length=550

 Score =   211 bits (538),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 137/219 (63%), Positives = 164/219 (75%), Gaps = 19/219 (9%)
 Frame = +2

Query  92   MLITVR-EVSSLSHCFA-----AFN------TPRTNRNTLICRAS-SVRLHGNPSLTHQS  232
            MLITVR  +SS   CF+     +F+      +PR  R+  +C+AS SV+   N + T  S
Sbjct  1    MLITVRGALSSSPLCFSNPHSHSFSYLTSKASPRLKRS--VCKASFSVQRKPNTNST-TS  57

Query  233  WNPITSSDNS---VFDPLGINSSRSSHLNTAWESAVGFVLKAFESTSGTRKEKNSSARRV  403
            W     S+ +   VFDPLGINS  +S LN  WES +G + +   S S ++KEK +SAR +
Sbjct  58   WKLGVLSNRTEAPVFDPLGINSDCNSGLNATWESFLGLLSQKLGSASSSKKEKPTSARGL  117

Query  404  AAAIEDTSIDFGDffkgplpgkflkllgYLALSRVGIYVPLGGVNRDAFVGNLDENSILS  583
            AAAIED+SIDFGDFF+GPLPGKFL LL YLALSR+GIY+PLGGVNR+AFVGNLD+NS+LS
Sbjct  118  AAAIEDSSIDFGDFFRGPLPGKFLMLLAYLALSRLGIYIPLGGVNREAFVGNLDQNSLLS  177

Query  584  TLDSFSGGGIGRLGICSLGIVPFINAQIVFQLLGQIYPK  700
            TLDSFSGGGIGRLGICSLGIVPFINAQIVFQLL QIYPK
Sbjct  178  TLDSFSGGGIGRLGICSLGIVPFINAQIVFQLLAQIYPK  216



>ref|XP_011018126.1| PREDICTED: preprotein translocase subunit SCY1, chloroplastic-like 
isoform X1 [Populus euphratica]
Length=532

 Score =   211 bits (536),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 133/208 (64%), Positives = 157/208 (75%), Gaps = 14/208 (7%)
 Frame = +2

Query  92   MLITVREV---SSLSHCFAAFNTPRTNRN--TLICRASSVRLHGNPSLTHQSWNPITSSD  256
            ML+TVRE    S +S  F+  N  R ++   T +CRAS       P    +SWN  T+ +
Sbjct  1    MLLTVREACPCSPISFNFSRINPTRASQRLRTSVCRAS---FSVQPKPNTKSWN--TTFN  55

Query  257  NSVFDPLGINSSRSSHLNTAWESAVGFVLKAFESTSGTRKEKNSSARRVAAAIEDTSIDF  436
               FDPLGINS+  S L+ +WES + F+   FES S T+K+K    R VAAAIED+SIDF
Sbjct  56   AKSFDPLGINSNVPSSLSASWESLLAFLSPIFESASSTKKDK----RGVAAAIEDSSIDF  111

Query  437  GDffkgplpgkflkllgYLALSRVGIYVPLGGVNRDAFVGNLDENSILSTLDSFSGGGIG  616
            GDFFKGPLPGKFLKLLG+LALSR+GIY+PLGGVN++AF GNLD+NS+LSTLDSFSGGGIG
Sbjct  112  GDFFKGPLPGKFLKLLGFLALSRLGIYIPLGGVNQEAFAGNLDQNSLLSTLDSFSGGGIG  171

Query  617  RLGICSLGIVPFINAQIVFQLLGQIYPK  700
            RLGICSLGIVPFINAQIVFQLL QIYPK
Sbjct  172  RLGICSLGIVPFINAQIVFQLLAQIYPK  199



>ref|XP_002324497.2| hypothetical protein POPTR_0018s10650g [Populus trichocarpa]
 gb|EEF03062.2| hypothetical protein POPTR_0018s10650g [Populus trichocarpa]
Length=532

 Score =   211 bits (536),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 133/208 (64%), Positives = 157/208 (75%), Gaps = 14/208 (7%)
 Frame = +2

Query  92   MLITVREV---SSLSHCFAAFNTPRTNR--NTLICRASSVRLHGNPSLTHQSWNPITSSD  256
            ML+TVRE    S +S   +  N  R ++   T +CRAS       P    +SWN  T+ +
Sbjct  1    MLLTVREACPCSPISFNLSRINPTRASQRLKTSVCRAS---FSVQPKPNTKSWN--TTLN  55

Query  257  NSVFDPLGINSSRSSHLNTAWESAVGFVLKAFESTSGTRKEKNSSARRVAAAIEDTSIDF  436
             + FDPLGINS+  S LN +WES + F+   FES S T+K+K    R VAAAIED+SIDF
Sbjct  56   ANSFDPLGINSNVPSSLNASWESLLAFLSPIFESASSTKKDK----RGVAAAIEDSSIDF  111

Query  437  GDffkgplpgkflkllgYLALSRVGIYVPLGGVNRDAFVGNLDENSILSTLDSFSGGGIG  616
            GDFFKGPLPGKFLKLLG+LALSR+GIY+PLGGVN++AF GNLD+NS+LSTLDSFSGGGIG
Sbjct  112  GDFFKGPLPGKFLKLLGFLALSRLGIYIPLGGVNQEAFAGNLDQNSLLSTLDSFSGGGIG  171

Query  617  RLGICSLGIVPFINAQIVFQLLGQIYPK  700
            RLGICSLGIVPFINAQIVFQLL QIYPK
Sbjct  172  RLGICSLGIVPFINAQIVFQLLAQIYPK  199



>ref|XP_010525749.1| PREDICTED: preprotein translocase subunit SCY1, chloroplastic 
[Tarenaya hassleriana]
Length=551

 Score =   210 bits (535),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 134/191 (70%), Positives = 151/191 (79%), Gaps = 6/191 (3%)
 Frame = +2

Query  146  NTPRTNRNTLICRAS-SVRLHGNPSLTHQSWN--PITSS---DNSVFDPLGINSSRSSHL  307
            N   +   T +CRAS SV      S + +SWN   +TSS   + SVFDPLGIN    S L
Sbjct  28   NKSSSRLRTSLCRASFSVPTRTRNSCSSKSWNFGLVTSSKSFEGSVFDPLGINPDEPSGL  87

Query  308  NTAWESAVGFVLKAFESTSGTRKEKNSSARRVAAAIEDTSIDFGDffkgplpgkflkllg  487
            ++ WE  +  +L A ES+SG +KEK  SAR VAAAIED+SIDFGDFFKGPLPGKFLKLLG
Sbjct  88   SSIWEGLLNLLLPALESSSGAKKEKTLSARGVAAAIEDSSIDFGDFFKGPLPGKFLKLLG  147

Query  488  YLALSRVGIYVPLGGVNRDAFVGNLDENSILSTLDSFSGGGIGRLGICSLGIVPFINAQI  667
            YLALSR+GIYVPLGGVNR+AFVGNLD+NS+LSTLDSFSGGGIGRLGICSLGIVPFINAQI
Sbjct  148  YLALSRLGIYVPLGGVNREAFVGNLDQNSLLSTLDSFSGGGIGRLGICSLGIVPFINAQI  207

Query  668  VFQLLGQIYPK  700
            VFQLL QIYPK
Sbjct  208  VFQLLAQIYPK  218



>ref|XP_006372102.1| hypothetical protein POPTR_0018s10650g [Populus trichocarpa]
 gb|ERP49899.1| hypothetical protein POPTR_0018s10650g [Populus trichocarpa]
Length=550

 Score =   210 bits (535),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 133/208 (64%), Positives = 157/208 (75%), Gaps = 14/208 (7%)
 Frame = +2

Query  92   MLITVREV---SSLSHCFAAFNTPRTNR--NTLICRASSVRLHGNPSLTHQSWNPITSSD  256
            ML+TVRE    S +S   +  N  R ++   T +CRAS       P    +SWN  T+ +
Sbjct  1    MLLTVREACPCSPISFNLSRINPTRASQRLKTSVCRAS---FSVQPKPNTKSWN--TTLN  55

Query  257  NSVFDPLGINSSRSSHLNTAWESAVGFVLKAFESTSGTRKEKNSSARRVAAAIEDTSIDF  436
             + FDPLGINS+  S LN +WES + F+   FES S T+K+K    R VAAAIED+SIDF
Sbjct  56   ANSFDPLGINSNVPSSLNASWESLLAFLSPIFESASSTKKDK----RGVAAAIEDSSIDF  111

Query  437  GDffkgplpgkflkllgYLALSRVGIYVPLGGVNRDAFVGNLDENSILSTLDSFSGGGIG  616
            GDFFKGPLPGKFLKLLG+LALSR+GIY+PLGGVN++AF GNLD+NS+LSTLDSFSGGGIG
Sbjct  112  GDFFKGPLPGKFLKLLGFLALSRLGIYIPLGGVNQEAFAGNLDQNSLLSTLDSFSGGGIG  171

Query  617  RLGICSLGIVPFINAQIVFQLLGQIYPK  700
            RLGICSLGIVPFINAQIVFQLL QIYPK
Sbjct  172  RLGICSLGIVPFINAQIVFQLLAQIYPK  199



>ref|XP_007138412.1| hypothetical protein PHAVU_009G206700g [Phaseolus vulgaris]
 gb|ESW10406.1| hypothetical protein PHAVU_009G206700g [Phaseolus vulgaris]
Length=536

 Score =   209 bits (533),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 134/208 (64%), Positives = 156/208 (75%), Gaps = 8/208 (4%)
 Frame = +2

Query  92   MLITVREVSSLSHCFAAFN----TPRTNRNTLICRAS-SVRLHGNPSLTHQSWNPITSSD  256
            MLITVRE S  S      N     P     T IC+AS SV+     SL       +++SD
Sbjct  1    MLITVREASCSSPLNFWLNRFKPKPSKPFKTSICQASFSVQRRPTHSLNT---GYLSTSD  57

Query  257  NSVFDPLGINSSRSSHLNTAWESAVGFVLKAFESTSGTRKEKNSSARRVAAAIEDTSIDF  436
             + FDPLGINS   S LN+ WE+ +    + FESTS T K K +S++ VAAAIED+SIDF
Sbjct  58   EAHFDPLGINSDLPSTLNSTWENLLCLFTQTFESTSSTEKGKPNSSQGVAAAIEDSSIDF  117

Query  437  GDffkgplpgkflkllgYLALSRVGIYVPLGGVNRDAFVGNLDENSILSTLDSFSGGGIG  616
            GDFFKGPLPGKFLKLLG+LALSR+G+Y+PLGGVNR+AFVGNLD+NS+LSTLDSFSGGGIG
Sbjct  118  GDFFKGPLPGKFLKLLGFLALSRLGVYIPLGGVNREAFVGNLDQNSLLSTLDSFSGGGIG  177

Query  617  RLGICSLGIVPFINAQIVFQLLGQIYPK  700
            RLG+CSLGIVPFINAQIVFQLL QIYPK
Sbjct  178  RLGVCSLGIVPFINAQIVFQLLAQIYPK  205



>ref|XP_006582101.1| PREDICTED: preprotein translocase subunit SCY1, chloroplastic-like 
isoform X2 [Glycine max]
Length=539

 Score =   209 bits (533),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 136/212 (64%), Positives = 163/212 (77%), Gaps = 13/212 (6%)
 Frame = +2

Query  92   MLITVREVSSLSHCFAAFNTPRTN-------RNTLICRASSVRLHGNPSLTHQSWNP--I  244
            MLITVRE SS S    +F   R N       + T IC+AS   +   P  TH SWN   +
Sbjct  1    MLITVREASSCSSSPLSFWLNRFNAKPSKTLKTTSICQAS-FSVQRRP--TH-SWNTRHL  56

Query  245  TSSDNSVFDPLGINSSRSSHLNTAWESAVGFVLKAFESTSGTRKEKNSSARRVAAAIEDT  424
            ++S+ + FDPLGINS  SS LN+ W++ V  + + FESTS   K K +S++ VAAAIED+
Sbjct  57   STSELANFDPLGINSDLSSGLNSTWKNLVCSITQTFESTSSAEKGKPNSSQGVAAAIEDS  116

Query  425  SIDFGDffkgplpgkflkllgYLALSRVGIYVPLGGVNRDAFVGNLDENSILSTLDSFSG  604
            SIDFGDFFKGPLPGKFLKLLG+LALSR+G+Y+PLGGVNR+AFVGNLD+NS+LSTLDSFSG
Sbjct  117  SIDFGDFFKGPLPGKFLKLLGFLALSRLGVYIPLGGVNREAFVGNLDQNSLLSTLDSFSG  176

Query  605  GGIGRLGICSLGIVPFINAQIVFQLLGQIYPK  700
            GGIGRLG+CSLGIVPFINAQIVFQLL Q+YPK
Sbjct  177  GGIGRLGVCSLGIVPFINAQIVFQLLAQVYPK  208



>ref|XP_003527188.1| PREDICTED: preprotein translocase subunit SCY1, chloroplastic-like 
isoform X1 [Glycine max]
 gb|KHN08736.1| Preprotein translocase subunit SECY, chloroplastic [Glycine soja]
Length=540

 Score =   209 bits (532),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 138/213 (65%), Positives = 162/213 (76%), Gaps = 14/213 (7%)
 Frame = +2

Query  92   MLITVREVSSLSHCFAAFNTPRTN-------RNTLICRASSVRLHGNPSLTHQSWNP---  241
            MLITVRE SS S    +F   R N       + T IC+AS   +   P  TH SWN    
Sbjct  1    MLITVREASSCSSSPLSFWLNRFNAKPSKTLKTTSICQAS-FSVQRRP--TH-SWNTRHL  56

Query  242  ITSSDNSVFDPLGINSSRSSHLNTAWESAVGFVLKAFESTSGTRKEKNSSARRVAAAIED  421
             TSS+ + FDPLGINS  SS LN+ W++ V  + + FESTS   K K +S++ VAAAIED
Sbjct  57   STSSELANFDPLGINSDLSSGLNSTWKNLVCSITQTFESTSSAEKGKPNSSQGVAAAIED  116

Query  422  TSIDFGDffkgplpgkflkllgYLALSRVGIYVPLGGVNRDAFVGNLDENSILSTLDSFS  601
            +SIDFGDFFKGPLPGKFLKLLG+LALSR+G+Y+PLGGVNR+AFVGNLD+NS+LSTLDSFS
Sbjct  117  SSIDFGDFFKGPLPGKFLKLLGFLALSRLGVYIPLGGVNREAFVGNLDQNSLLSTLDSFS  176

Query  602  GGGIGRLGICSLGIVPFINAQIVFQLLGQIYPK  700
            GGGIGRLG+CSLGIVPFINAQIVFQLL Q+YPK
Sbjct  177  GGGIGRLGVCSLGIVPFINAQIVFQLLAQVYPK  209



>ref|XP_007014008.1| SECY isoform 1 [Theobroma cacao]
 gb|EOY31627.1| SECY isoform 1 [Theobroma cacao]
Length=542

 Score =   209 bits (532),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 140/212 (66%), Positives = 160/212 (75%), Gaps = 12/212 (6%)
 Frame = +2

Query  92   MLITVREVSS--LSHCFAAFNTPRTNRNTL----ICRASSVRLHGNPSLTHQSWNPITSS  253
            MLITVRE SS  LS      + P    + L    +CRAS + +H  PS ++QSW     S
Sbjct  1    MLITVREASSWPLSFNLCTLSHPNPKPSPLFKNYVCRAS-LTVHRKPS-SNQSWKLGLLS  58

Query  254  DN---SVFDPLGINSSRSSHLNTAWESAVGFVLKAFESTSGTRKEKNSSARRVAAAIEDT  424
            +    SVFDPLGIN   S  LN  WES +  +   FESTSGT+K K+SSAR  AAAIED+
Sbjct  59   NGHKGSVFDPLGINPDVSG-LNGVWESFLALLTPTFESTSGTKKGKSSSARGAAAAIEDS  117

Query  425  SIDFGDffkgplpgkflkllgYLALSRVGIYVPLGGVNRDAFVGNLDENSILSTLDSFSG  604
            SIDFGDFFKG LPGKFLKLL YLALSR+G+Y+PLGGVNR+AFVGNLD+NS+LSTLDSFSG
Sbjct  118  SIDFGDFFKGELPGKFLKLLAYLALSRLGVYIPLGGVNREAFVGNLDQNSLLSTLDSFSG  177

Query  605  GGIGRLGICSLGIVPFINAQIVFQLLGQIYPK  700
            GGIGRLGICSLGIVPFINAQIVFQLL Q+YPK
Sbjct  178  GGIGRLGICSLGIVPFINAQIVFQLLAQVYPK  209



>ref|XP_002533181.1| protein translocase secy subunit, putative [Ricinus communis]
 gb|EEF29204.1| protein translocase secy subunit, putative [Ricinus communis]
Length=557

 Score =   209 bits (532),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 138/226 (61%), Positives = 158/226 (70%), Gaps = 26/226 (12%)
 Frame = +2

Query  92   MLITVRE-------------VSSLSHCFAAFNTPR----TNRNTLICRASSVRLHGNPSL  220
            MLITVRE             +SSLS     +  P         T  CRAS   L   P+ 
Sbjct  1    MLITVREAAAASPFSPICLNLSSLSANPIKYKIPSRPSSYRLKTCACRAS-FSLQNRPTS  59

Query  221  TH------QSWNPITSSDNSVFDPLGINSSRSSHLNTAWESAVGFVLKAFESTSGTRKEK  382
            +       + WN   S + SVFDPLGIN+   S +N AWES +  +   FES S T+++K
Sbjct  60   STTTTTTTKPWN-TNSCEGSVFDPLGINTDEYSGVNAAWESILALLSPIFESASSTKRDK  118

Query  383  NSSARRVAAAIEDTSIDFGDffkgplpgkflkllgYLALSRVGIYVPLGGVNRDAFVGNL  562
              SAR VAAAIED+SIDFGDFFKGPLPGKFLKLLG+LALSR+GIY+PLGGVNRDAFVGNL
Sbjct  119  -PSARGVAAAIEDSSIDFGDFFKGPLPGKFLKLLGFLALSRLGIYIPLGGVNRDAFVGNL  177

Query  563  DENSILSTLDSFSGGGIGRLGICSLGIVPFINAQIVFQLLGQIYPK  700
            D+NS+LSTLDSFSGGGIGRLGICSLGIVPFINAQIVFQLL Q+YPK
Sbjct  178  DQNSLLSTLDSFSGGGIGRLGICSLGIVPFINAQIVFQLLAQVYPK  223



>ref|NP_179461.1| preprotein translocase subunit secY [Arabidopsis thaliana]
 sp|Q38885.2|SCY1_ARATH RecName: Full=Preprotein translocase subunit SCY1, chloroplastic; 
AltName: Full=CpSecY; Flags: Precursor [Arabidopsis thaliana]
 gb|AAL11544.1|AF424550_1 At2g18710/MSF3.9 [Arabidopsis thaliana]
 gb|AAD08940.1| putative preprotein translocase SECY protein [Arabidopsis thaliana]
 gb|AAL24211.1| At2g18710/MSF3.9 [Arabidopsis thaliana]
 gb|AAL38269.1| putative preprotein translocase SECY protein [Arabidopsis thaliana]
 gb|AAO11548.1| At2g18710/MSF3.9 [Arabidopsis thaliana]
 gb|AEC06796.1| preprotein translocase subunit secY [Arabidopsis thaliana]
Length=551

 Score =   209 bits (531),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 128/182 (70%), Positives = 147/182 (81%), Gaps = 10/182 (5%)
 Frame = +2

Query  155  RTNRNTLICRASSVRLHGNPSLTHQSWNPITSSDNSVFDPLGINSSRSSHLNTAWESAVG  334
            +T RNT  C+A S     N  L   S     SS+ SVFDPLGIN   +S L++ WES V 
Sbjct  47   KTRRNT--CKAKS----WNLGLVINS----RSSEASVFDPLGINPDETSGLSSIWESFVS  96

Query  335  FVLKAFESTSGTRKEKNSSARRVAAAIEDTSIDFGDffkgplpgkflkllgYLALSRVGI  514
             +  +FES+SG R++K SS R VAAAIED+SIDFGDFFKGPLPGKFLKLLG+LALSR+GI
Sbjct  97   LLSPSFESSSGNRRDKPSSGRGVAAAIEDSSIDFGDFFKGPLPGKFLKLLGFLALSRLGI  156

Query  515  YVPLGGVNRDAFVGNLDENSILSTLDSFSGGGIGRLGICSLGIVPFINAQIVFQLLGQIY  694
            Y+PLGGVNR+AFVGNLD+NSILSTLD+FSGGGIGRLGICSLGIVPFINAQIVFQLL Q+Y
Sbjct  157  YIPLGGVNREAFVGNLDQNSILSTLDTFSGGGIGRLGICSLGIVPFINAQIVFQLLAQVY  216

Query  695  PK  700
            PK
Sbjct  217  PK  218



>ref|XP_004296426.1| PREDICTED: preprotein translocase subunit SCY1, chloroplastic 
[Fragaria vesca subsp. vesca]
Length=536

 Score =   208 bits (530),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 129/207 (62%), Positives = 155/207 (75%), Gaps = 8/207 (4%)
 Frame = +2

Query  92   MLITVR-EVSSLSHCFAAFNTPRTNRNTLICRASSVRLHGNPSLTHQSWNPIT---SSDN  259
            MLITV+ + SS   C+ +F+ P    +    R S  R    P+ T  SW       SS+ 
Sbjct  1    MLITVKGQFSSSPLCYNSFSYPSLKPSVCKPRFSVTR---KPN-TITSWKLSVLSNSSEA  56

Query  260  SVFDPLGINSSRSSHLNTAWESAVGFVLKAFESTSGTRKEKNSSARRVAAAIEDTSIDFG  439
            SVFDPLGINS   S L++ W+S    + K  ES S ++ E+++S+R +AAAIED+SIDFG
Sbjct  57   SVFDPLGINSDVHSSLDSTWDSFRSLLSKPLESASSSKNERSNSSRGLAAAIEDSSIDFG  116

Query  440  DffkgplpgkflkllgYLALSRVGIYVPLGGVNRDAFVGNLDENSILSTLDSFSGGGIGR  619
            DFFK PLPGKFL LLGYLALSR+GIY+PLGGVNR+AFVGNLD+NS+LSTLDSFSGGGIGR
Sbjct  117  DFFKSPLPGKFLILLGYLALSRLGIYIPLGGVNREAFVGNLDQNSLLSTLDSFSGGGIGR  176

Query  620  LGICSLGIVPFINAQIVFQLLGQIYPK  700
            LGICSLGIVPFINAQIVFQLL Q+YPK
Sbjct  177  LGICSLGIVPFINAQIVFQLLAQVYPK  203



>gb|AAB60305.1| SecY homolog; targetted to the thylakoid membrane; the protein 
has a chloroplast targetting signal, but the processing site 
is not known [Arabidopsis thaliana]
Length=551

 Score =   209 bits (531),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 128/182 (70%), Positives = 147/182 (81%), Gaps = 10/182 (5%)
 Frame = +2

Query  155  RTNRNTLICRASSVRLHGNPSLTHQSWNPITSSDNSVFDPLGINSSRSSHLNTAWESAVG  334
            +T RNT  C+A S  L     L   S     SS+ SVFDPLGIN   +S L++ WES V 
Sbjct  47   KTRRNT--CKAKSWNL----GLVINS----RSSEASVFDPLGINPDETSGLSSIWESFVS  96

Query  335  FVLKAFESTSGTRKEKNSSARRVAAAIEDTSIDFGDffkgplpgkflkllgYLALSRVGI  514
             +  +FES+SG R++K SS R VAAAIED+SIDFGDFFKGPLPGKFLKLLG+LALSR+GI
Sbjct  97   LLSPSFESSSGNRRDKPSSGRGVAAAIEDSSIDFGDFFKGPLPGKFLKLLGFLALSRLGI  156

Query  515  YVPLGGVNRDAFVGNLDENSILSTLDSFSGGGIGRLGICSLGIVPFINAQIVFQLLGQIY  694
            Y+PLGGVNR+AFVGNLD+NSILSTLD+FSGGGIGRLGICSLGIVPFINAQIVFQLL Q+Y
Sbjct  157  YIPLGGVNREAFVGNLDQNSILSTLDTFSGGGIGRLGICSLGIVPFINAQIVFQLLAQVY  216

Query  695  PK  700
            PK
Sbjct  217  PK  218



>ref|XP_004149897.2| PREDICTED: preprotein translocase subunit SCY1, chloroplastic 
[Cucumis sativus]
 gb|KGN65282.1| hypothetical protein Csa_1G294620 [Cucumis sativus]
Length=546

 Score =   207 bits (528),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 131/214 (61%), Positives = 157/214 (73%), Gaps = 12/214 (6%)
 Frame = +2

Query  92   MLITVREVSSLSHCFAAF--------NTPRTNRNTLICRASSVRLHGNPSLTHQSWN---  238
            MLIT  E  + S    +F        N+ R  R       +S  + G P+ T +SWN   
Sbjct  1    MLITFTEAVAPSSSPLSFTLSTHSLTNSNRFPRPRTSLTPASFSVPGKPTST-KSWNLRL  59

Query  239  PITSSDNSVFDPLGINSSRSSHLNTAWESAVGFVLKAFESTSGTRKEKNSSARRVAAAIE  418
               SS++SVFDPLGI    SS  ++ WE+ +G+  + F S S T+K+K+ SAR +AAAIE
Sbjct  60   VSNSSESSVFDPLGIRPDLSSEFSSTWENFLGYFGQTFNSASSTKKDKSPSARGLAAAIE  119

Query  419  DTSIDFGDffkgplpgkflkllgYLALSRVGIYVPLGGVNRDAFVGNLDENSILSTLDSF  598
            D+SID GDFFKGPLPGKFL+LLGYLALSR+GIY+PLGGVNR+AFVGNLD+NS+LSTLDSF
Sbjct  120  DSSIDIGDFFKGPLPGKFLQLLGYLALSRLGIYIPLGGVNREAFVGNLDQNSLLSTLDSF  179

Query  599  SGGGIGRLGICSLGIVPFINAQIVFQLLGQIYPK  700
            SGGGIGRLGICSLGIVPFINAQIVFQLL QIYPK
Sbjct  180  SGGGIGRLGICSLGIVPFINAQIVFQLLAQIYPK  213



>gb|KCW81069.1| hypothetical protein EUGRSUZ_C02439 [Eucalyptus grandis]
Length=367

 Score =   203 bits (516),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 135/206 (66%), Positives = 156/206 (76%), Gaps = 6/206 (3%)
 Frame = +2

Query  92   MLITVREVSSLSH---CFAAFNTPRTNRNTLICRASSVRLHGNPSLTHQSWNPITSSDNS  262
            MLITV E ++  +     ++F T  + +   +CRAS       PSL     +   SS+ +
Sbjct  1    MLITVGEAAATVYSRPLRSSFPTSSSKQRRWVCRAS-FGAQRKPSLKLGLVSS-NSSEGA  58

Query  263  VFDPLGINSSRSSHLNTAWESAVGFVLKAFESTSGTRKEKNSSARRVAAAIEDTSIDFGD  442
            VFDPLGI+S  SS LN+ WES +       ES+S TR+EK SS R VAAAIED+SIDFGD
Sbjct  59   VFDPLGIDSCHSSGLNSTWESFLDLFSPISESSSSTRREKTSS-RGVAAAIEDSSIDFGD  117

Query  443  ffkgplpgkflkllgYLALSRVGIYVPLGGVNRDAFVGNLDENSILSTLDSFSGGGIGRL  622
            FFKGPLPGKFLKLLGYLALSR+GIYVPLGGVNR+AF GNLD+NS+LSTLDSFSGGGIGRL
Sbjct  118  FFKGPLPGKFLKLLGYLALSRLGIYVPLGGVNREAFAGNLDQNSLLSTLDSFSGGGIGRL  177

Query  623  GICSLGIVPFINAQIVFQLLGQIYPK  700
            GICSLGIVPFINAQIVFQLL QIYPK
Sbjct  178  GICSLGIVPFINAQIVFQLLAQIYPK  203



>gb|KCW81068.1| hypothetical protein EUGRSUZ_C02439 [Eucalyptus grandis]
Length=452

 Score =   203 bits (516),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 135/206 (66%), Positives = 156/206 (76%), Gaps = 6/206 (3%)
 Frame = +2

Query  92   MLITVREVSSLSH---CFAAFNTPRTNRNTLICRASSVRLHGNPSLTHQSWNPITSSDNS  262
            MLITV E ++  +     ++F T  + +   +CRAS       PSL     +   SS+ +
Sbjct  1    MLITVGEAAATVYSRPLRSSFPTSSSKQRRWVCRAS-FGAQRKPSLKLGLVSS-NSSEGA  58

Query  263  VFDPLGINSSRSSHLNTAWESAVGFVLKAFESTSGTRKEKNSSARRVAAAIEDTSIDFGD  442
            VFDPLGI+S  SS LN+ WES +       ES+S TR+EK SS R VAAAIED+SIDFGD
Sbjct  59   VFDPLGIDSCHSSGLNSTWESFLDLFSPISESSSSTRREKTSS-RGVAAAIEDSSIDFGD  117

Query  443  ffkgplpgkflkllgYLALSRVGIYVPLGGVNRDAFVGNLDENSILSTLDSFSGGGIGRL  622
            FFKGPLPGKFLKLLGYLALSR+GIYVPLGGVNR+AF GNLD+NS+LSTLDSFSGGGIGRL
Sbjct  118  FFKGPLPGKFLKLLGYLALSRLGIYVPLGGVNREAFAGNLDQNSLLSTLDSFSGGGIGRL  177

Query  623  GICSLGIVPFINAQIVFQLLGQIYPK  700
            GICSLGIVPFINAQIVFQLL QIYPK
Sbjct  178  GICSLGIVPFINAQIVFQLLAQIYPK  203



>ref|XP_009600938.1| PREDICTED: preprotein translocase subunit SECY, chloroplastic, 
partial [Nicotiana tomentosiformis]
Length=483

 Score =   203 bits (517),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 120/146 (82%), Positives = 129/146 (88%), Gaps = 5/146 (3%)
 Frame = +2

Query  263  VFDPLGINSSRSSHLNTAWESAVGFVLKAFESTSGTRKEKNSSARRVAAAIEDTSIDFGD  442
            VFDPLGINS +SS     W++ V    + FES+S TRK+K SSAR  AAAIEDTSIDFGD
Sbjct  10   VFDPLGINSGKSS-----WDNLVSLFFETFESSSNTRKDKTSSARGFAAAIEDTSIDFGD  64

Query  443  ffkgplpgkflkllgYLALSRVGIYVPLGGVNRDAFVGNLDENSILSTLDSFSGGGIGRL  622
            FFKGPLPGKFLKLLG+LALSR+GIYVPLGGVNR+AFVGNLDENSILSTLDSFSGGGIGRL
Sbjct  65   FFKGPLPGKFLKLLGFLALSRLGIYVPLGGVNREAFVGNLDENSILSTLDSFSGGGIGRL  124

Query  623  GICSLGIVPFINAQIVFQLLGQIYPK  700
            GICSLGIVPFINAQIVFQLL QIYPK
Sbjct  125  GICSLGIVPFINAQIVFQLLAQIYPK  150



>ref|XP_010048699.1| PREDICTED: preprotein translocase subunit SCY1, chloroplastic 
[Eucalyptus grandis]
 gb|KCW81067.1| hypothetical protein EUGRSUZ_C02439 [Eucalyptus grandis]
Length=536

 Score =   204 bits (518),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 135/206 (66%), Positives = 156/206 (76%), Gaps = 6/206 (3%)
 Frame = +2

Query  92   MLITVREVSSLSH---CFAAFNTPRTNRNTLICRASSVRLHGNPSLTHQSWNPITSSDNS  262
            MLITV E ++  +     ++F T  + +   +CRAS       PSL     +   SS+ +
Sbjct  1    MLITVGEAAATVYSRPLRSSFPTSSSKQRRWVCRAS-FGAQRKPSLKLGLVSS-NSSEGA  58

