BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig13322

Length=1174
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_010087805.1|  Mitochondrial outer membrane protein porin o...    488   1e-169   Morus notabilis
ref|NP_001275154.1|  mitochondrial outer membrane protein porin o...    485   2e-168   Solanum tuberosum [potatoes]
ref|XP_004233349.1|  PREDICTED: mitochondrial outer membrane prot...    484   2e-168   Solanum lycopersicum
ref|XP_009587690.1|  PREDICTED: mitochondrial outer membrane prot...    483   7e-168   Nicotiana tomentosiformis
ref|XP_008443436.1|  PREDICTED: mitochondrial outer membrane prot...    481   6e-167   Cucumis melo [Oriental melon]
ref|XP_009798894.1|  PREDICTED: mitochondrial outer membrane prot...    480   8e-167   Nicotiana sylvestris
gb|ABC01904.1|  34 kDa outer mitochondrial membrane protein porin...    480   9e-167   Solanum tuberosum [potatoes]
ref|XP_009779190.1|  PREDICTED: mitochondrial outer membrane prot...    479   2e-166   Nicotiana sylvestris
ref|XP_009596455.1|  PREDICTED: mitochondrial outer membrane prot...    479   2e-166   Nicotiana tomentosiformis
ref|XP_011652245.1|  PREDICTED: mitochondrial outer membrane prot...    479   3e-166   Cucumis sativus [cucumbers]
ref|XP_006361834.1|  PREDICTED: uncharacterized LOC102577832            479   4e-166   Solanum tuberosum [potatoes]
dbj|BAF95070.1|  voltage-dependent anion channel                        478   5e-166   Nicotiana tabacum [American tobacco]
gb|AIL25718.1|  voltage-dependent anion channel                         477   2e-165   Nicotiana tabacum [American tobacco]
ref|XP_004234781.2|  PREDICTED: mitochondrial outer membrane prot...    474   3e-164   Solanum lycopersicum
ref|XP_011098570.1|  PREDICTED: mitochondrial outer membrane prot...    474   3e-164   Sesamum indicum [beniseed]
ref|XP_007215668.1|  hypothetical protein PRUPE_ppa008585mg             475   6e-164   
emb|CDP02196.1|  unnamed protein product                                472   2e-163   Coffea canephora [robusta coffee]
ref|XP_007032450.1|  Voltage dependent anion channel 1                  470   8e-163   
ref|XP_006482536.1|  PREDICTED: mitochondrial outer membrane prot...    469   2e-162   Citrus sinensis [apfelsine]
gb|AAB38498.1|  porin                                                   469   3e-162   Mesembryanthemum crystallinum
gb|KHG03636.1|  Mitochondrial outer membrane porin of 34 kDa            469   4e-162   Gossypium arboreum [tree cotton]
ref|XP_006431074.1|  hypothetical protein CICLE_v10012445mg             467   2e-161   Citrus clementina [clementine]
gb|KJB33661.1|  hypothetical protein B456_006G024700                    467   2e-161   Gossypium raimondii
ref|XP_010524325.1|  PREDICTED: mitochondrial outer membrane prot...    466   2e-161   Tarenaya hassleriana [spider flower]
emb|CDP00287.1|  unnamed protein product                                466   3e-161   Coffea canephora [robusta coffee]
ref|XP_008379329.1|  PREDICTED: LOW QUALITY PROTEIN: mitochondria...    466   3e-161   Malus domestica [apple tree]
ref|XP_010550070.1|  PREDICTED: mitochondrial outer membrane prot...    465   1e-160   Tarenaya hassleriana [spider flower]
ref|XP_011085778.1|  PREDICTED: mitochondrial outer membrane prot...    465   1e-160   Sesamum indicum [beniseed]
ref|XP_010029375.1|  PREDICTED: mitochondrial outer membrane prot...    464   2e-160   Eucalyptus grandis [rose gum]
ref|XP_008230727.1|  PREDICTED: mitochondrial outer membrane prot...    463   6e-160   Prunus mume [ume]
gb|EYU34113.1|  hypothetical protein MIMGU_mgv1a011597mg                462   2e-159   Erythranthe guttata [common monkey flower]
ref|XP_002282471.1|  PREDICTED: mitochondrial outer membrane prot...    461   5e-159   Vitis vinifera
ref|XP_010066951.1|  PREDICTED: mitochondrial outer membrane prot...    460   6e-159   Eucalyptus grandis [rose gum]
ref|XP_003543710.1|  PREDICTED: outer plastidial membrane protein...    460   7e-159   Glycine max [soybeans]
gb|KHN13242.1|  Outer plastidial membrane protein porin                 460   8e-159   Glycine soja [wild soybean]
ref|XP_002520135.1|  voltage-dependent anion-selective channel, p...    460   9e-159   Ricinus communis
ref|XP_011085779.1|  PREDICTED: mitochondrial outer membrane prot...    459   2e-158   Sesamum indicum [beniseed]
ref|XP_008341536.1|  PREDICTED: outer plastidial membrane protein...    459   3e-158   Malus domestica [apple tree]
ref|XP_003554316.1|  PREDICTED: mitochondrial outer membrane prot...    459   3e-158   Glycine max [soybeans]
gb|EPS57816.1|  hypothetical protein M569_17001                         457   8e-158   Genlisea aurea
gb|AAY82249.1|  mitochrondrial voltage-dependent anion-selective ...    457   8e-158   Phaseolus coccineus [scarlet runner bean]
gb|AAQ87020.1|  VDAC1.2                                                 457   1e-157   Lotus japonicus
gb|KJB11402.1|  hypothetical protein B456_001G256800                    457   1e-157   Gossypium raimondii
ref|XP_002312708.1|  porin family protein                               457   1e-157   Populus trichocarpa [western balsam poplar]
ref|XP_011034213.1|  PREDICTED: mitochondrial outer membrane prot...    457   1e-157   Populus euphratica
ref|NP_001238377.1|  peroxisomal voltage-dependent anion-selectiv...    456   4e-157   Glycine max [soybeans]
ref|XP_010256458.1|  PREDICTED: mitochondrial outer membrane prot...    455   9e-157   Nelumbo nucifera [Indian lotus]
ref|XP_003552508.1|  PREDICTED: outer plastidial membrane protein...    455   9e-157   Glycine max [soybeans]
ref|XP_002276636.1|  PREDICTED: mitochondrial outer membrane prot...    455   9e-157   Vitis vinifera
gb|KHN11584.1|  Outer plastidial membrane protein porin                 454   2e-156   Glycine soja [wild soybean]
emb|CDP00288.1|  unnamed protein product                                454   2e-156   Coffea canephora [robusta coffee]
gb|AFK40985.1|  unknown                                                 454   2e-156   Lotus japonicus
ref|XP_010096343.1|  Mitochondrial outer membrane protein porin o...    453   4e-156   Morus notabilis
gb|AAQ87019.1|  VDAC1.1                                                 453   5e-156   Lotus japonicus
ref|XP_011010796.1|  PREDICTED: mitochondrial outer membrane prot...    453   6e-156   Populus euphratica
ref|XP_006438620.1|  hypothetical protein CICLE_v10032366mg             453   6e-156   Citrus clementina [clementine]
gb|ACU20122.1|  unknown                                                 452   1e-155   Glycine max [soybeans]
ref|XP_009772199.1|  PREDICTED: mitochondrial outer membrane prot...    452   1e-155   Nicotiana sylvestris
ref|XP_006378154.1|  porin family protein                               452   1e-155   Populus trichocarpa [western balsam poplar]
ref|XP_008456460.1|  PREDICTED: mitochondrial outer membrane prot...    451   2e-155   Cucumis melo [Oriental melon]
ref|XP_006483230.1|  PREDICTED: mitochondrial outer membrane prot...    451   2e-155   Citrus sinensis [apfelsine]
gb|KJB11404.1|  hypothetical protein B456_001G256800                    451   3e-155   Gossypium raimondii
gb|ACU24178.1|  unknown                                                 451   3e-155   Glycine max [soybeans]
ref|XP_007139603.1|  hypothetical protein PHAVU_008G043800g             450   6e-155   Phaseolus vulgaris [French bean]
ref|XP_010683253.1|  PREDICTED: mitochondrial outer membrane prot...    450   7e-155   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010242364.1|  PREDICTED: mitochondrial outer membrane prot...    450   8e-155   Nelumbo nucifera [Indian lotus]
gb|AFK39621.1|  unknown                                                 450   1e-154   Lotus japonicus
ref|XP_010033217.1|  PREDICTED: mitochondrial outer membrane prot...    449   2e-154   Eucalyptus grandis [rose gum]
gb|KHG10147.1|  Mitochondrial outer membrane porin of 34 kDa            448   3e-154   Gossypium arboreum [tree cotton]
ref|XP_009627246.1|  PREDICTED: mitochondrial outer membrane prot...    448   3e-154   Nicotiana tomentosiformis
ref|XP_004146750.1|  PREDICTED: mitochondrial outer membrane prot...    448   5e-154   Cucumis sativus [cucumbers]
gb|KJB50696.1|  hypothetical protein B456_008G182700                    447   6e-154   Gossypium raimondii
ref|NP_001275134.1|  mitochondrial outer membrane protein porin o...    447   7e-154   Solanum tuberosum [potatoes]
gb|AAA96275.1|  voltage-dependent anion channel protein                 447   1e-153   Spinacia oleracea
ref|XP_004228386.1|  PREDICTED: mitochondrial outer membrane prot...    447   1e-153   Solanum lycopersicum
ref|XP_012082894.1|  PREDICTED: mitochondrial outer membrane prot...    447   1e-153   Jatropha curcas
ref|XP_008221678.1|  PREDICTED: mitochondrial outer membrane prot...    447   1e-153   Prunus mume [ume]
ref|XP_008339931.1|  PREDICTED: mitochondrial outer membrane prot...    447   2e-153   
ref|XP_008389525.1|  PREDICTED: mitochondrial outer membrane prot...    446   3e-153   Malus domestica [apple tree]
gb|KJB11403.1|  hypothetical protein B456_001G256800                    446   3e-153   Gossypium raimondii
emb|CAA56601.1|  36kDa porin I                                          446   3e-153   Solanum tuberosum [potatoes]
ref|XP_009360395.1|  PREDICTED: mitochondrial outer membrane prot...    446   4e-153   Pyrus x bretschneideri [bai li]
gb|AAD38145.1|AF139498_1  porin                                         446   5e-153   Prunus armeniaca
ref|XP_009797869.1|  PREDICTED: mitochondrial outer membrane prot...    445   6e-153   Nicotiana sylvestris
gb|KGN47800.1|  hypothetical protein Csa_6G404150                       447   9e-153   Cucumis sativus [cucumbers]
gb|AID59897.1|  voltage-dependent anion channel protein                 443   3e-152   Prunus persica
gb|EYU34669.1|  hypothetical protein MIMGU_mgv1a011608mg                443   5e-152   Erythranthe guttata [common monkey flower]
ref|XP_007222361.1|  hypothetical protein PRUPE_ppa008111mg             445   9e-152   
ref|XP_012091937.1|  PREDICTED: mitochondrial outer membrane prot...    442   2e-151   Jatropha curcas
gb|KHG13762.1|  Mitochondrial outer membrane porin of 36 kDa            441   2e-151   Gossypium arboreum [tree cotton]
gb|KJB30018.1|  hypothetical protein B456_005G139100                    441   4e-151   Gossypium raimondii
ref|XP_004302356.1|  PREDICTED: mitochondrial outer membrane prot...    440   6e-151   Fragaria vesca subsp. vesca
gb|KHG20441.1|  Mitochondrial outer membrane porin of 36 kDa            440   8e-151   Gossypium arboreum [tree cotton]
ref|XP_002324035.1|  hypothetical protein POPTR_0017s11430g             437   5e-150   Populus trichocarpa [western balsam poplar]
gb|KJB60739.1|  hypothetical protein B456_009G323300                    437   6e-150   Gossypium raimondii
ref|XP_009599229.1|  PREDICTED: mitochondrial outer membrane prot...    437   8e-150   Nicotiana tomentosiformis
ref|XP_004297335.1|  PREDICTED: mitochondrial outer membrane prot...    437   8e-150   Fragaria vesca subsp. vesca
ref|XP_007046221.1|  Voltage dependent anion channel 1 isoform 1        437   1e-149   Theobroma cacao [chocolate]
ref|XP_011005064.1|  PREDICTED: mitochondrial outer membrane prot...    436   3e-149   Populus euphratica
sp|P42054.2|VDAC_PEA  RecName: Full=Outer plastidial membrane pro...    435   6e-149   Pisum sativum [garden pea]
gb|KHG01383.1|  Mitochondrial outer membrane porin of 36 kDa            434   1e-148   Gossypium arboreum [tree cotton]
ref|XP_009131920.1|  PREDICTED: mitochondrial outer membrane prot...    434   1e-148   Brassica rapa
emb|CDY28690.1|  BnaCnng05760D                                          434   1e-148   Brassica napus [oilseed rape]
ref|XP_011071026.1|  PREDICTED: mitochondrial outer membrane prot...    434   1e-148   Sesamum indicum [beniseed]
ref|XP_002517470.1|  voltage-dependent anion-selective channel, p...    434   2e-148   Ricinus communis
ref|XP_011086392.1|  PREDICTED: mitochondrial outer membrane prot...    434   2e-148   Sesamum indicum [beniseed]
emb|CDY66736.1|  BnaCnng52100D                                          433   3e-148   Brassica napus [oilseed rape]
ref|XP_006408480.1|  hypothetical protein EUTSA_v10021076mg             435   5e-148   
ref|XP_009125035.1|  PREDICTED: mitochondrial outer membrane prot...    432   5e-148   Brassica rapa
ref|XP_010670319.1|  PREDICTED: mitochondrial outer membrane prot...    431   2e-147   Beta vulgaris subsp. vulgaris [field beet]
gb|EYU22439.1|  hypothetical protein MIMGU_mgv1a011543mg                431   2e-147   Erythranthe guttata [common monkey flower]
ref|XP_004489372.1|  PREDICTED: outer plastidial membrane protein...    429   1e-146   Cicer arietinum [garbanzo]
ref|XP_009147408.1|  PREDICTED: mitochondrial outer membrane prot...    429   2e-146   Brassica rapa
gb|KHN45480.1|  Mitochondrial outer membrane protein porin of 34 kDa    428   3e-146   Glycine soja [wild soybean]
ref|XP_006298185.1|  hypothetical protein CARUB_v10014234mg             429   5e-146   
gb|AAQ87021.1|  VDAC1.3                                                 427   6e-146   Lotus japonicus
emb|CDY68122.1|  BnaA05g37480D                                          427   7e-146   Brassica napus [oilseed rape]
ref|XP_006842115.1|  PREDICTED: mitochondrial outer membrane prot...    427   8e-146   Amborella trichopoda
gb|KFK37589.1|  hypothetical protein AALP_AA3G002700                    427   1e-145   Arabis alpina [alpine rockcress]
emb|CDY59668.1|  BnaCnng35410D                                          426   2e-145   Brassica napus [oilseed rape]
ref|XP_004489166.1|  PREDICTED: outer plastidial membrane protein...    426   2e-145   Cicer arietinum [garbanzo]
gb|AAS48868.1|  voltage-dependent anion-selective channel               426   2e-145   Brassica rapa subsp. pekinensis [bai cai]
ref|XP_002884286.1|  hypothetical protein ARALYDRAFT_477400             426   2e-145   
gb|KHG07129.1|  Mitochondrial outer membrane protein porin of 34 kDa    428   3e-145   Gossypium arboreum [tree cotton]
ref|NP_001288856.1|  mitochondrial outer membrane protein porin 3...    424   2e-144   Brassica rapa
emb|CDX91952.1|  BnaC03g32540D                                          424   2e-144   
gb|AAW22621.1|  outer mitochondrial membrane protein porin 1            423   2e-144   Brassica napus [oilseed rape]
gb|EYU28705.1|  hypothetical protein MIMGU_mgv1a011554mg                421   2e-143   Erythranthe guttata [common monkey flower]
emb|CDY63765.1|  BnaCnng42590D                                          420   5e-143   Brassica napus [oilseed rape]
ref|XP_003532049.1|  PREDICTED: mitochondrial outer membrane prot...    419   7e-143   Glycine max [soybeans]
ref|NP_186777.1|  voltage dependent anion channel 1                     419   1e-142   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009134621.1|  PREDICTED: mitochondrial outer membrane prot...    419   1e-142   Brassica rapa
ref|NP_001241054.1|  uncharacterized protein LOC100805016               419   1e-142   Glycine max [soybeans]
gb|AAM65525.1|  putative porin                                          419   2e-142   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006400027.1|  hypothetical protein EUTSA_v10014354mg             418   3e-142   Eutrema salsugineum [saltwater cress]
ref|XP_010512938.1|  PREDICTED: mitochondrial outer membrane prot...    418   4e-142   Camelina sativa [gold-of-pleasure]
gb|KHG07130.1|  Mitochondrial outer membrane protein porin of 34 kDa    417   5e-142   Gossypium arboreum [tree cotton]
emb|CDX85566.1|  BnaA02g02470D                                          417   7e-142   
ref|XP_010485517.1|  PREDICTED: mitochondrial outer membrane prot...    417   7e-142   Camelina sativa [gold-of-pleasure]
emb|CDX74294.1|  BnaA03g27530D                                          417   1e-141   
ref|XP_010463547.1|  PREDICTED: mitochondrial outer membrane prot...    416   2e-141   Camelina sativa [gold-of-pleasure]
ref|NP_001288964.1|  mitochondrial outer membrane protein porin 3       416   2e-141   Brassica rapa
ref|XP_007153842.1|  hypothetical protein PHAVU_003G069300g             416   3e-141   Phaseolus vulgaris [French bean]
ref|XP_010492333.1|  PREDICTED: mitochondrial outer membrane prot...    412   4e-140   Camelina sativa [gold-of-pleasure]
ref|XP_010932447.1|  PREDICTED: mitochondrial outer membrane prot...    412   9e-140   Elaeis guineensis
gb|KFK25745.1|  hypothetical protein AALP_AA8G154100                    411   2e-139   Arabis alpina [alpine rockcress]
ref|XP_009410756.1|  PREDICTED: mitochondrial outer membrane prot...    410   3e-139   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010925058.1|  PREDICTED: mitochondrial outer membrane prot...    410   3e-139   Elaeis guineensis
gb|AFK34190.1|  unknown                                                 410   3e-139   Medicago truncatula
ref|XP_010453637.1|  PREDICTED: mitochondrial outer membrane prot...    410   4e-139   Camelina sativa [gold-of-pleasure]
ref|XP_010420161.1|  PREDICTED: mitochondrial outer membrane prot...    409   1e-138   Camelina sativa [gold-of-pleasure]
ref|XP_006286537.1|  hypothetical protein CARUB_v10001678mg             408   2e-138   Capsella rubella
pir||B55017  porin, plastid - garden pea                                405   3e-137
ref|XP_002873707.1|  voltage-dependent anion-selective channel pr...    405   3e-137   Arabidopsis lyrata subsp. lyrata
ref|XP_008775594.1|  PREDICTED: mitochondrial outer membrane prot...    405   4e-137   Phoenix dactylifera
ref|XP_008808420.1|  PREDICTED: mitochondrial outer membrane prot...    404   1e-136   Phoenix dactylifera
ref|XP_004514771.1|  PREDICTED: mitochondrial outer membrane prot...    403   2e-136   Cicer arietinum [garbanzo]
gb|KJB30017.1|  hypothetical protein B456_005G139100                    402   3e-136   Gossypium raimondii
ref|XP_010925360.1|  PREDICTED: mitochondrial outer membrane prot...    402   3e-136   Elaeis guineensis
ref|XP_004956656.1|  PREDICTED: mitochondrial outer membrane prot...    401   1e-135   Setaria italica
ref|XP_006660565.1|  PREDICTED: mitochondrial outer membrane prot...    400   2e-135   Oryza brachyantha
ref|XP_008786741.1|  PREDICTED: mitochondrial outer membrane prot...    400   5e-135   Phoenix dactylifera
ref|XP_009408682.1|  PREDICTED: mitochondrial outer membrane prot...    398   2e-134   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003578022.1|  PREDICTED: mitochondrial outer membrane porin      398   2e-134   Brachypodium distachyon [annual false brome]
gb|ABK24200.1|  unknown                                                 396   9e-134   Picea sitchensis
gb|AAM62480.1|  voltage-dependent anion-selective channel protein...    396   2e-133   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001105619.1|  voltage-dependent anion channel protein1a          395   4e-133   Zea mays [maize]
ref|NP_001062983.1|  Os09g0361400                                       394   5e-133   
gb|EAZ44453.1|  hypothetical protein OsJ_29066                          394   7e-133   Oryza sativa Japonica Group [Japonica rice]
ref|NP_197013.1|  voltage dependent anion channel 3                     394   1e-132   Arabidopsis thaliana [mouse-ear cress]
gb|ACF85328.1|  unknown                                                 393   2e-132   Zea mays [maize]
gb|EAZ08792.1|  hypothetical protein OsI_31052                          393   2e-132   Oryza sativa Indica Group [Indian rice]
ref|XP_002460110.1|  hypothetical protein SORBIDRAFT_02g022910          392   5e-132   Sorghum bicolor [broomcorn]
ref|XP_003621109.1|  Outer plastidial membrane protein porin            392   5e-132   Medicago truncatula
gb|EPS68383.1|  hypothetical protein M569_06388                         391   1e-131   Genlisea aurea
gb|ACJ85253.1|  unknown                                                 390   2e-131   Medicago truncatula
gb|AFK38338.1|  unknown                                                 389   7e-131   Medicago truncatula
gb|KCW56275.1|  hypothetical protein EUGRSUZ_I02018                     388   8e-131   Eucalyptus grandis [rose gum]
tpg|DAA61162.1|  TPA: voltage-dependent anion-selective channel p...    387   4e-130   
gb|ACJ85279.1|  unknown                                                 386   9e-130   Medicago truncatula
emb|CBI32017.3|  unnamed protein product                                385   1e-129   Vitis vinifera
ref|XP_009393634.1|  PREDICTED: mitochondrial outer membrane prot...    386   1e-129   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006298184.1|  hypothetical protein CARUB_v10014234mg             385   1e-129   
ref|NP_001104948.1|  voltage-dependent anion channel protein1b          385   2e-129   
sp|P46274.1|VDAC1_WHEAT  RecName: Full=Mitochondrial outer membra...    385   4e-129   Triticum aestivum [Canadian hard winter wheat]
ref|XP_009408829.1|  PREDICTED: mitochondrial outer membrane prot...    381   7e-128   Musa acuminata subsp. malaccensis [pisang utan]
emb|CAJ42303.1|  VDAC-like porin                                        378   5e-127   Plantago major [cart-track plant]
ref|XP_009403419.1|  PREDICTED: mitochondrial outer membrane prot...    377   5e-126   Musa acuminata subsp. malaccensis [pisang utan]
gb|KEH19833.1|  porin/voltage-dependent anion-selective channel p...    372   3e-124   Medicago truncatula
ref|NP_001043433.1|  Os01g0588200                                       364   5e-121   
gb|EMS51310.1|  Mitochondrial outer membrane porin                      372   1e-119   Triticum urartu
ref|XP_006826371.2|  PREDICTED: mitochondrial outer membrane prot...    360   1e-119   Amborella trichopoda
ref|XP_010231957.1|  PREDICTED: mitochondrial outer membrane prot...    360   2e-119   Brachypodium distachyon [annual false brome]
emb|CDM83072.1|  unnamed protein product                                356   7e-118   Triticum aestivum [Canadian hard winter wheat]
gb|EMT02908.1|  Mitochondrial outer membrane porin                      369   7e-118   
ref|XP_004961383.1|  PREDICTED: mitochondrial outer membrane prot...    355   2e-117   Setaria italica
ref|XP_006646048.1|  PREDICTED: mitochondrial outer membrane prot...    354   2e-117   Oryza brachyantha
ref|XP_004969385.1|  PREDICTED: mitochondrial outer membrane prot...    353   9e-117   Setaria italica
gb|EMS47295.1|  Outer plastidial membrane protein porin                 353   9e-117   Triticum urartu
emb|CAA57646.1|  Voltage dependent anion channel (VDAC)                 352   1e-116   Triticum aestivum [Canadian hard winter wheat]
gb|ABK23226.1|  unknown                                                 351   6e-116   Picea sitchensis
dbj|BAJ99489.1|  predicted protein                                      350   2e-115   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002458065.1|  hypothetical protein SORBIDRAFT_03g026350          348   1e-114   Sorghum bicolor [broomcorn]
ref|XP_004969745.1|  PREDICTED: mitochondrial outer membrane prot...    346   4e-114   Setaria italica
ref|NP_001104949.1|  voltage-dependent anion channel protein2           345   8e-114   Zea mays [maize]
gb|ACG25664.1|  outer plastidial membrane protein porin                 345   1e-113   Zea mays [maize]
ref|NP_001141587.1|  outer plastidial membrane protein porin            344   3e-113   Zea mays [maize]
ref|XP_003568015.1|  PREDICTED: mitochondrial outer membrane prot...    344   4e-113   Brachypodium distachyon [annual false brome]
ref|NP_001278544.1|  outer plastidial membrane protein porin            343   1e-112   Zea mays [maize]
gb|AFW83107.1|  outer plastidial membrane protein porin                 342   2e-112   
ref|XP_002440144.1|  hypothetical protein SORBIDRAFT_09g026790          342   3e-112   Sorghum bicolor [broomcorn]
gb|ACG45954.1|  outer plastidial membrane protein porin                 342   3e-112   Zea mays [maize]
emb|CAA57647.1|  Voltage dependent anion channel (VDAC)                 341   5e-112   Triticum aestivum [Canadian hard winter wheat]
ref|XP_001779057.1|  predicted protein                                  341   6e-112   
gb|KJB30164.1|  hypothetical protein B456_005G132100                    343   7e-112   Gossypium raimondii
ref|XP_001781995.1|  predicted protein                                  340   2e-111   
sp|P42057.1|VDAC_MAIZE  RecName: Full=Outer plastidial membrane p...    338   5e-111   Zea mays [maize]
dbj|BAJ99317.1|  predicted protein                                      339   5e-111   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|NP_001056162.1|  Os05g0536200                                       338   1e-110   
gb|KJB31318.1|  hypothetical protein B456_005G186100                    336   2e-110   Gossypium raimondii
ref|XP_006655528.1|  PREDICTED: mitochondrial outer membrane prot...    335   1e-109   Oryza brachyantha
gb|ADE77918.1|  unknown                                                 335   1e-109   Picea sitchensis
gb|KJB11405.1|  hypothetical protein B456_001G256800                    327   2e-107   Gossypium raimondii
gb|KJB50697.1|  hypothetical protein B456_008G182700                    325   1e-106   Gossypium raimondii
ref|XP_002458403.1|  hypothetical protein SORBIDRAFT_03g032840          325   1e-105   Sorghum bicolor [broomcorn]
sp|Q0JJV1.3|VDAC4_ORYSJ  RecName: Full=Mitochondrial outer membra...    326   2e-105   Oryza sativa Japonica Group [Japonica rice]
gb|ACU19720.1|  unknown                                                 322   6e-105   Glycine max [soybeans]
ref|XP_003569678.1|  PREDICTED: mitochondrial outer membrane prot...    318   3e-102   Brachypodium distachyon [annual false brome]
ref|XP_002976531.1|  hypothetical protein SELMODRAFT_267998             312   1e-100   Selaginella moellendorffii
ref|XP_002973372.1|  hypothetical protein SELMODRAFT_271012             312   1e-100   Selaginella moellendorffii
ref|XP_006841082.1|  PREDICTED: mitochondrial outer membrane prot...    311   2e-100   Amborella trichopoda
ref|NP_001152335.1|  outer mitochondrial membrane protein porin         313   2e-100   Zea mays [maize]
gb|EEC71387.1|  hypothetical protein OsI_03508                          311   4e-100   Oryza sativa Indica Group [Indian rice]
ref|XP_008787191.1|  PREDICTED: mitochondrial outer membrane prot...    310   6e-100   Phoenix dactylifera
ref|XP_008338437.1|  PREDICTED: mitochondrial outer membrane prot...    310   1e-99    
gb|KJB60742.1|  hypothetical protein B456_009G323300                    307   1e-99    Gossypium raimondii
ref|XP_010550330.1|  PREDICTED: mitochondrial outer membrane prot...    309   2e-99    Tarenaya hassleriana [spider flower]
gb|EMT20213.1|  Mitochondrial outer membrane porin                      326   4e-99    
ref|XP_002279650.2|  PREDICTED: mitochondrial outer membrane prot...    308   5e-99    Vitis vinifera
ref|XP_010918626.1|  PREDICTED: mitochondrial outer membrane prot...    308   5e-99    Elaeis guineensis
ref|XP_009354614.1|  PREDICTED: mitochondrial outer membrane prot...    307   7e-99    Pyrus x bretschneideri [bai li]
ref|XP_008777255.1|  PREDICTED: mitochondrial outer membrane prot...    307   1e-98    Phoenix dactylifera
ref|XP_010942794.1|  PREDICTED: mitochondrial outer membrane prot...    306   1e-98    
ref|XP_002964960.1|  hypothetical protein SELMODRAFT_143103             306   1e-98    Selaginella moellendorffii
ref|XP_010652706.1|  PREDICTED: mitochondrial outer membrane prot...    306   2e-98    Vitis vinifera
ref|XP_008354718.1|  PREDICTED: mitochondrial outer membrane prot...    306   3e-98    Malus domestica [apple tree]
ref|NP_001044063.2|  Os01g0715500                                       307   3e-98    
ref|XP_007205702.1|  hypothetical protein PRUPE_ppa009821mg             305   6e-98    Prunus persica
ref|XP_007047520.1|  Voltage dependent anion channel 2                  305   7e-98    
ref|XP_004288248.1|  PREDICTED: mitochondrial outer membrane prot...    303   2e-97    Fragaria vesca subsp. vesca
ref|XP_008238010.1|  PREDICTED: mitochondrial outer membrane prot...    303   4e-97    Prunus mume [ume]
ref|XP_007046222.1|  Mitochondrial outer membrane protein porin 1...    301   5e-97    
gb|AFK37646.1|  unknown                                                 299   6e-97    Lotus japonicus
ref|XP_004511842.1|  PREDICTED: mitochondrial outer membrane prot...    302   9e-97    Cicer arietinum [garbanzo]
ref|XP_009150694.1|  PREDICTED: mitochondrial outer membrane prot...    301   1e-96    Brassica rapa
gb|ABB02635.1|  unknown                                                 297   2e-96    Solanum tuberosum [potatoes]
gb|EMS62963.1|  Mitochondrial outer membrane protein porin              320   2e-96    Triticum urartu
dbj|BAG09387.1|  peroxisomal voltage-dependent anion-selective ch...    297   3e-96    Glycine max [soybeans]
ref|XP_009413143.1|  PREDICTED: mitochondrial outer membrane prot...    301   3e-96    Musa acuminata subsp. malaccensis [pisang utan]
emb|CDY08723.1|  BnaA06g25010D                                          301   3e-96    Brassica napus [oilseed rape]
ref|XP_009386273.1|  PREDICTED: mitochondrial outer membrane prot...    300   4e-96    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008805725.1|  PREDICTED: mitochondrial outer membrane prot...    300   4e-96    Phoenix dactylifera
ref|NP_001239899.1|  uncharacterized protein LOC100790578               300   5e-96    Glycine max [soybeans]
gb|KJB48714.1|  hypothetical protein B456_008G082900                    300   7e-96    Gossypium raimondii
ref|NP_001241153.1|  uncharacterized protein LOC100818855               299   9e-96    Glycine max [soybeans]
ref|XP_009112213.1|  PREDICTED: mitochondrial outer membrane prot...    299   1e-95    Brassica rapa
gb|KHN36298.1|  Mitochondrial outer membrane protein porin 2            299   1e-95    Glycine soja [wild soybean]
emb|CDY18662.1|  BnaA09g07330D                                          298   2e-95    Brassica napus [oilseed rape]
emb|CDY36497.1|  BnaC03g48560D                                          298   3e-95    Brassica napus [oilseed rape]
ref|XP_008805677.1|  PREDICTED: mitochondrial outer membrane prot...    298   3e-95    Phoenix dactylifera
ref|XP_004231921.1|  PREDICTED: mitochondrial outer membrane prot...    300   3e-95    
ref|XP_008457836.1|  PREDICTED: mitochondrial outer membrane prot...    298   3e-95    Cucumis melo [Oriental melon]
ref|XP_010938962.1|  PREDICTED: mitochondrial outer membrane prot...    298   5e-95    Elaeis guineensis
ref|XP_002984740.1|  hypothetical protein SELMODRAFT_156847             297   6e-95    
emb|CAN67632.1|  hypothetical protein VITISV_019646                     293   8e-95    Vitis vinifera
emb|CDX81312.1|  BnaC09g07230D                                          296   1e-94    
ref|XP_004148030.1|  PREDICTED: mitochondrial outer membrane prot...    296   1e-94    Cucumis sativus [cucumbers]
ref|XP_006426127.1|  hypothetical protein CICLE_v10026251mg             296   1e-94    Citrus clementina [clementine]
ref|XP_010247341.1|  PREDICTED: mitochondrial outer membrane prot...    296   1e-94    Nelumbo nucifera [Indian lotus]
ref|XP_006280940.1|  hypothetical protein CARUB_v10026938mg             296   1e-94    
ref|XP_010272561.1|  PREDICTED: mitochondrial outer membrane prot...    296   2e-94    
gb|KHG00012.1|  Mitochondrial outer membrane porin 2 -like protein      296   2e-94    
ref|XP_006845625.1|  PREDICTED: mitochondrial outer membrane prot...    296   2e-94    
ref|XP_010463972.1|  PREDICTED: mitochondrial outer membrane prot...    296   3e-94    
ref|XP_007156717.1|  hypothetical protein PHAVU_002G011300g             295   4e-94    
ref|XP_010484488.1|  PREDICTED: mitochondrial outer membrane prot...    295   5e-94    
ref|NP_201551.1|  voltage dependent anion channel 2                     295   7e-94    
ref|XP_012079403.1|  PREDICTED: mitochondrial outer membrane prot...    294   8e-94    
ref|XP_008453611.1|  PREDICTED: mitochondrial outer membrane prot...    294   9e-94    
gb|KFK28435.1|  hypothetical protein AALP_AA8G514300                    294   1e-93    
ref|XP_010444638.1|  PREDICTED: mitochondrial outer membrane prot...    294   1e-93    
ref|XP_010943374.1|  PREDICTED: mitochondrial outer membrane prot...    293   2e-93    
ref|XP_004146313.1|  PREDICTED: mitochondrial outer membrane prot...    293   2e-93    
gb|AAW22622.1|  porin-like protein                                      293   3e-93    
ref|XP_002866701.1|  hypothetical protein ARALYDRAFT_496845             292   5e-93    
ref|XP_010102769.1|  Mitochondrial outer membrane protein porin 2       292   6e-93    
ref|XP_009411051.1|  PREDICTED: mitochondrial outer membrane prot...    292   7e-93    
ref|XP_003611587.1|  Mitochondrial outer membrane protein porin         291   9e-93    
emb|CAA63968.1|  pom30                                                  291   1e-92    
ref|XP_006381815.1|  VDAC3.1 family protein                             290   3e-92    
gb|KJB58633.1|  hypothetical protein B456_009G219700                    290   3e-92    
ref|XP_002306507.2|  hypothetical protein POPTR_0005s19050g             292   4e-92    
gb|KJB34748.1|  hypothetical protein B456_006G081500                    288   4e-92    
ref|XP_011008399.1|  PREDICTED: mitochondrial outer membrane prot...    290   5e-92    
ref|XP_006393957.1|  hypothetical protein EUTSA_v10004631mg             291   7e-92    
ref|XP_002525270.1|  voltage-dependent anion-selective channel, p...    288   2e-91    
ref|XP_007018499.1|  Voltage dependent anion channel 2                  288   2e-91    
ref|XP_010259833.1|  PREDICTED: mitochondrial outer membrane prot...    287   4e-91    
ref|XP_010547555.1|  PREDICTED: mitochondrial outer membrane prot...    287   5e-91    
ref|XP_009400023.1|  PREDICTED: mitochondrial outer membrane prot...    286   8e-91    
ref|XP_011007586.1|  PREDICTED: mitochondrial outer membrane prot...    286   9e-91    
gb|KHG14881.1|  Mitochondrial outer membrane porin 2 -like protein      286   1e-90    
emb|CDY11866.1|  BnaC03g12920D                                          285   2e-90    
ref|XP_008777257.1|  PREDICTED: mitochondrial outer membrane prot...    285   3e-90    
emb|CDX88625.1|  BnaA03g10240D                                          285   3e-90    
gb|KJB43907.1|  hypothetical protein B456_007G223000                    285   4e-90    
ref|XP_009132124.1|  PREDICTED: mitochondrial outer membrane prot...    285   4e-90    
ref|XP_010918628.1|  PREDICTED: mitochondrial outer membrane prot...    285   4e-90    
ref|XP_008223703.1|  PREDICTED: mitochondrial outer membrane prot...    284   6e-90    
emb|CDY02103.1|  BnaA03g40640D                                          284   7e-90    
ref|XP_012068225.1|  PREDICTED: mitochondrial outer membrane prot...    284   7e-90    
ref|XP_009136524.1|  PREDICTED: mitochondrial outer membrane prot...    284   9e-90    
emb|CDP02599.1|  unnamed protein product                                284   1e-89    
gb|KCW78721.1|  hypothetical protein EUGRSUZ_C00165                     285   2e-89    
ref|XP_006649583.1|  PREDICTED: mitochondrial outer membrane prot...    283   2e-89    
ref|NP_001149108.1|  outer mitochondrial membrane protein porin         283   2e-89    
ref|XP_007222510.1|  hypothetical protein PRUPE_ppa009817mg             283   3e-89    
ref|XP_002866208.1|  hypothetical protein ARALYDRAFT_495848             283   3e-89    
ref|XP_009338032.1|  PREDICTED: mitochondrial outer membrane prot...    283   3e-89    
ref|XP_010046987.1|  PREDICTED: mitochondrial outer membrane prot...    282   3e-89    
gb|KCW78720.1|  hypothetical protein EUGRSUZ_C00165                     285   3e-89    
ref|XP_009770519.1|  PREDICTED: mitochondrial outer membrane prot...    283   3e-89    
gb|KDO82798.1|  hypothetical protein CISIN_1g0238541mg                  279   3e-89    
ref|XP_009604076.1|  PREDICTED: mitochondrial outer membrane prot...    282   4e-89    
gb|AAQ87022.1|  VDAC2.1                                                 282   4e-89    
ref|XP_003558558.1|  PREDICTED: mitochondrial outer membrane prot...    282   4e-89    
gb|KJB23473.1|  hypothetical protein B456_004G100400                    282   5e-89    
ref|XP_011043983.1|  PREDICTED: mitochondrial outer membrane prot...    282   5e-89    
gb|ABB16970.1|  POM30-like protein                                      282   6e-89    
ref|NP_001048902.1|  Os03g0137500                                       282   6e-89    
ref|XP_009615970.1|  PREDICTED: mitochondrial outer membrane prot...    282   6e-89    
ref|XP_006280944.1|  hypothetical protein CARUB_v10026945mg             282   6e-89    
ref|XP_006649363.1|  PREDICTED: mitochondrial outer membrane prot...    281   7e-89    
ref|XP_002272180.1|  PREDICTED: mitochondrial outer membrane prot...    281   7e-89    
gb|KHG05706.1|  Mitochondrial outer membrane porin 4 -like protein      281   7e-89    
ref|XP_008363546.1|  PREDICTED: mitochondrial outer membrane prot...    281   8e-89    
ref|XP_009801997.1|  PREDICTED: mitochondrial outer membrane prot...    281   1e-88    
ref|XP_008351971.1|  PREDICTED: mitochondrial outer membrane prot...    281   1e-88    
gb|AFK33448.1|  unknown                                                 281   1e-88    
emb|CDP02971.1|  unnamed protein product                                282   2e-88    
gb|KHG11726.1|  Mitochondrial outer membrane porin of 34 kDa            278   3e-88    
ref|XP_010539443.1|  PREDICTED: mitochondrial outer membrane prot...    280   3e-88    
gb|EEC74475.1|  hypothetical protein OsI_09925                          280   3e-88    
ref|XP_007014286.1|  Voltage dependent anion channel 4                  282   4e-88    
emb|CAN64922.1|  hypothetical protein VITISV_017201                     280   4e-88    
gb|AAP46186.1|  PgPOR29                                                 280   5e-88    
ref|XP_002325061.1|  VDAC3.1 family protein                             280   5e-88    
ref|NP_001190641.1|  voltage dependent anion channel 2                  280   7e-88    
ref|XP_004985298.1|  PREDICTED: mitochondrial outer membrane prot...    279   9e-88    
ref|XP_002877711.1|  hypothetical protein ARALYDRAFT_323570             278   1e-87    
ref|XP_011011237.1|  PREDICTED: mitochondrial outer membrane prot...    278   3e-87    
ref|XP_010536913.1|  PREDICTED: mitochondrial outer membrane prot...    277   4e-87    
ref|NP_001049301.1|  Os03g0202200                                       277   4e-87    
ref|XP_004290968.1|  PREDICTED: mitochondrial outer membrane prot...    276   6e-87    
ref|XP_006380609.1|  VDAC2.1 family protein                             276   6e-87    
ref|XP_006350613.1|  PREDICTED: mitochondrial outer membrane prot...    276   7e-87    
ref|XP_004234649.1|  PREDICTED: mitochondrial outer membrane prot...    276   9e-87    
gb|EMT32910.1|  Mitochondrial outer membrane protein porin              276   9e-87    
ref|XP_003558860.1|  PREDICTED: mitochondrial outer membrane prot...    276   1e-86    
ref|XP_004296415.1|  PREDICTED: mitochondrial outer membrane prot...    276   1e-86    
ref|XP_006644617.1|  PREDICTED: mitochondrial outer membrane prot...    278   1e-86    
ref|XP_008220333.1|  PREDICTED: mitochondrial outer membrane prot...    276   2e-86    
ref|NP_200557.1|  voltage dependent anion channel 4                     275   3e-86    
ref|XP_009614284.1|  PREDICTED: mitochondrial outer membrane prot...    275   3e-86    
ref|XP_007227465.1|  hypothetical protein PRUPE_ppa009796mg             275   3e-86    
ref|XP_010688492.1|  PREDICTED: mitochondrial outer membrane prot...    274   8e-86    
gb|KJB29688.1|  hypothetical protein B456_005G114000                    271   9e-86    
gb|KJB30016.1|  hypothetical protein B456_005G139100                    270   1e-85    
tpg|DAA43264.1|  TPA: outer membrane protein porin                      273   1e-85    
ref|XP_010259832.1|  PREDICTED: mitochondrial outer membrane prot...    274   1e-85    
ref|XP_002465683.1|  hypothetical protein SORBIDRAFT_01g043700          273   2e-85    
ref|NP_001288497.1|  mitochondrial outer membrane protein porin 5       273   2e-85    
ref|XP_006453392.1|  hypothetical protein CICLE_v10009163mg             273   2e-85    
ref|XP_009798280.1|  PREDICTED: mitochondrial outer membrane prot...    272   5e-85    
gb|AAQ87023.1|  VDAC3.1                                                 271   9e-85    
dbj|BAD87377.1|  putative 36kDA porin II                                274   1e-84    
ref|XP_010483270.1|  PREDICTED: mitochondrial outer membrane prot...    270   2e-84    
ref|NP_001147486.1|  outer mitochondrial membrane protein porin         270   2e-84    
ref|NP_001147762.1|  outer mitochondrial membrane protein porin         270   2e-84    
ref|XP_010452150.1|  PREDICTED: mitochondrial outer membrane prot...    270   3e-84    
ref|XP_010028100.1|  PREDICTED: mitochondrial outer membrane prot...    270   4e-84    
ref|XP_010943375.1|  PREDICTED: mitochondrial outer membrane prot...    269   5e-84    
gb|ACG30926.1|  outer mitochondrial membrane protein porin              269   6e-84    
ref|XP_011079306.1|  PREDICTED: mitochondrial outer membrane prot...    269   6e-84    
ref|XP_006366956.1|  PREDICTED: mitochondrial outer membrane prot...    269   6e-84    
ref|XP_006401200.1|  hypothetical protein EUTSA_v10014362mg             269   7e-84    
dbj|BAL41368.1|  porin                                                  266   7e-84    
ref|XP_011099371.1|  PREDICTED: mitochondrial outer membrane prot...    269   7e-84    
gb|KJB60740.1|  hypothetical protein B456_009G323300                    265   7e-84    
gb|EYU20913.1|  hypothetical protein MIMGU_mgv1a011651mg                268   2e-83    
tpg|DAA43927.1|  TPA: outer membrane protein porin                      268   2e-83    
ref|NP_001149101.1|  outer mitochondrial membrane protein porin         268   2e-83    
emb|CDY70638.1|  BnaCnng69120D                                          266   2e-83    
gb|EMT12164.1|  Mitochondrial outer membrane protein porin of 34 kDa    268   2e-83    
gb|KFK34258.1|  hypothetical protein AALP_AA5G121500                    267   3e-83    
ref|XP_010679633.1|  PREDICTED: mitochondrial outer membrane prot...    267   3e-83    
ref|XP_002468550.1|  hypothetical protein SORBIDRAFT_01g047800          267   3e-83    
ref|XP_009360705.1|  PREDICTED: mitochondrial outer membrane prot...    267   4e-83    
ref|XP_010443435.1|  PREDICTED: mitochondrial outer membrane prot...    266   5e-83    
ref|XP_006600196.1|  PREDICTED: uncharacterized protein LOC100797...    266   1e-82    
ref|XP_006404089.1|  hypothetical protein EUTSA_v10010622mg             265   2e-82    
dbj|BAJ91367.1|  predicted protein                                      265   2e-82    
ref|XP_002510098.1|  voltage-dependent anion-selective channel, p...    265   3e-82    
ref|XP_010061677.1|  PREDICTED: mitochondrial outer membrane prot...    264   6e-82    
gb|AFW82970.1|  outer membrane protein porin                            261   1e-81    
ref|XP_010999872.1|  PREDICTED: mitochondrial outer membrane prot...    263   1e-81    
ref|NP_001242630.1|  uncharacterized protein LOC100797369               262   3e-81    
ref|XP_002320689.2|  hypothetical protein POPTR_0014s01660g             261   4e-81    
ref|XP_004507844.1|  PREDICTED: mitochondrial outer membrane prot...    261   8e-81    
ref|XP_007154773.1|  hypothetical protein PHAVU_003G146600g             261   9e-81    
ref|XP_010323316.1|  PREDICTED: mitochondrial outer membrane prot...    261   1e-80    
gb|AFW82971.1|  hypothetical protein ZEAMMB73_507543                    259   2e-80    
ref|XP_003557011.2|  PREDICTED: mitochondrial outer membrane prot...    261   2e-80    
ref|XP_011073688.1|  PREDICTED: mitochondrial outer membrane prot...    260   2e-80    
ref|XP_010061676.1|  PREDICTED: mitochondrial outer membrane prot...    259   3e-80    
ref|XP_004498999.1|  PREDICTED: mitochondrial outer membrane prot...    259   3e-80    
ref|XP_007160908.1|  hypothetical protein PHAVU_001G027200g             259   4e-80    
ref|XP_003610136.1|  Mitochondrial outer membrane protein porin         259   4e-80    
ref|XP_004507845.1|  PREDICTED: mitochondrial outer membrane prot...    259   5e-80    
ref|NP_001242891.1|  uncharacterized protein LOC100790270               258   1e-79    
ref|XP_006593432.1|  PREDICTED: uncharacterized protein LOC100790...    258   2e-79    
ref|XP_010545418.1|  PREDICTED: mitochondrial outer membrane prot...    258   2e-79    
tpg|DAA43267.1|  TPA: hypothetical protein ZEAMMB73_938356              257   3e-79    
ref|XP_004985785.1|  PREDICTED: mitochondrial outer membrane prot...    259   4e-79    
ref|XP_006662285.1|  PREDICTED: mitochondrial outer membrane prot...    255   1e-78    
ref|XP_010101100.1|  Mitochondrial outer membrane protein porin 4       257   2e-78    
gb|ACJ85119.1|  unknown                                                 254   3e-78    
gb|KEH40016.1|  porin/voltage-dependent anion-selective channel p...    254   5e-78    
ref|XP_010550772.1|  PREDICTED: mitochondrial outer membrane prot...    249   6e-77    
gb|ACU23163.1|  unknown                                                 251   8e-77    
emb|CDP01200.1|  unnamed protein product                                249   2e-76    
ref|XP_003589068.1|  Mitochondrial outer membrane protein porin         249   2e-76    
ref|XP_004141289.1|  PREDICTED: mitochondrial outer membrane prot...    248   7e-76    
ref|XP_008452645.1|  PREDICTED: mitochondrial outer membrane prot...    248   1e-75    
gb|EYU29628.1|  hypothetical protein MIMGU_mgv1a011618mg                247   2e-75    
gb|EPS73591.1|  pom30 protein                                           246   5e-75    
ref|XP_006607009.1|  PREDICTED: mitochondrial outer membrane prot...    248   5e-75    
gb|KHN17590.1|  Mitochondrial outer membrane protein porin 6            246   6e-75    
gb|ABE77194.1|  putative voltage-dependent ion channel                  246   2e-74    
gb|ADE76112.1|  unknown                                                 239   9e-74    
ref|XP_006291699.1|  hypothetical protein CARUB_v10017863mg             242   1e-73    
gb|KHN07668.1|  Mitochondrial outer membrane protein porin 2            240   2e-72    
gb|EPS70241.1|  hypothetical protein M569_04517                         238   8e-72    
ref|XP_006383551.1|  hypothetical protein POPTR_0005s19050g             235   4e-71    
gb|EMS46046.1|  Mitochondrial outer membrane protein porin of 34 kDa    233   4e-70    
gb|ABF94514.1|  Eukaryotic porin family protein, expressed              230   4e-69    
tpg|DAA43266.1|  TPA: hypothetical protein ZEAMMB73_938356              229   1e-68    
ref|XP_010691575.1|  PREDICTED: mitochondrial outer membrane prot...    226   2e-67    
gb|EEE58291.1|  hypothetical protein OsJ_09329                          236   6e-66    
ref|XP_006607010.1|  PREDICTED: mitochondrial outer membrane prot...    222   3e-65    
ref|XP_006607011.1|  PREDICTED: mitochondrial outer membrane prot...    221   7e-65    
gb|KDO82799.1|  hypothetical protein CISIN_1g0238541mg                  212   2e-63    
gb|EYU34672.1|  hypothetical protein MIMGU_mgv1a021682mg                209   2e-62    
ref|XP_003634314.2|  PREDICTED: mitochondrial outer membrane prot...    211   1e-61    
emb|CDY25906.1|  BnaC09g32780D                                          210   2e-60    
ref|XP_003634315.2|  PREDICTED: mitochondrial outer membrane prot...    205   9e-60    
ref|XP_004983259.1|  PREDICTED: mitochondrial outer membrane prot...    207   2e-59    
ref|XP_010426523.1|  PREDICTED: mitochondrial outer membrane prot...    204   2e-59    
tpg|DAA43265.1|  TPA: hypothetical protein ZEAMMB73_938356              203   3e-58    
gb|ERM93609.1|  hypothetical protein AMTR_s00004p00132460               197   5e-58    
ref|XP_003550309.2|  PREDICTED: LOW QUALITY PROTEIN: mitochondria...    202   1e-57    
ref|XP_010551867.1|  PREDICTED: mitochondrial outer membrane prot...    196   8e-57    
gb|AFK40114.1|  unknown                                                 197   2e-56    
gb|KHN36963.1|  Mitochondrial outer membrane protein porin 5            197   4e-56    
ref|XP_002318608.2|  hypothetical protein POPTR_0012s07210g             194   3e-55    
ref|XP_004508774.1|  PREDICTED: mitochondrial outer membrane prot...    193   5e-55    
ref|XP_011044010.1|  PREDICTED: mitochondrial outer membrane prot...    191   2e-54    
ref|XP_010551652.1|  PREDICTED: mitochondrial outer membrane prot...    186   2e-53    
ref|XP_003524958.1|  PREDICTED: mitochondrial outer membrane prot...    186   3e-52    
ref|XP_010086579.1|  Mitochondrial outer membrane protein porin o...    185   5e-52    
ref|XP_007037222.1|  Porin/voltage-dependent anion-selective chan...    185   5e-52    
ref|XP_012080209.1|  PREDICTED: mitochondrial outer membrane prot...    184   2e-51    
ref|XP_007201143.1|  hypothetical protein PRUPE_ppa016048mg             183   1e-50    
ref|XP_010029017.1|  PREDICTED: mitochondrial outer membrane prot...    181   3e-50    
gb|KDO82796.1|  hypothetical protein CISIN_1g0238542mg                  175   6e-50    
ref|XP_007155337.1|  hypothetical protein PHAVU_003G192600g             179   1e-49    
ref|NP_190561.1|  voltage dependent anion channel 5                     178   2e-49    
gb|KJB79456.1|  hypothetical protein B456_013G050600                    179   5e-49    
ref|XP_003549662.1|  PREDICTED: mitochondrial outer membrane prot...    176   1e-48    
ref|XP_007211055.1|  hypothetical protein PRUPE_ppa018776mg             176   2e-48    
gb|KJB50870.1|  hypothetical protein B456_008G190600                    175   3e-48    
gb|KHN48663.1|  Mitochondrial outer membrane protein porin 1            173   7e-48    
ref|XP_008236314.1|  PREDICTED: mitochondrial outer membrane prot...    176   7e-48    
ref|XP_002511521.1|  voltage-dependent anion-selective channel, p...    173   3e-47    
ref|XP_010029026.1|  PREDICTED: mitochondrial outer membrane prot...    171   4e-47    
ref|XP_011030342.1|  PREDICTED: mitochondrial outer membrane prot...    174   4e-47    
gb|KJB23472.1|  hypothetical protein B456_004G100400                    171   4e-47    
gb|KJB23474.1|  hypothetical protein B456_004G100400                    169   5e-47    
ref|XP_002298773.1|  hypothetical protein POPTR_0001s30130g             174   7e-47    
ref|XP_006439652.1|  hypothetical protein CICLE_v10021785mg             172   8e-47    



>ref|XP_010087805.1| Mitochondrial outer membrane protein porin of 34 kDa [Morus notabilis]
 gb|EXB30112.1| Mitochondrial outer membrane protein porin of 34 kDa [Morus notabilis]
Length=276

 Score =   488 bits (1256),  Expect = 1e-169, Method: Compositional matrix adjust.
 Identities = 237/276 (86%), Positives = 257/276 (93%), Gaps = 0/276 (0%)
 Frame = +2

Query  71   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  250
            MGKGPGLYTDIGKKARDLLY+DYQ+DHKFTITTYSPTGV ITSTG+KKGDLFL DVNTQL
Sbjct  1    MGKGPGLYTDIGKKARDLLYKDYQSDHKFTITTYSPTGVAITSTGTKKGDLFLADVNTQL  60

Query  251  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  430
            KNKNITTD KVDTNSN+FTT+TVDE APGLK I SFR+PDQRSGKVELQYLHD+AGI+TS
Sbjct  61   KNKNITTDIKVDTNSNLFTTVTVDEPAPGLKTILSFRLPDQRSGKVELQYLHDYAGITTS  120

Query  431  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  610
            VGLTANP+VNFSGV GTN +ALGTDVSFD+K+G FTK NAGLSF+N+DLIASLTLNDKGD
Sbjct  121  VGLTANPVVNFSGVFGTNVVALGTDVSFDSKTGQFTKLNAGLSFSNADLIASLTLNDKGD  180

Query  611  SLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTITVGTQHQLDPLTTVKARVNNFGRANAL  790
            +LSASYYH VN L+NTAVGAEV HSFS+N NTITVGTQH LDPLTTVKARVNNFG+ANAL
Sbjct  181  TLSASYYHTVNLLTNTAVGAEVTHSFSTNENTITVGTQHALDPLTTVKARVNNFGKANAL  240

Query  791  IQHEWRPKSLITLSGEVDVKAVDKSAKFGLALALKP  898
            IQHEWRPKS  TLSGEVD KA++KSAK GLALALKP
Sbjct  241  IQHEWRPKSFFTLSGEVDTKAIEKSAKVGLALALKP  276



>ref|NP_001275154.1| mitochondrial outer membrane protein porin of 34 kDa [Solanum 
tuberosum]
 sp|P42055.2|VDAC1_SOLTU RecName: Full=Mitochondrial outer membrane protein porin of 34 
kDa; AltName: Full=POM 34; AltName: Full=Voltage-dependent 
anion-selective channel protein; Short=VDAC [Solanum tuberosum]
 emb|CAA56599.1| 34 kDA porin [Solanum tuberosum]
Length=276

 Score =   485 bits (1248),  Expect = 2e-168, Method: Compositional matrix adjust.
 Identities = 232/276 (84%), Positives = 261/276 (95%), Gaps = 0/276 (0%)
 Frame = +2

Query  71   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  250
            MGKGPGLYT+IGKKARDLLY+DYQ+DHKF+ITTYSPTGVVITS+GSKKGDLFL DVNTQL
Sbjct  1    MGKGPGLYTEIGKKARDLLYKDYQSDHKFSITTYSPTGVVITSSGSKKGDLFLADVNTQL  60

Query  251  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  430
            KNKN+TTD KVDTNSN+FTTITVDEAAPGLK I SFRVPDQRSGK+E+QYLHD+AGI TS
Sbjct  61   KNKNVTTDIKVDTNSNLFTTITVDEAAPGLKTILSFRVPDQRSGKLEVQYLHDYAGICTS  120

Query  431  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  610
            VGLTANPIVNFSGVVGTN +ALGTDVSFDTK+G FTK NAGLSFTN+DL+ASL LN+KGD
Sbjct  121  VGLTANPIVNFSGVVGTNIIALGTDVSFDTKTGDFTKCNAGLSFTNADLVASLNLNNKGD  180

Query  611  SLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTITVGTQHQLDPLTTVKARVNNFGRANAL  790
            +L+ASYYH V+PL++TAVGAEVNHSFS+N N ITVGTQH+LDPLT+VKAR+NNFG+A+AL
Sbjct  181  NLTASYYHTVSPLTSTAVGAEVNHSFSTNENIITVGTQHRLDPLTSVKARINNFGKASAL  240

Query  791  IQHEWRPKSLITLSGEVDVKAVDKSAKFGLALALKP  898
            +QHEWRPKSL T+SGEVD K+VDK AKFGLALALKP
Sbjct  241  LQHEWRPKSLFTVSGEVDTKSVDKGAKFGLALALKP  276



>ref|XP_004233349.1| PREDICTED: mitochondrial outer membrane protein porin of 34 kDa 
[Solanum lycopersicum]
Length=276

 Score =   484 bits (1247),  Expect = 2e-168, Method: Compositional matrix adjust.
 Identities = 232/276 (84%), Positives = 261/276 (95%), Gaps = 0/276 (0%)
 Frame = +2

Query  71   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  250
            MGKGPGLYT+IGKKARDLLY+DYQ+DHKF+ITTYSPTGVVITS+GSKKGDLFL DVNTQL
Sbjct  1    MGKGPGLYTEIGKKARDLLYKDYQSDHKFSITTYSPTGVVITSSGSKKGDLFLADVNTQL  60

Query  251  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  430
            KNKN+TTD KVDTNSN+FTTITVDEAAPGLK I SFRVPDQRSGK+E+QYLHD+AGI TS
Sbjct  61   KNKNVTTDIKVDTNSNLFTTITVDEAAPGLKTILSFRVPDQRSGKLEVQYLHDYAGICTS  120

Query  431  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  610
            VGLTANPIVNFSGVVGTN +ALGTDVSFDTK+G FTK NAGLSFTN+DL+ASL LN+KGD
Sbjct  121  VGLTANPIVNFSGVVGTNIVALGTDVSFDTKTGDFTKCNAGLSFTNADLVASLNLNNKGD  180

Query  611  SLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTITVGTQHQLDPLTTVKARVNNFGRANAL  790
            +L+ASYYH V+PL++TAVGAEVNHSFS+N N ITVGTQH+LDPLT+VKAR+NNFG+A+AL
Sbjct  181  NLTASYYHTVSPLTSTAVGAEVNHSFSTNENIITVGTQHRLDPLTSVKARINNFGKASAL  240

Query  791  IQHEWRPKSLITLSGEVDVKAVDKSAKFGLALALKP  898
            +QHEWRPKSL T+SGEVD K+VDK AKFGLALALKP
Sbjct  241  LQHEWRPKSLFTVSGEVDTKSVDKGAKFGLALALKP  276



>ref|XP_009587690.1| PREDICTED: mitochondrial outer membrane protein porin of 34 kDa 
[Nicotiana tomentosiformis]
 dbj|BAF95072.1| voltage-dependent anion channel [Nicotiana tabacum]
Length=276

 Score =   483 bits (1244),  Expect = 7e-168, Method: Compositional matrix adjust.
 Identities = 232/276 (84%), Positives = 259/276 (94%), Gaps = 0/276 (0%)
 Frame = +2

Query  71   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  250
            MGKGPGLYT+IGKK RDLLY+DYQ+DHKFTITTYSPTGV ITS+G+KKGDLFL DVNTQL
Sbjct  1    MGKGPGLYTEIGKKTRDLLYKDYQSDHKFTITTYSPTGVAITSSGTKKGDLFLADVNTQL  60

Query  251  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  430
            KNKNITTD KVDTNSN+FTTITVD+AAPGLK I SFRVPDQRSGK+E+QYLH++AGISTS
Sbjct  61   KNKNITTDIKVDTNSNLFTTITVDDAAPGLKTILSFRVPDQRSGKLEVQYLHEYAGISTS  120

Query  431  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  610
            VGLTANPIVNFSGVVGTN LALGTDVSFD+K+G FTK NAGLSFTN+DL+ASL LNDKGD
Sbjct  121  VGLTANPIVNFSGVVGTNILALGTDVSFDSKTGDFTKCNAGLSFTNADLVASLNLNDKGD  180

Query  611  SLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTITVGTQHQLDPLTTVKARVNNFGRANAL  790
            +LSASYYH V+P ++TAVGAEVNH FS+N NTITVGTQH+LDPLT+VKARVNNFG+A+AL
Sbjct  181  NLSASYYHSVSPFTSTAVGAEVNHCFSTNENTITVGTQHRLDPLTSVKARVNNFGKASAL  240

Query  791  IQHEWRPKSLITLSGEVDVKAVDKSAKFGLALALKP  898
            +QHEWRPKSL T+SGEVD K+VDK AKFGLALALKP
Sbjct  241  LQHEWRPKSLFTISGEVDTKSVDKGAKFGLALALKP  276



>ref|XP_008443436.1| PREDICTED: mitochondrial outer membrane protein porin of 34 kDa 
[Cucumis melo]
Length=276

 Score =   481 bits (1237),  Expect = 6e-167, Method: Compositional matrix adjust.
 Identities = 233/276 (84%), Positives = 257/276 (93%), Gaps = 0/276 (0%)
 Frame = +2

Query  71   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  250
            MGKGPGLY+DIGK+ARDLLY+DYQ+DHKFTITTYSPTGV ITS+G+KKGDLFL DVNTQL
Sbjct  1    MGKGPGLYSDIGKRARDLLYKDYQSDHKFTITTYSPTGVAITSSGTKKGDLFLADVNTQL  60

Query  251  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  430
            KNKNITTD KVDT+SN+ TTITVDE APGLK I SF+VPDQRSGKVELQYLHD+AGISTS
Sbjct  61   KNKNITTDIKVDTSSNLVTTITVDEPAPGLKAIFSFKVPDQRSGKVELQYLHDYAGISTS  120

Query  431  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  610
            +GLTANPIVNFSGVVG+N LALGTD+SFDTK+G FTK NAGLSF N+DLIASLTLNDKGD
Sbjct  121  IGLTANPIVNFSGVVGSNLLALGTDLSFDTKTGNFTKVNAGLSFANADLIASLTLNDKGD  180

Query  611  SLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTITVGTQHQLDPLTTVKARVNNFGRANAL  790
            +LSASYYH VNPL++TAVGAEV HSFSSN NTITVGTQH LDPLT+VKARVNNFG+A+AL
Sbjct  181  TLSASYYHTVNPLTSTAVGAEVAHSFSSNENTITVGTQHALDPLTSVKARVNNFGKASAL  240

Query  791  IQHEWRPKSLITLSGEVDVKAVDKSAKFGLALALKP  898
            IQHEWRPKS  T+SGEVD KA++KSAK GLALALKP
Sbjct  241  IQHEWRPKSFFTVSGEVDTKAIEKSAKVGLALALKP  276



>ref|XP_009798894.1| PREDICTED: mitochondrial outer membrane protein porin of 34 kDa 
[Nicotiana sylvestris]
Length=276

 Score =   480 bits (1236),  Expect = 8e-167, Method: Compositional matrix adjust.
 Identities = 232/276 (84%), Positives = 256/276 (93%), Gaps = 0/276 (0%)
 Frame = +2

Query  71   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  250
            MGKGPGLYT+IGKK RDLLY+DY +DHKFTITTYSPTGV ITS+G+KKGDLFL DVNTQL
Sbjct  1    MGKGPGLYTEIGKKTRDLLYKDYHSDHKFTITTYSPTGVAITSSGTKKGDLFLADVNTQL  60

Query  251  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  430
            KNKNITTD KVDTNSN+FTTITVDEAAPGLK I SFRVPDQRSGK+E+QYLHD+AGISTS
Sbjct  61   KNKNITTDIKVDTNSNLFTTITVDEAAPGLKTILSFRVPDQRSGKLEVQYLHDYAGISTS  120

Query  431  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  610
            VGLTANPIVNFSGVVGTN LALGTDVSFDTK+G FTK NAGLSFTN+DL+ASL LNDKGD
Sbjct  121  VGLTANPIVNFSGVVGTNILALGTDVSFDTKTGDFTKCNAGLSFTNADLVASLNLNDKGD  180

Query  611  SLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTITVGTQHQLDPLTTVKARVNNFGRANAL  790
            +LSASYYH V+P ++T VGAEV H FS+N NTITVGTQH+LDPLT+VKARVNNFG+A+AL
Sbjct  181  NLSASYYHTVSPFTSTVVGAEVTHCFSTNENTITVGTQHRLDPLTSVKARVNNFGKASAL  240

Query  791  IQHEWRPKSLITLSGEVDVKAVDKSAKFGLALALKP  898
            +QHEWRPKSL T+SGEVD K+VDK AKFGLALALKP
Sbjct  241  LQHEWRPKSLFTISGEVDTKSVDKGAKFGLALALKP  276



>gb|ABC01904.1| 34 kDa outer mitochondrial membrane protein porin-like protein 
[Solanum tuberosum]
Length=276

 Score =   480 bits (1236),  Expect = 9e-167, Method: Compositional matrix adjust.
 Identities = 235/276 (85%), Positives = 250/276 (91%), Gaps = 0/276 (0%)
 Frame = +2

Query  71   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  250
            MGKGPGLY+DIGKK RDLLYRDYQTDHKFTITTYSPTGV ITS+G KKGDLFL DVNTQL
Sbjct  1    MGKGPGLYSDIGKKTRDLLYRDYQTDHKFTITTYSPTGVAITSSGLKKGDLFLADVNTQL  60

Query  251  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  430
            KNKNITTD KVDTNSN+  T+TVDEAAPGLK I S R+PDQ S K+ELQYLHD+AGI TS
Sbjct  61   KNKNITTDIKVDTNSNLLATVTVDEAAPGLKTIFSCRIPDQSSAKMELQYLHDYAGICTS  120

Query  431  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  610
            VGLTANPIVNFSGV+GTN LALGTDVSFDTK+GA TK NAGLSFTN+DLI SL LN+KGD
Sbjct  121  VGLTANPIVNFSGVLGTNVLALGTDVSFDTKAGAITKCNAGLSFTNADLITSLNLNNKGD  180

Query  611  SLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTITVGTQHQLDPLTTVKARVNNFGRANAL  790
            SLSASYYH V PL++TAVGAEV HSFS+N NTITVGTQHQLDPLTTVKARVNNFG A AL
Sbjct  181  SLSASYYHIVTPLTSTAVGAEVTHSFSTNENTITVGTQHQLDPLTTVKARVNNFGTATAL  240

Query  791  IQHEWRPKSLITLSGEVDVKAVDKSAKFGLALALKP  898
            IQHEWRPKSL T+SGEVD KAVDKSAKFGLALALKP
Sbjct  241  IQHEWRPKSLFTISGEVDTKAVDKSAKFGLALALKP  276



