BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig13310

Length=1220
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_011074054.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    696   0.0      Sesamum indicum [beniseed]
ref|XP_007018640.1|  Pyrophosphate--fructose 6-phosphate 1-phosph...    688   0.0      
ref|XP_002510738.1|  phosphofructokinase, putative                      687   0.0      Ricinus communis
ref|XP_004238468.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    684   0.0      Solanum lycopersicum
sp|Q41140.1|PFPA_RICCO  RecName: Full=Pyrophosphate--fructose 6-p...    684   0.0      Ricinus communis
gb|EYU41211.1|  hypothetical protein MIMGU_mgv1a003012mg                683   0.0      Erythranthe guttata [common monkey flower]
ref|XP_006435470.1|  hypothetical protein CICLE_v10000595mg             678   0.0      
ref|XP_012073552.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    682   0.0      Jatropha curcas
ref|XP_009608062.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    681   0.0      Nicotiana tomentosiformis
gb|AAC67587.1|  pyrophosphate-dependent phosphofructokinase alpha...    681   0.0      Citrus x paradisi [grapefruit]
gb|EYU36601.1|  hypothetical protein MIMGU_mgv1a003013mg                681   0.0      Erythranthe guttata [common monkey flower]
gb|AIE47261.1|  pyrophosphate-dependent phosphofructokinase             680   0.0      Hevea brasiliensis [jebe]
ref|XP_006435472.1|  hypothetical protein CICLE_v10000595mg             680   0.0      Citrus clementina [clementine]
ref|XP_011099944.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    680   0.0      Sesamum indicum [beniseed]
ref|XP_009777872.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    679   0.0      Nicotiana sylvestris
ref|XP_009759651.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    679   0.0      Nicotiana sylvestris
ref|XP_004253113.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    678   0.0      Solanum lycopersicum
gb|KCW70371.1|  hypothetical protein EUGRSUZ_F03611                     673   0.0      Eucalyptus grandis [rose gum]
gb|AHZ08764.1|  pyrophosphate--fructose 6-phosphate 1-phosphotran...    676   0.0      Nicotiana tabacum [American tobacco]
ref|XP_009607500.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    676   0.0      Nicotiana tomentosiformis
gb|KHG12069.1|  Pyrophosphate--fructose 6-phosphate 1-phosphotran...    676   0.0      Gossypium arboreum [tree cotton]
ref|XP_010063177.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    674   0.0      Eucalyptus grandis [rose gum]
ref|XP_010094500.1|  Pyrophosphate--fructose 6-phosphate 1-phosph...    674   0.0      
ref|XP_008453023.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    673   0.0      Cucumis melo [Oriental melon]
sp|P21342.2|PFPA_SOLTU  RecName: Full=Pyrophosphate--fructose 6-p...    672   0.0      Solanum tuberosum [potatoes]
ref|XP_006342524.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    672   0.0      Solanum tuberosum [potatoes]
gb|KJB29713.1|  hypothetical protein B456_005G115600                    672   0.0      Gossypium raimondii
gb|KJB29715.1|  hypothetical protein B456_005G115600                    670   0.0      Gossypium raimondii
gb|KJB29716.1|  hypothetical protein B456_005G115600                    670   0.0      Gossypium raimondii
ref|XP_002276269.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    671   0.0      Vitis vinifera
ref|XP_011034779.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    671   0.0      Populus euphratica
ref|XP_008796200.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    671   0.0      Phoenix dactylifera
gb|ABK93964.1|  unknown                                                 670   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_002307823.1|  pyrophosphate-dependent phosphofructokinase ...    670   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_003529192.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    670   0.0      Glycine max [soybeans]
ref|XP_010927304.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    670   0.0      Elaeis guineensis
gb|KCW68157.1|  hypothetical protein EUGRSUZ_F018231                    665   0.0      Eucalyptus grandis [rose gum]
ref|NP_001275358.1|  pyrophosphate--fructose 6-phosphate 1-phosph...    669   0.0      Solanum tuberosum [potatoes]
ref|XP_004498195.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    667   0.0      Cicer arietinum [garbanzo]
gb|KJB29714.1|  hypothetical protein B456_005G115600                    667   0.0      Gossypium raimondii
ref|XP_006386123.1|  hypothetical protein POPTR_0002s00490g             667   0.0      
ref|XP_011041141.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    667   0.0      Populus euphratica
ref|XP_002300615.1|  pyrophosphate-dependent phosphofructokinase ...    667   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_011654290.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    666   0.0      Cucumis sativus [cucumbers]
ref|XP_010266302.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    665   0.0      Nelumbo nucifera [Indian lotus]
ref|XP_003555655.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    666   0.0      Glycine max [soybeans]
ref|XP_010061240.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    666   0.0      Eucalyptus grandis [rose gum]
gb|KCW68155.1|  hypothetical protein EUGRSUZ_F018231                    664   0.0      Eucalyptus grandis [rose gum]
ref|XP_010266301.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    665   0.0      Nelumbo nucifera [Indian lotus]
ref|XP_007153134.1|  hypothetical protein PHAVU_003G009600g             664   0.0      Phaseolus vulgaris [French bean]
ref|XP_010539758.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    663   0.0      Tarenaya hassleriana [spider flower]
gb|ADZ96380.2|  pyrophosphate--fructose 6-phosphate 1-phosphotran...    663   0.0      Eriobotrya japonica [loquat]
ref|XP_008373335.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    661   0.0      
ref|XP_008346428.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    661   0.0      
ref|XP_010684564.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    659   0.0      Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010537247.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    659   0.0      Tarenaya hassleriana [spider flower]
ref|XP_009372651.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    657   0.0      Pyrus x bretschneideri [bai li]
ref|XP_010913868.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    657   0.0      Elaeis guineensis
ref|XP_010527650.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    657   0.0      Tarenaya hassleriana [spider flower]
ref|XP_007210294.1|  hypothetical protein PRUPE_ppa002571mg             658   0.0      
ref|XP_008237897.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    658   0.0      
ref|XP_009410339.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    655   0.0      Musa acuminata subsp. malaccensis [pisang utan]
gb|EPS71673.1|  hypothetical protein M569_03082                         652   0.0      Genlisea aurea
ref|XP_010270592.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    652   0.0      Nelumbo nucifera [Indian lotus]
emb|CBI40779.3|  unnamed protein product                                653   0.0      Vitis vinifera
ref|XP_002889091.1|  hypothetical protein ARALYDRAFT_476813             651   0.0      
gb|KCW68156.1|  hypothetical protein EUGRSUZ_F018231                    650   0.0      Eucalyptus grandis [rose gum]
ref|XP_008775478.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    650   0.0      Phoenix dactylifera
ref|XP_009149574.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    650   0.0      Brassica rapa
ref|XP_010416575.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    649   0.0      Camelina sativa [gold-of-pleasure]
ref|XP_006302013.1|  hypothetical protein CARUB_v10019988mg             649   0.0      Capsella rubella
ref|XP_009106323.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    647   0.0      Brassica rapa
ref|XP_006390180.1|  hypothetical protein EUTSA_v10018291mg             647   0.0      Eutrema salsugineum [saltwater cress]
emb|CDX87587.1|  BnaA07g32860D                                          646   0.0      
gb|KFK35354.1|  hypothetical protein AALP_AA5G273800                    646   0.0      Arabis alpina [alpine rockcress]
ref|XP_010471809.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    646   0.0      Camelina sativa [gold-of-pleasure]
emb|CDX88295.1|  BnaC06g37390D                                          645   0.0      
ref|XP_008802157.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    645   0.0      Phoenix dactylifera
emb|CDY67022.1|  BnaC05g50320D                                          645   0.0      Brassica napus [oilseed rape]
ref|XP_006416345.1|  hypothetical protein EUTSA_v10007087mg             645   0.0      Eutrema salsugineum [saltwater cress]
ref|XP_010428720.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    644   0.0      Camelina sativa [gold-of-pleasure]
ref|XP_010932134.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    644   0.0      Elaeis guineensis
ref|XP_009391869.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    644   0.0      Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010477351.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    639   0.0      Camelina sativa [gold-of-pleasure]
ref|XP_004300090.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    642   0.0      Fragaria vesca subsp. vesca
ref|XP_010498548.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    640   0.0      Camelina sativa [gold-of-pleasure]
gb|KFK42073.1|  hypothetical protein AALP_AA2G207700                    640   0.0      Arabis alpina [alpine rockcress]
ref|NP_177781.1|  pyrophosphate--fructose-6-phosphate 1-phosphotr...    640   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|NP_173519.1|  pyrophosphate--fructose 6-phosphate 1-phosphotr...    639   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_004498196.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    639   0.0      
ref|XP_006306984.1|  hypothetical protein CARUB_v10008559mg             640   0.0      
dbj|BAF01310.1|  putative pyrophosphate-dependent phosphofructoki...    637   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_002893141.1|  hypothetical protein ARALYDRAFT_472333             636   0.0      
ref|XP_010459789.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    635   0.0      Camelina sativa [gold-of-pleasure]
ref|XP_009414937.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    635   0.0      Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006849934.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    634   0.0      Amborella trichopoda
ref|XP_006435471.1|  hypothetical protein CICLE_v10000595mg             630   0.0      
ref|XP_006435473.1|  hypothetical protein CICLE_v10000595mg             631   0.0      
ref|XP_003570229.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    629   0.0      Brachypodium distachyon [annual false brome]
gb|EMS68198.1|  Pyrophosphate--fructose 6-phosphate 1-phosphotran...    627   0.0      Triticum urartu
dbj|BAJ92904.1|  predicted protein                                      627   0.0      Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009417287.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    626   0.0      Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010235882.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    624   0.0      
ref|NP_001047918.1|  Os02g0714200                                       623   0.0      
ref|XP_006659170.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    620   0.0      Oryza brachyantha
ref|XP_006648988.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    619   0.0      Oryza brachyantha
ref|XP_002452651.1|  hypothetical protein SORBIDRAFT_04g030000          617   0.0      Sorghum bicolor [broomcorn]
ref|XP_004953678.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    617   0.0      Setaria italica
ref|NP_001057528.1|  Os06g0326400                                       617   0.0      
gb|EEC80509.1|  hypothetical protein OsI_22776                          617   0.0      Oryza sativa Indica Group [Indian rice]
gb|ACN26363.1|  unknown                                                 614   0.0      Zea mays [maize]
gb|AFW73096.1|  pyrophosphate--fructose 6-phosphate 1-phosphotran...    614   0.0      
dbj|BAD33246.1|  putative Pyrophosphate--fructose 6-phosphate 1-p...    613   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|NP_001146841.1|  LOC100280449                                       612   0.0      Zea mays [maize]
ref|XP_003589697.1|  Pyrophosphate-fructose 6-phosphate 1-phospho...    612   0.0      
gb|AES59948.2|  pyrophosphate-fructose-6-phosphate 1-phosphotrans...    610   0.0      Medicago truncatula
ref|NP_001131947.1|  uncharacterized protein LOC100193340               610   0.0      Zea mays [maize]
gb|KDO85265.1|  hypothetical protein CISIN_1g006964mg                   607   0.0      Citrus sinensis [apfelsine]
ref|XP_004965353.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    606   0.0      Setaria italica
dbj|BAK04583.1|  predicted protein                                      601   0.0      Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AEZ53899.1|  pyrophosphate-dependent fructose-6-phosphate 1-ph...    593   0.0      Zea mays [maize]
ref|XP_008659507.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    592   0.0      
ref|XP_003563894.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    590   0.0      
emb|CDY33660.1|  BnaC08g19600D                                          581   0.0      Brassica napus [oilseed rape]
emb|CDX96611.1|  BnaA08g21540D                                          577   0.0      
ref|XP_009385723.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    556   0.0      Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011621223.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    554   0.0      
ref|XP_004956505.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    539   0.0      Setaria italica
tpg|DAA49241.1|  TPA: hypothetical protein ZEAMMB73_624432              526   0.0      
gb|ACL53065.1|  unknown                                                 526   2e-179   Zea mays [maize]
ref|NP_001061602.1|  Os08g0345700                                       525   4e-179   
ref|NP_001130747.1|  uncharacterized protein LOC100191851               525   4e-179   Zea mays [maize]
ref|XP_006660512.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    525   1e-178   Oryza brachyantha
gb|EEC84297.1|  hypothetical protein OsI_30782                          523   2e-178   Oryza sativa Indica Group [Indian rice]
gb|EEE69397.1|  hypothetical protein OsJ_28754                          522   2e-178   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004973257.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    523   5e-178   Setaria italica
ref|XP_003573791.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    522   9e-178   Brachypodium distachyon [annual false brome]
dbj|BAD33224.1|  putative pyrophosphate-dependent phosphofructoki...    521   1e-177   Oryza sativa Japonica Group [Japonica rice]
dbj|BAJ94879.1|  predicted protein                                      522   1e-177   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|ERN00267.1|  hypothetical protein AMTR_s00111p00148440               516   9e-176   Amborella trichopoda
gb|AGN30570.1|  pyrophosphate-fructose-6-phosphate-phosphotransfe...    516   3e-175   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002459996.1|  hypothetical protein SORBIDRAFT_02g020400          513   6e-174   Sorghum bicolor [broomcorn]
gb|AFW86518.1|  hypothetical protein ZEAMMB73_272382                    484   3e-167   
dbj|BAJ85819.1|  predicted protein                                      494   4e-167   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008652527.1|  PREDICTED: LOW QUALITY PROTEIN: pyrophosphat...    491   2e-165   Zea mays [maize]
ref|XP_010935015.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    483   2e-163   Elaeis guineensis
ref|XP_010935016.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    481   3e-163   
ref|XP_010275338.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    479   8e-162   Nelumbo nucifera [Indian lotus]
ref|XP_002978426.1|  hypothetical protein SELMODRAFT_108705             481   9e-162   
ref|XP_001773752.1|  predicted protein                                  481   1e-161   
ref|XP_002970269.1|  hypothetical protein SELMODRAFT_171380             481   1e-161   
ref|XP_006660071.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    480   4e-161   
ref|XP_002444175.1|  hypothetical protein SORBIDRAFT_07g012720          456   1e-152   
gb|AGY61461.1|  pyrophosphate-fructose-6-phosphate-phosphotransfe...    441   3e-151   Rorippa amphibia
ref|XP_001755711.1|  predicted protein                                  449   3e-149   
gb|AAO72618.1|  fructose-6-phosphate 1-phosphotransferase               434   1e-145   Oryza sativa Japonica Group [Japonica rice]
ref|XP_011041142.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    429   4e-143   Populus euphratica
gb|EMT11806.1|  Pyrophosphate--fructose 6-phosphate 1-phosphotran...    429   2e-142   
gb|EMS49340.1|  Pyrophosphate--fructose 6-phosphate 1-phosphotran...    410   5e-132   Triticum urartu
ref|XP_008788667.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    387   8e-129   
gb|ABC69165.1|  phosphofructokinase V11                                 382   4e-128   Gossypium hirsutum [American cotton]
ref|XP_004956506.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    383   6e-125   
tpg|DAA60935.1|  TPA: hypothetical protein ZEAMMB73_638083              383   7e-125   
gb|ABR16683.1|  unknown                                                 369   5e-119   Picea sitchensis
gb|AFK40094.1|  unknown                                                 353   5e-117   Lotus japonicus
ref|XP_008788668.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    327   1e-105   
emb|CBK21183.2|  unnamed protein product                                315   2e-97    Blastocystis hominis
gb|AGY61464.1|  pyrophosphate-fructose-6-phosphate-phosphotransfe...    291   1e-93    Rorippa sylvestris
gb|AGY61463.1|  pyrophosphate-fructose-6-phosphate-phosphotransfe...    291   2e-93    Rorippa amphibia
gb|EMS55626.1|  Pyrophosphate--fructose 6-phosphate 1-phosphotran...    297   2e-92    Triticum urartu
emb|CBK25474.2|  unnamed protein product                                290   8e-89    Blastocystis hominis
ref|WP_044979330.1|  diphosphate--fructose-6-phosphate 1-phosphot...    286   5e-87    Treponema putidum
ref|XP_002984967.1|  hypothetical protein SELMODRAFT_234662             286   8e-87    Selaginella moellendorffii
ref|WP_010697336.1|  diphosphate-fructose-6-phosphate 1-phosphotr...    286   9e-87    Treponema denticola
ref|WP_002693855.1|  diphosphate-fructose-6-phosphate 1-phosphotr...    285   1e-86    Treponema denticola
ref|WP_010956991.1|  diphosphate--fructose-6-phosphate 1-phosphot...    285   2e-86    Treponema denticola
ref|WP_002669081.1|  diphosphate--fructose-6-phosphate 1-phosphot...    285   2e-86    Treponema denticola
ref|WP_010699412.1|  diphosphate-fructose-6-phosphate 1-phosphotr...    285   2e-86    Treponema denticola
ref|WP_002682935.1|  diphosphate-fructose-6-phosphate 1-phosphotr...    285   2e-86    Treponema denticola
ref|WP_002678239.1|  diphosphate-fructose-6-phosphate 1-phosphotr...    285   2e-86    Treponema denticola
ref|WP_002689303.1|  diphosphate-fructose-6-phosphate 1-phosphotr...    285   2e-86    Treponema denticola
ref|XP_002986153.1|  hypothetical protein SELMODRAFT_234963             284   4e-86    Selaginella moellendorffii
ref|XP_004340159.1|  diphosphate-fructose-6-phosphate 1-phosphotr...    282   4e-85    Acanthamoeba castellanii str. Neff
ref|XP_008788669.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    271   3e-84    
ref|XP_001770321.1|  predicted protein                                  280   3e-84    
gb|EFB41793.1|  hypothetical protein pah_c022o077                       279   5e-84    Parachlamydia acanthamoebae str. Hall's coccus
ref|WP_013924907.1|  diphosphate--fructose-6-phosphate 1-phosphot...    278   1e-83    Parachlamydia acanthamoebae
ref|WP_006255527.1|  diphosphate--fructose-6-phosphate 1-phosphot...    277   2e-83    Alloprevotella tannerae
ref|WP_037547210.1|  diphosphate--fructose-6-phosphate 1-phosphot...    276   3e-83    Spirochaeta lutea
ref|WP_032125634.1|  diphosphate--fructose-6-phosphate 1-phosphot...    276   3e-83    Candidatus Protochlamydia massiliensis
ref|WP_013968126.1|  diphosphate--fructose-6-phosphate 1-phosphot...    276   6e-83    Treponema caldarium
ref|XP_003594152.1|  Pyrophosphate-fructose 6-phosphate 1-phospho...    276   9e-83    Medicago truncatula
ref|WP_014455241.1|  diphosphate--fructose-6-phosphate 1-phosphot...    275   1e-82    Spirochaeta africana
emb|CDP11324.1|  unnamed protein product                                273   7e-82    Coffea canephora [robusta coffee]
ref|WP_013314522.1|  Pyrophosphate--fructose 6-phosphate 1-phosph...    273   7e-82    Spirochaeta thermophila
ref|WP_037983302.1|  diphosphate--fructose-6-phosphate 1-phosphot...    273   8e-82    
ref|WP_037997392.1|  diphosphate--fructose-6-phosphate 1-phosphot...    273   8e-82    
ref|WP_006189908.1|  diphosphate--fructose-6-phosphate 1-phosphot...    273   9e-82    Treponema vincentii
ref|XP_007147679.1|  hypothetical protein PHAVU_006G145300g             273   9e-82    Phaseolus vulgaris [French bean]
ref|WP_025798196.1|  diphosphate--fructose-6-phosphate 1-phosphot...    272   9e-82    Prevotella saccharolytica
ref|XP_004955203.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    273   1e-81    Setaria italica
ref|WP_009161991.1|  diphosphate--fructose-6-phosphate 1-phosphot...    272   1e-81    Prevotella saccharolytica
ref|XP_007153992.1|  hypothetical protein PHAVU_003G082000g             273   1e-81    Phaseolus vulgaris [French bean]
ref|WP_024268710.1|  Pyrophosphate--fructose 6-phosphate 1-phosph...    272   1e-81    Salinispira pacifica
ref|WP_013758252.1|  diphosphate--fructose-6-phosphate 1-phosphot...    272   1e-81    Treponema brennaborense
ref|XP_001773466.1|  predicted protein                                  272   2e-81    
emb|CBK24494.2|  unnamed protein product                                271   3e-81    Blastocystis hominis
ref|WP_019188428.1|  diphosphate--fructose-6-phosphate 1-phosphot...    271   3e-81    Prevotella conceptionensis
ref|XP_003534704.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    271   3e-81    Glycine max [soybeans]
ref|WP_036897542.1|  diphosphate--fructose-6-phosphate 1-phosphot...    271   4e-81    Prevotella sp. S7 MS 2
ref|WP_014342471.1|  Pyrophosphate--fructose 6-phosphate 1-phosph...    271   4e-81    Treponema pallidum
ref|WP_010881989.1|  Pyrophosphate--fructose 6-phosphate 1-phosph...    271   4e-81    Treponema pallidum
ref|NP_001168412.1|  ppi-phosphofructokinase                            271   4e-81    Zea mays [maize]
ref|WP_016518245.1|  diphosphate-fructose-6-phosphate 1-phosphotr...    271   5e-81    Treponema vincentii
ref|XP_003564006.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    271   6e-81    Brachypodium distachyon [annual false brome]
ref|XP_003547272.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    271   6e-81    Glycine max [soybeans]
ref|WP_014625405.1|  diphosphate--fructose-6-phosphate 1-phosphot...    270   6e-81    Spirochaeta thermophila
ref|XP_004305986.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    270   7e-81    Fragaria vesca subsp. vesca
ref|WP_013945180.1|  diphosphate--fructose-6-phosphate 1-phosphot...    271   7e-81    Treponema paraluiscuniculi
ref|WP_009235627.1|  diphosphate--fructose-6-phosphate 1-phosphot...    270   8e-81    Prevotella sp. oral taxon 472
ref|XP_002438147.1|  hypothetical protein SORBIDRAFT_10g008850          270   8e-81    Sorghum bicolor [broomcorn]
ref|WP_009229809.1|  diphosphate--fructose-6-phosphate 1-phosphot...    270   9e-81    Prevotella sp. oral taxon 317
dbj|BAJ85690.1|  predicted protein                                      270   9e-81    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|WP_041620527.1|  diphosphate--fructose-6-phosphate 1-phosphot...    270   1e-80    Paludibacter propionicigenes
ref|WP_018966518.1|  diphosphate--fructose-6-phosphate 1-phosphot...    270   1e-80    Prevotella loescheii
ref|WP_025863645.1|  diphosphate--fructose-6-phosphate 1-phosphot...    270   1e-80    Prolixibacter bellariivorans
gb|ADQ78315.1|  pyrophosphate-dependent phosphofructokinase             270   1e-80    Paludibacter propionicigenes WB4
ref|WP_025278280.1|  diphosphate--fructose-6-phosphate 1-phosphot...    270   1e-80    Barnesiella viscericola
ref|NP_001148574.1|  LOC100282190                                       270   1e-80    Zea mays [maize]
gb|KJB67275.1|  hypothetical protein B456_010G184300                    268   1e-80    Gossypium raimondii
ref|XP_002269934.2|  PREDICTED: pyrophosphate--fructose 6-phospha...    270   1e-80    Vitis vinifera
ref|XP_003529650.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    270   2e-80    Glycine max [soybeans]
ref|WP_025267586.1|  Pyrophosphate--fructose 6-phosphate 1-phosph...    270   2e-80    Treponema pallidum
ref|WP_044045408.1|  diphosphate--fructose-6-phosphate 1-phosphot...    269   2e-80    Candidatus Protochlamydia amoebophila
ref|NP_001057284.1|  Os06g0247500                                       269   2e-80    
ref|WP_016524203.1|  diphosphate-fructose-6-phosphate 1-phosphotr...    269   2e-80    Treponema medium
emb|CAF23604.1|  putative 6-phosphofructokinase 1                       269   3e-80    
ref|XP_006396720.1|  hypothetical protein EUTSA_v10028543mg             266   3e-80    
ref|WP_015711192.1|  diphosphate--fructose-6-phosphate 1-phosphot...    268   3e-80    Treponema azotonutricium
ref|WP_025002795.1|  diphosphate--fructose-6-phosphate 1-phosphot...    268   3e-80    Prevotella dentasini
ref|WP_015708501.1|  diphosphate--fructose-6-phosphate 1-phosphot...    268   3e-80    Treponema primitia
ref|WP_022406493.1|  diphosphate-fructose-6-phosphate 1-phosphotr...    268   3e-80    
dbj|BAK07581.1|  predicted protein                                      269   4e-80    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|WP_008861193.1|  diphosphate--fructose-6-phosphate 1-phosphot...    268   4e-80    Barnesiella intestinihominis
ref|WP_042282134.1|  diphosphate--fructose-6-phosphate 1-phosphot...    268   4e-80    Candidatus Protochlamydia sp. R18
ref|WP_021892263.1|  diphosphate-fructose-6-phosphate 1-phosphotr...    268   4e-80    Bacteroides sp. AF14-46
ref|XP_006656840.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    268   5e-80    Oryza brachyantha
gb|KJB67269.1|  hypothetical protein B456_010G184300                    268   7e-80    Gossypium raimondii
gb|KJB42857.1|  hypothetical protein B456_007G170900                    268   9e-80    Gossypium raimondii
ref|XP_010035533.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    268   9e-80    Eucalyptus grandis [rose gum]
gb|KJB67273.1|  hypothetical protein B456_010G184300                    268   9e-80    Gossypium raimondii
ref|WP_021687206.1|  diphosphate--fructose-6-phosphate 1-phosphot...    267   1e-79    Treponema lecithinolyticum
ref|XP_004965128.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    267   1e-79    Setaria italica
ref|WP_010261490.1|  diphosphate--fructose-6-phosphate 1-phosphot...    267   1e-79    Treponema primitia
ref|WP_041419260.1|  diphosphate--fructose-6-phosphate 1-phosphot...    266   2e-79    
ref|XP_007049157.1|  Phosphofructokinase family protein                 267   2e-79    
ref|XP_006447633.1|  hypothetical protein CICLE_v10014750mg             267   2e-79    Citrus clementina [clementine]
ref|XP_004486196.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    267   2e-79    Cicer arietinum [garbanzo]
ref|XP_006396719.1|  hypothetical protein EUTSA_v10028543mg             267   2e-79    Eutrema salsugineum [saltwater cress]
ref|XP_005850148.1|  hypothetical protein CHLNCDRAFT_34452              267   2e-79    Chlorella variabilis
gb|AIE47260.1|  pyrophosphate-dependent phosphofructokinase             266   3e-79    Hevea brasiliensis [jebe]
gb|EMT25675.1|  Pyrophosphate--fructose 6-phosphate 1-phosphotran...    266   3e-79    
ref|WP_022385737.1|  diphosphate--fructose-6-phosphate 1-phosphot...    266   3e-79    
emb|CCB88843.1|  pyrophosphate--fructose 6-phosphate 1-phosphotra...    265   4e-79    Simkania negevensis Z
gb|ABL10095.1|  pyrophosphate-fructose-6-phosphate1-phosphotransf...    258   4e-79    Saccharum spontaneum [fodder cane]
gb|KDO54283.1|  hypothetical protein CISIN_1g042388mg                   266   4e-79    Citrus sinensis [apfelsine]
ref|WP_027470899.1|  diphosphate--fructose-6-phosphate 1-phosphot...    265   4e-79    Saccharicrinis fermentans
gb|KFK43462.1|  hypothetical protein AALP_AA1G128500                    266   5e-79    Arabis alpina [alpine rockcress]
ref|WP_014709913.1|  diphosphate--fructose-6-phosphate 1-phosphot...    265   5e-79    Prevotella intermedia
ref|XP_005707151.1|  pyrophosphate--fructose-6-phosphate 1-phosph...    266   5e-79    Galdieria sulphuraria
ref|WP_028904978.1|  diphosphate--fructose-6-phosphate 1-phosphot...    265   5e-79    Prevotella intermedia
ref|WP_045168043.1|  diphosphate--fructose-6-phosphate 1-phosphot...    265   6e-79    Prevotella intermedia
ref|WP_036877364.1|  diphosphate--fructose-6-phosphate 1-phosphot...    265   7e-79    Prevotella oryzae
ref|WP_039358021.1|  diphosphate--fructose-6-phosphate 1-phosphot...    265   8e-79    Candidatus Protochlamydia amoebophila
gb|KIC72145.1|  Pyrophosphate--fructose 6-phosphate 1-phosphotran...    265   9e-79    Candidatus Protochlamydia amoebophila
emb|CDZ81362.1|  6-phosphofructokinase                                  265   9e-79    Candidatus Rubidus massiliensis
ref|XP_012091282.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    265   1e-78    Jatropha curcas
ref|WP_014545075.1|  diphosphate--fructose-6-phosphate 1-phosphot...    265   1e-78    Fibrobacter
ref|WP_024467519.1|  diphosphate--fructose-6-phosphate 1-phosphot...    265   1e-78    Treponema pedis
ref|WP_042244225.1|  diphosphate--fructose-6-phosphate 1-phosphot...    264   1e-78    
ref|XP_008230005.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    266   1e-78    
ref|XP_002317160.2|  pyrophosphate--fructose-6-phosphate 1-phosph...    265   1e-78    
ref|XP_009408423.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    265   1e-78    
ref|XP_011002542.1|  PREDICTED: LOW QUALITY PROTEIN: pyrophosphat...    265   1e-78    
ref|WP_029901822.1|  diphosphate--fructose-6-phosphate 1-phosphot...    264   2e-78    
ref|WP_020966487.1|  diphosphate--fructose-6-phosphate 1-phosphot...    265   2e-78    
ref|WP_039420029.1|  MULTISPECIES: diphosphate--fructose-6-phosph...    264   2e-78    
ref|WP_006952714.1|  diphosphate--fructose-6-phosphate 1-phosphot...    264   2e-78    
ref|WP_039419596.1|  diphosphate--fructose-6-phosphate 1-phosphot...    264   2e-78    
ref|WP_010527175.1|  diphosphate--fructose-6-phosphate 1-phosphot...    264   2e-78    
ref|WP_013607434.1|  diphosphate--fructose-6-phosphate 1-phosphot...    264   2e-78    
ref|WP_022081702.1|  diphosphate-fructose-6-phosphate 1-phosphotr...    264   2e-78    
ref|WP_005923725.1|  MULTISPECIES: diphosphate--fructose-6-phosph...    264   2e-78    
ref|WP_039426896.1|  diphosphate--fructose-6-phosphate 1-phosphot...    264   2e-78    
ref|NP_172664.1|  pyrophosphate--fructose-6-phosphate 1-phosphotr...    264   2e-78    
gb|KDO54287.1|  hypothetical protein CISIN_1g008310mg                   264   2e-78    
ref|XP_010928237.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    264   2e-78    
ref|WP_044882394.1|  diphosphate--fructose-6-phosphate 1-phosphot...    263   2e-78    
ref|WP_006947947.1|  diphosphate--fructose-6-phosphate 1-phosphot...    263   2e-78    
ref|XP_009391472.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    264   3e-78    
ref|WP_026292223.1|  diphosphate--fructose-6-phosphate 1-phosphot...    263   3e-78    
ref|XP_007215516.1|  hypothetical protein PRUPE_ppa003662mg             264   3e-78    
gb|KIC73621.1|  Pyrophosphate--fructose 6-phosphate 1-phosphotran...    263   3e-78    
ref|XP_006287381.1|  hypothetical protein CARUB_v10000587mg             264   3e-78    
ref|XP_009114586.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    264   3e-78    
ref|XP_010476153.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    264   3e-78    
ref|XP_008458989.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    264   3e-78    
ref|WP_022511727.1|  diphosphate--fructose-6-phosphate 1-phosphot...    263   3e-78    
ref|XP_010458622.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    264   3e-78    
ref|WP_009317720.1|  MULTISPECIES: diphosphate--fructose-6-phosph...    263   4e-78    
ref|XP_010493617.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    263   4e-78    
ref|XP_008805585.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    263   4e-78    
ref|WP_039384525.1|  diphosphate--fructose-6-phosphate 1-phosphot...    263   4e-78    
ref|XP_009357501.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    263   5e-78    
ref|WP_026625143.1|  diphosphate--fructose-6-phosphate 1-phosphot...    263   5e-78    
ref|XP_010244159.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    263   5e-78    
ref|WP_021854968.1|  phosphofructokinase                                263   6e-78    
ref|WP_036790212.1|  MULTISPECIES: diphosphate--fructose-6-phosph...    263   6e-78    
ref|WP_044227866.1|  diphosphate--fructose-6-phosphate 1-phosphot...    262   7e-78    
ref|WP_007658653.1|  MULTISPECIES: diphosphate--fructose-6-phosph...    262   7e-78    
ref|WP_007133749.1|  diphosphate--fructose-6-phosphate 1-phosphot...    262   1e-77    
ref|XP_002892669.1|  hypothetical protein ARALYDRAFT_888516             262   1e-77    
ref|WP_022150455.1|  phosphofructokinase                                261   1e-77    
ref|XP_010686769.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    262   1e-77    
ref|WP_016525088.1|  diphosphate-fructose-6-phosphate 1-phosphotr...    261   1e-77    
ref|WP_036869019.1|  diphosphate--fructose-6-phosphate 1-phosphot...    261   1e-77    
sp|P21343.3|PFPB_SOLTU  RecName: Full=Pyrophosphate--fructose 6-p...    262   2e-77    
ref|WP_028727537.1|  diphosphate--fructose-6-phosphate 1-phosphot...    261   2e-77    
ref|WP_038563379.1|  diphosphate--fructose-6-phosphate 1-phosphot...    261   2e-77    
ref|WP_025017895.1|  diphosphate--fructose-6-phosphate 1-phosphot...    261   2e-77    
ref|WP_028909804.1|  diphosphate--fructose-6-phosphate 1-phosphot...    261   2e-77    
ref|XP_006469757.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    262   2e-77    
ref|WP_018669292.1|  diphosphate--fructose-6-phosphate 1-phosphot...    261   2e-77    
ref|XP_004134783.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    261   3e-77    
ref|WP_006843040.1|  diphosphate--fructose-6-phosphate 1-phosphot...    261   3e-77    
ref|XP_010529463.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    261   3e-77    
ref|WP_004365932.1|  diphosphate--fructose-6-phosphate 1-phosphot...    261   3e-77    
ref|WP_009346441.1|  diphosphate--fructose-6-phosphate 1-phosphot...    261   3e-77    
ref|WP_010663795.1|  diphosphate--fructose-6-phosphate 1-phosphot...    261   3e-77    
ref|WP_004357175.1|  diphosphate--fructose-6-phosphate 1-phosphot...    261   3e-77    
ref|XP_006417279.1|  hypothetical protein EUTSA_v10007237mg             261   3e-77    
ref|WP_021940332.1|  hypothetical protein                               259   4e-77    
ref|WP_021909549.1|  diphosphate--fructose-6-phosphate 1-phosphot...    254   4e-77    
ref|WP_026285932.1|  diphosphate--fructose-6-phosphate 1-phosphot...    260   4e-77    
ref|WP_016276863.1|  diphosphate-fructose-6-phosphate 1-phosphotr...    260   4e-77    
ref|WP_040561026.1|  diphosphate--fructose-6-phosphate 1-phosphot...    260   4e-77    
ref|WP_004376175.1|  diphosphate--fructose-6-phosphate 1-phosphot...    260   4e-77    
ref|WP_024989602.1|  diphosphate--fructose-6-phosphate 1-phosphot...    260   4e-77    
gb|EGV34403.1|  diphosphate-fructose-6-phosphate 1-phosphotransfe...    260   4e-77    
ref|WP_036890490.1|  diphosphate--fructose-6-phosphate 1-phosphot...    260   4e-77    
ref|WP_025881004.1|  diphosphate--fructose-6-phosphate 1-phosphot...    260   4e-77    
ref|WP_010422435.1|  diphosphate--fructose-6-phosphate 1-phosphot...    260   4e-77    
ref|XP_010252536.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    261   4e-77    
ref|WP_025070337.1|  diphosphate--fructose-6-phosphate 1-phosphot...    260   4e-77    
ref|WP_021670104.1|  diphosphate--fructose-6-phosphate 1-phosphot...    260   4e-77    
ref|XP_009414122.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    261   4e-77    
ref|WP_025839858.1|  diphosphate--fructose-6-phosphate 1-phosphot...    260   5e-77    
ref|XP_008440051.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    261   5e-77    
ref|XP_010529462.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    261   5e-77    
ref|WP_025877362.1|  diphosphate--fructose-6-phosphate 1-phosphot...    260   5e-77    
ref|WP_036829398.1|  diphosphate--fructose-6-phosphate 1-phosphot...    260   5e-77    
ref|WP_024752338.1|  diphosphate--fructose-6-phosphate 1-phosphot...    260   5e-77    
gb|EYU33871.1|  hypothetical protein MIMGU_mgv1a003790mg                260   5e-77    
ref|WP_022102965.1|  diphosphate--fructose-6-phosphate 1-phosphot...    260   6e-77    
gb|EFB33295.1|  diphosphate--fructose-6-phosphate 1-phosphotransf...    260   6e-77    
ref|WP_005936237.1|  MULTISPECIES: diphosphate-fructose-6-phospha...    260   6e-77    
ref|WP_005846138.1|  MULTISPECIES: diphosphate--fructose-6-phosph...    260   6e-77    
ref|WP_021980053.1|  diphosphate--fructose-6-phosphate 1-phosphot...    259   7e-77    
ref|WP_036881935.1|  diphosphate--fructose-6-phosphate 1-phosphot...    260   7e-77    
ref|WP_028973346.1|  diphosphate--fructose-6-phosphate 1-phosphot...    259   7e-77    
ref|WP_021931216.1|  diphosphate-fructose-6-phosphate 1-phosphotr...    259   7e-77    
ref|XP_003610482.1|  Pyrophosphate-fructose 6-phosphate 1-phospho...    260   7e-77    
ref|WP_008652858.1|  MULTISPECIES: diphosphate--fructose-6-phosph...    259   8e-77    
ref|WP_021589756.1|  diphosphate--fructose-6-phosphate 1-phosphot...    259   8e-77    
ref|WP_002701079.1|  diphosphate--fructose-6-phosphate 1-phosphot...    260   8e-77    
ref|WP_044233209.1|  diphosphate--fructose-6-phosphate 1-phosphot...    259   8e-77    
ref|XP_010533788.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    260   8e-77    
ref|XP_010546562.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    260   8e-77    
ref|WP_006798230.1|  diphosphate--fructose-6-phosphate 1-phosphot...    259   9e-77    
ref|XP_006383850.1|  hypothetical protein POPTR_0004s00550g             259   9e-77    
ref|XP_006307130.1|  hypothetical protein CARUB_v10008719mg             260   1e-76    
ref|XP_007026198.1|  Pyrophosphate--fructose 6-phosphate 1-phosph...    258   1e-76    
ref|WP_025067563.1|  diphosphate--fructose-6-phosphate 1-phosphot...    259   1e-76    
ref|WP_025001065.1|  diphosphate--fructose-6-phosphate 1-phosphot...    259   1e-76    
ref|WP_018525631.1|  hypothetical protein                               259   1e-76    
ref|WP_036865072.1|  diphosphate--fructose-6-phosphate 1-phosphot...    259   1e-76    
ref|WP_028896044.1|  diphosphate--fructose-6-phosphate 1-phosphot...    259   1e-76    
ref|WP_021671600.1|  diphosphate--fructose-6-phosphate 1-phosphot...    259   1e-76    
ref|WP_009010591.1|  diphosphate--fructose-6-phosphate 1-phosphot...    259   1e-76    
ref|WP_036854388.1|  diphosphate--fructose-6-phosphate 1-phosphot...    259   1e-76    
ref|WP_004353492.1|  diphosphate--fructose-6-phosphate 1-phosphot...    259   1e-76    
ref|WP_044190829.1|  diphosphate--fructose-6-phosphate 1-phosphot...    259   1e-76    
ref|WP_004362686.1|  diphosphate-fructose-6-phosphate 1-phosphotr...    259   1e-76    
ref|WP_038605987.1|  diphosphate--fructose-6-phosphate 1-phosphot...    259   2e-76    
ref|XP_008384111.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    259   2e-76    
ref|WP_004359492.1|  diphosphate--fructose-6-phosphate 1-phosphot...    259   2e-76    
ref|WP_008627564.1|  diphosphate--fructose-6-phosphate 1-phosphot...    259   2e-76    
ref|WP_021964522.1|  phosphofructokinase                                259   2e-76    
ref|WP_002561703.1|  MULTISPECIES: diphosphate--fructose-6-phosph...    259   2e-76    
ref|XP_009356464.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    259   2e-76    
ref|WP_007366298.1|  diphosphate--fructose-6-phosphate 1-phosphot...    258   2e-76    
ref|WP_026475518.1|  diphosphate--fructose-6-phosphate 1-phosphot...    259   2e-76    
ref|WP_007842406.1|  MULTISPECIES: diphosphate--fructose-6-phosph...    258   2e-76    
ref|WP_007837134.1|  diphosphate--fructose-6-phosphate 1-phosphot...    258   2e-76    
ref|WP_023983193.1|  diphosphate-fructose-6-phosphate 1-phosphotr...    258   2e-76    
ref|WP_023924546.1|  diphosphate-fructose-6-phosphate 1-phosphotr...    259   2e-76    
ref|XP_009788354.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    258   2e-76    
ref|WP_013265533.1|  diphosphate--fructose-6-phosphate 1-phosphot...    258   2e-76    
ref|WP_004370527.1|  diphosphate--fructose-6-phosphate 1-phosphot...    258   2e-76    
ref|XP_010057883.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    259   2e-76    
ref|WP_008622743.1|  diphosphate--fructose-6-phosphate 1-phosphot...    258   2e-76    
ref|XP_010089437.1|  Pyrophosphate--fructose 6-phosphate 1-phosph...    258   2e-76    
ref|WP_021662033.1|  diphosphate--fructose-6-phosphate 1-phosphot...    258   2e-76    
ref|WP_036925131.1|  diphosphate--fructose-6-phosphate 1-phosphot...    258   3e-76    
ref|WP_022252312.1|  diphosphate--fructose-6-phosphate 1-phosphot...    258   3e-76    
ref|XP_010422248.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    259   3e-76    
ref|WP_004290431.1|  diphosphate--fructose-6-phosphate 1-phosphot...    258   3e-76    
emb|CDY30046.1|  BnaC05g09740D                                          258   3e-76    
ref|XP_006826755.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    258   3e-76    
ref|WP_023847292.1|  diphosphate--fructose-6-phosphate 1-phosphot...    258   3e-76    
ref|WP_004292707.1|  diphosphate--fructose-6-phosphate 1-phosphot...    258   3e-76    
ref|WP_044533074.1|  diphosphate--fructose-6-phosphate 1-phosphot...    256   4e-76    
ref|WP_012457385.1|  Pyrophosphate--fructose 6-phosphate 1-phosph...    258   5e-76    
ref|WP_007902847.1|  MULTISPECIES: diphosphate--fructose-6-phosph...    258   5e-76    
ref|XP_006449816.1|  hypothetical protein CICLE_v10014760mg             258   5e-76    
ref|XP_007026197.1|  Pyrophosphate--fructose 6-phosphate 1-phosph...    258   5e-76    
ref|XP_008364088.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    258   5e-76    
ref|XP_009788347.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    258   6e-76    
ref|NP_192313.3|  pyrophosphate--fructose-6-phosphate 1-phosphotr...    258   6e-76    
ref|WP_008158638.1|  diphosphate--fructose-6-phosphate 1-phosphot...    257   6e-76    
ref|XP_002271059.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    258   6e-76    
ref|WP_013815410.1|  diphosphate--fructose-6-phosphate 1-phosphot...    257   7e-76    
ref|WP_007574011.1|  diphosphate--fructose-6-phosphate 1-phosphot...    257   7e-76    
ref|WP_013672124.1|  diphosphate--fructose-6-phosphate 1-phosphot...    257   7e-76    
ref|WP_022130193.1|  hypothetical protein                               257   7e-76    
ref|WP_021677112.1|  diphosphate--fructose-6-phosphate 1-phosphot...    257   7e-76    
ref|WP_004583807.1|  Pyrophosphate--fructose 6-phosphate 1-phosph...    257   7e-76    
ref|XP_010913416.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    257   7e-76    
ref|WP_021663363.1|  Pyrophosphate--fructose 6-phosphate 1-phosph...    257   7e-76    
ref|WP_042372185.1|  diphosphate--fructose-6-phosphate 1-phosphot...    257   8e-76    
gb|EDS15317.1|  diphosphate--fructose-6-phosphate 1-phosphotransf...    258   8e-76    
ref|XP_002518416.1|  phosphofructokinase, putative                      257   8e-76    
ref|XP_004243522.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    257   8e-76    
gb|AIE88316.1|  pyrophosphate--fructose 6-phosphate 1-phosphotran...    257   8e-76    
ref|WP_024991268.1|  diphosphate--fructose-6-phosphate 1-phosphot...    257   9e-76    
ref|WP_004345857.1|  diphosphate--fructose-6-phosphate 1-phosphot...    257   9e-76    
ref|WP_018464632.1|  diphosphate--fructose-6-phosphate 1-phosphot...    256   9e-76    
ref|XP_004145428.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    257   1e-75    
ref|WP_022353894.1|  hypothetical protein                               256   1e-75    
ref|WP_007412056.1|  diphosphate--fructose-6-phosphate 1-phosphot...    256   1e-75    
ref|XP_006357957.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    257   1e-75    
ref|XP_010099150.1|  Pyrophosphate--fructose 6-phosphate 1-phosph...    257   1e-75    
ref|WP_022103660.1|  MULTISPECIES: diphosphate--fructose-6-phosph...    256   1e-75    
ref|WP_008564004.1|  diphosphate--fructose-6-phosphate 1-phosphot...    256   1e-75    
gb|ADZ96379.1|  pyrophosphate--fructose 6-phosphate 1-phosphotran...    257   1e-75    
ref|WP_016661325.1|  diphosphate-fructose-6-phosphate 1-phosphotr...    256   1e-75    
ref|XP_010496159.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    257   1e-75    
ref|XP_011047000.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    257   1e-75    
ref|WP_004340656.1|  diphosphate--fructose-6-phosphate 1-phosphot...    256   1e-75    
ref|WP_021896515.1|  pyrophosphate-dependent phosphofructokinase        256   1e-75    
ref|WP_008822440.1|  diphosphate--fructose-6-phosphate 1-phosphot...    256   1e-75    
ref|XP_006467368.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    257   1e-75    
emb|CDX98086.1|  BnaA06g08370D                                          257   1e-75    
ref|XP_004293328.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    256   1e-75    
gb|KCW75230.1|  hypothetical protein EUGRSUZ_E03983                     258   1e-75    
ref|WP_019967261.1|  diphosphate--fructose-6-phosphate 1-phosphot...    256   2e-75    
ref|WP_045030071.1|  diphosphate--fructose-6-phosphate 1-phosphot...    256   2e-75    
gb|AAC67586.1|  pyrophosphate-dependent phosphofructokinase beta ...    256   2e-75    
ref|XP_010433059.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    256   2e-75    
ref|WP_008145850.1|  MULTISPECIES: diphosphate--fructose-6-phosph...    256   2e-75    
gb|KDO78376.1|  hypothetical protein CISIN_1g008424mg                   256   2e-75    
ref|WP_028899167.1|  diphosphate--fructose-6-phosphate 1-phosphot...    256   2e-75    
ref|WP_009120576.1|  diphosphate--fructose-6-phosphate 1-phosphot...    256   2e-75    
ref|WP_025065627.1|  diphosphate--fructose-6-phosphate 1-phosphot...    256   2e-75    
gb|KFK30957.1|  hypothetical protein AALP_AA6G049400                    256   2e-75    
ref|WP_025790489.1|  diphosphate--fructose-6-phosphate 1-phosphot...    256   2e-75    
gb|KJB69224.1|  hypothetical protein B456_011G011600                    254   2e-75    
ref|XP_002872678.1|  hypothetical protein ARALYDRAFT_490075             256   2e-75    
ref|WP_022302275.1|  phosphofructokinase                                252   3e-75    
ref|WP_036650726.1|  diphosphate--fructose-6-phosphate 1-phosphot...    256   3e-75    
ref|WP_016777789.1|  diphosphate--fructose-6-phosphate 1-phosphot...    256   3e-75    
ref|WP_044264258.1|  diphosphate--fructose-6-phosphate 1-phosphot...    256   3e-75    
ref|WP_008771783.1|  diphosphate--fructose-6-phosphate 1-phosphot...    255   3e-75    
ref|WP_032945214.1|  diphosphate--fructose-6-phosphate 1-phosphot...    255   3e-75    
gb|KJB67274.1|  hypothetical protein B456_010G184300                    256   3e-75    
ref|WP_019036414.1|  diphosphate--fructose-6-phosphate 1-phosphot...    255   3e-75    
ref|WP_008448175.1|  diphosphate--fructose-6-phosphate 1-phosphot...    255   3e-75    
sp|Q41141.1|PFPB_RICCO  RecName: Full=Pyrophosphate--fructose 6-p...    255   3e-75    
ref|WP_039876710.1|  diphosphate--fructose-6-phosphate 1-phosphot...    255   3e-75    
ref|WP_007214428.1|  MULTISPECIES: diphosphate--fructose-6-phosph...    255   4e-75    
ref|WP_005640886.1|  diphosphate--fructose-6-phosphate 1-phosphot...    255   4e-75    
ref|WP_028507542.1|  diphosphate--fructose-6-phosphate 1-phosphot...    255   4e-75    
ref|WP_022392567.1|  diphosphate-fructose-6-phosphate 1-phosphotr...    255   4e-75    
ref|XP_009365098.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    255   4e-75    
ref|WP_036864816.1|  diphosphate--fructose-6-phosphate 1-phosphot...    255   4e-75    
ref|WP_006044710.1|  diphosphate--fructose-6-phosphate 1-phosphot...    255   4e-75    
ref|WP_036856523.1|  diphosphate--fructose-6-phosphate 1-phosphot...    255   4e-75    
ref|WP_005647732.1|  diphosphate--fructose-6-phosphate 1-phosphot...    255   4e-75    
ref|WP_044468201.1|  diphosphate--fructose-6-phosphate 1-phosphot...    255   5e-75    
ref|WP_022322946.1|  diphosphate--fructose-6-phosphate 1-phosphot...    255   5e-75    



>ref|XP_011074054.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha [Sesamum indicum]
Length=616

 Score =   696 bits (1795),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 348/390 (89%), Positives = 375/390 (96%), Gaps = 0/390 (0%)
 Frame = +3

Query  51    MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  230
             MDSDFG+ RELSDLQKLRSQY+PELPPCLQGTTVRVEFGDAT AADPSG HTISR FPHT
Sbjct  1     MDSDFGIPRELSDLQKLRSQYQPELPPCLQGTTVRVEFGDATIAADPSGAHTISRSFPHT  60

Query  231   FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  410
             +GQP+AHFLRA+AKVPDAQIITEHPA+RVG+VFCGRQSPGGHN +WGL +ALKVHNP S 
Sbjct  61    YGQPIAHFLRATAKVPDAQIITEHPAVRVGVVFCGRQSPGGHNVVWGLLEALKVHNPESV  120

Query  411   llgflggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLK  590
             LLGFLGGSEGLFAQKTLE+TD+ILATYKNQGGYD+LGRTKDQIR+TEQVNAAL ACT+LK
Sbjct  121   LLGFLGGSEGLFAQKTLEVTDEILATYKNQGGYDLLGRTKDQIRTTEQVNAALNACTALK  180

Query  591   LDGLVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICKV  770
             LD LVI+GGVTSNTDAA LAE FAE KCPTKVVG+PVTLNGDLKNQFVETNVG+DTICKV
Sbjct  181   LDALVIIGGVTSNTDAAQLAETFAERKCPTKVVGIPVTLNGDLKNQFVETNVGYDTICKV  240

Query  771   NSQLISNVCTDALSAEKYYYFIRLMGRKTSHVALECTLQSHPNMVILAEEVAASKLTLFD  950
             NSQLISNVCTDALSAEKYYYFIRLMGRK SHVALECTLQSHPNMVILAEEVAASKLTLFD
Sbjct  241   NSQLISNVCTDALSAEKYYYFIRLMGRKASHVALECTLQSHPNMVILAEEVAASKLTLFD  300

Query  951   ITKQVCDAVQARAEQDKYHGVILLPEGLIESIPEIYALLKEIHVLLREGVSANNISSQLS  1130
             ITKQ+CDAVQARAEQDKYHGVILLPEGLIESIPE++ALL+EIH LLR+GVSA+NIS+QLS
Sbjct  301   ITKQICDAVQARAEQDKYHGVILLPEGLIESIPEVFALLQEIHGLLRQGVSADNISAQLS  360

Query  1131  PWASALFEFLPPFIRRELLLYPESDDSAQL  1220
             PWASALFEFLPPFIR++LLL+PESDDSAQL
Sbjct  361   PWASALFEFLPPFIRKQLLLHPESDDSAQL  390



>ref|XP_007018640.1| Pyrophosphate--fructose 6-phosphate 1-phosphotransferase subunit 
alpha [Theobroma cacao]
 gb|EOY15865.1| Pyrophosphate--fructose 6-phosphate 1-phosphotransferase subunit 
alpha [Theobroma cacao]
Length=617

 Score =   688 bits (1775),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 348/390 (89%), Positives = 370/390 (95%), Gaps = 0/390 (0%)
 Frame = +3

Query  51    MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  230
             MDSDFG+ RELSDLQKLRSQY+P LPPCL+GTTVRVEFGDATTA DP+  HTISR FPHT
Sbjct  1     MDSDFGIPRELSDLQKLRSQYQPGLPPCLEGTTVRVEFGDATTALDPADAHTISRAFPHT  60

Query  231   FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  410
             +GQPLAHFLRA+AKVPDAQIITEHPA+RVG+VFCGRQSPGGHN IWGL+ ALK+HNPNST
Sbjct  61    YGQPLAHFLRATAKVPDAQIITEHPAMRVGLVFCGRQSPGGHNVIWGLHKALKIHNPNST  120

Query  411   llgflggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLK  590
             LLGFLGG++GLFAQKTLEITDDIL+TYKNQGGYD+LGRT+DQIR+TEQVNAALTAC  LK
Sbjct  121   LLGFLGGTQGLFAQKTLEITDDILSTYKNQGGYDLLGRTQDQIRTTEQVNAALTACNDLK  180

Query  591   LDGLVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICKV  770
             LDGLVI+GGVTSNTDAA LAE FAEAKC TKVVGVPVTLNGDLKNQFVE NVGFDTICKV
Sbjct  181   LDGLVIIGGVTSNTDAAQLAETFAEAKCQTKVVGVPVTLNGDLKNQFVEANVGFDTICKV  240

Query  771   NSQLISNVCTDALSAEKYYYFIRLMGRKTSHVALECTLQSHPNMVILAEEVAASKLTLFD  950
             NSQLISNVCTDALSAEKYYYFIRLMGRK SHVALECTLQSHPNMVIL EEVAASKLTLFD
Sbjct  241   NSQLISNVCTDALSAEKYYYFIRLMGRKASHVALECTLQSHPNMVILGEEVAASKLTLFD  300

Query  951   ITKQVCDAVQARAEQDKYHGVILLPEGLIESIPEIYALLKEIHVLLREGVSANNISSQLS  1130
             ITKQ+CDAVQARAEQDK HGVILLPEGLIESIPE+YALLKEIH LLR+GVSA  ISSQLS
Sbjct  301   ITKQICDAVQARAEQDKNHGVILLPEGLIESIPEVYALLKEIHSLLRQGVSAEKISSQLS  360

Query  1131  PWASALFEFLPPFIRRELLLYPESDDSAQL  1220
             PWASALFEFLPPFIRR+LLL+PESDDSAQL
Sbjct  361   PWASALFEFLPPFIRRQLLLHPESDDSAQL  390



>ref|XP_002510738.1| phosphofructokinase, putative [Ricinus communis]
 gb|EEF52925.1| phosphofructokinase, putative [Ricinus communis]
Length=617

 Score =   687 bits (1773),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/390 (89%), Positives = 372/390 (95%), Gaps = 0/390 (0%)
 Frame = +3

Query  51    MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  230
             MDSDFG+ RELSDLQKLRS Y+PELPPCLQGTTVRVE GD TTAAD +G HTISR FPHT
Sbjct  1     MDSDFGIPRELSDLQKLRSLYQPELPPCLQGTTVRVELGDGTTAADEAGAHTISRSFPHT  60

Query  231   FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  410
             +GQPLAHFLRA+AKV DA II+EHPA+RVG+VFCGRQSPGGHN +WGL++ALK+HNPNST
Sbjct  61    YGQPLAHFLRATAKVADAHIISEHPAMRVGVVFCGRQSPGGHNVVWGLHNALKIHNPNST  120

Query  411   llgflggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLK  590
             LLGFLGGSEGLFAQKTLE+TDDIL+TYKNQGGYD+LGRTKDQIR+TEQV+AALT C +LK
Sbjct  121   LLGFLGGSEGLFAQKTLEVTDDILSTYKNQGGYDLLGRTKDQIRTTEQVHAALTTCKNLK  180

Query  591   LDGLVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICKV  770
             LDGLVI+GGVTSNTDAA LAE FAEAKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICKV
Sbjct  181   LDGLVIIGGVTSNTDAAQLAETFAEAKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICKV  240

Query  771   NSQLISNVCTDALSAEKYYYFIRLMGRKTSHVALECTLQSHPNMVILAEEVAASKLTLFD  950
             NSQLISNVCTDALSAEKYYYFIRLMGRK SHVALECTLQSHPNMVIL EEVAASKLTLFD
Sbjct  241   NSQLISNVCTDALSAEKYYYFIRLMGRKASHVALECTLQSHPNMVILGEEVAASKLTLFD  300

Query  951   ITKQVCDAVQARAEQDKYHGVILLPEGLIESIPEIYALLKEIHVLLREGVSANNISSQLS  1130
             +TKQVCDAVQARAEQDKYHGVILLPEGLIESIPE+YALLKEIH LLR+GVS NNISSQLS
Sbjct  301   LTKQVCDAVQARAEQDKYHGVILLPEGLIESIPEVYALLKEIHGLLRQGVSPNNISSQLS  360

Query  1131  PWASALFEFLPPFIRRELLLYPESDDSAQL  1220
             PWASALFEFLPPFI+++LLLYPESDDSAQL
Sbjct  361   PWASALFEFLPPFIKKQLLLYPESDDSAQL  390



>ref|XP_004238468.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha [Solanum lycopersicum]
Length=616

 Score =   684 bits (1765),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/390 (89%), Positives = 370/390 (95%), Gaps = 0/390 (0%)
 Frame = +3

Query  51    MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  230
             MD+D+G+ARELSDLQKLRS Y PELPPCLQGTTVRVE  DATTAADPSG HTI R FPHT
Sbjct  1     MDADYGIARELSDLQKLRSHYHPELPPCLQGTTVRVELRDATTAADPSGEHTIKRFFPHT  60

Query  231   FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  410
             +GQPLAHFLRA+AKVPDAQIITEHPAIRVG++FCGRQSPGGHN IWGL+DALKVHNPN+ 
Sbjct  61    YGQPLAHFLRATAKVPDAQIITEHPAIRVGVLFCGRQSPGGHNVIWGLHDALKVHNPNNI  120

Query  411   llgflggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLK  590
             LLGFLGGSEGLFAQKTLEITDD+LATYKNQGGYDMLGRTKDQIR+TEQVNAA+ AC +LK
Sbjct  121   LLGFLGGSEGLFAQKTLEITDDVLATYKNQGGYDMLGRTKDQIRTTEQVNAAMAACKALK  180

Query  591   LDGLVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICKV  770
             LDGLVI+GGVTSNTDAA+LAE FAE KCPTKVVGVPVTLNGDLKNQFVE NVGFDTICKV
Sbjct  181   LDGLVIIGGVTSNTDAAHLAEKFAETKCPTKVVGVPVTLNGDLKNQFVEANVGFDTICKV  240

Query  771   NSQLISNVCTDALSAEKYYYFIRLMGRKTSHVALECTLQSHPNMVILAEEVAASKLTLFD  950
             NSQLISNVCTDALSAEKYYYFIRLMGRK SHVALECTLQSHPNMVIL EEVAASKLT+FD
Sbjct  241   NSQLISNVCTDALSAEKYYYFIRLMGRKASHVALECTLQSHPNMVILGEEVAASKLTIFD  300

Query  951   ITKQVCDAVQARAEQDKYHGVILLPEGLIESIPEIYALLKEIHVLLREGVSANNISSQLS  1130
             IT+Q+CDAVQARAE DK HGVILLPEGLIESIPEIYALL+EIH LLR+GVSA+NISSQLS
Sbjct  301   ITQQICDAVQARAEHDKNHGVILLPEGLIESIPEIYALLQEIHGLLRQGVSADNISSQLS  360

Query  1131  PWASALFEFLPPFIRRELLLYPESDDSAQL  1220
             PWASALFEFLP FIR++LLL+PESDDSAQL
Sbjct  361   PWASALFEFLPHFIRKQLLLHPESDDSAQL  390



>sp|Q41140.1|PFPA_RICCO RecName: Full=Pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha; Short=PFP; AltName: Full=6-phosphofructokinase, 
pyrophosphate dependent; AltName: Full=PPi-PFK; 
AltName: Full=Pyrophosphate-dependent 6-phosphofructose-1-kinase 
[Ricinus communis]
 emb|CAA83682.1| pyrophosphate-dependent phosphofructokinase alpha subunit [Ricinus 
communis]
Length=617

 Score =   684 bits (1764),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 345/390 (88%), Positives = 370/390 (95%), Gaps = 0/390 (0%)
 Frame = +3

Query  51    MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  230
             MDSDFG+ RELSDLQKLRS Y+PELPPCLQGTTVRVE GD TTA   +G HTISR FPHT
Sbjct  1     MDSDFGIPRELSDLQKLRSLYKPELPPCLQGTTVRVELGDGTTACSEAGAHTISRSFPHT  60

Query  231   FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  410
             +GQPLAHFLRA+AKV DA II+EHPA+RVG+VFCGRQSPGGHN +WGL++ALK+HNPNST
Sbjct  61    YGQPLAHFLRATAKVADAHIISEHPAMRVGVVFCGRQSPGGHNVVWGLHNALKIHNPNST  120

Query  411   llgflggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLK  590
             LLGFLGGSEGLFAQKTLE+TDDIL+TYKNQGGYD+LGRTKDQIR+TEQV+AALT C +LK
Sbjct  121   LLGFLGGSEGLFAQKTLEVTDDILSTYKNQGGYDLLGRTKDQIRTTEQVHAALTTCKNLK  180

Query  591   LDGLVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICKV  770
             LDGLVI+GGVTSNTDAA LAE FAEAKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICKV
Sbjct  181   LDGLVIIGGVTSNTDAAQLAETFAEAKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICKV  240

Query  771   NSQLISNVCTDALSAEKYYYFIRLMGRKTSHVALECTLQSHPNMVILAEEVAASKLTLFD  950
             NSQLISNVCTDALSAEKYYYFIRLMGRK SHVALECTLQSHPNMVIL EEVAASKLTLFD
Sbjct  241   NSQLISNVCTDALSAEKYYYFIRLMGRKASHVALECTLQSHPNMVILGEEVAASKLTLFD  300

Query  951   ITKQVCDAVQARAEQDKYHGVILLPEGLIESIPEIYALLKEIHVLLREGVSANNISSQLS  1130
             +TKQVCDAVQARAEQDKYHGVILLPEGLIESIPE+YALLKEIH LLR+GVS NNISSQLS
Sbjct  301   LTKQVCDAVQARAEQDKYHGVILLPEGLIESIPEVYALLKEIHGLLRQGVSPNNISSQLS  360

Query  1131  PWASALFEFLPPFIRRELLLYPESDDSAQL  1220
             PWASALFEFLPPFI+++LLLYPESDDSAQL
Sbjct  361   PWASALFEFLPPFIKKQLLLYPESDDSAQL  390



>gb|EYU41211.1| hypothetical protein MIMGU_mgv1a003012mg [Erythranthe guttata]
Length=616

 Score =   683 bits (1762),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 345/390 (88%), Positives = 370/390 (95%), Gaps = 0/390 (0%)
 Frame = +3

Query  51    MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  230
             MDSD+G ARELSDLQKLRS Y+PELPPCLQGTTV VEFGD TTAADP G HTISR FPHT
Sbjct  1     MDSDYGTARELSDLQKLRSHYQPELPPCLQGTTVSVEFGDVTTAADPLGAHTISRSFPHT  60

Query  231   FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  410
             +GQP+AHFLRASAKVPDAQIIT+HPA+RVG+VFCGRQSPGGHN IWGL DALKVHNP ST
Sbjct  61    YGQPIAHFLRASAKVPDAQIITDHPAVRVGVVFCGRQSPGGHNVIWGLLDALKVHNPKST  120

Query  411   llgflggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLK  590
             LLGFLGGSEGLFAQKTLEITD ILATYKNQGGYD+LGRTKDQIR+TEQVNA+L ACT+LK
Sbjct  121   LLGFLGGSEGLFAQKTLEITDQILATYKNQGGYDLLGRTKDQIRTTEQVNASLKACTTLK  180

Query  591   LDGLVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICKV  770
             LD LVI+GGVTSNTDAA LAE FAE KCPTKVVG+PVTLNGDLKNQFVETNVGFDTICKV
Sbjct  181   LDALVIIGGVTSNTDAAQLAETFAERKCPTKVVGIPVTLNGDLKNQFVETNVGFDTICKV  240

Query  771   NSQLISNVCTDALSAEKYYYFIRLMGRKTSHVALECTLQSHPNMVILAEEVAASKLTLFD  950
             NSQLISNVCTDALSAEKYYYFIRLMGRK SHVALECTLQSHPNMVILAEEVA+SKLTLFD
Sbjct  241   NSQLISNVCTDALSAEKYYYFIRLMGRKASHVALECTLQSHPNMVILAEEVASSKLTLFD  300

Query  951   ITKQVCDAVQARAEQDKYHGVILLPEGLIESIPEIYALLKEIHVLLREGVSANNISSQLS  1130
             ITKQ+CDAVQAR EQDK+HGVILLPEGLIESIPE+YALL+EIH L++ GVSA+NIS+QLS
Sbjct  301   ITKQLCDAVQARGEQDKHHGVILLPEGLIESIPEVYALLQEIHGLIKVGVSADNISAQLS  360

Query  1131  PWASALFEFLPPFIRRELLLYPESDDSAQL  1220
             PWASALFEFLPPFIR++LLL+PESDDSAQL
Sbjct  361   PWASALFEFLPPFIRKQLLLHPESDDSAQL  390



>ref|XP_006435470.1| hypothetical protein CICLE_v10000595mg [Citrus clementina]
 gb|ESR48710.1| hypothetical protein CICLE_v10000595mg [Citrus clementina]
 gb|KDO85269.1| hypothetical protein CISIN_1g006964mg [Citrus sinensis]
 gb|KDO85270.1| hypothetical protein CISIN_1g006964mg [Citrus sinensis]
Length=494

 Score =   678 bits (1750),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 345/390 (88%), Positives = 370/390 (95%), Gaps = 0/390 (0%)
 Frame = +3

Query  51    MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  230
             MDSDFG+ RELS LQ+LRS Y+PELPPCLQGTTVRVEFGD+TT ADP+  H+ISR FPHT
Sbjct  1     MDSDFGIPRELSGLQQLRSLYQPELPPCLQGTTVRVEFGDSTTTADPADTHSISRSFPHT  60

Query  231   FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  410
             +GQPLAHFLRA+AKVPDAQIITEHPAIRVGIVFCGRQSPGGHN +WGLYDALK+HNP ST
Sbjct  61    YGQPLAHFLRATAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNVVWGLYDALKLHNPKST  120

Query  411   llgflggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLK  590
             LLGFLGGSEGLFAQKTLE+T +IL+TYKNQGGYDMLGRTKDQIR+TEQVNAALTAC +L 
Sbjct  121   LLGFLGGSEGLFAQKTLEVTKEILSTYKNQGGYDMLGRTKDQIRTTEQVNAALTACKNLN  180

Query  591   LDGLVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICKV  770
             LDGLVI+GGVTSNTDAAYLAE FAEAKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICKV
Sbjct  181   LDGLVIIGGVTSNTDAAYLAETFAEAKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICKV  240

Query  771   NSQLISNVCTDALSAEKYYYFIRLMGRKTSHVALECTLQSHPNMVILAEEVAASKLTLFD  950
             NSQLISNVCTDALSAEKYYYFIRLMGR+ SHVALECTLQSHPNMVIL EEVAASKLTLFD
Sbjct  241   NSQLISNVCTDALSAEKYYYFIRLMGRRASHVALECTLQSHPNMVILGEEVAASKLTLFD  300

Query  951   ITKQVCDAVQARAEQDKYHGVILLPEGLIESIPEIYALLKEIHVLLREGVSANNISSQLS  1130
             +TKQ+CDAVQARAEQDK HGVILLPEGLIESIPE+YALLKEIH LLR+GV  +NISSQLS
Sbjct  301   LTKQICDAVQARAEQDKNHGVILLPEGLIESIPEVYALLKEIHSLLRQGVPVDNISSQLS  360

Query  1131  PWASALFEFLPPFIRRELLLYPESDDSAQL  1220
             PWASALFEFLPPFI+++LLL PESDDSAQL
Sbjct  361   PWASALFEFLPPFIKKQLLLQPESDDSAQL  390



>ref|XP_012073552.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha [Jatropha curcas]
 ref|XP_012073553.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha [Jatropha curcas]
 gb|KDP36731.1| hypothetical protein JCGZ_08022 [Jatropha curcas]
Length=617

 Score =   682 bits (1760),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/390 (89%), Positives = 367/390 (94%), Gaps = 0/390 (0%)
 Frame = +3

Query  51    MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  230
             MDSDFG+ RELS+LQK RS Y+PELPPCLQGTTVRVEFGD T AAD +G HTISR FPHT
Sbjct  1     MDSDFGIPRELSELQKQRSHYQPELPPCLQGTTVRVEFGDGTIAADAAGAHTISRSFPHT  60

Query  231   FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  410
             +GQPLAHFLRA+AKVPDA IITEHPA+RVGIVFCGRQSPGGHN IWGL +ALK+HNPNST
Sbjct  61    YGQPLAHFLRATAKVPDAHIITEHPAMRVGIVFCGRQSPGGHNVIWGLLNALKIHNPNST  120

Query  411   llgflggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLK  590
             LLGFLGGSEGLFAQKTLEITD+IL+TYKNQGGYD+LGRTKDQIR+TEQV AALT C  LK
Sbjct  121   LLGFLGGSEGLFAQKTLEITDEILSTYKNQGGYDLLGRTKDQIRTTEQVKAALTTCQDLK  180

Query  591   LDGLVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICKV  770
             LDGLVI+GGVTSNTDAA LAE FAEAKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICKV
Sbjct  181   LDGLVIIGGVTSNTDAAQLAETFAEAKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICKV  240

Query  771   NSQLISNVCTDALSAEKYYYFIRLMGRKTSHVALECTLQSHPNMVILAEEVAASKLTLFD  950
             NSQLISNVC DALSAEKYYYFIRLMGRK SHVALECTLQSHPNMVIL EEVAASKLTLFD
Sbjct  241   NSQLISNVCIDALSAEKYYYFIRLMGRKASHVALECTLQSHPNMVILGEEVAASKLTLFD  300

Query  951   ITKQVCDAVQARAEQDKYHGVILLPEGLIESIPEIYALLKEIHVLLREGVSANNISSQLS  1130
             IT Q+CDAVQARAEQDKYHGVILLPEGLIESIPE+YALLKEIH LLR+GV+ NNISSQLS
Sbjct  301   ITTQICDAVQARAEQDKYHGVILLPEGLIESIPEVYALLKEIHGLLRQGVTPNNISSQLS  360

Query  1131  PWASALFEFLPPFIRRELLLYPESDDSAQL  1220
             PWASALFEFLPPFI+++LLLYPESDDSAQL
Sbjct  361   PWASALFEFLPPFIKKQLLLYPESDDSAQL  390



>ref|XP_009608062.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha {ECO:0000255|HAMAP-Rule:MF_03185} [Nicotiana 
tomentosiformis]
Length=616

 Score =   681 bits (1757),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/390 (88%), Positives = 369/390 (95%), Gaps = 0/390 (0%)
 Frame = +3

Query  51    MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  230
             MD+D+G+ RELSDLQKLRSQY+PELPPCLQGTTVRVE  DAT AADPSG HTI R FPHT
Sbjct  1     MDADYGIPRELSDLQKLRSQYQPELPPCLQGTTVRVELRDATIAADPSGEHTIKRFFPHT  60

Query  231   FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  410
             +GQPLAHFLRA+AKVPDAQIITEHP IRVG++FCGRQSPGGHN IWGL+DALKVHNPN+T
Sbjct  61    YGQPLAHFLRATAKVPDAQIITEHPVIRVGVLFCGRQSPGGHNVIWGLHDALKVHNPNNT  120

Query  411   llgflggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLK  590
             LLGFLGGSEGLFAQKTLEIT+D+LATYKNQGGYDMLGRTKDQIR+TEQVNA++ AC +LK
Sbjct  121   LLGFLGGSEGLFAQKTLEITNDVLATYKNQGGYDMLGRTKDQIRTTEQVNASMAACKALK  180

Query  591   LDGLVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICKV  770
             LDGLVI+GGVTSNTDAA LAE FAEAKCPTKVVGVPVTLNGDLKNQFVE NVGFDTICKV
Sbjct  181   LDGLVIIGGVTSNTDAAQLAEKFAEAKCPTKVVGVPVTLNGDLKNQFVEANVGFDTICKV  240

Query  771   NSQLISNVCTDALSAEKYYYFIRLMGRKTSHVALECTLQSHPNMVILAEEVAASKLTLFD  950
             NSQLISN+CTDALSAEKYYYFIRLMGRK SHVALECTLQSHPNMVIL EEVAASKLTLFD
Sbjct  241   NSQLISNMCTDALSAEKYYYFIRLMGRKASHVALECTLQSHPNMVILGEEVAASKLTLFD  300

Query  951   ITKQVCDAVQARAEQDKYHGVILLPEGLIESIPEIYALLKEIHVLLREGVSANNISSQLS  1130
             ITKQ+CDAVQARAE DK HGVILLPEGLIESIPE+YALL+EIH LLR+GVSA+ ISSQLS
Sbjct  301   ITKQICDAVQARAEHDKNHGVILLPEGLIESIPEVYALLQEIHGLLRQGVSADKISSQLS  360

Query  1131  PWASALFEFLPPFIRRELLLYPESDDSAQL  1220
             PWASALFEFLP FIR++LLLYPESDDSAQL
Sbjct  361   PWASALFEFLPYFIRKQLLLYPESDDSAQL  390



>gb|AAC67587.1| pyrophosphate-dependent phosphofructokinase alpha subunit [Citrus 
x paradisi]
Length=615

 Score =   681 bits (1756),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/390 (88%), Positives = 370/390 (95%), Gaps = 0/390 (0%)
 Frame = +3

Query  51    MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  230
             MDSDFG+ RELS LQ+LRS Y+PELPPCLQGTTVRVEFGD+TT ADP+  H+ISR FPHT
Sbjct  1     MDSDFGIPRELSGLQQLRSLYQPELPPCLQGTTVRVEFGDSTTTADPADTHSISRSFPHT  60

Query  231   FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  410
             +GQPLAHFLRA+AKVPDAQIITEHPAIRVGIVFCGRQSPGGHN +WGLYDA+K+HNP ST
Sbjct  61    YGQPLAHFLRATAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNVVWGLYDAIKLHNPKST  120

Query  411   llgflggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLK  590
             LLGFLGGSEGLFAQKTLE+T +I +TYKNQGGYDMLGRTKDQIR+TEQVNAALTAC +L 
Sbjct  121   LLGFLGGSEGLFAQKTLEVTKEIFSTYKNQGGYDMLGRTKDQIRTTEQVNAALTACKNLN  180

Query  591   LDGLVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICKV  770
             LDGLVI+GGVTSNTDAAYLAE FAEAKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICKV
Sbjct  181   LDGLVIIGGVTSNTDAAYLAETFAEAKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICKV  240

Query  771   NSQLISNVCTDALSAEKYYYFIRLMGRKTSHVALECTLQSHPNMVILAEEVAASKLTLFD  950
             NSQLISNVCTDALSAEKYYYFIRLMGR+ SHVALECTLQSHPNMVIL EEVAASKLTLFD
Sbjct  241   NSQLISNVCTDALSAEKYYYFIRLMGRRASHVALECTLQSHPNMVILGEEVAASKLTLFD  300

Query  951   ITKQVCDAVQARAEQDKYHGVILLPEGLIESIPEIYALLKEIHVLLREGVSANNISSQLS  1130
             +TKQ+CDAVQARAEQDK HGVILLPEGLIESIPE+YALLKEIH LLR+GV  +NISSQLS
Sbjct  301   LTKQICDAVQARAEQDKNHGVILLPEGLIESIPEVYALLKEIHSLLRQGVPVDNISSQLS  360

Query  1131  PWASALFEFLPPFIRRELLLYPESDDSAQL  1220
             PWASALFEFLPPFI+++LLLYPESDDSAQL
Sbjct  361   PWASALFEFLPPFIKKQLLLYPESDDSAQL  390



>gb|EYU36601.1| hypothetical protein MIMGU_mgv1a003013mg [Erythranthe guttata]
Length=616

 Score =   681 bits (1756),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 338/390 (87%), Positives = 370/390 (95%), Gaps = 0/390 (0%)
 Frame = +3

Query  51    MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  230
             MDSD+G+ARELSDLQKLRS Y+PELPPCLQGTTVRV FGDAT AADP+G HTISR FP T
Sbjct  1     MDSDYGIARELSDLQKLRSHYQPELPPCLQGTTVRVHFGDATAAADPTGAHTISRSFPLT  60

Query  231   FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  410
             +GQPLAHFLR++AKVPDAQIITEH A+RVG+VFCGRQSPGGHN IWGL++ALKVHNP S 
Sbjct  61    YGQPLAHFLRSTAKVPDAQIITEHAAVRVGVVFCGRQSPGGHNVIWGLHEALKVHNPKSV  120

Query  411   llgflggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLK  590
             LLGFLGGS+GLFAQKTLE+TD++LATYKNQGGYD+LGRTKDQIR+ EQVNAAL ACT+LK
Sbjct  121   LLGFLGGSDGLFAQKTLEVTDEVLATYKNQGGYDLLGRTKDQIRTIEQVNAALNACTALK  180

Query  591   LDGLVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICKV  770
             LD LVI+GGVTSNTDAA LAE FAE KCPTKVVG+PVTLNGDL+NQFVETNVGFDTICKV
Sbjct  181   LDALVIIGGVTSNTDAAQLAETFAERKCPTKVVGIPVTLNGDLRNQFVETNVGFDTICKV  240

Query  771   NSQLISNVCTDALSAEKYYYFIRLMGRKTSHVALECTLQSHPNMVILAEEVAASKLTLFD  950
             NSQLISNVCTDALSAEKYYYFIRLMGRK SHVALECTLQSHPNMVILAEEVAASKLT+FD
Sbjct  241   NSQLISNVCTDALSAEKYYYFIRLMGRKASHVALECTLQSHPNMVILAEEVAASKLTIFD  300

Query  951   ITKQVCDAVQARAEQDKYHGVILLPEGLIESIPEIYALLKEIHVLLREGVSANNISSQLS  1130
             IT Q+CDAVQARAEQDKYHGVILLPEGLIES PE++ALL+EIH LLR+GVSA+NIS+QLS
Sbjct  301   ITNQICDAVQARAEQDKYHGVILLPEGLIESFPEVFALLQEIHALLRQGVSADNISAQLS  360

Query  1131  PWASALFEFLPPFIRRELLLYPESDDSAQL  1220
             PWASALFEFLPPFIR++LLL+PESDDSAQL
Sbjct  361   PWASALFEFLPPFIRKQLLLHPESDDSAQL  390



>gb|AIE47261.1| pyrophosphate-dependent phosphofructokinase [Hevea brasiliensis]
Length=617

 Score =   680 bits (1755),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/390 (87%), Positives = 369/390 (95%), Gaps = 0/390 (0%)
 Frame = +3

Query  51    MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  230
             MDSDFG+ RELS+LQKLRS Y P+LPPCLQGTTVRVEFGD+TTAAD +G  TISR FPHT
Sbjct  1     MDSDFGIPRELSELQKLRSIYEPDLPPCLQGTTVRVEFGDSTTAADAAGARTISRYFPHT  60

Query  231   FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  410
             +GQPLAHFLRA+AKVPDA IITEHPA+RVGIVFCGRQSPGGHN +WGL +ALK+HNPNST
Sbjct  61    YGQPLAHFLRATAKVPDAHIITEHPAMRVGIVFCGRQSPGGHNVVWGLLNALKIHNPNST  120

Query  411   llgflggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLK  590
             LLGFLGGSEGLFAQ+TLEITD++L+TYKNQGGYD+LGRT+DQIR+TEQVNAALT C  +K
Sbjct  121   LLGFLGGSEGLFAQRTLEITDEVLSTYKNQGGYDLLGRTRDQIRTTEQVNAALTTCKDMK  180

Query  591   LDGLVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICKV  770
             LDGLVI+GGVTSNTDAA LAE FAEAKC TKVVGVPVTLNGDLKNQFVETNVGFDTICKV
Sbjct  181   LDGLVIIGGVTSNTDAAQLAETFAEAKCSTKVVGVPVTLNGDLKNQFVETNVGFDTICKV  240

Query  771   NSQLISNVCTDALSAEKYYYFIRLMGRKTSHVALECTLQSHPNMVILAEEVAASKLTLFD  950
             NSQLISNVCTDALSAEKYYYFIRLMGRK SHVALECTLQSHPNMVIL EEVAASKLTLFD
Sbjct  241   NSQLISNVCTDALSAEKYYYFIRLMGRKASHVALECTLQSHPNMVILGEEVAASKLTLFD  300

Query  951   ITKQVCDAVQARAEQDKYHGVILLPEGLIESIPEIYALLKEIHVLLREGVSANNISSQLS  1130
             +TKQ+CDAVQ RAEQDKYHGVILLPEGLIESIPE+YALLKEIH LLR+GV+ NNISSQLS
Sbjct  301   LTKQICDAVQVRAEQDKYHGVILLPEGLIESIPEVYALLKEIHGLLRQGVTPNNISSQLS  360

Query  1131  PWASALFEFLPPFIRRELLLYPESDDSAQL  1220
             PWASALFEFLPPFI+++LLLYPESDDSAQL
Sbjct  361   PWASALFEFLPPFIKKQLLLYPESDDSAQL  390



>ref|XP_006435472.1| hypothetical protein CICLE_v10000595mg [Citrus clementina]
 ref|XP_006473868.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha-like [Citrus sinensis]
 gb|ABY25305.1| pyrophosphate-dependent phosphofructokinase alpha subunit [Citrus 
sinensis x Citrus trifoliata]
 gb|ESR48712.1| hypothetical protein CICLE_v10000595mg [Citrus clementina]
 gb|KDO85266.1| hypothetical protein CISIN_1g006964mg [Citrus sinensis]
Length=615

 Score =   680 bits (1754),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 345/390 (88%), Positives = 370/390 (95%), Gaps = 0/390 (0%)
 Frame = +3

Query  51    MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  230
             MDSDFG+ RELS LQ+LRS Y+PELPPCLQGTTVRVEFGD+TT ADP+  H+ISR FPHT
Sbjct  1     MDSDFGIPRELSGLQQLRSLYQPELPPCLQGTTVRVEFGDSTTTADPADTHSISRSFPHT  60

Query  231   FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  410
             +GQPLAHFLRA+AKVPDAQIITEHPAIRVGIVFCGRQSPGGHN +WGLYDALK+HNP ST
Sbjct  61    YGQPLAHFLRATAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNVVWGLYDALKLHNPKST  120

Query  411   llgflggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLK  590
             LLGFLGGSEGLFAQKTLE+T +IL+TYKNQGGYDMLGRTKDQIR+TEQVNAALTAC +L 
Sbjct  121   LLGFLGGSEGLFAQKTLEVTKEILSTYKNQGGYDMLGRTKDQIRTTEQVNAALTACKNLN  180

Query  591   LDGLVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICKV  770
             LDGLVI+GGVTSNTDAAYLAE FAEAKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICKV
Sbjct  181   LDGLVIIGGVTSNTDAAYLAETFAEAKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICKV  240

Query  771   NSQLISNVCTDALSAEKYYYFIRLMGRKTSHVALECTLQSHPNMVILAEEVAASKLTLFD  950
             NSQLISNVCTDALSAEKYYYFIRLMGR+ SHVALECTLQSHPNMVIL EEVAASKLTLFD
Sbjct  241   NSQLISNVCTDALSAEKYYYFIRLMGRRASHVALECTLQSHPNMVILGEEVAASKLTLFD  300

Query  951   ITKQVCDAVQARAEQDKYHGVILLPEGLIESIPEIYALLKEIHVLLREGVSANNISSQLS  1130
             +TKQ+CDAVQARAEQDK HGVILLPEGLIESIPE+YALLKEIH LLR+GV  +NISSQLS
Sbjct  301   LTKQICDAVQARAEQDKNHGVILLPEGLIESIPEVYALLKEIHSLLRQGVPVDNISSQLS  360

Query  1131  PWASALFEFLPPFIRRELLLYPESDDSAQL  1220
             PWASALFEFLPPFI+++LLL PESDDSAQL
Sbjct  361   PWASALFEFLPPFIKKQLLLQPESDDSAQL  390



>ref|XP_011099944.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha-like [Sesamum indicum]
Length=626

 Score =   680 bits (1754),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/390 (88%), Positives = 371/390 (95%), Gaps = 0/390 (0%)
 Frame = +3

Query  51    MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  230
             MDSDFG+ARELS LQ LRSQY+P+LPPCLQGTTV VEFGDATTA DPS  HTISR FPHT
Sbjct  1     MDSDFGVARELSHLQNLRSQYQPQLPPCLQGTTVSVEFGDATTAPDPSDTHTISRFFPHT  60