Query  263  VFDPLGINSSRSSHLNTAWESAVGFVLKAFESTSGTRKEKNSSARRVAAAIEDTSIDFGD  442
            VFDPLGI+S  SS LN+ WES +       ES+S TR+EK SS R VAAAIED+SIDFGD
Sbjct  59   VFDPLGIDSCHSSGLNSTWESFLDLFSPISESSSSTRREKTSS-RGVAAAIEDSSIDFGD  117

Query  443  ffkgplpgkflkllgYLALSRVGIYVPLGGVNRDAFVGNLDENSILSTLDSFSGGGIGRL  622
            FFKGPLPGKFLKLLGYLALSR+GIYVPLGGVNR+AF GNLD+NS+LSTLDSFSGGGIGRL
Sbjct  118  FFKGPLPGKFLKLLGYLALSRLGIYVPLGGVNREAFAGNLDQNSLLSTLDSFSGGGIGRL  177

Query  623  GICSLGIVPFINAQIVFQLLGQIYPK  700
            GICSLGIVPFINAQIVFQLL QIYPK
Sbjct  178  GICSLGIVPFINAQIVFQLLAQIYPK  203



>ref|XP_010928618.1| PREDICTED: preprotein translocase subunit SCY1, chloroplastic 
[Elaeis guineensis]
Length=566

 Score =   204 bits (519),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 119/153 (78%), Positives = 130/153 (85%), Gaps = 0/153 (0%)
 Frame = +2

Query  242  ITSSDNSVFDPLGINSSRSSHLNTAWESAVGFVLKAFESTSGTRKEKNSSARRVAAAIED  421
            I  +D SVFDPL  N  + S LN AW+S V FV + FEST   RKEK+S  R  AAAIED
Sbjct  81   IPRTDGSVFDPLAFNVDKPSGLNVAWDSVVDFVSQTFESTFSPRKEKSSLNRGAAAAIED  140

Query  422  TSIDFGDffkgplpgkflkllgYLALSRVGIYVPLGGVNRDAFVGNLDENSILSTLDSFS  601
            +SID GDFFKGPLPGKFLKLLGYLALSR+G+YVPLGGVNR+AFVGNLD+NS+LSTLDSFS
Sbjct  141  SSIDIGDFFKGPLPGKFLKLLGYLALSRLGVYVPLGGVNREAFVGNLDQNSLLSTLDSFS  200

Query  602  GGGIGRLGICSLGIVPFINAQIVFQLLGQIYPK  700
            GGGIGRLGICSLGIVPFINAQIVFQLL QIYPK
Sbjct  201  GGGIGRLGICSLGIVPFINAQIVFQLLTQIYPK  233



>ref|XP_008789707.1| PREDICTED: preprotein translocase subunit SECY, chloroplastic 
[Phoenix dactylifera]
Length=565

 Score =   203 bits (516),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 118/153 (77%), Positives = 129/153 (84%), Gaps = 0/153 (0%)
 Frame = +2

Query  242  ITSSDNSVFDPLGINSSRSSHLNTAWESAVGFVLKAFESTSGTRKEKNSSARRVAAAIED  421
            I   D SVFDPL  N  + S LN AW+S + F  + FEST   RKEK+S  R VAAAIED
Sbjct  82   IPQPDGSVFDPLAFNMEKPSGLNVAWDSVMDFFSQTFESTFSPRKEKSSLNRGVAAAIED  141

Query  422  TSIDFGDffkgplpgkflkllgYLALSRVGIYVPLGGVNRDAFVGNLDENSILSTLDSFS  601
            +SID GDFFKGPLPGKFLKLLGYLALSR+G+YVPLGGVNR+AFVGNLD+NS+LSTLDSFS
Sbjct  142  SSIDIGDFFKGPLPGKFLKLLGYLALSRLGVYVPLGGVNREAFVGNLDQNSLLSTLDSFS  201

Query  602  GGGIGRLGICSLGIVPFINAQIVFQLLGQIYPK  700
            GGGIGRLGICSLGIVPFINAQIVFQLL QIYPK
Sbjct  202  GGGIGRLGICSLGIVPFINAQIVFQLLTQIYPK  234



>ref|XP_012077484.1| PREDICTED: preprotein translocase subunit SCY1, chloroplastic 
isoform X2 [Jatropha curcas]
Length=438

 Score =   200 bits (508),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 130/216 (60%), Positives = 154/216 (71%), Gaps = 16/216 (7%)
 Frame = +2

Query  92   MLITVREVSSLSHCFAAFNTPRTNRNTL----------ICRASSVRLHGNPSLTHQSWNP  241
            MLIT  E    S    A ++P TN N            +CRA+   +   P+ T +  + 
Sbjct  1    MLITAGEACPFSPICFALSSP-TNHNVSRKLYPRLKASVCRAT-FSVQSKPNSTTKPLDT  58

Query  242  ---ITSSDNSVFDPLGINSSRSSHLNTAWESAVGFVLKAFESTSGTRKEKNSSARRVAAA  412
                 S ++SVFDPLGIN+   S LN+AWE  +  +    ES S  +++K  SAR VAAA
Sbjct  59   SLNFNSCEDSVFDPLGINTDVYSGLNSAWERLLALLSPISESASSAKRDK-PSARGVAAA  117

Query  413  IEDTSIDFGDffkgplpgkflkllgYLALSRVGIYVPLGGVNRDAFVGNLDENSILSTLD  592
            IED+SIDFGDFFKGPLPGKFLKLLG+LALSR+GIY+PLGGVNRDAF GNLD+NS+LSTLD
Sbjct  118  IEDSSIDFGDFFKGPLPGKFLKLLGFLALSRLGIYIPLGGVNRDAFAGNLDQNSLLSTLD  177

Query  593  SFSGGGIGRLGICSLGIVPFINAQIVFQLLGQIYPK  700
            SFSGGGIGRLGICSLGIVPFINAQIVFQLL Q+YPK
Sbjct  178  SFSGGGIGRLGICSLGIVPFINAQIVFQLLAQVYPK  213



>ref|XP_002309386.2| hypothetical protein POPTR_0006s18970g [Populus trichocarpa]
 gb|EEE92909.2| hypothetical protein POPTR_0006s18970g [Populus trichocarpa]
Length=536

 Score =   202 bits (513),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 131/211 (62%), Positives = 153/211 (73%), Gaps = 15/211 (7%)
 Frame = +2

Query  92   MLITVREV---SSLSHCFAAFNTPRTNR--NTLICRASSVRLHGNPSLTHQSWNPITSS-  253
            ML+TVRE    S +S   +  N+ R ++   T +CRAS       P    +SWN   +S 
Sbjct  1    MLLTVREACPCSPISFNLSRLNSTRFSQRLKTSVCRAS---FSVQPKPNAKSWNSTLNSN  57

Query  254  --DNSVFDPLGINSSRSSHLNTAWESAVGFVLKAFESTSGTRKEKNSSARRVAAAIEDTS  427
              ++S FDPLGIN      LN AWES + F+    ES S TRK+K    R VAAAIED+S
Sbjct  58   SCESSSFDPLGINLDGPPSLNAAWESLLAFLSPILESASNTRKDK----RGVAAAIEDSS  113

Query  428  IDFGDffkgplpgkflkllgYLALSRVGIYVPLGGVNRDAFVGNLDENSILSTLDSFSGG  607
            IDFGDFFKGPLPGKFLKLLG+L +SR+GIY+PLGGVNR+AF GNLD+NS+LSTLDSFSGG
Sbjct  114  IDFGDFFKGPLPGKFLKLLGFLVVSRLGIYIPLGGVNREAFAGNLDQNSLLSTLDSFSGG  173

Query  608  GIGRLGICSLGIVPFINAQIVFQLLGQIYPK  700
            GIGRLGI SLGIVPFINAQIVFQLL QIYPK
Sbjct  174  GIGRLGIFSLGIVPFINAQIVFQLLAQIYPK  204



>gb|KFK40258.1| hypothetical protein AALP_AA3G350900 [Arabis alpina]
Length=551

 Score =   201 bits (512),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 118/164 (72%), Positives = 137/164 (84%), Gaps = 6/164 (4%)
 Frame = +2

Query  227  QSWNPI------TSSDNSVFDPLGINSSRSSHLNTAWESAVGFVLKAFESTSGTRKEKNS  388
            +SWN +       SS+ SVFDPLGIN   +  L++ WES V  +   FES+S  +++K S
Sbjct  55   KSWNNLGLVINSRSSEASVFDPLGINPEEAFGLSSIWESFVSVLSPTFESSSSNKRDKPS  114

Query  389  SARRVAAAIEDTSIDFGDffkgplpgkflkllgYLALSRVGIYVPLGGVNRDAFVGNLDE  568
            S R VAAAIED+SIDFGDFFKGPLPGKFLKLLG+LALSR+GIYVPLGGVNR+AFVGNLD+
Sbjct  115  SGRGVAAAIEDSSIDFGDFFKGPLPGKFLKLLGFLALSRLGIYVPLGGVNREAFVGNLDQ  174

Query  569  NSILSTLDSFSGGGIGRLGICSLGIVPFINAQIVFQLLGQIYPK  700
            NS+LSTLD+FSGGGIGRLGICSLGIVPFINAQIVFQLL Q+YPK
Sbjct  175  NSLLSTLDTFSGGGIGRLGICSLGIVPFINAQIVFQLLAQVYPK  218



>ref|XP_012077483.1| PREDICTED: preprotein translocase subunit SCY1, chloroplastic 
isoform X1 [Jatropha curcas]
 gb|KDP34242.1| hypothetical protein JCGZ_07813 [Jatropha curcas]
Length=546

 Score =   201 bits (510),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 130/216 (60%), Positives = 154/216 (71%), Gaps = 16/216 (7%)
 Frame = +2

Query  92   MLITVREVSSLSHCFAAFNTPRTNRNTL----------ICRASSVRLHGNPSLTHQSWNP  241
            MLIT  E    S    A ++P TN N            +CRA+   +   P+ T +  + 
Sbjct  1    MLITAGEACPFSPICFALSSP-TNHNVSRKLYPRLKASVCRAT-FSVQSKPNSTTKPLDT  58

Query  242  ---ITSSDNSVFDPLGINSSRSSHLNTAWESAVGFVLKAFESTSGTRKEKNSSARRVAAA  412
                 S ++SVFDPLGIN+   S LN+AWE  +  +    ES S  +++K  SAR VAAA
Sbjct  59   SLNFNSCEDSVFDPLGINTDVYSGLNSAWERLLALLSPISESASSAKRDK-PSARGVAAA  117

Query  413  IEDTSIDFGDffkgplpgkflkllgYLALSRVGIYVPLGGVNRDAFVGNLDENSILSTLD  592
            IED+SIDFGDFFKGPLPGKFLKLLG+LALSR+GIY+PLGGVNRDAF GNLD+NS+LSTLD
Sbjct  118  IEDSSIDFGDFFKGPLPGKFLKLLGFLALSRLGIYIPLGGVNRDAFAGNLDQNSLLSTLD  177

Query  593  SFSGGGIGRLGICSLGIVPFINAQIVFQLLGQIYPK  700
            SFSGGGIGRLGICSLGIVPFINAQIVFQLL Q+YPK
Sbjct  178  SFSGGGIGRLGICSLGIVPFINAQIVFQLLAQVYPK  213



>emb|CBI24093.3| unnamed protein product [Vitis vinifera]
Length=577

 Score =   201 bits (511),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 142/247 (57%), Positives = 168/247 (68%), Gaps = 47/247 (19%)
 Frame = +2

Query  92   MLITVREVSSLSHCF----------AAFNTPRTNRNTLICRASSVRLHGNPSLTHQSWN-  238
            M+ITVRE SS + CF          A+  +PR  RN+ + RAS   +H  P+ T  SWN 
Sbjct  1    MMITVREASSSALCFNLNLSRSSHPASTASPRL-RNS-VSRAS-FAVHTKPNSTPNSWNL  57

Query  239  ----------------------PITSSDN-----------SVFDPLGINSSRSSHLNTAW  319
                                  P+  S N            VFDPLGI+S +S  LN  W
Sbjct  58   ALFCNRTFCGKKILRPTMIIYIPLDVSPNMINMDSSFCKGPVFDPLGIDSDKSLGLNATW  117

Query  320  ESAVGFVLKAFESTSGTRKEKNSSARRVAAAIEDTSIDFGDffkgplpgkflkllgYLAL  499
            ESA+G + + F STS T+K+K++S + VAAAIED+SIDFGDFFKGPLPGKFLKLLG LAL
Sbjct  118  ESALGLLSQTFGSTSSTKKDKSASGQGVAAAIEDSSIDFGDFFKGPLPGKFLKLLGLLAL  177

Query  500  SRVGIYVPLGGVNRDAFVGNLDENSILSTLDSFSGGGIGRLGICSLGIVPFINAQIVFQL  679
            SR+G+YVPLGGVNR+AFVGNLD+NS+L+TLDSFSGGGIGRLGICSLGIVPFINAQIVFQL
Sbjct  178  SRLGVYVPLGGVNREAFVGNLDQNSLLTTLDSFSGGGIGRLGICSLGIVPFINAQIVFQL  237

Query  680  LGQIYPK  700
            L QIYPK
Sbjct  238  LTQIYPK  244



>ref|XP_011010036.1| PREDICTED: preprotein translocase subunit SCY1, chloroplastic-like 
isoform X2 [Populus euphratica]
Length=536

 Score =   197 bits (500),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 131/211 (62%), Positives = 152/211 (72%), Gaps = 15/211 (7%)
 Frame = +2

Query  92   MLITVR---EVSSLSHCFAAFNTPRTNR--NTLICRASSVRLHGNPSLTHQSWNP---IT  247
            ML+TVR     SS+S   +  N+ R ++   T  CRAS       P    +SWN      
Sbjct  1    MLLTVRVACPCSSISFNLSHLNSTRFSQRLKTSACRAS---FSVQPKPNTKSWNSTLNFN  57

Query  248  SSDNSVFDPLGINSSRSSHLNTAWESAVGFVLKAFESTSGTRKEKNSSARRVAAAIEDTS  427
            S ++S FDPLGIN    S LN A ES + F+   FES S T+K+K    R VAAAIED+S
Sbjct  58   SCESSSFDPLGINLDVPSSLNAAGESLLAFLSPIFESASSTKKDK----RGVAAAIEDSS  113

Query  428  IDFGDffkgplpgkflkllgYLALSRVGIYVPLGGVNRDAFVGNLDENSILSTLDSFSGG  607
            IDFGDFFKGPLPGKFLKLLG+L +SR+GIY+PLGGVNR+AF GNLD+NS+LSTLDSFSGG
Sbjct  114  IDFGDFFKGPLPGKFLKLLGFLVVSRLGIYIPLGGVNREAFAGNLDQNSLLSTLDSFSGG  173

Query  608  GIGRLGICSLGIVPFINAQIVFQLLGQIYPK  700
            GIGRLGI SLGIVPFINAQIVFQLL QIYPK
Sbjct  174  GIGRLGIFSLGIVPFINAQIVFQLLAQIYPK  204



>ref|XP_011010034.1| PREDICTED: preprotein translocase subunit SCY1, chloroplastic-like 
isoform X1 [Populus euphratica]
Length=541

 Score =   197 bits (500),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 131/211 (62%), Positives = 152/211 (72%), Gaps = 15/211 (7%)
 Frame = +2

Query  92   MLITVR---EVSSLSHCFAAFNTPRTNR--NTLICRASSVRLHGNPSLTHQSWNP---IT  247
            ML+TVR     SS+S   +  N+ R ++   T  CRAS       P    +SWN      
Sbjct  1    MLLTVRVACPCSSISFNLSHLNSTRFSQRLKTSACRAS---FSVQPKPNTKSWNSTLNFN  57

Query  248  SSDNSVFDPLGINSSRSSHLNTAWESAVGFVLKAFESTSGTRKEKNSSARRVAAAIEDTS  427
            S ++S FDPLGIN    S LN A ES + F+   FES S T+K+K    R VAAAIED+S
Sbjct  58   SCESSSFDPLGINLDVPSSLNAAGESLLAFLSPIFESASSTKKDK----RGVAAAIEDSS  113

Query  428  IDFGDffkgplpgkflkllgYLALSRVGIYVPLGGVNRDAFVGNLDENSILSTLDSFSGG  607
            IDFGDFFKGPLPGKFLKLLG+L +SR+GIY+PLGGVNR+AF GNLD+NS+LSTLDSFSGG
Sbjct  114  IDFGDFFKGPLPGKFLKLLGFLVVSRLGIYIPLGGVNREAFAGNLDQNSLLSTLDSFSGG  173

Query  608  GIGRLGICSLGIVPFINAQIVFQLLGQIYPK  700
            GIGRLGI SLGIVPFINAQIVFQLL QIYPK
Sbjct  174  GIGRLGIFSLGIVPFINAQIVFQLLAQIYPK  204



>ref|XP_002886190.1| hypothetical protein ARALYDRAFT_480774 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH62449.1| hypothetical protein ARALYDRAFT_480774 [Arabidopsis lyrata subsp. 
lyrata]
Length=549

 Score =   197 bits (500),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 127/188 (68%), Positives = 150/188 (80%), Gaps = 10/188 (5%)
 Frame = +2

Query  137  AAFNTPRTNRNTLICRASSVRLHGNPSLTHQSWNPITSSDNSVFDPLGINSSRSSHLNTA  316
            A+F+     RNT  C+A S     N  L   S     SS+ SVFDPLGIN   +S L++ 
Sbjct  39   ASFSVSTKTRNT--CKAKS----WNLGLVINS----RSSEASVFDPLGINPDETSGLSSI  88

Query  317  WESAVGFVLKAFESTSGTRKEKNSSARRVAAAIEDTSIDFGDffkgplpgkflkllgYLA  496
            WES V  +  ++ES+SG++++K SS R VAAAIED+SIDFGDFFKGPLPGKFLKLLG+LA
Sbjct  89   WESFVSLLSPSYESSSGSKRDKPSSGRGVAAAIEDSSIDFGDFFKGPLPGKFLKLLGFLA  148

Query  497  LSRVGIYVPLGGVNRDAFVGNLDENSILSTLDSFSGGGIGRLGICSLGIVPFINAQIVFQ  676
            LSR+GIY+PLGGVNR+AFVGNLD+NSILSTLD+FSGGGIGRLGICSLGIVPFINAQIVFQ
Sbjct  149  LSRLGIYIPLGGVNREAFVGNLDQNSILSTLDTFSGGGIGRLGICSLGIVPFINAQIVFQ  208

Query  677  LLGQIYPK  700
            LL Q+YPK
Sbjct  209  LLAQVYPK  216



>ref|XP_009102226.1| PREDICTED: preprotein translocase subunit SCY1, chloroplastic 
[Brassica rapa]
Length=551

 Score =   194 bits (492),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 124/187 (66%), Positives = 151/187 (81%), Gaps = 8/187 (4%)
 Frame = +2

Query  140  AFNTPRTNRNTLICRASSVRLHGNPSLTHQSWNPITSSDNSVFDPLGINSSRSSHLNTAW  319
            +F+ P   RNT  C+A+S +   N  L   S     SS+ S FDPLGIN   +S L++ W
Sbjct  40   SFSIPTKTRNT-CCKANSWK---NLGLVINS----RSSEVSTFDPLGINPKEASGLSSIW  91

Query  320  ESAVGFVLKAFESTSGTRKEKNSSARRVAAAIEDTSIDFGDffkgplpgkflkllgYLAL  499
            ES +  +  +FES+SG++++K SS R VAAAIED+SIDFGDFFKGPLPGKFLKLLG+LAL
Sbjct  92   ESLLSVLSPSFESSSGSKRDKPSSGRGVAAAIEDSSIDFGDFFKGPLPGKFLKLLGFLAL  151

Query  500  SRVGIYVPLGGVNRDAFVGNLDENSILSTLDSFSGGGIGRLGICSLGIVPFINAQIVFQL  679
            SR+GIY+PLGGVNR+AFVGNLD+NS+L+TLD+FSGGGIGRLGICSLGIVPFINAQIVFQL
Sbjct  152  SRLGIYIPLGGVNREAFVGNLDQNSLLTTLDTFSGGGIGRLGICSLGIVPFINAQIVFQL  211

Query  680  LGQIYPK  700
            L Q+YPK
Sbjct  212  LAQVYPK  218



>ref|XP_009396241.1| PREDICTED: preprotein translocase subunit SCY1, chloroplastic 
[Musa acuminata subsp. malaccensis]
Length=557

 Score =   194 bits (492),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 134/226 (59%), Positives = 158/226 (70%), Gaps = 23/226 (10%)
 Frame = +2

Query  92   MLITVREV-SSLSHC--FAAFNTPRTNRNTLI--------CRASSV-RLHGNPSLTHQSW  235
            ML++ RE+ S+ SH   F+ F + R+   +L         CRASS       P      W
Sbjct  1    MLLSARELLSAPSHGIHFSTFPSARSPAASLAFARTRGGPCRASSSGAADAEPRRRSVPW  60

Query  236  NP-----------ITSSDNSVFDPLGINSSRSSHLNTAWESAVGFVLKAFESTSGTRKEK  382
            +            I  SD SVFDPLG+N   S  L   WES + F  + FEST+ ++K+K
Sbjct  61   DTLRLNFSDDSRCIQPSDFSVFDPLGLNKESSLGLGALWESVLDFFSQTFESTASSKKDK  120

Query  383  NSSARRVAAAIEDTSIDFGDffkgplpgkflkllgYLALSRVGIYVPLGGVNRDAFVGNL  562
            +SS R VAAAIED+SID GDFFKGPLPGKFLKLLGYL LSR+G+YVPLGGVNR+AFVGNL
Sbjct  121  SSSKRGVAAAIEDSSIDIGDFFKGPLPGKFLKLLGYLTLSRLGVYVPLGGVNREAFVGNL  180

Query  563  DENSILSTLDSFSGGGIGRLGICSLGIVPFINAQIVFQLLGQIYPK  700
            D+NS+LSTLDSFSGGGIGRLG+CSLGIVPFINAQIVFQLL QIYPK
Sbjct  181  DQNSLLSTLDSFSGGGIGRLGVCSLGIVPFINAQIVFQLLTQIYPK  226



>emb|CDY49314.1| BnaA07g01530D [Brassica napus]
Length=551

 Score =   193 bits (491),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 124/187 (66%), Positives = 151/187 (81%), Gaps = 8/187 (4%)
 Frame = +2

Query  140  AFNTPRTNRNTLICRASSVRLHGNPSLTHQSWNPITSSDNSVFDPLGINSSRSSHLNTAW  319
            +F+ P   RNT  C+A+S +   N  L   S     SS+ S FDPLGIN   +S L++ W
Sbjct  40   SFSIPTKTRNT-CCKANSWK---NLGLVINS----RSSEVSTFDPLGINPKEASGLSSIW  91

Query  320  ESAVGFVLKAFESTSGTRKEKNSSARRVAAAIEDTSIDFGDffkgplpgkflkllgYLAL  499
            ES +  +  +FES+SG++++K SS R VAAAIED+SIDFGDFFKGPLPGKFLKLLG+LAL
Sbjct  92   ESLLSVLSPSFESSSGSKRDKPSSGRGVAAAIEDSSIDFGDFFKGPLPGKFLKLLGFLAL  151

Query  500  SRVGIYVPLGGVNRDAFVGNLDENSILSTLDSFSGGGIGRLGICSLGIVPFINAQIVFQL  679
            SR+GIY+PLGGVNR+AFVGNLD+NS+L+TLD+FSGGGIGRLGICSLGIVPFINAQIVFQL
Sbjct  152  SRLGIYIPLGGVNREAFVGNLDQNSLLTTLDTFSGGGIGRLGICSLGIVPFINAQIVFQL  211

Query  680  LGQIYPK  700
            L Q+YPK
Sbjct  212  LAQVYPK  218



>emb|CDY13013.1| BnaC07g03120D [Brassica napus]
Length=550

 Score =   191 bits (486),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 123/186 (66%), Positives = 149/186 (80%), Gaps = 9/186 (5%)
 Frame = +2

Query  143  FNTPRTNRNTLICRASSVRLHGNPSLTHQSWNPITSSDNSVFDPLGINSSRSSHLNTAWE  322
            F+ P   RNT  C+A+S +   N  L   S     SS+ S FDPLGIN   +S L++ WE
Sbjct  41   FSVPTKTRNT--CKANSWK---NLGLVINS----RSSEVSTFDPLGINPKEASGLSSIWE  91

Query  323  SAVGFVLKAFESTSGTRKEKNSSARRVAAAIEDTSIDFGDffkgplpgkflkllgYLALS  502
            S +  +  + ES+SG++++K SS R VAAAIED+SIDFGDFFKGPLPGKFLKLLG+LALS
Sbjct  92   SFLSVLSPSLESSSGSKRDKPSSGRGVAAAIEDSSIDFGDFFKGPLPGKFLKLLGFLALS  151

Query  503  RVGIYVPLGGVNRDAFVGNLDENSILSTLDSFSGGGIGRLGICSLGIVPFINAQIVFQLL  682
            R+GIY+PLGGVNR+AFVGNLD+NS+L+TLD+FSGGGIGRLGICSLGIVPFINAQIVFQLL
Sbjct  152  RLGIYIPLGGVNREAFVGNLDQNSLLTTLDTFSGGGIGRLGICSLGIVPFINAQIVFQLL  211

Query  683  GQIYPK  700
             Q+YPK
Sbjct  212  AQVYPK  217



>ref|XP_010656720.1| PREDICTED: preprotein translocase subunit SECY, chloroplastic 
isoform X2 [Vitis vinifera]
Length=503

 Score =   190 bits (483),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 115/146 (79%), Positives = 132/146 (90%), Gaps = 0/146 (0%)
 Frame = +2

Query  263  VFDPLGINSSRSSHLNTAWESAVGFVLKAFESTSGTRKEKNSSARRVAAAIEDTSIDFGD  442
            VFDPLGI+S +S  LN  WESA+G + + F STS T+K+K++S + VAAAIED+SIDFGD
Sbjct  25   VFDPLGIDSDKSLGLNATWESALGLLSQTFGSTSSTKKDKSASGQGVAAAIEDSSIDFGD  84

Query  443  ffkgplpgkflkllgYLALSRVGIYVPLGGVNRDAFVGNLDENSILSTLDSFSGGGIGRL  622
            FFKGPLPGKFLKLLG LALSR+G+YVPLGGVNR+AFVGNLD+NS+L+TLDSFSGGGIGRL
Sbjct  85   FFKGPLPGKFLKLLGLLALSRLGVYVPLGGVNREAFVGNLDQNSLLTTLDSFSGGGIGRL  144

Query  623  GICSLGIVPFINAQIVFQLLGQIYPK  700
            GICSLGIVPFINAQIVFQLL QIYPK
Sbjct  145  GICSLGIVPFINAQIVFQLLTQIYPK  170



>ref|XP_006409121.1| hypothetical protein EUTSA_v10022631mg [Eutrema salsugineum]
 gb|ESQ50574.1| hypothetical protein EUTSA_v10022631mg [Eutrema salsugineum]
Length=548

 Score =   191 bits (484),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 123/193 (64%), Positives = 149/193 (77%), Gaps = 20/193 (10%)
 Frame = +2

Query  137  AAFNTPRTNRNTLICRASSVRLHGNPSLTHQSWNPIT-----SSDNSVFDPLGINSSRSS  301
            A+F+     RNT  C+A             +SWN        SS+ S+FDPLGIN   +S
Sbjct  38   ASFSVSTKTRNT--CKA-------------KSWNLGVVINSRSSEASIFDPLGINPDETS  82

Query  302  HLNTAWESAVGFVLKAFESTSGTRKEKNSSARRVAAAIEDTSIDFGDffkgplpgkflkl  481
             L++ WES +  +  + ES+SG++++K SS R VAAAIED+SIDFGDFFKGPLPGKFLKL
Sbjct  83   GLSSVWESFLSLLSPSLESSSGSKRDKPSSGRGVAAAIEDSSIDFGDFFKGPLPGKFLKL  142

Query  482  lgYLALSRVGIYVPLGGVNRDAFVGNLDENSILSTLDSFSGGGIGRLGICSLGIVPFINA  661
            LG+LALSR+GIY+PLGGVNR+AFVGNLD+NS+LSTLD+FSGGGIGRLGICSLGIVPFINA
Sbjct  143  LGFLALSRLGIYIPLGGVNREAFVGNLDQNSLLSTLDTFSGGGIGRLGICSLGIVPFINA  202

Query  662  QIVFQLLGQIYPK  700
            QIVFQLL Q+YPK
Sbjct  203  QIVFQLLAQVYPK  215



>sp|P93690.1|SECY_SPIOL RecName: Full=Preprotein translocase subunit SECY, chloroplastic; 
AltName: Full=CpSecY; Flags: Precursor [Spinacia oleracea]
 emb|CAA91162.1| SecY [Spinacia oleracea]
Length=545

 Score =   189 bits (480),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 114/146 (78%), Positives = 129/146 (88%), Gaps = 0/146 (0%)
 Frame = +2

Query  263  VFDPLGINSSRSSHLNTAWESAVGFVLKAFESTSGTRKEKNSSARRVAAAIEDTSIDFGD  442
            VFDPLGI    S  + +AW+  + FV + FES+SGTRK+++SSAR VAAAIED+SIDFGD
Sbjct  70   VFDPLGIEQDNSWGVASAWDGVLKFVSQTFESSSGTRKDRSSSARGVAAAIEDSSIDFGD  129

Query  443  ffkgplpgkflkllgYLALSRVGIYVPLGGVNRDAFVGNLDENSILSTLDSFSGGGIGRL  622
            FFKGPLPGKFL LLG LALSR+GIYVPLGGVNR+AFVGNLD+NS +STLDSFSGGGIGRL
Sbjct  130  FFKGPLPGKFLTLLGLLALSRLGIYVPLGGVNREAFVGNLDQNSFISTLDSFSGGGIGRL  189

Query  623  GICSLGIVPFINAQIVFQLLGQIYPK  700
            GICSLGIVPFINAQIVFQLL Q+YPK
Sbjct  190  GICSLGIVPFINAQIVFQLLSQVYPK  215



>ref|XP_010414595.1| PREDICTED: preprotein translocase subunit SCY1, chloroplastic-like 
[Camelina sativa]
Length=553

 Score =   189 bits (481),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 116/151 (77%), Positives = 135/151 (89%), Gaps = 0/151 (0%)
 Frame = +2

Query  248  SSDNSVFDPLGINSSRSSHLNTAWESAVGFVLKAFESTSGTRKEKNSSARRVAAAIEDTS  427
            SS+ SVFDPLGIN   +S L++ WES    +  +FES+SG++++K SS R VAAAIED+S
Sbjct  70   SSEASVFDPLGINPEETSGLSSIWESFSSLLSPSFESSSGSKRDKPSSGRGVAAAIEDSS  129

Query  428  IDFGDffkgplpgkflkllgYLALSRVGIYVPLGGVNRDAFVGNLDENSILSTLDSFSGG  607
            IDFGDFFKGPLPGKFLKLLG+LALSR+GIY+PLGGVNR+AFVGNLD+NSILSTLD+FSGG
Sbjct  130  IDFGDFFKGPLPGKFLKLLGFLALSRLGIYIPLGGVNREAFVGNLDQNSILSTLDTFSGG  189

Query  608  GIGRLGICSLGIVPFINAQIVFQLLGQIYPK  700
            GIGRLGICSLGIVPFINAQIVFQLL Q+YPK
Sbjct  190  GIGRLGICSLGIVPFINAQIVFQLLSQVYPK  220



>ref|XP_010489581.1| PREDICTED: preprotein translocase subunit SCY1, chloroplastic-like 
[Camelina sativa]
Length=553

 Score =   189 bits (480),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 120/167 (72%), Positives = 140/167 (84%), Gaps = 5/167 (3%)
 Frame = +2

Query  215  SLTHQSWNP-----ITSSDNSVFDPLGINSSRSSHLNTAWESAVGFVLKAFESTSGTRKE  379
            S   +SWN        SS+ SVFDPLGIN   +S L++ WES    +  +FES+SG++++
Sbjct  54   SCKAKSWNRGLVINSRSSEASVFDPLGINPDETSGLSSIWESFSSLLSPSFESSSGSKRD  113