>ref|XP_009779190.1| PREDICTED: mitochondrial outer membrane protein porin of 34 kDa-like 
[Nicotiana sylvestris]
Length=276

 Score =   479 bits (1234),  Expect = 2e-166, Method: Compositional matrix adjust.
 Identities = 232/276 (84%), Positives = 252/276 (91%), Gaps = 0/276 (0%)
 Frame = +2

Query  71   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  250
            MGKGPGLY+DIGK+ARDLLYRDYQTDHKFTITTYSPTGV ITS+G KKGDLFL DVNTQL
Sbjct  1    MGKGPGLYSDIGKRARDLLYRDYQTDHKFTITTYSPTGVAITSSGLKKGDLFLADVNTQL  60

Query  251  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  430
            KNKN+TTD KVDTNSN+  T+TVDEAAPGLK I SFR+PDQ S K+E+QYLHD+AGISTS
Sbjct  61   KNKNVTTDIKVDTNSNLLATVTVDEAAPGLKTILSFRIPDQSSAKLEVQYLHDYAGISTS  120

Query  431  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  610
            +GLTANPIVNFSGVVGTN L+LGTD+SFDTK GA TK NAGLSFTN+DLIASL LNDKGD
Sbjct  121  LGLTANPIVNFSGVVGTNLLSLGTDLSFDTKVGAITKCNAGLSFTNTDLIASLNLNDKGD  180

Query  611  SLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTITVGTQHQLDPLTTVKARVNNFGRANAL  790
            +LSASYYH V+PL+ TAV AEV HSF +N NTITVGTQHQLDPLTTVKARVNN G+ANAL
Sbjct  181  ALSASYYHIVSPLTMTAVSAEVTHSFCTNENTITVGTQHQLDPLTTVKARVNNLGKANAL  240

Query  791  IQHEWRPKSLITLSGEVDVKAVDKSAKFGLALALKP  898
            IQHEWRPKSL T+SGEVD KAVDKSAKFGLALALKP
Sbjct  241  IQHEWRPKSLFTISGEVDTKAVDKSAKFGLALALKP  276



>ref|XP_009596455.1| PREDICTED: mitochondrial outer membrane protein porin of 34 kDa-like 
[Nicotiana tomentosiformis]
Length=276

 Score =   479 bits (1234),  Expect = 2e-166, Method: Compositional matrix adjust.
 Identities = 233/276 (84%), Positives = 252/276 (91%), Gaps = 0/276 (0%)
 Frame = +2

Query  71   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  250
            MGKGPGLY+DIGK+ARDLLYRDYQTDHKF ITTYSPTGV ITS+G KKGDLFL DVNTQL
Sbjct  1    MGKGPGLYSDIGKRARDLLYRDYQTDHKFAITTYSPTGVAITSSGLKKGDLFLADVNTQL  60

Query  251  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  430
            KNKN+TTD KVDTNSN+  T+TVDEAAPGLK I SFR+PD  S K+E+QYLHD+AGISTS
Sbjct  61   KNKNVTTDIKVDTNSNLLATVTVDEAAPGLKTILSFRIPDHSSAKLEVQYLHDYAGISTS  120

Query  431  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  610
            +GLTANPIVNFSGVVGTN L+LGTDVSFDTK GA TK NAGLSFTN+DLIASL LNDKGD
Sbjct  121  LGLTANPIVNFSGVVGTNLLSLGTDVSFDTKVGAITKCNAGLSFTNTDLIASLNLNDKGD  180

Query  611  SLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTITVGTQHQLDPLTTVKARVNNFGRANAL  790
            SLSASYYH V+PL+ TAVGAEV HSFS+N NTI+VGTQHQLDPLTTVKARVNN G+ANAL
Sbjct  181  SLSASYYHIVSPLTMTAVGAEVTHSFSTNENTISVGTQHQLDPLTTVKARVNNLGKANAL  240

Query  791  IQHEWRPKSLITLSGEVDVKAVDKSAKFGLALALKP  898
            IQHEWRPKSL T+SGEVD KAVDKSAKFGLALALKP
Sbjct  241  IQHEWRPKSLFTISGEVDTKAVDKSAKFGLALALKP  276



>ref|XP_011652245.1| PREDICTED: mitochondrial outer membrane protein porin of 34 kDa 
[Cucumis sativus]
 gb|KGN59595.1| Porin [Cucumis sativus]
Length=276

 Score =   479 bits (1232),  Expect = 3e-166, Method: Compositional matrix adjust.
 Identities = 232/276 (84%), Positives = 256/276 (93%), Gaps = 0/276 (0%)
 Frame = +2

Query  71   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  250
            MGKGPGLY+DIGK+ARDLLY+DYQ+DHKFTITTYSPTGV ITS+G+KKGDLFL DVNTQL
Sbjct  1    MGKGPGLYSDIGKRARDLLYKDYQSDHKFTITTYSPTGVAITSSGTKKGDLFLADVNTQL  60

Query  251  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  430
            KNKNITTD KVDT+SN+ TTITVDE APGLK I SF+VPDQRSGKVELQYLHD+AGISTS
Sbjct  61   KNKNITTDIKVDTSSNLVTTITVDEPAPGLKAIFSFKVPDQRSGKVELQYLHDYAGISTS  120

Query  431  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  610
            +GLTANPIVNFSGVVG+N LALGTD+SFDTK+G FTK N GLSF N+DLIASLTLNDKGD
Sbjct  121  IGLTANPIVNFSGVVGSNLLALGTDLSFDTKTGNFTKVNTGLSFANADLIASLTLNDKGD  180

Query  611  SLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTITVGTQHQLDPLTTVKARVNNFGRANAL  790
            +LSASYYH VNPL++TAVGAEV HSFSSN NTITVGTQH LDPLT+VKARVNNFG+A+AL
Sbjct  181  TLSASYYHTVNPLTSTAVGAEVAHSFSSNENTITVGTQHALDPLTSVKARVNNFGKASAL  240

Query  791  IQHEWRPKSLITLSGEVDVKAVDKSAKFGLALALKP  898
            IQHEWRPKS  T+SGEVD KA++KSAK GLALALKP
Sbjct  241  IQHEWRPKSFFTVSGEVDTKAIEKSAKVGLALALKP  276



>ref|XP_006361834.1| PREDICTED: uncharacterized LOC102577832 [Solanum tuberosum]
Length=276

 Score =   479 bits (1232),  Expect = 4e-166, Method: Compositional matrix adjust.
 Identities = 234/276 (85%), Positives = 250/276 (91%), Gaps = 0/276 (0%)
 Frame = +2

Query  71   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  250
            MGKGPGLY+DIGKK RDLLYRDYQTDHKFTITTYSPTGV ITS+G KKGDLFL DVNTQL
Sbjct  1    MGKGPGLYSDIGKKTRDLLYRDYQTDHKFTITTYSPTGVAITSSGLKKGDLFLADVNTQL  60

Query  251  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  430
            KNKNITTD KVDTNSN+  T+TVDEAAPGLK I S R+PDQ S K+ELQYLHD+AGI TS
Sbjct  61   KNKNITTDIKVDTNSNLLATVTVDEAAPGLKTIFSCRIPDQSSAKMELQYLHDYAGICTS  120

Query  431  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  610
            VGLTANPIVNFSGV+GTN LALGTDVSFDTK+GA TK NAGLSFTN+DLI SL LN+KGD
Sbjct  121  VGLTANPIVNFSGVLGTNVLALGTDVSFDTKAGAITKCNAGLSFTNADLITSLNLNNKGD  180

Query  611  SLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTITVGTQHQLDPLTTVKARVNNFGRANAL  790
            SLSASYYH V PL++TAVGAEV HSFS++ NTITVGTQHQLDPLTTVKARVNNFG A AL
Sbjct  181  SLSASYYHIVTPLTSTAVGAEVTHSFSTSENTITVGTQHQLDPLTTVKARVNNFGTATAL  240

Query  791  IQHEWRPKSLITLSGEVDVKAVDKSAKFGLALALKP  898
            IQHEWRPKSL T+SGEVD KAVDKSAKFGLALALKP
Sbjct  241  IQHEWRPKSLFTISGEVDTKAVDKSAKFGLALALKP  276



>dbj|BAF95070.1| voltage-dependent anion channel [Nicotiana tabacum]
Length=276

 Score =   478 bits (1231),  Expect = 5e-166, Method: Compositional matrix adjust.
 Identities = 231/276 (84%), Positives = 252/276 (91%), Gaps = 0/276 (0%)
 Frame = +2

Query  71   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  250
            MGKGPGLY+DIGK+ARDLLYRDYQTDHKFTITTYSPTGV ITS+G KKGDLFL DVNTQL
Sbjct  1    MGKGPGLYSDIGKRARDLLYRDYQTDHKFTITTYSPTGVAITSSGLKKGDLFLADVNTQL  60

Query  251  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  430
            KNKN+TTD KVDTNSN+  T+TVDEAAPGLK I SFR+PDQ S K+E+QYLHD+AGISTS
Sbjct  61   KNKNVTTDIKVDTNSNLLATVTVDEAAPGLKTILSFRIPDQSSAKLEVQYLHDYAGISTS  120

Query  431  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  610
            +GLTANPIVNFSGVVGTN L+LGTD+SFDTK GA TK NAGLSFTN+DLIASL LNDKGD
Sbjct  121  LGLTANPIVNFSGVVGTNLLSLGTDLSFDTKVGAITKCNAGLSFTNTDLIASLNLNDKGD  180

Query  611  SLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTITVGTQHQLDPLTTVKARVNNFGRANAL  790
            +LSASYYH V+PL+ TAV AEV HSF +N NTI+VGTQHQLDPLTTVKARVNN G+ANAL
Sbjct  181  ALSASYYHIVSPLTMTAVSAEVTHSFCTNENTISVGTQHQLDPLTTVKARVNNLGKANAL  240

Query  791  IQHEWRPKSLITLSGEVDVKAVDKSAKFGLALALKP  898
            IQHEWRPKSL T+SGEVD KAVDKSAKFGLALALKP
Sbjct  241  IQHEWRPKSLFTISGEVDTKAVDKSAKFGLALALKP  276



>gb|AIL25718.1| voltage-dependent anion channel [Nicotiana tabacum]
Length=276

 Score =   477 bits (1227),  Expect = 2e-165, Method: Compositional matrix adjust.
 Identities = 230/276 (83%), Positives = 252/276 (91%), Gaps = 0/276 (0%)
 Frame = +2

Query  71   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  250
            MGKGPGLY+DIGK+ARDLLYRDYQTDHKFTITTYSPTGV ITS+G KKGDLFL DVNTQL
Sbjct  1    MGKGPGLYSDIGKRARDLLYRDYQTDHKFTITTYSPTGVAITSSGLKKGDLFLADVNTQL  60

Query  251  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  430
            KNKN+TTD KVDTNSN+  T+TVDEAAPGLK I SFR+PDQ S ++E+QYLHD+AGISTS
Sbjct  61   KNKNVTTDIKVDTNSNLLATVTVDEAAPGLKTILSFRIPDQSSAELEVQYLHDYAGISTS  120

Query  431  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  610
            +GLTANPIVNFSGVVGTN L+LGTD+SFDTK GA TK NAGLSFTN+DLIASL LNDKGD
Sbjct  121  LGLTANPIVNFSGVVGTNLLSLGTDLSFDTKVGAITKCNAGLSFTNTDLIASLNLNDKGD  180

Query  611  SLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTITVGTQHQLDPLTTVKARVNNFGRANAL  790
            +LSASYYH V+PL+ TAV AEV HSF +N NTI+VGTQHQLDPLTTVKARVNN G+ANAL
Sbjct  181  ALSASYYHIVSPLTMTAVSAEVTHSFCTNENTISVGTQHQLDPLTTVKARVNNLGKANAL  240

Query  791  IQHEWRPKSLITLSGEVDVKAVDKSAKFGLALALKP  898
            IQHEWRPKSL T+SGEVD KAVDKSAKFGLALALKP
Sbjct  241  IQHEWRPKSLFTISGEVDTKAVDKSAKFGLALALKP  276



>ref|XP_004234781.2| PREDICTED: mitochondrial outer membrane protein porin of 34 kDa 
[Solanum lycopersicum]
Length=276

 Score =   474 bits (1219),  Expect = 3e-164, Method: Compositional matrix adjust.
 Identities = 231/276 (84%), Positives = 249/276 (90%), Gaps = 0/276 (0%)
 Frame = +2

Query  71   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  250
            MGKGPGLY+DIGKK RDLLYRDYQTDHKFTITTYS TGV ITS+G KKGDLFL DVNTQL
Sbjct  1    MGKGPGLYSDIGKKTRDLLYRDYQTDHKFTITTYSATGVAITSSGLKKGDLFLADVNTQL  60

Query  251  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  430
            KNKN+TTD KVDTNSN+  T+TVDEAAPGLK I S R+PDQ S K+ELQYLHD+AGI TS
Sbjct  61   KNKNLTTDIKVDTNSNLLATVTVDEAAPGLKTIFSCRIPDQSSAKMELQYLHDYAGICTS  120

Query  431  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  610
            VGLTANPIVNFSGV+GTN LALGTDVSFDTK+GA TK NAGL FTN+DLI SL LN+KGD
Sbjct  121  VGLTANPIVNFSGVLGTNVLALGTDVSFDTKAGAITKCNAGLRFTNADLITSLNLNNKGD  180

Query  611  SLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTITVGTQHQLDPLTTVKARVNNFGRANAL  790
            SLSASYYH V+PL++TAVGAEV HSFS++ NTITVGTQHQLDPLTTVKARVNNFG A AL
Sbjct  181  SLSASYYHIVSPLTSTAVGAEVTHSFSTSENTITVGTQHQLDPLTTVKARVNNFGMATAL  240

Query  791  IQHEWRPKSLITLSGEVDVKAVDKSAKFGLALALKP  898
            IQHEWRPKSL T+SGEVD KAVDKSAKFGLALALKP
Sbjct  241  IQHEWRPKSLFTISGEVDTKAVDKSAKFGLALALKP  276



>ref|XP_011098570.1| PREDICTED: mitochondrial outer membrane protein porin of 34 kDa-like 
[Sesamum indicum]
Length=276

 Score =   474 bits (1219),  Expect = 3e-164, Method: Compositional matrix adjust.
 Identities = 228/276 (83%), Positives = 254/276 (92%), Gaps = 0/276 (0%)
 Frame = +2

Query  71   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  250
            MGKGPGLY+DIGK+ARDLLYRDYQ+DHKFTITTYSPTGV +TSTG KKGDLFL DVNTQL
Sbjct  1    MGKGPGLYSDIGKRARDLLYRDYQSDHKFTITTYSPTGVTLTSTGIKKGDLFLADVNTQL  60

Query  251  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  430
            K+KN+TTD KVDT+SN+ TT+TVDE APGLK I SFRVPDQRSGK+ELQYLHD+AGIS+S
Sbjct  61   KHKNVTTDIKVDTSSNLLTTVTVDEPAPGLKTILSFRVPDQRSGKLELQYLHDYAGISSS  120

Query  431  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  610
            VGLTANPIVNFS V+G+N LA+G+DVSFD+K GA TK N G SFTNSDLIA+LTLNDKGD
Sbjct  121  VGLTANPIVNFSAVLGSNKLAVGSDVSFDSKEGAITKCNFGASFTNSDLIAALTLNDKGD  180

Query  611  SLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTITVGTQHQLDPLTTVKARVNNFGRANAL  790
            +LSASYYH VNPL+NTAVGAEV HSFSSN NTITVGTQH LDPLT VKARVNNFG+A+AL
Sbjct  181  TLSASYYHTVNPLTNTAVGAEVTHSFSSNENTITVGTQHSLDPLTMVKARVNNFGKASAL  240

Query  791  IQHEWRPKSLITLSGEVDVKAVDKSAKFGLALALKP  898
            IQHEWRPKSLIT+S EVD K++DKSAKFG+ALALKP
Sbjct  241  IQHEWRPKSLITVSTEVDTKSIDKSAKFGVALALKP  276



>ref|XP_007215668.1| hypothetical protein PRUPE_ppa008585mg [Prunus persica]
 gb|EMJ16867.1| hypothetical protein PRUPE_ppa008585mg [Prunus persica]
Length=326

 Score =   475 bits (1223),  Expect = 6e-164, Method: Compositional matrix adjust.
 Identities = 229/293 (78%), Positives = 264/293 (90%), Gaps = 2/293 (1%)
 Frame = +2

Query  23   LSPSR-LCFRFSALAAEMGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITS  199
            L PSR LC  F +L  +M  GPGLYTDIGKKARDLLY+DYQ+DHKFT+TTYSPTGV ITS
Sbjct  35   LIPSRFLCLLFQSLLGKM-VGPGLYTDIGKKARDLLYKDYQSDHKFTVTTYSPTGVAITS  93

Query  200  TGSKKGDLFLGDVNTQLKNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRS  379
            +G+KKG+LFL DVNTQLKNKN+TTD KVDT+SN+ TT+TVD+ APGLK I SF+VPDQRS
Sbjct  94   SGTKKGELFLADVNTQLKNKNVTTDIKVDTDSNLSTTVTVDQPAPGLKAIFSFKVPDQRS  153

Query  380  GKVELQYLHDHAGISTSVGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLS  559
            GKVELQYLHD+AGISTS+GLTANPIVNFSGV+GTN LALGTD+SFDTK+G  TK NAG+S
Sbjct  154  GKVELQYLHDYAGISTSIGLTANPIVNFSGVIGTNQLALGTDLSFDTKTGNLTKCNAGVS  213

Query  560  FTNSDLIASLTLNDKGDSLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTITVGTQHQLDP  739
            F+N+DLIA+LTLNDKGD LSASYYH+VNPL+NTAVGAEV H F +N NTIT+GTQH LDP
Sbjct  214  FSNADLIAALTLNDKGDILSASYYHNVNPLANTAVGAEVTHRFPTNENTITLGTQHALDP  273

Query  740  LTTVKARVNNFGRANALIQHEWRPKSLITLSGEVDVKAVDKSAKFGLALALKP  898
            LTT+KARVNNFG+A+ALIQHEWRPKS +T+SGEVD KA++K+AK GLALALKP
Sbjct  274  LTTLKARVNNFGKASALIQHEWRPKSFVTISGEVDTKAIEKTAKIGLALALKP  326



>emb|CDP02196.1| unnamed protein product [Coffea canephora]
Length=276

 Score =   472 bits (1215),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 224/276 (81%), Positives = 254/276 (92%), Gaps = 0/276 (0%)
 Frame = +2

Query  71   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  250
            M KGPGLYT+IGKK RDLLY+D+Q+DHKF+ITT SPTGV +TS+G+KKGDLF  DVN QL
Sbjct  1    MAKGPGLYTEIGKKVRDLLYKDFQSDHKFSITTCSPTGVAVTSSGTKKGDLFWADVNAQL  60

Query  251  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  430
            KNKNITTDFKVDTNSN+FT +T+DE  PGLK I SFRVPDQRSGK+ELQYLHD+AGISTS
Sbjct  61   KNKNITTDFKVDTNSNLFTAVTIDEPVPGLKTIFSFRVPDQRSGKLELQYLHDYAGISTS  120

Query  431  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  610
            VGLTANPI+NFSGVVGTNALALGTDVSFDTK+G  TK NAGLSFTNSDLIASLTLNDKGD
Sbjct  121  VGLTANPIINFSGVVGTNALALGTDVSFDTKTGTLTKCNAGLSFTNSDLIASLTLNDKGD  180

Query  611  SLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTITVGTQHQLDPLTTVKARVNNFGRANAL  790
            +LSASYYH V+PL++TAVGAEV HSFS+N NTIT+GTQH LDPLTT+KARVNN+G+A+AL
Sbjct  181  ALSASYYHTVSPLTSTAVGAEVTHSFSTNENTITLGTQHALDPLTTLKARVNNYGKASAL  240

Query  791  IQHEWRPKSLITLSGEVDVKAVDKSAKFGLALALKP  898
            IQHEWRPKSL T++GEVD K++D+SAKFGLAL LKP
Sbjct  241  IQHEWRPKSLFTITGEVDTKSIDQSAKFGLALVLKP  276



>ref|XP_007032450.1| Voltage dependent anion channel 1 [Theobroma cacao]
 gb|EOY03376.1| Voltage dependent anion channel 1 [Theobroma cacao]
Length=276

 Score =   470 bits (1210),  Expect = 8e-163, Method: Compositional matrix adjust.
 Identities = 226/276 (82%), Positives = 252/276 (91%), Gaps = 0/276 (0%)
 Frame = +2

Query  71   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  250
            MGKGPGLYTDIGKKARDLLY+DYQTD KFT+TT+SPTGV ITS G+KKGDLF+ DVNTQL
Sbjct  1    MGKGPGLYTDIGKKARDLLYKDYQTDQKFTLTTFSPTGVAITSAGTKKGDLFVADVNTQL  60

Query  251  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  430
            KN+N+TTD KVDT+SN+FTTITVDE APGLK I SFRVPDQRSGKVELQYLHD+AGIS+S
Sbjct  61   KNRNVTTDIKVDTSSNLFTTITVDEPAPGLKTIFSFRVPDQRSGKVELQYLHDYAGISSS  120

Query  431  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  610
            +GLTANPIVNFSGV GTN LALGTD+SFDTK+G FTK NAGLSF+N DLIAS+ LN+KGD
Sbjct  121  IGLTANPIVNFSGVFGTNVLALGTDLSFDTKTGNFTKCNAGLSFSNVDLIASVALNEKGD  180

Query  611  SLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTITVGTQHQLDPLTTVKARVNNFGRANAL  790
            SL+ASYYH VNPL+NTAVGAEV H FS+N NTITVGTQH LDPLT VKARVNN G+A+AL
Sbjct  181  SLNASYYHIVNPLTNTAVGAEVTHCFSTNENTITVGTQHALDPLTMVKARVNNAGKASAL  240

Query  791  IQHEWRPKSLITLSGEVDVKAVDKSAKFGLALALKP  898
            IQHEWRP+SL T+SGEVD K++DKSAK GLALALKP
Sbjct  241  IQHEWRPRSLFTISGEVDTKSIDKSAKVGLALALKP  276



>ref|XP_006482536.1| PREDICTED: mitochondrial outer membrane protein porin of 34 kDa-like 
[Citrus sinensis]
Length=274

 Score =   469 bits (1207),  Expect = 2e-162, Method: Compositional matrix adjust.
 Identities = 232/276 (84%), Positives = 253/276 (92%), Gaps = 2/276 (1%)
 Frame = +2

Query  71   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  250
            MGKGPGLYTDIGKKARDLLY+DYQ+DHKFTITTYSPTGV ITS+G+KKG+LFL DVNTQL
Sbjct  1    MGKGPGLYTDIGKKARDLLYKDYQSDHKFTITTYSPTGVAITSSGTKKGELFLADVNTQL  60

Query  251  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  430
            KNKNITTD KVDT SN+FTTITVDE APGLK I SF+VPDQRSGKVELQYLHD+AGISTS
Sbjct  61   KNKNITTDLKVDTASNLFTTITVDEPAPGLKTILSFKVPDQRSGKVELQYLHDYAGISTS  120

Query  431  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  610
            VGLTANPIVNFS V+GTN L+LGTD+SFD+KSG FTK NAGLSF N+DLIASL LN+KGD
Sbjct  121  VGLTANPIVNFSAVIGTNVLSLGTDLSFDSKSGNFTKCNAGLSFNNADLIASLNLNNKGD  180

Query  611  SLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTITVGTQHQLDPLTTVKARVNNFGRANAL  790
            SL+ASYYH VNPL  TAVGAEV HSFS+N NTITVGTQH LDPLTT+KARVNN G A+AL
Sbjct  181  SLAASYYHFVNPL--TAVGAEVIHSFSTNDNTITVGTQHILDPLTTLKARVNNAGIASAL  238

Query  791  IQHEWRPKSLITLSGEVDVKAVDKSAKFGLALALKP  898
            IQHEWRPKSL T+SGEVD KA++KSAKFGLALALKP
Sbjct  239  IQHEWRPKSLFTISGEVDTKAIEKSAKFGLALALKP  274



>gb|AAB38498.1| porin [Mesembryanthemum crystallinum]
Length=276

 Score =   469 bits (1207),  Expect = 3e-162, Method: Compositional matrix adjust.
 Identities = 224/276 (81%), Positives = 250/276 (91%), Gaps = 0/276 (0%)
 Frame = +2

Query  71   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  250
            M KGPGLYTDIGKKARDLLYRDYQTD KF+ITTYSPTGV ITS+G+KKGDLFL DVNTQL
Sbjct  1    MAKGPGLYTDIGKKARDLLYRDYQTDQKFSITTYSPTGVAITSSGTKKGDLFLADVNTQL  60

Query  251  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  430
            KNKN+TTD KVDTNSN+ TTITVDEAAPGLK I SFRVPDQRSGK+ELQYLHD+AGI TS
Sbjct  61   KNKNVTTDIKVDTNSNLLTTITVDEAAPGLKTILSFRVPDQRSGKLELQYLHDYAGICTS  120

Query  431  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  610
            VGLTANPIVNFSGV+GTN LA GTDVSFD+K+G FTK NAGLSF N+DLIASLTLNDKGD
Sbjct  121  VGLTANPIVNFSGVLGTNLLAFGTDVSFDSKTGNFTKCNAGLSFANADLIASLTLNDKGD  180

Query  611  SLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTITVGTQHQLDPLTTVKARVNNFGRANAL  790
            +L+ASYYH ++PL+++AVGAEV HSFS+N NTIT+G QH +DPLT +K RVNNFG+A AL
Sbjct  181  TLNASYYHTISPLTSSAVGAEVAHSFSTNQNTITLGAQHAIDPLTNLKGRVNNFGKATAL  240

Query  791  IQHEWRPKSLITLSGEVDVKAVDKSAKFGLALALKP  898
            IQHEWRPKSL+T S EVD KA++KSAK GLALALKP
Sbjct  241  IQHEWRPKSLVTFSAEVDTKAIEKSAKVGLALALKP  276



>gb|KHG03636.1| Mitochondrial outer membrane porin of 34 kDa [Gossypium arboreum]
Length=276

 Score =   469 bits (1206),  Expect = 4e-162, Method: Compositional matrix adjust.
 Identities = 224/276 (81%), Positives = 253/276 (92%), Gaps = 0/276 (0%)
 Frame = +2

Query  71   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  250
            MGKGPGLYT+IGKKARDLLY+DYQTDHKFT+TT SPTGV ITS G+KKG+LFL DVNTQL
Sbjct  1    MGKGPGLYTEIGKKARDLLYKDYQTDHKFTLTTSSPTGVAITSAGTKKGELFLADVNTQL  60

Query  251  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  430
            KNKN+TTD KVDT SN++TTITVD+ APGLK I SFR PDQRSGKVELQYLH++AGIS+S
Sbjct  61   KNKNVTTDIKVDTYSNLYTTITVDQPAPGLKAIFSFRAPDQRSGKVELQYLHEYAGISSS  120

Query  431  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  610
            +GLTANPIVN SGV+GTN LALGTD+SFDTK+G FTK NAGLSF+N DLIASLTLN+KGD
Sbjct  121  IGLTANPIVNLSGVIGTNVLALGTDLSFDTKTGNFTKCNAGLSFSNVDLIASLTLNEKGD  180

Query  611  SLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTITVGTQHQLDPLTTVKARVNNFGRANAL  790
            SL+ASYYH VNP++NTAVGAEV HSFS+N NTIT+GTQH LDPLT VKARVNN G+A+AL
Sbjct  181  SLNASYYHIVNPMTNTAVGAEVTHSFSTNENTITIGTQHALDPLTMVKARVNNAGKASAL  240

Query  791  IQHEWRPKSLITLSGEVDVKAVDKSAKFGLALALKP  898
            IQHEWRP+SLIT+SGEVD K++DKSAK GLALALKP
Sbjct  241  IQHEWRPRSLITISGEVDTKSIDKSAKVGLALALKP  276



>ref|XP_006431074.1| hypothetical protein CICLE_v10012445mg [Citrus clementina]
 gb|ESR44314.1| hypothetical protein CICLE_v10012445mg [Citrus clementina]
 gb|KDO72482.1| hypothetical protein CISIN_1g023969mg [Citrus sinensis]
 gb|KDO72483.1| hypothetical protein CISIN_1g023969mg [Citrus sinensis]
Length=274

 Score =   467 bits (1201),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 231/276 (84%), Positives = 252/276 (91%), Gaps = 2/276 (1%)
 Frame = +2

Query  71   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  250
            MGKGPGLYTDIGKKARDLLY+DYQ+DHKFTITTYSPTGV ITS+G+KKG+LFL DVNTQL
Sbjct  1    MGKGPGLYTDIGKKARDLLYKDYQSDHKFTITTYSPTGVAITSSGTKKGELFLADVNTQL  60

Query  251  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  430
            KNKNITTD KVDT SN+FTTITVDE APGLK I SF+VPDQRSGKVELQYLHD+AGISTS
Sbjct  61   KNKNITTDLKVDTASNLFTTITVDEPAPGLKTILSFKVPDQRSGKVELQYLHDYAGISTS  120

Query  431  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  610
            VGLTANPIVNFS V+GTN L+LGTD+SFD+KSG FTK NAGLSF N+DLIASL LN+KGD
Sbjct  121  VGLTANPIVNFSAVIGTNVLSLGTDLSFDSKSGNFTKCNAGLSFNNADLIASLNLNNKGD  180

Query  611  SLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTITVGTQHQLDPLTTVKARVNNFGRANAL  790
            SL+ASYYH VNPL  TAVGAEV HSFS+  NTITVGTQH LDPLTT+KARVNN G A+AL
Sbjct  181  SLAASYYHFVNPL--TAVGAEVIHSFSTTDNTITVGTQHILDPLTTLKARVNNAGIASAL  238

Query  791  IQHEWRPKSLITLSGEVDVKAVDKSAKFGLALALKP  898
            IQHEWRPKSL T+SGEVD KA++KSAKFGLALALKP
Sbjct  239  IQHEWRPKSLFTISGEVDTKAIEKSAKFGLALALKP  274



>gb|KJB33661.1| hypothetical protein B456_006G024700 [Gossypium raimondii]
Length=276

 Score =   467 bits (1201),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 224/276 (81%), Positives = 252/276 (91%), Gaps = 0/276 (0%)
 Frame = +2

Query  71   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  250
            MGKGPGLYT+IGKKARDLLY+DYQTDHKFT+TT SPTGV ITS G+KKG+LFL DVNTQL
Sbjct  1    MGKGPGLYTEIGKKARDLLYKDYQTDHKFTLTTSSPTGVAITSAGTKKGELFLADVNTQL  60

Query  251  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  430
            KNKN+TTD KVDT SN++TTITVD+ APGLK I SFRVPDQRSGKVELQYLH++AGIS+S
Sbjct  61   KNKNVTTDIKVDTYSNLYTTITVDQPAPGLKAIFSFRVPDQRSGKVELQYLHEYAGISSS  120

Query  431  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  610
            +GLTANPIVN SGV+GTN LALGTD+SFDTK+G FTK NAGLSF+N DLIASLTLN+KGD
Sbjct  121  IGLTANPIVNLSGVIGTNVLALGTDLSFDTKTGNFTKCNAGLSFSNVDLIASLTLNEKGD  180

Query  611  SLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTITVGTQHQLDPLTTVKARVNNFGRANAL  790
            SL+ASYYH VNP++NTAVGAEV HSFS+N NTIT+GTQH LDPLT VKARVNN G A+AL
Sbjct  181  SLNASYYHIVNPMTNTAVGAEVTHSFSTNENTITIGTQHALDPLTMVKARVNNAGNASAL  240

Query  791  IQHEWRPKSLITLSGEVDVKAVDKSAKFGLALALKP  898
            IQHEWRP+SL T+SGEVD K++DKSAK GLALALKP
Sbjct  241  IQHEWRPRSLFTISGEVDTKSIDKSAKVGLALALKP  276



>ref|XP_010524325.1| PREDICTED: mitochondrial outer membrane protein porin of 34 kDa-like 
[Tarenaya hassleriana]
Length=276

 Score =   466 bits (1200),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 229/276 (83%), Positives = 249/276 (90%), Gaps = 0/276 (0%)
 Frame = +2

Query  71   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  250
            M KGPGLYT+IGKKARDLLY+DYQ D KFTITTYSPTGV ITSTG+KKGD+FL DV TQL
Sbjct  1    MAKGPGLYTEIGKKARDLLYKDYQNDQKFTITTYSPTGVAITSTGTKKGDVFLADVATQL  60

Query  251  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  430
            KNKNITTD KV T+S + TTITVDE APGLK I SF+VPDQRSGKVELQYLHD+AGISTS
Sbjct  61   KNKNITTDIKVGTDSTLLTTITVDEPAPGLKSIFSFKVPDQRSGKVELQYLHDYAGISTS  120

Query  431  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  610
            +GLTANPIVNFSGVVGTN LALGTDVSFDTK+G FTK NAGLSFT  DLIASLTLNDKGD
Sbjct  121  IGLTANPIVNFSGVVGTNVLALGTDVSFDTKTGNFTKCNAGLSFTKDDLIASLTLNDKGD  180

Query  611  SLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTITVGTQHQLDPLTTVKARVNNFGRANAL  790
            +++ASYYH VNPLSNTAVGAEV+HSFS+N NTITVGTQH LDPLT VKARVNN G+A+AL
Sbjct  181  TVNASYYHIVNPLSNTAVGAEVSHSFSTNENTITVGTQHALDPLTAVKARVNNAGKASAL  240

Query  791  IQHEWRPKSLITLSGEVDVKAVDKSAKFGLALALKP  898
            IQHEWRPKS  T+SGEVD KA++KSAK GLALALKP
Sbjct  241  IQHEWRPKSFFTISGEVDTKAIEKSAKIGLALALKP  276



>emb|CDP00287.1| unnamed protein product [Coffea canephora]
Length=276

 Score =   466 bits (1200),  Expect = 3e-161, Method: Compositional matrix adjust.
 Identities = 222/276 (80%), Positives = 256/276 (93%), Gaps = 0/276 (0%)
 Frame = +2

Query  71   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  250
            M KGPGLY+DIGK+ARDLLY+DYQ DHKF++TTYSP GV IT++G KKG+LFLGDVNTQL
Sbjct  1    MVKGPGLYSDIGKRARDLLYKDYQGDHKFSVTTYSPNGVAITASGLKKGELFLGDVNTQL  60

Query  251  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  430
            KNKNITTDFKVDTNS VFTTITVDE APGLK I SF VPDQRSGKVELQYLH++AGIS+S
Sbjct  61   KNKNITTDFKVDTNSKVFTTITVDEPAPGLKTIFSFVVPDQRSGKVELQYLHEYAGISSS  120

Query  431  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  610
            +GLTANPIVNFSGV G + LALGTDVSFDT +G FTKYNAGLSFTNSDLIA+LTLNDKGD
Sbjct  121  IGLTANPIVNFSGVAGNDKLALGTDVSFDTATGNFTKYNAGLSFTNSDLIAALTLNDKGD  180

Query  611  SLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTITVGTQHQLDPLTTVKARVNNFGRANAL  790
            +L+ASYYH V+PL+NTAVGAE++HSFS+N N++T+GTQH LDPLTTVKARVNN+G+A+AL
Sbjct  181  TLTASYYHSVSPLTNTAVGAELSHSFSTNENSLTLGTQHLLDPLTTVKARVNNYGKASAL  240

Query  791  IQHEWRPKSLITLSGEVDVKAVDKSAKFGLALALKP  898
            IQHEWRPKSL+T+SGEVD +A++KSAK GLA+ALKP
Sbjct  241  IQHEWRPKSLLTISGEVDTRAIEKSAKIGLAVALKP  276



>ref|XP_008379329.1| PREDICTED: LOW QUALITY PROTEIN: mitochondrial outer membrane 
protein porin of 34 kDa-like [Malus domestica]
 ref|XP_009342873.1| PREDICTED: mitochondrial outer membrane protein porin of 34 kDa 
[Pyrus x bretschneideri]
Length=275

 Score =   466 bits (1200),  Expect = 3e-161, Method: Compositional matrix adjust.
 Identities = 223/273 (82%), Positives = 252/273 (92%), Gaps = 0/273 (0%)
 Frame = +2

Query  80   GPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQLKNK  259
            GPGLYTDIGKKARDLLYRDYQ+DHKFTITT+SPTGV ITS+G+KKG+LFL DVNTQLKNK
Sbjct  3    GPGLYTDIGKKARDLLYRDYQSDHKFTITTFSPTGVAITSSGTKKGELFLADVNTQLKNK  62

Query  260  NITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTSVGL  439
            N+TTD KVDT+SN+ TTITVD+ APGLK I SF+VPDQRSGKVELQYLHD+AGIS+SVGL
Sbjct  63   NVTTDVKVDTDSNLSTTITVDQPAPGLKAIFSFKVPDQRSGKVELQYLHDYAGISSSVGL  122

Query  440  TANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGDSLS  619
            TANPIVNFSGV+GTN LALGTD+SFDTK+G  TK NAGLSF+N+DL+A+LTLNDKGD LS
Sbjct  123  TANPIVNFSGVIGTNQLALGTDLSFDTKTGNLTKCNAGLSFSNADLVAALTLNDKGDILS  182

Query  620  ASYYHHVNPLSNTAVGAEVNHSFSSNVNTITVGTQHQLDPLTTVKARVNNFGRANALIQH  799
            ASYYH VNPLSNTAVGAEV H F +N NTIT+GTQH LDPLT++KARVNNFG+A+ALIQH
Sbjct  183  ASYYHSVNPLSNTAVGAEVTHRFPTNENTITLGTQHALDPLTSIKARVNNFGKASALIQH  242

Query  800  EWRPKSLITLSGEVDVKAVDKSAKFGLALALKP  898
            EWRPKS +T+SGEVD KA++KSAK GLALALKP
Sbjct  243  EWRPKSFLTVSGEVDTKAIEKSAKIGLALALKP  275



>ref|XP_010550070.1| PREDICTED: mitochondrial outer membrane protein porin of 34 kDa-like 
[Tarenaya hassleriana]
Length=276

 Score =   465 bits (1196),  Expect = 1e-160, Method: Compositional matrix adjust.
 Identities = 228/276 (83%), Positives = 249/276 (90%), Gaps = 0/276 (0%)
 Frame = +2

Query  71   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  250
            M KGPGLYT+IGKKARDLLY+DYQ+D KF+ITTYSPTGV ITSTG KKGDLFL DV TQL
Sbjct  1    MAKGPGLYTEIGKKARDLLYKDYQSDQKFSITTYSPTGVAITSTGIKKGDLFLADVATQL  60

Query  251  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  430
            KNKNITTD KV T+S + TTITVDE APGLK I SF+VPDQRSGKVELQYLHD+AGISTS
Sbjct  61   KNKNITTDIKVGTDSTLLTTITVDEPAPGLKSIFSFKVPDQRSGKVELQYLHDYAGISTS  120

Query  431  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  610
            +GLTANP+VNFSGVVG+N LALGTDVSFDTK+G FTK NAGLSFT  DLIASLTLNDKGD
Sbjct  121  IGLTANPVVNFSGVVGSNVLALGTDVSFDTKTGNFTKCNAGLSFTKDDLIASLTLNDKGD  180

Query  611  SLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTITVGTQHQLDPLTTVKARVNNFGRANAL  790
            +L+ SYYH VNPLSNTAVGAEV+HSFS+N NTITVGTQH LDPLTTVKARVNN G+A+AL
Sbjct  181  TLNGSYYHIVNPLSNTAVGAEVSHSFSTNENTITVGTQHALDPLTTVKARVNNTGKASAL  240

Query  791  IQHEWRPKSLITLSGEVDVKAVDKSAKFGLALALKP  898
            IQHEWRPKS  T+SGEVD KA++KSAK GLALALKP
Sbjct  241  IQHEWRPKSFFTISGEVDTKAIEKSAKVGLALALKP  276



>ref|XP_011085778.1| PREDICTED: mitochondrial outer membrane protein porin of 34 kDa-like 
[Sesamum indicum]
Length=276

 Score =   465 bits (1196),  Expect = 1e-160, Method: Compositional matrix adjust.
 Identities = 224/276 (81%), Positives = 252/276 (91%), Gaps = 0/276 (0%)
 Frame = +2

Query  71   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  250
            MGKGPGLY+DIGK+ARDLLY+DY +D KFT+TTYSPTGV +TS+G+KKGDLFL DVNTQL
Sbjct  1    MGKGPGLYSDIGKRARDLLYKDYNSDQKFTLTTYSPTGVTLTSSGTKKGDLFLADVNTQL  60

Query  251  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  430
            K+KNITTD KVDTNSN+ TT+TVDE  PGLK I SFRVPDQRSGK+ELQYLHD+AGIS++
Sbjct  61   KHKNITTDIKVDTNSNLHTTVTVDEPTPGLKTILSFRVPDQRSGKLELQYLHDYAGISSN  120

Query  431  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  610
            VGLTANPIVNFSGVVG N +ALG+DVSFDTK GAF K N G SFTN+DLIA+LTLNDKGD
Sbjct  121  VGLTANPIVNFSGVVGNNKVALGSDVSFDTKEGAFVKCNFGASFTNADLIAALTLNDKGD  180

Query  611  SLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTITVGTQHQLDPLTTVKARVNNFGRANAL  790
            +LSASYYH V+PL+NTAVGAEV HSFS+N NTITVGTQH LDPLT+VKARVNNFG+ANAL
Sbjct  181  TLSASYYHIVSPLTNTAVGAEVTHSFSTNENTITVGTQHALDPLTSVKARVNNFGKANAL  240

Query  791  IQHEWRPKSLITLSGEVDVKAVDKSAKFGLALALKP  898
            IQHEWRPKSLIT+S EVD K++DKSAKFG ALALKP
Sbjct  241  IQHEWRPKSLITVSTEVDTKSIDKSAKFGFALALKP  276



>ref|XP_010029375.1| PREDICTED: mitochondrial outer membrane protein porin of 34 kDa-like 
[Eucalyptus grandis]
 gb|KCW56274.1| hypothetical protein EUGRSUZ_I02018 [Eucalyptus grandis]
Length=276

 Score =   464 bits (1194),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 223/276 (81%), Positives = 253/276 (92%), Gaps = 0/276 (0%)
 Frame = +2

Query  71   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  250
            MGKGPGLY+DIGKKARDLLY+DYQ+DHKFTITT+SPTGV +TSTG+KKG+LFL DVNTQL
Sbjct  1    MGKGPGLYSDIGKKARDLLYKDYQSDHKFTITTFSPTGVTLTSTGTKKGELFLADVNTQL  60

Query  251  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  430
            KNKNITTD KVDT+SN+FTTITVDE APGLK I SF+VPDQRSGK+ELQYLH+HAGIS+S
Sbjct  61   KNKNITTDIKVDTSSNLFTTITVDEPAPGLKSIFSFKVPDQRSGKIELQYLHEHAGISSS  120

Query  431  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  610
            +GLTANPIV FSGV+GT+ALALGTDVSFDTKSG F K NAGLSF+N+DLIASLT+NDKGD
Sbjct  121  IGLTANPIVTFSGVIGTSALALGTDVSFDTKSGDFAKCNAGLSFSNADLIASLTVNDKGD  180

Query  611  SLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTITVGTQHQLDPLTTVKARVNNFGRANAL  790
            +L+ASYYH VN L+NTAVGAE  H FS+N NTITVGTQH LDPLT+VKARV N G+ +AL
Sbjct  181  TLAASYYHLVNGLTNTAVGAEFTHRFSTNENTITVGTQHALDPLTSVKARVTNAGKVSAL  240

Query  791  IQHEWRPKSLITLSGEVDVKAVDKSAKFGLALALKP  898
            IQHEWRP+SL T+SGEVD K++DKSAK GLALALKP
Sbjct  241  IQHEWRPRSLFTISGEVDSKSIDKSAKVGLALALKP  276



>ref|XP_008230727.1| PREDICTED: mitochondrial outer membrane protein porin of 34 kDa-like 
[Prunus mume]
Length=275

 Score =   463 bits (1191),  Expect = 6e-160, Method: Compositional matrix adjust.
 Identities = 220/273 (81%), Positives = 252/273 (92%), Gaps = 0/273 (0%)
 Frame = +2

Query  80   GPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQLKNK  259
            GPGLYTDIGKKARDLLY+DYQ+D KFT+TTYSPTGV ITS+G+KKG+LFL DVNTQLKNK
Sbjct  3    GPGLYTDIGKKARDLLYKDYQSDQKFTVTTYSPTGVAITSSGTKKGELFLADVNTQLKNK  62

Query  260  NITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTSVGL  439
            N+TTD KVDT+SN+ TT+TVD+ APGLK I SF+VPDQRSGKVELQYLHD+AGISTSVGL
Sbjct  63   NVTTDIKVDTDSNLSTTVTVDQPAPGLKAIFSFKVPDQRSGKVELQYLHDYAGISTSVGL  122

Query  440  TANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGDSLS  619
            TANPIVNFSGV+GTN LALGTD+SFDTK+G  TK NAG+SF+N+DLIA+LTLNDKGD LS
Sbjct  123  TANPIVNFSGVIGTNQLALGTDLSFDTKTGNLTKCNAGVSFSNADLIAALTLNDKGDILS  182

Query  620  ASYYHHVNPLSNTAVGAEVNHSFSSNVNTITVGTQHQLDPLTTVKARVNNFGRANALIQH  799
            ASYYH+VNPL+NTAVGAEV H F +N NTIT+GTQH LDPLTT+KARVNNFG+A+ALIQH
Sbjct  183  ASYYHNVNPLANTAVGAEVTHRFPTNENTITLGTQHALDPLTTLKARVNNFGKASALIQH  242

Query  800  EWRPKSLITLSGEVDVKAVDKSAKFGLALALKP  898
            EWRPKS +T+SGEVD KA++K+AK GLALALKP
Sbjct  243  EWRPKSFVTISGEVDTKAIEKTAKIGLALALKP  275



>gb|EYU34113.1| hypothetical protein MIMGU_mgv1a011597mg [Erythranthe guttata]
Length=276

 Score =   462 bits (1188),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 222/276 (80%), Positives = 251/276 (91%), Gaps = 0/276 (0%)
 Frame = +2

Query  71   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  250
            MGKGPGLY+DIGK+ARDLL RDYQ+D KFT+TT SPTGV +TSTG+KKGDLFL D+NTQL
Sbjct  1    MGKGPGLYSDIGKRARDLLNRDYQSDQKFTLTTCSPTGVTLTSTGTKKGDLFLADINTQL  60

Query  251  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  430
            K+KN+TTDFKVDT SN+FTT+T+DE APGLK I SF+VPDQRSGK+ELQYLHD+AGIS+S
Sbjct  61   KHKNVTTDFKVDTGSNLFTTVTIDEPAPGLKTIISFKVPDQRSGKLELQYLHDYAGISSS  120

Query  431  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  610
            VGLTANPIVNFSGVVG N  ++G+DVS+DTK GA TK N G SFTN+DLIASLTLNDKGD
Sbjct  121  VGLTANPIVNFSGVVGNNLFSVGSDVSYDTKEGALTKCNFGASFTNADLIASLTLNDKGD  180

Query  611  SLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTITVGTQHQLDPLTTVKARVNNFGRANAL  790
            SLSASYYH V P++NTAVGAEV HSFSSN NTITVGTQH LD LTTVKAR+NNFG+A+AL
Sbjct  181  SLSASYYHTVTPVTNTAVGAEVTHSFSSNENTITVGTQHSLDSLTTVKARLNNFGKASAL  240

Query  791  IQHEWRPKSLITLSGEVDVKAVDKSAKFGLALALKP  898
            IQHEWRPKSL+T+S EVD K+VDKSAKFGLALALKP
Sbjct  241  IQHEWRPKSLVTVSSEVDTKSVDKSAKFGLALALKP  276



>ref|XP_002282471.1| PREDICTED: mitochondrial outer membrane protein porin of 34 kDa 
[Vitis vinifera]
 emb|CAN61274.1| hypothetical protein VITISV_039065 [Vitis vinifera]
 emb|CBI22157.3| unnamed protein product [Vitis vinifera]
Length=276

 Score =   461 bits (1185),  Expect = 5e-159, Method: Compositional matrix adjust.
 Identities = 218/276 (79%), Positives = 254/276 (92%), Gaps = 0/276 (0%)
 Frame = +2

Query  71   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  250
            MGKGPGLYT+IGKKARDLLY+DYQ+DHK TIT+ SPTGV ITS+G+KKGD+F+ DVNTQL
Sbjct  1    MGKGPGLYTEIGKKARDLLYKDYQSDHKLTITSCSPTGVAITSSGTKKGDIFVADVNTQL  60

Query  251  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  430
            KNKNITTD K+DT+SN+F T+TVDE APGLK I +F+VPDQRSGKVELQYLHD+AGISTS
Sbjct  61   KNKNITTDVKIDTSSNLFVTVTVDEPAPGLKSIFNFKVPDQRSGKVELQYLHDYAGISTS  120

Query  431  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  610
            +GLTANPIVNFSG +GTN +ALGTD+SFDTKSG FTK NAG+SF N+DLIASLT+NDKGD
Sbjct  121  IGLTANPIVNFSGTIGTNVVALGTDLSFDTKSGNFTKCNAGVSFCNADLIASLTVNDKGD  180

Query  611  SLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTITVGTQHQLDPLTTVKARVNNFGRANAL  790
            +++ASY+H VN L+NTAVGAEV HSFS+N NT+T+G QH+LDPLTTVKARVNNFG+A+AL
Sbjct  181  AVNASYFHSVNLLTNTAVGAEVTHSFSTNQNTLTLGAQHKLDPLTTVKARVNNFGKASAL  240

Query  791  IQHEWRPKSLITLSGEVDVKAVDKSAKFGLALALKP  898
            IQHEWRP+SL T+SGEVD KAVDK+AK GLALALKP
Sbjct  241  IQHEWRPRSLFTISGEVDTKAVDKTAKVGLALALKP  276



>ref|XP_010066951.1| PREDICTED: mitochondrial outer membrane protein porin of 36 kDa 
[Eucalyptus grandis]
 gb|KCW65006.1| hypothetical protein EUGRSUZ_G02544 [Eucalyptus grandis]
Length=276

 Score =   460 bits (1184),  Expect = 6e-159, Method: Compositional matrix adjust.
 Identities = 223/276 (81%), Positives = 249/276 (90%), Gaps = 0/276 (0%)
 Frame = +2

Query  71   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  250
            M KGPGLY+DIGKKARDLLY+DYQ DHKFTITTY+ TG+ +TSTG KKG+ FL DV+TQL
Sbjct  1    MAKGPGLYSDIGKKARDLLYKDYQGDHKFTITTYTSTGIALTSTGIKKGEFFLADVSTQL  60

Query  251  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  430
            KNKNITTD KVDTNSN+ TTITVDE APGLK I SF VPDQRSGKVELQY H++AGISTS
Sbjct  61   KNKNITTDVKVDTNSNLLTTITVDEPAPGLKTIFSFIVPDQRSGKVELQYQHEYAGISTS  120

Query  431  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  610
            +GLTANPIVNFSGVVG N LALGTD+SFDT SG FTK NAGLSFTNSDLIASLTLNDKGD
Sbjct  121  IGLTANPIVNFSGVVGNNLLALGTDLSFDTASGNFTKCNAGLSFTNSDLIASLTLNDKGD  180

Query  611  SLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTITVGTQHQLDPLTTVKARVNNFGRANAL  790
            +LSASYYH V+PL++TAVGAE++HSFSSN N +T+GTQH LDPLT VKARVNN+GRA+AL
Sbjct  181  TLSASYYHTVSPLTSTAVGAELSHSFSSNENMLTIGTQHALDPLTNVKARVNNYGRASAL  240

Query  791  IQHEWRPKSLITLSGEVDVKAVDKSAKFGLALALKP  898
            IQHEWRPKSL T+SGEVD +A++KSAK GLALALKP
Sbjct  241  IQHEWRPKSLFTISGEVDTRAIEKSAKIGLALALKP  276



>ref|XP_003543710.1| PREDICTED: outer plastidial membrane protein porin-like [Glycine 
max]
Length=276

 Score =   460 bits (1184),  Expect = 7e-159, Method: Compositional matrix adjust.
 Identities = 222/276 (80%), Positives = 249/276 (90%), Gaps = 0/276 (0%)
 Frame = +2

Query  71   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  250
            M KGPGLY+DIGKKARDLL++DY +D KFTITTYSPTGV ITS+G+KKGDLF+ DVNTQL
Sbjct  1    MSKGPGLYSDIGKKARDLLFKDYHSDQKFTITTYSPTGVAITSSGTKKGDLFVADVNTQL  60

Query  251  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  430
            KNKNITTD K+DTNSN+ TTITV+E APGLK I SFRVPDQRSGKVE+QYLHD+AGISTS
Sbjct  61   KNKNITTDIKLDTNSNLLTTITVNEPAPGLKTIFSFRVPDQRSGKVEVQYLHDYAGISTS  120

Query  431  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  610
            VGLTANPIVNFSGVVGTN LALGTDVSFDTK G  TK+NAGL+FT  DL+ASLT+NDKGD
Sbjct  121  VGLTANPIVNFSGVVGTNVLALGTDVSFDTKIGELTKFNAGLNFTKDDLVASLTVNDKGD  180

Query  611  SLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTITVGTQHQLDPLTTVKARVNNFGRANAL  790
            +L+ASYYH VN L+NTAVGAEV H FS+N NT+T+GTQH LDPLTT+KARVNNFG+ANAL
Sbjct  181  ALNASYYHAVNRLTNTAVGAEVTHRFSTNENTLTLGTQHALDPLTTMKARVNNFGKANAL  240

Query  791  IQHEWRPKSLITLSGEVDVKAVDKSAKFGLALALKP  898
            IQHEWRPKS  T+SGEVD KA++KSAK GL LALKP
Sbjct  241  IQHEWRPKSFFTISGEVDTKAIEKSAKVGLGLALKP  276



>gb|KHN13242.1| Outer plastidial membrane protein porin [Glycine soja]
Length=276

 Score =   460 bits (1184),  Expect = 8e-159, Method: Compositional matrix adjust.
 Identities = 221/276 (80%), Positives = 249/276 (90%), Gaps = 0/276 (0%)
 Frame = +2

Query  71   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  250
            M KGPGLY+DIGKKARDLL++DY +D KFTITTYSPTGV ITS+G+KKGDLF+ DVNTQL
Sbjct  1    MSKGPGLYSDIGKKARDLLFKDYHSDQKFTITTYSPTGVAITSSGTKKGDLFVADVNTQL  60

Query  251  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  430
            KNKNITTD K+DTNSN+ TTITV+E APGLK I SFRVPDQRSGKVE+QYLHD+AGISTS
Sbjct  61   KNKNITTDIKLDTNSNLLTTITVNEPAPGLKTIFSFRVPDQRSGKVEVQYLHDYAGISTS  120

Query  431  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  610
            VGLTANPIVNFSG+VGTN LALGTDVSFDTK G  TK+NAGL+FT  DL+ASLT+NDKGD
Sbjct  121  VGLTANPIVNFSGIVGTNVLALGTDVSFDTKIGELTKFNAGLNFTKDDLVASLTVNDKGD  180

Query  611  SLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTITVGTQHQLDPLTTVKARVNNFGRANAL  790
            +L+ASYYH VN L+NTAVGAEV H FS+N NT+T+GTQH LDPLTT+KARVNNFG+ANAL
Sbjct  181  ALNASYYHAVNRLTNTAVGAEVTHRFSTNENTLTLGTQHALDPLTTMKARVNNFGKANAL  240

Query  791  IQHEWRPKSLITLSGEVDVKAVDKSAKFGLALALKP  898
            IQHEWRPKS  T+SGEVD KA++KSAK GL LALKP
Sbjct  241  IQHEWRPKSFFTISGEVDTKAIEKSAKVGLGLALKP  276



>ref|XP_002520135.1| voltage-dependent anion-selective channel, putative [Ricinus 
communis]
 gb|EEF42190.1| voltage-dependent anion-selective channel, putative [Ricinus 
communis]
Length=276

 Score =   460 bits (1183),  Expect = 9e-159, Method: Compositional matrix adjust.
 Identities = 219/276 (79%), Positives = 254/276 (92%), Gaps = 0/276 (0%)
 Frame = +2

Query  71   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  250
            MGKGPGLYTDIGKKARDLLY+DYQ DHKFT+TTY+ TGV ITSTG KKG+++LGD+ +QL
Sbjct  1    MGKGPGLYTDIGKKARDLLYKDYQGDHKFTVTTYTSTGVAITSTGIKKGEIYLGDITSQL  60

Query  251  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  430
            KNKNITTD KVDT+SNV TTITVDE APGLK I SF++PDQRSGKVELQY H+HAGISTS
Sbjct  61   KNKNITTDIKVDTSSNVSTTITVDEPAPGLKTIFSFKIPDQRSGKVELQYQHEHAGISTS  120

Query  431  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  610
            +GLTANPIVNFSGV+G++A+ALGTD+SFDT SG FTK NAGLS++N+DLIASLTLNDKGD
Sbjct  121  IGLTANPIVNFSGVIGSSAVALGTDLSFDTASGNFTKLNAGLSYSNTDLIASLTLNDKGD  180

Query  611  SLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTITVGTQHQLDPLTTVKARVNNFGRANAL  790
            +L+ASYYH V+PL+NTAVGAE+ HSFSSN NT+T GTQH LDPLTTVKARVN++G+A+AL
Sbjct  181  TLNASYYHIVSPLTNTAVGAELTHSFSSNENTLTFGTQHALDPLTTVKARVNSYGKASAL  240

Query  791  IQHEWRPKSLITLSGEVDVKAVDKSAKFGLALALKP  898
            IQHEWRPKSL T+SGEVD +A++KSAK GLALALKP
Sbjct  241  IQHEWRPKSLFTISGEVDTRAIEKSAKIGLALALKP  276



>ref|XP_011085779.1| PREDICTED: mitochondrial outer membrane protein porin of 34 kDa-like 
[Sesamum indicum]
Length=276

 Score =   459 bits (1181),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 220/276 (80%), Positives = 250/276 (91%), Gaps = 0/276 (0%)
 Frame = +2

Query  71   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  250
            MGKGPGLY+DIGK+ARDLLY+DY +D KFT+TTYSPTGV +TSTG+KKGDLFL DVNTQL
Sbjct  1    MGKGPGLYSDIGKRARDLLYKDYNSDQKFTLTTYSPTGVTLTSTGTKKGDLFLADVNTQL  60

Query  251  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  430
            K+KN+TTD KVDT+SN+ TT+TVDE  PGLK I SFRVPDQRSGK+ELQYLH++AGIS+S
Sbjct  61   KHKNVTTDIKVDTSSNLHTTVTVDEPTPGLKTILSFRVPDQRSGKLELQYLHEYAGISSS  120

Query  431  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  610
            VGLTANPIVNFSGVVG N LALG+DVSFDTK GAF K N G SFTN+DLIA+LTLNDKGD
Sbjct  121  VGLTANPIVNFSGVVGNNKLALGSDVSFDTKEGAFIKCNFGASFTNADLIAALTLNDKGD  180

Query  611  SLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTITVGTQHQLDPLTTVKARVNNFGRANAL  790
            +LSASYYH V+PLSNTAVGAEV HSFS+N NT+ VGTQH LDPLT+VKAR+NNFG+A+AL
Sbjct  181  TLSASYYHIVSPLSNTAVGAEVTHSFSTNENTVIVGTQHSLDPLTSVKARLNNFGKASAL  240

Query  791  IQHEWRPKSLITLSGEVDVKAVDKSAKFGLALALKP  898
            IQHEWRPKSLIT+S EVD K++DKS KFG ALALKP
Sbjct  241  IQHEWRPKSLITVSTEVDTKSIDKSPKFGFALALKP  276



>ref|XP_008341536.1| PREDICTED: outer plastidial membrane protein porin-like [Malus 
domestica]
Length=275

 Score =   459 bits (1180),  Expect = 3e-158, Method: Compositional matrix adjust.
 Identities = 218/273 (80%), Positives = 249/273 (91%), Gaps = 0/273 (0%)
 Frame = +2

Query  80   GPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQLKNK  259
            GPGLYTDIGKKARDLLY+DYQ+D KFTITT+SPTGV IT++G+ KG+LFLGDVNTQLKNK
Sbjct  3    GPGLYTDIGKKARDLLYKDYQSDKKFTITTFSPTGVAITTSGTNKGELFLGDVNTQLKNK  62

Query  260  NITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTSVGL  439
            N+TTD KVDT+SN+ TTITVD+ APGLK I  F+VPDQRSGKVELQYLHD+AGIS+SVGL
Sbjct  63   NVTTDIKVDTDSNLSTTITVDQPAPGLKAIFCFKVPDQRSGKVELQYLHDYAGISSSVGL  122

Query  440  TANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGDSLS  619
            TANPIVNFSGV+GTN LALG D+SFDTK+G  TK NAGLSF+N+DLIA+LTLNDKGD LS
Sbjct  123  TANPIVNFSGVIGTNQLALGADLSFDTKTGILTKCNAGLSFSNADLIAALTLNDKGDILS  182

Query  620  ASYYHHVNPLSNTAVGAEVNHSFSSNVNTITVGTQHQLDPLTTVKARVNNFGRANALIQH  799
            ASYYH VNPLSNTAVGAEV H F +N NTIT+GTQH LDP+TT+KARVNNFG+A+AL+QH
Sbjct  183  ASYYHSVNPLSNTAVGAEVTHRFPTNENTITLGTQHALDPMTTIKARVNNFGKASALVQH  242

Query  800  EWRPKSLITLSGEVDVKAVDKSAKFGLALALKP  898
            EWRPKS +T+SGEVD KA++KSAK GLALALKP
Sbjct  243  EWRPKSFLTVSGEVDTKAIEKSAKIGLALALKP  275



>ref|XP_003554316.1| PREDICTED: mitochondrial outer membrane protein porin of 34 kDa 
[Glycine max]
Length=276

 Score =   459 bits (1180),  Expect = 3e-158, Method: Compositional matrix adjust.
 Identities = 222/276 (80%), Positives = 248/276 (90%), Gaps = 0/276 (0%)
 Frame = +2

Query  71   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  250
            M KGPGLY+DIGKKARDLL++DY +D KFTITTYSPTGV ITS+G+KKGDLF+ DVNTQL
Sbjct  1    MSKGPGLYSDIGKKARDLLFKDYHSDQKFTITTYSPTGVAITSSGTKKGDLFVADVNTQL  60

Query  251  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  430
            KNKNITTD KVDT SN+FTTITV+E APGLK I SFRVPDQRSGKVE+QYLHD+AGISTS
Sbjct  61   KNKNITTDIKVDTGSNLFTTITVNEPAPGLKTIFSFRVPDQRSGKVEVQYLHDYAGISTS  120

Query  431  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  610
            VGLTANPIVNFSGVVGTN LALGTDVSFDTK G  TK+NAGL+FT  DL+ASLT+N+KGD
Sbjct  121  VGLTANPIVNFSGVVGTNVLALGTDVSFDTKIGELTKFNAGLNFTKDDLVASLTVNNKGD  180

Query  611  SLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTITVGTQHQLDPLTTVKARVNNFGRANAL  790
            SL+ASYYH VN L+NTAVGAEV H FS+N NT+T+GTQH LDPLTTVKARVNN G+ANAL
Sbjct  181  SLNASYYHTVNRLTNTAVGAEVTHQFSTNENTLTLGTQHALDPLTTVKARVNNLGKANAL  240

Query  791  IQHEWRPKSLITLSGEVDVKAVDKSAKFGLALALKP  898
            IQHEWRP+S  T+SGEVD KA++KSAK GL LALKP
Sbjct  241  IQHEWRPRSFFTISGEVDTKAIEKSAKVGLGLALKP  276



>gb|EPS57816.1| hypothetical protein M569_17001 [Genlisea aurea]
Length=276

 Score =   457 bits (1177),  Expect = 8e-158, Method: Compositional matrix adjust.
 Identities = 218/276 (79%), Positives = 252/276 (91%), Gaps = 0/276 (0%)
 Frame = +2

Query  71   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  250
            MGKGPGLY+DIGK+ARDLLY+DY +D KFT+TTYSPTGV +TS+G++KGDLFL DVNTQL
Sbjct  1    MGKGPGLYSDIGKRARDLLYKDYNSDQKFTLTTYSPTGVTLTSSGTRKGDLFLADVNTQL  60

Query  251  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  430
            KNKN+TTD KVDTNSN+FTTITVDE APGLK I SF+VPDQRSGK+ELQYLHD+AGIS+S
Sbjct  61   KNKNVTTDIKVDTNSNLFTTITVDEPAPGLKTILSFKVPDQRSGKLELQYLHDYAGISSS  120

Query  431  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  610
            VGLTANPIVNFSGV+G NA ALG+D+SFDTK G  TK+N G S++N+DLIA+L LNDKGD
Sbjct  121  VGLTANPIVNFSGVLGNNAFALGSDLSFDTKEGNVTKWNFGASYSNADLIAALALNDKGD  180

Query  611  SLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTITVGTQHQLDPLTTVKARVNNFGRANAL  790
            +LSASYYH V+P++NTAVG EV HSFSSN NTITVGTQH LDPLT+VKAR+NN G+A+AL
Sbjct  181  TLSASYYHLVSPVTNTAVGGEVTHSFSSNENTITVGTQHLLDPLTSVKARINNSGKASAL  240

Query  791  IQHEWRPKSLITLSGEVDVKAVDKSAKFGLALALKP  898
            IQHEWRPKSL+TLS EVD ++VDKSAKFGLALALKP
Sbjct  241  IQHEWRPKSLLTLSTEVDTRSVDKSAKFGLALALKP  276



>gb|AAY82249.1| mitochrondrial voltage-dependent anion-selective channel [Phaseolus 
coccineus]
Length=276

 Score =   457 bits (1177),  Expect = 8e-158, Method: Compositional matrix adjust.
 Identities = 220/276 (80%), Positives = 249/276 (90%), Gaps = 0/276 (0%)
 Frame = +2

Query  71   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  250
            M KGPGLYTDIGKKARDLL++DY +D KFT+TTYSPTGV ITS+G++KG+LFL DVNTQL
Sbjct  1    MAKGPGLYTDIGKKARDLLFKDYHSDQKFTVTTYSPTGVAITSSGTRKGELFLADVNTQL  60

Query  251  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  430
            KNKNITTD KVDT+SN+FTTITV+E APGLK I +F+VPDQRSGKVELQYLHD+AGISTS
Sbjct  61   KNKNITTDIKVDTDSNLFTTITVNEPAPGLKAIFNFKVPDQRSGKVELQYLHDYAGISTS  120

Query  431  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  610
            VGLTANPIVNFSGVVGTN LALG D+SFDTK G  TK NAGLSFT  DLIASLTLNDKGD
Sbjct  121  VGLTANPIVNFSGVVGTNILALGADLSFDTKIGELTKSNAGLSFTKDDLIASLTLNDKGD  180

Query  611  SLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTITVGTQHQLDPLTTVKARVNNFGRANAL  790
            +L+A+YYH VNPL+NTAVGAEV H FS+N NTIT+GTQH LDPLTT+KARVNNFG+++AL
Sbjct  181  ALNAAYYHVVNPLTNTAVGAEVTHRFSTNENTITLGTQHALDPLTTLKARVNNFGKSSAL  240

Query  791  IQHEWRPKSLITLSGEVDVKAVDKSAKFGLALALKP  898
            IQHEWRPKS  T+SGEVD KA++KSAK GL+L LKP
Sbjct  241  IQHEWRPKSFFTISGEVDTKAIEKSAKVGLSLVLKP  276



>gb|AAQ87020.1| VDAC1.2 [Lotus japonicus]
Length=276

 Score =   457 bits (1176),  Expect = 1e-157, Method: Compositional matrix adjust.
 Identities = 220/276 (80%), Positives = 248/276 (90%), Gaps = 0/276 (0%)
 Frame = +2

Query  71   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  250
            M KGPGLYTDIGK+ARDLL++DY +D KFTITTYSPTGV ITS+G KKG+LF+ DVNTQL
Sbjct  1    MAKGPGLYTDIGKRARDLLFKDYHSDQKFTITTYSPTGVAITSSGIKKGELFVADVNTQL  60

Query  251  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  430
            KNKNITTD KVDT+SN+FTT+TVDE APGLK I SFRVPDQRSGKVELQYLHD+AGISTS
Sbjct  61   KNKNITTDLKVDTDSNLFTTVTVDEPAPGLKAIFSFRVPDQRSGKVELQYLHDYAGISTS  120