Query  231   FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  410
             +GQPLAHFLRA+AKVP+AQ+ITE+PA+RVG+VFCGRQSPGGHN IWGL DALKVHNP ST
Sbjct  61    YGQPLAHFLRATAKVPNAQVITEYPAVRVGVVFCGRQSPGGHNVIWGLLDALKVHNPEST  120

Query  411   llgflggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLK  590
             LLGFLGGSEGLFAQKTLEITDDIL TYKNQGGYD+LGRTKDQIR+TEQVNAAL+ACT+LK
Sbjct  121   LLGFLGGSEGLFAQKTLEITDDILRTYKNQGGYDLLGRTKDQIRTTEQVNAALSACTTLK  180

Query  591   LDGLVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICKV  770
             LD LVI+GGVTSNTDAA LAE FAE KCPTKVVG+PVTLNGDLKNQFVETNVGFDTICKV
Sbjct  181   LDALVIIGGVTSNTDAAQLAETFAERKCPTKVVGIPVTLNGDLKNQFVETNVGFDTICKV  240

Query  771   NSQLISNVCTDALSAEKYYYFIRLMGRKTSHVALECTLQSHPNMVILAEEVAASKLTLFD  950
             NSQLISNVCTDALSAEKYYYFIRLMGRK SHVALECTLQSHPNMVILAEEVAASKLTLFD
Sbjct  241   NSQLISNVCTDALSAEKYYYFIRLMGRKASHVALECTLQSHPNMVILAEEVAASKLTLFD  300

Query  951   ITKQVCDAVQARAEQDKYHGVILLPEGLIESIPEIYALLKEIHVLLREGVSANNISSQLS  1130
             ITKQ+CDAVQ RA QDK+HGVILLPEGLIESIPE+YALL+EIH LLREGVSA++IS+QLS
Sbjct  301   ITKQICDAVQTRAGQDKHHGVILLPEGLIESIPEVYALLQEIHRLLREGVSADSISAQLS  360

Query  1131  PWASALFEFLPPFIRRELLLYPESDDSAQL  1220
             PW+SALFEFLPPFIR++LLL+PESDDSAQL
Sbjct  361   PWSSALFEFLPPFIRKQLLLHPESDDSAQL  390



>ref|XP_009777872.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha [Nicotiana sylvestris]
Length=616

 Score =   679 bits (1753),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 343/390 (88%), Positives = 370/390 (95%), Gaps = 0/390 (0%)
 Frame = +3

Query  51    MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  230
             MD+D+G+ RELSDLQKLRSQY+PELPPCLQGTTVRVE  DATTAADPSG HTI R FPHT
Sbjct  1     MDADYGIPRELSDLQKLRSQYQPELPPCLQGTTVRVELRDATTAADPSGEHTIKRFFPHT  60

Query  231   FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  410
             +GQPLAHFLRA+AKVPDAQIITEHP IRVG++FCGRQSPGGHN +WGL+DALKVHNPN+T
Sbjct  61    YGQPLAHFLRATAKVPDAQIITEHPVIRVGVLFCGRQSPGGHNVLWGLHDALKVHNPNNT  120

Query  411   llgflggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLK  590
             LLGFLGGSEGLFAQKTLEIT+D+LATYKNQGGYDMLGRTKDQIR+TEQVN+A+ AC +LK
Sbjct  121   LLGFLGGSEGLFAQKTLEITNDVLATYKNQGGYDMLGRTKDQIRTTEQVNSAMAACKALK  180

Query  591   LDGLVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICKV  770
             LDGLVI+GGVTSNTDAA LAE FAEAKCPTKVVGVPVTLNGDLKNQFVE NVGFDTICKV
Sbjct  181   LDGLVIIGGVTSNTDAAQLAEKFAEAKCPTKVVGVPVTLNGDLKNQFVEANVGFDTICKV  240

Query  771   NSQLISNVCTDALSAEKYYYFIRLMGRKTSHVALECTLQSHPNMVILAEEVAASKLTLFD  950
             NSQLISN+CTDALSAEKYYYFIRLMGRK SHVALECTLQSHPNMVIL EEVAASKLTLFD
Sbjct  241   NSQLISNMCTDALSAEKYYYFIRLMGRKASHVALECTLQSHPNMVILGEEVAASKLTLFD  300

Query  951   ITKQVCDAVQARAEQDKYHGVILLPEGLIESIPEIYALLKEIHVLLREGVSANNISSQLS  1130
             ITKQ+CDAVQARAE DK HGVILLPEGLIESIPE+YALL+EIH LLR+GVSA+ ISSQLS
Sbjct  301   ITKQICDAVQARAEHDKNHGVILLPEGLIESIPEVYALLQEIHGLLRQGVSADKISSQLS  360

Query  1131  PWASALFEFLPPFIRRELLLYPESDDSAQL  1220
             PWASALFEFLP FIR++LLL+PESDDSAQL
Sbjct  361   PWASALFEFLPYFIRKQLLLHPESDDSAQL  390



>ref|XP_009759651.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha [Nicotiana sylvestris]
Length=616

 Score =   679 bits (1752),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 342/390 (88%), Positives = 369/390 (95%), Gaps = 0/390 (0%)
 Frame = +3

Query  51    MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  230
             MD+D+G+ARELSDLQK RSQY+PELPPCLQGTTVRVE GDATTA+DPSG HTISR FPHT
Sbjct  1     MDADYGIARELSDLQKHRSQYQPELPPCLQGTTVRVELGDATTASDPSGEHTISRSFPHT  60

Query  231   FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  410
             +GQPLAHFLRA+AKV DAQIITEHPA RVG+VFCGRQSPGGHN IWG++DALK+HNPNST
Sbjct  61    YGQPLAHFLRATAKVTDAQIITEHPAKRVGVVFCGRQSPGGHNVIWGIHDALKIHNPNST  120

Query  411   llgflggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLK  590
             LLGFLGGSEGLFAQKTLEIT+D+L+TYKNQGGYDMLGRTKDQIRSTEQVNAA+ AC +LK
Sbjct  121   LLGFLGGSEGLFAQKTLEITNDVLSTYKNQGGYDMLGRTKDQIRSTEQVNAAMAACKTLK  180

Query  591   LDGLVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICKV  770
             LD L+IVGGVTSNTDAA LAE F EAKC TKVVGVPVTLNGDLKNQFVE NVGFDTICKV
Sbjct  181   LDALIIVGGVTSNTDAAQLAETFTEAKCQTKVVGVPVTLNGDLKNQFVEINVGFDTICKV  240

Query  771   NSQLISNVCTDALSAEKYYYFIRLMGRKTSHVALECTLQSHPNMVILAEEVAASKLTLFD  950
             NSQLISNVCTDALSAEKYYYFIRLMGRK SHVALECTLQSHPNMVIL EEVAASKLTLFD
Sbjct  241   NSQLISNVCTDALSAEKYYYFIRLMGRKASHVALECTLQSHPNMVILGEEVAASKLTLFD  300

Query  951   ITKQVCDAVQARAEQDKYHGVILLPEGLIESIPEIYALLKEIHVLLREGVSANNISSQLS  1130
             IT ++CDAVQARAEQDK HGV+LLPEGLIESIPE+YALL+EIH LLR+GVSA+ ISSQLS
Sbjct  301   ITNKICDAVQARAEQDKNHGVVLLPEGLIESIPEVYALLQEIHGLLRQGVSADKISSQLS  360

Query  1131  PWASALFEFLPPFIRRELLLYPESDDSAQL  1220
             PWASALFEFLPPFI+++LLLYPESDDSAQL
Sbjct  361   PWASALFEFLPPFIKKQLLLYPESDDSAQL  390



>ref|XP_004253113.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha-like [Solanum lycopersicum]
Length=617

 Score =   678 bits (1749),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 342/390 (88%), Positives = 370/390 (95%), Gaps = 0/390 (0%)
 Frame = +3

Query  51    MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  230
             MD+D+G+ARELSDLQKLRSQY+PELPPCLQGTTVRVE GDATTAADPSG H ISR FPHT
Sbjct  1     MDADYGIARELSDLQKLRSQYQPELPPCLQGTTVRVELGDATTAADPSGEHVISRSFPHT  60

Query  231   FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  410
             +GQPLAHFLRA+AKV DAQIITEHPA RVGIVFCGRQSPGGHN IWG++DALK+HNPNST
Sbjct  61    YGQPLAHFLRATAKVSDAQIITEHPAKRVGIVFCGRQSPGGHNVIWGIHDALKIHNPNST  120

Query  411   llgflggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLK  590
             LLGFLGGSEGLFAQKTLEIT+DILATYKNQGGYDMLGRTKDQIR+TEQVNAA+ AC +LK
Sbjct  121   LLGFLGGSEGLFAQKTLEITNDILATYKNQGGYDMLGRTKDQIRTTEQVNAAMAACKALK  180

Query  591   LDGLVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICKV  770
             LD L+I+GGVTSNTDAA LAE FAEAKC TKVVGVPVTLNGDLKNQFVETNVGFDTICKV
Sbjct  181   LDALIIIGGVTSNTDAAQLAETFAEAKCQTKVVGVPVTLNGDLKNQFVETNVGFDTICKV  240

Query  771   NSQLISNVCTDALSAEKYYYFIRLMGRKTSHVALECTLQSHPNMVILAEEVAASKLTLFD  950
             NSQLISN+CTDALSAEKYYYFIRLMGRK SHVALECTLQSHPNMVIL EEV+ASKLTLFD
Sbjct  241   NSQLISNMCTDALSAEKYYYFIRLMGRKASHVALECTLQSHPNMVILGEEVSASKLTLFD  300

Query  951   ITKQVCDAVQARAEQDKYHGVILLPEGLIESIPEIYALLKEIHVLLREGVSANNISSQLS  1130
             IT ++CD VQARAEQDK HGVILLPEGLIESIPE+YALL+EIH LL++GVSA+ ISSQLS
Sbjct  301   ITNKICDTVQARAEQDKNHGVILLPEGLIESIPEVYALLQEIHGLLKQGVSADKISSQLS  360

Query  1131  PWASALFEFLPPFIRRELLLYPESDDSAQL  1220
             PWASALFEFLPPFI+++LLL+PESDDSAQL
Sbjct  361   PWASALFEFLPPFIKKQLLLHPESDDSAQL  390



>gb|KCW70371.1| hypothetical protein EUGRSUZ_F03611 [Eucalyptus grandis]
Length=520

 Score =   673 bits (1737),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 343/390 (88%), Positives = 366/390 (94%), Gaps = 0/390 (0%)
 Frame = +3

Query  51    MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  230
             MDSD+G+ RELSDLQK RS Y PELPPCLQGTTVRVE+GDATTAADP+  H+ISR FPHT
Sbjct  1     MDSDYGIPRELSDLQKQRSLYHPELPPCLQGTTVRVEYGDATTAADPADVHSISRYFPHT  60

Query  231   FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  410
             +GQPLAHFLRA+A VPDA IITEHP IRVGIVFCGRQSPGGHN IWGLY ALK+HNP + 
Sbjct  61    YGQPLAHFLRATANVPDALIITEHPPIRVGIVFCGRQSPGGHNVIWGLYHALKIHNPKNV  120

Query  411   llgflggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLK  590
             LLGFLGGSEGLFAQKTLEITDDIL+TYKNQGGYD+LGRTKDQIR+TEQVNAAL +C  LK
Sbjct  121   LLGFLGGSEGLFAQKTLEITDDILSTYKNQGGYDLLGRTKDQIRTTEQVNAALISCNDLK  180

Query  591   LDGLVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICKV  770
             LDGLVI+GGVTSNTDAA LAE FAEAKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICKV
Sbjct  181   LDGLVIIGGVTSNTDAAQLAETFAEAKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICKV  240

Query  771   NSQLISNVCTDALSAEKYYYFIRLMGRKTSHVALECTLQSHPNMVILAEEVAASKLTLFD  950
             NSQLISNVCTDALSAEKYYYFIRLMGRK SHVALECTLQSHPNMVIL EEVAASKLTLFD
Sbjct  241   NSQLISNVCTDALSAEKYYYFIRLMGRKASHVALECTLQSHPNMVILGEEVAASKLTLFD  300

Query  951   ITKQVCDAVQARAEQDKYHGVILLPEGLIESIPEIYALLKEIHVLLREGVSANNISSQLS  1130
             ITKQ+CDAVQARA Q+KYHGVILLPEGLIESIPE+YALLKEIH LL+ GVSA+NISSQLS
Sbjct  301   ITKQICDAVQARAVQEKYHGVILLPEGLIESIPEVYALLKEIHGLLKLGVSADNISSQLS  360

Query  1131  PWASALFEFLPPFIRRELLLYPESDDSAQL  1220
             PWASALFEFLPPFIR++L+L+PESDDSAQL
Sbjct  361   PWASALFEFLPPFIRKQLILFPESDDSAQL  390



>gb|AHZ08764.1| pyrophosphate--fructose 6-phosphate 1-phosphotransferase [Nicotiana 
tabacum]
Length=616

 Score =   676 bits (1745),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 340/390 (87%), Positives = 368/390 (94%), Gaps = 0/390 (0%)
 Frame = +3

Query  51    MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  230
             MD+D+G+ARELSDLQK RSQY+PELPPCLQGTTVRVE GD TTA+DPSG HTISR FPHT
Sbjct  1     MDADYGIARELSDLQKHRSQYQPELPPCLQGTTVRVELGDTTTASDPSGEHTISRSFPHT  60

Query  231   FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  410
             +GQPLAHFLRA+AKV DAQIITEHPA RVG+VFCGRQSPGGHN IWG++DALK+HNPNST
Sbjct  61    YGQPLAHFLRATAKVTDAQIITEHPAKRVGVVFCGRQSPGGHNVIWGIHDALKIHNPNST  120

Query  411   llgflggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLK  590
             LLGFLGGSEGLFAQKTLEIT+D+L+TYKNQGGYDMLGRTKDQIRSTEQV+AA+ AC +LK
Sbjct  121   LLGFLGGSEGLFAQKTLEITNDVLSTYKNQGGYDMLGRTKDQIRSTEQVSAAMAACKTLK  180

Query  591   LDGLVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICKV  770
             LD L+IVGGVTSNTDAA LAE F EAKC TKVVGVPVTLNGDLKNQFVE NVGFDTICKV
Sbjct  181   LDALIIVGGVTSNTDAAQLAETFTEAKCQTKVVGVPVTLNGDLKNQFVEINVGFDTICKV  240

Query  771   NSQLISNVCTDALSAEKYYYFIRLMGRKTSHVALECTLQSHPNMVILAEEVAASKLTLFD  950
             NSQLISNVCTDALSAEKYYYFIRLMGRK SHVALECTLQSHPNMVIL EEVAASKLTLFD
Sbjct  241   NSQLISNVCTDALSAEKYYYFIRLMGRKASHVALECTLQSHPNMVILGEEVAASKLTLFD  300

Query  951   ITKQVCDAVQARAEQDKYHGVILLPEGLIESIPEIYALLKEIHVLLREGVSANNISSQLS  1130
             IT ++CDAVQARAEQDK HGV+LLPEGLIESIPE+YALL+EIH LLR+GVSA+ ISSQLS
Sbjct  301   ITNKICDAVQARAEQDKNHGVVLLPEGLIESIPEVYALLQEIHGLLRQGVSADKISSQLS  360

Query  1131  PWASALFEFLPPFIRRELLLYPESDDSAQL  1220
             PWASALFEFLPPFI+++LLLYPESDDSAQL
Sbjct  361   PWASALFEFLPPFIKKQLLLYPESDDSAQL  390



>ref|XP_009607500.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha {ECO:0000255|HAMAP-Rule:MF_03185}-like 
[Nicotiana tomentosiformis]
Length=616

 Score =   676 bits (1743),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/390 (87%), Positives = 370/390 (95%), Gaps = 0/390 (0%)
 Frame = +3

Query  51    MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  230
             MD+D+G+ARELSDLQK RSQY+PELPPCLQGTTVRVE GDATTA+DPSG HTISR FPHT
Sbjct  1     MDADYGIARELSDLQKHRSQYQPELPPCLQGTTVRVELGDATTASDPSGEHTISRSFPHT  60

Query  231   FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  410
             +GQPLAHFLRA+AKV DAQIITEHPA RVG+VFCGRQSPGGHN IWG++DALK+HNPNS+
Sbjct  61    YGQPLAHFLRATAKVADAQIITEHPAKRVGVVFCGRQSPGGHNVIWGIHDALKIHNPNSS  120

Query  411   llgflggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLK  590
             LLGFLGGSEGLFAQKTLEIT+D+L+TYKNQGGYDMLGRTKDQIR+TEQVNAA+ AC +LK
Sbjct  121   LLGFLGGSEGLFAQKTLEITNDVLSTYKNQGGYDMLGRTKDQIRTTEQVNAAMAACKALK  180

Query  591   LDGLVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICKV  770
             LD L+I+GGVTSNTDAA LAE FAEAKC TKVVGVPVTLNGDLKNQFVETNVGFDTICKV
Sbjct  181   LDALIIIGGVTSNTDAAQLAETFAEAKCQTKVVGVPVTLNGDLKNQFVETNVGFDTICKV  240

Query  771   NSQLISNVCTDALSAEKYYYFIRLMGRKTSHVALECTLQSHPNMVILAEEVAASKLTLFD  950
             NSQLISNVCTDALSAEKYYYFIRLMGRK SHVALECTLQSH NMVIL EEVAASKLTLFD
Sbjct  241   NSQLISNVCTDALSAEKYYYFIRLMGRKASHVALECTLQSHLNMVILGEEVAASKLTLFD  300

Query  951   ITKQVCDAVQARAEQDKYHGVILLPEGLIESIPEIYALLKEIHVLLREGVSANNISSQLS  1130
             IT ++CDAVQARAEQDK HGVILLPEGLIESIPE+YALL+EIH LLR+GVSA+ ISSQLS
Sbjct  301   ITNKICDAVQARAEQDKNHGVILLPEGLIESIPEVYALLQEIHGLLRQGVSADKISSQLS  360

Query  1131  PWASALFEFLPPFIRRELLLYPESDDSAQL  1220
             PWASALFEFLPPFI+++LLLYPESDDSAQL
Sbjct  361   PWASALFEFLPPFIKKQLLLYPESDDSAQL  390



>gb|KHG12069.1| Pyrophosphate--fructose 6-phosphate 1-phosphotransferase subunit 
alpha [Gossypium arboreum]
Length=616

 Score =   676 bits (1743),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 340/390 (87%), Positives = 368/390 (94%), Gaps = 0/390 (0%)
 Frame = +3

Query  51    MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  230
             MDSD+G+ RELSDLQKLRSQY+P+LPPCL+GTTVRVEFGD TT+ DP+  HTI+R FPHT
Sbjct  1     MDSDYGIPRELSDLQKLRSQYQPQLPPCLEGTTVRVEFGDTTTSLDPADAHTIARAFPHT  60

Query  231   FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  410
             +G+PLAHFLRA+AKVPDAQIITEHPAIRVG+VFCGRQSPGGHN +WGL+ ALK+HNPNST
Sbjct  61    YGKPLAHFLRATAKVPDAQIITEHPAIRVGLVFCGRQSPGGHNVVWGLHKALKIHNPNST  120

Query  411   llgflggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLK  590
             LLGFLGG++GLFAQKTLEITDDIL+TYKNQGGYD+LGRT+DQIR+TEQV AAL AC  LK
Sbjct  121   LLGFLGGTQGLFAQKTLEITDDILSTYKNQGGYDLLGRTQDQIRTTEQVKAALAACNDLK  180

Query  591   LDGLVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICKV  770
             LDGLVI+GGVTSNTDAA LAE FAEAKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICKV
Sbjct  181   LDGLVIIGGVTSNTDAAQLAETFAEAKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICKV  240

Query  771   NSQLISNVCTDALSAEKYYYFIRLMGRKTSHVALECTLQSHPNMVILAEEVAASKLTLFD  950
             NSQLISNVCTDALSAEKYYYFIRLMGRK SHVALECTLQSHPNMVIL EEVAASKLTLFD
Sbjct  241   NSQLISNVCTDALSAEKYYYFIRLMGRKASHVALECTLQSHPNMVILGEEVAASKLTLFD  300

Query  951   ITKQVCDAVQARAEQDKYHGVILLPEGLIESIPEIYALLKEIHVLLREGVSANNISSQLS  1130
             ITKQ+CDAVQARAEQDK HGVILLPEGLIESIPE+YALLKEIH LLR+ VSA+ ISSQLS
Sbjct  301   ITKQICDAVQARAEQDKNHGVILLPEGLIESIPEVYALLKEIHSLLRQNVSADKISSQLS  360

Query  1131  PWASALFEFLPPFIRRELLLYPESDDSAQL  1220
             PWASALFEFLP FIR++LLL PESDDSAQL
Sbjct  361   PWASALFEFLPHFIRKQLLLQPESDDSAQL  390



>ref|XP_010063177.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha [Eucalyptus grandis]
 gb|KCW70370.1| hypothetical protein EUGRSUZ_F03611 [Eucalyptus grandis]
Length=616

 Score =   674 bits (1740),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 343/390 (88%), Positives = 366/390 (94%), Gaps = 0/390 (0%)
 Frame = +3

Query  51    MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  230
             MDSD+G+ RELSDLQK RS Y PELPPCLQGTTVRVE+GDATTAADP+  H+ISR FPHT
Sbjct  1     MDSDYGIPRELSDLQKQRSLYHPELPPCLQGTTVRVEYGDATTAADPADVHSISRYFPHT  60

Query  231   FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  410
             +GQPLAHFLRA+A VPDA IITEHP IRVGIVFCGRQSPGGHN IWGLY ALK+HNP + 
Sbjct  61    YGQPLAHFLRATANVPDALIITEHPPIRVGIVFCGRQSPGGHNVIWGLYHALKIHNPKNV  120

Query  411   llgflggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLK  590
             LLGFLGGSEGLFAQKTLEITDDIL+TYKNQGGYD+LGRTKDQIR+TEQVNAAL +C  LK
Sbjct  121   LLGFLGGSEGLFAQKTLEITDDILSTYKNQGGYDLLGRTKDQIRTTEQVNAALISCNDLK  180

Query  591   LDGLVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICKV  770
             LDGLVI+GGVTSNTDAA LAE FAEAKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICKV
Sbjct  181   LDGLVIIGGVTSNTDAAQLAETFAEAKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICKV  240

Query  771   NSQLISNVCTDALSAEKYYYFIRLMGRKTSHVALECTLQSHPNMVILAEEVAASKLTLFD  950
             NSQLISNVCTDALSAEKYYYFIRLMGRK SHVALECTLQSHPNMVIL EEVAASKLTLFD
Sbjct  241   NSQLISNVCTDALSAEKYYYFIRLMGRKASHVALECTLQSHPNMVILGEEVAASKLTLFD  300

Query  951   ITKQVCDAVQARAEQDKYHGVILLPEGLIESIPEIYALLKEIHVLLREGVSANNISSQLS  1130
             ITKQ+CDAVQARA Q+KYHGVILLPEGLIESIPE+YALLKEIH LL+ GVSA+NISSQLS
Sbjct  301   ITKQICDAVQARAVQEKYHGVILLPEGLIESIPEVYALLKEIHGLLKLGVSADNISSQLS  360

Query  1131  PWASALFEFLPPFIRRELLLYPESDDSAQL  1220
             PWASALFEFLPPFIR++L+L+PESDDSAQL
Sbjct  361   PWASALFEFLPPFIRKQLILFPESDDSAQL  390



>ref|XP_010094500.1| Pyrophosphate--fructose 6-phosphate 1-phosphotransferase subunit 
alpha [Morus notabilis]
 gb|EXB56254.1| Pyrophosphate--fructose 6-phosphate 1-phosphotransferase subunit 
alpha [Morus notabilis]
Length=631

 Score =   674 bits (1738),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 350/404 (87%), Positives = 368/404 (91%), Gaps = 14/404 (3%)
 Frame = +3

Query  51    MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  230
             MDSD+G+ RELSDLQKLRS Y+P LPPCL+GTTVRVEFGDATT  DP+  HTISR FPHT
Sbjct  1     MDSDYGIPRELSDLQKLRSLYQPVLPPCLEGTTVRVEFGDATTTLDPTDVHTISRSFPHT  60

Query  231   FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  410
             +GQPLAHFLRA+AKVPDA IITEHPA RVGIVFCGRQSPGGHN IWGLY+ALK+HNPNST
Sbjct  61    YGQPLAHFLRATAKVPDAHIITEHPAKRVGIVFCGRQSPGGHNVIWGLYNALKLHNPNST  120

Query  411   llgflggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLK  590
             LLGFLGGSEGLFAQKTLEITDDILATYKNQGGYD+LGRTKDQIR+ EQVNAALTAC  LK
Sbjct  121   LLGFLGGSEGLFAQKTLEITDDILATYKNQGGYDLLGRTKDQIRTIEQVNAALTACKDLK  180

Query  591   LDGLVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICKV  770
             L GLVI+GGVTS TDAA LAE FAEAKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICKV
Sbjct  181   LVGLVIIGGVTSTTDAAQLAETFAEAKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICKV  240

Query  771   NSQLISNVCTDALSAEKYYYFIRLMGRKTSHVALECTLQSHPNMVILAEEVAASKLTLFD  950
             NSQLISNVCTDALSAEKYYYFIRLMGRK SHVALECTLQSHPNMVIL EEVAASKLTLFD
Sbjct  241   NSQLISNVCTDALSAEKYYYFIRLMGRKHSHVALECTLQSHPNMVILGEEVAASKLTLFD  300

Query  951   ITKQVCDAVQARAEQ--------------DKYHGVILLPEGLIESIPEIYALLKEIHVLL  1088
             ITKQ+CDAVQARAEQ              DKYHGVILLPEGLIESIPE+YALLKEIH LL
Sbjct  301   ITKQICDAVQARAEQVSFLSWLLKQRIWTDKYHGVILLPEGLIESIPEVYALLKEIHGLL  360

Query  1089  REGVSANNISSQLSPWASALFEFLPPFIRRELLLYPESDDSAQL  1220
             R+GVS +NISSQLSPWASALFEFLPPFI+R+LLLYPESDDSAQL
Sbjct  361   RQGVSVDNISSQLSPWASALFEFLPPFIKRQLLLYPESDDSAQL  404



>ref|XP_008453023.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha [Cucumis melo]
Length=619

 Score =   673 bits (1736),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 340/390 (87%), Positives = 365/390 (94%), Gaps = 0/390 (0%)
 Frame = +3

Query  51    MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  230
             MDSD+G+ R+LSDLQK+RS Y+P+LPPCLQGT VRVEFGDATTA DP+   TI R FPHT
Sbjct  1     MDSDYGIPRQLSDLQKIRSLYQPDLPPCLQGTAVRVEFGDATTAVDPADAPTICRAFPHT  60

Query  231   FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  410
             +GQPLAHFLRA+AKVPDAQIITEHPAIRVG+VFCGRQSPGGHN IWGL+DALK+HNPNS 
Sbjct  61    YGQPLAHFLRATAKVPDAQIITEHPAIRVGVVFCGRQSPGGHNVIWGLHDALKIHNPNSI  120

Query  411   llgflggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLK  590
             L GFLGGSEGLFAQKTLEITDDIL+TYKNQGGYD+LGRTKDQIR+ EQVNAAL  C  LK
Sbjct  121   LFGFLGGSEGLFAQKTLEITDDILSTYKNQGGYDLLGRTKDQIRTKEQVNAALKTCLDLK  180

Query  591   LDGLVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICKV  770
             LDGLVI+GGVTSNTDAA LAE FAEAKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICKV
Sbjct  181   LDGLVIIGGVTSNTDAAQLAETFAEAKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICKV  240

Query  771   NSQLISNVCTDALSAEKYYYFIRLMGRKTSHVALECTLQSHPNMVILAEEVAASKLTLFD  950
             NSQLISNVCTDALSAEKYYYFIRLMGRK SHVALECTLQSHPN+VIL EEVAASKLTLFD
Sbjct  241   NSQLISNVCTDALSAEKYYYFIRLMGRKASHVALECTLQSHPNLVILGEEVAASKLTLFD  300

Query  951   ITKQVCDAVQARAEQDKYHGVILLPEGLIESIPEIYALLKEIHVLLREGVSANNISSQLS  1130
             +T Q+CDAVQARA+QDKYHGVILLPEGLIESIPEIYALLKEIH LLR+GV  +NISSQLS
Sbjct  301   LTTQICDAVQARAQQDKYHGVILLPEGLIESIPEIYALLKEIHSLLRQGVLVDNISSQLS  360

Query  1131  PWASALFEFLPPFIRRELLLYPESDDSAQL  1220
             PWASALFEFLPPFIR++LLL+PESDDSAQL
Sbjct  361   PWASALFEFLPPFIRKQLLLHPESDDSAQL  390



>sp|P21342.2|PFPA_SOLTU RecName: Full=Pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha; Short=PFP; AltName: Full=6-phosphofructokinase, 
pyrophosphate dependent; AltName: Full=PPi-PFK; 
AltName: Full=Pyrophosphate-dependent 6-phosphofructose-1-kinase 
[Solanum tuberosum]
Length=616

 Score =   672 bits (1734),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/390 (87%), Positives = 366/390 (94%), Gaps = 0/390 (0%)
 Frame = +3

Query  51    MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  230
             MD+D+G+ RELSDLQKLRS Y PELPPCLQGTTVRVE  DATTAADPSG HTI R FPHT
Sbjct  1     MDADYGIPRELSDLQKLRSHYHPELPPCLQGTTVRVELRDATTAADPSGEHTIKRFFPHT  60

Query  231   FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  410
             +GQPLAHFLRA+AKVPDAQIITEHPAIRVG++FCGRQSPGGHN IWGL+DALKVHNP + 
Sbjct  61    YGQPLAHFLRATAKVPDAQIITEHPAIRVGVLFCGRQSPGGHNVIWGLHDALKVHNPKNI  120

Query  411   llgflggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLK  590
             LLGFLGGSEGLFAQKTLEITDD+LATYKNQGGYDMLGRTKDQIR+TEQVNAA+ AC +LK
Sbjct  121   LLGFLGGSEGLFAQKTLEITDDVLATYKNQGGYDMLGRTKDQIRTTEQVNAAMAACKALK  180

Query  591   LDGLVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICKV  770
             LDGLVI+GGVTSNTDAA+LAE FAE KC TKVVGVPVTLNGDLKNQFVE NVGFDTICKV
Sbjct  181   LDGLVIIGGVTSNTDAAHLAEKFAETKCLTKVVGVPVTLNGDLKNQFVEANVGFDTICKV  240

Query  771   NSQLISNVCTDALSAEKYYYFIRLMGRKTSHVALECTLQSHPNMVILAEEVAASKLTLFD  950
             NSQLISNVCTDALSAEKYYYFIRLMGRK SHVALECTLQSHPNMVIL EEVAASKLT+FD
Sbjct  241   NSQLISNVCTDALSAEKYYYFIRLMGRKASHVALECTLQSHPNMVILGEEVAASKLTIFD  300

Query  951   ITKQVCDAVQARAEQDKYHGVILLPEGLIESIPEIYALLKEIHVLLREGVSANNISSQLS  1130
             IT+Q+CDAVQARAE DK HGVILLPEGLIESIPE+YALL+EIH LLR+GVSA+ ISSQLS
Sbjct  301   ITQQICDAVQARAEHDKNHGVILLPEGLIESIPEVYALLQEIHGLLRQGVSADKISSQLS  360

Query  1131  PWASALFEFLPPFIRRELLLYPESDDSAQL  1220
             PWASALFEFLP FIR++LLL+PESDDSAQL
Sbjct  361   PWASALFEFLPHFIRKQLLLHPESDDSAQL  390



>ref|XP_006342524.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha-like [Solanum tuberosum]
Length=617

 Score =   672 bits (1734),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/390 (87%), Positives = 367/390 (94%), Gaps = 0/390 (0%)
 Frame = +3

Query  51    MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  230
             MD+D+G+ARELSDLQKLRSQY+PELPPCLQGTTVRVE GDATTAAD SG H ISR FPHT
Sbjct  1     MDADYGIARELSDLQKLRSQYQPELPPCLQGTTVRVELGDATTAADHSGEHVISRSFPHT  60

Query  231   FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  410
             +GQPLAHFLRA+AKV DAQIITEHPA RVGIVFCGRQSPGGHN IWG++DALK+HNPNST
Sbjct  61    YGQPLAHFLRATAKVSDAQIITEHPAKRVGIVFCGRQSPGGHNVIWGIHDALKIHNPNST  120

Query  411   llgflggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLK  590
             LLGFLGGSEGLFAQKTLEIT+DILATYKNQGGYDMLGRTKDQIR+TEQVNAA+ AC +LK
Sbjct  121   LLGFLGGSEGLFAQKTLEITNDILATYKNQGGYDMLGRTKDQIRTTEQVNAAMAACKALK  180

Query  591   LDGLVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICKV  770
             LD L+I+GGVTSNTDAA LAE FAEAKC TKVVGVPVTLNGDLKNQFVETNVGFDTICKV
Sbjct  181   LDALIIIGGVTSNTDAAQLAETFAEAKCQTKVVGVPVTLNGDLKNQFVETNVGFDTICKV  240

Query  771   NSQLISNVCTDALSAEKYYYFIRLMGRKTSHVALECTLQSHPNMVILAEEVAASKLTLFD  950
             NSQLISN+CTDALSAEKYYYFIRLMGRK SHVALECTLQSHPNMVIL EEVAASKLTLFD
Sbjct  241   NSQLISNMCTDALSAEKYYYFIRLMGRKASHVALECTLQSHPNMVILGEEVAASKLTLFD  300

Query  951   ITKQVCDAVQARAEQDKYHGVILLPEGLIESIPEIYALLKEIHVLLREGVSANNISSQLS  1130
             IT ++CD VQARAEQDK HGVILLPEGLIESIPE+YALL+EIH LL +GVS + ISSQLS
Sbjct  301   ITNKICDTVQARAEQDKNHGVILLPEGLIESIPEVYALLQEIHGLLTQGVSTDKISSQLS  360

Query  1131  PWASALFEFLPPFIRRELLLYPESDDSAQL  1220
             PWASALFEFLPPFI+++LLL+PESDDSAQL
Sbjct  361   PWASALFEFLPPFIKKQLLLHPESDDSAQL  390



>gb|KJB29713.1| hypothetical protein B456_005G115600 [Gossypium raimondii]
Length=616

 Score =   672 bits (1733),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 338/390 (87%), Positives = 366/390 (94%), Gaps = 0/390 (0%)
 Frame = +3

Query  51    MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  230
             MDSD+G+ RELSDLQKLRSQY+P+LPPCL+GTTVRVEFGD TT+ DP+  HTI+R FPHT
Sbjct  1     MDSDYGIPRELSDLQKLRSQYQPQLPPCLEGTTVRVEFGDTTTSLDPADAHTIARAFPHT  60

Query  231   FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  410
             +G+PLAHFLRA+AKVPDAQIITEHP IRVG+VFCGRQSP GHN +WGL+ ALK+HNPNST
Sbjct  61    YGKPLAHFLRATAKVPDAQIITEHPTIRVGLVFCGRQSPAGHNVVWGLHKALKIHNPNST  120

Query  411   llgflggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLK  590
             LLGFLGG++GLFAQKTLEITDDIL+TYKNQGGYD+LGRT+DQIR+TEQV AAL AC  LK
Sbjct  121   LLGFLGGTQGLFAQKTLEITDDILSTYKNQGGYDLLGRTQDQIRTTEQVKAALAACNDLK  180

Query  591   LDGLVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICKV  770
             LDGLVI+GGVTSNTDAA LAE FAEAKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICKV
Sbjct  181   LDGLVIIGGVTSNTDAAQLAETFAEAKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICKV  240

Query  771   NSQLISNVCTDALSAEKYYYFIRLMGRKTSHVALECTLQSHPNMVILAEEVAASKLTLFD  950
             NSQLISNVCTDALSAEKYYYFIRLMGRK SHVALECTLQSHPNMVIL EEVAASKLTLFD
Sbjct  241   NSQLISNVCTDALSAEKYYYFIRLMGRKASHVALECTLQSHPNMVILGEEVAASKLTLFD  300

Query  951   ITKQVCDAVQARAEQDKYHGVILLPEGLIESIPEIYALLKEIHVLLREGVSANNISSQLS  1130
             ITKQ+CDAVQARAEQDK HGVILLPEGLIESIPE+YALLKEIH LLR+ VSA+ ISSQLS
Sbjct  301   ITKQICDAVQARAEQDKNHGVILLPEGLIESIPEVYALLKEIHSLLRQNVSADKISSQLS  360

Query  1131  PWASALFEFLPPFIRRELLLYPESDDSAQL  1220
             PWASALFEFLP FIR++LLL PESDDSAQL
Sbjct  361   PWASALFEFLPHFIRKQLLLQPESDDSAQL  390



>gb|KJB29715.1| hypothetical protein B456_005G115600 [Gossypium raimondii]
Length=589

 Score =   670 bits (1729),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 338/390 (87%), Positives = 366/390 (94%), Gaps = 0/390 (0%)
 Frame = +3

Query  51    MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  230
             MDSD+G+ RELSDLQKLRSQY+P+LPPCL+GTTVRVEFGD TT+ DP+  HTI+R FPHT
Sbjct  1     MDSDYGIPRELSDLQKLRSQYQPQLPPCLEGTTVRVEFGDTTTSLDPADAHTIARAFPHT  60

Query  231   FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  410
             +G+PLAHFLRA+AKVPDAQIITEHP IRVG+VFCGRQSP GHN +WGL+ ALK+HNPNST
Sbjct  61    YGKPLAHFLRATAKVPDAQIITEHPTIRVGLVFCGRQSPAGHNVVWGLHKALKIHNPNST  120

Query  411   llgflggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLK  590
             LLGFLGG++GLFAQKTLEITDDIL+TYKNQGGYD+LGRT+DQIR+TEQV AAL AC  LK
Sbjct  121   LLGFLGGTQGLFAQKTLEITDDILSTYKNQGGYDLLGRTQDQIRTTEQVKAALAACNDLK  180

Query  591   LDGLVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICKV  770
             LDGLVI+GGVTSNTDAA LAE FAEAKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICKV
Sbjct  181   LDGLVIIGGVTSNTDAAQLAETFAEAKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICKV  240

Query  771   NSQLISNVCTDALSAEKYYYFIRLMGRKTSHVALECTLQSHPNMVILAEEVAASKLTLFD  950
             NSQLISNVCTDALSAEKYYYFIRLMGRK SHVALECTLQSHPNMVIL EEVAASKLTLFD
Sbjct  241   NSQLISNVCTDALSAEKYYYFIRLMGRKASHVALECTLQSHPNMVILGEEVAASKLTLFD  300

Query  951   ITKQVCDAVQARAEQDKYHGVILLPEGLIESIPEIYALLKEIHVLLREGVSANNISSQLS  1130
             ITKQ+CDAVQARAEQDK HGVILLPEGLIESIPE+YALLKEIH LLR+ VSA+ ISSQLS
Sbjct  301   ITKQICDAVQARAEQDKNHGVILLPEGLIESIPEVYALLKEIHSLLRQNVSADKISSQLS  360

Query  1131  PWASALFEFLPPFIRRELLLYPESDDSAQL  1220
             PWASALFEFLP FIR++LLL PESDDSAQL
Sbjct  361   PWASALFEFLPHFIRKQLLLQPESDDSAQL  390



>gb|KJB29716.1| hypothetical protein B456_005G115600 [Gossypium raimondii]
Length=586

 Score =   670 bits (1729),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 338/390 (87%), Positives = 366/390 (94%), Gaps = 0/390 (0%)
 Frame = +3

Query  51    MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  230
             MDSD+G+ RELSDLQKLRSQY+P+LPPCL+GTTVRVEFGD TT+ DP+  HTI+R FPHT
Sbjct  1     MDSDYGIPRELSDLQKLRSQYQPQLPPCLEGTTVRVEFGDTTTSLDPADAHTIARAFPHT  60

Query  231   FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  410
             +G+PLAHFLRA+AKVPDAQIITEHP IRVG+VFCGRQSP GHN +WGL+ ALK+HNPNST
Sbjct  61    YGKPLAHFLRATAKVPDAQIITEHPTIRVGLVFCGRQSPAGHNVVWGLHKALKIHNPNST  120

Query  411   llgflggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLK  590
             LLGFLGG++GLFAQKTLEITDDIL+TYKNQGGYD+LGRT+DQIR+TEQV AAL AC  LK
Sbjct  121   LLGFLGGTQGLFAQKTLEITDDILSTYKNQGGYDLLGRTQDQIRTTEQVKAALAACNDLK  180

Query  591   LDGLVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICKV  770
             LDGLVI+GGVTSNTDAA LAE FAEAKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICKV
Sbjct  181   LDGLVIIGGVTSNTDAAQLAETFAEAKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICKV  240

Query  771   NSQLISNVCTDALSAEKYYYFIRLMGRKTSHVALECTLQSHPNMVILAEEVAASKLTLFD  950
             NSQLISNVCTDALSAEKYYYFIRLMGRK SHVALECTLQSHPNMVIL EEVAASKLTLFD
Sbjct  241   NSQLISNVCTDALSAEKYYYFIRLMGRKASHVALECTLQSHPNMVILGEEVAASKLTLFD  300

Query  951   ITKQVCDAVQARAEQDKYHGVILLPEGLIESIPEIYALLKEIHVLLREGVSANNISSQLS  1130
             ITKQ+CDAVQARAEQDK HGVILLPEGLIESIPE+YALLKEIH LLR+ VSA+ ISSQLS
Sbjct  301   ITKQICDAVQARAEQDKNHGVILLPEGLIESIPEVYALLKEIHSLLRQNVSADKISSQLS  360

Query  1131  PWASALFEFLPPFIRRELLLYPESDDSAQL  1220
             PWASALFEFLP FIR++LLL PESDDSAQL
Sbjct  361   PWASALFEFLPHFIRKQLLLQPESDDSAQL  390



>ref|XP_002276269.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha [Vitis vinifera]
Length=616

 Score =   671 bits (1731),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 340/390 (87%), Positives = 368/390 (94%), Gaps = 0/390 (0%)
 Frame = +3

Query  51    MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  230
             MDSDFG+ RELSDLQK R  Y PELPPCLQGTTVRVEFGDATTA+D SG  TISR FPHT
Sbjct  1     MDSDFGIPRELSDLQKHRCLYEPELPPCLQGTTVRVEFGDATTASDLSGARTISRSFPHT  60

Query  231   FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  410
             +GQPLAHFLRA+AKVPDAQ+ITEHP IRVG+VFCGRQSPGGHN IWGL++ALK+HNP + 
Sbjct  61    YGQPLAHFLRATAKVPDAQVITEHPPIRVGVVFCGRQSPGGHNVIWGLHNALKIHNPKNI  120

Query  411   llgflggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLK  590
             LLGFLGGSEGLFAQKTLEITDDIL+TYKNQGGYD+LGRTKDQIR+TEQVNAAL+ C +LK
Sbjct  121   LLGFLGGSEGLFAQKTLEITDDILSTYKNQGGYDLLGRTKDQIRTTEQVNAALSTCKNLK  180

Query  591   LDGLVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICKV  770
             L+GLVI+GGVTSNTDAA LAE FAEAKC TKVVGVPV+LNGDLKNQFVE+NVGFDTICKV
Sbjct  181   LEGLVIIGGVTSNTDAAQLAETFAEAKCQTKVVGVPVSLNGDLKNQFVESNVGFDTICKV  240

Query  771   NSQLISNVCTDALSAEKYYYFIRLMGRKTSHVALECTLQSHPNMVILAEEVAASKLTLFD  950
             NSQLISNVCTDALSAEKYYYFIRLMGRK SHVALECTLQSHPNMVIL EEVAASKLTLFD
Sbjct  241   NSQLISNVCTDALSAEKYYYFIRLMGRKASHVALECTLQSHPNMVILGEEVAASKLTLFD  300

Query  951   ITKQVCDAVQARAEQDKYHGVILLPEGLIESIPEIYALLKEIHVLLREGVSANNISSQLS  1130
             +TKQ+CDAVQARAEQDKYHGVILLPEGLIESIPE+YALL+EIH LLR+GVSA NISS+LS
Sbjct  301   LTKQICDAVQARAEQDKYHGVILLPEGLIESIPEVYALLQEIHGLLRQGVSAVNISSKLS  360

Query  1131  PWASALFEFLPPFIRRELLLYPESDDSAQL  1220
             PWASALFEFLPPFI+++LLLYPESDDSAQL
Sbjct  361   PWASALFEFLPPFIKKQLLLYPESDDSAQL  390



>ref|XP_011034779.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha-like [Populus euphratica]
Length=617

 Score =   671 bits (1730),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 339/390 (87%), Positives = 363/390 (93%), Gaps = 0/390 (0%)
 Frame = +3

Query  51    MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  230
             MDSDFG+ RELSDLQKLRS Y+PELPPCLQGTTVRVEFGDATT ADP+  H ISR FPHT
Sbjct  1     MDSDFGIPRELSDLQKLRSLYQPELPPCLQGTTVRVEFGDATTCADPADVHAISRAFPHT  60

Query  231   FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  410
             +GQPLAHFLRA+AKVPDAQIIT+HPA+RVGIVFCGRQSPGGHN +WGL +ALK+HNP ST
Sbjct  61    YGQPLAHFLRATAKVPDAQIITDHPAVRVGIVFCGRQSPGGHNVVWGLQNALKIHNPKST  120

Query  411   llgflggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLK  590
             LLGFLGGSEG FAQKTLEITDDIL TYKNQGGYD+LGRTKDQIR+TEQV AALTAC  LK
Sbjct  121   LLGFLGGSEGFFAQKTLEITDDILETYKNQGGYDLLGRTKDQIRTTEQVRAALTACKDLK  180

Query  591   LDGLVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICKV  770
             LD LVI+GGVTSNTDAA LAE FA  KC TKVVGVPVTLNGDLKNQFVETNVGFDTICKV
Sbjct  181   LDALVIIGGVTSNTDAAQLAETFAVEKCQTKVVGVPVTLNGDLKNQFVETNVGFDTICKV  240

Query  771   NSQLISNVCTDALSAEKYYYFIRLMGRKTSHVALECTLQSHPNMVILAEEVAASKLTLFD  950
             NSQLISNVCTDALSAEKYYYFIRLMGRK SHVALECTLQSHPNMVIL EEVAASKLTLFD
Sbjct  241   NSQLISNVCTDALSAEKYYYFIRLMGRKASHVALECTLQSHPNMVILGEEVAASKLTLFD  300

Query  951   ITKQVCDAVQARAEQDKYHGVILLPEGLIESIPEIYALLKEIHVLLREGVSANNISSQLS  1130
             +TK++CDAVQARAEQDK HGVILLPEGLIESIPE+YALLKEIH LL++GV+ ++ISSQLS
Sbjct  301   LTKKICDAVQARAEQDKNHGVILLPEGLIESIPEVYALLKEIHSLLKQGVAPDSISSQLS  360

Query  1131  PWASALFEFLPPFIRRELLLYPESDDSAQL  1220
             PWASAL EFLPPFI+RELLL+PESDDSAQL
Sbjct  361   PWASALLEFLPPFIKRELLLHPESDDSAQL  390



>ref|XP_008796200.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha [Phoenix dactylifera]
Length=620

 Score =   671 bits (1730),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 336/390 (86%), Positives = 367/390 (94%), Gaps = 0/390 (0%)
 Frame = +3

Query  51    MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  230
             MDSD+G+ RELSDLQK R+ Y+PELPPCLQGTTVRVEFGDATTA DP+  H I + FPHT
Sbjct  1     MDSDYGVPRELSDLQKQRALYQPELPPCLQGTTVRVEFGDATTAGDPASAHVIGQNFPHT  60

Query  231   FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  410
             +GQPLAHFLRA+AKVPDAQIITEHPAIRVG+VF GRQSPGGHN IWGLYDA+K HNPNST
Sbjct  61    YGQPLAHFLRATAKVPDAQIITEHPAIRVGVVFSGRQSPGGHNVIWGLYDAIKAHNPNST  120

Query  411   llgflggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLK  590
             LLGF+GG+EGLFAQKTL+ITDDIL+TYKNQGGYD+LGRTKDQIR+TEQVNAA+TAC +LK
Sbjct  121   LLGFVGGTEGLFAQKTLKITDDILSTYKNQGGYDLLGRTKDQIRTTEQVNAAMTACQALK  180

Query  591   LDGLVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICKV  770
             LDGLVI+GGVTSNTDAA LAE FAE+KCPTKVVGVPVTLNGDLKNQFVETNVGFDTICKV
Sbjct  181   LDGLVIIGGVTSNTDAAQLAETFAESKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICKV  240

Query  771   NSQLISNVCTDALSAEKYYYFIRLMGRKTSHVALECTLQSHPNMVILAEEVAASKLTLFD  950
             NSQLISNVCTDALSAEKYYYFIRLMGRK SHVALECTLQSHPNMVIL EEVAASKLT+FD
Sbjct  241   NSQLISNVCTDALSAEKYYYFIRLMGRKASHVALECTLQSHPNMVILGEEVAASKLTIFD  300

Query  951   ITKQVCDAVQARAEQDKYHGVILLPEGLIESIPEIYALLKEIHVLLREGVSANNISSQLS  1130
             ITKQ+CDAVQARAE+DK HGVIL+PEGL+ESIPE+YALL+EIH L  +GVSA NISSQLS
Sbjct  301   ITKQICDAVQARAEKDKSHGVILIPEGLVESIPELYALLQEIHGLHLQGVSAENISSQLS  360

Query  1131  PWASALFEFLPPFIRRELLLYPESDDSAQL  1220
             PWASALFEFLP F+RR+LLL+PESDDSAQL
Sbjct  361   PWASALFEFLPAFLRRQLLLHPESDDSAQL  390



>gb|ABK93964.1| unknown [Populus trichocarpa]
Length=617

 Score =   670 bits (1729),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 343/390 (88%), Positives = 366/390 (94%), Gaps = 0/390 (0%)
 Frame = +3

Query  51    MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  230
             MDSDFG+ RELSDLQKLRS Y+PELPPCLQGT VRVE GDATTAADP+  H+ISR FP T
Sbjct  1     MDSDFGIPRELSDLQKLRSLYQPELPPCLQGTAVRVELGDATTAADPADVHSISRSFPLT  60

Query  231   FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  410
             +GQPLAHFLRASAKV DAQIIT+HPA RVGIVFCGRQSPGGHN IWGL++ALK+HNPNST
Sbjct  61    YGQPLAHFLRASAKVSDAQIITDHPAFRVGIVFCGRQSPGGHNVIWGLHNALKIHNPNST  120

Query  411   llgflggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLK  590
             LLGFLGGSEGLFAQKTLEITDDIL+TYKNQGGYD+LGRTKDQIR+TEQVNAALTAC  LK
Sbjct  121   LLGFLGGSEGLFAQKTLEITDDILSTYKNQGGYDLLGRTKDQIRTTEQVNAALTACKDLK  180

Query  591   LDGLVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICKV  770
             LDGLVI+GGVTSNTDAA LAE FAEAKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICKV
Sbjct  181   LDGLVIIGGVTSNTDAAQLAETFAEAKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICKV  240

Query  771   NSQLISNVCTDALSAEKYYYFIRLMGRKTSHVALECTLQSHPNMVILAEEVAASKLTLFD  950
             NSQLISNVCTDALSAEKYYYFIRLMGRK SHVALECTLQSHPNMVIL EEVAASKLTLFD
Sbjct  241   NSQLISNVCTDALSAEKYYYFIRLMGRKASHVALECTLQSHPNMVILGEEVAASKLTLFD  300

Query  951   ITKQVCDAVQARAEQDKYHGVILLPEGLIESIPEIYALLKEIHVLLREGVSANNISSQLS  1130
             +T Q+CDAVQARA QDK HGVILLPEGLIESIPE+YALLKEIH LLR GV+ +NISSQLS
Sbjct  301   LTTQICDAVQARAVQDKNHGVILLPEGLIESIPEVYALLKEIHGLLRHGVAPDNISSQLS  360

Query  1131  PWASALFEFLPPFIRRELLLYPESDDSAQL  1220
             PW SALFEFLPP+I+++LLL+PESDDSAQL
Sbjct  361   PWTSALFEFLPPYIKKQLLLHPESDDSAQL  390



>ref|XP_002307823.1| pyrophosphate-dependent phosphofructokinase alpha subunit family 
protein [Populus trichocarpa]
 gb|EEE94819.1| pyrophosphate-dependent phosphofructokinase alpha subunit family 
protein [Populus trichocarpa]
Length=617

 Score =   670 bits (1729),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 343/390 (88%), Positives = 366/390 (94%), Gaps = 0/390 (0%)
 Frame = +3

Query  51    MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  230
             MDSDFG+ RELSDLQKLRS Y+PELPPCLQGT VRVE GDATTAADP+  H+ISR FP T
Sbjct  1     MDSDFGIPRELSDLQKLRSLYQPELPPCLQGTAVRVELGDATTAADPADVHSISRSFPLT  60

Query  231   FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  410
             +GQPLAHFLRASAKV DAQIIT+HPA RVGIVFCGRQSPGGHN IWGL++ALK+HNPNST
Sbjct  61    YGQPLAHFLRASAKVSDAQIITDHPAFRVGIVFCGRQSPGGHNVIWGLHNALKIHNPNST  120

Query  411   llgflggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLK  590
             LLGFLGGSEGLFAQKTLEITDDIL+TYKNQGGYD+LGRTKDQIR+TEQVNAALTAC  LK
Sbjct  121   LLGFLGGSEGLFAQKTLEITDDILSTYKNQGGYDLLGRTKDQIRTTEQVNAALTACKDLK  180

Query  591   LDGLVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICKV  770
             LDGLVI+GGVTSNTDAA LAE FAEAKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICKV
Sbjct  181   LDGLVIIGGVTSNTDAAQLAETFAEAKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICKV  240

Query  771   NSQLISNVCTDALSAEKYYYFIRLMGRKTSHVALECTLQSHPNMVILAEEVAASKLTLFD  950
             NSQLISNVCTDALSAEKYYYFIRLMGRK SHVALECTLQSHPNMVIL EEVAASKLTLFD
Sbjct  241   NSQLISNVCTDALSAEKYYYFIRLMGRKASHVALECTLQSHPNMVILGEEVAASKLTLFD  300

Query  951   ITKQVCDAVQARAEQDKYHGVILLPEGLIESIPEIYALLKEIHVLLREGVSANNISSQLS  1130
             +T Q+CDAVQARA QDK HGVILLPEGLIESIPE+YALLKEIH LLR GV+ +NISSQLS
Sbjct  301   LTTQICDAVQARAVQDKNHGVILLPEGLIESIPEVYALLKEIHGLLRHGVAPDNISSQLS  360

Query  1131  PWASALFEFLPPFIRRELLLYPESDDSAQL  1220
             PW SALFEFLPP+I+++LLL+PESDDSAQL
Sbjct  361   PWTSALFEFLPPYIKKQLLLHPESDDSAQL  390



>ref|XP_003529192.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha-like [Glycine max]
Length=617

 Score =   670 bits (1728),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 340/390 (87%), Positives = 365/390 (94%), Gaps = 0/390 (0%)
 Frame = +3

Query  51    MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  230
             MDSD+G+ RELSDLQK+RS Y+PELPPCLQGTTVRVEFGDATT ADP+   TISR FP+T
Sbjct  1     MDSDYGIPRELSDLQKIRSLYQPELPPCLQGTTVRVEFGDATTTADPTDALTISRAFPNT  60

Query  231   FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  410
             +G PLAHFLRA+AKVPDAQIITE P IRVGIVFCGRQSPGGHN IWGL++ALK+HNPNS 
Sbjct  61    YGHPLAHFLRATAKVPDAQIITEFPPIRVGIVFCGRQSPGGHNVIWGLHNALKIHNPNSV  120

Query  411   llgflggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLK  590
             LLGFLGGSEGLFAQKTLEIT+DIL+TYKNQGGYD+LGRTKDQIR+TEQVNAAL AC +LK
Sbjct  121   LLGFLGGSEGLFAQKTLEITEDILSTYKNQGGYDLLGRTKDQIRTTEQVNAALAACNNLK  180

Query  591   LDGLVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICKV  770
             LDGLVI+GGVTSNTDAA LAE FA AKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICKV
Sbjct  181   LDGLVIIGGVTSNTDAAQLAETFAVAKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICKV  240

Query  771   NSQLISNVCTDALSAEKYYYFIRLMGRKTSHVALECTLQSHPNMVILAEEVAASKLTLFD  950
             NSQLISNVCTDALSAEKYYYFIRLMGRK SHVALECTLQSHPNMVIL EEVAASKLTL +
Sbjct  241   NSQLISNVCTDALSAEKYYYFIRLMGRKASHVALECTLQSHPNMVILGEEVAASKLTLSE  300

Query  951   ITKQVCDAVQARAEQDKYHGVILLPEGLIESIPEIYALLKEIHVLLREGVSANNISSQLS  1130
             I KQ+ DAVQARAEQDKYHGVILLPEGLIESIPE+YALLKEIH LLR+GV+ + ISSQL+
Sbjct  301   IAKQITDAVQARAEQDKYHGVILLPEGLIESIPEVYALLKEIHGLLRQGVAVDKISSQLT  360

Query  1131  PWASALFEFLPPFIRRELLLYPESDDSAQL  1220
             PWASALFEFLPPFIRR+LLLYPESDDSAQL
Sbjct  361   PWASALFEFLPPFIRRQLLLYPESDDSAQL  390



>ref|XP_010927304.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha [Elaeis guineensis]
 ref|XP_010927305.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha [Elaeis guineensis]
Length=617

 Score =   670 bits (1728),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 336/390 (86%), Positives = 368/390 (94%), Gaps = 0/390 (0%)
 Frame = +3

Query  51    MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  230
             MDSD+G+ RELSDLQK R+ Y+PELPPCLQGTTVRVEFGDATTAADP+  H I + FPHT
Sbjct  1     MDSDYGVPRELSDLQKQRTLYQPELPPCLQGTTVRVEFGDATTAADPASAHVIGQNFPHT  60

Query  231   FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  410
             +GQPLAHFLRA+AKVPDAQIITEHPAIRVG+VF GRQSPGGHN IWGLYDA+K HN NST
Sbjct  61    YGQPLAHFLRATAKVPDAQIITEHPAIRVGVVFSGRQSPGGHNVIWGLYDAIKAHNRNST  120

Query  411   llgflggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLK  590
             LLGF+GG+EGLFAQKTLEITDDIL+TYKNQGGYD+LGRTKDQIR+TEQVNAA+TAC +LK
Sbjct  121   LLGFVGGTEGLFAQKTLEITDDILSTYKNQGGYDLLGRTKDQIRTTEQVNAAMTACQALK  180

Query  591   LDGLVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICKV  770
             LDGLVI+GGVTSNTDAA LAE FAE++C TKVVGVPVTLNGDLKNQFVETNVGFDTICKV
Sbjct  181   LDGLVIIGGVTSNTDAAQLAETFAESQCSTKVVGVPVTLNGDLKNQFVETNVGFDTICKV  240

Query  771   NSQLISNVCTDALSAEKYYYFIRLMGRKTSHVALECTLQSHPNMVILAEEVAASKLTLFD  950
             NSQLISNVCTDALSAEKYYYFIRLMGRK SHVALECTLQSHPNMVIL EEVAASKLT+FD
Sbjct  241   NSQLISNVCTDALSAEKYYYFIRLMGRKASHVALECTLQSHPNMVILGEEVAASKLTIFD  300

Query  951   ITKQVCDAVQARAEQDKYHGVILLPEGLIESIPEIYALLKEIHVLLREGVSANNISSQLS  1130
             ITKQ+CDAVQARAE+DK+HGVIL+PEGL+ESIPE+YALL+EIH L  +GVSA NISSQLS
Sbjct  301   ITKQICDAVQARAEKDKHHGVILIPEGLVESIPELYALLQEIHGLHLQGVSAENISSQLS  360

Query  1131  PWASALFEFLPPFIRRELLLYPESDDSAQL  1220
             PWASALFEFLPPF+RR+LLL+PESDDSAQL
Sbjct  361   PWASALFEFLPPFLRRQLLLHPESDDSAQL  390



>gb|KCW68157.1| hypothetical protein EUGRSUZ_F018231 [Eucalyptus grandis]
Length=520

 Score =   665 bits (1716),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 338/390 (87%), Positives = 367/390 (94%), Gaps = 0/390 (0%)
 Frame = +3

Query  51    MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  230
             M+SD+G+ RELSDLQK RS Y+P+LPPCLQGTTVRVEFGDATTAADP+G HTISR FPHT
Sbjct  1     MESDYGIPRELSDLQKHRSLYQPDLPPCLQGTTVRVEFGDATTAADPAGSHTISRSFPHT  60

Query  231   FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  410
             +GQPLAHFLRA+AKV DAQIITEHPA RVGIVFCGRQSPGGHN +WGLY ALK+HNP+S 
Sbjct  61    YGQPLAHFLRATAKVADAQIITEHPAKRVGIVFCGRQSPGGHNVVWGLYSALKIHNPSSV  120

Query  411   llgflggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLK  590
             LLGFLGGSEGLFAQKTLEITD+IL+TYKNQGGYD+LGRTKDQIR+TEQVNAALT C +LK
Sbjct  121   LLGFLGGSEGLFAQKTLEITDEILSTYKNQGGYDLLGRTKDQIRTTEQVNAALTTCKNLK  180

Query  591   LDGLVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICKV  770
             LDGLVI+GGVTSNTDAA LAE FAEAKC TKVVGVPVTLNGDLKN FVET+VGFDTICKV
Sbjct  181   LDGLVIIGGVTSNTDAAQLAETFAEAKCSTKVVGVPVTLNGDLKNPFVETDVGFDTICKV  240

Query  771   NSQLISNVCTDALSAEKYYYFIRLMGRKTSHVALECTLQSHPNMVILAEEVAASKLTLFD  950
             NSQLISNVCTDALSAEKYYYFIRLMGRK SHVALECTLQSHPNMVIL EEVAASKLTLFD
Sbjct  241   NSQLISNVCTDALSAEKYYYFIRLMGRKASHVALECTLQSHPNMVILGEEVAASKLTLFD  300

Query  951   ITKQVCDAVQARAEQDKYHGVILLPEGLIESIPEIYALLKEIHVLLREGVSANNISSQLS  1130
             + KQ+CDAVQARAEQDK HGVIL+PEGLIESIPE+Y+LLKEIH LLR+GVS + ISSQLS
Sbjct  301   LAKQLCDAVQARAEQDKNHGVILIPEGLIESIPEVYSLLKEIHGLLRQGVSVDKISSQLS  360

Query  1131  PWASALFEFLPPFIRRELLLYPESDDSAQL  1220
             PWASALFEFLPPFI+++LLL+PESDDSAQL
Sbjct  361   PWASALFEFLPPFIKKQLLLHPESDDSAQL  390



>ref|NP_001275358.1| pyrophosphate--fructose 6-phosphate 1-phosphotransferase subunit 
alpha [Solanum tuberosum]
 gb|AAA63451.1| pyrophosphate-fructose 6-phosphate 1-phosphotransferase alpha-subunit 
[Solanum tuberosum]
Length=616

 Score =   669 bits (1725),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 338/390 (87%), Positives = 366/390 (94%), Gaps = 0/390 (0%)
 Frame = +3

Query  51    MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  230
             MD+D+G+ RELSDLQKLRS Y PELPPCLQGTTVRVE  DATTAADP+G HTI R FPHT
Sbjct  1     MDADYGIPRELSDLQKLRSHYHPELPPCLQGTTVRVELRDATTAADPAGEHTIKRFFPHT  60

Query  231   FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  410
             +GQPLAHFLRA+AKVPDAQIITEHPAIRVG++FCGRQSPGGHN IWGL+DALKVHNP + 
Sbjct  61    YGQPLAHFLRATAKVPDAQIITEHPAIRVGVLFCGRQSPGGHNVIWGLHDALKVHNPKNI  120

Query  411   llgflggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLK  590
             LLGFLGGSEGLFAQKTLEITDD+LATYKNQGGYDMLGRTKDQIR+TEQVNAA+ AC +LK
Sbjct  121   LLGFLGGSEGLFAQKTLEITDDVLATYKNQGGYDMLGRTKDQIRTTEQVNAAMAACKALK  180

Query  591   LDGLVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICKV  770
             LDGLVI+GGVTSNTDAA+LAE FAE KC TKVVGVPVTLNGDLKNQFVE NVGFDTICKV
Sbjct  181   LDGLVIIGGVTSNTDAAHLAEKFAETKCLTKVVGVPVTLNGDLKNQFVEANVGFDTICKV  240

Query  771   NSQLISNVCTDALSAEKYYYFIRLMGRKTSHVALECTLQSHPNMVILAEEVAASKLTLFD  950
             NSQLISNVCTDALSAEKYYYFIRLMGRK SHVAL+CTLQSHPNMVIL EEVAASKLT+FD
Sbjct  241   NSQLISNVCTDALSAEKYYYFIRLMGRKASHVALDCTLQSHPNMVILGEEVAASKLTIFD  300

Query  951   ITKQVCDAVQARAEQDKYHGVILLPEGLIESIPEIYALLKEIHVLLREGVSANNISSQLS  1130
             IT+Q+CDAVQARAE DK HGVILLPEGLIESIPE+Y+LL+EIH LLR+GVSA+ ISSQLS
Sbjct  301   ITQQICDAVQARAEHDKNHGVILLPEGLIESIPEVYSLLQEIHGLLRQGVSADKISSQLS  360

Query  1131  PWASALFEFLPPFIRRELLLYPESDDSAQL  1220
             PWASALFEFLP FIR++LLL+PESDDSAQL
Sbjct  361   PWASALFEFLPHFIRKQLLLHPESDDSAQL  390



>ref|XP_004498195.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha-like isoform X1 [Cicer arietinum]
Length=616

 Score =   667 bits (1721),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 339/390 (87%), Positives = 364/390 (93%), Gaps = 0/390 (0%)
 Frame = +3

Query  51    MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  230
             MDSD+G+ RELSDLQKLRS Y+PELPPCLQGTTVRVEFGDATT ADPS   +ISR FP+T
Sbjct  1     MDSDYGIPRELSDLQKLRSLYQPELPPCLQGTTVRVEFGDATTTADPSDEPSISRSFPNT  60

Query  231   FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  410
             +G PLAHFLRA+AKVPDAQIITEHP IRVG+VFCGRQSPGGHN IWGL+ ALK+HNP S 
Sbjct  61    YGHPLAHFLRATAKVPDAQIITEHPPIRVGLVFCGRQSPGGHNVIWGLHSALKIHNPYSV  120

Query  411   llgflggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLK  590
             LLGFLGGS+GLFAQKTLEIT+DIL+TYKNQGGYD+LGRTKDQIR+TEQVNAAL AC  LK
Sbjct  121   LLGFLGGSDGLFAQKTLEITEDILSTYKNQGGYDLLGRTKDQIRTTEQVNAALAACNDLK  180

Query  591   LDGLVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICKV  770
             LDGLVI+GGVTSNTDAA LAE FA AKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICKV
Sbjct  181   LDGLVIIGGVTSNTDAAQLAETFAVAKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICKV  240

Query  771   NSQLISNVCTDALSAEKYYYFIRLMGRKTSHVALECTLQSHPNMVILAEEVAASKLTLFD  950
             NSQLISNVCTDALSAEKYYYFIRLMGRK SHVALECTLQSHPNMVIL EEVA SKLTLF+
Sbjct  241   NSQLISNVCTDALSAEKYYYFIRLMGRKASHVALECTLQSHPNMVILGEEVAQSKLTLFE  300

Query  951   ITKQVCDAVQARAEQDKYHGVILLPEGLIESIPEIYALLKEIHVLLREGVSANNISSQLS  1130
             I++++ DAVQARAEQDKYHGVILLPEGLIESIPE+YALLKEIH LLR+GV A+ ISSQLS
Sbjct  301   ISRKISDAVQARAEQDKYHGVILLPEGLIESIPEVYALLKEIHGLLRQGVDADKISSQLS  360

Query  1131  PWASALFEFLPPFIRRELLLYPESDDSAQL  1220
             PWASALFEFLPPFIRR+LLLYPESDDSAQL
Sbjct  361   PWASALFEFLPPFIRRQLLLYPESDDSAQL  390



>gb|KJB29714.1| hypothetical protein B456_005G115600 [Gossypium raimondii]
Length=617

 Score =   667 bits (1721),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 338/391 (86%), Positives = 366/391 (94%), Gaps = 1/391 (0%)
 Frame = +3

Query  51    MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  230
             MDSD+G+ RELSDLQKLRSQY+P+LPPCL+GTTVRVEFGD TT+ DP+  HTI+R FPHT
Sbjct  1     MDSDYGIPRELSDLQKLRSQYQPQLPPCLEGTTVRVEFGDTTTSLDPADAHTIARAFPHT  60

Query  231   FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  410
             +G+PLAHFLRA+AKVPDAQIITEHP IRVG+VFCGRQSP GHN +WGL+ ALK+HNPNST
Sbjct  61    YGKPLAHFLRATAKVPDAQIITEHPTIRVGLVFCGRQSPAGHNVVWGLHKALKIHNPNST  120

Query  411   llgflggseglfAQKTLEITDDILATYKNQ-GGYDMLGRTKDQIRSTEQVNAALTACTSL  587
             LLGFLGG++GLFAQKTLEITDDIL+TYKNQ GGYD+LGRT+DQIR+TEQV AAL AC  L
Sbjct  121   LLGFLGGTQGLFAQKTLEITDDILSTYKNQEGGYDLLGRTQDQIRTTEQVKAALAACNDL  180

Query  588   KLDGLVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICK  767
             KLDGLVI+GGVTSNTDAA LAE FAEAKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICK
Sbjct  181   KLDGLVIIGGVTSNTDAAQLAETFAEAKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICK  240

Query  768   VNSQLISNVCTDALSAEKYYYFIRLMGRKTSHVALECTLQSHPNMVILAEEVAASKLTLF  947
             VNSQLISNVCTDALSAEKYYYFIRLMGRK SHVALECTLQSHPNMVIL EEVAASKLTLF
Sbjct  241   VNSQLISNVCTDALSAEKYYYFIRLMGRKASHVALECTLQSHPNMVILGEEVAASKLTLF  300

Query  948   DITKQVCDAVQARAEQDKYHGVILLPEGLIESIPEIYALLKEIHVLLREGVSANNISSQL  1127
             DITKQ+CDAVQARAEQDK HGVILLPEGLIESIPE+YALLKEIH LLR+ VSA+ ISSQL
Sbjct  301   DITKQICDAVQARAEQDKNHGVILLPEGLIESIPEVYALLKEIHSLLRQNVSADKISSQL  360

Query  1128  SPWASALFEFLPPFIRRELLLYPESDDSAQL  1220
             SPWASALFEFLP FIR++LLL PESDDSAQL
Sbjct  361   SPWASALFEFLPHFIRKQLLLQPESDDSAQL  391



>ref|XP_006386123.1| hypothetical protein POPTR_0002s00490g [Populus trichocarpa]
 gb|ERP63920.1| hypothetical protein POPTR_0002s00490g [Populus trichocarpa]
Length=618

 Score =   667 bits (1720),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 337/390 (86%), Positives = 361/390 (93%), Gaps = 0/390 (0%)
 Frame = +3

Query  51    MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  230
             MDSDFG+ RELSDLQKLRS Y+P LPPCLQGTTVRVEFGD TT ADP+  H ISR FPHT
Sbjct  1     MDSDFGIPRELSDLQKLRSLYQPGLPPCLQGTTVRVEFGDVTTCADPADVHAISRAFPHT  60

Query  231   FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  410
             +GQPLAHFLRA+AKVPDAQIIT+HPA+RVGIVFCGRQSPGGHN +WGL +ALK+HNP ST
Sbjct  61    YGQPLAHFLRATAKVPDAQIITDHPAVRVGIVFCGRQSPGGHNVVWGLQNALKIHNPKST  120

Query  411   llgflggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLK  590
             LLGFLGGSEG FAQKTLEITDDIL TYKNQGGYD+LGRTKDQIR+TEQV AALTAC  LK
Sbjct  121   LLGFLGGSEGFFAQKTLEITDDILETYKNQGGYDLLGRTKDQIRTTEQVRAALTACKDLK  180

Query  591   LDGLVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICKV  770
             LD LVI+GGVTSNTDAA LAE FA  KC TKVVGVPVTLNGDLKNQFVETNVGFDTICKV
Sbjct  181   LDALVIIGGVTSNTDAAQLAETFAVEKCQTKVVGVPVTLNGDLKNQFVETNVGFDTICKV  240

Query  771   NSQLISNVCTDALSAEKYYYFIRLMGRKTSHVALECTLQSHPNMVILAEEVAASKLTLFD  950
             NSQLISNVCTDALSAEKYYYFIRLMGRK SHVALECTLQSHPNMVIL EEVAASKLTLFD
Sbjct  241   NSQLISNVCTDALSAEKYYYFIRLMGRKASHVALECTLQSHPNMVILGEEVAASKLTLFD  300

Query  951   ITKQVCDAVQARAEQDKYHGVILLPEGLIESIPEIYALLKEIHVLLREGVSANNISSQLS  1130
             +TK++CDAVQARAEQDK HGVILLPEGLIESIPE+YALLKEIH LL++GV+ ++ISSQLS
Sbjct  301   LTKKICDAVQARAEQDKNHGVILLPEGLIESIPEVYALLKEIHSLLKQGVAPDSISSQLS  360

Query  1131  PWASALFEFLPPFIRRELLLYPESDDSAQL  1220
             PWASAL EFLPPFI+RELLL+PESDDSAQL
Sbjct  361   PWASALLEFLPPFIKRELLLHPESDDSAQL  390



>ref|XP_011041141.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha isoform X1 [Populus euphratica]
Length=617

 Score =   667 bits (1720),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 342/390 (88%), Positives = 364/390 (93%), Gaps = 0/390 (0%)
 Frame = +3

Query  51    MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  230
             MDSDFG+ RELSDLQKLRS Y+PELPPCLQGT VRVE GDATTAADP+  H+ISR FP T
Sbjct  1     MDSDFGIPRELSDLQKLRSLYQPELPPCLQGTAVRVELGDATTAADPADVHSISRSFPLT  60

Query  231   FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  410
             +GQPLAHFLRA+AKV DAQIIT HPA RVGIVFCGRQSPGGHN IWGL++ALKVHNPNST
Sbjct  61    YGQPLAHFLRATAKVSDAQIITYHPAFRVGIVFCGRQSPGGHNVIWGLHNALKVHNPNST  120

Query  411   llgflggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLK  590
             LLGFLGGSEGLFAQKTLEITDDIL+TYKNQGGYD+LGRTKDQIR+TEQVNAALTAC  LK
Sbjct  121   LLGFLGGSEGLFAQKTLEITDDILSTYKNQGGYDLLGRTKDQIRTTEQVNAALTACKDLK  180

Query  591   LDGLVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICKV  770
             LDGLVI+GGVTSNTDAA LAE FAEAKCPTKVVGVPVT NGDLKNQFVETNVGFDTICKV
Sbjct  181   LDGLVIIGGVTSNTDAAQLAETFAEAKCPTKVVGVPVTFNGDLKNQFVETNVGFDTICKV  240

Query  771   NSQLISNVCTDALSAEKYYYFIRLMGRKTSHVALECTLQSHPNMVILAEEVAASKLTLFD  950
             NSQLISNVCTDALSAEKYYYFIRLMGRK SHVALECTLQSHPNMVIL EEVAASKLTLFD
Sbjct  241   NSQLISNVCTDALSAEKYYYFIRLMGRKASHVALECTLQSHPNMVILGEEVAASKLTLFD  300

Query  951   ITKQVCDAVQARAEQDKYHGVILLPEGLIESIPEIYALLKEIHVLLREGVSANNISSQLS  1130
             +T Q+CDAVQARA QDK HGVILLPEGLIESIPE+YALLKEIH LLR GV+ +NISSQLS
Sbjct  301   LTTQICDAVQARAVQDKNHGVILLPEGLIESIPEVYALLKEIHGLLRHGVAPDNISSQLS  360

Query  1131  PWASALFEFLPPFIRRELLLYPESDDSAQL  1220
             PW SALFEFLPP+I+++LLL+PESDDSAQL
Sbjct  361   PWTSALFEFLPPYIKKQLLLHPESDDSAQL  390



>ref|XP_002300615.1| pyrophosphate-dependent phosphofructokinase alpha subunit family 
protein [Populus trichocarpa]
 gb|EEE79888.1| pyrophosphate-dependent phosphofructokinase alpha subunit family 
protein [Populus trichocarpa]
Length=617

 Score =   667 bits (1720),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 337/390 (86%), Positives = 361/390 (93%), Gaps = 0/390 (0%)
 Frame = +3

Query  51    MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  230
             MDSDFG+ RELSDLQKLRS Y+P LPPCLQGTTVRVEFGD TT ADP+  H ISR FPHT
Sbjct  1     MDSDFGIPRELSDLQKLRSLYQPGLPPCLQGTTVRVEFGDVTTCADPADVHAISRAFPHT  60

Query  231   FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  410
             +GQPLAHFLRA+AKVPDAQIIT+HPA+RVGIVFCGRQSPGGHN +WGL +ALK+HNP ST
Sbjct  61    YGQPLAHFLRATAKVPDAQIITDHPAVRVGIVFCGRQSPGGHNVVWGLQNALKIHNPKST  120

Query  411   llgflggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLK  590
             LLGFLGGSEG FAQKTLEITDDIL TYKNQGGYD+LGRTKDQIR+TEQV AALTAC  LK
Sbjct  121   LLGFLGGSEGFFAQKTLEITDDILETYKNQGGYDLLGRTKDQIRTTEQVRAALTACKDLK  180

Query  591   LDGLVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICKV  770
             LD LVI+GGVTSNTDAA LAE FA  KC TKVVGVPVTLNGDLKNQFVETNVGFDTICKV
Sbjct  181   LDALVIIGGVTSNTDAAQLAETFAVEKCQTKVVGVPVTLNGDLKNQFVETNVGFDTICKV  240

Query  771   NSQLISNVCTDALSAEKYYYFIRLMGRKTSHVALECTLQSHPNMVILAEEVAASKLTLFD  950
             NSQLISNVCTDALSAEKYYYFIRLMGRK SHVALECTLQSHPNMVIL EEVAASKLTLFD
Sbjct  241   NSQLISNVCTDALSAEKYYYFIRLMGRKASHVALECTLQSHPNMVILGEEVAASKLTLFD  300

Query  951   ITKQVCDAVQARAEQDKYHGVILLPEGLIESIPEIYALLKEIHVLLREGVSANNISSQLS  1130
             +TK++CDAVQARAEQDK HGVILLPEGLIESIPE+YALLKEIH LL++GV+ ++ISSQLS
Sbjct  301   LTKKICDAVQARAEQDKNHGVILLPEGLIESIPEVYALLKEIHSLLKQGVAPDSISSQLS  360

Query  1131  PWASALFEFLPPFIRRELLLYPESDDSAQL  1220
             PWASAL EFLPPFI+RELLL+PESDDSAQL
Sbjct  361   PWASALLEFLPPFIKRELLLHPESDDSAQL  390



>ref|XP_011654290.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha [Cucumis sativus]
 gb|KGN55545.1| hypothetical protein Csa_4G664520 [Cucumis sativus]
Length=619

 Score =   666 bits (1719),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 337/390 (86%), Positives = 362/390 (93%), Gaps = 0/390 (0%)
 Frame = +3

Query  51    MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  230
             MDSD+G+ R+LSDLQK+RS Y+P+LPPCLQGT VRVEFGD TTA DP+   T+SR FPHT
Sbjct  1     MDSDYGIPRQLSDLQKIRSLYQPDLPPCLQGTAVRVEFGDGTTAVDPADAPTVSRAFPHT  60

Query  231   FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  410
             +GQ LAHFLRA+AKVPDAQIITEHPAIRVG+VFCGRQSPGGHN IWGL+DALKVHNPNS 
Sbjct  61    YGQRLAHFLRATAKVPDAQIITEHPAIRVGVVFCGRQSPGGHNVIWGLHDALKVHNPNSI  120

Query  411   llgflggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLK  590
             L GFLGGSEGLF+QKTLEITDDIL TYKNQGGYD+LGRTKDQIR+ EQVNAAL  C  LK
Sbjct  121   LFGFLGGSEGLFSQKTLEITDDILTTYKNQGGYDLLGRTKDQIRTKEQVNAALKTCLDLK  180

Query  591   LDGLVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICKV  770
             LDGLVI+GGVTSNTDAA LAE FAEAKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICKV
Sbjct  181   LDGLVIIGGVTSNTDAAQLAETFAEAKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICKV  240

Query  771   NSQLISNVCTDALSAEKYYYFIRLMGRKTSHVALECTLQSHPNMVILAEEVAASKLTLFD  950
             NSQLISNVCTDALSAEKYYYFIRLMGRK SHVALECTLQSHPN+VIL EEVAASKLTLFD
Sbjct  241   NSQLISNVCTDALSAEKYYYFIRLMGRKASHVALECTLQSHPNLVILGEEVAASKLTLFD  300

Query  951   ITKQVCDAVQARAEQDKYHGVILLPEGLIESIPEIYALLKEIHVLLREGVSANNISSQLS  1130
             +T Q+CDAVQARA+QDKYHGVILLPEGLIESIPEIYALLKEIH LLR+GV  + ISSQLS
Sbjct  301   LTTQICDAVQARAQQDKYHGVILLPEGLIESIPEIYALLKEIHSLLRQGVLVDKISSQLS  360

Query  1131  PWASALFEFLPPFIRRELLLYPESDDSAQL  1220
             PWASALFEFLPPFIR++LLL+PESDDSAQL
Sbjct  361   PWASALFEFLPPFIRKQLLLHPESDDSAQL  390



>ref|XP_010266302.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha isoform X2 [Nelumbo nucifera]
Length=597

 Score =   665 bits (1717),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 334/390 (86%), Positives = 362/390 (93%), Gaps = 0/390 (0%)
 Frame = +3

Query  51    MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  230
             MDSDFG+ R+LSDLQK R+ Y PELPPCLQGTTVRVEFGDATT ADPSG H+ISR FPHT
Sbjct  1     MDSDFGIPRQLSDLQKYRALYEPELPPCLQGTTVRVEFGDATTTADPSGAHSISRAFPHT  60

Query  231   FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  410
             +GQPLAHFLR  A+VPDAQIITEHPAIRVG+VFCGRQSPGGHN IWGL+ ALK+HN N+ 
Sbjct  61    YGQPLAHFLRPKAQVPDAQIITEHPAIRVGVVFCGRQSPGGHNVIWGLHSALKIHNSNNV  120

Query  411   llgflggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLK  590
             LLGF+GG+EGLFAQKTLEITDDIL++YKNQGGYD+LGRTKDQIR++EQVNAAL +C +LK
Sbjct  121   LLGFIGGTEGLFAQKTLEITDDILSSYKNQGGYDLLGRTKDQIRTSEQVNAALASCKALK  180

Query  591   LDGLVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICKV  770
             LDGLVI+GGVTSNTDAA LAE FAE KC TKVVGVPVTLNGDLKNQFVE NVGFDTICKV
Sbjct  181   LDGLVIIGGVTSNTDAAQLAETFAEEKCATKVVGVPVTLNGDLKNQFVEANVGFDTICKV  240

Query  771   NSQLISNVCTDALSAEKYYYFIRLMGRKTSHVALECTLQSHPNMVILAEEVAASKLTLFD  950
             NSQLISNVCTDALSAEKYYYFIRLMGRK SHVALECTLQSHPNMVIL EEVA+SKLTLFD
Sbjct  241   NSQLISNVCTDALSAEKYYYFIRLMGRKASHVALECTLQSHPNMVILGEEVASSKLTLFD  300

Query  951   ITKQVCDAVQARAEQDKYHGVILLPEGLIESIPEIYALLKEIHVLLREGVSANNISSQLS  1130
             IT+Q+CDAVQAR EQDKYHGVILLPEGLIESIPEIYALL+EIH L R+GVS  NISSQLS
Sbjct  301   ITQQICDAVQARVEQDKYHGVILLPEGLIESIPEIYALLQEIHGLHRQGVSVENISSQLS  360

Query  1131  PWASALFEFLPPFIRRELLLYPESDDSAQL  1220
             PWASALFEFLP FI+R+LLL+PESDDSAQL
Sbjct  361   PWASALFEFLPHFIKRQLLLHPESDDSAQL  390



>ref|XP_003555655.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha-like [Glycine max]
 gb|KHM99024.1| Pyrophosphate--fructose 6-phosphate 1-phosphotransferase subunit 
alpha [Glycine soja]
Length=617

 Score =   666 bits (1718),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 336/390 (86%), Positives = 362/390 (93%), Gaps = 0/390 (0%)
 Frame = +3

Query  51    MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  230
             MDSD+G+ RELSDLQK+RS Y+PELPPCLQGTTVRVEFGDATT ADP+   T+ R FP+T
Sbjct  1     MDSDYGIPRELSDLQKIRSLYQPELPPCLQGTTVRVEFGDATTTADPTDALTVCRAFPNT  60

Query  231   FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  410
             +G PLAHFLRA+AKVPDAQIITE P IRVGIVFCGRQSPGGHN IWG+++ALK+HNPNS 
Sbjct  61    YGHPLAHFLRATAKVPDAQIITEFPPIRVGIVFCGRQSPGGHNVIWGIHNALKIHNPNSV  120

Query  411   llgflggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLK  590
             LLGFLGGSEGLFAQKTLEITDDIL+TYKNQGGYD+LGRTKDQIR+TEQVNAAL AC +LK
Sbjct  121   LLGFLGGSEGLFAQKTLEITDDILSTYKNQGGYDLLGRTKDQIRTTEQVNAALAACNNLK  180