Query  380  KNSSARRVAAAIEDTSIDFGDffkgplpgkflkllgYLALSRVGIYVPLGGVNRDAFVGN  559
            K SS R VAAAIED+SIDFGDFFKGPLPGKFLKLLG+LALSR+GIY+PLGGVNR+AFVGN
Sbjct  114  KPSSGRGVAAAIEDSSIDFGDFFKGPLPGKFLKLLGFLALSRLGIYIPLGGVNREAFVGN  173

Query  560  LDENSILSTLDSFSGGGIGRLGICSLGIVPFINAQIVFQLLGQIYPK  700
            LD+NSILSTLD+FSGGGIGRLGICSLGIVPFINAQIVFQLL Q+YPK
Sbjct  174  LDQNSILSTLDTFSGGGIGRLGICSLGIVPFINAQIVFQLLSQVYPK  220



>ref|XP_010467702.1| PREDICTED: preprotein translocase subunit SCY1, chloroplastic 
isoform X1 [Camelina sativa]
 ref|XP_010467703.1| PREDICTED: preprotein translocase subunit SCY1, chloroplastic 
isoform X2 [Camelina sativa]
Length=552

 Score =   189 bits (480),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 116/151 (77%), Positives = 134/151 (89%), Gaps = 0/151 (0%)
 Frame = +2

Query  248  SSDNSVFDPLGINSSRSSHLNTAWESAVGFVLKAFESTSGTRKEKNSSARRVAAAIEDTS  427
            SS+ SVFDPLGIN    S L++ WES    +  +FES+SG++++K SS R VAAAIED+S
Sbjct  69   SSEASVFDPLGINPDEKSGLSSIWESFSSLLSPSFESSSGSKRDKPSSGRGVAAAIEDSS  128

Query  428  IDFGDffkgplpgkflkllgYLALSRVGIYVPLGGVNRDAFVGNLDENSILSTLDSFSGG  607
            IDFGDFFKGPLPGKFLKLLG+LALSR+GIY+PLGGVNR+AFVGNLD+NSILSTLD+FSGG
Sbjct  129  IDFGDFFKGPLPGKFLKLLGFLALSRLGIYIPLGGVNREAFVGNLDQNSILSTLDTFSGG  188

Query  608  GIGRLGICSLGIVPFINAQIVFQLLGQIYPK  700
            GIGRLGICSLGIVPFINAQIVFQLL Q+YPK
Sbjct  189  GIGRLGICSLGIVPFINAQIVFQLLAQVYPK  219



>ref|XP_010687713.1| PREDICTED: preprotein translocase subunit SECY, chloroplastic 
[Beta vulgaris subsp. vulgaris]
Length=535

 Score =   187 bits (474),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 114/146 (78%), Positives = 128/146 (88%), Gaps = 0/146 (0%)
 Frame = +2

Query  263  VFDPLGINSSRSSHLNTAWESAVGFVLKAFESTSGTRKEKNSSARRVAAAIEDTSIDFGD  442
            VFDPLGI + +S  +   W+  + FV + FESTSGTRK++ SS R VAAAIED+SIDFGD
Sbjct  60   VFDPLGIENDKSWDVAGTWDGVLRFVSQTFESTSGTRKDRPSSGRGVAAAIEDSSIDFGD  119

Query  443  ffkgplpgkflkllgYLALSRVGIYVPLGGVNRDAFVGNLDENSILSTLDSFSGGGIGRL  622
            FFKGPLPGKFLKLLG LALSR+GIYVPLGGVNR+AFVGNLD+NS +STLDSFSGGGIGRL
Sbjct  120  FFKGPLPGKFLKLLGLLALSRLGIYVPLGGVNREAFVGNLDQNSFISTLDSFSGGGIGRL  179

Query  623  GICSLGIVPFINAQIVFQLLGQIYPK  700
            GICSLGIVPFINAQIVFQLL Q+YPK
Sbjct  180  GICSLGIVPFINAQIVFQLLAQVYPK  205



>ref|XP_004514142.1| PREDICTED: preprotein translocase subunit SECY, chloroplastic-like 
isoform X4 [Cicer arietinum]
Length=481

 Score =   185 bits (470),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 130/205 (63%), Positives = 152/205 (74%), Gaps = 12/205 (6%)
 Frame = +2

Query  92   MLITVREVSSLSHCFAAFNTPRTNRNTL-ICRAS-SVRLHGNPSLTHQSWNPITSSDNSV  265
            MLITVRE S    C       R    +  ICR + SVR     S      N  TS D + 
Sbjct  1    MLITVREASPSLRCLWLNPLIRKPSKSFSICRPTFSVRTISTTS------NIFTSCDLAN  54

Query  266  FDPLGINSSRSSHLNTAWESAVGFVLKAFESTSGTRKEKNSSARRVAAAIEDTSIDFGDf  445
            FDPLGIN+  SS     W++ V    + FES+S T KEK++S+R VAAAIED+SIDFGDF
Sbjct  55   FDPLGINTDTSS----TWKNLVSLFPQTFESSSSTEKEKSNSSRGVAAAIEDSSIDFGDF  110

Query  446  fkgplpgkflkllgYLALSRVGIYVPLGGVNRDAFVGNLDENSILSTLDSFSGGGIGRLG  625
            FKGPLPGKFLKLLG+LALSR+G+Y+PLGGVNR+AF+GNLD+NS+LSTLDSFSGGGIGRLG
Sbjct  111  FKGPLPGKFLKLLGFLALSRLGVYIPLGGVNREAFLGNLDQNSLLSTLDSFSGGGIGRLG  170

Query  626  ICSLGIVPFINAQIVFQLLGQIYPK  700
            +CSLGIVPFINAQIVFQLL Q+YPK
Sbjct  171  LCSLGIVPFINAQIVFQLLAQVYPK  195



>ref|XP_004514141.1| PREDICTED: preprotein translocase subunit SECY, chloroplastic-like 
isoform X3 [Cicer arietinum]
Length=506

 Score =   185 bits (470),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 130/205 (63%), Positives = 152/205 (74%), Gaps = 12/205 (6%)
 Frame = +2

Query  92   MLITVREVSSLSHCFAAFNTPRTNRNTL-ICRAS-SVRLHGNPSLTHQSWNPITSSDNSV  265
            MLITVRE S    C       R    +  ICR + SVR     S      N  TS D + 
Sbjct  1    MLITVREASPSLRCLWLNPLIRKPSKSFSICRPTFSVRTISTTS------NIFTSCDLAN  54

Query  266  FDPLGINSSRSSHLNTAWESAVGFVLKAFESTSGTRKEKNSSARRVAAAIEDTSIDFGDf  445
            FDPLGIN+  SS     W++ V    + FES+S T KEK++S+R VAAAIED+SIDFGDF
Sbjct  55   FDPLGINTDTSS----TWKNLVSLFPQTFESSSSTEKEKSNSSRGVAAAIEDSSIDFGDF  110

Query  446  fkgplpgkflkllgYLALSRVGIYVPLGGVNRDAFVGNLDENSILSTLDSFSGGGIGRLG  625
            FKGPLPGKFLKLLG+LALSR+G+Y+PLGGVNR+AF+GNLD+NS+LSTLDSFSGGGIGRLG
Sbjct  111  FKGPLPGKFLKLLGFLALSRLGVYIPLGGVNREAFLGNLDQNSLLSTLDSFSGGGIGRLG  170

Query  626  ICSLGIVPFINAQIVFQLLGQIYPK  700
            +CSLGIVPFINAQIVFQLL Q+YPK
Sbjct  171  LCSLGIVPFINAQIVFQLLAQVYPK  195



>ref|XP_004514140.1| PREDICTED: preprotein translocase subunit SECY, chloroplastic-like 
isoform X2 [Cicer arietinum]
Length=526

 Score =   185 bits (470),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 130/205 (63%), Positives = 152/205 (74%), Gaps = 12/205 (6%)
 Frame = +2

Query  92   MLITVREVSSLSHCFAAFNTPRTNRNTL-ICRAS-SVRLHGNPSLTHQSWNPITSSDNSV  265
            MLITVRE S    C       R    +  ICR + SVR     S      N  TS D + 
Sbjct  1    MLITVREASPSLRCLWLNPLIRKPSKSFSICRPTFSVRTISTTS------NIFTSCDLAN  54

Query  266  FDPLGINSSRSSHLNTAWESAVGFVLKAFESTSGTRKEKNSSARRVAAAIEDTSIDFGDf  445
            FDPLGIN+  SS     W++ V    + FES+S T KEK++S+R VAAAIED+SIDFGDF
Sbjct  55   FDPLGINTDTSS----TWKNLVSLFPQTFESSSSTEKEKSNSSRGVAAAIEDSSIDFGDF  110

Query  446  fkgplpgkflkllgYLALSRVGIYVPLGGVNRDAFVGNLDENSILSTLDSFSGGGIGRLG  625
            FKGPLPGKFLKLLG+LALSR+G+Y+PLGGVNR+AF+GNLD+NS+LSTLDSFSGGGIGRLG
Sbjct  111  FKGPLPGKFLKLLGFLALSRLGVYIPLGGVNREAFLGNLDQNSLLSTLDSFSGGGIGRLG  170

Query  626  ICSLGIVPFINAQIVFQLLGQIYPK  700
            +CSLGIVPFINAQIVFQLL Q+YPK
Sbjct  171  LCSLGIVPFINAQIVFQLLAQVYPK  195



>ref|XP_004514139.1| PREDICTED: preprotein translocase subunit SECY, chloroplastic-like 
isoform X1 [Cicer arietinum]
Length=551

 Score =   185 bits (470),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 130/205 (63%), Positives = 152/205 (74%), Gaps = 12/205 (6%)
 Frame = +2

Query  92   MLITVREVSSLSHCFAAFNTPRTNRNTL-ICRAS-SVRLHGNPSLTHQSWNPITSSDNSV  265
            MLITVRE S    C       R    +  ICR + SVR     S      N  TS D + 
Sbjct  1    MLITVREASPSLRCLWLNPLIRKPSKSFSICRPTFSVRTISTTS------NIFTSCDLAN  54

Query  266  FDPLGINSSRSSHLNTAWESAVGFVLKAFESTSGTRKEKNSSARRVAAAIEDTSIDFGDf  445
            FDPLGIN+  SS     W++ V    + FES+S T KEK++S+R VAAAIED+SIDFGDF
Sbjct  55   FDPLGINTDTSS----TWKNLVSLFPQTFESSSSTEKEKSNSSRGVAAAIEDSSIDFGDF  110

Query  446  fkgplpgkflkllgYLALSRVGIYVPLGGVNRDAFVGNLDENSILSTLDSFSGGGIGRLG  625
            FKGPLPGKFLKLLG+LALSR+G+Y+PLGGVNR+AF+GNLD+NS+LSTLDSFSGGGIGRLG
Sbjct  111  FKGPLPGKFLKLLGFLALSRLGVYIPLGGVNREAFLGNLDQNSLLSTLDSFSGGGIGRLG  170

Query  626  ICSLGIVPFINAQIVFQLLGQIYPK  700
            +CSLGIVPFINAQIVFQLL Q+YPK
Sbjct  171  LCSLGIVPFINAQIVFQLLAQVYPK  195



>gb|EYU42460.1| hypothetical protein MIMGU_mgv1a004013mg [Erythranthe guttata]
Length=549

 Score =   182 bits (463),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 137/220 (62%), Positives = 156/220 (71%), Gaps = 19/220 (9%)
 Frame = +2

Query  92   MLITVREVSS-------LSHCFAAFN------TPRT----NRNTLICRASSVRLHGNPSL  220
            ML+TVR++SS       LSH   + N       PR     N  +  CRA+ + +H N   
Sbjct  1    MLLTVRQISSSLCSTASLSHTSLSKNRSFSDKPPRNYVVRNHRSSTCRAT-LTVHRNNGA  59

Query  221  THQSWNPITSSDNSVFDPLGINSSRSSHLNTAWESAVGFVLKAFESTSGTRKEKNSSARR  400
               +     S + SVFDPLGIN    S L TAWES +    +   STSGTRK+K+SS R 
Sbjct  60   AATTAGK-RSHETSVFDPLGINPDGLSDLKTAWESVLQIFSETLNSTSGTRKDKSSSTRG  118

Query  401  VAAAIEDTSIDFGDffkgplpgkflkllgYLALSRVGIYVPLGGVNRDAFVGNLDENSIL  580
             AAAIEDTSIDFGDFFKGPLPGKFLKLLG+LALSR+GIY+PLGGVNR+AFVGNLD NS+L
Sbjct  119  AAAAIEDTSIDFGDFFKGPLPGKFLKLLGFLALSRLGIYIPLGGVNREAFVGNLDSNSLL  178

Query  581  STLDSFSGGGIGRLGICSLGIVPFINAQIVFQLLGQIYPK  700
             TLDSFSGGGIGRLGI SLGIVPFINAQIVFQLL QIYPK
Sbjct  179  GTLDSFSGGGIGRLGIGSLGIVPFINAQIVFQLLTQIYPK  218



>ref|XP_011069862.1| PREDICTED: preprotein translocase subunit SCY1, chloroplastic 
[Sesamum indicum]
Length=544

 Score =   181 bits (458),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 134/219 (61%), Positives = 151/219 (69%), Gaps = 22/219 (10%)
 Frame = +2

Query  92   MLITVREVSSL----------------SHCFAAFNTPRTNRNTLICRASSVRLHGNPSLT  223
            MLI+VR++SS                 S C    N    N+   ICRA+      N S  
Sbjct  1    MLISVRQISSSLCSTTSLTHNSISRKRSFCAKPHNYVHKNQKKSICRATLTIHRKNNSSD  60

Query  224  HQSWNPITSSDNSVFDPLGINSSRSSHLNTAWESAVGFVLKAFESTSGTRKEKNSSARRV  403
             QS        ++VFDPLGIN    S L +AW S +    +  +STSGTRKEK SS+R  
Sbjct  61   KQS------PQSAVFDPLGINPDGLSDLRSAWGSLLELFSQPLQSTSGTRKEKTSSSRGA  114

Query  404  AAAIEDTSIDFGDffkgplpgkflkllgYLALSRVGIYVPLGGVNRDAFVGNLDENSILS  583
            AAAIEDTSID GDFFKGPLPGKFLKLLGYLALSR+GIY+PLGGVNR+AFVGNLD+NS+L 
Sbjct  115  AAAIEDTSIDIGDFFKGPLPGKFLKLLGYLALSRLGIYIPLGGVNREAFVGNLDQNSLLG  174

Query  584  TLDSFSGGGIGRLGICSLGIVPFINAQIVFQLLGQIYPK  700
            TLDSFSGGGIGRLGI SLGIVPFINAQIVFQLL QIYPK
Sbjct  175  TLDSFSGGGIGRLGIGSLGIVPFINAQIVFQLLTQIYPK  213



>ref|XP_006659975.1| PREDICTED: preprotein translocase subunit SECY, chloroplastic-like 
[Oryza brachyantha]
Length=619

 Score =   177 bits (449),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 108/149 (72%), Positives = 121/149 (81%), Gaps = 3/149 (2%)
 Frame = +2

Query  263  VFDPLGI---NSSRSSHLNTAWESAVGFVLKAFESTSGTRKEKNSSARRVAAAIEDTSID  433
            VFDPLG+     SR    ++   +  G +   F S+SG RKEK+S  R  AAAIED+SID
Sbjct  138  VFDPLGLYNGGPSRPDTQSSPLSNFFGILSPVFGSSSGARKEKSSYGRGAAAAIEDSSID  197

Query  434  FGDffkgplpgkflkllgYLALSRVGIYVPLGGVNRDAFVGNLDENSILSTLDSFSGGGI  613
             GDFFKGPLPGKFLKLLGYLALSR+GIY+PLGGVNRDAF GNLD+NS+L TLDSFSGGGI
Sbjct  198  IGDFFKGPLPGKFLKLLGYLALSRLGIYIPLGGVNRDAFAGNLDQNSLLGTLDSFSGGGI  257

Query  614  GRLGICSLGIVPFINAQIVFQLLGQIYPK  700
            GRLGICSLGIVPFINAQIVFQLL Q+YPK
Sbjct  258  GRLGICSLGIVPFINAQIVFQLLAQLYPK  286



>sp|Q9XQU4.1|SECY_PEA RecName: Full=Preprotein translocase subunit SECY, chloroplastic; 
AltName: Full=CpSecY; Flags: Precursor [Pisum sativum]
 gb|AAD33936.1|AF144684_1 secY [Pisum sativum]
Length=527

 Score =   174 bits (442),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 122/207 (59%), Positives = 147/207 (71%), Gaps = 15/207 (7%)
 Frame = +2

Query  92   MLITVREVSSLSHCFAAFNTPRTNRNTLICRA--SSVRLHGNPSLTHQSWNP--ITSSDN  259
            MLITVR+ S    C +        ++ L  R   SS R H        S +    TS D 
Sbjct  1    MLITVRDPSPTLRCSSLNRRLIPTKHNLSPRLLRSSFRQHNLSLRLRSSSSSNLYTSCDL  60

Query  260  SVFDPLGINSSRSSHLNTAWESAVGFVLKAFESTSGTRKEKNSSARRVAAAIEDTSIDFG  439
            + FDPLGIN   SS  ++ W +    +L  F+++S  +K+K    R VAAAIED+SIDFG
Sbjct  61   ANFDPLGINPDLSS--SSTWRN----LLTIFQTSS--QKDK---PRGVAAAIEDSSIDFG  109

Query  440  DffkgplpgkflkllgYLALSRVGIYVPLGGVNRDAFVGNLDENSILSTLDSFSGGGIGR  619
            DFF GPLPGKFLKLLG+LALSR+G+Y+PLGGVNRDAF+GNLD+NS+L+TLDSFSGGGIGR
Sbjct  110  DFFNGPLPGKFLKLLGFLALSRLGVYIPLGGVNRDAFLGNLDQNSLLTTLDSFSGGGIGR  169

Query  620  LGICSLGIVPFINAQIVFQLLGQIYPK  700
            LGICSLGIVPFINAQIVFQLL Q+YPK
Sbjct  170  LGICSLGIVPFINAQIVFQLLAQVYPK  196



>ref|XP_003573616.1| PREDICTED: preprotein translocase subunit SECY, chloroplastic 
[Brachypodium distachyon]
Length=548

 Score =   174 bits (442),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 110/181 (61%), Positives = 131/181 (72%), Gaps = 15/181 (8%)
 Frame = +2

Query  182  RASSVRLHG------NPSLTHQSWNPITSSDNSVFDPLGI--NSSRSSHLNTAWESAVGF  337
            R +SVR  G      +P  T ++  P        FDPLG+  +    S   +   +  G 
Sbjct  42   RTASVRRRGRTAFACSPRCTLETAGP-------AFDPLGLYKDDPSGSDYQSPLSTFFGI  94

Query  338  VLKAFESTSGTRKEKNSSARRVAAAIEDTSIDFGDffkgplpgkflkllgYLALSRVGIY  517
            +L  F S+SG+R EK+S  R  AAA+ED+SID GDFFKGPLPGKFLKLLG+L LSR+G+Y
Sbjct  95   LLPVFGSSSGSRNEKSSYGRGAAAAMEDSSIDIGDFFKGPLPGKFLKLLGFLVLSRIGVY  154

Query  518  VPLGGVNRDAFVGNLDENSILSTLDSFSGGGIGRLGICSLGIVPFINAQIVFQLLGQIYP  697
            VPLGGVNR+AF GNLD+NS+L TLDSFSGGGIGRLGICSLGIVPFINAQIVFQLL Q+YP
Sbjct  155  VPLGGVNREAFAGNLDQNSLLGTLDSFSGGGIGRLGICSLGIVPFINAQIVFQLLAQLYP  214

Query  698  K  700
            K
Sbjct  215  K  215



>gb|KEH38065.1| preprotein translocase subunit SecY [Medicago truncatula]
Length=546

 Score =   172 bits (437),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 126/212 (59%), Positives = 149/212 (70%), Gaps = 23/212 (11%)
 Frame = +2

Query  86   ITMLITVREVS-SLSHCFAAFNTPRTNR------NTLICRASSVRLHGNPSLTHQSWNPI  244
            I MLITV++ S S   C    N P   +      ++ ICRA+      + +  H S    
Sbjct  20   IMMLITVKQASPSPRWCVRLNNRPLIPKPSSSSSSSSICRATLSVRRISTTQPHLS----  75

Query  245  TSSDNSVFDPLGINSSRSSHLNTAWESAVGFVLKAFESTSGTRKEKNSSARRVAAAIEDT  424
            TS D + FDPLGINSS SS   + W++ V      FES+   R         VAAAIED+
Sbjct  76   TSCDVANFDPLGINSSSSSS--STWKNIVSL----FESSEKPR------GGGVAAAIEDS  123

Query  425  SIDFGDffkgplpgkflkllgYLALSRVGIYVPLGGVNRDAFVGNLDENSILSTLDSFSG  604
            SIDFGDFFKGPLPGKFLKLLG+LALSR+G+Y+PLGGVNR+AF+GNLD+NS+LSTLDSFSG
Sbjct  124  SIDFGDFFKGPLPGKFLKLLGFLALSRLGVYIPLGGVNREAFLGNLDQNSLLSTLDSFSG  183

Query  605  GGIGRLGICSLGIVPFINAQIVFQLLGQIYPK  700
            GGIGRLGICSLGIVPFINAQIVFQLL Q+YPK
Sbjct  184  GGIGRLGICSLGIVPFINAQIVFQLLAQVYPK  215



>gb|EEC83207.1| hypothetical protein OsI_28473 [Oryza sativa Indica Group]
Length=1155

 Score =   174 bits (442),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 108/147 (73%), Positives = 120/147 (82%), Gaps = 2/147 (1%)
 Frame = +2

Query  266  FDPLGINSSRSSHLNTA--WESAVGFVLKAFESTSGTRKEKNSSARRVAAAIEDTSIDFG  439
            FDPLG+ +   S  +T     S  G +   F S+SG RKEK+S  R  AAAIED+SID G
Sbjct  676  FDPLGLYNDGPSRNDTQSPLSSFFGILSPVFGSSSGGRKEKSSYGRGAAAAIEDSSIDIG  735

Query  440  DffkgplpgkflkllgYLALSRVGIYVPLGGVNRDAFVGNLDENSILSTLDSFSGGGIGR  619
            DFFKGPLPGKFLKLLGYLALSR+GIY+PLGGVNRDAF GNLD+NS+L TLDSFSGGGIGR
Sbjct  736  DFFKGPLPGKFLKLLGYLALSRLGIYIPLGGVNRDAFAGNLDQNSLLGTLDSFSGGGIGR  795

Query  620  LGICSLGIVPFINAQIVFQLLGQIYPK  700
            LGICSLGIVPFINAQIVFQLL Q+YPK
Sbjct  796  LGICSLGIVPFINAQIVFQLLAQLYPK  822



>ref|XP_011623808.1| PREDICTED: preprotein translocase subunit SCY1, chloroplastic 
[Amborella trichopoda]
Length=526

 Score =   170 bits (430),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 122/192 (64%), Positives = 139/192 (72%), Gaps = 19/192 (10%)
 Frame = +2

Query  146  NTPRTNRNTLICRASSVRLHGNPSLTHQSWN---PITSS----DNSVFDPLGINSSRSSH  304
            +T R +  T I RAS    +  PS     W    P   S     NSVFDPLG      S 
Sbjct  16   STGRFSPKTRIFRASLTVPNPQPS-----WKFSIPFKRSFQEKGNSVFDPLGFYKETCS-  69

Query  305  LNTAWESAVGFVLKAFESTSGTRKEKNSSARRVAAAIEDTSIDFGDffkgplpgkflkll  484
            +++ W+    F+L   +STS TR+EK+S +R VAAAIED+SID GDFFKGPLPGKFLKLL
Sbjct  70   VSSTWKI---FLL---QSTSSTRQEKSSPSRGVAAAIEDSSIDIGDFFKGPLPGKFLKLL  123

Query  485  gYLALSRVGIYVPLGGVNRDAFVGNLDENSILSTLDSFSGGGIGRLGICSLGIVPFINAQ  664
            G LALSRVG Y+PLGGVNR+AF G LD+NS+LSTLDSFSGGGIGRLGICSLGIVPFINAQ
Sbjct  124  GLLALSRVGTYIPLGGVNREAFTGTLDQNSLLSTLDSFSGGGIGRLGICSLGIVPFINAQ  183

Query  665  IVFQLLGQIYPK  700
            IVFQLL QIYPK
Sbjct  184  IVFQLLTQIYPK  195



>gb|ERN07204.1| hypothetical protein AMTR_s00019p00172430 [Amborella trichopoda]
Length=499

 Score =   169 bits (428),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 114/165 (69%), Positives = 130/165 (79%), Gaps = 8/165 (5%)
 Frame = +2

Query  206  GNPSLTHQSWNPITSSDNSVFDPLGINSSRSSHLNTAWESAVGFVLKAFESTSGTRKEKN  385
            GNP L   + +      NSVFDPLG      S +++ W+    F+L   +STS TR+EK+
Sbjct  12   GNPWLGGVALS-FQEKGNSVFDPLGFYKETCS-VSSTWKI---FLL---QSTSSTRQEKS  63

Query  386  SSARRVAAAIEDTSIDFGDffkgplpgkflkllgYLALSRVGIYVPLGGVNRDAFVGNLD  565
            S +R VAAAIED+SID GDFFKGPLPGKFLKLLG LALSRVG Y+PLGGVNR+AF G LD
Sbjct  64   SPSRGVAAAIEDSSIDIGDFFKGPLPGKFLKLLGLLALSRVGTYIPLGGVNREAFTGTLD  123

Query  566  ENSILSTLDSFSGGGIGRLGICSLGIVPFINAQIVFQLLGQIYPK  700
            +NS+LSTLDSFSGGGIGRLGICSLGIVPFINAQIVFQLL QIYPK
Sbjct  124  QNSLLSTLDSFSGGGIGRLGICSLGIVPFINAQIVFQLLTQIYPK  168



>ref|NP_001061381.1| Os08g0254500 [Oryza sativa Japonica Group]
 sp|Q6ZG25.1|SECY_ORYSJ RecName: Full=Preprotein translocase subunit SECY, chloroplastic; 
AltName: Full=CpSecY; Flags: Precursor [Oryza sativa Japonica 
Group]
 dbj|BAC98517.1| putative Preprotein translocase secY subunit, chloroplast precursor 
[Oryza sativa Japonica Group]
 dbj|BAC98535.1| putative Preprotein translocase secY subunit, chloroplast precursor 
[Oryza sativa Japonica Group]
 dbj|BAF23295.1| Os08g0254500 [Oryza sativa Japonica Group]
 gb|EAZ42069.1| hypothetical protein OsJ_26630 [Oryza sativa Japonica Group]
Length=556

 Score =   169 bits (428),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 107/147 (73%), Positives = 119/147 (81%), Gaps = 3/147 (2%)
 Frame = +2

Query  266  FDPLGINSSRSSHLNTA--WESAVGFVLKAFESTSGTRKEKNSSARRVAAAIEDTSIDFG  439
            FDPLG+ +   S  +T     +  G +   F S+SG RKEK S  R  AAAIED+SID G
Sbjct  78   FDPLGLYNDGPSRNDTQSPLSNFFGVLSPVFGSSSGGRKEK-SYGRGAAAAIEDSSIDIG  136

Query  440  DffkgplpgkflkllgYLALSRVGIYVPLGGVNRDAFVGNLDENSILSTLDSFSGGGIGR  619
            DFFKGPLPGKFLKLLGYLALSR+GIY+PLGGVNRDAF GNLD+NS+L TLDSFSGGGIGR
Sbjct  137  DFFKGPLPGKFLKLLGYLALSRLGIYIPLGGVNRDAFAGNLDQNSLLGTLDSFSGGGIGR  196

Query  620  LGICSLGIVPFINAQIVFQLLGQIYPK  700
            LGICSLGIVPFINAQIVFQLL Q+YPK
Sbjct  197  LGICSLGIVPFINAQIVFQLLAQLYPK  223



>ref|XP_002445291.1| hypothetical protein SORBIDRAFT_07g007870 [Sorghum bicolor]
 gb|EES14786.1| hypothetical protein SORBIDRAFT_07g007870 [Sorghum bicolor]
Length=552

 Score =   166 bits (419),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 112/191 (59%), Positives = 130/191 (68%), Gaps = 10/191 (5%)
 Frame = +2

Query  137  AAFNTPRTNRNTLICRASSVRLHGNPSLTHQSWNPITSSDNSVFDPLGINSSRS-SHLNT  313
            A F   R    T   R     L  +P  T ++  P        FDPLG+    S S   +
Sbjct  36   AHFYPLRRRIATATARGRRAPLACSPRCTLETAGP-------GFDPLGLYEEGSDSPSRS  88

Query  314  AWESAVGFVLKAFESTSG--TRKEKNSSARRVAAAIEDTSIDFGDffkgplpgkflkllg  487
               +  G +   F S+SG   R+EK S  R  AAAIED+SID GDFFKGPLPGKFLKLLG
Sbjct  89   PLSNFFGILAPVFGSSSGGGARREKASYGRGAAAAIEDSSIDIGDFFKGPLPGKFLKLLG  148

Query  488  YLALSRVGIYVPLGGVNRDAFVGNLDENSILSTLDSFSGGGIGRLGICSLGIVPFINAQI  667
            +LALSR+G+Y+PLGGVNR+AF GNLD+NS+L TLDSFSGGGIGRLGICSLGIVPFINAQI
Sbjct  149  FLALSRLGVYIPLGGVNREAFAGNLDQNSLLGTLDSFSGGGIGRLGICSLGIVPFINAQI  208

Query  668  VFQLLGQIYPK  700
            VFQLL Q+YPK
Sbjct  209  VFQLLAQLYPK  219



>gb|AAB96657.1| SecY homolog [Zea mays]
Length=343

 Score =   158 bits (399),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 110/189 (58%), Positives = 131/189 (69%), Gaps = 18/189 (10%)
 Frame = +2

Query  140  AFNTPRTNRNTLICRASSVRLHGNPSLTHQSWNPITSSDNSVFDPLGINSSRSSHLN-TA  316
            A  T R  R TL C         +P  T ++  P        FDPLG+    S+ L+ + 
Sbjct  3    AITTTRGRRGTLDC---------SPRCTLETAGP-------GFDPLGLYEEGSNSLSRSP  46

Query  317  WESAVGFVLKAFESTSGTRKEK-NSSARRVAAAIEDTSIDFGDffkgplpgkflkllgYL  493
              +  G +   F S+SG    +  +S R  AAAIED+SID GDFFKGPLPGKFLKLLG+L
Sbjct  47   LSTFFGIMAPVFGSSSGGGASREKASGRGAAAAIEDSSIDIGDFFKGPLPGKFLKLLGFL  106

Query  494  ALSRVGIYVPLGGVNRDAFVGNLDENSILSTLDSFSGGGIGRLGICSLGIVPFINAQIVF  673
            ALSR+G+Y+PLGGVNR+AF GNLD+NS+L TLDSFSGGGIGRLGICSLGIVPFINAQIVF
Sbjct  107  ALSRLGVYIPLGGVNREAFAGNLDQNSLLGTLDSFSGGGIGRLGICSLGIVPFINAQIVF  166

Query  674  QLLGQIYPK  700
            QLL Q+YPK
Sbjct  167  QLLAQLYPK  175



>gb|EPS66347.1| hypothetical protein M569_08427, partial [Genlisea aurea]
Length=460

 Score =   160 bits (404),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 108/129 (84%), Positives = 116/129 (90%), Gaps = 0/129 (0%)
 Frame = +2

Query  314  AWESAVGFVLKAFESTSGTRKEKNSSARRVAAAIEDTSIDFGDffkgplpgkflkllgYL  493
            AWES  G   + F S+S TR EK+SSARRVAAAIEDTSID GDFFKGPLPGKFLKLLGYL
Sbjct  1    AWESCTGLFSQLFTSSSDTRNEKSSSARRVAAAIEDTSIDIGDFFKGPLPGKFLKLLGYL  60

Query  494  ALSRVGIYVPLGGVNRDAFVGNLDENSILSTLDSFSGGGIGRLGICSLGIVPFINAQIVF  673
            ALSR+GIY+PLGGVNR+AFVGNLD+NS+L TLDSFSGGGIGRLGI SLGIVPFINAQIVF
Sbjct  61   ALSRLGIYIPLGGVNREAFVGNLDQNSLLGTLDSFSGGGIGRLGIGSLGIVPFINAQIVF  120