Query  431  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  610
            VGLT NPIVNFSGVVGTNALA+GTD+SFDTK G  TK+NAGL+FT +DLIASLT+NDKGD
Sbjct  121  VGLTPNPIVNFSGVVGTNALAVGTDLSFDTKIGELTKFNAGLNFTKADLIASLTVNDKGD  180

Query  611  SLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTITVGTQHQLDPLTTVKARVNNFGRANAL  790
            +L+ASYYH VNPL+NTA GAEV H FS+N NT+T+GTQH LDPLT+VKARVNN G+ANAL
Sbjct  181  ALNASYYHIVNPLTNTAFGAEVTHRFSTNENTLTLGTQHALDPLTSVKARVNNLGKANAL  240

Query  791  IQHEWRPKSLITLSGEVDVKAVDKSAKFGLALALKP  898
            IQHEWR KS  T+SGEVD KA++KSAK GL LALKP
Sbjct  241  IQHEWRAKSFFTISGEVDTKAIEKSAKIGLGLALKP  276



>gb|KJB11402.1| hypothetical protein B456_001G256800 [Gossypium raimondii]
Length=276

 Score =   457 bits (1176),  Expect = 1e-157, Method: Compositional matrix adjust.
 Identities = 220/276 (80%), Positives = 249/276 (90%), Gaps = 0/276 (0%)
 Frame = +2

Query  71   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  250
            MGKGPGLYT+IGKKARDLLY+DYQTD KFT+TT SPTGV ITS G+KKGDLFL DVNTQL
Sbjct  1    MGKGPGLYTEIGKKARDLLYKDYQTDQKFTLTTSSPTGVAITSAGTKKGDLFLADVNTQL  60

Query  251  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  430
            K++N+TTD KVDT+SN+FTTITVDE APGLK I  FRVPDQRSGK+ELQYLH++AGIS+S
Sbjct  61   KSRNVTTDIKVDTSSNLFTTITVDEPAPGLKAIFGFRVPDQRSGKIELQYLHEYAGISSS  120

Query  431  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  610
            +GLTANPIVNFSGV+GTN LALGTD+SFDTK+G FTK NAG SFTN+DLIASL LN+KGD
Sbjct  121  IGLTANPIVNFSGVLGTNVLALGTDISFDTKTGNFTKCNAGFSFTNADLIASLALNEKGD  180

Query  611  SLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTITVGTQHQLDPLTTVKARVNNFGRANAL  790
            S++ASYYH VN  +NT VGAEV HSFS+NVNTITVGTQH LDP TT+KARVNN G+A+AL
Sbjct  181  SVNASYYHIVNLSTNTVVGAEVTHSFSTNVNTITVGTQHALDPSTTIKARVNNAGKASAL  240

Query  791  IQHEWRPKSLITLSGEVDVKAVDKSAKFGLALALKP  898
            IQHEWRPKSL T+SGEVD K++DKS K GLALALKP
Sbjct  241  IQHEWRPKSLFTISGEVDTKSIDKSPKVGLALALKP  276



>ref|XP_002312708.1| porin family protein [Populus trichocarpa]
 gb|ABK94257.1| unknown [Populus trichocarpa]
 gb|EEE90075.1| porin family protein [Populus trichocarpa]
Length=276

 Score =   457 bits (1176),  Expect = 1e-157, Method: Compositional matrix adjust.
 Identities = 216/276 (78%), Positives = 252/276 (91%), Gaps = 0/276 (0%)
 Frame = +2

Query  71   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  250
            MGKGPGLY DIGKKARDLLY+DYQ+DHKFT+TTY+ TGV +TSTG KKG+LFL DV+ QL
Sbjct  1    MGKGPGLYVDIGKKARDLLYKDYQSDHKFTVTTYTSTGVALTSTGIKKGELFLADVSGQL  60

Query  251  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  430
            KNKNITTD KVDTNSN+ TTIT+DE APGLK I SF+VPDQRSGKVELQY H++AGISTS
Sbjct  61   KNKNITTDIKVDTNSNLLTTITIDEPAPGLKTIFSFKVPDQRSGKVELQYQHEYAGISTS  120

Query  431  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  610
            +GLTANPIVNFSGV+G+N ++LGTD+SFDT +G FTKYNAGLS+TN+DLIASLT+NDKGD
Sbjct  121  LGLTANPIVNFSGVIGSNVVSLGTDLSFDTATGNFTKYNAGLSYTNADLIASLTVNDKGD  180

Query  611  SLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTITVGTQHQLDPLTTVKARVNNFGRANAL  790
            +L+ASYYH V PL++TAVGAE+  SFSSN NT+T+GTQH LDPLTTVKAR+NN+G+A+AL
Sbjct  181  TLTASYYHTVRPLTSTAVGAELTRSFSSNENTLTIGTQHALDPLTTVKARLNNYGKASAL  240

Query  791  IQHEWRPKSLITLSGEVDVKAVDKSAKFGLALALKP  898
            IQHEWRPKSL T+SGEVD KA++KSAK GLALALKP
Sbjct  241  IQHEWRPKSLFTISGEVDTKAIEKSAKIGLALALKP  276



>ref|XP_011034213.1| PREDICTED: mitochondrial outer membrane protein porin of 36 kDa-like 
[Populus euphratica]
Length=276

 Score =   457 bits (1176),  Expect = 1e-157, Method: Compositional matrix adjust.
 Identities = 216/276 (78%), Positives = 252/276 (91%), Gaps = 0/276 (0%)
 Frame = +2

Query  71   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  250
            MGKGPGLY DIGKKARDLLY+DYQ+DHKFT+TTY+ TGV +TSTG KKG+LFL DV+ QL
Sbjct  1    MGKGPGLYADIGKKARDLLYKDYQSDHKFTVTTYTSTGVALTSTGIKKGELFLADVSGQL  60

Query  251  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  430
            KNKNITTD KVDTNSN+ TTIT+DE APGLK I SF+VPDQRSGKVELQY H++AGISTS
Sbjct  61   KNKNITTDIKVDTNSNLLTTITIDEPAPGLKTIFSFKVPDQRSGKVELQYQHEYAGISTS  120

Query  431  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  610
            +GLTANPIVNFSGV+G+N ++LGTD+SFDT +G FTKYNAGLS+TN+DLIASLT+NDKGD
Sbjct  121  LGLTANPIVNFSGVIGSNVVSLGTDLSFDTATGNFTKYNAGLSYTNADLIASLTVNDKGD  180

Query  611  SLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTITVGTQHQLDPLTTVKARVNNFGRANAL  790
            +L+ASYYH V PL++TAVGAE+  SFSSN NT+T+GTQH LDPLTTVKAR+NN+G+A+AL
Sbjct  181  TLTASYYHTVRPLTSTAVGAELTRSFSSNENTLTIGTQHALDPLTTVKARLNNYGKASAL  240

Query  791  IQHEWRPKSLITLSGEVDVKAVDKSAKFGLALALKP  898
            IQHEWRPKSL T+SGEVD KA++KSAK GLALALKP
Sbjct  241  IQHEWRPKSLFTISGEVDTKAIEKSAKIGLALALKP  276



>ref|NP_001238377.1| peroxisomal voltage-dependent anion-selective channel protein 
[Glycine max]
 dbj|BAG09368.1| peroxisomal voltage-dependent anion-selective channel protein 
[Glycine max]
Length=276

 Score =   456 bits (1172),  Expect = 4e-157, Method: Compositional matrix adjust.
 Identities = 218/276 (79%), Positives = 247/276 (89%), Gaps = 0/276 (0%)
 Frame = +2

Query  71   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  250
            M KGPGLY+DIGKKARDLL++DY +D KFTITTYSPTGV IT++G++K +LFL DVNTQL
Sbjct  1    MAKGPGLYSDIGKKARDLLFKDYHSDQKFTITTYSPTGVAITASGTRKSELFLADVNTQL  60

Query  251  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  430
            KNKNITTD KVDT+SN+FTTITV+E APGLK I SF+VPDQRSGKVE+QYLHD+AGISTS
Sbjct  61   KNKNITTDIKVDTDSNLFTTITVNEPAPGLKAIFSFKVPDQRSGKVEVQYLHDYAGISTS  120

Query  431  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  610
            VGLTANPIVNFSGV+GTN LALG D+SFDTK G  TK NAGLSFT  DLIASLTLNDKGD
Sbjct  121  VGLTANPIVNFSGVIGTNVLALGADLSFDTKIGELTKSNAGLSFTKDDLIASLTLNDKGD  180

Query  611  SLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTITVGTQHQLDPLTTVKARVNNFGRANAL  790
            +L+A+YYH VNPL+NTAVGAEV H FS+N NT+T+GTQHQLDPLTT+KARVNNFGR +AL
Sbjct  181  ALNAAYYHVVNPLTNTAVGAEVTHRFSTNENTLTLGTQHQLDPLTTLKARVNNFGRTSAL  240

Query  791  IQHEWRPKSLITLSGEVDVKAVDKSAKFGLALALKP  898
            IQHEWRPKS  T+SGEVD KA++KSAK GL L LKP
Sbjct  241  IQHEWRPKSFFTISGEVDTKAIEKSAKVGLGLVLKP  276



>ref|XP_010256458.1| PREDICTED: mitochondrial outer membrane protein porin of 36 kDa-like 
[Nelumbo nucifera]
Length=276

 Score =   455 bits (1170),  Expect = 9e-157, Method: Compositional matrix adjust.
 Identities = 217/276 (79%), Positives = 252/276 (91%), Gaps = 0/276 (0%)
 Frame = +2

Query  71   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  250
            M KGPGLY+DIGKKARDLLY+DYQ+DHKFT+TTY+ TGV +TSTG KKG+LFL D+NTQL
Sbjct  1    MVKGPGLYSDIGKKARDLLYKDYQSDHKFTLTTYTSTGVAVTSTGIKKGELFLADINTQL  60

Query  251  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  430
            KNKNITTD KVDTNSNVFTTITVDE APGLK I SF+VPDQRSGK ELQYLHD+AGIS S
Sbjct  61   KNKNITTDIKVDTNSNVFTTITVDEPAPGLKTILSFKVPDQRSGKAELQYLHDYAGISAS  120

Query  431  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  610
            +GLTANPIVNFSGVVGT+A ++GTD+SFDT SG FTK+NAG S +N+DLIASLTLNDKGD
Sbjct  121  IGLTANPIVNFSGVVGTSAASVGTDLSFDTASGNFTKFNAGASLSNADLIASLTLNDKGD  180

Query  611  SLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTITVGTQHQLDPLTTVKARVNNFGRANAL  790
            +L+ASYYH V+PL++TAVGAE+  +FSSN NT+T GTQH LDPLTTVKAR+NN+G+A+AL
Sbjct  181  TLTASYYHIVSPLTHTAVGAELTRTFSSNDNTLTFGTQHALDPLTTVKARLNNYGKASAL  240

Query  791  IQHEWRPKSLITLSGEVDVKAVDKSAKFGLALALKP  898
            IQHEWRPKSL+T+SGEVD +A++KSAK GLALALKP
Sbjct  241  IQHEWRPKSLLTISGEVDTRAIEKSAKVGLALALKP  276



>ref|XP_003552508.1| PREDICTED: outer plastidial membrane protein porin-like isoform 
1 [Glycine max]
 gb|KHN13654.1| Outer plastidial membrane protein porin [Glycine soja]
Length=276

 Score =   455 bits (1170),  Expect = 9e-157, Method: Compositional matrix adjust.
 Identities = 217/276 (79%), Positives = 248/276 (90%), Gaps = 0/276 (0%)
 Frame = +2

Query  71   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  250
            M KGPGLY+DIGKKARDLL++DY +D KFTITTYSPTGV IT++G++K +LFL DVNTQL
Sbjct  1    MAKGPGLYSDIGKKARDLLFKDYHSDQKFTITTYSPTGVAITASGTRKSELFLADVNTQL  60

Query  251  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  430
            KNKNITTD KVDT+SN+FTTITV+E APGLK I SF+VPDQRSGKVE+QYLHD+AGISTS
Sbjct  61   KNKNITTDIKVDTDSNLFTTITVNEPAPGLKAIFSFKVPDQRSGKVEVQYLHDYAGISTS  120

Query  431  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  610
            VGLTANPIVNFSGV+GTN LALG D+SFD+K G  TK NAGLSFT  DLIASLTLNDKGD
Sbjct  121  VGLTANPIVNFSGVIGTNVLALGADLSFDSKIGELTKSNAGLSFTKDDLIASLTLNDKGD  180

Query  611  SLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTITVGTQHQLDPLTTVKARVNNFGRANAL  790
            +L+A+YYH VNPL+NTAVGAEV H FS+N NT+T+GTQHQLDPLTT+KARVNNFGR +AL
Sbjct  181  ALNAAYYHVVNPLTNTAVGAEVTHRFSTNENTLTLGTQHQLDPLTTLKARVNNFGRTSAL  240

Query  791  IQHEWRPKSLITLSGEVDVKAVDKSAKFGLALALKP  898
            IQHEWRPKS  T+SGEVD KA++KSAK GL+L LKP
Sbjct  241  IQHEWRPKSFFTISGEVDTKAIEKSAKVGLSLVLKP  276



>ref|XP_002276636.1| PREDICTED: mitochondrial outer membrane protein porin of 36 kDa 
[Vitis vinifera]
Length=276

 Score =   455 bits (1170),  Expect = 9e-157, Method: Compositional matrix adjust.
 Identities = 216/276 (78%), Positives = 250/276 (91%), Gaps = 0/276 (0%)
 Frame = +2

Query  71   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  250
            MGKGPGLY+DIGK ARDLLYRDYQ+DHKFT+TTY+ +GV ITS+G+KKG+LF+ DVNTQL
Sbjct  1    MGKGPGLYSDIGKIARDLLYRDYQSDHKFTVTTYTSSGVAITSSGTKKGELFIADVNTQL  60

Query  251  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  430
            KNKNITTD KVDTNSN+FTTITVDE APGLK I SF +PDQRSGKVELQYLH++AGISTS
Sbjct  61   KNKNITTDVKVDTNSNLFTTITVDEPAPGLKTIFSFIIPDQRSGKVELQYLHEYAGISTS  120

Query  431  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  610
            +GLTANPIVNFSGVVG N L+LGTD+SFDT +G FTK NAGL F+N+DLIA+LTLNDKGD
Sbjct  121  IGLTANPIVNFSGVVGNNTLSLGTDLSFDTATGNFTKCNAGLGFSNADLIAALTLNDKGD  180

Query  611  SLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTITVGTQHQLDPLTTVKARVNNFGRANAL  790
            +L+ASYYH V+PL+NTAVGAE++H FS+N NT+T+GTQH LDPLT VKAR NN G+ +AL
Sbjct  181  TLNASYYHTVSPLTNTAVGAELSHCFSTNENTLTIGTQHALDPLTKVKARANNSGKVSAL  240

Query  791  IQHEWRPKSLITLSGEVDVKAVDKSAKFGLALALKP  898
            IQHEWRPKSL T+SGEVD +AV+KSAK GLALALKP
Sbjct  241  IQHEWRPKSLFTISGEVDARAVEKSAKIGLALALKP  276



>gb|KHN11584.1| Outer plastidial membrane protein porin [Glycine soja]
Length=276

 Score =   454 bits (1168),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 217/276 (79%), Positives = 247/276 (89%), Gaps = 0/276 (0%)
 Frame = +2

Query  71   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  250
            M KGPGLY+DIGKKARDLL++DY +D KFTITTYSPTGV IT++G++K +LF+ DVNTQL
Sbjct  1    MAKGPGLYSDIGKKARDLLFKDYHSDQKFTITTYSPTGVAITASGTRKSELFVADVNTQL  60

Query  251  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  430
            KNKNITTD KVDT+SN+FTTITV+E APGLK I SF+VPDQRSGKVE+QYLHD+AGISTS
Sbjct  61   KNKNITTDIKVDTDSNLFTTITVNEPAPGLKAIFSFKVPDQRSGKVEVQYLHDYAGISTS  120

Query  431  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  610
            VGLTANPIVNFSGV+GTN LALG D+SFDTK G  TK NAGLSFT  DLIASLTLNDKGD
Sbjct  121  VGLTANPIVNFSGVIGTNVLALGADLSFDTKIGELTKSNAGLSFTKDDLIASLTLNDKGD  180

Query  611  SLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTITVGTQHQLDPLTTVKARVNNFGRANAL  790
            +L+A+YYH VNPL+NTAVGAEV H FS+N NT+T+GTQHQLDPLTT+KARVNNFGR +AL
Sbjct  181  ALNAAYYHVVNPLTNTAVGAEVTHRFSTNENTLTLGTQHQLDPLTTLKARVNNFGRTSAL  240

Query  791  IQHEWRPKSLITLSGEVDVKAVDKSAKFGLALALKP  898
            IQHEWRPKS  T+SGEVD KA++KSAK GL L LKP
Sbjct  241  IQHEWRPKSFFTISGEVDTKAIEKSAKVGLGLVLKP  276



>emb|CDP00288.1| unnamed protein product [Coffea canephora]
Length=276

 Score =   454 bits (1168),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 217/276 (79%), Positives = 248/276 (90%), Gaps = 0/276 (0%)
 Frame = +2

Query  71   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  250
            M KGPGLY+DIGK+ARDLLY+DYQ DHKFT+TTY+  GV ITS+G KKG+LFL DVNTQL
Sbjct  1    MVKGPGLYSDIGKRARDLLYKDYQGDHKFTVTTYTANGVAITSSGIKKGELFLADVNTQL  60

Query  251  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  430
            KNKNITTD KVDTNS VFTTITVDE APGLK I SF VPDQRSGKVELQYLH++AGIST 
Sbjct  61   KNKNITTDVKVDTNSKVFTTITVDEPAPGLKTIISFVVPDQRSGKVELQYLHEYAGISTG  120

Query  431  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  610
            +GLTANPIVNFSGV G + LALG D+SFDT +G FTKYNAG SFTNSDLIA+LTLNDKGD
Sbjct  121  IGLTANPIVNFSGVAGNDKLALGADLSFDTATGNFTKYNAGFSFTNSDLIAALTLNDKGD  180

Query  611  SLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTITVGTQHQLDPLTTVKARVNNFGRANAL  790
            +L+ASYYH V+PL+NTAVGAE++H FSSN NT+T+GTQH LDPLTT+KARVNN+G+A+AL
Sbjct  181  TLTASYYHSVSPLTNTAVGAELSHGFSSNENTLTIGTQHSLDPLTTLKARVNNYGKASAL  240

Query  791  IQHEWRPKSLITLSGEVDVKAVDKSAKFGLALALKP  898
            IQHEWRPKSL T+SGEVD +A++KSAK GLA+ALKP
Sbjct  241  IQHEWRPKSLFTISGEVDTRAIEKSAKIGLAVALKP  276



>gb|AFK40985.1| unknown [Lotus japonicus]
Length=276

 Score =   454 bits (1167),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 218/276 (79%), Positives = 247/276 (89%), Gaps = 0/276 (0%)
 Frame = +2

Query  71   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  250
            M KGPGLYTDIGK+ARDLL++DY +D KFTITTYSPTGV ITS+G +KG+LF+ DVNTQL
Sbjct  1    MAKGPGLYTDIGKRARDLLFKDYHSDQKFTITTYSPTGVAITSSGIEKGELFVADVNTQL  60

Query  251  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  430
            KNKNITTD KVDT+SN+FTT+TVDE APGLK I SFRVPDQRSGKVELQYLHD+AGISTS
Sbjct  61   KNKNITTDLKVDTDSNLFTTVTVDEPAPGLKAIFSFRVPDQRSGKVELQYLHDYAGISTS  120

Query  431  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  610
            VGLT NPIVNFSGVVGTNA A+GTD+SFDTK G  TK+NAGL+FT +DLIASLT+NDKGD
Sbjct  121  VGLTPNPIVNFSGVVGTNARAVGTDLSFDTKIGELTKFNAGLNFTKADLIASLTVNDKGD  180

Query  611  SLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTITVGTQHQLDPLTTVKARVNNFGRANAL  790
            +L+ASYYH VNPL+NTA GAEV H FS+N NT+T+GTQH LDPLT+VKARVNN G+ANAL
Sbjct  181  ALNASYYHIVNPLTNTAFGAEVTHRFSTNENTLTLGTQHALDPLTSVKARVNNLGKANAL  240

Query  791  IQHEWRPKSLITLSGEVDVKAVDKSAKFGLALALKP  898
            IQHEWR KS  T+SGEVD KA++KSAK GL LALKP
Sbjct  241  IQHEWRAKSFFTISGEVDTKAIEKSAKIGLGLALKP  276



>ref|XP_010096343.1| Mitochondrial outer membrane protein porin of 36 kDa [Morus notabilis]
 gb|EXB63818.1| Mitochondrial outer membrane protein porin of 36 kDa [Morus notabilis]
Length=276

 Score =   453 bits (1166),  Expect = 4e-156, Method: Compositional matrix adjust.
 Identities = 219/276 (79%), Positives = 248/276 (90%), Gaps = 0/276 (0%)
 Frame = +2

Query  71   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  250
            M KGPGLY+DIGKKARDLLY+DYQ DHKFTITTY+  GV ITSTG KKG+LFL DV+TQL
Sbjct  1    MVKGPGLYSDIGKKARDLLYKDYQADHKFTITTYTSAGVAITSTGIKKGELFLADVSTQL  60

Query  251  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  430
            KNKNITTD KVDTNSN+ TTITVDE APGLK I SF VPDQRSGKVELQY H++AGISTS
Sbjct  61   KNKNITTDVKVDTNSNLLTTITVDEPAPGLKAIFSFIVPDQRSGKVELQYQHEYAGISTS  120

Query  431  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  610
            +GLTANP VNFSG VG N LA+GTD+SFDT +G FTK+NAGL+FT SDLIASLTLNDKGD
Sbjct  121  IGLTANPSVNFSGAVGNNTLAIGTDLSFDTATGNFTKFNAGLNFTRSDLIASLTLNDKGD  180

Query  611  SLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTITVGTQHQLDPLTTVKARVNNFGRANAL  790
            +L+ASYYH V+PL+NTAVGAE++HSFSSN NT+T+GTQH LDPLTT+KARVNN G+A+AL
Sbjct  181  ALTASYYHSVSPLTNTAVGAELSHSFSSNENTLTIGTQHALDPLTTLKARVNNSGKASAL  240

Query  791  IQHEWRPKSLITLSGEVDVKAVDKSAKFGLALALKP  898
            IQHEWRPKSL T+SGEVD +A++KSAK GLALALKP
Sbjct  241  IQHEWRPKSLFTISGEVDTRAIEKSAKIGLALALKP  276



>gb|AAQ87019.1| VDAC1.1 [Lotus japonicus]
 gb|AFK40743.1| unknown [Lotus japonicus]
Length=276

 Score =   453 bits (1165),  Expect = 5e-156, Method: Compositional matrix adjust.
 Identities = 216/276 (78%), Positives = 249/276 (90%), Gaps = 0/276 (0%)
 Frame = +2

Query  71   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  250
            M KGPGLYTDIGKKARDLL++DY +D KFTITT+SPTGV ITS+G+KKG+LF+ DVNTQL
Sbjct  1    MAKGPGLYTDIGKKARDLLFKDYHSDQKFTITTFSPTGVAITSSGTKKGELFVADVNTQL  60

Query  251  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  430
            KNKNITTD KVDT+SN+FTTI V++ APGLK I SF+VPDQRSGKVELQYLHD+AGIS+S
Sbjct  61   KNKNITTDIKVDTDSNLFTTIAVNDPAPGLKAIFSFKVPDQRSGKVELQYLHDYAGISSS  120

Query  431  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  610
            +GLTANPIVNFSGV+GTN LALG D++FDTK G  TK NAGLSFT  DLIA+LTLNDKGD
Sbjct  121  IGLTANPIVNFSGVIGTNVLALGADLTFDTKIGELTKSNAGLSFTKDDLIAALTLNDKGD  180

Query  611  SLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTITVGTQHQLDPLTTVKARVNNFGRANAL  790
            +L+ASYYH V+PL+NTAVGAEV H FS+N NT+T+GTQH LDPLTT+KARVNNFG+A+AL
Sbjct  181  ALNASYYHVVSPLTNTAVGAEVTHRFSTNENTLTLGTQHALDPLTTLKARVNNFGKASAL  240

Query  791  IQHEWRPKSLITLSGEVDVKAVDKSAKFGLALALKP  898
            IQHEWRPKS  T+SGEVD KA++KSAK GLALALKP
Sbjct  241  IQHEWRPKSFFTISGEVDTKAIEKSAKVGLALALKP  276



>ref|XP_011010796.1| PREDICTED: mitochondrial outer membrane protein porin of 36 kDa 
[Populus euphratica]
Length=276

 Score =   453 bits (1165),  Expect = 6e-156, Method: Compositional matrix adjust.
 Identities = 215/276 (78%), Positives = 253/276 (92%), Gaps = 0/276 (0%)
 Frame = +2

Query  71   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  250
            MGKGPGLY+DIGKKARDLLY+DYQ+DHKFT+TTY+ TGV ITSTG KKG+LFL D+++QL
Sbjct  1    MGKGPGLYSDIGKKARDLLYKDYQSDHKFTVTTYTSTGVAITSTGIKKGELFLADISSQL  60

Query  251  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  430
            KNKNITTD KVDTNSN+ TTITVDE APGLK I SF+VPDQRSGKVELQY H++AGISTS
Sbjct  61   KNKNITTDVKVDTNSNLLTTITVDEPAPGLKTIFSFKVPDQRSGKVELQYQHEYAGISTS  120

Query  431  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  610
            +GLTANPIVNFSGVVG+N +ALGTD+SFDT +G FTK NAGLS+TNSDLIASLT+NDKGD
Sbjct  121  LGLTANPIVNFSGVVGSNVVALGTDLSFDTATGNFTKCNAGLSYTNSDLIASLTVNDKGD  180

Query  611  SLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTITVGTQHQLDPLTTVKARVNNFGRANAL  790
            +LSASYYH V+PL++TAVGAE+ HSFS+N N +T+GTQH LDPLTTVKAR+NN+G+ +AL
Sbjct  181  TLSASYYHTVSPLTSTAVGAELTHSFSNNENILTIGTQHALDPLTTVKARLNNYGKGSAL  240

Query  791  IQHEWRPKSLITLSGEVDVKAVDKSAKFGLALALKP  898
            IQ+EWRPK+L T+SGEVD KA++KSAK GLAL+LKP
Sbjct  241  IQNEWRPKALFTISGEVDTKAIEKSAKVGLALSLKP  276



>ref|XP_006438620.1| hypothetical protein CICLE_v10032366mg [Citrus clementina]
 gb|ESR51860.1| hypothetical protein CICLE_v10032366mg [Citrus clementina]
Length=276

 Score =   453 bits (1165),  Expect = 6e-156, Method: Compositional matrix adjust.
 Identities = 217/276 (79%), Positives = 251/276 (91%), Gaps = 0/276 (0%)
 Frame = +2

Query  71   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  250
            M KGPGLY++IGKKARDLLY+DYQ+DHKFT+TTY+  GV ITS+G KKG+LFL DV+TQL
Sbjct  1    MVKGPGLYSEIGKKARDLLYKDYQSDHKFTVTTYTSAGVAITSSGVKKGELFLADVSTQL  60

Query  251  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  430
            KNKNITTD KVDTNSN+FTTITVDE APGLK I SF VPDQRSGKVELQY H++AGIST 
Sbjct  61   KNKNITTDVKVDTNSNLFTTITVDEPAPGLKSIFSFIVPDQRSGKVELQYQHEYAGISTG  120

Query  431  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  610
            +G TANPIVNFSGVVG N++ALGTD+SFDT +G FTK NAGLS+T++DLIASLTLNDKGD
Sbjct  121  IGFTANPIVNFSGVVGNNSVALGTDLSFDTATGNFTKCNAGLSYTHTDLIASLTLNDKGD  180

Query  611  SLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTITVGTQHQLDPLTTVKARVNNFGRANAL  790
            +L+ASYYH V+PL+NTAVGAE+ HSFSSN NT+T+GTQH LDPLT+VKARVNN+GRA+AL
Sbjct  181  TLNASYYHIVSPLTNTAVGAELTHSFSSNENTLTIGTQHALDPLTSVKARVNNYGRASAL  240

Query  791  IQHEWRPKSLITLSGEVDVKAVDKSAKFGLALALKP  898
            IQHEWRPKSL T+SGEVD +A++KSAK GLALALKP
Sbjct  241  IQHEWRPKSLFTISGEVDTRAIEKSAKIGLALALKP  276



>gb|ACU20122.1| unknown [Glycine max]
Length=276

 Score =   452 bits (1163),  Expect = 1e-155, Method: Compositional matrix adjust.
 Identities = 216/276 (78%), Positives = 247/276 (89%), Gaps = 0/276 (0%)
 Frame = +2

Query  71   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  250
            M KGPGLY+DIGKKARDLL++DY +D KFTITTYSPTGV IT++G++K +LF+ DVNTQL
Sbjct  1    MAKGPGLYSDIGKKARDLLFKDYHSDQKFTITTYSPTGVAITASGTRKSELFVADVNTQL  60

Query  251  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  430
            KNKNITTD KVDT+SN+FTTITV+E APGLK I SF+VPDQRSGKVE+QYLHD+AGISTS
Sbjct  61   KNKNITTDIKVDTDSNLFTTITVNEPAPGLKAIFSFKVPDQRSGKVEVQYLHDYAGISTS  120

Query  431  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  610
            VGLTANPIVNFSGV+GTN LALG D+SFDTK G  TK NAGLSFT  DLIASLTLNDKGD
Sbjct  121  VGLTANPIVNFSGVIGTNVLALGADLSFDTKIGELTKSNAGLSFTKDDLIASLTLNDKGD  180

Query  611  SLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTITVGTQHQLDPLTTVKARVNNFGRANAL  790
            +L+A+YYH VNPL+NTAVGAEV H FS+N NT+T+GTQHQLDPLTT+KARVNNFGR +AL
Sbjct  181  ALNAAYYHVVNPLTNTAVGAEVTHRFSTNENTLTLGTQHQLDPLTTLKARVNNFGRTSAL  240

Query  791  IQHEWRPKSLITLSGEVDVKAVDKSAKFGLALALKP  898
            IQH+WRPKS  T+SGEVD KA++KSAK GL L LKP
Sbjct  241  IQHKWRPKSFFTISGEVDTKAIEKSAKVGLGLVLKP  276



>ref|XP_009772199.1| PREDICTED: mitochondrial outer membrane protein porin of 36 kDa 
[Nicotiana sylvestris]
 dbj|BAF95071.1| voltage-dependent anion channel [Nicotiana tabacum]
Length=276

 Score =   452 bits (1163),  Expect = 1e-155, Method: Compositional matrix adjust.
 Identities = 217/276 (79%), Positives = 248/276 (90%), Gaps = 0/276 (0%)
 Frame = +2

Query  71   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  250
            M KGPGLY+DIGKKARDLLYRDY +DHKFT+TTYS TGV ITS+G KKG+LFL DVNTQL
Sbjct  1    MVKGPGLYSDIGKKARDLLYRDYVSDHKFTVTTYSSTGVAITSSGLKKGELFLADVNTQL  60

Query  251  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  430
            KNKN+TTD KVDTNSNV+TTITVDE APGLK I SF +PDQRSGKVELQYLH++AGIST 
Sbjct  61   KNKNVTTDVKVDTNSNVYTTITVDEPAPGLKTIVSFVLPDQRSGKVELQYLHEYAGISTG  120

Query  431  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  610
            +GLTA+P+VNFSGV G N +ALGTD+SFDT SG FTK NAGLSF+ SDLIASL LNDKGD
Sbjct  121  IGLTASPLVNFSGVAGNNTVALGTDLSFDTASGNFTKCNAGLSFSTSDLIASLALNDKGD  180

Query  611  SLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTITVGTQHQLDPLTTVKARVNNFGRANAL  790
            +LSASYYH V P++NTAVGAE+ HSFSSN NT+T+GTQH LDPLTTVKARVN++G+A+AL
Sbjct  181  TLSASYYHTVKPVTNTAVGAELTHSFSSNENTLTIGTQHLLDPLTTVKARVNSYGKASAL  240

Query  791  IQHEWRPKSLITLSGEVDVKAVDKSAKFGLALALKP  898
            IQHEWRPKSL T+SGEVD +A++KSAK GLA+ALKP
Sbjct  241  IQHEWRPKSLFTISGEVDTRAIEKSAKIGLAVALKP  276



>ref|XP_006378154.1| porin family protein [Populus trichocarpa]
 gb|ABK92505.1| unknown [Populus trichocarpa]
 gb|ERP55951.1| porin family protein [Populus trichocarpa]
Length=276

 Score =   452 bits (1163),  Expect = 1e-155, Method: Compositional matrix adjust.
 Identities = 215/276 (78%), Positives = 251/276 (91%), Gaps = 0/276 (0%)
 Frame = +2

Query  71   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  250
            MGKGPGLY DIGKKARDLLY+DYQ+DHKFT+TTY+  GV ITSTG KKG+LFL D+++QL
Sbjct  1    MGKGPGLYFDIGKKARDLLYKDYQSDHKFTVTTYTSAGVAITSTGIKKGELFLADISSQL  60

Query  251  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  430
            KNKNITTD KVDTNSN+ TTIT+DE APGLK I SF+VPDQRSGKVELQY H++AGISTS
Sbjct  61   KNKNITTDVKVDTNSNLLTTITIDEPAPGLKTIFSFKVPDQRSGKVELQYQHEYAGISTS  120

Query  431  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  610
            +GLTANPIVNFSGVVG+N +ALGTD+SFDT +G FTK NAGLS+TNSDLIASLT+NDKGD
Sbjct  121  LGLTANPIVNFSGVVGSNVVALGTDLSFDTATGNFTKCNAGLSYTNSDLIASLTVNDKGD  180

Query  611  SLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTITVGTQHQLDPLTTVKARVNNFGRANAL  790
            +LSASYYH V+PL++TAVGAE+ HSFSSN N +T+GTQH LDPLTTVKAR+NN+G+ +AL
Sbjct  181  TLSASYYHTVSPLTSTAVGAELTHSFSSNENILTIGTQHALDPLTTVKARLNNYGKVSAL  240

Query  791  IQHEWRPKSLITLSGEVDVKAVDKSAKFGLALALKP  898
            IQ+EWRPKSL T+SGEVD KA++KSAK GLAL+LKP
Sbjct  241  IQNEWRPKSLFTISGEVDTKAIEKSAKVGLALSLKP  276



>ref|XP_008456460.1| PREDICTED: mitochondrial outer membrane protein porin of 36 kDa-like 
[Cucumis melo]
Length=276

 Score =   451 bits (1161),  Expect = 2e-155, Method: Compositional matrix adjust.
 Identities = 215/276 (78%), Positives = 250/276 (91%), Gaps = 0/276 (0%)
 Frame = +2

Query  71   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  250
            MGKGPGLY+DIGKKARDLLY+DYQ+DHKFT+TTY+  GV I+STG KKGD+FL DV+TQL
Sbjct  1    MGKGPGLYSDIGKKARDLLYKDYQSDHKFTVTTYTAGGVAISSTGVKKGDIFLADVSTQL  60

Query  251  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  430
            KN NITTD KVDT+SNV TT+T+DE APGLK I SFRVPDQRSGKVELQY H++AGIST 
Sbjct  61   KNNNITTDVKVDTHSNVHTTVTIDEPAPGLKTIFSFRVPDQRSGKVELQYQHEYAGISTG  120

Query  431  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  610
            +GLTA+PIVNF+GV+G   L+LGTD+SFDT SG  TK NAGLS+T+SDLIA+LTLNDKGD
Sbjct  121  IGLTASPIVNFAGVIGNEKLSLGTDLSFDTASGNITKLNAGLSYTHSDLIAALTLNDKGD  180

Query  611  SLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTITVGTQHQLDPLTTVKARVNNFGRANAL  790
            +L+ASYYH V+PLSNTAVGAE++HSFSSN NT+T+GTQH LDPLT+VKARVNN+GRA+AL
Sbjct  181  ALTASYYHLVSPLSNTAVGAELSHSFSSNENTLTIGTQHALDPLTSVKARVNNYGRASAL  240

Query  791  IQHEWRPKSLITLSGEVDVKAVDKSAKFGLALALKP  898
            IQHEWRPKSL T+SGEVD +A+DKSAK GLALALKP
Sbjct  241  IQHEWRPKSLFTISGEVDTRAIDKSAKIGLALALKP  276



>ref|XP_006483230.1| PREDICTED: mitochondrial outer membrane protein porin of 36 kDa-like 
[Citrus sinensis]
Length=276

 Score =   451 bits (1161),  Expect = 2e-155, Method: Compositional matrix adjust.
 Identities = 217/276 (79%), Positives = 250/276 (91%), Gaps = 0/276 (0%)
 Frame = +2

Query  71   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  250
            M KGPGLY++IGKKARDLLY+DYQ+DHKFT+TTY+  GV ITS+G KKG+LFL DV+TQL
Sbjct  1    MVKGPGLYSEIGKKARDLLYKDYQSDHKFTVTTYTSAGVAITSSGVKKGELFLADVSTQL  60

Query  251  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  430
            KNKNITTD KVDTNSN+FTTITVDE APGLK I SF VPDQRSGKVELQY H++AGIST 
Sbjct  61   KNKNITTDVKVDTNSNLFTTITVDEPAPGLKSIFSFIVPDQRSGKVELQYQHEYAGISTG  120

Query  431  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  610
            +G TANPIVNFSGVVG N++ALGTD+SFDT +G FTK NAGLS+T+ DLIASLTLNDKGD
Sbjct  121  IGFTANPIVNFSGVVGNNSVALGTDLSFDTATGNFTKCNAGLSYTHIDLIASLTLNDKGD  180

Query  611  SLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTITVGTQHQLDPLTTVKARVNNFGRANAL  790
            +L+ASYYH V+PL+NTAVGAE+ HSFSSN NT+T+GTQH LDPLT+VKARVNN+GRA+AL
Sbjct  181  TLNASYYHIVSPLTNTAVGAELTHSFSSNENTLTIGTQHALDPLTSVKARVNNYGRASAL  240

Query  791  IQHEWRPKSLITLSGEVDVKAVDKSAKFGLALALKP  898
            IQHEWRPKSL T+SGEVD +A++KSAK GLALALKP
Sbjct  241  IQHEWRPKSLFTISGEVDTRAIEKSAKIGLALALKP  276



>gb|KJB11404.1| hypothetical protein B456_001G256800 [Gossypium raimondii]
Length=275

 Score =   451 bits (1160),  Expect = 3e-155, Method: Compositional matrix adjust.
 Identities = 219/276 (79%), Positives = 248/276 (90%), Gaps = 1/276 (0%)
 Frame = +2

Query  71   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  250
            MGKGPGLYT+IGKKARDLLY+DYQTD KFT+TT SPTG  ITS G+KKGDLFL DVNTQL
Sbjct  1    MGKGPGLYTEIGKKARDLLYKDYQTDQKFTLTTSSPTGA-ITSAGTKKGDLFLADVNTQL  59

Query  251  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  430
            K++N+TTD KVDT+SN+FTTITVDE APGLK I  FRVPDQRSGK+ELQYLH++AGIS+S
Sbjct  60   KSRNVTTDIKVDTSSNLFTTITVDEPAPGLKAIFGFRVPDQRSGKIELQYLHEYAGISSS  119

Query  431  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  610
            +GLTANPIVNFSGV+GTN LALGTD+SFDTK+G FTK NAG SFTN+DLIASL LN+KGD
Sbjct  120  IGLTANPIVNFSGVLGTNVLALGTDISFDTKTGNFTKCNAGFSFTNADLIASLALNEKGD  179

Query  611  SLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTITVGTQHQLDPLTTVKARVNNFGRANAL  790
            S++ASYYH VN  +NT VGAEV HSFS+NVNTITVGTQH LDP TT+KARVNN G+A+AL
Sbjct  180  SVNASYYHIVNLSTNTVVGAEVTHSFSTNVNTITVGTQHALDPSTTIKARVNNAGKASAL  239

Query  791  IQHEWRPKSLITLSGEVDVKAVDKSAKFGLALALKP  898
            IQHEWRPKSL T+SGEVD K++DKS K GLALALKP
Sbjct  240  IQHEWRPKSLFTISGEVDTKSIDKSPKVGLALALKP  275



>gb|ACU24178.1| unknown [Glycine max]
Length=276

 Score =   451 bits (1160),  Expect = 3e-155, Method: Compositional matrix adjust.
 Identities = 215/276 (78%), Positives = 246/276 (89%), Gaps = 0/276 (0%)
 Frame = +2

Query  71   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  250
            M KGPGLY+DIGKKARDLL++DY +D KFTITTYSPTGV IT++G++K +LFL DVNTQL
Sbjct  1    MAKGPGLYSDIGKKARDLLFKDYHSDQKFTITTYSPTGVAITASGTRKSELFLADVNTQL  60

Query  251  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  430
            KNKNITTD KVDT+SN+FTTITV+E APGLK I SF+VPDQRSGKVE+QYLHD+AGISTS
Sbjct  61   KNKNITTDIKVDTDSNLFTTITVNEPAPGLKAIFSFKVPDQRSGKVEVQYLHDYAGISTS  120

Query  431  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  610
            VGLTANPIVNFSGV+GTN LALG D+SFD+K G  TK NAGLSFT  DLIASL LNDKGD
Sbjct  121  VGLTANPIVNFSGVIGTNVLALGADLSFDSKIGELTKSNAGLSFTKDDLIASLALNDKGD  180

Query  611  SLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTITVGTQHQLDPLTTVKARVNNFGRANAL  790
            +L+A+YYH VNPL+NTAVGAEV H FS+N NT+T+GTQHQLDPLTT+KARVNNFGR +AL
Sbjct  181  ALNAAYYHVVNPLTNTAVGAEVTHRFSTNENTLTLGTQHQLDPLTTLKARVNNFGRTSAL  240

Query  791  IQHEWRPKSLITLSGEVDVKAVDKSAKFGLALALKP  898
            IQHEWRPKS  T+ GEVD KA++KSAK GL+L LKP
Sbjct  241  IQHEWRPKSFFTIFGEVDTKAIEKSAKVGLSLVLKP  276



>ref|XP_007139603.1| hypothetical protein PHAVU_008G043800g [Phaseolus vulgaris]
 gb|ESW11597.1| hypothetical protein PHAVU_008G043800g [Phaseolus vulgaris]
Length=276

 Score =   450 bits (1158),  Expect = 6e-155, Method: Compositional matrix adjust.
 Identities = 216/276 (78%), Positives = 246/276 (89%), Gaps = 0/276 (0%)
 Frame = +2

Query  71   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  250
            M KGPGLYTDIGKKARDLL++DY +D KFT+TTYSPTGV ITS+G++KG+LF+ DVNTQL
Sbjct  1    MAKGPGLYTDIGKKARDLLFKDYHSDQKFTVTTYSPTGVAITSSGTRKGELFVADVNTQL  60

Query  251  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  430
            KNKNITTD KVDT+SN+FTTITV+E APGLK I +F+VPDQRSGKVELQYLHD+AGISTS
Sbjct  61   KNKNITTDIKVDTDSNLFTTITVNEPAPGLKAIFNFKVPDQRSGKVELQYLHDYAGISTS  120

Query  431  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  610
            VGLTANPIVNFSGVVGTN LALG D+SFDTK G  TK NAGLSFT  DLIASLTLNDKGD
Sbjct  121  VGLTANPIVNFSGVVGTNILALGADLSFDTKIGELTKSNAGLSFTKDDLIASLTLNDKGD  180

Query  611  SLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTITVGTQHQLDPLTTVKARVNNFGRANAL  790
            +L+A+YYH VNPL+NTAVGAEV H FS+N NT+ +GTQH LDPLTT+KARV NFG+ +AL
Sbjct  181  ALNAAYYHVVNPLTNTAVGAEVTHRFSTNENTLILGTQHALDPLTTLKARVTNFGKTSAL  240

Query  791  IQHEWRPKSLITLSGEVDVKAVDKSAKFGLALALKP  898
            IQHEWRPKS  T+SGEVD KA++KSAK GL+L LKP
Sbjct  241  IQHEWRPKSFFTISGEVDTKAIEKSAKVGLSLVLKP  276



>ref|XP_010683253.1| PREDICTED: mitochondrial outer membrane protein porin of 36 kDa 
[Beta vulgaris subsp. vulgaris]
Length=276

 Score =   450 bits (1158),  Expect = 7e-155, Method: Compositional matrix adjust.
 Identities = 215/276 (78%), Positives = 250/276 (91%), Gaps = 0/276 (0%)
 Frame = +2

Query  71   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  250
            M KGPGLY+DIGK+ARDLLYRDYQ+DHKFT+TT++  GV ITSTG+KKG+LFL DV+T+L
Sbjct  1    MVKGPGLYSDIGKRARDLLYRDYQSDHKFTLTTFTSNGVAITSTGTKKGELFLADVSTKL  60

Query  251  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  430
             NKNITTD KVDTNSN+FTTITVDE APGLK I SFRVPDQRSGKVELQYLH++AGISTS
Sbjct  61   TNKNITTDVKVDTNSNLFTTITVDEPAPGLKAIFSFRVPDQRSGKVELQYLHEYAGISTS  120

Query  431  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  610
            +GLTANPIVNFSGV+G + LALGTD+SFDT SG FTK NAGL+FTN+DLIASL +NDK D
Sbjct  121  LGLTANPIVNFSGVIGNSTLALGTDLSFDTASGNFTKCNAGLNFTNTDLIASLNVNDKAD  180

Query  611  SLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTITVGTQHQLDPLTTVKARVNNFGRANAL  790
             L+ASYYH V+PL+NTAVGAE++HSFSSN NT+T+GTQH LDPLT+VKARVNN+G+A+AL
Sbjct  181  ILNASYYHIVSPLTNTAVGAELSHSFSSNENTLTIGTQHALDPLTSVKARVNNYGKASAL  240

Query  791  IQHEWRPKSLITLSGEVDVKAVDKSAKFGLALALKP  898
            IQHEWRPKS +T+SGEVD  A++KSAK GLAL LKP
Sbjct  241  IQHEWRPKSTVTISGEVDTSAIEKSAKLGLALVLKP  276



>ref|XP_010242364.1| PREDICTED: mitochondrial outer membrane protein porin of 36 kDa 
[Nelumbo nucifera]
Length=276

 Score =   450 bits (1157),  Expect = 8e-155, Method: Compositional matrix adjust.
 Identities = 215/276 (78%), Positives = 247/276 (89%), Gaps = 0/276 (0%)
 Frame = +2

Query  71   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  250
            M KGPGLY+DIGKKARDLLY+DYQ DHKFT+TT++  GV ITSTG KKG+LFL DVNTQL
Sbjct  1    MVKGPGLYSDIGKKARDLLYKDYQNDHKFTLTTFTSAGVAITSTGLKKGELFLADVNTQL  60

Query  251  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  430
            KNKNITTD KVDTNSNVFTTITV+E APGLK I SF VPDQ+SGK ELQYLHDHAGISTS
Sbjct  61   KNKNITTDVKVDTNSNVFTTITVNEPAPGLKTIVSFVVPDQKSGKAELQYLHDHAGISTS  120

Query  431  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  610
            +GLTA+PIVNFSGVVGT+A ++GTD+SFDT +G F KYNAGLSF+N+DLIASLTLNDKGD
Sbjct  121  IGLTASPIVNFSGVVGTSAASIGTDLSFDTSTGKFVKYNAGLSFSNADLIASLTLNDKGD  180

Query  611  SLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTITVGTQHQLDPLTTVKARVNNFGRANAL  790
             L+ASYYH V+PL+NTAVGAE+   FSS  NT+T+GTQH LDPLT VKAR+N++G+A+AL
Sbjct  181  KLTASYYHTVSPLTNTAVGAEMTRIFSSKENTLTIGTQHALDPLTMVKARLNSYGKASAL  240

Query  791  IQHEWRPKSLITLSGEVDVKAVDKSAKFGLALALKP  898
            IQHEWRPKSL T+SGEVD +A++KSAK GLALALKP
Sbjct  241  IQHEWRPKSLFTISGEVDTRAIEKSAKVGLALALKP  276



>gb|AFK39621.1| unknown [Lotus japonicus]
Length=276

 Score =   450 bits (1157),  Expect = 1e-154, Method: Compositional matrix adjust.
 Identities = 214/276 (78%), Positives = 248/276 (90%), Gaps = 0/276 (0%)
 Frame = +2

Query  71   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  250
            M KGPGLYTDIGKKARDLL++DY +D KFTITT+SPTGV ITS+G+KKG+LF+ DVNTQL
Sbjct  1    MAKGPGLYTDIGKKARDLLFKDYHSDQKFTITTFSPTGVAITSSGTKKGELFVADVNTQL  60

Query  251  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  430
            KNKNITTD KVDT+SN+FTTI V++ APGLK I SF+VPDQRSGKVELQYLHD+AGIS+S
Sbjct  61   KNKNITTDIKVDTDSNLFTTIAVNDPAPGLKAIFSFKVPDQRSGKVELQYLHDYAGISSS  120

Query  431  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  610
            +GLTANPIVNFSGV+GTN LALG D++FDTK G  TK NAGL FT  DLIA+LTLND+GD
Sbjct  121  IGLTANPIVNFSGVIGTNVLALGADLTFDTKIGGLTKSNAGLGFTKDDLIAALTLNDRGD  180

Query  611  SLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTITVGTQHQLDPLTTVKARVNNFGRANAL  790
            +L+ASYYH V+PL+NTAVGAEV H FS+N NT+T+GTQH LDPLTT+KARVNNFG+A+AL
Sbjct  181  ALNASYYHVVSPLTNTAVGAEVTHRFSTNENTLTLGTQHALDPLTTLKARVNNFGKASAL  240

Query  791  IQHEWRPKSLITLSGEVDVKAVDKSAKFGLALALKP  898
            IQHEWRPKS  T+SGEVD KA++KSAK GLALALKP
Sbjct  241  IQHEWRPKSFFTISGEVDTKAIEKSAKVGLALALKP  276



>ref|XP_010033217.1| PREDICTED: mitochondrial outer membrane protein porin of 34 kDa-like 
[Eucalyptus grandis]
 gb|KCW52798.1| hypothetical protein EUGRSUZ_J02133 [Eucalyptus grandis]
Length=276

 Score =   449 bits (1155),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 214/276 (78%), Positives = 249/276 (90%), Gaps = 0/276 (0%)
 Frame = +2

Query  71   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  250
            MGKGPGLY+DIGKKA+DLLY+DYQ+DHKFTITT S TGV ITS  +KKG+LFL DVNTQL
Sbjct  1    MGKGPGLYSDIGKKAKDLLYKDYQSDHKFTITTSSVTGVTITSAATKKGELFLADVNTQL  60

Query  251  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  430
            KNKN+TTD KVDTNSN+ T ITVDE  PGLK I SF VPDQRSG++ELQYLHD+AGISTS
Sbjct  61   KNKNVTTDVKVDTNSNLVTKITVDEPFPGLKTIFSFTVPDQRSGQIELQYLHDYAGISTS  120

Query  431  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  610
            VGLTANP+VNF+ V+G+N L+LGTDVSFD+K+  FTK NAG+SF+N+DLIASL LN+KGD
Sbjct  121  VGLTANPVVNFAAVLGSNVLSLGTDVSFDSKASNFTKCNAGISFSNADLIASLALNNKGD  180

Query  611  SLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTITVGTQHQLDPLTTVKARVNNFGRANAL  790
            SL+ASYYH VNP+++TA+GAEV HSFSSNVNTITVGTQH LDPLTT+KAR+NN G+A+AL
Sbjct  181  SLTASYYHIVNPVTSTAIGAEVTHSFSSNVNTITVGTQHALDPLTTLKARINNSGKASAL  240

Query  791  IQHEWRPKSLITLSGEVDVKAVDKSAKFGLALALKP  898
            IQHEWRP+SL T+SGEVD K++DKSAK GLALALKP
Sbjct  241  IQHEWRPRSLFTVSGEVDTKSIDKSAKVGLALALKP  276



>gb|KHG10147.1| Mitochondrial outer membrane porin of 34 kDa [Gossypium arboreum]
Length=271

 Score =   448 bits (1153),  Expect = 3e-154, Method: Compositional matrix adjust.
 Identities = 216/276 (78%), Positives = 246/276 (89%), Gaps = 5/276 (2%)
 Frame = +2

Query  71   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  250
            MGKGPGLYT+IGKKARDLLY+DYQTD KFT+TT SPTGV ITS G+KKGDLFL DVNTQL
Sbjct  1    MGKGPGLYTEIGKKARDLLYKDYQTDQKFTLTTSSPTGVAITSAGTKKGDLFLADVNTQL  60

Query  251  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  430
            K++N+TTD KVDT+SN      +DE APGLK I  FRVPDQRSGK+ELQYLH++AGIS+S
Sbjct  61   KSRNVTTDIKVDTSSNA-----IDEPAPGLKAIFGFRVPDQRSGKIELQYLHEYAGISSS  115

Query  431  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  610
            +GLTANPIVNFSGV+GTN LALGTD+SFDTK+G FTK NAG SFTN+DLIASL LN+KGD
Sbjct  116  IGLTANPIVNFSGVLGTNVLALGTDISFDTKTGNFTKCNAGFSFTNADLIASLALNEKGD  175

Query  611  SLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTITVGTQHQLDPLTTVKARVNNFGRANAL  790
            S++ASYYH VNP +NTAVGAEV HSFS+NVNTITVGTQH LDPLTT+KARVNN G+A+AL
Sbjct  176  SVNASYYHIVNPSTNTAVGAEVTHSFSTNVNTITVGTQHALDPLTTIKARVNNAGKASAL  235

Query  791  IQHEWRPKSLITLSGEVDVKAVDKSAKFGLALALKP  898
            IQHEWRPKSL ++SGEVD K++DKS K GLALALKP
Sbjct  236  IQHEWRPKSLFSISGEVDTKSIDKSPKVGLALALKP  271



>ref|XP_009627246.1| PREDICTED: mitochondrial outer membrane protein porin of 36 kDa 
[Nicotiana tomentosiformis]
Length=276

 Score =   448 bits (1153),  Expect = 3e-154, Method: Compositional matrix adjust.
 Identities = 215/276 (78%), Positives = 247/276 (89%), Gaps = 0/276 (0%)
 Frame = +2

Query  71   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  250
            M KGPGLY+DIGKKARDLLYRDY +DHKFT+TTYS TGV ITS+G KKG+LFL DVNTQL
Sbjct  1    MVKGPGLYSDIGKKARDLLYRDYVSDHKFTVTTYSSTGVAITSSGLKKGELFLADVNTQL  60

Query  251  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  430
            KNKN+TTD KVDTNSNV+TTITVDE APGLK I SF +PDQ+SGKVELQYLH++AGIST 
Sbjct  61   KNKNVTTDVKVDTNSNVYTTITVDEPAPGLKTIVSFVLPDQKSGKVELQYLHEYAGISTG  120

Query  431  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  610
            +GLTA+P+VNFSGV G N +ALGTD+SF+T SG FTK NAGLSF+ SDLIASL LNDKGD
Sbjct  121  IGLTASPLVNFSGVAGNNTVALGTDLSFNTASGNFTKCNAGLSFSTSDLIASLALNDKGD  180

Query  611  SLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTITVGTQHQLDPLTTVKARVNNFGRANAL  790
            +LSASYYH V P++NTAVGAE+ HSFSSN NT+T+GTQH LDPLTTVKARVN++G+A AL
Sbjct  181  TLSASYYHTVKPVTNTAVGAELTHSFSSNENTLTIGTQHLLDPLTTVKARVNSYGKACAL  240

Query  791  IQHEWRPKSLITLSGEVDVKAVDKSAKFGLALALKP  898
            IQHEWRPKSL T+SGEVD +A++KSAK GLA+ALKP
Sbjct  241  IQHEWRPKSLFTISGEVDTRAIEKSAKIGLAVALKP  276



>ref|XP_004146750.1| PREDICTED: mitochondrial outer membrane protein porin of 36 kDa 
[Cucumis sativus]
Length=276

 Score =   448 bits (1152),  Expect = 5e-154, Method: Compositional matrix adjust.
 Identities = 213/276 (77%), Positives = 250/276 (91%), Gaps = 0/276 (0%)
 Frame = +2

Query  71   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  250
            MGKGPGLY+DIGKKARDLLY+DYQ+DHKFT+TTY+  GV I+STG KKG++FL DV+TQL
Sbjct  1    MGKGPGLYSDIGKKARDLLYKDYQSDHKFTVTTYTSGGVAISSTGIKKGEIFLADVSTQL  60

Query  251  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  430
            KN NITTD KVDT+SNV TT+T+DE APGLK I SFRVPDQRSGKVELQY H++AGIST 
Sbjct  61   KNNNITTDVKVDTHSNVHTTVTIDEPAPGLKTIFSFRVPDQRSGKVELQYQHEYAGISTG  120

Query  431  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  610
            +GLTA+PIVNF+GV+G + L+LGTD+SFDT SG  TK NAGLS+T+SDLIA+LTLNDKGD
Sbjct  121  IGLTASPIVNFAGVIGNDKLSLGTDLSFDTASGNITKLNAGLSYTHSDLIAALTLNDKGD  180

Query  611  SLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTITVGTQHQLDPLTTVKARVNNFGRANAL  790
            +L+ASYYH V+PLSNTAVGAE++HSFSSN NT+T+GTQH LDPLT+VKARVNN+GRA+AL
Sbjct  181  ALTASYYHLVSPLSNTAVGAELSHSFSSNENTLTIGTQHALDPLTSVKARVNNYGRASAL  240

Query  791  IQHEWRPKSLITLSGEVDVKAVDKSAKFGLALALKP  898
            IQHEWRPKSL T+SGEVD +A+DKSAK GLAL LKP
Sbjct  241  IQHEWRPKSLFTISGEVDTRAIDKSAKIGLALVLKP  276



>gb|KJB50696.1| hypothetical protein B456_008G182700 [Gossypium raimondii]
Length=276

 Score =   447 bits (1151),  Expect = 6e-154, Method: Compositional matrix adjust.
 Identities = 214/276 (78%), Positives = 250/276 (91%), Gaps = 0/276 (0%)
 Frame = +2

Query  71   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  250
            MGKGPGLYTDIGKKARDLLY+DYQ DHKFT+TTY+  GV ITSTG+KKG+L L D++T+L
Sbjct  1    MGKGPGLYTDIGKKARDLLYKDYQADHKFTLTTYTSNGVAITSTGTKKGELLLADISTEL  60

Query  251  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  430
            KNKNITT+ KVDT+S +F T+TVDE APGLK I SF  PDQRSGKVELQY H++AGISTS
Sbjct  61   KNKNITTNVKVDTSSKLFATVTVDEPAPGLKTIFSFIAPDQRSGKVELQYQHEYAGISTS  120

Query  431  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  610
            +GLTANP+VNFSGVVG N++ +GTD+SFDT SG FTK NAGL+FT+SDLIASLTLNDKGD
Sbjct  121  IGLTANPLVNFSGVVGNNSVTVGTDLSFDTASGNFTKLNAGLNFTHSDLIASLTLNDKGD  180

Query  611  SLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTITVGTQHQLDPLTTVKARVNNFGRANAL  790
            +L+ASYYH V+PL+NTAVGAE++HSFSSN NT+T+GTQH LDPLTTVKAR+NN+GRA+AL
Sbjct  181  TLNASYYHIVSPLTNTAVGAELSHSFSSNENTLTIGTQHALDPLTTVKARLNNYGRASAL  240

Query  791  IQHEWRPKSLITLSGEVDVKAVDKSAKFGLALALKP  898
            IQHEWRPKSLIT+SGEVD  A++KSAK GLALALKP
Sbjct  241  IQHEWRPKSLITISGEVDTGAIEKSAKVGLALALKP  276



>ref|NP_001275134.1| mitochondrial outer membrane protein porin of 36 kDa [Solanum 
tuberosum]
 sp|P42056.2|VDAC2_SOLTU RecName: Full=Mitochondrial outer membrane protein porin of 36 
kDa; AltName: Full=POM 36; AltName: Full=Voltage-dependent 
anion-selective channel protein; Short=VDAC [Solanum tuberosum]
 emb|CAA56600.1| 36kDA porin II [Solanum tuberosum]
Length=276

 Score =   447 bits (1151),  Expect = 7e-154, Method: Compositional matrix adjust.
 Identities = 214/276 (78%), Positives = 250/276 (91%), Gaps = 0/276 (0%)
 Frame = +2

Query  71   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  250
            M KGPGLY+DIGKKARDLLYRDY +DHKFT+TTYS TGV IT++G KKG+LFL DV+TQL
Sbjct  1    MVKGPGLYSDIGKKARDLLYRDYVSDHKFTVTTYSTTGVAITASGLKKGELFLADVSTQL  60

Query  251  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  430
            KNKNITTD KVDTNSNV+TTITVDE APGLK I SF VPDQ+SGKVELQYLH++AGI+TS
Sbjct  61   KNKNITTDVKVDTNSNVYTTITVDEPAPGLKTIFSFVVPDQKSGKVELQYLHEYAGINTS  120

Query  431  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  610
            +GLTA+P+VNFSGV G N +ALGTD+SFDT +G FTK NAGLSF++SDLIASL LNDKGD
Sbjct  121  IGLTASPLVNFSGVAGNNTVALGTDLSFDTATGNFTKCNAGLSFSSSDLIASLALNDKGD  180

Query  611  SLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTITVGTQHQLDPLTTVKARVNNFGRANAL  790
            ++SASYYH V P++NTAVGAE+ HSFSSN NT+T+GTQH LDPLTTVKARVN++G+A+AL
Sbjct  181  TVSASYYHTVKPVTNTAVGAELTHSFSSNENTLTIGTQHLLDPLTTVKARVNSYGKASAL  240

Query  791  IQHEWRPKSLITLSGEVDVKAVDKSAKFGLALALKP  898
            IQHEWRPKSL T+SGEVD +A++KSAK GLA+ALKP
Sbjct  241  IQHEWRPKSLFTISGEVDTRAIEKSAKIGLAVALKP  276



>gb|AAA96275.1| voltage-dependent anion channel protein [Spinacia oleracea]
Length=276

 Score =   447 bits (1150),  Expect = 1e-153, Method: Compositional matrix adjust.
 Identities = 215/276 (78%), Positives = 248/276 (90%), Gaps = 0/276 (0%)
 Frame = +2

Query  71   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  250
            M KGPGLY+DIGK+ARDLLYRDYQ+DHKFT+TTY+  GV ITSTG+KKG+LFL DV+T+L
Sbjct  1    MVKGPGLYSDIGKRARDLLYRDYQSDHKFTLTTYTANGVAITSTGTKKGELFLADVSTKL  60

Query  251  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  430
             NKNITTD KVDTNSN+FTTITVDE APGLK I SFRVPDQRSGKVELQYLH++AGISTS
Sbjct  61   TNKNITTDVKVDTNSNLFTTITVDEPAPGLKAIFSFRVPDQRSGKVELQYLHEYAGISTS  120

Query  431  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  610
            +GLTANPIVNFSGV G + LALGTD+SFDT SG FTK NAGLSFTN DLIAS+ +NDK D
Sbjct  121  LGLTANPIVNFSGVFGNSTLALGTDLSFDTASGNFTKCNAGLSFTNDDLIASVNVNDKLD  180

Query  611  SLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTITVGTQHQLDPLTTVKARVNNFGRANAL  790
             L+ASYYH V+PL+NTAVGAE++HSFSSN NT+ +GTQH LDPLT+VKARVNN+G+A+AL
Sbjct  181  ILNASYYHIVSPLTNTAVGAELSHSFSSNENTLNIGTQHALDPLTSVKARVNNYGKASAL  240

Query  791  IQHEWRPKSLITLSGEVDVKAVDKSAKFGLALALKP  898
            IQHEWRPKS++T+SGEVD  A++KSAK GLAL LKP
Sbjct  241  IQHEWRPKSIVTISGEVDTSAIEKSAKLGLALVLKP  276



>ref|XP_004228386.1| PREDICTED: mitochondrial outer membrane protein porin of 36 kDa 
[Solanum lycopersicum]
Length=276

 Score =   447 bits (1150),  Expect = 1e-153, Method: Compositional matrix adjust.
 Identities = 215/276 (78%), Positives = 250/276 (91%), Gaps = 0/276 (0%)
 Frame = +2

Query  71   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  250
            M KGPGLY+DIGKKARDLLYRDY +DHKFTITT+S TGV ITS+G KKG+LFL DV+TQL
Sbjct  1    MVKGPGLYSDIGKKARDLLYRDYVSDHKFTITTFSTTGVAITSSGLKKGELFLADVSTQL  60

Query  251  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  430
            KNKNITTD KVDTNSN++TTITVDE APGLK I SF VPDQ+SGKVELQYLH++AGI+TS
Sbjct  61   KNKNITTDVKVDTNSNLYTTITVDEPAPGLKTIFSFVVPDQKSGKVELQYLHEYAGINTS  120

Query  431  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  610
            +GLTA+P+VNFSGV G N +ALGTDVSFDT +G FTK NAGLSF++SDLIASL LNDKGD
Sbjct  121  IGLTASPLVNFSGVAGNNIVALGTDVSFDTATGNFTKCNAGLSFSSSDLIASLALNDKGD  180

Query  611  SLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTITVGTQHQLDPLTTVKARVNNFGRANAL  790
            ++SASYYH V P++NTAVGAE+ HSFSSN NT+T+GTQH LDPLTTVKARVN++G+A+AL
Sbjct  181  TVSASYYHTVKPVTNTAVGAELTHSFSSNENTLTIGTQHLLDPLTTVKARVNSYGKASAL  240

Query  791  IQHEWRPKSLITLSGEVDVKAVDKSAKFGLALALKP  898
            IQHEWRPKSL T+SGEVD +A++KSAK GLA+ALKP
Sbjct  241  IQHEWRPKSLFTISGEVDTRAIEKSAKIGLAVALKP  276



>ref|XP_012082894.1| PREDICTED: mitochondrial outer membrane protein porin of 34 kDa 
[Jatropha curcas]
 gb|KDP45473.1| hypothetical protein JCGZ_09722 [Jatropha curcas]
Length=274

 Score =   447 bits (1149),  Expect = 1e-153, Method: Compositional matrix adjust.
 Identities = 214/276 (78%), Positives = 247/276 (89%), Gaps = 2/276 (1%)
 Frame = +2

Query  71   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  250
            MGKGPGLYT+IGKKARDLLY+DYQTD KFTITTYSPTGV ITSTG KKG+LFL DVNTQL
Sbjct  1    MGKGPGLYTEIGKKARDLLYKDYQTDQKFTITTYSPTGVAITSTGLKKGELFLADVNTQL  60

Query  251  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  430
            K  N TTD KVDT+SN+FTTITVDE APGLK I SF+VPDQRSGK+E+QYLHD+A +S+S
Sbjct  61   KKNNFTTDVKVDTDSNLFTTITVDEPAPGLKAILSFKVPDQRSGKLEVQYLHDYAAVSSS  120

Query  431  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  610
            +GLT NPIVNFSGV+G+NA++LGTD+SFDTKSG FTK NAGLS++N+DL+A+LTLNDKGD
Sbjct  121  IGLTPNPIVNFSGVIGSNAVSLGTDLSFDTKSGNFTKCNAGLSYSNADLVAALTLNDKGD  180

Query  611  SLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTITVGTQHQLDPLTTVKARVNNFGRANAL  790
            SL ASYYH VNP    AVGAEV+HSFS+N NT+TVG+QH LDPLTT+KARVNNFG+ +AL
Sbjct  181  SLKASYYHIVNPTH--AVGAEVSHSFSTNENTVTVGSQHALDPLTTLKARVNNFGKVSAL  238

Query  791  IQHEWRPKSLITLSGEVDVKAVDKSAKFGLALALKP  898
            IQHEWRPKS  T++GEVD KA++KS K GLALALKP
Sbjct  239  IQHEWRPKSFFTVTGEVDTKAIEKSTKIGLALALKP  274



>ref|XP_008221678.1| PREDICTED: mitochondrial outer membrane protein porin of 36 kDa 
[Prunus mume]
Length=276

 Score =   447 bits (1150),  Expect = 1e-153, Method: Compositional matrix adjust.
 Identities = 214/276 (78%), Positives = 250/276 (91%), Gaps = 0/276 (0%)
 Frame = +2

Query  71   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  250
            M KGPGLY DIGKKARDLLY+DYQ+DHKFT+TTY+ TGV I+STG +KGDL+LGDV+TQL
Sbjct  1    MVKGPGLYLDIGKKARDLLYKDYQSDHKFTVTTYTSTGVAISSTGIRKGDLYLGDVSTQL  60