Query  591   LDGLVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICKV  770
             LDGLVI+GGVTSNTDAA LAE F  AKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICKV
Sbjct  181   LDGLVIIGGVTSNTDAAQLAETFVVAKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICKV  240

Query  771   NSQLISNVCTDALSAEKYYYFIRLMGRKTSHVALECTLQSHPNMVILAEEVAASKLTLFD  950
             NSQLISNVCTDALSAEKYYYFIRLMGRK SHVALECTLQSHPNMVIL EEVAASKLTL +
Sbjct  241   NSQLISNVCTDALSAEKYYYFIRLMGRKASHVALECTLQSHPNMVILGEEVAASKLTLSE  300

Query  951   ITKQVCDAVQARAEQDKYHGVILLPEGLIESIPEIYALLKEIHVLLREGVSANNISSQLS  1130
             I KQ+ DA+QARAEQDKYHGVILLPEGLIESIPE+YALLKEIH LLR+GV  + ISSQL+
Sbjct  301   IAKQITDAIQARAEQDKYHGVILLPEGLIESIPEVYALLKEIHGLLRQGVEVDKISSQLT  360

Query  1131  PWASALFEFLPPFIRRELLLYPESDDSAQL  1220
             PWASALFEFLPPFIRR+LLLYPESDDSAQL
Sbjct  361   PWASALFEFLPPFIRRQLLLYPESDDSAQL  390



>ref|XP_010061240.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha [Eucalyptus grandis]
Length=617

 Score =   666 bits (1718),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 338/390 (87%), Positives = 367/390 (94%), Gaps = 0/390 (0%)
 Frame = +3

Query  51    MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  230
             M+SD+G+ RELSDLQK RS Y+P+LPPCLQGTTVRVEFGDATTAADP+G HTISR FPHT
Sbjct  1     MESDYGIPRELSDLQKHRSLYQPDLPPCLQGTTVRVEFGDATTAADPAGSHTISRSFPHT  60

Query  231   FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  410
             +GQPLAHFLRA+AKV DAQIITEHPA RVGIVFCGRQSPGGHN +WGLY ALK+HNP+S 
Sbjct  61    YGQPLAHFLRATAKVADAQIITEHPAKRVGIVFCGRQSPGGHNVVWGLYSALKIHNPSSV  120

Query  411   llgflggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLK  590
             LLGFLGGSEGLFAQKTLEITD+IL+TYKNQGGYD+LGRTKDQIR+TEQVNAALT C +LK
Sbjct  121   LLGFLGGSEGLFAQKTLEITDEILSTYKNQGGYDLLGRTKDQIRTTEQVNAALTTCKNLK  180

Query  591   LDGLVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICKV  770
             LDGLVI+GGVTSNTDAA LAE FAEAKC TKVVGVPVTLNGDLKN FVET+VGFDTICKV
Sbjct  181   LDGLVIIGGVTSNTDAAQLAETFAEAKCSTKVVGVPVTLNGDLKNPFVETDVGFDTICKV  240

Query  771   NSQLISNVCTDALSAEKYYYFIRLMGRKTSHVALECTLQSHPNMVILAEEVAASKLTLFD  950
             NSQLISNVCTDALSAEKYYYFIRLMGRK SHVALECTLQSHPNMVIL EEVAASKLTLFD
Sbjct  241   NSQLISNVCTDALSAEKYYYFIRLMGRKASHVALECTLQSHPNMVILGEEVAASKLTLFD  300

Query  951   ITKQVCDAVQARAEQDKYHGVILLPEGLIESIPEIYALLKEIHVLLREGVSANNISSQLS  1130
             + KQ+CDAVQARAEQDK HGVIL+PEGLIESIPE+Y+LLKEIH LLR+GVS + ISSQLS
Sbjct  301   LAKQLCDAVQARAEQDKNHGVILIPEGLIESIPEVYSLLKEIHGLLRQGVSVDKISSQLS  360

Query  1131  PWASALFEFLPPFIRRELLLYPESDDSAQL  1220
             PWASALFEFLPPFI+++LLL+PESDDSAQL
Sbjct  361   PWASALFEFLPPFIKKQLLLHPESDDSAQL  390



>gb|KCW68155.1| hypothetical protein EUGRSUZ_F018231, partial [Eucalyptus grandis]
Length=575

 Score =   664 bits (1712),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 338/390 (87%), Positives = 367/390 (94%), Gaps = 0/390 (0%)
 Frame = +3

Query  51    MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  230
             M+SD+G+ RELSDLQK RS Y+P+LPPCLQGTTVRVEFGDATTAADP+G HTISR FPHT
Sbjct  1     MESDYGIPRELSDLQKHRSLYQPDLPPCLQGTTVRVEFGDATTAADPAGSHTISRSFPHT  60

Query  231   FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  410
             +GQPLAHFLRA+AKV DAQIITEHPA RVGIVFCGRQSPGGHN +WGLY ALK+HNP+S 
Sbjct  61    YGQPLAHFLRATAKVADAQIITEHPAKRVGIVFCGRQSPGGHNVVWGLYSALKIHNPSSV  120

Query  411   llgflggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLK  590
             LLGFLGGSEGLFAQKTLEITD+IL+TYKNQGGYD+LGRTKDQIR+TEQVNAALT C +LK
Sbjct  121   LLGFLGGSEGLFAQKTLEITDEILSTYKNQGGYDLLGRTKDQIRTTEQVNAALTTCKNLK  180

Query  591   LDGLVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICKV  770
             LDGLVI+GGVTSNTDAA LAE FAEAKC TKVVGVPVTLNGDLKN FVET+VGFDTICKV
Sbjct  181   LDGLVIIGGVTSNTDAAQLAETFAEAKCSTKVVGVPVTLNGDLKNPFVETDVGFDTICKV  240

Query  771   NSQLISNVCTDALSAEKYYYFIRLMGRKTSHVALECTLQSHPNMVILAEEVAASKLTLFD  950
             NSQLISNVCTDALSAEKYYYFIRLMGRK SHVALECTLQSHPNMVIL EEVAASKLTLFD
Sbjct  241   NSQLISNVCTDALSAEKYYYFIRLMGRKASHVALECTLQSHPNMVILGEEVAASKLTLFD  300

Query  951   ITKQVCDAVQARAEQDKYHGVILLPEGLIESIPEIYALLKEIHVLLREGVSANNISSQLS  1130
             + KQ+CDAVQARAEQDK HGVIL+PEGLIESIPE+Y+LLKEIH LLR+GVS + ISSQLS
Sbjct  301   LAKQLCDAVQARAEQDKNHGVILIPEGLIESIPEVYSLLKEIHGLLRQGVSVDKISSQLS  360

Query  1131  PWASALFEFLPPFIRRELLLYPESDDSAQL  1220
             PWASALFEFLPPFI+++LLL+PESDDSAQL
Sbjct  361   PWASALFEFLPPFIKKQLLLHPESDDSAQL  390



>ref|XP_010266301.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha isoform X1 [Nelumbo nucifera]
Length=617

 Score =   665 bits (1716),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 334/390 (86%), Positives = 362/390 (93%), Gaps = 0/390 (0%)
 Frame = +3

Query  51    MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  230
             MDSDFG+ R+LSDLQK R+ Y PELPPCLQGTTVRVEFGDATT ADPSG H+ISR FPHT
Sbjct  1     MDSDFGIPRQLSDLQKYRALYEPELPPCLQGTTVRVEFGDATTTADPSGAHSISRAFPHT  60

Query  231   FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  410
             +GQPLAHFLR  A+VPDAQIITEHPAIRVG+VFCGRQSPGGHN IWGL+ ALK+HN N+ 
Sbjct  61    YGQPLAHFLRPKAQVPDAQIITEHPAIRVGVVFCGRQSPGGHNVIWGLHSALKIHNSNNV  120

Query  411   llgflggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLK  590
             LLGF+GG+EGLFAQKTLEITDDIL++YKNQGGYD+LGRTKDQIR++EQVNAAL +C +LK
Sbjct  121   LLGFIGGTEGLFAQKTLEITDDILSSYKNQGGYDLLGRTKDQIRTSEQVNAALASCKALK  180

Query  591   LDGLVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICKV  770
             LDGLVI+GGVTSNTDAA LAE FAE KC TKVVGVPVTLNGDLKNQFVE NVGFDTICKV
Sbjct  181   LDGLVIIGGVTSNTDAAQLAETFAEEKCATKVVGVPVTLNGDLKNQFVEANVGFDTICKV  240

Query  771   NSQLISNVCTDALSAEKYYYFIRLMGRKTSHVALECTLQSHPNMVILAEEVAASKLTLFD  950
             NSQLISNVCTDALSAEKYYYFIRLMGRK SHVALECTLQSHPNMVIL EEVA+SKLTLFD
Sbjct  241   NSQLISNVCTDALSAEKYYYFIRLMGRKASHVALECTLQSHPNMVILGEEVASSKLTLFD  300

Query  951   ITKQVCDAVQARAEQDKYHGVILLPEGLIESIPEIYALLKEIHVLLREGVSANNISSQLS  1130
             IT+Q+CDAVQAR EQDKYHGVILLPEGLIESIPEIYALL+EIH L R+GVS  NISSQLS
Sbjct  301   ITQQICDAVQARVEQDKYHGVILLPEGLIESIPEIYALLQEIHGLHRQGVSVENISSQLS  360

Query  1131  PWASALFEFLPPFIRRELLLYPESDDSAQL  1220
             PWASALFEFLP FI+R+LLL+PESDDSAQL
Sbjct  361   PWASALFEFLPHFIKRQLLLHPESDDSAQL  390



>ref|XP_007153134.1| hypothetical protein PHAVU_003G009600g [Phaseolus vulgaris]
 gb|ESW25128.1| hypothetical protein PHAVU_003G009600g [Phaseolus vulgaris]
Length=617

 Score =   664 bits (1712),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 337/390 (86%), Positives = 361/390 (93%), Gaps = 0/390 (0%)
 Frame = +3

Query  51    MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  230
             MDSD+G+ RELSDLQK+RS Y+PELPPCLQGTTVRVEFGDATT+ADP+   TISR FP+T
Sbjct  1     MDSDYGIPRELSDLQKIRSLYQPELPPCLQGTTVRVEFGDATTSADPTDALTISRAFPNT  60

Query  231   FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  410
             +G PLAHFLRA+AKVPDAQIITE P IRVGIVFCGRQSPGGHN IWGL++ALK HN NS 
Sbjct  61    YGHPLAHFLRATAKVPDAQIITEFPPIRVGIVFCGRQSPGGHNVIWGLHNALKTHNSNSV  120

Query  411   llgflggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLK  590
             LLGFLGGSEGLFAQKTLEITD +L++YKNQGGYD+LGRTKDQIR+TEQVNAAL  C +LK
Sbjct  121   LLGFLGGSEGLFAQKTLEITDSVLSSYKNQGGYDLLGRTKDQIRTTEQVNAALATCNNLK  180

Query  591   LDGLVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICKV  770
             LDGLVI+GGVTSNTDAA LAE FA A CPTKVVGVPVTLNGDLKNQFVETNVGFDTICKV
Sbjct  181   LDGLVIIGGVTSNTDAAQLAETFAVANCPTKVVGVPVTLNGDLKNQFVETNVGFDTICKV  240

Query  771   NSQLISNVCTDALSAEKYYYFIRLMGRKTSHVALECTLQSHPNMVILAEEVAASKLTLFD  950
             NSQLISNVCTDALSAEKYYYFIRLMGRK SHVALECTLQSHPNMVIL EEVAASKLTLF+
Sbjct  241   NSQLISNVCTDALSAEKYYYFIRLMGRKASHVALECTLQSHPNMVILGEEVAASKLTLFE  300

Query  951   ITKQVCDAVQARAEQDKYHGVILLPEGLIESIPEIYALLKEIHVLLREGVSANNISSQLS  1130
             ITKQ+ DAVQ RAEQDKYHGVILLPEGLIESIPE+YALLKEIH LLR+GV  + ISSQLS
Sbjct  301   ITKQITDAVQTRAEQDKYHGVILLPEGLIESIPEVYALLKEIHGLLRQGVVVDKISSQLS  360

Query  1131  PWASALFEFLPPFIRRELLLYPESDDSAQL  1220
             PWASALFEFLPPFIRR+LLLYPESDDSAQL
Sbjct  361   PWASALFEFLPPFIRRQLLLYPESDDSAQL  390



>ref|XP_010539758.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha 2-like [Tarenaya hassleriana]
Length=613

 Score =   663 bits (1711),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/390 (86%), Positives = 363/390 (93%), Gaps = 0/390 (0%)
 Frame = +3

Query  51    MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  230
             MDSDFG+ RELS LQ+LRSQY+PELPPCLQGTTVRVEFGD TT A+ +  H ISR FPHT
Sbjct  1     MDSDFGIPRELSPLQQLRSQYQPELPPCLQGTTVRVEFGDGTTVAEAADAHIISRAFPHT  60

Query  231   FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  410
             + QPLAHFLRA++KVPDAQIITEHPAIRVG+VF GRQSPGGHN IWGLY+ALKVHNP S 
Sbjct  61    YSQPLAHFLRATSKVPDAQIITEHPAIRVGVVFSGRQSPGGHNVIWGLYEALKVHNPKSA  120

Query  411   llgflggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLK  590
             LLGF+GGSEGLFA+ TLEITDDIL TYKNQGGYD+LGRTKDQIR+TEQVNAAL +CT LK
Sbjct  121   LLGFVGGSEGLFAKNTLEITDDILQTYKNQGGYDLLGRTKDQIRTTEQVNAALASCTELK  180

Query  591   LDGLVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICKV  770
             LDGLVI+GGVTSNTDAA+LAE FAE KCPTKVVGVPVT+NGDLKNQFVETNVGFDTICKV
Sbjct  181   LDGLVIIGGVTSNTDAAHLAEFFAETKCPTKVVGVPVTINGDLKNQFVETNVGFDTICKV  240

Query  771   NSQLISNVCTDALSAEKYYYFIRLMGRKTSHVALECTLQSHPNMVILAEEVAASKLTLFD  950
             NSQLISNVCTDALSAEKYYYFIRLMGRK SHVALECTLQSHPNMVIL EEVAASKLTLFD
Sbjct  241   NSQLISNVCTDALSAEKYYYFIRLMGRKHSHVALECTLQSHPNMVILGEEVAASKLTLFD  300

Query  951   ITKQVCDAVQARAEQDKYHGVILLPEGLIESIPEIYALLKEIHVLLREGVSANNISSQLS  1130
             IT Q+CDAVQARA  DKYHGVIL+PEGLIESIPE+YALLKEIH LLR+GVSA+ ISSQLS
Sbjct  301   ITTQICDAVQARAGDDKYHGVILIPEGLIESIPEVYALLKEIHELLRKGVSADKISSQLS  360

Query  1131  PWASALFEFLPPFIRRELLLYPESDDSAQL  1220
             PW+SALFEFLPPFI+++LLL+PESDDSAQL
Sbjct  361   PWSSALFEFLPPFIKKQLLLHPESDDSAQL  390



>gb|ADZ96380.2| pyrophosphate--fructose 6-phosphate 1-phosphotransferase [Eriobotrya 
japonica]
Length=617

 Score =   663 bits (1710),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 336/390 (86%), Positives = 363/390 (93%), Gaps = 0/390 (0%)
 Frame = +3

Query  51    MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  230
             MDSD+G+ RELSDLQKLRSQY+PELPPCLQG TVRVEFGD TT+ DP+  HTISR FPHT
Sbjct  1     MDSDYGIPRELSDLQKLRSQYQPELPPCLQGATVRVEFGDTTTSLDPTDSHTISRYFPHT  60

Query  231   FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  410
             +GQPLAHFLRA+AKVP AQ+ITEHP +RVGIVFCGRQSPGGHN IWGL++ALKVHNPN+T
Sbjct  61    YGQPLAHFLRATAKVPGAQVITEHPPVRVGIVFCGRQSPGGHNVIWGLHNALKVHNPNNT  120

Query  411   llgflggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLK  590
             LLGFLGGSEGLFAQKTLEITD+ILATYKNQGGYD+LGRTKDQIR+ EQVNA LTAC  LK
Sbjct  121   LLGFLGGSEGLFAQKTLEITDEILATYKNQGGYDLLGRTKDQIRTVEQVNATLTACKDLK  180

Query  591   LDGLVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICKV  770
             LDGLVI+GGVTSNTDAA LAE FAEAKC TKVVGVPVTLNGDLKNQFVE NVGFDTICKV
Sbjct  181   LDGLVIIGGVTSNTDAAQLAETFAEAKCSTKVVGVPVTLNGDLKNQFVEANVGFDTICKV  240

Query  771   NSQLISNVCTDALSAEKYYYFIRLMGRKTSHVALECTLQSHPNMVILAEEVAASKLTLFD  950
             NSQLISN+CTDALSAEKYYYFIRLMGRK SHVALECTLQSHPN+VIL EEVAASKLTLFD
Sbjct  241   NSQLISNMCTDALSAEKYYYFIRLMGRKASHVALECTLQSHPNLVILGEEVAASKLTLFD  300

Query  951   ITKQVCDAVQARAEQDKYHGVILLPEGLIESIPEIYALLKEIHVLLREGVSANNISSQLS  1130
             IT Q+CDAV+ARA QDK HGVILLPEGLIESIPE+YALLKEIH L R+GVSA+ IS+QLS
Sbjct  301   ITTQICDAVEARAAQDKNHGVILLPEGLIESIPEVYALLKEIHGLHRQGVSADKISTQLS  360

Query  1131  PWASALFEFLPPFIRRELLLYPESDDSAQL  1220
             PWASALFEFLPPFI+++LLL PESDDSAQL
Sbjct  361   PWASALFEFLPPFIKKQLLLLPESDDSAQL  390



>ref|XP_008373335.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha [Malus domestica]
Length=617

 Score =   661 bits (1706),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 334/390 (86%), Positives = 363/390 (93%), Gaps = 0/390 (0%)
 Frame = +3

Query  51    MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  230
             MDSD+G+ RELSDLQKLRSQY+PELPPCLQG TVRVEFGD TT+ DP+  HTISR FPHT
Sbjct  1     MDSDYGIPRELSDLQKLRSQYQPELPPCLQGATVRVEFGDTTTSLDPTDSHTISRYFPHT  60

Query  231   FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  410
             +GQPLAHFLRA+AKVP AQ+ITEHP +RVG+VFCGRQSPGGHN IWGL++ALKVHNPN+T
Sbjct  61    YGQPLAHFLRATAKVPGAQVITEHPPVRVGVVFCGRQSPGGHNVIWGLHNALKVHNPNNT  120

Query  411   llgflggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLK  590
             LLGFLGGSEGLFAQKTLEITD+ILATYKNQGGYD+LGRTKDQIR+ EQVNA LTAC  LK
Sbjct  121   LLGFLGGSEGLFAQKTLEITDEILATYKNQGGYDLLGRTKDQIRTVEQVNATLTACKDLK  180

Query  591   LDGLVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICKV  770
             LDGLVI+GGVTSNTDAA LAE FAEAKC TKVVGVPVTLNGDLKNQFVE NVGFDTICKV
Sbjct  181   LDGLVIIGGVTSNTDAAQLAETFAEAKCSTKVVGVPVTLNGDLKNQFVEANVGFDTICKV  240

Query  771   NSQLISNVCTDALSAEKYYYFIRLMGRKTSHVALECTLQSHPNMVILAEEVAASKLTLFD  950
             NSQLISN+CTDALSAEKYYYFIRLMGRK SHVALECTLQSHPN+VIL EEVAASKLTLFD
Sbjct  241   NSQLISNMCTDALSAEKYYYFIRLMGRKASHVALECTLQSHPNLVILGEEVAASKLTLFD  300

Query  951   ITKQVCDAVQARAEQDKYHGVILLPEGLIESIPEIYALLKEIHVLLREGVSANNISSQLS  1130
             IT Q+CDAV+ARA QDK HGVILLPEGLIESIPE+YALLKEIH L R+GVSA+ IS+QLS
Sbjct  301   ITTQICDAVEARAAQDKNHGVILLPEGLIESIPEVYALLKEIHGLHRQGVSADKISTQLS  360

Query  1131  PWASALFEFLPPFIRRELLLYPESDDSAQL  1220
             PWASALFEFLPPFI++++LL PESDDSAQL
Sbjct  361   PWASALFEFLPPFIKKQVLLLPESDDSAQL  390



>ref|XP_008346428.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha [Malus domestica]
Length=617

 Score =   661 bits (1705),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 334/390 (86%), Positives = 363/390 (93%), Gaps = 0/390 (0%)
 Frame = +3

Query  51    MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  230
             MDSD+G+ RELSDLQKLRSQY+PELPPCLQG TVRVEFGD TT+ DP+  HTISR FPHT
Sbjct  1     MDSDYGIPRELSDLQKLRSQYQPELPPCLQGATVRVEFGDTTTSLDPTDSHTISRYFPHT  60

Query  231   FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  410
             +GQPLAHFLRA+AKVP AQ+ITEHP +RVG+VFCGRQSPGGHN IWGL++ALKVHNPN+T
Sbjct  61    YGQPLAHFLRATAKVPGAQVITEHPPVRVGVVFCGRQSPGGHNVIWGLHNALKVHNPNNT  120

Query  411   llgflggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLK  590
             LLGFLGGSEGLFAQKTLEITD+ILATYKNQGGYD+LGRTKDQIR+ EQVNA LTAC  LK
Sbjct  121   LLGFLGGSEGLFAQKTLEITDEILATYKNQGGYDLLGRTKDQIRTVEQVNATLTACKDLK  180

Query  591   LDGLVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICKV  770
             LDGLVI+GGVTSNTDAA LAE FAEAKC TKVVGVPVTLNGDLKNQFVE NVGFDTICKV
Sbjct  181   LDGLVIIGGVTSNTDAAQLAETFAEAKCSTKVVGVPVTLNGDLKNQFVEANVGFDTICKV  240

Query  771   NSQLISNVCTDALSAEKYYYFIRLMGRKTSHVALECTLQSHPNMVILAEEVAASKLTLFD  950
             NSQLISN+CTDALSAEKYYYFIRLMGRK SHVALECTLQSHPN+VIL EEVAASKLTLFD
Sbjct  241   NSQLISNMCTDALSAEKYYYFIRLMGRKASHVALECTLQSHPNLVILGEEVAASKLTLFD  300

Query  951   ITKQVCDAVQARAEQDKYHGVILLPEGLIESIPEIYALLKEIHVLLREGVSANNISSQLS  1130
             IT Q+CDAV+ARA QDK HGVILLPEGLIESIPE+YALLKEIH L R+GVSA+ IS+QLS
Sbjct  301   ITTQICDAVEARAAQDKNHGVILLPEGLIESIPEVYALLKEIHGLHRQGVSADKISTQLS  360

Query  1131  PWASALFEFLPPFIRRELLLYPESDDSAQL  1220
             PWASALFEFLPPFI++++LL PESDDSAQL
Sbjct  361   PWASALFEFLPPFIKKQVLLLPESDDSAQL  390



>ref|XP_010684564.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha [Beta vulgaris subsp. vulgaris]
Length=617

 Score =   659 bits (1701),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/390 (86%), Positives = 363/390 (93%), Gaps = 0/390 (0%)
 Frame = +3

Query  51    MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  230
             MDSDFG+ RELSDLQK RS Y+PELPPCLQGTTVRVE+GD TTA DPS  H ISR FPHT
Sbjct  1     MDSDFGIPRELSDLQKQRSLYQPELPPCLQGTTVRVEYGDGTTAIDPSDVHAISRYFPHT  60

Query  231   FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  410
             +GQPLAHFLRA+AKVPDAQIITEHP IRVGIVF GRQSPGGHN +WGLY+ALK+HN N+ 
Sbjct  61    YGQPLAHFLRATAKVPDAQIITEHPTIRVGIVFSGRQSPGGHNVVWGLYNALKIHNTNNI  120

Query  411   llgflggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLK  590
             LLGFLGG+EGLFAQKTLEITDDIL+TYKNQGGYD+LGRTKDQIR+ EQVNAAL +C +LK
Sbjct  121   LLGFLGGTEGLFAQKTLEITDDILSTYKNQGGYDLLGRTKDQIRTIEQVNAALASCKALK  180

Query  591   LDGLVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICKV  770
             LDGLVI+GGVTSNTDAA LAE FAEAKCPTKVVGVPVTLNGDLKNQFVET+VGFDTICKV
Sbjct  181   LDGLVIIGGVTSNTDAAQLAETFAEAKCPTKVVGVPVTLNGDLKNQFVETDVGFDTICKV  240

Query  771   NSQLISNVCTDALSAEKYYYFIRLMGRKTSHVALECTLQSHPNMVILAEEVAASKLTLFD  950
             NSQLISNVCTDALSAEKYYYFIRLMGRK SHVALECTLQSHPN+VIL EEVAASKLTLFD
Sbjct  241   NSQLISNVCTDALSAEKYYYFIRLMGRKASHVALECTLQSHPNLVILGEEVAASKLTLFD  300

Query  951   ITKQVCDAVQARAEQDKYHGVILLPEGLIESIPEIYALLKEIHVLLREGVSANNISSQLS  1130
             +TKQ+CDAVQ RAE+DK HGVILLPEGLIESIPEIYALL+EIH L REGVS + +SSQLS
Sbjct  301   LTKQICDAVQTRAEKDKNHGVILLPEGLIESIPEIYALLQEIHGLHREGVSVDVMSSQLS  360

Query  1131  PWASALFEFLPPFIRRELLLYPESDDSAQL  1220
             PWASALFEFLPPFI+++LLL+PESDDSAQL
Sbjct  361   PWASALFEFLPPFIKKQLLLHPESDDSAQL  390



>ref|XP_010537247.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha 2 [Tarenaya hassleriana]
Length=610

 Score =   659 bits (1699),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 334/390 (86%), Positives = 362/390 (93%), Gaps = 0/390 (0%)
 Frame = +3

Query  51    MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  230
             MDSDFG+ RELS LQ+LRSQY+PELPPCLQGTTVRVEFGD  T ++ +  H +SR FPHT
Sbjct  1     MDSDFGIPRELSPLQQLRSQYQPELPPCLQGTTVRVEFGDGATVSEAADAHVVSRAFPHT  60

Query  231   FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  410
             + QPLAHFLRA+AKVPDAQIITEHPAIRVG+VFCGRQSPGGHN IWGLY+AL+VHNP S 
Sbjct  61    YSQPLAHFLRATAKVPDAQIITEHPAIRVGVVFCGRQSPGGHNVIWGLYEALQVHNPKSN  120

Query  411   llgflggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLK  590
             LLGF+GGSEGLFA+KTLEITDDIL TYKNQGGYD+LGRTKDQIR+TEQVNAAL ACT LK
Sbjct  121   LLGFVGGSEGLFAKKTLEITDDILQTYKNQGGYDLLGRTKDQIRTTEQVNAALAACTELK  180

Query  591   LDGLVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICKV  770
             LDGLVI+GGVTSNTDAAYLAE FAEAKCPTKVVGVPVT+NGDLKNQFVETNVGFDTICKV
Sbjct  181   LDGLVIIGGVTSNTDAAYLAEFFAEAKCPTKVVGVPVTINGDLKNQFVETNVGFDTICKV  240

Query  771   NSQLISNVCTDALSAEKYYYFIRLMGRKTSHVALECTLQSHPNMVILAEEVAASKLTLFD  950
             NSQLISNVCTDALSAEKYYYFIRLMGRK SHVALECTLQSHPNM+IL EEVAASKLTLFD
Sbjct  241   NSQLISNVCTDALSAEKYYYFIRLMGRKHSHVALECTLQSHPNMLILGEEVAASKLTLFD  300

Query  951   ITKQVCDAVQARAEQDKYHGVILLPEGLIESIPEIYALLKEIHVLLREGVSANNISSQLS  1130
             I KQ+CDAVQARA  +K HGVIL+PEGLIESIPE+YALLKEIH LLR GVSA+ ISSQLS
Sbjct  301   IAKQICDAVQARAGDEKNHGVILIPEGLIESIPEVYALLKEIHGLLRHGVSADKISSQLS  360

Query  1131  PWASALFEFLPPFIRRELLLYPESDDSAQL  1220
             PW+SALFEFLPPFI+++LLL PESDDSAQL
Sbjct  361   PWSSALFEFLPPFIKKQLLLRPESDDSAQL  390



>ref|XP_009372651.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha [Pyrus x bretschneideri]
Length=617

 Score =   657 bits (1696),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 334/390 (86%), Positives = 360/390 (92%), Gaps = 0/390 (0%)
 Frame = +3

Query  51    MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  230
             MDSD+G+ RELSDLQK RSQY+PELPPCLQG TVRVEFGD TT+ DP+  HTISR FPHT
Sbjct  1     MDSDYGIPRELSDLQKHRSQYQPELPPCLQGATVRVEFGDTTTSLDPTDSHTISRYFPHT  60

Query  231   FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  410
             +GQPLAHFLRA+AKVP AQ+ITEHP +RVG+VFCGRQSPGGHN IWGL++ALKVHNPN+T
Sbjct  61    YGQPLAHFLRATAKVPGAQVITEHPPVRVGVVFCGRQSPGGHNVIWGLHNALKVHNPNNT  120

Query  411   llgflggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLK  590
             LLGFLGGSEGLFAQKTLEITD ILATYKNQGGYD+LGRTKDQIR+ EQVNA LTAC  LK
Sbjct  121   LLGFLGGSEGLFAQKTLEITDQILATYKNQGGYDLLGRTKDQIRTVEQVNATLTACKDLK  180

Query  591   LDGLVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICKV  770
             LDGLVI+GGVTSNTDAA LAE FAEAKC TKVVGVPVTLNGDLKNQFVE NVGFDTICKV
Sbjct  181   LDGLVIIGGVTSNTDAAQLAETFAEAKCSTKVVGVPVTLNGDLKNQFVEANVGFDTICKV  240

Query  771   NSQLISNVCTDALSAEKYYYFIRLMGRKTSHVALECTLQSHPNMVILAEEVAASKLTLFD  950
             NSQLISN+CTDALSAEKYYYFIRLMGRK SHVALECTLQSHPN+VIL EEVAASKLTLFD
Sbjct  241   NSQLISNMCTDALSAEKYYYFIRLMGRKASHVALECTLQSHPNLVILGEEVAASKLTLFD  300

Query  951   ITKQVCDAVQARAEQDKYHGVILLPEGLIESIPEIYALLKEIHVLLREGVSANNISSQLS  1130
             IT Q+CDAV+ARA QDK HGVILLPEGLIESIPE+YALLKEIH L R+GVSA+ I +QLS
Sbjct  301   ITTQICDAVEARAAQDKNHGVILLPEGLIESIPEVYALLKEIHGLHRQGVSADKICTQLS  360

Query  1131  PWASALFEFLPPFIRRELLLYPESDDSAQL  1220
             PWASALFEFLPPFI+R+LLL PESDDSAQL
Sbjct  361   PWASALFEFLPPFIKRQLLLLPESDDSAQL  390



>ref|XP_010913868.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha-like [Elaeis guineensis]
Length=617

 Score =   657 bits (1695),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/390 (83%), Positives = 361/390 (93%), Gaps = 0/390 (0%)
 Frame = +3

Query  51    MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  230
             M+SDFG+ RELS+LQ+ R++Y PELPPCLQGTTVRVEFGD+TT ADPS  H ISR FPHT
Sbjct  1     MNSDFGVPRELSELQQKRAEYHPELPPCLQGTTVRVEFGDSTTTADPSSAHVISRAFPHT  60

Query  231   FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  410
             F QPLAHFLRA+AKVPDAQIITEHP +RVG+VFCGRQSPGGHN +WGLY+A+K+HNP+S 
Sbjct  61    FEQPLAHFLRATAKVPDAQIITEHPPMRVGVVFCGRQSPGGHNVVWGLYNAIKIHNPDSV  120

Query  411   llgflggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLK  590
             LLGF+GG+EG FAQKTLEITDD+L+TYKNQGGYD+LGRTKDQIR+TEQVNAA+T C +LK
Sbjct  121   LLGFVGGTEGFFAQKTLEITDDVLSTYKNQGGYDLLGRTKDQIRTTEQVNAAMTTCHALK  180

Query  591   LDGLVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICKV  770
             LDGLVI+GGVTSN+DAA LAE FAE+KCPTKVVGVPVTLNGDLKNQFVETNVGFDT+C+V
Sbjct  181   LDGLVIIGGVTSNSDAAQLAETFAESKCPTKVVGVPVTLNGDLKNQFVETNVGFDTVCRV  240

Query  771   NSQLISNVCTDALSAEKYYYFIRLMGRKTSHVALECTLQSHPNMVILAEEVAASKLTLFD  950
             NSQLISNVCTDALSAEKYYYFIRLMGRK SHVALEC LQSHPNMVIL EEVA SKLT+FD
Sbjct  241   NSQLISNVCTDALSAEKYYYFIRLMGRKASHVALECALQSHPNMVILGEEVALSKLTIFD  300

Query  951   ITKQVCDAVQARAEQDKYHGVILLPEGLIESIPEIYALLKEIHVLLREGVSANNISSQLS  1130
             ITKQ+CDAVQARAE+ KYHGVIL+PEGL+ESIPE+YALL+EIH L  +GVS  NISS LS
Sbjct  301   ITKQICDAVQARAEKAKYHGVILIPEGLVESIPELYALLQEIHSLHNQGVSTENISSHLS  360

Query  1131  PWASALFEFLPPFIRRELLLYPESDDSAQL  1220
             PWASALFEFLPPFIR++LLL PESDDSAQL
Sbjct  361   PWASALFEFLPPFIRKQLLLLPESDDSAQL  390



>ref|XP_010527650.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha-like [Tarenaya hassleriana]
Length=614

 Score =   657 bits (1695),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 334/390 (86%), Positives = 357/390 (92%), Gaps = 0/390 (0%)
 Frame = +3

Query  51    MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  230
             MDSD+G+ RELSD+Q+LRS Y PELPPCLQGTTVRVEFGDATT A+    H I+R FP+T
Sbjct  1     MDSDYGIPRELSDIQELRSHYEPELPPCLQGTTVRVEFGDATTVAEVDSAHIIARAFPNT  60

Query  231   FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  410
             +GQ L HFLRA+AKVP AQIITEH AIRVG +FCGRQSPGGHN IWGLYDALK+HNP ST
Sbjct  61    YGQRLVHFLRATAKVPGAQIITEHQAIRVGFLFCGRQSPGGHNVIWGLYDALKIHNPQST  120

Query  411   llgflggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLK  590
             LLGFLGGSEGLFAQKTLEITDDIL TYKNQGGYD+LGRTKDQIR+TEQV+AAL AC  LK
Sbjct  121   LLGFLGGSEGLFAQKTLEITDDILRTYKNQGGYDLLGRTKDQIRTTEQVDAALEACRELK  180

Query  591   LDGLVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICKV  770
             LDGLVIVGGVTSNTDAA LAE FA AKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICKV
Sbjct  181   LDGLVIVGGVTSNTDAAQLAETFARAKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICKV  240

Query  771   NSQLISNVCTDALSAEKYYYFIRLMGRKTSHVALECTLQSHPNMVILAEEVAASKLTLFD  950
             NSQLISNVCTDALSAEKYYYFIRLMGRK SHVALECTLQSHPNMVIL EEV ASKLTLFD
Sbjct  241   NSQLISNVCTDALSAEKYYYFIRLMGRKASHVALECTLQSHPNMVILGEEVVASKLTLFD  300

Query  951   ITKQVCDAVQARAEQDKYHGVILLPEGLIESIPEIYALLKEIHVLLREGVSANNISSQLS  1130
             ITKQ+CDAVQARAEQ K HGV+L+PEGLIESIPE+YALLKEIH L REG+SA+ ISSQLS
Sbjct  301   ITKQICDAVQARAEQGKNHGVVLIPEGLIESIPEVYALLKEIHGLFREGISADKISSQLS  360

Query  1131  PWASALFEFLPPFIRRELLLYPESDDSAQL  1220
             PWASALFEFLP FI+++LLLYPESDDSAQL
Sbjct  361   PWASALFEFLPSFIKKQLLLYPESDDSAQL  390



>ref|XP_007210294.1| hypothetical protein PRUPE_ppa002571mg [Prunus persica]
 gb|EMJ11493.1| hypothetical protein PRUPE_ppa002571mg [Prunus persica]
Length=657

 Score =   658 bits (1698),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 333/392 (85%), Positives = 360/392 (92%), Gaps = 0/392 (0%)
 Frame = +3

Query  45    VKMDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFP  224
             + MDSD+G+ RELSD+QK RSQY+PELPPCLQG TVRVEFGD TT+ DP+  HTI R FP
Sbjct  39    ISMDSDYGIPRELSDVQKFRSQYQPELPPCLQGATVRVEFGDTTTSLDPTDAHTIGRYFP  98

Query  225   HTFGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPN  404
             HT+GQPLAHFLRA+AKVP AQ+ITEHP  RVG+VFCGRQSPGGHN IWGL++ALKVHNP 
Sbjct  99    HTYGQPLAHFLRATAKVPGAQVITEHPPFRVGVVFCGRQSPGGHNVIWGLHNALKVHNPK  158

Query  405   STllgflggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTS  584
             STLLGFLGGSEGLFAQKTLEITD+ILATYKNQGGYD+LGRTKDQIR+ EQVNA LTAC  
Sbjct  159   STLLGFLGGSEGLFAQKTLEITDEILATYKNQGGYDLLGRTKDQIRTVEQVNATLTACKD  218

Query  585   LKLDGLVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTIC  764
             LKLDGLVI+GGVTSNTDAA LAE FAEAKC TKVVGVPVTLNGDLKNQFVE NVGFDTIC
Sbjct  219   LKLDGLVIIGGVTSNTDAAQLAETFAEAKCQTKVVGVPVTLNGDLKNQFVEANVGFDTIC  278

Query  765   KVNSQLISNVCTDALSAEKYYYFIRLMGRKTSHVALECTLQSHPNMVILAEEVAASKLTL  944
             KVNSQLISNVCTDALSAEKYYYFIRLMGRK SHVALECTLQSHPN+VIL EEVAASKLTL
Sbjct  279   KVNSQLISNVCTDALSAEKYYYFIRLMGRKASHVALECTLQSHPNLVILGEEVAASKLTL  338

Query  945   FDITKQVCDAVQARAEQDKYHGVILLPEGLIESIPEIYALLKEIHVLLREGVSANNISSQ  1124
             FDIT Q+CDAV+ARA QDK HGVILLPEGLIESIPE+YALLKEIH L R+GVSA+ ISSQ
Sbjct  339   FDITTQICDAVEARAAQDKNHGVILLPEGLIESIPEVYALLKEIHGLHRQGVSADKISSQ  398

Query  1125  LSPWASALFEFLPPFIRRELLLYPESDDSAQL  1220
             LSPWASALFEFLPPFI++++LL PESDDSAQL
Sbjct  399   LSPWASALFEFLPPFIKKQVLLLPESDDSAQL  430



>ref|XP_008237897.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha [Prunus mume]
Length=668

 Score =   658 bits (1697),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 333/392 (85%), Positives = 360/392 (92%), Gaps = 0/392 (0%)
 Frame = +3

Query  45    VKMDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFP  224
             + MDSD+G+ RELSD+QK RSQY+PELPPCLQG TVRVEFGD TT+ DP+  HTI R FP
Sbjct  50    ISMDSDYGIPRELSDVQKFRSQYQPELPPCLQGATVRVEFGDTTTSLDPTDAHTIGRYFP  109

Query  225   HTFGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPN  404
             HT+GQPLAHFLRA+AKVP AQ+ITEHP  RVG+VFCGRQSPGGHN IWGL++ALKVHNP 
Sbjct  110   HTYGQPLAHFLRATAKVPGAQVITEHPPFRVGVVFCGRQSPGGHNVIWGLHNALKVHNPK  169

Query  405   STllgflggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTS  584
             STLLGFLGGSEGLFAQKTLEITD+ILATYKNQGGYD+LGRTKDQIR+ EQVNA LTAC  
Sbjct  170   STLLGFLGGSEGLFAQKTLEITDEILATYKNQGGYDLLGRTKDQIRTVEQVNATLTACKD  229

Query  585   LKLDGLVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTIC  764
             LKLDGLVI+GGVTSNTDAA LAE FAEAKC TKVVGVPVTLNGDLKNQFVE NVGFDTIC
Sbjct  230   LKLDGLVIIGGVTSNTDAAQLAETFAEAKCQTKVVGVPVTLNGDLKNQFVEANVGFDTIC  289

Query  765   KVNSQLISNVCTDALSAEKYYYFIRLMGRKTSHVALECTLQSHPNMVILAEEVAASKLTL  944
             KVNSQLISNVCTDALSAEKYYYFIRLMGRK SHVALECTLQSHPN+VIL EEVAASKLTL
Sbjct  290   KVNSQLISNVCTDALSAEKYYYFIRLMGRKASHVALECTLQSHPNLVILGEEVAASKLTL  349

Query  945   FDITKQVCDAVQARAEQDKYHGVILLPEGLIESIPEIYALLKEIHVLLREGVSANNISSQ  1124
             FDIT Q+CDAV+ARA QDK HGVILLPEGLIESIPE+YALLKEIH L R+GVSA+ ISSQ
Sbjct  350   FDITTQICDAVEARAAQDKNHGVILLPEGLIESIPEVYALLKEIHGLHRQGVSADKISSQ  409

Query  1125  LSPWASALFEFLPPFIRRELLLYPESDDSAQL  1220
             LSPWASALFEFLPPFI++++LL PESDDSAQL
Sbjct  410   LSPWASALFEFLPPFIKKQVLLLPESDDSAQL  441



>ref|XP_009410339.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha {ECO:0000255|HAMAP-Rule:MF_03185} [Musa 
acuminata subsp. malaccensis]
Length=613

 Score =   655 bits (1690),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/390 (84%), Positives = 363/390 (93%), Gaps = 0/390 (0%)
 Frame = +3

Query  51    MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  230
             MDSD+G+ RELSDLQKLR+ Y+P LPPC+QGTTVRVEFGDATT +DP+G H IS+ FPHT
Sbjct  1     MDSDYGVLRELSDLQKLRALYQPGLPPCVQGTTVRVEFGDATTTSDPAGAHVISQAFPHT  60

Query  231   FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  410
             +GQPLAHFLR +AKVPDAQII E PAIRVG+VFCGRQSPGGHN IWGL+ A+K HNPNST
Sbjct  61    YGQPLAHFLRPTAKVPDAQIIVEQPAIRVGVVFCGRQSPGGHNVIWGLHSAIKSHNPNST  120

Query  411   llgflggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLK  590
             LLGF+GG+EGLFA+KTLEIT+DIL+TY+NQGGYD+LGRTKDQIR+TEQVNAA++AC  LK
Sbjct  121   LLGFVGGTEGLFAKKTLEITNDILSTYQNQGGYDLLGRTKDQIRTTEQVNAAMSACQELK  180

Query  591   LDGLVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICKV  770
             LDGLVI+GGVTSNTDAA LAE FAE KC TKVVGVPVTLNGDLKNQFVETNVGFDTICKV
Sbjct  181   LDGLVIIGGVTSNTDAAQLAETFAELKCSTKVVGVPVTLNGDLKNQFVETNVGFDTICKV  240

Query  771   NSQLISNVCTDALSAEKYYYFIRLMGRKTSHVALECTLQSHPNMVILAEEVAASKLTLFD  950
             NSQLISNVCTDALSAEKYYYFIRLMGRK SHVALECTLQSHPNMVIL EEVAASKLT+FD
Sbjct  241   NSQLISNVCTDALSAEKYYYFIRLMGRKASHVALECTLQSHPNMVILGEEVAASKLTIFD  300

Query  951   ITKQVCDAVQARAEQDKYHGVILLPEGLIESIPEIYALLKEIHVLLREGVSANNISSQLS  1130
             IT+Q+CDAVQARAE+DKYHGVIL+PEGL+ESIPE+YALL+EIH L R GVS  +ISSQLS
Sbjct  301   ITQQICDAVQARAEKDKYHGVILIPEGLVESIPELYALLQEIHGLHRRGVSVEDISSQLS  360

Query  1131  PWASALFEFLPPFIRRELLLYPESDDSAQL  1220
             PWASALF FLPPFIR++LLL+PESDDSAQL
Sbjct  361   PWASALFVFLPPFIRKQLLLHPESDDSAQL  390



>gb|EPS71673.1| hypothetical protein M569_03082, partial [Genlisea aurea]
Length=608

 Score =   652 bits (1683),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 336/391 (86%), Positives = 367/391 (94%), Gaps = 1/391 (0%)
 Frame = +3

Query  51    MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  230
             MDSD+G+ RELSDLQKLRS Y+PELPPC+QGTTVRVEFGDAT AADP+G HTISR  PHT
Sbjct  1     MDSDYGVPRELSDLQKLRSHYKPELPPCVQGTTVRVEFGDATAAADPAGAHTISRSLPHT  60

Query  231   FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHN-PNS  407
             +GQPLAHFLRA+AKVPDAQIITEHP +RVG+VFCGRQSPGGHN IWGL+DALK+HN  N 
Sbjct  61    YGQPLAHFLRATAKVPDAQIITEHPPVRVGVVFCGRQSPGGHNVIWGLFDALKLHNSKNV  120

Query  408   TllgflggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSL  587
              L     GSEGLFAQKTLEITD+ILATYKNQGGYD+LGRTKDQIR+TEQVNAAL +CT+L
Sbjct  121   LLGFLGRGSEGLFAQKTLEITDEILATYKNQGGYDLLGRTKDQIRTTEQVNAALNSCTAL  180

Query  588   KLDGLVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICK  767
             KLD LVI+GGVTSNTDAA LAE FAE KCPTKVVGVPVTLNGDLKNQFVETNVGFDTICK
Sbjct  181   KLDALVIIGGVTSNTDAAQLAETFAERKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICK  240

Query  768   VNSQLISNVCTDALSAEKYYYFIRLMGRKTSHVALECTLQSHPNMVILAEEVAASKLTLF  947
             VNSQLISNVCTDALSAEKYYYFIRLMGRK SHVALECTLQSHPNMVILAEEVAASKLTLF
Sbjct  241   VNSQLISNVCTDALSAEKYYYFIRLMGRKASHVALECTLQSHPNMVILAEEVAASKLTLF  300

Query  948   DITKQVCDAVQARAEQDKYHGVILLPEGLIESIPEIYALLKEIHVLLREGVSANNISSQL  1127
             DIT+Q+CDAVQAR+EQDKYHGVILLPEGLIESIPE+ ALL+EIHVLL++GVSA++ISSQL
Sbjct  301   DITQQICDAVQARSEQDKYHGVILLPEGLIESIPEVSALLQEIHVLLKQGVSADHISSQL  360

Query  1128  SPWASALFEFLPPFIRRELLLYPESDDSAQL  1220
             SPWASALFEFLPPFIR+++LL+PESD+SAQL
Sbjct  361   SPWASALFEFLPPFIRKQVLLHPESDESAQL  391



>ref|XP_010270592.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha-like [Nelumbo nucifera]
Length=617

 Score =   652 bits (1683),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 329/390 (84%), Positives = 362/390 (93%), Gaps = 0/390 (0%)
 Frame = +3

Query  51    MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  230
             MDSDFG+ RELSDLQK R+ Y PE+PPCLQGTTVRVEFGDATT ADP+G   I R FPHT
Sbjct  1     MDSDFGVPRELSDLQKKRALYEPEVPPCLQGTTVRVEFGDATTTADPAGSLGIIRAFPHT  60

Query  231   FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  410
             +GQPLAHFLR  ++VPDAQIIT+HPAIRVG+VFCGRQSPGGHN +WGLY+ALK+HNPN+ 
Sbjct  61    YGQPLAHFLRPKSQVPDAQIITDHPAIRVGVVFCGRQSPGGHNVVWGLYNALKIHNPNNV  120

Query  411   llgflggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLK  590
             LLGFLGGSEGLFAQKTLEITDD+L++YKNQGG+DMLGRTKDQIR+TEQVNAAL +C +L 
Sbjct  121   LLGFLGGSEGLFAQKTLEITDDVLSSYKNQGGFDMLGRTKDQIRTTEQVNAALASCKALN  180

Query  591   LDGLVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICKV  770
             LDGLVI+GGVTSNTDAA LAE FAEAKC TKVVGVPVTL GDL+NQFVETNVGFDTICKV
Sbjct  181   LDGLVIIGGVTSNTDAAQLAETFAEAKCTTKVVGVPVTLYGDLRNQFVETNVGFDTICKV  240

Query  771   NSQLISNVCTDALSAEKYYYFIRLMGRKTSHVALECTLQSHPNMVILAEEVAASKLTLFD  950
             NSQLISNVCTDALSAEKYYYFIRLMGR+ SHVALEC LQSHPNMVIL EEVA+SKLTLFD
Sbjct  241   NSQLISNVCTDALSAEKYYYFIRLMGRRASHVALECALQSHPNMVILGEEVASSKLTLFD  300

Query  951   ITKQVCDAVQARAEQDKYHGVILLPEGLIESIPEIYALLKEIHVLLREGVSANNISSQLS  1130
             ITKQ+CDA+QARAEQDKYHGVILLPEGLIESIPEIYALL+EI+ L ++GVS +NISSQLS
Sbjct  301   ITKQICDAIQARAEQDKYHGVILLPEGLIESIPEIYALLQEINGLHKQGVSVDNISSQLS  360

Query  1131  PWASALFEFLPPFIRRELLLYPESDDSAQL  1220
             PWASALFEFLP FI+RELLL+PESDDSAQL
Sbjct  361   PWASALFEFLPHFIKRELLLHPESDDSAQL  390



>emb|CBI40779.3| unnamed protein product [Vitis vinifera]
Length=653

 Score =   653 bits (1685),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 334/427 (78%), Positives = 364/427 (85%), Gaps = 37/427 (9%)
 Frame = +3

Query  51    MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  230
             MDSDFG+ RELSDLQK R  Y PELPPCLQGTTVRVEFGDATTA+D SG  TISR FPHT
Sbjct  1     MDSDFGIPRELSDLQKHRCLYEPELPPCLQGTTVRVEFGDATTASDLSGARTISRSFPHT  60

Query  231   FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  410
             +GQPLAHFLRA+AKVPDAQ+ITEHP IRVG+VFCGRQSPGGHN IWGL++ALK+HNP + 
Sbjct  61    YGQPLAHFLRATAKVPDAQVITEHPPIRVGVVFCGRQSPGGHNVIWGLHNALKIHNPKNI  120

Query  411   llgflggsegl-------------------------------------fAQKTLEITDDI  479
             LLGFL   + +                                     FAQKTLEITDDI
Sbjct  121   LLGFLAQYDRMDNWAIMSSVMVMFEGYLASDAYNSNIHLSLFCGSEGLFAQKTLEITDDI  180

Query  480   LATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLKLDGLVIVGGVTSNTDaaylaeaf  659
             L+TYKNQGGYD+LGRTKDQIR+TEQVNAAL+ C +LKL+GLVI+GGVTSNTDAA LAE F
Sbjct  181   LSTYKNQGGYDLLGRTKDQIRTTEQVNAALSTCKNLKLEGLVIIGGVTSNTDAAQLAETF  240

Query  660   aeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICKVNSQLISNVCTDALSAEKYYYFIR  839
             AEAKC TKVVGVPV+LNGDLKNQFVE+NVGFDTICKVNSQLISNVCTDALSAEKYYYFIR
Sbjct  241   AEAKCQTKVVGVPVSLNGDLKNQFVESNVGFDTICKVNSQLISNVCTDALSAEKYYYFIR  300

Query  840   LMGRKTSHVALECTLQSHPNMVILAEEVAASKLTLFDITKQVCDAVQARAEQDKYHGVIL  1019
             LMGRK SHVALECTLQSHPNMVIL EEVAASKLTLFD+TKQ+CDAVQARAEQDKYHGVIL
Sbjct  301   LMGRKASHVALECTLQSHPNMVILGEEVAASKLTLFDLTKQICDAVQARAEQDKYHGVIL  360

Query  1020  LPEGLIESIPEIYALLKEIHVLLREGVSANNISSQLSPWASALFEFLPPFIRRELLLYPE  1199
             LPEGLIESIPE+YALL+EIH LLR+GVSA NISS+LSPWASALFEFLPPFI+++LLLYPE
Sbjct  361   LPEGLIESIPEVYALLQEIHGLLRQGVSAVNISSKLSPWASALFEFLPPFIKKQLLLYPE  420

Query  1200  SDDSAQL  1220
             SDDSAQL
Sbjct  421   SDDSAQL  427



>ref|XP_002889091.1| hypothetical protein ARALYDRAFT_476813 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH65350.1| hypothetical protein ARALYDRAFT_476813 [Arabidopsis lyrata subsp. 
lyrata]
Length=617

 Score =   651 bits (1679),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 329/390 (84%), Positives = 358/390 (92%), Gaps = 0/390 (0%)
 Frame = +3

Query  51    MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  230
             MDSDFG+ RELS LQ+LRSQY PELPPCLQGTTVRVE GD TT A     H I+R FPHT
Sbjct  1     MDSDFGIPRELSPLQQLRSQYHPELPPCLQGTTVRVELGDGTTVAKAGDAHIIARAFPHT  60

Query  231   FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  410
              GQPLAHFLRA+AKVPDAQIITEHPA RVGIVF GRQ+PGGHN +WGLY+ALKVHN  +T
Sbjct  61    LGQPLAHFLRATAKVPDAQIITEHPAKRVGIVFSGRQAPGGHNVVWGLYEALKVHNAKNT  120

Query  411   llgflggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLK  590
             LLGFLGGSEGLFAQKTLEIT+D+L TYKNQGGYDMLGRTKDQIR+TEQVNAAL ACT LK
Sbjct  121   LLGFLGGSEGLFAQKTLEITEDVLQTYKNQGGYDMLGRTKDQIRTTEQVNAALKACTDLK  180

Query  591   LDGLVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICKV  770
             LDGLVI+GGVTSNTDAA+LAE FAEAKCPTKVVGVPVT+NGDLKNQFVE NVGFDT CKV
Sbjct  181   LDGLVIIGGVTSNTDAAHLAEFFAEAKCPTKVVGVPVTINGDLKNQFVEANVGFDTTCKV  240

Query  771   NSQLISNVCTDALSAEKYYYFIRLMGRKTSHVALECTLQSHPNMVILAEEVAASKLTLFD  950
             NSQLISN+CTDALSAEKYYYF+RLMGRK SHVALECTLQSHPNMVIL EEV ASKLT+FD
Sbjct  241   NSQLISNICTDALSAEKYYYFVRLMGRKHSHVALECTLQSHPNMVILGEEVTASKLTIFD  300

Query  951   ITKQVCDAVQARAEQDKYHGVILLPEGLIESIPEIYALLKEIHVLLREGVSANNISSQLS  1130
             I KQ+CDAVQARAEQDK HGVIL+PEGL+ESIPE+YALLKEIH LL+EGV A+NIS+QLS
Sbjct  301   IIKQICDAVQARAEQDKNHGVILIPEGLVESIPELYALLKEIHGLLKEGVQADNISTQLS  360

Query  1131  PWASALFEFLPPFIRRELLLYPESDDSAQL  1220
             PW+SALFEFLPPFI+++LLL+PESDDSAQL
Sbjct  361   PWSSALFEFLPPFIKKQLLLHPESDDSAQL  390



>gb|KCW68156.1| hypothetical protein EUGRSUZ_F018231, partial [Eucalyptus grandis]
Length=599

 Score =   650 bits (1677),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 338/414 (82%), Positives = 367/414 (89%), Gaps = 24/414 (6%)
 Frame = +3

Query  51    MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  230
             M+SD+G+ RELSDLQK RS Y+P+LPPCLQGTTVRVEFGDATTAADP+G HTISR FPHT
Sbjct  1     MESDYGIPRELSDLQKHRSLYQPDLPPCLQGTTVRVEFGDATTAADPAGSHTISRSFPHT  60

Query  231   FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  410
             +GQPLAHFLRA+AKV DAQIITEHPA RVGIVFCGRQSPGGHN +WGLY ALK+HNP+S 
Sbjct  61    YGQPLAHFLRATAKVADAQIITEHPAKRVGIVFCGRQSPGGHNVVWGLYSALKIHNPSSV  120

Query  411   llgflggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLK  590
             LLGFLGGSEGLFAQKTLEITD+IL+TYKNQGGYD+LGRTKDQIR+TEQVNAALT C +LK
Sbjct  121   LLGFLGGSEGLFAQKTLEITDEILSTYKNQGGYDLLGRTKDQIRTTEQVNAALTTCKNLK  180

Query  591   LDGLVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICKV  770
             LDGLVI+GGVTSNTDAA LAE FAEAKC TKVVGVPVTLNGDLKN FVET+VGFDTICKV
Sbjct  181   LDGLVIIGGVTSNTDAAQLAETFAEAKCSTKVVGVPVTLNGDLKNPFVETDVGFDTICKV  240

Query  771   NSQLISNVCTDALSAEKYYYFIRLMGRKTSHVALECTLQSHPNMVILAEEVAASKLTLFD  950
             NSQLISNVCTDALSAEKYYYFIRLMGRK SHVALECTLQSHPNMVIL EEVAASKLTLFD
Sbjct  241   NSQLISNVCTDALSAEKYYYFIRLMGRKASHVALECTLQSHPNMVILGEEVAASKLTLFD  300

Query  951   ITKQVCDAVQARAEQ------------------------DKYHGVILLPEGLIESIPEIY  1058
             + KQ+CDAVQARAEQ                        DK HGVIL+PEGLIESIPE+Y
Sbjct  301   LAKQLCDAVQARAEQGFLDISRNALLFLNSPTDSVYVLIDKNHGVILIPEGLIESIPEVY  360

Query  1059  ALLKEIHVLLREGVSANNISSQLSPWASALFEFLPPFIRRELLLYPESDDSAQL  1220
             +LLKEIH LLR+GVS + ISSQLSPWASALFEFLPPFI+++LLL+PESDDSAQL
Sbjct  361   SLLKEIHGLLRQGVSVDKISSQLSPWASALFEFLPPFIKKQLLLHPESDDSAQL  414



>ref|XP_008775478.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha-like [Phoenix dactylifera]
Length=617

 Score =   650 bits (1677),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/390 (83%), Positives = 361/390 (93%), Gaps = 0/390 (0%)
 Frame = +3

Query  51    MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  230
             M+SDFG+ RELS+LQ+ R++Y  ELPPCLQGTTVRVEFGD+TT ADPS  H ISR FPHT
Sbjct  1     MNSDFGVPRELSELQQKRAEYLAELPPCLQGTTVRVEFGDSTTTADPSSAHVISRAFPHT  60

Query  231   FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  410
             FGQPLAHFLRA+AKVPDAQIITEHP +RVGIVF GRQSPGGHN +WGL++ALK+HNP+S 
Sbjct  61    FGQPLAHFLRATAKVPDAQIITEHPPMRVGIVFSGRQSPGGHNVVWGLHNALKIHNPDSV  120

Query  411   llgflggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLK  590
             LLGFLGG+EG FAQKTLEIT+D+L+TYKNQGGYD+LGRTKDQIR+TEQVNAA+T C +LK
Sbjct  121   LLGFLGGTEGFFAQKTLEITNDVLSTYKNQGGYDLLGRTKDQIRTTEQVNAAMTTCRALK  180

Query  591   LDGLVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICKV  770
             LDGLVI+GGVTSN+DAA LAE FAE+KCPTKVVGVPVTLNGDLKNQFVETNVGFDT+C+V
Sbjct  181   LDGLVIIGGVTSNSDAAQLAETFAESKCPTKVVGVPVTLNGDLKNQFVETNVGFDTVCRV  240

Query  771   NSQLISNVCTDALSAEKYYYFIRLMGRKTSHVALECTLQSHPNMVILAEEVAASKLTLFD  950
             NSQLISNVCTDALSA+KYYYFIRLMGRK SHVALEC LQSHPNM+IL EEVA SKLT+FD
Sbjct  241   NSQLISNVCTDALSAQKYYYFIRLMGRKASHVALECALQSHPNMLILGEEVALSKLTIFD  300

Query  951   ITKQVCDAVQARAEQDKYHGVILLPEGLIESIPEIYALLKEIHVLLREGVSANNISSQLS  1130
             ITKQ+CDAVQARAE+DKYHGVIL+PEGL+ESIPE+YALL+EIH L  +GVS  NISS LS
Sbjct  301   ITKQICDAVQARAEKDKYHGVILIPEGLVESIPELYALLQEIHGLHNQGVSTENISSHLS  360

Query  1131  PWASALFEFLPPFIRRELLLYPESDDSAQL  1220
             PWASALFEFLPPFIR++LLL PESDDSAQL
Sbjct  361   PWASALFEFLPPFIRKQLLLLPESDDSAQL  390



>ref|XP_009149574.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha 1 [Brassica rapa]
 emb|CDY67203.1| BnaA06g38560D [Brassica napus]
Length=619

 Score =   650 bits (1676),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 331/390 (85%), Positives = 359/390 (92%), Gaps = 0/390 (0%)
 Frame = +3

Query  51    MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  230
             MDSDFG+ RELS LQ+LRSQY PELPPCLQGTTVRVEFGD TT A+ S  H ++R FPHT
Sbjct  1     MDSDFGIPRELSPLQQLRSQYHPELPPCLQGTTVRVEFGDGTTVAEASDSHIVARAFPHT  60

Query  231   FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  410
              GQPLAHFLR +AKV DA IIT+ P+IRVGIVFCGRQ+PGGHN IWGLY+ALKVHN NST
Sbjct  61    LGQPLAHFLREAAKVSDAHIITQLPSIRVGIVFCGRQAPGGHNVIWGLYEALKVHNANST  120

Query  411   llgflggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLK  590
             LLGFLGGSEGLFAQKTLEITDDIL TYKNQGGYD+LGRTKDQIR+TEQVNAAL ACT LK
Sbjct  121   LLGFLGGSEGLFAQKTLEITDDILQTYKNQGGYDLLGRTKDQIRTTEQVNAALKACTDLK  180

Query  591   LDGLVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICKV  770
             LDGLVI+GGVTSNTDAA+LAE FAEAKC TKVVGVPVT NGDLKNQFVE NVGFDTICKV
Sbjct  181   LDGLVIIGGVTSNTDAAHLAEFFAEAKCSTKVVGVPVTTNGDLKNQFVEANVGFDTICKV  240

Query  771   NSQLISNVCTDALSAEKYYYFIRLMGRKTSHVALECTLQSHPNMVILAEEVAASKLTLFD  950
             NSQLISN CTDALSAEKYYYFIRLMGRK SHVALECTLQSHPNMVIL EEVAASKLT+FD
Sbjct  241   NSQLISNACTDALSAEKYYYFIRLMGRKHSHVALECTLQSHPNMVILGEEVAASKLTIFD  300

Query  951   ITKQVCDAVQARAEQDKYHGVILLPEGLIESIPEIYALLKEIHVLLREGVSANNISSQLS  1130
             I+KQ+CDAVQARA QDK HGVIL+PEG+IESIPE+YALLKEIH LLREGV+A+ IS+QLS
Sbjct  301   ISKQICDAVQARAGQDKNHGVILIPEGIIESIPEVYALLKEIHGLLREGVAADKISTQLS  360

Query  1131  PWASALFEFLPPFIRRELLLYPESDDSAQL  1220
             PW+SALFEFLPPFI+++LLL+PESDDSAQL
Sbjct  361   PWSSALFEFLPPFIKKQLLLHPESDDSAQL  390



>ref|XP_010416575.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha 2 [Camelina sativa]
Length=617

 Score =   649 bits (1675),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 328/390 (84%), Positives = 359/390 (92%), Gaps = 0/390 (0%)
 Frame = +3

Query  51    MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  230
             MDSDFG+ RELS LQ+LRSQY PELPPCLQGTTVRVE GD TT A  +  H I+R FPH+
Sbjct  1     MDSDFGIPRELSPLQQLRSQYHPELPPCLQGTTVRVELGDGTTVAKAADAHIIARAFPHS  60

Query  231   FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  410
              GQPLAHFLRA+AKVPDAQIITEHPA RVGIVF GRQ+PGGHN +WGLY+ALKVHN  +T
Sbjct  61    LGQPLAHFLRATAKVPDAQIITEHPAKRVGIVFSGRQAPGGHNVVWGLYEALKVHNAKNT  120

Query  411   llgflggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLK  590
             LLGFLGGSEGLFAQKTLEITDD+L TYKNQGG+D+LGRTKDQIR+TEQVNAAL ACT LK
Sbjct  121   LLGFLGGSEGLFAQKTLEITDDVLQTYKNQGGFDLLGRTKDQIRTTEQVNAALKACTDLK  180

Query  591   LDGLVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICKV  770
             LDGLVI+GGVTSNTDAA+LAE FAEAKCPTKVVGVPVT+NGDLKNQFVE NVGFDT CKV
Sbjct  181   LDGLVIIGGVTSNTDAAHLAEFFAEAKCPTKVVGVPVTINGDLKNQFVEANVGFDTTCKV  240

Query  771   NSQLISNVCTDALSAEKYYYFIRLMGRKTSHVALECTLQSHPNMVILAEEVAASKLTLFD  950
             NSQLISN+CTDALSAEKYYYF+RLMGRK SHVALECTLQSHPNMVIL EEV ASKLT+FD
Sbjct  241   NSQLISNICTDALSAEKYYYFVRLMGRKHSHVALECTLQSHPNMVILGEEVTASKLTIFD  300

Query  951   ITKQVCDAVQARAEQDKYHGVILLPEGLIESIPEIYALLKEIHVLLREGVSANNISSQLS  1130
             ITKQ+CDAVQARAEQDK HGVIL+PEGL+ESIPE+YALLKEIH LL+EGV  +NISSQLS
Sbjct  301   ITKQICDAVQARAEQDKNHGVILIPEGLVESIPELYALLKEIHGLLKEGVHTDNISSQLS  360

Query  1131  PWASALFEFLPPFIRRELLLYPESDDSAQL  1220
             PW+SALFEFLPPFI+++LLL+PESDDSAQL
Sbjct  361   PWSSALFEFLPPFIKKQLLLHPESDDSAQL  390



>ref|XP_006302013.1| hypothetical protein CARUB_v10019988mg [Capsella rubella]
 gb|EOA34911.1| hypothetical protein CARUB_v10019988mg [Capsella rubella]
Length=617

 Score =   649 bits (1674),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 329/390 (84%), Positives = 357/390 (92%), Gaps = 0/390 (0%)
 Frame = +3

Query  51    MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  230
             MDSDFG+ RELS LQ+LRSQY PELPPCLQGTTVRVE GD TT A     H I+R FPHT
Sbjct  1     MDSDFGIPRELSPLQQLRSQYHPELPPCLQGTTVRVELGDGTTVAKAGDAHIIARAFPHT  60

Query  231   FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  410
              GQPLAHFLRASAKVPDAQIITEHPA RVGIVF GRQ+PGGHN +WGLY+ALKVHN  +T
Sbjct  61    LGQPLAHFLRASAKVPDAQIITEHPAKRVGIVFSGRQAPGGHNVVWGLYEALKVHNAKNT  120

Query  411   llgflggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLK  590
             LLGFLGGSEGLFAQKTLEITDD+L TYKNQGG+D+LGRTKDQIR+TEQVNAAL ACT LK
Sbjct  121   LLGFLGGSEGLFAQKTLEITDDVLQTYKNQGGFDLLGRTKDQIRTTEQVNAALKACTDLK  180

Query  591   LDGLVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICKV  770
             LDGLVI+GGVTSNTDAA+LAE FAEAKCPTKVVGVPVT+NGDLKNQFVE NVGFDT CKV
Sbjct  181   LDGLVIIGGVTSNTDAAHLAEFFAEAKCPTKVVGVPVTINGDLKNQFVEANVGFDTTCKV  240

Query  771   NSQLISNVCTDALSAEKYYYFIRLMGRKTSHVALECTLQSHPNMVILAEEVAASKLTLFD  950
             NSQLISN+CTDALSAEKYYYF+RLMGRK SHVALECTLQSHPNMVIL EEV ASKLT+FD
Sbjct  241   NSQLISNICTDALSAEKYYYFVRLMGRKHSHVALECTLQSHPNMVILGEEVTASKLTIFD  300

Query  951   ITKQVCDAVQARAEQDKYHGVILLPEGLIESIPEIYALLKEIHVLLREGVSANNISSQLS  1130
             ITKQ+CDAVQARAEQDK HGVIL+PEGL+ESIPE+YALLKEIH LL+EGV  +NIS+QLS
Sbjct  301   ITKQICDAVQARAEQDKNHGVILIPEGLVESIPELYALLKEIHGLLKEGVHVDNISTQLS  360

Query  1131  PWASALFEFLPPFIRRELLLYPESDDSAQL  1220
             PW+ ALFEFLPPFI+R+LLL+PESDDSAQL
Sbjct  361   PWSCALFEFLPPFIKRQLLLHPESDDSAQL  390



>ref|XP_009106323.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha 2 [Brassica rapa]
Length=617

 Score =   647 bits (1670),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 328/390 (84%), Positives = 360/390 (92%), Gaps = 0/390 (0%)
 Frame = +3

Query  51    MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  230
             MDSDFG+ RELS LQ+LRSQY+P+LPPCLQG TVRVEFGD TT A     H I+R FPHT
Sbjct  1     MDSDFGIPRELSPLQQLRSQYQPQLPPCLQGRTVRVEFGDGTTVAKSGDSHIIARAFPHT  60

Query  231   FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  410
              GQPLAHFLRA+AKVPDAQIITEHPAIRVGIVF GRQ+PGGHN IWGLY+ALKVHN  +T
Sbjct  61    LGQPLAHFLRANAKVPDAQIITEHPAIRVGIVFSGRQAPGGHNVIWGLYEALKVHNAKNT  120

Query  411   llgflggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLK  590
             LLGFLGGSEGLFAQKT+EITDD+L TYKNQGG+D+LGRTKDQIR+TEQVNAAL ACT LK
Sbjct  121   LLGFLGGSEGLFAQKTVEITDDVLQTYKNQGGFDLLGRTKDQIRTTEQVNAALKACTDLK  180

Query  591   LDGLVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICKV  770
             LDGLVI+GGVTSNTDAA+LAE FAEAKC TKVVGVPVT+NGDLKNQFVE NVGFDTICKV
Sbjct  181   LDGLVIIGGVTSNTDAAHLAEFFAEAKCSTKVVGVPVTINGDLKNQFVEANVGFDTICKV  240

Query  771   NSQLISNVCTDALSAEKYYYFIRLMGRKTSHVALECTLQSHPNMVILAEEVAASKLTLFD  950
             NSQLISNVCTDALSAEKYYYF+RLMGRK SHVALECTLQSHPNMVIL EEV ASKLT+FD
Sbjct  241   NSQLISNVCTDALSAEKYYYFVRLMGRKHSHVALECTLQSHPNMVILGEEVTASKLTIFD  300

Query  951   ITKQVCDAVQARAEQDKYHGVILLPEGLIESIPEIYALLKEIHVLLREGVSANNISSQLS  1130
             ITKQ+CDAVQARA QDK HGVIL+PEG++ESIPE+YALLKEIH LL+EGV A+NIS+QLS
Sbjct  301   ITKQICDAVQARAGQDKNHGVILIPEGIVESIPELYALLKEIHGLLKEGVHADNISTQLS  360

Query  1131  PWASALFEFLPPFIRRELLLYPESDDSAQL  1220
             PW+SALFEFLPPFI+++LLL+PESDDSAQL
Sbjct  361   PWSSALFEFLPPFIKKQLLLHPESDDSAQL  390



>ref|XP_006390180.1| hypothetical protein EUTSA_v10018291mg [Eutrema salsugineum]
 gb|ESQ27466.1| hypothetical protein EUTSA_v10018291mg [Eutrema salsugineum]
Length=617

 Score =   647 bits (1668),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/390 (84%), Positives = 359/390 (92%), Gaps = 0/390 (0%)
 Frame = +3

Query  51    MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  230
             MDSDFG+ RELS LQ+LRSQY PELPPCLQGTTVRVE GD TT A     H I+R FPHT
Sbjct  1     MDSDFGIPRELSPLQQLRSQYHPELPPCLQGTTVRVELGDGTTVAKAGDAHIIARAFPHT  60

Query  231   FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  410
              GQPLAHFLRA+AKVPDAQIITEHPAIRVGIVF GRQ+PGGHN IWGLY+ALKVHN  +T
Sbjct  61    LGQPLAHFLRATAKVPDAQIITEHPAIRVGIVFSGRQAPGGHNVIWGLYEALKVHNAKNT  120

Query  411   llgflggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLK  590
             LLGFLGGSEGLFAQKTLEITD++L TYKNQGG+D+LGRTKDQIR+TEQVNAAL ACT LK
Sbjct  121   LLGFLGGSEGLFAQKTLEITDNVLQTYKNQGGFDLLGRTKDQIRTTEQVNAALKACTDLK  180

Query  591   LDGLVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICKV  770
             L+GLVI+GGVTSNTDAA+LAE FAEAKCPTKVVGVPVT+NGDLKNQFVE NVGFDTICKV
Sbjct  181   LNGLVIIGGVTSNTDAAHLAEFFAEAKCPTKVVGVPVTINGDLKNQFVEANVGFDTICKV  240

Query  771   NSQLISNVCTDALSAEKYYYFIRLMGRKTSHVALECTLQSHPNMVILAEEVAASKLTLFD  950
             NSQLISNVCTDALSAEKYYYF+RLMGRK SHVALECTLQSHPNMVIL EE+ ASKLT+FD
Sbjct  241   NSQLISNVCTDALSAEKYYYFVRLMGRKHSHVALECTLQSHPNMVILGEEITASKLTIFD  300

Query  951   ITKQVCDAVQARAEQDKYHGVILLPEGLIESIPEIYALLKEIHVLLREGVSANNISSQLS  1130
             ITKQ+CDAVQARA QDK HGVIL+PEG++ESIPE+YALLKEIH LL+EGV A+ IS+QLS
Sbjct  301   ITKQICDAVQARAGQDKNHGVILIPEGIVESIPELYALLKEIHGLLKEGVHADKISTQLS  360

Query  1131  PWASALFEFLPPFIRRELLLYPESDDSAQL  1220
             PW+SALFEFLPPFI+++LLL+PESDDSAQL
Sbjct  361   PWSSALFEFLPPFIKKQLLLHPESDDSAQL  390



>emb|CDX87587.1| BnaA07g32860D [Brassica napus]
Length=617

 Score =   646 bits (1667),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/390 (84%), Positives = 360/390 (92%), Gaps = 0/390 (0%)
 Frame = +3

Query  51    MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  230
             MDSDFG+ RELS LQ+LRSQY+P+LPPCLQG TVRVEFGD TT A     H I+R FPHT
Sbjct  1     MDSDFGIPRELSPLQQLRSQYQPQLPPCLQGRTVRVEFGDGTTVAKSGDSHIIARAFPHT  60

Query  231   FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  410
              GQPLAHFLRA+AKVPDAQIITEHPAIRVGIVF GRQ+PGGHN IWGLY+ALKVHN  +T
Sbjct  61    LGQPLAHFLRATAKVPDAQIITEHPAIRVGIVFSGRQAPGGHNVIWGLYEALKVHNAKNT  120

Query  411   llgflggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLK  590
             LLGFLGGSEGLFAQKT+EITD++L TYKNQGG+D+LGRTKDQIR+TEQVNAAL ACT LK
Sbjct  121   LLGFLGGSEGLFAQKTVEITDEVLQTYKNQGGFDLLGRTKDQIRTTEQVNAALKACTYLK  180

Query  591   LDGLVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICKV  770
             LDGLVI+GGVTSNTDAA+LAE FAEAKC TKVVGVPVT+NGDLKNQFVE NVGFDTICKV
Sbjct  181   LDGLVIIGGVTSNTDAAHLAEFFAEAKCSTKVVGVPVTINGDLKNQFVEANVGFDTICKV  240

Query  771   NSQLISNVCTDALSAEKYYYFIRLMGRKTSHVALECTLQSHPNMVILAEEVAASKLTLFD  950
             NSQLISNVCTDALSAEKYYYF+RLMGRK SHVALECTLQSHPNMVIL EEV ASKLT+FD
Sbjct  241   NSQLISNVCTDALSAEKYYYFVRLMGRKHSHVALECTLQSHPNMVILGEEVTASKLTIFD  300

Query  951   ITKQVCDAVQARAEQDKYHGVILLPEGLIESIPEIYALLKEIHVLLREGVSANNISSQLS  1130
             ITKQ+CDAVQARA QDK HGVIL+PEG++ESIPE+YALLKEIH LL+EGV A+NIS+QLS
Sbjct  301   ITKQICDAVQARAGQDKNHGVILIPEGIVESIPELYALLKEIHGLLKEGVHADNISTQLS  360

Query  1131  PWASALFEFLPPFIRRELLLYPESDDSAQL  1220
             PW+SALFEFLPPFI+++LLL+PESDDSAQL
Sbjct  361   PWSSALFEFLPPFIKKQLLLHPESDDSAQL  390



>gb|KFK35354.1| hypothetical protein AALP_AA5G273800 [Arabis alpina]
Length=619

 Score =   646 bits (1667),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 328/390 (84%), Positives = 357/390 (92%), Gaps = 0/390 (0%)
 Frame = +3

Query  51    MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  230
             MDSDFG+ RELS LQ+LRSQY PELPPCLQGTTVRVE GD TT A+ +  H ++R FPHT
Sbjct  1     MDSDFGIPRELSPLQQLRSQYHPELPPCLQGTTVRVELGDGTTVAEATDSHIMARAFPHT  60

Query  231   FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  410
              GQPLAHFLR +AKV DAQIITE P+IRVGIVFCGRQSPGGHN IWGLY+ALKVHN  ST
Sbjct  61    LGQPLAHFLRETAKVSDAQIITELPSIRVGIVFCGRQSPGGHNVIWGLYEALKVHNAKST  120

Query  411   llgflggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLK  590
             LLGFLGGSEGLFAQKTLE+TDDIL TYKNQGGYD+LGRTKDQIR+TEQVNAAL ACT LK
Sbjct  121   LLGFLGGSEGLFAQKTLEMTDDILQTYKNQGGYDLLGRTKDQIRTTEQVNAALKACTDLK  180

Query  591   LDGLVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICKV  770
             LDGLVI+GGVTSNTDAA+LAE F EAKCPTKVVGVPVT NGDLKNQFVE NVGFDTICKV
Sbjct  181   LDGLVIIGGVTSNTDAAHLAEFFTEAKCPTKVVGVPVTTNGDLKNQFVEANVGFDTICKV  240

Query  771   NSQLISNVCTDALSAEKYYYFIRLMGRKTSHVALECTLQSHPNMVILAEEVAASKLTLFD  950
             NSQLISN CTDALSAEKYYYFIRLMGRK SHVALECTLQSHPNMVIL EEVAASKLT+FD
Sbjct  241   NSQLISNACTDALSAEKYYYFIRLMGRKHSHVALECTLQSHPNMVILGEEVAASKLTIFD  300

Query  951   ITKQVCDAVQARAEQDKYHGVILLPEGLIESIPEIYALLKEIHVLLREGVSANNISSQLS  1130
             I KQ+CDAVQARA +DK HGVIL+PEG+IESIPE+YALLKEIH LLR+GV+A+ IS+QLS
Sbjct  301   IAKQICDAVQARAGEDKNHGVILIPEGIIESIPEVYALLKEIHGLLRQGVAADKISTQLS  360

Query  1131  PWASALFEFLPPFIRRELLLYPESDDSAQL  1220
             PW+SALFEFLPPFI+++LLL+PESDDSAQL
Sbjct  361   PWSSALFEFLPPFIKKQLLLHPESDDSAQL  390



>ref|XP_010471809.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha 2-like [Camelina sativa]
Length=617

 Score =   646 bits (1666),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/390 (84%), Positives = 358/390 (92%), Gaps = 0/390 (0%)
 Frame = +3

Query  51    MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  230
             MDSDFG+ RELS LQ+LRSQY PELPPCLQGTTVRVE GD TT A  +  H I+R FPH+
Sbjct  1     MDSDFGIPRELSPLQQLRSQYHPELPPCLQGTTVRVELGDGTTVAKAADAHIIARAFPHS  60

Query  231   FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  410
              GQPLAHFLRA+AKVPDAQIITEHPA RVGIVF GRQ+PGGHN +WGLY+ALKVHN  +T
Sbjct  61    LGQPLAHFLRATAKVPDAQIITEHPAKRVGIVFSGRQAPGGHNVVWGLYEALKVHNAKNT  120

Query  411   llgflggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLK  590
             LLGFLGGSEGLFAQKTLEITDD+L TYKNQGG+D+LGRTKDQIR+TEQVNAAL ACT LK
Sbjct  121   LLGFLGGSEGLFAQKTLEITDDVLQTYKNQGGFDLLGRTKDQIRTTEQVNAALKACTDLK  180

Query  591   LDGLVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICKV  770
             LDGLVI+GGVTSNTDAA+LAE FAEAKCPTKVVGVPVT+NGDLKNQFVE NVGFDT CKV
Sbjct  181   LDGLVIIGGVTSNTDAAHLAEFFAEAKCPTKVVGVPVTINGDLKNQFVEANVGFDTTCKV  240

Query  771   NSQLISNVCTDALSAEKYYYFIRLMGRKTSHVALECTLQSHPNMVILAEEVAASKLTLFD  950
             NSQLISN+CTDALSAEKYYYF+RLMGRK SHVALECTLQSHPNMVIL EEV ASKLT+FD
Sbjct  241   NSQLISNICTDALSAEKYYYFVRLMGRKHSHVALECTLQSHPNMVILGEEVTASKLTIFD  300

Query  951   ITKQVCDAVQARAEQDKYHGVILLPEGLIESIPEIYALLKEIHVLLREGVSANNISSQLS  1130
             ITKQ+CDAVQARAEQDK HGVIL+PEGL+ESIPE+YALLKEIH LL+EGV  +NISSQLS
Sbjct  301   ITKQICDAVQARAEQDKNHGVILIPEGLVESIPELYALLKEIHGLLKEGVHTDNISSQLS  360

Query  1131  PWASALFEFLPPFIRRELLLYPESDDSAQL  1220
             PW+SALFEFLPP I+++LLL+PESDDSAQL
Sbjct  361   PWSSALFEFLPPCIKKQLLLHPESDDSAQL  390



>emb|CDX88295.1| BnaC06g37390D [Brassica napus]
Length=617

 Score =   645 bits (1665),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/390 (84%), Positives = 359/390 (92%), Gaps = 0/390 (0%)
 Frame = +3

Query  51    MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  230
             MDSDFG+ RELS LQ++RSQY P+LPPCLQGTTVRVEFGD TT A     H I+R FPHT
Sbjct  1     MDSDFGIPRELSPLQQIRSQYLPQLPPCLQGTTVRVEFGDGTTVAKAGDAHIIARAFPHT  60

Query  231   FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  410
              GQPLAHFLRA+AKVPDAQIITEHPAIRVGIVF GRQ+PGGHN IWGLY+ALKVHN  +T
Sbjct  61    LGQPLAHFLRATAKVPDAQIITEHPAIRVGIVFSGRQAPGGHNVIWGLYEALKVHNAKNT  120

Query  411   llgflggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLK  590
             LLGFLGGSEGLFAQK LEITDD+L TYKNQGG+D+LGRTKDQIR+TEQVNAAL ACT LK
Sbjct  121   LLGFLGGSEGLFAQKALEITDDVLQTYKNQGGFDLLGRTKDQIRTTEQVNAALKACTDLK  180

Query  591   LDGLVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICKV  770
             LDGLVI+GGVTSNTDAA+LAE FAEAKC TKVVGVPVT+NGDLKNQFVE NVGFDTICKV
Sbjct  181   LDGLVIIGGVTSNTDAAHLAEFFAEAKCSTKVVGVPVTINGDLKNQFVEANVGFDTICKV  240

Query  771   NSQLISNVCTDALSAEKYYYFIRLMGRKTSHVALECTLQSHPNMVILAEEVAASKLTLFD  950
             NSQLISNVCTDALSAEKYYYF+RLMGRK SHVALECTLQSHPNMVIL EEV ASKLT+FD
Sbjct  241   NSQLISNVCTDALSAEKYYYFVRLMGRKHSHVALECTLQSHPNMVILGEEVTASKLTIFD  300

Query  951   ITKQVCDAVQARAEQDKYHGVILLPEGLIESIPEIYALLKEIHVLLREGVSANNISSQLS  1130
             ITKQ+CDAVQARA QDK HGVIL+PEG++ESIPE+YALLKEIH LL+EGV A+NIS++LS
Sbjct  301   ITKQICDAVQARAGQDKNHGVILIPEGIVESIPELYALLKEIHGLLKEGVHADNISTKLS  360

Query  1131  PWASALFEFLPPFIRRELLLYPESDDSAQL  1220
             PW+SALFEFLPPFI+++LLL+PESDDSAQL
Sbjct  361   PWSSALFEFLPPFIKKQLLLHPESDDSAQL  390



>ref|XP_008802157.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha-like [Phoenix dactylifera]
Length=617

 Score =   645 bits (1665),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 325/390 (83%), Positives = 358/390 (92%), Gaps = 0/390 (0%)
 Frame = +3

Query  51    MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  230
             MDS +G+ RELS LQK R+ Y+P LPPCLQ TTVRVEFGDATT+ADP+G H IS+ FP T
Sbjct  1     MDSAYGVPRELSGLQKQRALYQPGLPPCLQDTTVRVEFGDATTSADPAGAHVISQYFPRT  60

Query  231   FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  410
             +GQPLAHFLRA AKVPDAQIITEHPAIRVG+VF GRQSPGGHN IWGLYDA+K HN NST
Sbjct  61    YGQPLAHFLRAKAKVPDAQIITEHPAIRVGVVFSGRQSPGGHNVIWGLYDAIKSHNHNST  120