Query  674  QLLGQIYPK  700
            QLL QIYPK
Sbjct  121  QLLAQIYPK  129



>ref|NP_001105505.2| preprotein translocase subunit SECY, chloroplastic [Zea mays]
 gb|ACF84716.1| unknown [Zea mays]
Length=553

 Score =   159 bits (401),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 110/189 (58%), Positives = 131/189 (69%), Gaps = 18/189 (10%)
 Frame = +2

Query  140  AFNTPRTNRNTLICRASSVRLHGNPSLTHQSWNPITSSDNSVFDPLGINSSRSSHLN-TA  316
            A  T R  R TL C         +P  T ++  P        FDPLG+    S+ L+ + 
Sbjct  48   AITTTRGRRGTLDC---------SPRCTLETAGP-------GFDPLGLYEEGSNSLSRSP  91

Query  317  WESAVGFVLKAFESTSGTRKEK-NSSARRVAAAIEDTSIDFGDffkgplpgkflkllgYL  493
              +  G +   F S+SG    +  +S R  AAAIED+SID GDFFKGPLPGKFLKLLG+L
Sbjct  92   LSTFFGIMAPVFGSSSGGGASREKASGRGAAAAIEDSSIDIGDFFKGPLPGKFLKLLGFL  151

Query  494  ALSRVGIYVPLGGVNRDAFVGNLDENSILSTLDSFSGGGIGRLGICSLGIVPFINAQIVF  673
            ALSR+G+Y+PLGGVNR+AF GNLD+NS+L TLDSFSGGGIGRLGICSLGIVPFINAQIVF
Sbjct  152  ALSRLGVYIPLGGVNREAFAGNLDQNSLLGTLDSFSGGGIGRLGICSLGIVPFINAQIVF  211

Query  674  QLLGQIYPK  700
            QLL Q+YPK
Sbjct  212  QLLAQLYPK  220



>sp|O63066.1|SECY_MAIZE RecName: Full=Preprotein translocase subunit SECY, chloroplastic; 
AltName: Full=CpSecY; Flags: Precursor [Zea mays]
 gb|AAC05019.1| cpSecY [Zea mays]
Length=553

 Score =   159 bits (401),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 110/189 (58%), Positives = 131/189 (69%), Gaps = 18/189 (10%)
 Frame = +2

Query  140  AFNTPRTNRNTLICRASSVRLHGNPSLTHQSWNPITSSDNSVFDPLGINSSRSSHLN-TA  316
            A  T R  R TL C         +P  T ++  P        FDPLG+    S+ L+ + 
Sbjct  48   AITTTRGRRGTLDC---------SPRCTLETAGP-------GFDPLGLYEEGSNSLSRSP  91

Query  317  WESAVGFVLKAFESTSGTRKEK-NSSARRVAAAIEDTSIDFGDffkgplpgkflkllgYL  493
              +  G +   F S+SG    +  +S R  AAAIED+SID GDFFKGPLPGKFLKLLG+L
Sbjct  92   LSTFFGIMAPVFGSSSGGGASREKASGRGAAAAIEDSSIDIGDFFKGPLPGKFLKLLGFL  151

Query  494  ALSRVGIYVPLGGVNRDAFVGNLDENSILSTLDSFSGGGIGRLGICSLGIVPFINAQIVF  673
            ALSR+G+Y+PLGGVNR+AF GNLD+NS+L TLDSFSGGGIGRLGICSLGIVPFINAQIVF
Sbjct  152  ALSRLGVYIPLGGVNREAFAGNLDQNSLLGTLDSFSGGGIGRLGICSLGIVPFINAQIVF  211

Query  674  QLLGQIYPK  700
            QLL Q+YPK
Sbjct  212  QLLAQLYPK  220



>gb|AFW56837.1| chloroplast SecY-1 [Zea mays]
Length=553

 Score =   155 bits (392),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 109/189 (58%), Positives = 130/189 (69%), Gaps = 18/189 (10%)
 Frame = +2

Query  140  AFNTPRTNRNTLICRASSVRLHGNPSLTHQSWNPITSSDNSVFDPLGINSSRSSHLN-TA  316
            A  T R  R TL C         +P  T ++  P        F PLG+    S+ L+ + 
Sbjct  48   AITTTRGRRGTLDC---------SPRCTLETAGP-------GFYPLGLYEEGSNSLSRSP  91

Query  317  WESAVGFVLKAFESTSGTRKEK-NSSARRVAAAIEDTSIDFGDffkgplpgkflkllgYL  493
              +  G +   F S+SG    +  +S R  AAAIED+SID GDFFKGPLPGKFLKLLG+L
Sbjct  92   LSTFFGIMAPVFGSSSGGGASREKASGRGAAAAIEDSSIDIGDFFKGPLPGKFLKLLGFL  151

Query  494  ALSRVGIYVPLGGVNRDAFVGNLDENSILSTLDSFSGGGIGRLGICSLGIVPFINAQIVF  673
            ALSR+G+Y+PLGGVNR+AF GNLD+NS+L TLDSFSGGGIGRLGICSLGIVPFINAQIVF
Sbjct  152  ALSRLGVYIPLGGVNREAFAGNLDQNSLLGTLDSFSGGGIGRLGICSLGIVPFINAQIVF  211

Query  674  QLLGQIYPK  700
            QLL Q+YPK
Sbjct  212  QLLAQLYPK  220



>gb|KDO62391.1| hypothetical protein CISIN_1g009193mg [Citrus sinensis]
 gb|KDO62392.1| hypothetical protein CISIN_1g009193mg [Citrus sinensis]
Length=429

 Score =   146 bits (369),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 87/96 (91%), Positives = 94/96 (98%), Gaps = 0/96 (0%)
 Frame = +2

Query  413  IEDTSIDFGDffkgplpgkflkllgYLALSRVGIYVPLGGVNRDAFVGNLDENSILSTLD  592
            +ED+SIDFGDFFKGPLPGKFLKLLGYLALSR+GIY+PLGGVNR+AFVGNLD+NS+LSTLD
Sbjct  1    MEDSSIDFGDFFKGPLPGKFLKLLGYLALSRLGIYIPLGGVNREAFVGNLDQNSLLSTLD  60

Query  593  SFSGGGIGRLGICSLGIVPFINAQIVFQLLGQIYPK  700
            SFSGGGIGRLGICSLGIVPFINAQIVFQLL QI PK
Sbjct  61   SFSGGGIGRLGICSLGIVPFINAQIVFQLLAQINPK  96



>gb|EMS49011.1| Preprotein translocase subunit secY, chloroplastic [Triticum 
urartu]
Length=451

 Score =   139 bits (351),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 81/96 (84%), Positives = 92/96 (96%), Gaps = 0/96 (0%)
 Frame = +2

Query  413  IEDTSIDFGDffkgplpgkflkllgYLALSRVGIYVPLGGVNRDAFVGNLDENSILSTLD  592
            +ED++IDFGDFFKGPLPGKFLKLLG+LALSR+G+Y+PLGGVN+ AF GNLD+NS+L TLD
Sbjct  1    MEDSTIDFGDFFKGPLPGKFLKLLGFLALSRLGVYIPLGGVNQAAFAGNLDQNSLLGTLD  60

Query  593  SFSGGGIGRLGICSLGIVPFINAQIVFQLLGQIYPK  700
            SFSGGGIGRLGICSLGIVPFINAQIVFQLL Q+YPK
Sbjct  61   SFSGGGIGRLGICSLGIVPFINAQIVFQLLTQLYPK  96



>gb|EMT21873.1| Preprotein translocase subunit secY, chloroplastic [Aegilops 
tauschii]
Length=562

 Score =   139 bits (350),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 81/96 (84%), Positives = 92/96 (96%), Gaps = 0/96 (0%)
 Frame = +2

Query  413  IEDTSIDFGDffkgplpgkflkllgYLALSRVGIYVPLGGVNRDAFVGNLDENSILSTLD  592
            +ED++IDFGDFFKGPLPGKFLKLLG+LALSR+G+Y+PLGGVN+ AF GNLD+NS+L TLD
Sbjct  1    MEDSTIDFGDFFKGPLPGKFLKLLGFLALSRLGVYIPLGGVNQAAFAGNLDQNSLLGTLD  60

Query  593  SFSGGGIGRLGICSLGIVPFINAQIVFQLLGQIYPK  700
            SFSGGGIGRLGICSLGIVPFINAQIVFQLL Q+YPK
Sbjct  61   SFSGGGIGRLGICSLGIVPFINAQIVFQLLTQLYPK  96



>ref|XP_002993375.1| hypothetical protein SELMODRAFT_187415 [Selaginella moellendorffii]
 gb|EFJ05560.1| hypothetical protein SELMODRAFT_187415 [Selaginella moellendorffii]
Length=503

 Score =   139 bits (349),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 89/147 (61%), Positives = 111/147 (76%), Gaps = 6/147 (4%)
 Frame = +2

Query  266  FDPLGINSSRSSHLNTAWESAVGFVLKAF--ESTSGTRKEKNSSARRVAAAIEDTSIDFG  439
            FDPLGI    + +   AW       +KA   + TSG    K S+ + +AAAIED+SIDFG
Sbjct  35   FDPLGICEPANGNFVAAWGDLCVVAMKAIGNKQTSG----KQSTGKGIAAAIEDSSIDFG  90

Query  440  DffkgplpgkflkllgYLALSRVGIYVPLGGVNRDAFVGNLDENSILSTLDSFSGGGIGR  619
            DFF+G LPGKFL LLG+LALSRVG Y+PL GV+R AF G++ +NS+  TLD+FSGGGIGR
Sbjct  91   DFFRGKLPGKFLLLLGWLALSRVGTYIPLPGVDRAAFSGSMTDNSLFRTLDAFSGGGIGR  150

Query  620  LGICSLGIVPFINAQIVFQLLGQIYPK  700
            LG+CSLGIVPFINAQI+FQLLG ++P+
Sbjct  151  LGVCSLGIVPFINAQILFQLLGSLFPE  177



>ref|XP_006297673.1| hypothetical protein CARUB_v10013710mg [Capsella rubella]
 gb|EOA30571.1| hypothetical protein CARUB_v10013710mg [Capsella rubella]
Length=443

 Score =   137 bits (346),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 87/99 (88%), Positives = 96/99 (97%), Gaps = 0/99 (0%)
 Frame = +2

Query  404  AAAIEDTSIDFGDffkgplpgkflkllgYLALSRVGIYVPLGGVNRDAFVGNLDENSILS  583
            +AAIED+SIDFGDFFKGPLPGKFL+LLG LALSR+GIY+PLGGVN +AFVGNLD+NSILS
Sbjct  12   SAAIEDSSIDFGDFFKGPLPGKFLQLLGLLALSRLGIYIPLGGVNGEAFVGNLDQNSILS  71

Query  584  TLDSFSGGGIGRLGICSLGIVPFINAQIVFQLLGQIYPK  700
            TLD+FSGGGIGRLGICSLGIVPFINAQIVFQLL Q+YPK
Sbjct  72   TLDTFSGGGIGRLGICSLGIVPFINAQIVFQLLAQVYPK  110



>ref|XP_002972955.1| hypothetical protein SELMODRAFT_98540, partial [Selaginella moellendorffii]
 gb|EFJ26176.1| hypothetical protein SELMODRAFT_98540, partial [Selaginella moellendorffii]
Length=424

 Score =   119 bits (299),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 73/98 (74%), Positives = 88/98 (90%), Gaps = 0/98 (0%)
 Frame = +2

Query  407  AAIEDTSIDFGDffkgplpgkflkllgYLALSRVGIYVPLGGVNRDAFVGNLDENSILST  586
            AAIED+SIDFGDFF+G LPGKFL LLG+LALSRVG Y+PL GV+R AF G++ +NS+  T
Sbjct  1    AAIEDSSIDFGDFFRGKLPGKFLLLLGWLALSRVGTYIPLPGVDRAAFSGSMTDNSLFRT  60

Query  587  LDSFSGGGIGRLGICSLGIVPFINAQIVFQLLGQIYPK  700
            LD+FSGGGIGRLG+CSLGIVPFINAQI+FQLLG ++P+
Sbjct  61   LDAFSGGGIGRLGVCSLGIVPFINAQILFQLLGSLFPE  98



>gb|EAZ06230.1| hypothetical protein OsI_28472 [Oryza sativa Indica Group]
Length=241

 Score =   114 bits (286),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 79/116 (68%), Positives = 90/116 (78%), Gaps = 2/116 (2%)
 Frame = +2

Query  266  FDPLGINSSRSSHLNT--AWESAVGFVLKAFESTSGTRKEKNSSARRVAAAIEDTSIDFG  439
            FDPLG+ +   S  +T     S  G +   F S+SG RKEK+S  R  AAAIED+SID G
Sbjct  79   FDPLGLYNDGPSRNDTQSPLSSFFGILSPVFGSSSGGRKEKSSYGRGAAAAIEDSSIDIG  138

Query  440  DffkgplpgkflkllgYLALSRVGIYVPLGGVNRDAFVGNLDENSILSTLDSFSGG  607
            DFFKGPLPGKFLKLLGYLALSR+GIY+PLGGVNRDAF GNLD+NS+L TLDSFSGG
Sbjct  139  DFFKGPLPGKFLKLLGYLALSRLGIYIPLGGVNRDAFAGNLDQNSLLGTLDSFSGG  194



>ref|XP_001754986.1| predicted protein [Physcomitrella patens]
 gb|EDQ80440.1| predicted protein [Physcomitrella patens]
Length=543

 Score =   115 bits (288),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 90/184 (49%), Positives = 114/184 (62%), Gaps = 23/184 (13%)
 Frame = +2

Query  152  PRTNRNTLICRAS-SVRLHGNPSLTHQSWNPITSSDNSVFDPLGINSSRSSHLNTAWESA  328
            P   R+   CRA+ +V   G+   +   W          FDPLG+     S    A +SA
Sbjct  47   PWRARHAFSCRAALAVDREGS---SEGDWR---------FDPLGLEDDSQSFSWNAIQSA  94

Query  329  VGFVLKAFESTSGTRKEKNSSARRVAAAIEDTSIDFGDffkgplpgkflkllgYLALSRV  508
                         +R    SS++  AAA+ED S+DFGDFFKG LP KFL LLG+L LSR+
Sbjct  95   F----------MMSRSGSGSSSKGAAAAMEDKSVDFGDFFKGKLPEKFLILLGWLILSRI  144

Query  509  GIYVPLGGVNRDAFVGNLDENSILSTLDSFSGGGIGRLGICSLGIVPFINAQIVFQLLGQ  688
            G Y+PL GV+R AF G++D NS+L TL++FSGG IGRLG+ SLGIVPFINAQIV QLLG 
Sbjct  145  GTYIPLWGVDRSAFQGSIDTNSLLGTLNTFSGGSIGRLGLASLGIVPFINAQIVVQLLGT  204

Query  689  IYPK  700
            ++PK
Sbjct  205  VFPK  208



>ref|XP_005649807.1| pre protein translocase secY subunit [Coccomyxa subellipsoidea 
C-169]
 gb|EIE25263.1| pre protein translocase secY subunit [Coccomyxa subellipsoidea 
C-169]
Length=537

 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 52/123 (42%), Positives = 73/123 (59%), Gaps = 5/123 (4%)
 Frame = +2

Query  329  VGFVLKAFESTSGTRKEKNSSARRVAAAIEDTSIDFGDffkgplpgkflkllgYLALSRV  508
            +G  L+  ++T+  R +  S A++      D   +FGDF KG LPGK   +L  +  SRV
Sbjct  94   LGMSLRYLQATTDRRPKAQSGAQK-----GDGGFNFGDFLKGDLPGKLGIILALIVFSRV  148

Query  509  GIYVPLGGVNRDAFVGNLDENSILSTLDSFSGGGIGRLGICSLGIVPFINAQIVFQLLGQ  688
            G+Y+ L GV+ D F   +    IL  +D+ SGG I R+GI SLGIVP+INA I+ QLL  
Sbjct  149  GVYMRLPGVDADRFAETVQSGGILGYIDALSGGSISRVGIFSLGIVPYINASIILQLLAT  208

Query  689  IYP  697
             +P
Sbjct  209  TFP  211



>ref|XP_007512827.1| preprotein translocase subunit SecY [Bathycoccus prasinos]
 emb|CCO17427.1| preprotein translocase subunit SecY [Bathycoccus prasinos]
Length=558

 Score = 78.6 bits (192),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 35/71 (49%), Positives = 53/71 (75%), Gaps = 1/71 (1%)
 Frame = +2

Query  491  LALSRVGIYVPLGGVNRDAFVGNL-DENSILSTLDSFSGGGIGRLGICSLGIVPFINAQI  667
            L +SR+G Y+P+ GV+R AF  +L +   ++S +D+ +GG I +LGI SLGIVPFIN+ I
Sbjct  157  LVVSRIGAYIPISGVDRTAFAESLSNTGGVMSYVDTLTGGSISKLGIFSLGIVPFINSSI  216

Query  668  VFQLLGQIYPK  700
            +FQLL  ++P+
Sbjct  217  IFQLLSSVFPE  227



>ref|XP_003078812.1| SecY homolog; targetted to the thylakoid membrane; the protein 
has a chloroplast targetting signal, but the processing site 
is not known (ISS) [Ostreococcus tauri]
Length=552

 Score = 78.2 bits (191),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 36/71 (51%), Positives = 52/71 (73%), Gaps = 1/71 (1%)
 Frame = +2

Query  491  LALSRVGIYVPLGGVNRDAFVGNLDENS-ILSTLDSFSGGGIGRLGICSLGIVPFINAQI  667
            L LSRVG Y+P+ GV+R AF  +L     ++  +D+ +GG I +LGI SLGIVP+IN+ I
Sbjct  126  LVLSRVGTYIPISGVDRAAFAESLSGGGGVMGYVDTLTGGSISKLGIFSLGIVPYINSSI  185

Query  668  VFQLLGQIYPK  700
            +FQLLG ++P+
Sbjct  186  IFQLLGSVFPE  196



>ref|XP_002508181.1| type II secretory pathway family [Micromonas sp. RCC299]
 gb|ACO69439.1| type II secretory pathway family [Micromonas sp. RCC299]
Length=423

 Score = 77.4 bits (189),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 37/70 (53%), Positives = 52/70 (74%), Gaps = 1/70 (1%)
 Frame = +2

Query  491  LALSRVGIYVPLGGVNRDAFVGNLDEN-SILSTLDSFSGGGIGRLGICSLGIVPFINAQI  667
            L LSRVG Y+P+ GV+RDAF  +L    ++L  +D+ +GG I +LGI SLGIVP+IN+ I
Sbjct  20   LILSRVGTYIPISGVDRDAFAESLQGGGNVLGYVDTLTGGSISKLGIFSLGIVPYINSSI  79

Query  668  VFQLLGQIYP  697
            +FQLL  ++P
Sbjct  80   IFQLLTSVFP  89



>emb|CEF97600.1| SecY/SEC61-alpha family [Ostreococcus tauri]
Length=422

 Score = 77.0 bits (188),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 36/71 (51%), Positives = 52/71 (73%), Gaps = 1/71 (1%)
 Frame = +2

Query  491  LALSRVGIYVPLGGVNRDAFVGNLDENS-ILSTLDSFSGGGIGRLGICSLGIVPFINAQI  667
            L LSRVG Y+P+ GV+R AF  +L     ++  +D+ +GG I +LGI SLGIVP+IN+ I
Sbjct  20   LVLSRVGTYIPISGVDRAAFAESLSGGGGVMGYVDTLTGGSISKLGIFSLGIVPYINSSI  79

Query  668  VFQLLGQIYPK  700
            +FQLLG ++P+
Sbjct  80   IFQLLGSVFPE  90



>gb|AIA21530.1| preprotein translocase subunit SecY [Pyropia fucicola]
Length=411

 Score = 76.6 bits (187),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 33/69 (48%), Positives = 54/69 (78%), Gaps = 0/69 (0%)
 Frame = +2

Query  491  LALSRVGIYVPLGGVNRDAFVGNLDENSILSTLDSFSGGGIGRLGICSLGIVPFINAQIV  670
            L L+R+GI++P+ G++ DAF  ++++N++++ L+ FSGGG   +GI +LGIVP+IN+ IV
Sbjct  18   LVLARLGIFIPVPGIDHDAFYASVEKNTLVNFLNIFSGGGFSTIGIFALGIVPYINSSIV  77

Query  671  FQLLGQIYP  697
             QLL +I P
Sbjct  78   MQLLTKIVP  86



>ref|YP_536977.1| preprotein translocase subunit SecY [Pyropia yezoensis]
 sp|Q1XDJ1.1|SECY_PYRYE RecName: Full=Protein translocase subunit SecY (chloroplast) 
[Pyropia yezoensis]
 dbj|BAE92420.1| Preprotein translocase subunit [Pyropia yezoensis]
 gb|AGH27623.1| preprotein translocase subunit SecY (chloroplast) [Pyropia yezoensis]
Length=411

 Score = 76.6 bits (187),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 33/69 (48%), Positives = 54/69 (78%), Gaps = 0/69 (0%)
 Frame = +2

Query  491  LALSRVGIYVPLGGVNRDAFVGNLDENSILSTLDSFSGGGIGRLGICSLGIVPFINAQIV  670
            L L+R+GI++P+ G++ DAF  ++++N++++ L+ FSGGG   +GI +LGIVP+IN+ IV
Sbjct  18   LVLARLGIFIPVPGIDHDAFYASVEKNTLVNFLNIFSGGGFSTIGIFALGIVPYINSSIV  77

Query  671  FQLLGQIYP  697
             QLL +I P
Sbjct  78   MQLLTKIVP  86



>gb|ABJ91302.1| preprotein translocase subunit [Pyropia yezoensis]
Length=411

 Score = 76.6 bits (187),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 33/69 (48%), Positives = 54/69 (78%), Gaps = 0/69 (0%)
 Frame = +2

Query  491  LALSRVGIYVPLGGVNRDAFVGNLDENSILSTLDSFSGGGIGRLGICSLGIVPFINAQIV  670
            L L+R+GI++P+ G++ DAF  ++++N++++ L+ FSGGG   +GI +LGIVP+IN+ IV
Sbjct  18   LVLARLGIFIPVPGIDHDAFYASVEKNTLVNFLNIFSGGGFSTIGIFALGIVPYINSSIV  77

Query  671  FQLLGQIYP  697
             QLL +I P
Sbjct  78   MQLLTKIVP  86



>ref|XP_002508180.1| SecY protein [Micromonas sp. RCC299]
 gb|ACO69438.1| SecY protein [Micromonas sp. RCC299]
Length=487

 Score = 77.0 bits (188),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 37/70 (53%), Positives = 52/70 (74%), Gaps = 1/70 (1%)
 Frame = +2

Query  491  LALSRVGIYVPLGGVNRDAFVGNLDEN-SILSTLDSFSGGGIGRLGICSLGIVPFINAQI  667
            L LSRVG Y+P+ GV+RDAF  +L    ++L  +D+ +GG I +LGI SLGIVP+IN+ I
Sbjct  84   LILSRVGTYIPISGVDRDAFAESLQGGGNVLGYVDTLTGGSISKLGIFSLGIVPYINSSI  143

Query  668  VFQLLGQIYP  697
            +FQLL  ++P
Sbjct  144  IFQLLTSVFP  153



>gb|AFC39966.1| preprotein translocase subunit SecY [Porphyra umbilicalis]
Length=411

 Score = 76.3 bits (186),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 33/69 (48%), Positives = 54/69 (78%), Gaps = 0/69 (0%)
 Frame = +2

Query  491  LALSRVGIYVPLGGVNRDAFVGNLDENSILSTLDSFSGGGIGRLGICSLGIVPFINAQIV  670
            L L+R+GI++P+ G++ DAF  ++++N++++ L+ FSGGG   +GI +LGIVP+IN+ IV
Sbjct  18   LILARLGIFIPVPGIDHDAFYASVEKNTLVNFLNIFSGGGFSTIGIFALGIVPYINSSIV  77

Query  671  FQLLGQIYP  697
             QLL +I P
Sbjct  78   MQLLTKIIP  86



>ref|YP_007947826.1| preprotein translocase subunit SecY (chloroplast) [Pyropia haitanensis]
 gb|AGG37075.1| preprotein translocase subunit SecY (chloroplast) [Pyropia haitanensis]
Length=411

 Score = 76.3 bits (186),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 33/69 (48%), Positives = 54/69 (78%), Gaps = 0/69 (0%)
 Frame = +2

Query  491  LALSRVGIYVPLGGVNRDAFVGNLDENSILSTLDSFSGGGIGRLGICSLGIVPFINAQIV  670
            L L+R+GI++P+ G++ DAF  ++++N++++ L+ FSGGG   +GI +LGIVP+IN+ IV
Sbjct  18   LVLARLGIFIPVPGIDHDAFYASVEKNTLVNFLNIFSGGGFSTIGIFALGIVPYINSSIV  77

Query  671  FQLLGQIYP  697
             QLL +I P
Sbjct  78   MQLLTKIIP  86



>gb|AIA21324.1| preprotein translocase subunit SecY [Pyropia kanakaensis]
Length=411

 Score = 75.9 bits (185),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 32/69 (46%), Positives = 54/69 (78%), Gaps = 0/69 (0%)
 Frame = +2

Query  491  LALSRVGIYVPLGGVNRDAFVGNLDENSILSTLDSFSGGGIGRLGICSLGIVPFINAQIV  670
            L L+R+GI++P+ G++ DAF  ++++N++++ L+ FSGGG   +G+ +LGIVP+IN+ IV
Sbjct  18   LVLARLGIFIPVPGIDHDAFYASVEKNTLVNFLNIFSGGGFSTIGVFALGIVPYINSSIV  77

Query  671  FQLLGQIYP  697
             QLL +I P
Sbjct  78   MQLLTKIIP  86



>ref|XP_001417520.1| IISP family transporter: preprotein translocase SecY subunit 
[Ostreococcus lucimarinus CCE9901]
 gb|ABO95813.1| IISP family transporter: preprotein translocase SecY subunit 
[Ostreococcus lucimarinus CCE9901]
Length=423

 Score = 75.9 bits (185),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 36/71 (51%), Positives = 52/71 (73%), Gaps = 1/71 (1%)
 Frame = +2

Query  491  LALSRVGIYVPLGGVNRDAFVGNL-DENSILSTLDSFSGGGIGRLGICSLGIVPFINAQI  667
            L LSRVG Y+P+ GV+R AF  +L     +++  D+ +GG I +LGI SLGIVP+IN+ I
Sbjct  20   LVLSRVGTYIPISGVDRAAFAESLAGGGGMMAYADTLTGGSISKLGIFSLGIVPYINSSI  79

Query  668  VFQLLGQIYPK  700
            +FQLLG ++P+
Sbjct  80   IFQLLGSVFPE  90



>ref|YP_009027579.1| preprotein translocase subunit SecY [Pyropia perforata]
 gb|AGQ17114.1| preprotein translocase subunit SecY [Pyropia perforata]
 gb|AHB35073.1| preprotein translocase subunit SecY (chloroplast) [Pyropia perforata]
 gb|AHB35282.1| preprotein translocase subunit SecY (chloroplast) [Pyropia perforata]
 gb|AIA19444.1| preprotein translocase subunit SecY [Pyropia perforata]
 gb|AIA19653.1| preprotein translocase subunit SecY [Pyropia perforata]
 gb|AIA19862.1| preprotein translocase subunit SecY [Pyropia perforata]
 gb|AIA20071.1| preprotein translocase subunit SecY [Pyropia perforata]
 gb|AIA20280.1| preprotein translocase subunit SecY [Pyropia perforata]
 gb|AIA20489.1| preprotein translocase subunit SecY [Pyropia perforata]
 gb|AIA20698.1| preprotein translocase subunit SecY [Pyropia perforata]
 gb|AIA20907.1| preprotein translocase subunit SecY [Pyropia perforata]
 gb|AIA21116.1| preprotein translocase subunit SecY [Pyropia perforata]
Length=411

 Score = 75.9 bits (185),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 32/69 (46%), Positives = 54/69 (78%), Gaps = 0/69 (0%)
 Frame = +2

Query  491  LALSRVGIYVPLGGVNRDAFVGNLDENSILSTLDSFSGGGIGRLGICSLGIVPFINAQIV  670
            L L+R+GI++P+ G++ DAF  ++++N++++ L+ FSGGG   +G+ +LGIVP+IN+ IV
Sbjct  18   LVLARLGIFIPVPGIDHDAFYASVEKNTLVNFLNIFSGGGFSTIGVFALGIVPYINSSIV  77

Query  671  FQLLGQIYP  697
             QLL +I P
Sbjct  78   MQLLTKIIP  86



>ref|WP_015125761.1| preprotein translocase subunit SecY [Synechococcus sp. PCC 6312]
 gb|AFY62221.1| protein translocase subunit secY/sec61 alpha [Synechococcus sp. 
PCC 6312]
Length=436

 Score = 73.9 bits (180),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 34/69 (49%), Positives = 47/69 (68%), Gaps = 0/69 (0%)
 Frame = +2

Query  491  LALSRVGIYVPLGGVNRDAFVGNLDENSILSTLDSFSGGGIGRLGICSLGIVPFINAQIV  670
            L L R+GIY+P+ G++R  F   +  NS++  LD FSGGGI  LGI +LGI+P+INA I+
Sbjct  35   LILVRLGIYLPVPGIDRQVFAAAVQNNSVIRFLDIFSGGGISALGIFALGILPYINASII  94

Query  671  FQLLGQIYP  697
             QL+    P
Sbjct  95   MQLMTAALP  103



>ref|WP_026099036.1| preprotein translocase subunit SecY [Oscillatoria sp. PCC 10802]
Length=437

 Score = 73.6 bits (179),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 35/69 (51%), Positives = 48/69 (70%), Gaps = 0/69 (0%)
 Frame = +2

Query  491  LALSRVGIYVPLGGVNRDAFVGNLDENSILSTLDSFSGGGIGRLGICSLGIVPFINAQIV  670
            L L R+GI++P+ GVNR AF  N+  + ++  LD FSGGGI  LGI +LGI+P+INA I+
Sbjct  35   LILVRLGIFLPVPGVNRSAFTANISNSPLIGFLDFFSGGGIRTLGIFALGILPYINASII  94

Query  671  FQLLGQIYP  697
             QL+    P
Sbjct  95   LQLMTAAIP  103



>ref|WP_015186050.1| preprotein translocase subunit SecY [Microcoleus sp. PCC 7113]
 gb|AFZ21922.1| protein translocase subunit secY/sec61 alpha [Microcoleus sp. 
PCC 7113]
Length=448

 Score = 73.6 bits (179),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 35/69 (51%), Positives = 49/69 (71%), Gaps = 0/69 (0%)
 Frame = +2

Query  491  LALSRVGIYVPLGGVNRDAFVGNLDENSILSTLDSFSGGGIGRLGICSLGIVPFINAQIV  670
            L ++R+GI++PL G++R  F  ++  NS+L  LD FSGGGI  +GI +LGI+PFINA I+
Sbjct  35   LIVARMGIFLPLPGIDRARFSADIQNNSVLGFLDIFSGGGISAVGIFALGILPFINASII  94

Query  671  FQLLGQIYP  697
             QLL    P
Sbjct  95   LQLLTAAIP  103



>ref|XP_003057705.1| type II secretory pathway family protein [Micromonas pusilla 
CCMP1545]
 gb|EEH57656.1| type II secretory pathway family protein [Micromonas pusilla 
CCMP1545]
Length=423

 Score = 73.2 bits (178),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 35/70 (50%), Positives = 50/70 (71%), Gaps = 1/70 (1%)
 Frame = +2

Query  491  LALSRVGIYVPLGGVNRDAFVGNL-DENSILSTLDSFSGGGIGRLGICSLGIVPFINAQI  667
            L +SR+G Y+P+ GV+R AF  +L     +L  +D+ +GG I +LGI SLGIVPFIN+ I
Sbjct  16   LVVSRIGTYIPISGVDRAAFAESLAGGGGMLGYVDTLTGGSISKLGIFSLGIVPFINSSI  75