Query  251  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  430
            KNKNITTD KVDT+SN+ TTIT+DE APGLK I SF VPDQRSGKVELQY H++AGISTS
Sbjct  61   KNKNITTDVKVDTDSNLRTTITIDEPAPGLKAIFSFIVPDQRSGKVELQYQHEYAGISTS  120

Query  431  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  610
            +GLTANPIVNFSGVVG N L+LGTD+SFDT SG FTK+NAGL+FT++DLIASL LNDK D
Sbjct  121  IGLTANPIVNFSGVVGNNLLSLGTDLSFDTASGNFTKWNAGLNFTHTDLIASLILNDKAD  180

Query  611  SLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTITVGTQHQLDPLTTVKARVNNFGRANAL  790
            +++ASYYH V+PL+NTAVGAE++HSFSSN N++T+GTQH LDPLTTVK RVNN+GRA+AL
Sbjct  181  TVTASYYHTVSPLTNTAVGAELSHSFSSNENSLTIGTQHALDPLTTVKGRVNNYGRASAL  240

Query  791  IQHEWRPKSLITLSGEVDVKAVDKSAKFGLALALKP  898
            IQHEWRPKS  T+SGEVD +A++KSAK GLALALKP
Sbjct  241  IQHEWRPKSFFTISGEVDTRAIEKSAKIGLALALKP  276



>ref|XP_008339931.1| PREDICTED: mitochondrial outer membrane protein porin of 36 kDa 
[Malus domestica]
Length=276

 Score =   447 bits (1149),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 214/276 (78%), Positives = 248/276 (90%), Gaps = 0/276 (0%)
 Frame = +2

Query  71   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  250
            M KGPGLY DIGKKARDLLY+DYQ+DHKFT+TTY+ TGV I+STG +KG+L+LGDV+TQL
Sbjct  1    MVKGPGLYFDIGKKARDLLYKDYQSDHKFTVTTYTSTGVAISSTGIRKGELYLGDVSTQL  60

Query  251  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  430
            KNKNITTD KVDTNSN+ TTIT+DE APGLK I SF  PDQRSGKVELQY H++AGISTS
Sbjct  61   KNKNITTDVKVDTNSNLLTTITIDEPAPGLKAIFSFIAPDQRSGKVELQYQHEYAGISTS  120

Query  431  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  610
            +GLTANPIVNFSGVVG N L+LGTD+SFDT SG FTK NAGL+FT+SDLIASL LNDK D
Sbjct  121  IGLTANPIVNFSGVVGNNLLSLGTDLSFDTASGNFTKVNAGLNFTHSDLIASLLLNDKAD  180

Query  611  SLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTITVGTQHQLDPLTTVKARVNNFGRANAL  790
            +++ASYYH V+PL+NTAVGAE++HSFSSN N++T+GT H LDPLTTVKARVNN+GRA+AL
Sbjct  181  TITASYYHTVSPLTNTAVGAELSHSFSSNENSLTIGTAHALDPLTTVKARVNNYGRASAL  240

Query  791  IQHEWRPKSLITLSGEVDVKAVDKSAKFGLALALKP  898
            IQHEWRPKS  T+SGEVD +A++KSAK GLALALKP
Sbjct  241  IQHEWRPKSFFTISGEVDTRAIEKSAKIGLALALKP  276



>ref|XP_008389525.1| PREDICTED: mitochondrial outer membrane protein porin of 36 kDa-like 
[Malus domestica]
Length=276

 Score =   446 bits (1147),  Expect = 3e-153, Method: Compositional matrix adjust.
 Identities = 215/276 (78%), Positives = 248/276 (90%), Gaps = 0/276 (0%)
 Frame = +2

Query  71   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  250
            M KGPGLY DIGKKARDLLY+DYQ+DHKFT+TTY+ TGV I+STG +KGDL+LGDV+TQL
Sbjct  1    MVKGPGLYLDIGKKARDLLYKDYQSDHKFTVTTYTSTGVAISSTGIRKGDLYLGDVSTQL  60

Query  251  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  430
            KNKNITTD KVDTNSNV TTITVDE +PGLK I SF  PDQRSGKVELQY H++AGISTS
Sbjct  61   KNKNITTDVKVDTNSNVITTITVDEPSPGLKAIFSFIAPDQRSGKVELQYQHEYAGISTS  120

Query  431  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  610
            +GLTANPIV+FSGVVG N L+LGTD+SFDT SG FTK NAGL+FT+SDLIASL LNDK D
Sbjct  121  IGLTANPIVHFSGVVGNNLLSLGTDLSFDTASGNFTKVNAGLNFTHSDLIASLLLNDKAD  180

Query  611  SLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTITVGTQHQLDPLTTVKARVNNFGRANAL  790
            +++ASYYH V+PL+NTAVGAE++HSFSSN N++T+GT H LDPLTTVKARVNN+GRA+AL
Sbjct  181  TITASYYHTVSPLTNTAVGAELSHSFSSNENSLTIGTAHALDPLTTVKARVNNYGRASAL  240

Query  791  IQHEWRPKSLITLSGEVDVKAVDKSAKFGLALALKP  898
            IQHEWRPKS  T+SGEVD +A++KSAK GLALALKP
Sbjct  241  IQHEWRPKSFFTISGEVDTRAIEKSAKVGLALALKP  276



>gb|KJB11403.1| hypothetical protein B456_001G256800 [Gossypium raimondii]
Length=275

 Score =   446 bits (1147),  Expect = 3e-153, Method: Compositional matrix adjust.
 Identities = 218/276 (79%), Positives = 246/276 (89%), Gaps = 1/276 (0%)
 Frame = +2

Query  71   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  250
            MGKGPGLYT+IGKKARDLLY+DYQTD KFT+TT SPTGV ITS G+KKGDLFL DVNTQL
Sbjct  1    MGKGPGLYTEIGKKARDLLYKDYQTDQKFTLTTSSPTGVAITSAGTKKGDLFLADVNTQL  60

Query  251  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  430
            K++N+TTD KVDT+SN+FTTITVDE APGLK I  FRVPDQRSGK+ELQYLH++AGIS+S
Sbjct  61   KSRNVTTDIKVDTSSNLFTTITVDEPAPGLKAIFGFRVPDQRSGKIELQYLHEYAGISSS  120

Query  431  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  610
            +GLTANPIVNFSGV+GTN LALGTD+SFDTK+G FTK NAG SFTN+DLIASL L   GD
Sbjct  121  IGLTANPIVNFSGVLGTNVLALGTDISFDTKTGNFTKCNAGFSFTNADLIASLALY-VGD  179

Query  611  SLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTITVGTQHQLDPLTTVKARVNNFGRANAL  790
            S++ASYYH VN  +NT VGAEV HSFS+NVNTITVGTQH LDP TT+KARVNN G+A+AL
Sbjct  180  SVNASYYHIVNLSTNTVVGAEVTHSFSTNVNTITVGTQHALDPSTTIKARVNNAGKASAL  239

Query  791  IQHEWRPKSLITLSGEVDVKAVDKSAKFGLALALKP  898
            IQHEWRPKSL T+SGEVD K++DKS K GLALALKP
Sbjct  240  IQHEWRPKSLFTISGEVDTKSIDKSPKVGLALALKP  275



>emb|CAA56601.1| 36kDa porin I [Solanum tuberosum]
Length=276

 Score =   446 bits (1147),  Expect = 3e-153, Method: Compositional matrix adjust.
 Identities = 213/276 (77%), Positives = 249/276 (90%), Gaps = 0/276 (0%)
 Frame = +2

Query  71   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  250
            M KGPGLY+DIGKKARDLLYRDY +DHKFT+TTYS TGV IT++G KKG+LFL DV+TQL
Sbjct  1    MVKGPGLYSDIGKKARDLLYRDYVSDHKFTVTTYSTTGVAITASGLKKGELFLADVSTQL  60

Query  251  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  430
            KNKNITTD KVD NSNV+TTITVDE APGLK I SF VPDQ+SGKVELQYLH++AGI+TS
Sbjct  61   KNKNITTDVKVDANSNVYTTITVDEPAPGLKTIFSFVVPDQKSGKVELQYLHEYAGINTS  120

Query  431  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  610
            +GLTA+P+VNFSGV G N +ALGTD+SFDT +G FTK NAGLSF++SDLIASL LNDKGD
Sbjct  121  IGLTASPLVNFSGVAGNNTVALGTDLSFDTATGNFTKCNAGLSFSSSDLIASLALNDKGD  180

Query  611  SLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTITVGTQHQLDPLTTVKARVNNFGRANAL  790
            ++SASYYH V P++NTAVGAE+ HSFSSN NT+T+GTQH LDPLTTVKARVN++G+A+AL
Sbjct  181  TVSASYYHTVKPVTNTAVGAELTHSFSSNENTLTIGTQHLLDPLTTVKARVNSYGKASAL  240

Query  791  IQHEWRPKSLITLSGEVDVKAVDKSAKFGLALALKP  898
            IQHEWRPKSL T+SGEVD +A++KSAK GLA+ALKP
Sbjct  241  IQHEWRPKSLFTISGEVDTRAIEKSAKIGLAVALKP  276



>ref|XP_009360395.1| PREDICTED: mitochondrial outer membrane protein porin of 36 kDa 
[Pyrus x bretschneideri]
Length=276

 Score =   446 bits (1146),  Expect = 4e-153, Method: Compositional matrix adjust.
 Identities = 215/276 (78%), Positives = 245/276 (89%), Gaps = 0/276 (0%)
 Frame = +2

Query  71   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  250
            M KGPGLY DIGKKARDLLY+DYQ+DHKFT+TTY+ TGV I+STG +KGDL+LGDV+TQL
Sbjct  1    MVKGPGLYLDIGKKARDLLYKDYQSDHKFTVTTYTSTGVAISSTGIRKGDLYLGDVSTQL  60

Query  251  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  430
            KNKNITTD KVDTNSNV TTITVDE APGLK I SF  PDQRSGKVELQY H++AGISTS
Sbjct  61   KNKNITTDVKVDTNSNVITTITVDEPAPGLKAIFSFIAPDQRSGKVELQYQHEYAGISTS  120

Query  431  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  610
            +GLTANPIVNFSGVVG N L+LGTD+SFDT SG FTK NAGL+F + DLIASL LNDK D
Sbjct  121  IGLTANPIVNFSGVVGNNLLSLGTDLSFDTASGNFTKVNAGLNFIHCDLIASLLLNDKAD  180

Query  611  SLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTITVGTQHQLDPLTTVKARVNNFGRANAL  790
            +++ASYYH V+PL+NTAVGAE+ HSFSSN N++T+GT H LDPLTTVKARVNN+GRA+AL
Sbjct  181  TITASYYHTVSPLTNTAVGAELAHSFSSNENSLTIGTAHALDPLTTVKARVNNYGRASAL  240

Query  791  IQHEWRPKSLITLSGEVDVKAVDKSAKFGLALALKP  898
            IQHEWRPKS  T+SGEVD +A++KSAK GLALALKP
Sbjct  241  IQHEWRPKSFFTISGEVDTRAIEKSAKVGLALALKP  276



>gb|AAD38145.1|AF139498_1 porin [Prunus armeniaca]
Length=276

 Score =   446 bits (1146),  Expect = 5e-153, Method: Compositional matrix adjust.
 Identities = 214/276 (78%), Positives = 249/276 (90%), Gaps = 0/276 (0%)
 Frame = +2

Query  71   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  250
            M KGPGLY DIGKKARDLLY+DYQ+DHKFT+TTY+ TGV I+STG +KGDL+LGDV+TQL
Sbjct  1    MVKGPGLYLDIGKKARDLLYKDYQSDHKFTVTTYTSTGVAISSTGIRKGDLYLGDVSTQL  60

Query  251  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  430
            KNKNITTD KVDT+SN+ TTIT+DE APGLK I SF VPDQRSGKVELQY H++AGISTS
Sbjct  61   KNKNITTDVKVDTDSNLRTTITIDEPAPGLKAIFSFIVPDQRSGKVELQYQHEYAGISTS  120

Query  431  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  610
            +GLTANPIVNFSGVVG N L+LGTD+SFDT SG FTK NAGL+FT++DLIASL LNDK D
Sbjct  121  IGLTANPIVNFSGVVGNNLLSLGTDLSFDTASGNFTKCNAGLNFTHTDLIASLILNDKAD  180

Query  611  SLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTITVGTQHQLDPLTTVKARVNNFGRANAL  790
            +++ASYYH V+PL+NTAVGAE++HSFSSN N++T+GTQH LDPLTTVK RVNN+GRA+AL
Sbjct  181  TVTASYYHTVSPLTNTAVGAELSHSFSSNENSLTIGTQHALDPLTTVKGRVNNYGRASAL  240

Query  791  IQHEWRPKSLITLSGEVDVKAVDKSAKFGLALALKP  898
            IQHEWRPKS  T+SGEVD +A++KSAK GLALALKP
Sbjct  241  IQHEWRPKSFFTISGEVDTRAIEKSAKIGLALALKP  276



>ref|XP_009797869.1| PREDICTED: mitochondrial outer membrane protein porin of 36 kDa-like 
[Nicotiana sylvestris]
Length=276

 Score =   445 bits (1145),  Expect = 6e-153, Method: Compositional matrix adjust.
 Identities = 214/276 (78%), Positives = 244/276 (88%), Gaps = 0/276 (0%)
 Frame = +2

Query  71   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  250
            M KGPGLY+DIGKKARDLLYRDY +DHKFT+TTY+  GV ITS+G KKG+  L DVNTQL
Sbjct  1    MVKGPGLYSDIGKKARDLLYRDYVSDHKFTVTTYTSNGVAITSSGVKKGEFLLADVNTQL  60

Query  251  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  430
            KNKN TTD KVDTNSNV+TTITVDE APGLK I SF VPDQ+SGKVELQYLH++AGISTS
Sbjct  61   KNKNFTTDVKVDTNSNVYTTITVDEPAPGLKTIFSFVVPDQKSGKVELQYLHEYAGISTS  120

Query  431  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  610
            +GL A+P+VNFSGV G N +ALGTD+SFDT SG FTK NAGL+FT SDLIASL LNDKGD
Sbjct  121  IGLAASPLVNFSGVAGNNKIALGTDLSFDTSSGNFTKCNAGLNFTTSDLIASLALNDKGD  180

Query  611  SLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTITVGTQHQLDPLTTVKARVNNFGRANAL  790
            +LSASYYH VNPL+NTAVGAE+ HSFSSN NT+T+GT H LDPLTTVKARVN++G+A+AL
Sbjct  181  TLSASYYHTVNPLTNTAVGAELTHSFSSNENTMTIGTHHSLDPLTTVKARVNSYGKASAL  240

Query  791  IQHEWRPKSLITLSGEVDVKAVDKSAKFGLALALKP  898
            IQHEWRPKSL T+SGEVD +A++KSAK GLA+ALKP
Sbjct  241  IQHEWRPKSLFTISGEVDTRAIEKSAKVGLAVALKP  276



>gb|KGN47800.1| hypothetical protein Csa_6G404150 [Cucumis sativus]
Length=342

 Score =   447 bits (1150),  Expect = 9e-153, Method: Compositional matrix adjust.
 Identities = 213/276 (77%), Positives = 250/276 (91%), Gaps = 0/276 (0%)
 Frame = +2

Query  71   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  250
            MGKGPGLY+DIGKKARDLLY+DYQ+DHKFT+TTY+  GV I+STG KKG++FL DV+TQL
Sbjct  67   MGKGPGLYSDIGKKARDLLYKDYQSDHKFTVTTYTSGGVAISSTGIKKGEIFLADVSTQL  126

Query  251  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  430
            KN NITTD KVDT+SNV TT+T+DE APGLK I SFRVPDQRSGKVELQY H++AGIST 
Sbjct  127  KNNNITTDVKVDTHSNVHTTVTIDEPAPGLKTIFSFRVPDQRSGKVELQYQHEYAGISTG  186

Query  431  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  610
            +GLTA+PIVNF+GV+G + L+LGTD+SFDT SG  TK NAGLS+T+SDLIA+LTLNDKGD
Sbjct  187  IGLTASPIVNFAGVIGNDKLSLGTDLSFDTASGNITKLNAGLSYTHSDLIAALTLNDKGD  246

Query  611  SLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTITVGTQHQLDPLTTVKARVNNFGRANAL  790
            +L+ASYYH V+PLSNTAVGAE++HSFSSN NT+T+GTQH LDPLT+VKARVNN+GRA+AL
Sbjct  247  ALTASYYHLVSPLSNTAVGAELSHSFSSNENTLTIGTQHALDPLTSVKARVNNYGRASAL  306

Query  791  IQHEWRPKSLITLSGEVDVKAVDKSAKFGLALALKP  898
            IQHEWRPKSL T+SGEVD +A+DKSAK GLAL LKP
Sbjct  307  IQHEWRPKSLFTISGEVDTRAIDKSAKIGLALVLKP  342



>gb|AID59897.1| voltage-dependent anion channel protein [Prunus persica]
Length=276

 Score =   443 bits (1140),  Expect = 3e-152, Method: Compositional matrix adjust.
 Identities = 212/276 (77%), Positives = 249/276 (90%), Gaps = 0/276 (0%)
 Frame = +2

Query  71   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  250
            M KGPGLY DIGKKARDLLY+DYQ+DHKFT+TTY+ TGV I+STG +KGDL+LGDV+TQL
Sbjct  1    MVKGPGLYLDIGKKARDLLYKDYQSDHKFTVTTYTSTGVAISSTGIRKGDLYLGDVSTQL  60

Query  251  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  430
            KNKNITTD KVDT+SN+ TTIT+DE APGLK I SF VPDQRSGKVELQY H++AGIST 
Sbjct  61   KNKNITTDVKVDTDSNLRTTITIDEPAPGLKAIFSFIVPDQRSGKVELQYQHEYAGISTG  120

Query  431  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  610
            +GLTANPIVNFSGVVG N L+LGTD+SFDT SG FTK+NAGL+FT++DLIASL LNDK D
Sbjct  121  IGLTANPIVNFSGVVGNNLLSLGTDLSFDTASGNFTKWNAGLNFTHTDLIASLILNDKAD  180

Query  611  SLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTITVGTQHQLDPLTTVKARVNNFGRANAL  790
            +++ASYYH V+PL+NTAVGAE++HSFSSN N++T+GT+H LDPLTTVK RVNN+GRA+AL
Sbjct  181  TVTASYYHTVSPLTNTAVGAELSHSFSSNENSLTIGTRHALDPLTTVKGRVNNYGRASAL  240

Query  791  IQHEWRPKSLITLSGEVDVKAVDKSAKFGLALALKP  898
            IQHEWRPKS  T+SGEVD +A++KSAK GLALALKP
Sbjct  241  IQHEWRPKSFFTISGEVDTRAIEKSAKIGLALALKP  276



>gb|EYU34669.1| hypothetical protein MIMGU_mgv1a011608mg [Erythranthe guttata]
Length=276

 Score =   443 bits (1139),  Expect = 5e-152, Method: Compositional matrix adjust.
 Identities = 212/276 (77%), Positives = 245/276 (89%), Gaps = 0/276 (0%)
 Frame = +2

Query  71   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  250
            MGKGPGLY+DIGK+ARDLL +DY +D KFT+TTYSPTGV +TS+G+KKG+LFL DVNTQ 
Sbjct  1    MGKGPGLYSDIGKRARDLLNKDYNSDQKFTLTTYSPTGVTLTSSGTKKGELFLADVNTQF  60

Query  251  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  430
            KNKN+TTD KVDT+SN+FTTITVDE  PGLK I SF+ PDQRSGK+ELQYLHD+AG+S+S
Sbjct  61   KNKNVTTDIKVDTSSNLFTTITVDELTPGLKTILSFKAPDQRSGKLELQYLHDYAGLSSS  120

Query  431  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  610
            +GLTANP+VNF+GV+G N LALG+DVSFDTK GAF KYN G SFTN+DLIA++TLN+K D
Sbjct  121  IGLTANPVVNFAGVLGNNKLALGSDVSFDTKEGAFLKYNFGASFTNADLIAAVTLNNKFD  180

Query  611  SLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTITVGTQHQLDPLTTVKARVNNFGRANAL  790
            S+SASYYH V+PL+NTAVG E  HSFSS+ NTITVGTQH LDPLT VKARVNN G+ +AL
Sbjct  181  SVSASYYHTVSPLTNTAVGGEFTHSFSSSENTITVGTQHSLDPLTNVKARVNNAGKVSAL  240

Query  791  IQHEWRPKSLITLSGEVDVKAVDKSAKFGLALALKP  898
            IQHEWRPKSLIT+S EVD KA DKSAKFGLALALKP
Sbjct  241  IQHEWRPKSLITVSTEVDAKAFDKSAKFGLALALKP  276



>ref|XP_007222361.1| hypothetical protein PRUPE_ppa008111mg [Prunus persica]
 gb|EMJ23560.1| hypothetical protein PRUPE_ppa008111mg [Prunus persica]
Length=344

 Score =   445 bits (1144),  Expect = 9e-152, Method: Compositional matrix adjust.
 Identities = 216/285 (76%), Positives = 252/285 (88%), Gaps = 1/285 (0%)
 Frame = +2

Query  44   FRFSALAAEMGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDL  223
            F FS     M KGPGLY DIGKKARDLLY+DYQ+DHKFT+TTY+ TGV I+STG +KGDL
Sbjct  61   FEFSR-ETIMVKGPGLYLDIGKKARDLLYKDYQSDHKFTVTTYTSTGVAISSTGIRKGDL  119

Query  224  FLGDVNTQLKNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYL  403
            +LGDV+TQLKNKNITTD KVDT+SN+ TTIT+DE APGLK I SF VPDQRSGKVELQY 
Sbjct  120  YLGDVSTQLKNKNITTDVKVDTDSNLRTTITIDEPAPGLKAIFSFIVPDQRSGKVELQYQ  179

Query  404  HDHAGISTSVGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIA  583
            H++AGIST +GLTANPIVNFSGVVG N L+LGTD+SFDT SG FTK+NAGL+FT++DLIA
Sbjct  180  HEYAGISTGIGLTANPIVNFSGVVGNNLLSLGTDLSFDTASGNFTKWNAGLNFTHTDLIA  239

Query  584  SLTLNDKGDSLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTITVGTQHQLDPLTTVKARV  763
            SL LNDK D+++ASYYH V+PL+NTAVGAE++HSFSSN N++T+GTQH LDPLTTVK RV
Sbjct  240  SLILNDKADTVTASYYHTVSPLTNTAVGAELSHSFSSNENSLTIGTQHALDPLTTVKGRV  299

Query  764  NNFGRANALIQHEWRPKSLITLSGEVDVKAVDKSAKFGLALALKP  898
            NN+GRA+ALIQHEWRPKS  T+SGEVD +A++KSAK GLALALKP
Sbjct  300  NNYGRASALIQHEWRPKSFFTISGEVDTRAIEKSAKIGLALALKP  344



>ref|XP_012091937.1| PREDICTED: mitochondrial outer membrane protein porin of 36 kDa-like 
[Jatropha curcas]
 gb|KDP21225.1| hypothetical protein JCGZ_21696 [Jatropha curcas]
Length=276

 Score =   442 bits (1136),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 211/276 (76%), Positives = 248/276 (90%), Gaps = 0/276 (0%)
 Frame = +2

Query  71   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  250
            MGKGPGLY+DIGKKARDLLY+DYQ DHKFT TTY+  GV ITSTG KKG+LFL DV++QL
Sbjct  1    MGKGPGLYSDIGKKARDLLYKDYQGDHKFTFTTYTAAGVAITSTGIKKGELFLADVSSQL  60

Query  251  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  430
            KNKNITTD KVDTNSN+FTTIT+D+ APGLK I SF++PDQRSGKV+LQY H+++GIST 
Sbjct  61   KNKNITTDVKVDTNSNLFTTITIDDLAPGLKTIFSFKIPDQRSGKVDLQYQHEYSGISTG  120

Query  431  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  610
            +GLTANPIVNFSGVVG + +ALGTD+SFDT SG FTK NAGLS+TN+DLIAS+TLNDKGD
Sbjct  121  IGLTANPIVNFSGVVGNSTIALGTDLSFDTASGNFTKLNAGLSYTNADLIASVTLNDKGD  180

Query  611  SLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTITVGTQHQLDPLTTVKARVNNFGRANAL  790
            +L+ASYYH V+PL++TAVGAE+ HSFSSN NT+T+GT+H LDPLTTVKAR NN+G A+AL
Sbjct  181  TLNASYYHTVSPLTDTAVGAELTHSFSSNENTLTIGTKHALDPLTTVKARANNYGIASAL  240

Query  791  IQHEWRPKSLITLSGEVDVKAVDKSAKFGLALALKP  898
            IQHEWR KSL T+SGEVD +A++KSAK GLALALKP
Sbjct  241  IQHEWRLKSLFTISGEVDTRAIEKSAKIGLALALKP  276



>gb|KHG13762.1| Mitochondrial outer membrane porin of 36 kDa [Gossypium arboreum]
Length=276

 Score =   441 bits (1135),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 210/276 (76%), Positives = 246/276 (89%), Gaps = 0/276 (0%)
 Frame = +2

Query  71   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  250
            MGKGPGLY+DIGKK+RDLLY+DYQ DHKFT+TTY+  GV ITSTG KKG+L L DV+T+L
Sbjct  1    MGKGPGLYSDIGKKSRDLLYKDYQADHKFTVTTYTSNGVAITSTGIKKGELLLADVSTEL  60

Query  251  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  430
            KN NITT+ KVDT SN+F T+TVDE APGLK I SF VPDQRSGKVELQY H++AGISTS
Sbjct  61   KNNNITTNVKVDTKSNLFATVTVDEPAPGLKTIFSFIVPDQRSGKVELQYQHEYAGISTS  120

Query  431  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  610
            +GL ANP+VNFSGVVG N +++GTD+SFDT SG FTK NAGL+FT+SDLIASLTLNDKGD
Sbjct  121  IGLNANPLVNFSGVVGNNCVSVGTDLSFDTASGNFTKLNAGLNFTHSDLIASLTLNDKGD  180

Query  611  SLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTITVGTQHQLDPLTTVKARVNNFGRANAL  790
            +L+ASYYH V+PL+NTAVGAE+ HSFSSN NT+T+GTQH LDPLTTV+ R+NN+GRA+AL
Sbjct  181  TLNASYYHIVSPLTNTAVGAELTHSFSSNENTLTIGTQHALDPLTTVRTRLNNYGRASAL  240

Query  791  IQHEWRPKSLITLSGEVDVKAVDKSAKFGLALALKP  898
            IQHEWRPKSL T+SGEVD +A++KSAK GLALALKP
Sbjct  241  IQHEWRPKSLFTISGEVDTRAIEKSAKVGLALALKP  276



>gb|KJB30018.1| hypothetical protein B456_005G139100 [Gossypium raimondii]
 gb|KJB30019.1| hypothetical protein B456_005G139100 [Gossypium raimondii]
Length=276

 Score =   441 bits (1133),  Expect = 4e-151, Method: Compositional matrix adjust.
 Identities = 211/276 (76%), Positives = 245/276 (89%), Gaps = 0/276 (0%)
 Frame = +2

Query  71   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  250
            MGKGPGLY+DIGKKARDLLY+DYQ DHKFT+TTY+  GV ITSTG KKG+L L DV+T+L
Sbjct  1    MGKGPGLYSDIGKKARDLLYKDYQADHKFTVTTYTSNGVAITSTGIKKGELLLADVSTEL  60

Query  251  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  430
            KN NITT+ KVDT S +F T+TVDE APGLK I SF VPDQRSGKVELQY H++AGISTS
Sbjct  61   KNNNITTNVKVDTKSTLFATVTVDEPAPGLKTIFSFIVPDQRSGKVELQYQHEYAGISTS  120

Query  431  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  610
            +GL ANP+VNFSGVVG N +++GTD+SFDT SG FTK NAGL+FT+SDLIASLTLNDKGD
Sbjct  121  IGLNANPLVNFSGVVGNNCVSVGTDLSFDTGSGNFTKLNAGLNFTHSDLIASLTLNDKGD  180

Query  611  SLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTITVGTQHQLDPLTTVKARVNNFGRANAL  790
            +L+ASYYH V+PL+NTAVGAE+ HSFSSN NT+T+GTQH LDPLTTVKAR+NN+GRA+ L
Sbjct  181  TLNASYYHIVSPLTNTAVGAELTHSFSSNENTLTIGTQHALDPLTTVKARLNNYGRASGL  240

Query  791  IQHEWRPKSLITLSGEVDVKAVDKSAKFGLALALKP  898
            IQHEWRPKSL T+SGEVD +A++KSAK GLALALKP
Sbjct  241  IQHEWRPKSLFTISGEVDTRAIEKSAKVGLALALKP  276



>ref|XP_004302356.1| PREDICTED: mitochondrial outer membrane protein porin of 34 kDa 
[Fragaria vesca subsp. vesca]
Length=276

 Score =   440 bits (1132),  Expect = 6e-151, Method: Compositional matrix adjust.
 Identities = 209/276 (76%), Positives = 241/276 (87%), Gaps = 0/276 (0%)
 Frame = +2

Query  71   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  250
            M  GPGLYT+IGKKARDLLY+DYQ+DHKFTITTYSPTGV ITS+G+KKGD+FL DV TQL
Sbjct  1    MANGPGLYTEIGKKARDLLYKDYQSDHKFTITTYSPTGVAITSSGTKKGDVFLADVTTQL  60

Query  251  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  430
            K +N+TTD KVDT SN+ TTITVD+  PG+K I SF+VPDQ SGK ELQYLHD+AGISTS
Sbjct  61   KKQNVTTDIKVDTESNLLTTITVDQPCPGVKAILSFKVPDQNSGKAELQYLHDYAGISTS  120

Query  431  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  610
            VGLTANP+VNFSGV+GTN LALGTDVSFDTKSG FTK NAGL+F+N+DL+ASL LN+KGD
Sbjct  121  VGLTANPVVNFSGVLGTNLLALGTDVSFDTKSGNFTKCNAGLNFSNADLMASLNLNEKGD  180

Query  611  SLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTITVGTQHQLDPLTTVKARVNNFGRANAL  790
             +S S+YH + P  NTAVGAEV H FS++ NTIT+G QH LDPLT+VKARVNN G+ANAL
Sbjct  181  VVSGSFYHSLYPEQNTAVGAEVTHRFSNSENTITLGAQHALDPLTSVKARVNNIGKANAL  240

Query  791  IQHEWRPKSLITLSGEVDVKAVDKSAKFGLALALKP  898
            IQHEWRPKS  T+SGEVD +A++KSAK GLALALKP
Sbjct  241  IQHEWRPKSFFTISGEVDTRAIEKSAKIGLALALKP  276



>gb|KHG20441.1| Mitochondrial outer membrane porin of 36 kDa [Gossypium arboreum]
Length=276

 Score =   440 bits (1131),  Expect = 8e-151, Method: Compositional matrix adjust.
 Identities = 207/276 (75%), Positives = 247/276 (89%), Gaps = 0/276 (0%)
 Frame = +2

Query  71   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  250
            MGKGPGLY+DIGKKARDLLY+DYQ DHKFT+TTY+  GV ITSTG+KKG+L L DVNTQL
Sbjct  1    MGKGPGLYSDIGKKARDLLYKDYQADHKFTVTTYTSNGVAITSTGTKKGELLLADVNTQL  60

Query  251  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  430
            KNKNITTD K D+ SN+FTT+T+DE APGLK I SF VPDQ+SGKVELQY H++AGIST 
Sbjct  61   KNKNITTDVKFDSRSNLFTTVTIDEPAPGLKTIFSFVVPDQKSGKVELQYRHEYAGISTG  120

Query  431  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  610
            +GLTA P+V+FSGV+G +++++GTD+SFDT SG F K NAGL+ T+SDLIAS+TLNDKGD
Sbjct  121  IGLTAKPLVSFSGVIGNDSVSVGTDLSFDTASGNFIKLNAGLNITHSDLIASMTLNDKGD  180

Query  611  SLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTITVGTQHQLDPLTTVKARVNNFGRANAL  790
            +L+ASYYH V+PL+NTAVGAE+ HSFSSN NT+T+GTQH LDPLTTVKAR+NN+GRA+AL
Sbjct  181  TLTASYYHIVSPLTNTAVGAELTHSFSSNENTLTIGTQHALDPLTTVKARMNNYGRASAL  240

Query  791  IQHEWRPKSLITLSGEVDVKAVDKSAKFGLALALKP  898
            IQHEWRPKSL T+SGEVD +A++KSAK GLALALKP
Sbjct  241  IQHEWRPKSLFTISGEVDTRAIEKSAKVGLALALKP  276



>ref|XP_002324035.1| hypothetical protein POPTR_0017s11430g [Populus trichocarpa]
 gb|ABK94151.1| unknown [Populus trichocarpa]
 gb|EEF04168.1| hypothetical protein POPTR_0017s11430g [Populus trichocarpa]
Length=274

 Score =   437 bits (1125),  Expect = 5e-150, Method: Compositional matrix adjust.
 Identities = 213/276 (77%), Positives = 243/276 (88%), Gaps = 2/276 (1%)
 Frame = +2

Query  71   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  250
            M  GPGLY++IGKKARDLLY+DYQTDHKFT+ T SPTGV ITS+G+KKGDL   DVNTQL
Sbjct  1    MVNGPGLYSEIGKKARDLLYKDYQTDHKFTLNTSSPTGVTITSSGTKKGDLLAADVNTQL  60

Query  251  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  430
            KNKNITTD KVDT+SN+FTTITVDE APGLK I SF+VPDQRSGKVE+QYLHD+A +S+S
Sbjct  61   KNKNITTDIKVDTSSNLFTTITVDEPAPGLKTIFSFKVPDQRSGKVEIQYLHDYAAVSSS  120

Query  431  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  610
            VGLT NPIVNFSGV+GTN  +LGTD+SFDTK+G F K NAG+S +  DLIASLTLNDKGD
Sbjct  121  VGLTVNPIVNFSGVIGTNVASLGTDLSFDTKTGDFIKCNAGVSLSKVDLIASLTLNDKGD  180

Query  611  SLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTITVGTQHQLDPLTTVKARVNNFGRANAL  790
            SL+ASYYH VNPL  TAVGAEV+HSFSSN NTITVG QH LDPLTT+KARVNN G+A+AL
Sbjct  181  SLNASYYHIVNPL--TAVGAEVSHSFSSNENTITVGAQHALDPLTTLKARVNNAGKASAL  238

Query  791  IQHEWRPKSLITLSGEVDVKAVDKSAKFGLALALKP  898
            +QH+WRPKS  T+SGEVD KA++K+AK GLALALKP
Sbjct  239  VQHQWRPKSFFTVSGEVDTKAIEKTAKVGLALALKP  274



>gb|KJB60739.1| hypothetical protein B456_009G323300 [Gossypium raimondii]
Length=276

 Score =   437 bits (1125),  Expect = 6e-150, Method: Compositional matrix adjust.
 Identities = 206/276 (75%), Positives = 245/276 (89%), Gaps = 0/276 (0%)
 Frame = +2

Query  71   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  250
            MGKGPGLY+DIGKKARDLLY+DYQ DHKFT+TTY+  GV ITSTG+KKG+L L DVNTQL
Sbjct  1    MGKGPGLYSDIGKKARDLLYKDYQVDHKFTVTTYTSNGVAITSTGTKKGELLLADVNTQL  60

Query  251  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  430
            KNKNITTD KVD+ SN+FTT+T+DE APGLK I SF VPDQ+SG VELQY H++AGIS  
Sbjct  61   KNKNITTDVKVDSRSNLFTTVTIDEPAPGLKTIFSFVVPDQKSGMVELQYRHEYAGISNG  120

Query  431  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  610
            +GLTA P+V+FSGV+G + +++GTD+SFDT SG F K NAGL+ T+SDLIAS+TLNDKGD
Sbjct  121  IGLTAKPLVSFSGVIGNDCVSVGTDLSFDTASGNFIKLNAGLNITHSDLIASMTLNDKGD  180

Query  611  SLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTITVGTQHQLDPLTTVKARVNNFGRANAL  790
            +L+ASYYH V+PL+NTAVGAE+ HSFSSN NT+T+GTQH LDPLTTVKAR+NN+GRA+AL
Sbjct  181  TLTASYYHIVSPLTNTAVGAELTHSFSSNENTLTIGTQHALDPLTTVKARMNNYGRASAL  240

Query  791  IQHEWRPKSLITLSGEVDVKAVDKSAKFGLALALKP  898
            IQHEWRPKSL T+SGEVD +A++KSAK GLALALKP
Sbjct  241  IQHEWRPKSLFTISGEVDTRAIEKSAKVGLALALKP  276



>ref|XP_009599229.1| PREDICTED: mitochondrial outer membrane protein porin of 36 kDa-like 
[Nicotiana tomentosiformis]
Length=276

 Score =   437 bits (1125),  Expect = 8e-150, Method: Compositional matrix adjust.
 Identities = 210/275 (76%), Positives = 241/275 (88%), Gaps = 0/275 (0%)
 Frame = +2

Query  71   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  250
            M  GPGLY+DIGKKARDLLYRDY +DHKFT+TTY+  GV ITS+G KKG+  L DVNTQL
Sbjct  1    MVMGPGLYSDIGKKARDLLYRDYVSDHKFTVTTYTSNGVAITSSGVKKGEFLLADVNTQL  60

Query  251  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  430
            KNKN TTD KVDTNSNV+TTITVDE APGLK I SF VPDQ+SGKVELQYLH++AGISTS
Sbjct  61   KNKNFTTDVKVDTNSNVYTTITVDEPAPGLKTIFSFVVPDQKSGKVELQYLHEYAGISTS  120

Query  431  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  610
            +GL A+P+VNFSGV G N +ALGTD+SFDT SG FTK NAGL+FT SDLIASL LNDK D
Sbjct  121  IGLAASPLVNFSGVAGNNKIALGTDLSFDTSSGNFTKCNAGLNFTTSDLIASLALNDKAD  180

Query  611  SLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTITVGTQHQLDPLTTVKARVNNFGRANAL  790
            +L+ASYYH VNPL+NTAVGAE+ HSFSSN NT+T+GT H LDPLTTVKARVN++G+A+AL
Sbjct  181  TLTASYYHTVNPLTNTAVGAELTHSFSSNENTMTIGTHHSLDPLTTVKARVNSYGKASAL  240

Query  791  IQHEWRPKSLITLSGEVDVKAVDKSAKFGLALALK  895
            IQHEWRPKSL T+SGEVD +A++KSAK GLA+ALK
Sbjct  241  IQHEWRPKSLFTISGEVDTRAIEKSAKVGLAVALK  275



>ref|XP_004297335.1| PREDICTED: mitochondrial outer membrane protein porin of 36 kDa-like 
[Fragaria vesca subsp. vesca]
Length=276

 Score =   437 bits (1124),  Expect = 8e-150, Method: Compositional matrix adjust.
 Identities = 210/276 (76%), Positives = 244/276 (88%), Gaps = 0/276 (0%)
 Frame = +2

Query  71   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  250
            M KGPGLY+DIGKKARDLLYRDYQTDHKFT+TT + +GV ITS+G KKGDL LGDV+TQL
Sbjct  1    MVKGPGLYSDIGKKARDLLYRDYQTDHKFTVTTLTASGVAITSSGIKKGDLLLGDVSTQL  60

Query  251  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  430
            KNKNITTD KVDTNSN+  TITVDE APGLK I SF VPDQ+S +VELQY H++AGISTS
Sbjct  61   KNKNITTDVKVDTNSNLLATITVDEPAPGLKAILSFIVPDQKSARVELQYQHEYAGISTS  120

Query  431  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  610
            +GLTANP++NFSGVVG  AL+LGTDVSFDT SG  TK NAGL+F ++DLIASL +NDKGD
Sbjct  121  LGLTANPVINFSGVVGNAALSLGTDVSFDTASGNLTKLNAGLNFIHTDLIASLLVNDKGD  180

Query  611  SLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTITVGTQHQLDPLTTVKARVNNFGRANAL  790
            +L+ASYY  V+P++ TAVGAE++HSFSSN NT T+GTQH LDPLT+VKARVNN+GRA+AL
Sbjct  181  TLTASYYQTVSPITCTAVGAELSHSFSSNENTFTIGTQHALDPLTSVKARVNNYGRASAL  240

Query  791  IQHEWRPKSLITLSGEVDVKAVDKSAKFGLALALKP  898
            IQHEWRPKSL T+SGEVD +A++KSAK GLALALKP
Sbjct  241  IQHEWRPKSLFTISGEVDTRAIEKSAKIGLALALKP  276



>ref|XP_007046221.1| Voltage dependent anion channel 1 isoform 1 [Theobroma cacao]
 gb|EOY02053.1| Voltage dependent anion channel 1 isoform 1 [Theobroma cacao]
Length=276

 Score =   437 bits (1123),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 210/276 (76%), Positives = 248/276 (90%), Gaps = 0/276 (0%)
 Frame = +2

Query  71   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  250
            MGKGPGLY++IGKKARDLLY+DYQ DHKFT+TTY+  GV ITSTG KKG+L L DV+TQL
Sbjct  1    MGKGPGLYSEIGKKARDLLYKDYQGDHKFTVTTYTSDGVAITSTGIKKGELLLADVSTQL  60

Query  251  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  430
            KNKNITTD KVDT+S +FTT+TVDE APGLK I SF VPDQRSGKVELQY H++AGISTS
Sbjct  61   KNKNITTDVKVDTSSKLFTTVTVDEPAPGLKTIFSFVVPDQRSGKVELQYQHEYAGISTS  120

Query  431  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  610
            +GLTANP+VNFSGVVG N +++GTD+SFDT SG FTK NAGL+FT+SDLIAS+T+NDK D
Sbjct  121  IGLTANPLVNFSGVVGNNCVSVGTDLSFDTASGNFTKLNAGLNFTHSDLIASVTVNDKCD  180

Query  611  SLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTITVGTQHQLDPLTTVKARVNNFGRANAL  790
            +L+ASYYH V+PL+NTAVGAE+ HSFSSN NT+T GTQ++LDPLTTVKAR NNFGRA+AL
Sbjct  181  NLTASYYHIVSPLTNTAVGAELTHSFSSNENTLTFGTQYELDPLTTVKARWNNFGRASAL  240

Query  791  IQHEWRPKSLITLSGEVDVKAVDKSAKFGLALALKP  898
            IQHE+RPKSL+T+SGEVD +A++KSAK G+AL LKP
Sbjct  241  IQHEFRPKSLLTISGEVDTRAIEKSAKVGMALLLKP  276



>ref|XP_011005064.1| PREDICTED: mitochondrial outer membrane protein porin of 34 kDa-like 
[Populus euphratica]
Length=274

 Score =   436 bits (1120),  Expect = 3e-149, Method: Compositional matrix adjust.
 Identities = 211/276 (76%), Positives = 244/276 (88%), Gaps = 2/276 (1%)
 Frame = +2

Query  71   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  250
            M KGPGLY++IGKKARDLLY+DYQTDHKFT+ T SPTGV ITS+G+KKGDL   DVNTQL
Sbjct  1    MVKGPGLYSEIGKKARDLLYKDYQTDHKFTLNTSSPTGVTITSSGTKKGDLLAADVNTQL  60

Query  251  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  430
            K+KNITTD KVDT+SN+FTTITVDE APGLK I SF+VPDQRSGKVE+QYLHD+A +S+S
Sbjct  61   KSKNITTDIKVDTSSNLFTTITVDEPAPGLKTIFSFKVPDQRSGKVEIQYLHDYAAVSSS  120

Query  431  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  610
            +GLT NPIVNFSGV+GTN  +LGTD+SFDTK+G F K NAG+S +  DLIASLTLN+KGD
Sbjct  121  IGLTVNPIVNFSGVIGTNVASLGTDLSFDTKTGDFIKCNAGVSLSKVDLIASLTLNNKGD  180

Query  611  SLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTITVGTQHQLDPLTTVKARVNNFGRANAL  790
            SL+ASYYH VNPL  TAVGAEV+HSFSSN NTIT+G QH LDPLTT+KARVNN G+A+AL
Sbjct  181  SLNASYYHIVNPL--TAVGAEVSHSFSSNDNTITIGAQHALDPLTTLKARVNNAGKASAL  238

Query  791  IQHEWRPKSLITLSGEVDVKAVDKSAKFGLALALKP  898
            +QHEWRPKS  T+SGEVD KA++K+AK GLALALKP
Sbjct  239  VQHEWRPKSFFTVSGEVDTKAIEKTAKVGLALALKP  274



>sp|P42054.2|VDAC_PEA RecName: Full=Outer plastidial membrane protein porin; AltName: 
Full=Voltage-dependent anion-selective channel protein; Short=VDAC 
[Pisum sativum]
 emb|CAA80988.1| Porin [Pisum sativum]
Length=276

 Score =   435 bits (1119),  Expect = 6e-149, Method: Compositional matrix adjust.
 Identities = 209/276 (76%), Positives = 240/276 (87%), Gaps = 0/276 (0%)
 Frame = +2

Query  71   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  250
            M KGPGLYTDIGKKARDLLY+DY +D KFTI+TYSPTGV ITS+G+KKG+LFLGDVNTQL
Sbjct  1    MVKGPGLYTDIGKKARDLLYKDYHSDKKFTISTYSPTGVAITSSGTKKGELFLGDVNTQL  60

Query  251  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  430
            KNKNITTD KVDTNSN+FTTITV+E APG+K I SF+VP+Q SGKVELQYLH++AGIS+S
Sbjct  61   KNKNITTDIKVDTNSNLFTTITVNEPAPGVKAILSFKVPEQTSGKVELQYLHEYAGISSS  120

Query  431  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  610
            VGL ANPIVNFS V+GTNALA G D+SFDTK G  TK NA ++F   DLI SLTLN+KGD
Sbjct  121  VGLKANPIVNFSSVIGTNALAFGADISFDTKLGELTKSNAAVNFVKDDLIGSLTLNEKGD  180

Query  611  SLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTITVGTQHQLDPLTTVKARVNNFGRANAL  790
             LSASYYH +NPLSNTAVG +++H FS+  NT T+GTQH LDPLTTVK RV N G+A+AL
Sbjct  181  LLSASYYHAINPLSNTAVGVDISHRFSTKENTFTLGTQHALDPLTTVKGRVTNSGKASAL  240

Query  791  IQHEWRPKSLITLSGEVDVKAVDKSAKFGLALALKP  898
            IQHEWRPKSLIT+S EVD KA++KSAK GL+LALKP
Sbjct  241  IQHEWRPKSLITISSEVDTKAIEKSAKIGLSLALKP  276



>gb|KHG01383.1| Mitochondrial outer membrane porin of 36 kDa [Gossypium arboreum]
 gb|KHG16984.1| Mitochondrial outer membrane porin of 36 kDa [Gossypium arboreum]
Length=270

 Score =   434 bits (1116),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 210/276 (76%), Positives = 245/276 (89%), Gaps = 6/276 (2%)
 Frame = +2

Query  71   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  250
            MGKGPGLYTDIGKKARDLLY+DYQ DHKFT+TTY+  GV ITSTG+KKG+L L D++T+L
Sbjct  1    MGKGPGLYTDIGKKARDLLYKDYQADHKFTLTTYTSNGVAITSTGTKKGELLLADISTEL  60

Query  251  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  430
            KNKNITT+ K+      F T+TVDE APGLK I SF  PDQRSGKVELQY H++AGISTS
Sbjct  61   KNKNITTNVKL------FATVTVDEPAPGLKTIFSFIAPDQRSGKVELQYQHEYAGISTS  114

Query  431  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  610
            +GLTANP+VNFSGVVG N++ +GTD+SFDT SG FTK NAGL+FT+SDLIASLTLNDKGD
Sbjct  115  IGLTANPLVNFSGVVGNNSVTVGTDLSFDTASGNFTKLNAGLNFTHSDLIASLTLNDKGD  174

Query  611  SLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTITVGTQHQLDPLTTVKARVNNFGRANAL  790
            +L+ASYYH V+PL+NTAVGAE++HSFSSN NT+T+GTQH LDPLTTVKAR+NN+GRA+AL
Sbjct  175  TLNASYYHIVSPLTNTAVGAELSHSFSSNENTLTIGTQHALDPLTTVKARLNNYGRASAL  234

Query  791  IQHEWRPKSLITLSGEVDVKAVDKSAKFGLALALKP  898
            IQHEWRPKSLIT+SGEVD  A++KSAK GLALALKP
Sbjct  235  IQHEWRPKSLITISGEVDTGAIEKSAKVGLALALKP  270



>ref|XP_009131920.1| PREDICTED: mitochondrial outer membrane protein porin 1 [Brassica 
rapa]
Length=276

 Score =   434 bits (1117),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 215/276 (78%), Positives = 237/276 (86%), Gaps = 0/276 (0%)
 Frame = +2

Query  71   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  250
            MGKGPGLYTDIGKKARDLLY+D+ +D K +ITTYSP GV ITSTG+KKG+  LGDV  QL
Sbjct  1    MGKGPGLYTDIGKKARDLLYKDHNSDQKLSITTYSPAGVAITSTGTKKGESLLGDVVFQL  60

Query  251  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  430
            K KNITTDFKV T++ V  T TVDEAAPGLK I SF+ PDQ SGK+ELQYLHD+AGISTS
Sbjct  61   KQKNITTDFKVSTDNTVLITATVDEAAPGLKSIFSFKAPDQNSGKIELQYLHDYAGISTS  120

Query  431  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  610
            +GLT NP VNFSGV+G NALA+GTDVSFDTKSG FTK NAGL+FT  DLIASLTLNDKGD
Sbjct  121  MGLTQNPTVNFSGVIGNNALAVGTDVSFDTKSGNFTKINAGLNFTKDDLIASLTLNDKGD  180

Query  611  SLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTITVGTQHQLDPLTTVKARVNNFGRANAL  790
            S++ASYYH VNPL NTAVGAEVNH FSS VNTITVGTQH +DPLT VKARVN+ G ANAL
Sbjct  181  SVNASYYHIVNPLFNTAVGAEVNHKFSSKVNTITVGTQHSIDPLTMVKARVNSAGIANAL  240

Query  791  IQHEWRPKSLITLSGEVDVKAVDKSAKFGLALALKP  898
            IQHEW PKS  T+SGEVD KA+DKSAK GLAL+LKP
Sbjct  241  IQHEWSPKSFFTVSGEVDTKAIDKSAKVGLALSLKP  276



>emb|CDY28690.1| BnaCnng05760D [Brassica napus]
Length=276

 Score =   434 bits (1116),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 215/276 (78%), Positives = 237/276 (86%), Gaps = 0/276 (0%)
 Frame = +2

Query  71   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  250
            MGKGPGLYTDIGKKARDLLY+D+ +D K +ITTYSP GV ITSTG+KKG+  LGDV  QL
Sbjct  1    MGKGPGLYTDIGKKARDLLYKDHNSDQKLSITTYSPAGVAITSTGTKKGESLLGDVVFQL  60

Query  251  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  430
            K KNITTDFKV T++ V  T TVDEAAPGLK I SF+ PDQ SGK+ELQYLHD+AGISTS
Sbjct  61   KQKNITTDFKVSTDNTVLITATVDEAAPGLKSIFSFKAPDQNSGKIELQYLHDYAGISTS  120

Query  431  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  610
            +GLT NP VNFSGVVG N LALGTDVSFDTKSG+FTK NAGL+FT  DLIASLTLNDKGD
Sbjct  121  MGLTQNPTVNFSGVVGNNLLALGTDVSFDTKSGSFTKINAGLNFTKDDLIASLTLNDKGD  180

Query  611  SLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTITVGTQHQLDPLTTVKARVNNFGRANAL  790
            S++ASYYH VNPL NTAVGAEVNH F+S VNTITVGTQH +DPLT VKARVN+ G ANAL
Sbjct  181  SVNASYYHIVNPLFNTAVGAEVNHKFASKVNTITVGTQHSIDPLTMVKARVNSAGIANAL  240

Query  791  IQHEWRPKSLITLSGEVDVKAVDKSAKFGLALALKP  898
            IQHEW PKS  T+SGEVD KA+DKSAK GLAL+LKP
Sbjct  241  IQHEWSPKSFFTVSGEVDTKAIDKSAKVGLALSLKP  276



>ref|XP_011071026.1| PREDICTED: mitochondrial outer membrane protein porin of 36 kDa-like 
[Sesamum indicum]
Length=278

 Score =   434 bits (1117),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 207/274 (76%), Positives = 243/274 (89%), Gaps = 0/274 (0%)
 Frame = +2

Query  77   KGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQLKN  256
            KGPGLY+DIGK+ARDLLY+DYQ D KFT+TT +  GV+ITS+G+KKG+LFL DVNTQLKN
Sbjct  5    KGPGLYSDIGKRARDLLYKDYQGDQKFTLTTCTSNGVIITSSGTKKGELFLADVNTQLKN  64

Query  257  KNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTSVG  436
            KNITTD KVDTNSNV TTITVDE APG+K I SF  PDQ+SGKVELQYLH++AGISTS+G
Sbjct  65   KNITTDVKVDTNSNVHTTITVDEPAPGVKAIFSFVAPDQKSGKVELQYLHEYAGISTSLG  124

Query  437  LTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGDSL  616
            LTA PIVNFSGV G +  A GTD+SFDT +G FTKYNAG+SFT +DLIASL LNDKG ++
Sbjct  125  LTAKPIVNFSGVAGNHKAAFGTDISFDTATGNFTKYNAGVSFTTTDLIASLILNDKGQTV  184

Query  617  SASYYHHVNPLSNTAVGAEVNHSFSSNVNTITVGTQHQLDPLTTVKARVNNFGRANALIQ  796
            +ASY+H ++PL+NTAVGAE+ HSFSSN NT+T+GTQH LDPLT+VKARVNN GRA+ALIQ
Sbjct  185  TASYFHTISPLTNTAVGAELTHSFSSNENTLTIGTQHSLDPLTSVKARVNNHGRASALIQ  244

Query  797  HEWRPKSLITLSGEVDVKAVDKSAKFGLALALKP  898
            HEWRPKSLIT+SGEVD +A++KSAK GLA+ALKP
Sbjct  245  HEWRPKSLITISGEVDTRAIEKSAKIGLAVALKP  278



>ref|XP_002517470.1| voltage-dependent anion-selective channel, putative [Ricinus 
communis]
 gb|EEF45012.1| voltage-dependent anion-selective channel, putative [Ricinus 
communis]
Length=274

 Score =   434 bits (1115),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 208/276 (75%), Positives = 241/276 (87%), Gaps = 2/276 (1%)
 Frame = +2

Query  71   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  250
            MGKGPGLYT+IGKKARDLLY+DYQTD KFTITTYSPTGV ITSTG KKG+LFL DVNTQL
Sbjct  1    MGKGPGLYTEIGKKARDLLYKDYQTDQKFTITTYSPTGVAITSTGVKKGELFLADVNTQL  60

Query  251  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  430
            K KN+TTD KVDT+SN+FTT TVDE APGLK I S ++PDQRSGK+E+QYLHD+A +S+S
Sbjct  61   KQKNVTTDIKVDTDSNLFTTTTVDELAPGLKTILSCKLPDQRSGKLEIQYLHDYAAVSSS  120

Query  431  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  610
            VGL  NP VNFSGV+GTN ++LGT++SFDTKSG FTK NAG S++N+DLIASLTLNDKGD
Sbjct  121  VGLAPNPTVNFSGVIGTNVVSLGTELSFDTKSGNFTKCNAGFSYSNADLIASLTLNDKGD  180

Query  611  SLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTITVGTQHQLDPLTTVKARVNNFGRANAL  790
            SL ASYY  VNP+   AVGAEV+HSFS+N NTIT+G+QH LDPLTT+K RVNNFG+A+AL
Sbjct  181  SLKASYYQIVNPVH--AVGAEVSHSFSTNENTITLGSQHALDPLTTMKTRVNNFGKASAL  238

Query  791  IQHEWRPKSLITLSGEVDVKAVDKSAKFGLALALKP  898
             QHEWRPKS IT+S EVD KA++ + K GLALALKP
Sbjct  239  FQHEWRPKSFITVSAEVDTKAIESNPKIGLALALKP  274



>ref|XP_011086392.1| PREDICTED: mitochondrial outer membrane protein porin of 36 kDa 
[Sesamum indicum]
Length=278

 Score =   434 bits (1115),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 205/274 (75%), Positives = 241/274 (88%), Gaps = 0/274 (0%)
 Frame = +2

Query  77   KGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQLKN  256
            KGPGLY+DIGKKARDLLYRDYQ D KFT+TTY+  GV ITS+G++KGDLFL D+NTQLKN
Sbjct  5    KGPGLYSDIGKKARDLLYRDYQGDQKFTLTTYTSNGVAITSSGTRKGDLFLADINTQLKN  64

Query  257  KNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTSVG  436
            KNITTD KVDT SNV+TTITVDE APG+K I SF  PDQ+SGKVELQY H+HAGISTS+G
Sbjct  65   KNITTDVKVDTYSNVYTTITVDEPAPGVKAIVSFVAPDQKSGKVELQYFHEHAGISTSLG  124

Query  437  LTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGDSL  616
            LTA PIVNFSGV G    A GTD+SFDT +G FTK NAG+SFT +DLIASL LNDKG+++
Sbjct  125  LTAKPIVNFSGVAGNQKAAFGTDISFDTATGNFTKCNAGVSFTTTDLIASLMLNDKGETV  184

Query  617  SASYYHHVNPLSNTAVGAEVNHSFSSNVNTITVGTQHQLDPLTTVKARVNNFGRANALIQ  796
            +ASY+H V+PL+NTAVGAE+ HSFS+N NT+T+GTQH LDPLT+VKARVNN+G+ +ALIQ
Sbjct  185  TASYFHTVSPLTNTAVGAELTHSFSTNENTLTIGTQHLLDPLTSVKARVNNYGKVSALIQ  244

Query  797  HEWRPKSLITLSGEVDVKAVDKSAKFGLALALKP  898
            HEWRPKSLIT+SGEVD +A++KSAK GLA+ALKP
Sbjct  245  HEWRPKSLITISGEVDTRAIEKSAKVGLAVALKP  278



>emb|CDY66736.1| BnaCnng52100D [Brassica napus]
Length=276

 Score =   433 bits (1114),  Expect = 3e-148, Method: Compositional matrix adjust.
 Identities = 214/276 (78%), Positives = 238/276 (86%), Gaps = 0/276 (0%)
 Frame = +2

Query  71   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  250
            MGKGPG YTDIGKKARDLLY+D+ +D K +ITT+SP GV ITSTG+KKGD  LGDV+ QL
Sbjct  1    MGKGPGRYTDIGKKARDLLYKDHNSDQKLSITTHSPAGVAITSTGTKKGDSLLGDVSLQL  60

Query  251  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  430
            K KNITTD KV T+S V  T TVDEAAPGLK I SFR PDQ SGK+ELQYLH++AGISTS
Sbjct  61   KQKNITTDLKVSTDSTVLITATVDEAAPGLKSIFSFRAPDQNSGKIELQYLHEYAGISTS  120

Query  431  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  610
            +GLT NP VNFSGVVGTN LALGTDVSFDTKSG FTK NAG++FT  DLIASLTLNDKGD
Sbjct  121  MGLTQNPTVNFSGVVGTNVLALGTDVSFDTKSGNFTKINAGVNFTKDDLIASLTLNDKGD  180

Query  611  SLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTITVGTQHQLDPLTTVKARVNNFGRANAL  790
            S++ASYYH VNPL NTAVGAEVNH FS+NVNTITVGTQH LDPLTTVKARVN+ G ANAL
Sbjct  181  SVNASYYHIVNPLFNTAVGAEVNHKFSTNVNTITVGTQHSLDPLTTVKARVNSAGIANAL  240

Query  791  IQHEWRPKSLITLSGEVDVKAVDKSAKFGLALALKP  898
            IQH+W P+S  T+SGEVD KA+DK+AK GLAL+LKP
Sbjct  241  IQHQWTPRSFFTISGEVDTKAIDKNAKVGLALSLKP  276



>ref|XP_006408480.1| hypothetical protein EUTSA_v10021076mg [Eutrema salsugineum]
 gb|ESQ49933.1| hypothetical protein EUTSA_v10021076mg [Eutrema salsugineum]
Length=341

 Score =   435 bits (1119),  Expect = 5e-148, Method: Compositional matrix adjust.
 Identities = 220/298 (74%), Positives = 244/298 (82%), Gaps = 10/298 (3%)
 Frame = +2

Query  35   RLCFRFS----------ALAAEMGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTG  184
            RL  RFS             A+M KGPGLYTDIGKKARDLLY+D+ +D K +ITTYSP G
Sbjct  44   RLYLRFSDSVELSFLSFTTEAKMVKGPGLYTDIGKKARDLLYKDHNSDQKLSITTYSPAG  103

Query  185  VVITSTGSKKGDLFLGDVNTQLKNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRV  364
            V ITSTG+KKGDL LGDV  Q K KNITTDFKV T+S V  T TVDEAAPGLK I SF+V
Sbjct  104  VAITSTGTKKGDLLLGDVAFQSKQKNITTDFKVCTDSTVLITATVDEAAPGLKSIFSFKV  163

Query  365  PDQRSGKVELQYLHDHAGISTSVGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKY  544
            PDQ SGK+ELQYLHD+AGISTS+GLT NP VNFSGV+G+N +ALGTDVSFDTKSG FTK 
Sbjct  164  PDQNSGKIELQYLHDYAGISTSMGLTQNPTVNFSGVIGSNVVALGTDVSFDTKSGNFTKI  223

Query  545  NAGLSFTNSDLIASLTLNDKGDSLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTITVGTQ  724
            NAGLSFT  DLIASLTLN+KGD+++ SYYH VNPL NTAVGAEV+H FSS  NTITVGTQ
Sbjct  224  NAGLSFTKDDLIASLTLNEKGDAMNLSYYHIVNPLFNTAVGAEVSHKFSSKDNTITVGTQ  283

Query  725  HQLDPLTTVKARVNNFGRANALIQHEWRPKSLITLSGEVDVKAVDKSAKFGLALALKP  898
            H LDPLT+VKARVN+ G A+ALIQHEWRPKS  T+SGEVD KA+DKSAK GLALALKP
Sbjct  284  HSLDPLTSVKARVNSAGIASALIQHEWRPKSFFTISGEVDTKAIDKSAKVGLALALKP  341



>ref|XP_009125035.1| PREDICTED: mitochondrial outer membrane protein porin 1-like 
[Brassica rapa]
Length=276

 Score =   432 bits (1112),  Expect = 5e-148, Method: Compositional matrix adjust.
 Identities = 215/276 (78%), Positives = 236/276 (86%), Gaps = 0/276 (0%)
 Frame = +2

Query  71   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  250
            MGKGPGLYTDIGKKARDLLY+D+ +D K +ITTYSP GV ITSTG+KKG+  LGD   QL
Sbjct  1    MGKGPGLYTDIGKKARDLLYKDHNSDQKLSITTYSPAGVAITSTGTKKGESLLGDGGFQL  60

Query  251  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  430
            K KNITTDFKV T++ V  T TVDEAAPGLK I SF+ PDQ SGK+ELQYLHD+AGISTS
Sbjct  61   KQKNITTDFKVSTDNTVLITATVDEAAPGLKSIFSFKAPDQNSGKIELQYLHDYAGISTS  120

Query  431  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  610
            +GLT NP VNFSGVVG N LALGTDVSFDTKSG+FTK NAGL+FT  DLIASLTLNDKGD
Sbjct  121  MGLTQNPTVNFSGVVGNNLLALGTDVSFDTKSGSFTKINAGLNFTKDDLIASLTLNDKGD  180

Query  611  SLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTITVGTQHQLDPLTTVKARVNNFGRANAL  790
            S++ASYYH VNPL NTAVGAEVNH FSS VNTITVGTQH +DPLT VKARVN+ G ANAL
Sbjct  181  SVNASYYHIVNPLFNTAVGAEVNHKFSSKVNTITVGTQHSIDPLTMVKARVNSAGIANAL  240

Query  791  IQHEWRPKSLITLSGEVDVKAVDKSAKFGLALALKP  898
            IQHEW PKS  T+SGEVD KA+DKSAK GLAL+LKP
Sbjct  241  IQHEWSPKSFFTVSGEVDTKAIDKSAKVGLALSLKP  276



>ref|XP_010670319.1| PREDICTED: mitochondrial outer membrane protein porin of 34 kDa-like 
[Beta vulgaris subsp. vulgaris]
Length=276

 Score =   431 bits (1109),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 201/276 (73%), Positives = 240/276 (87%), Gaps = 0/276 (0%)
 Frame = +2

Query  71   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  250
            M KGPGLYTDIGKKARDLLY+DYQTD KF+ITTYS TGV +TS G+K+GDLF GDV+T+L
Sbjct  1    MAKGPGLYTDIGKKARDLLYKDYQTDQKFSITTYSATGVALTSCGTKEGDLFFGDVSTKL  60

Query  251  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  430
            K  NITTD KVDTNSN+ TTITVD AAPGLK I SF+VPDQRSGK+ELQYLHD+ G+ TS
Sbjct  61   KKNNITTDIKVDTNSNLVTTITVDGAAPGLKTILSFKVPDQRSGKLELQYLHDYVGVCTS  120

Query  431  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  610
            VG TANPIVNFSGV+GTN +ALGTDVSFDTK+G FTKYNAGLSF + DLIA+LT NDKG+
Sbjct  121  VGATANPIVNFSGVIGTNMVALGTDVSFDTKTGNFTKYNAGLSFASEDLIAALTFNDKGN  180

Query  611  SLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTITVGTQHQLDPLTTVKARVNNFGRANAL  790
            +L+AS+YH+VNP++  ++GAEV HS S+  NT+T+G QH LDPLT VKAR+NN G+A+AL
Sbjct  181  NLNASFYHYVNPMTKLSIGAEVTHSLSTKENTVTLGAQHALDPLTNVKARINNLGKASAL  240

Query  791  IQHEWRPKSLITLSGEVDVKAVDKSAKFGLALALKP  898
            +QHEWRP S +T+S EVD +A++K+AK GLALALKP
Sbjct  241  LQHEWRPMSTVTVSAEVDTRAIEKTAKVGLALALKP  276



>gb|EYU22439.1| hypothetical protein MIMGU_mgv1a011543mg [Erythranthe guttata]
Length=278

 Score =   431 bits (1109),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 205/274 (75%), Positives = 241/274 (88%), Gaps = 0/274 (0%)
 Frame = +2

Query  77   KGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQLKN  256
            KGPGLY DIGK+ARDLLY+DYQ DHKFT+TTYS  G+ ITSTG+KKG+L LGDVNTQLKN
Sbjct  5    KGPGLYPDIGKRARDLLYKDYQGDHKFTLTTYSSNGLAITSTGTKKGELILGDVNTQLKN  64

Query  257  KNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTSVG  436
            KNITTD KVDTNSNV TTITVDE APG+K I SF  PDQ+SGKVELQY H++A ISTS+G
Sbjct  65   KNITTDLKVDTNSNVCTTITVDEPAPGVKAIISFAAPDQKSGKVELQYFHEYAAISTSLG  124

Query  437  LTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGDSL  616
            LTA PIVNFSGV G++  A GTDVSFDT +G FTKYNAG+SFT +DLIAS  LNDKG SL
Sbjct  125  LTAKPIVNFSGVAGSHKAAFGTDVSFDTATGNFTKYNAGVSFTTTDLIASFILNDKGQSL  184

Query  617  SASYYHHVNPLSNTAVGAEVNHSFSSNVNTITVGTQHQLDPLTTVKARVNNFGRANALIQ  796
            +ASY+H V+PL+NTAVGAE+ HSF+SN NT+T+GTQH LD LT+VKAR+NN+G+A+ALIQ
Sbjct  185  TASYFHTVSPLTNTAVGAELTHSFTSNENTLTIGTQHSLDHLTSVKARLNNYGKASALIQ  244

Query  797  HEWRPKSLITLSGEVDVKAVDKSAKFGLALALKP  898
            H+WRPKSL+T+SGEVD +A+DK+AK GLA+ALKP
Sbjct  245  HQWRPKSLVTISGEVDTRAIDKTAKIGLAVALKP  278



>ref|XP_004489372.1| PREDICTED: outer plastidial membrane protein porin-like [Cicer 
arietinum]
Length=276

 Score =   429 bits (1103),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 205/276 (74%), Positives = 239/276 (87%), Gaps = 0/276 (0%)
 Frame = +2