Query  411   llgflggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLK  590
             LLGF+GG+EGLFAQKTLEITDDIL+TYKNQGGYD+LGRTKDQIR+TEQVNAA+ AC +LK
Sbjct  121   LLGFVGGTEGLFAQKTLEITDDILSTYKNQGGYDLLGRTKDQIRTTEQVNAAMAACQALK  180

Query  591   LDGLVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICKV  770
             LDGLVI+GGVTSN DAA+LAE FAE+KCPTKVVGVPVTLNGDLKNQFVETNVGFDTICKV
Sbjct  181   LDGLVILGGVTSNMDAAHLAETFAESKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICKV  240

Query  771   NSQLISNVCTDALSAEKYYYFIRLMGRKTSHVALECTLQSHPNMVILAEEVAASKLTLFD  950
             NSQLI NVCTDALSAEKYYYFIRLMGRK SHVALEC LQS  NMVIL EEVAASKLT+FD
Sbjct  241   NSQLIGNVCTDALSAEKYYYFIRLMGRKASHVALECALQSQSNMVILGEEVAASKLTIFD  300

Query  951   ITKQVCDAVQARAEQDKYHGVILLPEGLIESIPEIYALLKEIHVLLREGVSANNISSQLS  1130
             ITKQ+CDAVQARAE+DKYHGVIL+PEGL+ES+PE+YAL++EIH L  +GVSA NI SQLS
Sbjct  301   ITKQICDAVQARAEKDKYHGVILIPEGLVESVPELYALIQEIHGLHLQGVSAENIPSQLS  360

Query  1131  PWASALFEFLPPFIRRELLLYPESDDSAQL  1220
             PWA+ALFEFLPPFIR +LLL+PESDDSAQL
Sbjct  361   PWAAALFEFLPPFIRNQLLLHPESDDSAQL  390



>emb|CDY67022.1| BnaC05g50320D [Brassica napus]
Length=619

 Score =   645 bits (1665),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/390 (85%), Positives = 358/390 (92%), Gaps = 0/390 (0%)
 Frame = +3

Query  51    MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  230
             MDSDFG+ RELS LQ+LRSQY+PELPPCLQGTTVRVEFGD TT A+ S  H I+R F HT
Sbjct  1     MDSDFGIPRELSPLQQLRSQYQPELPPCLQGTTVRVEFGDGTTVAEASDSHIIARAFTHT  60

Query  231   FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  410
              GQPLAHFLR +AKV DA IIT+ P+IRVGIVFCGRQ+PGGHN IWGLY+ALKVHN  ST
Sbjct  61    LGQPLAHFLREAAKVSDAHIITQLPSIRVGIVFCGRQAPGGHNVIWGLYEALKVHNAKST  120

Query  411   llgflggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLK  590
             LLGFLGGSEGLFAQKTLEITDDIL TYKNQGGYD+LGRTKDQIR+TEQVNAAL ACT LK
Sbjct  121   LLGFLGGSEGLFAQKTLEITDDILQTYKNQGGYDLLGRTKDQIRTTEQVNAALKACTDLK  180

Query  591   LDGLVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICKV  770
             LDGLVI+GGVTSNTDAA+LAE FAEAKC TKVVGVPVT NGDLKNQFVE NVGFDTICKV
Sbjct  181   LDGLVIIGGVTSNTDAAHLAEFFAEAKCSTKVVGVPVTTNGDLKNQFVEANVGFDTICKV  240

Query  771   NSQLISNVCTDALSAEKYYYFIRLMGRKTSHVALECTLQSHPNMVILAEEVAASKLTLFD  950
             NSQLISN CTDALSAEKYYYFIRLMGRK SHVALECTLQSHPNMVIL EEVAASKLT+FD
Sbjct  241   NSQLISNACTDALSAEKYYYFIRLMGRKHSHVALECTLQSHPNMVILGEEVAASKLTIFD  300

Query  951   ITKQVCDAVQARAEQDKYHGVILLPEGLIESIPEIYALLKEIHVLLREGVSANNISSQLS  1130
             I+KQ+CDAVQARA QDK HGVIL+PEG+IESIPE+YALLKEIH LLREGV+A+ IS+QLS
Sbjct  301   ISKQICDAVQARAGQDKNHGVILIPEGIIESIPEVYALLKEIHGLLREGVAADKISTQLS  360

Query  1131  PWASALFEFLPPFIRRELLLYPESDDSAQL  1220
             PW+SALFEFLPPFI+++LLL+PESDDSAQL
Sbjct  361   PWSSALFEFLPPFIKKQLLLHPESDDSAQL  390



>ref|XP_006416345.1| hypothetical protein EUTSA_v10007087mg [Eutrema salsugineum]
 gb|ESQ34698.1| hypothetical protein EUTSA_v10007087mg [Eutrema salsugineum]
Length=619

 Score =   645 bits (1664),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/390 (84%), Positives = 357/390 (92%), Gaps = 0/390 (0%)
 Frame = +3

Query  51    MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  230
             MDSDFG+ RELS LQ+LRSQY PELPPCLQGTTVRVE GD TT A+ +  H ++R FPHT
Sbjct  1     MDSDFGIPRELSPLQQLRSQYHPELPPCLQGTTVRVELGDGTTVAEAADSHIMARAFPHT  60

Query  231   FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  410
              GQPLAHFLR +AKV DAQIITE P+IRVGIVFCGRQ+PGGHN IWGLY+ALKVHN  ST
Sbjct  61    LGQPLAHFLREAAKVSDAQIITELPSIRVGIVFCGRQAPGGHNVIWGLYEALKVHNAKST  120

Query  411   llgflggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLK  590
             LLGFLGGSEGLFAQKTLEITDDIL TYKNQGGYD+LGRTKDQIR+TEQVNAAL ACT LK
Sbjct  121   LLGFLGGSEGLFAQKTLEITDDILQTYKNQGGYDLLGRTKDQIRTTEQVNAALKACTDLK  180

Query  591   LDGLVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICKV  770
             LDGLVI+GGVTSNTDAA+LAE F+E KC TKVVGVPVT NGDLKNQFVE NVGFDTICKV
Sbjct  181   LDGLVIIGGVTSNTDAAHLAEFFSEVKCSTKVVGVPVTTNGDLKNQFVEANVGFDTICKV  240

Query  771   NSQLISNVCTDALSAEKYYYFIRLMGRKTSHVALECTLQSHPNMVILAEEVAASKLTLFD  950
             NSQLISN CTDALSAEKYYYFIRLMGRK SHVALECTLQSHPNMVIL EEVAASKLT+FD
Sbjct  241   NSQLISNACTDALSAEKYYYFIRLMGRKHSHVALECTLQSHPNMVILGEEVAASKLTIFD  300

Query  951   ITKQVCDAVQARAEQDKYHGVILLPEGLIESIPEIYALLKEIHVLLREGVSANNISSQLS  1130
             I+KQ+CDAVQARA QDK HGVIL+PEG+IESIPE+YALLKEIH LLR+GV+A+ IS+QLS
Sbjct  301   ISKQICDAVQARAGQDKNHGVILIPEGIIESIPEVYALLKEIHGLLRQGVAADKISTQLS  360

Query  1131  PWASALFEFLPPFIRRELLLYPESDDSAQL  1220
             PW+SALFEFLPPFI+++LLL+PESDDSAQL
Sbjct  361   PWSSALFEFLPPFIKKQLLLHPESDDSAQL  390



>ref|XP_010428720.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha 2-like [Camelina sativa]
Length=617

 Score =   644 bits (1662),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/390 (84%), Positives = 357/390 (92%), Gaps = 0/390 (0%)
 Frame = +3

Query  51    MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  230
             MDSDFG+ RELS LQ+LRSQY PELPPCLQGTTVRVE GD TT A  +  H I+R FPH+
Sbjct  1     MDSDFGIPRELSPLQQLRSQYHPELPPCLQGTTVRVELGDGTTVAKAADAHIIARAFPHS  60

Query  231   FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  410
              GQPLAHFLRA+A VPDAQIITEHPA RVGIVF GRQ+PGGHN +WGLY+ALKVHN  +T
Sbjct  61    LGQPLAHFLRATANVPDAQIITEHPAKRVGIVFSGRQAPGGHNVVWGLYEALKVHNVENT  120

Query  411   llgflggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLK  590
             LLGFLGGSEGLFAQKTLEITDD+L TYKNQGG+D+LGRTKDQIR+TEQVNAAL ACT LK
Sbjct  121   LLGFLGGSEGLFAQKTLEITDDVLQTYKNQGGFDLLGRTKDQIRTTEQVNAALKACTDLK  180

Query  591   LDGLVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICKV  770
             LDGLVI+GGVTSNTDAA+LAE FAEAKCPTKVVGVPVT+NGDLKNQFVE NVGFDT CKV
Sbjct  181   LDGLVIIGGVTSNTDAAHLAEFFAEAKCPTKVVGVPVTINGDLKNQFVEANVGFDTTCKV  240

Query  771   NSQLISNVCTDALSAEKYYYFIRLMGRKTSHVALECTLQSHPNMVILAEEVAASKLTLFD  950
             NSQLISN+CTDALSAEKYYYF+RLMGRK SHVALECTLQSHPNMVIL EEV ASKLT+FD
Sbjct  241   NSQLISNICTDALSAEKYYYFVRLMGRKHSHVALECTLQSHPNMVILGEEVTASKLTIFD  300

Query  951   ITKQVCDAVQARAEQDKYHGVILLPEGLIESIPEIYALLKEIHVLLREGVSANNISSQLS  1130
             ITKQ+CDAVQARAEQDK HGVIL+PEGL+ESIPE+YALLKEIH LL+EGV  + ISSQLS
Sbjct  301   ITKQICDAVQARAEQDKNHGVILIPEGLVESIPELYALLKEIHGLLKEGVHTDKISSQLS  360

Query  1131  PWASALFEFLPPFIRRELLLYPESDDSAQL  1220
             PW+SALFEFLPPFI+++LLL+PESDDSAQL
Sbjct  361   PWSSALFEFLPPFIKKQLLLHPESDDSAQL  390



>ref|XP_010932134.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha [Elaeis guineensis]
Length=622

 Score =   644 bits (1660),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/390 (83%), Positives = 357/390 (92%), Gaps = 0/390 (0%)
 Frame = +3

Query  51    MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  230
             MDSD+G+ RELSD Q+ R+ Y+PELPPCLQGTTVRVEFGDATTAADP+  H I + FPHT
Sbjct  1     MDSDYGVPRELSDTQRQRTLYQPELPPCLQGTTVRVEFGDATTAADPASAHVIGQNFPHT  60

Query  231   FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  410
             +GQ LAHFLRA+AKVPDAQIITEHPA RVG+VF GRQSPGGHN +WGLYDA+K HNP+ST
Sbjct  61    YGQSLAHFLRATAKVPDAQIITEHPATRVGVVFSGRQSPGGHNVVWGLYDAIKAHNPHST  120

Query  411   llgflggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLK  590
             LLGF+GG+EGLFAQKTLEITDDIL+TYKNQGGYD+LGRTKDQIR+ EQVNAA+TAC +LK
Sbjct  121   LLGFVGGTEGLFAQKTLEITDDILSTYKNQGGYDLLGRTKDQIRTAEQVNAAMTACQTLK  180

Query  591   LDGLVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICKV  770
             L+GLVI+GGVTSN DAA+LAE FAE+KCPTKVVGVPVTLNGDLKNQFVETNVGFDTICKV
Sbjct  181   LNGLVILGGVTSNMDAAHLAETFAESKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICKV  240

Query  771   NSQLISNVCTDALSAEKYYYFIRLMGRKTSHVALECTLQSHPNMVILAEEVAASKLTLFD  950
             NSQLISNVCTDALSAEKYYYFIRLMGRK SHVALEC LQS  NMVIL EEVAASKLT+FD
Sbjct  241   NSQLISNVCTDALSAEKYYYFIRLMGRKASHVALECALQSQSNMVILGEEVAASKLTIFD  300

Query  951   ITKQVCDAVQARAEQDKYHGVILLPEGLIESIPEIYALLKEIHVLLREGVSANNISSQLS  1130
             I KQ+CD VQ RAE+DKYHGVIL+PEGL+ESIPE+YAL++EIH L   GVSA NI SQLS
Sbjct  301   IMKQICDTVQGRAEKDKYHGVILIPEGLVESIPELYALIQEIHGLHLHGVSAENIPSQLS  360

Query  1131  PWASALFEFLPPFIRRELLLYPESDDSAQL  1220
             PWA ALFEFLPPFIR++LLL+PESDDSAQL
Sbjct  361   PWACALFEFLPPFIRKQLLLHPESDDSAQL  390



>ref|XP_009391869.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha {ECO:0000255|HAMAP-Rule:MF_03185}-like 
[Musa acuminata subsp. malaccensis]
Length=618

 Score =   644 bits (1660),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/390 (82%), Positives = 357/390 (92%), Gaps = 0/390 (0%)
 Frame = +3

Query  51    MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  230
             M+SDFG+ RELS+LQK R++Y PELPPCLQGTTVRVEFGD+TT ADPS  H I R FPHT
Sbjct  1     MESDFGVPRELSELQKKRAEYHPELPPCLQGTTVRVEFGDSTTCADPSSEHVIGRAFPHT  60

Query  231   FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  410
             FGQPLAHFLRA+AKVPDAQIITEHP +RVG+VFCGRQSPGGHN +WGLY A+K+HNP+S 
Sbjct  61    FGQPLAHFLRATAKVPDAQIITEHPPMRVGVVFCGRQSPGGHNVVWGLYSAIKIHNPDSI  120

Query  411   llgflggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLK  590
             LLGF+GG+EGLFAQ+TLEITD++LATYKNQGGYD+LGRT DQIR+TEQVNAALTAC  LK
Sbjct  121   LLGFVGGTEGLFAQRTLEITDEVLATYKNQGGYDLLGRTVDQIRTTEQVNAALTACRDLK  180

Query  591   LDGLVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICKV  770
             LDGLVIVGGVTSN+DAA LAE FAEAKCPTKVVGVPVT  GDLKNQFVET+VGFDT+C+V
Sbjct  181   LDGLVIVGGVTSNSDAAQLAETFAEAKCPTKVVGVPVTFYGDLKNQFVETDVGFDTVCRV  240

Query  771   NSQLISNVCTDALSAEKYYYFIRLMGRKTSHVALECTLQSHPNMVILAEEVAASKLTLFD  950
             NSQLISNVC DALSAEKYYYFIRLMGRK SHVALEC LQSHPNM+IL EEVA SKLT+FD
Sbjct  241   NSQLISNVCIDALSAEKYYYFIRLMGRKASHVALECALQSHPNMLILGEEVALSKLTIFD  300

Query  951   ITKQVCDAVQARAEQDKYHGVILLPEGLIESIPEIYALLKEIHVLLREGVSANNISSQLS  1130
             ITKQ+CDAVQ RAE++KYHGVIL+PEGLIESIPE+YALL+EIH L  +G+   NISS LS
Sbjct  301   ITKQICDAVQVRAEKEKYHGVILIPEGLIESIPELYALLQEIHGLHNQGILTENISSHLS  360

Query  1131  PWASALFEFLPPFIRRELLLYPESDDSAQL  1220
             PWASALFEFLPPFIR++LLL+PESDDSAQL
Sbjct  361   PWASALFEFLPPFIRKQLLLHPESDDSAQL  390



>ref|XP_010477351.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha 1-like [Camelina sativa]
Length=522

 Score =   639 bits (1647),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/390 (83%), Positives = 358/390 (92%), Gaps = 0/390 (0%)
 Frame = +3

Query  51    MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  230
             M+SDFG+ RELS LQ+LRSQY+P+LPPCLQGTTVRVE GD TT A+ +  HT++R FPHT
Sbjct  1     MNSDFGIPRELSPLQQLRSQYKPDLPPCLQGTTVRVELGDGTTVAEAADSHTMARAFPHT  60

Query  231   FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  410
              GQPLAHFLR +A+V DA IITE P++RVGIVFCGRQ+PGGHN IWGL++ALKVHN NST
Sbjct  61    LGQPLAHFLRETAQVTDAHIITELPSVRVGIVFCGRQAPGGHNVIWGLFEALKVHNSNST  120

Query  411   llgflggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLK  590
             LLGFLGGSEGLFAQKTLEITDDIL TYKNQGGYD+LGRTKDQI++TEQVNAAL ACT LK
Sbjct  121   LLGFLGGSEGLFAQKTLEITDDILQTYKNQGGYDLLGRTKDQIKTTEQVNAALKACTDLK  180

Query  591   LDGLVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICKV  770
             LDGLVI+GGVTSNTDAA+LAE F EAKC TKVVGVPVT NGDLKNQFVETNVGFDTICKV
Sbjct  181   LDGLVIIGGVTSNTDAAHLAEFFVEAKCSTKVVGVPVTTNGDLKNQFVETNVGFDTICKV  240

Query  771   NSQLISNVCTDALSAEKYYYFIRLMGRKTSHVALECTLQSHPNMVILAEEVAASKLTLFD  950
             NSQLISN CTDALSAEKYYYFIRLMGRK SHVALECTLQSHPNMVIL EEVAASKLT+FD
Sbjct  241   NSQLISNACTDALSAEKYYYFIRLMGRKHSHVALECTLQSHPNMVILGEEVAASKLTIFD  300

Query  951   ITKQVCDAVQARAEQDKYHGVILLPEGLIESIPEIYALLKEIHVLLREGVSANNISSQLS  1130
             I KQ+CDAVQARA +DK HGVIL+PEG+IESIPE+YALLKEIH LLR+GV+A+ IS+QLS
Sbjct  301   IAKQICDAVQARAVEDKNHGVILIPEGIIESIPEVYALLKEIHGLLRQGVAADKISTQLS  360

Query  1131  PWASALFEFLPPFIRRELLLYPESDDSAQL  1220
             PW+SALFEFLPPFI+++LLL PESDDSAQL
Sbjct  361   PWSSALFEFLPPFIKKQLLLRPESDDSAQL  390



>ref|XP_004300090.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha [Fragaria vesca subsp. vesca]
Length=618

 Score =   642 bits (1656),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/390 (84%), Positives = 357/390 (92%), Gaps = 0/390 (0%)
 Frame = +3

Query  51    MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  230
             MDSD+G+ RELS +QKLRSQY+P+LPPCLQGTTVRVEFGD TTAADP+  +TISR FP+T
Sbjct  1     MDSDYGIPRELSAVQKLRSQYQPDLPPCLQGTTVRVEFGDTTTAADPTDANTISRYFPNT  60

Query  231   FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  410
             +GQPLAHFLRA+AKV  AQ+I+EHPA+RVGIVFCGRQSPGGHN IWGL  ALK HNPNST
Sbjct  61    YGQPLAHFLRATAKVAGAQVISEHPAMRVGIVFCGRQSPGGHNVIWGLLKALKTHNPNST  120

Query  411   llgflggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLK  590
             LLGFLGGSEGLFAQKTLEITDD+LATYKNQGGYD+LGRTKDQIR+ EQVNA LTAC +LK
Sbjct  121   LLGFLGGSEGLFAQKTLEITDDVLATYKNQGGYDLLGRTKDQIRTKEQVNATLTACNALK  180

Query  591   LDGLVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICKV  770
             L GLVI+GGVTSNTDAA LAE FAEAKC TKVVGVPVT+NGDLKNQFVE NVGFDT+CKV
Sbjct  181   LAGLVIIGGVTSNTDAAQLAETFAEAKCQTKVVGVPVTMNGDLKNQFVEANVGFDTVCKV  240

Query  771   NSQLISNVCTDALSAEKYYYFIRLMGRKTSHVALECTLQSHPNMVILAEEVAASKLTLFD  950
             NSQLISN+CTDALSAEKYYYFIRLMGRK SHVALECTLQSHPN+VIL EEVAASKLTLFD
Sbjct  241   NSQLISNMCTDALSAEKYYYFIRLMGRKASHVALECTLQSHPNLVILGEEVAASKLTLFD  300

Query  951   ITKQVCDAVQARAEQDKYHGVILLPEGLIESIPEIYALLKEIHVLLREGVSANNISSQLS  1130
             I  ++CDAVQ RA QDK HGVILLPEGLIESIPE+YALLKEIH L R+GVSA+ I SQLS
Sbjct  301   IATRICDAVQDRAAQDKNHGVILLPEGLIESIPEVYALLKEIHGLYRQGVSADKILSQLS  360

Query  1131  PWASALFEFLPPFIRRELLLYPESDDSAQL  1220
             PWASALFEFLP FI+++LLL PESDDSAQL
Sbjct  361   PWASALFEFLPHFIKKQLLLLPESDDSAQL  390



>ref|XP_010498548.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha 1 [Camelina sativa]
Length=614

 Score =   640 bits (1652),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/390 (83%), Positives = 358/390 (92%), Gaps = 0/390 (0%)
 Frame = +3

Query  51    MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  230
             MDSDFG+ RELS LQ+LRSQY+PE+PPCLQGTTVRVE GD TT A+ +  HT++R FPHT
Sbjct  1     MDSDFGIPRELSPLQQLRSQYKPEIPPCLQGTTVRVELGDGTTVAEAADSHTMARAFPHT  60

Query  231   FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  410
              GQPLAHFLR +A+V DA IITE P++RVGIVFCGRQ+PGGHN IWGL++ALKVHN NST
Sbjct  61    LGQPLAHFLRETAQVTDAHIITELPSVRVGIVFCGRQAPGGHNVIWGLFEALKVHNSNST  120

Query  411   llgflggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLK  590
             LLGFLGGSEGLFAQKTLEITDDIL TYKNQGGYD+LGRTKDQI++TEQVNA L ACT LK
Sbjct  121   LLGFLGGSEGLFAQKTLEITDDILQTYKNQGGYDLLGRTKDQIKTTEQVNATLKACTDLK  180

Query  591   LDGLVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICKV  770
             LDGLVI+GGVTSNTDAA+LAE F EAKC TKVVGVPVT NGDLKNQFVETNVGFDTICKV
Sbjct  181   LDGLVIIGGVTSNTDAAHLAEFFVEAKCSTKVVGVPVTTNGDLKNQFVETNVGFDTICKV  240

Query  771   NSQLISNVCTDALSAEKYYYFIRLMGRKTSHVALECTLQSHPNMVILAEEVAASKLTLFD  950
             NSQLISN CTDALSAEKYYYFIRLMGRK SHVALECTLQSHPNMVIL EEVAASKLT+FD
Sbjct  241   NSQLISNACTDALSAEKYYYFIRLMGRKHSHVALECTLQSHPNMVILGEEVAASKLTIFD  300

Query  951   ITKQVCDAVQARAEQDKYHGVILLPEGLIESIPEIYALLKEIHVLLREGVSANNISSQLS  1130
             I KQ+CDAVQARA +DK HGVIL+PEG+IESIPE+YALLKEIH LLR+GV+A+ IS+QLS
Sbjct  301   IAKQICDAVQARAVEDKNHGVILIPEGIIESIPEVYALLKEIHGLLRQGVAADKISTQLS  360

Query  1131  PWASALFEFLPPFIRRELLLYPESDDSAQL  1220
             PW+SALFEFLPPFI+++LLL+PESDDSAQL
Sbjct  361   PWSSALFEFLPPFIKKQLLLHPESDDSAQL  390



>gb|KFK42073.1| hypothetical protein AALP_AA2G207700 [Arabis alpina]
Length=617

 Score =   640 bits (1652),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/390 (83%), Positives = 356/390 (91%), Gaps = 0/390 (0%)
 Frame = +3

Query  51    MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  230
             MDSDFG+ RELS LQ+LRSQY+P LPPCLQGTTVRVE GD TT A     H I+R FPHT
Sbjct  1     MDSDFGIPRELSPLQQLRSQYQPLLPPCLQGTTVRVELGDGTTGAKAGDAHIIARAFPHT  60

Query  231   FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  410
              GQPLAHFLRA+AKV DAQIITEHPAIRVGIVF GRQ+PGGHN IWGLY+ALKVHN  +T
Sbjct  61    LGQPLAHFLRANAKVVDAQIITEHPAIRVGIVFSGRQAPGGHNVIWGLYEALKVHNAKNT  120

Query  411   llgflggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLK  590
             LLGFLGGSEGLFAQKT+EITDD+L TYKNQGG+D+LGRTKDQIR+TEQVNAAL ACT LK
Sbjct  121   LLGFLGGSEGLFAQKTVEITDDVLQTYKNQGGFDLLGRTKDQIRTTEQVNAALKACTDLK  180

Query  591   LDGLVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICKV  770
             LDGLVI+GGVTSNTDA +LAE FAE KCPTKVVGVPVT+NGDLKNQFVE NVGFDTICKV
Sbjct  181   LDGLVIIGGVTSNTDAGHLAEFFAETKCPTKVVGVPVTINGDLKNQFVEANVGFDTICKV  240

Query  771   NSQLISNVCTDALSAEKYYYFIRLMGRKTSHVALECTLQSHPNMVILAEEVAASKLTLFD  950
             NSQLISNVCTDALSAEKYYYFIRLMGRK SHVALECTLQSHPNMVIL EEVAASKLT+FD
Sbjct  241   NSQLISNVCTDALSAEKYYYFIRLMGRKHSHVALECTLQSHPNMVILGEEVAASKLTIFD  300

Query  951   ITKQVCDAVQARAEQDKYHGVILLPEGLIESIPEIYALLKEIHVLLREGVSANNISSQLS  1130
             I KQ+CDAVQARAEQDK HGVIL+PEGL+ESIPE++ALLKEIH LL+EGV A+ IS++LS
Sbjct  301   IAKQICDAVQARAEQDKNHGVILIPEGLVESIPELFALLKEIHGLLKEGVDADKISTKLS  360

Query  1131  PWASALFEFLPPFIRRELLLYPESDDSAQL  1220
             PW+ ALFEFLPPF++++LLL+PESDDSAQL
Sbjct  361   PWSFALFEFLPPFMKKQLLLHPESDDSAQL  390



>ref|NP_177781.1| pyrophosphate--fructose-6-phosphate 1-phosphotransferase [Arabidopsis 
thaliana]
 sp|Q9C9K3.1|PFPA2_ARATH RecName: Full=Pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha 2; Short=PFP 2; AltName: Full=6-phosphofructokinase, 
pyrophosphate dependent 2; AltName: Full=PPi-PFK 
2; AltName: Full=Pyrophosphate-dependent 6-phosphofructose-1-kinase 
2 [Arabidopsis thaliana]
 gb|AAG51940.1|AC015450_1 putative pyrophosphate-dependent phosphofructokinase alpha subunit; 
63231-59202 [Arabidopsis thaliana]
 gb|AEE35858.1| pyrophosphate--fructose-6-phosphate 1-phosphotransferase [Arabidopsis 
thaliana]
Length=617

 Score =   640 bits (1650),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/390 (83%), Positives = 353/390 (91%), Gaps = 0/390 (0%)
 Frame = +3

Query  51    MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  230
             MDSDFG+ RELS LQ+LRSQY PELPPCLQGTTVRVE GD TT A     H I+R FPHT
Sbjct  1     MDSDFGIPRELSPLQQLRSQYHPELPPCLQGTTVRVELGDGTTVAKAGDAHIIARAFPHT  60

Query  231   FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  410
              GQPLAHFLRA+AKV DAQIITEHP  RVGIVFCGRQ+PGGHN +WGLY+ALKVHN  +T
Sbjct  61    LGQPLAHFLRATAKVADAQIITEHPVKRVGIVFCGRQAPGGHNVVWGLYEALKVHNAKNT  120

Query  411   llgflggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLK  590
             LLGFLGGSEGLFAQKTLEITD++L TYKNQGGYDMLGRTKDQIR+TEQVNAAL ACT LK
Sbjct  121   LLGFLGGSEGLFAQKTLEITDEVLQTYKNQGGYDMLGRTKDQIRTTEQVNAALKACTDLK  180

Query  591   LDGLVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICKV  770
             LD LVI+GGVTSNTDAA+LAE FAEAKC TKVVGVPVT+NGDLKNQFVE NVGFDT CKV
Sbjct  181   LDSLVIIGGVTSNTDAAHLAEFFAEAKCSTKVVGVPVTINGDLKNQFVEANVGFDTTCKV  240

Query  771   NSQLISNVCTDALSAEKYYYFIRLMGRKTSHVALECTLQSHPNMVILAEEVAASKLTLFD  950
             NSQLISN+CTDALSAEKYYYF+RLMGRK SHVALECTLQSHPNMVIL EEV ASKLT+FD
Sbjct  241   NSQLISNICTDALSAEKYYYFVRLMGRKHSHVALECTLQSHPNMVILGEEVTASKLTIFD  300

Query  951   ITKQVCDAVQARAEQDKYHGVILLPEGLIESIPEIYALLKEIHVLLREGVSANNISSQLS  1130
             I KQ+CDAVQARAEQDK HGVIL+PEGL+ESIPE+YALLKEIH LL+EGV  +NIS+QLS
Sbjct  301   IIKQICDAVQARAEQDKNHGVILIPEGLVESIPELYALLKEIHGLLKEGVQVDNISTQLS  360

Query  1131  PWASALFEFLPPFIRRELLLYPESDDSAQL  1220
              W+SALFEFLPPFI+++LLL+PESDDSAQL
Sbjct  361   SWSSALFEFLPPFIKKQLLLHPESDDSAQL  390



>ref|NP_173519.1| pyrophosphate--fructose 6-phosphate 1-phosphotransferase subunit 
alpha 1 [Arabidopsis thaliana]
 sp|Q9SYP2.1|PFPA1_ARATH RecName: Full=Pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha 1; Short=PFP 1; AltName: Full=6-phosphofructokinase, 
pyrophosphate dependent 1; AltName: Full=PPi-PFK 
1; AltName: Full=Pyrophosphate-dependent 6-phosphofructose-1-kinase 
1 [Arabidopsis thaliana]
 gb|AAD30596.1|AC007369_6 pyrophosphate-dependent phosphofructokinase alpha subunit [Arabidopsis 
thaliana]
 gb|AAL24337.1| pyrophosphate-dependent phosphofructokinase alpha subunit [Arabidopsis 
thaliana]
 gb|AAP37733.1| At1g20950 [Arabidopsis thaliana]
 gb|AEE30045.1| pyrophosphate--fructose 6-phosphate 1-phosphotransferase subunit 
alpha 1 [Arabidopsis thaliana]
Length=614

 Score =   639 bits (1649),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/390 (83%), Positives = 356/390 (91%), Gaps = 0/390 (0%)
 Frame = +3

Query  51    MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  230
             MDSDFG+ RELS LQ+LRSQY+PELPPCLQGTTVRVE GD TT A+ +  HT++R FPHT
Sbjct  1     MDSDFGIPRELSPLQQLRSQYKPELPPCLQGTTVRVELGDGTTVAEAADSHTMARAFPHT  60

Query  231   FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  410
              GQPLAHFLR +A+VPDA IITE P++RVGIVFCGRQ+PGGHN IWGL++ALKVHN  ST
Sbjct  61    LGQPLAHFLRETAQVPDAHIITELPSVRVGIVFCGRQAPGGHNVIWGLFEALKVHNAKST  120

Query  411   llgflggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLK  590
             LLGFLGGSEGLFAQKTLEITDDIL TYKNQGGYD+LGRTKDQI++TEQVNAAL ACT LK
Sbjct  121   LLGFLGGSEGLFAQKTLEITDDILQTYKNQGGYDLLGRTKDQIKTTEQVNAALKACTDLK  180

Query  591   LDGLVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICKV  770
             LDGLVI+GGV SNTDAA+LAE FA AKC TKVVGVPVT NGDLKNQFVE NVGFDTICKV
Sbjct  181   LDGLVIIGGVISNTDAAHLAEFFAAAKCSTKVVGVPVTTNGDLKNQFVEANVGFDTICKV  240

Query  771   NSQLISNVCTDALSAEKYYYFIRLMGRKTSHVALECTLQSHPNMVILAEEVAASKLTLFD  950
             NSQLISN CTDALSAEKYYYFIRLMGRK SHVALECTLQSHPNMVIL EEVAASKLT+FD
Sbjct  241   NSQLISNACTDALSAEKYYYFIRLMGRKHSHVALECTLQSHPNMVILGEEVAASKLTIFD  300

Query  951   ITKQVCDAVQARAEQDKYHGVILLPEGLIESIPEIYALLKEIHVLLREGVSANNISSQLS  1130
             I KQ+CDAVQARA +DK HGVIL+PEGLI SIPE+YALLKEIH LLR+GVSA+ IS+QLS
Sbjct  301   IAKQICDAVQARAVEDKNHGVILIPEGLIVSIPEVYALLKEIHGLLRQGVSADKISTQLS  360

Query  1131  PWASALFEFLPPFIRRELLLYPESDDSAQL  1220
             PW+SALFEFLPPFI+++LLL+PESDDSAQL
Sbjct  361   PWSSALFEFLPPFIKKQLLLHPESDDSAQL  390



>ref|XP_004498196.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha-like isoform X2 [Cicer arietinum]
Length=604

 Score =   639 bits (1648),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/390 (85%), Positives = 354/390 (91%), Gaps = 12/390 (3%)
 Frame = +3

Query  51    MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  230
             MDSD+G+ RELSDLQKLRS Y+PELPPCLQGTTVRVEFGDATT ADPS   +I+      
Sbjct  1     MDSDYGIPRELSDLQKLRSLYQPELPPCLQGTTVRVEFGDATTTADPSDEPSIT------  54

Query  231   FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  410
                   HFLRA+AKVPDAQIITEHP IRVG+VFCGRQSPGGHN IWGL+ ALK+HNP S 
Sbjct  55    ------HFLRATAKVPDAQIITEHPPIRVGLVFCGRQSPGGHNVIWGLHSALKIHNPYSV  108

Query  411   llgflggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLK  590
             LLGFLGGS+GLFAQKTLEIT+DIL+TYKNQGGYD+LGRTKDQIR+TEQVNAAL AC  LK
Sbjct  109   LLGFLGGSDGLFAQKTLEITEDILSTYKNQGGYDLLGRTKDQIRTTEQVNAALAACNDLK  168

Query  591   LDGLVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICKV  770
             LDGLVI+GGVTSNTDAA LAE FA AKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICKV
Sbjct  169   LDGLVIIGGVTSNTDAAQLAETFAVAKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICKV  228

Query  771   NSQLISNVCTDALSAEKYYYFIRLMGRKTSHVALECTLQSHPNMVILAEEVAASKLTLFD  950
             NSQLISNVCTDALSAEKYYYFIRLMGRK SHVALECTLQSHPNMVIL EEVA SKLTLF+
Sbjct  229   NSQLISNVCTDALSAEKYYYFIRLMGRKASHVALECTLQSHPNMVILGEEVAQSKLTLFE  288

Query  951   ITKQVCDAVQARAEQDKYHGVILLPEGLIESIPEIYALLKEIHVLLREGVSANNISSQLS  1130
             I++++ DAVQARAEQDKYHGVILLPEGLIESIPE+YALLKEIH LLR+GV A+ ISSQLS
Sbjct  289   ISRKISDAVQARAEQDKYHGVILLPEGLIESIPEVYALLKEIHGLLRQGVDADKISSQLS  348

Query  1131  PWASALFEFLPPFIRRELLLYPESDDSAQL  1220
             PWASALFEFLPPFIRR+LLLYPESDDSAQL
Sbjct  349   PWASALFEFLPPFIRRQLLLYPESDDSAQL  378



>ref|XP_006306984.1| hypothetical protein CARUB_v10008559mg, partial [Capsella rubella]
 gb|EOA39882.1| hypothetical protein CARUB_v10008559mg, partial [Capsella rubella]
Length=639

 Score =   640 bits (1650),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 325/390 (83%), Positives = 356/390 (91%), Gaps = 0/390 (0%)
 Frame = +3

Query  51    MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  230
             MDSDFG+ RELS LQ+LRSQY+PELPPCLQGTTVRVE GD TT A+ +  HT+ R FPHT
Sbjct  26    MDSDFGIPRELSPLQQLRSQYKPELPPCLQGTTVRVELGDGTTVAEAADSHTMVRAFPHT  85

Query  231   FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  410
              GQPLAHFLR +A+V DA IITE P++RVGIVFCGRQ+PGGHN IWGL++ALKVHN  ST
Sbjct  86    LGQPLAHFLRETAQVTDAHIITELPSVRVGIVFCGRQAPGGHNVIWGLFEALKVHNSKST  145

Query  411   llgflggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLK  590
             LLGFLGGSEGLFAQKTLEITDDIL TYKNQGGYD+LGRTKDQI++TEQVNAAL ACT LK
Sbjct  146   LLGFLGGSEGLFAQKTLEITDDILQTYKNQGGYDLLGRTKDQIKTTEQVNAALKACTDLK  205

Query  591   LDGLVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICKV  770
             LDGLVI+GGVTSNTDAA+LAE F EAKCPTKVVGVPVT NGDLKNQFVETNVGFDTICKV
Sbjct  206   LDGLVIIGGVTSNTDAAHLAEFFVEAKCPTKVVGVPVTTNGDLKNQFVETNVGFDTICKV  265

Query  771   NSQLISNVCTDALSAEKYYYFIRLMGRKTSHVALECTLQSHPNMVILAEEVAASKLTLFD  950
             NSQLISN CTDALSAEKYYYFIRLMGRK SHVALECTLQSHPNMVIL EEVAASKLT+FD
Sbjct  266   NSQLISNACTDALSAEKYYYFIRLMGRKHSHVALECTLQSHPNMVILGEEVAASKLTIFD  325

Query  951   ITKQVCDAVQARAEQDKYHGVILLPEGLIESIPEIYALLKEIHVLLREGVSANNISSQLS  1130
             I KQ+CDAVQARA +DK HGVIL+PEG+IESIPE+YALLKEIH LLR+GV A+ IS+QLS
Sbjct  326   IAKQICDAVQARAGEDKNHGVILIPEGIIESIPEVYALLKEIHGLLRQGVPADKISTQLS  385

Query  1131  PWASALFEFLPPFIRRELLLYPESDDSAQL  1220
             PW+SALFEFLPPFI+++LLL PESDDSAQL
Sbjct  386   PWSSALFEFLPPFIKKQLLLRPESDDSAQL  415



>dbj|BAF01310.1| putative pyrophosphate-dependent phosphofructokinase alpha subunit 
[Arabidopsis thaliana]
Length=617

 Score =   637 bits (1644),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/390 (83%), Positives = 352/390 (90%), Gaps = 0/390 (0%)
 Frame = +3

Query  51    MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  230
             MDSDFG+ RELS LQ+LRSQY PELPPCLQGTTVRVE GD TT A     H I+R FPHT
Sbjct  1     MDSDFGIPRELSPLQQLRSQYHPELPPCLQGTTVRVELGDGTTVAKAGDAHIIARAFPHT  60

Query  231   FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  410
              GQPLAHFLRA+AKV DAQIITEHP  RVGIVFCGRQ+PGGHN +WGLY+ALKVHN  +T
Sbjct  61    LGQPLAHFLRATAKVADAQIITEHPVKRVGIVFCGRQAPGGHNVVWGLYEALKVHNAKNT  120

Query  411   llgflggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLK  590
             LLGFLGGSEGLFAQKTLEITD++L TYKNQGGYDMLGRTKDQIR+TEQVNAAL ACT LK
Sbjct  121   LLGFLGGSEGLFAQKTLEITDEVLQTYKNQGGYDMLGRTKDQIRTTEQVNAALKACTDLK  180

Query  591   LDGLVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICKV  770
             LD LVI+GGVTSNTDAA+LAE FAEAKC TKVVGVPVT+NGDLKNQFVE NVGFDT CKV
Sbjct  181   LDSLVIIGGVTSNTDAAHLAEFFAEAKCSTKVVGVPVTINGDLKNQFVEANVGFDTTCKV  240

Query  771   NSQLISNVCTDALSAEKYYYFIRLMGRKTSHVALECTLQSHPNMVILAEEVAASKLTLFD  950
             NSQLISN+CTDALSAEKYYYF+RLMGRK SHVALECTLQSHPNMVIL EEV ASKLT+FD
Sbjct  241   NSQLISNICTDALSAEKYYYFVRLMGRKHSHVALECTLQSHPNMVILGEEVTASKLTIFD  300

Query  951   ITKQVCDAVQARAEQDKYHGVILLPEGLIESIPEIYALLKEIHVLLREGVSANNISSQLS  1130
             I KQ+CDAVQARAEQDK HGVIL+PEGL+ESIPE+YALLKEIH LL+EGV  +NIS+QLS
Sbjct  301   IIKQICDAVQARAEQDKNHGVILIPEGLVESIPELYALLKEIHGLLKEGVQVDNISTQLS  360

Query  1131  PWASALFEFLPPFIRRELLLYPESDDSAQL  1220
              W+SALFEFLPPFI+++LLL+PESDD AQL
Sbjct  361   SWSSALFEFLPPFIKKQLLLHPESDDYAQL  390



>ref|XP_002893141.1| hypothetical protein ARALYDRAFT_472333 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH69400.1| hypothetical protein ARALYDRAFT_472333 [Arabidopsis lyrata subsp. 
lyrata]
Length=614

 Score =   636 bits (1640),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/390 (83%), Positives = 355/390 (91%), Gaps = 0/390 (0%)
 Frame = +3

Query  51    MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  230
             MDSDFG+ RELS LQ+LRSQY PELPPCLQGTTVRVE GD TT A+ +  HT++R FPHT
Sbjct  1     MDSDFGIPRELSPLQQLRSQYHPELPPCLQGTTVRVELGDGTTVAEAADSHTMARAFPHT  60

Query  231   FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  410
              GQPLAHFLR +A+V DA IITE P++RVGIVFCGRQ+PGGHN IWGL++ALKVHN  ST
Sbjct  61    LGQPLAHFLRETAQVADAHIITELPSVRVGIVFCGRQAPGGHNVIWGLFEALKVHNTKST  120

Query  411   llgflggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLK  590
             LLGFLGGSEGLFAQKTLEITDDIL TYKNQGGYD+LGRTKDQI++TEQVNAAL ACT LK
Sbjct  121   LLGFLGGSEGLFAQKTLEITDDILQTYKNQGGYDLLGRTKDQIKTTEQVNAALKACTDLK  180

Query  591   LDGLVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICKV  770
             LDGLVI+GGV SNTDAA+LAE FA AKCPTKVVGVPVT NGDLKNQFVE NVGFDTICKV
Sbjct  181   LDGLVIIGGVISNTDAAHLAEFFAAAKCPTKVVGVPVTTNGDLKNQFVEANVGFDTICKV  240

Query  771   NSQLISNVCTDALSAEKYYYFIRLMGRKTSHVALECTLQSHPNMVILAEEVAASKLTLFD  950
             NSQLISN CTDALSAEKYYYFIRLMGRK SHVALECTLQSHPNMVIL EEV+ASKLT+FD
Sbjct  241   NSQLISNACTDALSAEKYYYFIRLMGRKHSHVALECTLQSHPNMVILGEEVSASKLTIFD  300

Query  951   ITKQVCDAVQARAEQDKYHGVILLPEGLIESIPEIYALLKEIHVLLREGVSANNISSQLS  1130
             I KQ+CDAVQARA +DK HGVIL+PEGLI SIPE+YALLKEIH LLR+GV+A+ IS+QLS
Sbjct  301   IAKQICDAVQARAVEDKNHGVILIPEGLIVSIPEVYALLKEIHGLLRQGVAADKISTQLS  360

Query  1131  PWASALFEFLPPFIRRELLLYPESDDSAQL  1220
             PW+SALFEFLPPFI+++LLL+PESDDSAQL
Sbjct  361   PWSSALFEFLPPFIKKQLLLHPESDDSAQL  390



>ref|XP_010459789.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha 1-like [Camelina sativa]
Length=614

 Score =   635 bits (1639),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/390 (83%), Positives = 356/390 (91%), Gaps = 0/390 (0%)
 Frame = +3

Query  51    MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  230
             MDSDFG+ RELS LQ+LRSQY+ +LPPCLQGTTVRVE GD TT A+ +  HT++R FPHT
Sbjct  1     MDSDFGIPRELSPLQQLRSQYKSDLPPCLQGTTVRVELGDGTTVAEAADSHTMARAFPHT  60

Query  231   FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  410
              GQPLAHFLR +A+V DA IITE P++RVGIVFCGRQ+PGGHN IWGL++ALKVHN NST
Sbjct  61    LGQPLAHFLRETAQVTDAHIITELPSVRVGIVFCGRQAPGGHNVIWGLFEALKVHNSNST  120

Query  411   llgflggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLK  590
             LLGFLGGSEGLFAQKTLEITDDIL TYKNQGGYD+LGRTKDQI++TEQVNAAL ACT LK
Sbjct  121   LLGFLGGSEGLFAQKTLEITDDILQTYKNQGGYDLLGRTKDQIKTTEQVNAALKACTDLK  180

Query  591   LDGLVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICKV  770
             LDGLVI+GGVTSNTDAA+LAE F EAKC TKVVG PVT NGDLKNQFVETNVGFDTICKV
Sbjct  181   LDGLVIIGGVTSNTDAAHLAEFFVEAKCSTKVVGAPVTTNGDLKNQFVETNVGFDTICKV  240

Query  771   NSQLISNVCTDALSAEKYYYFIRLMGRKTSHVALECTLQSHPNMVILAEEVAASKLTLFD  950
             NSQLISN CTDALSAEKYYYFIRLMGRK SHVALECTLQSHPNMVIL EEVAASKLT+FD
Sbjct  241   NSQLISNACTDALSAEKYYYFIRLMGRKHSHVALECTLQSHPNMVILGEEVAASKLTIFD  300

Query  951   ITKQVCDAVQARAEQDKYHGVILLPEGLIESIPEIYALLKEIHVLLREGVSANNISSQLS  1130
             I KQ+CDAVQARA +DK HGVIL+PEG+IESIPE+YALLKEIH LLR+GV+A+ IS+QLS
Sbjct  301   IAKQICDAVQARAVEDKNHGVILIPEGIIESIPEVYALLKEIHGLLRQGVAADKISTQLS  360

Query  1131  PWASALFEFLPPFIRRELLLYPESDDSAQL  1220
             PW+SALFEFLPPFI+++LLL PESDDSAQL
Sbjct  361   PWSSALFEFLPPFIKKQLLLRPESDDSAQL  390



>ref|XP_009414937.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha {ECO:0000255|HAMAP-Rule:MF_03185}-like 
[Musa acuminata subsp. malaccensis]
 ref|XP_009415019.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha {ECO:0000255|HAMAP-Rule:MF_03185}-like 
[Musa acuminata subsp. malaccensis]
Length=617

 Score =   635 bits (1639),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/390 (81%), Positives = 355/390 (91%), Gaps = 0/390 (0%)
 Frame = +3

Query  51    MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  230
             MDSDFG+ RELS+LQK R+QY PELPPCLQG TVRVEFGD+TT ADPS  + I R FPHT
Sbjct  1     MDSDFGVPRELSELQKKRAQYHPELPPCLQGITVRVEFGDSTTCADPSSTNVIGRAFPHT  60

Query  231   FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  410
             FGQPLAHFLRA+AKVPDAQIITEHP +RVG++FCGRQSPGGHN +WGLY A+K+ NP+S 
Sbjct  61    FGQPLAHFLRATAKVPDAQIITEHPPMRVGVLFCGRQSPGGHNVVWGLYKAIKIRNPDSV  120

Query  411   llgflggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLK  590
             LLGF+GG+EGLF QKT EITD++LATYKNQGGYD+LGRT DQIR+TEQVNAA+TAC  LK
Sbjct  121   LLGFVGGTEGLFTQKTREITDEVLATYKNQGGYDLLGRTVDQIRTTEQVNAAMTACNDLK  180

Query  591   LDGLVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICKV  770
             LDGLVI+GGVTSN+DAA LAE FAEAKCPTKVVGVPVTLNGDLKNQFVETNVGFDT+C+V
Sbjct  181   LDGLVIIGGVTSNSDAAQLAETFAEAKCPTKVVGVPVTLNGDLKNQFVETNVGFDTVCRV  240

Query  771   NSQLISNVCTDALSAEKYYYFIRLMGRKTSHVALECTLQSHPNMVILAEEVAASKLTLFD  950
             NSQLISNVC DA SAEKYYYFIRLMGRK SHVALEC LQSHPNM+IL EEVA SKLT+FD
Sbjct  241   NSQLISNVCIDAQSAEKYYYFIRLMGRKVSHVALECALQSHPNMLILGEEVALSKLTIFD  300

Query  951   ITKQVCDAVQARAEQDKYHGVILLPEGLIESIPEIYALLKEIHVLLREGVSANNISSQLS  1130
             I KQ+CDAVQARAE++KYHGVIL+PEGL+ESIPE+YALL+EIH L  +G+  + ISS+LS
Sbjct  301   IAKQICDAVQARAEKEKYHGVILIPEGLVESIPELYALLQEIHGLHNQGILTDKISSRLS  360

Query  1131  PWASALFEFLPPFIRRELLLYPESDDSAQL  1220
             PWASALFEFLPPFIR++LLL+PESDDSAQL
Sbjct  361   PWASALFEFLPPFIRKQLLLHPESDDSAQL  390



>ref|XP_006849934.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha [Amborella trichopoda]
 gb|ERN11515.1| hypothetical protein AMTR_s00022p00121950 [Amborella trichopoda]
Length=615

 Score =   634 bits (1636),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/387 (82%), Positives = 354/387 (91%), Gaps = 0/387 (0%)
 Frame = +3

Query  60    DFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHTFGQ  239
             DFG+ RELSDLQK R+ Y+P  PPCLQGTTVRVEFGD TT AD S  HTISR FP T+GQ
Sbjct  2     DFGIPRELSDLQKERTLYQPVPPPCLQGTTVRVEFGDGTTTADASDAHTISRSFPLTYGQ  61

Query  240   PLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNSTllg  419
             PL HFLRA+A+VPDA+II EHP IRVG+VF GRQSPGGHN IWGLYDA+K HNPNSTLLG
Sbjct  62    PLVHFLRATAQVPDAKIIQEHPVIRVGVVFSGRQSPGGHNVIWGLYDAIKCHNPNSTLLG  121

Query  420   flggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLKLDG  599
             F+GG++GLFA +TLE+T+ +L+TYKNQGGYDMLGR+KDQIR+TEQVNAAL AC +LKLD 
Sbjct  122   FVGGTDGLFALQTLEVTEKVLSTYKNQGGYDMLGRSKDQIRTTEQVNAALAACQALKLDA  181

Query  600   LVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICKVNSQ  779
             LVI+GGVTSNTDAA LAE FAE KCPTKVVGVPVTLNGDLKNQFVET+VGFDTICKVNSQ
Sbjct  182   LVIIGGVTSNTDAAQLAETFAEKKCPTKVVGVPVTLNGDLKNQFVETDVGFDTICKVNSQ  241

Query  780   LISNVCTDALSAEKYYYFIRLMGRKTSHVALECTLQSHPNMVILAEEVAASKLTLFDITK  959
             LISNVCTDALSAEKYYYFIRLMGRK SHVALECTLQSHPNMVIL EEVAASKLTLFD+T 
Sbjct  242   LISNVCTDALSAEKYYYFIRLMGRKASHVALECTLQSHPNMVILGEEVAASKLTLFDLTI  301

Query  960   QVCDAVQARAEQDKYHGVILLPEGLIESIPEIYALLKEIHVLLREGVSANNISSQLSPWA  1139
             Q+CD+VQARAEQ+KYHGVILLPEGLIESIPE+YALL+EIH L ++GVS  ++SSQLSPWA
Sbjct  302   QICDSVQARAEQNKYHGVILLPEGLIESIPEVYALLQEIHGLHKQGVSVESMSSQLSPWA  361

Query  1140  SALFEFLPPFIRRELLLYPESDDSAQL  1220
             SALFEFLPPFIR++LLL+PESDDSAQL
Sbjct  362   SALFEFLPPFIRKQLLLHPESDDSAQL  388



>ref|XP_006435471.1| hypothetical protein CICLE_v10000595mg [Citrus clementina]
 gb|ESR48711.1| hypothetical protein CICLE_v10000595mg [Citrus clementina]
Length=502

 Score =   630 bits (1625),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/362 (89%), Positives = 345/362 (95%), Gaps = 0/362 (0%)
 Frame = +3

Query  135   LQGTTVRVEFGDATTAADPSGGHTISRLFPHTFGQPLAHFLRASAKVPDAQIITEHPAIR  314
             +QGTTVRVEFGD+TT ADP+  H+ISR FPHT+GQPLAHFLRA+AKVPDAQIITEHPAIR
Sbjct  37    MQGTTVRVEFGDSTTTADPADTHSISRSFPHTYGQPLAHFLRATAKVPDAQIITEHPAIR  96

Query  315   VGIVFCGRQSPGGHNAIWGLYDALKVHNPNSTllgflggseglfAQKTLEITDDILATYK  494
             VGIVFCGRQSPGGHN +WGLYDALK+HNP STLLGFLGGSEGLFAQKTLE+T +IL+TYK
Sbjct  97    VGIVFCGRQSPGGHNVVWGLYDALKLHNPKSTLLGFLGGSEGLFAQKTLEVTKEILSTYK  156

Query  495   NQGGYDMLGRTKDQIRSTEQVNAALTACTSLKLDGLVIVGGVTSNTDaaylaeafaeaKC  674
             NQGGYDMLGRTKDQIR+TEQVNAALTAC +L LDGLVI+GGVTSNTDAAYLAE FAEAKC
Sbjct  157   NQGGYDMLGRTKDQIRTTEQVNAALTACKNLNLDGLVIIGGVTSNTDAAYLAETFAEAKC  216

Query  675   PTKVVGVPVTLNGDLKNQFVETNVGFDTICKVNSQLISNVCTDALSAEKYYYFIRLMGRK  854
             PTKVVGVPVTLNGDLKNQFVETNVGFDTICKVNSQLISNVCTDALSAEKYYYFIRLMGR+
Sbjct  217   PTKVVGVPVTLNGDLKNQFVETNVGFDTICKVNSQLISNVCTDALSAEKYYYFIRLMGRR  276

Query  855   TSHVALECTLQSHPNMVILAEEVAASKLTLFDITKQVCDAVQARAEQDKYHGVILLPEGL  1034
              SHVALECTLQSHPNMVIL EEVAASKLTLFD+TKQ+CDAVQARAEQDK HGVILLPEGL
Sbjct  277   ASHVALECTLQSHPNMVILGEEVAASKLTLFDLTKQICDAVQARAEQDKNHGVILLPEGL  336

Query  1035  IESIPEIYALLKEIHVLLREGVSANNISSQLSPWASALFEFLPPFIRRELLLYPESDDSA  1214
             IESIPE+YALLKEIH LLR+GV  +NISSQLSPWASALFEFLPPFI+++LLL PESDDSA
Sbjct  337   IESIPEVYALLKEIHSLLRQGVPVDNISSQLSPWASALFEFLPPFIKKQLLLQPESDDSA  396

Query  1215  QL  1220
             QL
Sbjct  397   QL  398



>ref|XP_006435473.1| hypothetical protein CICLE_v10000595mg [Citrus clementina]
 ref|XP_006435474.1| hypothetical protein CICLE_v10000595mg [Citrus clementina]
 gb|ESR48713.1| hypothetical protein CICLE_v10000595mg [Citrus clementina]
 gb|ESR48714.1| hypothetical protein CICLE_v10000595mg [Citrus clementina]
 gb|KDO85267.1| hypothetical protein CISIN_1g006964mg [Citrus sinensis]
 gb|KDO85268.1| hypothetical protein CISIN_1g006964mg [Citrus sinensis]
Length=623

 Score =   631 bits (1627),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/362 (89%), Positives = 345/362 (95%), Gaps = 0/362 (0%)
 Frame = +3

Query  135   LQGTTVRVEFGDATTAADPSGGHTISRLFPHTFGQPLAHFLRASAKVPDAQIITEHPAIR  314
             +QGTTVRVEFGD+TT ADP+  H+ISR FPHT+GQPLAHFLRA+AKVPDAQIITEHPAIR
Sbjct  37    MQGTTVRVEFGDSTTTADPADTHSISRSFPHTYGQPLAHFLRATAKVPDAQIITEHPAIR  96

Query  315   VGIVFCGRQSPGGHNAIWGLYDALKVHNPNSTllgflggseglfAQKTLEITDDILATYK  494
             VGIVFCGRQSPGGHN +WGLYDALK+HNP STLLGFLGGSEGLFAQKTLE+T +IL+TYK
Sbjct  97    VGIVFCGRQSPGGHNVVWGLYDALKLHNPKSTLLGFLGGSEGLFAQKTLEVTKEILSTYK  156

Query  495   NQGGYDMLGRTKDQIRSTEQVNAALTACTSLKLDGLVIVGGVTSNTDaaylaeafaeaKC  674
             NQGGYDMLGRTKDQIR+TEQVNAALTAC +L LDGLVI+GGVTSNTDAAYLAE FAEAKC
Sbjct  157   NQGGYDMLGRTKDQIRTTEQVNAALTACKNLNLDGLVIIGGVTSNTDAAYLAETFAEAKC  216

Query  675   PTKVVGVPVTLNGDLKNQFVETNVGFDTICKVNSQLISNVCTDALSAEKYYYFIRLMGRK  854
             PTKVVGVPVTLNGDLKNQFVETNVGFDTICKVNSQLISNVCTDALSAEKYYYFIRLMGR+
Sbjct  217   PTKVVGVPVTLNGDLKNQFVETNVGFDTICKVNSQLISNVCTDALSAEKYYYFIRLMGRR  276

Query  855   TSHVALECTLQSHPNMVILAEEVAASKLTLFDITKQVCDAVQARAEQDKYHGVILLPEGL  1034
              SHVALECTLQSHPNMVIL EEVAASKLTLFD+TKQ+CDAVQARAEQDK HGVILLPEGL
Sbjct  277   ASHVALECTLQSHPNMVILGEEVAASKLTLFDLTKQICDAVQARAEQDKNHGVILLPEGL  336

Query  1035  IESIPEIYALLKEIHVLLREGVSANNISSQLSPWASALFEFLPPFIRRELLLYPESDDSA  1214
             IESIPE+YALLKEIH LLR+GV  +NISSQLSPWASALFEFLPPFI+++LLL PESDDSA
Sbjct  337   IESIPEVYALLKEIHSLLRQGVPVDNISSQLSPWASALFEFLPPFIKKQLLLQPESDDSA  396

Query  1215  QL  1220
             QL
Sbjct  397   QL  398



>ref|XP_003570229.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha-like isoform X2 [Brachypodium distachyon]
Length=617

 Score =   629 bits (1621),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/390 (79%), Positives = 354/390 (91%), Gaps = 0/390 (0%)
 Frame = +3

Query  51    MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  230
             MDSD+G+ RELS++QK R+ Y+PELPPCLQGTTVRVE+GD   AADP+G H IS  FPHT
Sbjct  1     MDSDYGVPRELSEVQKQRTLYQPELPPCLQGTTVRVEYGDVAIAADPTGAHVISHAFPHT  60

Query  231   FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  410
             +GQPLAHFLR +A VPDA++I+EHPA+RVG+VFCGRQSPGGHN IWGL++A+K HN NS 
Sbjct  61    YGQPLAHFLRKAAIVPDAKVISEHPAVRVGVVFCGRQSPGGHNVIWGLHEAIKAHNLNSK  120

Query  411   llgflggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLK  590
             L+GFLGG++GL AQKTLEIT+++L++YKNQGGYDMLGRTKDQIR+TEQV  A+ +C +LK
Sbjct  121   LIGFLGGTDGLLAQKTLEITNEVLSSYKNQGGYDMLGRTKDQIRTTEQVKGAMASCQALK  180

Query  591   LDGLVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICKV  770
             LD LVI+GGVTSNTDAA LAE FAEAKC TKVVGVPVTLNGDLKNQFVET VGFDTICKV
Sbjct  181   LDALVIIGGVTSNTDAAQLAETFAEAKCATKVVGVPVTLNGDLKNQFVETTVGFDTICKV  240

Query  771   NSQLISNVCTDALSAEKYYYFIRLMGRKTSHVALECTLQSHPNMVILAEEVAASKLTLFD  950
             NSQLISNVCTDALSAEKYYYFIR+MGRK SHVALEC LQSHPNMVIL EEVAASKLT+FD
Sbjct  241   NSQLISNVCTDALSAEKYYYFIRMMGRKASHVALECALQSHPNMVILGEEVAASKLTIFD  300

Query  951   ITKQVCDAVQARAEQDKYHGVILLPEGLIESIPEIYALLKEIHVLLREGVSANNISSQLS  1130
             ITKQ+CDAVQARAE+DKYHGV+L+PEGL+ESIPE+YALL+EI+ L  +GVS  NISSQLS
Sbjct  301   ITKQICDAVQARAEKDKYHGVVLIPEGLVESIPELYALLQEINGLHGKGVSIENISSQLS  360

Query  1131  PWASALFEFLPPFIRRELLLYPESDDSAQL  1220
             PWASALFEFLP FIR++LLL PESDDSAQL
Sbjct  361   PWASALFEFLPQFIRQQLLLRPESDDSAQL  390



>gb|EMS68198.1| Pyrophosphate--fructose 6-phosphate 1-phosphotransferase subunit 
alpha [Triticum urartu]
 gb|EMT25737.1| Pyrophosphate--fructose 6-phosphate 1-phosphotransferase subunit 
alpha [Aegilops tauschii]
Length=581

 Score =   627 bits (1617),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/390 (79%), Positives = 353/390 (91%), Gaps = 0/390 (0%)
 Frame = +3

Query  51    MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  230
             MDSD+G+ RELS++Q+ R+ Y+PELPPCLQGTTVRVE+GD   AADP+G H IS  +PHT
Sbjct  1     MDSDYGVPRELSEVQQNRTLYQPELPPCLQGTTVRVEYGDVAIAADPAGAHVISHAYPHT  60

Query  231   FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  410
             +GQPLAHFLR +A VPDA++I+EHPA+RVGIVFCGRQSPGGHN IWGL++A+K HN NS 
Sbjct  61    YGQPLAHFLRKAANVPDAKVISEHPAVRVGIVFCGRQSPGGHNVIWGLHEAIKAHNVNSK  120

Query  411   llgflggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLK  590
             L+GFLGG++GL AQKTLEIT+++L++YKNQGGYDMLGRTKDQIR+TEQVN A+  C +LK
Sbjct  121   LIGFLGGTDGLLAQKTLEITNEVLSSYKNQGGYDMLGRTKDQIRTTEQVNGAMATCQALK  180

Query  591   LDGLVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICKV  770
             LD LVI+GGVTSNTDAA LAE FAEAKC TKVVGVPVTLNGDLKNQFVET VGFDTICKV
Sbjct  181   LDALVIIGGVTSNTDAAQLAETFAEAKCATKVVGVPVTLNGDLKNQFVETTVGFDTICKV  240

Query  771   NSQLISNVCTDALSAEKYYYFIRLMGRKTSHVALECTLQSHPNMVILAEEVAASKLTLFD  950
             NSQLISN+CTDALSAEKYYYFIR+MGRK SHVALEC LQSHPNMVIL EEVAASKLT+FD
Sbjct  241   NSQLISNMCTDALSAEKYYYFIRMMGRKASHVALECALQSHPNMVILGEEVAASKLTIFD  300

Query  951   ITKQVCDAVQARAEQDKYHGVILLPEGLIESIPEIYALLKEIHVLLREGVSANNISSQLS  1130
             ITKQ+CDAVQARAE+DK HGVIL+PEGL+ESIPE+YALL+EI+ L  +GVS  NISSQLS
Sbjct  301   ITKQICDAVQARAEKDKNHGVILIPEGLVESIPELYALLQEINGLHGKGVSVENISSQLS  360

Query  1131  PWASALFEFLPPFIRRELLLYPESDDSAQL  1220
             PWASALFEFLP FIR++LLL PESDDSAQL
Sbjct  361   PWASALFEFLPQFIRQQLLLRPESDDSAQL  390



>dbj|BAJ92904.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=616

 Score =   627 bits (1616),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/390 (79%), Positives = 353/390 (91%), Gaps = 0/390 (0%)
 Frame = +3

Query  51    MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  230
             MDSD+G+ RELS++Q+ R+ Y+PELPPCLQGTTVRVE+GD   AADP+G H IS  FPHT
Sbjct  1     MDSDYGVPRELSEVQQKRTLYQPELPPCLQGTTVRVEYGDVAIAADPAGAHVISHAFPHT  60

Query  231   FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  410
             +GQPLAHFLR +A VPDA++I+EHPA+RVGIVFCGRQSPGGHN IWGL++A+K HN NS 
Sbjct  61    YGQPLAHFLRKAANVPDAKVISEHPAVRVGIVFCGRQSPGGHNVIWGLHEAIKAHNLNSK  120

Query  411   llgflggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLK  590
             L+GFLGG++GL AQKTLEIT+++L++YKNQGGYDMLGRTKDQIR+TEQVN A+  C +LK
Sbjct  121   LIGFLGGTDGLLAQKTLEITNEVLSSYKNQGGYDMLGRTKDQIRTTEQVNGAMATCQALK  180

Query  591   LDGLVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICKV  770
             LD LVI+GGVTSNTDAA LAE FAEAKC TKVVGVPVTLNGDLKNQFVET VGFDTICKV
Sbjct  181   LDALVIIGGVTSNTDAAQLAETFAEAKCATKVVGVPVTLNGDLKNQFVETTVGFDTICKV  240

Query  771   NSQLISNVCTDALSAEKYYYFIRLMGRKTSHVALECTLQSHPNMVILAEEVAASKLTLFD  950
             NSQLISN+CTDALSAEKYYYFIR+MGRK SHVALEC LQSHPNMVIL EEVAASKLT+FD
Sbjct  241   NSQLISNMCTDALSAEKYYYFIRMMGRKASHVALECALQSHPNMVILGEEVAASKLTIFD  300

Query  951   ITKQVCDAVQARAEQDKYHGVILLPEGLIESIPEIYALLKEIHVLLREGVSANNISSQLS  1130
             ITKQ+CDAVQARAE+DK HGVIL+PEGL+ESIPE+YALL+EI+ L  +GVS  NISSQLS
Sbjct  301   ITKQICDAVQARAEKDKNHGVILIPEGLVESIPELYALLQEINGLHGKGVSVENISSQLS  360

Query  1131  PWASALFEFLPPFIRRELLLYPESDDSAQL  1220
             PWASALFEFLP FIR++LLL PESDDSAQL
Sbjct  361   PWASALFEFLPQFIRQQLLLRPESDDSAQL  390



>ref|XP_009417287.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha {ECO:0000255|HAMAP-Rule:MF_03185}-like 
[Musa acuminata subsp. malaccensis]
Length=616

 Score =   626 bits (1615),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/390 (80%), Positives = 353/390 (91%), Gaps = 0/390 (0%)
 Frame = +3

Query  51    MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  230
             M+SD+G+ R+LS LQK R+ Y+PELP CLQGTTVRVEFGD T AADP+  H I + FPHT
Sbjct  1     MESDYGVPRDLSGLQKQRALYQPELPLCLQGTTVRVEFGDTTIAADPADDHAIRQAFPHT  60

Query  231   FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  410
              GQPLAHFLRA+A VPDAQII EHPAIRVGIVFCGRQSPGGHN IWGLY+A+K HNP ST
Sbjct  61    SGQPLAHFLRATANVPDAQIIEEHPAIRVGIVFCGRQSPGGHNVIWGLYNAIKSHNPEST  120

Query  411   llgflggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLK  590
             L GF+GG+EGLFA++ L+ITDDIL+TYKNQGGYD+LGRTKDQIR++EQVNAA++AC  L 
Sbjct  121   LFGFVGGTEGLFARRILKITDDILSTYKNQGGYDLLGRTKDQIRTSEQVNAAMSACQELN  180

Query  591   LDGLVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICKV  770
             L GLVI+GGVTS+TDAA LAE F E+KC TKVVGVPVTLNGDLKNQ VET+VGFDTICKV
Sbjct  181   LTGLVIIGGVTSHTDAAQLAETFVESKCQTKVVGVPVTLNGDLKNQIVETDVGFDTICKV  240

Query  771   NSQLISNVCTDALSAEKYYYFIRLMGRKTSHVALECTLQSHPNMVILAEEVAASKLTLFD  950
             NSQLISNVCTDALSAEKYYYFIRLMGRK SHVALECTLQSHPNMVILAE+VA SKLT+FD
Sbjct  241   NSQLISNVCTDALSAEKYYYFIRLMGRKASHVALECTLQSHPNMVILAEDVAVSKLTIFD  300

Query  951   ITKQVCDAVQARAEQDKYHGVILLPEGLIESIPEIYALLKEIHVLLREGVSANNISSQLS  1130
             ITKQ+CDAVQARAE+DKYHGVIL+PEGL+ESIPE+YALL+EIH L R+GVS   I SQLS
Sbjct  301   ITKQICDAVQARAEKDKYHGVILIPEGLVESIPELYALLQEIHGLHRQGVSVETIPSQLS  360

Query  1131  PWASALFEFLPPFIRRELLLYPESDDSAQL  1220
             PWASALFEFLPPF+R++L+L+PESDDSAQL
Sbjct  361   PWASALFEFLPPFMRKQLVLHPESDDSAQL  390



>ref|XP_010235882.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha-like isoform X1 [Brachypodium distachyon]
Length=618

 Score =   624 bits (1609),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/391 (79%), Positives = 354/391 (91%), Gaps = 1/391 (0%)
 Frame = +3

Query  51    MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  230
             MDSD+G+ RELS++QK R+ Y+PELPPCLQGTTVRVE+GD   AADP+G H IS  FPHT
Sbjct  1     MDSDYGVPRELSEVQKQRTLYQPELPPCLQGTTVRVEYGDVAIAADPTGAHVISHAFPHT  60

Query  231   FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  410
             +GQPLAHFLR +A VPDA++I+EHPA+RVG+VFCGRQSPGGHN IWGL++A+K HN NS 
Sbjct  61    YGQPLAHFLRKAAIVPDAKVISEHPAVRVGVVFCGRQSPGGHNVIWGLHEAIKAHNLNSK  120

Query  411   llgflggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLK  590
             L+GFLGG++GL AQKTLEIT+++L++YKNQGGYDMLGRTKDQIR+TEQV  A+ +C +LK
Sbjct  121   LIGFLGGTDGLLAQKTLEITNEVLSSYKNQGGYDMLGRTKDQIRTTEQVKGAMASCQALK  180

Query  591   LDGLVIVGGVTSNTDaaylaeafaeaKCPTK-VVGVPVTLNGDLKNQFVETNVGFDTICK  767
             LD LVI+GGVTSNTDAA LAE FAEAKC TK VVGVPVTLNGDLKNQFVET VGFDTICK
Sbjct  181   LDALVIIGGVTSNTDAAQLAETFAEAKCATKQVVGVPVTLNGDLKNQFVETTVGFDTICK  240

Query  768   VNSQLISNVCTDALSAEKYYYFIRLMGRKTSHVALECTLQSHPNMVILAEEVAASKLTLF  947
             VNSQLISNVCTDALSAEKYYYFIR+MGRK SHVALEC LQSHPNMVIL EEVAASKLT+F
Sbjct  241   VNSQLISNVCTDALSAEKYYYFIRMMGRKASHVALECALQSHPNMVILGEEVAASKLTIF  300

Query  948   DITKQVCDAVQARAEQDKYHGVILLPEGLIESIPEIYALLKEIHVLLREGVSANNISSQL  1127
             DITKQ+CDAVQARAE+DKYHGV+L+PEGL+ESIPE+YALL+EI+ L  +GVS  NISSQL
Sbjct  301   DITKQICDAVQARAEKDKYHGVVLIPEGLVESIPELYALLQEINGLHGKGVSIENISSQL  360

Query  1128  SPWASALFEFLPPFIRRELLLYPESDDSAQL  1220
             SPWASALFEFLP FIR++LLL PESDDSAQL
Sbjct  361   SPWASALFEFLPQFIRQQLLLRPESDDSAQL  391



>ref|NP_001047918.1| Os02g0714200 [Oryza sativa Japonica Group]
 dbj|BAD07793.1| putative diphosphate-fructose-6-phosphate 1-phosphotransferase 
alpha chain [Oryza sativa Japonica Group]
 dbj|BAF09832.1| Os02g0714200 [Oryza sativa Japonica Group]
 dbj|BAG91865.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC73886.1| hypothetical protein OsI_08678 [Oryza sativa Indica Group]
 gb|EEE57680.1| hypothetical protein OsJ_08132 [Oryza sativa Japonica Group]
Length=617

 Score =   623 bits (1607),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/390 (81%), Positives = 357/390 (92%), Gaps = 0/390 (0%)
 Frame = +3

Query  51    MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  230
             MDSD+G+ RELS++QK R+ Y+PELPPCLQGTTVRVE+GDA  AADP+G H IS  FPHT
Sbjct  1     MDSDYGVPRELSEVQKKRALYQPELPPCLQGTTVRVEYGDAAIAADPAGAHVISHAFPHT  60

Query  231   FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  410
             +GQPLAHFLR +A VPDA +I+EHP +RVG+VFCGRQSPGGHN IWGL++A+K HNPNS 
Sbjct  61    YGQPLAHFLRKTANVPDATVISEHPVVRVGVVFCGRQSPGGHNVIWGLHEAIKAHNPNSK  120

Query  411   llgflggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLK  590
             L+GFLGGS+GL AQKTLEITD++L++YKNQGGYDMLGRTKDQIR+TEQVN A+ +C +LK
Sbjct  121   LIGFLGGSDGLLAQKTLEITDEVLSSYKNQGGYDMLGRTKDQIRTTEQVNGAMASCQALK  180

Query  591   LDGLVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICKV  770
             LD LVI+GGVTSNTDAA LAE FAEAKC TKVVGVPVTLNGDLKNQFVET VGFDTICKV
Sbjct  181   LDALVIIGGVTSNTDAAQLAETFAEAKCATKVVGVPVTLNGDLKNQFVETTVGFDTICKV  240

Query  771   NSQLISNVCTDALSAEKYYYFIRLMGRKTSHVALECTLQSHPNMVILAEEVAASKLTLFD  950
             NSQLISNVCTDALSAEKYYYFIR+MGRK SHVALEC LQSHPNMVIL EEVAASKLT+FD
Sbjct  241   NSQLISNVCTDALSAEKYYYFIRMMGRKASHVALECALQSHPNMVILGEEVAASKLTIFD  300

Query  951   ITKQVCDAVQARAEQDKYHGVILLPEGLIESIPEIYALLKEIHVLLREGVSANNISSQLS  1130
             ITKQ+CDAVQARAE+DKYHGV+L+PEGL+ESIPE+YALL+EIH L  +GVS  NISSQLS
Sbjct  301   ITKQICDAVQARAEKDKYHGVVLIPEGLVESIPELYALLQEIHGLHGKGVSMENISSQLS  360

Query  1131  PWASALFEFLPPFIRRELLLYPESDDSAQL  1220
             PWASALFEFLPPFIR++LLL+PESDDSAQL
Sbjct  361   PWASALFEFLPPFIRKQLLLHPESDDSAQL  390



>ref|XP_006659170.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha-like [Oryza brachyantha]
Length=622

 Score =   620 bits (1600),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/394 (80%), Positives = 355/394 (90%), Gaps = 0/394 (0%)
 Frame = +3

Query  39    GQVKMDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRL  218
             G V MDSD+G+ RELS LQK R+ YRP LPPCLQGTTVRVE+GDA  AAD +G H IS  
Sbjct  2     GSVAMDSDYGVPRELSALQKARALYRPGLPPCLQGTTVRVEYGDAAVAADVAGAHVISHA  61

Query  219   FPHTFGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHN  398
             FPHT+GQPLAHFLR ++ VPDA +I EHP +RVGIVF GRQSPGGHN IWGL+DA+K HN
Sbjct  62    FPHTYGQPLAHFLRKTSVVPDATVIREHPVVRVGIVFSGRQSPGGHNVIWGLHDAIKAHN  121

Query  399   PNSTllgflggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTAC  578
             PNS L+GFLGG++GLFAQKTLEITD++L++YKNQGGYDMLGRT+DQIR+TEQVNAA+TAC
Sbjct  122   PNSKLIGFLGGTDGLFAQKTLEITDEVLSSYKNQGGYDMLGRTRDQIRTTEQVNAAMTAC  181

Query  579   TSLKLDGLVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDT  758
               LKLD LVI+GGVTSNTDAA L+E FAE+KC TKVVGVPVTLNGDLKNQFVET VGFDT
Sbjct  182   QDLKLDALVIIGGVTSNTDAAQLSETFAESKCSTKVVGVPVTLNGDLKNQFVETTVGFDT  241

Query  759   ICKVNSQLISNVCTDALSAEKYYYFIRLMGRKTSHVALECTLQSHPNMVILAEEVAASKL  938
             ICKVNSQLISNVCTDALSAEKYYYF+RLMGRK SHVALEC LQSHPNMVIL EEVAASKL
Sbjct  242   ICKVNSQLISNVCTDALSAEKYYYFVRLMGRKASHVALECALQSHPNMVILGEEVAASKL  301

Query  939   TLFDITKQVCDAVQARAEQDKYHGVILLPEGLIESIPEIYALLKEIHVLLREGVSANNIS  1118
             T+FDITKQ+CDAVQARA++DKYHGV+L+PEGL+ESIPE+YALL+EIH L  +GVS  NIS
Sbjct  302   TIFDITKQICDAVQARAQKDKYHGVVLIPEGLVESIPELYALLQEIHGLHGKGVSVENIS  361

Query  1119  SQLSPWASALFEFLPPFIRRELLLYPESDDSAQL  1220
             S LSPWASALFEFLPPFIR++LLL+PESDDSAQL
Sbjct  362   SHLSPWASALFEFLPPFIRKQLLLHPESDDSAQL  395



>ref|XP_006648988.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha-like [Oryza brachyantha]
Length=617

 Score =   619 bits (1596),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/390 (80%), Positives = 354/390 (91%), Gaps = 0/390 (0%)
 Frame = +3

Query  51    MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  230
             MDSD+G+ RELS++QK R+ Y+PELPPCLQGTTVRVE+GDA  AADP+G H IS  FPHT
Sbjct  1     MDSDYGVPRELSEVQKKRALYQPELPPCLQGTTVRVEYGDAAIAADPAGAHVISHAFPHT  60

Query  231   FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  410
             +GQPLAHFLR +A VP+A +I EHP +RVG+VFCGRQSPGGHN IWGLY+A+K HNPNS 
Sbjct  61    YGQPLAHFLRKTANVPEATVIAEHPTVRVGVVFCGRQSPGGHNVIWGLYEAIKAHNPNSM  120

Query  411   llgflggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLK  590
             L+GFLGGS+GL AQK  EIT+++L++YKNQGGYDMLGRTKDQIR+TEQVN A+ +C +LK
Sbjct  121   LIGFLGGSDGLLAQKAFEITEEVLSSYKNQGGYDMLGRTKDQIRTTEQVNGAMASCQALK  180

Query  591   LDGLVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICKV  770
             LD LVI+GGVTSNTDAA LAE FAEAKC TKVVGVPVTLNGDLKNQFVET VGFDTICKV
Sbjct  181   LDALVIIGGVTSNTDAAQLAETFAEAKCATKVVGVPVTLNGDLKNQFVETTVGFDTICKV  240

Query  771   NSQLISNVCTDALSAEKYYYFIRLMGRKTSHVALECTLQSHPNMVILAEEVAASKLTLFD  950
             NSQLISNVCTDALSAEKYYYFIR+MGRK SHVALEC LQSHPNMVIL EEVAASKLT+FD
Sbjct  241   NSQLISNVCTDALSAEKYYYFIRMMGRKASHVALECALQSHPNMVILGEEVAASKLTIFD  300

Query  951   ITKQVCDAVQARAEQDKYHGVILLPEGLIESIPEIYALLKEIHVLLREGVSANNISSQLS  1130
             ITKQ+CDAVQARAE+DKYHGV+L+PEGL+ESIPE+YALL+EIH L  +GVS  NISSQLS
Sbjct  301   ITKQICDAVQARAEKDKYHGVVLIPEGLVESIPELYALLQEIHGLHGKGVSMENISSQLS  360

Query  1131  PWASALFEFLPPFIRRELLLYPESDDSAQL  1220
             PWASALFEFLPPFIR++LLL+PESDDSAQL
Sbjct  361   PWASALFEFLPPFIRKQLLLHPESDDSAQL  390



>ref|XP_002452651.1| hypothetical protein SORBIDRAFT_04g030000 [Sorghum bicolor]
 gb|EES05627.1| hypothetical protein SORBIDRAFT_04g030000 [Sorghum bicolor]
Length=616

 Score =   617 bits (1592),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/390 (81%), Positives = 357/390 (92%), Gaps = 0/390 (0%)
 Frame = +3

Query  51    MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  230
             MDSD+G+ RELS++QK R+ Y+PELPPCLQGTTVRVE+GDA  AADP+G H IS +FPHT
Sbjct  1     MDSDYGVPRELSEVQKKRALYQPELPPCLQGTTVRVEYGDAAIAADPAGAHVISHVFPHT  60

Query  231   FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  410
             +GQPLAHFLR +A VPDA++I+EH A+RVGIVFCGRQSPGGHN +WGLY+A+K HN NS 
Sbjct  61    YGQPLAHFLRKTAVVPDAKVISEHLAVRVGIVFCGRQSPGGHNVVWGLYEAIKAHNQNSK  120

Query  411   llgflggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLK  590
             L+GFLGGS+GL AQ+TLEITD++LA+YKNQGGYDMLGRTKDQIR+TEQVN A+ +C +LK
Sbjct  121   LIGFLGGSDGLLAQRTLEITDEVLASYKNQGGYDMLGRTKDQIRTTEQVNGAMASCQALK  180

Query  591   LDGLVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICKV  770
             LD LVI+GGVTSNTDAA LAE FAEAKC TKVVGVPVTLNGDLKNQFVET VGFDTICKV
Sbjct  181   LDALVIIGGVTSNTDAAQLAETFAEAKCATKVVGVPVTLNGDLKNQFVETTVGFDTICKV  240

Query  771   NSQLISNVCTDALSAEKYYYFIRLMGRKTSHVALECTLQSHPNMVILAEEVAASKLTLFD  950
             N+QLISN+CTDALSAEKYYYFIRLMGRK SHVALEC LQSHPNMVIL EEVAASKLT+FD
Sbjct  241   NAQLISNMCTDALSAEKYYYFIRLMGRKASHVALECALQSHPNMVILGEEVAASKLTIFD  300

Query  951   ITKQVCDAVQARAEQDKYHGVILLPEGLIESIPEIYALLKEIHVLLREGVSANNISSQLS  1130
             ITKQ+CDAVQARAE+DK HGVIL+PEGL+ESIPE+YALL+EIH L  +GVS  NISSQLS
Sbjct  301   ITKQICDAVQARAEKDKNHGVILIPEGLVESIPELYALLQEIHGLHGQGVSVENISSQLS  360

Query  1131  PWASALFEFLPPFIRRELLLYPESDDSAQL  1220
             PWASALFEFLPPFIR++LLL+PESDDSAQL
Sbjct  361   PWASALFEFLPPFIRKQLLLHPESDDSAQL  390



>ref|XP_004953678.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha-like [Setaria italica]
Length=616

 Score =   617 bits (1591),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/390 (81%), Positives = 358/390 (92%), Gaps = 0/390 (0%)
 Frame = +3

Query  51    MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  230
             MDSD+G+ RELS++QK R+ Y+PE+PPCLQGTTVRVE+GDA  AADP+G H IS+ FPHT
Sbjct  1     MDSDYGVPRELSEVQKKRALYQPEVPPCLQGTTVRVEYGDAAIAADPAGAHVISQAFPHT  60

Query  231   FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  410
             +GQPLAHFLR +A VPDA++I+EHPA+RVGIVFCGRQSPGGHN IWGLY+A+K HN NS 
Sbjct  61    YGQPLAHFLRKTAVVPDAKVISEHPAVRVGIVFCGRQSPGGHNVIWGLYEAIKAHNQNSK  120

Query  411   llgflggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLK  590
             L+GFLGGS+GL AQKTLEITD++L++YKNQGGYDMLGRTKDQIR+TEQV  A+ +C +LK
Sbjct  121   LIGFLGGSDGLLAQKTLEITDEVLSSYKNQGGYDMLGRTKDQIRTTEQVKGAMASCQALK  180

Query  591   LDGLVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICKV  770
             LD LVI+GGVTSNTDAA LAE FAEAKC TKVVGVPVTLNGDLKNQFVET VGFDTICKV
Sbjct  181   LDALVIIGGVTSNTDAAQLAETFAEAKCATKVVGVPVTLNGDLKNQFVETTVGFDTICKV  240

Query  771   NSQLISNVCTDALSAEKYYYFIRLMGRKTSHVALECTLQSHPNMVILAEEVAASKLTLFD  950
             NSQLISN+CTDALSAEKYYYFIRLMGRK SHVALEC+LQSHPNMVIL EEVAASKLT+FD
Sbjct  241   NSQLISNMCTDALSAEKYYYFIRLMGRKASHVALECSLQSHPNMVILGEEVAASKLTIFD  300

Query  951   ITKQVCDAVQARAEQDKYHGVILLPEGLIESIPEIYALLKEIHVLLREGVSANNISSQLS  1130
             ITKQ+CDAVQARAE+DK HGV+L+PEGL+ESIPE+YALL+EIH L  +GVSA NISSQLS
Sbjct  301   ITKQICDAVQARAEKDKNHGVVLIPEGLVESIPELYALLQEIHGLHGKGVSAENISSQLS  360

Query  1131  PWASALFEFLPPFIRRELLLYPESDDSAQL  1220
             PWASALFEFLPPFI ++LLL+PESDDSAQL
Sbjct  361   PWASALFEFLPPFIGKQLLLHPESDDSAQL  390