Query  668  VFQLLGQIYP  697
            +FQLL  ++P
Sbjct  76   IFQLLTSVFP  85



>ref|WP_040943655.1| preprotein translocase subunit SecY [Prochloron didemni]
Length=440

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 34/69 (49%), Positives = 47/69 (68%), Gaps = 0/69 (0%)
 Frame = +2

Query  491  LALSRVGIYVPLGGVNRDAFVGNLDENSILSTLDSFSGGGIGRLGICSLGIVPFINAQIV  670
            L L R G+++PL G+NRDAF   + +  +L  LD F+GGGI  +GI +LGI+P+INA I+
Sbjct  35   LVLVRFGVFIPLPGINRDAFQQGIQDLPVLGFLDIFTGGGISAVGIFALGILPYINASII  94

Query  671  FQLLGQIYP  697
             QLL    P
Sbjct  95   MQLLTAAIP  103



>ref|WP_015167576.1| preprotein translocase subunit SecY [Synechococcus sp. PCC 7502]
 gb|AFY72917.1| protein translocase subunit secY/sec61 alpha [Synechococcus sp. 
PCC 7502]
Length=434

 Score = 72.4 bits (176),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 34/69 (49%), Positives = 48/69 (70%), Gaps = 0/69 (0%)
 Frame = +2

Query  491  LALSRVGIYVPLGGVNRDAFVGNLDENSILSTLDSFSGGGIGRLGICSLGIVPFINAQIV  670
            L L R+GI++PL G+NR  F   +  NS+++ LD FSGGG+  LGI +LGI+P+INA I+
Sbjct  35   LILVRLGIFLPLPGINRAIFAEAVKNNSVVNFLDIFSGGGLSALGIFALGIIPYINASII  94

Query  671  FQLLGQIYP  697
             QL+    P
Sbjct  95   MQLMTTALP  103



>ref|WP_039889180.1| preprotein translocase subunit SecY [Leptotrichia hofstadii]
Length=435

 Score = 72.4 bits (176),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 36/70 (51%), Positives = 49/70 (70%), Gaps = 0/70 (0%)
 Frame = +2

Query  491  LALSRVGIYVPLGGVNRDAFVGNLDENSILSTLDSFSGGGIGRLGICSLGIVPFINAQIV  670
            + ++RVGI++ + G+N DAF      N+I   L+ FSGG + R  I +LGIVP+INA IV
Sbjct  31   IMVARVGIHIAVPGINTDAFKNFQQGNAIAQFLNLFSGGAVERASIFALGIVPYINASIV  90

Query  671  FQLLGQIYPK  700
            FQLLG I+PK
Sbjct  91   FQLLGVIFPK  100



>gb|EEX73182.1| preprotein translocase, SecY subunit [Leptotrichia hofstadii 
F0254]
Length=438

 Score = 72.4 bits (176),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 36/70 (51%), Positives = 49/70 (70%), Gaps = 0/70 (0%)
 Frame = +2

Query  491  LALSRVGIYVPLGGVNRDAFVGNLDENSILSTLDSFSGGGIGRLGICSLGIVPFINAQIV  670
            + ++RVGI++ + G+N DAF      N+I   L+ FSGG + R  I +LGIVP+INA IV
Sbjct  34   IMVARVGIHIAVPGINTDAFKNFQQGNAIAQFLNLFSGGAVERASIFALGIVPYINASIV  93

Query  671  FQLLGQIYPK  700
            FQLLG I+PK
Sbjct  94   FQLLGVIFPK  103



>ref|WP_026745844.1| preprotein translocase subunit SecY [Leptotrichia hofstadii]
Length=435

 Score = 72.0 bits (175),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 36/70 (51%), Positives = 49/70 (70%), Gaps = 0/70 (0%)
 Frame = +2

Query  491  LALSRVGIYVPLGGVNRDAFVGNLDENSILSTLDSFSGGGIGRLGICSLGIVPFINAQIV  670
            + ++RVGI++ + G+N DAF      N+I   L+ FSGG + R  I +LGIVP+INA IV
Sbjct  31   IMVARVGIHIAVPGINTDAFKNFQQGNAIAQFLNLFSGGAVERASIFALGIVPYINASIV  90

Query  671  FQLLGQIYPK  700
            FQLLG I+PK
Sbjct  91   FQLLGVIFPK  100



>ref|WP_023174150.1| preprotein translocase subunit SecY [Gloeobacter kilaueensis]
 gb|AGY58943.1| preprotein translocase subunit SecY [Gloeobacter kilaueensis 
JS1]
Length=433

 Score = 72.0 bits (175),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 33/70 (47%), Positives = 50/70 (71%), Gaps = 0/70 (0%)
 Frame = +2

Query  491  LALSRVGIYVPLGGVNRDAFVGNLDENSILSTLDSFSGGGIGRLGICSLGIVPFINAQIV  670
            + L+RVGIY+PL GV++ AF      N+++  L+ F+GGG   LGI +LGI+P+INA I+
Sbjct  35   VVLARVGIYIPLPGVDQTAFHQATQSNALIGFLNIFAGGGFSTLGIFTLGILPYINASII  94

Query  671  FQLLGQIYPK  700
             QLL  ++P+
Sbjct  95   VQLLVPVFPQ  104



>ref|WP_039901264.1| preprotein translocase subunit SecY [Leptotrichia sp. oral taxon 
879]
Length=435

 Score = 72.0 bits (175),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 36/70 (51%), Positives = 49/70 (70%), Gaps = 0/70 (0%)
 Frame = +2

Query  491  LALSRVGIYVPLGGVNRDAFVGNLDENSILSTLDSFSGGGIGRLGICSLGIVPFINAQIV  670
            + ++RVGI++ + G+N DAF      N+I   L+ FSGG + R  I +LGIVP+INA IV
Sbjct  31   IIVARVGIHIAVPGINTDAFKNFQQGNAIAQFLNLFSGGAVERASIFALGIVPYINASIV  90

Query  671  FQLLGQIYPK  700
            FQLLG I+PK
Sbjct  91   FQLLGVIFPK  100



>gb|KIY98619.1| Preprotein translocase subunit secY, partial [Monoraphidium neglectum]
Length=424

 Score = 72.0 bits (175),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 34/69 (49%), Positives = 47/69 (68%), Gaps = 0/69 (0%)
 Frame = +2

Query  491  LALSRVGIYVPLGGVNRDAFVGNLDENSILSTLDSFSGGGIGRLGICSLGIVPFINAQIV  670
            + LSRVG+YV L GV+ DAF   +  N +L  +D+ SGG I ++G+ SLGI+P+INA IV
Sbjct  133  IVLSRVGVYVRLPGVDVDAFGETMASNGLLGYVDALSGGSISKVGLFSLGIIPYINASIV  192

Query  671  FQLLGQIYP  697
             QL    +P
Sbjct  193  LQLFSAAFP  201



>gb|ERK55426.1| preprotein translocase, SecY subunit [Leptotrichia sp. oral taxon 
879 str. F0557]
Length=438

 Score = 72.0 bits (175),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 36/70 (51%), Positives = 49/70 (70%), Gaps = 0/70 (0%)
 Frame = +2

Query  491  LALSRVGIYVPLGGVNRDAFVGNLDENSILSTLDSFSGGGIGRLGICSLGIVPFINAQIV  670
            + ++RVGI++ + G+N DAF      N+I   L+ FSGG + R  I +LGIVP+INA IV
Sbjct  34   IIVARVGIHIAVPGINTDAFKNFQQGNAIAQFLNLFSGGAVERASIFALGIVPYINASIV  93

Query  671  FQLLGQIYPK  700
            FQLLG I+PK
Sbjct  94   FQLLGVIFPK  103



>ref|WP_011055954.1| preprotein translocase subunit SecY [Thermosynechococcus elongatus]
 ref|NP_680890.1| preprotein translocase subunit SecY [Thermosynechococcus elongatus 
BP-1]
 dbj|BAC07652.1| preprotein translocase SecY subunit [Thermosynechococcus elongatus 
BP-1]
Length=436

 Score = 72.0 bits (175),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 31/65 (48%), Positives = 47/65 (72%), Gaps = 0/65 (0%)
 Frame = +2

Query  503  RVGIYVPLGGVNRDAFVGNLDENSILSTLDSFSGGGIGRLGICSLGIVPFINAQIVFQLL  682
            R+GIY+P+ G++R  F  N+ +N+++  LD F+GGG+  LGI +LGI+P+INA I+ QLL
Sbjct  39   RLGIYLPIPGIDRAVFAQNVQDNAVIRFLDIFAGGGLSALGIFALGILPYINASIIMQLL  98

Query  683  GQIYP  697
                P
Sbjct  99   TAALP  103



>ref|WP_012626780.1| preprotein translocase subunit SecY [Cyanothece sp. PCC 7425]
 gb|ACL43687.1| preprotein translocase, SecY subunit [Cyanothece sp. PCC 7425]
Length=436

 Score = 72.0 bits (175),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 33/69 (48%), Positives = 46/69 (67%), Gaps = 0/69 (0%)
 Frame = +2

Query  491  LALSRVGIYVPLGGVNRDAFVGNLDENSILSTLDSFSGGGIGRLGICSLGIVPFINAQIV  670
            L L R+GIY+P+ G++R  F   +  N ++  LD FSGGG+  LGI +LGI+P+INA I+
Sbjct  35   LILVRLGIYLPVPGIDRQVFAQTIQNNPVIGFLDIFSGGGLSALGIFALGILPYINASII  94

Query  671  FQLLGQIYP  697
             QLL    P
Sbjct  95   LQLLTAALP  103



>ref|WP_008275488.1| preprotein translocase subunit SecY [Cyanothece sp. CCY0110]
 gb|EAZ91362.1| protein translocase subunit SecY [Cyanothece sp. CCY0110]
Length=438

 Score = 71.6 bits (174),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 33/65 (51%), Positives = 44/65 (68%), Gaps = 0/65 (0%)
 Frame = +2

Query  503  RVGIYVPLGGVNRDAFVGNLDENSILSTLDSFSGGGIGRLGICSLGIVPFINAQIVFQLL  682
            R GI++P+ G++R  FV  +  N +L  LD F+GGGI  LGI +LGI+PFINA I+ QLL
Sbjct  39   RFGIFIPIPGIDRAKFVSAISNNQVLGFLDIFTGGGISTLGIFALGILPFINASIIMQLL  98

Query  683  GQIYP  697
                P
Sbjct  99   TAAIP  103



>ref|WP_007311595.1| preprotein translocase subunit SecY [Crocosphaera watsonii]
 gb|EHJ11715.1| Preprotein translocase secY subunit (TC 3.A.5.1.1) [Crocosphaera 
watsonii WH 0003]
 emb|CCQ53518.1| Preprotein translocase secY subunit (TC 3.A.5.1.1) [Crocosphaera 
watsonii WH 8502]
Length=438

 Score = 71.6 bits (174),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 33/65 (51%), Positives = 45/65 (69%), Gaps = 0/65 (0%)
 Frame = +2

Query  503  RVGIYVPLGGVNRDAFVGNLDENSILSTLDSFSGGGIGRLGICSLGIVPFINAQIVFQLL  682
            R GI++P+ G++R  F   + +NS+L  LD F+GGGI  LGI +LGI+PFINA I+ QLL
Sbjct  39   RFGIFIPIPGIDRTEFARAISDNSVLGFLDIFTGGGISTLGIFALGILPFINASIIMQLL  98

Query  683  GQIYP  697
                P
Sbjct  99   TAAIP  103



>ref|WP_009543879.1| MULTISPECIES: preprotein translocase subunit SecY [Cyanothece]
 gb|ACB53381.1| preprotein translocase SecY subunit [Cyanothece sp. ATCC 51142]
Length=438

 Score = 71.2 bits (173),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 33/65 (51%), Positives = 44/65 (68%), Gaps = 0/65 (0%)
 Frame = +2

Query  503  RVGIYVPLGGVNRDAFVGNLDENSILSTLDSFSGGGIGRLGICSLGIVPFINAQIVFQLL  682
            R GI++P+ G++R  FV  +  N +L  LD F+GGGI  LGI +LGI+PFINA I+ QLL
Sbjct  39   RFGIFIPIPGIDRAKFVSAISNNQVLGFLDIFTGGGISTLGIFALGILPFINASIIMQLL  98

Query  683  GQIYP  697
                P
Sbjct  99   TAAIP  103



>ref|WP_044106041.1| preprotein translocase subunit SecY [cyanobacterium endosymbiont 
of Epithemia turgida]
 dbj|BAP17363.1| preprotein translocase subunit SecY [cyanobacterium endosymbiont 
of Epithemia turgida isolate EtSB Lake Yunoko]
Length=438

 Score = 71.2 bits (173),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 33/65 (51%), Positives = 45/65 (69%), Gaps = 0/65 (0%)
 Frame = +2

Query  503  RVGIYVPLGGVNRDAFVGNLDENSILSTLDSFSGGGIGRLGICSLGIVPFINAQIVFQLL  682
            R GI++P+ G++R+AF   +  + IL  LD F+GGGI  LGI +LGI+PFINA I+ QLL
Sbjct  39   RFGIFIPIPGIDREAFAAAISNSPILGFLDIFTGGGIAALGIFALGILPFINASIIMQLL  98

Query  683  GQIYP  697
                P
Sbjct  99   TAAIP  103



>emb|CCQ60085.1| Preprotein translocase secY subunit (TC 3.A.5.1.1) [Crocosphaera 
watsonii WH 0401]
Length=438

 Score = 71.2 bits (173),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 33/65 (51%), Positives = 45/65 (69%), Gaps = 0/65 (0%)
 Frame = +2

Query  503  RVGIYVPLGGVNRDAFVGNLDENSILSTLDSFSGGGIGRLGICSLGIVPFINAQIVFQLL  682
            R GI++P+ G++R  F   + +NS+L  LD F+GGGI  LGI +LGI+PFINA I+ QLL
Sbjct  39   RFGIFIPIPGIDRTEFARAISDNSVLGFLDIFTGGGISTLGIFALGILPFINASIIMQLL  98

Query  683  GQIYP  697
                P
Sbjct  99   TAAIP  103



>gb|EAM49869.1| SecY protein [Crocosphaera watsonii WH 8501]
Length=439

 Score = 71.2 bits (173),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 33/65 (51%), Positives = 45/65 (69%), Gaps = 0/65 (0%)
 Frame = +2

Query  503  RVGIYVPLGGVNRDAFVGNLDENSILSTLDSFSGGGIGRLGICSLGIVPFINAQIVFQLL  682
            R GI++P+ G++R  F   + +NS+L  LD F+GGGI  LGI +LGI+PFINA I+ QLL
Sbjct  39   RFGIFIPIPGIDRTEFARAISDNSVLGFLDIFTGGGISTLGIFALGILPFINASIIMQLL  98

Query  683  GQIYP  697
                P
Sbjct  99   TAAIP  103



>ref|WP_017659048.1| preprotein translocase subunit SecY [Geitlerinema sp. PCC 7105]
Length=434

 Score = 71.2 bits (173),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 34/69 (49%), Positives = 46/69 (67%), Gaps = 0/69 (0%)
 Frame = +2

Query  491  LALSRVGIYVPLGGVNRDAFVGNLDENSILSTLDSFSGGGIGRLGICSLGIVPFINAQIV  670
            LA+ R+GIY+P+ G++R  F  +L  +     LD+FSGGG+  LGI +LGI+PFINA I 
Sbjct  35   LAIVRLGIYLPVPGIDRARFAADLQNSPFFGLLDAFSGGGLQALGIFALGILPFINASIA  94

Query  671  FQLLGQIYP  697
             QLL    P
Sbjct  95   IQLLTAAIP  103



>gb|KIJ83480.1| preprotein translocase subunit SecY [Scytonema tolypothrichoides 
VB-61278]
Length=437

 Score = 70.9 bits (172),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 36/70 (51%), Positives = 48/70 (69%), Gaps = 1/70 (1%)
 Frame = +2

Query  491  LALSRVGIYVPLGGVNRDAFVGNLD-ENSILSTLDSFSGGGIGRLGICSLGIVPFINAQI  667
            L L R+GI++P+ G+NRD F   L   N +LS LD FSGGG+  LG+ +LGI+P+INA I
Sbjct  34   LMLIRLGIHLPIPGINRDEFARALQGNNQVLSFLDIFSGGGLSALGVFALGILPYINASI  93

Query  668  VFQLLGQIYP  697
            + QLL    P
Sbjct  94   IIQLLTAAIP  103



>gb|ERK53800.1| preprotein translocase, SecY subunit [Leptotrichia wadei F0279]
Length=438

 Score = 70.9 bits (172),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 35/70 (50%), Positives = 49/70 (70%), Gaps = 0/70 (0%)
 Frame = +2

Query  491  LALSRVGIYVPLGGVNRDAFVGNLDENSILSTLDSFSGGGIGRLGICSLGIVPFINAQIV  670
            + ++RVGI++ + G+N +AF      N+I   L+ FSGG + R  I +LGIVP+INA IV
Sbjct  34   IMVARVGIHIAVPGINTEAFKNFQQGNAIAQFLNLFSGGAVERASIFALGIVPYINASIV  93

Query  671  FQLLGQIYPK  700
            FQLLG I+PK
Sbjct  94   FQLLGVIFPK  103



>ref|WP_009625472.1| preprotein translocase subunit SecY [Pseudanabaena biceps]
 gb|ELS34378.1| protein translocase subunit secY/sec61 alpha [Pseudanabaena biceps 
PCC 7429]
Length=446

 Score = 70.9 bits (172),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 35/69 (51%), Positives = 48/69 (70%), Gaps = 0/69 (0%)
 Frame = +2

Query  491  LALSRVGIYVPLGGVNRDAFVGNLDENSILSTLDSFSGGGIGRLGICSLGIVPFINAQIV  670
            L L R+GIY+PL GV+R  F   +  N++++ LD FSGGG+  LGI +LGI+PFINA I+
Sbjct  35   LILVRLGIYLPLPGVDRLRFTEIVKNNAVVNFLDIFSGGGLSLLGIFALGILPFINASII  94

Query  671  FQLLGQIYP  697
             QL+    P
Sbjct  95   MQLMTSALP  103



>ref|WP_018451274.1| preprotein translocase subunit SecY [Leptotrichia shahii]
Length=435

 Score = 70.9 bits (172),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 35/70 (50%), Positives = 49/70 (70%), Gaps = 0/70 (0%)
 Frame = +2

Query  491  LALSRVGIYVPLGGVNRDAFVGNLDENSILSTLDSFSGGGIGRLGICSLGIVPFINAQIV  670
            + ++RVGI++ + G+N +AF      N+I   L+ FSGG + R  I +LGIVP+INA IV
Sbjct  31   IMVARVGIHIAVPGINTEAFKNFQQGNAIAQFLNLFSGGAVERASIFALGIVPYINASIV  90

Query  671  FQLLGQIYPK  700
            FQLLG I+PK
Sbjct  91   FQLLGVIFPK  100



>ref|WP_012806366.1| preprotein translocase subunit SecY [Leptotrichia buccalis]
 gb|ACV38179.1| preprotein translocase, SecY subunit [Leptotrichia buccalis C-1013-b]
Length=435

 Score = 70.9 bits (172),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 35/70 (50%), Positives = 49/70 (70%), Gaps = 0/70 (0%)
 Frame = +2

Query  491  LALSRVGIYVPLGGVNRDAFVGNLDENSILSTLDSFSGGGIGRLGICSLGIVPFINAQIV  670
            + ++RVGI++ + G+N +AF      N+I   L+ FSGG + R  I +LGIVP+INA IV
Sbjct  31   IMVARVGIHIAVPGINTEAFKNFQQGNAIAQFLNLFSGGAVERASIFALGIVPYINASIV  90

Query  671  FQLLGQIYPK  700
            FQLLG I+PK
Sbjct  91   FQLLGVIFPK  100



>ref|WP_026079504.1| preprotein translocase subunit SecY [Spirulina subsalsa]
Length=443

 Score = 70.9 bits (172),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 32/65 (49%), Positives = 46/65 (71%), Gaps = 0/65 (0%)
 Frame = +2

Query  503  RVGIYVPLGGVNRDAFVGNLDENSILSTLDSFSGGGIGRLGICSLGIVPFINAQIVFQLL  682
            R+G+YVP+ GV+R  F+  ++ + ++  LD FSGGG+  LGI +LGI+PFINA I+ QLL
Sbjct  39   RLGVYVPIPGVDRPRFLAEIEGSPVIGFLDVFSGGGLSLLGIFALGILPFINASIIMQLL  98

Query  683  GQIYP  697
                P
Sbjct  99   TAALP  103



>ref|WP_018498266.1| preprotein translocase subunit SecY [Leptotrichia wadei]
Length=435

 Score = 70.9 bits (172),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 35/70 (50%), Positives = 49/70 (70%), Gaps = 0/70 (0%)
 Frame = +2

Query  491  LALSRVGIYVPLGGVNRDAFVGNLDENSILSTLDSFSGGGIGRLGICSLGIVPFINAQIV  670
            + ++RVGI++ + G+N +AF      N+I   L+ FSGG + R  I +LGIVP+INA IV
Sbjct  31   IMVARVGIHIAVPGINTEAFKNFQQGNAIAQFLNLFSGGAVERASIFALGIVPYINASIV  90

Query  671  FQLLGQIYPK  700
            FQLLG I+PK
Sbjct  91   FQLLGVIFPK  100



>ref|WP_026748129.1| preprotein translocase subunit SecY [Leptotrichia trevisanii]
Length=435

 Score = 70.9 bits (172),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 35/70 (50%), Positives = 49/70 (70%), Gaps = 0/70 (0%)
 Frame = +2

Query  491  LALSRVGIYVPLGGVNRDAFVGNLDENSILSTLDSFSGGGIGRLGICSLGIVPFINAQIV  670
            + ++RVGI++ + G+N +AF      N+I   L+ FSGG + R  I +LGIVP+INA IV
Sbjct  31   IMVARVGIHIAVPGINTEAFKNFQQGNAIAQFLNLFSGGAVERASIFALGIVPYINASIV  90

Query  671  FQLLGQIYPK  700
            FQLLG I+PK
Sbjct  91   FQLLGVIFPK  100



>ref|WP_036070397.1| preprotein translocase subunit SecY [Leptotrichia sp. oral taxon 
225]
Length=435

 Score = 70.9 bits (172),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 35/70 (50%), Positives = 49/70 (70%), Gaps = 0/70 (0%)
 Frame = +2

Query  491  LALSRVGIYVPLGGVNRDAFVGNLDENSILSTLDSFSGGGIGRLGICSLGIVPFINAQIV  670
            + ++RVGI++ + G+N +AF      N+I   L+ FSGG + R  I +LGIVP+INA IV
Sbjct  31   IMVARVGIHIAVPGINTEAFKNFQQGNAIAQFLNLFSGGAVERASIFALGIVPYINASIV  90

Query  671  FQLLGQIYPK  700
            FQLLG I+PK
Sbjct  91   FQLLGVIFPK  100



>gb|AJW30847.1| Preprotein translocase secY subunit [Prochlorococcus marinus 
str. P0903-H212]
Length=439

 Score = 70.9 bits (172),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 34/71 (48%), Positives = 50/71 (70%), Gaps = 1/71 (1%)
 Frame = +2

Query  491  LALSRVGIYVPLGGVNRDAFVGNLDEN-SILSTLDSFSGGGIGRLGICSLGIVPFINAQI  667
            L + R+GIY+P+ G++R+AF   +D+   ++  LD F+GGGI  LGI +LGI+PFINA I
Sbjct  35   LLIVRLGIYIPMPGIDREAFKTFIDQGGQLIGFLDIFTGGGISTLGIFALGILPFINASI  94

Query  668  VFQLLGQIYPK  700
            + QLL    P+
Sbjct  95   IIQLLTASLPQ  105



>ref|WP_038654328.1| preprotein translocase subunit SecY [Prochlorococcus sp. MIT 
0801]
 gb|AIQ98151.1| Preprotein translocase secY subunit [Prochlorococcus sp. MIT 
0801]
Length=439

 Score = 70.9 bits (172),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 34/71 (48%), Positives = 50/71 (70%), Gaps = 1/71 (1%)
 Frame = +2

Query  491  LALSRVGIYVPLGGVNRDAFVGNLDEN-SILSTLDSFSGGGIGRLGICSLGIVPFINAQI  667
            L + R+GIY+P+ G++R+AF   +D+   ++  LD F+GGGI  LGI +LGI+PFINA I
Sbjct  35   LLIVRLGIYIPMPGIDREAFKTFIDQGGQLIGFLDIFTGGGISTLGIFALGILPFINASI  94

Query  668  VFQLLGQIYPK  700
            + QLL    P+
Sbjct  95   IIQLLTASLPQ  105



>sp|P38397.1|SECY_PYRSA RecName: Full=Protein translocase subunit SecY, partial (chloroplast) 
[Pyrenomonas salina]
 emb|CAA52783.1| SecY [Pyrenomonas salina]
Length=412

 Score = 70.5 bits (171),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 33/63 (52%), Positives = 46/63 (73%), Gaps = 0/63 (0%)
 Frame = +2

Query  491  LALSRVGIYVPLGGVNRDAFVGNLDENSILSTLDSFSGGGIGRLGICSLGIVPFINAQIV  670
            L LSR+G ++P+ GV+ DAF  ++  N I++ L+ FSGGG   +GI +LGIVP+INA IV
Sbjct  24   LVLSRLGTFIPVPGVDHDAFYQSISTNPIVTFLNIFSGGGFASIGIFALGIVPYINASIV  83

Query  671  FQL  679
             QL
Sbjct  84   IQL  86



>ref|XP_001691898.1| preprotein translocase secY subunit [Chlamydomonas reinhardtii]
 gb|EDP04388.1| preprotein translocase secY subunit [Chlamydomonas reinhardtii]
Length=451

 Score = 70.9 bits (172),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 32/66 (48%), Positives = 46/66 (70%), Gaps = 0/66 (0%)
 Frame = +2

Query  500  SRVGIYVPLGGVNRDAFVGNLDENSILSTLDSFSGGGIGRLGICSLGIVPFINAQIVFQL  679
            SRVG+Y+ L GV+ DAF  +L  + +L  +D+ SGG I ++G+ SLGI+P+INA IV QL
Sbjct  56   SRVGVYIRLPGVDVDAFAESLTNSGLLGYIDTLSGGSISKVGLFSLGIIPYINASIVLQL  115

Query  680  LGQIYP  697
                +P
Sbjct  116  FSAAFP  121



>gb|ERL26976.1| preprotein translocase, SecY subunit [Leptotrichia sp. oral taxon 
225 str. F0581]
Length=438

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 35/70 (50%), Positives = 49/70 (70%), Gaps = 0/70 (0%)
 Frame = +2

Query  491  LALSRVGIYVPLGGVNRDAFVGNLDENSILSTLDSFSGGGIGRLGICSLGIVPFINAQIV  670
            + ++RVGI++ + G+N +AF      N+I   L+ FSGG + R  I +LGIVP+INA IV
Sbjct  34   IMVARVGIHIAVPGINTEAFKNFQQGNAIAQFLNLFSGGAVERASIFALGIVPYINASIV  93

Query  671  FQLLGQIYPK  700
            FQLLG I+PK
Sbjct  94   FQLLGVIFPK  103



>ref|WP_017291208.1| preprotein translocase subunit SecY [Leptolyngbya boryana]
Length=434

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 34/69 (49%), Positives = 47/69 (68%), Gaps = 0/69 (0%)
 Frame = +2

Query  491  LALSRVGIYVPLGGVNRDAFVGNLDENSILSTLDSFSGGGIGRLGICSLGIVPFINAQIV  670
            L   R+GI++PL G++R AF   +  NS LS +D F+GGG+  LG+ +LGI+PFINA I+
Sbjct  35   LVFVRLGIFIPLPGIDRAAFSQAIQSNSALSFVDLFAGGGLRTLGLFALGILPFINASII  94

Query  671  FQLLGQIYP  697
             QLL    P
Sbjct  95   IQLLTAAIP  103



>ref|WP_006807202.1| preprotein translocase subunit SecY [Leptotrichia goodfellowii]
 gb|EEY35157.1| preprotein translocase, SecY subunit [Leptotrichia goodfellowii 
F0264]
Length=432

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 34/70 (49%), Positives = 49/70 (70%), Gaps = 1/70 (1%)
 Frame = +2

Query  491  LALSRVGIYVPLGGVNRDAFVGNLDENSILSTLDSFSGGGIGRLGICSLGIVPFINAQIV  670
             A++R+G+++ + G+N  AF  N   N+I   L+ FSGG + R  I SLGI+P+IN+ IV
Sbjct  31   FAIARIGVHIAVPGINMAAF-KNFQNNAIAGFLNLFSGGAVQRASIFSLGIIPYINSSIV  89

Query  671  FQLLGQIYPK  700
            FQLLG I+PK
Sbjct  90   FQLLGVIFPK  99



>gb|AJO68424.1| preprotein translocase subunit SecY (chloroplast) [Gracilariopsis 
lemaneiformis]
Length=411

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 31/70 (44%), Positives = 52/70 (74%), Gaps = 0/70 (0%)
 Frame = +2

Query  491  LALSRVGIYVPLGGVNRDAFVGNLDENSILSTLDSFSGGGIGRLGICSLGIVPFINAQIV  670
            L L+R+GI++P+ G++ ++    L++N +++ L+ FSGGG   +GI +LGIVP+INA I+
Sbjct  18   LILARLGIFIPIPGIDHNSLDNTLNQNGLINFLNIFSGGGFSTIGIFALGIVPYINASII  77

Query  671  FQLLGQIYPK  700
             QLL +I P+
Sbjct  78   MQLLTKIIPE  87



>ref|NP_053907.1| preprotein translocase subunit SecY [Porphyra purpurea]
 sp|P51297.1|SECY_PORPU RecName: Full=Protein translocase subunit SecY (chloroplast) 
[Porphyra purpurea]
 gb|AAC08183.1| Preprotein translocase subunit (chloroplast) [Porphyra purpurea]
Length=411

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/63 (48%), Positives = 49/63 (78%), Gaps = 0/63 (0%)
 Frame = +2

Query  509  GIYVPLGGVNRDAFVGNLDENSILSTLDSFSGGGIGRLGICSLGIVPFINAQIVFQLLGQ  688
            GI++P+ G++ DAF  ++++N++++ L+ FSGGG   +GI +LGIVP+IN+ IV QLL +
Sbjct  24   GIFIPVPGIDHDAFYASVEKNTLVNFLNIFSGGGFSTIGIFALGIVPYINSSIVMQLLTK  83

Query  689  IYP  697
            I P
Sbjct  84   IIP  86



>ref|WP_024125576.1| preprotein translocase subunit SecY [Thermosynechococcus sp. 
NK55a]
 gb|AHB89196.1| preprotein translocase subunit SecY [Thermosynechococcus sp. 
NK55a]
Length=436

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 31/65 (48%), Positives = 46/65 (71%), Gaps = 0/65 (0%)
 Frame = +2

Query  503  RVGIYVPLGGVNRDAFVGNLDENSILSTLDSFSGGGIGRLGICSLGIVPFINAQIVFQLL  682
            R+GIY+P+ G+ R  F  ++ +N+++  LD FSGGG+  LGI +LGI+P+INA I+ QLL
Sbjct  39   RLGIYLPIPGIERAVFAQSVQDNAVIRFLDIFSGGGLSALGIFALGILPYINASIIMQLL  98

Query  683  GQIYP  697
                P
Sbjct  99   TAALP  103



>ref|WP_011141393.1| preprotein translocase subunit SecY [Gloeobacter violaceus]
 ref|NP_924339.1| preprotein translocase subunit SecY [Gloeobacter violaceus PCC 
7421]
 dbj|BAC89334.1| preprotein translocase subunit [Gloeobacter violaceus PCC 7421]
Length=433

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 32/67 (48%), Positives = 46/67 (69%), Gaps = 0/67 (0%)
 Frame = +2

Query  500  SRVGIYVPLGGVNRDAFVGNLDENSILSTLDSFSGGGIGRLGICSLGIVPFINAQIVFQL  679
            SR+GIY+PL  +N+ AF      N+I+  L+ F+GGG   LG+  LGI+P+INA I+ QL
Sbjct  38   SRIGIYIPLPEINQAAFQQATQNNAIIGFLNIFAGGGFTTLGVFMLGILPYINASIIMQL  97