Query  71   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  250
            M KGPGLY+DIGKKARDLLYRDY +D KFTITTYSPTGV ITS+G+KKG+LF+ DVNTQL
Sbjct  1    MAKGPGLYSDIGKKARDLLYRDYNSDQKFTITTYSPTGVAITSSGTKKGELFVADVNTQL  60

Query  251  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  430
            KN+NITTD KVDT+SN+ TTITV+E APG+K + SFR+PDQRSGKVE+QYLHD+ GI  S
Sbjct  61   KNRNITTDIKVDTDSNLSTTITVNEPAPGVKTVLSFRIPDQRSGKVEVQYLHDYFGIGAS  120

Query  431  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  610
            VGLTANPI+N SG +GTN +ALG D+++DTK G FTK N GL+FT  DL+ASLTL DKGD
Sbjct  121  VGLTANPIINVSGTLGTNVIALGHDLTYDTKIGEFTKLNTGLNFTKDDLVASLTLTDKGD  180

Query  611  SLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTITVGTQHQLDPLTTVKARVNNFGRANAL  790
             L+ASYYH VN L+ TAVGAEV H FS+  NT+T+GTQH LDPLTTVKAR NNFG+ANAL
Sbjct  181  VLNASYYHVVNHLTKTAVGAEVTHRFSNTENTLTLGTQHALDPLTTVKARFNNFGKANAL  240

Query  791  IQHEWRPKSLITLSGEVDVKAVDKSAKFGLALALKP  898
            IQHEWRP+S +T+SGEVD KA++KSAK GLALALKP
Sbjct  241  IQHEWRPRSFLTISGEVDTKAIEKSAKVGLALALKP  276



>ref|XP_009147408.1| PREDICTED: mitochondrial outer membrane protein porin 1-like 
[Brassica rapa]
Length=276

 Score =   429 bits (1102),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 212/276 (77%), Positives = 237/276 (86%), Gaps = 0/276 (0%)
 Frame = +2

Query  71   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  250
            MGKGPGLYTDIGKKA+DLLY+D+ +D KF+ITT SP GV ITS+G+KKGD  LGDV+ QL
Sbjct  1    MGKGPGLYTDIGKKAKDLLYKDHNSDQKFSITTQSPAGVGITSSGTKKGDSLLGDVSLQL  60

Query  251  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  430
            K KNITTD KV T++ V  T TVDEAAPGLK I SFR PDQ SGK+ELQYLH++AGISTS
Sbjct  61   KQKNITTDLKVSTDNTVLITATVDEAAPGLKSIFSFRAPDQNSGKIELQYLHEYAGISTS  120

Query  431  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  610
            +GLT NP VNFS V+GTN LA GTDVSFDTKSG FTK NAGLSFT  DLIASLTLNDKGD
Sbjct  121  MGLTQNPTVNFSAVMGTNVLAAGTDVSFDTKSGNFTKINAGLSFTKDDLIASLTLNDKGD  180

Query  611  SLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTITVGTQHQLDPLTTVKARVNNFGRANAL  790
            S++ASYYH VNPL NTAVGAEVNH FS+NVNTITVGTQH LDPLTTVKARVN+ G ANAL
Sbjct  181  SVNASYYHIVNPLFNTAVGAEVNHKFSTNVNTITVGTQHSLDPLTTVKARVNSAGIANAL  240

Query  791  IQHEWRPKSLITLSGEVDVKAVDKSAKFGLALALKP  898
            IQH+W P+S  T+SGEVD KA+DK+AK GLAL+LKP
Sbjct  241  IQHQWTPRSFFTISGEVDTKAIDKNAKVGLALSLKP  276



>gb|KHN45480.1| Mitochondrial outer membrane protein porin of 34 kDa [Glycine 
soja]
Length=267

 Score =   428 bits (1100),  Expect = 3e-146, Method: Compositional matrix adjust.
 Identities = 208/260 (80%), Positives = 233/260 (90%), Gaps = 0/260 (0%)
 Frame = +2

Query  119  DLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQLKNKNITTDFKVDTNSN  298
            DLL++DY +D KFTITTYSPTGV ITS+G+KKGDLF+ DVNTQLKNKNITTD KVDT SN
Sbjct  8    DLLFKDYHSDQKFTITTYSPTGVAITSSGTKKGDLFVADVNTQLKNKNITTDIKVDTGSN  67

Query  299  VFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTSVGLTANPIVNFSGVVG  478
            +FTTITV+E APGLK I SFRVPDQRSGKVE+QYLHD+AGISTSVGLTANPIVNFSGVVG
Sbjct  68   LFTTITVNEPAPGLKTIFSFRVPDQRSGKVEVQYLHDYAGISTSVGLTANPIVNFSGVVG  127

Query  479  TNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGDSLSASYYHHVNPLSNT  658
            TN LALGTDVSFDTK G  TK+NAGL+FT  DL+ASLT+N+KGDSL+ASYYH VN L+NT
Sbjct  128  TNVLALGTDVSFDTKIGELTKFNAGLNFTKDDLVASLTVNNKGDSLNASYYHTVNRLTNT  187

Query  659  AVGAEVNHSFSSNVNTITVGTQHQLDPLTTVKARVNNFGRANALIQHEWRPKSLITLSGE  838
            AVGAEV H FS+N NT+T+GTQH LDPLTTVKARVNN G+ANALIQHEWRP+S  T+SGE
Sbjct  188  AVGAEVTHQFSTNENTLTLGTQHALDPLTTVKARVNNLGKANALIQHEWRPRSFFTISGE  247

Query  839  VDVKAVDKSAKFGLALALKP  898
            VD KA++KSAK GL LALKP
Sbjct  248  VDTKAIEKSAKVGLGLALKP  267



>ref|XP_006298185.1| hypothetical protein CARUB_v10014234mg, partial [Capsella rubella]
 gb|EOA31083.1| hypothetical protein CARUB_v10014234mg, partial [Capsella rubella]
Length=309

 Score =   429 bits (1103),  Expect = 5e-146, Method: Compositional matrix adjust.
 Identities = 212/278 (76%), Positives = 238/278 (86%), Gaps = 0/278 (0%)
 Frame = +2

Query  65   AEMGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNT  244
            A M KGPGLYT+IGKKARDLLYRD+ +D KF+ITTYSP GV ITS+G+KKGDL LGDV  
Sbjct  32   ATMVKGPGLYTEIGKKARDLLYRDHNSDQKFSITTYSPAGVAITSSGTKKGDLLLGDVAF  91

Query  245  QLKNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGIS  424
            Q + KN+TTDFKV T+S V  T TVDEAAPGLK I SF+ PDQ SGK+ELQYLHD+AGIS
Sbjct  92   QSRQKNVTTDFKVCTDSTVLITATVDEAAPGLKSIFSFKAPDQNSGKIELQYLHDYAGIS  151

Query  425  TSVGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDK  604
            TS+GLT NP VNFSGV+GTN LA+GTDVSFDTKSG FTK NAGLSFT  DLIASLT+N+K
Sbjct  152  TSMGLTQNPTVNFSGVIGTNVLAVGTDVSFDTKSGNFTKINAGLSFTKDDLIASLTVNEK  211

Query  605  GDSLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTITVGTQHQLDPLTTVKARVNNFGRAN  784
            GD L+ASYYH VNPL NTAVGAEV+H FSS  NTITVGTQH LDPLT+VKARVN+ G A+
Sbjct  212  GDLLNASYYHIVNPLFNTAVGAEVSHKFSSKDNTITVGTQHSLDPLTSVKARVNSAGIAS  271

Query  785  ALIQHEWRPKSLITLSGEVDVKAVDKSAKFGLALALKP  898
            ALIQHEWRPKS  T+SGEVD KA+DK+A+ GLALALKP
Sbjct  272  ALIQHEWRPKSFFTISGEVDTKAIDKNARVGLALALKP  309



>gb|AAQ87021.1| VDAC1.3 [Lotus japonicus]
Length=276

 Score =   427 bits (1099),  Expect = 6e-146, Method: Compositional matrix adjust.
 Identities = 205/276 (74%), Positives = 245/276 (89%), Gaps = 0/276 (0%)
 Frame = +2

Query  71   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  250
            M KGPGLY+DIGKKARDLL++DYQ DHKFTITTY+  GV ITSTG KKG+++L DV+T+L
Sbjct  1    MVKGPGLYSDIGKKARDLLFKDYQNDHKFTITTYTSAGVEITSTGVKKGEIYLADVSTKL  60

Query  251  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  430
            KNKNITTD KVDTNSN+ TTITVDE APGLK I SF  PDQ+SGKVELQY H++AGISTS
Sbjct  61   KNKNITTDVKVDTNSNLHTTITVDEPAPGLKTIFSFIFPDQKSGKVELQYQHEYAGISTS  120

Query  431  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  610
            +GLTA+PIVNFSG++G N +A+GTD+SFDT SG FTKYNAGL+ T++DLIASLTLNDKGD
Sbjct  121  IGLTASPIVNFSGIIGNNLVAVGTDLSFDTASGNFTKYNAGLNVTHADLIASLTLNDKGD  180

Query  611  SLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTITVGTQHQLDPLTTVKARVNNFGRANAL  790
            SL+ASYYH V+PL+NTAVGAE++HSFSSN N +T+GTQH LDP+T +KARVNN+GRA+AL
Sbjct  181  SLNASYYHVVSPLTNTAVGAELSHSFSSNENILTIGTQHALDPITLLKARVNNYGRASAL  240

Query  791  IQHEWRPKSLITLSGEVDVKAVDKSAKFGLALALKP  898
            IQHEW P++ ++L GEVD  A++KSAK GLALALKP
Sbjct  241  IQHEWNPRTRVSLVGEVDTGAIEKSAKVGLALALKP  276



>emb|CDY68122.1| BnaA05g37480D [Brassica napus]
Length=276

 Score =   427 bits (1098),  Expect = 7e-146, Method: Compositional matrix adjust.
 Identities = 211/276 (76%), Positives = 236/276 (86%), Gaps = 0/276 (0%)
 Frame = +2

Query  71   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  250
            MGKGPGLYTDIGKKA+DLLY+D+ +D KF+ITT SP GV ITS+G+KKGD  LGDV+ QL
Sbjct  1    MGKGPGLYTDIGKKAKDLLYKDHNSDQKFSITTQSPAGVGITSSGTKKGDSLLGDVSLQL  60

Query  251  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  430
            K KNITTD KV T++ V  T TVDEAAPGLK I SFR PDQ SGK+ELQYLH++AGISTS
Sbjct  61   KQKNITTDLKVSTDNTVLITATVDEAAPGLKSIFSFRAPDQNSGKIELQYLHEYAGISTS  120

Query  431  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  610
            +GLT NP VNFS V+GTN LA GTDVSFDTKSG FTK NAGLSFT  DL+ASLTLNDKGD
Sbjct  121  MGLTQNPTVNFSAVMGTNVLAAGTDVSFDTKSGNFTKINAGLSFTKDDLVASLTLNDKGD  180

Query  611  SLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTITVGTQHQLDPLTTVKARVNNFGRANAL  790
            S++ASYYH VNPL NTAVGAEVNH FS+NVNTITVGTQH LDPLTTVKARVN+ G ANAL
Sbjct  181  SVNASYYHIVNPLFNTAVGAEVNHKFSTNVNTITVGTQHSLDPLTTVKARVNSAGIANAL  240

Query  791  IQHEWRPKSLITLSGEVDVKAVDKSAKFGLALALKP  898
            IQH+W P S  T+SGEVD KA+DK+AK GLAL+LKP
Sbjct  241  IQHQWTPSSFFTISGEVDTKAIDKNAKVGLALSLKP  276



>ref|XP_006842115.1| PREDICTED: mitochondrial outer membrane protein porin of 36 kDa 
[Amborella trichopoda]
 gb|ERN03790.1| hypothetical protein AMTR_s00078p00100600 [Amborella trichopoda]
Length=276

 Score =   427 bits (1098),  Expect = 8e-146, Method: Compositional matrix adjust.
 Identities = 202/276 (73%), Positives = 239/276 (87%), Gaps = 0/276 (0%)
 Frame = +2

Query  71   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  250
            MGKGPGLY++IGKKARDLLY+DY +D KF +TTY+ TGV ITS+G+KKGDLFL DV TQL
Sbjct  1    MGKGPGLYSEIGKKARDLLYKDYHSDQKFILTTYTSTGVAITSSGTKKGDLFLADVTTQL  60

Query  251  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  430
            KNKN+TTD KVDTNSN+ TTITVDEAAPGLK I S   PDQRSGKVELQYLHD+AGIS+S
Sbjct  61   KNKNVTTDIKVDTNSNLSTTITVDEAAPGLKTIFSCIFPDQRSGKVELQYLHDYAGISSS  120

Query  431  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  610
            +GLTA PIVNFSGV+G    ALGTDV+FDT +   TK NAG SFT SDLIA+ T+NDKG+
Sbjct  121  IGLTATPIVNFSGVLGNETFALGTDVAFDTATSKLTKCNAGFSFTTSDLIAAATVNDKGN  180

Query  611  SLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTITVGTQHQLDPLTTVKARVNNFGRANAL  790
            +L+ASYYH V+PL+ T+VGAE++HS S+N NT+T+GTQH LDPLTTVK R+NNFG+A+AL
Sbjct  181  TLTASYYHTVSPLTRTSVGAELSHSLSTNENTLTIGTQHSLDPLTTVKGRLNNFGKASAL  240

Query  791  IQHEWRPKSLITLSGEVDVKAVDKSAKFGLALALKP  898
            IQHEWRPKSL TL GEVD +A++KSAK GL++ALKP
Sbjct  241  IQHEWRPKSLFTLCGEVDARAIEKSAKVGLSVALKP  276



>gb|KFK37589.1| hypothetical protein AALP_AA3G002700 [Arabis alpina]
Length=276

 Score =   427 bits (1097),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 208/276 (75%), Positives = 235/276 (85%), Gaps = 0/276 (0%)
 Frame = +2

Query  71   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  250
            M KGPGLYTD+GKKARDL+Y+D+ +D KF+I+TYSPTGV ITSTG KKG+L +GDV  Q 
Sbjct  1    MVKGPGLYTDVGKKARDLIYKDHNSDQKFSISTYSPTGVAITSTGIKKGELLVGDVAFQS  60

Query  251  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  430
            K KN+TTD KV T+S V  T TVDEAAPGLK I SF+VPDQ SGK+ELQYLHD+AGISTS
Sbjct  61   KQKNVTTDLKVCTDSTVLVTATVDEAAPGLKSIFSFKVPDQNSGKIELQYLHDYAGISTS  120

Query  431  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  610
            +GLT NP VNFSGV+GTNALA+GTDVSFDTKSG FTK N GLSF   DLIASLTLN+KGD
Sbjct  121  MGLTQNPTVNFSGVIGTNALAIGTDVSFDTKSGNFTKINGGLSFIKEDLIASLTLNEKGD  180

Query  611  SLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTITVGTQHQLDPLTTVKARVNNFGRANAL  790
             L+ASYYHHVNPL NTAVGAEV+H FSS  NTITVGTQH LDPLT+VKARVN+ G A+AL
Sbjct  181  LLNASYYHHVNPLFNTAVGAEVSHKFSSKDNTITVGTQHSLDPLTSVKARVNSVGIASAL  240

Query  791  IQHEWRPKSLITLSGEVDVKAVDKSAKFGLALALKP  898
            IQHEW+PKS  T+ GEVD KA+DKSAK G A+ALKP
Sbjct  241  IQHEWKPKSFFTICGEVDTKAIDKSAKVGFAIALKP  276



>emb|CDY59668.1| BnaCnng35410D [Brassica napus]
Length=276

 Score =   426 bits (1096),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 207/276 (75%), Positives = 235/276 (85%), Gaps = 0/276 (0%)
 Frame = +2

Query  71   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  250
            MGKGPGLYT+IGKKARDLLY+DYQ D K +ITTYS TGV IT++G+ KGDLF+GDV TQ+
Sbjct  1    MGKGPGLYTEIGKKARDLLYKDYQGDQKLSITTYSSTGVSITTSGTNKGDLFVGDVATQV  60

Query  251  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  430
            KNKN T D KV ++S++ TT T DEA PGLK I S +VPDQ+S KVELQYLH HAGI TS
Sbjct  61   KNKNFTADIKVASDSSILTTFTYDEATPGLKTIVSAKVPDQKSAKVELQYLHPHAGICTS  120

Query  431  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  610
            VGLTANP+VNFSGV+GT+ LALGTDVSFDT+SG F  +NAG+SFT  DLIASLTLNDKG+
Sbjct  121  VGLTANPVVNFSGVIGTSVLALGTDVSFDTESGNFKHFNAGVSFTKDDLIASLTLNDKGE  180

Query  611  SLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTITVGTQHQLDPLTTVKARVNNFGRANAL  790
             L+ASYYH VNPL NT VGAEV+H+  S VN+ITVGTQH LDPLTTVKARVNN G ANAL
Sbjct  181  KLNASYYHIVNPLKNTVVGAEVSHNLKSQVNSITVGTQHALDPLTTVKARVNNAGIANAL  240

Query  791  IQHEWRPKSLITLSGEVDVKAVDKSAKFGLALALKP  898
            IQHEWRPKS IT+SGEVD KA++KSAK G ALALKP
Sbjct  241  IQHEWRPKSFITISGEVDSKAIEKSAKVGFALALKP  276



>ref|XP_004489166.1| PREDICTED: outer plastidial membrane protein porin-like [Cicer 
arietinum]
Length=276

 Score =   426 bits (1095),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 206/276 (75%), Positives = 237/276 (86%), Gaps = 0/276 (0%)
 Frame = +2

Query  71   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  250
            M KGPGLYTDIGKKARDLL++DY +D KF+ITTYSPTGV ITS+G+KKG+LFL DVNTQL
Sbjct  1    MAKGPGLYTDIGKKARDLLFKDYHSDQKFSITTYSPTGVAITSSGTKKGELFLADVNTQL  60

Query  251  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  430
            KNKN+TTD KVDT SN+FTTITV+E APG+K I SF+VPDQ SGKVELQYLHD+AG+S S
Sbjct  61   KNKNVTTDIKVDTESNLFTTITVNEPAPGVKAILSFKVPDQTSGKVELQYLHDYAGLSGS  120

Query  431  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  610
             GL ANPIVN S VVGTN LA+G D+SFDTK G  TK NAGLS+   DLIASLTLN+KGD
Sbjct  121  FGLKANPIVNLSSVVGTNVLAIGADLSFDTKLGELTKSNAGLSYAKDDLIASLTLNNKGD  180

Query  611  SLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTITVGTQHQLDPLTTVKARVNNFGRANAL  790
            +L+AS+YH VNPL+NTA G +VNH FS+  NT T+GTQH LD LTTVKARV N G+A+AL
Sbjct  181  ALNASFYHLVNPLTNTAFGVDVNHRFSTKENTFTLGTQHALDSLTTVKARVTNAGKASAL  240

Query  791  IQHEWRPKSLITLSGEVDVKAVDKSAKFGLALALKP  898
            IQHEWRPKSL T+SGEVD KA++KSAK GL+LALKP
Sbjct  241  IQHEWRPKSLFTISGEVDTKAIEKSAKVGLSLALKP  276



>gb|AAS48868.1| voltage-dependent anion-selective channel [Brassica rapa subsp. 
pekinensis]
 emb|CDY69321.1| BnaA10g29750D [Brassica napus]
Length=276

 Score =   426 bits (1095),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 206/276 (75%), Positives = 234/276 (85%), Gaps = 0/276 (0%)
 Frame = +2

Query  71   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  250
            MGKGPGLYT+IGKKARDLLY+DYQ D K +ITTYS TGV IT++G+ KGDLFLGDV TQ+
Sbjct  1    MGKGPGLYTEIGKKARDLLYKDYQGDQKLSITTYSSTGVAITTSGTNKGDLFLGDVVTQI  60

Query  251  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  430
            KNKN T D KV ++S++ TT T DEA PGLK I S +VPDQ+S KVELQY+H HAGI TS
Sbjct  61   KNKNFTADIKVASDSSILTTFTYDEATPGLKAIVSAKVPDQKSAKVELQYMHPHAGICTS  120

Query  431  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  610
            VGLTANP+VNFSGV+GT+ LALGTDVSFDT+SG F  +N G+SFT  DLIASLTLNDKG+
Sbjct  121  VGLTANPVVNFSGVIGTSVLALGTDVSFDTESGNFKHFNTGVSFTKDDLIASLTLNDKGE  180

Query  611  SLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTITVGTQHQLDPLTTVKARVNNFGRANAL  790
             L+ASYYH VNPL NT VGAEV+H+  S VN+ITVGTQH LDPLTTVKARVNN G ANAL
Sbjct  181  KLTASYYHIVNPLKNTVVGAEVSHNLKSQVNSITVGTQHALDPLTTVKARVNNAGIANAL  240

Query  791  IQHEWRPKSLITLSGEVDVKAVDKSAKFGLALALKP  898
            IQHEWRPKS IT+SGEVD KA++KSAK G ALALKP
Sbjct  241  IQHEWRPKSFITISGEVDSKAIEKSAKVGFALALKP  276



>ref|XP_002884286.1| hypothetical protein ARALYDRAFT_477400 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH60545.1| hypothetical protein ARALYDRAFT_477400 [Arabidopsis lyrata subsp. 
lyrata]
Length=276

 Score =   426 bits (1095),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 211/276 (76%), Positives = 237/276 (86%), Gaps = 0/276 (0%)
 Frame = +2

Query  71   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  250
            M KGPGLYT+IGKKARDLLY+D+ +D KF+ITT+SP GV ITSTG+KKGDL LGDV  Q 
Sbjct  1    MVKGPGLYTEIGKKARDLLYKDHNSDQKFSITTFSPAGVAITSTGTKKGDLLLGDVAFQS  60

Query  251  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  430
            + KNITTD KV T+S V  T TVDEAAPGLK I SF+VPDQ SGK+ELQYLHD+AGISTS
Sbjct  61   RQKNITTDLKVCTDSTVLITATVDEAAPGLKSIFSFKVPDQNSGKIELQYLHDYAGISTS  120

Query  431  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  610
            +GLT NP VNFSGV+GTN LA+GTDVSFDTKSG FTK NAGLSFT  DLIASLT+N+KGD
Sbjct  121  MGLTQNPTVNFSGVIGTNVLAVGTDVSFDTKSGNFTKINAGLSFTKDDLIASLTVNEKGD  180

Query  611  SLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTITVGTQHQLDPLTTVKARVNNFGRANAL  790
             L+ASYYH VNPL NTAVGAEV+H FSS  NTITVGTQH LDPLT+VKARVN+ G A+AL
Sbjct  181  LLNASYYHIVNPLFNTAVGAEVSHKFSSKDNTITVGTQHSLDPLTSVKARVNSAGIASAL  240

Query  791  IQHEWRPKSLITLSGEVDVKAVDKSAKFGLALALKP  898
            IQHEW+PKS  T+SGEVD K++DKSAK GLALALKP
Sbjct  241  IQHEWKPKSFFTISGEVDTKSIDKSAKVGLALALKP  276



>gb|KHG07129.1| Mitochondrial outer membrane protein porin of 34 kDa [Gossypium 
arboreum]
Length=344

 Score =   428 bits (1101),  Expect = 3e-145, Method: Compositional matrix adjust.
 Identities = 207/266 (78%), Positives = 236/266 (89%), Gaps = 5/266 (2%)
 Frame = +2

Query  101  IGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQLKNKNITTDFK  280
            IGKKARDLLY+DYQTD KFT+TT SPTGV ITS G+KKGDLFL DVNTQLK++N+TTD K
Sbjct  84   IGKKARDLLYKDYQTDQKFTLTTSSPTGVAITSAGTKKGDLFLADVNTQLKSRNVTTDIK  143

Query  281  VDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTSVGLTANPIVN  460
            VDT+SN      +DE APGLK I  FRVPDQRSGK+ELQYLH++AGIS+S+GLTANPIVN
Sbjct  144  VDTSSNA-----IDEPAPGLKAIFGFRVPDQRSGKIELQYLHEYAGISSSIGLTANPIVN  198

Query  461  FSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGDSLSASYYHHV  640
            FSGV+GTN LALGTD+SFDTK+G FTK NAG SFTN+DLIASL LN+KGDS++ASYYH V
Sbjct  199  FSGVLGTNVLALGTDISFDTKTGNFTKCNAGFSFTNADLIASLALNEKGDSVNASYYHIV  258

Query  641  NPLSNTAVGAEVNHSFSSNVNTITVGTQHQLDPLTTVKARVNNFGRANALIQHEWRPKSL  820
            NP +NTAVGAEV HSFS+NVNTITVGTQH LDPLTT+KARVNN G+A+ALIQHEWRPKSL
Sbjct  259  NPSTNTAVGAEVTHSFSTNVNTITVGTQHALDPLTTIKARVNNAGKASALIQHEWRPKSL  318

Query  821  ITLSGEVDVKAVDKSAKFGLALALKP  898
             ++SGEVD K++DKS K GLALALKP
Sbjct  319  FSISGEVDTKSIDKSPKVGLALALKP  344



>ref|NP_001288856.1| mitochondrial outer membrane protein porin 3-like [Brassica rapa]
 gb|AAS21632.1| voltage-dependent anion-selective channel protein [Brassica rapa]
Length=276

 Score =   424 bits (1089),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 205/276 (74%), Positives = 233/276 (84%), Gaps = 0/276 (0%)
 Frame = +2

Query  71   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  250
            MGKGPGLYT+IGKKARDLLY+DYQ D K +IT YS TGV IT++G+ KGDLFLGDV TQ+
Sbjct  1    MGKGPGLYTEIGKKARDLLYKDYQGDQKLSITAYSSTGVAITTSGTNKGDLFLGDVVTQI  60

Query  251  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  430
            KNKN T D KV ++S++ TT T DEA PGLK I S +VPDQ+S KVELQY+H HAGI TS
Sbjct  61   KNKNFTADIKVASDSSILTTFTYDEATPGLKAIVSAKVPDQKSAKVELQYMHPHAGICTS  120

Query  431  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  610
            VGLTANP+VNFSGV+GT+ LALGTDVSFDT+SG F  +N G+SFT  DLIASLTLNDKG+
Sbjct  121  VGLTANPVVNFSGVIGTSVLALGTDVSFDTESGNFKHFNTGVSFTKDDLIASLTLNDKGE  180

Query  611  SLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTITVGTQHQLDPLTTVKARVNNFGRANAL  790
             L+ASYYH VNPL NT VGAEV+H+  S VN+ITVGTQH LDPLTTVKARVNN G ANAL
Sbjct  181  KLNASYYHIVNPLKNTVVGAEVSHNLKSQVNSITVGTQHALDPLTTVKARVNNAGIANAL  240

Query  791  IQHEWRPKSLITLSGEVDVKAVDKSAKFGLALALKP  898
            IQHEWRPKS IT+SGEVD KA++KSAK G ALALKP
Sbjct  241  IQHEWRPKSFITISGEVDSKAIEKSAKVGFALALKP  276



>emb|CDX91952.1| BnaC03g32540D [Brassica napus]
Length=276

 Score =   424 bits (1089),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 210/276 (76%), Positives = 234/276 (85%), Gaps = 0/276 (0%)
 Frame = +2

Query  71   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  250
            M KGPGLYTDIGKK RDLLY+D+ +DHK +ITT+SP GV ITSTG+KKGDL LGDV  QL
Sbjct  1    MVKGPGLYTDIGKKVRDLLYKDHNSDHKLSITTHSPAGVAITSTGTKKGDLLLGDVTFQL  60

Query  251  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  430
            K KNITTD +V T++ V  T TVDEAAPGLK I SFR PDQ SGK+ELQYLHD+AGISTS
Sbjct  61   KQKNITTDLRVCTDNTVLITATVDEAAPGLKSIFSFRAPDQNSGKIELQYLHDYAGISTS  120

Query  431  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  610
            +GLT NP VNFSGV+GTN LA GTDVSFDTKSG FTK NAG++FT  DLIASLTLNDKGD
Sbjct  121  MGLTQNPTVNFSGVIGTNVLAAGTDVSFDTKSGNFTKINAGVNFTKDDLIASLTLNDKGD  180

Query  611  SLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTITVGTQHQLDPLTTVKARVNNFGRANAL  790
            S++ASYYH VNPL NTAVGAEV+H FSS  NTITVGTQH LDPLTTVKARVN+ G ANAL
Sbjct  181  SVNASYYHIVNPLFNTAVGAEVSHKFSSKTNTITVGTQHSLDPLTTVKARVNSAGIANAL  240

Query  791  IQHEWRPKSLITLSGEVDVKAVDKSAKFGLALALKP  898
            IQH+W P S  T+SGEVD KA+DK+AK GLAL+LKP
Sbjct  241  IQHQWTPGSFFTISGEVDTKAIDKNAKVGLALSLKP  276



>gb|AAW22621.1| outer mitochondrial membrane protein porin 1 [Brassica napus]
Length=276

 Score =   423 bits (1088),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 210/276 (76%), Positives = 236/276 (86%), Gaps = 0/276 (0%)
 Frame = +2

Query  71   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  250
            MGKGPG YTDIGKKARDLLY+D+ +D K +ITT+SP GV ITSTG+KKGD  LGDV+ QL
Sbjct  1    MGKGPGRYTDIGKKARDLLYKDHNSDQKLSITTHSPAGVAITSTGTKKGDSLLGDVSLQL  60

Query  251  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  430
            K KNITTD KV T+S V  T TVDEAAPGLK I SFR PDQ SGK+ELQYLH++AGISTS
Sbjct  61   KQKNITTDLKVSTDSTVLITATVDEAAPGLKSIFSFRAPDQNSGKIELQYLHEYAGISTS  120

Query  431  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  610
            +GLT NP VNFSGVVGTN LALGTDVSFDTKSG FTK NAG++FT  DLIASLTLNDKGD
Sbjct  121  MGLTQNPTVNFSGVVGTNVLALGTDVSFDTKSGNFTKINAGVNFTKDDLIASLTLNDKGD  180

Query  611  SLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTITVGTQHQLDPLTTVKARVNNFGRANAL  790
            S++ASYYH VNPL NTAVGAEVNH FS+NVNTITVGTQ+ LDPLTTVKA VN+ G A +L
Sbjct  181  SVNASYYHIVNPLFNTAVGAEVNHKFSTNVNTITVGTQNSLDPLTTVKAPVNSAGIAKSL  240

Query  791  IQHEWRPKSLITLSGEVDVKAVDKSAKFGLALALKP  898
            IQH+W P+S  T+SGEVD KA+DK+AK GLAL+LKP
Sbjct  241  IQHQWTPRSFFTISGEVDTKAIDKNAKVGLALSLKP  276



>gb|EYU28705.1| hypothetical protein MIMGU_mgv1a011554mg [Erythranthe guttata]
Length=278

 Score =   421 bits (1083),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 199/274 (73%), Positives = 240/274 (88%), Gaps = 0/274 (0%)
 Frame = +2

Query  77   KGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQLKN  256
            KGPGLY DIGK+ARDLLY+DYQ D KFT+TTY+  GV ITS+G++KGDLFL DV+TQ+KN
Sbjct  5    KGPGLYPDIGKRARDLLYKDYQGDQKFTLTTYTSNGVAITSSGTQKGDLFLADVSTQMKN  64

Query  257  KNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTSVG  436
            KNITTD KVDTNSNV+TT TVDE APG+K I SF  PDQ+SGKVELQY H+++GISTS+G
Sbjct  65   KNITTDVKVDTNSNVYTTFTVDEPAPGVKAIFSFVAPDQKSGKVELQYFHEYSGISTSLG  124

Query  437  LTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGDSL  616
            LTA PIVNFSGV G +  A GTDVSFDT++G F K NA LSFT +DL+ASL L+DKG+++
Sbjct  125  LTAKPIVNFSGVAGNHTFAFGTDVSFDTETGNFIKSNAALSFTTADLVASLGLSDKGETV  184

Query  617  SASYYHHVNPLSNTAVGAEVNHSFSSNVNTITVGTQHQLDPLTTVKARVNNFGRANALIQ  796
            +ASY+H V+PL+NTAVGAE+ HSFS+N NT+T+GTQH LDPLT VKARVNN+G+A+ALIQ
Sbjct  185  TASYFHTVSPLTNTAVGAEMVHSFSTNENTLTIGTQHLLDPLTAVKARVNNYGKASALIQ  244

Query  797  HEWRPKSLITLSGEVDVKAVDKSAKFGLALALKP  898
            HEWRPKSLIT+SGEVD +A++KSAK GLA+ALKP
Sbjct  245  HEWRPKSLITISGEVDTRAIEKSAKVGLAVALKP  278



>emb|CDY63765.1| BnaCnng42590D [Brassica napus]
Length=276

 Score =   420 bits (1080),  Expect = 5e-143, Method: Compositional matrix adjust.
 Identities = 204/276 (74%), Positives = 234/276 (85%), Gaps = 0/276 (0%)
 Frame = +2

Query  71   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  250
            M KGPGLYT+IGKKARDLLY+DYQ D K ++TTYS TGV IT+TG+ KGDLF+GDV+TQ+
Sbjct  1    MVKGPGLYTEIGKKARDLLYKDYQGDQKLSVTTYSSTGVAITTTGTNKGDLFVGDVSTQV  60

Query  251  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  430
            KNKN T D KV T+S++ TT T DEA PGLK I S +VPDQ+SGKVELQYLHD+AGI TS
Sbjct  61   KNKNFTADIKVATDSSLLTTFTYDEATPGLKAIVSAKVPDQKSGKVELQYLHDYAGICTS  120

Query  431  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  610
            VGLTA+PIVNFSGVVG N LALGTDVSF+T+SG F  +NAG SFT  DLIA+LTLNDKGD
Sbjct  121  VGLTASPIVNFSGVVGNNVLALGTDVSFNTQSGGFKHFNAGFSFTKDDLIAALTLNDKGD  180

Query  611  SLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTITVGTQHQLDPLTTVKARVNNFGRANAL  790
             L+ASYYH VNPLSNT VGAEV HSF++  N ITVG QH +DPLTTVKAR+NN G ANAL
Sbjct  181  KLNASYYHIVNPLSNTVVGAEVTHSFTTQKNAITVGAQHAIDPLTTVKARLNNDGVANAL  240

Query  791  IQHEWRPKSLITLSGEVDVKAVDKSAKFGLALALKP  898
            IQH+WRPKS IT+SGEVD +A++KSAK G ALALKP
Sbjct  241  IQHQWRPKSFITVSGEVDSRAIEKSAKVGFALALKP  276



>ref|XP_003532049.1| PREDICTED: mitochondrial outer membrane protein porin of 36 kDa-like 
[Glycine max]
 gb|KHN13488.1| Mitochondrial outer membrane protein porin of 36 kDa [Glycine 
soja]
Length=276

 Score =   419 bits (1078),  Expect = 7e-143, Method: Compositional matrix adjust.
 Identities = 201/276 (73%), Positives = 243/276 (88%), Gaps = 0/276 (0%)
 Frame = +2

Query  71   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  250
            M KGPGLY+DIGK+ARDLL++DYQ DHKFTITTY+ TGV ITSTG +KG+++L DV+T++
Sbjct  1    MVKGPGLYSDIGKRARDLLFKDYQNDHKFTITTYTSTGVEITSTGVRKGEIYLADVSTKV  60

Query  251  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  430
            KNKNITTD KVDTNSN+ TTITVDE APGLK I SF  PDQ+SGKVELQY H++AGI+TS
Sbjct  61   KNKNITTDVKVDTNSNLRTTITVDEPAPGLKTIFSFNFPDQKSGKVELQYQHEYAGINTS  120

Query  431  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  610
            +GLTANP+VNFSGVVG N +A+GTD+SFDT SG FTKYNAGL+ T++DLIASLTLNDKGD
Sbjct  121  IGLTANPVVNFSGVVGNNLVAVGTDLSFDTASGNFTKYNAGLNITHADLIASLTLNDKGD  180

Query  611  SLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTITVGTQHQLDPLTTVKARVNNFGRANAL  790
            +L+ASYYH VNPL+NTAVGAE++HSFS N N +T GTQH LDPLT +K+RVNN+GRA+AL
Sbjct  181  NLTASYYHIVNPLTNTAVGAELSHSFSGNENILTFGTQHALDPLTLLKSRVNNYGRASAL  240

Query  791  IQHEWRPKSLITLSGEVDVKAVDKSAKFGLALALKP  898
            IQH+W P++  +L GEVD  A++KSAK GLA+ALKP
Sbjct  241  IQHDWTPRTRFSLVGEVDTGAIEKSAKVGLAVALKP  276



>ref|NP_186777.1| voltage dependent anion channel 1 [Arabidopsis thaliana]
 sp|Q9SRH5.3|VDAC1_ARATH RecName: Full=Mitochondrial outer membrane protein porin 1; AltName: 
Full=Voltage-dependent anion-selective channel protein 
1; Short=AtVDAC1; Short=VDAC-1 [Arabidopsis thaliana]
 gb|AAF03498.1|AC010676_8 putative porin [Arabidopsis thaliana]
 gb|AAK59817.1| AT3g01280/T22N4_9 [Arabidopsis thaliana]
 gb|AAM47472.1| AT3g01280/T22N4_9 [Arabidopsis thaliana]
 gb|AEE73632.1| voltage dependent anion channel 1 [Arabidopsis thaliana]
Length=276

 Score =   419 bits (1077),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 207/276 (75%), Positives = 235/276 (85%), Gaps = 0/276 (0%)
 Frame = +2

Query  71   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  250
            M KGPGLYT+IGKKARDLLY+D+ +D KF+ITT+SP GV ITSTG+KKGDL LGDV  Q 
Sbjct  1    MVKGPGLYTEIGKKARDLLYKDHNSDQKFSITTFSPAGVAITSTGTKKGDLLLGDVAFQS  60

Query  251  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  430
            + KNITTD KV T+S    T TVDEAAPGL+ I SF+VPDQ SGKVELQYLH++AGISTS
Sbjct  61   RRKNITTDLKVCTDSTFLITATVDEAAPGLRSIFSFKVPDQNSGKVELQYLHEYAGISTS  120

Query  431  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  610
            +GLT NP VNFSGV+G+N LA+GTDVSFDTKSG FTK NAGLSFT  DLIASLT+NDKGD
Sbjct  121  MGLTQNPTVNFSGVIGSNVLAVGTDVSFDTKSGNFTKINAGLSFTKEDLIASLTVNDKGD  180

Query  611  SLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTITVGTQHQLDPLTTVKARVNNFGRANAL  790
             L+ASYYH VNPL NTAVGAEV+H  SS  +TITVGTQH LDPLT+VKARVN+ G A+AL
Sbjct  181  LLNASYYHIVNPLFNTAVGAEVSHKLSSKDSTITVGTQHSLDPLTSVKARVNSAGIASAL  240

Query  791  IQHEWRPKSLITLSGEVDVKAVDKSAKFGLALALKP  898
            IQHEW+PKS  T+SGEVD K++DKSAK GLALALKP
Sbjct  241  IQHEWKPKSFFTISGEVDTKSIDKSAKVGLALALKP  276



>ref|XP_009134621.1| PREDICTED: mitochondrial outer membrane protein porin 1-like 
[Brassica rapa]
Length=276

 Score =   419 bits (1076),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 208/276 (75%), Positives = 233/276 (84%), Gaps = 0/276 (0%)
 Frame = +2

Query  71   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  250
            M KGPGLYTDIGKK RDLLY+D+ +DHK +ITT+SP GV ITSTG+KKGDL LGDV   L
Sbjct  1    MVKGPGLYTDIGKKVRDLLYKDHNSDHKLSITTHSPAGVAITSTGTKKGDLLLGDVGFLL  60

Query  251  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  430
            K KNITTD +V T++ V  T TVDEAAPGLK I SFR PDQ SGK+ELQYLHD+AGISTS
Sbjct  61   KQKNITTDLRVCTDNTVLITATVDEAAPGLKSIFSFRAPDQNSGKIELQYLHDYAGISTS  120

Query  431  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  610
            +GLT NP VNFSGV+GTN LA GTDVSFDTKSG FTK NAG++FT  DLIASLTLNDKGD
Sbjct  121  MGLTQNPTVNFSGVIGTNVLAAGTDVSFDTKSGNFTKINAGVNFTKDDLIASLTLNDKGD  180

Query  611  SLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTITVGTQHQLDPLTTVKARVNNFGRANAL  790
            S++ASYYH VNPL NTAVGAEV+H FSS  NTITVGTQH LDPLTTVKARVN+ G ANAL
Sbjct  181  SVNASYYHIVNPLFNTAVGAEVSHKFSSKTNTITVGTQHSLDPLTTVKARVNSAGIANAL  240

Query  791  IQHEWRPKSLITLSGEVDVKAVDKSAKFGLALALKP  898
            IQH+W P S  T+SGEVD KA+DK+AK GLAL+L+P
Sbjct  241  IQHQWTPGSFFTISGEVDTKAIDKNAKVGLALSLRP  276



>ref|NP_001241054.1| uncharacterized protein LOC100805016 [Glycine max]
 gb|ACU21099.1| unknown [Glycine max]
 gb|KHN31779.1| Mitochondrial outer membrane protein porin of 36 kDa [Glycine 
soja]
Length=276

 Score =   419 bits (1076),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 201/276 (73%), Positives = 242/276 (88%), Gaps = 0/276 (0%)
 Frame = +2

Query  71   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  250
            M KGPGLY+DIGK+ARDLL++DYQ DHKFTITTY+ TGV ITSTG +KG+++L DV+T++
Sbjct  1    MVKGPGLYSDIGKRARDLLFKDYQNDHKFTITTYTSTGVEITSTGVRKGEIYLADVSTKV  60

Query  251  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  430
            KNKNITTD KVDTNSN+ T ITVDE APGLK I SF  PDQ+SGKVELQY H++AGISTS
Sbjct  61   KNKNITTDVKVDTNSNLRTIITVDEPAPGLKTIFSFNFPDQKSGKVELQYQHEYAGISTS  120

Query  431  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  610
            +GLTANP+VNFSGVVG N +A+GTD+SFDT SG FTKYNAGL+ T++DLIASLTLNDKGD
Sbjct  121  IGLTANPVVNFSGVVGNNLVAVGTDLSFDTTSGNFTKYNAGLNITHADLIASLTLNDKGD  180

Query  611  SLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTITVGTQHQLDPLTTVKARVNNFGRANAL  790
            +L+ASYYH VNPL+N+AVGAE++HSFS N N +T GTQH LDPLT +KARVNN+GRA+AL
Sbjct  181  NLTASYYHIVNPLTNSAVGAELSHSFSGNENILTFGTQHALDPLTLLKARVNNYGRASAL  240

Query  791  IQHEWRPKSLITLSGEVDVKAVDKSAKFGLALALKP  898
            IQH+W P++  +L GEVD  A++KSAK GLA+ALKP
Sbjct  241  IQHDWTPRTRFSLVGEVDTGAIEKSAKVGLAVALKP  276



>gb|AAM65525.1| putative porin [Arabidopsis thaliana]
Length=276

 Score =   419 bits (1076),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 206/276 (75%), Positives = 235/276 (85%), Gaps = 0/276 (0%)
 Frame = +2

Query  71   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  250
            M KGPGLYT+IGKKARDLLY+D+ +D KF+ITT+SP GV ITSTG+KKGDL LGDV  Q 
Sbjct  1    MVKGPGLYTEIGKKARDLLYKDHNSDQKFSITTFSPAGVAITSTGTKKGDLLLGDVAFQS  60

Query  251  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  430
            + KNITTD KV T+S    T TVDEAAPGL+ I SF+VPDQ SGKVELQYLH++AGISTS
Sbjct  61   RRKNITTDLKVCTDSTFLITATVDEAAPGLRSIFSFKVPDQNSGKVELQYLHEYAGISTS  120

Query  431  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  610
            +GLT NP VNFSGV+G+N LA+GTDVSFDTKSG FTK NAGLSFT  DLIASLT+NDKGD
Sbjct  121  MGLTQNPTVNFSGVIGSNVLAVGTDVSFDTKSGNFTKINAGLSFTKEDLIASLTVNDKGD  180

Query  611  SLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTITVGTQHQLDPLTTVKARVNNFGRANAL  790
             L+ASYYH VNPL NTAVGAEV+H  SS  +TITVGTQH LDPLT+VKARVN+ G A+AL
Sbjct  181  LLNASYYHIVNPLFNTAVGAEVSHKLSSKDSTITVGTQHSLDPLTSVKARVNSAGIASAL  240

Query  791  IQHEWRPKSLITLSGEVDVKAVDKSAKFGLALALKP  898
            IQHEW+PKS  T+SGE+D K++DKSAK GLALALKP
Sbjct  241  IQHEWKPKSFFTISGEIDTKSIDKSAKVGLALALKP  276



>ref|XP_006400027.1| hypothetical protein EUTSA_v10014354mg [Eutrema salsugineum]
 gb|ESQ41480.1| hypothetical protein EUTSA_v10014354mg [Eutrema salsugineum]
Length=276

 Score =   418 bits (1074),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 203/276 (74%), Positives = 234/276 (85%), Gaps = 0/276 (0%)
 Frame = +2

Query  71   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  250
            M KGPGLYT+IGKKARDLLY+DYQ D K +ITTYS +GV IT++G+ KGDLFL DV TQ+
Sbjct  1    MAKGPGLYTEIGKKARDLLYKDYQGDQKLSITTYSASGVAITTSGTNKGDLFLADVATQV  60

Query  251  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  430
            KNK  T D KV T+S++ TT T DEA PGLK I S ++PDQ+SGKVELQYLHD+AGISTS
Sbjct  61   KNKKFTADIKVATDSSLLTTFTYDEATPGLKAILSAKLPDQKSGKVELQYLHDYAGISTS  120

Query  431  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  610
            VGLTANPIVNFSGVVGTN LALG DVSF+T+SG F  +NAG SFT  DLIASLTLNDKG+
Sbjct  121  VGLTANPIVNFSGVVGTNVLALGADVSFNTESGNFKHFNAGFSFTKDDLIASLTLNDKGE  180

Query  611  SLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTITVGTQHQLDPLTTVKARVNNFGRANAL  790
             L+ASYYH VNPLSNT VGAEV+H+F++  N ITVGTQH LDPLTTVKARVN+ G ANAL
Sbjct  181  KLNASYYHIVNPLSNTVVGAEVSHNFTTKENAITVGTQHALDPLTTVKARVNHAGVANAL  240

Query  791  IQHEWRPKSLITLSGEVDVKAVDKSAKFGLALALKP  898
            IQHEWRPKS +T+SGEVD K+++K+ KFG ALALKP
Sbjct  241  IQHEWRPKSFVTISGEVDSKSIEKNPKFGFALALKP  276



>ref|XP_010512938.1| PREDICTED: mitochondrial outer membrane protein porin 1 [Camelina 
sativa]
Length=276

 Score =   418 bits (1074),  Expect = 4e-142, Method: Compositional matrix adjust.
 Identities = 205/276 (74%), Positives = 235/276 (85%), Gaps = 0/276 (0%)
 Frame = +2

Query  71   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  250
            M KGPGLYT+IGKKARDLLYRD+ +D KF+ITTYSP GV ITSTG+KKGD+ LGDV  Q 
Sbjct  1    MVKGPGLYTEIGKKARDLLYRDHNSDQKFSITTYSPAGVAITSTGTKKGDVLLGDVAFQS  60

Query  251  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  430
            + KN+TTDFKV T+S V  T TVDEAAPGLK I SF+ PDQ SGK+E+QYLH++AGISTS
Sbjct  61   RQKNVTTDFKVCTDSTVLITATVDEAAPGLKSIFSFKAPDQNSGKIEVQYLHEYAGISTS  120

Query  431  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  610
            +GLT NP VNFSGV+GTN LA+GTD+SFDTKSG FTK NAGLSF   DLIASLT+N+K D
Sbjct  121  MGLTQNPTVNFSGVIGTNVLAVGTDISFDTKSGNFTKINAGLSFAKEDLIASLTVNEKFD  180

Query  611  SLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTITVGTQHQLDPLTTVKARVNNFGRANAL  790
             L+ASYYH VNPL NTAVGAEV+H FS+  NTITVGTQH LDPLT+VKARVN+ G A+AL
Sbjct  181  LLNASYYHIVNPLFNTAVGAEVSHRFSNKDNTITVGTQHSLDPLTSVKARVNSAGIASAL  240

Query  791  IQHEWRPKSLITLSGEVDVKAVDKSAKFGLALALKP  898
            IQHEW+PKS  T+SGEVD KA+DK+AK GLALALKP
Sbjct  241  IQHEWKPKSFFTISGEVDTKAIDKNAKVGLALALKP  276



>gb|KHG07130.1| Mitochondrial outer membrane protein porin of 34 kDa [Gossypium 
arboreum]
Length=258

 Score =   417 bits (1071),  Expect = 5e-142, Method: Compositional matrix adjust.
 Identities = 201/261 (77%), Positives = 231/261 (89%), Gaps = 5/261 (2%)
 Frame = +2

Query  116  RDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQLKNKNITTDFKVDTNS  295
            +DLLY+DYQTD KFT+TT SPTGV ITS G+KKGDLFL DVNTQLK++N+TTD KVDT+S
Sbjct  3    KDLLYKDYQTDQKFTLTTSSPTGVAITSAGTKKGDLFLADVNTQLKSRNVTTDIKVDTSS  62

Query  296  NVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTSVGLTANPIVNFSGVV  475
            N      +DE APGLK I  FRVPDQRSGK+ELQYLH++AGIS+S+GLTANPIVNFSGV+
Sbjct  63   NA-----IDEPAPGLKAIFGFRVPDQRSGKIELQYLHEYAGISSSIGLTANPIVNFSGVL  117

Query  476  GTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGDSLSASYYHHVNPLSN  655
            GTN LALGTD+SFDTK+G FTK NAG SFTN+DLIASL LN+KGDS++ASYYH VNP +N
Sbjct  118  GTNVLALGTDISFDTKTGNFTKCNAGFSFTNADLIASLALNEKGDSVNASYYHIVNPSTN  177

Query  656  TAVGAEVNHSFSSNVNTITVGTQHQLDPLTTVKARVNNFGRANALIQHEWRPKSLITLSG  835
            TAVGAEV HSFS+NVNTITVGTQH LDPLTT+KARVNN G+A+ALIQHEWRPKSL ++SG
Sbjct  178  TAVGAEVTHSFSTNVNTITVGTQHALDPLTTIKARVNNAGKASALIQHEWRPKSLFSISG  237

Query  836  EVDVKAVDKSAKFGLALALKP  898
            EVD K++DKS K GLALALKP
Sbjct  238  EVDTKSIDKSPKVGLALALKP  258



>emb|CDX85566.1| BnaA02g02470D [Brassica napus]
Length=276

 Score =   417 bits (1072),  Expect = 7e-142, Method: Compositional matrix adjust.
 Identities = 203/276 (74%), Positives = 233/276 (84%), Gaps = 0/276 (0%)
 Frame = +2

Query  71   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  250
            M KGPGLYT+IGKKARDLLY+DYQ D K ++TTYS TGV IT+TG+ KGDLF+GDV TQ+
Sbjct  1    MVKGPGLYTEIGKKARDLLYKDYQGDQKLSVTTYSSTGVAITTTGTNKGDLFVGDVTTQV  60

Query  251  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  430
            KNKN T D KV T+S++ TT T DEA PGLK I S +VPDQ+SGKVELQYLHD+AGI TS
Sbjct  61   KNKNFTADIKVATDSSLLTTFTYDEATPGLKAIVSAKVPDQKSGKVELQYLHDYAGICTS  120

Query  431  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  610
            VGLTA+PIVNFSGVVG N LALGTDVSF+T+SG F ++NAG SFT  DLIA+LTLNDKGD
Sbjct  121  VGLTASPIVNFSGVVGNNVLALGTDVSFNTQSGDFKQFNAGFSFTKDDLIAALTLNDKGD  180

Query  611  SLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTITVGTQHQLDPLTTVKARVNNFGRANAL  790
             L+ASYYH VNPLSNT VGAEV HSF++  N ITVG QH LDPLTT+KARVNN G ANAL
Sbjct  181  KLNASYYHIVNPLSNTVVGAEVTHSFTTQKNAITVGAQHALDPLTTLKARVNNDGVANAL  240

Query  791  IQHEWRPKSLITLSGEVDVKAVDKSAKFGLALALKP  898
            IQH+WRPKS IT+SGEV+ +A++K AK G ALALKP
Sbjct  241  IQHQWRPKSFITVSGEVNSRAIEKGAKVGFALALKP  276



>ref|XP_010485517.1| PREDICTED: mitochondrial outer membrane protein porin 1-like 
[Camelina sativa]
Length=276

 Score =   417 bits (1072),  Expect = 7e-142, Method: Compositional matrix adjust.
 Identities = 206/276 (75%), Positives = 234/276 (85%), Gaps = 0/276 (0%)
 Frame = +2

Query  71   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  250
            M KGPGLYT+IGKKARDLLYRD+ +D KF+ITTYSP GV ITS+G+KKGD+ LGDV  Q 
Sbjct  1    MVKGPGLYTEIGKKARDLLYRDHNSDQKFSITTYSPAGVAITSSGTKKGDVLLGDVAFQS  60

Query  251  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  430
            K KN+TTD KV T+S V  T TVDEAAPGLK I SF+ PDQ SGK+E+QYLHD+AGISTS
Sbjct  61   KQKNVTTDLKVCTDSTVLITATVDEAAPGLKSIFSFKAPDQNSGKIEVQYLHDYAGISTS  120

Query  431  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  610
            +GLT NP VNFSGV+GTN LA+GTDVSFDTKSG FTK NAGLSF   DLIASLT+N+K D
Sbjct  121  MGLTQNPTVNFSGVIGTNVLAVGTDVSFDTKSGNFTKINAGLSFAKEDLIASLTVNEKFD  180

Query  611  SLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTITVGTQHQLDPLTTVKARVNNFGRANAL  790
             L+ASYYH VNPL NTAVGAEV+H FS+  NTITVGTQH LDPLT+VKARVN+ G A+AL
Sbjct  181  LLNASYYHIVNPLFNTAVGAEVSHRFSNKDNTITVGTQHSLDPLTSVKARVNSAGIASAL  240

Query  791  IQHEWRPKSLITLSGEVDVKAVDKSAKFGLALALKP  898
            IQHEW+PKS  T+SGEVD KA+DK+AK GLALALKP
Sbjct  241  IQHEWKPKSFFTISGEVDTKAIDKNAKVGLALALKP  276



>emb|CDX74294.1| BnaA03g27530D [Brassica napus]
Length=276

 Score =   417 bits (1071),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 207/276 (75%), Positives = 232/276 (84%), Gaps = 0/276 (0%)
 Frame = +2

Query  71   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  250
            M KGPGLYTDIGKK RDLL++D+ +DHK +ITT SP GV ITSTG+KKGDL LGDV   L
Sbjct  1    MVKGPGLYTDIGKKVRDLLFKDHNSDHKLSITTQSPAGVAITSTGTKKGDLLLGDVGFLL  60

Query  251  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  430
            K KNITTD +V T++ V  T TVDEAAPGLK I SFR PDQ SGK+ELQYLHD+AGISTS
Sbjct  61   KQKNITTDLRVCTDNTVLITATVDEAAPGLKSIFSFRAPDQNSGKIELQYLHDYAGISTS  120

Query  431  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  610
            +GLT NP VNFSGV+GTN LA GTDVSFDTKSG FTK NAG++FT  DLIASLTLNDKGD
Sbjct  121  MGLTQNPTVNFSGVIGTNVLAAGTDVSFDTKSGNFTKINAGVNFTKDDLIASLTLNDKGD  180

Query  611  SLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTITVGTQHQLDPLTTVKARVNNFGRANAL  790
            S++ASYYH VNPL NTAVGAEV+H FSS  NTITVGTQH LDPLTTVKARVN+ G ANAL
Sbjct  181  SVNASYYHIVNPLFNTAVGAEVSHKFSSKTNTITVGTQHSLDPLTTVKARVNSAGIANAL  240

Query  791  IQHEWRPKSLITLSGEVDVKAVDKSAKFGLALALKP  898
            IQH+W P S  T+SGEVD KA+DK+AK GLAL+L+P
Sbjct  241  IQHQWTPGSFFTISGEVDTKAIDKNAKVGLALSLRP  276



>ref|XP_010463547.1| PREDICTED: mitochondrial outer membrane protein porin 1-like 
[Camelina sativa]
Length=276

 Score =   416 bits (1069),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 205/276 (74%), Positives = 234/276 (85%), Gaps = 0/276 (0%)
 Frame = +2

Query  71   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  250
            M KGPGLYT+IGKKARDLLYRD+ +D KF+ITTYSP GV ITS+G+KKGD+ LGDV  Q 
Sbjct  1    MVKGPGLYTEIGKKARDLLYRDHNSDQKFSITTYSPAGVAITSSGTKKGDVLLGDVAFQS  60

Query  251  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  430
            K KN+TTD KV T+S V  T TVDEAAPGLK I SF+ PDQ SGK+E+QYLHD+AGISTS
Sbjct  61   KQKNVTTDLKVCTDSTVLITATVDEAAPGLKSIFSFKAPDQNSGKIEVQYLHDYAGISTS  120

Query  431  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  610
            +GLT NP VNFSGV+GTN LA+GTDVSFDTKSG FTK NAGLSF   DLIASLT+N+K D
Sbjct  121  MGLTQNPTVNFSGVIGTNVLAVGTDVSFDTKSGNFTKINAGLSFAKEDLIASLTVNEKFD  180

Query  611  SLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTITVGTQHQLDPLTTVKARVNNFGRANAL  790
             L+ASYYH VNP+ NTAVGAEV+H FS+  NTITVGTQH LDPLT+VKARVN+ G A+AL
Sbjct  181  LLNASYYHIVNPVFNTAVGAEVSHRFSNKDNTITVGTQHSLDPLTSVKARVNSAGIASAL  240

Query  791  IQHEWRPKSLITLSGEVDVKAVDKSAKFGLALALKP  898
            IQHEW+PKS  T+SGEVD KA+DK+AK GLALALKP
Sbjct  241  IQHEWKPKSFFTISGEVDTKAIDKNAKVGLALALKP  276



>ref|NP_001288964.1| mitochondrial outer membrane protein porin 3 [Brassica rapa]
 gb|ABB97031.1| unknown [Brassica rapa]
Length=276

 Score =   416 bits (1068),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 202/276 (73%), Positives = 232/276 (84%), Gaps = 0/276 (0%)
 Frame = +2

Query  71   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  250
            M KGPGLYT+IGKKARDLLY+DYQ D K ++TTYS TGV IT+TG+ KGDLF+GDV TQ+
Sbjct  1    MVKGPGLYTEIGKKARDLLYKDYQGDQKLSVTTYSSTGVAITTTGTNKGDLFVGDVTTQV  60

Query  251  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  430
            KNKN T D KV T+S++ TT T DEA PGLK I S +VPDQ+SGKVELQYLHD+AGI TS
Sbjct  61   KNKNFTADIKVATDSSLLTTFTYDEATPGLKAIVSAKVPDQKSGKVELQYLHDYAGICTS  120

Query  431  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  610
            VGLTA+PIVNFSGVVG N LALGTDVSF+T+SG F ++NAG SFT  DLIA+LTLNDKGD
Sbjct  121  VGLTASPIVNFSGVVGNNVLALGTDVSFNTQSGDFKQFNAGFSFTKDDLIAALTLNDKGD  180

Query  611  SLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTITVGTQHQLDPLTTVKARVNNFGRANAL  790
             L+ASYYH VNPLSNT VGAEV HSF++  N ITVG QH LDPL T+KARVNN G ANAL
Sbjct  181  KLNASYYHIVNPLSNTVVGAEVTHSFTTQKNAITVGAQHALDPLATLKARVNNDGVANAL  240

Query  791  IQHEWRPKSLITLSGEVDVKAVDKSAKFGLALALKP  898
            IQH+WRPKS IT+SGEV+ +A++K AK G ALALKP
Sbjct  241  IQHQWRPKSFITVSGEVNSRAIEKGAKVGFALALKP  276



>ref|XP_007153842.1| hypothetical protein PHAVU_003G069300g [Phaseolus vulgaris]
 gb|ESW25836.1| hypothetical protein PHAVU_003G069300g [Phaseolus vulgaris]
Length=276

 Score =   416 bits (1068),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 201/276 (73%), Positives = 243/276 (88%), Gaps = 0/276 (0%)
 Frame = +2

Query  71   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  250
            M KGPGLYTDIGK+ RDLL++DYQ DHKFTITT + TGV ITSTG +KG+L+L D++T+L
Sbjct  1    MVKGPGLYTDIGKRTRDLLFKDYQNDHKFTITTQTSTGVEITSTGVRKGELYLADISTKL  60

Query  251  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  430
            KNKNIT+D KVDTNS++ TTITVDE APGLK I SF  PDQ+SGKVELQYLH++AGISTS
Sbjct  61   KNKNITSDIKVDTNSSLRTTITVDEPAPGLKAIFSFIFPDQKSGKVELQYLHEYAGISTS  120

Query  431  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  610
            +GLTANPIVNFSGVVG N +A+GTD+SFDT SG FTKYNAGL+ T++DLIASLTLNDKGD
Sbjct  121  IGLTANPIVNFSGVVGNNLVAVGTDLSFDTASGNFTKYNAGLNITHADLIASLTLNDKGD  180

Query  611  SLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTITVGTQHQLDPLTTVKARVNNFGRANAL  790
            +L+ASYYH V+PL+NTAVGAE++H+FSSN N++T+GTQH LDPLT +KARVNN+G A+AL
Sbjct  181  TLNASYYHIVSPLTNTAVGAELSHNFSSNENSLTIGTQHALDPLTHLKARVNNYGLASAL  240

Query  791  IQHEWRPKSLITLSGEVDVKAVDKSAKFGLALALKP  898
            IQH+W P++  +L GEVD  A+ KSAK GLA+ALKP
Sbjct  241  IQHDWNPRTRFSLVGEVDTGAIGKSAKVGLAVALKP  276



>ref|XP_010492333.1| PREDICTED: mitochondrial outer membrane protein porin 3-like 
[Camelina sativa]
Length=276

 Score =   412 bits (1060),  Expect = 4e-140, Method: Compositional matrix adjust.
 Identities = 200/276 (72%), Positives = 234/276 (85%), Gaps = 0/276 (0%)
 Frame = +2

Query  71   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  250
            MGKGPGLYT+IGKKARDLLY+DYQ D KF++TTYS TGV IT+TG+ KG +FLGDV TQ+
Sbjct  1    MGKGPGLYTEIGKKARDLLYKDYQGDQKFSVTTYSSTGVAITTTGTNKGSVFLGDVATQV  60

Query  251  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  430
            KNKN T D KV T+S++ TT TVDE  PG+K I S R+PDQ+SGK+ELQYLHD+AGISTS
Sbjct  61   KNKNFTADIKVSTDSSLVTTFTVDEPTPGVKAILSARLPDQKSGKLELQYLHDYAGISTS  120

Query  431  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  610
            VGLT +P VNFSGVVGTN LALGTDVSF+T SG F  +NAGLSFT  DLIASL L+DKG+
Sbjct  121  VGLTGSPTVNFSGVVGTNVLALGTDVSFETDSGNFKHFNAGLSFTKEDLIASLILSDKGE  180

Query  611  SLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTITVGTQHQLDPLTTVKARVNNFGRANAL  790
             L+ASYY  VNPL+NT VGAEV+H+F++  N ITVG+Q+ +DPLTTVKARVNN G ANAL
Sbjct  181  KLNASYYQIVNPLTNTVVGAEVSHNFTTKENAITVGSQYAIDPLTTVKARVNNAGIANAL  240

Query  791  IQHEWRPKSLITLSGEVDVKAVDKSAKFGLALALKP  898
            IQHEWRPKS  T+SGEVD KA++KSAK G+ALALKP
Sbjct  241  IQHEWRPKSFFTVSGEVDSKAIEKSAKVGIALALKP  276



>ref|XP_010932447.1| PREDICTED: mitochondrial outer membrane protein porin 1-like 
[Elaeis guineensis]
Length=275

 Score =   412 bits (1058),  Expect = 9e-140, Method: Compositional matrix adjust.
 Identities = 196/274 (72%), Positives = 234/274 (85%), Gaps = 1/274 (0%)
 Frame = +2

Query  80   GPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQLKNK  259
            GPGLY++IGKKARDLLY+DY TD KFT+TTY+  GV IT++G+KK +   G++ +QLKNK
Sbjct  2    GPGLYSEIGKKARDLLYKDYLTDQKFTVTTYTSNGVAITASGTKKNEFIFGEIQSQLKNK  61

Query  260  NITTDFKVDTNSNVFTTITVDE-AAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTSVG  436
            NIT D K +++SN+ TT+TVDE A PGLK I SF VPDQRSGKVELQYLHD+AG++  +G
Sbjct  62   NITVDVKANSDSNLLTTVTVDELATPGLKTIFSFVVPDQRSGKVELQYLHDYAGVNAGIG  121

Query  437  LTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGDSL  616
            LTANPIVN SGVVGT AL++G DVSFDT SG FTKYNAGLS TN+DLIA+LTLN+KGDSL
Sbjct  122  LTANPIVNLSGVVGTKALSVGADVSFDTASGNFTKYNAGLSVTNADLIAALTLNNKGDSL  181

Query  617  SASYYHHVNPLSNTAVGAEVNHSFSSNVNTITVGTQHQLDPLTTVKARVNNFGRANALIQ  796
            SASYYH VNPLS+TAVGAE+ HSFS N NT+T GTQH LDPLT VKAR NN+G+A+ALIQ
Sbjct  182  SASYYHLVNPLSSTAVGAEITHSFSGNENTLTFGTQHALDPLTLVKARFNNYGKASALIQ  241

Query  797  HEWRPKSLITLSGEVDVKAVDKSAKFGLALALKP  898
            HEWRPKS  T+SGEVD KA++KS+K GL+L L+P
Sbjct  242  HEWRPKSFFTISGEVDTKAIEKSSKVGLSLVLRP  275



>gb|KFK25745.1| hypothetical protein AALP_AA8G154100 [Arabis alpina]
Length=276

 Score =   411 bits (1056),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 200/276 (72%), Positives = 233/276 (84%), Gaps = 0/276 (0%)
 Frame = +2

Query  71   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  250
            M KGPGLYT+IGKKARDLLY+DYQ DHK T+TT S TGVVIT+TG  KG+LF+GDV TQ+
Sbjct  1    MAKGPGLYTEIGKKARDLLYKDYQGDHKLTVTTSSETGVVITTTGINKGNLFVGDVATQV  60

Query  251  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  430
            KNKN T D KV T+S++ TT+T DEAAPGLK I S ++PDQ+SGK+ELQYLHD+AGI TS
Sbjct  61   KNKNFTADLKVATDSSLLTTLTYDEAAPGLKTILSAKLPDQKSGKLELQYLHDYAGICTS  120

Query  431  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  610
            VGLTANP VNF+GVVGTN LALGTD SF+T++G     N GLSFT  DLIASL LNDKG+
Sbjct  121  VGLTANPTVNFAGVVGTNILALGTDASFNTETGNLKHLNFGLSFTKDDLIASLNLNDKGE  180

Query  611  SLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTITVGTQHQLDPLTTVKARVNNFGRANAL  790
             L+ASYYH VNPL+NT VGAEVNH+FS+N NTITVGTQH LD LTTVKARVNN G ANAL
Sbjct  181  KLNASYYHIVNPLTNTVVGAEVNHNFSTNQNTITVGTQHALDSLTTVKARVNNAGVANAL  240

Query  791  IQHEWRPKSLITLSGEVDVKAVDKSAKFGLALALKP  898
            IQH+WRPKS +T+S E+D KA++K+ K G+ALALKP
Sbjct  241  IQHQWRPKSFVTISSEIDSKAIEKTPKVGIALALKP  276



>ref|XP_009410756.1| PREDICTED: mitochondrial outer membrane protein porin 1-like 
[Musa acuminata subsp. malaccensis]
Length=275

 Score =   410 bits (1055),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 193/274 (70%), Positives = 237/274 (86%), Gaps = 1/274 (0%)
 Frame = +2

Query  80   GPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQLKNK  259
            GPGLY++IGKKARDLLYRDYQTDHKFT+TT +  GV IT+TG++K DL  G++ +Q+KNK
Sbjct  2    GPGLYSEIGKKARDLLYRDYQTDHKFTVTTCTSNGVAITATGTRKNDLIFGEIQSQIKNK  61

Query  260  NITTDFKVDTNSNVFTTITVDE-AAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTSVG  436
            N+T D K +++SNV TT+TVDE A PGLK I SF +PDQRSGKVELQYLHD+AG++ S+G
Sbjct  62   NVTFDVKTNSDSNVTTTVTVDELATPGLKTIFSFVIPDQRSGKVELQYLHDYAGVNASIG  121