>ref|NP_001057528.1| Os06g0326400 [Oryza sativa Japonica Group]
 dbj|BAF19442.1| Os06g0326400 [Oryza sativa Japonica Group]
 dbj|BAG89341.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE65619.1| hypothetical protein OsJ_21179 [Oryza sativa Japonica Group]
Length=622

 Score =   617 bits (1592),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/394 (80%), Positives = 356/394 (90%), Gaps = 0/394 (0%)
 Frame = +3

Query  39    GQVKMDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRL  218
             G V MDSD+G+ RELS LQK R+ YRP+LPPCLQGTTV+VE+GDA  AAD +G H IS  
Sbjct  2     GSVAMDSDYGVPRELSALQKARALYRPDLPPCLQGTTVKVEYGDAAIAADVAGAHVISHA  61

Query  219   FPHTFGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHN  398
             FPHT+GQPLAHFLR +A VPDA +ITEHP +RVG+VF GRQSPGGHN IWGL+DA+K HN
Sbjct  62    FPHTYGQPLAHFLRKTAAVPDATVITEHPVVRVGVVFSGRQSPGGHNVIWGLHDAIKAHN  121

Query  399   PNSTllgflggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTAC  578
              NS L+GFLGG++GLFAQKTLEI+D++L++YKNQGGYD+LGRT+DQIR+TEQVNAA+TAC
Sbjct  122   ANSKLIGFLGGTDGLFAQKTLEISDEVLSSYKNQGGYDLLGRTRDQIRTTEQVNAAMTAC  181

Query  579   TSLKLDGLVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDT  758
              +LKLD LVI+GGVTSNTDAA LAE FAE+KC TKVVGVPVTLNGDLKNQFVET VGFDT
Sbjct  182   QALKLDALVIIGGVTSNTDAAQLAETFAESKCSTKVVGVPVTLNGDLKNQFVETTVGFDT  241

Query  759   ICKVNSQLISNVCTDALSAEKYYYFIRLMGRKTSHVALECTLQSHPNMVILAEEVAASKL  938
             ICKVNSQLISNVCTDALSAEKYYYF+RLMGRK SHVALEC LQSHPNMVIL EEVAASKL
Sbjct  242   ICKVNSQLISNVCTDALSAEKYYYFVRLMGRKASHVALECALQSHPNMVILGEEVAASKL  301

Query  939   TLFDITKQVCDAVQARAEQDKYHGVILLPEGLIESIPEIYALLKEIHVLLREGVSANNIS  1118
             T+FDITKQ+CDAVQARAE+DK HGV+L+PEGL+ESIPE+YALL+EIH L  +GVS  NIS
Sbjct  302   TIFDITKQICDAVQARAEKDKNHGVVLIPEGLVESIPELYALLQEIHGLHDKGVSVENIS  361

Query  1119  SQLSPWASALFEFLPPFIRRELLLYPESDDSAQL  1220
             S LSPWASALFEFLPPFIR++LLL+PESDDSAQL
Sbjct  362   SHLSPWASALFEFLPPFIRKQLLLHPESDDSAQL  395



>gb|EEC80509.1| hypothetical protein OsI_22776 [Oryza sativa Indica Group]
Length=622

 Score =   617 bits (1591),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/394 (80%), Positives = 356/394 (90%), Gaps = 0/394 (0%)
 Frame = +3

Query  39    GQVKMDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRL  218
             G V MDSD+G+ RELS LQK R+ YRP+LPPCLQGTTV+VE+GDA  AAD +G H IS  
Sbjct  2     GSVAMDSDYGVPRELSALQKARALYRPDLPPCLQGTTVKVEYGDAAIAADVAGAHVISHA  61

Query  219   FPHTFGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHN  398
             FPHT+GQPLAHFLR +A VPDA +ITEHP +RVG+VF GRQSPGGHN IWGL+DA+K HN
Sbjct  62    FPHTYGQPLAHFLRKTAAVPDATVITEHPLVRVGVVFSGRQSPGGHNVIWGLHDAIKAHN  121

Query  399   PNSTllgflggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTAC  578
              NS L+GFLGG++GLFAQKTLEI+D++L++YKNQGGYD+LGRT+DQIR+TEQVNAA+TAC
Sbjct  122   ANSKLIGFLGGTDGLFAQKTLEISDEVLSSYKNQGGYDLLGRTRDQIRTTEQVNAAMTAC  181

Query  579   TSLKLDGLVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDT  758
              +LKLD LVI+GGVTSNTDAA LAE FAE+KC TKVVGVPVTLNGDLKNQFVET VGFDT
Sbjct  182   QALKLDALVIIGGVTSNTDAAQLAETFAESKCSTKVVGVPVTLNGDLKNQFVETTVGFDT  241

Query  759   ICKVNSQLISNVCTDALSAEKYYYFIRLMGRKTSHVALECTLQSHPNMVILAEEVAASKL  938
             ICKVNSQLISNVCTDALSAEKYYYF+RLMGRK SHVALEC LQSHPNMVIL EEVAASKL
Sbjct  242   ICKVNSQLISNVCTDALSAEKYYYFVRLMGRKASHVALECALQSHPNMVILGEEVAASKL  301

Query  939   TLFDITKQVCDAVQARAEQDKYHGVILLPEGLIESIPEIYALLKEIHVLLREGVSANNIS  1118
             T+FDITKQ+CDAVQARAE+DK HGV+L+PEGL+ESIPE+YALL+EIH L  +GVS  NIS
Sbjct  302   TIFDITKQICDAVQARAEKDKNHGVVLIPEGLVESIPELYALLQEIHGLHDKGVSVENIS  361

Query  1119  SQLSPWASALFEFLPPFIRRELLLYPESDDSAQL  1220
             S LSPWASALFEFLPPFIR++LLL+PESDDSAQL
Sbjct  362   SHLSPWASALFEFLPPFIRKQLLLHPESDDSAQL  395



>gb|ACN26363.1| unknown [Zea mays]
Length=616

 Score =   614 bits (1584),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/390 (81%), Positives = 355/390 (91%), Gaps = 0/390 (0%)
 Frame = +3

Query  51    MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  230
             MDSD+G+ RELS++QK R+ Y+PELPPCLQGTTVRVE+GDA  AADP+G H IS  FPHT
Sbjct  1     MDSDYGVPRELSEVQKKRTLYQPELPPCLQGTTVRVEYGDAAIAADPAGAHVISHAFPHT  60

Query  231   FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  410
             +GQP+AHFLR +A VPDA++I+EH A+RVGIVFCGRQSPGGHN +WGLY+A+K HN NS 
Sbjct  61    YGQPIAHFLRKTAVVPDAKVISEHQAVRVGIVFCGRQSPGGHNVVWGLYEAIKAHNQNSK  120

Query  411   llgflggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLK  590
             L+GFLGGS+GL AQ+TLEITD ++A+YKNQGGYDMLGRTKDQIR+TEQVN A+ +C +LK
Sbjct  121   LIGFLGGSDGLLAQRTLEITDKVIASYKNQGGYDMLGRTKDQIRTTEQVNGAMASCQALK  180

Query  591   LDGLVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICKV  770
             LD LVI+GGVTSNTDAA LAE FAEAKC TKVVGVPVTLNGDLKNQFVET VGFDTICKV
Sbjct  181   LDALVIIGGVTSNTDAAQLAETFAEAKCATKVVGVPVTLNGDLKNQFVETTVGFDTICKV  240

Query  771   NSQLISNVCTDALSAEKYYYFIRLMGRKTSHVALECTLQSHPNMVILAEEVAASKLTLFD  950
             N+QLISNVCTDALSAEKYYYFIRLMGRK SHVALEC LQSHPNMVIL EEVAASKLT+FD
Sbjct  241   NAQLISNVCTDALSAEKYYYFIRLMGRKASHVALECALQSHPNMVILGEEVAASKLTIFD  300

Query  951   ITKQVCDAVQARAEQDKYHGVILLPEGLIESIPEIYALLKEIHVLLREGVSANNISSQLS  1130
             ITKQ+CDAVQARAE+DK HGVIL+PEGL+ESIPE+YALL+EIH L  +GVS  NISSQLS
Sbjct  301   ITKQICDAVQARAEKDKNHGVILIPEGLVESIPELYALLQEIHGLHGKGVSVENISSQLS  360

Query  1131  PWASALFEFLPPFIRRELLLYPESDDSAQL  1220
             PWASALFEFLPPFIR++LLL+PESDDSAQL
Sbjct  361   PWASALFEFLPPFIRKQLLLHPESDDSAQL  390



>gb|AFW73096.1| pyrophosphate--fructose 6-phosphate 1-phosphotransferase alpha 
subunit isoform 1 [Zea mays]
 gb|AFW73097.1| pyrophosphate--fructose 6-phosphate 1-phosphotransferase alpha 
subunit isoform 2 [Zea mays]
Length=618

 Score =   614 bits (1584),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/390 (81%), Positives = 355/390 (91%), Gaps = 0/390 (0%)
 Frame = +3

Query  51    MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  230
             MDSD+G+ RELS++QK R+ Y+PELPPCLQGTTVRVE+GDA  AADP+G H IS  FPHT
Sbjct  1     MDSDYGVPRELSEVQKKRTLYQPELPPCLQGTTVRVEYGDAAIAADPAGAHVISHAFPHT  60

Query  231   FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  410
             +GQP+AHFLR +A VPDA++I+EH A+RVGIVFCGRQSPGGHN +WGLY+A+K HN NS 
Sbjct  61    YGQPIAHFLRKTAVVPDAKVISEHQAVRVGIVFCGRQSPGGHNVVWGLYEAIKAHNQNSK  120

Query  411   llgflggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLK  590
             L+GFLGGS+GL AQ+TLEITD ++A+YKNQGGYDMLGRTKDQIR+TEQVN A+ +C +LK
Sbjct  121   LIGFLGGSDGLLAQRTLEITDKVIASYKNQGGYDMLGRTKDQIRTTEQVNGAMASCQALK  180

Query  591   LDGLVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICKV  770
             LD LVI+GGVTSNTDAA LAE FAEAKC TKVVGVPVTLNGDLKNQFVET VGFDTICKV
Sbjct  181   LDALVIIGGVTSNTDAAQLAETFAEAKCATKVVGVPVTLNGDLKNQFVETTVGFDTICKV  240

Query  771   NSQLISNVCTDALSAEKYYYFIRLMGRKTSHVALECTLQSHPNMVILAEEVAASKLTLFD  950
             N+QLISNVCTDALSAEKYYYFIRLMGRK SHVALEC LQSHPNMVIL EEVAASKLT+FD
Sbjct  241   NAQLISNVCTDALSAEKYYYFIRLMGRKASHVALECALQSHPNMVILGEEVAASKLTIFD  300

Query  951   ITKQVCDAVQARAEQDKYHGVILLPEGLIESIPEIYALLKEIHVLLREGVSANNISSQLS  1130
             ITKQ+CDAVQARAE+DK HGVIL+PEGL+ESIPE+YALL+EIH L  +GVS  NISSQLS
Sbjct  301   ITKQICDAVQARAEKDKNHGVILIPEGLVESIPELYALLQEIHGLHGKGVSVENISSQLS  360

Query  1131  PWASALFEFLPPFIRRELLLYPESDDSAQL  1220
             PWASALFEFLPPFIR++LLL+PESDDSAQL
Sbjct  361   PWASALFEFLPPFIRKQLLLHPESDDSAQL  390



>dbj|BAD33246.1| putative Pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
alpha subunit [Oryza sativa Japonica Group]
Length=617

 Score =   613 bits (1581),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/390 (80%), Positives = 354/390 (91%), Gaps = 0/390 (0%)
 Frame = +3

Query  51    MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  230
             MDSD+G+ RELS LQK R+ YRP+LPPCLQGTTV+VE+GDA  AAD +G H IS  FPHT
Sbjct  1     MDSDYGVPRELSALQKARALYRPDLPPCLQGTTVKVEYGDAAIAADVAGAHVISHAFPHT  60

Query  231   FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  410
             +GQPLAHFLR +A VPDA +ITEHP +RVG+VF GRQSPGGHN IWGL+DA+K HN NS 
Sbjct  61    YGQPLAHFLRKTAAVPDATVITEHPVVRVGVVFSGRQSPGGHNVIWGLHDAIKAHNANSK  120

Query  411   llgflggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLK  590
             L+GFLGG++GLFAQKTLEI+D++L++YKNQGGYD+LGRT+DQIR+TEQVNAA+TAC +LK
Sbjct  121   LIGFLGGTDGLFAQKTLEISDEVLSSYKNQGGYDLLGRTRDQIRTTEQVNAAMTACQALK  180

Query  591   LDGLVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICKV  770
             LD LVI+GGVTSNTDAA LAE FAE+KC TKVVGVPVTLNGDLKNQFVET VGFDTICKV
Sbjct  181   LDALVIIGGVTSNTDAAQLAETFAESKCSTKVVGVPVTLNGDLKNQFVETTVGFDTICKV  240

Query  771   NSQLISNVCTDALSAEKYYYFIRLMGRKTSHVALECTLQSHPNMVILAEEVAASKLTLFD  950
             NSQLISNVCTDALSAEKYYYF+RLMGRK SHVALEC LQSHPNMVIL EEVAASKLT+FD
Sbjct  241   NSQLISNVCTDALSAEKYYYFVRLMGRKASHVALECALQSHPNMVILGEEVAASKLTIFD  300

Query  951   ITKQVCDAVQARAEQDKYHGVILLPEGLIESIPEIYALLKEIHVLLREGVSANNISSQLS  1130
             ITKQ+CDAVQARAE+DK HGV+L+PEGL+ESIPE+YALL+EIH L  +GVS  NISS LS
Sbjct  301   ITKQICDAVQARAEKDKNHGVVLIPEGLVESIPELYALLQEIHGLHDKGVSVENISSHLS  360

Query  1131  PWASALFEFLPPFIRRELLLYPESDDSAQL  1220
             PWASALFEFLPPFIR++LLL+PESDDSAQL
Sbjct  361   PWASALFEFLPPFIRKQLLLHPESDDSAQL  390



>ref|NP_001146841.1| LOC100280449 [Zea mays]
 gb|ACG23899.1| pyrophosphate--fructose 6-phosphate 1-phosphotransferase alpha 
subunit [Zea mays]
 gb|ACN28159.1| unknown [Zea mays]
 gb|AFW63610.1| Pyrophosphate--fructose 6-phosphate 1-phosphotransferase alpha 
subunit [Zea mays]
Length=616

 Score =   612 bits (1579),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/390 (80%), Positives = 354/390 (91%), Gaps = 0/390 (0%)
 Frame = +3

Query  51    MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  230
             MDSD+G+ RELS++QK R+ Y+PE+PPCLQGTTVRVE+GDA  AAD +G H IS  FPHT
Sbjct  1     MDSDYGVPRELSEVQKKRALYQPEVPPCLQGTTVRVEYGDAAIAADQAGAHVISHAFPHT  60

Query  231   FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  410
             +GQPLAHFLR +A V DA++I+EHP +RVGIVFCGRQSPGGHN +WGLY+A+K HN NS 
Sbjct  61    YGQPLAHFLRKTAVVLDAKVISEHPVVRVGIVFCGRQSPGGHNVVWGLYEAIKAHNQNSK  120

Query  411   llgflggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLK  590
             L+GFLGGS+GL AQ+TLEIT+++LA+YKNQGGYDMLGRTKDQIR+TEQVN A+ +C +LK
Sbjct  121   LIGFLGGSDGLLAQRTLEITNEVLASYKNQGGYDMLGRTKDQIRTTEQVNGAMASCQALK  180

Query  591   LDGLVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICKV  770
             LD LVI+GGVTSNTDAA LAE FAEAKC TKVVGVPVTLNGDLKNQFVET VGFDTICKV
Sbjct  181   LDALVIIGGVTSNTDAAQLAETFAEAKCATKVVGVPVTLNGDLKNQFVETTVGFDTICKV  240

Query  771   NSQLISNVCTDALSAEKYYYFIRLMGRKTSHVALECTLQSHPNMVILAEEVAASKLTLFD  950
             N+QLISNVCTDALSAEKYYYFIRLMGRK SHVALEC LQSHPNMVIL EEVAASKLT+FD
Sbjct  241   NAQLISNVCTDALSAEKYYYFIRLMGRKASHVALECALQSHPNMVILGEEVAASKLTIFD  300

Query  951   ITKQVCDAVQARAEQDKYHGVILLPEGLIESIPEIYALLKEIHVLLREGVSANNISSQLS  1130
             ITKQ+CDAVQARAE+DK HGV+L+PEGL+ESIPE+YALL+EIH L  +GVS  NISSQLS
Sbjct  301   ITKQICDAVQARAEKDKNHGVVLIPEGLVESIPELYALLQEIHGLHGKGVSVENISSQLS  360

Query  1131  PWASALFEFLPPFIRRELLLYPESDDSAQL  1220
             PWASALFEFLPPFIR++LLL+PESDDSAQL
Sbjct  361   PWASALFEFLPPFIRKQLLLHPESDDSAQL  390



>ref|XP_003589697.1| Pyrophosphate-fructose 6-phosphate 1-phosphotransferase alpha 
subunit [Medicago truncatula]
Length=596

 Score =   612 bits (1577),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/390 (82%), Positives = 342/390 (88%), Gaps = 20/390 (5%)
 Frame = +3

Query  51    MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  230
             MDSD+G+ RELSDLQKLRS Y+PELPPCLQGTTVRVEFGD TT ADP+            
Sbjct  1     MDSDYGIPRELSDLQKLRSLYQPELPPCLQGTTVRVEFGDGTTTADPAD-----------  49

Query  231   FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  410
                       A+AKVPDAQIITEHP IRVGIVF GRQSPGGHN IWGL+ ALK+HNP S 
Sbjct  50    ---------EATAKVPDAQIITEHPPIRVGIVFSGRQSPGGHNVIWGLHSALKIHNPKSV  100

Query  411   llgflggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLK  590
             LLGFLGGSEGLF+QKTLEITDDIL+TYKNQGGYD+LGRTKDQIR+TEQVNAAL  C +LK
Sbjct  101   LLGFLGGSEGLFSQKTLEITDDILSTYKNQGGYDLLGRTKDQIRTTEQVNAALATCNNLK  160

Query  591   LDGLVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICKV  770
             LDGLVI+GGVTSNTDAA LAE FA AKCPTKVVGVPVTLNGDLKNQFVETNVGFDTI KV
Sbjct  161   LDGLVIIGGVTSNTDAAQLAETFAVAKCPTKVVGVPVTLNGDLKNQFVETNVGFDTISKV  220

Query  771   NSQLISNVCTDALSAEKYYYFIRLMGRKTSHVALECTLQSHPNMVILAEEVAASKLTLFD  950
             NSQLISNVCTDALSAEKYYYFIRLMGRK SHVALECTLQSHPNMVIL EEVA SKLTLF+
Sbjct  221   NSQLISNVCTDALSAEKYYYFIRLMGRKASHVALECTLQSHPNMVILGEEVAQSKLTLFE  280

Query  951   ITKQVCDAVQARAEQDKYHGVILLPEGLIESIPEIYALLKEIHVLLREGVSANNISSQLS  1130
             I++++ DAVQAR+EQDKYHGVIL+PEGLIESIPE+YALLKEIH LLR+GV    I+SQLS
Sbjct  281   ISRKIADAVQARSEQDKYHGVILIPEGLIESIPEVYALLKEIHGLLRQGVDVEKIASQLS  340

Query  1131  PWASALFEFLPPFIRRELLLYPESDDSAQL  1220
             PWASALFEFLPPFIRR+LLLYPESDDSAQL
Sbjct  341   PWASALFEFLPPFIRRQLLLYPESDDSAQL  370



>gb|AES59948.2| pyrophosphate-fructose-6-phosphate 1-phosphotransferase [Medicago 
truncatula]
Length=597

 Score =   610 bits (1573),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/390 (82%), Positives = 342/390 (88%), Gaps = 19/390 (5%)
 Frame = +3

Query  51    MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  230
             MDSD+G+ RELSDLQKLRS Y+PELPPCLQGTTVRVEFGD TT ADP+   TI+      
Sbjct  1     MDSDYGIPRELSDLQKLRSLYQPELPPCLQGTTVRVEFGDGTTTADPADEPTIT------  54

Query  231   FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  410
                          KVPDAQIITEHP IRVGIVF GRQSPGGHN IWGL+ ALK+HNP S 
Sbjct  55    -------------KVPDAQIITEHPPIRVGIVFSGRQSPGGHNVIWGLHSALKIHNPKSV  101

Query  411   llgflggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLK  590
             LLGFLGGSEGLF+QKTLEITDDIL+TYKNQGGYD+LGRTKDQIR+TEQVNAAL  C +LK
Sbjct  102   LLGFLGGSEGLFSQKTLEITDDILSTYKNQGGYDLLGRTKDQIRTTEQVNAALATCNNLK  161

Query  591   LDGLVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICKV  770
             LDGLVI+GGVTSNTDAA LAE FA AKCPTKVVGVPVTLNGDLKNQFVETNVGFDTI KV
Sbjct  162   LDGLVIIGGVTSNTDAAQLAETFAVAKCPTKVVGVPVTLNGDLKNQFVETNVGFDTISKV  221

Query  771   NSQLISNVCTDALSAEKYYYFIRLMGRKTSHVALECTLQSHPNMVILAEEVAASKLTLFD  950
             NSQLISNVCTDALSAEKYYYFIRLMGRK SHVALECTLQSHPNMVIL EEVA SKLTLF+
Sbjct  222   NSQLISNVCTDALSAEKYYYFIRLMGRKASHVALECTLQSHPNMVILGEEVAQSKLTLFE  281

Query  951   ITKQVCDAVQARAEQDKYHGVILLPEGLIESIPEIYALLKEIHVLLREGVSANNISSQLS  1130
             I++++ DAVQAR+EQDKYHGVIL+PEGLIESIPE+YALLKEIH LLR+GV    I+SQLS
Sbjct  282   ISRKIADAVQARSEQDKYHGVILIPEGLIESIPEVYALLKEIHGLLRQGVDVEKIASQLS  341

Query  1131  PWASALFEFLPPFIRRELLLYPESDDSAQL  1220
             PWASALFEFLPPFIRR+LLLYPESDDSAQL
Sbjct  342   PWASALFEFLPPFIRRQLLLYPESDDSAQL  371



>ref|NP_001131947.1| uncharacterized protein LOC100193340 [Zea mays]
 gb|ACG24291.1| pyrophosphate--fructose 6-phosphate 1-phosphotransferase alpha 
subunit [Zea mays]
Length=618

 Score =   610 bits (1573),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/390 (80%), Positives = 353/390 (91%), Gaps = 0/390 (0%)
 Frame = +3

Query  51    MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  230
             MDSD+G+ RELS++QK R+ Y+PELPPCLQGTTVRVE+GDA  AADP+G H IS  FPHT
Sbjct  1     MDSDYGVPRELSEVQKKRTLYQPELPPCLQGTTVRVEYGDAAIAADPAGAHVISHAFPHT  60

Query  231   FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  410
             + QP+AHFLR +A VPDA++I+EH A+RVGIVFCGRQSPGGHN +WGLY+A+K HN NS 
Sbjct  61    YAQPIAHFLRKTAVVPDAKVISEHQAVRVGIVFCGRQSPGGHNVVWGLYEAIKAHNQNSK  120

Query  411   llgflggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLK  590
             L+GFLGGS+GL AQ+TLEITD ++A+YKNQGGYDMLGRTKDQIR+TEQVN A+ +C +LK
Sbjct  121   LIGFLGGSDGLLAQRTLEITDKVIASYKNQGGYDMLGRTKDQIRTTEQVNGAMASCQALK  180

Query  591   LDGLVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICKV  770
             LD LVI+GGVTSNTDAA LAE FAEAKC TKVVGVPVTLNGDLKNQFVET VGFDTICKV
Sbjct  181   LDALVIIGGVTSNTDAAQLAETFAEAKCATKVVGVPVTLNGDLKNQFVETTVGFDTICKV  240

Query  771   NSQLISNVCTDALSAEKYYYFIRLMGRKTSHVALECTLQSHPNMVILAEEVAASKLTLFD  950
             N+QLISNVCTDALSAEKYYYFIRLMGRK SHVALEC LQSHPNMVIL EEVAASKLT+FD
Sbjct  241   NAQLISNVCTDALSAEKYYYFIRLMGRKASHVALECALQSHPNMVILGEEVAASKLTIFD  300

Query  951   ITKQVCDAVQARAEQDKYHGVILLPEGLIESIPEIYALLKEIHVLLREGVSANNISSQLS  1130
             ITKQ+CDAVQARAE+DK HGVIL+PEGL+ESIPE+YALL+EIH L  +GVS  NISSQLS
Sbjct  301   ITKQICDAVQARAEKDKNHGVILIPEGLVESIPELYALLQEIHGLHGKGVSVENISSQLS  360

Query  1131  PWASALFEFLPPFIRRELLLYPESDDSAQL  1220
             PWASALFEFLPP IR++LLL+PESDDSAQL
Sbjct  361   PWASALFEFLPPLIRKQLLLHPESDDSAQL  390



>gb|KDO85265.1| hypothetical protein CISIN_1g006964mg [Citrus sinensis]
Length=588

 Score =   607 bits (1566),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/390 (82%), Positives = 344/390 (88%), Gaps = 27/390 (7%)
 Frame = +3

Query  51    MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  230
             MDSDFG+ RELS LQ+LRS Y+PELPPCLQGTTVRVEFGD+TT ADP+  H+ISR FPHT
Sbjct  1     MDSDFGIPRELSGLQQLRSLYQPELPPCLQGTTVRVEFGDSTTTADPADTHSISRSFPHT  60

Query  231   FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  410
             +GQPLAHFLRA+AKVPDAQIITEHPAIRVGIVFCGRQSPGGHN +WGLYDALK+HNP ST
Sbjct  61    YGQPLAHFLRATAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNVVWGLYDALKLHNPKST  120

Query  411   llgflggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLK  590
             LLGFLGGSEGLFAQKTLE+T +IL+TYKNQGGYDMLGRTKDQIR+TEQVNAALTAC +L 
Sbjct  121   LLGFLGGSEGLFAQKTLEVTKEILSTYKNQGGYDMLGRTKDQIRTTEQVNAALTACKNLN  180

Query  591   LDGLVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICKV  770
             LDGLVI+GGVTSNTDAAYLAE FAEAKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICKV
Sbjct  181   LDGLVIIGGVTSNTDAAYLAETFAEAKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICKV  240

Query  771   NSQLISNVCTDALSAEKYYYFIRLMGRKTSHVALECTLQSHPNMVILAEEVAASKLTLFD  950
             NSQLISNVCTDALSAEK                           VIL EEVAASKLTLFD
Sbjct  241   NSQLISNVCTDALSAEK---------------------------VILGEEVAASKLTLFD  273

Query  951   ITKQVCDAVQARAEQDKYHGVILLPEGLIESIPEIYALLKEIHVLLREGVSANNISSQLS  1130
             +TKQ+CDAVQARAEQDK HGVILLPEGLIESIPE+YALLKEIH LLR+GV  +NISSQLS
Sbjct  274   LTKQICDAVQARAEQDKNHGVILLPEGLIESIPEVYALLKEIHSLLRQGVPVDNISSQLS  333

Query  1131  PWASALFEFLPPFIRRELLLYPESDDSAQL  1220
             PWASALFEFLPPFI+++LLL PESDDSAQL
Sbjct  334   PWASALFEFLPPFIKKQLLLQPESDDSAQL  363



>ref|XP_004965353.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha-like [Setaria italica]
Length=622

 Score =   606 bits (1563),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/394 (78%), Positives = 350/394 (89%), Gaps = 0/394 (0%)
 Frame = +3

Query  39    GQVKMDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRL  218
             G V M+SD+G+ RELS LQK R+ Y+PELPPCLQGTTVRVE+GDA  AAD +G H IS+ 
Sbjct  2     GSVAMESDYGVPRELSSLQKARALYQPELPPCLQGTTVRVEYGDAAIAADVAGAHVISQA  61

Query  219   FPHTFGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHN  398
             FPHT+GQPLAHFL  +A V DA I+TEHP +RVGIVF GRQSPGGHN IWGLYDA+K HN
Sbjct  62    FPHTYGQPLAHFLGKTANVQDATIMTEHPVVRVGIVFSGRQSPGGHNVIWGLYDAIKAHN  121

Query  399   PNSTllgflggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTAC  578
             PNS L+GFLGG++GLFAQKT++I+D+ LA+YKNQGGYDMLGRT+DQIR+TEQV A L  C
Sbjct  122   PNSKLIGFLGGTDGLFAQKTMDISDEALASYKNQGGYDMLGRTRDQIRTTEQVEATLAIC  181

Query  579   TSLKLDGLVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDT  758
              +LKLD LVI+GGVTSNTDAA LAE FAE KCPTKVVGVPVTLNGDLKNQFVET VGFDT
Sbjct  182   QALKLDSLVIIGGVTSNTDAAQLAETFAELKCPTKVVGVPVTLNGDLKNQFVETTVGFDT  241

Query  759   ICKVNSQLISNVCTDALSAEKYYYFIRLMGRKTSHVALECTLQSHPNMVILAEEVAASKL  938
             ICKVNSQLISNVCTDALSAEKYYYFIR MG+K SHVALEC LQSHPNMVIL EEV+ SKL
Sbjct  242   ICKVNSQLISNVCTDALSAEKYYYFIRFMGQKASHVALECALQSHPNMVILGEEVSLSKL  301

Query  939   TLFDITKQVCDAVQARAEQDKYHGVILLPEGLIESIPEIYALLKEIHVLLREGVSANNIS  1118
             T+FDITKQ+CDAVQARAE+DKYHGV+L+PEGL+E+IPE+YALL+EIH L  +GVS  NIS
Sbjct  302   TIFDITKQICDAVQARAEKDKYHGVVLIPEGLVETIPELYALLQEIHGLHNKGVSVENIS  361

Query  1119  SQLSPWASALFEFLPPFIRRELLLYPESDDSAQL  1220
             S LSPWASALFEFLPPFIR++LLL+PESD+SAQL
Sbjct  362   SHLSPWASALFEFLPPFIRKQLLLHPESDESAQL  395



>dbj|BAK04583.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=622

 Score =   601 bits (1550),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/394 (78%), Positives = 348/394 (88%), Gaps = 0/394 (0%)
 Frame = +3

Query  39    GQVKMDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRL  218
             G V MDSD+G  RELS LQK R+ YRPELPPCLQGT VRVE GDA  AAD +  H I   
Sbjct  2     GSVAMDSDYGATRELSPLQKERALYRPELPPCLQGTAVRVEHGDAAIAADGADAHVIGHA  61

Query  219   FPHTFGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHN  398
             FPHT+GQPLAHFL  +A  PDA +IT+HPA+RVG+VF GRQSPGGHN IWGL++A+  HN
Sbjct  62    FPHTYGQPLAHFLPKTANAPDATVITKHPAVRVGVVFSGRQSPGGHNVIWGLHNAINSHN  121

Query  399   PNSTllgflggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTAC  578
             P+S L+GFLGG++GLFAQKTLEITD++L++YKNQGGYDMLGRT+DQIR+TEQV AA+T C
Sbjct  122   PSSKLIGFLGGTDGLFAQKTLEITDEVLSSYKNQGGYDMLGRTRDQIRTTEQVKAAMTTC  181

Query  579   TSLKLDGLVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDT  758
              +LKLD LVIVGGVTSNTDAA LAE FAE+KC TKVVGVPVTLNGDLKNQFVET VGFDT
Sbjct  182   QALKLDALVIVGGVTSNTDAAQLAETFAESKCLTKVVGVPVTLNGDLKNQFVETTVGFDT  241

Query  759   ICKVNSQLISNVCTDALSAEKYYYFIRLMGRKTSHVALECTLQSHPNMVILAEEVAASKL  938
             ICKVNSQLISNVCTDALSAEKYYYFIRLMGRK SHVALEC LQSHPNMV+L EEVAASKL
Sbjct  242   ICKVNSQLISNVCTDALSAEKYYYFIRLMGRKASHVALECALQSHPNMVLLGEEVAASKL  301

Query  939   TLFDITKQVCDAVQARAEQDKYHGVILLPEGLIESIPEIYALLKEIHVLLREGVSANNIS  1118
             T+ DITKQ+CDAVQARAE+DKYHGV+L+PEGL+ESIPE+YALL+EIH L  +GVS  NIS
Sbjct  302   TISDITKQICDAVQARAEKDKYHGVVLIPEGLVESIPELYALLQEIHGLHDKGVSVENIS  361

Query  1119  SQLSPWASALFEFLPPFIRRELLLYPESDDSAQL  1220
             S LSPWASALF+FLPPFIR++LLL+PESDDSAQL
Sbjct  362   SHLSPWASALFDFLPPFIRKQLLLHPESDDSAQL  395



>gb|AEZ53899.1| pyrophosphate-dependent fructose-6-phosphate 1-phosphotransferase 
alpha subunit short variant, partial [Zea mays]
 gb|AEZ53900.1| pyrophosphate-dependent fructose-6-phosphate 1-phosphotransferase 
alpha subunit short variant [Zea mays]
Length=587

 Score =   593 bits (1528),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/394 (76%), Positives = 339/394 (86%), Gaps = 0/394 (0%)
 Frame = +3

Query  39    GQVKMDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRL  218
             G V MD+D+G  RELS LQK R+ YRPE PPCLQG TV VE+GDA  AAD +G H IS  
Sbjct  2     GSVAMDADYGAPRELSPLQKARALYRPETPPCLQGPTVSVEYGDAAIAADVAGAHVISHA  61

Query  219   FPHTFGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHN  398
             FPHT+GQPL HFL  +A V DA I+TEHP +R+G+VF GRQSPGGHN IWGLYD +K HN
Sbjct  62    FPHTYGQPLVHFLTKTANVHDATIVTEHPVVRIGVVFSGRQSPGGHNVIWGLYDVVKAHN  121

Query  399   PNSTllgflggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTAC  578
              NS ++GFLGG++GLFAQKT+EITD+ L +YKNQGGYDMLGRT+DQIR+TEQV A +  C
Sbjct  122   SNSKIIGFLGGTDGLFAQKTIEITDEALPSYKNQGGYDMLGRTRDQIRTTEQVKATIGTC  181

Query  579   TSLKLDGLVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDT  758
              +LKLD LVI+GGVTSNTDAA LAE FA+ KCPTKVVGVPVTLNGDLKNQFVET VGFDT
Sbjct  182   QALKLDALVIIGGVTSNTDAAQLAETFAQLKCPTKVVGVPVTLNGDLKNQFVETTVGFDT  241

Query  759   ICKVNSQLISNVCTDALSAEKYYYFIRLMGRKTSHVALECTLQSHPNMVILAEEVAASKL  938
             ICKVNSQLISN C DALSAEKYYYFIR+MGRK SHVALEC LQSHPNMVIL EEV+ SKL
Sbjct  242   ICKVNSQLISNACIDALSAEKYYYFIRMMGRKASHVALECALQSHPNMVILGEEVSVSKL  301

Query  939   TLFDITKQVCDAVQARAEQDKYHGVILLPEGLIESIPEIYALLKEIHVLLREGVSANNIS  1118
             T+FDITKQ+CDAVQARAE+DKYHGV+L+PEGL+ESIPE+YALL+EIH L  +GVS  NIS
Sbjct  302   TIFDITKQICDAVQARAEKDKYHGVVLIPEGLVESIPELYALLQEIHGLHNKGVSVENIS  361

Query  1119  SQLSPWASALFEFLPPFIRRELLLYPESDDSAQL  1220
             S LSPWASALFEFLPPFIR++LLL+P SDDSAQL
Sbjct  362   SHLSPWASALFEFLPPFIRKQLLLHPGSDDSAQL  395



>ref|XP_008659507.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha [Zea mays]
Length=622

 Score =   592 bits (1525),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/394 (76%), Positives = 339/394 (86%), Gaps = 0/394 (0%)
 Frame = +3

Query  39    GQVKMDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRL  218
             G V MD+D+G  RELS LQK R+ YRPE PPCLQG TV VE+GDA  AAD +G H IS  
Sbjct  2     GSVAMDADYGAPRELSPLQKARALYRPETPPCLQGPTVSVEYGDAAIAADVAGAHVISHA  61

Query  219   FPHTFGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHN  398
             FPHT+GQPL HFL  +A V DA I+TEHP +R+G+VF GRQSPGGHN IWGLYD +K HN
Sbjct  62    FPHTYGQPLVHFLTKTANVHDATIVTEHPVVRIGVVFSGRQSPGGHNVIWGLYDVVKAHN  121

Query  399   PNSTllgflggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTAC  578
              NS ++GFLGG++GLFAQKT+EITD+ L +YKNQGGYDMLGRT+DQIR+TEQV A +  C
Sbjct  122   SNSKIIGFLGGTDGLFAQKTIEITDEALPSYKNQGGYDMLGRTRDQIRTTEQVKATIGTC  181

Query  579   TSLKLDGLVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDT  758
              +LKLD LVI+GGVTSNTDAA LAE FA+ KCPTKVVGVPVTLNGDLKNQFVET VGFDT
Sbjct  182   QALKLDALVIIGGVTSNTDAAQLAETFAQLKCPTKVVGVPVTLNGDLKNQFVETTVGFDT  241

Query  759   ICKVNSQLISNVCTDALSAEKYYYFIRLMGRKTSHVALECTLQSHPNMVILAEEVAASKL  938
             ICKVNSQLISN C DALSAEKYYYFIR+MGRK SHVALEC LQSHPNMVIL EEV+ SKL
Sbjct  242   ICKVNSQLISNACIDALSAEKYYYFIRMMGRKASHVALECALQSHPNMVILGEEVSVSKL  301

Query  939   TLFDITKQVCDAVQARAEQDKYHGVILLPEGLIESIPEIYALLKEIHVLLREGVSANNIS  1118
             T+FDITKQ+CDAVQARAE+DKYHGV+L+PEGL+ESIPE+YALL+EIH L  +GVS  NIS
Sbjct  302   TIFDITKQICDAVQARAEKDKYHGVVLIPEGLVESIPELYALLQEIHGLHNKGVSVENIS  361

Query  1119  SQLSPWASALFEFLPPFIRRELLLYPESDDSAQL  1220
             S LSPWASALFEFLPPFIR++LLL+P SDDSAQL
Sbjct  362   SHLSPWASALFEFLPPFIRKQLLLHPGSDDSAQL  395



>ref|XP_003563894.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha-like [Brachypodium distachyon]
Length=626

 Score =   590 bits (1520),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/397 (76%), Positives = 343/397 (86%), Gaps = 3/397 (1%)
 Frame = +3

Query  39    GQVKMDSDFGLARELSDLQKLRSQYRPELPPCL---QGTTVRVEFGDATTAADPSGGHTI  209
             G   ++SD+G  RELS LQK R+ YRPELPPCL   QGT VRVE+GDAT AAD +  H I
Sbjct  2     GSTAVNSDYGATRELSALQKERALYRPELPPCLHGNQGTAVRVEYGDATIAADGADAHVI  61

Query  210   SRLFPHTFGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALK  389
                FPHT+GQPLAHFL  +A   DA IITEHP +RVG+VF GRQSPGGHN IWGL+DAL 
Sbjct  62    GNAFPHTYGQPLAHFLPEAANAADAAIITEHPVVRVGVVFSGRQSPGGHNVIWGLHDALS  121

Query  390   VHNPNSTllgflggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAAL  569
              HNP+S L+GFLGG++GLFAQKTLEIT+++L++YKNQGGYDM+GRT+DQIR+TEQV AA+
Sbjct  122   AHNPSSKLIGFLGGTDGLFAQKTLEITEEVLSSYKNQGGYDMIGRTRDQIRTTEQVKAAM  181

Query  570   TACTSLKLDGLVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVG  749
             T C +L LD LVI+GGVTSNTDAA LAE FAE+KC TK+VGVPVTLNGDLKNQFVET VG
Sbjct  182   TTCQTLMLDALVIIGGVTSNTDAAQLAETFAESKCSTKIVGVPVTLNGDLKNQFVETTVG  241

Query  750   FDTICKVNSQLISNVCTDALSAEKYYYFIRLMGRKTSHVALECTLQSHPNMVILAEEVAA  929
             FDTICKVNSQLISN+CTDALSAEKYYYFIRLMGRK SHVALEC L+SHPNMVIL EEVAA
Sbjct  242   FDTICKVNSQLISNICTDALSAEKYYYFIRLMGRKASHVALECALESHPNMVILGEEVAA  301

Query  930   SKLTLFDITKQVCDAVQARAEQDKYHGVILLPEGLIESIPEIYALLKEIHVLLREGVSAN  1109
             SKLT+ DITKQ+CDAVQARAE DKYHGV+L+PEGL+ESIPE+YALL+EIH L  +GVS  
Sbjct  302   SKLTISDITKQICDAVQARAENDKYHGVMLIPEGLVESIPELYALLQEIHGLHDKGVSVE  361

Query  1110  NISSQLSPWASALFEFLPPFIRRELLLYPESDDSAQL  1220
             +ISS LSPWASALF FLP FIR++LLL+PESDDSAQL
Sbjct  362   SISSHLSPWASALFNFLPQFIRKQLLLHPESDDSAQL  398



>emb|CDY33660.1| BnaC08g19600D [Brassica napus]
Length=598

 Score =   581 bits (1497),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/390 (79%), Positives = 333/390 (85%), Gaps = 21/390 (5%)
 Frame = +3

Query  51    MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  230
             MDSDFG+ RELS LQ+LRSQY+PELPPCLQGTTVRVE GD TT ++ S  H I+R FPHT
Sbjct  1     MDSDFGIPRELSPLQQLRSQYQPELPPCLQGTTVRVELGDGTTVSEASDSHIIARAFPHT  60

Query  231   FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  410
              GQPLAHFLR +AKV DA IIT+ P+IRVGIVFCGRQ+PGGHN IWGLY+ALKVHN  ST
Sbjct  61    LGQPLAHFLRETAKVSDAHIITQLPSIRVGIVFCGRQAPGGHNVIWGLYEALKVHNAKST  120

Query  411   llgflggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLK  590
             LLGFLGGSEGLFAQKTLEITDDIL TYKNQGGYD+LGRTKDQIR+TEQVNAAL ACT LK
Sbjct  121   LLGFLGGSEGLFAQKTLEITDDILQTYKNQGGYDLLGRTKDQIRTTEQVNAALKACTDLK  180

Query  591   LDGLVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICKV  770
             LDGLVI+GGVTSNTDAA+LAE FAEAKC TKVVGVPVT NGDLKNQFVE NVGFDTICKV
Sbjct  181   LDGLVIIGGVTSNTDAAHLAEFFAEAKCSTKVVGVPVTTNGDLKNQFVEANVGFDTICKV  240

Query  771   NSQLISNVCTDALSAEKYYYFIRLMGRKTSHVALECTLQSHPNMVILAEEVAASKLTLFD  950
             NSQLISN CTDALSAEKYYYFIRLMGRK SHVALECTLQSHPNMVIL EEVAASKLT+FD
Sbjct  241   NSQLISNACTDALSAEKYYYFIRLMGRKHSHVALECTLQSHPNMVILGEEVAASKLTIFD  300

Query  951   ITKQVCDAVQARAEQDKYHGVILLPEGLIESIPEIYALLKEIHVLLREGVSANNISSQLS  1130
             I+KQ+CDAVQARA QDK HGVIL+PEG+IESIPE+YALLKEIH LLRE            
Sbjct  301   ISKQICDAVQARAGQDKNHGVILIPEGIIESIPEVYALLKEIHGLLRE------------  348

Query  1131  PWASALFEFLPPFIRRELLLYPESDDSAQL  1220
                + +  F        LLL+PESDDSAQL
Sbjct  349   --ETGMRLFF-------LLLHPESDDSAQL  369



>emb|CDX96611.1| BnaA08g21540D [Brassica napus]
Length=598

 Score =   577 bits (1487),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/390 (79%), Positives = 330/390 (85%), Gaps = 21/390 (5%)
 Frame = +3

Query  51    MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  230
             MDSDFG+ RELS LQ+LRS Y+PELPPCLQGTTVRVE GD TT ++ S  H I+R FPHT
Sbjct  1     MDSDFGIPRELSPLQQLRSHYQPELPPCLQGTTVRVELGDGTTVSEASDSHIIARAFPHT  60

Query  231   FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  410
              GQPLAHFLR + KV DA IIT+ P+IRVGIVFCGRQ+PGGHN IWGLY+ALKVHN  ST
Sbjct  61    LGQPLAHFLRETTKVSDAHIITQLPSIRVGIVFCGRQAPGGHNVIWGLYEALKVHNAKST  120

Query  411   llgflggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLK  590
             LLGFLGGSEGLFAQKTLEITDDIL TYKNQGGYD+LGRTKDQIR+TEQVNAAL ACT LK
Sbjct  121   LLGFLGGSEGLFAQKTLEITDDILQTYKNQGGYDLLGRTKDQIRTTEQVNAALKACTDLK  180

Query  591   LDGLVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICKV  770
             LDGLVI+GGVTSNTDAA+LAE FAEAKC TKVVGVPVT NGDLKNQFVE NVGFDTICKV
Sbjct  181   LDGLVIIGGVTSNTDAAHLAEFFAEAKCSTKVVGVPVTTNGDLKNQFVEANVGFDTICKV  240

Query  771   NSQLISNVCTDALSAEKYYYFIRLMGRKTSHVALECTLQSHPNMVILAEEVAASKLTLFD  950
             NSQLISN CTDALSAEKYYYFIRLMGRK SHVALECTLQSHPNMVIL EEVAASKLT+FD
Sbjct  241   NSQLISNACTDALSAEKYYYFIRLMGRKHSHVALECTLQSHPNMVILGEEVAASKLTIFD  300

Query  951   ITKQVCDAVQARAEQDKYHGVILLPEGLIESIPEIYALLKEIHVLLREGVSANNISSQLS  1130
             I+KQ+CDAVQARA QDK HGVIL+PEG+IESIPE+YALLKEIH LLRE            
Sbjct  301   ISKQICDAVQARAGQDKNHGVILIPEGIIESIPEVYALLKEIHGLLREETGMR-------  353

Query  1131  PWASALFEFLPPFIRRELLLYPESDDSAQL  1220
                  LF          LLL+PESDDSAQL
Sbjct  354   ----LLF----------LLLHPESDDSAQL  369



>ref|XP_009385723.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha {ECO:0000255|HAMAP-Rule:MF_03185}-like 
[Musa acuminata subsp. malaccensis]
Length=623

 Score =   556 bits (1433),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/387 (74%), Positives = 326/387 (84%), Gaps = 0/387 (0%)
 Frame = +3

Query  60    DFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHTFGQ  239
             +FG   E S LQK RS Y P+LPPCLQG+ V+VEFGDATT  DP    +I R FP T+GQ
Sbjct  2     EFGAGIEFSTLQKQRSLYVPQLPPCLQGSHVQVEFGDATTVPDPLDAESIKRSFPLTYGQ  61

Query  240   PLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNSTllg  419
             PL HF+ +  K P   +  + P +RVG+VFCGRQSPGGHN I GLYDA+K+HNP STLLG
Sbjct  62    PLVHFVSSLEKPPPNGVQDQQPPLRVGVVFCGRQSPGGHNIICGLYDAMKLHNPKSTLLG  121

Query  420   flggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLKLDG  599
             F GG+EGLF QKTL I+DDI+A Y+NQGGYDMLGRTKDQI S EQVN+AL AC +L L+G
Sbjct  122   FCGGTEGLFVQKTLVISDDIVAAYRNQGGYDMLGRTKDQITSKEQVNSALNACQTLDLNG  181

Query  600   LVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICKVNSQ  779
             LV++GGVTSNTDAA LAE FAEAKC TKVVGVPVT  GDL+NQFVE NVGFDTICKVNSQ
Sbjct  182   LVVIGGVTSNTDAAQLAETFAEAKCLTKVVGVPVTFYGDLQNQFVEANVGFDTICKVNSQ  241

Query  780   LISNVCTDALSAEKYYYFIRLMGRKTSHVALECTLQSHPNMVILAEEVAASKLTLFDITK  959
             LISN+CTDALSAEKYYYFIRLMGR  SHV LEC+LQSHPNMVIL EEVA+SKLTL DITK
Sbjct  242   LISNICTDALSAEKYYYFIRLMGRSASHVTLECSLQSHPNMVILGEEVASSKLTLHDITK  301

Query  960   QVCDAVQARAEQDKYHGVILLPEGLIESIPEIYALLKEIHVLLREGVSANNISSQLSPWA  1139
             ++C+AVQ+RAE+ KYHGVILLPEGL+ESIPE+YALL+EIHVLL+ GVS  +IS QLSPWA
Sbjct  302   RICNAVQSRAEKGKYHGVILLPEGLVESIPEVYALLQEIHVLLKNGVSTESISGQLSPWA  361

Query  1140  SALFEFLPPFIRRELLLYPESDDSAQL  1220
             SALFE +PPFI+++LLL PESD SAQL
Sbjct  362   SALFESMPPFIKKQLLLSPESDQSAQL  388



>ref|XP_011621223.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha [Amborella trichopoda]
Length=603

 Score =   554 bits (1427),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/381 (76%), Positives = 325/381 (85%), Gaps = 2/381 (1%)
 Frame = +3

Query  78    ELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHTFGQPLAHFL  257
             EL  LQK RS Y PELPPCLQ + VRVEF DAT  ++P    +I R FP T+GQPL HFL
Sbjct  2     ELEGLQKHRSLYIPELPPCLQESRVRVEFADATITSNPL--DSIGRSFPLTYGQPLLHFL  59

Query  258   RASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNSTllgflggse  437
               S  V DA ++ E   IRVG+VFCGRQSPGGHN I GL++A+K+HNP STLLGF+GGSE
Sbjct  60    AESDNVIDAHVVQELTPIRVGVVFCGRQSPGGHNVICGLHEAIKIHNPKSTLLGFVGGSE  119

Query  438   glfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLKLDGLVIVGG  617
             GLFAQKTLEIT D+++ Y+NQGGYDMLGRTKDQIR+ EQVNAALT C +LKLDGLVI+GG
Sbjct  120   GLFAQKTLEITKDVVSAYRNQGGYDMLGRTKDQIRTNEQVNAALTTCQALKLDGLVIIGG  179

Query  618   VTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICKVNSQLISNVC  797
             VTSNTDAA LAE FAEAKC TKV+GVPVTL GDLKNQFVE +VGFDTICKVNSQLISN+C
Sbjct  180   VTSNTDAAQLAETFAEAKCQTKVIGVPVTLYGDLKNQFVEADVGFDTICKVNSQLISNIC  239

Query  798   TDALSAEKYYYFIRLMGRKTSHVALECTLQSHPNMVILAEEVAASKLTLFDITKQVCDAV  977
             TDALSAEKYYYFIRLMG   SHVALEC LQS PNMVIL EEVA+SKLTLFD+TK++CDAV
Sbjct  240   TDALSAEKYYYFIRLMGSSASHVALECALQSQPNMVILGEEVASSKLTLFDVTKRICDAV  299

Query  978   QARAEQDKYHGVILLPEGLIESIPEIYALLKEIHVLLREGVSANNISSQLSPWASALFEF  1157
             QARAEQDKYHGVILLPEGLIESIPEI+ALL+EI  L   GVS +NISS LSPWASALFEF
Sbjct  300   QARAEQDKYHGVILLPEGLIESIPEIHALLQEIRGLHSRGVSVDNISSLLSPWASALFEF  359

Query  1158  LPPFIRRELLLYPESDDSAQL  1220
             LPPFI+++LLL P SD+SAQL
Sbjct  360   LPPFIKKQLLLSPASDNSAQL  380



>ref|XP_004956505.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha-like isoform X1 [Setaria italica]
Length=620

 Score =   539 bits (1389),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/390 (69%), Positives = 326/390 (84%), Gaps = 0/390 (0%)
 Frame = +3

Query  51    MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  230
             M++D G  REL+ LQ+ R+ Y+PELPPCLQGT VRVEFGD+TT+ DP     ++++FP T
Sbjct  1     MNADQGSPRELTGLQRRRALYQPELPPCLQGTRVRVEFGDSTTSIDPKCADIVAQVFPQT  60

Query  231   FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  410
             FGQ L HFL  ++KV DAQ+I EHP IRVG++F GRQSPGGHN IWG YDA+K  NP++ 
Sbjct  61    FGQKLVHFLEPNSKVSDAQVIKEHPPIRVGVLFSGRQSPGGHNVIWGTYDAMKAQNPHNV  120

Query  411   llgflggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLK  590
             LLGF+GG+EGLFA+K LEITDD+L++YKNQGG+D+LGRT DQIR+TEQVNAA++ C  L 
Sbjct  121   LLGFIGGTEGLFAKKMLEITDDVLSSYKNQGGFDLLGRTVDQIRTTEQVNAAMSTCCDLS  180

Query  591   LDGLVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICKV  770
             LDGL+I+GGVTSN+DAA LAE FA+  C TKV+GVPVTL+GDLKNQFVET VGFDT+CKV
Sbjct  181   LDGLIIIGGVTSNSDAAQLAETFAKHNCNTKVIGVPVTLSGDLKNQFVETTVGFDTVCKV  240

Query  771   NSQLISNVCTDALSAEKYYYFIRLMGRKTSHVALECTLQSHPNMVILAEEVAASKLTLFD  950
             NSQLISNVC DA+SA KYYYF+RLMG K SHVA EC LQSHPNMVIL EEVA SKLTL +
Sbjct  241   NSQLISNVCLDAVSAGKYYYFVRLMGGKASHVAFECALQSHPNMVILGEEVALSKLTLME  300

Query  951   ITKQVCDAVQARAEQDKYHGVILLPEGLIESIPEIYALLKEIHVLLREGVSANNISSQLS  1130
             I  ++CD V+ARA + KYHGV+L+PEGLIESIPE+YAL++EI+ L    V  + I SQLS
Sbjct  301   IINKICDGVEARAARGKYHGVLLIPEGLIESIPEMYALIQEINNLYINNVPEDEIPSQLS  360

Query  1131  PWASALFEFLPPFIRRELLLYPESDDSAQL  1220
             PWA+ALF+FLP FIRREL+L+ ESD+SAQL
Sbjct  361   PWAAALFKFLPSFIRRELVLHQESDNSAQL  390



>tpg|DAA49241.1| TPA: hypothetical protein ZEAMMB73_624432 [Zea mays]
Length=488

 Score =   526 bits (1355),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/391 (68%), Positives = 320/391 (82%), Gaps = 4/391 (1%)
 Frame = +3

Query  51    MDSDFGLARELSD-LQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPH  227
             M++DFG  +EL+  LQ+ R+ Y+P LPPCLQG TVR E+GDATT  DP+    +++ FPH
Sbjct  1     MNADFGAPKELAGGLQQRRALYQPRLPPCLQGPTVRAEYGDATTTIDPTCAQAVAQAFPH  60

Query  228   TFGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNS  407
             TFGQPL  F+  +A     +    HP IRVG+VF GRQSPGGHN +WGL+DALK +NP S
Sbjct  61    TFGQPLVSFVAPAAGAGAVE--ERHP-IRVGVVFSGRQSPGGHNVVWGLHDALKAYNPQS  117

Query  408   TllgflggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSL  587
              L GF+GG+EGLFA KTLEITDD+LA+YKNQGG+D+LGR+ DQIR+T+QVNAA+T C SL
Sbjct  118   LLYGFVGGTEGLFANKTLEITDDVLASYKNQGGFDLLGRSIDQIRTTKQVNAAMTTCHSL  177

Query  588   KLDGLVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICK  767
              LDGLVI+GGVTSN+DAA LAE   +  C TKVVGVPV+LNGDLKNQFVET VGFDT+CK
Sbjct  178   NLDGLVIIGGVTSNSDAAQLAETLIQNNCKTKVVGVPVSLNGDLKNQFVETTVGFDTVCK  237

Query  768   VNSQLISNVCTDALSAEKYYYFIRLMGRKTSHVALECTLQSHPNMVILAEEVAASKLTLF  947
             VNSQL+SNVC DA+SA KYYYF+RLMGRK SHVA EC LQSHPNM+IL EEVA SKLTL 
Sbjct  238   VNSQLVSNVCLDAISAGKYYYFVRLMGRKASHVAFECALQSHPNMLILGEEVALSKLTLM  297

Query  948   DITKQVCDAVQARAEQDKYHGVILLPEGLIESIPEIYALLKEIHVLLREGVSANNISSQL  1127
             +I  ++CD VQARAE  KYHGV+++PEGLIESIPE+YAL++EI++L    V    +SSQL
Sbjct  298   EIISKICDGVQARAELGKYHGVLVIPEGLIESIPEMYALIQEINILHNSNVPVAEMSSQL  357

Query  1128  SPWASALFEFLPPFIRRELLLYPESDDSAQL  1220
             SPWA+ALF+FLPPFIRRELLL+ ESD+SAQL
Sbjct  358   SPWAAALFQFLPPFIRRELLLHQESDNSAQL  388



>gb|ACL53065.1| unknown [Zea mays]
 gb|ACN27719.1| unknown [Zea mays]
 tpg|DAA49242.1| TPA: hypothetical protein ZEAMMB73_624432 [Zea mays]
Length=618

 Score =   526 bits (1355),  Expect = 2e-179, Method: Compositional matrix adjust.
 Identities = 266/391 (68%), Positives = 320/391 (82%), Gaps = 4/391 (1%)
 Frame = +3

Query  51    MDSDFGLARELSD-LQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPH  227
             M++DFG  +EL+  LQ+ R+ Y+P LPPCLQG TVR E+GDATT  DP+    +++ FPH
Sbjct  1     MNADFGAPKELAGGLQQRRALYQPRLPPCLQGPTVRAEYGDATTTIDPTCAQAVAQAFPH  60

Query  228   TFGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNS  407
             TFGQPL  F+  +A     +    HP IRVG+VF GRQSPGGHN +WGL+DALK +NP S
Sbjct  61    TFGQPLVSFVAPAAGAGAVE--ERHP-IRVGVVFSGRQSPGGHNVVWGLHDALKAYNPQS  117

Query  408   TllgflggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSL  587
              L GF+GG+EGLFA KTLEITDD+LA+YKNQGG+D+LGR+ DQIR+T+QVNAA+T C SL
Sbjct  118   LLYGFVGGTEGLFANKTLEITDDVLASYKNQGGFDLLGRSIDQIRTTKQVNAAMTTCHSL  177

Query  588   KLDGLVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICK  767
              LDGLVI+GGVTSN+DAA LAE   +  C TKVVGVPV+LNGDLKNQFVET VGFDT+CK
Sbjct  178   NLDGLVIIGGVTSNSDAAQLAETLIQNNCKTKVVGVPVSLNGDLKNQFVETTVGFDTVCK  237

Query  768   VNSQLISNVCTDALSAEKYYYFIRLMGRKTSHVALECTLQSHPNMVILAEEVAASKLTLF  947
             VNSQL+SNVC DA+SA KYYYF+RLMGRK SHVA EC LQSHPNM+IL EEVA SKLTL 
Sbjct  238   VNSQLVSNVCLDAISAGKYYYFVRLMGRKASHVAFECALQSHPNMLILGEEVALSKLTLM  297

Query  948   DITKQVCDAVQARAEQDKYHGVILLPEGLIESIPEIYALLKEIHVLLREGVSANNISSQL  1127
             +I  ++CD VQARAE  KYHGV+++PEGLIESIPE+YAL++EI++L    V    +SSQL
Sbjct  298   EIISKICDGVQARAELGKYHGVLVIPEGLIESIPEMYALIQEINILHNSNVPVAEMSSQL  357

Query  1128  SPWASALFEFLPPFIRRELLLYPESDDSAQL  1220
             SPWA+ALF+FLPPFIRRELLL+ ESD+SAQL
Sbjct  358   SPWAAALFQFLPPFIRRELLLHQESDNSAQL  388



>ref|NP_001061602.1| Os08g0345700 [Oryza sativa Japonica Group]
 dbj|BAC75438.1| putative pyrophosphate-dependent phosphofructokinase alpha subunit 
[Oryza sativa Japonica Group]
 dbj|BAF23516.1| Os08g0345700 [Oryza sativa Japonica Group]
 dbj|BAG94900.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG94364.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC83431.1| hypothetical protein OsI_28900 [Oryza sativa Indica Group]
 gb|EEE68536.1| hypothetical protein OsJ_26990 [Oryza sativa Japonica Group]
Length=617

 Score =   525 bits (1353),  Expect = 4e-179, Method: Compositional matrix adjust.
 Identities = 266/391 (68%), Positives = 324/391 (83%), Gaps = 5/391 (1%)
 Frame = +3

Query  51    MDSDFGLARELSD-LQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPH  227
             M++DFG  ++L+  LQ+ RS Y+P LPPCLQG TV+VE+GDATT  DP+  + +++ FP 
Sbjct  1     MNADFGAPKDLAGGLQQRRSLYQPTLPPCLQGATVKVEYGDATTTIDPTCANVVAQAFPR  60

Query  228   TFGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNS  407
             T+GQPL  F+   A  PDA +  +   IRVG+VF GRQSPGGHN IWGL+DALK +NP+S
Sbjct  61    TYGQPLVSFV---APPPDA-VDKDRAPIRVGVVFSGRQSPGGHNVIWGLHDALKAYNPHS  116

Query  408   TllgflggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSL  587
              L GF+GG+EGLFA KT+EITDD+LA+YKNQGG+D+LGR+ DQIRST+QVNAA+T C +L
Sbjct  117   VLYGFVGGTEGLFANKTIEITDDVLASYKNQGGFDLLGRSIDQIRSTKQVNAAMTTCNNL  176

Query  588   KLDGLVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICK  767
              LDGLVI+GGVTSN+DAA LAEA  +  C TKVVGVPV+LNGDLKNQFVET VGFDT+CK
Sbjct  177   NLDGLVIIGGVTSNSDAAQLAEALVQNNCKTKVVGVPVSLNGDLKNQFVETTVGFDTVCK  236

Query  768   VNSQLISNVCTDALSAEKYYYFIRLMGRKTSHVALECTLQSHPNMVILAEEVAASKLTLF  947
             VNSQL+SNVC DA+SA KYYYF+RLMGRK SHVA EC LQSHPNM+ILAEEVA SKLTL 
Sbjct  237   VNSQLVSNVCLDAISAGKYYYFVRLMGRKASHVAFECALQSHPNMLILAEEVALSKLTLM  296

Query  948   DITKQVCDAVQARAEQDKYHGVILLPEGLIESIPEIYALLKEIHVLLREGVSANNISSQL  1127
             ++  ++CD VQARAE  K+HGV+L+PEGLIESIPE+YALL+EI++L    V    + SQL
Sbjct  297   EVINKICDGVQARAELGKFHGVLLIPEGLIESIPEMYALLQEINILHNNNVPVAEMPSQL  356

Query  1128  SPWASALFEFLPPFIRRELLLYPESDDSAQL  1220
             SPWA+ALF+FLPPFIRRELLL+ ESD+SAQL
Sbjct  357   SPWAAALFQFLPPFIRRELLLHQESDNSAQL  387



>ref|NP_001130747.1| uncharacterized protein LOC100191851 [Zea mays]
 gb|ACF79089.1| unknown [Zea mays]
Length=618

 Score =   525 bits (1353),  Expect = 4e-179, Method: Compositional matrix adjust.
 Identities = 266/391 (68%), Positives = 320/391 (82%), Gaps = 4/391 (1%)
 Frame = +3

Query  51    MDSDFGLARELSD-LQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPH  227
             M++DFG  +EL+  LQ+ R+ Y+P LPPCLQG TVR E+GDATT  DP+    +++ FPH
Sbjct  1     MNADFGAPKELAGGLQQRRALYQPRLPPCLQGPTVRAEYGDATTTIDPTCAQAVAQPFPH  60

Query  228   TFGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNS  407
             TFGQPL  F+  +A     +    HP IRVG+VF GRQSPGGHN +WGL+DALK +NP S
Sbjct  61    TFGQPLVSFVAPAAGAGAVE--ERHP-IRVGVVFSGRQSPGGHNVVWGLHDALKAYNPQS  117

Query  408   TllgflggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSL  587
              L GF+GG+EGLFA KTLEITDD+LA+YKNQGG+D+LGR+ DQIR+T+QVNAA+T C SL
Sbjct  118   LLYGFVGGTEGLFANKTLEITDDVLASYKNQGGFDLLGRSIDQIRTTKQVNAAMTTCHSL  177

Query  588   KLDGLVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICK  767
              LDGLVI+GGVTSN+DAA LAE   +  C TKVVGVPV+LNGDLKNQFVET VGFDT+CK
Sbjct  178   NLDGLVIIGGVTSNSDAAQLAETLIQNNCKTKVVGVPVSLNGDLKNQFVETTVGFDTVCK  237

Query  768   VNSQLISNVCTDALSAEKYYYFIRLMGRKTSHVALECTLQSHPNMVILAEEVAASKLTLF  947
             VNSQL+SNVC DA+SA KYYYF+RLMGRK SHVA EC LQSHPNM+IL EEVA SKLTL 
Sbjct  238   VNSQLVSNVCLDAISAGKYYYFVRLMGRKASHVAFECALQSHPNMLILGEEVALSKLTLM  297

Query  948   DITKQVCDAVQARAEQDKYHGVILLPEGLIESIPEIYALLKEIHVLLREGVSANNISSQL  1127
             +I  ++CD VQARAE  KYHGV+++PEGLIESIPE+YAL++EI++L    V    +SSQL
Sbjct  298   EIISKICDGVQARAELGKYHGVLVIPEGLIESIPEMYALIQEINILHNSNVPVAEMSSQL  357

Query  1128  SPWASALFEFLPPFIRRELLLYPESDDSAQL  1220
             SPWA+ALF+FLPPFIRRELLL+ ESD+SAQL
Sbjct  358   SPWAAALFQFLPPFIRRELLLHQESDNSAQL  388



>ref|XP_006660512.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha-like [Oryza brachyantha]
Length=620

 Score =   525 bits (1351),  Expect = 1e-178, Method: Compositional matrix adjust.
 Identities = 266/392 (68%), Positives = 318/392 (81%), Gaps = 2/392 (1%)
 Frame = +3

Query  45    VKMDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFP  224
             + M++D G  REL+ LQ+ R+ Y+PELPPCLQG  +RVE GDATT  DP+  + +++ FP
Sbjct  1     MSMNADLGKPRELTGLQQRRALYQPELPPCLQGKAIRVELGDATTTIDPTCVNMVAQEFP  60

Query  225   HTFGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPN  404
             HTFGQPL HFL+++    DAQ    H +IRVG+VF GRQSPGGHN IWG+YDA+K  NP 
Sbjct  61    HTFGQPLVHFLKSNKL--DAQATDAHTSIRVGVVFSGRQSPGGHNVIWGIYDAMKTQNPQ  118

Query  405   STllgflggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTS  584
             S LLGF+GG+EGLF  KTL+ITDD+L+ YKNQGG+D LGRT DQI +TEQVNAA++ C  
Sbjct  119   SVLLGFIGGTEGLFTNKTLKITDDVLSAYKNQGGFDFLGRTVDQIHTTEQVNAAMSTCCD  178

Query  585   LKLDGLVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTIC  764
             L LDGLVI+GGVTSN+DAA LAE FA   C TKVVGVPV+LNGDLKNQFVET VGFDT+C
Sbjct  179   LDLDGLVIIGGVTSNSDAAQLAETFASHNCKTKVVGVPVSLNGDLKNQFVETTVGFDTVC  238

Query  765   KVNSQLISNVCTDALSAEKYYYFIRLMGRKTSHVALECTLQSHPNMVILAEEVAASKLTL  944
             KVNSQLISNVC DA+SA KYY+FIR+MG K SHVALEC LQS PNMVIL EEVA SKLTL
Sbjct  239   KVNSQLISNVCLDAISAGKYYHFIRVMGWKASHVALECALQSQPNMVILGEEVAFSKLTL  298

Query  945   FDITKQVCDAVQARAEQDKYHGVILLPEGLIESIPEIYALLKEIHVLLREGVSANNISSQ  1124
              +I  ++CD VQ RA QDKYHGV+L+ EGLIESIPE+YAL++EI++L    V  N I SQ
Sbjct  299   KEIVSKICDGVQERATQDKYHGVLLISEGLIESIPEMYALIQEINILHSNKVPENKIPSQ  358

Query  1125  LSPWASALFEFLPPFIRRELLLYPESDDSAQL  1220
             LSPWA+AL+ +LPPFIRRELLL+ +SD+SAQL
Sbjct  359   LSPWATALYNYLPPFIRRELLLHQDSDNSAQL  390



>gb|EEC84297.1| hypothetical protein OsI_30782 [Oryza sativa Indica Group]
Length=581

 Score =   523 bits (1346),  Expect = 2e-178, Method: Compositional matrix adjust.
 Identities = 264/392 (67%), Positives = 320/392 (82%), Gaps = 2/392 (1%)
 Frame = +3

Query  45    VKMDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFP  224
             + M++D G  REL+ LQ+ R+ Y+PELPPCL+G  +RVEFGD+TT  DP+  + + + FP
Sbjct  1     MSMNADLGKPRELTGLQQRRALYQPELPPCLEGKAIRVEFGDSTTTIDPTCANMVVQEFP  60

Query  225   HTFGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPN  404
             +TFGQPL HFL+ +    DAQ   EHP IRVG+VF GRQSPGGHN IWG+YDA+K  N  
Sbjct  61    NTFGQPLVHFLKPNKM--DAQANDEHPPIRVGVVFSGRQSPGGHNVIWGIYDAMKTQNLQ  118

Query  405   STllgflggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTS  584
             S LLGF+GG+EGLFA +TLEITDD+L+ Y+NQGG+D LGRT DQI +TEQVNAA++ C  
Sbjct  119   SVLLGFIGGTEGLFANQTLEITDDVLSAYRNQGGFDFLGRTVDQIHTTEQVNAAMSTCCD  178

Query  585   LKLDGLVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTIC  764
             L LDGLVI+GGVTSN+DAA LAE FA   C TKVVGVPV+LNGDLKNQFVET VGFDT+C
Sbjct  179   LDLDGLVIIGGVTSNSDAAQLAETFANHNCKTKVVGVPVSLNGDLKNQFVETTVGFDTVC  238

Query  765   KVNSQLISNVCTDALSAEKYYYFIRLMGRKTSHVALECTLQSHPNMVILAEEVAASKLTL  944
             KVNSQLISNVC DA+SA KYY+F+R+MG K SHVALEC LQS PNMVIL EEVA SKLTL
Sbjct  239   KVNSQLISNVCLDAISAGKYYHFVRVMGWKASHVALECALQSQPNMVILGEEVAFSKLTL  298

Query  945   FDITKQVCDAVQARAEQDKYHGVILLPEGLIESIPEIYALLKEIHVLLREGVSANNISSQ  1124
              +I  ++CD VQARA Q+KYHGV+L+ EGLIESIPE++AL++EI++L    V  NNI SQ
Sbjct  299   KEIISKICDGVQARAAQEKYHGVLLISEGLIESIPEMFALIQEINILHSNKVPENNIPSQ  358

Query  1125  LSPWASALFEFLPPFIRRELLLYPESDDSAQL  1220
             LSPWA+AL+ +LPPFIRRELLL+ +SD+SAQL
Sbjct  359   LSPWATALYNYLPPFIRRELLLHQDSDNSAQL  390



>gb|EEE69397.1| hypothetical protein OsJ_28754 [Oryza sativa Japonica Group]
Length=579

 Score =   522 bits (1345),  Expect = 2e-178, Method: Compositional matrix adjust.
 Identities = 264/390 (68%), Positives = 319/390 (82%), Gaps = 2/390 (1%)
 Frame = +3

Query  51    MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  230
             M++D G  REL+ LQ+ R+ Y+PELPPCL+G  +RVEFGD+TT  DP+  + + + FP+T
Sbjct  1     MNADLGKPRELTGLQQRRALYQPELPPCLEGKAIRVEFGDSTTTIDPTCANMVVQEFPNT  60

Query  231   FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  410
             FGQPL HFL+ +    DAQ   EHP IRVG+VF GRQSPGGHN IWG+YDA+K  N  S 
Sbjct  61    FGQPLVHFLKPNKM--DAQANDEHPPIRVGVVFSGRQSPGGHNVIWGIYDAMKTQNLQSV  118

Query  411   llgflggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLK  590
             LLGF+GG+EGLFA +TLEITDD+L+ Y+NQGG+D LGRT DQI +TEQVNAA++ C  L 
Sbjct  119   LLGFIGGTEGLFANQTLEITDDVLSAYRNQGGFDFLGRTVDQIHTTEQVNAAMSTCCDLD  178

Query  591   LDGLVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICKV  770
             LDGLVI+GGVTSN+DAA LAE FA   C TKVVGVPV+LNGDLKNQFVET VGFDT+CKV
Sbjct  179   LDGLVIIGGVTSNSDAAQLAETFANHNCKTKVVGVPVSLNGDLKNQFVETTVGFDTVCKV  238

Query  771   NSQLISNVCTDALSAEKYYYFIRLMGRKTSHVALECTLQSHPNMVILAEEVAASKLTLFD  950
             NSQLISNVC DA+SA KYY+F+R+MG K SHVALEC LQS PNMVIL EEVA SKLTL +
Sbjct  239   NSQLISNVCLDAISAGKYYHFVRVMGWKASHVALECALQSQPNMVILGEEVAFSKLTLKE  298

Query  951   ITKQVCDAVQARAEQDKYHGVILLPEGLIESIPEIYALLKEIHVLLREGVSANNISSQLS  1130
             I  ++CD VQARA Q+KYHGV+L+ EGLIESIPE++AL++EI++L    V  NNI SQLS
Sbjct  299   IISKICDGVQARAAQEKYHGVLLISEGLIESIPEMFALIQEINILHSNKVPENNIPSQLS  358

Query  1131  PWASALFEFLPPFIRRELLLYPESDDSAQL  1220
             PWA+AL+ +LPPFIRRELLL+ +SD+SAQL
Sbjct  359   PWATALYNYLPPFIRRELLLHQDSDNSAQL  388



>ref|XP_004973257.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha-like [Setaria italica]
Length=618

 Score =   523 bits (1346),  Expect = 5e-178, Method: Compositional matrix adjust.
 Identities = 262/391 (67%), Positives = 320/391 (82%), Gaps = 4/391 (1%)
 Frame = +3

Query  51    MDSDFGLARELSD-LQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPH  227
             M++DFG  +EL+  LQ+ R+ Y+P LPPCLQG TVR E+GDATT  DPS  + +++ FP+
Sbjct  1     MNADFGAPKELAGGLQQRRALYQPRLPPCLQGPTVRAEYGDATTTIDPSCANVVAQAFPN  60

Query  228   TFGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNS  407
             TFGQPL  F+  +     A+   E P IRVG+VF GRQSPGGHN +WGL+DALK +NP+S
Sbjct  61    TFGQPLVSFVAPADAAAAAE---ERPPIRVGVVFSGRQSPGGHNVVWGLHDALKAYNPHS  117

Query  408   TllgflggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSL  587
              L GF+GG+EGLFA KTLEITDD+LA+YKNQGG+D+LGR+ DQIR+T+QV++A+  C SL
Sbjct  118   VLYGFVGGTEGLFANKTLEITDDVLASYKNQGGFDLLGRSIDQIRTTKQVSSAMATCRSL  177

Query  588   KLDGLVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICK  767
              LDGLVI+GGVTSN+DAA LAE   +  C TKVVGVPV+LNGDLKNQFVET VGFDT+CK
Sbjct  178   NLDGLVIIGGVTSNSDAAQLAETLIQNNCKTKVVGVPVSLNGDLKNQFVETTVGFDTVCK  237

Query  768   VNSQLISNVCTDALSAEKYYYFIRLMGRKTSHVALECTLQSHPNMVILAEEVAASKLTLF  947
             VNSQL+SNVC DA+SA KYYYF+RLMGRK SHVA EC LQSHPNM+IL EEV  SKLTL 
Sbjct  238   VNSQLVSNVCLDAISAGKYYYFVRLMGRKASHVAFECALQSHPNMLILGEEVTLSKLTLM  297

Query  948   DITKQVCDAVQARAEQDKYHGVILLPEGLIESIPEIYALLKEIHVLLREGVSANNISSQL  1127
             +I  ++CD VQARAE  KYHGV+++PEGLIESIPE+YAL++EI++L    V    +SSQL
Sbjct  298   EIINKICDGVQARAELGKYHGVLVIPEGLIESIPEMYALIQEINILHNNNVPVAEMSSQL  357

Query  1128  SPWASALFEFLPPFIRRELLLYPESDDSAQL  1220
             SPWA+ALF+FLPPFIRRELLL+ ESD+SAQL
Sbjct  358   SPWAAALFQFLPPFIRRELLLHQESDNSAQL  388



>ref|XP_003573791.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha-like [Brachypodium distachyon]
Length=617

 Score =   522 bits (1344),  Expect = 9e-178, Method: Compositional matrix adjust.
 Identities = 264/391 (68%), Positives = 320/391 (82%), Gaps = 5/391 (1%)
 Frame = +3

Query  51    MDSDFGLARELSD-LQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPH  227
             M++D+G + EL   LQ+ R+ Y+P LPPCLQG TVRVE+GDATT  DP+G   ++R FP 
Sbjct  1     MNADYGASTELEGPLQQRRALYQPRLPPCLQGATVRVEYGDATTTIDPAGAPEVARAFPR  60

Query  228   TFGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNS  407
             T+GQPL +FL A+A         E P IRVG+VF GRQSPGGHN +WGL+DALK HNP+ 
Sbjct  61    TYGQPLVNFLAAAADKAAG----ERPPIRVGVVFSGRQSPGGHNLVWGLHDALKAHNPHC  116

Query  408   TllgflggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSL  587
              L GF+GG+EGLFA KTLEIT+D+LA+YKNQGG+D+LGR+ DQIR+++Q++AA+T CT+L
Sbjct  117   ALYGFIGGTEGLFANKTLEITNDVLASYKNQGGFDLLGRSIDQIRTSKQLSAAMTTCTNL  176

Query  588   KLDGLVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICK  767
              LDGLVIVGGVTSN+DAA LAE   +  C TKVVGVPV+LNGDLKNQFVET VGFDT+CK
Sbjct  177   NLDGLVIVGGVTSNSDAAQLAETLVQNNCKTKVVGVPVSLNGDLKNQFVETTVGFDTVCK  236

Query  768   VNSQLISNVCTDALSAEKYYYFIRLMGRKTSHVALECTLQSHPNMVILAEEVAASKLTLF  947
             VNSQLISNVC DA+SA KYYYF+RLMGRK SHVA EC LQSHPNM+I+ EEVA SKLTL 
Sbjct  237   VNSQLISNVCLDAISAGKYYYFVRLMGRKASHVAFECALQSHPNMLIMGEEVALSKLTLM  296

Query  948   DITKQVCDAVQARAEQDKYHGVILLPEGLIESIPEIYALLKEIHVLLREGVSANNISSQL  1127
             +I  ++CD V ARAE  KYHGV+L+PEGLI+SIPE+YAL++EI +L    V    +SSQL
Sbjct  297   EIINKICDGVVARAELGKYHGVLLIPEGLIQSIPEMYALIQEISILHNNNVPVAEMSSQL  356

Query  1128  SPWASALFEFLPPFIRRELLLYPESDDSAQL  1220
             SPWA+ALF+FLPPFIRRELLL+ ESD+SAQL
Sbjct  357   SPWAAALFQFLPPFIRRELLLHQESDNSAQL  387



>dbj|BAD33224.1| putative pyrophosphate-dependent phosphofructokinase alpha subunit 
[Oryza sativa Japonica Group]
 dbj|BAD32985.1| putative pyrophosphate-dependent phosphofructokinase alpha subunit 
[Oryza sativa Japonica Group]
Length=618

 Score =   521 bits (1343),  Expect = 1e-177, Method: Compositional matrix adjust.
 Identities = 264/390 (68%), Positives = 319/390 (82%), Gaps = 2/390 (1%)
 Frame = +3

Query  51    MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  230
             M++D G  REL+ LQ+ R+ Y+PELPPCL+G  +RVEFGD+TT  DP+  + + + FP+T
Sbjct  1     MNADLGKPRELTGLQQRRALYQPELPPCLEGKAIRVEFGDSTTTIDPTCANMVVQEFPNT  60

Query  231   FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  410
             FGQPL HFL+ +    DAQ   EHP IRVG+VF GRQSPGGHN IWG+YDA+K  N  S 
Sbjct  61    FGQPLVHFLKPNKM--DAQANDEHPPIRVGVVFSGRQSPGGHNVIWGIYDAMKTQNLQSV  118

Query  411   llgflggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLK  590
             LLGF+GG+EGLFA +TLEITDD+L+ Y+NQGG+D LGRT DQI +TEQVNAA++ C  L 
Sbjct  119   LLGFIGGTEGLFANQTLEITDDVLSAYRNQGGFDFLGRTVDQIHTTEQVNAAMSTCCDLD  178

Query  591   LDGLVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICKV  770
             LDGLVI+GGVTSN+DAA LAE FA   C TKVVGVPV+LNGDLKNQFVET VGFDT+CKV
Sbjct  179   LDGLVIIGGVTSNSDAAQLAETFANHNCKTKVVGVPVSLNGDLKNQFVETTVGFDTVCKV  238

Query  771   NSQLISNVCTDALSAEKYYYFIRLMGRKTSHVALECTLQSHPNMVILAEEVAASKLTLFD  950
             NSQLISNVC DA+SA KYY+F+R+MG K SHVALEC LQS PNMVIL EEVA SKLTL +
Sbjct  239   NSQLISNVCLDAISAGKYYHFVRVMGWKASHVALECALQSQPNMVILGEEVAFSKLTLKE  298

Query  951   ITKQVCDAVQARAEQDKYHGVILLPEGLIESIPEIYALLKEIHVLLREGVSANNISSQLS  1130
             I  ++CD VQARA Q+KYHGV+L+ EGLIESIPE++AL++EI++L    V  NNI SQLS
Sbjct  299   IISKICDGVQARAAQEKYHGVLLISEGLIESIPEMFALIQEINILHSNKVPENNIPSQLS  358

Query  1131  PWASALFEFLPPFIRRELLLYPESDDSAQL  1220
             PWA+AL+ +LPPFIRRELLL+ +SD+SAQL
Sbjct  359   PWATALYNYLPPFIRRELLLHQDSDNSAQL  388



>dbj|BAJ94879.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=622

 Score =   522 bits (1344),  Expect = 1e-177, Method: Compositional matrix adjust.
 Identities = 261/392 (67%), Positives = 318/392 (81%), Gaps = 2/392 (1%)
 Frame = +3

Query  51    MDSDFGLARELSD-LQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPH  227
             M++D+G    L+  LQ+ R+ Y+P LPPCLQG TVR E+G+ATT  DP+G H +++ FP 
Sbjct  1     MNADYGAPTALAGPLQQRRALYQPRLPPCLQGATVRAEYGEATTTIDPAGAHAVAQAFPR  60

Query  228   TFGQPLAHFLRASAKVPDAQI-ITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPN  404
             T+GQ L  FL         +  + E P IRVG+VF GRQSPGGHN +WGL+DAL+ +NP+
Sbjct  61    TYGQRLVTFLAPDDAAGADKAAVHERPPIRVGVVFSGRQSPGGHNVVWGLHDALRAYNPH  120

Query  405   STllgflggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTS  584
             S L GF+GG+EGLFA KTLEITDD+LA+YKNQGG+D+LGR+ DQIRS++QV+AA+T C +
Sbjct  121   SVLYGFIGGTEGLFANKTLEITDDVLASYKNQGGFDLLGRSIDQIRSSKQVSAAMTTCHN  180

Query  585   LKLDGLVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTIC  764
             L LDGLVIVGGVTSN+DAA LAE   +  C TKVVGVPV+LNGDLKNQFVET VGFDT+C
Sbjct  181   LNLDGLVIVGGVTSNSDAAQLAETLVQKNCKTKVVGVPVSLNGDLKNQFVETTVGFDTVC  240

Query  765   KVNSQLISNVCTDALSAEKYYYFIRLMGRKTSHVALECTLQSHPNMVILAEEVAASKLTL  944
             KVNSQLISNVC DA+SA KYYYF+RLMGRK SHVALEC LQSHPNM+I+ EEVA SKLTL
Sbjct  241   KVNSQLISNVCLDAISAGKYYYFVRLMGRKASHVALECALQSHPNMLIMGEEVALSKLTL  300

Query  945   FDITKQVCDAVQARAEQDKYHGVILLPEGLIESIPEIYALLKEIHVLLREGVSANNISSQ  1124
              ++  ++CD VQARAE DKYHGV+L+PEGLIESIPE+YAL++EI +L    V    I +Q
Sbjct  301   MEVINKICDGVQARAELDKYHGVLLIPEGLIESIPEMYALIQEISILHNNNVPVTEIPTQ  360

Query  1125  LSPWASALFEFLPPFIRRELLLYPESDDSAQL  1220
             LSPWA+ALF+FLPPFIRRELLL+ ESD+SAQL
Sbjct  361   LSPWAAALFQFLPPFIRRELLLHQESDNSAQL  392



>gb|ERN00267.1| hypothetical protein AMTR_s00111p00148440 [Amborella trichopoda]
Length=589

 Score =   516 bits (1328),  Expect = 9e-176, Method: Compositional matrix adjust.
 Identities = 271/353 (77%), Positives = 304/353 (86%), Gaps = 2/353 (1%)
 Frame = +3

Query  162   FGDATTAADPSGGHTISRLFPHTFGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQ  341
             F DAT  ++P    +I R FP T+GQPL HFL  S  V DA ++ E   IRVG+VFCGRQ
Sbjct  16    FADATITSNPL--DSIGRSFPLTYGQPLLHFLAESDNVIDAHVVQELTPIRVGVVFCGRQ  73