Query  680  LGQIYPK  700
            L  ++PK
Sbjct  98   LVPVFPK  104



>ref|WP_026101011.1| preprotein translocase subunit SecY [Synechococcus sp. PCC 7336]
Length=433

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 34/69 (49%), Positives = 45/69 (65%), Gaps = 0/69 (0%)
 Frame = +2

Query  491  LALSRVGIYVPLGGVNRDAFVGNLDENSILSTLDSFSGGGIGRLGICSLGIVPFINAQIV  670
            L L R+GIY+P+ G++R AF   L  N  L  ++ F+GGGI  LG+  LGI+PFINA I+
Sbjct  35   LLLVRLGIYIPIPGIDRAAFAEQLASNDFLGFVNIFTGGGISALGVFMLGILPFINASII  94

Query  671  FQLLGQIYP  697
             QLL    P
Sbjct  95   IQLLTSAVP  103



>ref|WP_036904560.1| preprotein translocase subunit SecY [Prochlorococcus marinus]
 gb|KGG22020.1| Preprotein translocase secY subunit [Prochlorococcus marinus 
str. PAC1]
Length=439

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 33/71 (46%), Positives = 50/71 (70%), Gaps = 1/71 (1%)
 Frame = +2

Query  491  LALSRVGIYVPLGGVNRDAFVGNLDEN-SILSTLDSFSGGGIGRLGICSLGIVPFINAQI  667
            L + R+GIY+P+ G++R+AF   +D+   ++  LD F+GGGI  LG+ +LGI+PFINA I
Sbjct  35   LLIVRLGIYIPMPGIDREAFKSFIDQGGQLIGFLDIFTGGGISTLGVFALGILPFINASI  94

Query  668  VFQLLGQIYPK  700
            + QLL    P+
Sbjct  95   IIQLLTASLPQ  105



>ref|WP_036485206.1| preprotein translocase subunit SecY [Myxosarcina sp. GI1]
Length=442

 Score = 70.1 bits (170),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 35/72 (49%), Positives = 49/72 (68%), Gaps = 3/72 (4%)
 Frame = +2

Query  491  LALSRVGIYVPLGGVNRDAF---VGNLDENSILSTLDSFSGGGIGRLGICSLGIVPFINA  661
            L L R+G+++P+ G++R+ F   +GN    SI+  LD F+GGGI  LGI +LGI+PFINA
Sbjct  33   LILVRLGVFIPIPGIDRERFGNLLGNTTNASIVGFLDIFTGGGISALGIFALGILPFINA  92

Query  662  QIVFQLLGQIYP  697
             I+ QLL    P
Sbjct  93   SIIMQLLASAIP  104



>gb|AJW30821.1| Preprotein translocase secY subunit [Prochlorococcus marinus 
str. P0902-H212]
Length=439

 Score = 70.1 bits (170),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 33/71 (46%), Positives = 50/71 (70%), Gaps = 1/71 (1%)
 Frame = +2

Query  491  LALSRVGIYVPLGGVNRDAFVGNLDEN-SILSTLDSFSGGGIGRLGICSLGIVPFINAQI  667
            L + R+GIY+P+ G++R+AF   +D+   ++  LD F+GGGI  LG+ +LGI+PFINA I
Sbjct  35   LLIVRLGIYIPMPGIDREAFKNFIDQGGQLIGFLDIFTGGGISTLGVFALGILPFINASI  94

Query  668  VFQLLGQIYPK  700
            + QLL    P+
Sbjct  95   IIQLLTASLPQ  105



>ref|WP_011824503.1| preprotein translocase subunit SecY [Prochlorococcus marinus]
 gb|ABM76541.1| preprotein translocase SecY subunit [Prochlorococcus marinus 
str. NATL1A]
Length=439

 Score = 70.1 bits (170),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 33/71 (46%), Positives = 50/71 (70%), Gaps = 1/71 (1%)
 Frame = +2

Query  491  LALSRVGIYVPLGGVNRDAFVGNLDEN-SILSTLDSFSGGGIGRLGICSLGIVPFINAQI  667
            L + R+GIY+P+ G++R+AF   +D+   ++  LD F+GGGI  LG+ +LGI+PFINA I
Sbjct  35   LLIVRLGIYIPMPGIDREAFKNFIDQGGQLIGFLDIFTGGGISTLGVFALGILPFINASI  94

Query  668  VFQLLGQIYPK  700
            + QLL    P+
Sbjct  95   IIQLLTASLPQ  105



>ref|WP_011295455.1| preprotein translocase subunit SecY [Prochlorococcus marinus]
 gb|AAZ58601.1| protein translocase subunit secY/sec61 alpha [Prochlorococcus 
marinus str. NATL2A]
Length=439

 Score = 70.1 bits (170),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 33/71 (46%), Positives = 50/71 (70%), Gaps = 1/71 (1%)
 Frame = +2

Query  491  LALSRVGIYVPLGGVNRDAFVGNLDEN-SILSTLDSFSGGGIGRLGICSLGIVPFINAQI  667
            L + R+GIY+P+ G++R+AF   +D+   ++  LD F+GGGI  LG+ +LGI+PFINA I
Sbjct  35   LLIVRLGIYIPMPGIDREAFKTFIDQGGQLIGFLDIFTGGGISTLGVFALGILPFINASI  94

Query  668  VFQLLGQIYPK  700
            + QLL    P+
Sbjct  95   IIQLLTASLPQ  105



>ref|WP_040054591.1| preprotein translocase subunit SecY [Candidatus Atelocyanobacterium 
thalassa]
 gb|KFF41668.1| protein translocase subunit secY/sec61 alpha [Candidatus Atelocyanobacterium 
thalassa isolate SIO64986]
Length=438

 Score = 70.1 bits (170),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 31/65 (48%), Positives = 45/65 (69%), Gaps = 0/65 (0%)
 Frame = +2

Query  503  RVGIYVPLGGVNRDAFVGNLDENSILSTLDSFSGGGIGRLGICSLGIVPFINAQIVFQLL  682
            R GI++P+ G++R+ F+  +  + +L  LD F+GGGI  LGI +LGI+PFINA I+ QLL
Sbjct  39   RFGIFIPIPGIDREKFISAISNSPVLGFLDIFTGGGISTLGIFALGILPFINASIIMQLL  98

Query  683  GQIYP  697
                P
Sbjct  99   TAAIP  103



>ref|WP_012954407.1| preprotein translocase subunit SecY [Candidatus Atelocyanobacterium 
thalassa]
 gb|ADB95720.1| protein translocase subunit secY/sec61 alpha [Candidatus Atelocyanobacterium 
thalassa isolate ALOHA]
Length=438

 Score = 69.7 bits (169),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 31/65 (48%), Positives = 45/65 (69%), Gaps = 0/65 (0%)
 Frame = +2

Query  503  RVGIYVPLGGVNRDAFVGNLDENSILSTLDSFSGGGIGRLGICSLGIVPFINAQIVFQLL  682
            R GI++P+ G++R+ F+  +  + +L  LD F+GGGI  LGI +LGI+PFINA I+ QLL
Sbjct  39   RFGIFIPIPGIDREKFISAISNSPVLGFLDIFTGGGISTLGIFALGILPFINASIIMQLL  98

Query  683  GQIYP  697
                P
Sbjct  99   TAAIP  103



>ref|WP_044195108.1| preprotein translocase subunit SecY [Oscillatoria acuminata]
Length=436

 Score = 69.7 bits (169),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 32/69 (46%), Positives = 48/69 (70%), Gaps = 0/69 (0%)
 Frame = +2

Query  491  LALSRVGIYVPLGGVNRDAFVGNLDENSILSTLDSFSGGGIGRLGICSLGIVPFINAQIV  670
            L L R+GI++P+ G++ + F  N+D + ++  LD FSGGG+  LGI +LGI+P+INA I+
Sbjct  35   LVLVRLGIWIPVPGIDLERFQANIDGSPLIGFLDLFSGGGLRALGIFALGIIPYINASII  94

Query  671  FQLLGQIYP  697
             QLL    P
Sbjct  95   MQLLTAALP  103



>gb|AFY82348.1| protein translocase subunit secY/sec61 alpha [Oscillatoria acuminata 
PCC 6304]
Length=421

 Score = 69.7 bits (169),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 32/69 (46%), Positives = 48/69 (70%), Gaps = 0/69 (0%)
 Frame = +2

Query  491  LALSRVGIYVPLGGVNRDAFVGNLDENSILSTLDSFSGGGIGRLGICSLGIVPFINAQIV  670
            L L R+GI++P+ G++ + F  N+D + ++  LD FSGGG+  LGI +LGI+P+INA I+
Sbjct  20   LVLVRLGIWIPVPGIDLERFQANIDGSPLIGFLDLFSGGGLRALGIFALGIIPYINASII  79

Query  671  FQLLGQIYP  697
             QLL    P
Sbjct  80   MQLLTAALP  88



>ref|WP_009767980.1| preprotein translocase subunit SecY [Oscillatoriales cyanobacterium 
JSC-12]
 gb|EKQ68869.1| protein translocase subunit secY/sec61 alpha [Oscillatoriales 
cyanobacterium JSC-12]
Length=465

 Score = 69.7 bits (169),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 32/69 (46%), Positives = 48/69 (70%), Gaps = 0/69 (0%)
 Frame = +2

Query  491  LALSRVGIYVPLGGVNRDAFVGNLDENSILSTLDSFSGGGIGRLGICSLGIVPFINAQIV  670
            L L R+GI++P+  ++R AF  ++  N ++S LD F+GGG+  LGI +LGI+P+INA I+
Sbjct  35   LILVRLGIFLPIPDIDRQAFAQSVQNNPVISFLDIFAGGGLSALGIFALGILPYINASII  94

Query  671  FQLLGQIYP  697
             QLL    P
Sbjct  95   LQLLTAALP  103



>ref|WP_017314779.1| preprotein translocase subunit SecY [Mastigocladopsis repens]
Length=437

 Score = 69.7 bits (169),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 35/70 (50%), Positives = 48/70 (69%), Gaps = 1/70 (1%)
 Frame = +2

Query  491  LALSRVGIYVPLGGVNRDAFVGNLD-ENSILSTLDSFSGGGIGRLGICSLGIVPFINAQI  667
            + L R+GI++P+ G+NRD F   +   N ILS LD FSGGG+  LG+ +LGI+P+INA I
Sbjct  34   ILLIRLGIHLPIPGINRDEFASAIQGNNQILSFLDIFSGGGLSALGVFALGILPYINASI  93

Query  668  VFQLLGQIYP  697
            + QLL    P
Sbjct  94   IIQLLTAAIP  103



>ref|WP_009782731.1| MULTISPECIES: preprotein translocase subunit SecY [Lyngbya]
 gb|EAW38756.1| preprotein translocase SecY [Lyngbya sp. PCC 8106]
 gb|ERT06411.1| preprotein translocase, SecY subunit [Lyngbya aestuarii BL J]
Length=435

 Score = 69.7 bits (169),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 31/69 (45%), Positives = 47/69 (68%), Gaps = 0/69 (0%)
 Frame = +2

Query  491  LALSRVGIYVPLGGVNRDAFVGNLDENSILSTLDSFSGGGIGRLGICSLGIVPFINAQIV  670
            L L R+G+++P+ G++R AF  N+  + ++  LD F GGG+  LGI +LGI+PFINA I+
Sbjct  35   LILVRLGVFLPIPGIDRAAFSANIQNSPVIGFLDLFVGGGLSALGIFALGILPFINASII  94

Query  671  FQLLGQIYP  697
             QL+    P
Sbjct  95   MQLMTAALP  103



>ref|WP_012196211.1| preprotein translocase subunit SecY [Prochlorococcus marinus]
 gb|ABX09591.1| preprotein translocase SecY subunit [Prochlorococcus marinus 
str. MIT 9211]
Length=439

 Score = 69.3 bits (168),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 34/71 (48%), Positives = 49/71 (69%), Gaps = 1/71 (1%)
 Frame = +2

Query  491  LALSRVGIYVPLGGVNRDAFVGNLDEN-SILSTLDSFSGGGIGRLGICSLGIVPFINAQI  667
            L L R+GIY+P+ G++R+AF   + +   ++  LD F+GGGI  LGI +LGI+PFINA I
Sbjct  35   LLLVRLGIYIPVPGIDREAFKEFIQQGGQLIGFLDIFTGGGISTLGIFALGILPFINASI  94

Query  668  VFQLLGQIYPK  700
            + QLL    P+
Sbjct  95   IIQLLTAALPQ  105



>ref|WP_036912676.1| MULTISPECIES: preprotein translocase subunit SecY [Prochlorococcus]
 gb|KGG27384.1| Preprotein translocase secY subunit [Prochlorococcus sp. MIT 
0701]
 gb|KGG29450.1| Preprotein translocase secY subunit [Prochlorococcus sp. MIT 
0702]
 gb|KGG34535.1| Preprotein translocase secY subunit [Prochlorococcus sp. MIT 
0703]
Length=439

 Score = 69.3 bits (168),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 34/71 (48%), Positives = 48/71 (68%), Gaps = 1/71 (1%)
 Frame = +2

Query  491  LALSRVGIYVPLGGVNRDAFVGNLDEN-SILSTLDSFSGGGIGRLGICSLGIVPFINAQI  667
            L   R+GIY+P+ G++R+AF   L +   ++  LD F+GGGI  LGI +LGI+PFINA I
Sbjct  35   LLFIRLGIYIPMPGIDREAFQSFLQQGGQLIGFLDIFTGGGISTLGIFALGILPFINASI  94

Query  668  VFQLLGQIYPK  700
            + QLL    P+
Sbjct  95   ILQLLTAALPQ  105



>ref|WP_036900628.1| preprotein translocase subunit SecY [Prochlorococcus sp. MIT 
0601]
 gb|KGG13565.1| Preprotein translocase secY subunit [Prochlorococcus sp. MIT 
0601]
Length=439

 Score = 69.3 bits (168),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 34/71 (48%), Positives = 49/71 (69%), Gaps = 1/71 (1%)
 Frame = +2

Query  491  LALSRVGIYVPLGGVNRDAFVGNLDEN-SILSTLDSFSGGGIGRLGICSLGIVPFINAQI  667
            L L R+GIY+P+ G++R+AF   + +   ++  LD F+GGGI  LGI +LGI+PFINA I
Sbjct  35   LLLVRLGIYIPVPGIDREAFKEFIQQGGQLIGFLDIFTGGGISTLGIFALGILPFINASI  94

Query  668  VFQLLGQIYPK  700
            + QLL    P+
Sbjct  95   IIQLLTAALPQ  105



>ref|WP_012593614.1| preprotein translocase subunit SecY [Cyanothece sp. PCC 8801]
 gb|ACK64337.1| preprotein translocase, SecY subunit [Cyanothece sp. PCC 8801]
Length=438

 Score = 69.3 bits (168),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 31/65 (48%), Positives = 45/65 (69%), Gaps = 0/65 (0%)
 Frame = +2

Query  503  RVGIYVPLGGVNRDAFVGNLDENSILSTLDSFSGGGIGRLGICSLGIVPFINAQIVFQLL  682
            R GI++P+ G++R+AF   +  + +L  LD F+GGGI  LGI +LGI+P+INA I+ QLL
Sbjct  39   RFGIFIPIPGIDREAFAAAISSSPVLGFLDIFTGGGISTLGIFALGILPYINASIIIQLL  98

Query  683  GQIYP  697
                P
Sbjct  99   TAAIP  103



>ref|WP_012796698.1| preprotein translocase subunit SecY [Cyanothece sp. PCC 8802]
 gb|ACU99199.1| preprotein translocase, SecY subunit [Cyanothece sp. PCC 8802]
Length=438

 Score = 69.3 bits (168),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 31/65 (48%), Positives = 45/65 (69%), Gaps = 0/65 (0%)
 Frame = +2

Query  503  RVGIYVPLGGVNRDAFVGNLDENSILSTLDSFSGGGIGRLGICSLGIVPFINAQIVFQLL  682
            R GI++P+ G++R+AF   +  + +L  LD F+GGGI  LGI +LGI+P+INA I+ QLL
Sbjct  39   RFGIFIPIPGIDREAFAAAISSSPVLGFLDIFTGGGISTLGIFALGILPYINASIIIQLL  98

Query  683  GQIYP  697
                P
Sbjct  99   TAAIP  103



>ref|WP_006634983.1| preprotein translocase subunit SecY [Microcoleus vaginatus]
 gb|EGK84828.1| preprotein translocase, SecY subunit [Microcoleus vaginatus FGP-2]
Length=434

 Score = 69.3 bits (168),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 32/69 (46%), Positives = 49/69 (71%), Gaps = 0/69 (0%)
 Frame = +2

Query  491  LALSRVGIYVPLGGVNRDAFVGNLDENSILSTLDSFSGGGIGRLGICSLGIVPFINAQIV  670
            L L R+G+++P+ G++R AF  N++ + ++  LD FSGGG+  LGI +LGI+P+INA I+
Sbjct  35   LILVRLGVHLPVPGIDRVAFAQNVENSPLIGFLDLFSGGGLSALGIFALGILPYINASII  94

Query  671  FQLLGQIYP  697
             QLL    P
Sbjct  95   VQLLTAALP  103



>ref|XP_005850454.1| hypothetical protein CHLNCDRAFT_59612 [Chlorella variabilis]
 gb|EFN58352.1| hypothetical protein CHLNCDRAFT_59612 [Chlorella variabilis]
Length=523

 Score = 69.3 bits (168),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 32/69 (46%), Positives = 48/69 (70%), Gaps = 0/69 (0%)
 Frame = +2

Query  491  LALSRVGIYVPLGGVNRDAFVGNLDENSILSTLDSFSGGGIGRLGICSLGIVPFINAQIV  670
            +  SR+G+Y+ L GV+ DAF   +  + I+  +D+ SGG I ++G+ SLGIVP+INA I+
Sbjct  126  IVFSRLGVYLRLPGVDVDAFSEAMAGSGIMGYIDTLSGGSISKVGVFSLGIVPYINASIL  185

Query  671  FQLLGQIYP  697
            FQLL   +P
Sbjct  186  FQLLATAFP  194



>ref|WP_009634238.1| preprotein translocase subunit SecY [Synechocystis sp. PCC 7509]
Length=437

 Score = 69.3 bits (168),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 33/70 (47%), Positives = 50/70 (71%), Gaps = 1/70 (1%)
 Frame = +2

Query  491  LALSRVGIYVPLGGVNRDAFVGNL-DENSILSTLDSFSGGGIGRLGICSLGIVPFINAQI  667
            L L+R+G+++P+ G+NR+ F   + + N+I+  LD FSGGG+  LGI +LGI+P+INA I
Sbjct  34   LILARLGVFLPIPGINREQFTQAVQNNNAIIGFLDIFSGGGLSTLGIFALGILPYINASI  93

Query  668  VFQLLGQIYP  697
            + QLL    P
Sbjct  94   IIQLLTAAIP  103



>ref|WP_010469295.1| MULTISPECIES: preprotein translocase subunit SecY [Acaryochloris]
 gb|ABW29686.1| preprotein translocase, SecY subunit [Acaryochloris marina MBIC11017]
Length=435

 Score = 68.9 bits (167),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 35/69 (51%), Positives = 43/69 (62%), Gaps = 0/69 (0%)
 Frame = +2

Query  491  LALSRVGIYVPLGGVNRDAFVGNLDENSILSTLDSFSGGGIGRLGICSLGIVPFINAQIV  670
            L L R+GI +P+ G+NR AF      N +   LD FSGGG   LGI +LGI+PFINA I+
Sbjct  35   LILVRLGIRLPVPGINRAAFTSTFAGNPVFGFLDFFSGGGFSALGIFALGIIPFINASII  94

Query  671  FQLLGQIYP  697
             QLL    P
Sbjct  95   LQLLTAALP  103



>ref|WP_015152284.1| MULTISPECIES: preprotein translocase subunit SecY [Cyanobacteria]
 gb|AFY85733.1| protein translocase subunit secY/sec61 alpha [Chroococcidiopsis 
thermalis PCC 7203]
 gb|KIF17309.1| preprotein translocase subunit SecY [Scytonema millei VB511283]
Length=435

 Score = 68.9 bits (167),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 32/70 (46%), Positives = 50/70 (71%), Gaps = 1/70 (1%)
 Frame = +2

Query  491  LALSRVGIYVPLGGVNRDAFVGNLDENS-ILSTLDSFSGGGIGRLGICSLGIVPFINAQI  667
            L L+R+G+++P+ G+NR+ F  ++  NS ++  LD FSGGG+  LG+ +LGI+P+INA I
Sbjct  34   LILARLGVFLPVPGINREQFAQSVQNNSAVIGFLDIFSGGGLSTLGVFALGILPYINASI  93

Query  668  VFQLLGQIYP  697
            + QLL    P
Sbjct  94   IIQLLTAAIP  103



>ref|WP_035156530.1| preprotein translocase subunit SecY [Calothrix sp. 336/3]
 gb|KFB85339.1| preprotein translocase subunit SecY [Calothrix sp. 336/3]
Length=437

 Score = 68.9 bits (167),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 33/70 (47%), Positives = 49/70 (70%), Gaps = 1/70 (1%)
 Frame = +2

Query  491  LALSRVGIYVPLGGVNRDAFVGNL-DENSILSTLDSFSGGGIGRLGICSLGIVPFINAQI  667
            L L R+GI++P+ G+NR+ F   + + N I++ LD FSGGG+  LG+ +LGI+P+INA I
Sbjct  34   LVLIRMGIHIPIPGINREKFAAAIQNNNQIVNFLDIFSGGGLSALGVFALGILPYINASI  93

Query  668  VFQLLGQIYP  697
            + QLL    P
Sbjct  94   IIQLLTAAIP  103



>ref|WP_015218380.1| preprotein translocase subunit SecY [Cyanobacterium aponinum]
 gb|AFZ52649.1| protein translocase subunit secY/sec61 alpha [Cyanobacterium 
aponinum PCC 10605]
Length=437

 Score = 68.9 bits (167),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 30/65 (46%), Positives = 44/65 (68%), Gaps = 0/65 (0%)
 Frame = +2

Query  503  RVGIYVPLGGVNRDAFVGNLDENSILSTLDSFSGGGIGRLGICSLGIVPFINAQIVFQLL  682
            R+GIY+P+ G++RDAF   +     L  LD F+GGG+  +GI +LGI+P+INA I+ QL+
Sbjct  39   RLGIYIPVPGIDRDAFAAAIQNLPFLGFLDIFTGGGLSTIGIFALGILPYINASIIMQLM  98

Query  683  GQIYP  697
                P
Sbjct  99   TSAVP  103



>ref|WP_045054259.1| preprotein translocase subunit SecY [Chroococcales cyanobacterium 
CENA595]
 gb|KJH72135.1| preprotein translocase subunit SecY [Chroococcales cyanobacterium 
CENA595]
Length=437

 Score = 68.9 bits (167),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 33/70 (47%), Positives = 49/70 (70%), Gaps = 1/70 (1%)
 Frame = +2

Query  491  LALSRVGIYVPLGGVNRDAFVGNLD-ENSILSTLDSFSGGGIGRLGICSLGIVPFINAQI  667
            L L+R+G+++P+ G+NR+ F   +   N+I+  LD FSGGG+  LGI +LGI+P+INA I
Sbjct  34   LILARLGVFLPIPGINREQFAQAVQGNNAIIGFLDIFSGGGLSTLGIFALGILPYINASI  93

Query  668  VFQLLGQIYP  697
            + QLL    P
Sbjct  94   IIQLLTAAIP  103



>ref|YP_002049219.1| preprotein translocase SecY [Paulinella chromatophora]
 gb|ACB43009.1| preprotein translocase SecY [Paulinella chromatophora]
Length=438

 Score = 68.9 bits (167),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 33/71 (46%), Positives = 50/71 (70%), Gaps = 1/71 (1%)
 Frame = +2

Query  491  LALSRVGIYVPLGGVNRDAFVGNLDEN-SILSTLDSFSGGGIGRLGICSLGIVPFINAQI  667
            L + R+GIY+P+ G++R AF   L++   ++  LD F+GGG+  LGI +LGI+PFINA I
Sbjct  35   LLIIRLGIYIPVPGIDRVAFQAFLNQGGQLIGFLDIFTGGGLSTLGIFALGILPFINASI  94

Query  668  VFQLLGQIYPK  700
            + QLL  + P+
Sbjct  95   IIQLLTTVLPQ  105



>ref|WP_007356152.1| MULTISPECIES: preprotein translocase subunit SecY [Kamptonema]
 emb|CBN56948.1| preprotein translocase subunit SecY [ [[Oscillatoria] sp. PCC 
6506]
Length=435

 Score = 68.6 bits (166),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 32/69 (46%), Positives = 48/69 (70%), Gaps = 0/69 (0%)
 Frame = +2

Query  491  LALSRVGIYVPLGGVNRDAFVGNLDENSILSTLDSFSGGGIGRLGICSLGIVPFINAQIV  670
            L L R+G+++P+ G++R AF  N+  + ++  LD FSGGG+  LGI +LGI+P+INA I+
Sbjct  35   LILVRLGVHLPVPGIDRVAFAQNVQNSPLIGFLDLFSGGGLSALGIFALGILPYINASII  94

Query  671  FQLLGQIYP  697
             QLL    P
Sbjct  95   IQLLTAALP  103



>ref|WP_015178720.1| preprotein translocase subunit SecY [Oscillatoria nigro-viridis]
 gb|AFZ09500.1| protein translocase subunit secY/sec61 alpha [Oscillatoria nigro-viridis 
PCC 7112]
Length=434

 Score = 68.6 bits (166),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 32/69 (46%), Positives = 48/69 (70%), Gaps = 0/69 (0%)
 Frame = +2

Query  491  LALSRVGIYVPLGGVNRDAFVGNLDENSILSTLDSFSGGGIGRLGICSLGIVPFINAQIV  670
            L L R+G+++P+ G++R AF  N+  + ++  LD FSGGG+  LGI +LGI+P+INA I+
Sbjct  35   LILVRLGVHLPVPGIDRVAFAQNVQNSPLIGFLDLFSGGGLSALGIFALGILPYINASII  94

Query  671  FQLLGQIYP  697
             QLL    P
Sbjct  95   VQLLTAALP  103



>ref|WP_009455545.1| MULTISPECIES: preprotein translocase subunit SecY [Fischerella]
 gb|EHC18130.1| preprotein translocase, SecY subunit [Fischerella sp. JSC-11]
Length=440

 Score = 68.6 bits (166),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 33/70 (47%), Positives = 48/70 (69%), Gaps = 1/70 (1%)
 Frame = +2

Query  491  LALSRVGIYVPLGGVNRDAFVGNLDEN-SILSTLDSFSGGGIGRLGICSLGIVPFINAQI  667
            L L R+GI++P+ G++R AF   ++ N  + S LD FSGGG+  LG+ +LGI+P+INA I
Sbjct  34   LILIRLGIHIPIPGIDRQAFAAAINSNNQVFSFLDIFSGGGLSALGVFALGILPYINASI  93

Query  668  VFQLLGQIYP  697
            + QLL    P
Sbjct  94   IIQLLTAAIP  103



>ref|WP_006854810.1| preprotein translocase subunit SecY [Synechococcus sp. WH 8016]
 gb|EHA59307.1| preprotein translocase, SecY subunit [Synechococcus sp. WH 8016]
Length=439

 Score = 68.2 bits (165),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 33/71 (46%), Positives = 50/71 (70%), Gaps = 1/71 (1%)
 Frame = +2

Query  491  LALSRVGIYVPLGGVNRDAFVGNLDEN-SILSTLDSFSGGGIGRLGICSLGIVPFINAQI  667
            L L R+GIY+P+ G++R AF   +++  +++  LD F+GGGI  LG+ +LGI+PFINA I
Sbjct  35   LMLVRLGIYIPMPGIDRVAFEQFIEQGGTLIGFLDIFTGGGISTLGVFALGILPFINASI  94

Query  668  VFQLLGQIYPK  700
            + QLL    P+
Sbjct  95   IIQLLTASLPQ  105



>ref|WP_011618384.1| preprotein translocase subunit SecY [Synechococcus sp. CC9311]
 gb|ABI47075.1| preprotein translocase, SecY subunit [Synechococcus sp. CC9311]
Length=439

 Score = 68.2 bits (165),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 33/71 (46%), Positives = 50/71 (70%), Gaps = 1/71 (1%)
 Frame = +2

Query  491  LALSRVGIYVPLGGVNRDAFVGNLDEN-SILSTLDSFSGGGIGRLGICSLGIVPFINAQI  667
            L L R+GIY+P+ G++R AF   +++  +++  LD F+GGGI  LG+ +LGI+PFINA I
Sbjct  35   LMLVRLGIYIPMPGIDRVAFEQFIEQGGTLIGFLDIFTGGGISTLGVFALGILPFINASI  94

Query  668  VFQLLGQIYPK  700
            + QLL    P+
Sbjct  95   IIQLLTASLPQ  105



>ref|WP_019500650.1| preprotein translocase subunit SecY [Pseudanabaena sp. PCC 6802]
Length=438

 Score = 68.2 bits (165),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 33/69 (48%), Positives = 46/69 (67%), Gaps = 0/69 (0%)
 Frame = +2

Query  491  LALSRVGIYVPLGGVNRDAFVGNLDENSILSTLDSFSGGGIGRLGICSLGIVPFINAQIV  670
            L L R+GI++PL  VNR  F   +  N I++ +D FSGGG+  LGI +LGI+P+INA I+
Sbjct  35   LILVRLGIFLPLPDVNRQVFSQAVKGNQIINFIDIFSGGGLSALGIFALGIIPYINASII  94

Query  671  FQLLGQIYP  697
             QL+    P
Sbjct  95   MQLMTAALP  103



>ref|WP_015195215.1| preprotein translocase subunit SecY [Stanieria cyanosphaera]
 gb|AFZ37561.1| protein translocase subunit secY/sec61 alpha [Stanieria cyanosphaera 
PCC 7437]
Length=436

 Score = 68.2 bits (165),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 32/69 (46%), Positives = 45/69 (65%), Gaps = 0/69 (0%)
 Frame = +2

Query  491  LALSRVGIYVPLGGVNRDAFVGNLDENSILSTLDSFSGGGIGRLGICSLGIVPFINAQIV  670
            L L R+GI++P+ G++R  F   +    +L  LD F+GGG+  LGI +LGI+PFINA I+
Sbjct  33   LILVRLGIFIPVPGIDRAKFAAGIQNLPVLGFLDIFTGGGLSALGIFALGILPFINASII  92

Query  671  FQLLGQIYP  697
             QLL    P
Sbjct  93   MQLLTAAIP  101



>ref|WP_016877824.1| preprotein translocase subunit SecY [Chlorogloeopsis fritschii]
Length=441

 Score = 68.2 bits (165),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 34/70 (49%), Positives = 47/70 (67%), Gaps = 1/70 (1%)
 Frame = +2

Query  491  LALSRVGIYVPLGGVNRDAFVGNLDEN-SILSTLDSFSGGGIGRLGICSLGIVPFINAQI  667
            L L R+GI++P+ G++R+ F   +  N  I S LD FSGGG+  LG+ +LGI+PFINA I
Sbjct  34   LILIRMGIHIPIPGIDRERFAAAVSSNNQIFSFLDIFSGGGLSALGVFALGILPFINASI  93

Query  668  VFQLLGQIYP  697
            + QLL    P
Sbjct  94   IIQLLTAAIP  103



>ref|WP_011125843.1| MULTISPECIES: preprotein translocase subunit SecY [Prochlorococcus]
 ref|NP_876085.1| Preprotein translocase subunit SecY [Prochlorococcus marinus 
subsp. marinus str. CCMP1375]
 gb|AAQ00738.1| Preprotein translocase subunit SecY [Prochlorococcus marinus 
subsp. marinus str. CCMP1375]
 gb|KGG10766.1| Preprotein translocase secY subunit [Prochlorococcus marinus 
str. LG]
 gb|KGG21189.1| Preprotein translocase secY subunit [Prochlorococcus marinus 
str. SS2]
 gb|KGG24013.1| Preprotein translocase secY subunit [Prochlorococcus marinus 
str. SS35]
 gb|KGG31728.1| Preprotein translocase secY subunit [Prochlorococcus marinus 
str. SS51]
 gb|KGG34794.1| Preprotein translocase secY subunit [Prochlorococcus sp. SS52]
Length=439