Query  437  LTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGDSL  616
            LTANP+VN SGVVG+  +++G DV+FDT +G F KYNAGLS TN+DLIASLTLN+KGDSL
Sbjct  122  LTANPVVNLSGVVGSKNVSVGADVAFDTATGNFIKYNAGLSITNTDLIASLTLNNKGDSL  181

Query  617  SASYYHHVNPLSNTAVGAEVNHSFSSNVNTITVGTQHQLDPLTTVKARVNNFGRANALIQ  796
            SASYYH VNPLS+TAVGAE+NHSFSSN NT+T GTQH LDPLTT KAR NN+G+A+ALIQ
Sbjct  182  SASYYHLVNPLSSTAVGAELNHSFSSNENTLTFGTQHALDPLTTAKARFNNYGKASALIQ  241

Query  797  HEWRPKSLITLSGEVDVKAVDKSAKFGLALALKP  898
            HEW+PKS +T+SGEVD KA++ S+K GL+L L+P
Sbjct  242  HEWKPKSFLTISGEVDTKAIENSSKIGLSLVLRP  275



>ref|XP_010925058.1| PREDICTED: mitochondrial outer membrane protein porin 1-like 
[Elaeis guineensis]
Length=275

 Score =   410 bits (1055),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 196/274 (72%), Positives = 232/274 (85%), Gaps = 1/274 (0%)
 Frame = +2

Query  80   GPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQLKNK  259
            GPGLY++IGKKARDLLY+DY TD KFT+TTY+ TGV IT++G+KK +   G++ +QLK K
Sbjct  2    GPGLYSEIGKKARDLLYKDYLTDQKFTVTTYTSTGVAITASGTKKTEFIFGEIQSQLKKK  61

Query  260  NITTDFKVDTNSNVFTTITVDE-AAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTSVG  436
            NIT D K ++ SN+ TT+TVDE A PGLK I SF VPDQRSGKVELQYLHD+AG++TS+G
Sbjct  62   NITVDVKANSESNLLTTVTVDELATPGLKTIFSFVVPDQRSGKVELQYLHDYAGVNTSIG  121

Query  437  LTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGDSL  616
            LTANPIVN S V GT A A+G DVSFDT SG FTKYNAGLS TN+DLIA+LTLN+KGDSL
Sbjct  122  LTANPIVNISSVFGTKAFAVGADVSFDTASGNFTKYNAGLSVTNADLIAALTLNNKGDSL  181

Query  617  SASYYHHVNPLSNTAVGAEVNHSFSSNVNTITVGTQHQLDPLTTVKARVNNFGRANALIQ  796
            S SYYH V+PLS+TAVGAE+ HSFSSN NT+T G QH LDPLTTVKAR NN+G+A+ALIQ
Sbjct  182  SGSYYHLVSPLSSTAVGAEITHSFSSNENTLTFGMQHALDPLTTVKARFNNYGKASALIQ  241

Query  797  HEWRPKSLITLSGEVDVKAVDKSAKFGLALALKP  898
            HEWRPKS  T+SGEVD KA++KS+K GL+L LKP
Sbjct  242  HEWRPKSFFTISGEVDTKAIEKSSKVGLSLVLKP  275



>gb|AFK34190.1| unknown [Medicago truncatula]
 gb|KEH24972.1| porin/voltage-dependent anion-selective channel protein [Medicago 
truncatula]
Length=278

 Score =   410 bits (1054),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 192/278 (69%), Positives = 237/278 (85%), Gaps = 2/278 (1%)
 Frame = +2

Query  71   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  250
            M KGPGLY+DIGKKARDLLY+DY TD KFT+TTYSPTG+ +T++ +KKG+LFL D+NTQL
Sbjct  1    MSKGPGLYSDIGKKARDLLYKDYNTDQKFTLTTYSPTGIALTASSTKKGELFLADINTQL  60

Query  251  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQ--RSGKVELQYLHDHAGIS  424
            K+KN+TTD KVDT+SN+FTTITV E APGLK I SFR+P+   +SGK E+QYLHD+AGIS
Sbjct  61   KHKNVTTDIKVDTDSNLFTTITVTEPAPGLKTILSFRIPEPELKSGKAEVQYLHDYAGIS  120

Query  425  TSVGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDK  604
             S+GLTANP+ NFSGV+G N +ALG D+S+DTK+G FT+ NAGL+FT  DLIASLTLN+K
Sbjct  121  ASIGLTANPVANFSGVIGNNVVALGGDLSYDTKTGVFTRLNAGLNFTKDDLIASLTLNEK  180

Query  605  GDSLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTITVGTQHQLDPLTTVKARVNNFGRAN  784
             ++L+ASYYH VNP++ TAVGAEV+H FS+  NT+T+GTQH +D LTT K R NNFG A+
Sbjct  181  ANALNASYYHVVNPVTKTAVGAEVSHRFSTKENTLTLGTQHAIDSLTTAKLRFNNFGLAS  240

Query  785  ALIQHEWRPKSLITLSGEVDVKAVDKSAKFGLALALKP  898
             LIQHEWRPKS  T+SGEVD KA++KSA+ G+ALALKP
Sbjct  241  GLIQHEWRPKSFFTISGEVDTKAIEKSARIGIALALKP  278



>ref|XP_010453637.1| PREDICTED: mitochondrial outer membrane protein porin 3-like 
[Camelina sativa]
Length=276

 Score =   410 bits (1054),  Expect = 4e-139, Method: Compositional matrix adjust.
 Identities = 197/276 (71%), Positives = 235/276 (85%), Gaps = 0/276 (0%)
 Frame = +2

Query  71   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  250
            M KGPGLYT+IGKKARDLLY+DYQ D KF++TTYS TGV IT+TG+ KG +FLGDV TQ+
Sbjct  1    MVKGPGLYTEIGKKARDLLYKDYQGDQKFSVTTYSSTGVAITTTGTNKGSVFLGDVATQV  60

Query  251  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  430
            KNKN T D KV T+S++ TT TVDE  PG+K I + ++PDQ+SGK+ELQYLHD+AGI+TS
Sbjct  61   KNKNFTADIKVSTDSSLLTTFTVDEPTPGVKAILTAKLPDQKSGKLELQYLHDYAGIATS  120

Query  431  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  610
            +GLT +P VNFSGVVGTN LALGTDVSF+T SG F  +NAGLSFT  DLIASLTLNDKG+
Sbjct  121  IGLTGSPTVNFSGVVGTNVLALGTDVSFETDSGNFKHFNAGLSFTKDDLIASLTLNDKGE  180

Query  611  SLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTITVGTQHQLDPLTTVKARVNNFGRANAL  790
             L+ASYYH VNP++NT VGAEV+H+F++  N ITVG+Q+ +DPLTTVKARVNN G ANAL
Sbjct  181  KLNASYYHIVNPVTNTVVGAEVSHNFTTKENAITVGSQYAMDPLTTVKARVNNAGIANAL  240

Query  791  IQHEWRPKSLITLSGEVDVKAVDKSAKFGLALALKP  898
            IQHEWRPKS  T+SGEVD KA++KSAK G+ALALKP
Sbjct  241  IQHEWRPKSFFTVSGEVDSKAIEKSAKVGIALALKP  276



>ref|XP_010420161.1| PREDICTED: mitochondrial outer membrane protein porin 3 [Camelina 
sativa]
Length=276

 Score =   409 bits (1050),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 197/276 (71%), Positives = 233/276 (84%), Gaps = 0/276 (0%)
 Frame = +2

Query  71   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  250
            M KGPGLYT+IGKKARDLLY+DYQ D KF++TTYS TGV IT+TG+ KG +FLGDV TQ+
Sbjct  1    MVKGPGLYTEIGKKARDLLYKDYQGDQKFSVTTYSSTGVAITTTGTNKGSVFLGDVATQV  60

Query  251  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  430
            KNKN T D KV T+S++ TT TVDE  PG+K I S ++PDQ+SGK+ELQY HD+AGI+TS
Sbjct  61   KNKNFTADIKVSTDSSLLTTFTVDEPTPGVKAILSAKLPDQKSGKLELQYFHDYAGIATS  120

Query  431  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  610
            +GLT +P VNFSGVVGTN LALGTDVSF+T SG F  +NAGLSFT  DLIASLTLNDKG+
Sbjct  121  IGLTGSPTVNFSGVVGTNVLALGTDVSFETDSGNFKHFNAGLSFTKDDLIASLTLNDKGE  180

Query  611  SLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTITVGTQHQLDPLTTVKARVNNFGRANAL  790
             L+ASYYH V+PL+NT VGAEV+H+F++  N ITVG+QH +DPLT VKARVNN G ANAL
Sbjct  181  KLNASYYHIVSPLTNTVVGAEVSHNFTTKENAITVGSQHAIDPLTIVKARVNNAGIANAL  240

Query  791  IQHEWRPKSLITLSGEVDVKAVDKSAKFGLALALKP  898
            IQHEWRPKS  T+SGEVD KA++KSAK G+ALALKP
Sbjct  241  IQHEWRPKSFFTVSGEVDSKAIEKSAKVGIALALKP  276



>ref|XP_006286537.1| hypothetical protein CARUB_v10001678mg [Capsella rubella]
 gb|EOA19435.1| hypothetical protein CARUB_v10001678mg [Capsella rubella]
Length=276

 Score =   408 bits (1049),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 197/276 (71%), Positives = 235/276 (85%), Gaps = 0/276 (0%)
 Frame = +2

Query  71   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  250
            M KGPGLYT+IGKKARDLLY+DYQ D KF++TTYS TGV IT+TG+ KG +FLGDV TQ+
Sbjct  1    MVKGPGLYTEIGKKARDLLYKDYQGDQKFSVTTYSSTGVAITTTGTNKGSVFLGDVATQV  60

Query  251  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  430
            KNKN T D KV T+S++ TT T+DE  PG+K I S ++PDQ+SGK ELQYL+D+AGI+TS
Sbjct  61   KNKNFTADIKVSTDSSLLTTFTLDEPTPGVKAIFSAKLPDQKSGKFELQYLNDYAGIATS  120

Query  431  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  610
            + LT +PIVNFSGVVGTN +ALGTDVSF+T+SG F  +NAG+SFT  DLIASLTLNDKG+
Sbjct  121  LSLTGSPIVNFSGVVGTNVVALGTDVSFETESGNFKHFNAGVSFTKDDLIASLTLNDKGE  180

Query  611  SLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTITVGTQHQLDPLTTVKARVNNFGRANAL  790
             L+ASYYH VNPLSNT VGAEV+H+F++  N ITVGTQH +DPLTTVKARVNN G ANAL
Sbjct  181  KLNASYYHIVNPLSNTVVGAEVSHNFTTKENAITVGTQHAIDPLTTVKARVNNAGIANAL  240

Query  791  IQHEWRPKSLITLSGEVDVKAVDKSAKFGLALALKP  898
            IQHEWRPKS  T+SGEVD +A++KSAK G+ALALKP
Sbjct  241  IQHEWRPKSFFTVSGEVDSRAIEKSAKVGIALALKP  276



>pir||B55017 porin, plastid - garden pea
Length=275

 Score =   405 bits (1041),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 195/275 (71%), Positives = 231/275 (84%), Gaps = 0/275 (0%)
 Frame = +2

Query  71   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  250
            M KGPGLYTDIGKKARDLLY+DY +D KFTI+TYSPTGV ITS+G+KKG L LGDVNTQL
Sbjct  1    MVKGPGLYTDIGKKARDLLYKDYHSDKKFTISTYSPTGVAITSSGTKKGFLELGDVNTQL  60

Query  251  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  430
            KNKNITT  KVDTNSN+FTTITV+E APG+K I S +VP+QRSGK+E QYLH++AG++ S
Sbjct  61   KNKNITTQIKVDTNSNLFTTITVNEPAPGVKAILSEKVPEQRSGKLEFQYLHEYAGVNAS  120

Query  431  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  610
            VGL +NP+VN SG  G+ AL++G DVSFDT +  FTKYNA ++F    LI SLTLN+KGD
Sbjct  121  VGLNSNPMVNLSGAFGSKALSVGVDVSFDTATSDFTKYNAAVNFVKDSLIGSLTLNEKGD  180

Query  611  SLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTITVGTQHQLDPLTTVKARVNNFGRANAL  790
             LSASYYH +NPLSNTAVG +++H FS+  N  T+GTQH LDPLTTVK RV N G+A+AL
Sbjct  181  LLSASYYHAINPLSNTAVGVDISHRFSTKENDFTLGTQHALDPLTTVKGRVTNSGKASAL  240

Query  791  IQHEWRPKSLITLSGEVDVKAVDKSAKFGLALALK  895
            IQHEWRPKSLIT+S EVD KA++KSAK GL+LALK
Sbjct  241  IQHEWRPKSLITISSEVDTKAIEKSAKIGLSLALK  275



>ref|XP_002873707.1| voltage-dependent anion-selective channel protein hsr2 [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH49966.1| voltage-dependent anion-selective channel protein hsr2 [Arabidopsis 
lyrata subsp. lyrata]
Length=276

 Score =   405 bits (1041),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 193/276 (70%), Positives = 232/276 (84%), Gaps = 0/276 (0%)
 Frame = +2

Query  71   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  250
            M KGPGLYT+IGKKARDLLY+DYQ D KF++TTYS TGV IT+TG+ KG +FLGDV TQ+
Sbjct  1    MVKGPGLYTEIGKKARDLLYKDYQGDQKFSVTTYSSTGVAITTTGTNKGSVFLGDVATQV  60

Query  251  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  430
            KNKN T D KV T+S++ TT+T DE APGLK+I   ++PD +SGK E+QY HD+A ISTS
Sbjct  61   KNKNFTADVKVSTDSSLLTTLTFDEPAPGLKVIVQAKLPDHKSGKAEVQYFHDYAAISTS  120

Query  431  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  610
            VG TA+PIVNFSGVVGTN LALGTDV+F+T+SG F  +NAGL+FT  DLIASL LN+KG+
Sbjct  121  VGFTASPIVNFSGVVGTNVLALGTDVAFNTESGNFKHFNAGLNFTKDDLIASLILNEKGE  180

Query  611  SLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTITVGTQHQLDPLTTVKARVNNFGRANAL  790
             L+ASYY  VNPL+NT VGAE++H+F++  N ITVGTQH +DPLTTVKARVNN G ANAL
Sbjct  181  KLNASYYQIVNPLTNTVVGAEISHNFTTKENAITVGTQHAIDPLTTVKARVNNVGVANAL  240

Query  791  IQHEWRPKSLITLSGEVDVKAVDKSAKFGLALALKP  898
            IQHEWRPKS  T+SGEVD +A++KSAK G+ALALKP
Sbjct  241  IQHEWRPKSFFTVSGEVDSRAIEKSAKVGIALALKP  276



>ref|XP_008775594.1| PREDICTED: mitochondrial outer membrane protein porin 1-like 
[Phoenix dactylifera]
Length=275

 Score =   405 bits (1041),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 193/274 (70%), Positives = 232/274 (85%), Gaps = 1/274 (0%)
 Frame = +2

Query  80   GPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQLKNK  259
            GPGLY++IG+KARDLLY+DY TD KFT+TTY+  GV IT++G+KK +   G++ +QLKNK
Sbjct  2    GPGLYSEIGRKARDLLYKDYLTDQKFTVTTYTSNGVAITASGTKKNEFIFGEIQSQLKNK  61

Query  260  NITTDFKVDTNSNVFTTITVDE-AAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTSVG  436
            NI+ D K +++SN+ TT+TVDE A PGLK I SF VPDQRSGKVELQYLHD+AG++  +G
Sbjct  62   NISVDVKANSDSNLLTTVTVDELATPGLKTIFSFVVPDQRSGKVELQYLHDYAGVNAGIG  121

Query  437  LTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGDSL  616
            LTANPIVN SGVVGT  L++G DVSFDT SG FTKYNAGLS  N+DLIA+LTLN+KGDSL
Sbjct  122  LTANPIVNLSGVVGTRGLSVGADVSFDTASGNFTKYNAGLSVINADLIAALTLNNKGDSL  181

Query  617  SASYYHHVNPLSNTAVGAEVNHSFSSNVNTITVGTQHQLDPLTTVKARVNNFGRANALIQ  796
            SASYYH VNPL NTAVGAE+ HSFSSN NT+T GTQH LDPLT VKAR NN+G+A+ALIQ
Sbjct  182  SASYYHLVNPLWNTAVGAEITHSFSSNENTLTFGTQHALDPLTLVKARFNNYGKASALIQ  241

Query  797  HEWRPKSLITLSGEVDVKAVDKSAKFGLALALKP  898
            HEWR KS +T+SGEVD KA++KS+K GL+L LKP
Sbjct  242  HEWRLKSFLTISGEVDTKAIEKSSKVGLSLVLKP  275



>ref|XP_008808420.1| PREDICTED: mitochondrial outer membrane protein porin 1-like 
[Phoenix dactylifera]
Length=275

 Score =   404 bits (1038),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 191/274 (70%), Positives = 229/274 (84%), Gaps = 1/274 (0%)
 Frame = +2

Query  80   GPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQLKNK  259
            GPGLY++IGKKARDLLYRDY TD KFT+TTY+ +GV IT++G+KK +   G++ +QLK K
Sbjct  2    GPGLYSEIGKKARDLLYRDYLTDQKFTVTTYTSSGVAITASGTKKNEFIFGEIQSQLKKK  61

Query  260  NITTDFKVDTNSNVFTTITVDE-AAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTSVG  436
            NIT D K ++ SN+ TT+TVDE A PGL+ I SF VP+QRSGKVELQYLHD+AG++TS+G
Sbjct  62   NITVDVKANSESNLLTTVTVDELATPGLRTIFSFVVPEQRSGKVELQYLHDYAGVNTSIG  121

Query  437  LTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGDSL  616
            LTANPIVN SGV GT   A+G DVSFDT SG FTKYNAGLS TN+DLIA+LTLN+KGDSL
Sbjct  122  LTANPIVNLSGVFGTKGFAVGADVSFDTASGNFTKYNAGLSVTNADLIAALTLNNKGDSL  181

Query  617  SASYYHHVNPLSNTAVGAEVNHSFSSNVNTITVGTQHQLDPLTTVKARVNNFGRANALIQ  796
            SASYYH  +PLS+ AVGAE+ HSFSSN NT+T G Q  LDPLT VKAR NN+G+A+ALIQ
Sbjct  182  SASYYHLASPLSSAAVGAEITHSFSSNENTLTFGMQQALDPLTMVKARFNNYGKASALIQ  241

Query  797  HEWRPKSLITLSGEVDVKAVDKSAKFGLALALKP  898
            HEWRPKS  T+SGEVD KA++KS+K GL+L LKP
Sbjct  242  HEWRPKSFFTISGEVDTKAIEKSSKVGLSLVLKP  275



>ref|XP_004514771.1| PREDICTED: mitochondrial outer membrane protein porin of 36 kDa-like 
[Cicer arietinum]
Length=276

 Score =   403 bits (1036),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 192/276 (70%), Positives = 238/276 (86%), Gaps = 0/276 (0%)
 Frame = +2

Query  71   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  250
            M KGPGLY+DIGK+ARDLL++DYQ DHKFT+TT + +GV ITS+G +KG++FL DV+T++
Sbjct  1    MVKGPGLYSDIGKRARDLLFKDYQNDHKFTVTTQTLSGVEITSSGVRKGEIFLADVSTKV  60

Query  251  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  430
            KNKNITTD KVDTNSN+ TTITVDE APGLK I SF  PDQ S KVELQY H++ GI+TS
Sbjct  61   KNKNITTDIKVDTNSNLLTTITVDEPAPGLKTIFSFIFPDQNSAKVELQYQHEYVGINTS  120

Query  431  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  610
            +GLTA+PIVNFS V+G N +++G+DVSFDT SG F KYNAGL+ T++DLIASLT+NDKGD
Sbjct  121  IGLTASPIVNFSSVIGNNLVSVGSDVSFDTASGNFIKYNAGLNVTHADLIASLTINDKGD  180

Query  611  SLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTITVGTQHQLDPLTTVKARVNNFGRANAL  790
            +L+ASYYH V+PL+NTAVGAE++ SFSSN N +T+GTQH LDP+T +KARVNN+GRA+AL
Sbjct  181  TLNASYYHVVSPLTNTAVGAELSRSFSSNENLLTIGTQHALDPITLLKARVNNYGRASAL  240

Query  791  IQHEWRPKSLITLSGEVDVKAVDKSAKFGLALALKP  898
            IQH+W P++ I+L GEVD  A+ KSAK GLALALKP
Sbjct  241  IQHDWNPRTRISLVGEVDTVAIQKSAKVGLALALKP  276



>gb|KJB30017.1| hypothetical protein B456_005G139100 [Gossypium raimondii]
Length=255

 Score =   402 bits (1033),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 197/276 (71%), Positives = 228/276 (83%), Gaps = 21/276 (8%)
 Frame = +2

Query  71   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  250
            MGKGPGLY+DIGKKARDLLY+DYQ DHKFT+TTY+  GV ITSTG KKG+L L D+    
Sbjct  1    MGKGPGLYSDIGKKARDLLYKDYQADHKFTVTTYTSNGVAITSTGIKKGELLLADL----  56

Query  251  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  430
                             F T+TVDE APGLK I SF VPDQRSGKVELQY H++AGISTS
Sbjct  57   -----------------FATVTVDEPAPGLKTIFSFIVPDQRSGKVELQYQHEYAGISTS  99

Query  431  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  610
            +GL ANP+VNFSGVVG N +++GTD+SFDT SG FTK NAGL+FT+SDLIASLTLNDKGD
Sbjct  100  IGLNANPLVNFSGVVGNNCVSVGTDLSFDTGSGNFTKLNAGLNFTHSDLIASLTLNDKGD  159

Query  611  SLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTITVGTQHQLDPLTTVKARVNNFGRANAL  790
            +L+ASYYH V+PL+NTAVGAE+ HSFSSN NT+T+GTQH LDPLTTVKAR+NN+GRA+ L
Sbjct  160  TLNASYYHIVSPLTNTAVGAELTHSFSSNENTLTIGTQHALDPLTTVKARLNNYGRASGL  219

Query  791  IQHEWRPKSLITLSGEVDVKAVDKSAKFGLALALKP  898
            IQHEWRPKSL T+SGEVD +A++KSAK GLALALKP
Sbjct  220  IQHEWRPKSLFTISGEVDTRAIEKSAKVGLALALKP  255



>ref|XP_010925360.1| PREDICTED: mitochondrial outer membrane protein porin 1-like 
[Elaeis guineensis]
Length=275

 Score =   402 bits (1034),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 190/274 (69%), Positives = 234/274 (85%), Gaps = 1/274 (0%)
 Frame = +2

Query  80   GPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQLKNK  259
            GPGLY++IGK+ARDLLY+DYQTD KFT+TTY+  GV IT++G+KK +L  G++ +QLKNK
Sbjct  2    GPGLYSEIGKQARDLLYKDYQTDQKFTVTTYTANGVAITASGTKKNELIFGEIQSQLKNK  61

Query  260  NITTDFKVDTNSNVFTTITVDE-AAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTSVG  436
            NIT D K  ++SN+ T + VDE A PGLK I SF +PDQRSG+VELQY HDHAG++ S+G
Sbjct  62   NITVDVKAGSDSNLSTKVAVDELATPGLKTIFSFVLPDQRSGQVELQYQHDHAGVNASIG  121

Query  437  LTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGDSL  616
            LTANPIV+ SGVVGTNA+A+G DVSFDT  G F KYNAGLS TN+DLIASLT+NDKGDS+
Sbjct  122  LTANPIVSLSGVVGTNAVAVGADVSFDTAVGDFIKYNAGLSITNADLIASLTVNDKGDSV  181

Query  617  SASYYHHVNPLSNTAVGAEVNHSFSSNVNTITVGTQHQLDPLTTVKARVNNFGRANALIQ  796
            +ASYYH V+PLS+TAVGAE+ HSFSSN NT+T GTQH LDPLT VKAR NN+G+A+ALIQ
Sbjct  182  NASYYHLVSPLSSTAVGAELTHSFSSNQNTLTFGTQHALDPLTLVKARFNNYGKASALIQ  241

Query  797  HEWRPKSLITLSGEVDVKAVDKSAKFGLALALKP  898
            HEWRPKS +T++GEVD KA++KS+K GL+L L+P
Sbjct  242  HEWRPKSFLTVTGEVDTKAIEKSSKVGLSLVLRP  275



>ref|XP_004956656.1| PREDICTED: mitochondrial outer membrane protein porin 1-like 
[Setaria italica]
Length=276

 Score =   401 bits (1031),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 188/274 (69%), Positives = 231/274 (84%), Gaps = 1/274 (0%)
 Frame = +2

Query  80   GPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQLKNK  259
            GPGLYT+IGKK RDLLYRDYQTDHKFT+TTY+  GV +T+T +KK DL +G++ +Q+KNK
Sbjct  3    GPGLYTEIGKKTRDLLYRDYQTDHKFTLTTYTSNGVAVTATSTKKADLIIGEIQSQIKNK  62

Query  260  NITTDFKVDTNSNVFTTITVDEAA-PGLKIISSFRVPDQRSGKVELQYLHDHAGISTSVG  436
            NIT D K +++SNV TT+T+DE A PGLK I SF VPDQRSGK ELQYLHD+AG++ S+G
Sbjct  63   NITVDVKANSDSNVITTVTIDEVATPGLKAILSFAVPDQRSGKFELQYLHDYAGVNASIG  122

Query  437  LTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGDSL  616
            +TANPIVN SG  GT ALA+G D+S DT +G FTKYNAGLS T+ DLIASL LN+KGDSL
Sbjct  123  MTANPIVNLSGSFGTKALAVGADISLDTATGNFTKYNAGLSVTHEDLIASLNLNNKGDSL  182

Query  617  SASYYHHVNPLSNTAVGAEVNHSFSSNVNTITVGTQHQLDPLTTVKARVNNFGRANALIQ  796
            +A+YYH V+ L++TAVGAE+ HSFSSN NT+T GTQH LDPLT +KAR NN G+A+ALIQ
Sbjct  183  TAAYYHSVSQLTSTAVGAELTHSFSSNENTLTFGTQHALDPLTVLKARFNNSGKASALIQ  242

Query  797  HEWRPKSLITLSGEVDVKAVDKSAKFGLALALKP  898
            HEWRPKSL+T+S EVD K ++KS+K G+A+ALKP
Sbjct  243  HEWRPKSLVTISAEVDTKTIEKSSKVGIAVALKP  276



>ref|XP_006660565.1| PREDICTED: mitochondrial outer membrane protein porin 1-like 
[Oryza brachyantha]
Length=274

 Score =   400 bits (1029),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 194/273 (71%), Positives = 227/273 (83%), Gaps = 1/273 (0%)
 Frame = +2

Query  80   GPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQLKNK  259
            GPGLY +IGKKARDLLYRDYQTDHKFT+TTY+  GV IT+T +KK DL  G++ +Q+KNK
Sbjct  3    GPGLYPEIGKKARDLLYRDYQTDHKFTLTTYTSNGVAITATSTKKADLIFGEIQSQIKNK  62

Query  260  NITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTSVGL  439
            NIT D K +++SNV TT+TVDE  PGLK I SF VPDQRSGK ELQYLHD+AG+S S+GL
Sbjct  63   NITVDVKANSDSNVVTTVTVDELTPGLKSILSFAVPDQRSGKFELQYLHDYAGVSASIGL  122

Query  440  TANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGDSLS  619
            TANP+VN S V GT ALA+G DVS DT +G  TKYNAGLSFTN DLIASL LN+KGDSL+
Sbjct  123  TANPVVNLSSVFGTKALAVGADVSLDTATGNLTKYNAGLSFTNDDLIASLNLNNKGDSLT  182

Query  620  ASYYHHVNPLSNTAVGAEVNHSFSSNVNTITVGTQHQLDPLTTVKARVNNFGRANALIQH  799
            ASYYH VN  S TAVGAE+ HSFSSN N++T GTQH LDPLT VKAR NN G+A+AL+QH
Sbjct  183  ASYYHIVNH-SATAVGAELTHSFSSNENSLTFGTQHTLDPLTVVKARFNNSGKASALLQH  241

Query  800  EWRPKSLITLSGEVDVKAVDKSAKFGLALALKP  898
            EWRPKSL T+S EVD KA++KS+K G+A+ALKP
Sbjct  242  EWRPKSLWTISAEVDTKAIEKSSKVGIAVALKP  274



>ref|XP_008786741.1| PREDICTED: mitochondrial outer membrane protein porin 1-like 
[Phoenix dactylifera]
Length=276

 Score =   400 bits (1027),  Expect = 5e-135, Method: Compositional matrix adjust.
 Identities = 191/275 (69%), Positives = 234/275 (85%), Gaps = 2/275 (1%)
 Frame = +2

Query  80   GPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQLKNK  259
            GPGLY++IGKKARDLLY+DY TD KFT+ TY+  GV IT++G+KK +L  G++ +QLKNK
Sbjct  2    GPGLYSEIGKKARDLLYKDYHTDQKFTVATYTANGVAITASGTKKNELIFGEIQSQLKNK  61

Query  260  NITTDFKVDTNSNVFTTITVDE-AAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTSVG  436
            NIT D K +++SN+ TT+TVDE A PGLK I SF VPDQRSGKVELQYLHDH G++ S+G
Sbjct  62   NITVDVKANSDSNLSTTVTVDELATPGLKTIFSFVVPDQRSGKVELQYLHDHGGVNASIG  121

Query  437  LTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGDSL  616
            LTANPIVN SGVVGT+A+A+G DVSFDT +G F K NAGLS TN+DLIASLT+NDKGD +
Sbjct  122  LTANPIVNLSGVVGTDAVAVGADVSFDTANGDFIKCNAGLSITNADLIASLTVNDKGDCV  181

Query  617  SASYYHHVNPLSNTAVGAEVNHSFSSNV-NTITVGTQHQLDPLTTVKARVNNFGRANALI  793
            +ASYYH V+PLS+TAVGAE+ HSFSSN  NT+T GTQH LDPLT VKAR NN+G+A+ALI
Sbjct  182  NASYYHLVSPLSSTAVGAELTHSFSSNQKNTLTFGTQHALDPLTLVKARFNNYGKASALI  241

Query  794  QHEWRPKSLITLSGEVDVKAVDKSAKFGLALALKP  898
            QHEWRPKS +T++GEVD KA++KS+K GL+L L+P
Sbjct  242  QHEWRPKSFLTITGEVDTKAIEKSSKVGLSLVLRP  276



>ref|XP_009408682.1| PREDICTED: mitochondrial outer membrane protein porin 1-like 
[Musa acuminata subsp. malaccensis]
Length=275

 Score =   398 bits (1023),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 185/274 (68%), Positives = 233/274 (85%), Gaps = 1/274 (0%)
 Frame = +2

Query  80   GPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQLKNK  259
            GPGLY++IGKKARDLLY+DYQTDHKFT+TT +  GV IT++G++K D+  G++ +Q+KN 
Sbjct  2    GPGLYSEIGKKARDLLYKDYQTDHKFTVTTCTANGVAITASGTRKNDIIFGEIQSQIKNN  61

Query  260  NITTDFKVDTNSNVFTTITVDE-AAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTSVG  436
            NIT D K +++SNV TT+T++E A PGLK I SF +PDQRSGKVEL YLHD+AG++ S+G
Sbjct  62   NITFDVKTNSDSNVTTTVTINELATPGLKTIFSFVIPDQRSGKVELHYLHDYAGVNASIG  121

Query  437  LTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGDSL  616
            LTANP+VNFSGVVG+  +++G DV+FDT +G F KYNA LS TN+DLIA+L LN+KGDSL
Sbjct  122  LTANPVVNFSGVVGSKTVSVGADVAFDTATGNFIKYNASLSITNADLIAALALNNKGDSL  181

Query  617  SASYYHHVNPLSNTAVGAEVNHSFSSNVNTITVGTQHQLDPLTTVKARVNNFGRANALIQ  796
            SASYYH VNPLS+TAVGAE+ HSFSSN NT+  GTQH LDPLTT+KAR NN+G+A+ALIQ
Sbjct  182  SASYYHLVNPLSSTAVGAELTHSFSSNENTLAFGTQHALDPLTTIKARFNNYGKASALIQ  241

Query  797  HEWRPKSLITLSGEVDVKAVDKSAKFGLALALKP  898
            HEW+PKS  T+SGEVD KA++KS+K GL+L LKP
Sbjct  242  HEWKPKSFFTISGEVDTKAIEKSSKIGLSLVLKP  275



>ref|XP_003578022.1| PREDICTED: mitochondrial outer membrane porin [Brachypodium distachyon]
Length=276

 Score =   398 bits (1022),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 191/274 (70%), Positives = 227/274 (83%), Gaps = 1/274 (0%)
 Frame = +2

Query  80   GPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQLKNK  259
            GPGLYT+IGKK RDLLYRDYQTDHKFT+TTY+  GV IT+T SKK DL  G++ +Q+KNK
Sbjct  3    GPGLYTEIGKKTRDLLYRDYQTDHKFTLTTYTANGVAITATSSKKADLIFGEIQSQIKNK  62

Query  260  NITTDFKVDTNSNVFTTITVDE-AAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTSVG  436
             +T D K ++ SNV TT+TVDE AAPGLK I SF +PDQRSGK+ELQYLHD+AGI+ S+G
Sbjct  63   GVTVDVKANSASNVITTVTVDELAAPGLKTIFSFAIPDQRSGKLELQYLHDYAGINASIG  122

Query  437  LTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGDSL  616
            LTANP+VN SG  GTNALA+G DVS DT +  FTKYNAGLSFTN DL ASL LN+KGDSL
Sbjct  123  LTANPVVNLSGSFGTNALAVGADVSLDTATKNFTKYNAGLSFTNDDLTASLNLNNKGDSL  182

Query  617  SASYYHHVNPLSNTAVGAEVNHSFSSNVNTITVGTQHQLDPLTTVKARVNNFGRANALIQ  796
            +ASYYH V   + TAVGAE+ HSFSSN NT+  GTQH LDPLT VKAR+NN G+A+ALIQ
Sbjct  183  TASYYHFVEKSTKTAVGAELTHSFSSNENTLIFGTQHTLDPLTLVKARINNSGKASALIQ  242

Query  797  HEWRPKSLITLSGEVDVKAVDKSAKFGLALALKP  898
            HE+RP+SL T+S EVD KA++KS+K G+A+ALKP
Sbjct  243  HEFRPRSLCTISAEVDTKAIEKSSKVGIAVALKP  276



>gb|ABK24200.1| unknown [Picea sitchensis]
Length=276

 Score =   396 bits (1018),  Expect = 9e-134, Method: Compositional matrix adjust.
 Identities = 187/276 (68%), Positives = 228/276 (83%), Gaps = 0/276 (0%)
 Frame = +2

Query  71   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  250
            MGKGPGLY+DIGKK RDLL +DY  D KF+ T+Y+ TG+  TSTG KKG+ FLGD+NTQL
Sbjct  1    MGKGPGLYSDIGKKTRDLLNKDYNFDQKFSFTSYTSTGLAFTSTGIKKGEFFLGDLNTQL  60

Query  251  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  430
            KN N+TTD KVDT+SN+F T+T+DE APGLK I SF VPDQRSGKVELQYLHD+AG+STS
Sbjct  61   KNNNVTTDIKVDTSSNLFATVTIDEPAPGLKTILSFTVPDQRSGKVELQYLHDYAGVSTS  120

Query  431  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  610
            +GLT +PI +FSGV+G +  ++G +VSFDT SG F KY+AGLSF+  D ++SLTL  KGD
Sbjct  121  IGLTPSPITHFSGVIGNDTFSVGGEVSFDTASGNFLKYDAGLSFSKPDFVSSLTLTGKGD  180

Query  611  SLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTITVGTQHQLDPLTTVKARVNNFGRANAL  790
            +L ASY H V+PL+ TAVGAE++HSFS + NT T+GTQH LDPLTTVK R+NN+G+A AL
Sbjct  181  TLKASYLHTVSPLTKTAVGAEISHSFSRSENTFTIGTQHALDPLTTVKGRLNNYGKAAAL  240

Query  791  IQHEWRPKSLITLSGEVDVKAVDKSAKFGLALALKP  898
            +QHEWRPKS +TLSGEVD KA+  SAK GL+L LKP
Sbjct  241  LQHEWRPKSFVTLSGEVDTKALHNSAKVGLSLILKP  276



>gb|AAM62480.1| voltage-dependent anion-selective channel protein hsr2 [Arabidopsis 
thaliana]
Length=274

 Score =   396 bits (1017),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 193/276 (70%), Positives = 228/276 (83%), Gaps = 2/276 (1%)
 Frame = +2

Query  71   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  250
            M KGPGLYT+IGKKARDLLYRDYQ D KF++TTYS TGV IT+TG+ KG LFLGDV TQ+
Sbjct  1    MVKGPGLYTEIGKKARDLLYRDYQGDQKFSVTTYSSTGVAITTTGTNKGSLFLGDVATQV  60

Query  251  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  430
            KNKN T D KV T+S++ TT+T DE APGLK+I   ++PD +SGK E+QY HD+AGISTS
Sbjct  61   KNKNFTADVKVSTDSSLLTTLTFDEPAPGLKVIVQAKLPDHKSGKAEVQYFHDYAGISTS  120

Query  431  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  610
            VG TA PIVNFSGVVGTN L+LGTDV+++T+SG F  +NAG +FT  DL ASL LNDKG+
Sbjct  121  VGFTATPIVNFSGVVGTNGLSLGTDVAYNTESGNFKHFNAGFNFTKDDLTASLILNDKGE  180

Query  611  SLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTITVGTQHQLDPLTTVKARVNNFGRANAL  790
             L+ASYY  V+P  +T VGAE++H+F++  N ITVGTQH LDPLTTVKARVNN G ANAL
Sbjct  181  KLNASYYQIVSP--STVVGAEISHNFTTKENAITVGTQHALDPLTTVKARVNNAGVANAL  238

Query  791  IQHEWRPKSLITLSGEVDVKAVDKSAKFGLALALKP  898
            IQHEWRPKS  T+SGEVD KA+DKSAK G+ALALKP
Sbjct  239  IQHEWRPKSFFTVSGEVDSKAIDKSAKVGIALALKP  274



>ref|NP_001105619.1| voltage-dependent anion channel protein1a [Zea mays]
 gb|AAD56651.1|AF178950_1 voltage-dependent anion channel protein 1a [Zea mays]
Length=276

 Score =   395 bits (1014),  Expect = 4e-133, Method: Compositional matrix adjust.
 Identities = 182/274 (66%), Positives = 227/274 (83%), Gaps = 1/274 (0%)
 Frame = +2

Query  80   GPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQLKNK  259
            GPGLYT+IGKK RDLLY+DYQTDHKFT+TTY+  GV +T++ +KK DL LG++ +Q+KNK
Sbjct  3    GPGLYTEIGKKTRDLLYKDYQTDHKFTLTTYTSNGVAVTASSTKKADLILGEIQSQIKNK  62

Query  260  NITTDFKVDTNSNVFTTITVDE-AAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTSVG  436
            N+T D K ++ SN+ TTITVDE A PGLK I SF VPDQRSGKVELQYLHD+AG++ S+G
Sbjct  63   NMTIDVKANSESNIITTITVDEIATPGLKTILSFAVPDQRSGKVELQYLHDYAGVNASIG  122

Query  437  LTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGDSL  616
            LTANP+VN S   GT A+ALG D+S DT +G  TKYNA L FT+ DL+ASL LN+KGDSL
Sbjct  123  LTANPVVNLSAAFGTKAVALGADISLDTATGNLTKYNAALRFTHEDLVASLNLNNKGDSL  182

Query  617  SASYYHHVNPLSNTAVGAEVNHSFSSNVNTITVGTQHQLDPLTTVKARVNNFGRANALIQ  796
            + +YYH V+ L+NTAVGAE+ HSFS+N NT+T G QH LDPLT +KAR+NN G+A+ALIQ
Sbjct  183  TGAYYHKVSELTNTAVGAELTHSFSTNENTLTFGGQHALDPLTVLKARINNSGKASALIQ  242

Query  797  HEWRPKSLITLSGEVDVKAVDKSAKFGLALALKP  898
            HEWRPKSL+T+S EVD K ++KS+K G+A+ALKP
Sbjct  243  HEWRPKSLVTISAEVDTKTIEKSSKVGIAVALKP  276



>ref|NP_001062983.1| Os09g0361400 [Oryza sativa Japonica Group]
 sp|Q6K548.3|VDAC1_ORYSJ RecName: Full=Mitochondrial outer membrane protein porin 1; AltName: 
Full=Voltage-dependent anion-selective channel protein 
1; Short=OsVDAC1 [Oryza sativa Japonica Group]
 emb|CAB82853.1| voltage-dependent anion channel [Oryza sativa]
 dbj|BAD23330.1| voltage-dependent anion channel [Oryza sativa Japonica Group]
 dbj|BAF24897.1| Os09g0361400 [Oryza sativa Japonica Group]
 dbj|BAG87823.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG87525.1| unnamed protein product [Oryza sativa Japonica Group]
Length=274

 Score =   394 bits (1013),  Expect = 5e-133, Method: Compositional matrix adjust.
 Identities = 191/273 (70%), Positives = 226/273 (83%), Gaps = 1/273 (0%)
 Frame = +2

Query  80   GPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQLKNK  259
            GPGLY +IGKKARDLLYRDYQTDHKFT+TTY+  GV IT+T +KK DL  G++ +Q+KNK
Sbjct  3    GPGLYPEIGKKARDLLYRDYQTDHKFTLTTYTSNGVAITATSTKKADLIFGEIQSQIKNK  62

Query  260  NITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTSVGL  439
            NIT D K +++SNV TT+TVDE  PGLK I SF VPDQRSGK ELQY HD+AG+S S+GL
Sbjct  63   NITVDVKANSDSNVVTTVTVDELTPGLKSILSFAVPDQRSGKFELQYSHDYAGVSASIGL  122

Query  440  TANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGDSLS  619
            TA+P+VN S V GT ALA+G DVS DT +G  TKYNAGLSF+N DLIASL LN+KGDSL+
Sbjct  123  TASPVVNLSSVFGTKALAVGADVSLDTATGNLTKYNAGLSFSNDDLIASLNLNNKGDSLT  182

Query  620  ASYYHHVNPLSNTAVGAEVNHSFSSNVNTITVGTQHQLDPLTTVKARVNNFGRANALIQH  799
            ASYYH VN  S TAVGAE+ HSFSSN N++T GTQH LDPLT VKAR NN G+A+AL+QH
Sbjct  183  ASYYHIVNH-SATAVGAELTHSFSSNENSLTFGTQHTLDPLTVVKARFNNSGKASALLQH  241

Query  800  EWRPKSLITLSGEVDVKAVDKSAKFGLALALKP  898
            EWRPKS+ T+S EVD KA+DKS+K G+A+ALKP
Sbjct  242  EWRPKSVWTISAEVDTKAIDKSSKVGIAVALKP  274



>gb|EAZ44453.1| hypothetical protein OsJ_29066 [Oryza sativa Japonica Group]
Length=274

 Score =   394 bits (1012),  Expect = 7e-133, Method: Compositional matrix adjust.
 Identities = 191/273 (70%), Positives = 225/273 (82%), Gaps = 1/273 (0%)
 Frame = +2

Query  80   GPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQLKNK  259
            GPGLY +IGKKARDLLYRDYQTDHKFT+TTY+  GV IT+T +KK DL  G++ +Q+KNK
Sbjct  3    GPGLYPEIGKKARDLLYRDYQTDHKFTLTTYTSNGVAITATSTKKADLIFGEIQSQIKNK  62

Query  260  NITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTSVGL  439
            NIT D K +++SNV TT+TVDE  PGLK I SF VPDQRSGK ELQY HD+AG+S S+GL
Sbjct  63   NITVDVKANSDSNVVTTVTVDELTPGLKSILSFAVPDQRSGKFELQYSHDYAGVSASIGL  122

Query  440  TANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGDSLS  619
            TA+P+VN S V GT ALA+G DVS DT +G  TKYNAGLSF+N DLIASL LN+KGDSL+
Sbjct  123  TASPVVNLSSVFGTKALAVGADVSLDTATGNLTKYNAGLSFSNDDLIASLNLNNKGDSLT  182

Query  620  ASYYHHVNPLSNTAVGAEVNHSFSSNVNTITVGTQHQLDPLTTVKARVNNFGRANALIQH  799
            ASYYH VN  S TAVGAE+ HSFSSN N++T GTQH LDPLT VKAR NN G+A AL+QH
Sbjct  183  ASYYHIVNH-SATAVGAELTHSFSSNENSLTFGTQHTLDPLTVVKARFNNSGKARALLQH  241

Query  800  EWRPKSLITLSGEVDVKAVDKSAKFGLALALKP  898
            EWRPKS+ T+S EVD KA+DKS+K G+A+ALKP
Sbjct  242  EWRPKSVWTISAEVDTKAIDKSSKVGIAVALKP  274



>ref|NP_197013.1| voltage dependent anion channel 3 [Arabidopsis thaliana]
 ref|NP_001190314.1| voltage dependent anion channel 3 [Arabidopsis thaliana]
 sp|Q9SMX3.3|VDAC3_ARATH RecName: Full=Mitochondrial outer membrane protein porin 3; AltName: 
Full=Protein HYPERSENSITIVE RESPONSE 2; Short=Athsr2; 
AltName: Full=Voltage-dependent anion-selective channel protein 
3; Short=AtVDAC3; Short=VDAC-3 [Arabidopsis thaliana]
 emb|CAA10363.1| voltage-dependent anion-selective channel protein [Arabidopsis 
thaliana]
 emb|CAC01828.1| voltage-dependent anion-selective channel protein hsr2 [Arabidopsis 
thaliana]
 gb|AAL36247.1| putative voltage-dependent anion-selective channel protein hsr2 
[Arabidopsis thaliana]
 gb|AAM67451.1| putative voltage-dependent anion-selective channel protein hsr2 
[Arabidopsis thaliana]
 gb|AED92115.1| voltage dependent anion channel 3 [Arabidopsis thaliana]
 gb|AED92116.1| voltage dependent anion channel 3 [Arabidopsis thaliana]
Length=274

 Score =   394 bits (1011),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 192/276 (70%), Positives = 227/276 (82%), Gaps = 2/276 (1%)
 Frame = +2

Query  71   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  250
            M KGPGLYT+IGKKARDLLYRDYQ D KF++TTYS TGV IT+TG+ KG LFLGDV TQ+
Sbjct  1    MVKGPGLYTEIGKKARDLLYRDYQGDQKFSVTTYSSTGVAITTTGTNKGSLFLGDVATQV  60

Query  251  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  430
            KN N T D KV T+S++ TT+T DE APGLK+I   ++PD +SGK E+QY HD+AGISTS
Sbjct  61   KNNNFTADVKVSTDSSLLTTLTFDEPAPGLKVIVQAKLPDHKSGKAEVQYFHDYAGISTS  120

Query  431  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  610
            VG TA PIVNFSGVVGTN L+LGTDV+++T+SG F  +NAG +FT  DL ASL LNDKG+
Sbjct  121  VGFTATPIVNFSGVVGTNGLSLGTDVAYNTESGNFKHFNAGFNFTKDDLTASLILNDKGE  180

Query  611  SLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTITVGTQHQLDPLTTVKARVNNFGRANAL  790
             L+ASYY  V+P  +T VGAE++H+F++  N ITVGTQH LDPLTTVKARVNN G ANAL
Sbjct  181  KLNASYYQIVSP--STVVGAEISHNFTTKENAITVGTQHALDPLTTVKARVNNAGVANAL  238

Query  791  IQHEWRPKSLITLSGEVDVKAVDKSAKFGLALALKP  898
            IQHEWRPKS  T+SGEVD KA+DKSAK G+ALALKP
Sbjct  239  IQHEWRPKSFFTVSGEVDSKAIDKSAKVGIALALKP  274



>gb|ACF85328.1| unknown [Zea mays]
 gb|ACG42313.1| isochorismate synthase 1 [Zea mays]
 tpg|DAA39954.1| TPA: voltage-dependent anion channel protein 1a [Zea mays]
Length=276

 Score =   393 bits (1010),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 181/274 (66%), Positives = 227/274 (83%), Gaps = 1/274 (0%)
 Frame = +2

Query  80   GPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQLKNK  259
            GPGLYT+IGKK RDLLY+DYQTDHKFT+TTY+  GV +T++ +KK DL LG++ +Q+KNK
Sbjct  3    GPGLYTEIGKKTRDLLYKDYQTDHKFTLTTYTSNGVAVTASSTKKADLILGEIQSQIKNK  62

Query  260  NITTDFKVDTNSNVFTTITVDE-AAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTSVG  436
            N+T D K ++ SN+ TTITVDE A PGLK I SF VPDQRSGKVELQYLHD+AG++ S+G
Sbjct  63   NMTIDVKANSESNIITTITVDEIATPGLKTILSFAVPDQRSGKVELQYLHDYAGVNASIG  122

Query  437  LTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGDSL  616
            LTANP+VN S   GT A+A+G D+S DT +G  TKYNA L FT+ DL+ASL LN+KGDSL
Sbjct  123  LTANPVVNLSAAFGTKAVAVGADISLDTATGNLTKYNAALRFTHEDLVASLNLNNKGDSL  182

Query  617  SASYYHHVNPLSNTAVGAEVNHSFSSNVNTITVGTQHQLDPLTTVKARVNNFGRANALIQ  796
            + +YYH V+ L+NTAVGAE+ HSFS+N NT+T G QH LDPLT +KAR+NN G+A+ALIQ
Sbjct  183  TGAYYHKVSELTNTAVGAELTHSFSTNENTLTFGGQHALDPLTVLKARINNSGKASALIQ  242

Query  797  HEWRPKSLITLSGEVDVKAVDKSAKFGLALALKP  898
            HEWRPKSL+T+S EVD K ++KS+K G+A+ALKP
Sbjct  243  HEWRPKSLVTISAEVDTKTIEKSSKVGIAVALKP  276



>gb|EAZ08792.1| hypothetical protein OsI_31052 [Oryza sativa Indica Group]
Length=274

 Score =   393 bits (1009),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 190/273 (70%), Positives = 226/273 (83%), Gaps = 1/273 (0%)
 Frame = +2

Query  80   GPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQLKNK  259
            GPGLY +IGKKARDLLYRDYQTDHKFT+TTY+  GV IT+T +KK DL  G++ +Q+KNK
Sbjct  3    GPGLYPEIGKKARDLLYRDYQTDHKFTLTTYTSNGVAITATSTKKADLIFGEIQSQIKNK  62

Query  260  NITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTSVGL  439
            NIT D K +++SNV TT+TVDE  PGLK I SF VPDQRSGK ELQY HD+AG+S S+GL
Sbjct  63   NITVDVKANSDSNVVTTVTVDELTPGLKSILSFAVPDQRSGKFELQYSHDYAGVSASIGL  122

Query  440  TANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGDSLS  619
            TA+P+VN S V GT ALA+G DVS DT +G  TKYNAGLSF+N DLIASL+LN+KGDSL+
Sbjct  123  TASPVVNLSSVFGTKALAVGADVSLDTATGNLTKYNAGLSFSNDDLIASLSLNNKGDSLT  182

Query  620  ASYYHHVNPLSNTAVGAEVNHSFSSNVNTITVGTQHQLDPLTTVKARVNNFGRANALIQH  799
            ASYYH VN  S TAVGAE+ HSFSSN N++T GTQH LDPLT VKA  NN G+A+AL+QH
Sbjct  183  ASYYHIVNH-SATAVGAELTHSFSSNENSLTFGTQHTLDPLTVVKAHFNNSGKASALLQH  241

Query  800  EWRPKSLITLSGEVDVKAVDKSAKFGLALALKP  898
            EWRPKS+ T+S EVD KA+DKS+K G+A+ALKP
Sbjct  242  EWRPKSVWTISAEVDTKAIDKSSKVGIAVALKP  274



>ref|XP_002460110.1| hypothetical protein SORBIDRAFT_02g022910 [Sorghum bicolor]
 gb|EER96631.1| hypothetical protein SORBIDRAFT_02g022910 [Sorghum bicolor]
Length=276

 Score =   392 bits (1007),  Expect = 5e-132, Method: Compositional matrix adjust.
 Identities = 180/274 (66%), Positives = 227/274 (83%), Gaps = 1/274 (0%)
 Frame = +2

Query  80   GPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQLKNK  259
            GPGLY +IGKK +DLLY+DYQTDHKFT+TTY+  GV +T++ +KK DL  G++ +Q+KNK
Sbjct  3    GPGLYAEIGKKTKDLLYKDYQTDHKFTLTTYTSNGVAVTASSTKKADLIFGEIQSQIKNK  62

Query  260  NITTDFKVDTNSNVFTTITVDE-AAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTSVG  436
            NIT D K ++ SN+ TT+TVDE A PGLK I SF VPDQRSGKVELQYLHD+AG++ S+G
Sbjct  63   NITVDVKANSESNIITTVTVDEIATPGLKTILSFAVPDQRSGKVELQYLHDYAGVNASIG  122

Query  437  LTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGDSL  616
            LTANP+VN S   GT ALA+G DVS DT +G  TKYN+GL FT+ DLIASL+LN++GDSL
Sbjct  123  LTANPVVNLSAAFGTKALAVGADVSLDTATGNLTKYNSGLRFTHEDLIASLSLNNRGDSL  182

Query  617  SASYYHHVNPLSNTAVGAEVNHSFSSNVNTITVGTQHQLDPLTTVKARVNNFGRANALIQ  796
            + +YYH V+ L+NTAVGAE+ HSFS+N NT+T G QH LDPLT +KAR+NN G+A+ALIQ
Sbjct  183  TGAYYHKVSELTNTAVGAELTHSFSTNENTVTFGGQHALDPLTVLKARINNSGKASALIQ  242

Query  797  HEWRPKSLITLSGEVDVKAVDKSAKFGLALALKP  898
            HEWRPKSL+T+S EVD K ++KS+K G+A+ALKP
Sbjct  243  HEWRPKSLVTISAEVDTKTIEKSSKVGIAVALKP  276



>ref|XP_003621109.1| Outer plastidial membrane protein porin [Medicago truncatula]
 gb|AES77327.1| porin/voltage-dependent anion-selective channel protein [Medicago 
truncatula]
Length=277

 Score =   392 bits (1007),  Expect = 5e-132, Method: Compositional matrix adjust.
 Identities = 186/274 (68%), Positives = 225/274 (82%), Gaps = 0/274 (0%)
 Frame = +2

Query  77   KGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQLKN  256
            KGPGLYTDIGKKARDLL++DY +D KFT++TYSPTGV ITS+G+KKG+LF+GDVNTQLKN
Sbjct  4    KGPGLYTDIGKKARDLLFKDYNSDQKFTVSTYSPTGVAITSSGTKKGELFVGDVNTQLKN  63

Query  257  KNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTSVG  436
            KN T D KVDT SN+FTTITV E APG+K I S +VPD  SGKVELQYLHD+AGIS ++G
Sbjct  64   KNYTADIKVDTESNLFTTITVTEPAPGVKAIISCKVPDPASGKVELQYLHDYAGISGNIG  123

Query  437  LTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGDSL  616
            L ANP+VN SGV GTNALA G D+S+DTK    TK N G+SF   DL+ +LTLN+KGD L
Sbjct  124  LKANPVVNLSGVFGTNALAFGGDISYDTKLRELTKSNVGVSFIKDDLLGALTLNEKGDVL  183

Query  617  SASYYHHVNPLSNTAVGAEVNHSFSSNVNTITVGTQHQLDPLTTVKARVNNFGRANALIQ  796
            +ASYYH +NP++NTAVG ++ H FS+  N  T+G QH LDPLTT+K R+ N  +A+ALIQ
Sbjct  184  NASYYHVINPVTNTAVGVDMGHRFSTRENNFTLGVQHALDPLTTLKGRITNSAKASALIQ  243

Query  797  HEWRPKSLITLSGEVDVKAVDKSAKFGLALALKP  898
            HEWRPKSLIT+S E+D KA++KSAK GL+L LKP
Sbjct  244  HEWRPKSLITISTELDTKAIEKSAKVGLSLVLKP  277



>gb|EPS68383.1| hypothetical protein M569_06388 [Genlisea aurea]
Length=278

 Score =   391 bits (1005),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 187/274 (68%), Positives = 226/274 (82%), Gaps = 0/274 (0%)
 Frame = +2

Query  77   KGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQLKN  256
            K PGLY+DIGKKARDLLYRDY  DHKFT+T+Y+  GV ITS+  KKGD  L D++ QLKN
Sbjct  5    KSPGLYSDIGKKARDLLYRDYGGDHKFTLTSYTSNGVSITSSAVKKGDSVLADISAQLKN  64

Query  257  KNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTSVG  436
            KNITTD KVDTNS V TTIT+DE APG+K I S   PDQ+SGKVELQY H++AGISTS+ 
Sbjct  65   KNITTDVKVDTNSKVLTTITIDEPAPGVKAIFSITAPDQKSGKVELQYFHEYAGISTSLF  124

Query  437  LTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGDSL  616
            LTA PIVNFSGV G   +  GTDVSFDT +G FTKYNAG+SFT +DLIASL LNDKG+ +
Sbjct  125  LTAKPIVNFSGVAGNKNVFFGTDVSFDTATGNFTKYNAGISFTTADLIASLNLNDKGEKI  184

Query  617  SASYYHHVNPLSNTAVGAEVNHSFSSNVNTITVGTQHQLDPLTTVKARVNNFGRANALIQ  796
            +ASY+H V+PL+NTAVGAE  H+ ++  N + VGTQH LDPLT VK R+N++G+A+A+IQ
Sbjct  185  TASYFHTVSPLTNTAVGAEFTHNLTTKENVVFVGTQHLLDPLTAVKGRLNSYGQASAVIQ  244

Query  797  HEWRPKSLITLSGEVDVKAVDKSAKFGLALALKP  898
            HEWRPKSLIT+SGEVD +A++K+AK GLA+ALKP
Sbjct  245  HEWRPKSLITISGEVDTRAIEKTAKIGLAVALKP  278



>gb|ACJ85253.1| unknown [Medicago truncatula]
Length=277

 Score =   390 bits (1003),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 185/274 (68%), Positives = 225/274 (82%), Gaps = 0/274 (0%)
 Frame = +2

Query  77   KGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQLKN  256
            KGPGLYT+IGKKARDLL++DY +D KFT++TYSPTGV ITS+G+KKG+LF+GDVNTQLKN
Sbjct  4    KGPGLYTNIGKKARDLLFKDYNSDQKFTVSTYSPTGVAITSSGAKKGELFVGDVNTQLKN  63

Query  257  KNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTSVG  436
            KN T D KVDT SN+FTTITV E APG+K I S +VPD  SGKVELQYLHD+AGIS ++G
Sbjct  64   KNYTADIKVDTESNLFTTITVTEPAPGVKAIISCKVPDPASGKVELQYLHDYAGISGNIG  123

Query  437  LTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGDSL  616
            L ANP+VN SGV GTNALA G D+S+DTK    TK N G+SF   DL+ +LTLN+KGD L
Sbjct  124  LKANPVVNLSGVFGTNALAFGGDISYDTKLRELTKSNVGVSFIKDDLLGALTLNEKGDVL  183

Query  617  SASYYHHVNPLSNTAVGAEVNHSFSSNVNTITVGTQHQLDPLTTVKARVNNFGRANALIQ  796
            +ASYYH +NP++NTAVG ++ H FS+  N  T+G QH LDPLTT+K R+ N  +A+ALIQ
Sbjct  184  NASYYHVINPVTNTAVGVDMGHRFSTRENNFTLGVQHALDPLTTLKGRITNSAKASALIQ  243

Query  797  HEWRPKSLITLSGEVDVKAVDKSAKFGLALALKP  898
            HEWRPKSLIT+S E+D KA++KSAK GL+L LKP
Sbjct  244  HEWRPKSLITISTELDTKAIEKSAKVGLSLVLKP  277



>gb|AFK38338.1| unknown [Medicago truncatula]
Length=277

 Score =   389 bits (999),  Expect = 7e-131, Method: Compositional matrix adjust.
 Identities = 185/274 (68%), Positives = 224/274 (82%), Gaps = 0/274 (0%)
 Frame = +2

Query  77   KGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQLKN  256
            KGPGLYTDIGKKARDLL++DY +D KFT++TYSPTGV ITS+G+KKG+LF+GDVNTQLKN
Sbjct  4    KGPGLYTDIGKKARDLLFKDYNSDQKFTVSTYSPTGVAITSSGTKKGELFVGDVNTQLKN  63

Query  257  KNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTSVG  436
            KN T D KVDT SN+FTTITV E APG+K I S +VPD  SGKVELQYLHD+AGIS ++G
Sbjct  64   KNYTADIKVDTESNLFTTITVTEPAPGVKAIISCKVPDPASGKVELQYLHDYAGISGNIG  123

Query  437  LTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGDSL  616
            L ANP+VN SGV GTNALA G D+S+DTK    TK N G+SF   DL+ +LTLN+KGD L
Sbjct  124  LKANPVVNLSGVFGTNALAFGGDISYDTKLRELTKSNVGVSFIKDDLLGALTLNEKGDVL  183

Query  617  SASYYHHVNPLSNTAVGAEVNHSFSSNVNTITVGTQHQLDPLTTVKARVNNFGRANALIQ  796
            +ASYYH +NP++NTAVG ++ H FS+  N  T+G QH LDPLTT+K R+ N  +A+ALIQ
Sbjct  184  NASYYHVINPVTNTAVGVDMGHRFSTRENNFTLGVQHALDPLTTLKGRITNSAKASALIQ  243

Query  797  HEWRPKSLITLSGEVDVKAVDKSAKFGLALALKP  898
            HEWRPKSLIT+  E+D KA++KSAK GL+L LKP
Sbjct  244  HEWRPKSLITIFTELDTKAIEKSAKVGLSLVLKP  277



>gb|KCW56275.1| hypothetical protein EUGRSUZ_I02018 [Eucalyptus grandis]
Length=260

 Score =   388 bits (997),  Expect = 8e-131, Method: Compositional matrix adjust.
 Identities = 188/236 (80%), Positives = 214/236 (91%), Gaps = 0/236 (0%)
 Frame = +2

Query  191  ITSTGSKKGDLFLGDVNTQLKNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPD  370
            +TSTG+KKG+LFL DVNTQLKNKNITTD KVDT+SN+FTTITVDE APGLK I SF+VPD
Sbjct  25   LTSTGTKKGELFLADVNTQLKNKNITTDIKVDTSSNLFTTITVDEPAPGLKSIFSFKVPD  84

Query  371  QRSGKVELQYLHDHAGISTSVGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNA  550
            QRSGK+ELQYLH+HAGIS+S+GLTANPIV FSGV+GT+ALALGTDVSFDTKSG F K NA
Sbjct  85   QRSGKIELQYLHEHAGISSSIGLTANPIVTFSGVIGTSALALGTDVSFDTKSGDFAKCNA  144

Query  551  GLSFTNSDLIASLTLNDKGDSLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTITVGTQHQ  730
            GLSF+N+DLIASLT+NDKGD+L+ASYYH VN L+NTAVGAE  H FS+N NTITVGTQH 
Sbjct  145  GLSFSNADLIASLTVNDKGDTLAASYYHLVNGLTNTAVGAEFTHRFSTNENTITVGTQHA  204

Query  731  LDPLTTVKARVNNFGRANALIQHEWRPKSLITLSGEVDVKAVDKSAKFGLALALKP  898
            LDPLT+VKARV N G+ +ALIQHEWRP+SL T+SGEVD K++DKSAK GLALALKP
Sbjct  205  LDPLTSVKARVTNAGKVSALIQHEWRPRSLFTISGEVDSKSIDKSAKVGLALALKP  260



>tpg|DAA61162.1| TPA: voltage-dependent anion-selective channel protein [Zea mays]
Length=276

 Score =   387 bits (994),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 178/274 (65%), Positives = 226/274 (82%), Gaps = 1/274 (0%)
 Frame = +2

Query  80   GPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQLKNK  259
            GPGLYT+IGKK RDLLY+DYQTDHKFT+TTYS  GV +T+T +KK DL   ++++Q+KNK
Sbjct  3    GPGLYTEIGKKTRDLLYKDYQTDHKFTLTTYSSNGVAVTATSTKKADLIFSEIHSQIKNK  62

Query  260  NITTDFKVDTNSNVFTTITVDE-AAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTSVG  436
            N+T D K ++ SN+ TT+TV+E A PGLK I SF VPDQRSGKVELQYLHD+AG++ SV 
Sbjct  63   NMTVDVKANSESNIITTVTVNEIATPGLKTILSFAVPDQRSGKVELQYLHDYAGVNASVS  122

Query  437  LTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGDSL  616
            LTANP+ N S   GT ALA+G ++SFD+ +G FTKYNAGL FT+ DLIASL +N+KGD+L
Sbjct  123  LTANPVANLSAAFGTKALAVGAEISFDSATGNFTKYNAGLMFTHEDLIASLNMNNKGDNL  182

Query  617  SASYYHHVNPLSNTAVGAEVNHSFSSNVNTITVGTQHQLDPLTTVKARVNNFGRANALIQ  796
            + +YYH V+ L+NTAVGAE+ HSFS+N NT+T G QH LDPLT +KAR+NN G+A+ LIQ
Sbjct  183  TGAYYHKVSELTNTAVGAELTHSFSTNENTLTFGGQHTLDPLTVLKARINNSGKASVLIQ  242

Query  797  HEWRPKSLITLSGEVDVKAVDKSAKFGLALALKP  898
            HEWRPKSL+T+S EVD K ++KS+K G+A+ALKP
Sbjct  243  HEWRPKSLVTISAEVDTKTIEKSSKVGIAVALKP  276



>gb|ACJ85279.1| unknown [Medicago truncatula]
 gb|AFK33360.1| unknown [Medicago truncatula]
 gb|KEH19832.1| porin/voltage-dependent anion-selective channel protein [Medicago 
truncatula]
Length=276

 Score =   386 bits (992),  Expect = 9e-130, Method: Compositional matrix adjust.
 Identities = 184/276 (67%), Positives = 231/276 (84%), Gaps = 0/276 (0%)
 Frame = +2

Query  71   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  250
            M KGPGLY+DIGK+ARDLL++DYQ DHKFTITT +  GV ITS G +KG+ FL DV+T++
Sbjct  1    MVKGPGLYSDIGKRARDLLFKDYQNDHKFTITTQTLAGVEITSAGVRKGEAFLADVSTKV  60

Query  251  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  430
            KNKN+TTD KVDTNSN+ TTITVDE  PGLK I SF  P+Q+SGKVELQYLHD+AGISTS
Sbjct  61   KNKNVTTDIKVDTNSNLRTTITVDETVPGLKTIFSFIYPEQKSGKVELQYLHDYAGISTS  120

Query  431  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  610
            +GLTA P VN S V+G N +++G+DVSF+T SG+  K N GL+ T++DLIASLT+ND+GD
Sbjct  121  IGLTATPTVNISAVLGNNLVSVGSDVSFETSSGSLNKCNFGLNVTHADLIASLTVNDRGD  180

Query  611  SLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTITVGTQHQLDPLTTVKARVNNFGRANAL  790
            SL+ASYYH V+PL+NTAVGAE++HSFSSN N +T+GTQH LDP+T +KA+VNN+G+A+AL
Sbjct  181  SLNASYYHVVSPLTNTAVGAELSHSFSSNENVLTIGTQHALDPVTLLKAKVNNYGKASAL  240

Query  791  IQHEWRPKSLITLSGEVDVKAVDKSAKFGLALALKP  898
            IQH+W  ++  +L GEVD  A+ K+AK GLA ALKP
Sbjct  241  IQHDWSRQARFSLVGEVDTAAIQKTAKVGLACALKP  276



>emb|CBI32017.3| unnamed protein product [Vitis vinifera]
Length=240

 Score =   385 bits (988),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 184/236 (78%), Positives = 214/236 (91%), Gaps = 0/236 (0%)
 Frame = +2

Query  71   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  250
            MGKGPGLY+DIGK ARDLLYRDYQ+DHKFT+TTY+ +GV ITS+G+KKG+LF+ DVNTQL
Sbjct  1    MGKGPGLYSDIGKIARDLLYRDYQSDHKFTVTTYTSSGVAITSSGTKKGELFIADVNTQL  60