Query  342   SPGGHNAIWGLYDALKVHNPNSTllgflggseglfAQKTLEITDDILATYKNQGGYDMLG  521
             SPGGHN I GL++A+K+HNP STLLGF+GGSEGLFAQKTLEIT D+++ Y+NQGGYDMLG
Sbjct  74    SPGGHNVICGLHEAIKIHNPKSTLLGFVGGSEGLFAQKTLEITKDVVSAYRNQGGYDMLG  133

Query  522   RTKDQIRSTEQVNAALTACTSLKLDGLVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPV  701
             RTKDQIR+ EQVNAALT C +LKLDGLVI+GGVTSNTDAA LAE FAEAKC TKV+GVPV
Sbjct  134   RTKDQIRTNEQVNAALTTCQALKLDGLVIIGGVTSNTDAAQLAETFAEAKCQTKVIGVPV  193

Query  702   TLNGDLKNQFVETNVGFDTICKVNSQLISNVCTDALSAEKYYYFIRLMGRKTSHVALECT  881
             TL GDLKNQFVE +VGFDTICKVNSQLISN+CTDALSAEKYYYFIRLMG   SHVALEC 
Sbjct  194   TLYGDLKNQFVEADVGFDTICKVNSQLISNICTDALSAEKYYYFIRLMGSSASHVALECA  253

Query  882   LQSHPNMVILAEEVAASKLTLFDITKQVCDAVQARAEQDKYHGVILLPEGLIESIPEIYA  1061
             LQS PNMVIL EEVA+SKLTLFD+TK++CDAVQARAEQDKYHGVILLPEGLIESIPEI+A
Sbjct  254   LQSQPNMVILGEEVASSKLTLFDVTKRICDAVQARAEQDKYHGVILLPEGLIESIPEIHA  313

Query  1062  LLKEIHVLLREGVSANNISSQLSPWASALFEFLPPFIRRELLLYPESDDSAQL  1220
             LL+EI  L   GVS +NISS LSPWASALFEFLPPFI+++LLL P SD+SAQL
Sbjct  314   LLQEIRGLHSRGVSVDNISSLLSPWASALFEFLPPFIKKQLLLSPASDNSAQL  366



>gb|AGN30570.1| pyrophosphate-fructose-6-phosphate-phosphotransferase PFPA4 [Oryza 
sativa Japonica Group]
Length=627

 Score =   516 bits (1329),  Expect = 3e-175, Method: Compositional matrix adjust.
 Identities = 265/399 (66%), Positives = 320/399 (80%), Gaps = 9/399 (2%)
 Frame = +3

Query  45    VKMDSDFGLARELSDLQKLRSQYRPELPPCL-------QGTTVRVEFGDATTAADPSGGH  203
             + M++D G  REL+ LQ+ R+ Y+PELPPCL       QG  +RVEFGD+TT  DP+  +
Sbjct  1     MSMNADLGKPRELTGLQQRRALYQPELPPCLEFFNQHVQGKAIRVEFGDSTTTIDPTCAN  60

Query  204   TISRLFPHTFGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDA  383
              + + FP+TFGQPL HFL+ +    DAQ   EHP IRVG+VF GRQSPGGHN IWG+YDA
Sbjct  61    MVVQEFPNTFGQPLVHFLKPNKM--DAQANDEHPPIRVGVVFSGRQSPGGHNVIWGIYDA  118

Query  384   LKVHNPNSTllgflggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNA  563
             +K  N  S LLGF+GG+EGLFA +TLEITDD+L+ Y+NQGG+D LGRT DQI +TEQVNA
Sbjct  119   MKTQNLQSVLLGFIGGTEGLFANQTLEITDDVLSAYRNQGGFDFLGRTVDQIHTTEQVNA  178

Query  564   ALTACTSLKLDGLVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETN  743
             A++ C  L LDGLVI+GGVTSN+DAA LAE FA   C TKVVGVPV+LNGDLKNQFVET 
Sbjct  179   AMSTCCDLDLDGLVIIGGVTSNSDAAQLAETFANHNCKTKVVGVPVSLNGDLKNQFVETT  238

Query  744   VGFDTICKVNSQLISNVCTDALSAEKYYYFIRLMGRKTSHVALECTLQSHPNMVILAEEV  923
             VGFDT+CKVNSQLISNVC DA+SA KYY+F+R+MG K SHVALEC LQS PNMVIL EEV
Sbjct  239   VGFDTVCKVNSQLISNVCLDAISAGKYYHFVRVMGWKASHVALECALQSQPNMVILGEEV  298

Query  924   AASKLTLFDITKQVCDAVQARAEQDKYHGVILLPEGLIESIPEIYALLKEIHVLLREGVS  1103
             A SKLTL +I  ++CD VQARA Q+KYHGV+L+ EGLIESIPE++AL++EI++L    V 
Sbjct  299   AFSKLTLKEIISKICDGVQARAAQEKYHGVLLISEGLIESIPEMFALIQEINILHSNKVP  358

Query  1104  ANNISSQLSPWASALFEFLPPFIRRELLLYPESDDSAQL  1220
              NNI SQLSPWA+AL+ +LPPFIRRELLL+ +SD+SAQL
Sbjct  359   ENNIPSQLSPWATALYNYLPPFIRRELLLHQDSDNSAQL  397



>ref|XP_002459996.1| hypothetical protein SORBIDRAFT_02g020400 [Sorghum bicolor]
 gb|EER96517.1| hypothetical protein SORBIDRAFT_02g020400 [Sorghum bicolor]
Length=626

 Score =   513 bits (1320),  Expect = 6e-174, Method: Compositional matrix adjust.
 Identities = 265/392 (68%), Positives = 317/392 (81%), Gaps = 5/392 (1%)
 Frame = +3

Query  60    DFGLARELSDLQKLRSQYRPELPPCL-QGTTVRVEFGDATTAADPSGGHTISRLFPHTFG  236
             D G  REL+ LQ+ R+ Y+PELPPCL QGT +RVEFGD+TT  D      +++ FPH FG
Sbjct  5     DLGSPRELTGLQRRRALYQPELPPCLVQGTRIRVEFGDSTTTIDSKCADIVAQAFPHIFG  64

Query  237   QPLAHFLRASAKV----PDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPN  404
             Q L  FL           DAQ+I E+  IRVG+VF GRQSPGGHN IWG YDALK  NP+
Sbjct  65    QKLVRFLEPHMDTVVSESDAQVIQENSPIRVGVVFSGRQSPGGHNVIWGTYDALKAQNPH  124

Query  405   STllgflggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTS  584
             + LLGF+GG+EGLFA+KTLEITDD+L++YKNQGG+D+LGRT DQIR+TEQ+NAA   C  
Sbjct  125   NVLLGFIGGTEGLFAKKTLEITDDVLSSYKNQGGFDLLGRTVDQIRTTEQINAAKATCCD  184

Query  585   LKLDGLVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTIC  764
             L LDGL+I+GGVTSN+DAA LAE FAE  C TKV+GVPVTL+GDL+NQFVET VGFDT+C
Sbjct  185   LNLDGLIIIGGVTSNSDAAQLAEIFAEHNCKTKVIGVPVTLSGDLRNQFVETTVGFDTVC  244

Query  765   KVNSQLISNVCTDALSAEKYYYFIRLMGRKTSHVALECTLQSHPNMVILAEEVAASKLTL  944
             KVNSQLISNVC DA+SA KYYYF+RLMG K SHVALEC LQSHPNMVIL EEVA SKLTL
Sbjct  245   KVNSQLISNVCLDAISAGKYYYFVRLMGGKASHVALECALQSHPNMVILGEEVAFSKLTL  304

Query  945   FDITKQVCDAVQARAEQDKYHGVILLPEGLIESIPEIYALLKEIHVLLREGVSANNISSQ  1124
              +IT ++CD V+ARAEQ K+HGV+++PEGLIESIPE+YAL++EI+ L    +S  +I SQ
Sbjct  305   KEITNKICDGVEARAEQGKHHGVLVIPEGLIESIPEMYALIQEINNLHSNNISEADIPSQ  364

Query  1125  LSPWASALFEFLPPFIRRELLLYPESDDSAQL  1220
             LSPWA+ALF+FLP FIRREL+L+ ESD+SAQL
Sbjct  365   LSPWAAALFKFLPSFIRRELILHQESDNSAQL  396



>gb|AFW86518.1| hypothetical protein ZEAMMB73_272382, partial [Zea mays]
Length=333

 Score =   484 bits (1246),  Expect = 3e-167, Method: Compositional matrix adjust.
 Identities = 242/303 (80%), Positives = 272/303 (90%), Gaps = 0/303 (0%)
 Frame = +3

Query  312   RVGIVFCGRQSPGGHNAIWGLYDALKVHNPNSTllgflggseglfAQKTLEITDDILATY  491
             R+G+VF GRQSPGGHN IWGLYD +K HN NS ++GFLGG++GLFAQKT+EITD+ L +Y
Sbjct  4     RIGVVFSGRQSPGGHNVIWGLYDVVKAHNSNSKIIGFLGGTDGLFAQKTIEITDEALPSY  63

Query  492   KNQGGYDMLGRTKDQIRSTEQVNAALTACTSLKLDGLVIVGGVTSNTDaaylaeafaeaK  671
             KNQGGYDMLGRT+DQIR+TEQV A +  C +LKLD LVI+GGVTSNTDAA LAE FA+ K
Sbjct  64    KNQGGYDMLGRTRDQIRTTEQVKATIGTCQALKLDALVIIGGVTSNTDAAQLAETFAQLK  123

Query  672   CPTKVVGVPVTLNGDLKNQFVETNVGFDTICKVNSQLISNVCTDALSAEKYYYFIRLMGR  851
             CPTKVVGVPVTLNGDLKNQFVET VGFDTICKVNSQLISN C DALSAEKYYYFIR+MGR
Sbjct  124   CPTKVVGVPVTLNGDLKNQFVETTVGFDTICKVNSQLISNACIDALSAEKYYYFIRMMGR  183

Query  852   KTSHVALECTLQSHPNMVILAEEVAASKLTLFDITKQVCDAVQARAEQDKYHGVILLPEG  1031
             K SHVALEC LQSHPNMVIL EEV+ SKLT+FDITKQ+CDAVQARAE+DKYHGV+L+PEG
Sbjct  184   KASHVALECALQSHPNMVILGEEVSVSKLTIFDITKQICDAVQARAEKDKYHGVVLIPEG  243

Query  1032  LIESIPEIYALLKEIHVLLREGVSANNISSQLSPWASALFEFLPPFIRRELLLYPESDDS  1211
             L+ESIPE+YALL+EIH L  +GVS  NISS LSPWASALFEFLPPFIR++LLL+P SDDS
Sbjct  244   LVESIPELYALLQEIHGLHNKGVSVENISSHLSPWASALFEFLPPFIRKQLLLHPGSDDS  303

Query  1212  AQL  1220
             AQL
Sbjct  304   AQL  306



>dbj|BAJ85819.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=598

 Score =   494 bits (1271),  Expect = 4e-167, Method: Compositional matrix adjust.
 Identities = 247/362 (68%), Positives = 297/362 (82%), Gaps = 1/362 (0%)
 Frame = +3

Query  138   QGTTVRVEFGDATTAADPSGGHTISRLFPHTFGQPLAHFLRASAKVPDAQI-ITEHPAIR  314
             QG TVR E+G+ATT  DP+G H +++ FP T+GQ L  FL         +  + E P IR
Sbjct  7     QGATVRAEYGEATTTIDPAGAHAVAQAFPRTYGQRLVTFLAPDDAAGADKAAVHERPPIR  66

Query  315   VGIVFCGRQSPGGHNAIWGLYDALKVHNPNSTllgflggseglfAQKTLEITDDILATYK  494
             VG+VF GRQSPGGHN +WGL+DAL+ +NP+S L GF+GG+EGLFA KTLEITDD+LA+YK
Sbjct  67    VGVVFSGRQSPGGHNVVWGLHDALRAYNPHSVLYGFIGGTEGLFANKTLEITDDVLASYK  126

Query  495   NQGGYDMLGRTKDQIRSTEQVNAALTACTSLKLDGLVIVGGVTSNTDaaylaeafaeaKC  674
             NQGG+D+LGR+ DQIRS++QV+AA+T C +L LDGLVIVGGVTSN+DAA LAE   +  C
Sbjct  127   NQGGFDLLGRSIDQIRSSKQVSAAMTTCHNLNLDGLVIVGGVTSNSDAAQLAETLVQKNC  186

Query  675   PTKVVGVPVTLNGDLKNQFVETNVGFDTICKVNSQLISNVCTDALSAEKYYYFIRLMGRK  854
              TKVVGVPV+LNGDLKNQFVET VGFDT+CKVNSQLISNVC DA+SA KYYYF+RLMGRK
Sbjct  187   KTKVVGVPVSLNGDLKNQFVETTVGFDTVCKVNSQLISNVCLDAISAGKYYYFVRLMGRK  246

Query  855   TSHVALECTLQSHPNMVILAEEVAASKLTLFDITKQVCDAVQARAEQDKYHGVILLPEGL  1034
              SHVALEC LQSHPNM+I+ EEVA SKLTL ++  ++CD VQARAE DKYHGV+L+PEGL
Sbjct  247   ASHVALECALQSHPNMLIMGEEVALSKLTLMEVINKICDGVQARAELDKYHGVLLIPEGL  306

Query  1035  IESIPEIYALLKEIHVLLREGVSANNISSQLSPWASALFEFLPPFIRRELLLYPESDDSA  1214
             IESIPE+YAL++EI +L    V    I +QLSPWA+ALF+FLPPFIRRELLL+ ESD+SA
Sbjct  307   IESIPEMYALIQEISILHNNNVPVTEIPTQLSPWAAALFQFLPPFIRRELLLHQESDNSA  366

Query  1215  QL  1220
             QL
Sbjct  367   QL  368



>ref|XP_008652527.1| PREDICTED: LOW QUALITY PROTEIN: pyrophosphate--fructose 6-phosphate 
1-phosphotransferase subunit alpha [Zea mays]
Length=623

 Score =   491 bits (1263),  Expect = 2e-165, Method: Compositional matrix adjust.
 Identities = 263/394 (67%), Positives = 316/394 (80%), Gaps = 12/394 (3%)
 Frame = +3

Query  60    DFGLARELSDLQKLRSQYRPELPPCL-QGTTVRVEFGDATTAADPSGGHTISRLFPHTFG  236
             D G  REL+ LQ+ R+ Y+PELPPCL QGT  RVEFGD TT  D      +++ FPHTFG
Sbjct  5     DLGSPRELTGLQRRRALYQPELPPCLLQGT--RVEFGDPTTTIDSKCADIVAQAFPHTFG  62

Query  237   QPLAHFLR-----ASAKVPDAQIITEHPAIRVGIVFCGRQSP-GGHNAIWGLYDALKVHN  398
             Q L  FL        +   DAQ   E P +R+G+VF GRQSP GGHN IWG +DA+K  N
Sbjct  63    QRLVRFLEPHPDTVVSGSSDAQ---ERPPVRLGVVFSGRQSPRGGHNVIWGTFDAMKARN  119

Query  399   PNSTllgflggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTAC  578
             P+S LLGFLGG+EGLFA+KTLEIT+D+L++YKNQGG+D+LGRT DQIR+TEQV+AA +AC
Sbjct  120   PHSVLLGFLGGTEGLFAKKTLEITEDMLSSYKNQGGFDLLGRTVDQIRTTEQVDAAKSAC  179

Query  579   TSLKLDGLVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDT  758
               L LDGL+I+GGVTSN+DAA LAE FAE  C TKV+GVPVTL+GDL+NQFVE  VGFDT
Sbjct  180   CDLNLDGLIIIGGVTSNSDAAQLAEFFAEHDCKTKVIGVPVTLSGDLRNQFVEATVGFDT  239

Query  759   ICKVNSQLISNVCTDALSAEKYYYFIRLMGRKTSHVALECTLQSHPNMVILAEEVAASKL  938
             +CKVNSQLISNVC DA+SA KYYYF+RLMG K SHVALEC LQSHPNMVIL EEVA SKL
Sbjct  240   VCKVNSQLISNVCLDAISAGKYYYFVRLMGGKASHVALECALQSHPNMVILGEEVAFSKL  299

Query  939   TLFDITKQVCDAVQARAEQDKYHGVILLPEGLIESIPEIYALLKEIHVLLREGVSANNIS  1118
             TL +IT ++CD V+ARA+Q KYHGV+++PEGLIESIPE+YAL++EI+ L    V+  +I 
Sbjct  300   TLKEITNKICDGVEARADQGKYHGVLVIPEGLIESIPEMYALIQEINNLHSSNVTEADIP  359

Query  1119  SQLSPWASALFEFLPPFIRRELLLYPESDDSAQL  1220
             SQLSPWA+ALF+FLP FIRREL+L+ ESD+SAQL
Sbjct  360   SQLSPWAAALFKFLPSFIRRELILHQESDNSAQL  393



>ref|XP_010935015.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha-like isoform X1 [Elaeis guineensis]
Length=543

 Score =   483 bits (1243),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 247/302 (82%), Positives = 275/302 (91%), Gaps = 0/302 (0%)
 Frame = +3

Query  315   VGIVFCGRQSPGGHNAIWGLYDALKVHNPNSTllgflggseglfAQKTLEITDDILATYK  494
             VG+VFCGRQSPGGHN I GL+DA+K HNP STLLGF GG+EGLF QKTLEIT+D+++ Y+
Sbjct  12    VGVVFCGRQSPGGHNVICGLHDAMKSHNPKSTLLGFCGGTEGLFKQKTLEITEDVVSKYR  71

Query  495   NQGGYDMLGRTKDQIRSTEQVNAALTACTSLKLDGLVIVGGVTSNTDaaylaeafaeaKC  674
             NQGGYDMLGRT DQIR+TEQVNA LT C +LKLDGLVI+GGVTSNTDAA LAE FAEAKC
Sbjct  72    NQGGYDMLGRTMDQIRTTEQVNAGLTTCQTLKLDGLVIIGGVTSNTDAAQLAETFAEAKC  131

Query  675   PTKVVGVPVTLNGDLKNQFVETNVGFDTICKVNSQLISNVCTDALSAEKYYYFIRLMGRK  854
              TKVVGVPVT  GDLKNQFVE NVGFDTICKVNSQLISN+C DALSAEKYYYFIRLMGR+
Sbjct  132   STKVVGVPVTFYGDLKNQFVEANVGFDTICKVNSQLISNICIDALSAEKYYYFIRLMGRR  191

Query  855   TSHVALECTLQSHPNMVILAEEVAASKLTLFDITKQVCDAVQARAEQDKYHGVILLPEGL  1034
              SHVALEC LQSHPNMVIL+EEVAASKLTL+DITKQ+CDAVQARAE  KYHGVILLPEGL
Sbjct  192   ASHVALECALQSHPNMVILSEEVAASKLTLYDITKQICDAVQARAELGKYHGVILLPEGL  251

Query  1035  IESIPEIYALLKEIHVLLREGVSANNISSQLSPWASALFEFLPPFIRRELLLYPESDDSA  1214
             IESIPE+YALL+EIHVLL+ GVS +N+S QLSPWASAL+E +PPFI+++LLL PESD+SA
Sbjct  252   IESIPEVYALLQEIHVLLKNGVSVDNVSKQLSPWASALYESMPPFIKKQLLLSPESDESA  311

Query  1215  QL  1220
             QL
Sbjct  312   QL  313



>ref|XP_010935016.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha-like isoform X2 [Elaeis guineensis]
Length=527

 Score =   481 bits (1239),  Expect = 3e-163, Method: Compositional matrix adjust.
 Identities = 247/302 (82%), Positives = 275/302 (91%), Gaps = 0/302 (0%)
 Frame = +3

Query  315   VGIVFCGRQSPGGHNAIWGLYDALKVHNPNSTllgflggseglfAQKTLEITDDILATYK  494
             VG+VFCGRQSPGGHN I GL+DA+K HNP STLLGF GG+EGLF QKTLEIT+D+++ Y+
Sbjct  12    VGVVFCGRQSPGGHNVICGLHDAMKSHNPKSTLLGFCGGTEGLFKQKTLEITEDVVSKYR  71

Query  495   NQGGYDMLGRTKDQIRSTEQVNAALTACTSLKLDGLVIVGGVTSNTDaaylaeafaeaKC  674
             NQGGYDMLGRT DQIR+TEQVNA LT C +LKLDGLVI+GGVTSNTDAA LAE FAEAKC
Sbjct  72    NQGGYDMLGRTMDQIRTTEQVNAGLTTCQTLKLDGLVIIGGVTSNTDAAQLAETFAEAKC  131

Query  675   PTKVVGVPVTLNGDLKNQFVETNVGFDTICKVNSQLISNVCTDALSAEKYYYFIRLMGRK  854
              TKVVGVPVT  GDLKNQFVE NVGFDTICKVNSQLISN+C DALSAEKYYYFIRLMGR+
Sbjct  132   STKVVGVPVTFYGDLKNQFVEANVGFDTICKVNSQLISNICIDALSAEKYYYFIRLMGRR  191

Query  855   TSHVALECTLQSHPNMVILAEEVAASKLTLFDITKQVCDAVQARAEQDKYHGVILLPEGL  1034
              SHVALEC LQSHPNMVIL+EEVAASKLTL+DITKQ+CDAVQARAE  KYHGVILLPEGL
Sbjct  192   ASHVALECALQSHPNMVILSEEVAASKLTLYDITKQICDAVQARAELGKYHGVILLPEGL  251

Query  1035  IESIPEIYALLKEIHVLLREGVSANNISSQLSPWASALFEFLPPFIRRELLLYPESDDSA  1214
             IESIPE+YALL+EIHVLL+ GVS +N+S QLSPWASAL+E +PPFI+++LLL PESD+SA
Sbjct  252   IESIPEVYALLQEIHVLLKNGVSVDNVSKQLSPWASALYESMPPFIKKQLLLSPESDESA  311

Query  1215  QL  1220
             QL
Sbjct  312   QL  313



>ref|XP_010275338.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha-like [Nelumbo nucifera]
Length=562

 Score =   479 bits (1233),  Expect = 8e-162, Method: Compositional matrix adjust.
 Identities = 256/387 (66%), Positives = 297/387 (77%), Gaps = 51/387 (13%)
 Frame = +3

Query  60    DFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHTFGQ  239
             +F    ELS LQK RS Y PELP CLQ                                 
Sbjct  2     EFAAVMELSGLQKQRSSYIPELPLCLQCY-------------------------------  30

Query  240   PLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNSTllg  419
              L H+                   R+G++FCGRQSPGGHN + GL+DA+K HNP STLLG
Sbjct  31    -LKHY-------------------RIGVIFCGRQSPGGHNIVCGLHDAIKSHNPKSTLLG  70

Query  420   flggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLKLDG  599
             F GG+EGLF+QKT+EIT+DI+ +Y+NQGGY MLGRTKDQIR++EQV AAL AC +LKLDG
Sbjct  71    FCGGTEGLFSQKTIEITEDIVLSYRNQGGYGMLGRTKDQIRTSEQVKAALDACEALKLDG  130

Query  600   LVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICKVNSQ  779
             LVIVGG+ SNTDAA LAE FA AKC TKVVGVPVT+ GDLKNQFVE NVGFDT CKVN+Q
Sbjct  131   LVIVGGIISNTDAAQLAETFAVAKCRTKVVGVPVTIYGDLKNQFVEANVGFDTTCKVNAQ  190

Query  780   LISNVCTDALSAEKYYYFIRLMGRKTSHVALECTLQSHPNMVILAEEVAASKLTLFDITK  959
             L+SN+CTDALSAEKYYYFIR+MGR+TSHV LEC LQS+PNM IL+EEVA+SKLTLFDITK
Sbjct  191   LVSNICTDALSAEKYYYFIRVMGRRTSHVVLECALQSNPNMFILSEEVASSKLTLFDITK  250

Query  960   QVCDAVQARAEQDKYHGVILLPEGLIESIPEIYALLKEIHVLLREGVSANNISSQLSPWA  1139
             ++CDAVQ RAEQDKYHGVILLPEGLIESIPE+YALL+EIH L ++GVS++NI +QLSPWA
Sbjct  251   RICDAVQDRAEQDKYHGVILLPEGLIESIPEVYALLQEIHQLHKKGVSSDNIPAQLSPWA  310

Query  1140  SALFEFLPPFIRRELLLYPESDDSAQL  1220
             +A FEFLPPFIR+++LL PESDDSAQL
Sbjct  311   TAFFEFLPPFIRKQVLLSPESDDSAQL  337



>ref|XP_002978426.1| hypothetical protein SELMODRAFT_108705 [Selaginella moellendorffii]
 gb|EFJ20412.1| hypothetical protein SELMODRAFT_108705 [Selaginella moellendorffii]
Length=616

 Score =   481 bits (1238),  Expect = 9e-162, Method: Compositional matrix adjust.
 Identities = 243/383 (63%), Positives = 303/383 (79%), Gaps = 6/383 (2%)
 Frame = +3

Query  90    LQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHTFGQPLAHFLRASA  269
             +Q +R  Y+  LPP L+   V++  GDATTA D S    I R F  T+GQPL H L    
Sbjct  7     IQGIRRGYKVSLPPALEAPNVQLVCGDATTAMDASDALAIQRSFSLTYGQPLVHLLPGKK  66

Query  270   KV------PDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNSTllgflgg  431
                     P   ++ +  A RVG+VFCGRQSPGGHN + GL+DALK HNP++ L+G +GG
Sbjct  67    STGEKKLSPLRSVLCDAFAGRVGVVFCGRQSPGGHNIVAGLFDALKAHNPDNVLIGIVGG  126

Query  432   seglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLKLDGLVIV  611
             ++GLFAQK++EIT D+LA Y+NQGGYD+LGRTKDQI+S +QV+ A  AC ++KLDG+V++
Sbjct  127   TDGLFAQKSVEITADVLAVYRNQGGYDLLGRTKDQIKSVQQVDDARAACEAMKLDGIVLI  186

Query  612   GGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICKVNSQLISN  791
             GG  ++TDAA+LAE FA  +C TKV+ VP T++GDLKN FVET+VGFDT+CKVNSQLISN
Sbjct  187   GGCGTSTDAAHLAENFAATECRTKVIAVPATIDGDLKNPFVETDVGFDTVCKVNSQLISN  246

Query  792   VCTDALSAEKYYYFIRLMGRKTSHVALECTLQSHPNMVILAEEVAASKLTLFDITKQVCD  971
             + TDALSAEKYYYFIRLMGR+ SHV+LEC LQSHPNMVIL EEVA SK+TLFD+TKQ+CD
Sbjct  247   ISTDALSAEKYYYFIRLMGRRASHVSLECALQSHPNMVILGEEVATSKMTLFDVTKQICD  306

Query  972   AVQARAEQDKYHGVILLPEGLIESIPEIYALLKEIHVLLREGVSANNISSQLSPWASALF  1151
             A+QARAE +KYHGVILLPEGLIESIPE+YALL+EIH L ++ +   +I ++LSPWASALF
Sbjct  307   AIQARAEHEKYHGVILLPEGLIESIPEVYALLQEIHGLQKQNIEVEHIPTRLSPWASALF  366

Query  1152  EFLPPFIRRELLLYPESDDSAQL  1220
             EFLPPFI+++ LL  ESDDS QL
Sbjct  367   EFLPPFIKKQFLLDRESDDSVQL  389



>ref|XP_001773752.1| predicted protein [Physcomitrella patens]
 gb|EDQ61369.1| predicted protein [Physcomitrella patens]
Length=613

 Score =   481 bits (1237),  Expect = 1e-161, Method: Compositional matrix adjust.
 Identities = 245/383 (64%), Positives = 305/383 (80%), Gaps = 9/383 (2%)
 Frame = +3

Query  78    ELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHTFGQPLAHFL  257
             +L  L  LR+QY P++PP L+G  V+V  GD TTAADPS    +SR +PHT+GQPL H +
Sbjct  11    KLQGLSALRAQYEPQIPPALKGGNVKVSKGDNTTAADPSDRLAVSRAYPHTYGQPLVHLV  70

Query  258   RASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNSTllgflggse  437
                          +H  +R+G+ FCGRQSPGGHN I GL+DALK  N +S L+GF+GG+E
Sbjct  71    SEDKAA-------KHSTLRIGVAFCGRQSPGGHNVITGLFDALKSQNADSVLIGFVGGTE  123

Query  438   glfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLKLDGLVIVGG  617
             G+FAQKT+E+T+D L  ++NQGGYD+LGRTKDQI+S++QVN A  AC +LKLD LV++GG
Sbjct  124   GIFAQKTVELTNDHLKDFRNQGGYDLLGRTKDQIKSSQQVNDAKAACEALKLDALVLIGG  183

Query  618   VTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICKVNSQLISNVC  797
               +NTDAA LAE+F E+ C TKV+GVPVT++GDLKNQFVET+VGFDT CKV SQLISN+C
Sbjct  184   TGTNTDAAQLAESFLESGCTTKVIGVPVTIDGDLKNQFVETDVGFDTTCKVYSQLISNIC  243

Query  798   TDALSAEKYYYFIRLMGRKTSHVALECTLQSHPNMVILAEEVAASKLTLFDITKQVCDAV  977
             TDALSAEKYYYFIRLMGR+ SHV+LEC LQS  NMV+L EEVA SK+TLFD+T Q+CDA+
Sbjct  244   TDALSAEKYYYFIRLMGRQASHVSLECALQSQANMVLLGEEVANSKMTLFDVTMQICDAI  303

Query  978   QARAEQDKYHGVILLPEGLIESIPEIYALLKEIHVLLR--EGVSANNISSQLSPWASALF  1151
             QAR EQ K HGV+LLPEGLIESIPE YALL+EI+ LL+  E +  NNISS+L+PWA+AL+
Sbjct  304   QARGEQGKNHGVVLLPEGLIESIPEFYALLQEINGLLKQDEDIDVNNISSRLTPWAAALY  363

Query  1152  EFLPPFIRRELLLYPESDDSAQL  1220
             +FLP FI+++LLL  ESD S QL
Sbjct  364   DFLPIFIKKQLLLDRESDGSVQL  386



>ref|XP_002970269.1| hypothetical protein SELMODRAFT_171380 [Selaginella moellendorffii]
 gb|EFJ28399.1| hypothetical protein SELMODRAFT_171380 [Selaginella moellendorffii]
Length=616

 Score =   481 bits (1237),  Expect = 1e-161, Method: Compositional matrix adjust.
 Identities = 243/383 (63%), Positives = 303/383 (79%), Gaps = 6/383 (2%)
 Frame = +3

Query  90    LQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHTFGQPLAHFLRASA  269
             +Q +R  Y+  LPP L+   V++  GDATTA D S    I R F  T+GQPL H L    
Sbjct  7     IQGIRRGYKVSLPPALEAPNVQLVCGDATTAMDASDALAIQRSFSLTYGQPLVHLLPGKK  66

Query  270   KV------PDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNSTllgflgg  431
                     P   ++ +  A RVG+VFCGRQSPGGHN + GL+DALK HNP++ L+G +GG
Sbjct  67    STGEKKLSPLRSVLCDAFAGRVGVVFCGRQSPGGHNIVAGLFDALKAHNPDNVLIGIVGG  126

Query  432   seglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLKLDGLVIV  611
             ++GLFAQK++EIT D+LA Y+NQGGYD+LGRTKDQI+S +QV+ A  AC ++KLDG+V++
Sbjct  127   TDGLFAQKSVEITADVLAVYRNQGGYDLLGRTKDQIKSVQQVDDARAACEAMKLDGIVLI  186

Query  612   GGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICKVNSQLISN  791
             GG  ++TDAA+LAE FA  +C TKV+ VP T++GDLKN FVET+VGFDT+CKVNSQLISN
Sbjct  187   GGCGTSTDAAHLAENFAATECRTKVIAVPATIDGDLKNPFVETDVGFDTVCKVNSQLISN  246

Query  792   VCTDALSAEKYYYFIRLMGRKTSHVALECTLQSHPNMVILAEEVAASKLTLFDITKQVCD  971
             + TDALSAEKYYYFIRLMGR+ SHV+LEC LQSHPNMVIL EEVA SK+TLFD+TKQ+CD
Sbjct  247   ISTDALSAEKYYYFIRLMGRRASHVSLECALQSHPNMVILGEEVATSKMTLFDVTKQICD  306

Query  972   AVQARAEQDKYHGVILLPEGLIESIPEIYALLKEIHVLLREGVSANNISSQLSPWASALF  1151
             A+QARAE +KYHGVILLPEGLIESIPE+YALL+EIH L ++ +   +I ++LSPWASALF
Sbjct  307   AIQARAEHEKYHGVILLPEGLIESIPEVYALLQEIHGLQKQDIEVEHIPTRLSPWASALF  366

Query  1152  EFLPPFIRRELLLYPESDDSAQL  1220
             EFLPPFI+++ LL  ESDDS QL
Sbjct  367   EFLPPFIKKQFLLDRESDDSVQL  389



>ref|XP_006660071.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha-like [Oryza brachyantha]
Length=631

 Score =   480 bits (1235),  Expect = 4e-161, Method: Compositional matrix adjust.
 Identities = 243/362 (67%), Positives = 294/362 (81%), Gaps = 3/362 (1%)
 Frame = +3

Query  135   LQGTTVRVEFGDATTAADPSGGHTISRLFPHTFGQPLAHFLRASAKVPDAQIITEHPAIR  314
             + G TV+VE+GD TT  DP+  + ++  FP T+GQPL  F+   A    A        +R
Sbjct  43    MSGATVKVEYGDPTTTIDPTCANVVADAFPCTYGQPLVSFVAPPAD---AAADEARKPLR  99

Query  315   VGIVFCGRQSPGGHNAIWGLYDALKVHNPNSTllgflggseglfAQKTLEITDDILATYK  494
             VG+VF GRQSPGGHN IWGL+DALK +NP+S L GF+GG+EGLFA KT+EITDD+LA+YK
Sbjct  100   VGVVFSGRQSPGGHNVIWGLHDALKAYNPHSVLYGFVGGTEGLFANKTIEITDDVLASYK  159

Query  495   NQGGYDMLGRTKDQIRSTEQVNAALTACTSLKLDGLVIVGGVTSNTDaaylaeafaeaKC  674
             NQGG+D+LGR+ DQIRST+QVNAA+T C +L LDGLVI+GGVTSN+DAA LAE   +  C
Sbjct  160   NQGGFDLLGRSIDQIRSTKQVNAAMTTCNNLNLDGLVIIGGVTSNSDAAQLAETLVQNNC  219

Query  675   PTKVVGVPVTLNGDLKNQFVETNVGFDTICKVNSQLISNVCTDALSAEKYYYFIRLMGRK  854
              TKVVGVPV+LNGDLKNQFVET VGFDT+CKVNSQL+SNVC DA+SA KYYYF+RLMGRK
Sbjct  220   KTKVVGVPVSLNGDLKNQFVETTVGFDTVCKVNSQLVSNVCLDAISAGKYYYFVRLMGRK  279

Query  855   TSHVALECTLQSHPNMVILAEEVAASKLTLFDITKQVCDAVQARAEQDKYHGVILLPEGL  1034
              SHVA EC LQSHPNM+ILAEEVA SKLTL ++  ++CD VQARAE  K+HGV+L+PEGL
Sbjct  280   ASHVAFECALQSHPNMLILAEEVALSKLTLMEVISKICDGVQARAELGKFHGVLLIPEGL  339

Query  1035  IESIPEIYALLKEIHVLLREGVSANNISSQLSPWASALFEFLPPFIRRELLLYPESDDSA  1214
             IESIPE+YAL++EI++L    V    + SQLSPWA+ALF+FLPPFIRRELLL+ ESD+SA
Sbjct  340   IESIPEMYALIQEINILHNNNVPVAEMPSQLSPWAAALFQFLPPFIRRELLLHQESDNSA  399

Query  1215  QL  1220
             QL
Sbjct  400   QL  401



>ref|XP_002444175.1| hypothetical protein SORBIDRAFT_07g012720 [Sorghum bicolor]
 gb|EES13670.1| hypothetical protein SORBIDRAFT_07g012720 [Sorghum bicolor]
Length=582

 Score =   456 bits (1174),  Expect = 1e-152, Method: Compositional matrix adjust.
 Identities = 234/332 (70%), Positives = 277/332 (83%), Gaps = 3/332 (1%)
 Frame = +3

Query  225   HTFGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPN  404
             HTFGQPL  F+  SA    A+    HP IRVG+VF GRQSPGGHN +WGL+DALK +NP 
Sbjct  24    HTFGQPLVSFVAPSADAAAAE--ERHP-IRVGVVFSGRQSPGGHNVVWGLHDALKAYNPQ  80

Query  405   STllgflggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTS  584
             S L GF+GG+EGLFA KTL +TDD+LA+YKNQGG+D+LGR+ DQIR+T+QVNAA+T C S
Sbjct  81    SVLYGFVGGTEGLFANKTLVLTDDVLASYKNQGGFDLLGRSIDQIRTTKQVNAAMTTCRS  140

Query  585   LKLDGLVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTIC  764
             L LDGLVI+GGVTSN+DAA LAE   +  C TKVVGVPV+LNGDLKNQFVET VGFDT+C
Sbjct  141   LNLDGLVIIGGVTSNSDAAQLAETLIQNNCKTKVVGVPVSLNGDLKNQFVETTVGFDTVC  200

Query  765   KVNSQLISNVCTDALSAEKYYYFIRLMGRKTSHVALECTLQSHPNMVILAEEVAASKLTL  944
             KVNSQL+SNVC DA+SA KYYYF+RLMGRK SHVA EC LQSHPNM+IL EEVA SKLTL
Sbjct  201   KVNSQLVSNVCLDAISAGKYYYFVRLMGRKASHVAFECALQSHPNMLILGEEVALSKLTL  260

Query  945   FDITKQVCDAVQARAEQDKYHGVILLPEGLIESIPEIYALLKEIHVLLREGVSANNISSQ  1124
              +I  ++CD VQARAE  KYHGV+++PEGLIESIPE+YA+++EI++L    V    +SSQ
Sbjct  261   MEIINKICDGVQARAELGKYHGVLVIPEGLIESIPEMYAIIQEINILHNNNVPVAEMSSQ  320

Query  1125  LSPWASALFEFLPPFIRRELLLYPESDDSAQL  1220
             LSPWA+ALF+FLPPFIRRELLL+ ESD+SAQL
Sbjct  321   LSPWAAALFQFLPPFIRRELLLHQESDNSAQL  352



>gb|AGY61461.1| pyrophosphate-fructose-6-phosphate-phosphotransferase alpha2, 
partial [Rorippa amphibia]
 gb|AGY61462.1| pyrophosphate-fructose-6-phosphate-phosphotransferase alpha2, 
partial [Rorippa sylvestris]
Length=267

 Score =   441 bits (1134),  Expect = 3e-151, Method: Compositional matrix adjust.
 Identities = 233/267 (87%), Positives = 248/267 (93%), Gaps = 0/267 (0%)
 Frame = +3

Query  258   RASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNSTllgflggse  437
             RA+AKVPDAQIITEH   RVGIVF GRQ+PGGHN IWGLYDALKVHN  +TLLGFLGGSE
Sbjct  1     RATAKVPDAQIITEHSPKRVGIVFSGRQAPGGHNVIWGLYDALKVHNAKNTLLGFLGGSE  60

Query  438   glfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLKLDGLVIVGG  617
             GLFAQKTLEITDD+L TYKNQGGYD+LGRTKDQIR+T QVNAAL ACT LKLDGLVI+GG
Sbjct  61    GLFAQKTLEITDDVLQTYKNQGGYDLLGRTKDQIRTTVQVNAALKACTDLKLDGLVIIGG  120

Query  618   VTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICKVNSQLISNVC  797
             VTSNTDAA+LAE FAEAKCPTKVVGVPVT+NGDLKNQFVE NVGFDTICKVNSQLISNVC
Sbjct  121   VTSNTDAAHLAEFFAEAKCPTKVVGVPVTINGDLKNQFVEANVGFDTICKVNSQLISNVC  180

Query  798   TDALSAEKYYYFIRLMGRKTSHVALECTLQSHPNMVILAEEVAASKLTLFDITKQVCDAV  977
              DALSAEKYYYF+RLMGRK SHVALECTLQSHPNMVIL EEV ASKLT+FDI KQ+CDAV
Sbjct  181   IDALSAEKYYYFVRLMGRKHSHVALECTLQSHPNMVILGEEVTASKLTIFDIAKQICDAV  240

Query  978   QARAEQDKYHGVILLPEGLIESIPEIY  1058
             QARAEQDK HGVIL+PEGL+ESIPE+Y
Sbjct  241   QARAEQDKNHGVILIPEGLVESIPELY  267



>ref|XP_001755711.1| predicted protein [Physcomitrella patens]
 gb|EDQ79384.1| predicted protein [Physcomitrella patens]
Length=621

 Score =   449 bits (1155),  Expect = 3e-149, Method: Compositional matrix adjust.
 Identities = 235/389 (60%), Positives = 302/389 (78%), Gaps = 7/389 (2%)
 Frame = +3

Query  69    LARELSDLQKL---RSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHTFGQ  239
             L R++S LQ L   R+QY+P +PP L+  +V+V  GDA+  A+ S    +S  +PHT+G 
Sbjct  5     LHRKVSKLQGLSAVRAQYQPRVPPALKCGSVKVSVGDASATAELSDRLAVSEAYPHTYGL  64

Query  240   PLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNSTllg  419
             PL   +  S+  P+A      P  R+G+ FCGRQSPGGHN I GL+DALK  N NS L+G
Sbjct  65    PLVQLM--SSGGPNATTAKHLPLSRIGVAFCGRQSPGGHNVITGLFDALKSQNANSILIG  122

Query  420   flggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLKLDG  599
             F+GG+EG+F+Q+T+E+T+D+L  ++NQGGYD+LGRTKDQI+S +Q+  A  AC +LKLD 
Sbjct  123   FIGGTEGIFSQRTVELTNDMLKDFRNQGGYDLLGRTKDQIKSYQQIKDAKAACEALKLDV  182

Query  600   LVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICKVNSQ  779
             LV++GG  +N+DAA LAE F E+ C TKVVG+PVT++GDLKNQFVETNVGFDT CKV SQ
Sbjct  183   LVLIGGCGTNSDAAQLAEFFLESGCTTKVVGIPVTIDGDLKNQFVETNVGFDTTCKVYSQ  242

Query  780   LISNVCTDALSAEKYYYFIRLMGRKTSHVALECTLQSHPNMVILAEEVAASKLTLFDITK  959
             LISN+CTDALSAEKYYYFIRLMGR+ SHV+LECTLQS  NMV+L EEVA SK+TLFD+T 
Sbjct  243   LISNICTDALSAEKYYYFIRLMGRQASHVSLECTLQSQSNMVLLGEEVANSKMTLFDVTM  302

Query  960   QVCDAVQARAEQDKYHGVILLPEGLIESIPEIYALLKEIHVLLR--EGVSANNISSQLSP  1133
             Q+CDA+QAR EQ K +GV+LLPEGLIE IPE  ALL+EI+ L +  E +  +NISS+L+ 
Sbjct  303   QICDAIQARGEQGKNYGVVLLPEGLIERIPEFRALLQEINTLRKQDEDIGVDNISSRLTL  362

Query  1134  WASALFEFLPPFIRRELLLYPESDDSAQL  1220
             WA+AL++FLP FI+++LLL  ESD S QL
Sbjct  363   WAAALYDFLPIFIKKQLLLDRESDGSVQL  391



>gb|AAO72618.1| fructose-6-phosphate 1-phosphotransferase [Oryza sativa Japonica 
Group]
Length=449

 Score =   434 bits (1115),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 220/304 (72%), Positives = 260/304 (86%), Gaps = 4/304 (1%)
 Frame = +3

Query  309   IRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNSTllgflggseglfAQKTLEITDDILAT  488
              RVG+VF GRQSPGGHN IWGL+DALK +NP+S L GF+GG+EGLFA KT+EITDD+LA+
Sbjct  28    FRVGVVFSGRQSPGGHNVIWGLHDALKAYNPHSVLYGFVGGTEGLFANKTIEITDDVLAS  87

Query  489   YKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLKLDGLVIVGGVTSNTDaaylaeafaea  668
             YKNQGG+D+LGR+ DQIRST+QVNAA+T C +L LDGLVI+GGVTSN+DAA LAEA  + 
Sbjct  88    YKNQGGFDLLGRSIDQIRSTKQVNAAMTTCNNLNLDGLVIIGGVTSNSDAAQLAEALVQN  147

Query  669   KCPTKVVGVPVTLNGDLKNQFVETNVGFDTICKVNSQLISNVCTDALSAEKYYYFIRLMG  848
              C TKVVGVPV+LNGDLKNQFVET VGFDT+CK    L+SNVC DA+SA KYYYF+RLMG
Sbjct  148   NCKTKVVGVPVSLNGDLKNQFVETTVGFDTVCK----LVSNVCLDAISAGKYYYFVRLMG  203

Query  849   RKTSHVALECTLQSHPNMVILAEEVAASKLTLFDITKQVCDAVQARAEQDKYHGVILLPE  1028
             RK SHVA EC LQSHPNM+ILAEEVA SKLTL ++  ++CD VQARAE  K+HGV+L+PE
Sbjct  204   RKASHVAFECALQSHPNMLILAEEVALSKLTLMEVINKICDGVQARAELGKFHGVLLIPE  263

Query  1029  GLIESIPEIYALLKEIHVLLREGVSANNISSQLSPWASALFEFLPPFIRRELLLYPESDD  1208
             GLIESIPE+YALL+EI++L    V    + SQLSPWA+ALF+FLPPFIRRELLL+ ESD+
Sbjct  264   GLIESIPEMYALLQEINILHNNNVPVAEMPSQLSPWAAALFQFLPPFIRRELLLHQESDN  323

Query  1209  SAQL  1220
             SAQL
Sbjct  324   SAQL  327



>ref|XP_011041142.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha isoform X2 [Populus euphratica]
Length=489

 Score =   429 bits (1102),  Expect = 4e-143, Method: Compositional matrix adjust.
 Identities = 215/243 (88%), Positives = 228/243 (94%), Gaps = 0/243 (0%)
 Frame = +3

Query  492   KNQGGYDMLGRTKDQIRSTEQVNAALTACTSLKLDGLVIVGGVTSNTDaaylaeafaeaK  671
             K QGGYD+LGRTKDQIR+TEQVNAALTAC  LKLDGLVI+GGVTSNTDAA LAE FAEAK
Sbjct  20    KMQGGYDLLGRTKDQIRTTEQVNAALTACKDLKLDGLVIIGGVTSNTDAAQLAETFAEAK  79

Query  672   CPTKVVGVPVTLNGDLKNQFVETNVGFDTICKVNSQLISNVCTDALSAEKYYYFIRLMGR  851
             CPTKVVGVPVT NGDLKNQFVETNVGFDTICKVNSQLISNVCTDALSAEKYYYFIRLMGR
Sbjct  80    CPTKVVGVPVTFNGDLKNQFVETNVGFDTICKVNSQLISNVCTDALSAEKYYYFIRLMGR  139

Query  852   KTSHVALECTLQSHPNMVILAEEVAASKLTLFDITKQVCDAVQARAEQDKYHGVILLPEG  1031
             K SHVALECTLQSHPNMVIL EEVAASKLTLFD+T Q+CDAVQARA QDK HGVILLPEG
Sbjct  140   KASHVALECTLQSHPNMVILGEEVAASKLTLFDLTTQICDAVQARAVQDKNHGVILLPEG  199

Query  1032  LIESIPEIYALLKEIHVLLREGVSANNISSQLSPWASALFEFLPPFIRRELLLYPESDDS  1211
             LIESIPE+YALLKEIH LLR GV+ +NISSQLSPW SALFEFLPP+I+++LLL+PESDDS
Sbjct  200   LIESIPEVYALLKEIHGLLRHGVAPDNISSQLSPWTSALFEFLPPYIKKQLLLHPESDDS  259

Query  1212  AQL  1220
             AQL
Sbjct  260   AQL  262



>gb|EMT11806.1| Pyrophosphate--fructose 6-phosphate 1-phosphotransferase subunit 
alpha [Aegilops tauschii]
Length=558

 Score =   429 bits (1104),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 213/258 (83%), Positives = 237/258 (92%), Gaps = 0/258 (0%)
 Frame = +3

Query  447   AQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLKLDGLVIVGGVTS  626
             AQKTLEIT+++ ++YKNQGGY MLGRT+DQIR+TEQV AA+T C +LKLD LVI+GGVTS
Sbjct  74    AQKTLEITEEVFSSYKNQGGYYMLGRTRDQIRTTEQVKAAMTTCQALKLDALVIIGGVTS  133

Query  627   NTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICKVNSQLISNVCTDA  806
             NTDAA LAE FAE+KC TKVVGVPVTLNGDLKNQFVET VGFDTICKVNSQLISNVCTDA
Sbjct  134   NTDAAQLAETFAESKCSTKVVGVPVTLNGDLKNQFVETTVGFDTICKVNSQLISNVCTDA  193

Query  807   LSAEKYYYFIRLMGRKTSHVALECTLQSHPNMVILAEEVAASKLTLFDITKQVCDAVQAR  986
             LSAEKYYYFIRLMGRK SHVALEC LQSHPNMV+L EEVAASKLT+ DITKQ+CDAVQAR
Sbjct  194   LSAEKYYYFIRLMGRKASHVALECALQSHPNMVLLGEEVAASKLTISDITKQICDAVQAR  253

Query  987   AEQDKYHGVILLPEGLIESIPEIYALLKEIHVLLREGVSANNISSQLSPWASALFEFLPP  1166
             AE+DKYHGVIL+PEGL+ESIPE+YALL+EIH L  +GV   NISS LSPWASALF+FLPP
Sbjct  254   AEKDKYHGVILIPEGLVESIPELYALLQEIHGLHDKGVFIENISSHLSPWASALFDFLPP  313

Query  1167  FIRRELLLYPESDDSAQL  1220
             FIR++LLL+PESDDSAQL
Sbjct  314   FIRKQLLLHPESDDSAQL  331



>gb|EMS49340.1| Pyrophosphate--fructose 6-phosphate 1-phosphotransferase subunit 
alpha [Triticum urartu]
Length=794

 Score =   410 bits (1054),  Expect = 5e-132, Method: Compositional matrix adjust.
 Identities = 219/351 (62%), Positives = 263/351 (75%), Gaps = 27/351 (8%)
 Frame = +3

Query  141   GTTVRVEFGDATTAADPSGGHTISRLFPHTFGQPLAHFLRASAKVPDAQIITEHPAIRVG  320
             G TVRVE+GDAT   DP+G H +++ FP  +GQ L  FL         + + E P IRVG
Sbjct  141   GATVRVEYGDATATIDPTGAHAVAQAFPRPYGQRLVTFLAPDGTAGAGKAVDERPPIRVG  200

Query  321   IVFCGRQSPGGHNAIWGLYDALKVHNPNSTllgflggseglfAQKTLEITDDILATYKNQ  500
             +VF GRQSPGGHN +WGL+DALK +NP S L GF+GG+EGLFA KTLEITDD+LA+YKNQ
Sbjct  201   VVFSGRQSPGGHNVVWGLHDALKAYNPQSILYGFIGGTEGLFANKTLEITDDVLASYKNQ  260

Query  501   GGYDMLGRTKDQIRSTEQVNAALTACTSLKLDGLVIVGGVTSNTDaaylaeafaeaKCPT  680
             GG+D+LGR+ DQIRS++QV+AA+T C  L LDGLVIVGGVTSN+DAA LAE   +  C T
Sbjct  261   GGFDLLGRSIDQIRSSKQVSAAMTTCQDLNLDGLVIVGGVTSNSDAAQLAETLVQKNCKT  320

Query  681   K--------------VVGVPVTLNGDLKNQFVETNVGFDTICKVNSQLISNVCTDALSAE  818
             K              VVGVPV+LNGDLKNQFVET VGFDT+CKVNSQLISNVC DA+SA 
Sbjct  321   KGPRSLSGTNVFIEQVVGVPVSLNGDLKNQFVETTVGFDTVCKVNSQLISNVCLDAISAG  380

Query  819   KYYYFIRLMGRKTSHVALECTLQSHPNMVILAEEVAASKLTLFDITKQVCDAVQARAE--  992
             KYYYF+RLMGRK SHVALEC LQSHPNM+I+ EEVA SKLTL ++  ++CD VQARAE  
Sbjct  381   KYYYFVRLMGRKASHVALECALQSHPNMLIMGEEVALSKLTLMEVINKICDGVQARAELG  440

Query  993   -----QDKYHGVILLPEGLIESIPEIYALLKEIHVLLREGVSANNISSQLS  1130
                    K+HGV+L+PEGLIESIPE+YAL   I +LL +    ++ S+QLS
Sbjct  441   LYSPSAGKHHGVLLIPEGLIESIPEMYAL---IQLLLHQ---ESDNSAQLS  485



>ref|XP_008788667.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha-like isoform X1 [Phoenix dactylifera]
Length=361

 Score =   387 bits (995),  Expect = 8e-129, Method: Compositional matrix adjust.
 Identities = 193/230 (84%), Positives = 213/230 (93%), Gaps = 0/230 (0%)
 Frame = +3

Query  531   DQIRSTEQVNAALTACTSLKLDGLVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLN  710
             DQIR+TEQVNAALT C +L+LDGLVI+GGVTSNTDAA LAE FAEAKC TKVVGVPVT  
Sbjct  2     DQIRTTEQVNAALTTCQTLRLDGLVIIGGVTSNTDAAQLAETFAEAKCSTKVVGVPVTFY  61

Query  711   GDLKNQFVETNVGFDTICKVNSQLISNVCTDALSAEKYYYFIRLMGRKTSHVALECTLQS  890
             GDLKNQFVE NVGFDTICKVNSQLISN+CTDALSAEKYYYFIRLMGR+ SHVALEC LQS
Sbjct  62    GDLKNQFVEANVGFDTICKVNSQLISNICTDALSAEKYYYFIRLMGRRASHVALECALQS  121

Query  891   HPNMVILAEEVAASKLTLFDITKQVCDAVQARAEQDKYHGVILLPEGLIESIPEIYALLK  1070
             HPNMVIL+EEVAASKLTL+DITKQ+CDAVQARAE  KYHGVILLPEGLIESIPE+YALL+
Sbjct  122   HPNMVILSEEVAASKLTLYDITKQICDAVQARAELGKYHGVILLPEGLIESIPEVYALLQ  181

Query  1071  EIHVLLREGVSANNISSQLSPWASALFEFLPPFIRRELLLYPESDDSAQL  1220
             EIHVLL++GVS  +IS QLSPWASAL+E +PPFI+++LLL PESD+SAQL
Sbjct  182   EIHVLLKKGVSVGSISKQLSPWASALYESMPPFIKKQLLLSPESDESAQL  231



>gb|ABC69165.1| phosphofructokinase V11 [Gossypium hirsutum]
Length=267

 Score =   382 bits (982),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 205/229 (90%), Positives = 218/229 (95%), Gaps = 0/229 (0%)
 Frame = +3

Query  369   GLYDALKVHNPNSTllgflggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRST  548
             GL+ ALK+HNPNSTLLGFLGG++GLFAQKTLEITDDIL+TYKNQGGYD+LGRT+DQIR+T
Sbjct  17    GLHKALKIHNPNSTLLGFLGGTQGLFAQKTLEITDDILSTYKNQGGYDLLGRTQDQIRTT  76

Query  549   EQVNAALTACTSLKLDGLVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQ  728
             EQV AAL AC  LKLDGLVI+GGVTSNTDAA LAE FAEAKCPT VVGVPVTLNGDLKNQ
Sbjct  77    EQVKAALAACNDLKLDGLVIIGGVTSNTDAAQLAETFAEAKCPTMVVGVPVTLNGDLKNQ  136

Query  729   FVETNVGFDTICKVNSQLISNVCTDALSAEKYYYFIRLMGRKTSHVALECTLQSHPNMVI  908
             FVET+VGFDTICKVNSQLISNVCTDALSAEKYYYFIRLMGRK SHVALECTLQSHPNMVI
Sbjct  137   FVETDVGFDTICKVNSQLISNVCTDALSAEKYYYFIRLMGRKASHVALECTLQSHPNMVI  196

Query  909   LAEEVAASKLTLFDITKQVCDAVQARAEQDKYHGVILLPEGLIESIPEI  1055
             L EEVAASKLTLFDITKQ+CDAV+ARAEQDK HGVILLPEGLIESIPE+
Sbjct  197   LGEEVAASKLTLFDITKQICDAVRARAEQDKNHGVILLPEGLIESIPEV  245



>ref|XP_004956506.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha-like isoform X2 [Setaria italica]
Length=509

 Score =   383 bits (983),  Expect = 6e-125, Method: Compositional matrix adjust.
 Identities = 199/279 (71%), Positives = 239/279 (86%), Gaps = 0/279 (0%)
 Frame = +3

Query  384   LKVHNPNSTllgflggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNA  563
             +K  NP++ LLGF+GG+EGLFA+K LEITDD+L++YKNQGG+D+LGRT DQIR+TEQVNA
Sbjct  1     MKAQNPHNVLLGFIGGTEGLFAKKMLEITDDVLSSYKNQGGFDLLGRTVDQIRTTEQVNA  60

Query  564   ALTACTSLKLDGLVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETN  743
             A++ C  L LDGL+I+GGVTSN+DAA LAE FA+  C TKV+GVPVTL+GDLKNQFVET 
Sbjct  61    AMSTCCDLSLDGLIIIGGVTSNSDAAQLAETFAKHNCNTKVIGVPVTLSGDLKNQFVETT  120

Query  744   VGFDTICKVNSQLISNVCTDALSAEKYYYFIRLMGRKTSHVALECTLQSHPNMVILAEEV  923
             VGFDT+CKVNSQLISNVC DA+SA KYYYF+RLMG K SHVA EC LQSHPNMVIL EEV
Sbjct  121   VGFDTVCKVNSQLISNVCLDAVSAGKYYYFVRLMGGKASHVAFECALQSHPNMVILGEEV  180

Query  924   AASKLTLFDITKQVCDAVQARAEQDKYHGVILLPEGLIESIPEIYALLKEIHVLLREGVS  1103
             A SKLTL +I  ++CD V+ARA + KYHGV+L+PEGLIESIPE+YAL++EI+ L    V 
Sbjct  181   ALSKLTLMEIINKICDGVEARAARGKYHGVLLIPEGLIESIPEMYALIQEINNLYINNVP  240

Query  1104  ANNISSQLSPWASALFEFLPPFIRRELLLYPESDDSAQL  1220
              + I SQLSPWA+ALF+FLP FIRREL+L+ ESD+SAQL
Sbjct  241   EDEIPSQLSPWAAALFKFLPSFIRRELVLHQESDNSAQL  279



>tpg|DAA60935.1| TPA: hypothetical protein ZEAMMB73_638083 [Zea mays]
Length=509

 Score =   383 bits (983),  Expect = 7e-125, Method: Compositional matrix adjust.
 Identities = 202/279 (72%), Positives = 243/279 (87%), Gaps = 0/279 (0%)
 Frame = +3

Query  384   LKVHNPNSTllgflggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNA  563
             +K  NP+S LLGFLGG+EGLFA+KTLEIT+D+L++YKNQGG+D+LGRT DQIR+TEQV+A
Sbjct  1     MKARNPHSVLLGFLGGTEGLFAKKTLEITEDMLSSYKNQGGFDLLGRTVDQIRTTEQVDA  60

Query  564   ALTACTSLKLDGLVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETN  743
             A +AC  L LDGL+I+GGVTSN+DAA LAE FAE  C TKV+GVPVTL+GDL+NQFVE  
Sbjct  61    AKSACCDLNLDGLIIIGGVTSNSDAAQLAEFFAEHDCKTKVIGVPVTLSGDLRNQFVEAT  120

Query  744   VGFDTICKVNSQLISNVCTDALSAEKYYYFIRLMGRKTSHVALECTLQSHPNMVILAEEV  923
             VGFDT+CKVNSQLISNVC DA+SA KYYYF+RLMG K SHVALEC LQSHPNMVIL EEV
Sbjct  121   VGFDTVCKVNSQLISNVCLDAISAGKYYYFVRLMGGKASHVALECALQSHPNMVILGEEV  180

Query  924   AASKLTLFDITKQVCDAVQARAEQDKYHGVILLPEGLIESIPEIYALLKEIHVLLREGVS  1103
             A SKLTL +IT ++CD V+ARA+Q KYHGV+++PEGLIESIPE+YAL++EI+ L    V+
Sbjct  181   AFSKLTLKEITNKICDGVEARADQGKYHGVLVIPEGLIESIPEMYALIQEINNLHSSNVT  240

Query  1104  ANNISSQLSPWASALFEFLPPFIRRELLLYPESDDSAQL  1220
               +I SQLSPWA+ALF+FLP FIRREL+L+ ESD+SAQL
Sbjct  241   EADIPSQLSPWAAALFKFLPSFIRRELILHQESDNSAQL  279



>gb|ABR16683.1| unknown [Picea sitchensis]
Length=558

 Score =   369 bits (948),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 207/392 (53%), Positives = 275/392 (70%), Gaps = 15/392 (4%)
 Frame = +3

Query  45    VKMDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFP  224
             + M++D G+      +QKLRS + P++PP L+G  V++  GD T+AA       I + F 
Sbjct  1     MDMENDTGI------MQKLRSLFVPQIPPALEGGRVQLLRGDTTSAAHSDDEDEIRKSFN  54

Query  225   HTFGQPLAHFLRASAKVPDAQIITEH---PAI-RVGIVF-CGRQSPGGHNAIWGLYDALK  389
              T+GQPL  F+  S  + D +   E    PA+ RVG+VF    +SPG HN I G++DALK
Sbjct  55    FTYGQPLVQFV--SQNLVDGE--NEENICPAVTRVGVVFGMEAESPGAHNVIAGIFDALK  110

Query  390   VHNPNSTllgflggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAAL  569
              HN  S L GF+GG+EGL +Q  L +TDD+L +Y+NQGG D+L ++  +I   +    A 
Sbjct  111   AHNNKSILFGFVGGTEGLCSQNALVVTDDMLKSYRNQGGSDLLEQSSKKIHDFQHREEAR  170

Query  570   TACTSLKLDGLVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVG  749
              +C +LKLDGLV VGG ++NTDAA LAE F   KC T VVGVPVTL GDLKN+FVET+VG
Sbjct  171   RSCITLKLDGLVFVGGCSTNTDAARLAEYFKSRKCQTTVVGVPVTLEGDLKNEFVETDVG  230

Query  750   FDTICKVNSQLISNVCTDALSAEKYYYFIRLMGRKTSHVALECTLQSHPNMVILAEEVAA  929
             FDT+CK +SQLI N+C DALSA KYY+FIRLMG++ SHVALEC+ QSHPN+VIL EEVA 
Sbjct  231   FDTVCKFSSQLIGNICLDALSAGKYYFFIRLMGKEASHVALECSFQSHPNLVILGEEVAT  290

Query  930   SKLTLFDITKQVCDAVQARAEQDKYHGVILLPEGLIESIPEIYALLKEIHVLLREGVSAN  1109
             S +TL  +T ++CDAVQARA++ KYHGVI+L EGLIE+I +   L++EI  LL+EG+S  
Sbjct  291   SNMTLSQVTNRICDAVQARADKGKYHGVIVLSEGLIENIVDTQLLIQEIKGLLKEGISTQ  350

Query  1110  NISSQLSPWASALFEFLPPFIRRELLLYPESD  1205
                S LSPWA+AL + LP  I+++LL   E++
Sbjct  351   KCLSLLSPWAAALLKSLPLLIQKQLLEEMETE  382



>gb|AFK40094.1| unknown [Lotus japonicus]
Length=246

 Score =   353 bits (906),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 168/182 (92%), Positives = 175/182 (96%), Gaps = 0/182 (0%)
 Frame = +3

Query  675   PTKVVGVPVTLNGDLKNQFVETNVGFDTICKVNSQLISNVCTDALSAEKYYYFIRLMGRK  854
             PTKVVGVPVTLNGDLKNQFVETNVGFDTICKVNSQLISNVCTDALSAEKYYYFIRLMGRK
Sbjct  15    PTKVVGVPVTLNGDLKNQFVETNVGFDTICKVNSQLISNVCTDALSAEKYYYFIRLMGRK  74

Query  855   TSHVALECTLQSHPNMVILAEEVAASKLTLFDITKQVCDAVQARAEQDKYHGVILLPEGL  1034
              SHVALECTLQSHPNMVIL EEVAASKLTLF+ITKQ+ DAVQARAEQDKYHGVILLPEGL
Sbjct  75    ASHVALECTLQSHPNMVILGEEVAASKLTLFEITKQISDAVQARAEQDKYHGVILLPEGL  134

Query  1035  IESIPEIYALLKEIHVLLREGVSANNISSQLSPWASALFEFLPPFIRRELLLYPESDDSA  1214
             IESIPE+YALLKEIH LLR+GV+   ISSQLSPWASALFEFLPPFIR++LLLYPESDDSA
Sbjct  135   IESIPEVYALLKEIHTLLRQGVAVGKISSQLSPWASALFEFLPPFIRKQLLLYPESDDSA  194

Query  1215  QL  1220
             QL
Sbjct  195   QL  196



>ref|XP_008788668.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha-like isoform X2 [Phoenix dactylifera]
Length=339

 Score =   327 bits (839),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 174/236 (74%), Positives = 193/236 (82%), Gaps = 27/236 (11%)
 Frame = +3

Query  513   MLGRTKDQIRSTEQVNAALTACTSLKLDGLVIVGGVTSNTDaaylaeafaeaKCPTKVVG  692
             MLGRT DQIR+TEQVNAALT C +L+LDGLVI+GGVTSNTDAA LAE FAEAKC TKVVG
Sbjct  1     MLGRTMDQIRTTEQVNAALTTCQTLRLDGLVIIGGVTSNTDAAQLAETFAEAKCSTKVVG  60

Query  693   VPVTLNGDLKNQFVETNVGFDTICKVNSQLISNVCTDALSAEKYYYFIRLMGRKTSHVAL  872
             VPVT  GDLKNQFVE NVGFDTICKVNSQLISN+CTDALSAEK                 
Sbjct  61    VPVTFYGDLKNQFVEANVGFDTICKVNSQLISNICTDALSAEK-----------------  103

Query  873   ECTLQSHPNMVILAEEVAASKLTLFDITKQVCDAVQARAEQDKYHGVILLPEGLIESIPE  1052
                       VIL+EEVAASKLTL+DITKQ+CDAVQARAE  KYHGVILLPEGLIESIPE
Sbjct  104   ----------VILSEEVAASKLTLYDITKQICDAVQARAELGKYHGVILLPEGLIESIPE  153

Query  1053  IYALLKEIHVLLREGVSANNISSQLSPWASALFEFLPPFIRRELLLYPESDDSAQL  1220
             +YALL+EIHVLL++GVS  +IS QLSPWASAL+E +PPFI+++LLL PESD+SAQL
Sbjct  154   VYALLQEIHVLLKKGVSVGSISKQLSPWASALYESMPPFIKKQLLLSPESDESAQL  209



>emb|CBK21183.2| unnamed protein product [Blastocystis hominis]
 emb|CBK23261.2| unnamed protein product [Blastocystis hominis]
Length=606

 Score =   315 bits (807),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 178/400 (45%), Positives = 246/400 (62%), Gaps = 12/400 (3%)
 Frame = +3

Query  24    ESGEKGQVKMDSDFGLARELSDLQKLRSQYRPELPPCLQG-TTVRVEFGDATTAADPSGG  200
             ES + G + +D       +LS L K R  Y+P  P C +    V VEF D TT  D    
Sbjct  5     ESIQTGNIHIDEGERNIEDLSPLAKDRINYKPRYPACFENPEKVNVEFFDHTTFKDIDRP  64

Query  201   HTISRLFPHTFGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYD  380
               +   FP++   P+  F+    +           A+ VGIVFCGRQS GGHN I G++D
Sbjct  65    -LLEGYFPNSIHYPIMKFVDEEGRTD---------ALNVGIVFCGRQSSGGHNVITGVFD  114

Query  381   ALKVHNPNSTllgflggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVN  560
              L   NPNS L GF+GG+ GLF   ++E+T++ L  Y+N GGYD+LGR+ D+I S E  +
Sbjct  115   YLHKMNPNSKLYGFIGGTSGLFEGSSVELTEEKLKLYRNMGGYDLLGRSADKI-SEEDYS  173

Query  561   AALTACTSLKLDGLVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVET  740
               +  CT L L GLV++GG  + TDA  L E F  +   T++V VP   + DLKN F+ET
Sbjct  174   KVVATCTKLNLHGLVLIGGAYTATDATLLTEFFLNSGVTTRIVVVPCDYSRDLKNHFIET  233

Query  741   NVGFDTICKVNSQLISNVCTDALSAEKYYYFIRLMGRKTSHVALECTLQSHPNMVILAEE  920
              VGFDT C+  SQLI N+CTD+ SA KYY+FIRL+GR  SHV LE  LQSHPN  +++EE
Sbjct  234   TVGFDTFCRTVSQLIGNICTDSRSAAKYYHFIRLLGRSPSHVVLESALQSHPNYAVISEE  293

Query  921   VAASKLTLFDITKQVCDAVQARAEQDKYHGVILLPEGLIESIPEIYALLKEIHVLLREGV  1100
             VAA ++TL  +  ++ D +  RAE+   +GV+L+PEGLI++I E Y LL EI   + +G+
Sbjct  294   VAAKRMTLLQVVNKIADMICQRAEKGLNYGVVLIPEGLIKAISEFYYLLDEISTYVNKGM  353

Query  1101  SANNISSQLSPWASALFEFLPPFIRRELLLYPESDDSAQL  1220
                 I ++L+PW+ ALF+FLP  I++++   PES  S QL
Sbjct  354   KHEEIYAKLTPWSKALFDFLPAVIQKQIFNPPESRGSFQL  393



>gb|AGY61464.1| pyrophosphate-fructose-6-phosphate-phosphotransferase alpha1, 
partial [Rorippa sylvestris]
Length=185

 Score =   291 bits (745),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 162/185 (88%), Positives = 171/185 (92%), Gaps = 0/185 (0%)
 Frame = +3

Query  228  TFGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNS  407
            T GQPLAHFLRA+AKV DA IITE P+IRVGIVF GRQ+PGGHN IWGLY+ALKVHN  S
Sbjct  1    TLGQPLAHFLRATAKVSDAHIITELPSIRVGIVFSGRQAPGGHNVIWGLYEALKVHNAKS  60

Query  408  TllgflggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSL  587
            TLLGFLGGSEGLFAQKTLEITDDIL TYKNQGGYD+LGRTKDQIR+TEQVNAAL ACT L
Sbjct  61   TLLGFLGGSEGLFAQKTLEITDDILQTYKNQGGYDLLGRTKDQIRTTEQVNAALKACTDL  120

Query  588  KLDGLVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICK  767
            KLDGLVI+GGVTSNTDAA+LAE F EAKCPTKVVGVPVT+NGDLKNQFVE NVGFDTICK
Sbjct  121  KLDGLVIIGGVTSNTDAAHLAEFFVEAKCPTKVVGVPVTINGDLKNQFVEANVGFDTICK  180

Query  768  VNSQL  782
            VNSQL
Sbjct  181  VNSQL  185



>gb|AGY61463.1| pyrophosphate-fructose-6-phosphate-phosphotransferase alpha1, 
partial [Rorippa amphibia]
Length=185

 Score =   291 bits (744),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 161/185 (87%), Positives = 171/185 (92%), Gaps = 0/185 (0%)
 Frame = +3

Query  228  TFGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNS  407
            T GQPLAHFLRA+AKV DA IITE P+IRVGIVF GRQ+PGGHN IWGLY+ALKVHN  S
Sbjct  1    TLGQPLAHFLRATAKVSDAHIITELPSIRVGIVFSGRQAPGGHNVIWGLYEALKVHNAKS  60

Query  408  TllgflggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSL  587
            TLLGFLGGSEGLFAQKTLEITDDIL TYKNQGGYD+LGRTKDQIR+TEQVNAAL ACT L
Sbjct  61   TLLGFLGGSEGLFAQKTLEITDDILQTYKNQGGYDLLGRTKDQIRTTEQVNAALKACTDL  120

Query  588  KLDGLVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICK  767
            KLDGLVI+GGVTSNTDAA+LAE F EAKCPTKVVGVPVT+NGDLKNQFVE NVGFDT+CK
Sbjct  121  KLDGLVIIGGVTSNTDAAHLAEFFVEAKCPTKVVGVPVTINGDLKNQFVEANVGFDTVCK  180

Query  768  VNSQL  782
            VNSQL
Sbjct  181  VNSQL  185



>gb|EMS55626.1| Pyrophosphate--fructose 6-phosphate 1-phosphotransferase subunit 
alpha [Triticum urartu]
Length=451

 Score =   297 bits (761),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 160/229 (70%), Positives = 184/229 (80%), Gaps = 16/229 (7%)
 Frame = +3

Query  567   LTACTSLKLDGLVIVGGVTSNTDaaylaeafaeaKCPTK--VVGVPVTLNGDLKN-----  725
             +T C +LKLD LVI+GGVTSNTDAA LAE FAE+KC TK  +  +P    G +       
Sbjct  1     MTTCQALKLDALVIIGGVTSNTDAAQLAETFAESKCSTKQAIELLPYLACGIILEMHCPP  60

Query  726   ----QFVETNVGFDTICKVNSQLISNVCTDALSAEKYYYFIRLMGRKTSHVALECTLQSH  893
                  F++ + G      VNSQLISNVCTDALSAEKYYYFIRLMGRK SHVALEC LQSH
Sbjct  61    VRLLHFIDLSRG-----TVNSQLISNVCTDALSAEKYYYFIRLMGRKASHVALECALQSH  115

Query  894   PNMVILAEEVAASKLTLFDITKQVCDAVQARAEQDKYHGVILLPEGLIESIPEIYALLKE  1073
             PNMV+L EEVAASKLT+ DITKQ+CDAVQARAE+DKYHGV+L+PEGL+ESIPE+YALL+E
Sbjct  116   PNMVLLGEEVAASKLTISDITKQICDAVQARAEKDKYHGVVLIPEGLVESIPELYALLQE  175

Query  1074  IHVLLREGVSANNISSQLSPWASALFEFLPPFIRRELLLYPESDDSAQL  1220
             IH L  +GVS  NISS LSPWASALF+FLPPFIR++LLL+PESDDSAQL
Sbjct  176   IHGLHDKGVSIENISSHLSPWASALFDFLPPFIRKQLLLHPESDDSAQL  224



>emb|CBK25474.2| unnamed protein product [Blastocystis hominis]
Length=529

 Score =   290 bits (743),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 153/305 (50%), Positives = 210/305 (69%), Gaps = 1/305 (0%)
 Frame = +3

Query  306   AIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNSTllgflggseglfAQKTLEITDDILA  485
             A+ VGIVFCGRQS GGHN I G++D L   NPNS L GF+GG+ GLF   ++E+T++ L 
Sbjct  12    ALNVGIVFCGRQSSGGHNVITGVFDYLHKMNPNSKLYGFIGGTSGLFEGSSVELTEEKLK  71

Query  486   TYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLKLDGLVIVGGVTSNTDaaylaeafae  665
              Y+N GGYD+LGR+ D+I S E  +  +  CT L L GLV++GG  + TDA  L E F  
Sbjct  72    LYRNMGGYDLLGRSADKI-SEEDYSKVVATCTKLNLHGLVLIGGAYTATDATLLTEFFLN  130

Query  666   aKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICKVNSQLISNVCTDALSAEKYYYFIRLM  845
             +   T++V VP   + DLKN F+ET VGFDT C+  SQLI N+CTD+ SA KYY+FIRL+
Sbjct  131   SGVTTRIVVVPCDYSRDLKNHFIETTVGFDTFCRTVSQLIGNICTDSRSAAKYYHFIRLL  190

Query  846   GRKTSHVALECTLQSHPNMVILAEEVAASKLTLFDITKQVCDAVQARAEQDKYHGVILLP  1025
             GR  SHV LE  LQSHPN  +++EEVAA ++TL  +  ++ D +  RAE+   +GV+L+P
Sbjct  191   GRSPSHVVLESALQSHPNYAVISEEVAAKRMTLLQVVNKIADMICQRAEKGLNYGVVLIP  250

Query  1026  EGLIESIPEIYALLKEIHVLLREGVSANNISSQLSPWASALFEFLPPFIRRELLLYPESD  1205
             EGLI++I E Y LL+EI   + +G+    I ++L+PW+ ALF+FLP  I++++   PES 
Sbjct  251   EGLIKAISEFYYLLEEISTYVDKGMKHEEIYAKLTPWSKALFDFLPAVIQKQIFNPPESR  310

Query  1206  DSAQL  1220
              S QL
Sbjct  311   GSFQL  315



>ref|WP_044979330.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Treponema 
putidum]
 gb|AIN94596.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Treponema 
putidum]
Length=563

 Score =   286 bits (733),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 161/382 (42%), Positives = 245/382 (64%), Gaps = 22/382 (6%)
 Frame = +3

Query  84    SDLQKLRSQYRPELPPCLQG--TTVRVEFGDATTAADPSGGHTISRLFPHTFGQPLAHFL  257
             S +Q+LR  Y P++P   +   + ++ E G+AT A   S    +  +FPHT+G P+  F+
Sbjct  4     STMQRLRYHYEPKIPKVFEEPLSLIKPEIGEATHAQ--SNQAELKEIFPHTYGMPIIRFV  61

Query  258   RASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNSTllgflggse  437
             +  ++V       EH  ++ G++  G Q+PGGHN I GL+DALK  +PNS L GFL G E
Sbjct  62    KGKSEV-------EHKPLKFGVILSGGQAPGGHNVISGLFDALKKGSPNSKLYGFLSGPE  114

Query  438   glfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLKLDGLVIVGG  617
             GL   + +EI   ++  Y+N GG+D++G  + +I + EQV +++     L LD LVI+GG
Sbjct  115   GLVKGRYIEIKKSLIDKYRNTGGFDIIGSGRTKIETEEQVESSIQNVKKLNLDALVIIGG  174

Query  618   VTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICKVNSQLISNVC  797
               SNT+AA+LA+ F +AK  TKV+GVP T++GDLKN+++ET+ GFDT  K+ S+LI N+C
Sbjct  175   DDSNTNAAFLAKYFIQAKLNTKVIGVPKTIDGDLKNEYIETSFGFDTATKLYSELIGNIC  234

Query  798   TDALSAEKYYYFIRLMGRKTSHVALECTLQSHPNMVILAEEVAASKLTLFDITKQVCDAV  977
              D  SA KY++FI+LMGR  SH+ALEC L++ PN+ ++ EE+A  K+TL  +T  + D +
Sbjct  235   RDVNSARKYWHFIKLMGRSASHIALECALKTQPNVCLIGEELAEKKVTLQQVTDYIVDII  294

Query  978   QARAEQDKYHGVILLPEGLIESIPEIYALLKEIHVLLREGVSANN-----------ISSQ  1124
               R+++ +  GV+L+PEG+IE IPE+  L++EI+ L+ E  SA +           +   
Sbjct  295   VKRSKKGENFGVVLVPEGIIEFIPEMDELIEEINDLMAEKASAFSKLKTFSGKRSWLQKH  354

Query  1125  LSPWASALFEFLPPFIRRELLL  1190
             LS  A ALF+ LP  I  +LL+
Sbjct  355   LSKKAFALFDSLPENISLQLLM  376



>ref|XP_002984967.1| hypothetical protein SELMODRAFT_234662 [Selaginella moellendorffii]
 gb|EFJ13842.1| hypothetical protein SELMODRAFT_234662 [Selaginella moellendorffii]
Length=560

 Score =   286 bits (732),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 164/381 (43%), Positives = 234/381 (61%), Gaps = 10/381 (3%)
 Frame = +3

Query  84    SDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHTFGQPLAHFLRA  263
             S +Q  R  Y+P +P  L+G   +VE G +T+AA  +G   I++LFP  FGQP  H +  
Sbjct  22    SPVQSSRLDYKPPMPSVLEGH-FKVEHGSSTSAAGDAG--AIAQLFPKLFGQPSVHIVPC  78

Query  264   SAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNSTllgflggsegl  443
             +A         E   +R+G+V  G Q+PGGHN I GL+D L+ H P S LLGF GG  G+
Sbjct  79    AAAA-----FKEEVKLRIGVVLSGGQAPGGHNVIAGLFDYLQKHAPGSLLLGFRGGPAGI  133

Query  444   fAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLKLDGLVIVGGVT  623
                K +EIT + L  Y+NQGG+D++   +D+I + EQ   A      L LDG+V++GG  
Sbjct  134   MRCKYVEITSEFLYPYRNQGGFDIICSGRDKIETPEQFKQAEDTAVKLDLDGIVVIGGDD  193

Query  624   SNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICKVNSQLISNVCTD  803
             SNT+A  LAE F      T V+G P T++GDLK++ V  + GFDT CK+ +++I N+  D
Sbjct  194   SNTNACLLAEYFRARNLKTHVIGCPKTIDGDLKSKEVPISFGFDTACKIYAEMIGNIMVD  253

Query  804   ALSAEKYYYFIRLMGRKTSHVALECTLQSHPNMVILAEEVAASKLTLFDITKQVCDAVQA  983
             A S  KYY+F+RLMGR  SH+ LEC LQ+HPN+ ++ EEV+  K TL  +T  + D +  
Sbjct  254   ARSTGKYYHFVRLMGRAASHITLECALQTHPNVALIGEEVSVKKQTLRQVTNSITDTICK  313

Query  984   RAEQDKYHGVILLPEGLIESIPEIYALLKEIHVLLREGV--SANNISSQLSPWASALFEF  1157
             RAE  +++GVIL+PEGLI+ IPEI  L+ E++ +L  G      +   +LSP   ALF+ 
Sbjct  314   RAENGQHYGVILIPEGLIDFIPEIQHLISELNEILASGTVDEEGHWRHKLSPQCHALFDS  373

Query  1158  LPPFIRRELLLYPESDDSAQL  1220
             LP  I+ ELLL  +   + Q+
Sbjct  374   LPHSIQEELLLERDPHGNVQV  394



>ref|WP_010697336.1| diphosphate-fructose-6-phosphate 1-phosphotransferase [Treponema 
denticola]
 gb|EMB21954.1| diphosphate-fructose-6-phosphate 1-phosphotransferase [Treponema 
denticola SP33]
 gb|EPF35925.1| diphosphate-fructose-6-phosphate 1-phosphotransferase [Treponema 
denticola SP32]
Length=560

 Score =   286 bits (732),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 162/382 (42%), Positives = 244/382 (64%), Gaps = 22/382 (6%)
 Frame = +3

Query  84    SDLQKLRSQYRPELPPCLQG--TTVRVEFGDATTAADPSGGHTISRLFPHTFGQPLAHFL  257
             S +Q+LR  Y P++P       + ++ E G+AT A   S    +  +FPHT+G P+  F+
Sbjct  4     STMQRLRYHYEPKIPKVFAEPLSLIKPEIGEATHAQ--SDQAELKEIFPHTYGMPIIRFV  61

Query  258   RASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNSTllgflggse  437
             +  ++V       EH  ++ G++  G Q+PGGHN I GL+DALK  N NS L GFL G E
Sbjct  62    KGKSEV-------EHTPLKFGVILSGGQAPGGHNVISGLFDALKKGNANSKLYGFLSGPE  114

Query  438   glfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLKLDGLVIVGG  617
             GL   + +EI   ++  Y+N GG+D++G  + +I + EQV +++     LKLD L+I+GG
Sbjct  115   GLIKGRYVEIKKALIDKYRNTGGFDIIGSGRTKIETEEQVESSIQNVKKLKLDALIIIGG  174

Query  618   VTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICKVNSQLISNVC  797
               SNT+AA+LA+ F +AK  TKV+GVP T++GDLKNQ++ET+ GFDT  K+ S+LI N+C
Sbjct  175   DDSNTNAAFLAKYFIQAKLDTKVIGVPKTIDGDLKNQYIETSFGFDTATKLYSELIGNIC  234

Query  798   TDALSAEKYYYFIRLMGRKTSHVALECTLQSHPNMVILAEEVAASKLTLFDITKQVCDAV  977
              D  SA KY++FI+LMGR  SH+ALEC L++ PN+ ++ EE+A  K+TL  +T  + D +
Sbjct  235   RDVNSARKYWHFIKLMGRSASHIALECALKTQPNVCLIGEELAEKKVTLKQVTDYIVDII  294

Query  978   QARAEQDKYHGVILLPEGLIESIPEIYALLKEIHVLLREGVSANN-----------ISSQ  1124
               R+++ +  GV+L+PEG+IE IPE+  L++EI+ L+ E  SA +           +   
Sbjct  295   VKRSQKGENFGVVLVPEGIIEFIPEMDELIEEINDLMAEKTSAFSKLKTFAGKKSWLQKH  354

Query  1125  LSPWASALFEFLPPFIRRELLL  1190
             LS  A ALF+ LP  I  +LL+
Sbjct  355   LSKKAFALFDNLPENISLQLLM  376



>ref|WP_002693855.1| diphosphate-fructose-6-phosphate 1-phosphotransferase [Treponema 
denticola]
 gb|EMB19415.1| diphosphate-fructose-6-phosphate 1-phosphotransferase [Treponema 
denticola OTK]
Length=560

 Score =   285 bits (730),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 160/382 (42%), Positives = 244/382 (64%), Gaps = 22/382 (6%)
 Frame = +3

Query  84    SDLQKLRSQYRPELPPCLQG--TTVRVEFGDATTAADPSGGHTISRLFPHTFGQPLAHFL  257
             S +Q+LR  Y P++P       + ++ E G+AT A   S    +  +FPHT+G P+  F+
Sbjct  4     STMQRLRYNYEPKIPKVFAEPLSLIKPEIGEATHAQ--SNQAELKEIFPHTYGMPIIRFV  61

Query  258   RASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNSTllgflggse  437
             +  ++V       EH  ++ G++  G Q+PGGHN I GL+DALK  N NS L GFL G E
Sbjct  62    KGKSEV-------EHKPLKFGVILSGGQAPGGHNVISGLFDALKKGNANSKLYGFLRGPE  114