 Score = 67.8 bits (164),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 33/71 (46%), Positives = 48/71 (68%), Gaps = 1/71 (1%)
 Frame = +2

Query  491  LALSRVGIYVPLGGVNRDAFVGNLDEN-SILSTLDSFSGGGIGRLGICSLGIVPFINAQI  667
            L   R+GIY+P+ G++R+AF   + +   ++  LD F+GGGI  LGI +LGI+PFINA I
Sbjct  35   LLFVRLGIYIPVPGIDREAFKEFIQQGGQLIGFLDIFTGGGISTLGIFALGILPFINASI  94

Query  668  VFQLLGQIYPK  700
            + QLL    P+
Sbjct  95   IIQLLTAALPQ  105



>ref|WP_006618082.1| preprotein translocase subunit SecY [Arthrospira platensis]
 dbj|BAI90074.1| preprotein translocase SecY subunit [Arthrospira platensis NIES-39]
 gb|KDR56834.1| preprotein translocase subunit SecY [Arthrospira platensis str. 
Paraca]
Length=438

 Score = 67.8 bits (164),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 31/69 (45%), Positives = 45/69 (65%), Gaps = 0/69 (0%)
 Frame = +2

Query  491  LALSRVGIYVPLGGVNRDAFVGNLDENSILSTLDSFSGGGIGRLGICSLGIVPFINAQIV  670
            L L R+G+++P+ G++R AF  N+     +  LD FSGGG   LGI +LGI+P+INA I+
Sbjct  35   LILVRLGVFLPIPGIDRQAFSQNIQNTPFIGFLDLFSGGGFSALGIFALGILPYINASII  94

Query  671  FQLLGQIYP  697
             QL+    P
Sbjct  95   MQLMTAALP  103



>ref|WP_006621327.1| preprotein translocase subunit SecY [Arthrospira platensis]
 emb|CCE20747.1| preprotein translocase membrane subunit [Arthrospira sp. PCC 
8005]
 gb|EKD10649.1| preprotein translocase SecY subunit [Arthrospira platensis C1]
 emb|CDM93376.1| preprotein translocase membrane subunit [Arthrospira sp. PCC 
8005]
Length=438

 Score = 67.8 bits (164),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 31/69 (45%), Positives = 45/69 (65%), Gaps = 0/69 (0%)
 Frame = +2

Query  491  LALSRVGIYVPLGGVNRDAFVGNLDENSILSTLDSFSGGGIGRLGICSLGIVPFINAQIV  670
            L L R+G+++P+ G++R AF  N+     +  LD FSGGG   LGI +LGI+P+INA I+
Sbjct  35   LILVRLGVFLPIPGIDRQAFSQNIQNTPFIGFLDLFSGGGFSALGIFALGILPYINASII  94

Query  671  FQLLGQIYP  697
             QL+    P
Sbjct  95   MQLMTAALP  103



>ref|WP_006670293.1| preprotein translocase subunit SecY [Arthrospira maxima]
 gb|EDZ92804.1| preprotein translocase, SecY subunit [Arthrospira maxima CS-328]
Length=438

 Score = 67.8 bits (164),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 31/69 (45%), Positives = 45/69 (65%), Gaps = 0/69 (0%)
 Frame = +2

Query  491  LALSRVGIYVPLGGVNRDAFVGNLDENSILSTLDSFSGGGIGRLGICSLGIVPFINAQIV  670
            L L R+G+++P+ G++R AF  N+     +  LD FSGGG   LGI +LGI+P+INA I+
Sbjct  35   LILVRLGVFLPIPGIDRQAFSENIQNTPFIGFLDLFSGGGFSALGIFALGILPYINASII  94

Query  671  FQLLGQIYP  697
             QL+    P
Sbjct  95   MQLMTAALP  103



>ref|WP_011131117.1| preprotein translocase subunit SecY [Prochlorococcus marinus]
 emb|CAE21925.1| preprotein translocase SecY subunit [Prochlorococcus marinus 
str. MIT 9313]
Length=439

 Score = 67.8 bits (164),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 34/71 (48%), Positives = 47/71 (66%), Gaps = 1/71 (1%)
 Frame = +2

Query  491  LALSRVGIYVPLGGVNRDAFVGNLDEN-SILSTLDSFSGGGIGRLGICSLGIVPFINAQI  667
            L   R+GIY+P+ G++R AF   L +   ++  LD F+GGGI  LGI +LGI+PFINA I
Sbjct  35   LLFIRLGIYIPMPGIDRVAFQSFLQQGGQLIGFLDIFTGGGISTLGIFALGILPFINASI  94

Query  668  VFQLLGQIYPK  700
            + QLL    P+
Sbjct  95   ILQLLTAALPQ  105



>ref|WP_019508906.1| preprotein translocase subunit SecY [Pleurocapsa sp. PCC 7319]
Length=442

 Score = 67.8 bits (164),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 36/73 (49%), Positives = 49/73 (67%), Gaps = 5/73 (7%)
 Frame = +2

Query  491  LALSRVGIYVPLGGVNRDAFVGNLDENS----ILSTLDSFSGGGIGRLGICSLGIVPFIN  658
            L L R+G+++P+ G++R+ F GN   NS    I+  LD F+GGGI  LGI +LGI+PFIN
Sbjct  33   LILVRLGVFIPVPGIDREIF-GNFINNSGNASIVGFLDIFTGGGISALGIFALGILPFIN  91

Query  659  AQIVFQLLGQIYP  697
            A I+ QLL    P
Sbjct  92   ASIIMQLLATAIP  104



>ref|WP_011826922.1| preprotein translocase subunit SecY [Prochlorococcus marinus]
 gb|ABM79056.1| preprotein translocase SecY subunit [Prochlorococcus marinus 
str. MIT 9303]
Length=439

 Score = 67.8 bits (164),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 34/71 (48%), Positives = 47/71 (66%), Gaps = 1/71 (1%)
 Frame = +2

Query  491  LALSRVGIYVPLGGVNRDAFVGNLDEN-SILSTLDSFSGGGIGRLGICSLGIVPFINAQI  667
            L   R+GIY+P+ G++R AF   L +   ++  LD F+GGGI  LGI +LGI+PFINA I
Sbjct  35   LLFIRLGIYIPMPGIDRVAFQSFLQQGGQLIGFLDIFTGGGISTLGIFALGILPFINASI  94

Query  668  VFQLLGQIYPK  700
            + QLL    P+
Sbjct  95   ILQLLTAALPQ  105



>ref|WP_011128943.1| preprotein translocase subunit SecY [Synechococcus sp. WH 8102]
 emb|CAE08600.1| preprotein translocase SecY subunit [Synechococcus sp. WH 8102]
Length=441

 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 32/65 (49%), Positives = 47/65 (72%), Gaps = 1/65 (2%)
 Frame = +2

Query  509  GIYVPLGGVNRDAFVGNLDEN-SILSTLDSFSGGGIGRLGICSLGIVPFINAQIVFQLLG  685
            GIY+P+ G++R+AF   +++  S+L  LD F+GGGI  LG+ +LGI+PFINA I+ QLL 
Sbjct  41   GIYIPIPGIDREAFASFIEQGGSLLGFLDIFTGGGISTLGVFALGILPFINASIILQLLT  100

Query  686  QIYPK  700
               P+
Sbjct  101  ASLPQ  105



>ref|WP_015200864.1| preprotein translocase subunit SecY [Calothrix parietina]
 gb|AFZ04255.1| protein translocase subunit secY/sec61 alpha [Calothrix sp. PCC 
6303]
Length=437

 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 36/70 (51%), Positives = 49/70 (70%), Gaps = 1/70 (1%)
 Frame = +2

Query  491  LALSRVGIYVPLGGVNRDAFVGNLDENS-ILSTLDSFSGGGIGRLGICSLGIVPFINAQI  667
            L L R+GI++P+  ++R AF   + +NS ILS LD FSGGG+  LGI +LGI+P+INA I
Sbjct  34   LMLIRMGIHIPIPNIDRLAFADAVAKNSQILSFLDIFSGGGLSALGIFALGILPYINASI  93

Query  668  VFQLLGQIYP  697
            + QLL    P
Sbjct  94   IIQLLTAAIP  103



>ref|WP_019491988.1| preprotein translocase subunit SecY [Calothrix sp. PCC 7103]
Length=437

 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 36/70 (51%), Positives = 47/70 (67%), Gaps = 1/70 (1%)
 Frame = +2

Query  491  LALSRVGIYVPLGGVNRDAFVGNL-DENSILSTLDSFSGGGIGRLGICSLGIVPFINAQI  667
            L L R+GI++P+ G+NR  F   +   N ILS LD FSGGG+  LGI +LGI+P+INA I
Sbjct  34   LVLIRLGIHLPIPGINRVEFARAVASNNQILSFLDIFSGGGLSALGIFALGILPYINASI  93

Query  668  VFQLLGQIYP  697
            + QLL    P
Sbjct  94   IIQLLTAAIP  103



>ref|WP_036919325.1| MULTISPECIES: preprotein translocase subunit SecY [Prochlorococcus]
 gb|KGG14694.1| Preprotein translocase secY subunit [Prochlorococcus sp. MIT 
0602]
 gb|KGG15876.1| Preprotein translocase secY subunit [Prochlorococcus sp. MIT 
0603]
Length=439

 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 32/71 (45%), Positives = 48/71 (68%), Gaps = 1/71 (1%)
 Frame = +2

Query  491  LALSRVGIYVPLGGVNRDAFVGNLDEN-SILSTLDSFSGGGIGRLGICSLGIVPFINAQI  667
            L   R+GIY+P+ G++R+AF   + +   ++  LD F+GGGI  LG+ +LGI+PFINA I
Sbjct  35   LLFVRLGIYIPVPGIDREAFKEFIQQGGQLIGFLDIFTGGGISTLGVFALGILPFINASI  94

Query  668  VFQLLGQIYPK  700
            + QLL    P+
Sbjct  95   IIQLLTAALPQ  105



>ref|WP_015223443.1| preprotein translocase subunit SecY [Cyanobacterium stanieri]
 gb|AFZ48128.1| protein translocase subunit secY/sec61 alpha [Cyanobacterium 
stanieri PCC 7202]
Length=437

 Score = 67.0 bits (162),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 31/69 (45%), Positives = 46/69 (67%), Gaps = 0/69 (0%)
 Frame = +2

Query  491  LALSRVGIYVPLGGVNRDAFVGNLDENSILSTLDSFSGGGIGRLGICSLGIVPFINAQIV  670
            L + R+GIY+P+ G++R+AF   +     L  LD F+GGG+  +GI +LGI+P+INA I+
Sbjct  35   LIVVRLGIYIPVPGIDREAFEAAVQNLPFLGFLDLFTGGGLATVGIFALGILPYINASII  94

Query  671  FQLLGQIYP  697
             QLL    P
Sbjct  95   IQLLTSAVP  103



>ref|WP_041036060.1| preprotein translocase subunit SecY [Tolypothrix campylonemoides]
 gb|KIJ75813.1| preprotein translocase subunit SecY [Tolypothrix campylonemoides 
VB511288]
Length=437

 Score = 67.0 bits (162),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 35/70 (50%), Positives = 47/70 (67%), Gaps = 1/70 (1%)
 Frame = +2

Query  491  LALSRVGIYVPLGGVNRDAFVGNLD-ENSILSTLDSFSGGGIGRLGICSLGIVPFINAQI  667
            L L R+GI++P+  +NRD F   +   N ILS LD FSGGG+  LG+ +LGI+P+INA I
Sbjct  34   LFLIRLGIHLPIPNINRDEFARAIQGNNQILSFLDIFSGGGLSALGVFALGILPYINASI  93

Query  668  VFQLLGQIYP  697
            + QLL    P
Sbjct  94   IIQLLTAAIP  103



>ref|WP_016868075.1| preprotein translocase subunit SecY [Fischerella muscicola]
Length=441

 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 33/70 (47%), Positives = 47/70 (67%), Gaps = 1/70 (1%)
 Frame = +2

Query  491  LALSRVGIYVPLGGVNRDAFVGNLDEN-SILSTLDSFSGGGIGRLGICSLGIVPFINAQI  667
            L L R+GI++P+ G++R  F   ++ N  I S LD FSGGG+  LG+ +LGI+P+INA I
Sbjct  34   LILIRLGIHIPIPGIDRQQFAAAINSNNQIFSFLDIFSGGGLSALGVFALGILPYINASI  93

Query  668  VFQLLGQIYP  697
            + QLL    P
Sbjct  94   IIQLLTAAIP  103



>ref|WP_017310476.1| MULTISPECIES: preprotein translocase subunit SecY [Stigonematales]
 gb|KIY13451.1| preprotein translocase subunit SecY [Mastigocladus laminosus 
UU774]
Length=441

 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 33/70 (47%), Positives = 47/70 (67%), Gaps = 1/70 (1%)
 Frame = +2

Query  491  LALSRVGIYVPLGGVNRDAFVGNLD-ENSILSTLDSFSGGGIGRLGICSLGIVPFINAQI  667
            L L R+GI++P+ G++R  F   ++  N I S LD FSGGG+  LG+ +LGI+P+INA I
Sbjct  34   LILIRLGIHIPIPGIDRQQFAAAINGNNQIFSFLDIFSGGGLSALGVFALGILPYINASI  93

Query  668  VFQLLGQIYP  697
            + QLL    P
Sbjct  94   IIQLLTAAIP  103



>ref|WP_026722077.1| preprotein translocase subunit SecY [Fischerella sp. PCC 9431]
Length=441

 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 33/70 (47%), Positives = 47/70 (67%), Gaps = 1/70 (1%)
 Frame = +2

Query  491  LALSRVGIYVPLGGVNRDAFVGNLD-ENSILSTLDSFSGGGIGRLGICSLGIVPFINAQI  667
            L L R+GI++P+ G++R  F   ++  N I S LD FSGGG+  LG+ +LGI+P+INA I
Sbjct  34   LILIRLGIHIPIPGIDRQQFAAAINGNNQIFSFLDIFSGGGLSALGVFALGILPYINASI  93

Query  668  VFQLLGQIYP  697
            + QLL    P
Sbjct  94   IIQLLTAAIP  103



>ref|WP_016859430.1| preprotein translocase subunit SecY [Fischerella muscicola]
Length=441

 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 33/70 (47%), Positives = 47/70 (67%), Gaps = 1/70 (1%)
 Frame = +2

Query  491  LALSRVGIYVPLGGVNRDAFVGNLD-ENSILSTLDSFSGGGIGRLGICSLGIVPFINAQI  667
            L L R+GI++P+ G++R  F   ++  N I S LD FSGGG+  LG+ +LGI+P+INA I
Sbjct  34   LILIRLGIHIPIPGIDRQQFAAAINGNNQIFSFLDIFSGGGLSALGVFALGILPYINASI  93

Query  668  VFQLLGQIYP  697
            + QLL    P
Sbjct  94   IIQLLTAAIP  103



>ref|WP_026732526.1| preprotein translocase subunit SecY [Fischerella sp. PCC 9605]
Length=441

 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 33/70 (47%), Positives = 47/70 (67%), Gaps = 1/70 (1%)
 Frame = +2

Query  491  LALSRVGIYVPLGGVNRDAFVGNLDEN-SILSTLDSFSGGGIGRLGICSLGIVPFINAQI  667
            L L R+GI++P+ G++R  F   ++ N  I S LD FSGGG+  LG+ +LGI+P+INA I
Sbjct  34   LFLIRMGIHIPIPGIDRQQFAAAINSNNQIFSFLDIFSGGGLSALGVFALGILPYINASI  93

Query  668  VFQLLGQIYP  697
            + QLL    P
Sbjct  94   IIQLLTAAIP  103



>ref|WP_038543118.1| preprotein translocase subunit SecY [Synechococcus sp. KORDI-100]
 gb|AII42415.1| preprotein translocase subunit SecY [Synechococcus sp. KORDI-100]
Length=439

 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 31/64 (48%), Positives = 46/64 (72%), Gaps = 1/64 (2%)
 Frame = +2

Query  512  IYVPLGGVNRDAFVGNLDEN-SILSTLDSFSGGGIGRLGICSLGIVPFINAQIVFQLLGQ  688
            IY+P+ G++R+AF   +D+  S++  LD F+GGGI  LG+ +LGI+PFINA I+ QLL  
Sbjct  42   IYIPIPGIDREAFRSFIDQGGSLIGFLDIFTGGGISTLGVFALGILPFINASIILQLLTA  101

Query  689  IYPK  700
              P+
Sbjct  102  ALPQ  105



>ref|YP_001293597.1| preprotein translocase subunit SecY [Rhodomonas salina]
 gb|ABO70781.1| preprotein translocase subunit SecY [Rhodomonas salina]
Length=420

 Score = 66.2 bits (160),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 30/60 (50%), Positives = 44/60 (73%), Gaps = 0/60 (0%)
 Frame = +2

Query  500  SRVGIYVPLGGVNRDAFVGNLDENSILSTLDSFSGGGIGRLGICSLGIVPFINAQIVFQL  679
            SR+G ++P+ GV+ DAF  ++  N I++ L+ FSGGG   +GI +LGIVP+INA I+ QL
Sbjct  27   SRLGTFIPVPGVDHDAFYQSISTNPIVTFLNIFSGGGFASIGIFALGIVPYINASIIIQL  86



>ref|WP_015203282.1| preprotein translocase subunit SecY [Crinalium epipsammum]
 gb|AFZ13168.1| protein translocase subunit secY/sec61 alpha [Crinalium epipsammum 
PCC 9333]
Length=447

 Score = 66.2 bits (160),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 30/69 (43%), Positives = 47/69 (68%), Gaps = 0/69 (0%)
 Frame = +2

Query  491  LALSRVGIYVPLGGVNRDAFVGNLDENSILSTLDSFSGGGIGRLGICSLGIVPFINAQIV  670
            L L R+G+++P+ G++R  F  ++  + ++  LD FSGGGI  +GI +LGI+P+INA I+
Sbjct  35   LILVRLGVHIPIPGIDRARFAQDIQNSPVIGFLDIFSGGGISAVGIFALGILPYINASII  94

Query  671  FQLLGQIYP  697
             QLL    P
Sbjct  95   LQLLTAALP  103



>ref|YP_008144835.1| protein translocase subunit SecY [Grateloupia taiwanensis]
 gb|AGO19920.1| protein translocase subunit SecY [Grateloupia taiwanensis]
Length=411

 Score = 66.2 bits (160),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 28/66 (42%), Positives = 48/66 (73%), Gaps = 0/66 (0%)
 Frame = +2

Query  500  SRVGIYVPLGGVNRDAFVGNLDENSILSTLDSFSGGGIGRLGICSLGIVPFINAQIVFQL  679
            +R+GI++P+ G++ D+   +  +N +++ L+ FSGGG   +GI +LGIVP+IN+ I+ QL
Sbjct  21   ARMGIFIPIPGIDHDSLENSFGQNGVINFLNIFSGGGFSTIGIFALGIVPYINSSIIMQL  80

Query  680  LGQIYP  697
            L +I P
Sbjct  81   LIKIIP  86



>ref|WP_043694876.1| preprotein translocase subunit SecY [Synechococcus sp. KORDI-49]
 gb|AII46923.1| preprotein translocase subunit SecY [Synechococcus sp. KORDI-49]
Length=439

 Score = 66.2 bits (160),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 31/64 (48%), Positives = 45/64 (70%), Gaps = 1/64 (2%)
 Frame = +2

Query  512  IYVPLGGVNRDAFVGNLDEN-SILSTLDSFSGGGIGRLGICSLGIVPFINAQIVFQLLGQ  688
            IY+P+ G++RDAF   +D+   ++  LD F+GGGI  LG+ +LGI+PFINA I+ QLL  
Sbjct  42   IYIPIPGIDRDAFRSFIDQGGQLIGFLDIFTGGGISTLGVFALGILPFINASIILQLLTA  101

Query  689  IYPK  700
              P+
Sbjct  102  ALPQ  105



>ref|WP_009788918.1| preprotein translocase subunit SecY [Synechococcus sp. BL107]
 gb|EAU71563.1| preprotein translocase SecY [Synechococcus sp. BL107]
Length=439

 Score = 66.2 bits (160),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 31/64 (48%), Positives = 45/64 (70%), Gaps = 1/64 (2%)
 Frame = +2

Query  512  IYVPLGGVNRDAFVGNLDEN-SILSTLDSFSGGGIGRLGICSLGIVPFINAQIVFQLLGQ  688
            IY+P+ G++R+AF   +D+   ++  LD F+GGGI  LGI +LGI+PFINA I+ QLL  
Sbjct  42   IYIPMPGIDREAFKQFIDQGGQLIGFLDIFTGGGISTLGIFALGILPFINASIILQLLTA  101

Query  689  IYPK  700
              P+
Sbjct  102  ALPQ  105



>ref|WP_029912331.1| preprotein translocase subunit SecY [Caulobacter sp. UNC358MFTsu5.1]
Length=452

 Score = 66.2 bits (160),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 30/71 (42%), Positives = 46/71 (65%), Gaps = 2/71 (3%)
 Frame = +2

Query  491  LALSRVGIYVPLGGVNRDAFVGNLDENS--ILSTLDSFSGGGIGRLGICSLGIVPFINAQ  664
            L + R+G YVP+ G+N +AF     + S  IL   + FSGG + R+ I SL ++P+I+A 
Sbjct  34   LIVYRLGTYVPIPGINPEAFAAAFSQQSKGILGMFNMFSGGAVQRMAIFSLNVMPYISAS  93

Query  665  IVFQLLGQIYP  697
            I+ QL+G +YP
Sbjct  94   IIVQLMGSVYP  104



>ref|WP_037217669.1| preprotein translocase subunit SecY [Richelia intracellularis]
Length=438

 Score = 66.2 bits (160),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 34/70 (49%), Positives = 47/70 (67%), Gaps = 1/70 (1%)
 Frame = +2

Query  491  LALSRVGIYVPLGGVNRDAFVGNLD-ENSILSTLDSFSGGGIGRLGICSLGIVPFINAQI  667
            L L R G +VP+ G++RD+F   L   N +L+ LD FSGGG+  LG+ +LGI+P+INA I
Sbjct  35   LILIRFGNHVPIPGIDRDSFAAALQGNNQVLNFLDIFSGGGLSALGVFALGILPYINASI  94

Query  668  VFQLLGQIYP  697
            + QLL    P
Sbjct  95   IIQLLTAAIP  104



>ref|WP_026786887.1| MULTISPECIES: preprotein translocase subunit SecY [Planktothrix]
Length=435

 Score = 65.9 bits (159),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 30/69 (43%), Positives = 46/69 (67%), Gaps = 0/69 (0%)
 Frame = +2

Query  491  LALSRVGIYVPLGGVNRDAFVGNLDENSILSTLDSFSGGGIGRLGICSLGIVPFINAQIV  670
            L L RVG+++P+ G++  +F   +  N ++  LD FSGGG+  LGI +LGI+P+INA I+
Sbjct  35   LLLVRVGVFLPIPGIDTASFRAAIQNNPVIGFLDLFSGGGLSALGIFALGILPYINASII  94

Query  671  FQLLGQIYP  697
             QL+    P
Sbjct  95   MQLMTTALP  103



>ref|WP_015129705.1| preprotein translocase subunit SecY [Calothrix sp. PCC 7507]
 gb|AFY33898.1| protein translocase subunit secY/sec61 alpha [Calothrix sp. PCC 
7507]
Length=437

 Score = 65.9 bits (159),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 35/70 (50%), Positives = 46/70 (66%), Gaps = 1/70 (1%)
 Frame = +2

Query  491  LALSRVGIYVPLGGVNRDAFVGNLD-ENSILSTLDSFSGGGIGRLGICSLGIVPFINAQI  667
            L L R+GI++P+ G+NRD F   +   NSI   LD FSG G+  LG+ +LGI+PFINA I
Sbjct  34   LILVRLGIFLPVPGINRDRFHEAISGNNSIFGLLDIFSGRGLSTLGVFALGILPFINASI  93

Query  668  VFQLLGQIYP  697
            + QLL    P
Sbjct  94   IIQLLTAALP  103



>ref|WP_038556630.1| preprotein translocase subunit SecY [Synechococcus sp. KORDI-52]
Length=439

 Score = 65.9 bits (159),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 31/64 (48%), Positives = 45/64 (70%), Gaps = 1/64 (2%)
 Frame = +2

Query  512  IYVPLGGVNRDAFVGNLDEN-SILSTLDSFSGGGIGRLGICSLGIVPFINAQIVFQLLGQ  688
            IY+P+ G++R+AF   +D+   ++  LD F+GGGI  LGI +LGI+PFINA I+ QLL  
Sbjct  42   IYIPMPGIDREAFKQFIDQGGQLIGFLDIFTGGGISTLGIFALGILPFINASIILQLLTA  101

Query  689  IYPK  700
              P+
Sbjct  102  ALPQ  105



>gb|AII47686.1| preprotein translocase subunit SecY [Synechococcus sp. KORDI-52]
Length=448

 Score = 65.9 bits (159),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 31/64 (48%), Positives = 45/64 (70%), Gaps = 1/64 (2%)
 Frame = +2

Query  512  IYVPLGGVNRDAFVGNLDEN-SILSTLDSFSGGGIGRLGICSLGIVPFINAQIVFQLLGQ  688
            IY+P+ G++R+AF   +D+   ++  LD F+GGGI  LGI +LGI+PFINA I+ QLL  
Sbjct  51   IYIPMPGIDREAFKQFIDQGGQLIGFLDIFTGGGISTLGIFALGILPFINASIILQLLTA  110

Query  689  IYPK  700
              P+
Sbjct  111  ALPQ  114



>ref|WP_013191487.1| preprotein translocase subunit SecY [Trichormus azollae]
 gb|ADI64470.1| preprotein translocase, SecY subunit ['Nostoc azollae' 0708]
Length=437

 Score = 65.9 bits (159),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 34/70 (49%), Positives = 46/70 (66%), Gaps = 1/70 (1%)
 Frame = +2

Query  491  LALSRVGIYVPLGGVNRDAFVGNLD-ENSILSTLDSFSGGGIGRLGICSLGIVPFINAQI  667
            L L R+GI++P+ G+NR+ F   +   NSI   LD FSG G+  LG+ +LGI+PFINA I
Sbjct  34   LILVRLGIFLPVPGINRERFAEAISGNNSIFGLLDIFSGRGLSTLGVFALGILPFINASI  93

Query  668  VFQLLGQIYP  697
            + QLL    P
Sbjct  94   IIQLLTAAIP  103



>ref|WP_012640191.1| preprotein translocase subunit SecY [Caulobacter vibrioides]
 ref|YP_002516699.1| protein translocase subunit secY [Caulobacter crescentus NA1000]
 gb|ACL94791.1| protein translocase subunit secY [Caulobacter crescentus NA1000]
Length=451

 Score = 65.9 bits (159),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 31/71 (44%), Positives = 46/71 (65%), Gaps = 2/71 (3%)
 Frame = +2

Query  491  LALSRVGIYVPLGGVNRDAFVGNLDENS--ILSTLDSFSGGGIGRLGICSLGIVPFINAQ  664
            L + R+G YVP+ GV+  AF     +NS  +L   D FSGG + R+ I SL ++P+I+A 
Sbjct  34   LIVYRLGTYVPIPGVDPTAFASLFSQNSKGLLGMFDMFSGGAVERMAIFSLNVMPYISAS  93

Query  665  IVFQLLGQIYP  697
            I+ QL+G +YP
Sbjct  94   IIVQLMGTVYP  104



>ref|WP_006850514.1| preprotein translocase subunit SecY [Synechococcus sp. WH 8109]
 gb|AHF62769.1| SecY protein [Synechococcus sp. WH 8109]
Length=439

 Score = 65.9 bits (159),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 31/64 (48%), Positives = 45/64 (70%), Gaps = 1/64 (2%)
 Frame = +2

Query  512  IYVPLGGVNRDAFVGNLDEN-SILSTLDSFSGGGIGRLGICSLGIVPFINAQIVFQLLGQ  688
            IY+P+ G++R+AF   +D+   ++  LD F+GGGI  LGI +LGI+PFINA I+ QLL  
Sbjct  42   IYIPMPGIDREAFKQFIDQGGQLIGFLDIFTGGGISTLGIFALGILPFINASIILQLLTA  101

Query  689  IYPK  700
              P+
Sbjct  102  ALPQ  105



>ref|WP_011363377.1| preprotein translocase subunit SecY [Synechococcus sp. CC9605]
 gb|ABB34134.1| SecY protein [Synechococcus sp. CC9605]
Length=439

 Score = 65.9 bits (159),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 31/64 (48%), Positives = 45/64 (70%), Gaps = 1/64 (2%)
 Frame = +2

Query  512  IYVPLGGVNRDAFVGNLDEN-SILSTLDSFSGGGIGRLGICSLGIVPFINAQIVFQLLGQ  688
            IY+P+ G++R+AF   +D+   ++  LD F+GGGI  LGI +LGI+PFINA I+ QLL  
Sbjct  42   IYIPMPGIDREAFKQFIDQGGQLIGFLDIFTGGGISTLGIFALGILPFINASIILQLLTA  101

Query  689  IYPK  700
              P+
Sbjct  102  ALPQ  105



>ref|WP_012285682.1| preprotein translocase subunit SecY [Caulobacter sp. K31]
 gb|ABZ70763.1| preprotein translocase, SecY subunit [Caulobacter sp. K31]
Length=452

 Score = 65.9 bits (159),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 29/71 (41%), Positives = 46/71 (65%), Gaps = 2/71 (3%)
 Frame = +2

Query  491  LALSRVGIYVPLGGVNRDAFVGNLDENS--ILSTLDSFSGGGIGRLGICSLGIVPFINAQ  664
            L + R+G YVP+ G+N +AF     + S  IL   + FSGG + R+ + SL ++P+I+A 
Sbjct  34   LIVYRLGTYVPIPGINPEAFAAAFSQQSKGILGMFNMFSGGAVQRMAVFSLNVMPYISAS  93

Query  665  IVFQLLGQIYP  697
            I+ QL+G +YP
Sbjct  94   IIVQLMGSVYP  104



>ref|WP_010919147.1| preprotein translocase subunit SecY [Caulobacter vibrioides]
 ref|NP_420081.1| preprotein translocase subunit SecY [Caulobacter crescentus CB15]
 gb|AAK23249.1| preprotein translocase SecY subunit [Caulobacter crescentus CB15]
Length=440

 Score = 65.9 bits (159),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 31/71 (44%), Positives = 46/71 (65%), Gaps = 2/71 (3%)
 Frame = +2

Query  491  LALSRVGIYVPLGGVNRDAFVGNLDENS--ILSTLDSFSGGGIGRLGICSLGIVPFINAQ  664
            L + R+G YVP+ GV+  AF     +NS  +L   D FSGG + R+ I SL ++P+I+A 
Sbjct  23   LIVYRLGTYVPIPGVDPTAFASLFSQNSKGLLGMFDMFSGGAVERMAIFSLNVMPYISAS  82

Query  665  IVFQLLGQIYP  697
            I+ QL+G +YP
Sbjct  83   IIVQLMGTVYP  93



>ref|WP_026222368.1| preprotein translocase subunit SecY [filamentous cyanobacterium 
ESFC-1]
Length=446

 Score = 65.9 bits (159),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 30/65 (46%), Positives = 44/65 (68%), Gaps = 0/65 (0%)
 Frame = +2

Query  503  RVGIYVPLGGVNRDAFVGNLDENSILSTLDSFSGGGIGRLGICSLGIVPFINAQIVFQLL  682
            R G+++P+ G++R AF   +  + ++  LD FSGGG+  LGI +LGI+PFINA I+ QLL
Sbjct  39   RFGVFLPVPGIDRVAFAREIQNSPVIGFLDIFSGGGLSALGIFALGILPFINASIIMQLL  98

Query  683  GQIYP  697
                P
Sbjct  99   TAALP  103



>ref|WP_035080009.1| preprotein translocase subunit SecY [Caulobacter henricii]
Length=452