Query  251  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  430
            KNKNITTD KVDTNSN+FTTITVDE APGLK I SF +PDQRSGKVELQYLH++AGISTS
Sbjct  61   KNKNITTDVKVDTNSNLFTTITVDEPAPGLKTIFSFIIPDQRSGKVELQYLHEYAGISTS  120

Query  431  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  610
            +GLTANPIVNFSGVVG N L+LGTD+SFDT +G FTK NAGL F+N+DLIA+LTLNDKGD
Sbjct  121  IGLTANPIVNFSGVVGNNTLSLGTDLSFDTATGNFTKCNAGLGFSNADLIAALTLNDKGD  180

Query  611  SLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTITVGTQHQLDPLTTVKARVNNFGR  778
            +L+ASYYH V+PL+NTAVGAE++H FS+N NT+T+GTQH LDPLT VKAR NN G+
Sbjct  181  TLNASYYHTVSPLTNTAVGAELSHCFSTNENTLTIGTQHALDPLTKVKARANNSGK  236



>ref|XP_009393634.1| PREDICTED: mitochondrial outer membrane protein porin 1-like 
[Musa acuminata subsp. malaccensis]
Length=275

 Score =   386 bits (991),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 180/274 (66%), Positives = 230/274 (84%), Gaps = 1/274 (0%)
 Frame = +2

Query  80   GPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQLKNK  259
            GPGLY +IG+KAR+LLYRDYQTDHK T+TT +  GV IT++G++K DL  G++ + +KNK
Sbjct  2    GPGLYFEIGRKARELLYRDYQTDHKVTVTTCTSNGVEITASGTRKNDLIFGEIQSHIKNK  61

Query  260  NITTDFKVDTNSNVFTTITVDE-AAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTSVG  436
            N+T D K +++SNV TTIT+DE A+PGLK I SF VPDQRSGKVE+QYLHD+ GI+ S+G
Sbjct  62   NVTFDVKTNSDSNVTTTITIDELASPGLKTIFSFVVPDQRSGKVEIQYLHDYTGINASIG  121

Query  437  LTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGDSL  616
            LTANP+VN SG VG+  L++G DV+FDT +G F KYNAGLS TN+DLIA+LTLN++GDSL
Sbjct  122  LTANPVVNLSGAVGSKTLSVGADVAFDTTTGKFIKYNAGLSITNADLIAALTLNNRGDSL  181

Query  617  SASYYHHVNPLSNTAVGAEVNHSFSSNVNTITVGTQHQLDPLTTVKARVNNFGRANALIQ  796
            +ASYYH V  LS TAVGAE+ HSFSSN NT+T GTQH LD LTTVK R+N++G+A+ALIQ
Sbjct  182  TASYYHLVKSLSRTAVGAELTHSFSSNENTLTFGTQHALDRLTTVKGRINSYGKASALIQ  241

Query  797  HEWRPKSLITLSGEVDVKAVDKSAKFGLALALKP  898
            HEW+PKS +T+SGE+D KA++KS+K GL+L L+P
Sbjct  242  HEWKPKSFLTISGEIDTKAIEKSSKVGLSLVLRP  275



>ref|XP_006298184.1| hypothetical protein CARUB_v10014234mg, partial [Capsella rubella]
 gb|EOA31082.1| hypothetical protein CARUB_v10014234mg, partial [Capsella rubella]
Length=267

 Score =   385 bits (990),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 192/255 (75%), Positives = 217/255 (85%), Gaps = 0/255 (0%)
 Frame = +2

Query  134  DYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQLKNKNITTDFKVDTNSNVFTTI  313
            D+ +D KF+ITTYSP GV ITS+G+KKGDL LGDV  Q + KN+TTDFKV T+S V  T 
Sbjct  13   DHNSDQKFSITTYSPAGVAITSSGTKKGDLLLGDVAFQSRQKNVTTDFKVCTDSTVLITA  72

Query  314  TVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTSVGLTANPIVNFSGVVGTNALA  493
            TVDEAAPGLK I SF+ PDQ SGK+ELQYLHD+AGISTS+GLT NP VNFSGV+GTN LA
Sbjct  73   TVDEAAPGLKSIFSFKAPDQNSGKIELQYLHDYAGISTSMGLTQNPTVNFSGVIGTNVLA  132

Query  494  LGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGDSLSASYYHHVNPLSNTAVGAE  673
            +GTDVSFDTKSG FTK NAGLSFT  DLIASLT+N+KGD L+ASYYH VNPL NTAVGAE
Sbjct  133  VGTDVSFDTKSGNFTKINAGLSFTKDDLIASLTVNEKGDLLNASYYHIVNPLFNTAVGAE  192

Query  674  VNHSFSSNVNTITVGTQHQLDPLTTVKARVNNFGRANALIQHEWRPKSLITLSGEVDVKA  853
            V+H FSS  NTITVGTQH LDPLT+VKARVN+ G A+ALIQHEWRPKS  T+SGEVD KA
Sbjct  193  VSHKFSSKDNTITVGTQHSLDPLTSVKARVNSAGIASALIQHEWRPKSFFTISGEVDTKA  252

Query  854  VDKSAKFGLALALKP  898
            +DK+A+ GLALALKP
Sbjct  253  IDKNARVGLALALKP  267



>ref|NP_001104948.1| voltage-dependent anion channel protein1b [Zea mays]
 gb|AAD56652.1|AF178951_1 voltage-dependent anion channel protein 1b [Zea mays]
Length=276

 Score =   385 bits (990),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 178/274 (65%), Positives = 226/274 (82%), Gaps = 1/274 (0%)
 Frame = +2

Query  80   GPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQLKNK  259
            GPGLYT+IGKK RDLLY+DYQTDHKFT+TTYS  GV +T+T +KK DL   ++++Q+KNK
Sbjct  3    GPGLYTEIGKKTRDLLYKDYQTDHKFTLTTYSSNGVAVTATSTKKADLIFSEIHSQIKNK  62

Query  260  NITTDFKVDTNSNVFTTITVDE-AAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTSVG  436
            N+T D K ++ SN+ TT+TV+E A PGLK I SF VPDQRSGKVELQYLHD+AG++ SV 
Sbjct  63   NMTVDVKANSESNIITTVTVNEIATPGLKTILSFAVPDQRSGKVELQYLHDYAGVNASVS  122

Query  437  LTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGDSL  616
            LTANP+ N S   GT ALA+G ++SFD+ +G FTKYNAGL FT+ DLIASL +N+KGD+L
Sbjct  123  LTANPVANLSAGFGTKALAVGAEISFDSATGNFTKYNAGLMFTHEDLIASLNMNNKGDNL  182

Query  617  SASYYHHVNPLSNTAVGAEVNHSFSSNVNTITVGTQHQLDPLTTVKARVNNFGRANALIQ  796
            + +YYH V+ L+NTAVGAE+ HSFS+N NT+T G QH LDPLT +KAR+NN G+A+ LIQ
Sbjct  183  TGAYYHKVSELTNTAVGAELTHSFSTNENTLTFGGQHTLDPLTVLKARINNSGKASVLIQ  242

Query  797  HEWRPKSLITLSGEVDVKAVDKSAKFGLALALKP  898
            HEWRPKSL+T+S EVD K ++KS+K G+A+ALKP
Sbjct  243  HEWRPKSLVTISAEVDTKTIEKSSKVGIAVALKP  276



>sp|P46274.1|VDAC1_WHEAT RecName: Full=Mitochondrial outer membrane porin; AltName: Full=Voltage-dependent 
anion-selective channel protein; Short=VDAC 
[Triticum aestivum]
 emb|CAA54788.1| voltage dependent anion channel (VDAC) [Triticum aestivum]
Length=275

 Score =   385 bits (988),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 190/277 (69%), Positives = 228/277 (82%), Gaps = 3/277 (1%)
 Frame = +2

Query  71   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  250
            MG GPGLY+ IGKKA+DLLYRDYQTDHKFT+TTY+  G  IT+T +KK DL +G++ +Q+
Sbjct  1    MG-GPGLYSGIGKKAKDLLYRDYQTDHKFTLTTYTANGPAITATSTKKADLTVGEIQSQI  59

Query  251  KNKNITTDFKVDTNSNVFTTITVDE-AAPGLKIISSFRVPDQRSGKVELQYLHDHAGIST  427
            KNKNIT D K ++ SNV TTIT D+ AAPGLK I SF VPDQ+SGKVELQYLHD+AGI+ 
Sbjct  60   KNKNITVDVKANSASNVITTITADDLAAPGLKTILSFAVPDQKSGKVELQYLHDYAGINA  119

Query  428  SVGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKG  607
            S+GLTANP+VN SG  GT+ALA+G DVS DT +  F KYNA LS+TN DLIASL LN+KG
Sbjct  120  SIGLTANPVVNLSGAFGTSALAVGADVSLDTATKNFAKYNAALSYTNQDLIASLNLNNKG  179

Query  608  DSLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTITVGTQHQLDPLTTVKARVNNFGRANA  787
            DSL+ASYYH V   S TAVGAE+ HSFSSN N++T GTQH LDPLT VKAR+NN G+A+A
Sbjct  180  DSLTASYYHIVEK-SGTAVGAELTHSFSSNENSLTFGTQHTLDPLTLVKARINNSGKASA  238

Query  788  LIQHEWRPKSLITLSGEVDVKAVDKSAKFGLALALKP  898
            LIQHE+ PKSL T+S EVD KA++KS+K G+A+ALKP
Sbjct  239  LIQHEFMPKSLCTISAEVDTKAIEKSSKVGIAIALKP  275



>ref|XP_009408829.1| PREDICTED: mitochondrial outer membrane protein porin 1-like 
[Musa acuminata subsp. malaccensis]
Length=275

 Score =   381 bits (979),  Expect = 7e-128, Method: Compositional matrix adjust.
 Identities = 179/274 (65%), Positives = 228/274 (83%), Gaps = 1/274 (0%)
 Frame = +2

Query  80   GPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQLKNK  259
            GPGLY+DIGKKARDLLY+DYQTD K T+TTY+  G+ I+++G+KK +L  G++ +QLKNK
Sbjct  2    GPGLYSDIGKKARDLLYKDYQTDQKVTLTTYTLNGIAISASGTKKNELIFGELQSQLKNK  61

Query  260  NITTDFKVDTNSNVFTTITVDE-AAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTSVG  436
            NI+ D K  ++S + TT+TVDE A PGL+ I +F +PDQ+ GKVELQYLHD+ G++ +VG
Sbjct  62   NISFDVKATSDSKLLTTVTVDELATPGLRSIFNFIIPDQQLGKVELQYLHDYVGVTAAVG  121

Query  437  LTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGDSL  616
            LTANPIVN SGVVGTN  ++G DVSFDT +G F K N GLS  N+DLIASLT+NDKGDS+
Sbjct  122  LTANPIVNLSGVVGTNVYSVGADVSFDTATGNFIKCNGGLSVINADLIASLTVNDKGDSI  181

Query  617  SASYYHHVNPLSNTAVGAEVNHSFSSNVNTITVGTQHQLDPLTTVKARVNNFGRANALIQ  796
            +ASYYH V+PLS+TAVGAE+ H+FS+N N++T GTQH LDPLT VKAR+NN+G+A+ALIQ
Sbjct  182  NASYYHLVSPLSSTAVGAELTHNFSTNENSLTFGTQHALDPLTIVKARLNNYGKASALIQ  241

Query  797  HEWRPKSLITLSGEVDVKAVDKSAKFGLALALKP  898
            HEWRPKS  T+SGE+D KA++K AK GLAL L+P
Sbjct  242  HEWRPKSFFTISGEIDSKAIEKGAKVGLALVLRP  275



>emb|CAJ42303.1| VDAC-like porin [Plantago major]
Length=250

 Score =   378 bits (971),  Expect = 5e-127, Method: Compositional matrix adjust.
 Identities = 183/229 (80%), Positives = 204/229 (89%), Gaps = 0/229 (0%)
 Frame = +2

Query  71   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  250
            MGKGPGLYT+IGK+ARDLLY+DYQTDHKFT+TT SPTGV +TS G+KKGDLFL D+ TQL
Sbjct  22   MGKGPGLYTEIGKRARDLLYKDYQTDHKFTLTTTSPTGVTLTSAGTKKGDLFLADITTQL  81

Query  251  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  430
            KNKNITTDFKVDT+SN+ TTIT+DE  PG K I SF+VPDQRSGK+ELQYLHD+AGI+TS
Sbjct  82   KNKNITTDFKVDTSSNLLTTITIDEPCPGTKTILSFKVPDQRSGKLELQYLHDYAGITTS  141

Query  431  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  610
            VGLTANPIVNFSGV+GT  LA G D+SFDTK GA TKYN G SF+N DLIASL LNDKGD
Sbjct  142  VGLTANPIVNFSGVLGTKTLAAGADLSFDTKEGALTKYNFGASFSNVDLIASLALNDKGD  201

Query  611  SLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTITVGTQHQLDPLTTVKA  757
            +LSASYYH VNPL++T+VGAEV HSFSSN NTITVGTQH LDPLTTVKA
Sbjct  202  TLSASYYHIVNPLTSTSVGAEVTHSFSSNENTITVGTQHALDPLTTVKA  250



>ref|XP_009403419.1| PREDICTED: mitochondrial outer membrane protein porin 1-like 
[Musa acuminata subsp. malaccensis]
Length=273

 Score =   377 bits (967),  Expect = 5e-126, Method: Compositional matrix adjust.
 Identities = 180/273 (66%), Positives = 221/273 (81%), Gaps = 1/273 (0%)
 Frame = +2

Query  80   GPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQLKNK  259
            GPGLY+D+ K+ARDLLY+DYQTD KFTITT +  GV IT++G+KK +L  G++ +Q KN 
Sbjct  2    GPGLYSDVAKRARDLLYKDYQTDQKFTITTSTLNGVSITTSGTKKNELIFGELQSQWKNN  61

Query  260  NITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTSVGL  439
            NI+ D K  ++S   TT+TVDE  PGL+ I S  +PDQRSGKVELQYLH++AG++  +GL
Sbjct  62   NISVDVKATSDSKFATTVTVDELTPGLRSIFSVIIPDQRSGKVELQYLHNYAGVTAGIGL  121

Query  440  TANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGDSLS  619
            TANP+VN SGVVGTN  A+G DVSFDT +G F K N GL+  N+DLIASLT+NDKGDS++
Sbjct  122  TANPVVNLSGVVGTNTYAVGADVSFDTATGNFIKCNGGLNVINADLIASLTVNDKGDSVT  181

Query  620  ASYYHHVNPLSNTAVGAEVNHSFSSNVNTITVGTQHQLDPLTTVKARVNNFGRANALIQH  799
            ASYYH V+PLS TAVGAE+ H FSSN NT+T GTQH LDPLT VKAR NN G+A+ALIQH
Sbjct  182  ASYYHLVSPLS-TAVGAELTHCFSSNENTMTFGTQHTLDPLTNVKARFNNCGKASALIQH  240

Query  800  EWRPKSLITLSGEVDVKAVDKSAKFGLALALKP  898
            EWRPKS +T+SGEVD KA++KSAK GLAL L+P
Sbjct  241  EWRPKSFVTISGEVDTKAIEKSAKVGLALVLRP  273



>gb|KEH19833.1| porin/voltage-dependent anion-selective channel protein [Medicago 
truncatula]
Length=278

 Score =   372 bits (955),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 177/267 (66%), Positives = 224/267 (84%), Gaps = 0/267 (0%)
 Frame = +2

Query  71   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  250
            M KGPGLY+DIGK+ARDLL++DYQ DHKFTITT +  GV ITS G +KG+ FL DV+T++
Sbjct  1    MVKGPGLYSDIGKRARDLLFKDYQNDHKFTITTQTLAGVEITSAGVRKGEAFLADVSTKV  60

Query  251  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  430
            KNKN+TTD KVDTNSN+ TTITVDE  PGLK I SF  P+Q+SGKVELQYLHD+AGISTS
Sbjct  61   KNKNVTTDIKVDTNSNLRTTITVDETVPGLKTIFSFIYPEQKSGKVELQYLHDYAGISTS  120

Query  431  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  610
            +GLTA P VN S V+G N +++G+DVSF+T SG+  K N GL+ T++DLIASLT+ND+GD
Sbjct  121  IGLTATPTVNISAVLGNNLVSVGSDVSFETSSGSLNKCNFGLNVTHADLIASLTVNDRGD  180

Query  611  SLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTITVGTQHQLDPLTTVKARVNNFGRANAL  790
            SL+ASYYH V+PL+NTAVGAE++HSFSSN N +T+GTQH LDP+T +KA+VNN+G+A+AL
Sbjct  181  SLNASYYHVVSPLTNTAVGAELSHSFSSNENVLTIGTQHALDPVTLLKAKVNNYGKASAL  240

Query  791  IQHEWRPKSLITLSGEVDVKAVDKSAK  871
            IQH+W  ++  +L GEVD  A+ K+AK
Sbjct  241  IQHDWSRQARFSLVGEVDTAAIQKTAK  267



>ref|NP_001043433.1| Os01g0588200 [Oryza sativa Japonica Group]
 sp|Q7F4F8.1|VDAC3_ORYSJ RecName: Full=Mitochondrial outer membrane protein porin 3; AltName: 
Full=Voltage-dependent anion-selective channel protein 
3; Short=OsVDAC3 [Oryza sativa Japonica Group]
 emb|CAC80851.1| voltage-dependent anion channel [Oryza sativa Japonica Group]
 dbj|BAB89921.1| putative porin [Oryza sativa Japonica Group]
 dbj|BAF05347.1| Os01g0588200 [Oryza sativa Japonica Group]
 gb|EAY74735.1| hypothetical protein OsI_02626 [Oryza sativa Indica Group]
 gb|EAZ12509.1| hypothetical protein OsJ_02405 [Oryza sativa Japonica Group]
 dbj|BAG92122.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96666.1| unnamed protein product [Oryza sativa Japonica Group]
Length=275

 Score =   364 bits (934),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 177/273 (65%), Positives = 216/273 (79%), Gaps = 1/273 (0%)
 Frame = +2

Query  80   GPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQLKNK  259
             PGLYTDIGKK RDLLYRDY T HKFT+TT +P GV IT+ G++K +   G++ TQLKNK
Sbjct  2    APGLYTDIGKKTRDLLYRDYGTHHKFTLTTCTPEGVTITAAGTRKNESVFGELQTQLKNK  61

Query  260  NITTDFKVDTNSNVFTTITVDE-AAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTSVG  436
             +T D K ++ S++ TT+TVDE   PGLK I S  VPDQRSGK+ELQYLH++AGI+ SVG
Sbjct  62   KLTVDVKANSESDLLTTVTVDEFGTPGLKSILSLVVPDQRSGKLELQYLHEYAGINASVG  121

Query  437  LTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGDSL  616
            L +NP+VN SGV G+  L++G DV+FDT +  FTKYNA LS TNSDLIASL LN+ GD+L
Sbjct  122  LNSNPMVNLSGVFGSKELSVGVDVAFDTATSNFTKYNAALSLTNSDLIASLHLNNHGDTL  181

Query  617  SASYYHHVNPLSNTAVGAEVNHSFSSNVNTITVGTQHQLDPLTTVKARVNNFGRANALIQ  796
             ASYYH V   SNTAVGAE++HSFS N +T+  G+QH LDP TTVKAR NN+G A+AL+Q
Sbjct  182  IASYYHLVKHHSNTAVGAELSHSFSRNESTLIFGSQHSLDPHTTVKARFNNYGMASALVQ  241

Query  797  HEWRPKSLITLSGEVDVKAVDKSAKFGLALALK  895
            HEWRPKSLIT+SGEVD KA++KS K GL+L LK
Sbjct  242  HEWRPKSLITISGEVDTKAIEKSTKVGLSLVLK  274



>gb|EMS51310.1| Mitochondrial outer membrane porin [Triticum urartu]
Length=596

 Score =   372 bits (954),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 187/269 (70%), Positives = 221/269 (82%), Gaps = 4/269 (1%)
 Frame = +2

Query  71   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  250
            MG GPGLY+ IGKKA+DLLYRDYQTDHKFT+TTY+  G  IT+T +KK DL LG++ +Q+
Sbjct  1    MG-GPGLYSGIGKKAKDLLYRDYQTDHKFTLTTYTANGAAITATSTKKADLILGEIQSQI  59

Query  251  KNKNITTDFKVDTNSNVFTTITVDE-AAPGLKIISSFRVPDQRSGKV-ELQYLHDHAGIS  424
            KNKNIT D K ++ SNV TTIT D+ AAPGLK I SF VPDQ+SGKV ELQYLHD+AGI+
Sbjct  60   KNKNITVDVKANSASNVITTITADDLAAPGLKTILSFAVPDQKSGKVVELQYLHDYAGIN  119

Query  425  TSVGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDK  604
             S+GLTANP+VN SG  GT+ALALG DVS DT +  FTKYNA LS+TN DLIASL LN+K
Sbjct  120  ASIGLTANPVVNLSGAFGTSALALGADVSLDTATKNFTKYNAALSYTNQDLIASLNLNNK  179

Query  605  GDSLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTITVGTQHQLDPLTTVKARVNNFGRAN  784
            GDSL+ASYYH V   S TAVGAE+ HSFSSN N++T GTQH LDPLT VKAR+NN G+A+
Sbjct  180  GDSLTASYYHIVEK-SGTAVGAELTHSFSSNENSLTFGTQHTLDPLTLVKARINNSGKAS  238

Query  785  ALIQHEWRPKSLITLSGEVDVKAVDKSAK  871
            ALIQHE+ PKSL T+S EVD KA++KS+K
Sbjct  239  ALIQHEFMPKSLCTISAEVDTKAIEKSSK  267



>ref|XP_006826371.2| PREDICTED: mitochondrial outer membrane protein porin of 34 kDa 
[Amborella trichopoda]
Length=274

 Score =   360 bits (925),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 177/273 (65%), Positives = 225/273 (82%), Gaps = 0/273 (0%)
 Frame = +2

Query  80   GPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQLKNK  259
            GPGLY++IGKKARDLLYRDYQTD KF +TT +PTGV +T+TG+K GDLF+ D++TQL+ K
Sbjct  2    GPGLYSEIGKKARDLLYRDYQTDQKFVLTTCTPTGVTVTTTGAKIGDLFVADLSTQLRKK  61

Query  260  NITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTSVGL  439
            NITTD KVD NSN+F T+TVDE APG K I S+ +PDQRS K ELQ+LH++ G++TSVGL
Sbjct  62   NITTDIKVDINSNLFATMTVDEPAPGAKAILSYAIPDQRSPKAELQFLHEYVGVTTSVGL  121

Query  440  TANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGDSLS  619
            TANP+VNFS  VGT   A GTDVSFD+ +GAFTK N GLSF+ +D+IASL LN+KGD+L 
Sbjct  122  TANPMVNFSTTVGTGEFAFGTDVSFDSATGAFTKCNVGLSFSQADIIASLNLNNKGDTLI  181

Query  620  ASYYHHVNPLSNTAVGAEVNHSFSSNVNTITVGTQHQLDPLTTVKARVNNFGRANALIQH  799
            ASY+H VNPL NTAVGAE++H+FS + +T+T+G     DPLTT KA++NN+G+A+ALIQH
Sbjct  182  ASYFHTVNPLKNTAVGAELSHTFSKSDDTLTLGMMQAFDPLTTFKAKINNYGKASALIQH  241

Query  800  EWRPKSLITLSGEVDVKAVDKSAKFGLALALKP  898
             WRPKSL+T+S E D  A++K+ K GLA+ L+P
Sbjct  242  GWRPKSLMTISVEADAGAIEKTTKVGLAMVLRP  274



>ref|XP_010231957.1| PREDICTED: mitochondrial outer membrane protein porin 3 [Brachypodium 
distachyon]
Length=275

 Score =   360 bits (923),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 173/273 (63%), Positives = 214/273 (78%), Gaps = 1/273 (0%)
 Frame = +2

Query  80   GPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQLKNK  259
             PGLYTDIGKK RDLLYRDY T  KFT+TT +P GV IT+ G++K +   G++ TQ+KNK
Sbjct  2    APGLYTDIGKKTRDLLYRDYCTHQKFTLTTCTPEGVAITAAGTRKNESIFGELQTQIKNK  61

Query  260  NITTDFKVDTNSNVFTTITVDE-AAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTSVG  436
            N+T D K ++ S++ TT+TVDE   PGLK I S  VPDQRSGK+E QYLH+ AGI+ +VG
Sbjct  62   NLTVDVKANSESDLLTTVTVDEFGTPGLKSILSLVVPDQRSGKLEFQYLHEFAGINANVG  121

Query  437  LTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGDSL  616
            L  NP+VN SGV G+  L++G DVSFDT +  FTKYNA LS TN DLIASL LN+ GD+L
Sbjct  122  LNPNPMVNLSGVFGSKELSVGVDVSFDTATSNFTKYNAALSLTNPDLIASLHLNNHGDTL  181

Query  617  SASYYHHVNPLSNTAVGAEVNHSFSSNVNTITVGTQHQLDPLTTVKARVNNFGRANALIQ  796
            +ASYYH V P S+TAVGAE++HSFS N +T+  G+QH LDP TTVKAR NN+G A+AL+Q
Sbjct  182  TASYYHLVKPHSSTAVGAELSHSFSRNESTLIFGSQHSLDPHTTVKARFNNYGMASALVQ  241

Query  797  HEWRPKSLITLSGEVDVKAVDKSAKFGLALALK  895
            HEWRPKSL+T+SGEVD KA++KS K GL+L LK
Sbjct  242  HEWRPKSLVTISGEVDTKAIEKSTKVGLSLVLK  274



>emb|CDM83072.1| unnamed protein product [Triticum aestivum]
Length=275

 Score =   356 bits (913),  Expect = 7e-118, Method: Compositional matrix adjust.
 Identities = 172/274 (63%), Positives = 213/274 (78%), Gaps = 1/274 (0%)
 Frame = +2

Query  80   GPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQLKNK  259
             PGLYTDIGKK RDLLYRDY T  KFT+TT +P GV IT+ G++K +   G++ TQLKNK
Sbjct  2    APGLYTDIGKKTRDLLYRDYCTHQKFTLTTCTPEGVAITAAGTRKNESIFGELQTQLKNK  61

Query  260  NITTDFKVDTNSNVFTTITVDE-AAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTSVG  436
            N+T D K ++ S++ TT TVDE A PGLK I S  VPDQRSGK+ELQYLH+ AG++ SVG
Sbjct  62   NLTVDIKANSESDLLTTFTVDEFATPGLKSILSLVVPDQRSGKLELQYLHEFAGVNASVG  121

Query  437  LTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGDSL  616
            L  NP+VN SGV G+  L++G DVSFDT +  FTKYNA LS T  DLIASL LN+ GD+L
Sbjct  122  LNPNPMVNLSGVFGSKELSVGVDVSFDTATSNFTKYNAALSLTYPDLIASLHLNNHGDTL  181

Query  617  SASYYHHVNPLSNTAVGAEVNHSFSSNVNTITVGTQHQLDPLTTVKARVNNFGRANALIQ  796
            +ASYYH V   S+TAVGAE++H+F  N +T+  G+QH LDP T+VKAR NN+G A+AL+Q
Sbjct  182  TASYYHLVKSHSSTAVGAELSHNFPRNESTLIFGSQHSLDPHTSVKARFNNYGMASALVQ  241

Query  797  HEWRPKSLITLSGEVDVKAVDKSAKFGLALALKP  898
            HEWRPKSL+T+SGEVD KA++KS K GL+L LKP
Sbjct  242  HEWRPKSLVTISGEVDTKAIEKSTKVGLSLVLKP  275



>gb|EMT02908.1| Mitochondrial outer membrane porin [Aegilops tauschii]
Length=667

 Score =   369 bits (948),  Expect = 7e-118, Method: Compositional matrix adjust.
 Identities = 186/269 (69%), Positives = 221/269 (82%), Gaps = 4/269 (1%)
 Frame = +2

Query  71   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  250
            MG GPGLY+ IGKKA+DLLYRDYQTDHKFT+TTY+  G  IT+T +KK DL LG++ +Q+
Sbjct  1    MG-GPGLYSGIGKKAKDLLYRDYQTDHKFTLTTYTANGAAITATSTKKADLILGEIQSQI  59

Query  251  KNKNITTDFKVDTNSNVFTTITVDE-AAPGLKIISSFRVPDQRSGKV-ELQYLHDHAGIS  424
            KNKNIT D K ++ SNV TTIT D+ AAPGLK I SF VPDQ+SGKV ELQYLHD+AGI+
Sbjct  60   KNKNITVDVKANSASNVITTITADDLAAPGLKTILSFAVPDQKSGKVVELQYLHDYAGIN  119

Query  425  TSVGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDK  604
             S+GLTANP+VN SG  GT+ALA+G DVS DT +  FTKYNA LS+TN DLIASL LN+K
Sbjct  120  ASIGLTANPVVNLSGAFGTSALAVGADVSLDTATKNFTKYNAALSYTNQDLIASLNLNNK  179

Query  605  GDSLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTITVGTQHQLDPLTTVKARVNNFGRAN  784
            GDSL+ASYYH V   S TAVGAE+ HSF SN N++T GTQH LDPLT VKAR+NN G+A+
Sbjct  180  GDSLTASYYHIVEK-SGTAVGAELTHSFLSNENSLTFGTQHTLDPLTLVKARINNSGKAS  238

Query  785  ALIQHEWRPKSLITLSGEVDVKAVDKSAK  871
            ALIQHE+RPKSL T+S EVD KA++KS+K
Sbjct  239  ALIQHEFRPKSLCTISAEVDTKAIEKSSK  267



>ref|XP_004961383.1| PREDICTED: mitochondrial outer membrane protein porin 2-like 
[Setaria italica]
Length=276

 Score =   355 bits (911),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 172/274 (63%), Positives = 208/274 (76%), Gaps = 3/274 (1%)
 Frame = +2

Query  80   GPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQLKNK  259
            GPGLYT+IGKKARDLLY+DY TD KFT+TTY+  G  IT+  ++K +    ++ +QLK++
Sbjct  5    GPGLYTEIGKKARDLLYKDYHTDQKFTLTTYASNGAAITAASTRKNEAIFSEIQSQLKHE  64

Query  260  NITTDFKVDTNSNVFTTITVDE-AAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTSVG  436
            N+T D K  + SNV TT TV E   PGLK I     P Q+S K ELQYLH HAG++ SVG
Sbjct  65   NVTVDVKATSESNVTTTFTVHELGTPGLKAILCIPFPYQKSAKAELQYLHHHAGVAASVG  124

Query  437  LTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGDSL  616
            L ANP+VN SGV GT  +A+G D SFDT SG  TKYNAGLS+   D +A+ TLN+KGDSL
Sbjct  125  LNANPVVNLSGVFGTKTIAVGADASFDTSSGDLTKYNAGLSYNAGDFVAAATLNNKGDSL  184

Query  617  SASYYHHVNPLSNTAVGAEVNHSFSSNVNTITVGTQHQLDPLTTVKARVNNFGRANALIQ  796
            +ASYYH VN  S TAVG E+ HSFSSN NT+T GTQH LDPLTTVKAR NN+G A+ALIQ
Sbjct  185  AASYYHLVN--STTAVGGELTHSFSSNENTLTFGTQHALDPLTTVKARFNNYGMASALIQ  242

Query  797  HEWRPKSLITLSGEVDVKAVDKSAKFGLALALKP  898
            HEWRPKSL+T+S EVD KA++KS+K GL+L LKP
Sbjct  243  HEWRPKSLVTISTEVDTKAIEKSSKVGLSLVLKP  276



>ref|XP_006646048.1| PREDICTED: mitochondrial outer membrane protein porin 3-like 
[Oryza brachyantha]
Length=275

 Score =   354 bits (909),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 170/273 (62%), Positives = 215/273 (79%), Gaps = 1/273 (0%)
 Frame = +2

Query  80   GPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQLKNK  259
             PGLY DIGKK RDLLY+DY T  KFT+TT +  GV +T+ G++K +   G+++TQLKNK
Sbjct  2    APGLYADIGKKTRDLLYKDYGTHQKFTLTTCTSEGVAVTAAGTRKNESVFGELHTQLKNK  61

Query  260  NITTDFKVDTNSNVFTTITVDE-AAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTSVG  436
            N+T D K ++ S++ TT+TVDE   PGLK I S  VPDQRSGK+ELQYLH++AGI+ SVG
Sbjct  62   NLTVDVKANSESDLLTTVTVDEFGTPGLKSILSLVVPDQRSGKLELQYLHEYAGINASVG  121

Query  437  LTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGDSL  616
            L +NP+VN SGV G+  L++G DV+FDT +  FTKYNA LS TNS+LIAS+ LN+ GD+L
Sbjct  122  LNSNPMVNLSGVFGSKELSVGVDVAFDTATSNFTKYNAALSLTNSELIASMHLNNHGDTL  181

Query  617  SASYYHHVNPLSNTAVGAEVNHSFSSNVNTITVGTQHQLDPLTTVKARVNNFGRANALIQ  796
            + SYYH V   SNTAVGAE++HSFS N +T+  G+QH LDP TTVKAR NN+G A+AL+Q
Sbjct  182  TTSYYHLVKHHSNTAVGAELSHSFSRNESTLIFGSQHSLDPHTTVKARFNNYGMASALVQ  241

Query  797  HEWRPKSLITLSGEVDVKAVDKSAKFGLALALK  895
            HEWRPKSLIT+SGEVD KA++KS K GL+L LK
Sbjct  242  HEWRPKSLITISGEVDTKAIEKSTKVGLSLVLK  274



>ref|XP_004969385.1| PREDICTED: mitochondrial outer membrane protein porin 3-like 
[Setaria italica]
Length=275

 Score =   353 bits (906),  Expect = 9e-117, Method: Compositional matrix adjust.
 Identities = 170/273 (62%), Positives = 213/273 (78%), Gaps = 1/273 (0%)
 Frame = +2

Query  80   GPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQLKNK  259
             PGLYTDIGKK RDLLY+DY T  KF++TT SP GV IT+ G++K +   G+++TQ+KNK
Sbjct  2    APGLYTDIGKKTRDLLYKDYNTHQKFSVTTCSPHGVAITAAGTRKNESLFGELHTQIKNK  61

Query  260  NITTDFKVDTNSNVFTTITVDE-AAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTSVG  436
             +T D K ++ S++ TTITVDE   PGLK I S  VPDQRSGK+ELQYLH++AG++ SVG
Sbjct  62   KLTVDVKANSESDLLTTITVDEFGTPGLKSILSLVVPDQRSGKLELQYLHEYAGVNASVG  121

Query  437  LTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGDSL  616
            L +NP+VN SGV G+  L++G DVSFDT +  FTKYNA LS TN DLIASL LN+ GD++
Sbjct  122  LNSNPMVNLSGVFGSKELSVGVDVSFDTATSNFTKYNAALSLTNPDLIASLHLNNHGDTM  181

Query  617  SASYYHHVNPLSNTAVGAEVNHSFSSNVNTITVGTQHQLDPLTTVKARVNNFGRANALIQ  796
             ASYYH V   S TAVGAE++HSFS N +T+  G+QH LDP TTVKAR NN+G A+AL+Q
Sbjct  182  VASYYHLVKHHSGTAVGAELSHSFSRNESTLIFGSQHSLDPHTTVKARFNNYGMASALVQ  241

Query  797  HEWRPKSLITLSGEVDVKAVDKSAKFGLALALK  895
            HEWRPKS IT+SGEVD KA++KS K GL++ LK
Sbjct  242  HEWRPKSFITISGEVDTKAIEKSTKVGLSVVLK  274



>gb|EMS47295.1| Outer plastidial membrane protein porin [Triticum urartu]
Length=275

 Score =   353 bits (906),  Expect = 9e-117, Method: Compositional matrix adjust.
 Identities = 172/274 (63%), Positives = 212/274 (77%), Gaps = 1/274 (0%)
 Frame = +2

Query  80   GPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQLKNK  259
             PGLYTDIGKK RDLLYRDY T  KFT+TT +P GV IT+ G++K +   G++ TQLKNK
Sbjct  2    APGLYTDIGKKTRDLLYRDYCTHQKFTLTTCTPEGVAITAAGTRKNESIFGELQTQLKNK  61

Query  260  NITTDFKVDTNSNVFTTITVDE-AAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTSVG  436
            N+T D K ++ S++ TT TVDE A PGLK I S  VPDQRSGK+ELQYLH+ AGI+ SVG
Sbjct  62   NLTVDIKANSESDLLTTFTVDEFATPGLKSILSLVVPDQRSGKLELQYLHEFAGINASVG  121

Query  437  LTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGDSL  616
            L  NP+VN SGV G+  L++G DVSFDT +  FTKYNA LS T  DLIASL LN+ GD+L
Sbjct  122  LNPNPMVNLSGVFGSKELSVGVDVSFDTATSNFTKYNAALSLTYPDLIASLHLNNHGDTL  181

Query  617  SASYYHHVNPLSNTAVGAEVNHSFSSNVNTITVGTQHQLDPLTTVKARVNNFGRANALIQ  796
            +ASYYH V   S+TAVGAE++H+F  N +T+  G+QH LDP T+VKAR NN+G A+AL+Q
Sbjct  182  TASYYHLVKSHSSTAVGAELSHNFPRNESTLIFGSQHSLDPHTSVKARFNNYGMASALVQ  241

Query  797  HEWRPKSLITLSGEVDVKAVDKSAKFGLALALKP  898
            HEWR KSL+T+SGEVD KA++KS K GL+L LKP
Sbjct  242  HEWRAKSLVTISGEVDTKAIEKSTKVGLSLVLKP  275



>emb|CAA57646.1| Voltage dependent anion channel (VDAC) [Triticum aestivum]
Length=275

 Score =   352 bits (904),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 172/274 (63%), Positives = 212/274 (77%), Gaps = 1/274 (0%)
 Frame = +2

Query  80   GPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQLKNK  259
             PGLYTDIGKK RDLLYRDY T  KFT+TT +P GV IT+ G++K +   G++ TQLKNK
Sbjct  2    APGLYTDIGKKTRDLLYRDYCTHQKFTLTTCTPEGVAITAAGTRKNESIFGELQTQLKNK  61

Query  260  NITTDFKVDTNSNVFTTITVDE-AAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTSVG  436
            N+T D K ++ S++ TT TVDE A PGLK I S  VPDQRSGK+ELQYLH+ AGI+ SVG
Sbjct  62   NLTVDIKANSESDLLTTFTVDEFATPGLKSILSLVVPDQRSGKLELQYLHEFAGINASVG  121

Query  437  LTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGDSL  616
            L  NP+VN SGV G+  L++G DVSFDT +  FTKYNA LS T  DLIASL LN+ GD+L
Sbjct  122  LNPNPMVNLSGVFGSKELSVGVDVSFDTATSNFTKYNAALSLTYPDLIASLHLNNHGDTL  181

Query  617  SASYYHHVNPLSNTAVGAEVNHSFSSNVNTITVGTQHQLDPLTTVKARVNNFGRANALIQ  796
            +ASYYH V   S+TAVGAE++H+F  N +T+  G+QH LDP T+VKAR NN+G A+AL+Q
Sbjct  182  TASYYHLVKYTSSTAVGAELSHNFPRNESTLIFGSQHSLDPHTSVKARFNNYGMASALVQ  241

Query  797  HEWRPKSLITLSGEVDVKAVDKSAKFGLALALKP  898
            HEWR KSL+T+SGEVD KA++KS K GL+L LKP
Sbjct  242  HEWRAKSLVTISGEVDTKAIEKSTKVGLSLVLKP  275



>gb|ABK23226.1| unknown [Picea sitchensis]
Length=276

 Score =   351 bits (901),  Expect = 6e-116, Method: Compositional matrix adjust.
 Identities = 163/276 (59%), Positives = 216/276 (78%), Gaps = 0/276 (0%)
 Frame = +2

Query  71   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  250
            MGKGPGL+++IGKKA+DLL RDY  D KFT+TT+S TG+  TSTG KKG+LF GD+NTQ 
Sbjct  1    MGKGPGLFSEIGKKAKDLLTRDYNYDQKFTVTTFSETGLAFTSTGVKKGELFSGDLNTQY  60

Query  251  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  430
            K +N T D K+DTNSN+ TTIT+D+  P  K I SF++PDQ+SGKV+LQY HDH G+S+S
Sbjct  61   KYQNATVDVKIDTNSNILTTITLDQPIPNAKTIFSFKIPDQKSGKVDLQYFHDHVGLSSS  120

Query  431  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  610
            +GLT  PIV  SG +G++ +++G +++FDT S  F+KY+AG+  +  +  A++ L DKGD
Sbjct  121  IGLTPTPIVEVSGALGSDGISVGGEMAFDTASSTFSKYSAGIGVSKPEYTAAVILADKGD  180

Query  611  SLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTITVGTQHQLDPLTTVKARVNNFGRANAL  790
            ++ ASY H VNP++ TAV AE  H FS+N NT TVG+ H +D LTT+K+R++N G+  AL
Sbjct  181  TVKASYTHIVNPITKTAVAAEFTHKFSTNENTYTVGSSHAIDRLTTMKSRLDNRGKLAAL  240

Query  791  IQHEWRPKSLITLSGEVDVKAVDKSAKFGLALALKP  898
            IQHEWRPKSL+T+SGE D KA+DKSAK GL+LALKP
Sbjct  241  IQHEWRPKSLVTISGEFDTKALDKSAKIGLSLALKP  276



>dbj|BAJ99489.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ88464.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=275

 Score =   350 bits (897),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 169/274 (62%), Positives = 211/274 (77%), Gaps = 1/274 (0%)
 Frame = +2

Query  80   GPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQLKNK  259
             PGLYTDIGKK RDLLYRDY T  KFT+TT +P GV IT+ G++K +   G++ TQLKNK
Sbjct  2    APGLYTDIGKKTRDLLYRDYCTHQKFTLTTCTPEGVAITAAGTRKNESIFGELQTQLKNK  61

Query  260  NITTDFKVDTNSNVFTTITVDE-AAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTSVG  436
            N+T D K ++ S++ TT TVDE A PGLK I S  VPDQRSGK+ELQYLH+ A ++ SVG
Sbjct  62   NLTVDIKANSESDLLTTFTVDEFATPGLKSILSLVVPDQRSGKLELQYLHEFASVNASVG  121

Query  437  LTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGDSL  616
            L  +P+VN SGV G+  L++G DVSFDT +  FTKYNA LS    DLIASL LN+ GD+L
Sbjct  122  LNPSPMVNLSGVFGSKELSVGVDVSFDTATSNFTKYNAALSLAYPDLIASLHLNNHGDTL  181

Query  617  SASYYHHVNPLSNTAVGAEVNHSFSSNVNTITVGTQHQLDPLTTVKARVNNFGRANALIQ  796
            +ASYYH V   S+TAVGAE++H+F  N +T+  G+QH LDP T+VKAR NN+G A+AL+Q
Sbjct  182  TASYYHLVKSHSSTAVGAELSHNFPRNESTLIFGSQHSLDPHTSVKARFNNYGMASALVQ  241

Query  797  HEWRPKSLITLSGEVDVKAVDKSAKFGLALALKP  898
            HEWRPKSL+T+SGEVD KA++KS K GL+L LKP
Sbjct  242  HEWRPKSLVTISGEVDTKAIEKSTKVGLSLVLKP  275



>ref|XP_002458065.1| hypothetical protein SORBIDRAFT_03g026350 [Sorghum bicolor]
 gb|EES03185.1| hypothetical protein SORBIDRAFT_03g026350 [Sorghum bicolor]
Length=275

 Score =   348 bits (892),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 169/273 (62%), Positives = 210/273 (77%), Gaps = 1/273 (0%)
 Frame = +2

Query  80   GPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQLKNK  259
             PGLYTDIGKK RDLLY+DY T  KF++TT SP GV IT+ G++K +   G+++TQ+KNK
Sbjct  2    APGLYTDIGKKTRDLLYKDYNTHQKFSLTTCSPHGVAITAAGTRKNESIFGELHTQIKNK  61

Query  260  NITTDFKVDTNSNVFTTITVDE-AAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTSVG  436
             +T D K ++ S++ TTITVDE   PGLK I S  VPDQRSGK ELQYLH++AG++ S+G
Sbjct  62   KLTVDIKANSESDLLTTITVDELGTPGLKSILSLVVPDQRSGKFELQYLHEYAGVNASIG  121

Query  437  LTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGDSL  616
            L  NP+VN SGV G+ AL++G DVSFDT +  FTKYNA LS T+ DLIASL LN+ GD+L
Sbjct  122  LNPNPMVNISGVFGSKALSVGVDVSFDTATSNFTKYNAALSLTSPDLIASLHLNNHGDTL  181

Query  617  SASYYHHVNPLSNTAVGAEVNHSFSSNVNTITVGTQHQLDPLTTVKARVNNFGRANALIQ  796
              SYYH V   S TAVGAE++HS S N +T+  G+QH LDP TTVKAR NN+G A+AL+Q
Sbjct  182  VGSYYHLVKHHSGTAVGAELSHSISRNESTLIFGSQHSLDPHTTVKARFNNYGMASALVQ  241

Query  797  HEWRPKSLITLSGEVDVKAVDKSAKFGLALALK  895
            HEWRPKS IT+SGEVD KA++KS K GL+L LK
Sbjct  242  HEWRPKSFITISGEVDTKAIEKSTKVGLSLVLK  274



>ref|XP_004969745.1| PREDICTED: mitochondrial outer membrane protein porin 4-like 
[Setaria italica]
Length=275

 Score =   346 bits (888),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 169/274 (62%), Positives = 210/274 (77%), Gaps = 1/274 (0%)
 Frame = +2

Query  80   GPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQLKNK  259
            GPGLY+DIGKKARDLL +D+ TD KFT+TTY+  G  IT+  +KK +    ++  QLK K
Sbjct  2    GPGLYSDIGKKARDLLNKDFHTDQKFTLTTYTSNGAAITAASTKKNEAIFSEIQAQLKQK  61

Query  260  NITTDFKVDTNSNVFTTITVDE-AAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTSVG  436
            N+T D K  T+S + TT+TV+E   PGLK I +   P+Q +GK E+QYLHD+AGI+ S G
Sbjct  62   NVTVDVKATTDSLLLTTVTVEEFGVPGLKKIVTIPFPNQAAGKAEVQYLHDYAGINASFG  121

Query  437  LTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGDSL  616
            L + P+VN SGV GT A+A+G DV++DT +G FTKYNAGL+FTN+DLIAS+TLN+KGDSL
Sbjct  122  LNSKPLVNLSGVFGTKAIAVGADVAYDTATGDFTKYNAGLNFTNTDLIASVTLNNKGDSL  181

Query  617  SASYYHHVNPLSNTAVGAEVNHSFSSNVNTITVGTQHQLDPLTTVKARVNNFGRANALIQ  796
            +ASYYH VN   NTAVGAEV  SFSS  N +T GTQH LDP TTVKAR N+ G A+ALIQ
Sbjct  182  TASYYHLVNAEKNTAVGAEVTRSFSSKKNIVTFGTQHALDPSTTVKARYNSNGMASALIQ  241

Query  797  HEWRPKSLITLSGEVDVKAVDKSAKFGLALALKP  898
            HEWRPKS +TL+ EVD KA +KS+K GL+L LKP
Sbjct  242  HEWRPKSFVTLTTEVDTKAFEKSSKVGLSLVLKP  275



>ref|NP_001104949.1| voltage-dependent anion channel protein2 [Zea mays]
 gb|AAD56653.1|AF178952_1 voltage-dependent anion channel protein 2 [Zea mays]
 gb|ACF85067.1| unknown [Zea mays]
 gb|ACG34248.1| outer mitochondrial membrane protein porin [Zea mays]
 gb|AFW78894.1| outer membrane protein porinVoltage-dependent anion channel protein 
2 [Zea mays]
Length=276

 Score =   345 bits (886),  Expect = 8e-114, Method: Compositional matrix adjust.
 Identities = 170/274 (62%), Positives = 211/274 (77%), Gaps = 3/274 (1%)
 Frame = +2

Query  80   GPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQLKNK  259
            GPGLY++IGKKARDLLY+DY TD KFT+TTY+  G  IT+  ++K +    ++ +QLK+ 
Sbjct  5    GPGLYSEIGKKARDLLYKDYHTDQKFTLTTYAANGAAITAASTRKDEAIFNEIQSQLKHN  64

Query  260  NITTDFKVDTNSNVFTTITVDE-AAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTSVG  436
            N+T D K  + SNV TTITV E   PGLK I     P Q+S K ELQYLH HAG++ SVG
Sbjct  65   NVTVDVKATSESNVITTITVHELGTPGLKAILCVPFPYQKSAKAELQYLHHHAGVAASVG  124

Query  437  LTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGDSL  616
            L ANP+VN SGV GT A+A+G D +FDT SG  TKYNAGLS+T  D +A+ TLN+KGD++
Sbjct  125  LNANPVVNLSGVFGTKAIAVGADAAFDTSSGDLTKYNAGLSYTTPDFVAAATLNNKGDNI  184

Query  617  SASYYHHVNPLSNTAVGAEVNHSFSSNVNTITVGTQHQLDPLTTVKARVNNFGRANALIQ  796
            +ASYYH V+P   TAVG E++HSFS+N NTIT GTQH LDPLTTVKAR NN+G A+ALIQ
Sbjct  185  AASYYHSVSP--TTAVGGELSHSFSTNGNTITFGTQHALDPLTTVKARFNNYGMASALIQ  242

Query  797  HEWRPKSLITLSGEVDVKAVDKSAKFGLALALKP  898
            HEWRPKSL+T+S EVD KA++KS+K GL+L LKP
Sbjct  243  HEWRPKSLVTISTEVDTKAIEKSSKVGLSLVLKP  276



>gb|ACG25664.1| outer plastidial membrane protein porin [Zea mays]
Length=275

 Score =   345 bits (884),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 166/273 (61%), Positives = 210/273 (77%), Gaps = 1/273 (0%)
 Frame = +2

Query  80   GPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQLKNK  259
             PGLYTDIGKK RDLLY+DY T  KF++TT SP G+ IT+ G++K +   GD++TQ+KN 
Sbjct  2    APGLYTDIGKKTRDLLYKDYNTHQKFSLTTCSPHGIAITAAGTRKNESTFGDLHTQIKNN  61

Query  260  NITTDFKVDTNSNVFTTITVDE-AAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTSVG  436
             +T D K ++ S++ TTITVDE   PGLK I +  VPDQRSGK+ELQYLH++ G++ S+G
Sbjct  62   KLTVDVKANSESDLLTTITVDEIGTPGLKSILTLVVPDQRSGKLELQYLHEYTGVNASIG  121

Query  437  LTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGDSL  616
            L +NP+VN SG  G+ AL++G DVSFDT+S  FTKYNA LS  N DLIASL LN+ GD+L
Sbjct  122  LNSNPMVNLSGAFGSKALSVGVDVSFDTESSNFTKYNAALSLANPDLIASLHLNNHGDTL  181

Query  617  SASYYHHVNPLSNTAVGAEVNHSFSSNVNTITVGTQHQLDPLTTVKARVNNFGRANALIQ  796
             ASYYH V   S TAVGAE++HS S N +T+  G+QH LDP TTVKAR NN+G A+AL+Q
Sbjct  182  VASYYHLVKHHSGTAVGAELSHSISRNESTLIFGSQHSLDPHTTVKARFNNYGMASALVQ  241

Query  797  HEWRPKSLITLSGEVDVKAVDKSAKFGLALALK  895
            HEWRPKS IT+SGEVD +A++KS K GL+L LK
Sbjct  242  HEWRPKSFITVSGEVDTRAIEKSTKVGLSLVLK  274



>ref|NP_001141587.1| outer plastidial membrane protein porin [Zea mays]
 gb|ACF86667.1| unknown [Zea mays]
 tpg|DAA58725.1| TPA: outer plastidial membrane protein porin [Zea mays]
Length=275

 Score =   344 bits (882),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 165/273 (60%), Positives = 210/273 (77%), Gaps = 1/273 (0%)
 Frame = +2

Query  80   GPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQLKNK  259
             PGLYTDIGKK RDLLY+DY T  KF++TT SP G+ IT+ G++K +   GD++TQ+KN 
Sbjct  2    APGLYTDIGKKTRDLLYKDYNTHQKFSLTTCSPHGIAITAAGTRKNESTFGDLHTQIKNN  61

Query  260  NITTDFKVDTNSNVFTTITVDE-AAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTSVG  436
             +T D K ++ S++ TTITVDE   PGLK I +  VPDQRSGK+ELQYLH++ G++ S+G
Sbjct  62   KLTVDVKANSESDLLTTITVDEIGTPGLKSILTLVVPDQRSGKLELQYLHEYTGVNASIG  121

Query  437  LTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGDSL  616
            L +NP+VN SG  G+ AL++G DVSFDT++  FTKYNA LS  N DLIASL LN+ GD+L
Sbjct  122  LNSNPMVNLSGAFGSKALSVGVDVSFDTETSNFTKYNAALSLANPDLIASLHLNNHGDTL  181

Query  617  SASYYHHVNPLSNTAVGAEVNHSFSSNVNTITVGTQHQLDPLTTVKARVNNFGRANALIQ  796
             ASYYH V   S TAVGAE++HS S N +T+  G+QH LDP TTVKAR NN+G A+AL+Q
Sbjct  182  VASYYHLVKHHSGTAVGAELSHSISRNESTLIFGSQHSLDPHTTVKARFNNYGMASALVQ  241

Query  797  HEWRPKSLITLSGEVDVKAVDKSAKFGLALALK  895
            HEWRPKS IT+SGEVD +A++KS K GL+L LK
Sbjct  242  HEWRPKSFITVSGEVDTRAIEKSTKVGLSLVLK  274



>ref|XP_003568015.1| PREDICTED: mitochondrial outer membrane protein porin 2-like 
[Brachypodium distachyon]
Length=278

 Score =   344 bits (882),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 172/276 (62%), Positives = 209/276 (76%), Gaps = 5/276 (2%)
 Frame = +2

Query  80   GPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQLKNK  259
            GPGLYT+IGKK+RDLLY+DYQTD KFT+TT +  G  IT+  +KK +  + ++ +QLK K
Sbjct  5    GPGLYTEIGKKSRDLLYKDYQTDQKFTLTTVAANGATITAASTKKNEAIVSEIQSQLKGK  64

Query  260  NITTDFKVDTNSNVFTTITVDEA-APGLKIISSFRVPDQRS--GKVELQYLHDHAGISTS  430
            N+T D KV + S+V  T+TV E   PGLK +    +P  +S  GK ELQYLH HAGI+ S
Sbjct  65   NVTVDVKVTSESSVIATVTVPELYTPGLKGMLCVPIPYNKSASGKAELQYLHAHAGINAS  124

Query  431  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  610
            VGL ANP+VN SGV+GT  LA G DV+FDT SG FTKYNAG+S TN DL AS+ LN+KGD
Sbjct  125  VGLNANPLVNLSGVLGTKDLAFGADVAFDTASGDFTKYNAGVSLTNEDLTASVVLNNKGD  184

Query  611  SLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTITVGTQHQLDPLTTVKARVNNFGRANAL  790
            +L+ASYY  V    +TAVGAE+ HSFSSN NT+T+GTQH LDPLTTVK R NN G A+AL
Sbjct  185  TLAASYYQQVK--GSTAVGAELAHSFSSNANTLTIGTQHALDPLTTVKGRFNNNGIASAL  242

Query  791  IQHEWRPKSLITLSGEVDVKAVDKSAKFGLALALKP  898
            IQH WRP SL+T+S E D KA++KS KFGLALALKP
Sbjct  243  IQHAWRPNSLVTVSTEFDTKAMEKSPKFGLALALKP  278



>ref|NP_001278544.1| outer plastidial membrane protein porin [Zea mays]
 gb|ACF81491.1| unknown [Zea mays]
Length=275

 Score =   343 bits (879),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 165/273 (60%), Positives = 210/273 (77%), Gaps = 1/273 (0%)
 Frame = +2

Query  80   GPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQLKNK  259
             PGLYTDIGKK RDLLY+DY T  KF++TT SP GV IT+ G++K +   G+++TQ+KNK
Sbjct  2    APGLYTDIGKKTRDLLYKDYNTHQKFSLTTSSPNGVAITAAGTRKNESIFGELHTQIKNK  61

Query  260  NITTDFKVDTNSNVFTTITVDE-AAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTSVG  436
             +T D K ++ S++ TTITVDE   PGLK I +  VPDQRSGK+E QYLH++AG++ SVG
Sbjct  62   KLTVDVKANSESDLLTTITVDEFGTPGLKSIINLVVPDQRSGKLEFQYLHEYAGVNASVG  121

Query  437  LTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGDSL  616
            L +NP+VN SG  G+ AL++G DVSFDT S  FTKYNA LS T+ DLIASL LN+ GD+L
Sbjct  122  LNSNPMVNLSGAFGSKALSVGVDVSFDTASSDFTKYNAALSLTSPDLIASLHLNNHGDTL  181

Query  617  SASYYHHVNPLSNTAVGAEVNHSFSSNVNTITVGTQHQLDPLTTVKARVNNFGRANALIQ  796
             ASYYH V   S TAVGAE++HS S N +T+  G+QH LDP TT+K R NN+G A+AL+Q
Sbjct  182  VASYYHLVKNHSGTAVGAELSHSMSRNESTLIFGSQHSLDPHTTIKTRFNNYGMASALVQ  241

Query  797  HEWRPKSLITLSGEVDVKAVDKSAKFGLALALK  895
            HEWRPKS +T+SG+VD KA++KS K GL+L LK
Sbjct  242  HEWRPKSFVTISGDVDTKAIEKSTKVGLSLVLK  274



>gb|AFW83107.1| outer plastidial membrane protein porin [Zea mays]
Length=275

 Score =   342 bits (877),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 164/273 (60%), Positives = 210/273 (77%), Gaps = 1/273 (0%)
 Frame = +2

Query  80   GPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQLKNK  259
             PGLYTDIGKK RDLLY+DY T  KF++TT SP GV IT+ G++K +   G+++TQ+KNK
Sbjct  2    APGLYTDIGKKTRDLLYKDYNTHQKFSLTTCSPNGVAITAAGTRKNESIFGELHTQIKNK  61

Query  260  NITTDFKVDTNSNVFTTITVDE-AAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTSVG  436
             +T D K ++ S++ TTITVDE   PGLK I +  VPDQRSGK+E QYLH++AG++ SVG
Sbjct  62   KLTVDVKANSESDLLTTITVDEFGTPGLKSIINLVVPDQRSGKLEFQYLHEYAGVNASVG  121

Query  437  LTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGDSL  616
            L +NP+VN SG  G+ AL++G DVSFDT +  FTKYNA LS T+ DLIASL LN+ GD+L
Sbjct  122  LNSNPMVNLSGAFGSKALSVGVDVSFDTATSDFTKYNAALSLTSPDLIASLHLNNHGDTL  181

Query  617  SASYYHHVNPLSNTAVGAEVNHSFSSNVNTITVGTQHQLDPLTTVKARVNNFGRANALIQ  796
             ASYYH V   S TAVGAE++HS S N +T+  G+QH LDP TT+K R NN+G A+AL+Q
Sbjct  182  VASYYHLVKNHSGTAVGAELSHSMSRNESTLIFGSQHSLDPHTTIKTRFNNYGMASALVQ  241

Query  797  HEWRPKSLITLSGEVDVKAVDKSAKFGLALALK  895
            HEWRPKS +T+SG+VD KA++KS K GL+L LK
Sbjct  242  HEWRPKSFVTISGDVDTKAIEKSTKVGLSLVLK  274



>ref|XP_002440144.1| hypothetical protein SORBIDRAFT_09g026790 [Sorghum bicolor]
 gb|EES18574.1| hypothetical protein SORBIDRAFT_09g026790 [Sorghum bicolor]
Length=276

 Score =   342 bits (876),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 168/274 (61%), Positives = 210/274 (77%), Gaps = 3/274 (1%)
 Frame = +2

Query  80   GPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQLKNK  259
            GPGLY++IGKKARDLLY+DY TD KFT+TTY+  G  IT+  ++K +    ++ +QLK+ 
Sbjct  5    GPGLYSEIGKKARDLLYKDYHTDQKFTLTTYAANGAAITAASTRKDEAIFNEIQSQLKHN  64

Query  260  NITTDFKVDTNSNVFTTITVDE-AAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTSVG  436
            N+T D K  + SN+ TTITV E   PGLK I     P Q+S K ELQYLH HAG++ SVG
Sbjct  65   NVTVDVKATSESNLITTITVHELGTPGLKGILCIPFPYQKSAKAELQYLHHHAGVAASVG  124

Query  437  LTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGDSL  616
            L ANP+VN SGV GT  +A+G D ++DT SG  TKYNAGLS+T SD +A+ TLN KGD++
Sbjct  125  LNANPVVNLSGVFGTKTIAVGADAAYDTSSGDLTKYNAGLSYTTSDFVAAATLNHKGDNI  184

Query  617  SASYYHHVNPLSNTAVGAEVNHSFSSNVNTITVGTQHQLDPLTTVKARVNNFGRANALIQ  796
            +ASYYH V+P   TAVG E++HSFS+N NTIT GTQH LDPLTTVKAR NN+G A+ALIQ
Sbjct  185  AASYYHLVSP--TTAVGGELSHSFSTNGNTITFGTQHALDPLTTVKARFNNYGMASALIQ  242

Query  797  HEWRPKSLITLSGEVDVKAVDKSAKFGLALALKP  898
            HEWRPKSL+T+S EVD KA++KS+K GL+L LKP
Sbjct  243  HEWRPKSLVTISAEVDTKAIEKSSKVGLSLVLKP  276



>gb|ACG45954.1| outer plastidial membrane protein porin [Zea mays]
Length=275

 Score =   342 bits (876),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 164/273 (60%), Positives = 209/273 (77%), Gaps = 1/273 (0%)
 Frame = +2

Query  80   GPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQLKNK  259
             PGLYTDIGKK RDLLY+DY T  KF +TT SP GV IT+ G++K +   G+++TQ+KNK
Sbjct  2    APGLYTDIGKKTRDLLYKDYNTHQKFCLTTSSPNGVAITAAGTRKNESIFGELHTQIKNK  61

Query  260  NITTDFKVDTNSNVFTTITVDE-AAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTSVG  436
             +T D K ++ S++ TTITVDE   PGLK I +  VPDQRSGK+E QYLH++AG++ SVG
Sbjct  62   KLTVDVKANSESDLLTTITVDEFGTPGLKSIINLVVPDQRSGKLEFQYLHEYAGVNASVG  121

Query  437  LTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGDSL  616
            L +NP+VN SG  G+ AL++G DVSFDT +  FTKYNA LS T+ DLIASL LN+ GD+L
Sbjct  122  LNSNPMVNLSGAFGSKALSVGVDVSFDTATSDFTKYNAALSLTSPDLIASLHLNNHGDTL  181

Query  617  SASYYHHVNPLSNTAVGAEVNHSFSSNVNTITVGTQHQLDPLTTVKARVNNFGRANALIQ  796
             ASYYH V   S TAVGAE++HS S N +T+  G+QH LDP TT+K R NN+G A+AL+Q
Sbjct  182  VASYYHLVKNHSGTAVGAELSHSMSRNESTLIFGSQHSLDPHTTIKTRFNNYGMASALVQ  241

Query  797  HEWRPKSLITLSGEVDVKAVDKSAKFGLALALK  895
            HEWRPKS +T+SG+VD KA++KS K GL+L LK
Sbjct  242  HEWRPKSFVTISGDVDTKAIEKSTKVGLSLVLK  274



>emb|CAA57647.1| Voltage dependent anion channel (VDAC) [Triticum aestivum]
Length=273

 Score =   341 bits (874),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 178/275 (65%), Positives = 206/275 (75%), Gaps = 5/275 (2%)
 Frame = +2

Query  83   PGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQLKNKN  262
            P LY +IGKKARDLL RDY T  KFT TT +  G  ITS+ +KK +  L D+ TQ+K KN
Sbjct  1    PALYNNIGKKARDLLNRDYTTGQKFTFTTTAANGATITSSSTKKNEAILADLQTQVKIKN  60

Query  263  ITTDFKVDTNSNVFTTITVDEA-APGLKIISSFRVPDQRS--GKVELQYLHDHAGISTSV  433
             T D K  ++S+V TTITV E   PGLK + S   P Q+S  GK ELQYLH H GI+ SV
Sbjct  61   FTVDVKATSDSSVVTTITVPELYTPGLKGVLSLPFPYQKSTPGKAELQYLHPHLGINGSV  120

Query  434  GLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGDS  613
            GL +NP+VNFSGV+GT A A G DV+FDT SG FTKYNAGLS TN DL ASL LN+K ++
Sbjct  121  GLNSNPLVNFSGVIGTKAFAFGVDVAFDTASGDFTKYNAGLSHTNQDLTASLNLNNKVNT  180

Query  614  LSASYYHHVNPLSNTAVGAEVNHSFSSNVNTITVGTQHQLDPLTTVKARVNNFGRANALI  793
            L+ASYYH V     TAVGAE+ HSFSSN NTIT+GTQH+LDPLTTVK R NNFG A+ALI
Sbjct  181  LAASYYHQVQ--RTTAVGAEIAHSFSSNENTITIGTQHELDPLTTVKGRYNNFGVASALI  238

Query  794  QHEWRPKSLITLSGEVDVKAVDKSAKFGLALALKP  898
            QH WRPKSLIT S EVD KA++KS KFGLAL+LKP
Sbjct  239  QHAWRPKSLITFSTEVDTKAIEKSPKFGLALSLKP  273



>ref|XP_001779057.1| predicted protein [Physcomitrella patens]
 gb|EDQ56094.1| predicted protein [Physcomitrella patens]
Length=276

 Score =   341 bits (874),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 161/276 (58%), Positives = 208/276 (75%), Gaps = 0/276 (0%)
 Frame = +2

Query  71   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  250
            MGKGPG YTDIGKK +DLL +DY  D KF ITT + +G+  TSTG K+G+ F GD+NTQ 
Sbjct  1    MGKGPGFYTDIGKKTKDLLNKDYTYDQKFVITTSTKSGLAFTSTGLKRGEAFTGDLNTQF  60

Query  251  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  430
            KNKN+T D KVDT SN+FTTIT+DE APG K + SF +PD +SGK+E+QY  D+ GI+ S
Sbjct  61   KNKNVTADVKVDTKSNIFTTITIDEFAPGAKSVFSFTIPDHKSGKLEIQYKQDYCGITGS  120

Query  431  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  610
            +GL+ +PIV  +G +G +  ++G +V+FD+ +G+  KYNAG+     D  AS+ L +KGD
Sbjct  121  IGLSPSPIVEATGALGNDGFSVGGEVAFDSANGSLIKYNAGVGLVKPDFNASIILAEKGD  180

Query  611  SLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTITVGTQHQLDPLTTVKARVNNFGRANAL  790
             L ASY H V+P+S T + AE+ H FS N NT TVG  ++LD LTTVKAR+NN G+  AL
Sbjct  181  LLKASYLHTVSPISRTTMAAEIAHRFSKNENTFTVGGLYELDTLTTVKARLNNHGKLAAL  240

Query  791  IQHEWRPKSLITLSGEVDVKAVDKSAKFGLALALKP  898
            +QHEWRPKSL+TLSGEVD K++DK+AK GLALALKP
Sbjct  241  LQHEWRPKSLVTLSGEVDTKSLDKTAKIGLALALKP  276



>gb|KJB30164.1| hypothetical protein B456_005G132100 [Gossypium raimondii]
Length=335

 Score =   343 bits (879),  Expect = 7e-112, Method: Compositional matrix adjust.
 Identities = 174/254 (69%), Positives = 204/254 (80%), Gaps = 7/254 (3%)
 Frame = +2

Query  158  TITTYSPTGVVITSTGSKKGDLFLGDVNTQLKNKNITTDFKVDTNSN---VFTTITVDEA  328
             +  YSPT V IT  G KK DLFL DVNTQLK +N+TTD KVDT+SN   +FTTITVDE 
Sbjct  82   CLIVYSPTDVAITFAGMKKCDLFLADVNTQLKFRNVTTDIKVDTSSNGLQLFTTITVDEP  141

Query  329  APGLKIISSFRVPDQRSGKVELQYLHDHAGISTSVGLTANPIVNFSGVVGTNALALGTDV  508
            APGLK I  F+VPDQRSGK++LQYL+++A IS+S+GLT NPIVNFSGV GTN LALGTD+
Sbjct  142  APGLKTIFGFKVPDQRSGKIKLQYLYEYARISSSIGLTTNPIVNFSGVFGTNVLALGTDI  201