Query  438   glfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLKLDGLVIVGG  617
             GL   + +EI   ++  Y+N GG+D++G  + +I + EQ+ +++     LKLD L+I+GG
Sbjct  115   GLVKGRYVEIKKALIDKYRNTGGFDIIGSGRTKIETEEQIESSIQNVKKLKLDALIIIGG  174

Query  618   VTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICKVNSQLISNVC  797
               SNT+AA+LA+ F +AK  TKV+GVP T++GDLKNQ++ET+ GFDT  K+ S+LI N+C
Sbjct  175   DDSNTNAAFLAKYFIQAKLDTKVIGVPKTIDGDLKNQYIETSFGFDTATKLYSELIGNIC  234

Query  798   TDALSAEKYYYFIRLMGRKTSHVALECTLQSHPNMVILAEEVAASKLTLFDITKQVCDAV  977
              D  SA KY++FI+LMGR  SH+ALEC L++ PN+ ++ EE+A  K+TL  +T  + D +
Sbjct  235   RDVNSARKYWHFIKLMGRSASHIALECALKTQPNVCLIGEELAEKKVTLQQVTDYIVDII  294

Query  978   QARAEQDKYHGVILLPEGLIESIPEIYALLKEIHVLLREGVSANN-----------ISSQ  1124
               R+++ +  GV+L+PEG+IE IPE+  L++EI+ ++ E  SA +           +   
Sbjct  295   VKRSQKGENFGVVLVPEGIIEFIPEMDELIEEINDIMAEKTSAFSKLKTFAGKKSWLQKH  354

Query  1125  LSPWASALFEFLPPFIRRELLL  1190
             LS  A ALF+ LP  I  +LL+
Sbjct  355   LSKKAFALFDNLPENISLQLLM  376



>ref|WP_010956991.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Treponema 
denticola]
 ref|NP_972156.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Treponema 
denticola ATCC 35405]
 gb|AAS12067.1| phosphofructokinase, pyrophosphate-dependent [Treponema denticola 
ATCC 35405]
Length=560

 Score =   285 bits (730),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 160/382 (42%), Positives = 244/382 (64%), Gaps = 22/382 (6%)
 Frame = +3

Query  84    SDLQKLRSQYRPELPPCLQG--TTVRVEFGDATTAADPSGGHTISRLFPHTFGQPLAHFL  257
             S +Q+LR  Y P++P       + ++ E G+AT A   S    +  +FPHT+G P+  F+
Sbjct  4     STMQRLRYNYEPKIPKVFAEPLSLIKPEIGEATHAQ--SNQAELKEIFPHTYGMPIIRFV  61

Query  258   RASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNSTllgflggse  437
             +  ++V       EH  ++ G++  G Q+PGGHN I GL+DALK  N NS L GFL G E
Sbjct  62    KGKSEV-------EHKPLKFGVILSGGQAPGGHNVISGLFDALKKGNANSKLYGFLRGPE  114

Query  438   glfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLKLDGLVIVGG  617
             GL   + +EI   ++  Y+N GG+D++G  + +I + EQ+ +++     LKLD L+I+GG
Sbjct  115   GLVKGRYVEIKKALIDKYRNTGGFDIIGSGRTKIETEEQIESSIQNVKKLKLDALIIIGG  174

Query  618   VTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICKVNSQLISNVC  797
               SNT+AA+LA+ F +AK  TKV+GVP T++GDLKNQ++ET+ GFDT  K+ S+LI N+C
Sbjct  175   DDSNTNAAFLAKYFIQAKLDTKVIGVPKTIDGDLKNQYIETSFGFDTATKLYSELIGNIC  234

Query  798   TDALSAEKYYYFIRLMGRKTSHVALECTLQSHPNMVILAEEVAASKLTLFDITKQVCDAV  977
              D  SA KY++FI+LMGR  SH+ALEC L++ PN+ ++ EE+A  K+TL  +T  + D +
Sbjct  235   RDVNSARKYWHFIKLMGRSASHIALECALKTQPNVCLIGEELAEKKVTLQQVTDYIVDII  294

Query  978   QARAEQDKYHGVILLPEGLIESIPEIYALLKEIHVLLREGVSANN-----------ISSQ  1124
               R+++ +  GV+L+PEG+IE IPE+  L++EI+ ++ E  SA +           +   
Sbjct  295   VKRSQKGENFGVVLVPEGIIEFIPEMDELIEEINDIMAEKTSAFSKLKTFAGKKSWLQKH  354

Query  1125  LSPWASALFEFLPPFIRRELLL  1190
             LS  A ALF+ LP  I  +LL+
Sbjct  355   LSKKAFALFDNLPENISLQLLM  376



>ref|WP_002669081.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Treponema 
denticola]
 gb|EGC77300.1| phosphofructokinase [Treponema denticola F0402]
 gb|EMB46853.1| diphosphate-fructose-6-phosphate 1-phosphotransferase [Treponema 
denticola AL-2]
Length=560

 Score =   285 bits (729),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 160/382 (42%), Positives = 244/382 (64%), Gaps = 22/382 (6%)
 Frame = +3

Query  84    SDLQKLRSQYRPELPPCLQG--TTVRVEFGDATTAADPSGGHTISRLFPHTFGQPLAHFL  257
             S +Q+LR  Y P++P       + ++ E G+AT A   S    +  +FPHT+G P+  F+
Sbjct  4     STMQRLRYNYEPKIPKVFAEPLSLIKPEIGEATHAQ--SNQAELKEIFPHTYGMPIIRFV  61

Query  258   RASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNSTllgflggse  437
             +  ++V       EH  ++ G++  G Q+PGGHN I GL+DALK  N NS L GFL G E
Sbjct  62    KGKSEV-------EHKPLKFGVILSGGQAPGGHNVISGLFDALKKGNANSKLYGFLRGPE  114

Query  438   glfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLKLDGLVIVGG  617
             GL   + +EI   ++  Y+N GG+D++G  + +I + EQ+ +++     LKLD L+I+GG
Sbjct  115   GLVKGRYVEIKKALIDKYRNTGGFDIIGSGRTKIETEEQIESSIQNVKKLKLDALIIIGG  174

Query  618   VTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICKVNSQLISNVC  797
               SNT+AA+LA+ F +AK  TKV+GVP T++GDLKNQ++ET+ GFDT  K+ S+LI N+C
Sbjct  175   DDSNTNAAFLAKYFIQAKLDTKVIGVPKTIDGDLKNQYIETSFGFDTATKLYSELIGNIC  234

Query  798   TDALSAEKYYYFIRLMGRKTSHVALECTLQSHPNMVILAEEVAASKLTLFDITKQVCDAV  977
              D  SA KY++FI+LMGR  SH+ALEC L++ PN+ ++ EE+A  K+TL  +T  + D +
Sbjct  235   RDVNSARKYWHFIKLMGRSASHIALECALKTQPNVCLIGEELAKKKVTLQQVTDYIVDII  294

Query  978   QARAEQDKYHGVILLPEGLIESIPEIYALLKEIHVLLREGVSANN-----------ISSQ  1124
               R+++ +  GV+L+PEG+IE IPE+  L++EI+ ++ E  SA +           +   
Sbjct  295   VKRSQKGENFGVVLVPEGIIEFIPEMDELIEEINDIMAEKTSAFSKLKTFAGKKSWLQKH  354

Query  1125  LSPWASALFEFLPPFIRRELLL  1190
             LS  A ALF+ LP  I  +LL+
Sbjct  355   LSKKAFALFDNLPENISLQLLM  376



>ref|WP_010699412.1| diphosphate-fructose-6-phosphate 1-phosphotransferase [Treponema 
denticola]
 gb|EMB21050.1| diphosphate-fructose-6-phosphate 1-phosphotransferase [Treponema 
denticola SP37]
 gb|EPF33080.1| diphosphate-fructose-6-phosphate 1-phosphotransferase [Treponema 
denticola SP44]
 gb|EPF40558.1| diphosphate-fructose-6-phosphate 1-phosphotransferase [Treponema 
denticola SP23]
Length=560

 Score =   285 bits (729),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 160/382 (42%), Positives = 244/382 (64%), Gaps = 22/382 (6%)
 Frame = +3

Query  84    SDLQKLRSQYRPELPPCLQG--TTVRVEFGDATTAADPSGGHTISRLFPHTFGQPLAHFL  257
             S +Q+LR  Y P++P       + ++ E G+AT A   S    +  +FPHT+G P+  F+
Sbjct  4     STMQRLRYNYEPKIPKVFAEPLSLIKPEIGEATHAQ--SNQAELKEIFPHTYGMPIIRFV  61

Query  258   RASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNSTllgflggse  437
             +  ++V       EH  ++ G++  G Q+PGGHN I GL+DALK  N NS L GFL G E
Sbjct  62    KGKSEV-------EHKPLKFGVILSGGQAPGGHNVISGLFDALKKGNANSKLYGFLRGPE  114

Query  438   glfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLKLDGLVIVGG  617
             GL   + +EI   ++  Y+N GG+D++G  + +I + EQ+ +++     LKLD L+I+GG
Sbjct  115   GLVKGRYVEIKKALIDKYRNTGGFDIIGSGRTKIETEEQIESSIQNVKKLKLDALIIIGG  174

Query  618   VTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICKVNSQLISNVC  797
               SNT+AA+LA+ F +AK  TKV+GVP T++GDLKNQ++ET+ GFDT  K+ S+LI N+C
Sbjct  175   DDSNTNAAFLAKYFIQAKLDTKVIGVPKTIDGDLKNQYIETSFGFDTATKLYSELIGNIC  234

Query  798   TDALSAEKYYYFIRLMGRKTSHVALECTLQSHPNMVILAEEVAASKLTLFDITKQVCDAV  977
              D  SA KY++FI+LMGR  SH+ALEC L++ PN+ ++ EE+A  K+TL  +T  + D +
Sbjct  235   RDVNSARKYWHFIKLMGRSASHIALECALKTQPNVCLIGEELAEKKVTLQQVTDYIVDII  294

Query  978   QARAEQDKYHGVILLPEGLIESIPEIYALLKEIHVLLREGVSANN-----------ISSQ  1124
               R+++ +  GV+L+PEG+IE IPE+  L++EI+ ++ E  SA +           +   
Sbjct  295   VKRSQKGENFGVVLVPEGIIEFIPEMDELIEEINDIMAEKTSAFSKLKTFAGKKSWLQKH  354

Query  1125  LSPWASALFEFLPPFIRRELLL  1190
             LS  A ALF+ LP  I  +LL+
Sbjct  355   LSKKAFALFDNLPENISLQLLM  376



>ref|WP_002682935.1| diphosphate-fructose-6-phosphate 1-phosphotransferase [Treponema 
denticola]
 gb|EMB36139.1| diphosphate-fructose-6-phosphate 1-phosphotransferase [Treponema 
denticola H-22]
Length=560

 Score =   285 bits (729),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 160/382 (42%), Positives = 244/382 (64%), Gaps = 22/382 (6%)
 Frame = +3

Query  84    SDLQKLRSQYRPELPPCLQG--TTVRVEFGDATTAADPSGGHTISRLFPHTFGQPLAHFL  257
             S +Q+LR  Y P++P       + ++ E G+AT A   S    +  +FPHT+G P+  F+
Sbjct  4     STMQRLRYNYEPKIPKVFAEPLSLIKPEIGEATHAQ--SNQAELKEIFPHTYGMPIIRFV  61

Query  258   RASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNSTllgflggse  437
             +  ++V       EH  ++ G++  G Q+PGGHN I GL+DALK  N NS L GFL G E
Sbjct  62    KGKSEV-------EHKPLKFGVILSGGQAPGGHNVISGLFDALKKGNANSKLYGFLSGPE  114

Query  438   glfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLKLDGLVIVGG  617
             GL   + +EI   ++  Y+N GG+D++G  + +I + EQ+ +++     LKLD L+I+GG
Sbjct  115   GLIKGRYVEIKKALIDKYRNTGGFDIIGSGRTKIETEEQIESSIQNVKKLKLDALIIIGG  174

Query  618   VTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICKVNSQLISNVC  797
               SNT+AA+LA+ F +AK  TKV+GVP T++GDLKNQ++ET+ GFDT  K+ S+LI N+C
Sbjct  175   DDSNTNAAFLAKYFIQAKLNTKVIGVPKTIDGDLKNQYIETSFGFDTATKLYSELIGNIC  234

Query  798   TDALSAEKYYYFIRLMGRKTSHVALECTLQSHPNMVILAEEVAASKLTLFDITKQVCDAV  977
              D  SA KY++FI+LMGR  SH+ALEC L++ PN+ ++ EE+A  K+TL  +T  + D +
Sbjct  235   RDVNSARKYWHFIKLMGRSASHIALECALKTQPNVCLIGEELAEKKVTLQQVTDYIVDII  294

Query  978   QARAEQDKYHGVILLPEGLIESIPEIYALLKEIHVLLREGVSANN-----------ISSQ  1124
               R+++ +  GV+L+PEG+IE IPE+  L++EI+ ++ E  SA +           +   
Sbjct  295   VKRSQKGENFGVVLVPEGIIEFIPEMDELIEEINDIMAEKTSAFSKLKTFAGKKSWLQKH  354

Query  1125  LSPWASALFEFLPPFIRRELLL  1190
             LS  A ALF+ LP  I  +LL+
Sbjct  355   LSKKAFALFDNLPENISLQLLM  376



>ref|WP_002678239.1| diphosphate-fructose-6-phosphate 1-phosphotransferase [Treponema 
denticola]
 gb|EMB43331.1| diphosphate-fructose-6-phosphate 1-phosphotransferase [Treponema 
denticola ASLM]
 gb|EMD56694.1| diphosphate-fructose-6-phosphate 1-phosphotransferase [Treponema 
denticola US-Trep]
Length=560

 Score =   285 bits (729),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 160/382 (42%), Positives = 244/382 (64%), Gaps = 22/382 (6%)
 Frame = +3

Query  84    SDLQKLRSQYRPELPPCLQG--TTVRVEFGDATTAADPSGGHTISRLFPHTFGQPLAHFL  257
             S +Q+LR  Y P++P       + ++ E G+AT A   S    +  +FPHT+G P+  F+
Sbjct  4     STMQRLRYNYEPKIPKVFAEPLSLIKPEIGEATHAQ--SNQAELKEIFPHTYGMPIIRFV  61

Query  258   RASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNSTllgflggse  437
             +  ++V       EH  ++ G++  G Q+PGGHN I GL+DALK  N NS L GFL G E
Sbjct  62    KGKSEV-------EHKPLKFGVILSGGQAPGGHNVISGLFDALKKGNANSKLYGFLRGPE  114

Query  438   glfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLKLDGLVIVGG  617
             GL   + +EI   ++  Y+N GG+D++G  + +I + EQ+ +++     LKLD L+I+GG
Sbjct  115   GLVKGRYVEIKKALIDKYRNTGGFDIIGSGRTKIETEEQIESSIQNVKKLKLDALIIIGG  174

Query  618   VTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICKVNSQLISNVC  797
               SNT+AA+LA+ F +AK  TKV+GVP T++GDLKNQ++ET+ GFDT  K+ S+LI N+C
Sbjct  175   DDSNTNAAFLAKYFIQAKLNTKVIGVPKTIDGDLKNQYIETSFGFDTATKLYSELIGNIC  234

Query  798   TDALSAEKYYYFIRLMGRKTSHVALECTLQSHPNMVILAEEVAASKLTLFDITKQVCDAV  977
              D  SA KY++FI+LMGR  SH+ALEC L++ PN+ ++ EE+A  K+TL  +T  + D +
Sbjct  235   RDVNSARKYWHFIKLMGRSASHIALECALKTQPNVCLIGEELAEKKVTLQQVTDYIVDII  294

Query  978   QARAEQDKYHGVILLPEGLIESIPEIYALLKEIHVLLREGVSANN-----------ISSQ  1124
               R+++ +  GV+L+PEG+IE IPE+  L++EI+ ++ E  SA +           +   
Sbjct  295   VKRSQKGENFGVVLVPEGIIEFIPEMDELIEEINDIMAEKTSAFSKLKTFAGKKSWLQKH  354

Query  1125  LSPWASALFEFLPPFIRRELLL  1190
             LS  A ALF+ LP  I  +LL+
Sbjct  355   LSKKAFALFDNLPENISLQLLM  376



>ref|WP_002689303.1| diphosphate-fructose-6-phosphate 1-phosphotransferase [Treponema 
denticola]
 gb|EMB28300.1| diphosphate-fructose-6-phosphate 1-phosphotransferase [Treponema 
denticola MYR-T]
 gb|EMB29042.1| diphosphate-fructose-6-phosphate 1-phosphotransferase [Treponema 
denticola H1-T]
 gb|EMB39731.1| diphosphate-fructose-6-phosphate 1-phosphotransferase [Treponema 
denticola ATCC 33520]
Length=560

 Score =   285 bits (729),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 160/382 (42%), Positives = 244/382 (64%), Gaps = 22/382 (6%)
 Frame = +3

Query  84    SDLQKLRSQYRPELPPCLQG--TTVRVEFGDATTAADPSGGHTISRLFPHTFGQPLAHFL  257
             S +Q+LR  Y P++P       + ++ E G+AT A   S    +  +FPHT+G P+  F+
Sbjct  4     STMQRLRYNYEPKIPKVFAEPLSLIKPEIGEATHAQ--SNQAELKEIFPHTYGMPIIRFV  61

Query  258   RASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNSTllgflggse  437
             +  ++V       EH  ++ G++  G Q+PGGHN I GL+DALK  N NS L GFL G E
Sbjct  62    KGKSEV-------EHKPLKFGVILSGGQAPGGHNVISGLFDALKKGNANSKLYGFLRGPE  114

Query  438   glfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLKLDGLVIVGG  617
             GL   + +EI   ++  Y+N GG+D++G  + +I + EQ+ +++     LKLD L+I+GG
Sbjct  115   GLVKGRCVEIKKALIDKYRNTGGFDIIGSGRTKIETEEQIESSIQNVKKLKLDALIIIGG  174

Query  618   VTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICKVNSQLISNVC  797
               SNT+AA+LA+ F +AK  TKV+GVP T++GDLKNQ++ET+ GFDT  K+ S+LI N+C
Sbjct  175   DDSNTNAAFLAKYFIQAKLDTKVIGVPKTIDGDLKNQYIETSFGFDTATKLYSELIGNIC  234

Query  798   TDALSAEKYYYFIRLMGRKTSHVALECTLQSHPNMVILAEEVAASKLTLFDITKQVCDAV  977
              D  SA KY++FI+LMGR  SH+ALEC L++ PN+ ++ EE+A  K+TL  +T  + D +
Sbjct  235   RDVNSARKYWHFIKLMGRSASHIALECALKTQPNVCLIGEELAEKKVTLQQVTDYIVDII  294

Query  978   QARAEQDKYHGVILLPEGLIESIPEIYALLKEIHVLLREGVSANN-----------ISSQ  1124
               R+++ +  GV+L+PEG+IE IPE+  L++EI+ ++ E  SA +           +   
Sbjct  295   VKRSQKGENFGVVLVPEGIIEFIPEMDELIEEINDIMAEKTSAFSKLKTFAGKKSWLQKH  354

Query  1125  LSPWASALFEFLPPFIRRELLL  1190
             LS  A ALF+ LP  I  +LL+
Sbjct  355   LSKKAFALFDNLPENISLQLLM  376



>ref|XP_002986153.1| hypothetical protein SELMODRAFT_234963 [Selaginella moellendorffii]
 gb|EFJ12684.1| hypothetical protein SELMODRAFT_234963 [Selaginella moellendorffii]
Length=560

 Score =   284 bits (727),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 163/381 (43%), Positives = 233/381 (61%), Gaps = 10/381 (3%)
 Frame = +3

Query  84    SDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHTFGQPLAHFLRA  263
             S +Q  R  Y+P +P  L+G   +VE G +T+A   +G   I++LFP  FGQP  H +  
Sbjct  22    SPVQSSRLDYKPPMPSVLEGH-FKVEHGSSTSAVGDAG--AIAQLFPKLFGQPSVHIVPC  78

Query  264   SAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNSTllgflggsegl  443
             +A         E   +R+G+V  G Q+PGGHN I GL+D L+ H P S LLGF GG  G+
Sbjct  79    AAAA-----FKEEVKLRIGVVLSGGQAPGGHNVIAGLFDYLQKHAPGSLLLGFRGGPAGI  133

Query  444   fAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLKLDGLVIVGGVT  623
                K +EIT + L  Y+NQGG+D++   +D+I + EQ   A      L LDG+V++GG  
Sbjct  134   MRCKYVEITSEFLYPYRNQGGFDIICSGRDKIETPEQFKQAEDTAVKLDLDGIVVIGGDD  193

Query  624   SNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICKVNSQLISNVCTD  803
             SNT+A  LAE F      T V+G P T++GDLK++ V  + GFDT CK+ +++I N+  D
Sbjct  194   SNTNACLLAEYFRARNLKTHVIGCPKTIDGDLKSKEVPISFGFDTACKIYAEMIGNIMVD  253

Query  804   ALSAEKYYYFIRLMGRKTSHVALECTLQSHPNMVILAEEVAASKLTLFDITKQVCDAVQA  983
             A S  KYY+F+RLMGR  SH+ LEC LQ+HPN+ ++ EEV+  K TL  +T  + D +  
Sbjct  254   ARSTGKYYHFVRLMGRAASHITLECALQTHPNVALIGEEVSVKKQTLRQVTNSITDTICK  313

Query  984   RAEQDKYHGVILLPEGLIESIPEIYALLKEIHVLLREGV--SANNISSQLSPWASALFEF  1157
             RAE  +++GVIL+PEGLI+ IPEI  L+ E++ +L  G      +   +LSP   ALF+ 
Sbjct  314   RAENGQHYGVILIPEGLIDFIPEIQHLISELNEILASGTVDEEGHWRHKLSPQCHALFDS  373

Query  1158  LPPFIRRELLLYPESDDSAQL  1220
             LP  I+ ELLL  +   + Q+
Sbjct  374   LPHSIQEELLLERDPHGNVQV  394



>ref|XP_004340159.1| diphosphate-fructose-6-phosphate 1-phosphotransferase [Acanthamoeba 
castellanii str. Neff]
 gb|ELR18139.1| diphosphate-fructose-6-phosphate 1-phosphotransferase [Acanthamoeba 
castellanii str. Neff]
Length=572

 Score =   282 bits (721),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 168/391 (43%), Positives = 239/391 (61%), Gaps = 27/391 (7%)
 Frame = +3

Query  78    ELSDLQKLRSQYRPELPPCLQG-TTVRVEFGDATTAADPSGGHTISRLFPHTFGQPLAHF  254
             E+S LQ+ R  ++P + P L+G TT+R      ++ A P     I +  PH FGQP    
Sbjct  6     EVSTLQRARLAHQPPVTPTLRGRTTLRRHAHPTSSLAQPE---EIEKRLPHIFGQPRVEL  62

Query  255   LRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNSTllgflggs  434
               AS    DA     H  +R+G+V  G Q+ GGHN I GL+D +   +P+S L GF+GG 
Sbjct  63    EAASTAGDDAS----HSPLRIGVVLSGGQAAGGHNVIAGLFDYVAAGHPHSKLYGFIGGP  118

Query  435   eglfAQKTLEITDDILATYKNQGGYDMLG------------------RTKDQIRSTEQVN  560
              GL     + I   ++A Y+NQGG+D++G                  +  D+I + +Q+ 
Sbjct  119   IGLVKGDFIVIDAPLVAKYRNQGGFDIIGAIALHHSRVDQKNLLAESKRADKIETDKQLL  178

Query  561   AALTACTSLKLDGLVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQF-VE  737
             A+   C +L LDGLVI+GG  SNT+AA LAE F      T VVGVP T++GDLK+   VE
Sbjct  179   ASRVVCENLALDGLVIIGGDDSNTNAALLAEYFKSHHLKTNVVGVPKTIDGDLKSSLGVE  238

Query  738   TNVGFDTICKVNSQLISNVCTDALSAEKYYYFIRLMGRKTSHVALECTLQSHPNMVILAE  917
              + GFDT C + S+LI N+ TDA S+ KYY+FIRLMGR  SH+ LEC LQ+ PN+ ++ E
Sbjct  239   VSFGFDTACMIYSELIGNIATDANSSRKYYHFIRLMGRSASHITLECALQTRPNITLIGE  298

Query  918   EVAASKLTLFDITKQVCDAVQARAEQDKYHGVILLPEGLIESIPEIYALLKEIHVLLREG  1097
             EVAA K TL D+T ++C  +  RA+  K  G++LLPEGLIE +PE++ L+ E++ L+ +G
Sbjct  299   EVAARKQTLSDLTNELCHVIVERAKAGKNFGIVLLPEGLIEFVPEVHRLISELNELMAKG  358

Query  1098  VSANNISSQLSPWASALFEFLPPFIRRELLL  1190
              SA+ +  +L+  + A+F+FLP  IR ELLL
Sbjct  359   NSADVVGEKLTEESRAVFDFLPSAIRHELLL  389



>ref|XP_008788669.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha-like isoform X3 [Phoenix dactylifera]
Length=290

 Score =   271 bits (692),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 127/152 (84%), Positives = 143/152 (94%), Gaps = 0/152 (0%)
 Frame = +3

Query  765   KVNSQLISNVCTDALSAEKYYYFIRLMGRKTSHVALECTLQSHPNMVILAEEVAASKLTL  944
             KVNSQLISN+CTDALSAEKYYYFIRLMGR+ SHVALEC LQSHPNMVIL+EEVAASKLTL
Sbjct  9     KVNSQLISNICTDALSAEKYYYFIRLMGRRASHVALECALQSHPNMVILSEEVAASKLTL  68

Query  945   FDITKQVCDAVQARAEQDKYHGVILLPEGLIESIPEIYALLKEIHVLLREGVSANNISSQ  1124
             +DITKQ+CDAVQARAE  KYHGVILLPEGLIESIPE+YALL+EIHVLL++GVS  +IS Q
Sbjct  69    YDITKQICDAVQARAELGKYHGVILLPEGLIESIPEVYALLQEIHVLLKKGVSVGSISKQ  128

Query  1125  LSPWASALFEFLPPFIRRELLLYPESDDSAQL  1220
             LSPWASAL+E +PPFI+++LLL PESD+SAQL
Sbjct  129   LSPWASALYESMPPFIKKQLLLSPESDESAQL  160



>ref|XP_001770321.1| predicted protein [Physcomitrella patens]
 gb|EDQ64811.1| predicted protein [Physcomitrella patens]
Length=565

 Score =   280 bits (715),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 171/383 (45%), Positives = 236/383 (62%), Gaps = 14/383 (4%)
 Frame = +3

Query  84    SDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGH--TISRLFPHTFGQPLAHFL  257
             S +Q  R  + P LP    G   +++ G  +TAA    GH   I++LFP+ FGQP    +
Sbjct  28    SPVQASRLDHTPPLPKVFHGH-FKLKHGPPSTAA----GHPEEIAKLFPNLFGQPSVEMI  82

Query  258   RASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNSTllgflggse  437
                    D     E+  ++VG+V  G Q+PGGHN I G++D L+ H P S L GF GG  
Sbjct  83    PCEGSAYD-----ENRVLKVGVVLSGGQAPGGHNVIAGMFDYLQTHAPGSILYGFKGGPA  137

Query  438   glfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLKLDGLVIVGG  617
             G+   K LEIT  +L  Y+NQGG+D++   +D+I   EQ   A T  T+L LDGLV++GG
Sbjct  138   GIMRNKWLEITTPLLYPYRNQGGFDIICSGRDKIELPEQFKQAETTVTALDLDGLVVIGG  197

Query  618   VTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICKVNSQLISNVC  797
               SNT+AA LAE F E K  T+V+G P T++GDLK++ V  + GFDT CK+ S++I N+ 
Sbjct  198   DDSNTNAAVLAEYFREKKIKTRVLGCPKTIDGDLKSKQVPISFGFDTACKIYSEMIGNIM  257

Query  798   TDALSAEKYYYFIRLMGRKTSHVALECTLQSHPNMVILAEEVAASKLTLFDITKQVCDAV  977
              DA S  KYY+F+RLMGR  SH+ LEC LQ+HPNM I+ EEV A K TL  +T  + D V
Sbjct  258   VDARSTGKYYHFVRLMGRAASHITLECALQTHPNMAIIGEEVHAQKKTLRQVTNSIADVV  317

Query  978   QARAEQDKYHGVILLPEGLIESIPEIYALLKEIHVLL-REGVSA-NNISSQLSPWASALF  1151
               RA   K++GVIL+PEGLI+ IPEI +L+ +++ LL  +G     +  S+L P   ALF
Sbjct  318   CRRAGLGKHYGVILIPEGLIDFIPEIESLIADLNDLLATQGCDPQGHWKSKLKPACRALF  377

Query  1152  EFLPPFIRRELLLYPESDDSAQL  1220
             + LP  I+ ELLL  +   + Q+
Sbjct  378   DSLPHNIQEELLLERDPHGNVQV  400



>gb|EFB41793.1| hypothetical protein pah_c022o077 [Parachlamydia acanthamoebae 
str. Hall's coccus]
 gb|KIA77973.1| Pyrophosphate--fructose 6-phosphate 1-phosphotransferase subunit 
beta 1 [Parachlamydia acanthamoebae]
Length=567

 Score =   279 bits (714),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 159/340 (47%), Positives = 216/340 (64%), Gaps = 9/340 (3%)
 Frame = +3

Query  69    LARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHTFGQPLA  248
             L R  S LQK R  Y P LP  L+  T  V   +A    +      + +LF  T  Q L 
Sbjct  3     LMRIHSSLQKRRLAYLPRLPEILRSLTRLVPLFEAENHENELP-LPVVQLFSKTIDQQLL  61

Query  249   HFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNSTllgflg  428
              F+    K         H  + VG+VF G Q+ GGHN I GL+DALK+ NP S + GFL 
Sbjct  62    RFVEGENKT--------HRPLNVGVVFSGGQASGGHNVISGLFDALKLLNPESKVFGFLN  113

Query  429   gseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLKLDGLVI  608
             G  G+   +++EIT +IL  ++N GG+D++G  + +I S +Q  AAL A   L LDGL+I
Sbjct  114   GPAGIINNQSMEITAEILKNFRNLGGFDLIGSGRTKIESPDQFQAALKAVQGLHLDGLLI  173

Query  609   VGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICKVNSQLIS  788
             +GG  SNT+AA+LAE F    C T VVG+P T++GDLKN+ +E + GFDT CK  SQ I 
Sbjct  174   IGGDDSNTNAAFLAEYFLAKGCKTCVVGIPKTIDGDLKNESIEVSFGFDTACKTFSQTIG  233

Query  789   NVCTDALSAEKYYYFIRLMGRKTSHVALECTLQSHPNMVILAEEVAASKLTLFDITKQVC  968
             ++ TD LSA+KYY+FI+LMGR  SH+ LEC LQ+HPN+  + EE+AA + TL DI +Q+ 
Sbjct  234   SILTDCLSAKKYYFFIKLMGRSASHITLECALQTHPNLTFIGEEIAAQQKTLKDIVRQIT  293

Query  969   DAVQARAEQDKYHGVILLPEGLIESIPEIYALLKEIHVLL  1088
             D +  RAE+ K +GVIL+PEGLIE IPE+  L++E++ LL
Sbjct  294   DMICLRAEKKKNYGVILIPEGLIEFIPEVKTLIQELNTLL  333



>ref|WP_013924907.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Parachlamydia 
acanthamoebae]
 emb|CCB86320.1| pyrophosphate--fructose 6-phosphate 1-phosphotransferase subunit 
beta [Parachlamydia acanthamoebae UV-7]
Length=564

 Score =   278 bits (710),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 157/335 (47%), Positives = 214/335 (64%), Gaps = 9/335 (3%)
 Frame = +3

Query  84    SDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHTFGQPLAHFLRA  263
             S LQK R  Y P LP  L+  T  V   +A    +      + +LF  T  Q L  F+  
Sbjct  5     SSLQKRRLAYLPRLPEILRSLTRLVPLFEAENHENELP-LPVVQLFSKTIDQQLLRFVEG  63

Query  264   SAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNSTllgflggsegl  443
               K         H  + VG+VF G Q+ GGHN I GL+DALK+ NP S + GFL G  G+
Sbjct  64    ENKT--------HRPLNVGVVFSGGQASGGHNVISGLFDALKLLNPESKVFGFLNGPAGI  115

Query  444   fAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLKLDGLVIVGGVT  623
                +++EIT +IL  ++N GG+D++G  + +I S +Q  AAL A   L LDGL+I+GG  
Sbjct  116   INNQSMEITAEILKNFRNLGGFDLIGSGRTKIESPDQFQAALKAVQGLHLDGLLIIGGDD  175

Query  624   SNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICKVNSQLISNVCTD  803
             SNT+AA+LAE F    C T VVG+P T++GDLKN+ +E + GFDT CK  SQ I ++ TD
Sbjct  176   SNTNAAFLAEYFLAKGCKTCVVGIPKTIDGDLKNESIEVSFGFDTACKTFSQTIGSILTD  235

Query  804   ALSAEKYYYFIRLMGRKTSHVALECTLQSHPNMVILAEEVAASKLTLFDITKQVCDAVQA  983
              LSA+KYY+FI+LMGR  SH+ LEC LQ+HPN+  + EE+AA + TL DI +Q+ D +  
Sbjct  236   CLSAKKYYFFIKLMGRSASHITLECALQTHPNLTFIGEEIAAQQKTLKDIVRQITDMICL  295

Query  984   RAEQDKYHGVILLPEGLIESIPEIYALLKEIHVLL  1088
             RAE+ K +GVIL+PEGLIE IPE+  L++E++ LL
Sbjct  296   RAEKKKNYGVILIPEGLIEFIPEVKTLIQELNTLL  330



>ref|WP_006255527.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Alloprevotella 
tannerae]
 gb|EEX71434.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Prevotella 
tannerae ATCC 51259]
Length=550

 Score =   277 bits (708),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 151/337 (45%), Positives = 212/337 (63%), Gaps = 10/337 (3%)
 Frame = +3

Query  78    ELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHTFGQPLAHFL  257
             E+S LQK RS Y+P+LP  L+G    +E     +  D +    I RLFPHT+G PL  F 
Sbjct  2     EISALQKARSSYQPKLPKGLRGNVDIIEGAPTESVGDQA---EIKRLFPHTYGMPLVEF-  57

Query  258   RASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNSTllgflggse  437
                     A+ + E+  I VGI+  G Q+PGGHN I GL+D LK  NP S L GFL G  
Sbjct  58    ------APAKEVKEYAPINVGIILSGGQAPGGHNVICGLFDELKKQNPKSKLYGFLMGPS  111

Query  438   glfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLKLDGLVIVGG  617
             GL   K  E+T +++  Y+N GG+DM+G  + ++ + EQ ++ L     L L+ ++I+GG
Sbjct  112   GLVDHKYKELTAEVIDKYRNTGGFDMIGSGRTKLETKEQFDSGLEIIRQLNLNAVIIIGG  171

Query  618   VTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICKVNSQLISNVC  797
               SNT+A  LAE +A       V+G P T++GDLKN  +ET+ GFD+ CK  S+LI N+ 
Sbjct  172   DDSNTNACMLAEYYASINAGVSVIGCPKTIDGDLKNDQIETSFGFDSACKTYSELIGNIQ  231

Query  798   TDALSAEKYYYFIRLMGRKTSHVALECTLQSHPNMVILAEEVAASKLTLFDITKQVCDAV  977
              DA SA KY++FI+LMGR  SH+ALEC LQ+ PN+ I++EEV A+ +TL D+  Q+C+ V
Sbjct  232   RDANSARKYWHFIKLMGRSASHIALECALQTQPNICIISEEVEANNMTLDDVVNQICEVV  291

Query  978   QARAEQDKYHGVILLPEGLIESIPEIYALLKEIHVLL  1088
               R+E+  Y+G IL+PEGLIE +P    L+ E+  LL
Sbjct  292   VKRSEEGLYYGTILIPEGLIEFVPAFKRLIAELSDLL  328



>ref|WP_037547210.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Spirochaeta 
sp. JC230]
 gb|KGE72441.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Spirochaeta 
sp. JC230]
Length=552

 Score =   276 bits (707),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 161/383 (42%), Positives = 234/383 (61%), Gaps = 22/383 (6%)
 Frame = +3

Query  78    ELSDLQKLRSQYRPELPPCLQGT--TVRVEFGDATTAADPSGGHTISRLFPHTFGQPLAH  251
             E+S LQK R +Y P+LPP L G    + V FGD T +   +    + +LF  T+G+P+A 
Sbjct  2     EISALQKARLEYSPKLPPALSGAIDAIAVSFGDPTESI--ANQAELKQLFAKTYGKPIAA  59

Query  252   FLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNSTllgflgg  431
             F     K  +  +  E   +RVG++  G Q+PGGHN I GLYD LK  NPNS L GFLGG
Sbjct  60    F----GKGANPNVGKE---LRVGVILSGGQAPGGHNVITGLYDGLKKANPNSVLFGFLGG  112

Query  432   seglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLKLDGLVIV  611
               GL   + +E TD+ +  Y+N GG+D++G  + +I +  Q  A L      KL+ +V++
Sbjct  113   PSGLIDDEAVEFTDEFIDRYRNTGGFDIIGSGRTKIETDAQFAAVLETAKKRKLNAVVVI  172

Query  612   GGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICKVNSQLISN  791
             GG  SNT+AA LAE F       +V+GVP T++GDLKN+++ET+ GFDT CK  S+LI N
Sbjct  173   GGDDSNTNAALLAEYFQTQGTDIQVIGVPKTIDGDLKNEYIETSFGFDTACKTYSELIGN  232

Query  792   VCTDALSAEKYYYFIRLMGRKTSHVALECTLQSHPNMVILAEEVAASKLTLFDITKQVCD  971
             +  DA SA+KY++FI+LMGR  SH+ALEC LQ+ PN+ I++EEV + K +L  I +++ D
Sbjct  233   IGRDANSAKKYWHFIKLMGRSASHIALECALQTQPNIAIISEEVESKKKSLAQIVEEIAD  292

Query  972   AVQARAEQDKYHGVILLPEGLIESIPEIYALLKEIHVLLREGVS-----------ANNIS  1118
              V  RA +    G+ L+PEGLIE +PE+  L+ E++ LL                A  +S
Sbjct  293   VVAKRAAKGNNFGIALIPEGLIEFVPEMKILIAELNDLLAHNAEYFASLRTFDDQAEFVS  352

Query  1119  SQLSPWASALFEFLPPFIRRELL  1187
              +L+  ++ +F  LP  IR +L+
Sbjct  353   GKLTDHSAKVFGSLPRGIRAQLM  375



>ref|WP_032125634.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Chlamydia 
sp. 'Diamant']
Length=556

 Score =   276 bits (707),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 166/386 (43%), Positives = 237/386 (61%), Gaps = 29/386 (8%)
 Frame = +3

Query  81    LSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHTFGQPLAHFLR  260
             LS LQ+ R  Y P+LPP L+  +  V        A       + + FP T  QP+  F +
Sbjct  4     LSPLQRYRLGYEPKLPPILESPSCLVPHPKEGLEAI---NQDLRQQFPFTADQPVLTFQK  60

Query  261   ASAKVPDAQIITEHP--AIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNSTllgflggs  434
                         + P   ++VG+V  G Q+PGGHN I GL+DALK ++ NS+L+GF  G 
Sbjct  61    GE----------QQPLRPLKVGVVLSGGQAPGGHNVIAGLFDALKKNHSNSSLIGFCNGP  110

Query  435   eglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLKLDGLVIVG  614
              G+   +++EIT+D+LA Y+NQGG+D++G  + +I + EQ  AA    T L LDGLV++G
Sbjct  111   NGIVKNQSIEITEDLLALYRNQGGFDLIGSGRTKIETPEQFEAAEKTVTCLSLDGLVVIG  170

Query  615   GVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICKVNSQLISNV  794
             G  SNT+AA LAE F ++   T VVGVP T++GDLKN ++E + GFDT CK+ S++I N+
Sbjct  171   GDDSNTNAAVLAEYFKQSGVKTHVVGVPKTIDGDLKNDYIEVSFGFDTACKIYSEIIGNI  230

Query  795   CTDALSAEKYYYFIRLMGRKTSHVALECTLQSHPNMVILAEEVAASKLTLFDITKQVCDA  974
               DALSA+KYY+FI+LMGR  SH+ALEC LQ+HPN+ +++EEVA  +L+L  I  Q+   
Sbjct  231   LKDALSAKKYYHFIKLMGRSASHIALECALQTHPNLTLISEEVADKQLSLKQIVGQIVAM  290

Query  975   VQARAEQDKYHGVILLPEGLIESIPEIYALLKEIHVLLREGVSANNISSQLSPWASAL--  1148
             + +RA+   ++GVIL+PEG+IE IPE+  L+ E++ LL  G+       QL   AS L  
Sbjct  291   ICSRADNGCHYGVILVPEGMIEFIPEVKRLIHELNHLLVPGLPHARQLEQLEEHASQLAY  350

Query  1149  ------------FEFLPPFIRRELLL  1190
                            LP  I+R+LLL
Sbjct  351   VQKYLSESSIQCLLTLPGSIQRQLLL  376



>ref|WP_013968126.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Treponema 
caldaria]
 gb|AEJ18814.1| diphosphate/fructose-6-phosphate1-phosphotransfe rase [Treponema 
caldaria DSM 7334]
Length=551

 Score =   276 bits (705),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 169/385 (44%), Positives = 241/385 (63%), Gaps = 24/385 (6%)
 Frame = +3

Query  78    ELSDLQKLRSQYRPELPPCLQG--TTVRVEFGDAT-TAADPSGGHTISRLFPHTFGQPLA  248
             E+S LQK R  YRP+LP  L G  + + +EFG  T + AD +    +  LF H++G+PLA
Sbjct  2     EISALQKARYAYRPKLPVILTGPVSDIAIEFGTPTESVADQA---DLRALFKHSYGKPLA  58

Query  249   HFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNSTllgflg  428
              F++          IT    + VG++  G Q+PGGHN I GLYD LK  N +S LLGFLG
Sbjct  59    RFVKGKN-----DKITRR--LTVGVILSGGQAPGGHNVIAGLYDGLKKGNKDSKLLGFLG  111

Query  429   gseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLKLDGLVI  608
             G  GL   K +EITD  +  Y+N GG+DM+G  + +I + EQ  A+L     L LD +VI
Sbjct  112   GPSGLIENKVVEITDAFMDEYRNTGGFDMIGSGRTKIETPEQFAASLETAKKLGLDAVVI  171

Query  609   VGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICKVNSQLIS  788
             +GG  SNT+AA LAE F E     +V+G P T++GDLKN+ +ET+ GFDT  K  S+LI 
Sbjct  172   IGGDDSNTNAALLAEYFLEKGEKIQVIGCPKTIDGDLKNEHIETSFGFDTATKTYSELIG  231

Query  789   NVCTDALSAEKYYYFIRLMGRKTSHVALECTLQSHPNMVILAEEVAASKLTLFDITKQVC  968
             N+  DA SA+KY++FI+LMGR  SH+ALEC LQ+ PN+ +++EEV A KL+L  I  Q+C
Sbjct  232   NIERDANSAKKYWHFIKLMGRSASHIALECALQTQPNICLISEEVEAKKLSLGQIVDQIC  291

Query  969   DAVQARAEQDKYHGVILLPEGLIESIPEIYALLKEIHVLLRE------GVS-----ANNI  1115
             D++  RA   +  GV+L+PEGL+E +PE+  L+ E++ L+        G+S     A  +
Sbjct  292   DSIVKRAANKENFGVVLIPEGLVEFVPEMKKLIAELNDLMAHYADEFAGLSGFETQAAWL  351

Query  1116  SSQLSPWASALFEFLPPFIRRELLL  1190
               +LS  ++ +F  LP  I ++LL+
Sbjct  352   GKKLSAESAKVFASLPAEIAKQLLM  376



>ref|XP_003594152.1| Pyrophosphate-fructose 6-phosphate 1-phosphotransferase subunit 
beta [Medicago truncatula]
 gb|ABD32662.1| Pyrophosphate-dependent phosphofructokinase PfpB [Medicago truncatula]
 gb|AES64403.1| pyrophosphate-fructose-6-phosphate 1-phosphotransferase [Medicago 
truncatula]
Length=565

 Score =   276 bits (705),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 161/386 (42%), Positives = 233/386 (60%), Gaps = 10/386 (3%)
 Frame = +3

Query  69    LARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHTFGQPLA  248
              A   S++Q  R  ++  LP  LQ     V+   ++ A +P     I++LFP+ FGQP A
Sbjct  22    FASVYSEVQNSRVDHKLRLPSVLQAPFAIVDGPKSSAAGNPD---EIAKLFPYLFGQPSA  78

Query  249   HFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNSTllgflg  428
               + A            H  +++G+V  G Q+PGGHN I G+YD L+     STL GF G
Sbjct  79    ALVPAGENTA-----LPHRKLKIGVVLSGGQAPGGHNVISGIYDYLQQSASGSTLYGFKG  133

Query  429   gseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLKLDGLVI  608
             G  G+   K +E+  D +  Y+NQGG+DM+   +D+I + EQ   A    T L LDGLV+
Sbjct  134   GPAGIMKGKYVELNSDYIYPYRNQGGFDMICSGRDKIETPEQFKQAEETATKLDLDGLVV  193

Query  609   VGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICKVNSQLIS  788
             +GG  SNT+A  LAE F      T+V+G P T++GDLK++ V T+ GFDT CK+ +++I 
Sbjct  194   IGGDDSNTNACLLAENFRSKNLKTQVLGCPKTIDGDLKSKEVPTSFGFDTACKIYAEMIG  253

Query  789   NVCTDALSAEKYYYFIRLMGRKTSHVALECTLQSHPNMVILAEEVAASKLTLFDITKQVC  968
             NV  DA S  KYY+F+RLMGR  SH+ LEC LQ+HPN+ I+ EEVAA KLTL ++T  + 
Sbjct  254   NVMIDARSTGKYYHFVRLMGRAASHITLECALQTHPNITIIGEEVAAKKLTLKNVTDYIV  313

Query  969   DAVQARAEQDKYHGVILLPEGLIESIPEIYALLKEIH-VLLREGVSANNI-SSQLSPWAS  1142
             D +  RAE +  +GVIL+PEGLI+ IPE+  L+ E++ +L  E V    +   +L+  + 
Sbjct  314   DVICKRAEDNYNYGVILIPEGLIDFIPEVQHLIAELNEILAHETVDEGGLWKKKLTDQSL  373

Query  1143  ALFEFLPPFIRRELLLYPESDDSAQL  1220
              LFEFLP  I+ +L+L  +   + Q+
Sbjct  374   ELFEFLPQAIQEQLMLERDPHGNVQV  399



>ref|WP_014455241.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Spirochaeta 
africana]
 gb|AFG37252.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Spirochaeta 
africana DSM 8902]
Length=554

 Score =   275 bits (703),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 162/385 (42%), Positives = 240/385 (62%), Gaps = 24/385 (6%)
 Frame = +3

Query  78    ELSDLQKLRSQYRPELPPCLQG--TTVRVEFGDATTA-ADPSGGHTISRLFPHTFGQPLA  248
             +LS LQK R +Y+P+LP  LQ    ++ VEFG AT A AD +    +  LF  T+G+P+A
Sbjct  5     QLSPLQKARYEYQPKLPKALQSDLASISVEFGAATEAIADQA---RLKELFAKTYGKPIA  61

Query  249   HFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNSTllgflg  428
              F   S  V           +RVG++  G Q+PGGHN I G+YD LK  NP S L+GF G
Sbjct  62    SFTSGSNDV-------SSKLLRVGVILSGGQAPGGHNVIAGIYDGLKKGNPESVLIGFKG  114

Query  429   gseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLKLDGLVI  608
             G  GL  +  +EITD  +  Y+N GG+DM+G  + +I + +Q   +L     L+L+ +V+
Sbjct  115   GPSGLLEKDYVEITDSFMDEYRNTGGFDMIGSGRTKISTDQQFADSLRVAKELQLNAVVV  174

Query  609   VGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICKVNSQLIS  788
             +GG  SNT+AA LAE F +     +V+GVP T++GDLKN+++ET+ GFDT  K  ++LI 
Sbjct  175   IGGDDSNTNAALLAEYFIQEGTNIQVIGVPKTIDGDLKNEYIETSFGFDTAVKTYAELIG  234

Query  789   NVCTDALSAEKYYYFIRLMGRKTSHVALECTLQSHPNMVILAEEVAASKLTLFDITKQVC  968
             N+  DA SA+KY++FI+LMGR  SH+ALEC LQ+ PN+ +++EE+A  K TL  I   + 
Sbjct  235   NIGRDANSAKKYWHFIKLMGRSASHIALECALQTRPNICLISEEIAEKKQTLEQIVNSIA  294

Query  969   DAVQARAEQDKYHGVILLPEGLIESIPEIYALLKEIHVLL-REGVSANNIS---------  1118
             D V  R+   +  G++L+PEGLIE IPE+  L+ +++ LL +E      +S         
Sbjct  295   DTVVTRSSNGENFGLVLIPEGLIEFIPEMNELIAQLNDLLAKEAAEYEKLSSFEDQTAWV  354

Query  1119  -SQLSPWASALFEFLPPFIRRELLL  1190
              S+LS  + A+F+ LP  I+++LL+
Sbjct  355   ISKLSAASGAVFKELPADIQKQLLM  379



>emb|CDP11324.1| unnamed protein product [Coffea canephora]
Length=551

 Score =   273 bits (698),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 162/386 (42%), Positives = 234/386 (61%), Gaps = 9/386 (2%)
 Frame = +3

Query  69    LARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHTFGQPLA  248
             LA   S+LQ  R      LP  L+ +   V+   ++ A +P     I++LFP+ FGQP A
Sbjct  7     LASFYSELQASRLDVSLPLPSVLKNSFNVVDGPPSSAAGNPD---EIAKLFPNLFGQPSA  63

Query  249   HFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNSTllgflg  428
               +   +    +  ++ + ++++G+V  G Q+PGGHN I G++D L+     STL GF G
Sbjct  64    MLVPGDS----SGALSSNQSLKIGVVLSGGQAPGGHNVICGIFDYLQERTKGSTLYGFRG  119

Query  429   gseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLKLDGLVI  608
             G  G+   K +E+T D +  Y+NQGG+DM+   +D+I + EQ   A      L LDGLV+
Sbjct  120   GPAGIMNCKYVELTTDFIYPYRNQGGFDMICSGRDKIETPEQFKQAEETAQKLNLDGLVV  179

Query  609   VGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICKVNSQLIS  788
             +GG  SNT+A  LAE F      T+V+G P T++GDLK + V T+ GFDT CKV +++I 
Sbjct  180   IGGDDSNTNACLLAENFRAKNLKTRVIGCPKTIDGDLKCKEVPTSFGFDTACKVYAEMIG  239

Query  789   NVCTDALSAEKYYYFIRLMGRKTSHVALECTLQSHPNMVILAEEVAASKLTLFDITKQVC  968
             NV  DA S  KYY+F+RLMGR  SH+ALEC LQ+HPN+ I+ EEVAA KLTL ++T  + 
Sbjct  240   NVMIDARSTGKYYHFVRLMGRAASHIALECALQTHPNITIIGEEVAAKKLTLKNVTDYIT  299

Query  969   DAVQARAEQDKYHGVILLPEGLIESIPEIYALLKEIHVLLREGV--SANNISSQLSPWAS  1142
             D +  RAE    +GVIL+PEGLI+ IPE+  L+ E++ +L   V     N   +L   + 
Sbjct  300   DVICKRAELGFNYGVILVPEGLIDFIPEVQQLIAELNEILAHDVVDEEGNWKKKLRSQSH  359

Query  1143  ALFEFLPPFIRRELLLYPESDDSAQL  1220
              LFEFLP  I+ +LLL  +   + Q+
Sbjct  360   QLFEFLPQAIQEQLLLERDPHGNVQV  385



>ref|WP_013314522.1| Pyrophosphate--fructose 6-phosphate 1-phosphotransferase [Spirochaeta 
thermophila]
 sp|Q9EZ02.1|PFP_SPITD RecName: Full=Pyrophosphate--fructose 6-phosphate 1-phosphotransferase; 
AltName: Full=6-phosphofructokinase, pyrophosphate 
dependent; AltName: Full=PPi-dependent phosphofructokinase; 
Short=PPi-PFK; AltName: Full=Pyrophosphate-dependent 6-phosphofructose-1-kinase 
[Spirochaeta thermophila DSM 6192]
 gb|AAG37271.1|AF307859_1 pyrophosphate-dependent phosphofructokinase [Spirochaeta thermophila]
 gb|ADN02683.1| pyrophosphate--fructose 6-phosphate 1-phosphotransferase subunit 
beta [Spirochaeta thermophila DSM 6192]
Length=554

 Score =   273 bits (698),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 164/383 (43%), Positives = 232/383 (61%), Gaps = 22/383 (6%)
 Frame = +3

Query  81    LSDLQKLRSQYRPELPPCLQGTTVRV--EFGDATTAADPSGGHTISRLFPHTFGQPLAHF  254
             +S LQK R  Y P+LPP LQ    R+  E G  T A   +    + RLF +T+G+P+A  
Sbjct  4     ISPLQKARYGYVPKLPPVLQDEIARIQAELGQPTEAV--ADREDLKRLFANTYGKPIATL  61

Query  255   LRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNSTllgflggs  434
              R S   P+A          VG++  G  +PGGHN I GL+DALK  N  STL+GF GG 
Sbjct  62    TRGSN--PEA-----GRRRTVGVILSGGPAPGGHNVICGLFDALKKANRESTLIGFKGGP  114

Query  435   eglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLKLDGLVIVG  614
              G+   + +E TD ++  Y+N GG+D++G  + +I + EQ   AL       LD LVI+G
Sbjct  115   SGILDDEWIEFTDSLINQYRNTGGFDIIGSGRTKIETPEQFAKALENAKKHGLDALVIIG  174

Query  615   GVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICKVNSQLISNV  794
             G  SNT+AA LAE F +   P +V+G+P T++GDLKN+++E + GFDT  KV ++LI N+
Sbjct  175   GDDSNTNAALLAEYFVQQGAPIQVIGIPKTIDGDLKNEYIEASFGFDTATKVYAELIGNI  234

Query  795   CTDALSAEKYYYFIRLMGRKTSHVALECTLQSHPNMVILAEEVAASKLTLFDITKQVCDA  974
               DA+S+ KY++FIRLMGR  SH+ALEC LQ+HPN+ I++EEV    +TL  I  Q+ DA
Sbjct  235   ARDAISSRKYWHFIRLMGRSASHIALECALQTHPNVCIVSEEVREKNMTLSQIVDQIVDA  294

Query  975   VQARAEQDKYHGVILLPEGLIESIPEIYALLKEIHVLLREGVSANN-----------ISS  1121
             V  RA + +  GV+L+PEGLIE IPE+ AL+ E++ LL +     N           +  
Sbjct  295   VVKRAAKGENFGVVLVPEGLIEFIPEVGALIDELNTLLAKEAEVFNRIDDPRERISWVKG  354

Query  1122  QLSPWASALFEFLPPFIRRELLL  1190
             +LS     +F  LP  I+ +LL+
Sbjct  355   KLSGNNQHVFSSLPETIQAQLLM  377



>ref|WP_037983302.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Tannerella 
sp. oral taxon BU063]
 gb|ETK00674.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Tannerella 
sp. oral taxon BU063 isolate Cell 2]
 gb|ETK04037.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Tannerella 
sp. oral taxon BU063 isolate Cell 5]
 gb|ETK06766.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Tannerella 
sp. oral taxon BU063 isolate Cell 1/3]
 gb|ETK08124.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Tannerella 
sp. oral taxon BU063 isolate Cell 6/7/9]
Length=548

 Score =   273 bits (697),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 160/379 (42%), Positives = 224/379 (59%), Gaps = 20/379 (5%)
 Frame = +3

Query  84    SDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHTFGQPLAHFLRA  263
             S LQ  R+ Y P++P  L+G+   VE G AT AA       I RLFPHT+G P   F R 
Sbjct  4     SALQIARAAYVPKMPVALRGSVRAVE-GAATEAAGDK--EEIKRLFPHTYGMPAVTFERG  60

Query  264   SAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNSTllgflggsegl  443
              A  P        P I  G++  G Q+PGGHN I GL+D LK  NP S L GF+ G  GL
Sbjct  61    DAADP-------MPPINAGVILSGGQAPGGHNVIAGLFDGLKAANPESRLFGFILGPGGL  113

Query  444   fAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLKLDGLVIVGGVT  623
                K +E+T DI+  Y+N GG+DM+G  + ++   EQ +  L     L +  LVI+GG  
Sbjct  114   VEHKYMELTADIIDEYRNTGGFDMIGSGRTKLERREQFDKGLEILKELGISALVIIGGDD  173

Query  624   SNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICKVNSQLISNVCTD  803
             SNT+AA LAE +        V+G P T++GDLKN  +ET+ GFDT CKV S++I N+  D
Sbjct  174   SNTNAAVLAEYYRSIGAGVSVIGCPKTIDGDLKNDLIETSFGFDTACKVYSEVIGNIQRD  233

Query  804   ALSAEKYYYFIRLMGRKTSHVALECTLQSHPNMVILAEEVAASKLTLFDITKQVCDAVQA  983
               SA KY++FI+LMGR  SH+ALEC LQ+HPN+ I++EEV A+ L+L +I  ++   V  
Sbjct  234   CNSARKYWHFIKLMGRSASHIALECALQTHPNVCIISEEVEANDLSLDEIVNRIARVVAR  293

Query  984   RAEQDKYHGVILLPEGLIESIPEIYALLKEIH----------VLLREGVSANNISSQLSP  1133
             RA +    G +L+PEGLIE IP +  L+ E++           ++++ V  + + S+LS 
Sbjct  294   RAAEGNNFGTVLIPEGLIEFIPAMKRLIAELNDFLARNKAEFKMIKKSVRHSYLISKLSK  353

Query  1134  WASALFEFLPPFIRRELLL  1190
               +AL+  LP  + R+L L
Sbjct  354   ENAALYASLPEGVARQLAL  372



>ref|WP_037997392.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Tannerella 
sp. oral taxon BU063]
 gb|ETK12975.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Tannerella 
sp. oral taxon BU063 isolate Cell 8/11]
Length=548

 Score =   273 bits (697),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 160/379 (42%), Positives = 224/379 (59%), Gaps = 20/379 (5%)
 Frame = +3

Query  84    SDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHTFGQPLAHFLRA  263
             S LQ  R+ Y P++P  L+G+   VE G AT AA       I RLFPHT+G P   F R 
Sbjct  4     SALQIARAAYVPKMPVALRGSVRAVE-GAATEAAGDK--EEIKRLFPHTYGMPAVTFERG  60

Query  264   SAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNSTllgflggsegl  443
              A  P        P I  G++  G Q+PGGHN I GL+D LK  NP S L GF+ G  GL
Sbjct  61    DAADP-------MPPINAGVILSGGQAPGGHNVIAGLFDGLKAANPESRLFGFILGPGGL  113

Query  444   fAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLKLDGLVIVGGVT  623
                K +E+T DI+  Y+N GG+DM+G  + ++   EQ +  L     L +  LVI+GG  
Sbjct  114   VEHKYMELTADIIDEYRNTGGFDMIGSGRTKLERREQFDKGLEILKELGISALVIIGGDD  173

Query  624   SNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICKVNSQLISNVCTD  803
             SNT+AA LAE +        V+G P T++GDLKN  +ET+ GFDT CKV S++I N+  D
Sbjct  174   SNTNAAVLAEYYRSIGAGVSVIGCPKTIDGDLKNDLIETSFGFDTACKVYSEVIGNIQRD  233

Query  804   ALSAEKYYYFIRLMGRKTSHVALECTLQSHPNMVILAEEVAASKLTLFDITKQVCDAVQA  983
               SA KY++FI+LMGR  SH+ALEC LQ+HPN+ I++EEV A+ L+L +I  ++   V  
Sbjct  234   CNSARKYWHFIKLMGRSASHIALECALQTHPNVCIISEEVEANDLSLDEIVNRIARVVAR  293

Query  984   RAEQDKYHGVILLPEGLIESIPEIYALLKEIH----------VLLREGVSANNISSQLSP  1133
             RA +    G +L+PEGLIE IP +  L+ E++           ++++ V  + + S+LS 
Sbjct  294   RAAEGNNFGTVLIPEGLIEFIPAMKRLIAELNDFLARNKAEFKMIKKSVRHSYLISKLSK  353

Query  1134  WASALFEFLPPFIRRELLL  1190
               +AL+  LP  + R+L L
Sbjct  354   ENAALYASLPEGVARQLAL  372



>ref|WP_006189908.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Treponema 
vincentii]
 gb|EEV19357.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Treponema 
vincentii ATCC 35580]
Length=556

 Score =   273 bits (697),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 157/380 (41%), Positives = 228/380 (60%), Gaps = 18/380 (5%)
 Frame = +3

Query  81    LSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHTFGQPLAHFLR  260
             +S L K R  Y P  P  L      +        A  +    I  LFPH +G+P+ HF++
Sbjct  3     VSQLHKARYAYIPRFPAILDEPIESIAMQKEQETASIANAEEIQPLFPHIYGKPVVHFVK  62

Query  261   ASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNSTllgflggseg  440
              +A +       +   +RVG +  G Q+PGGHN I GLYD L+  NPNS L GFLGG EG
Sbjct  63    GTAHI-------DKKPLRVGTILSGGQAPGGHNVIAGLYDGLQKANPNSKLFGFLGGPEG  115

Query  441   lfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLKLDGLVIVGGV  620
             L   + +EIT  I+  Y+N GG+DM+G  + +I + EQ+  A+     ++LD +VI+GG 
Sbjct  116   LVIGRAIEITGAIIEKYRNTGGFDMIGSGRAKIETPEQIAGAVETVKRMELDAVVIIGGD  175

Query  621   TSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICKVNSQLISNVCT  800
              SNT+AA L+E F +    T+++GVP T++GDLK   VET+ GFDT  K+ + LI N+  
Sbjct  176   DSNTNAAVLSEYFVQQGIATQIIGVPKTIDGDLKYDMVETSFGFDTATKIYADLIGNIAR  235

Query  801   DALSAEKYYYFIRLMGRKTSHVALECTLQSHPNMVILAEEVAASKLTLFDITKQVCDAVQ  980
             DA SA+KY++FI+LMGR  SH+ALEC L++ PN+ +++EEVA  K+TL  IT  + DAV 
Sbjct  236   DANSAKKYWHFIKLMGRFASHIALECALRTQPNICLISEEVAEKKMTLQQITDIIADAVV  295

Query  981   ARAEQDKYHGVILLPEGLIESIPEIYALLKEIHVLLREGVSANN-----------ISSQL  1127
              RA + +  GV+L+PEG+IE IPE+  L+KE++  + +     N           +S  +
Sbjct  296   KRAVRKENFGVVLIPEGVIEFIPEMKQLIKELNEAMAQHADTFNTLETFKQQKAWVSQHI  355

Query  1128  SPWASALFEFLPPFIRRELL  1187
             SP ++ALF  +P  I  E L
Sbjct  356   SPESAALFASMPEDIAAEFL  375



>ref|XP_007147679.1| hypothetical protein PHAVU_006G145300g [Phaseolus vulgaris]
 gb|ESW19673.1| hypothetical protein PHAVU_006G145300g [Phaseolus vulgaris]
Length=561

 Score =   273 bits (698),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 162/387 (42%), Positives = 234/387 (60%), Gaps = 12/387 (3%)
 Frame = +3

Query  69    LARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHTFGQPLA  248
             L+   S++QK R  +   LP  L+     ++   ++ A +P     I++LFPH FGQP  
Sbjct  18    LSSVYSEVQKKRVDHALPLPSVLKHPFTLLDGPPSSAAGNPD---EIAKLFPHLFGQP--  72

Query  249   HFLRASAKVP-DAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNSTllgfl  425
                 + A VP D ++   H  +++G+V  G Q+PGGHN I G++D L+   P STL GF 
Sbjct  73    ----SVALVPSDPRVAQTHQKLKIGVVLSGGQAPGGHNVISGIFDYLQERAPGSTLYGFR  128

Query  426   ggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLKLDGLV  605
             GG  G+   K +E+T + +  Y+NQGG+DM+   +D+I + EQ   A      L LDGLV
Sbjct  129   GGPAGIMKCKYVELTSEYIYPYRNQGGFDMICSGRDKIETPEQFKQAEETAKKLDLDGLV  188

Query  606   IVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICKVNSQLI  785
             ++GG  SNT+A  LAE F      T V+G P T++GDLK + V T+ GFDT CK+ S++I
Sbjct  189   VIGGDDSNTNACLLAENFRSKNLKTHVIGCPKTIDGDLKCKEVPTSFGFDTACKIYSEMI  248

Query  786   SNVCTDALSAEKYYYFIRLMGRKTSHVALECTLQSHPNMVILAEEVAASKLTLFDITKQV  965
              NV  DA S  KYY+F+RLMGR  SH+ LEC LQ+HPN+ I+ EEVAA KLTL ++T  +
Sbjct  249   GNVMIDARSTGKYYHFVRLMGRAASHITLECALQTHPNITIIGEEVAAKKLTLKNVTDYI  308

Query  966   CDAVQARAEQDKYHGVILLPEGLIESIPEIYALLKEIHVLLREGV--SANNISSQLSPWA  1139
              D V  RAE    +GVIL+PEGLI+ IPE+  L+ E++ +L   +         +LS  +
Sbjct  309   VDVVCKRAEISYNYGVILIPEGLIDFIPEVQHLIGELNEILAHDIVDEGGLWKKKLSDQS  368

Query  1140  SALFEFLPPFIRRELLLYPESDDSAQL  1220
               LF+FLP  I+ +L+L  +   + Q+
Sbjct  369   LKLFDFLPQAIQEQLMLERDPHGNVQV  395



>ref|WP_025798196.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Prevotella 
saccharolytica]
Length=546

 Score =   272 bits (696),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 165/381 (43%), Positives = 230/381 (60%), Gaps = 21/381 (6%)
 Frame = +3

Query  78    ELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHTFGQPLAHFL  257
             E S LQK R+ Y+P+LP  LQG  V++  G  T + D      I +LFP+T+G PL  F+
Sbjct  2     EKSALQKARASYQPKLPKALQGA-VKIAEGAPTQSVDNQ--EDIKKLFPNTYGMPLIEFV  58

Query  258   RASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNSTllgflggse  437
             + + ++P         AI VGI+  G Q+PGGHN I GL+D +K  NPN+ L GFL G  
Sbjct  59    QGN-EIP-------AKAINVGIILSGGQAPGGHNVISGLFDEVKKLNPNNRLYGFLMGPG  110

Query  438   glfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLKLDGLVIVGG  617
             GL   K +EIT D L  Y+N GG+DM+G  + ++ +TEQ    L     L ++ +VI+GG
Sbjct  111   GLVDHKYIEITADFLNDYRNTGGFDMIGSGRTKLETTEQFEKGLEIIRKLDINAIVIIGG  170

Query  618   VTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICKVNSQLISNVC  797
               SNT+A  LAE +A      +V+G P T++GDLKN  +ET+ GFDT  K  S+LI N+ 
Sbjct  171   DDSNTNACVLAEYYAAKNYGVQVIGCPKTIDGDLKNDQIETSFGFDTATKTYSELIGNIE  230

Query  798   TDALSAEKYYYFIRLMGRKTSHVALECTLQSHPNMVILAEEVAASKLTLFDITKQVCDAV  977
              D  SA KY++F++LMGR  SH+ALEC LQ+ PN+ I++EEV A  LTL +I + +  AV
Sbjct  231   RDCNSARKYWHFVKLMGRSASHIALECALQTQPNICIISEEVEAKDLTLNNIIENIAAAV  290

Query  978   QARAEQDKYHGVILLPEGLIESIPEIYALLKEIHVLLR----------EGVSANNISSQL  1127
               RAEQ +  GV+L+PEGLIE +P I  L++E++ LL           +      I + L
Sbjct  291   AYRAEQGQNFGVVLIPEGLIEFVPAIGRLIQELNDLLAAHGADYKDLDKDAQREYIMTHL  350

Query  1128  SPWASALFEFLPPFIRRELLL  1190
             S    A FE LP  + R+L L
Sbjct  351   SAENKATFETLPESVGRQLSL  371



>ref|XP_004955203.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit beta 1-like [Setaria italica]
Length=553

 Score =   273 bits (697),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 160/386 (41%), Positives = 234/386 (61%), Gaps = 12/386 (3%)
 Frame = +3

Query  69    LARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHTFGQPLA  248
             LA   S++Q  R  +  +LP  L      V+   ++   +P     I++LFP+ FGQP  
Sbjct  12    LASVYSEVQTSRLHHALQLPSVLCSQFTLVDGPPSSATGNPD---EIAKLFPNLFGQP--  66

Query  249   HFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNSTllgflg  428
                 ++A VP  + +   P ++VG+V  G Q+PGGHN I G++D L+     ST+ GF G
Sbjct  67    ----SAALVPAKEAVEGKP-LKVGVVLSGGQAPGGHNVICGIFDFLQQRAKGSTMYGFKG  121

Query  429   gseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLKLDGLVI  608
             G  G+   K +E+  D +  Y+NQGG+DM+   +D+I + EQ   A      L+LDGLV+
Sbjct  122   GPAGVMNCKYVELNTDFVYPYRNQGGFDMICSGRDKIETPEQFKQAEDTANKLELDGLVV  181

Query  609   VGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICKVNSQLIS  788
             +GG  SNT+A  +AE F      T+V+G P T++GDLK + V T+ GFDT CK+ S++I 
Sbjct  182   IGGDDSNTNACLIAEYFRSKNLKTRVIGCPKTIDGDLKCKEVPTSFGFDTACKIYSEMIG  241

Query  789   NVCTDALSAEKYYYFIRLMGRKTSHVALECTLQSHPNMVILAEEVAASKLTLFDITKQVC  968
             NV TDA S+ KYY+F+RLMGR  SH+ LEC LQ+HPN+ ++ EEVA  K TL ++T  + 
Sbjct  242   NVMTDARSSGKYYHFVRLMGRAASHITLECALQTHPNIALIGEEVAEKKQTLKNVTDYIT  301

Query  969   DAVQARAEQDKYHGVILLPEGLIESIPEIYALLKEIHVLLREGV--SANNISSQLSPWAS  1142
             D V  RAE    +GVIL+PEGLI+ IPE+  L+ E++ +L       A    ++L P + 
Sbjct  302   DIVCKRAELGYNYGVILIPEGLIDFIPEVQKLIAELNEILAHDTVDEAGVWKNKLEPESK  361

Query  1143  ALFEFLPPFIRRELLLYPESDDSAQL  1220
              LFEFLPP I+ +LLL  +   + Q+
Sbjct  362   KLFEFLPPSIQEQLLLERDPHGNVQV  387



>ref|WP_009161991.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Prevotella 
saccharolytica]
 gb|EKY02337.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Prevotella 
saccharolytica F0055]
Length=546

 Score =   272 bits (696),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 165/381 (43%), Positives = 230/381 (60%), Gaps = 21/381 (6%)
 Frame = +3

Query  78    ELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHTFGQPLAHFL  257
             E S LQK R+ Y+P+LP  LQG  V++  G  T + D      I +LFP+T+G PL  F+
Sbjct  2     EKSALQKARASYQPKLPKALQGA-VKIAEGAPTQSVDNQ--EDIKKLFPNTYGMPLIEFV  58

Query  258   RASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNSTllgflggse  437
             + + ++P         AI VGI+  G Q+PGGHN I GL+D +K  NPN+ L GFL G  
Sbjct  59    QGN-EIP-------AKAINVGIILSGGQAPGGHNVISGLFDEVKKLNPNNRLYGFLMGPG  110

Query  438   glfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLKLDGLVIVGG  617
             GL   K +EIT D L  Y+N GG+DM+G  + ++ +TEQ    L     L ++ +VI+GG
Sbjct  111   GLVDHKYIEITADFLNDYRNTGGFDMIGSGRTKLETTEQFEKGLEIIRKLDINAIVIIGG  170

Query  618   VTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICKVNSQLISNVC  797
               SNT+A  LAE +A      +V+G P T++GDLKN  +ET+ GFDT  K  S+LI N+ 
Sbjct  171   DDSNTNACVLAEYYAAKNYGVQVIGCPKTIDGDLKNDQIETSFGFDTATKTYSELIGNIE  230

Query  798   TDALSAEKYYYFIRLMGRKTSHVALECTLQSHPNMVILAEEVAASKLTLFDITKQVCDAV  977
              D  SA KY++F++LMGR  SH+ALEC LQ+ PN+ I++EEV A  LTL +I + +  AV
Sbjct  231   RDCNSARKYWHFVKLMGRSASHIALECALQTQPNICIISEEVEAKDLTLNNIIENIAAAV  290

Query  978   QARAEQDKYHGVILLPEGLIESIPEIYALLKEIHVLLR----------EGVSANNISSQL  1127
               RAEQ +  GV+L+PEGLIE +P I  L++E++ LL           +      I + L
Sbjct  291   AYRAEQGQNFGVVLIPEGLIEFVPAIGRLIQELNDLLAAHGADYKDLDKDAQREYIMAHL  350

Query  1128  SPWASALFEFLPPFIRRELLL  1190
             S    A FE LP  + R+L L
Sbjct  351   SAENKATFETLPESVGRQLSL  371



>ref|XP_007153992.1| hypothetical protein PHAVU_003G082000g [Phaseolus vulgaris]
 gb|ESW25986.1| hypothetical protein PHAVU_003G082000g [Phaseolus vulgaris]
Length=568

 Score =   273 bits (697),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 160/381 (42%), Positives = 233/381 (61%), Gaps = 11/381 (3%)
 Frame = +3

Query  57    SDFG-LARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHTF  233
             SD G  A   S++Q  R  +   LP  L+   V V+   +T A +P     I++LFP+ F
Sbjct  20    SDTGRFAAVYSEVQNSRIDHALPLPSVLKNPFVIVDGHQSTAAGNPD---EIAKLFPNLF  76

Query  234   GQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNSTl  413
             GQP A  + +     D+  +  +P +++G+V  G Q+PGGHN I G++D L+     STL
Sbjct  77    GQPSASLVPS-----DSHALHANPKLKIGVVLSGGQAPGGHNVISGIFDYLQDKAEGSTL  131

Query  414   lgflggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLKL  593
              GF GG  G+   K +E+T D +  Y+NQGG+DM+   +D+I + EQ   A      L L
Sbjct  132   YGFRGGPAGIMKSKYVELTSDYIYPYRNQGGFDMIRSGRDKIETPEQFRQAEETVQKLDL  191

Query  594   DGLVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICKVN  773
             DGLV++GG  SNT+A  LAE F      T+V+G P T++GDLK + V T+ GFDT CK+ 
Sbjct  192   DGLVVIGGDDSNTNACLLAEYFRSKNIKTRVIGCPKTIDGDLKCKEVPTSFGFDTACKIY  251

Query  774   SQLISNVCTDALSAEKYYYFIRLMGRKTSHVALECTLQSHPNMVILAEEVAASKLTLFDI  953
             +++I NV  DA S  KYY+F+RLMGR  SH+ LEC LQ+HPN+ I+ EEVA  K+TL D+
Sbjct  252   AEMIGNVMIDARSTGKYYHFVRLMGRAASHITLECALQTHPNITIIGEEVATKKMTLKDV  311

Query  954   TKQVCDAVQARAEQDKYHGVILLPEGLIESIPEIYALLKEIH-VLLREGVSANNI-SSQL  1127
             T  + D +  RAE +  +GVIL+PEGLI+ IPE+  L+ E++ +L  + V    +   +L
Sbjct  312   TDYIVDIISKRAEDNYNYGVILIPEGLIDFIPEVQHLIAELNEILAHDTVDEGGLWKKKL  371

Query  1128  SPWASALFEFLPPFIRRELLL  1190
             +  +  LFE LP  I+ +L+L
Sbjct  372   TDQSLNLFELLPKAIQEQLML  392



>ref|WP_024268710.1| Pyrophosphate--fructose 6-phosphate 1-phosphotransferase, beta 
subunit [Salinispira pacifica]
 gb|AHC15807.1| Pyrophosphate--fructose 6-phosphate 1-phosphotransferase, beta 
subunit [Salinispira pacifica]
Length=553

 Score =   272 bits (696),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 163/385 (42%), Positives = 234/385 (61%), Gaps = 24/385 (6%)
 Frame = +3

Query  78    ELSDLQKLRSQYRPELPPCLQG--TTVRVEFGDAT-TAADPSGGHTISRLFPHTFGQPLA  248
             E+S LQK R +Y+P+LP  L    + +RVE GD T + AD      +  LFPH++G P+A
Sbjct  2     EISSLQKARYEYQPKLPAALDSAISDIRVELGDPTESVADQD---QVKSLFPHSYGAPIA  58

Query  249   HFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNSTllgflg  428
              F     K       T    +RVG++  G Q+PGGHN I GLYD LK  N  S L+GFLG
Sbjct  59    VFASGKGK-------TSQNPLRVGVILSGGQAPGGHNVITGLYDGLKKANSQSNLVGFLG  111

Query  429   gseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLKLDGLVI  608
             G  GL     +   D  +  ++N GG+D++G  + +I + EQ  AAL      KLD +V+
Sbjct  112   GPSGLMDNDFIVFDDAKIDAFRNTGGFDIIGSGRTKIETDEQFAAALNTAKEQKLDAVVV  171

Query  609   VGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICKVNSQLIS  788
             +GG  SNT+AA LAE F +     +V+GVP T++GDLKN+++ET+ GFDT  K  S+LI 
Sbjct  172   IGGDDSNTNAALLAEYFKDNGTDIQVIGVPKTIDGDLKNEYIETSFGFDTAVKTYSELIG  231

Query  789   NVCTDALSAEKYYYFIRLMGRKTSHVALECTLQSHPNMVILAEEVAASKLTLFDITKQVC  968
             N+  DA SA+KY++FI+LMGR  SH+ALE  LQ+HPN+ I++EEVA  K +L  I +++ 
Sbjct  232   NIMRDANSAKKYWHFIKLMGRSASHIALEAALQTHPNVAIISEEVAEKKKSLNQIVEEIA  291

Query  969   DAVQARAEQDKYHGVILLPEGLIESIPEIYALLKEIHVLLREGVS-----------ANNI  1115
             + V+ R++  +  G+ L+PEGLIE IPE+  L+ E++ LL                A   
Sbjct  292   NVVRHRSDNGENFGIALIPEGLIEFIPEMKTLISELNDLLAHDEKYFATLKSFEDQAEFA  351

Query  1116  SSQLSPWASALFEFLPPFIRRELLL  1190
              S+LS  ++ +F  LP  IR++LLL
Sbjct  352   VSKLSDHSAKVFSSLPRGIRQQLLL  376



>ref|WP_013758252.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Treponema 
brennaborense]
 gb|AEE16544.1| diphosphate/fructose-6-phosphate 1-phosphotransferase [Treponema 
brennaborense DSM 12168]
Length=553

 Score =   272 bits (696),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 163/386 (42%), Positives = 236/386 (61%), Gaps = 25/386 (6%)
 Frame = +3

Query  75    RELSDLQKLRSQYRPELPPCLQGT---TVRVEFGDATTA-ADPSGGHTISRLFPHTFGQP  242
             + +S LQ  R  Y+P+LP  L+      V +EFG  TTA AD +    ++ LF HT+G+P
Sbjct  2     KSVSALQTARYAYQPKLPAVLRDNEPENVALEFGKPTTALADQA---ELASLFKHTYGKP  58

Query  243   LAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNSTllgf  422
              A F + +      +I       RVG++  G Q+PGGHN I GLYD +K  N +S + GF
Sbjct  59    EALFKKGANPAAGKKI-------RVGVILSGGQAPGGHNVIAGLYDGIKKGNKDSVVFGF  111

Query  423   lggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLKLDGL  602
              GG  GL   + +EITD  +  Y+N GG+DM+G  + +I + EQ  A++     L LD +
Sbjct  112   TGGPSGLIDGEYVEITDSFMDEYRNTGGFDMIGSGRTKIETPEQYAASVATAKKLDLDAI  171

Query  603   VIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICKVNSQL  782
             VI+GG  SNT+AA LAE FAE    T+V+GVP T++GDLKN+ +ET+ GFDT CK  S+L
Sbjct  172   VIIGGDDSNTNAALLAERFAELGEKTRVIGVPKTIDGDLKNEQIETSFGFDTACKTYSEL  231

Query  783   ISNVCTDALSAEKYYYFIRLMGRKTSHVALECTLQSHPNMVILAEEVAASKLTLFDITKQ  962
             I N+  DA SA+KY++FI+LMGR  SH+ALEC LQ+ PN+ +++EEV A K+TL  IT  
Sbjct  232   IGNIGRDANSAKKYWHFIKLMGRSASHIALECALQTQPNVCLVSEEVEAQKMTLRRITDD  291

Query  963   VCDAVQARAEQDKYHGVILLPEGLIESIPEIYALLKEIHVLLREGVSANN----------  1112
             +C  +  RA   +  G++L+PEGL+E IPE+ +L+ E++  + +  +A N          
Sbjct  292   ICSVIAKRAANKENFGIVLIPEGLVEFIPEMKSLIAELNDTMAKHEAAFNALSDFAAKKA  351

Query  1113  -ISSQLSPWASALFEFLPPFIRRELL  1187
              + S LS  +   F+ LP  I  + L
Sbjct  352   WLKSNLSAASYETFDSLPDAIAAQFL  377



>ref|XP_001773466.1| predicted protein [Physcomitrella patens]
 gb|EDQ61666.1| predicted protein [Physcomitrella patens]
Length=567

 Score =   272 bits (695),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 160/381 (42%), Positives = 227/381 (60%), Gaps = 10/381 (3%)
 Frame = +3

Query  84    SDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHTFGQPLAHFLRA  263
             S +Q  R  + P LP  LQG         +T+A  P     I +LFP  FGQP    +++
Sbjct  27    SPVQTSRIDHTPTLPSVLQGNFKLNHGPPSTSAGQPE---EIQKLFPCLFGQPSVQIVKS  83

Query  264   SAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNSTllgflggsegl  443
                  D+        ++VG+V  G Q+PGGHN I G +D L+ H P S L GF GG  G+
Sbjct  84    -----DSPSYNVDQKLKVGVVLSGGQAPGGHNVIAGFFDYLQAHAPGSVLYGFKGGPAGI  138

Query  444   fAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLKLDGLVIVGGVT  623
                K +EIT + L  Y+NQGG+D++   +D+I + EQ   A+   T L LDGLV++GG  
Sbjct  139   MRNKVVEITAEFLYPYRNQGGFDIICSGRDKIETPEQFQQAVDTVTKLDLDGLVVIGGDD  198

Query  624   SNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICKVNSQLISNVCTD  803
             SNT+AA L E F   K    V+G P T++GDLK+  V  + GFDT CK+ +++I N+  D
Sbjct  199   SNTNAALLGEYFRSKKVKCHVIGCPKTIDGDLKSVEVPISFGFDTACKIYAEMIGNIMVD  258

Query  804   ALSAEKYYYFIRLMGRKTSHVALECTLQSHPNMVILAEEVAASKLTLFDITKQVCDAVQA  983
             A S  KYY+F+RLMGR  SH+ LEC LQ+HPN+ I+ EEV +   TL ++T  + D V  
Sbjct  259   ARSTGKYYHFVRLMGRAASHITLECALQTHPNVAIIGEEVNSQNKTLREVTNSIADLVCQ  318

Query  984   RAEQDKYHGVILLPEGLIESIPEIYALLKEIH-VLLREGVSAN-NISSQLSPWASALFEF  1157
             RAE  K++GV+L+PEGLI+ IPEI  L+ E++ +L  +G   + +  S L P + ALF+ 
Sbjct  319   RAEMGKHYGVVLIPEGLIDFIPEIQHLISELNEILANQGCDEHGHWKSTLKPPSRALFDS  378

Query  1158  LPPFIRRELLLYPESDDSAQL  1220
             LP  I+ ELLL  +   + Q+
Sbjct  379   LPHSIQEELLLERDPHGNVQV  399



>emb|CBK24494.2| unnamed protein product [Blastocystis hominis]
 emb|CBK25089.2| unnamed protein product [Blastocystis hominis]
 emb|CBK20473.2| unnamed protein product [Blastocystis hominis]
Length=538

 Score =   271 bits (693),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 155/381 (41%), Positives = 234/381 (61%), Gaps = 14/381 (4%)
 Frame = +3

Query  81    LSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHTFGQPLAHFLR  260
             +S+LQ  R  Y P LP  L    V V+  +A  AA  +    I  LFP T+G P   +  
Sbjct  1     MSELQTFRRSYIPPLPTILT-KDVNVKKCEALGAA--ADHEKIQALFPCTYGLPRVEYEE  57

Query  261   ASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNSTllgflggseg  440
              + KV           + +G+V  G Q+PGGHN I G+YD  K    N  + GF  G  G
Sbjct  58    CTGKV--------WRPMNIGVVLSGGQAPGGHNVIAGIYDFTKKVGGN--MYGFRYGPRG  107

Query  441   lfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLKLDGLVIVGGV  620
             +F  K ++I D  +  Y+N GG+DM+G  +D+I+  +Q  A+   C  L+LDGL+++GG 
Sbjct  108   VFTGKYVKIDDKFMDQYRNMGGFDMIGSGRDKIKGDDQFQASAKVCNDLELDGLIVIGGD  167

Query  621   TSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICKVNSQLISNVCT  800
              SNT+AA LAE F      T V+G P T++GDLKN ++  + GFDT CK+ S+LI N+C 
Sbjct  168   DSNTNAALLAEYFQSIHHRTHVIGCPKTIDGDLKNDYIPVSFGFDTACKIYSELIGNICV  227