 Score = 65.9 bits (159),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 29/71 (41%), Positives = 46/71 (65%), Gaps = 2/71 (3%)
 Frame = +2

Query  491  LALSRVGIYVPLGGVNRDAFVGNLDENS--ILSTLDSFSGGGIGRLGICSLGIVPFINAQ  664
            L + R+G YVP+ G+N +AF     + S  IL   + FSGG + R+ + SL ++P+I+A 
Sbjct  34   LIVYRLGTYVPIPGINPEAFAAAFSQQSKGILGMFNMFSGGAVQRMAVFSLNVMPYISAS  93

Query  665  IVFQLLGQIYP  697
            I+ QL+G +YP
Sbjct  94   IIVQLMGSVYP  104



>ref|WP_018061133.1| MULTISPECIES: preprotein translocase subunit SecY [Caulobacter]
Length=452

 Score = 65.5 bits (158),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 29/71 (41%), Positives = 46/71 (65%), Gaps = 2/71 (3%)
 Frame = +2

Query  491  LALSRVGIYVPLGGVNRDAFVGNLDENS--ILSTLDSFSGGGIGRLGICSLGIVPFINAQ  664
            L + R+G YVP+ G+N +AF     + S  IL   + FSGG + R+ + SL ++P+I+A 
Sbjct  34   LIVYRLGTYVPIPGINPEAFAAAFSQQSKGILGMFNMFSGGAVQRMAVFSLNVMPYISAS  93

Query  665  IVFQLLGQIYP  697
            I+ QL+G +YP
Sbjct  94   IIVQLMGSVYP  104



>ref|WP_011244193.1| MULTISPECIES: protein translocase subunit SecY [Synechococcus]
 sp|P0A4H0.1|SECY_SYNE7 RecName: Full=Protein translocase subunit SecY [Synechococcus 
elongatus PCC 7942]
 sp|P0A4H1.1|SECY_SYNP6 RecName: Full=Protein translocase subunit SecY [Synechococcus 
elongatus PCC 6301]
 pir||S27155 preprotein translocase secY - Synechococcus sp
 emb|CAA48194.1| SecY protein [Synechococcus elongatus PCC 7942]
 dbj|BAA22467.1| preprotein translocase SecY subunit [Synechococcus elongatus 
PCC 6301]
 dbj|BAD80073.1| preprotein translocase SecY subunit [Synechococcus elongatus 
PCC 6301]
 gb|ABB58244.1| protein translocase subunit secY/sec61 alpha [Synechococcus elongatus 
PCC 7942]
 gb|AJD57284.1| preprotein translocase subunit SecY [Synechococcus sp. UTEX 2973]
Length=439

 Score = 65.5 bits (158),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 49/73 (67%), Gaps = 4/73 (5%)
 Frame = +2

Query  491  LALSRVGIYVPLGGVNRDAFVGNLDENS----ILSTLDSFSGGGIGRLGICSLGIVPFIN  658
            L L R+GI++P+ G++R AF  +L  N+    ++  LD FSGGG+  LG+ +LGI+P+IN
Sbjct  35   LILCRLGIFIPVPGIDRVAFSNDLQGNANLGGVIGFLDIFSGGGLSALGVFALGILPYIN  94

Query  659  AQIVFQLLGQIYP  697
            A I+ QLL    P
Sbjct  95   ASIILQLLTAAVP  107



>ref|WP_008191183.1| preprotein translocase subunit SecY [Moorea producens]
 gb|EGJ28568.1| protein translocase subunit secY/sec61 alpha [Moorea producens 
3L]
Length=446

 Score = 65.5 bits (158),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 31/69 (45%), Positives = 45/69 (65%), Gaps = 0/69 (0%)
 Frame = +2

Query  491  LALSRVGIYVPLGGVNRDAFVGNLDENSILSTLDSFSGGGIGRLGICSLGIVPFINAQIV  670
            L L+R+G+++P+ G++R  F   L  +  +  LD FSGGG   LGI +LGI+P+INA I+
Sbjct  35   LILARLGVFLPVPGIDRARFSAELQNSPFVGLLDFFSGGGFSALGIFALGILPYINASII  94

Query  671  FQLLGQIYP  697
             QLL    P
Sbjct  95   LQLLTAAIP  103



>ref|WP_028041099.1| preprotein translocase subunit SecY [Caulobacter sp. URHA0033]
Length=452

 Score = 65.5 bits (158),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 29/71 (41%), Positives = 46/71 (65%), Gaps = 2/71 (3%)
 Frame = +2

Query  491  LALSRVGIYVPLGGVNRDAFVGNLDENS--ILSTLDSFSGGGIGRLGICSLGIVPFINAQ  664
            L + R+G YVP+ G+N +AF     + S  IL   + FSGG + R+ + SL ++P+I+A 
Sbjct  34   LIVYRLGTYVPIPGINPEAFAAAFSQQSKGILGMFNMFSGGAVQRMAVFSLNVMPYISAS  93

Query  665  IVFQLLGQIYP  697
            I+ QL+G +YP
Sbjct  94   IIVQLMGSVYP  104



>ref|WP_011360727.1| preprotein translocase subunit SecY [Synechococcus sp. CC9902]
 gb|ABB26931.1| protein translocase subunit secY/sec61 alpha [Synechococcus sp. 
CC9902]
Length=439

 Score = 65.5 bits (158),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 31/64 (48%), Positives = 45/64 (70%), Gaps = 1/64 (2%)
 Frame = +2

Query  512  IYVPLGGVNRDAFVGNLDEN-SILSTLDSFSGGGIGRLGICSLGIVPFINAQIVFQLLGQ  688
            IY+P+ G++R+AF   +D+   ++  LD F+GGGI  LGI +LGI+PFINA I+ QLL  
Sbjct  42   IYIPMPGIDREAFKQFIDQGGQLIGFLDIFTGGGISTLGIFALGILPFINASIILQLLTA  101

Query  689  IYPK  700
              P+
Sbjct  102  SLPQ  105



>ref|WP_029956127.1| preprotein translocase subunit SecY, partial [Prochlorococcus 
sp. scB241_527G5]
Length=102

 Score = 61.6 bits (148),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 30/58 (52%), Positives = 42/58 (72%), Gaps = 1/58 (2%)
 Frame = +2

Query  512  IYVPLGGVNRDAFVGNLDEN-SILSTLDSFSGGGIGRLGICSLGIVPFINAQIVFQLL  682
            IY+P+ G++R AF   +D+   ++  LD F+GGGI  LGI +LGI+PFINA I+ QLL
Sbjct  42   IYIPMPGIDRVAFKSFIDQGGQLIGFLDIFTGGGISTLGIFALGILPFINASIILQLL  99



>ref|WP_006512308.1| preprotein translocase subunit SecY [Xenococcus sp. PCC 7305]
 gb|ELS00555.1| protein translocase subunit secY/sec61 alpha [Xenococcus sp. 
PCC 7305]
Length=440

 Score = 65.5 bits (158),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 30/65 (46%), Positives = 44/65 (68%), Gaps = 0/65 (0%)
 Frame = +2

Query  503  RVGIYVPLGGVNRDAFVGNLDENSILSTLDSFSGGGIGRLGICSLGIVPFINAQIVFQLL  682
            R+GI++P+ G++R +F   +    +L  LD F+GGG+  LGI +LGI+PFINA I+ QLL
Sbjct  37   RLGIFIPVPGIDRASFAEAVQNLPVLGFLDIFTGGGLSALGIFALGILPFINASIIMQLL  96

Query  683  GQIYP  697
                P
Sbjct  97   TAAIP  101



>ref|WP_019477690.1| preprotein translocase subunit SecY [Prochlorococcus sp. W7]
Length=439

 Score = 65.1 bits (157),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 31/63 (49%), Positives = 44/63 (70%), Gaps = 1/63 (2%)
 Frame = +2

Query  512  IYVPLGGVNRDAFVGNLDEN-SILSTLDSFSGGGIGRLGICSLGIVPFINAQIVFQLLGQ  688
            IY+P+ G++R+AF   +D+   ++  LD F+GGGI  LGI +LGI+PFINA I+ QLL  
Sbjct  42   IYIPMPGIDREAFKSFIDQGGQLIGFLDIFTGGGISTLGIFALGILPFINASIIIQLLTA  101

Query  689  IYP  697
              P
Sbjct  102  ALP  104



>ref|WP_010871961.1| protein translocase subunit SecY [Synechocystis sp. PCC 6803]
 ref|NP_440651.1| preprotein translocase subunit SecY [Synechocystis sp. PCC 6803]
 sp|P77964.1|SECY_SYNY3 RecName: Full=Protein translocase subunit SecY [Synechocystis 
sp. PCC 6803 substr. Kazusa]
 dbj|BAA17331.1| preprotein translocase SecY subunit [Synechocystis sp. PCC 6803]
 dbj|BAK49505.1| preprotein translocase SecY subunit [Synechocystis sp. PCC 6803]
 dbj|BAL28504.1| preprotein translocase SecY subunit [Synechocystis sp. PCC 6803 
substr. GT-I]
 dbj|BAL31673.1| preprotein translocase SecY subunit [Synechocystis sp. PCC 6803 
substr. PCC-N]
 dbj|BAL34842.1| preprotein translocase SecY subunit [Synechocystis sp. PCC 6803 
substr. PCC-P]
 dbj|BAM51055.1| preprotein translocase subunit SecY [Bacillus subtilis BEST7613]
 gb|AGF51020.1| preprotein translocase SecY subunit [Synechocystis sp. PCC 6803]
Length=442

 Score = 65.1 bits (157),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 29/65 (45%), Positives = 47/65 (72%), Gaps = 0/65 (0%)
 Frame = +2

Query  503  RVGIYVPLGGVNRDAFVGNLDENSILSTLDSFSGGGIGRLGICSLGIVPFINAQIVFQLL  682
            RVGI++P+  ++R AF   +++NS++  L+ F+GGG+  +GI +LGI+P+INA I+ QLL
Sbjct  39   RVGIFIPVPDIDRQAFSQAINDNSVIGFLNIFTGGGLSTVGIFALGILPYINASIIMQLL  98

Query  683  GQIYP  697
                P
Sbjct  99   TAAIP  103



>ref|WP_036922394.1| preprotein translocase subunit SecY [Prochlorococcus marinus]
Length=439

 Score = 65.1 bits (157),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 31/63 (49%), Positives = 44/63 (70%), Gaps = 1/63 (2%)
 Frame = +2

Query  512  IYVPLGGVNRDAFVGNLDEN-SILSTLDSFSGGGIGRLGICSLGIVPFINAQIVFQLLGQ  688
            IY+P+ G++R+AF   +D+   ++  LD F+GGGI  LGI +LGI+PFINA I+ QLL  
Sbjct  42   IYIPMPGIDREAFKSFIDQGGQLIGFLDIFTGGGISTLGIFALGILPFINASIIIQLLTA  101

Query  689  IYP  697
              P
Sbjct  102  ALP  104



>ref|WP_028947562.1| preprotein translocase subunit SecY [Synechocystis sp. PCC 6714]
 gb|AIE75039.1| Preprotein translocase secY subunit [Synechocystis sp. PCC 6714]
Length=442

 Score = 65.1 bits (157),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 29/65 (45%), Positives = 47/65 (72%), Gaps = 0/65 (0%)
 Frame = +2

Query  503  RVGIYVPLGGVNRDAFVGNLDENSILSTLDSFSGGGIGRLGICSLGIVPFINAQIVFQLL  682
            RVGI++P+  ++R AF   +++NS++  L+ F+GGG+  +GI +LGI+P+INA I+ QLL
Sbjct  39   RVGIFIPVPDIDRQAFSQAINDNSVIGFLNIFTGGGLSTVGIFALGILPYINASIIMQLL  98

Query  683  GQIYP  697
                P
Sbjct  99   TAAIP  103



>ref|WP_019477844.1| preprotein translocase subunit SecY [Prochlorococcus sp. W8]
Length=439

 Score = 65.1 bits (157),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 31/63 (49%), Positives = 44/63 (70%), Gaps = 1/63 (2%)
 Frame = +2

Query  512  IYVPLGGVNRDAFVGNLDEN-SILSTLDSFSGGGIGRLGICSLGIVPFINAQIVFQLLGQ  688
            IY+P+ G++R+AF   +D+   ++  LD F+GGGI  LGI +LGI+PFINA I+ QLL  
Sbjct  42   IYIPMPGIDREAFKSFIDQGGQLIGFLDIFTGGGISTLGIFALGILPFINASIIIQLLTA  101

Query  689  IYP  697
              P
Sbjct  102  ALP  104



>ref|WP_013324971.1| preprotein translocase subunit SecY [Cyanothece sp. PCC 7822]
 gb|ADN16933.1| preprotein translocase, SecY subunit [Cyanothece sp. PCC 7822]
Length=439

 Score = 65.1 bits (157),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 33/69 (48%), Positives = 44/69 (64%), Gaps = 0/69 (0%)
 Frame = +2

Query  491  LALSRVGIYVPLGGVNRDAFVGNLDENSILSTLDSFSGGGIGRLGICSLGIVPFINAQIV  670
            L L R GI+VP+ G++R  F   +  +  L  LD F+GGG+  LGI +LGI+PFINA I+
Sbjct  35   LILVRFGIFVPVPGLDRAKFADFIQNSPALGILDIFTGGGLSTLGIFALGILPFINASII  94

Query  671  FQLLGQIYP  697
             QLL    P
Sbjct  95   MQLLTAAIP  103



>ref|WP_029635490.1| preprotein translocase subunit SecY [[Scytonema hofmanni] UTEX 
B 1581]
Length=437

 Score = 65.1 bits (157),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 34/70 (49%), Positives = 46/70 (66%), Gaps = 1/70 (1%)
 Frame = +2

Query  491  LALSRVGIYVPLGGVNRDAFVGNLDENS-ILSTLDSFSGGGIGRLGICSLGIVPFINAQI  667
            L L R+GIY+P+ G+NR+ F   +  NS I   LD FSG G+  LG+ +LGI+P+INA I
Sbjct  34   LILIRLGIYLPIPGINRELFHQAIQGNSAIFGLLDIFSGRGLSTLGVFALGILPYINASI  93

Query  668  VFQLLGQIYP  697
            + QLL    P
Sbjct  94   IIQLLTTAIP  103



>ref|WP_006276972.1| preprotein translocase subunit SecY [Cylindrospermopsis raciborskii]
 gb|EFA70176.1| SecY protein [Cylindrospermopsis raciborskii CS-505]
Length=437

 Score = 65.1 bits (157),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 33/70 (47%), Positives = 46/70 (66%), Gaps = 1/70 (1%)
 Frame = +2

Query  491  LALSRVGIYVPLGGVNRDAFVGNLD-ENSILSTLDSFSGGGIGRLGICSLGIVPFINAQI  667
            L L R+GI++P+ G+NR+ F   +   N+I   LD FSG G+  LG+ +LGI+PFINA I
Sbjct  34   LILVRLGIFLPVPGINRERFAEAISGNNAIFGLLDIFSGRGLSTLGVFALGILPFINASI  93

Query  668  VFQLLGQIYP  697
            + QLL    P
Sbjct  94   IIQLLTAAIP  103



>ref|WP_015208454.1| preprotein translocase subunit SecY [Cylindrospermum stagnale]
 gb|AFZ25202.1| protein translocase subunit secY/sec61 alpha [Cylindrospermum 
stagnale PCC 7417]
Length=437

 Score = 64.7 bits (156),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 34/70 (49%), Positives = 46/70 (66%), Gaps = 1/70 (1%)
 Frame = +2

Query  491  LALSRVGIYVPLGGVNRDAFVGNLD-ENSILSTLDSFSGGGIGRLGICSLGIVPFINAQI  667
            L L R+GI++P+ G+NR+ F   +   NSI   LD FSG G+  LG+ +LGI+PFINA I
Sbjct  34   LILVRLGIFLPVPGINRERFSEAISGNNSIFGLLDIFSGRGLSTLGVFALGILPFINASI  93

Query  668  VFQLLGQIYP  697
            + QLL    P
Sbjct  94   IIQLLTAAIP  103



>ref|WP_008225915.1| preprotein translocase subunit SecY [Richelia intracellularis]
 emb|CCH64800.1| Preprotein translocase secY subunit (TC 3.A.5.1.1) [Richelia 
intracellularis HM01]
 emb|CCH66351.1| Preprotein translocase secY subunit (TC 3.A.5.1.1) [Richelia 
intracellularis HH01]
Length=438

 Score = 64.7 bits (156),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 34/70 (49%), Positives = 47/70 (67%), Gaps = 1/70 (1%)
 Frame = +2

Query  491  LALSRVGIYVPLGGVNRDAFVGNLD-ENSILSTLDSFSGGGIGRLGICSLGIVPFINAQI  667
            L L R G ++P+ G++RD+F   L   N IL+ LD FSGGG+  LG+ +LGI+P+INA I
Sbjct  35   LILIRFGNHIPIPGIDRDSFAVALQGNNQILNFLDIFSGGGLSALGVFALGILPYINASI  94

Query  668  VFQLLGQIYP  697
            + QLL    P
Sbjct  95   IIQLLTAAIP  104



>ref|WP_015118733.1| preprotein translocase subunit SecY [Rivularia sp. PCC 7116]
 gb|AFY55160.1| protein translocase subunit secY/sec61 alpha [Rivularia sp. PCC 
7116]
Length=437

 Score = 64.7 bits (156),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 33/70 (47%), Positives = 45/70 (64%), Gaps = 1/70 (1%)
 Frame = +2

Query  491  LALSRVGIYVPLGGVNRDAFVGNLDE-NSILSTLDSFSGGGIGRLGICSLGIVPFINAQI  667
            L L R+GIY+P+ G++R  F   + + N +   LD FSGGG   LG+ +LGI+PFINA I
Sbjct  34   LLLIRLGIYIPIPGIDRVRFSAAMSQGNGLAGILDIFSGGGFSALGVFTLGILPFINASI  93

Query  668  VFQLLGQIYP  697
            + QLL    P
Sbjct  94   IIQLLTAAIP  103



>gb|AHF23510.1| preprotein translocase SecY [uncultured Phormidium sp.]
Length=434

 Score = 64.7 bits (156),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 31/69 (45%), Positives = 47/69 (68%), Gaps = 0/69 (0%)
 Frame = +2

Query  491  LALSRVGIYVPLGGVNRDAFVGNLDENSILSTLDSFSGGGIGRLGICSLGIVPFINAQIV  670
            L L R+G+++P+  ++R AF  N+  + ++  LD FSGGG+  LGI +LGI+P+INA I+
Sbjct  35   LILVRLGVHLPVPSIDRLAFSQNVQNSPLIGFLDLFSGGGLSALGIFALGILPYINASII  94

Query  671  FQLLGQIYP  697
             QLL    P
Sbjct  95   VQLLTAALP  103



>ref|NP_050786.1| preprotein translocase subunit SecY (chloroplast) [Guillardia 
theta]
 sp|P28527.2|SECY_GUITH RecName: Full=Protein translocase subunit SecY (chloroplast) 
[Guillardia theta]
 pir||S20577 preprotein translocase secY - Cryptomonas sp. chloroplast
 gb|AAC35720.1| SecY-type transporter protein (chloroplast) [Guillardia theta]
Length=420

 Score = 64.7 bits (156),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 28/63 (44%), Positives = 46/63 (73%), Gaps = 0/63 (0%)
 Frame = +2

Query  491  LALSRVGIYVPLGGVNRDAFVGNLDENSILSTLDSFSGGGIGRLGICSLGIVPFINAQIV  670
            + +SR+G ++P+ GV+ DAF  ++  N +++ L+ FSGGG   +G+ +LGIVP+INA I+
Sbjct  24   IVMSRLGTFLPIPGVDHDAFYQSIISNPLVNFLNVFSGGGFASIGVFALGIVPYINASII  83

Query  671  FQL  679
             QL
Sbjct  84   VQL  86



>ref|WP_025947011.1| preprotein translocase subunit SecY [Prochlorococcus sp. scB241_528N20]
Length=439

 Score = 64.7 bits (156),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 31/59 (53%), Positives = 43/59 (73%), Gaps = 1/59 (2%)
 Frame = +2

Query  509  GIYVPLGGVNRDAFVGNLDEN-SILSTLDSFSGGGIGRLGICSLGIVPFINAQIVFQLL  682
            GIY+P+ G++R AF   +D+   ++  LD F+GGGI  LGI +LGI+PFINA I+ QLL
Sbjct  41   GIYIPMPGIDRVAFKSFIDQGGQLIGFLDIFTGGGISTLGIFALGILPFINASIIIQLL  99



>ref|WP_015215929.1| preprotein translocase subunit SecY [Anabaena cylindrica]
 gb|AFZ59309.1| protein translocase subunit secY/sec61 alpha [Anabaena cylindrica 
PCC 7122]
Length=437

 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 34/70 (49%), Positives = 45/70 (64%), Gaps = 1/70 (1%)
 Frame = +2

Query  491  LALSRVGIYVPLGGVNRDAFVGNLD-ENSILSTLDSFSGGGIGRLGICSLGIVPFINAQI  667
            L L R+GI++P+ G+NR  F   +   NS+   LD FSG G+  LGI +LGI+PFINA I
Sbjct  34   LILVRLGIFLPIPGINRVRFAEAISGNNSVFGLLDIFSGRGLSTLGIFALGILPFINASI  93

Query  668  VFQLLGQIYP  697
            + QLL    P
Sbjct  94   IIQLLTAAIP  103



>ref|WP_028085243.1| preprotein translocase subunit SecY [Dolichospermum circinale]
Length=437

 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 34/70 (49%), Positives = 45/70 (64%), Gaps = 1/70 (1%)
 Frame = +2

Query  491  LALSRVGIYVPLGGVNRDAFVGNLD-ENSILSTLDSFSGGGIGRLGICSLGIVPFINAQI  667
            L L R+GI++P+ G++R  F   +   NSI   LD FSG G+  LGI +LGI+PFINA I
Sbjct  34   LILVRLGIFLPVPGIDRPKFAEAISGNNSIFGLLDIFSGRGLSTLGIFALGILPFINASI  93

Query  668  VFQLLGQIYP  697
            + QLL    P
Sbjct  94   IIQLLTAALP  103



>ref|WP_027402089.1| preprotein translocase subunit SecY [Aphanizomenon flos-aquae]
Length=437

 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 34/70 (49%), Positives = 45/70 (64%), Gaps = 1/70 (1%)
 Frame = +2

Query  491  LALSRVGIYVPLGGVNRDAFVGNLD-ENSILSTLDSFSGGGIGRLGICSLGIVPFINAQI  667
            L L R+GI++P+ G++R  F   +   NSI   LD FSG G+  LGI +LGI+PFINA I
Sbjct  34   LILVRLGIFLPVPGIDRPKFAEAISGNNSIFGLLDIFSGRGLSTLGIFALGILPFINASI  93

Query  668  VFQLLGQIYP  697
            + QLL    P
Sbjct  94   IIQLLTAALP  103



>ref|WP_016953009.1| preprotein translocase subunit SecY [Anabaena sp. PCC 7108]
Length=436

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 33/70 (47%), Positives = 45/70 (64%), Gaps = 1/70 (1%)
 Frame = +2

Query  491  LALSRVGIYVPLGGVNRDAFVGNLD-ENSILSTLDSFSGGGIGRLGICSLGIVPFINAQI  667
            L L R+GI++P+ G+NR  F   +   NS+   LD FSG G+  LG+ +LGI+PFINA I
Sbjct  34   LILVRLGIFLPIPGINRVRFAEAISGNNSVFGLLDIFSGRGLSTLGVFALGILPFINASI  93

Query  668  VFQLLGQIYP  697
            + QLL    P
Sbjct  94   IIQLLTTALP  103



>ref|WP_026797654.1| MULTISPECIES: preprotein translocase subunit SecY [Planktothrix]
 gb|KEI65646.1| SecY [Planktothrix agardhii NIVA-CYA 126/8]
Length=435

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 28/65 (43%), Positives = 44/65 (68%), Gaps = 0/65 (0%)
 Frame = +2

Query  503  RVGIYVPLGGVNRDAFVGNLDENSILSTLDSFSGGGIGRLGICSLGIVPFINAQIVFQLL  682
            RVG+++P+ G++  +F   +  N ++  LD FSGGG+  LGI +LGI+P+INA I+ QL+
Sbjct  39   RVGVFLPIPGIDTASFRAAIQNNPVIGFLDLFSGGGLSALGIFALGILPYINASIIMQLM  98

Query  683  GQIYP  697
                P
Sbjct  99   TTALP  103



>ref|WP_009452516.1| preprotein translocase subunit SecY [Nitratireductor indicus]
 gb|EKF40338.1| preprotein translocase subunit SecY [Nitratireductor indicus 
C115]
Length=446

 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 46/71 (65%), Gaps = 2/71 (3%)
 Frame = +2

Query  491  LALSRVGIYVPLGGVNRDAFVGNLDENS--ILSTLDSFSGGGIGRLGICSLGIVPFINAQ  664
            L + R+G Y+P+ G+N DAF     + S  +L   + F+GG +GR+ I +LGI+P+I+A 
Sbjct  34   LLVYRLGTYIPMPGINPDAFAQAFQQQSGGVLGMFNMFAGGAVGRMAIFALGIMPYISAS  93

Query  665  IVFQLLGQIYP  697
            I+ QL+  + P
Sbjct  94   IIMQLMTSVVP  104



>ref|XP_002949456.1| hypothetical protein VOLCADRAFT_104339 [Volvox carteri f. nagariensis]
 gb|EFJ49475.1| hypothetical protein VOLCADRAFT_104339 [Volvox carteri f. nagariensis]
Length=501

 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 31/68 (46%), Positives = 46/68 (68%), Gaps = 2/68 (3%)
 Frame = +2

Query  500  SRVGIYVPLGGVNRDAFVGNLDENSILSTLDSFSGGGIGR--LGICSLGIVPFINAQIVF  673
            SRVG+Y+ L GV+ DAF  +L  + +L  +D+ SGG I +  +G+ SLGI+P+IN+ IV 
Sbjct  104  SRVGVYIRLPGVDVDAFAESLTNSGLLGYIDTLSGGSISKVQVGLFSLGIIPYINSSIVL  163

Query  674  QLLGQIYP  697
            QL    +P
Sbjct  164  QLFSAAFP  171



>ref|WP_015079195.1| preprotein translocase subunit SecY [Anabaena sp. 90]
 gb|AFW94032.1| preprotein translocase subunit SecY [Anabaena sp. 90]
Length=437

 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 33/70 (47%), Positives = 45/70 (64%), Gaps = 1/70 (1%)
 Frame = +2

Query  491  LALSRVGIYVPLGGVNRDAFVGNLD-ENSILSTLDSFSGGGIGRLGICSLGIVPFINAQI  667
            L L R+GI++P+ G++R  F   +   NSI   LD FSG G+  LG+ +LGI+PFINA I
Sbjct  34   LILVRLGIFLPVPGIDRPKFAEAISGNNSIFGLLDIFSGRGLSTLGVFALGILPFINASI  93

Query  668  VFQLLGQIYP  697
            + QLL    P
Sbjct  94   IIQLLTSALP  103



>ref|WP_029087824.1| preprotein translocase subunit SecY [Brevundimonas aveniformis]
Length=452

 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 29/71 (41%), Positives = 46/71 (65%), Gaps = 2/71 (3%)
 Frame = +2

Query  491  LALSRVGIYVPLGGVNRDAFVGNLDENS--ILSTLDSFSGGGIGRLGICSLGIVPFINAQ  664
            + + R+G Y+P+ G+N DAF       S  IL  ++ FSGG + R+ I +L ++P+I+A 
Sbjct  34   MIVYRLGTYIPIPGLNVDAFAQAFQNQSQGILGMVNMFSGGAVERMAIFALNVMPYISAS  93

Query  665  IVFQLLGQIYP  697
            I+ QLLG +YP
Sbjct  94   IIVQLLGAVYP  104



>ref|WP_013909573.1| preprotein translocase subunit SecY [Thermodesulfobacterium geofontis]
 gb|AEH22874.1| preprotein translocase, SecY subunit [Thermodesulfobacterium 
geofontis OPF15]
Length=436

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 29/71 (41%), Positives = 46/71 (65%), Gaps = 2/71 (3%)
 Frame = +2

Query  491  LALSRVGIYVPLGGVNRDAFVGNLDENS--ILSTLDSFSGGGIGRLGICSLGIVPFINAQ  664
            LA+ R  +++P  G+N +AF+    + S  +   LD FSGG + R  IC+LG++P+I+A 
Sbjct  27   LAIYRFAVHIPTPGINGEAFLSLFKQASGTLFGFLDIFSGGALRRFSICALGVMPYISAS  86

Query  665  IVFQLLGQIYP  697
            I+ QL+  IYP
Sbjct  87   IILQLMTVIYP  97



>ref|WP_028953619.1| preprotein translocase subunit SecY [Synechococcus sp. CC9616]
Length=439

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 29/64 (45%), Positives = 46/64 (72%), Gaps = 1/64 (2%)
 Frame = +2

Query  512  IYVPLGGVNRDAFVGNLDEN-SILSTLDSFSGGGIGRLGICSLGIVPFINAQIVFQLLGQ  688
            IY+P+ G++R+AF   +++  S++  LD F+GGG+  LG+ +LGI+PFINA I+ QLL  
Sbjct  42   IYIPIPGIDREAFRSFIEQGGSLIGFLDIFTGGGLSTLGVFALGILPFINASIILQLLTA  101

Query  689  IYPK  700
              P+
Sbjct  102  ALPQ  105



>ref|WP_039754631.1| preprotein translocase subunit SecY [Hassallia byssoidea]
 gb|KIF28294.1| preprotein translocase subunit SecY [Hassallia byssoidea VB512170]
Length=437

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 33/70 (47%), Positives = 46/70 (66%), Gaps = 1/70 (1%)
 Frame = +2

Query  491  LALSRVGIYVPLGGVNRDAFVGNLDENS-ILSTLDSFSGGGIGRLGICSLGIVPFINAQI  667
            L L R+GI++P+ G+NR+ F   +  NS I   LD FSG G+  LG+ +LGI+P+INA I
Sbjct  34   LILIRLGIFLPVPGINRELFGQAIQNNSAIFGLLDIFSGRGLSTLGVFALGILPYINASI  93

Query  668  VFQLLGQIYP  697
            + QLL    P
Sbjct  94   IIQLLTTAIP  103



>ref|WP_045870357.1| preprotein translocase subunit SecY [Tolypothrix sp. PCC 7601]
 gb|EKF02221.1| preprotein translocase subunit SecY [Tolypothrix sp. PCC 7601]
Length=437

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 36/73 (49%), Positives = 47/73 (64%), Gaps = 7/73 (10%)
 Frame = +2

Query  491  LALSRVGIYVPLGGVNR----DAFVGNLDENSILSTLDSFSGGGIGRLGICSLGIVPFIN  658
            L L R+GI++P+ G++R    DA  GN   NSI   LD FSG G+  LG+ +LGI+PFIN
Sbjct  34   LILVRLGIFLPVPGIDRTRFHDAISGN---NSIFGLLDIFSGRGLSTLGVFALGILPFIN  90

Query  659  AQIVFQLLGQIYP  697
            A I+ QLL    P
Sbjct  91   ASIIIQLLTAAIP  103



>ref|WP_006515897.1| preprotein translocase subunit SecY [Leptolyngbya sp. PCC 7375]
 gb|EKV01502.1| protein translocase subunit secY/sec61 alpha [Leptolyngbya sp. 
PCC 7375]
Length=440

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 29/63 (46%), Positives = 42/63 (67%), Gaps = 0/63 (0%)
 Frame = +2

Query  512  IYVPLGGVNRDAFVGNLDENSILSTLDSFSGGGIGRLGICSLGIVPFINAQIVFQLLGQI  691
            +Y+P+ G++R AF   +D   +L  LD F GGG+  LGI +LGI+P+INA I+ QLL   
Sbjct  42   MYIPVPGIDRVAFSQQVDAGGLLGFLDIFVGGGLSLLGIFALGILPYINASIIMQLLTAA  101

Query  692  YPK  700
             P+
Sbjct  102  IPQ  104



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1239542226394