Query  509  SFDTKSGAFTKYNAGLSFTNSDLIASLTL----NDKGDSLSASYYHHVNPLSNTAVGAEV  676
            SF+ K G FTK NAGLSFTN+DLIASL L    N+KGDS++ASYYH VNP +N  VGAEV
Sbjct  202  SFNMKFGNFTKCNAGLSFTNADLIASLALHVVMNEKGDSVNASYYHIVNPSTNIVVGAEV  261

Query  677  NHSFSSNVNTITVGTQHQLDPLTTVKARVNNFGRANALIQHEWRPKSLITLSGEVDVKAV  856
             +SF++NVNTITVGTQ+ LDPLTT+KA VNN    +ALIQHEW  KSL T+ GEVD +++
Sbjct  262  TYSFTTNVNTITVGTQYALDPLTTIKAWVNNASMVSALIQHEWLSKSLFTIYGEVDTESI  321

Query  857  DKSAKFGLALALKP  898
            DKS K GLALALKP
Sbjct  322  DKSPKVGLALALKP  335



>ref|XP_001781995.1| predicted protein [Physcomitrella patens]
 gb|EDQ53219.1| predicted protein [Physcomitrella patens]
Length=276

 Score =   340 bits (871),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 164/276 (59%), Positives = 205/276 (74%), Gaps = 0/276 (0%)
 Frame = +2

Query  71   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  250
            MGKGPG+Y+DIGKK +DLL +DY  D KF ITT + +G+  TSTG K+G+ F GDVNT  
Sbjct  1    MGKGPGMYSDIGKKTKDLLNKDYTYDQKFVITTNTQSGLAFTSTGVKRGEGFSGDVNTSF  60

Query  251  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  430
            KNKN+T D KVDT SN+F T+TVDE APG K + +F +PD +SGK+EL Y  D+ GIS S
Sbjct  61   KNKNVTADVKVDTKSNIFATVTVDEFAPGAKSVFTFTIPDHKSGKLELLYKQDYCGISGS  120

Query  431  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  610
            +GLT +PIV  +G +G    ++G +++FDT SG+  KYNAG+ F   D  ASL L +KGD
Sbjct  121  IGLTPSPIVEATGALGNEGFSVGGELAFDTASGSLIKYNAGVGFVKPDFNASLMLAEKGD  180

Query  611  SLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTITVGTQHQLDPLTTVKARVNNFGRANAL  790
             L ASY H V+P+S T V AE+ H FS N NT TVG  ++LD LTTVKAR+NN G+  AL
Sbjct  181  LLKASYLHTVSPVSRTTVAAEIAHKFSKNENTFTVGGLYELDTLTTVKARLNNHGKLAAL  240

Query  791  IQHEWRPKSLITLSGEVDVKAVDKSAKFGLALALKP  898
            +QHEWRPKSLIT SGEVD K++DK+AK GLALALKP
Sbjct  241  LQHEWRPKSLITFSGEVDTKSLDKTAKIGLALALKP  276



>sp|P42057.1|VDAC_MAIZE RecName: Full=Outer plastidial membrane protein porin; AltName: 
Full=Voltage-dependent anion-selective channel protein; Short=VDAC 
[Zea mays]
 emb|CAA51828.1| porin [Zea mays]
Length=277

 Score =   338 bits (868),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 163/271 (60%), Positives = 208/271 (77%), Gaps = 1/271 (0%)
 Frame = +2

Query  86   GLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQLKNKNI  265
            GLYTDIGKK RDLLY+DY T  KF +TT SP GV IT+ G++K +   G+++TQ+KNK +
Sbjct  6    GLYTDIGKKTRDLLYKDYNTHQKFCLTTSSPNGVAITAAGTRKNESIFGELHTQIKNKKL  65

Query  266  TTDFKVDTNSNVFTTITVDE-AAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTSVGLT  442
            T D K ++ S++ TTITVDE   PGLK I +  VPDQRSGK+E QYLH++AG++ SVGL 
Sbjct  66   TVDVKANSESDLLTTITVDEFGTPGLKSIINLVVPDQRSGKLEFQYLHEYAGVNASVGLN  125

Query  443  ANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGDSLSA  622
            +NP+VN SG  G+ AL++G DVSFDT +  FTKYNA LS T+ DLIASL LN+ GD+L A
Sbjct  126  SNPMVNLSGAFGSKALSVGVDVSFDTATSDFTKYNAALSLTSPDLIASLHLNNHGDTLVA  185

Query  623  SYYHHVNPLSNTAVGAEVNHSFSSNVNTITVGTQHQLDPLTTVKARVNNFGRANALIQHE  802
            SYYH V   S TAVGAE++HS S N +T+  G+QH LDP TT+K R NN+G A+AL+QHE
Sbjct  186  SYYHLVKNHSGTAVGAELSHSMSRNESTLIFGSQHSLDPHTTIKTRFNNYGMASALVQHE  245

Query  803  WRPKSLITLSGEVDVKAVDKSAKFGLALALK  895
            WRPKS +T+SG+VD KA++KS K GL+L LK
Sbjct  246  WRPKSFVTISGDVDTKAIEKSTKVGLSLVLK  276



>dbj|BAJ99317.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ86472.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=290

 Score =   339 bits (869),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 177/273 (65%), Positives = 205/273 (75%), Gaps = 5/273 (2%)
 Frame = +2

Query  89   LYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQLKNKNIT  268
            LY DIGKKARDLL RDY T  KFT TT +  G  ITS+ +KK +  L D+ TQ+K KN T
Sbjct  20   LYADIGKKARDLLNRDYTTGQKFTFTTTAANGATITSSSTKKNEAILSDLQTQVKIKNFT  79

Query  269  TDFKVDTNSNVFTTITVDE-AAPGLKIISSFRVPDQRS--GKVELQYLHDHAGISTSVGL  439
             D K  ++S+V TTIT+ E   PGLK + S   P Q+S  GK ELQYLH H GI+ SVGL
Sbjct  80   VDVKATSDSSVVTTITIPELCKPGLKGVLSLPFPYQKSTPGKAELQYLHPHLGINGSVGL  139

Query  440  TANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGDSLS  619
              NP+VN SGV+GT ALA G DV+FDT SG FTKYNAG+S TN DL ASL LN+KG++L+
Sbjct  140  NPNPLVNISGVIGTKALAFGLDVAFDTASGDFTKYNAGMSHTNQDLTASLMLNNKGNTLA  199

Query  620  ASYYHHVNPLSNTAVGAEVNHSFSSNVNTITVGTQHQLDPLTTVKARVNNFGRANALIQH  799
            ASYYH V     TAVGAE+ HSFSSN NTITVGTQH+LDPLTT+K R NNFG A+ALIQH
Sbjct  200  ASYYHQVQ--LTTAVGAEIAHSFSSNENTITVGTQHELDPLTTLKGRYNNFGIASALIQH  257

Query  800  EWRPKSLITLSGEVDVKAVDKSAKFGLALALKP  898
             WRPKS+IT S EVD KAV+KS KFGLAL+LKP
Sbjct  258  AWRPKSVITFSTEVDTKAVEKSPKFGLALSLKP  290



>ref|NP_001056162.1| Os05g0536200 [Oryza sativa Japonica Group]
 sp|Q6L5I5.1|VDAC2_ORYSJ RecName: Full=Mitochondrial outer membrane protein porin 2; AltName: 
Full=Voltage-dependent anion-selective channel protein 
2; Short=OsVDAC2 [Oryza sativa Japonica Group]
 emb|CAC80850.1| voltage-dependent anion channel [Oryza sativa Japonica Group]
 gb|AAT39214.1| voltage-dependent anion-selective channel (VDAC) protein [Oryza 
sativa Japonica Group]
 dbj|BAF18076.1| Os05g0536200 [Oryza sativa Japonica Group]
 dbj|BAG92718.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC79592.1| hypothetical protein OsI_20774 [Oryza sativa Indica Group]
 gb|EEE64499.1| hypothetical protein OsJ_19349 [Oryza sativa Japonica Group]
Length=280

 Score =   338 bits (866),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 171/271 (63%), Positives = 207/271 (76%), Gaps = 3/271 (1%)
 Frame = +2

Query  89   LYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQLKNKNIT  268
            LY+DIGKKARDLLYRDY TD KFT+TTY+  G  IT  G+KK +    ++ +Q+KN N++
Sbjct  12   LYSDIGKKARDLLYRDYHTDQKFTLTTYAANGAAITVAGTKKNESIFSEIQSQVKNNNVS  71

Query  269  TDFKVDTNSNVFTTITV-DEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTSVGLTA  445
             D K  ++S + TT TV D   PGLK I S   P Q+S K E+QYLH HAG++  VGL A
Sbjct  72   VDVKATSDSKLITTFTVHDLGTPGLKGILSIPFPYQKSAKAEVQYLHPHAGLNAIVGLNA  131

Query  446  NPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGDSLSAS  625
            NP+V+FSGV GT A A+GTDV+FDT +G FTKYNAGLS T  DL A+L LN+KGDSL+AS
Sbjct  132  NPLVSFSGVFGTGAFAVGTDVAFDTATGDFTKYNAGLSHTTPDLTAALLLNNKGDSLAAS  191

Query  626  YYHHVNPLSNTAVGAEVNHSFSSNVNTITVGTQHQLDPLTTVKARVNNFGRANALIQHEW  805
            YYH V+  S  AVGAE+ HSFSSN NT+T GTQH LD LTTVKAR NNFG A+ALIQHE+
Sbjct  192  YYHKVSKTS--AVGAELAHSFSSNENTLTFGTQHALDELTTVKARFNNFGMASALIQHEF  249

Query  806  RPKSLITLSGEVDVKAVDKSAKFGLALALKP  898
            RPKSL+T+S EVD KA+DKS+K GL+L LKP
Sbjct  250  RPKSLVTISTEVDTKAIDKSSKVGLSLVLKP  280



>gb|KJB31318.1| hypothetical protein B456_005G186100, partial [Gossypium raimondii]
Length=247

 Score =   336 bits (861),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 172/249 (69%), Positives = 199/249 (80%), Gaps = 15/249 (6%)
 Frame = +2

Query  173  SPTGVVITSTGSKKGDLFLGDVNTQLKNKNITTDFKVDTNSNV-------FTTITVDEAA  331
            SPTGV ITS G+KK DLFLGDVNTQLK++N+TTD KVD NSN+       FTT+ VD+  
Sbjct  7    SPTGVAITSAGTKKCDLFLGDVNTQLKSRNVTTDIKVDINSNIIHYVYKLFTTVIVDKPI  66

Query  332  PGLKIISSFRVPDQRSGKVELQYLHDHAGISTSVGLTANPIVNFSGVVGTNALALGTDVS  511
            P LK I  FRV DQRS K        +AGIS+S+GLTANPIVN SGV+GTN LALGTD+S
Sbjct  67   PRLKAIFGFRVSDQRSCK--------YAGISSSIGLTANPIVNLSGVLGTNVLALGTDIS  118

Query  512  FDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGDSLSASYYHHVNPLSNTAVGAEVNHSFS  691
            FDTK+  FTK NA LSFTN+DLIASL LN+KG+S++ASYYH VNP +NT VG EV HSFS
Sbjct  119  FDTKTKNFTKCNARLSFTNADLIASLALNEKGNSINASYYHIVNPSTNTVVGVEVTHSFS  178

Query  692  SNVNTITVGTQHQLDPLTTVKARVNNFGRANALIQHEWRPKSLITLSGEVDVKAVDKSAK  871
            +NVNTITVGTQH LDPLTT KARVN+ G+A+ LIQH+WRPKSL T+S EVD K++DKS K
Sbjct  179  TNVNTITVGTQHVLDPLTTTKARVNHAGKASTLIQHKWRPKSLFTISREVDTKSIDKSPK  238

Query  872  FGLALALKP  898
             GLALALKP
Sbjct  239  VGLALALKP  247



>ref|XP_006655528.1| PREDICTED: mitochondrial outer membrane protein porin 2-like 
[Oryza brachyantha]
Length=281

 Score =   335 bits (860),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 168/274 (61%), Positives = 205/274 (75%), Gaps = 3/274 (1%)
 Frame = +2

Query  80   GPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQLKNK  259
            GPGLY++IGKKARDLLY+DY T+ KFT+TTY+  G  IT   ++K +    ++ +QLKN 
Sbjct  10   GPGLYSEIGKKARDLLYKDYHTNQKFTLTTYAANGAAITVASTRKDEAMSSEIQSQLKNN  69

Query  260  NITTDFKVDTNSNVFTTITV-DEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTSVG  436
            N+T D K  ++S + TT TV D   PG K I S   P Q+S K E+QYLH HAG++  VG
Sbjct  70   NVTVDVKATSDSTLMTTFTVHDLCMPGTKGILSIPFPYQKSAKAEVQYLHPHAGLNACVG  129

Query  437  LTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGDSL  616
            L+ANP+V+FSG  GT A A+G DV+FDT +G FTKYNA LS T  DL ASL LN+KGDSL
Sbjct  130  LSANPLVSFSGAFGTRAFAVGADVTFDTATGDFTKYNAALSHTTEDLTASLLLNNKGDSL  189

Query  617  SASYYHHVNPLSNTAVGAEVNHSFSSNVNTITVGTQHQLDPLTTVKARVNNFGRANALIQ  796
              SYYH V+ +S  AVGAE+ HSFSSN NT+T GTQH LD LTTVKAR NNFG A+ALIQ
Sbjct  190  VTSYYHSVSKVS--AVGAELAHSFSSNENTLTFGTQHALDELTTVKARFNNFGLASALIQ  247

Query  797  HEWRPKSLITLSGEVDVKAVDKSAKFGLALALKP  898
            HE+RPKSLIT+S EVD KA+DKS+K GL+L LKP
Sbjct  248  HEFRPKSLITISTEVDTKAIDKSSKVGLSLVLKP  281



>gb|ADE77918.1| unknown [Picea sitchensis]
Length=276

 Score =   335 bits (859),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 156/276 (57%), Positives = 204/276 (74%), Gaps = 0/276 (0%)
 Frame = +2

Query  71   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  250
            MGKGPGL+++IGKKARDLL +DY  D KF +TTYS  G+ ITSTG  KG LF GD++T  
Sbjct  1    MGKGPGLFSNIGKKARDLLTKDYSHDQKFAVTTYSEDGLGITSTGMNKGGLFCGDIDTHY  60

Query  251  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  430
            K +N T + KVDTNSN+ TTIT+DE  PG K + SF++PD++SGK++ QY H+H G+S+S
Sbjct  61   KYQNSTINVKVDTNSNISTTITIDEVLPGAKTVLSFKLPDEKSGKLDFQYSHEHVGLSSS  120

Query  431  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  610
            VGLT  P V+FSG +G++   +G +V FDT SG FTKYN G+  T  +  A++   DKGD
Sbjct  121  VGLTPKPQVDFSGAIGSDVFTVGGEVGFDTSSGLFTKYNGGIGITKPEFSAAILFADKGD  180

Query  611  SLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTITVGTQHQLDPLTTVKARVNNFGRANAL  790
            +L ASY H +NP++ T   AE++  FS+N NT TVG+ + LDPLTT+K R+NN G+   +
Sbjct  181  TLKASYLHELNPITKTCFAAEISRKFSANQNTFTVGSSYALDPLTTMKTRLNNHGKLGTV  240

Query  791  IQHEWRPKSLITLSGEVDVKAVDKSAKFGLALALKP  898
            +QHEW+PKSLITLS E D KA+DKS K GLALA KP
Sbjct  241  LQHEWKPKSLITLSSEFDTKALDKSPKIGLALAFKP  276



>gb|KJB11405.1| hypothetical protein B456_001G256800 [Gossypium raimondii]
Length=214

 Score =   327 bits (838),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 158/200 (79%), Positives = 179/200 (90%), Gaps = 0/200 (0%)
 Frame = +2

Query  299  VFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTSVGLTANPIVNFSGVVG  478
            +FTTITVDE APGLK I  FRVPDQRSGK+ELQYLH++AGIS+S+GLTANPIVNFSGV+G
Sbjct  15   LFTTITVDEPAPGLKAIFGFRVPDQRSGKIELQYLHEYAGISSSIGLTANPIVNFSGVLG  74

Query  479  TNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGDSLSASYYHHVNPLSNT  658
            TN LALGTD+SFDTK+G FTK NAG SFTN+DLIASL LN+KGDS++ASYYH VN  +NT
Sbjct  75   TNVLALGTDISFDTKTGNFTKCNAGFSFTNADLIASLALNEKGDSVNASYYHIVNLSTNT  134

Query  659  AVGAEVNHSFSSNVNTITVGTQHQLDPLTTVKARVNNFGRANALIQHEWRPKSLITLSGE  838
             VGAEV HSFS+NVNTITVGTQH LDP TT+KARVNN G+A+ALIQHEWRPKSL T+SGE
Sbjct  135  VVGAEVTHSFSTNVNTITVGTQHALDPSTTIKARVNNAGKASALIQHEWRPKSLFTISGE  194

Query  839  VDVKAVDKSAKFGLALALKP  898
            VD K++DKS K GLALALKP
Sbjct  195  VDTKSIDKSPKVGLALALKP  214



>gb|KJB50697.1| hypothetical protein B456_008G182700 [Gossypium raimondii]
Length=210

 Score =   325 bits (833),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 156/200 (78%), Positives = 182/200 (91%), Gaps = 0/200 (0%)
 Frame = +2

Query  299  VFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTSVGLTANPIVNFSGVVG  478
            +F T+TVDE APGLK I SF  PDQRSGKVELQY H++AGISTS+GLTANP+VNFSGVVG
Sbjct  11   LFATVTVDEPAPGLKTIFSFIAPDQRSGKVELQYQHEYAGISTSIGLTANPLVNFSGVVG  70

Query  479  TNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGDSLSASYYHHVNPLSNT  658
             N++ +GTD+SFDT SG FTK NAGL+FT+SDLIASLTLNDKGD+L+ASYYH V+PL+NT
Sbjct  71   NNSVTVGTDLSFDTASGNFTKLNAGLNFTHSDLIASLTLNDKGDTLNASYYHIVSPLTNT  130

Query  659  AVGAEVNHSFSSNVNTITVGTQHQLDPLTTVKARVNNFGRANALIQHEWRPKSLITLSGE  838
            AVGAE++HSFSSN NT+T+GTQH LDPLTTVKAR+NN+GRA+ALIQHEWRPKSLIT+SGE
Sbjct  131  AVGAELSHSFSSNENTLTIGTQHALDPLTTVKARLNNYGRASALIQHEWRPKSLITISGE  190

Query  839  VDVKAVDKSAKFGLALALKP  898
            VD  A++KSAK GLALALKP
Sbjct  191  VDTGAIEKSAKVGLALALKP  210



>ref|XP_002458403.1| hypothetical protein SORBIDRAFT_03g032840 [Sorghum bicolor]
 gb|EES03523.1| hypothetical protein SORBIDRAFT_03g032840 [Sorghum bicolor]
Length=277

 Score =   325 bits (832),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 163/276 (59%), Positives = 205/276 (74%), Gaps = 3/276 (1%)
 Frame = +2

Query  80   GPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQLKNK  259
            GPGLY+DIGKKARDLL +D+ TD KF +TTYS  G VIT++ +KK +    ++  QLK K
Sbjct  2    GPGLYSDIGKKARDLLSKDFHTDQKFILTTYSSNGTVITASSTKKNESIFSEIQAQLKQK  61

Query  260  NITTDFKVDTNSNVFTTITVDE-AAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTSVG  436
            N+T D K +++S + TT+TV+E   PGLK   +   P +  GK E+QYLHD+AGIS S G
Sbjct  62   NVTVDVKANSDSLLLTTVTVEELGVPGLKKTMTIPFPHRGFGKFEIQYLHDYAGISASAG  121

Query  437  LTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGDSL  616
            + A P+VN S V G  A+A G DV++DT +  FTKYNAGLSFTN+DLIA++TLN+KG+SL
Sbjct  122  MNAKPLVNLSAVFGNKAIAAGADVAYDTATRDFTKYNAGLSFTNADLIAAVTLNNKGESL  181

Query  617  SASYYHHVNPLSNTAVGAEVNHSFSSNVNTITVGTQHQLDPLTTVKARVNNFGRANALIQ  796
            +ASYYH VN   NTAVGAEV H+FS+  +T+T GTQH LDP TTVKAR ++ G A+ALIQ
Sbjct  182  TASYYHIVNTEKNTAVGAEVTHNFSTKGSTVTFGTQHALDPTTTVKARYSSNGMASALIQ  241

Query  797  HEWRPKSLITLSGEVDVKA--VDKSAKFGLALALKP  898
            HEWRPKS  TLS EVD+ A  V KS K GL+L LKP
Sbjct  242  HEWRPKSFFTLSTEVDIDASGVKKSPKVGLSLVLKP  277



>sp|Q0JJV1.3|VDAC4_ORYSJ RecName: Full=Mitochondrial outer membrane protein porin 4; AltName: 
Full=Voltage-dependent anion-selective channel protein 
4; Short=OsVDAC4 [Oryza sativa Japonica Group]
Length=317

 Score =   326 bits (835),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 161/271 (59%), Positives = 201/271 (74%), Gaps = 1/271 (0%)
 Frame = +2

Query  89   LYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQLKNKNIT  268
            LY +IGKKARDLLY+D+ TD KFT+TTY+  GVVIT+  + K +    ++ T+LK+ N+ 
Sbjct  47   LYFEIGKKARDLLYKDFHTDQKFTLTTYTNNGVVITAASTMKDEAIFSEIQTKLKSNNVM  106

Query  269  TDFKVDTNSNVFTTITVDE-AAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTSVGLTA  445
             D K  ++S V TTIT ++    GLK I S   P Q +GK ELQYLHD+AGIS  VGLT+
Sbjct  107  LDVKATSDSQVLTTITTEDLGVSGLKQIVSLPFPYQTAGKAELQYLHDYAGISLGVGLTS  166

Query  446  NPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGDSLSAS  625
             P+VN SGV G  ++A+G DV+ DT +G FTKY+AGL+  NSDL A LTLN+KGDSL+AS
Sbjct  167  KPLVNLSGVFGNKSVAVGADVAVDTSTGDFTKYDAGLTINNSDLAADLTLNNKGDSLTAS  226

Query  626  YYHHVNPLSNTAVGAEVNHSFSSNVNTITVGTQHQLDPLTTVKARVNNFGRANALIQHEW  805
            YYH VN  S TA GAE+ HSFS+  NT++ G QH LDPLTTVKAR NN G  +ALIQHEW
Sbjct  227  YYHLVNKESGTAAGAELTHSFSTKENTLSFGMQHALDPLTTVKARYNNHGMVSALIQHEW  286

Query  806  RPKSLITLSGEVDVKAVDKSAKFGLALALKP  898
            RPKS +TLS EVD KA+DK++K GL+L LKP
Sbjct  287  RPKSFLTLSAEVDTKAIDKASKVGLSLVLKP  317



>gb|ACU19720.1| unknown [Glycine max]
Length=241

 Score =   322 bits (824),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 164/236 (69%), Positives = 196/236 (83%), Gaps = 2/236 (1%)
 Frame = +2

Query  71   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  250
            M KGPGLY+DIGK+ARDLL++DYQ DHKFTITTY+ TGV ITSTG +KG+++L DV+T++
Sbjct  1    MVKGPGLYSDIGKRARDLLFKDYQNDHKFTITTYTSTGVEITSTGVRKGEIYLADVSTKV  60

Query  251  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  430
            KNKNITTD KVDTNSN+ TTITVDE APGLK I SF  PDQ+SGKVELQY H++AGI+TS
Sbjct  61   KNKNITTDVKVDTNSNLRTTITVDEPAPGLKTIFSFNFPDQKSGKVELQYQHEYAGINTS  120

Query  431  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  610
            +GLTANP+VNFSGVVG N +A+GTD+SFDT SG F KYNAGL+ T++DLIASLTLNDKGD
Sbjct  121  IGLTANPVVNFSGVVGNNLVAVGTDLSFDTASGNFIKYNAGLNITHADLIASLTLNDKGD  180

Query  611  SLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTITVGTQHQLDPLTTVKARVNNFGR  778
            +L+ASYYH V+PL+NTAVGAE++HSFS    T    T      L  V   VNN+GR
Sbjct  181  NLTASYYHIVSPLTNTAVGAELSHSFSGMKYTHLWYTACSGSLLCEVP--VNNYGR  234



>ref|XP_003569678.1| PREDICTED: mitochondrial outer membrane protein porin 2-like 
[Brachypodium distachyon]
Length=327

 Score =   318 bits (815),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 158/279 (57%), Positives = 202/279 (72%), Gaps = 3/279 (1%)
 Frame = +2

Query  65   AEMGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNT  244
            +++  G GLY+++G+KARDLLY+D+ TD KFT+TT +  G  IT+T +KK +  LGD+ T
Sbjct  51   SKVAPGHGLYSEVGQKARDLLYKDFHTDQKFTLTTRANNGAAITATSTKKNEAILGDIKT  110

Query  245  QLKNKNITTDFKVDTNSNVF-TTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGI  421
            Q K  N+  D K  T+S V  TT T D    GLK I +   P+Q +GKVE+QYLHD+AG+
Sbjct  111  QFKFNNVKVDVKATTDSEVLITTTTEDLGLVGLKKIVTIPFPNQTAGKVEVQYLHDYAGL  170

Query  422  STSVGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLND  601
            + SVGL + P++N SGV G  ALA G DV++D+ +G FTKYNAG+S TN DL A++ LN+
Sbjct  171  NVSVGLNSKPLINLSGVFGNKALAAGADVAYDSATGNFTKYNAGVSLTNEDLSAAVMLNN  230

Query  602  KGDSLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTITVGTQHQLDPLTTVKARVNNFGRA  781
            KGDSL+ASYYH VN    TAVGAEV HSFSS  NT T G+Q+ LDPLTT K R NN G  
Sbjct  231  KGDSLTASYYHSVN--KETAVGAEVTHSFSSKENTFTFGSQYSLDPLTTAKLRYNNLGMV  288

Query  782  NALIQHEWRPKSLITLSGEVDVKAVDKSAKFGLALALKP  898
            + LIQHEWRPKS + LS EVD KA+DKS+K GL+L L+P
Sbjct  289  STLIQHEWRPKSFLALSTEVDTKAIDKSSKIGLSLVLEP  327



>ref|XP_002976531.1| hypothetical protein SELMODRAFT_267998 [Selaginella moellendorffii]
 gb|EFJ22200.1| hypothetical protein SELMODRAFT_267998 [Selaginella moellendorffii]
Length=278

 Score =   312 bits (799),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 140/274 (51%), Positives = 201/274 (73%), Gaps = 0/274 (0%)
 Frame = +2

Query  77   KGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQLKN  256
            KGPG ++D+GKK  DLLY+D+  D +F++++ + TG+  +S G KKGD+F GD  T    
Sbjct  5    KGPGFWSDVGKKTSDLLYKDFSADQRFSLSSTTSTGLTFSSFGVKKGDVFDGDFTTTYVC  64

Query  257  KNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTSVG  436
            KN+T D KVDT S +F+T+ VD+ APG + I +F +PDQ+SGK+ELQY H +AG++ SVG
Sbjct  65   KNVTVDVKVDTQSKIFSTVKVDDLAPGTRAIFNFSLPDQKSGKMELQYCHQYAGVTGSVG  124

Query  437  LTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGDSL  616
            L ++P+V  +   G+N + +G + +FDT SG FTKYNAG+     +  A++ + DKGD+L
Sbjct  125  LASSPVVECTSAFGSNDVVIGGEAAFDTASGNFTKYNAGVGINKPEFTAAVVVADKGDTL  184

Query  617  SASYYHHVNPLSNTAVGAEVNHSFSSNVNTITVGTQHQLDPLTTVKARVNNFGRANALIQ  796
             ASY H ++P + T VGAE++H  S+  NT ++G  + LD LTT+KAR+NN GR  A++Q
Sbjct  185  KASYSHVLSPFTRTTVGAEISHKLSTKANTFSIGGMYGLDALTTIKARLNNHGRIAAVVQ  244

Query  797  HEWRPKSLITLSGEVDVKAVDKSAKFGLALALKP  898
            HEWRPKS+I++SGEVD KA++KSAK GLAL+LKP
Sbjct  245  HEWRPKSVISMSGEVDTKALEKSAKLGLALSLKP  278



>ref|XP_002973372.1| hypothetical protein SELMODRAFT_271012 [Selaginella moellendorffii]
 gb|EFJ25746.1| hypothetical protein SELMODRAFT_271012 [Selaginella moellendorffii]
Length=278

 Score =   312 bits (799),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 140/274 (51%), Positives = 201/274 (73%), Gaps = 0/274 (0%)
 Frame = +2

Query  77   KGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQLKN  256
            KGPG ++D+GKK  DLLY+D+  D +F++++ + TG+  +S G KKGD+F GD  T    
Sbjct  5    KGPGFWSDVGKKTGDLLYKDFSADQRFSLSSTTSTGLTFSSFGVKKGDVFDGDFTTTYVC  64

Query  257  KNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTSVG  436
            KN+T D KVDT S +F+T+ VD+ APG + I +F +PDQ+SGK+ELQY H +AG++ SVG
Sbjct  65   KNVTVDVKVDTQSKIFSTVKVDDLAPGTRAIFNFSLPDQKSGKMELQYCHQYAGVTASVG  124

Query  437  LTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGDSL  616
            L ++P+V  +   G+N + +G + +FDT SG FTKYNAG+     +  A++ + DKGD+L
Sbjct  125  LASSPVVECTSAFGSNDVVIGGEAAFDTASGNFTKYNAGVGINKPEFTAAVVVADKGDTL  184

Query  617  SASYYHHVNPLSNTAVGAEVNHSFSSNVNTITVGTQHQLDPLTTVKARVNNFGRANALIQ  796
             ASY H ++P + T VGAE++H  S+  NT ++G  + LD LTT+KAR+NN GR  A++Q
Sbjct  185  KASYSHVLSPFTRTTVGAEISHKLSTKANTFSIGGMYGLDALTTIKARLNNHGRIAAVVQ  244

Query  797  HEWRPKSLITLSGEVDVKAVDKSAKFGLALALKP  898
            HEWRPKS+I++SGEVD KA++KSAK GLAL+LKP
Sbjct  245  HEWRPKSVISISGEVDTKALEKSAKLGLALSLKP  278



>ref|XP_006841082.1| PREDICTED: mitochondrial outer membrane protein porin 5 [Amborella 
trichopoda]
 gb|ERN02757.1| hypothetical protein AMTR_s00086p00035910 [Amborella trichopoda]
Length=276

 Score =   311 bits (798),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 149/276 (54%), Positives = 198/276 (72%), Gaps = 0/276 (0%)
 Frame = +2

Query  71   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  250
            M +GPGL++DIGKKARDLL +DY  D KFT++T+S  GV ITST  KKG +  GD+  Q 
Sbjct  1    MIRGPGLFSDIGKKARDLLTKDYSYDQKFTLSTFSEVGVGITSTAVKKGGISCGDIAVQY  60

Query  251  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  430
            K+K+   D KVDT SN+ TT T+ E  P  K I SF++PD  SGK+E+QY HDHAG S+ 
Sbjct  61   KHKSTIVDLKVDTESNILTTFTISEILPSTKAIVSFKLPDHNSGKLEVQYFHDHAGFSSI  120

Query  431  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  610
            VGL  +P V+ +G +GT   A+G +  F+T S A TKYNAGLS T  +L AS+ L DKGD
Sbjct  121  VGLNGSPTVDLTGTIGTQGFAIGVEAGFNTTSNAMTKYNAGLSLTKPELCASVILADKGD  180

Query  611  SLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTITVGTQHQLDPLTTVKARVNNFGRANAL  790
            +   SY H  +  + +++ AE++  FS+N NTITVG  +++DPLTTVKAR+NN G+  AL
Sbjct  181  NFKVSYMHTFDKFNASSIVAELSRKFSTNENTITVGGAYKVDPLTTVKARLNNHGKLGAL  240

Query  791  IQHEWRPKSLITLSGEVDVKAVDKSAKFGLALALKP  898
            +QHE +PKS++TLSGE D K++DK+ + GLALALKP
Sbjct  241  LQHELKPKSVLTLSGEFDTKSMDKTPRLGLALALKP  276



>ref|NP_001152335.1| outer mitochondrial membrane protein porin [Zea mays]
 gb|ACG47097.1| outer mitochondrial membrane protein porin [Zea mays]
Length=314

 Score =   313 bits (801),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 162/312 (52%), Positives = 203/312 (65%), Gaps = 41/312 (13%)
 Frame = +2

Query  80   GPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGV------------------------  187
            GPGLY+DIGKKAR LLY+DY TD KFT+TTY+  G                         
Sbjct  5    GPGLYSDIGKKARGLLYKDYHTDRKFTLTTYAANGAFKARVTMDMKHRVVRAMIAGSMGD  64

Query  188  --------------VITSTGSKKGDLFLGDVNTQLKNKNITTDFKVDTNSNVFTTITVDE  325
                           IT+  ++K +     +  QLK+ N+T D K  + S V TTITV E
Sbjct  65   GDGAPVHVQDKTESAITAASTRKDEAIFNKIQGQLKHNNVTVDVKATSESKVTTTITVHE  124

Query  326  -AAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTSVGLTANPIVNFSGVVGTNALALGT  502
             A PGLK       P ++S K ELQYLH HAG++ SVGL ANP+V  SGV GT  +++G 
Sbjct  125  LATPGLKAFLCIPFPYKKSAKAELQYLHHHAGVAASVGLNANPVVKLSGVFGTKTVSVGA  184

Query  503  DVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGDSLSASYYHHVNPLSNTAVGAEVNH  682
            DV+FDT SG  TKYNAGLS++ SD +A+ TLN+KGD ++ASYYH V+P   TAVG E++H
Sbjct  185  DVAFDTSSGNLTKYNAGLSYSTSDFVAAATLNNKGDKIAASYYHSVSP--TTAVGGELSH  242

Query  683  SFSSNVNTITVGTQHQLDPLTTVKARVNNFGRANALIQHEWRPKSLITLSGEVDVKAVDK  862
            SFS+N +TIT GTQH LD LTTVKAR NN G A+ALIQH+WRPKSL+T+S EVD KA++K
Sbjct  243  SFSTNGSTITFGTQHALDRLTTVKARFNNCGMASALIQHKWRPKSLVTISMEVDTKAIEK  302

Query  863  SAKFGLALALKP  898
            S+K  L+L LKP
Sbjct  303  SSKIELSLVLKP  314



>gb|EEC71387.1| hypothetical protein OsI_03508 [Oryza sativa Indica Group]
 gb|EEE55296.1| hypothetical protein OsJ_03247 [Oryza sativa Japonica Group]
Length=305

 Score =   311 bits (798),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 158/271 (58%), Positives = 196/271 (72%), Gaps = 13/271 (5%)
 Frame = +2

Query  89   LYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQLKNKNIT  268
            LY +IGKKARDLLY+D+ TD KFT+TTY+  GVVIT+  + K +    ++ T+LK+    
Sbjct  47   LYFEIGKKARDLLYKDFHTDQKFTLTTYTNNGVVITAASTMKDEAIFSEIQTKLKS----  102

Query  269  TDFKVDTNSNVFTTITVDE-AAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTSVGLTA  445
                    +NV TTIT ++    GLK I S   P Q +GK ELQYLHD+AGIS  VGLT+
Sbjct  103  --------NNVLTTITTEDLGVSGLKQIVSLPFPYQTAGKAELQYLHDYAGISLGVGLTS  154

Query  446  NPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGDSLSAS  625
             P+VN SGV G  ++A+G DV+ DT +G FTKY+AGL+  NSDL A LTLN+KGDSL+AS
Sbjct  155  KPLVNLSGVFGNKSVAVGADVAVDTSTGDFTKYDAGLTINNSDLAADLTLNNKGDSLTAS  214

Query  626  YYHHVNPLSNTAVGAEVNHSFSSNVNTITVGTQHQLDPLTTVKARVNNFGRANALIQHEW  805
            YYH VN  S TA GAE+ HSFS+  NT++ G QH LDPLTTVKAR NN G  +ALIQHEW
Sbjct  215  YYHLVNKESGTAAGAELTHSFSTKENTLSFGMQHALDPLTTVKARYNNHGMVSALIQHEW  274

Query  806  RPKSLITLSGEVDVKAVDKSAKFGLALALKP  898
            RPKS +TLS EVD KA+DK++K GL+L LKP
Sbjct  275  RPKSFLTLSAEVDTKAIDKASKVGLSLVLKP  305



>ref|XP_008787191.1| PREDICTED: mitochondrial outer membrane protein porin 5-like 
[Phoenix dactylifera]
Length=275

 Score =   310 bits (794),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 148/274 (54%), Positives = 199/274 (73%), Gaps = 0/274 (0%)
 Frame = +2

Query  77   KGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQLKN  256
            KGPGL++DIGKKA+DLL + Y  D K TI+TYS +GV +TS   KKG L+  D+ TQ K 
Sbjct  2    KGPGLFSDIGKKAKDLLTKGYSCDQKLTISTYSASGVGLTSAAVKKGGLYSFDIGTQYKY  61

Query  257  KNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTSVG  436
            KN   D KVDT+SNV TT+T+ E  P  K I+SF++PD  SGK+E+QY HDHAG++T+V 
Sbjct  62   KNTLVDVKVDTDSNVSTTLTMSEILPSTKTIASFKLPDYNSGKLEIQYFHDHAGVATAVA  121

Query  437  LTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGDSL  616
            L  +P+V+ SG +G + +A G +  FDT SG FTKYNAG+S    D  AS+ L DKGD+L
Sbjct  122  LKQSPVVDLSGTIGIHGIAFGAEAGFDTASGTFTKYNAGISLGKPDYNASIILADKGDTL  181

Query  617  SASYYHHVNPLSNTAVGAEVNHSFSSNVNTITVGTQHQLDPLTTVKARVNNFGRANALIQ  796
             ASY +H++ +  +A+  E+   FS+N NT TVG Q+ +DP TTVK+R+NN G+  AL+Q
Sbjct  182  RASYVYHLDEMQKSAMVGEITRRFSTNENTFTVGGQYIIDPQTTVKSRLNNSGKLAALLQ  241

Query  797  HEWRPKSLITLSGEVDVKAVDKSAKFGLALALKP  898
            HE +PKS++T+SGE D K +D++ KFGLALALKP
Sbjct  242  HELKPKSILTISGEFDTKDLDRAPKFGLALALKP  275



>ref|XP_008338437.1| PREDICTED: mitochondrial outer membrane protein porin 2 [Malus 
domestica]
Length=276

 Score =   310 bits (793),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 150/276 (54%), Positives = 198/276 (72%), Gaps = 0/276 (0%)
 Frame = +2

Query  71   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  250
            M KGPGL+TDIGKKA+DLL +DY +D KFTI+TYS  GV +TST  KKG L +GD+ TQ 
Sbjct  1    MSKGPGLFTDIGKKAKDLLTKDYSSDQKFTISTYSDAGVALTSTAVKKGGLSIGDILTQY  60

Query  251  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  430
            K KN   D KVDT SN+ TT T++E  P  K I+SF+ PD  SGK+E+QY HDHA  +T+
Sbjct  61   KYKNTVVDVKVDTESNILTTFTINEIVPSTKTIASFKAPDFNSGKLEVQYFHDHAAXTTA  120

Query  431  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  610
            V L  +P ++FS  +GT  +A G +  +DT SG FTKY AG+S T  D  AS+ L DKGD
Sbjct  121  VALNQSPAIDFSATIGTPTIAFGAEGGYDTTSGNFTKYTAGISITKPDQSASIILGDKGD  180

Query  611  SLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTITVGTQHQLDPLTTVKARVNNFGRANAL  790
            S+ ASY H+++ L ++A   E+   FS+N NT TVG Q+ +D  T VKA++NN G+  AL
Sbjct  181  SIRASYVHYMDLLKSSAAVGEITRKFSTNENTFTVGGQYAVDIYTVVKAKLNNHGKLGAL  240

Query  791  IQHEWRPKSLITLSGEVDVKAVDKSAKFGLALALKP  898
            +QHE  PKS++T+SGEVD KA+DK+ +FG+A+ALKP
Sbjct  241  LQHEXIPKSVLTISGEVDTKALDKNPRFGVAIALKP  276



>gb|KJB60742.1| hypothetical protein B456_009G323300 [Gossypium raimondii]
Length=207

 Score =   307 bits (786),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 146/201 (73%), Positives = 176/201 (88%), Gaps = 0/201 (0%)
 Frame = +2

Query  71   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  250
            MGKGPGLY+DIGKKARDLLY+DYQ DHKFT+TTY+  GV ITSTG+KKG+L L DVNTQL
Sbjct  1    MGKGPGLYSDIGKKARDLLYKDYQVDHKFTVTTYTSNGVAITSTGTKKGELLLADVNTQL  60

Query  251  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  430
            KNKNITTD KVD+ SN+FTT+T+DE APGLK I SF VPDQ+SG VELQY H++AGIS  
Sbjct  61   KNKNITTDVKVDSRSNLFTTVTIDEPAPGLKTIFSFVVPDQKSGMVELQYRHEYAGISNG  120

Query  431  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  610
            +GLTA P+V+FSGV+G + +++GTD+SFDT SG F K NAGL+ T+SDLIAS+TLNDKGD
Sbjct  121  IGLTAKPLVSFSGVIGNDCVSVGTDLSFDTASGNFIKLNAGLNITHSDLIASMTLNDKGD  180

Query  611  SLSASYYHHVNPLSNTAVGAE  673
            +L+ASYYH V+PL+NTAVGA+
Sbjct  181  TLTASYYHIVSPLTNTAVGAD  201



>ref|XP_010550330.1| PREDICTED: mitochondrial outer membrane protein porin 2 [Tarenaya 
hassleriana]
Length=276

 Score =   309 bits (791),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 151/276 (55%), Positives = 193/276 (70%), Gaps = 0/276 (0%)
 Frame = +2

Query  71   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  250
            M KGPGL+ DIGKKARDLL +DY +D KF+++TYS +GV +TST  KKG L   DV TQ 
Sbjct  1    MAKGPGLFADIGKKARDLLTKDYNSDQKFSVSTYSASGVALTSTALKKGGLHAADVATQY  60

Query  251  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  430
            K KN   D K+DT SN+ TTIT  E  P  K I+SF+VPD  SGK+E+QY HDHA ++  
Sbjct  61   KYKNTLFDVKIDTESNISTTITFTEVLPSTKAIASFKVPDYNSGKLEVQYFHDHATLTAV  120

Query  431  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  610
              L  NP+++ +  +GT  +A G +  +DT S  FTKYNAG+S T  D  AS+ L DKGD
Sbjct  121  AALKQNPLIDVTATLGTPTIAFGAEAGYDTASKTFTKYNAGISVTKPDACASIILGDKGD  180

Query  611  SLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTITVGTQHQLDPLTTVKARVNNFGRANAL  790
            S+ ASY HHV+    +A   EV   FS+N NT+TVG  + +D LTTVKA++NN G+  AL
Sbjct  181  SIKASYLHHVDEAKRSAAVGEVYRKFSTNENTVTVGGLYAVDHLTTVKAKLNNHGKLGAL  240

Query  791  IQHEWRPKSLITLSGEVDVKAVDKSAKFGLALALKP  898
            IQHE  PKSL+T+SGE+D KA+DK  +FGL+LALKP
Sbjct  241  IQHEVVPKSLVTVSGEIDTKALDKYPRFGLSLALKP  276



>gb|EMT20213.1| Mitochondrial outer membrane porin [Aegilops tauschii]
Length=902

 Score =   326 bits (836),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 169/263 (64%), Positives = 196/263 (75%), Gaps = 5/263 (2%)
 Frame = +2

Query  119  DLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQLKNKNITTDFKVDTNSN  298
            DLL RDY T  KFT TT +  G  ITS+ +KK +  + D+ TQ+K KN T D K  ++S+
Sbjct  642  DLLNRDYTTGQKFTFTTTAANGATITSSSTKKNEAIVADLQTQVKIKNFTVDVKATSDSS  701

Query  299  VFTTITVDEA-APGLKIISSFRVPDQRS--GKVELQYLHDHAGISTSVGLTANPIVNFSG  469
            V TTITV E   PGLK + S   P Q+S  GK ELQYLH H GI+ SVGL +NP+VNFSG
Sbjct  702  VVTTITVPELYTPGLKGVLSLPFPYQKSTPGKAELQYLHPHLGINGSVGLNSNPLVNFSG  761

Query  470  VVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGDSLSASYYHHVNPL  649
            V+GT A A G DV+FDT SG FTKYNAGLS TN DL ASL LN+K ++L+ASYYH V   
Sbjct  762  VIGTKAFAFGVDVAFDTASGDFTKYNAGLSHTNQDLTASLNLNNKANTLAASYYHQVQ--  819

Query  650  SNTAVGAEVNHSFSSNVNTITVGTQHQLDPLTTVKARVNNFGRANALIQHEWRPKSLITL  829
              TAVGAE+ HSFSSN NTITVGTQH+LDPLTTVK R NNFG A+ALIQH WRPKSLIT 
Sbjct  820  RTTAVGAEIAHSFSSNENTITVGTQHELDPLTTVKGRYNNFGIASALIQHAWRPKSLITF  879

Query  830  SGEVDVKAVDKSAKFGLALALKP  898
            S EVD KA++KS KFGLAL+LKP
Sbjct  880  STEVDTKAIEKSPKFGLALSLKP  902



>ref|XP_002279650.2| PREDICTED: mitochondrial outer membrane protein porin 2 [Vitis 
vinifera]
 emb|CAN75907.1| hypothetical protein VITISV_001975 [Vitis vinifera]
 emb|CBI33694.3| unnamed protein product [Vitis vinifera]
Length=276

 Score =   308 bits (788),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 153/276 (55%), Positives = 193/276 (70%), Gaps = 0/276 (0%)
 Frame = +2

Query  71   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  250
            M KGPGL+ DIGKKA+DLL RDY +D KFT++TYS TGV ITST  KKG L  GDV  Q 
Sbjct  1    MSKGPGLFADIGKKAKDLLTRDYISDQKFTVSTYSDTGVAITSTAVKKGGLSTGDVAVQY  60

Query  251  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  430
            K KN   D K DT SN+ TT+T  E  P  K I+SF+ PD  SGK+E+QY HDHA ++TS
Sbjct  61   KYKNSVIDVKADTGSNINTTLTFTEIIPSTKTIASFKFPDYNSGKLEVQYFHDHATLTTS  120

Query  431  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  610
            V L  +P V+ S  +GT ++A G +  +DT SG FTKY AG+S    D  AS+ L DKGD
Sbjct  121  VALNQSPAVDLSVTIGTPSIAFGAEAGYDTTSGCFTKYTAGISVAKPDSCASIILGDKGD  180

Query  611  SLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTITVGTQHQLDPLTTVKARVNNFGRANAL  790
            ++ ASY HH++ L  +A   E++  FS+N NT TVG  + +DPLT VKA++NN G   AL
Sbjct  181  TIRASYVHHLDSLKKSAAVGEISRRFSTNDNTFTVGGSYAIDPLTNVKAKLNNHGNLGAL  240

Query  791  IQHEWRPKSLITLSGEVDVKAVDKSAKFGLALALKP  898
            +QHE  PKS++TLSGE D KA+DK+ +FGLALALKP
Sbjct  241  LQHEIIPKSILTLSGEFDTKALDKTPRFGLALALKP  276



>ref|XP_010918626.1| PREDICTED: mitochondrial outer membrane protein porin 6 isoform 
X1 [Elaeis guineensis]
 ref|XP_010918627.1| PREDICTED: mitochondrial outer membrane protein porin 6 isoform 
X1 [Elaeis guineensis]
Length=276

 Score =   308 bits (788),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 147/276 (53%), Positives = 195/276 (71%), Gaps = 0/276 (0%)
 Frame = +2

Query  71   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  250
            MG GP  + DIGK+ARDLL +DY  D KFT+ T S  G+ + +TG K   LF+GD++TQ 
Sbjct  1    MGNGPAPFFDIGKRARDLLTKDYNFDQKFTLITSSDAGLGLMATGVKIDQLFIGDISTQY  60

Query  251  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  430
            K+   T D KVDTNSNV +T++V E   G+K   SF++PDQ+S K+++QYLHDHA I++S
Sbjct  61   KSGKTTVDVKVDTNSNVSSTVSVTELVAGVKTSFSFKIPDQKSSKLDVQYLHDHAAINSS  120

Query  431  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  610
            +GLT  P++  +  VG+  LALG +V FD+ S + TKYNAG+ F   D  A+L L DKG+
Sbjct  121  IGLTPTPLLELAAAVGSKELALGVEVGFDSASASVTKYNAGIGFNKHDFSAALILADKGE  180

Query  611  SLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTITVGTQHQLDPLTTVKARVNNFGRANAL  790
            +L ASY H VNP++  AV AE+ H F++  NT T+G+ H LDPLTT+K R NN G+A  +
Sbjct  181  TLKASYVHVVNPITGAAVAAEIVHRFNTYENTFTIGSCHSLDPLTTLKTRFNNSGKAAVV  240

Query  791  IQHEWRPKSLITLSGEVDVKAVDKSAKFGLALALKP  898
             QHEWRPKSLITLS E D KA+   ++ GLALALKP
Sbjct  241  CQHEWRPKSLITLSAEYDPKAISAPSRVGLALALKP  276



>ref|XP_009354614.1| PREDICTED: mitochondrial outer membrane protein porin 2-like 
[Pyrus x bretschneideri]
 ref|XP_009379335.1| PREDICTED: mitochondrial outer membrane protein porin 2 [Pyrus 
x bretschneideri]
Length=276

 Score =   307 bits (787),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 150/276 (54%), Positives = 197/276 (71%), Gaps = 0/276 (0%)
 Frame = +2

Query  71   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  250
            M KGPGL+TDIGKKA+DLL +DY +D KFT++TYS  GV +TST  KKG L  GD+ TQ 
Sbjct  1    MSKGPGLFTDIGKKAKDLLTKDYSSDQKFTVSTYSDAGVALTSTAVKKGGLSTGDILTQY  60

Query  251  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  430
            K KN   D KVDT SN+ TT T++E  P  K I+SF+ PD  SGK+E+QY HDHA I+T+
Sbjct  61   KYKNTVVDVKVDTESNISTTFTINEIVPSTKTIASFKAPDFNSGKLEVQYFHDHATITTA  120

Query  431  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  610
            V L  +P ++FS  +GT  +A G +  +DT SG FTKY AG+S T  D  AS+ L DKGD
Sbjct  121  VALNQSPAIDFSATIGTPTIAFGAEGGYDTTSGNFTKYTAGISITKPDQSASIILGDKGD  180

Query  611  SLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTITVGTQHQLDPLTTVKARVNNFGRANAL  790
            S+ ASY H+++ L  +A   E+   FS+N NT TVG Q+ +D  T VKA++NN G+  AL
Sbjct  181  SIRASYVHYMDLLKRSAAVGEITRKFSTNENTFTVGGQYAVDIYTVVKAKLNNHGKLGAL  240

Query  791  IQHEWRPKSLITLSGEVDVKAVDKSAKFGLALALKP  898
            +QHE  PKS++T+SGEVD KA+DK+ +FG+A+ALKP
Sbjct  241  LQHEVIPKSVLTISGEVDTKALDKNPRFGVAIALKP  276



>ref|XP_008777255.1| PREDICTED: mitochondrial outer membrane protein porin 6-like 
isoform X1 [Phoenix dactylifera]
 ref|XP_008777256.1| PREDICTED: mitochondrial outer membrane protein porin 6-like 
isoform X1 [Phoenix dactylifera]
Length=282

 Score =   307 bits (786),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 147/276 (53%), Positives = 195/276 (71%), Gaps = 0/276 (0%)
 Frame = +2

Query  71   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  250
            MG GP  ++DIGK+ARDLL +DY  D K T+TT S  G+ + +TG   G LF+GD++TQ 
Sbjct  1    MGDGPAPFSDIGKRARDLLTKDYNFDQKITLTTLSDNGLGLAATGVNIGQLFIGDISTQY  60

Query  251  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  430
            K+   T D KVDTNSNV +T+TV+E   G+K   SF++PDQ+SGK+++QYLH HA I++ 
Sbjct  61   KSGKATVDVKVDTNSNVSSTVTVNELVAGVKTSFSFKIPDQKSGKLDVQYLHGHAAINSG  120

Query  431  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  610
            +GLT  P++  +  VG+  LALG +V FD+ S +FTKYNAG+ F   D  A+L L DKG+
Sbjct  121  IGLTPTPVLELAAAVGSKELALGAEVGFDSASASFTKYNAGIGFNKHDFSAALILADKGE  180

Query  611  SLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTITVGTQHQLDPLTTVKARVNNFGRANAL  790
            +L ASY H VNP++ TAV AE+ H F+   N+ T+G  H L+PLTTVK R NN G+A+ L
Sbjct  181  TLKASYVHVVNPITGTAVAAEIIHRFNKYENSFTIGGCHSLNPLTTVKTRFNNSGKASIL  240

Query  791  IQHEWRPKSLITLSGEVDVKAVDKSAKFGLALALKP  898
             QHEWRPKS ITLS E D K +   ++ GLALALKP
Sbjct  241  CQHEWRPKSFITLSAEYDPKNISAPSRVGLALALKP  276



>ref|XP_010942794.1| PREDICTED: mitochondrial outer membrane protein porin 5-like 
[Elaeis guineensis]
Length=275

 Score =   306 bits (785),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 147/274 (54%), Positives = 195/274 (71%), Gaps = 0/274 (0%)
 Frame = +2

Query  77   KGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQLKN  256
            KGPGL++DIGKKA+DLL +DY  D K TI+TYS +GV +TS   KKG L+  D+ TQ K 
Sbjct  2    KGPGLFSDIGKKAKDLLNKDYSCDQKLTISTYSASGVGLTSAAVKKGGLYSFDIGTQYKY  61

Query  257  KNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTSVG  436
            KN   D KVDTNSN+ TT+T+ E  P  K I+SF++PD  SGK+E+QY HDHA ++T+V 
Sbjct  62   KNTLIDVKVDTNSNISTTLTLSEILPSTKTIASFKLPDYNSGKLEIQYFHDHASVATAVA  121

Query  437  LTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGDSL  616
            L  +P+V+ SG +G + +A G +  FDT SG FTKY AG+S    D  AS+ L D GD+L
Sbjct  122  LKQSPVVDLSGTIGVDGIAFGAEAGFDTASGTFTKYTAGISLGKPDYSASIILADMGDTL  181

Query  617  SASYYHHVNPLSNTAVGAEVNHSFSSNVNTITVGTQHQLDPLTTVKARVNNFGRANALIQ  796
             ASY  H++ +   AV  EV   FS+N NT TVG Q+ +DP TTVK+++ N G+  AL+Q
Sbjct  182  RASYIFHLDEMQKNAVVGEVTRRFSTNENTFTVGGQYVIDPQTTVKSKLENSGKLAALLQ  241

Query  797  HEWRPKSLITLSGEVDVKAVDKSAKFGLALALKP  898
            HE +PKS++T+SGE D KA+D++ KFGLALALKP
Sbjct  242  HELKPKSILTVSGEFDTKALDRAPKFGLALALKP  275



>ref|XP_002964960.1| hypothetical protein SELMODRAFT_143103 [Selaginella moellendorffii]
 gb|EFJ33798.1| hypothetical protein SELMODRAFT_143103 [Selaginella moellendorffii]
Length=276

 Score =   306 bits (785),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 143/276 (52%), Positives = 197/276 (71%), Gaps = 0/276 (0%)
 Frame = +2

Query  71   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  250
            MGKGPG++ DIGK+ +DLL RD+ +D KFT+T+ + +G+  TS G+KKG+ F G+VNTQ 
Sbjct  1    MGKGPGMFGDIGKRTKDLLTRDFTSDQKFTVTSSTSSGITFTSFGNKKGEQFAGNVNTQF  60

Query  251  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  430
            K  N+T + KVDT SN+   IT DE A G K + +F +PD + GK++ QY+HD  G++TS
Sbjct  61   KTNNMTVNVKVDTESNIHGVITADEIAKGAKTVFTFTIPDNKCGKIKFQYVHDLFGLATS  120

Query  431  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  610
            +GLT++P+ + S  +G + +A+G ++SFDT SG  ++Y+ G+  T  D  A+L   DKGD
Sbjct  121  IGLTSSPVADLSAALGNDVVAVGGELSFDTASGKLSRYSGGIGLTKPDYSAALITADKGD  180

Query  611  SLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTITVGTQHQLDPLTTVKARVNNFGRANAL  790
            +L ASY H VN  + T VGAEV+HS S   NT T+G  + LDPLT VKAR+NN G+  AL
Sbjct  181  TLKASYCHTVNANTKTTVGAEVSHSISKKQNTFTIGALYVLDPLTAVKARLNNHGQVGAL  240

Query  791  IQHEWRPKSLITLSGEVDVKAVDKSAKFGLALALKP  898
            +QHEWRPKS +TL GEVD KA++   K GLA+ALKP
Sbjct  241  LQHEWRPKSTVTLCGEVDTKALNSRPKIGLAVALKP  276



>ref|XP_010652706.1| PREDICTED: mitochondrial outer membrane protein porin 2-like 
[Vitis vinifera]
Length=276

 Score =   306 bits (784),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 152/276 (55%), Positives = 193/276 (70%), Gaps = 0/276 (0%)
 Frame = +2

Query  71   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  250
            M KGPGL+ DIGKKA+DLL RDY +D KFT++TYS TGV ITST  KKG L  GDV  Q 
Sbjct  1    MSKGPGLFADIGKKAKDLLTRDYISDQKFTVSTYSDTGVAITSTAVKKGGLSTGDVAVQY  60

Query  251  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  430
            K KN   D K DT SN+ TT+T  E  P  K I+SF+ PD  SGK+E+QY HDHA ++TS
Sbjct  61   KYKNSVIDVKADTGSNINTTLTFTEIIPSTKTIASFKFPDYNSGKLEVQYFHDHATLTTS  120

Query  431  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  610
            V L  +P V+ S  +GT ++A G +  +DT SG FTKY AG+S    D  AS+ L DKGD
Sbjct  121  VALNQSPAVDLSVTIGTPSIAFGAEAGYDTTSGCFTKYTAGISVAKPDSCASIILGDKGD  180

Query  611  SLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTITVGTQHQLDPLTTVKARVNNFGRANAL  790
            ++ ASY HH++ L  +A   E++  FS+N NT TVG  + +DPLT VKA+++N G   AL
Sbjct  181  TIRASYVHHLDSLKKSAAVGEISRRFSTNDNTFTVGGSYAIDPLTNVKAKLDNHGNLGAL  240

Query  791  IQHEWRPKSLITLSGEVDVKAVDKSAKFGLALALKP  898
            +QHE  PKS++TLSGE D KA+DK+ +FGLALALKP
Sbjct  241  LQHEIIPKSILTLSGEFDTKALDKTPRFGLALALKP  276



>ref|XP_008354718.1| PREDICTED: mitochondrial outer membrane protein porin 2-like 
[Malus domestica]
 ref|XP_009362557.1| PREDICTED: mitochondrial outer membrane protein porin 2-like 
[Pyrus x bretschneideri]
Length=276

 Score =   306 bits (783),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 149/276 (54%), Positives = 197/276 (71%), Gaps = 0/276 (0%)
 Frame = +2

Query  71   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  250
            M KGPGL+TDIGKKA+DLL +DY +D KFT++TYS  GV +TST  KKG L  GD+ TQ 
Sbjct  1    MSKGPGLFTDIGKKAKDLLTKDYSSDQKFTVSTYSDAGVALTSTAVKKGGLSTGDILTQY  60

Query  251  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  430
            K KN   D KVDT SN+ TT T++E  P  K I+SF+ PD  SGK+E+QY HDHA  +T+
Sbjct  61   KYKNTVVDVKVDTESNISTTFTINEIVPSTKTIASFKAPDFNSGKLEVQYFHDHATFTTA  120

Query  431  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  610
            V L+ +P ++FS  +GT  +A G +  +DT SG FTKY AG+S T  D  AS+ L DKGD
Sbjct  121  VALSQSPAIDFSATIGTPTIAFGAEGGYDTTSGNFTKYTAGISITKPDQSASIILGDKGD  180

Query  611  SLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTITVGTQHQLDPLTTVKARVNNFGRANAL  790
            S+ ASY H+++ L  +A   E+   FS+N NT TVG Q+ +D  T VKA++NN G+  AL
Sbjct  181  SIRASYVHYMDLLKRSAAVGEITRKFSTNENTFTVGGQYAVDIYTIVKAKLNNHGKLGAL  240

Query  791  IQHEWRPKSLITLSGEVDVKAVDKSAKFGLALALKP  898
            +QHE  PKS++T+SGEVD KA+DK+ +FG+A+ALKP
Sbjct  241  LQHEVIPKSVLTISGEVDTKALDKNPRFGVAIALKP  276



>ref|NP_001044063.2| Os01g0715500 [Oryza sativa Japonica Group]
 dbj|BAF05977.2| Os01g0715500 [Oryza sativa Japonica Group]
Length=318

 Score =   307 bits (787),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 159/280 (57%), Positives = 197/280 (70%), Gaps = 18/280 (6%)
 Frame = +2

Query  89   LYTDIGKKAR---------DLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVN  241
            LY +IGKKAR         DLLY+D+ TD KFT+TTY+  GVVIT+  + K +    ++ 
Sbjct  47   LYFEIGKKARGVHALFILFDLLYKDFHTDQKFTLTTYTNNGVVITAASTMKDEAIFSEIQ  106

Query  242  TQLKNKNITTDFKVDTNSNVFTTITVDE-AAPGLKIISSFRVPDQRSGKVELQYLHDHAG  418
            T+LK+ N+  D        V TTIT ++    GLK I S   P Q +GK ELQYLHD+AG
Sbjct  107  TKLKSNNVMLD--------VLTTITTEDLGVSGLKQIVSLPFPYQTAGKAELQYLHDYAG  158

Query  419  ISTSVGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLN  598
            IS  VGLT+ P+VN SGV G  ++A+G DV+ DT +G FTKY+AGL+  NSDL A LTLN
Sbjct  159  ISLGVGLTSKPLVNLSGVFGNKSVAVGADVAVDTSTGDFTKYDAGLTINNSDLAADLTLN  218

Query  599  DKGDSLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTITVGTQHQLDPLTTVKARVNNFGR  778
            +KGDSL+ASYYH VN  S TA GAE+ HSFS+  NT++ G QH LDPLTTVKAR NN G 
Sbjct  219  NKGDSLTASYYHLVNKESGTAAGAELTHSFSTKENTLSFGMQHALDPLTTVKARYNNHGM  278

Query  779  ANALIQHEWRPKSLITLSGEVDVKAVDKSAKFGLALALKP  898
             +ALIQHEWRPKS +TLS EVD KA+DK++K GL+L LKP
Sbjct  279  VSALIQHEWRPKSFLTLSAEVDTKAIDKASKVGLSLVLKP  318



>ref|XP_007205702.1| hypothetical protein PRUPE_ppa009821mg [Prunus persica]
 gb|EMJ06901.1| hypothetical protein PRUPE_ppa009821mg [Prunus persica]
Length=276

 Score =   305 bits (781),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 148/276 (54%), Positives = 195/276 (71%), Gaps = 0/276 (0%)
 Frame = +2

Query  71   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  250
            M KGPGL++DIGKKA+DLL +DY +D KFT++TYS  GV +TST  KKG L  GD+ TQ 
Sbjct  1    MSKGPGLFSDIGKKAKDLLTKDYNSDQKFTVSTYSDAGVALTSTAVKKGGLSTGDIVTQY  60

Query  251  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  430
            K KN   D KVDT SN+ TT T++E  P  K I+SF++PD  SGK+E+QY HDHA  +T+
Sbjct  61   KYKNTVVDVKVDTESNISTTFTINEIVPSTKTIASFKIPDHNSGKLEVQYFHDHATFTTA  120

Query  431  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  610
            V L  +P ++FS  +GT  +A G +  +DT SG FTKY AG+S    D  AS+ L DKGD
Sbjct  121  VALNQSPAIDFSATIGTPTIAFGAEGGYDTTSGNFTKYTAGISVNKPDQSASIILGDKGD  180

Query  611  SLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTITVGTQHQLDPLTTVKARVNNFGRANAL  790
            S+ ASY H ++ L  TA   E+   FS+N NT TVG  + +D LT VKA++NN G+  AL
Sbjct  181  SIRASYVHFLDVLKRTATVGEITRKFSTNENTFTVGGSYAIDLLTVVKAKLNNHGKLGAL  240

Query  791  IQHEWRPKSLITLSGEVDVKAVDKSAKFGLALALKP  898
            +QHE  PKSL+T+SGE+D KA+DK+ +FG+A+ALKP
Sbjct  241  LQHEVIPKSLVTISGEIDTKALDKNPRFGVAIALKP  276



>ref|XP_007047520.1| Voltage dependent anion channel 2 [Theobroma cacao]
 gb|EOX91677.1| Voltage dependent anion channel 2 [Theobroma cacao]
Length=276

 Score =   305 bits (780),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 149/276 (54%), Positives = 196/276 (71%), Gaps = 0/276 (0%)
 Frame = +2

Query  71   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  250
            M KGPGL++DIGKKA+DLL +DY +DHKFT++TY+  GV +TST  KKG L +GDV    
Sbjct  1    MSKGPGLFSDIGKKAKDLLNKDYSSDHKFTVSTYTGAGVALTSTALKKGGLSIGDVAALY  60

Query  251  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  430
            K KN   D KVDT+SN+  T+T  E  P  K I+SF+VPD  SGK+E+QY HDHA  +T+
Sbjct  61   KYKNTLFDVKVDTDSNISATLTFTEILPSTKTIASFKVPDYNSGKLEVQYFHDHATFTTA  120

Query  431  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  610
            +GL   P V+ +  +GT A+A G +  +DT SG FT+Y AG+S T  D  AS+ L DKGD
Sbjct  121  IGLNQTPGVDVTATIGTPAIAFGAEAGYDTTSGNFTRYTAGISVTKPDAYASIILGDKGD  180

Query  611  SLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTITVGTQHQLDPLTTVKARVNNFGRANAL  790
            S+ ASY H+++ L   A   E++  FS+N NT TVG  + +D LT +KA++NN GR  AL
Sbjct  181  SIKASYVHYLDQLKKCAAVGEISRRFSTNENTFTVGGAYAVDHLTLIKAKLNNHGRLGAL  240

Query  791  IQHEWRPKSLITLSGEVDVKAVDKSAKFGLALALKP  898
            +QHE  PKSL+T+SGE+D KA+DKS +FGLALALKP
Sbjct  241  LQHEVIPKSLLTISGEIDTKALDKSPRFGLALALKP  276



>ref|XP_004288248.1| PREDICTED: mitochondrial outer membrane protein porin 2-like 
[Fragaria vesca subsp. vesca]
Length=276

 Score =   303 bits (777),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 146/276 (53%), Positives = 193/276 (70%), Gaps = 0/276 (0%)
 Frame = +2

Query  71   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  250
            M KGPGL+ DIGKKA+DLL +DY +D KF+++TYS  GV +TST  K+G L  GD+  Q 
Sbjct  1    MSKGPGLFADIGKKAKDLLTKDYNSDQKFSVSTYSEAGVALTSTAVKRGGLSAGDIGAQY  60

Query  251  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPDQRSGKVELQYLHDHAGISTS  430
            K KN   D KVDT+SN+ TT T+ +  P  K I+SF+VPD   GK+E+QY HDHA  +T+
Sbjct  61   KYKNALVDVKVDTDSNISTTFTITDIIPSTKTIASFKVPDYNGGKLEVQYFHDHASFTTA  120

Query  431  VGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGD  610
            V L   P ++FS  +GT  +A G +  +DT SG FTKY AG S T    +AS+ L DKGD
Sbjct  121  VALNQCPAIDFSATIGTPTIAFGAEAGYDTTSGNFTKYTAGFSVTQPVSVASIILGDKGD  180

Query  611  SLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTITVGTQHQLDPLTTVKARVNNFGRANAL  790
            S+ ASY H+V+ L  +A   E+   FS+N NT TVG Q+ +DPLT VKA++NN G+  AL
Sbjct  181  SVKASYVHYVDLLKRSAGVMEITRKFSTNENTFTVGGQYAIDPLTVVKAKLNNHGKLGAL  240

Query  791  IQHEWRPKSLITLSGEVDVKAVDKSAKFGLALALKP  898
            +QHE  PKS++T+SGE+D K++DK  KFGLA+ALKP
Sbjct  241  LQHEVIPKSMLTVSGEIDTKSLDKHPKFGLAIALKP  276



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3219410483011