Query  801   DALSAEKYYYFIRLMGRKTSHVALECTLQSHPNMVILAEEVAASKLTLFDITKQVCDAVQ  980
             DALSA+KYY+F+RLMGR  SH+ +EC  ++HPN   + EE++  K ++  IT++V D + 
Sbjct  228   DALSAQKYYHFVRLMGRSASHITMECAFETHPNYTFIGEEISQKKKSVKQITQEVVDLIV  287

Query  981   ARAEQDKYHGVILLPEGLIESIPEIYALLKEIHVLLREGVSA-NNISSQLSPWASALFEF  1157
              RA+  K +GVILLPEGLIE IPE+ +L++E++ ++  G +A ++I++ L P +  LF++
Sbjct  288   ERAKLGKNYGVILLPEGLIEFIPEMGSLIEELNEVIAAGHTAQDDIAAHLQPASRELFDY  347

Query  1158  LPPFIRRELLLYPESDDSAQL  1220
             LP  +R +L L  +S  + ++
Sbjct  348   LPQSLRDQLTLDRDSHGNVKV  368



>ref|WP_019188428.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Candidatus 
Prevotella conceptionensis]
Length=546

 Score =   271 bits (693),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 166/381 (44%), Positives = 229/381 (60%), Gaps = 21/381 (6%)
 Frame = +3

Query  78    ELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHTFGQPLAHFL  257
             E S LQK R+ Y+P+LP  LQG  V+V  G  T + D  G   I +LFP+T+G PL  F+
Sbjct  2     EKSALQKARASYQPKLPKALQGA-VKVSEGAPTKSVDNQG--EIKKLFPNTYGMPLVEFV  58

Query  258   RASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNSTllgflggse  437
             +   ++P  +I        VGI+  G Q+PGGHN I GL+D +K  NPN+ L GFL G  
Sbjct  59    QGD-EMPSKEI-------NVGIILSGGQAPGGHNVISGLFDEVKRLNPNNRLYGFLMGPG  110

Query  438   glfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLKLDGLVIVGG  617
             GL     +EIT D +  Y+N GG+DM+G  + ++ +TEQ    L     L +  +VI+GG
Sbjct  111   GLVDHNYIEITADFIDEYRNTGGFDMIGSGRTKLETTEQFEKGLEIIRKLDIKAIVIIGG  170

Query  618   VTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICKVNSQLISNVC  797
               SNT+A  LAE +A      +V+G P T++GDLKN+ +ET+ GFDT  K  S+LI N+ 
Sbjct  171   DDSNTNACVLAEYYAAKNYGVQVIGCPKTIDGDLKNEQIETSFGFDTATKTYSELIGNIE  230

Query  798   TDALSAEKYYYFIRLMGRKTSHVALECTLQSHPNMVILAEEVAASKLTLFDITKQVCDAV  977
              D  SA KY++FI+LMGR  SH+ALEC LQ+ PN+ I++EEV A  LTL DI +++  AV
Sbjct  231   RDCNSARKYWHFIKLMGRSASHIALECALQTQPNICIISEEVEAKDLTLNDIIEEIASAV  290

Query  978   QARAEQDKYHGVILLPEGLIESIPEIYALLKEIHVLL-REGVSANN---------ISSQL  1127
               RA   + +GV+L+PEGLIE +P I  L+ E++ LL   G    +         I S L
Sbjct  291   AHRAANGQNYGVVLIPEGLIEFVPAIGRLIHELNDLLAAHGADYKDLDKDAQRAYIMSHL  350

Query  1128  SPWASALFEFLPPFIRRELLL  1190
             S    A FE LP  + R+L L
Sbjct  351   SAENKATFETLPYSVARQLSL  371



>ref|XP_003534704.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit beta-like [Glycine max]
Length=562

 Score =   271 bits (694),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 163/386 (42%), Positives = 234/386 (61%), Gaps = 12/386 (3%)
 Frame = +3

Query  69    LARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHTFGQPLA  248
             LA   S++QK R  +   LP  L+     +    ++ A +P     I++LFPH FGQP A
Sbjct  21    LASVYSEVQKTRVDHALPLPSVLKHPFTILHGPPSSAAGNPD---EIAKLFPHLFGQPSA  77

Query  249   HFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNSTllgflg  428
                R+ A    AQ       +++G+V  G Q+PGGHN I G++D L+   P STL GF G
Sbjct  78    ALARSDA----AQT---QKKLKIGVVLSGGQAPGGHNVISGIFDYLQERAPGSTLYGFKG  130

Query  429   gseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLKLDGLVI  608
             G  G+   K +E+T + +  Y+NQGG+DM+   +D+I + EQ   A      L LDGLV+
Sbjct  131   GPAGIMKCKYVELTSEYIYPYRNQGGFDMICSGRDKIETPEQFKQAEETAKKLDLDGLVV  190

Query  609   VGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICKVNSQLIS  788
             +GG  SNT+A  LAE F      T V+G P T++GDLK + V T+ GFDT CK+ S++I 
Sbjct  191   IGGDDSNTNACLLAENFRSKNLKTSVIGCPKTIDGDLKCKEVPTSFGFDTACKIYSEMIG  250

Query  789   NVCTDALSAEKYYYFIRLMGRKTSHVALECTLQSHPNMVILAEEVAASKLTLFDITKQVC  968
             NV  DA S  KYY+F+RLMGR  SH+ LEC LQ+HPN+ I+ EEVAA KLTL ++T  + 
Sbjct  251   NVMIDARSTGKYYHFVRLMGRAASHITLECALQTHPNITIIGEEVAAKKLTLKNVTDYIV  310

Query  969   DAVQARAEQDKYHGVILLPEGLIESIPEIYALLKEIH-VLLREGVSANNI-SSQLSPWAS  1142
             D V  RAE +  +GVIL+PEGLI+ IPE+  L+ E++ +L  + V    +   +L+  + 
Sbjct  311   DVVCKRAEINYNYGVILIPEGLIDFIPEVQHLIAELNEILAHDTVDEGGLWKKKLTDQSL  370

Query  1143  ALFEFLPPFIRRELLLYPESDDSAQL  1220
              LF+FLP  I+ +L+L  +   + Q+
Sbjct  371   KLFDFLPQAIQEQLMLERDPHGNVQV  396



>ref|WP_036897542.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Prevotella 
sp. S7 MS 2]
 gb|KGI60529.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Prevotella 
sp. S7 MS 2]
Length=546

 Score =   271 bits (692),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 164/381 (43%), Positives = 226/381 (59%), Gaps = 21/381 (6%)
 Frame = +3

Query  78    ELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHTFGQPLAHFL  257
             E+S LQK R+ Y+P+LP  LQG  V+++ G+ T + D      I +LFP+T+G PL  F+
Sbjct  2     EISALQKERAGYQPKLPKALQGA-VKIKEGEPTQSVDNQ--EEIKKLFPNTYGMPLVEFI  58

Query  258   RASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNSTllgflggse  437
                 K            + VGI+  G Q+PGGHN I GL+DA+K  NPN+ L GFL G  
Sbjct  59    PGDEK--------NSLEMNVGIILSGGQAPGGHNVISGLFDAVKNLNPNNRLYGFLMGPG  110

Query  438   glfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLKLDGLVIVGG  617
             GL     +EIT + L  Y+N GG+DM+G  + ++   EQ    L     L +  +VI+GG
Sbjct  111   GLVDHNYIEITPEFLDEYRNTGGFDMIGSGRTKLEKEEQFEKGLEIIRELNIKAIVIIGG  170

Query  618   VTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICKVNSQLISNVC  797
               SNT+A  LAE +A  K   +V+G P T++GDLKN  +ET+ GFDT  K  S+LI N+ 
Sbjct  171   DDSNTNACVLAEYYAAKKYGVQVIGCPKTIDGDLKNDQIETSFGFDTATKTYSELIGNIE  230

Query  798   TDALSAEKYYYFIRLMGRKTSHVALECTLQSHPNMVILAEEVAASKLTLFDITKQVCDAV  977
              D  SA KY++FI+LMGR  SH+ALEC LQ+ PN+ +++EEV A   TL DI +Q+  AV
Sbjct  231   RDCNSARKYWHFIKLMGRSASHIALECALQTQPNICLISEEVEAKDQTLNDIVEQIASAV  290

Query  978   QARAEQDKYHGVILLPEGLIESIPEIYALLKEIHVLLR----------EGVSANNISSQL  1127
              +RA Q +  GV+L+PEGLIE IP I  L++E++ LL           +      I S L
Sbjct  291   ASRAAQGQNFGVVLIPEGLIEFIPAIGRLIQELNDLLAAHGDDYKDLDKAAQREYILSHL  350

Query  1128  SPWASALFEFLPPFIRRELLL  1190
             S    A FE LP  + R+L L
Sbjct  351   SEANKATFETLPEGVARQLSL  371



>ref|WP_014342471.1| Pyrophosphate--fructose 6-phosphate 1-phosphotransferase [Treponema 
pallidum]
 gb|AEZ57666.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Treponema 
pallidum subsp. pertenue str. SamoaD]
 gb|AEZ58735.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Treponema 
pallidum subsp. pertenue str. CDC2]
 gb|AEZ59803.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Treponema 
pallidum subsp. pertenue str. Gauthier]
 gb|AGK84187.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Treponema 
pallidum str. Fribourg-Blanc]
 gb|AJB40563.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Treponema 
pallidum subsp. endemicum str. Bosnia A]
Length=573

 Score =   271 bits (694),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 169/384 (44%), Positives = 237/384 (62%), Gaps = 17/384 (4%)
 Frame = +3

Query  81    LSDLQKLRSQYRPELPPCLQGTTVRV--EFGDATTAADPSGGHTISRLFPHTFGQPLAHF  254
             +S LQ+ R +Y P++P  L+G   RV    G +TTA   +    +  LF  T+GQPL +F
Sbjct  3     ISLLQQERHRYLPKVPDLLRGDFRRVCARRGLSTTAV--ADYDALRSLFARTYGQPLVNF  60

Query  255   LRASAKVPDAQIIT--EHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNSTllgflg  428
             + AS K  D+ + T  E   +RV IV  G Q+PGGHN I GL+D LK  + +S L+GFLG
Sbjct  61    VNASEKNEDSPMETAPEPRGLRVAIVLSGGQAPGGHNVIAGLFDGLKRWHADSVLIGFLG  120

Query  429   gseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLKLDGLVI  608
             G  G+ +   +EI  D +  Y+N GG+D++G  + +I S  Q  AA    T + LD LV+
Sbjct  121   GPAGVLSGDHIEICADRVDAYRNTGGFDLIGSGRTKIESESQFAAAAQTVTRMALDALVV  180

Query  609   VGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICKVNSQLIS  788
             VGG  SNT+AA LAE F  +   TKV+GVP T++GDLKN+ +ET+ GFDT  K  S+LI 
Sbjct  181   VGGDDSNTNAALLAEHFVNSGISTKVIGVPKTIDGDLKNEAIETSFGFDTATKTYSELIG  240

Query  789   NVCTDALSAEKYYYFIRLMGRKTSHVALECTLQSHPNMVILAEEVAASKLTLFDITKQVC  968
             N+  DA SA KY++FI+LMGR  SH+ALEC L++ PN+ +++EEVAA  LTL  I + +C
Sbjct  241   NIARDACSARKYWHFIKLMGRSASHIALECALKTQPNVCLISEEVAAQSLTLAQIVQSLC  300

Query  969   DAVQARAEQDKYHGVILLPEGLIESIPEIYALLKEIH-VLLREGVSANN----------I  1115
             D +  RA+  ++ G++L+PEGLIE IPE+ AL+ E++ V+ R                 I
Sbjct  301   DTIATRAQHGEHFGIVLVPEGLIEFIPEMKALITELNEVMARRAQEFEALDTPDAQRVWI  360

Query  1116  SSQLSPWASALFEFLPPFIRRELL  1187
                LS  A A+F  LP  I  +LL
Sbjct  361   EQALSASARAVFNALPAEISTQLL  384



>ref|WP_010881989.1| Pyrophosphate--fructose 6-phosphate 1-phosphotransferase [Treponema 
pallidum]
 sp|O83553.1|PFP_TREPA RecName: Full=Pyrophosphate--fructose 6-phosphate 1-phosphotransferase; 
AltName: Full=6-phosphofructokinase, pyrophosphate 
dependent; AltName: Full=PPi-dependent phosphofructokinase; 
Short=PPi-PFK; AltName: Full=Pyrophosphate-dependent 6-phosphofructose-1-kinase 
[Treponema pallidum subsp. pallidum str. 
Nichols]
 gb|AAC65526.1| pyrophosphate--fructose 6-phosphate 1-phosphotransferase, beta 
subunit [Treponema pallidum subsp. pallidum str. Nichols]
 gb|ACD70963.1| pyrophosphate--fructose 6-phosphate 1-phosphotransferase, beta 
subunit [Treponema pallidum subsp. pallidum SS14]
 gb|ADD72654.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Treponema 
pallidum subsp. pallidum str. Chicago]
 gb|AEZ60866.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Treponema 
pallidum subsp. pallidum DAL-1]
 gb|AFU66539.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Treponema 
pallidum subsp. pallidum str. Mexico A]
 gb|AGN75729.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Treponema 
pallidum subsp. pallidum str. Nichols]
 gb|AGN76705.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Treponema 
pallidum subsp. pallidum SS14]
Length=573

 Score =   271 bits (694),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 169/384 (44%), Positives = 237/384 (62%), Gaps = 17/384 (4%)
 Frame = +3

Query  81    LSDLQKLRSQYRPELPPCLQGTTVRV--EFGDATTAADPSGGHTISRLFPHTFGQPLAHF  254
             +S LQ+ R +Y P++P  L+G   RV    G +TTA   +    +  LF  T+GQPL +F
Sbjct  3     ISLLQQERHRYLPKVPDLLRGDFRRVCARRGLSTTAV--ADYDALRSLFARTYGQPLVNF  60

Query  255   LRASAKVPDAQIIT--EHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNSTllgflg  428
             + AS K  D+ + T  E   +RV IV  G Q+PGGHN I GL+D LK  + +S L+GFLG
Sbjct  61    VNASEKNEDSPMETAPEPRGLRVAIVLSGGQAPGGHNVIAGLFDGLKRWHADSVLIGFLG  120

Query  429   gseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLKLDGLVI  608
             G  G+ +   +EI  D +  Y+N GG+D++G  + +I S  Q  AA    T + LD LV+
Sbjct  121   GPAGVLSGDHIEICADRVDAYRNTGGFDLIGSGRTKIESESQFAAAAQTVTRMALDALVV  180

Query  609   VGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICKVNSQLIS  788
             VGG  SNT+AA LAE F  +   TKV+GVP T++GDLKN+ +ET+ GFDT  K  S+LI 
Sbjct  181   VGGDDSNTNAALLAEHFVNSGISTKVIGVPKTIDGDLKNEAIETSFGFDTATKTYSELIG  240

Query  789   NVCTDALSAEKYYYFIRLMGRKTSHVALECTLQSHPNMVILAEEVAASKLTLFDITKQVC  968
             N+  DA SA KY++FI+LMGR  SH+ALEC L++ PN+ +++EEVAA  LTL  I + +C
Sbjct  241   NIARDACSARKYWHFIKLMGRSASHIALECALKTQPNVCLISEEVAAQSLTLAQIVQSLC  300

Query  969   DAVQARAEQDKYHGVILLPEGLIESIPEIYALLKEIH-VLLREGVSANN----------I  1115
             D +  RA+  ++ G++L+PEGLIE IPE+ AL+ E++ V+ R                 I
Sbjct  301   DTIATRAQHGEHFGIVLVPEGLIEFIPEMKALITELNEVMARRAQEFEALDTPDAQRVWI  360

Query  1116  SSQLSPWASALFEFLPPFIRRELL  1187
                LS  A A+F  LP  I  +LL
Sbjct  361   EQALSASARAVFNALPAEISTQLL  384



>ref|NP_001168412.1| ppi-phosphofructokinase [Zea mays]
 gb|ACN28133.1| unknown [Zea mays]
 gb|AFW76871.1| ppi-phosphofructokinase [Zea mays]
Length=564

 Score =   271 bits (693),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 165/387 (43%), Positives = 234/387 (60%), Gaps = 14/387 (4%)
 Frame = +3

Query  69    LARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAA-DPSGGHTISRLFPHTFGQPL  245
             LA   S++Q  R  +   LP  L+ +   V  G A++AA +P     I++LFP+ FGQP 
Sbjct  23    LASVYSEVQTNRLLHALPLPSVLR-SNFSVVVGPASSAAGNPD---EIAKLFPNLFGQPS  78

Query  246   AHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNSTllgfl  425
             A        VP A+     P +++G+V  G Q+PGGHN I G++D L+     STL GF 
Sbjct  79    ASL------VPSAEPAATRP-LKIGVVLSGGQAPGGHNVICGIFDYLQERAKGSTLYGFK  131

Query  426   ggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLKLDGLV  605
             GG  G+   K +E+T D +  Y+NQGG+DM+   +D+I + EQ   A      L LDGLV
Sbjct  132   GGPAGIMKCKYVELTSDFVYPYRNQGGFDMICSGRDKIETPEQFKQAEDTANKLDLDGLV  191

Query  606   IVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICKVNSQLI  785
             ++GG  SNT+A  L E F      T+V+G P T++GDLK + V T+ GFDT CK+ S++I
Sbjct  192   VIGGDDSNTNACLLGEYFRSRNMKTRVIGCPKTIDGDLKCKEVPTSFGFDTACKIYSEMI  251

Query  786   SNVCTDALSAEKYYYFIRLMGRKTSHVALECTLQSHPNMVILAEEVAASKLTLFDITKQV  965
              NV TDA S  KYY+F+RLMGR  SH+ LEC LQ+HPN  ++ EEVAA K TL ++T  +
Sbjct  252   GNVMTDARSTGKYYHFVRLMGRAASHITLECALQTHPNAALIGEEVAAKKQTLKNVTNYI  311

Query  966   CDAVQARAEQDKYHGVILLPEGLIESIPEIYALLKEIHVLLREGV--SANNISSQLSPWA  1139
              D +  RA+    +GVIL+PEGLI+ IPE+  L+ E++ +L   V   A    S+L P +
Sbjct  312   TDIICKRADLGYNYGVILIPEGLIDFIPEVQKLIAELNEILAHDVVDEAGAWKSKLQPES  371

Query  1140  SALFEFLPPFIRRELLLYPESDDSAQL  1220
               LFEFLP  I+ +L+L  +   + Q+
Sbjct  372   RELFEFLPNTIQEQLMLERDPHGNVQV  398



>ref|WP_016518245.1| diphosphate-fructose-6-phosphate 1-phosphotransferase [Treponema 
vincentii]
 gb|EPF47448.1| diphosphate-fructose-6-phosphate 1-phosphotransferase [Treponema 
vincentii F0403]
Length=556

 Score =   271 bits (692),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 156/380 (41%), Positives = 228/380 (60%), Gaps = 18/380 (5%)
 Frame = +3

Query  81    LSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHTFGQPLAHFLR  260
             +S L K R  Y P  P  L      +        A  +    I  LFPH +G+P+ HF++
Sbjct  3     VSQLHKARYAYIPRFPAILDEPIESIAMQKEQETASIANTEEIQPLFPHIYGKPVVHFVK  62

Query  261   ASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNSTllgflggseg  440
              +A +       +   +RVG +  G Q+PGGHN I GLYD L+  NPNS L GFLGG EG
Sbjct  63    GTAHI-------DKKPLRVGTILSGGQAPGGHNVIAGLYDGLQKANPNSKLFGFLGGPEG  115

Query  441   lfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLKLDGLVIVGGV  620
             L   + +EIT  I+  Y+N GG+DM+G  + +I + EQ+  A+     ++LD +VI+GG 
Sbjct  116   LVIGRAIEITGAIIEKYRNTGGFDMIGSGRAKIETPEQIAGAVETVKRMELDAVVIIGGD  175

Query  621   TSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICKVNSQLISNVCT  800
              SNT+AA L+E F +    T+++GVP T++GDLK   VET+ GFDT  K+ + LI N+  
Sbjct  176   DSNTNAAVLSEYFVQQGIATQIIGVPKTIDGDLKYDMVETSFGFDTATKIYADLIGNIAR  235

Query  801   DALSAEKYYYFIRLMGRKTSHVALECTLQSHPNMVILAEEVAASKLTLFDITKQVCDAVQ  980
             DA SA+KY++FI+LMGR  SH+ALEC L++ PN+ +++EEVA  K+TL  IT  + DAV 
Sbjct  236   DANSAKKYWHFIKLMGRFASHIALECALRTQPNICLISEEVAEKKMTLQQITDIIADAVV  295

Query  981   ARAEQDKYHGVILLPEGLIESIPEIYALLKEIHVLLREGVSANN-----------ISSQL  1127
              RA + +  GV+L+PEG+IE IPE+  L+KE++  + +     N           ++  +
Sbjct  296   KRAVRKENFGVVLIPEGVIEFIPEMKQLIKELNEAMAQHADTFNTLETFKQQKAWVAQHI  355

Query  1128  SPWASALFEFLPPFIRRELL  1187
             SP ++ALF  +P  I  E L
Sbjct  356   SPESAALFASMPEDIAAEFL  375



>ref|XP_003564006.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit beta 1-like [Brachypodium distachyon]
Length=562

 Score =   271 bits (692),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 157/376 (42%), Positives = 230/376 (61%), Gaps = 12/376 (3%)
 Frame = +3

Query  69    LARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHTFGQPLA  248
             LA   S++Q  R  +   LP  L+      +   ++ A +P     I++LFP+ +GQP  
Sbjct  21    LASVYSEVQTSRLTHMLPLPSVLRSHFTLADGPASSAAGNPD---EIAKLFPNLYGQP--  75

Query  249   HFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNSTllgflg  428
                 +++ VP A+ +   P +++G+V  G Q+PGGHN I G++D L+     ST+ GF G
Sbjct  76    ----SASVVPSAEPVPAKP-LKIGVVLSGGQAPGGHNVICGIFDYLQERVKGSTMYGFKG  130

Query  429   gseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLKLDGLVI  608
             G  G+   K +E+T D +  Y+NQGG+DM+   +D+I + EQ   A      L LDGLV+
Sbjct  131   GPAGVMKGKYVELTSDFVYPYRNQGGFDMICSGRDKIETPEQFKQAEDTVNRLDLDGLVV  190

Query  609   VGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICKVNSQLIS  788
             +GG  SNT+A  L E F      T+V+G P T++GDLK++ V T+ GFDT CK+ S++I 
Sbjct  191   IGGDDSNTNACLLGEYFRGRNLKTRVIGCPKTIDGDLKSKEVPTSFGFDTACKIYSEMIG  250

Query  789   NVCTDALSAEKYYYFIRLMGRKTSHVALECTLQSHPNMVILAEEVAASKLTLFDITKQVC  968
             NV TDA S  KYY+F+RLMGR  SH+ LEC LQ+HPN+ ++ EEVA  K TL ++T  + 
Sbjct  251   NVMTDARSTGKYYHFVRLMGRAASHITLECALQTHPNVALIGEEVAEKKETLKNVTDYIT  310

Query  969   DAVQARAEQDKYHGVILLPEGLIESIPEIYALLKEIHVLLREGV--SANNISSQLSPWAS  1142
             D +  RAE    +GVIL+PEGLI+ IPE+  L+ E++ +L   V   A    S+L P + 
Sbjct  311   DIICKRAELGYNYGVILIPEGLIDFIPEVQKLIAELNEILAHDVVDEAGAWKSKLQPESR  370

Query  1143  ALFEFLPPFIRRELLL  1190
              LF+FLP  I+ +LLL
Sbjct  371   QLFDFLPKTIQEQLLL  386



>ref|XP_003547272.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit beta-like [Glycine max]
 gb|KHN32989.1| Pyrophosphate--fructose 6-phosphate 1-phosphotransferase subunit 
beta [Glycine soja]
Length=562

 Score =   271 bits (692),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 161/386 (42%), Positives = 236/386 (61%), Gaps = 12/386 (3%)
 Frame = +3

Query  69    LARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHTFGQPLA  248
             LA   S++QK R  +   LP  L+     ++   ++ A +P     I++LFPH FGQP  
Sbjct  21    LASVYSEVQKTRVDHALPLPSVLKHPFTILDGPPSSAAGNPD---EIAKLFPHLFGQP--  75

Query  249   HFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNSTllgflg  428
                 ++A  P   + T+   +++G+V  G Q+PGGHN I G++D L+   P STL GF G
Sbjct  76    ----SAALAPSGAVQTQK-KLKIGVVLSGGQAPGGHNVISGIFDYLQERAPGSTLYGFKG  130

Query  429   gseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLKLDGLVI  608
             G  G+   K +E+T + +  Y+NQGG+DM+   +D+I + EQ   A      L LDGLV+
Sbjct  131   GPAGIMKCKYVELTSEYIYPYRNQGGFDMICSGRDKIETPEQFKQAEETAKKLDLDGLVV  190

Query  609   VGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICKVNSQLIS  788
             +GG  SNT+A  LAE F      T V+G P T++GDLK + V T+ GFDT CK+ S++I 
Sbjct  191   IGGDDSNTNACLLAENFRSKNLKTSVIGCPKTIDGDLKCKEVPTSFGFDTACKIYSEMIG  250

Query  789   NVCTDALSAEKYYYFIRLMGRKTSHVALECTLQSHPNMVILAEEVAASKLTLFDITKQVC  968
             NV  DA S  KYY+F+RLMGR  SH+ LEC LQ+HPN+ I+ EEVAA KLTL ++T  + 
Sbjct  251   NVMIDARSTGKYYHFVRLMGRAASHITLECALQTHPNITIIGEEVAAKKLTLKNVTDYIV  310

Query  969   DAVQARAEQDKYHGVILLPEGLIESIPEIYALLKEIH-VLLREGVSANNI-SSQLSPWAS  1142
             D V  RAE +  +GVIL+PEGLI+ IPE+  L+ E++ +L  + V    +   +L+  + 
Sbjct  311   DVVCKRAEINYNYGVILIPEGLIDFIPEVQHLIAELNEILAHDTVDEGGLWKKKLTDQSL  370

Query  1143  ALFEFLPPFIRRELLLYPESDDSAQL  1220
              LF+FLP  I+ +L+L  +   + Q+
Sbjct  371   KLFDFLPQAIQEQLMLERDPHGNVQV  396



>ref|WP_014625405.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Spirochaeta 
thermophila]
 gb|AEJ62079.1| diphosphate/fructose-6-phosphate1-phosphotransferase [Spirochaeta 
thermophila DSM 6578]
Length=554

 Score =   270 bits (691),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 163/383 (43%), Positives = 231/383 (60%), Gaps = 22/383 (6%)
 Frame = +3

Query  81    LSDLQKLRSQYRPELPPCLQGTTVRV--EFGDATTAADPSGGHTISRLFPHTFGQPLAHF  254
             +S LQK R  Y P+LPP LQ    R+  E G  T A   +    + RLF +T+G+P+A  
Sbjct  4     ISPLQKARYGYVPKLPPVLQDEIARIQAELGQPTEAV--ADREDLKRLFANTYGKPIATL  61

Query  255   LRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNSTllgflggs  434
              R S   P+A          VG++  G  +PGGHN I GL+DALK  N  STL+GF GG 
Sbjct  62    TRGSN--PEA-----GRRRTVGVILSGGPAPGGHNVICGLFDALKKANRESTLIGFKGGP  114

Query  435   eglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLKLDGLVIVG  614
              G+   + +E TD ++  Y+N GG+D++G  + +I + EQ   AL       LD LVI+G
Sbjct  115   SGILDDEWIEFTDSLINQYRNTGGFDIIGSGRTKIETPEQFAKALENAKKHGLDALVIIG  174

Query  615   GVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICKVNSQLISNV  794
             G  SNT+AA LAE F +   P +V+G+P T++GDLKN+++E + GFDT  KV ++LI N+
Sbjct  175   GDDSNTNAALLAEYFVQQGAPIQVIGIPKTIDGDLKNEYIEASFGFDTATKVYAELIGNI  234

Query  795   CTDALSAEKYYYFIRLMGRKTSHVALECTLQSHPNMVILAEEVAASKLTLFDITKQVCDA  974
               DA+S+ KY++FIRLMGR  SH+ALEC LQ+ PN+ I++EEV    +TL  I  Q+ DA
Sbjct  235   ARDAISSRKYWHFIRLMGRSASHIALECALQTQPNVCIVSEEVREKNMTLSQIVDQIVDA  294

Query  975   VQARAEQDKYHGVILLPEGLIESIPEIYALLKEIHVLLREGVSANN-----------ISS  1121
             V  RA + +  GV+L+PEGLIE IPE+ AL+ E++ LL +     N           +  
Sbjct  295   VVKRAAKGENFGVVLVPEGLIEFIPEVGALIDELNTLLAKEAEVFNRIDDPRERISWVKG  354

Query  1122  QLSPWASALFEFLPPFIRRELLL  1190
             +LS     +F  LP  I+ +LL+
Sbjct  355   KLSGNNQRVFSSLPETIQAQLLM  377



>ref|XP_004305986.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit beta-like [Fragaria vesca subsp. vesca]
Length=557

 Score =   270 bits (691),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 156/382 (41%), Positives = 233/382 (61%), Gaps = 11/382 (3%)
 Frame = +3

Query  84    SDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHTFGQPLAHFLRA  263
             S++Q  R      LP  L+G    V+   ++   +P     I++LFP+ FGQP      A
Sbjct  20    SEVQTSRLDVLLPLPSVLKGPFSVVDGPKSSATGNPD---EIAKLFPNLFGQP-----SA  71

Query  264   SAKVPDAQ-IITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNSTllgflggseg  440
             S K  DA   +++  ++++G+V  G Q+PGGHN I G++D L+     S + GF GG  G
Sbjct  72    SLKAGDASSALSKDKSLKIGVVLSGGQAPGGHNVISGIFDYLQQRTTGSIMYGFRGGPAG  131

Query  441   lfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLKLDGLVIVGGV  620
             +   K +E++ + +  Y+NQGG+DM+   +D+I + EQ   A    + L LDGLV++GG 
Sbjct  132   VMKGKYVELSTEYVYPYRNQGGFDMIASGRDKIETPEQFQQAADTASKLDLDGLVVIGGD  191

Query  621   TSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICKVNSQLISNVCT  800
              SNT+A  LAE F      T+V+G P T++GDLK + V T+ GFDT C++ S++I N+ T
Sbjct  192   DSNTNACLLAENFRGRNLKTRVIGCPKTIDGDLKCKEVPTSFGFDTACRIYSEMIGNLMT  251

Query  801   DALSAEKYYYFIRLMGRKTSHVALECTLQSHPNMVILAEEVAASKLTLFDITKQVCDAVQ  980
             DA S  KYY+F+RLMGR  SH+ LEC L++HPN+ I+ EEVAA K TL ++T  + D V 
Sbjct  252   DARSTGKYYHFVRLMGRAASHITLECALETHPNITIIGEEVAAKKQTLKNVTDYITDIVC  311

Query  981   ARAEQDKYHGVILLPEGLIESIPEIYALLKEIHVLLREGV--SANNISSQLSPWASALFE  1154
              RAEQ   +G++L+PEGLI+ IPE+  L+ E++ +L  G    A     +L P +  LFE
Sbjct  312   KRAEQGYNYGLVLIPEGLIDFIPEVQQLIAELNEILAHGAVDEAGEWKKKLQPQSHKLFE  371

Query  1155  FLPPFIRRELLLYPESDDSAQL  1220
             FLP  I+ +LLL  +   + Q+
Sbjct  372   FLPQAIQEQLLLERDPHGNVQV  393



>ref|WP_013945180.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Treponema 
paraluiscuniculi]
 gb|AEH40481.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Treponema 
paraluiscuniculi Cuniculi A]
Length=573

 Score =   271 bits (692),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 169/384 (44%), Positives = 236/384 (61%), Gaps = 17/384 (4%)
 Frame = +3

Query  81    LSDLQKLRSQYRPELPPCLQGTTVRV--EFGDATTAADPSGGHTISRLFPHTFGQPLAHF  254
             +S LQ+ R +Y P++P  L+G   RV    G +TTA   +    +  LF  T+GQPL +F
Sbjct  3     ISLLQQERHRYLPKVPDLLRGDFRRVCARRGLSTTAV--ADHDALRSLFARTYGQPLVNF  60

Query  255   LRASAKVPDAQIIT--EHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNSTllgflg  428
             + AS K  D+ + T  E   +RV IV  G Q+PGGHN I GL+D LK  + +S L+GFLG
Sbjct  61    VNASEKNEDSPMETAPEPRGLRVAIVLSGGQAPGGHNVIAGLFDGLKRWHADSVLIGFLG  120

Query  429   gseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLKLDGLVI  608
             G  G+ +   +EI  D +  Y+N GG+D++G  + +I S  Q  AA    T + LD LV+
Sbjct  121   GPAGVLSGDHIEICADRVDAYRNTGGFDLIGSGRTKIESESQFTAAAQTVTRMALDALVV  180

Query  609   VGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICKVNSQLIS  788
             VGG  SNT+AA LAE F  +   TKV+GVP T++GDLKN+ +ET+ GFDT  K  S+LI 
Sbjct  181   VGGDDSNTNAALLAEHFVNSGISTKVIGVPKTIDGDLKNEAIETSFGFDTATKTYSELIG  240

Query  789   NVCTDALSAEKYYYFIRLMGRKTSHVALECTLQSHPNMVILAEEVAASKLTLFDITKQVC  968
             N+  DA SA KY++FI+LMGR  SH+ALEC L++ PN+ +++EEVAA  LTL  I + +C
Sbjct  241   NIARDACSARKYWHFIKLMGRSASHIALECALKTQPNVCLISEEVAAQSLTLAQIVQSLC  300

Query  969   DAVQARAEQDKYHGVILLPEGLIESIPEIYALLKEIH-VLLREGVSANN----------I  1115
             D +  RA+  +  G++L+PEGLIE IPE+ AL+ E++ V+ R                 I
Sbjct  301   DTIATRAQHGENFGIVLVPEGLIEFIPEMKALITELNEVMARRAQEFEALDTPDAQRVWI  360

Query  1116  SSQLSPWASALFEFLPPFIRRELL  1187
                LS  A A+F  LP  I  +LL
Sbjct  361   EQALSASARAVFNALPAEISTQLL  384



>ref|WP_009235627.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Prevotella 
sp. oral taxon 472]
 gb|EEX52180.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Prevotella 
sp. oral taxon 472 str. F0295]
Length=546

 Score =   270 bits (690),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 164/381 (43%), Positives = 229/381 (60%), Gaps = 21/381 (6%)
 Frame = +3

Query  78    ELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHTFGQPLAHFL  257
             E S LQK R+ Y+P+LP  LQG  V+V  G  T + D      I +LFP+T+G PL  F+
Sbjct  2     EKSALQKARASYQPKLPKALQGA-VKVSEGAPTQSVDNQ--DEIKKLFPNTYGMPLVEFV  58

Query  258   RASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNSTllgflggse  437
             +   ++P  +I        VGI+  G Q+PGGHN I GL+D +K  NPN+ L GFL G  
Sbjct  59    QGD-EMPSKEI-------NVGIILSGGQAPGGHNVISGLFDEVKRLNPNNRLYGFLMGPG  110

Query  438   glfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLKLDGLVIVGG  617
             GL     +EIT D +  Y+N GG+DM+G  + ++ +TEQ    L     L +  +VI+GG
Sbjct  111   GLVDHDYIEITADFVEEYRNTGGFDMIGSGRTKLETTEQFEKGLEIIRELNIKAIVIIGG  170

Query  618   VTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICKVNSQLISNVC  797
               SNT+A  LAE +A      +V+G P T++GDLKN+ +ET+ GFDT  K  S+LI N+ 
Sbjct  171   DDSNTNACVLAEYYAAKNYGVQVIGCPKTIDGDLKNEQIETSFGFDTATKTYSELIGNIE  230

Query  798   TDALSAEKYYYFIRLMGRKTSHVALECTLQSHPNMVILAEEVAASKLTLFDITKQVCDAV  977
              D  SA KY++F++LMGR  SH+ALEC LQ+ PN+ I++EEV A  LTL DI +++  AV
Sbjct  231   RDCNSARKYWHFVKLMGRSASHIALECALQTQPNICIISEEVEAKDLTLNDIIEEIASAV  290

Query  978   QARAEQDKYHGVILLPEGLIESIPEIYALLKEIHVLL-REGVSANN---------ISSQL  1127
               RA   +  GV+L+PEGLIE +P I  L++E++ LL   G    +         I + L
Sbjct  291   AHRAANGQNFGVVLIPEGLIEFVPAIGRLIQELNDLLAAHGADYKDLDKDAQRAYIMAHL  350

Query  1128  SPWASALFEFLPPFIRRELLL  1190
             SP   A FE LP  + R+L L
Sbjct  351   SPENKATFETLPDSVARQLSL  371



>ref|XP_002438147.1| hypothetical protein SORBIDRAFT_10g008850 [Sorghum bicolor]
 gb|EER89514.1| hypothetical protein SORBIDRAFT_10g008850 [Sorghum bicolor]
Length=565

 Score =   270 bits (691),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 160/376 (43%), Positives = 226/376 (60%), Gaps = 12/376 (3%)
 Frame = +3

Query  69    LARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHTFGQPLA  248
             LA   S++Q  R  +   LP  L+     V+   ++ A +P     I++LFP+ FGQP A
Sbjct  24    LASVYSEVQTNRLLHALPLPSVLRSNFSVVDGPASSAAGNPD---EIAKLFPNLFGQPSA  80

Query  249   HFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNSTllgflg  428
                     VP A+     P ++VG+V  G Q+PGGHN I G++D L+     ST+ GF G
Sbjct  81    SL------VPAAEPAATRP-LKVGVVLSGGQAPGGHNVICGIFDYLQERAKGSTMYGFKG  133

Query  429   gseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLKLDGLVI  608
             G  G+   K +E+T D +  Y+NQGG+DM+   +D+I + EQ   A      L LDGLV+
Sbjct  134   GPAGVMKCKYVELTADFVYPYRNQGGFDMICSGRDKIETPEQFKQAEDTANKLDLDGLVV  193

Query  609   VGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICKVNSQLIS  788
             +GG  SNT+A  L E F      T+V+G P T++GDLK + V T+ GFDT CK+ S++I 
Sbjct  194   IGGDDSNTNACLLGEYFRSRNLKTRVIGCPKTIDGDLKCKEVPTSFGFDTACKIYSEMIG  253

Query  789   NVCTDALSAEKYYYFIRLMGRKTSHVALECTLQSHPNMVILAEEVAASKLTLFDITKQVC  968
             NV TDA S  KYY+F+RLMGR  SH+ LEC LQ+HPN  ++ EEVA  K TL ++T  + 
Sbjct  254   NVMTDARSTGKYYHFVRLMGRAASHITLECALQTHPNAALIGEEVAEKKQTLKNVTNYIT  313

Query  969   DAVQARAEQDKYHGVILLPEGLIESIPEIYALLKEIHVLLREGV--SANNISSQLSPWAS  1142
             D +  RA+    +GVIL+PEGLI+ IPE+  L+ E++ +L   V   A    S+L P + 
Sbjct  314   DIICKRADLGYNYGVILIPEGLIDFIPEVQKLIAELNEILAHDVVDEAGAWKSKLQPESK  373

Query  1143  ALFEFLPPFIRRELLL  1190
              LFEFLP  I+ +L+L
Sbjct  374   ELFEFLPKTIQEQLML  389



>ref|WP_009229809.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Prevotella 
sp. oral taxon 317]
 gb|EFC69384.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Prevotella 
sp. oral taxon 317 str. F0108]
Length=546

 Score =   270 bits (690),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 166/381 (44%), Positives = 228/381 (60%), Gaps = 21/381 (6%)
 Frame = +3

Query  78    ELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHTFGQPLAHFL  257
             E S LQK R+ Y+P+LP  LQG  V+V  G  T + D      I +LFP+T+G PL  F+
Sbjct  2     EKSALQKARASYQPKLPKALQGA-VKVSEGAPTKSVDNQ--DEIKKLFPNTYGMPLVEFV  58

Query  258   RASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNSTllgflggse  437
             +   K+P  +I        VGI+  G Q+PGGHN I GL+D +K  NPN+ L GFL G  
Sbjct  59    QGD-KMPSKEI-------NVGIILSGGQAPGGHNVISGLFDEVKRLNPNNRLYGFLMGPG  110

Query  438   glfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLKLDGLVIVGG  617
             GL     +EIT D +  Y+N GG+DM+G  + ++ +TEQ    L     L +  +VI+GG
Sbjct  111   GLVDHNYIEITADFIDEYRNTGGFDMIGSGRTKLETTEQFEKGLEIIRKLDIKAIVIIGG  170

Query  618   VTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICKVNSQLISNVC  797
               SNT+A  LAE +A      +V+G P T++GDLKN+ +ET+ GFDT  K  S+LI N+ 
Sbjct  171   DDSNTNACVLAEYYAAKNYGVQVIGCPKTIDGDLKNEQIETSFGFDTATKTYSELIGNIE  230

Query  798   TDALSAEKYYYFIRLMGRKTSHVALECTLQSHPNMVILAEEVAASKLTLFDITKQVCDAV  977
              D  SA KY++FI+LMGR  SH+ALEC LQ+ PN+ I++EEV A  LTL DI +++  AV
Sbjct  231   RDCNSARKYWHFIKLMGRSASHIALECALQTQPNICIISEEVEAKDLTLNDIIEEIASAV  290

Query  978   QARAEQDKYHGVILLPEGLIESIPEIYALLKEIHVLL-REGVSANN---------ISSQL  1127
               RA   + +GV+L+PEGLIE +P I  L+ E++ LL   G    +         I S L
Sbjct  291   AHRAANGQNYGVVLIPEGLIEFVPAIGRLIHELNDLLAAHGADYKDLDKDAQRAYIMSHL  350

Query  1128  SPWASALFEFLPPFIRRELLL  1190
             S    A FE LP  + R+L L
Sbjct  351   SAENKATFETLPYSVARQLSL  371



>dbj|BAJ85690.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ85834.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=560

 Score =   270 bits (691),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 160/386 (41%), Positives = 231/386 (60%), Gaps = 12/386 (3%)
 Frame = +3

Query  69    LARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHTFGQPLA  248
             LA   S++Q  R  +   LP  L+      +   +T A  P     I++LFP  +GQP  
Sbjct  19    LASVYSEVQTSRIAHMLPLPSVLRSHFTLADGPASTAAGSPD---EIAKLFPCLYGQP--  73

Query  249   HFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNSTllgflg  428
                 +++ VP A+ +   P +++G+V  G Q+PGGHN I G++D L+     ST+ GF G
Sbjct  74    ----SASVVPTAEPVASKP-LKIGVVLSGGQAPGGHNVICGIFDYLQERAKGSTMYGFKG  128

Query  429   gseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLKLDGLVI  608
             G  G+   K +E+T D +  Y+NQGG+DM+   +D+I + EQ   A      L LDGLV+
Sbjct  129   GPAGVMKGKYVELTADFVYPYRNQGGFDMICSGRDKIETPEQFKQAEDTVNRLDLDGLVV  188

Query  609   VGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICKVNSQLIS  788
             +GG  SNT+A  L E F      T+V+G P T++GDLK + V T+ GFDT CK+ S++I 
Sbjct  189   IGGDDSNTNACLLGEYFRGRNLKTRVIGCPKTIDGDLKCKEVPTSFGFDTACKIYSEMIG  248

Query  789   NVCTDALSAEKYYYFIRLMGRKTSHVALECTLQSHPNMVILAEEVAASKLTLFDITKQVC  968
             NV TDA S  KYY+F+RLMGR  SH+ LEC LQ+HPN+ ++ EEVA  K TL ++T  + 
Sbjct  249   NVMTDARSTGKYYHFVRLMGRAASHITLECALQTHPNVALIGEEVAEKKETLKNVTDYIT  308

Query  969   DAVQARAEQDKYHGVILLPEGLIESIPEIYALLKEIHVLLREGV--SANNISSQLSPWAS  1142
             D V  RAE    +GV+L+PEGLI+ IPEI  L+ E++ +L   V   A    S+L P + 
Sbjct  309   DVVCKRAELGYNYGVVLIPEGLIDFIPEIQKLIAELNEILAHDVVDEAGAWKSKLEPASR  368

Query  1143  ALFEFLPPFIRRELLLYPESDDSAQL  1220
              LF+FLP  I+ +LLL  +   + Q+
Sbjct  369   QLFDFLPKTIQEQLLLERDPHGNVQV  394



>ref|WP_041620527.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Paludibacter 
propionicigenes]
Length=548

 Score =   270 bits (689),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 157/379 (41%), Positives = 226/379 (60%), Gaps = 21/379 (6%)
 Frame = +3

Query  84    SDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHTFGQPLAHFLRA  263
             S LQ  R+ Y+P+LP  L+G  V  E     + AD +    I  LFP+T+G PL  F   
Sbjct  4     SPLQIARASYQPKLPTALKGNVVLKEGAATESVADQA---DIKTLFPNTYGMPLISF---  57

Query  264   SAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNSTllgflggsegl  443
                  +A +  E+PA+  G++  G Q+PGGHN I GL+D LK  NPN+ L GFL G  GL
Sbjct  58    -----EAGVKKEYPAVAAGVILSGGQAPGGHNVICGLFDGLKALNPNNKLYGFLAGPSGL  112

Query  444   fAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLKLDGLVIVGGVT  623
                  +E+T +I+  Y+N GG+D++G  + ++    Q +     C  L ++ +VI+GG  
Sbjct  113   VDHNYIELTKEIVDEYRNTGGFDIIGSGRTKLEEEWQYDKGTEICKKLGINAIVIIGGDD  172

Query  624   SNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICKVNSQLISNVCTD  803
             SNT+A  LAE +++ K   +V+G P T++GDLKN+ +ET+ GFDT CKV S+LI N+  D
Sbjct  173   SNTNACVLAEYYSQKKTGIQVIGCPKTIDGDLKNEMIETSFGFDTACKVYSELIGNIQRD  232

Query  804   ALSAEKYYYFIRLMGRKTSHVALECTLQSHPNMVILAEEVAASKLTLFDITKQVCDAVQA  983
             A SA+KY++FIRLMGR  SH+ LEC LQS PN+ I++EEV A   TL D+   +   +  
Sbjct  233   ANSAKKYWHFIRLMGRSASHITLECALQSQPNICIVSEEVEAKNQTLNDVVDDIIKVIVH  292

Query  984   RAEQDKYHGVILLPEGLIESIPEIYALLKEIHVLL--REGVSANN--------ISSQLSP  1133
             RAE     G IL+PEGLIE IP +  L+ E++ LL   E  +A N        +   LSP
Sbjct  293   RAEHGLNFGTILIPEGLIEFIPAVKKLISELNDLLAHNEDFNALNTDEEKRQYVKGMLSP  352

Query  1134  WASALFEFLPPFIRRELLL  1190
              ++ ++  LP  I ++L L
Sbjct  353   VSAEVYRSLPKGIAKQLTL  371



>ref|WP_018966518.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Prevotella 
loescheii]
 gb|KDR53753.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Prevotella 
loescheii DSM 19665 = JCM 12249 = ATCC 15930]
Length=546

 Score =   270 bits (689),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 164/381 (43%), Positives = 229/381 (60%), Gaps = 21/381 (6%)
 Frame = +3

Query  78    ELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHTFGQPLAHFL  257
             E S LQK R+ Y+P+LP  LQG  V+V  G  T + D      I +LFP+T+G PL  F+
Sbjct  2     EKSALQKARASYQPKLPKALQGA-VKVSEGAHTQSVDNQ--DEIKKLFPNTYGMPLVEFV  58

Query  258   RASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNSTllgflggse  437
             +   ++P  +I        VGI+  G Q+PGGHN I GL+D +K  NPN+ L GFL G  
Sbjct  59    QGD-EMPSKEI-------NVGIILSGGQAPGGHNVISGLFDEVKRLNPNNRLYGFLMGPG  110

Query  438   glfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLKLDGLVIVGG  617
             GL     +EIT D +  Y+N GG+DM+G  + ++ +TEQ    L     L +  +VI+GG
Sbjct  111   GLVDHDYIEITADFVEEYRNTGGFDMIGSGRTKLETTEQFENGLEIIRELNIKAIVIIGG  170

Query  618   VTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICKVNSQLISNVC  797
               SNT+A  LAE +A      +V+G P T++GDLKN+ +ET+ GFDT  K  S+LI N+ 
Sbjct  171   DDSNTNACVLAEYYAAKNYGVQVIGCPKTIDGDLKNEQIETSFGFDTATKTYSELIGNIE  230

Query  798   TDALSAEKYYYFIRLMGRKTSHVALECTLQSHPNMVILAEEVAASKLTLFDITKQVCDAV  977
              D  SA KY++F++LMGR  SH+ALEC LQ+ PN+ I++EEV A  LTL DI +++  AV
Sbjct  231   RDCNSARKYWHFVKLMGRSASHIALECALQTQPNICIISEEVEAKDLTLNDIIEEIASAV  290

Query  978   QARAEQDKYHGVILLPEGLIESIPEIYALLKEIHVLL-REGVSANN---------ISSQL  1127
               RA   +  GV+L+PEGLIE +P I  L++E++ LL   G    +         I + L
Sbjct  291   AHRAANGQNFGVVLIPEGLIEFVPAIGRLIQELNDLLAAHGADYKDLDKDAQRAYIMAHL  350

Query  1128  SPWASALFEFLPPFIRRELLL  1190
             SP   A FE LP  + R+L L
Sbjct  351   SPENKATFETLPDSVARQLSL  371



>ref|WP_025863645.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Prolixibacter 
bellariivorans]
Length=552

 Score =   270 bits (689),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 161/385 (42%), Positives = 235/385 (61%), Gaps = 26/385 (7%)
 Frame = +3

Query  81    LSDLQKLRSQYRPELPPCLQGTTVRVEFGDAT-TAADPSGGHTISRLFPHTFGQPLAHFL  257
             +S LQ  RS+Y P+LP  LQG  V+V  G  T + AD      I +LFP+T+G PL  F 
Sbjct  3     ISALQFERSKYAPKLPKALQGP-VKVVVGKETESVADQ---EEIQKLFPNTYGMPLITFE  58

Query  258   RASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNSTllgflggse  437
               +    D   +   P + VG++  G Q+PGGHN I G+YD LK  NP + L GFLGG  
Sbjct  59    EGA----DTGSL---PVMNVGVILSGGQAPGGHNVISGIYDGLKKLNPENKLYGFLGGPG  111

Query  438   glfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLKLDGLVIVGG  617
             GL   + +E+TD+I+  Y+N GG+D++G  + ++    Q +  +  C  L ++ LV++GG
Sbjct  112   GLVDHEYMELTDEIIDEYRNTGGFDIIGSGRTKLEEEAQFDKGVEICKELNINALVVIGG  171

Query  618   VTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICKVNSQLISNVC  797
               SNT+A  LAE + + +   +V+G P T++GDLKN+ +ET+ GFDT  KV S+LI N+ 
Sbjct  172   DDSNTNACVLAEYYLQKETGIQVIGCPKTIDGDLKNEMIETSFGFDTAIKVYSELIGNIM  231

Query  798   TDALSAEKYYYFIRLMGRKTSHVALECTLQSHPNMVILAEEVAASKLTLFDITKQVCDAV  977
              DA SA+KY++FI+LMGR  SH+ALEC LQ+ PN+ +++EEVA  + TL +I   + + +
Sbjct  232   RDANSAKKYWHFIKLMGRSASHIALECALQTRPNVTLISEEVAEKEQTLAEIVDYIANVI  291

Query  978   QARAEQDKYHGVILLPEGLIESIPEIYALLKEIHVLLREGVSANN--------------I  1115
               RAE D   GVIL+PEGLIE IPE+  L+ E++ LL EG  + N              +
Sbjct  292   ARRAEDDHNFGVILVPEGLIEFIPEMKTLITELNDLLAEGQQSANEFKALVTDAEKRTYV  351

Query  1116  SSQLSPWASALFEFLPPFIRRELLL  1190
               +LS  +S +F  LP  I ++L L
Sbjct  352   IGKLSETSSKVFASLPEGIAKQLTL  376



>gb|ADQ78315.1| pyrophosphate-dependent phosphofructokinase [Paludibacter propionicigenes 
WB4]
Length=551

 Score =   270 bits (689),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 157/379 (41%), Positives = 226/379 (60%), Gaps = 21/379 (6%)
 Frame = +3

Query  84    SDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHTFGQPLAHFLRA  263
             S LQ  R+ Y+P+LP  L+G  V  E     + AD +    I  LFP+T+G PL  F   
Sbjct  7     SPLQIARASYQPKLPTALKGNVVLKEGAATESVADQA---DIKTLFPNTYGMPLISF---  60

Query  264   SAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNSTllgflggsegl  443
                  +A +  E+PA+  G++  G Q+PGGHN I GL+D LK  NPN+ L GFL G  GL
Sbjct  61    -----EAGVKKEYPAVAAGVILSGGQAPGGHNVICGLFDGLKALNPNNKLYGFLAGPSGL  115

Query  444   fAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLKLDGLVIVGGVT  623
                  +E+T +I+  Y+N GG+D++G  + ++    Q +     C  L ++ +VI+GG  
Sbjct  116   VDHNYIELTKEIVDEYRNTGGFDIIGSGRTKLEEEWQYDKGTEICKKLGINAIVIIGGDD  175

Query  624   SNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICKVNSQLISNVCTD  803
             SNT+A  LAE +++ K   +V+G P T++GDLKN+ +ET+ GFDT CKV S+LI N+  D
Sbjct  176   SNTNACVLAEYYSQKKTGIQVIGCPKTIDGDLKNEMIETSFGFDTACKVYSELIGNIQRD  235

Query  804   ALSAEKYYYFIRLMGRKTSHVALECTLQSHPNMVILAEEVAASKLTLFDITKQVCDAVQA  983
             A SA+KY++FIRLMGR  SH+ LEC LQS PN+ I++EEV A   TL D+   +   +  
Sbjct  236   ANSAKKYWHFIRLMGRSASHITLECALQSQPNICIVSEEVEAKNQTLNDVVDDIIKVIVH  295

Query  984   RAEQDKYHGVILLPEGLIESIPEIYALLKEIHVLL--REGVSANN--------ISSQLSP  1133
             RAE     G IL+PEGLIE IP +  L+ E++ LL   E  +A N        +   LSP
Sbjct  296   RAEHGLNFGTILIPEGLIEFIPAVKKLISELNDLLAHNEDFNALNTDEEKRQYVKGMLSP  355

Query  1134  WASALFEFLPPFIRRELLL  1190
              ++ ++  LP  I ++L L
Sbjct  356   VSAEVYRSLPKGIAKQLTL  374



>ref|WP_025278280.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Barnesiella 
viscericola]
 gb|AHF12352.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Barnesiella 
viscericola DSM 18177]
Length=550

 Score =   270 bits (689),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 156/379 (41%), Positives = 227/379 (60%), Gaps = 21/379 (6%)
 Frame = +3

Query  84    SDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHTFGQPLAHFLRA  263
             S LQ  R+ Y+P+LP  ++     VE     + AD      I++LFP+T+G P+  F  A
Sbjct  4     SALQTARASYQPKLPEAIKNGVTIVEGKATQSVADQ---EAIAKLFPNTYGMPVLRFEAA  60

Query  264   SAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNSTllgflggsegl  443
               K        E+PAI VG++  G Q+PGGHN I GL+D LK  N +S L GFL G  GL
Sbjct  61    PKK--------EYPAINVGVILSGGQAPGGHNVISGLFDGLKAMNKDSRLFGFLLGPGGL  112

Query  444   fAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLKLDGLVIVGGVT  623
                K +E+T DI+  Y+N GG+D++G  + ++ + EQ ++ L     L +  +VI+GG  
Sbjct  113   IDHKYMELTADIIDDYRNTGGFDIIGSGRTKLETKEQFDSGLEIIKELGIKAVVIIGGDD  172

Query  624   SNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICKVNSQLISNVCTD  803
             SNT+A  LAE + +     +V+G P T++GDLKN+ +E + GFDT CKV S++I N+  D
Sbjct  173   SNTNACVLAEYYKQIGAGVQVIGCPKTIDGDLKNEMIECSFGFDTACKVYSEVIGNIQRD  232

Query  804   ALSAEKYYYFIRLMGRKTSHVALECTLQSHPNMVILAEEVAASKLTLFDITKQVCDAVQA  983
               SA+KY++FI+LMGR  SH+ALEC LQ+ PN+ +++EEV A ++TL DI   + + V A
Sbjct  233   CNSAKKYWHFIKLMGRSASHIALECALQTQPNICLISEEVEAKQMTLDDIVNNIANIVAA  292

Query  984   RAEQDKYHGVILLPEGLIESIPEIYALLKEIHVLLREGVSA----------NNISSQLSP  1133
             RA +    G +L+PEGLIE IP +  L+ E++  L E  S           N I   LSP
Sbjct  293   RAAKGFNFGTVLIPEGLIEFIPAMKRLIAELNDYLAENGSEFAMIKKSEQRNYIIKHLSP  352

Query  1134  WASALFEFLPPFIRRELLL  1190
               SA++  LP  + R+L L
Sbjct  353   ENSAIYASLPEGVARQLTL  371



>ref|NP_001148574.1| LOC100282190 [Zea mays]
 gb|ACF84415.1| unknown [Zea mays]
 gb|ACG32090.1| pyrophosphate--fructose 6-phosphate 1-phosphotransferase beta 
subunit [Zea mays]
Length=564

 Score =   270 bits (690),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 162/376 (43%), Positives = 227/376 (60%), Gaps = 12/376 (3%)
 Frame = +3

Query  69    LARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHTFGQPLA  248
             LA   S++Q  R  +   LP  L+     V+   ++ A +P     I++LFP+ FGQP A
Sbjct  23    LASVYSEVQTSRLLHTLPLPSVLRSNFSVVDGPASSAAGNPD---EIAKLFPNLFGQPSA  79

Query  249   HFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNSTllgflg  428
                     VP A+     P ++VG+V  G Q+PGGHN I G++D L+     STLLGF G
Sbjct  80    SL------VPSAEPAATRP-LKVGVVLSGGQAPGGHNVICGIFDYLQERAKGSTLLGFKG  132

Query  429   gseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLKLDGLVI  608
             G  G+   K +E+T D +  Y+NQGG+DM+   +D+I + EQ   A      L LDGLV+
Sbjct  133   GPAGIMKCKYVELTSDFVYPYRNQGGFDMICSGRDKIETPEQFKQAEDTANKLDLDGLVV  192

Query  609   VGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICKVNSQLIS  788
             +GG  SNT+A  L E F      T+V+G P T++GDLK + V T+ GFDT CK+ S++I 
Sbjct  193   IGGDDSNTNACLLGEYFRSRNLKTRVIGCPKTIDGDLKCKEVPTSFGFDTACKIYSEMIG  252

Query  789   NVCTDALSAEKYYYFIRLMGRKTSHVALECTLQSHPNMVILAEEVAASKLTLFDITKQVC  968
             NV TDA S  KYY+F+RLMGR  SH+ LEC LQ+HPN  ++ EEVAA K TL ++T  + 
Sbjct  253   NVMTDARSTGKYYHFVRLMGRAASHITLECALQTHPNAALIGEEVAAKKETLKNVTNYIT  312

Query  969   DAVQARAEQDKYHGVILLPEGLIESIPEIYALLKEIHVLLREGV--SANNISSQLSPWAS  1142
             D +  RA+    +GVIL+PEGLI+ IPE+  L+ E++ +L   V   A    S+L   + 
Sbjct  313   DIICKRADLGYNYGVILIPEGLIDFIPEVQKLIAELNEILAHDVVDEAGAWKSKLQAESR  372

Query  1143  ALFEFLPPFIRRELLL  1190
              LFEFLP  I+ +L+L
Sbjct  373   ELFEFLPKTIQEQLML  388



>gb|KJB67275.1| hypothetical protein B456_010G184300 [Gossypium raimondii]
Length=502

 Score =   268 bits (685),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 161/387 (42%), Positives = 233/387 (60%), Gaps = 12/387 (3%)
 Frame = +3

Query  69    LARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHTFGQPLA  248
             LA   S++Q  R  +   +P  L+     V+   ++ A +P     I++LFP+ FGQP  
Sbjct  23    LASVYSEVQTSRIDHALPVPSVLRSPFKIVDGPASSAAGNPD---EIAKLFPNLFGQP--  77

Query  249   HFLRASAKVPDA-QIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNSTllgfl  425
                 +S  VP+    I     +++G+V  G Q+PGGHN I G++D L+   P STL GF 
Sbjct  78    ----SSMLVPNGVDNIGSDQKLKIGVVLSGGQAPGGHNVISGIFDYLQERAPGSTLYGFK  133

Query  426   ggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLKLDGLV  605
             GG  G+   K +E+T D +  Y+NQGG+DM+   +D+I + EQ   A      L LDGLV
Sbjct  134   GGPAGIMKGKYVELTADYIYPYRNQGGFDMICSGRDKIETPEQFKQAEETAAKLDLDGLV  193

Query  606   IVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICKVNSQLI  785
             ++GG  SNT+A  LAE F      T+V+G P T++GDLK + V T+ GFDT CK+ +++I
Sbjct  194   VIGGDDSNTNACLLAENFRSKNLKTRVIGCPKTIDGDLKCKEVPTSFGFDTACKIYAEMI  253

Query  786   SNVCTDALSAEKYYYFIRLMGRKTSHVALECTLQSHPNMVILAEEVAASKLTLFDITKQV  965
              NV  DA S  KYY+F+RLMGR  SH+ LEC LQ+HPN+ I+ EEVAA KLTL ++T  +
Sbjct  254   GNVMIDARSTGKYYHFVRLMGRAASHITLECALQTHPNITIIGEEVAAKKLTLKNVTDYM  313

Query  966   CDAVQARAEQDKYHGVILLPEGLIESIPEIYALLKEIHVLLREGVSANN--ISSQLSPWA  1139
              D +  RAE    +GVIL+PEGLI+ IPE+  L+ E++ +L   V   N     +L+  +
Sbjct  314   VDVICKRAELGYNYGVILIPEGLIDFIPEVQQLIAELNEILAHDVVDENGLWKKKLTDQS  373

Query  1140  SALFEFLPPFIRRELLLYPESDDSAQL  1220
               LFEFLP  I+ +L+L  +   + Q+
Sbjct  374   LKLFEFLPQAIQEQLMLERDPHGNVQV  400



>ref|XP_002269934.2| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit beta [Vitis vinifera]
 emb|CBI33004.3| unnamed protein product [Vitis vinifera]
Length=565

 Score =   270 bits (689),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 158/386 (41%), Positives = 232/386 (60%), Gaps = 11/386 (3%)
 Frame = +3

Query  69    LARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHTFGQPLA  248
              A   S++Q  R  +   LP  L+     VE   ++ A +P     I++LFP+ FGQP A
Sbjct  21    FAAVYSEVQTSRLNHSLPLPSVLKSPFKIVEGPPSSAAGNPG---EIAKLFPNMFGQPSA  77

Query  249   HFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNSTllgflg  428
               + + + +P  Q       +++G+V  G Q+PGGHN I G++D L+ H   STL GF G
Sbjct  78    MLVPSESALPSDQ------KLKIGVVLSGGQAPGGHNVISGIFDYLQNHVKGSTLYGFKG  131

Query  429   gseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLKLDGLVI  608
             G  G+   K +E+  + +  Y+NQGG+DM+   +D+I + EQ   A      L LDGL++
Sbjct  132   GPAGIMKCKYVELDSEFIYPYRNQGGFDMICSGRDKIETPEQFKQAEETAVKLDLDGLLV  191

Query  609   VGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICKVNSQLIS  788
             +GG  SNT+A  LAE F       +V+G P T++GDLK + V T+ GFDT CK+ +++I 
Sbjct  192   IGGDDSNTNACLLAENFRGKNMKARVIGCPKTIDGDLKCKEVPTSFGFDTACKIYAEMIG  251

Query  789   NVCTDALSAEKYYYFIRLMGRKTSHVALECTLQSHPNMVILAEEVAASKLTLFDITKQVC  968
             NV  DA S  KYY+F+RLMGR  SH+ LEC LQ+HPN+ I+ EEVAA KLTL ++T  + 
Sbjct  252   NVMIDARSTGKYYHFVRLMGRAASHITLECALQTHPNITIIGEEVAAKKLTLKNVTDYIV  311

Query  969   DAVQARAEQDKYHGVILLPEGLIESIPEIYALLKEIHVLLREGV--SANNISSQLSPWAS  1142
             D V  RAE    +GVIL+PEGLI+ IPE+  L+ E++ +L   +   A     +L+  + 
Sbjct  312   DVVCKRAELGYNYGVILIPEGLIDFIPEVQHLIAELNEILAHEIVDDAGLWKKKLTNQSL  371

Query  1143  ALFEFLPPFIRRELLLYPESDDSAQL  1220
              LFEFLPP I+ +L+L  +   + Q+
Sbjct  372   QLFEFLPPAIQEQLMLERDPHGNVQV  397



>ref|XP_003529650.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit beta-like [Glycine max]
Length=568

 Score =   270 bits (689),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 157/386 (41%), Positives = 234/386 (61%), Gaps = 10/386 (3%)
 Frame = +3

Query  69    LARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHTFGQPLA  248
              A   S++Q  R  +   LP  L+   + V+   ++ A +P     I++LFP  FGQP A
Sbjct  25    FAAVYSEVQNSRIDHELPLPSVLKNPFIIVDGPQSSAAGNP---EEIAKLFPKLFGQPSA  81

Query  249   HFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNSTllgflg  428
               + + +  P A     +  +++G+V  G Q+PGGHN I G++D L+     STL GF G
Sbjct  82    ALVPSDSHAPHA-----NRKLKIGVVLSGGQAPGGHNVISGIFDYLQDLAEGSTLYGFRG  136

Query  429   gseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLKLDGLVI  608
             G  G+   K +E+T D +  Y+NQGG+DM+   +D+I + EQ   A      L LDGLV+
Sbjct  137   GPAGIMKCKYVELTSDYIYPYRNQGGFDMIRSGRDKIETPEQFKQAEETVQKLNLDGLVV  196

Query  609   VGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICKVNSQLIS  788
             +GG  SNT+A  LAE F      T+V+G P T++GDLK + V T+ GFDT CK+ +++I 
Sbjct  197   IGGDDSNTNACLLAEHFRSKNMKTRVIGCPKTIDGDLKCKEVPTSFGFDTACKIYAEMIG  256

Query  789   NVCTDALSAEKYYYFIRLMGRKTSHVALECTLQSHPNMVILAEEVAASKLTLFDITKQVC  968
             NV  DA S  KYY+F+RLMGR  SH+ LEC LQ+HPN+ I+ EEVAA K+TL D+T  + 
Sbjct  257   NVMIDARSTGKYYHFVRLMGRAASHITLECALQTHPNITIIGEEVAAKKMTLKDVTDYIV  316

Query  969   DAVQARAEQDKYHGVILLPEGLIESIPEIYALLKEIH-VLLREGVSANNI-SSQLSPWAS  1142
             + +  RAE +  +GVIL+PEGLI+ IPE+  L+ E++ +L  + V    +   +L+  + 
Sbjct  317   NIISKRAEDNYNYGVILIPEGLIDFIPEVQHLIAELNEILANDAVDEGGLWKKKLTDQSL  376

Query  1143  ALFEFLPPFIRRELLLYPESDDSAQL  1220
              LFEFLP  I+ +L+L  +   + Q+
Sbjct  377   KLFEFLPKAIQEQLMLERDPHGNVQV  402



>ref|WP_025267586.1| Pyrophosphate--fructose 6-phosphate 1-phosphotransferase [Treponema 
pallidum]
 gb|AHN67213.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Treponema 
pallidum subsp. pallidum str. Sea 81-4]
Length=573

 Score =   270 bits (690),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 168/384 (44%), Positives = 237/384 (62%), Gaps = 17/384 (4%)
 Frame = +3

Query  81    LSDLQKLRSQYRPELPPCLQGTTVRV--EFGDATTAADPSGGHTISRLFPHTFGQPLAHF  254
             +S LQ+ R +Y P++P  L+G   RV    G +TTA   +    +  LF  T+GQPL +F
Sbjct  3     ISLLQQERHRYLPKVPDLLRGDFRRVCARRGLSTTAV--ADYDALRSLFARTYGQPLVNF  60

Query  255   LRASAKVPDAQIIT--EHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNSTllgflg  428
             + AS K  D+ + T  +   +RV IV  G Q+PGGHN I GL+D LK  + +S L+GFLG
Sbjct  61    VNASEKNEDSPMETAPDPRGLRVAIVLSGGQAPGGHNVIAGLFDGLKRWHADSVLIGFLG  120

Query  429   gseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLKLDGLVI  608
             G  G+ +   +EI  D +  Y+N GG+D++G  + +I S  Q  AA    T + LD LV+
Sbjct  121   GPAGVLSGDHIEICADRVDAYRNTGGFDLIGSGRTKIESESQFAAAAQTVTRMALDALVV  180

Query  609   VGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICKVNSQLIS  788
             VGG  SNT+AA LAE F  +   TKV+GVP T++GDLKN+ +ET+ GFDT  K  S+LI 
Sbjct  181   VGGDDSNTNAALLAEHFVNSGISTKVIGVPKTIDGDLKNEAIETSFGFDTATKTYSELIG  240

Query  789   NVCTDALSAEKYYYFIRLMGRKTSHVALECTLQSHPNMVILAEEVAASKLTLFDITKQVC  968
             N+  DA SA KY++FI+LMGR  SH+ALEC L++ PN+ +++EEVAA  LTL  I + +C
Sbjct  241   NIARDACSARKYWHFIKLMGRSASHIALECALKTQPNVCLISEEVAAQSLTLAQIVQSLC  300

Query  969   DAVQARAEQDKYHGVILLPEGLIESIPEIYALLKEIH-VLLREGVSANN----------I  1115
             D +  RA+  ++ G++L+PEGLIE IPE+ AL+ E++ V+ R                 I
Sbjct  301   DTIATRAQHGEHFGIVLVPEGLIEFIPEMKALITELNEVMARRAQEFEALDTPDAQRVWI  360

Query  1116  SSQLSPWASALFEFLPPFIRRELL  1187
                LS  A A+F  LP  I  +LL
Sbjct  361   EQALSASARAVFNALPAEISTQLL  384



>ref|WP_044045408.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Candidatus 
Protochlamydia amoebophila]
Length=545

 Score =   269 bits (688),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 158/345 (46%), Positives = 225/345 (65%), Gaps = 19/345 (6%)
 Frame = +3

Query  219   FPHTFGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHN  398
             FP TF QP+  F R + K        E   ++VG+V  G Q+PGGHN I GL+DALK  +
Sbjct  47    FPQTFQQPIITFRRGNKK--------EATPLKVGVVLSGGQAPGGHNVIAGLFDALKQIH  98

Query  399   PNSTllgflggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTAC  578
             P S LLGFL G  G+    ++E+T  ++ +Y+NQGG+DM+G  + +I +  Q+ AA+   
Sbjct  99    PESILLGFLDGPLGILKNTSIELTKMVIDSYRNQGGFDMIGSGRTKIETPAQLEAAMLTV  158

Query  579   TSLKLDGLVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDT  758
              +L LDGLVI+GG  SNT+AA LAE F +    T V+GVP T++GDLKN+F++ + GFDT
Sbjct  159   QTLALDGLVIIGGDDSNTNAAILAEYFKQVGVKTSVIGVPKTIDGDLKNEFIDISFGFDT  218

Query  759   ICKVNSQLISNVCTDALSAEKYYYFIRLMGRKTSHVALECTLQSHPNMVILAEEVAASKL  938
               K+ ++ I N+  DALSA+KYY+FI+LMGR  SH+ALEC L +HPN+V ++EEVA  K 
Sbjct  219   ASKIYAECIGNILKDALSAKKYYHFIKLMGRSASHLALECALLTHPNLVFISEEVAEKKQ  278

Query  939   TLFDITKQVCDAVQARAEQDKYHGVILLPEGLIESIPEIYALLKEIHVLLR------EGV  1100
             TL +I  Q+   +  RAE++ ++GVIL+PEGLIESI EI AL+++++ LL       EG+
Sbjct  279   TLQEIVGQITTMICKRAEKNLHYGVILIPEGLIESISEIGALIQKLNELLFSHSEKIEGL  338

Query  1101  -----SANNISSQLSPWASALFEFLPPFIRRELLLYPESDDSAQL  1220
                    N I SQL+   +  F  LP  +R +LLL  +S  + Q+
Sbjct  339   LITEEKDNYIISQLTSNEAKTFLALPKEVRDQLLLERDSHGNVQV  383



>ref|NP_001057284.1| Os06g0247500 [Oryza sativa Japonica Group]
 dbj|BAD45669.1| putative pyrophosphate-dependent phosphofructokinase beta subunit 
[Oryza sativa Japonica Group]
 dbj|BAF19198.1| Os06g0247500 [Oryza sativa Japonica Group]
 gb|EAZ00352.1| hypothetical protein OsI_22368 [Oryza sativa Indica Group]
 gb|EAZ36477.1| hypothetical protein OsJ_20808 [Oryza sativa Japonica Group]
Length=567

 Score =   269 bits (688),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 163/376 (43%), Positives = 231/376 (61%), Gaps = 12/376 (3%)
 Frame = +3

Query  69    LARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHTFGQPLA  248
             LA   S++Q  R ++   LP  L+      + G A++AA   G   I++LFP+ FGQP  
Sbjct  26    LASVYSEVQTSRLKHALPLPSVLRSPFALAD-GPASSAAGNPG--EIAKLFPNLFGQP--  80

Query  249   HFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNSTllgflg  428
                 + + VP  +  +  P ++VG+V  G Q+PGGHN I G++D L+ +   S + GF G
Sbjct  81    ----SVSLVPSPEPASTRP-LKVGVVLSGGQAPGGHNVICGIFDYLQEYAKGSVMYGFKG  135

Query  429   gseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLKLDGLVI  608
             G  G+   K +E+T D +  Y+NQGG+DM+   +D+I + EQ   A      L LDGLV+
Sbjct  136   GPAGVMKCKYVELTADYVYPYRNQGGFDMICSGRDKIETPEQFKQAEDTVNKLDLDGLVV  195

Query  609   VGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICKVNSQLIS  788
             +GG  SNT+A  LAE F      T+V+G P T++GDLK + V T+ GFDT CK+ S++I 
Sbjct  196   IGGDDSNTNACLLAEYFRGKNMKTRVIGCPKTIDGDLKCKEVPTSFGFDTACKIYSEMIG  255

Query  789   NVCTDALSAEKYYYFIRLMGRKTSHVALECTLQSHPNMVILAEEVAASKLTLFDITKQVC  968
             NV TDA S  KYY+F+RLMGR  SH+ LEC LQ+HPN+ ++ EEVAA K TL  +T  + 
Sbjct  256   NVMTDARSTGKYYHFVRLMGRAASHITLECALQTHPNVALIGEEVAAKKETLKSVTDYIT  315

Query  969   DAVQARAEQDKYHGVILLPEGLIESIPEIYALLKEIHVLLREGV--SANNISSQLSPWAS  1142
             D V  RAE    +GVIL+PEGLI+ IPE+  L+ E++ +L   V   A    S+L P + 
Sbjct  316   DIVCKRAELGYNYGVILIPEGLIDFIPEVQKLIAELNEILAHDVVDEAGAWKSKLQPESR  375

Query  1143  ALFEFLPPFIRRELLL  1190
              LF+FLP  I+ +LLL
Sbjct  376   QLFDFLPKTIQEQLLL  391



>ref|WP_016524203.1| diphosphate-fructose-6-phosphate 1-phosphotransferase [Treponema 
medium]
 gb|EPF27781.1| diphosphate-fructose-6-phosphate 1-phosphotransferase [Treponema 
medium ATCC 700293]
Length=556

 Score =   269 bits (687),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 158/382 (41%), Positives = 233/382 (61%), Gaps = 22/382 (6%)
 Frame = +3

Query  81    LSDLQKLRSQYRPELPPCLQG--TTVRVEFGDATTAADPSGGHTISRLFPHTFGQPLAHF  254
             +S L K R  Y P  P  L     ++ ++ G  TT+   +    I  LFPHT+G+P+ HF
Sbjct  3     VSQLHKARYTYTPRFPAILDEPIESIAMQKGQETTSM--AHAEEIKPLFPHTYGKPVIHF  60

Query  255   LRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNSTllgflggs  434
             ++ +A +       +   +RVG +  G Q+PGGHN I GLYD LK  NP S L GFLGG 
Sbjct  61    VKGTAHI-------DKKPLRVGTILSGGQAPGGHNVIAGLYDGLKKANPGSKLFGFLGGP  113

Query  435   eglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLKLDGLVIVG  614
             EGL     +EI+ +I+  Y+N GG+DM+G  + +I + EQV   +     ++LD +VI+G
Sbjct  114   EGLIIGNAIEISGEIVDRYRNTGGFDMIGSGRAKIETPEQVAGVIATVKRMELDAVVIIG  173

Query  615   GVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICKVNSQLISNV  794
             G  SNT+AA L+E F +    T+++GVP T++GDLK   +ET+ GFDT  K+ S LI N+
Sbjct  174   GDDSNTNAAILSEYFLQHGIATQIIGVPKTIDGDLKYDMLETSFGFDTATKIYSDLIGNI  233

Query  795   CTDALSAEKYYYFIRLMGRKTSHVALECTLQSHPNMVILAEEVAASKLTLFDITKQVCDA  974
               DA SA+KY++FI+LMGR  SH+ALEC L++ PN+ +++EEVA  K+TL  IT  + DA
Sbjct  234   ARDANSAKKYWHFIKLMGRFASHIALECALRTQPNICLISEEVAEKKMTLKQITDIIADA  293

Query  975   VQARAEQDKYHGVILLPEGLIESIPEIYALLKEIHVLLREGVSANN-----------ISS  1121
             V  RA + +  GV+L+PEG+IE IPE+  L+KE++  + +   A N           +  
Sbjct  294   VVKRANRKENFGVVLIPEGVIEFIPEMKQLIKELNAAMAQYPDAFNTLETFKQQRTWVEQ  353

Query  1122  QLSPWASALFEFLPPFIRRELL  1187
              ++P ++ALF  +P  I  E L
Sbjct  354   HINPESAALFASMPEDIAAEFL  375



>emb|CAF23604.1| putative 6-phosphofructokinase 1 [Candidatus Protochlamydia amoebophila 
UWE25]
Length=553

 Score =   269 bits (687),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 158/345 (46%), Positives = 225/345 (65%), Gaps = 19/345 (6%)
 Frame = +3

Query  219   FPHTFGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHN  398
             FP TF QP+  F R + K        E   ++VG+V  G Q+PGGHN I GL+DALK  +
Sbjct  55    FPQTFQQPIITFRRGNKK--------EATPLKVGVVLSGGQAPGGHNVIAGLFDALKQIH  106

Query  399   PNSTllgflggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTAC  578
             P S LLGFL G  G+    ++E+T  ++ +Y+NQGG+DM+G  + +I +  Q+ AA+   
Sbjct  107   PESILLGFLDGPLGILKNTSIELTKMVIDSYRNQGGFDMIGSGRTKIETPAQLEAAMLTV  166

Query  579   TSLKLDGLVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDT  758
              +L LDGLVI+GG  SNT+AA LAE F +    T V+GVP T++GDLKN+F++ + GFDT
Sbjct  167   QTLALDGLVIIGGDDSNTNAAILAEYFKQVGVKTSVIGVPKTIDGDLKNEFIDISFGFDT  226

Query  759   ICKVNSQLISNVCTDALSAEKYYYFIRLMGRKTSHVALECTLQSHPNMVILAEEVAASKL  938
               K+ ++ I N+  DALSA+KYY+FI+LMGR  SH+ALEC L +HPN+V ++EEVA  K 
Sbjct  227   ASKIYAECIGNILKDALSAKKYYHFIKLMGRSASHLALECALLTHPNLVFISEEVAEKKQ  286

Query  939   TLFDITKQVCDAVQARAEQDKYHGVILLPEGLIESIPEIYALLKEIHVLLR------EGV  1100
             TL +I  Q+   +  RAE++ ++GVIL+PEGLIESI EI AL+++++ LL       EG+
Sbjct  287   TLQEIVGQITTMICKRAEKNLHYGVILIPEGLIESISEIGALIQKLNELLFSHSEKIEGL  346

Query  1101  -----SANNISSQLSPWASALFEFLPPFIRRELLLYPESDDSAQL  1220
                    N I SQL+   +  F  LP  +R +LLL  +S  + Q+
Sbjct  347   LITEEKDNYIISQLTSNEAKTFLALPKEVRDQLLLERDSHGNVQV  391



>ref|XP_006396720.1| hypothetical protein EUTSA_v10028543mg [Eutrema salsugineum]
 gb|ESQ38173.1| hypothetical protein EUTSA_v10028543mg [Eutrema salsugineum]
Length=480

 Score =   266 bits (681),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 158/379 (42%), Positives = 229/379 (60%), Gaps = 14/379 (4%)
 Frame = +3

Query  69    LARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHTFGQPLA  248
             +A   S++Q  R  +   LP   +    ++  G  ++AA  S    I++LFP+ FGQP A
Sbjct  25    VASVYSEVQASRIDHSLPLPSVFK-IPFKIVDGPPSSAAGNS--EEIAKLFPNLFGQPSA  81

Query  249   HFLRASAKVPD---AQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNSTllg  419
                     VPD   + I ++   +++G+V  G Q+PGGHN I G++D L+ H   S+L G
Sbjct  82    LL------VPDQTNSAISSDKKKLKIGVVLSGGQAPGGHNVICGIFDYLEEHAKGSSLFG  135

Query  420   flggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLKLDG  599
             F GG  G+   K +E+T D +  Y+NQGG+DM+   +D+I + EQ   A    T + LDG
Sbjct  136   FRGGPAGIMKGKLVELTSDFVYPYRNQGGFDMICSGRDKIETPEQFQQAEETVTKMDLDG  195

Query  600   LVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICKVNSQ  779
             LV++GG  SNT+A  LAE F      T+V+G P T++GDLK++ V T+ GFDT CK+ S+
Sbjct  196   LVVIGGDDSNTNACLLAEYFRGKNMKTRVIGCPKTIDGDLKSKEVPTSFGFDTACKIYSE  255

Query  780   LISNVCTDALSAEKYYYFIRLMGRKTSHVALECTLQSHPNMVILAEEVAASKLTLFDITK  959
             +I NV  DA S  KYY+F+RLMGR  SH+ LEC LQ+HPN+ I+ EEV+  KLTL ++T 
Sbjct  256   MIGNVMIDARSTGKYYHFVRLMGRAASHITLECALQTHPNITIIGEEVSEKKLTLKNVTD  315

Query  960   QVCDAVQARAEQDKYHGVILLPEGLIESIPEIYALLKEIHVLLREGV--SANNISSQLSP  1133
              + D +  RAE    +GVIL+PEGLI+ IPE+  L+ E++ +L +G           L  
Sbjct  316   YIVDVICKRAENGYNYGVILVPEGLIDFIPEVQELISELNEILAQGNVDEEGQWKKNLKE  375

Query  1134  WASALFEFLPPFIRRELLL  1190
                 LFEFLP  I+ +L+L
Sbjct  376   ETLNLFEFLPQTIQEQLML  394



>ref|WP_015711192.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Treponema 
azotonutricium]
 gb|AEF82681.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Treponema 
azotonutricium ZAS-9]
Length=551

 Score =   268 bits (686),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 164/386 (42%), Positives = 236/386 (61%), Gaps = 26/386 (7%)
 Frame = +3

Query  78    ELSDLQKLRSQYRPELPPCLQG--TTVRVEFGDAT-TAADPSGGHTISRLFPHTFGQPLA  248
             E+S LQK R  Y+P+LP  + G  + + VE G  T + AD +    +  LF HT+G+PLA
Sbjct  2     EISALQKARYAYQPKLPANIAGAISDIAVELGKPTDSVADQA---ALKELFNHTYGKPLA  58

Query  249   HFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNSTllgflg  428
              F +      DA    +   + VG++  G Q+PGGHN I GLYD LK  NP S L GFLG
Sbjct  59    VFAKGKG---DA----DKKELTVGVILSGGQAPGGHNVIAGLYDGLKKGNPASRLYGFLG  111

Query  429   gseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLKLDGLVI  608
             G  GL   KT+  +D  +  Y+N GG+D++G  + +I + EQ  A+L     L L+ +V+
Sbjct  112   GPSGLIENKTMVFSDKFIDEYRNTGGFDIIGSGRTKIETPEQFAASLETAKKLNLNAVVV  171

Query  609   VGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICKVNSQLIS  788
             +GG  SNT+AA LAE F E     +V+G P T++GDLKN+ +ET+ GFDT CK  S+LI 
Sbjct  172   IGGDDSNTNAALLAEYFLEKGSAIQVIGCPKTIDGDLKNEHIETSFGFDTACKTYSELIG  231

Query  789   NVCTDALSAEKYYYFIRLMGRKTSHVALECTLQSHPNMVILAEEVAASKLTLFDITKQVC  968
             N+  DA SA+KY++F++LMGR  SH+ALEC LQ+ PN+ +++EEV   K++L  + +Q+C
Sbjct  232   NIERDANSAKKYWHFVKLMGRAASHIALECALQTQPNICLISEEVQEKKISLNQVVEQIC  291

Query  969   DAVQARAEQDKYHGVILLPEGLIESIPEIYALLKEIHVLL----REGVSANNISSQLSPW  1136
              +V  RAE  +  GV+L+PEGL+E IPE+  L+ E++  +     E V  ++   QL  W
Sbjct  292   SSVIKRAENKENFGVVLIPEGLVEFIPEMKKLIDELNDAMGLKGAEFVELSSFIDQLY-W  350

Query  1137  AS--------ALFEFLPPFIRRELLL  1190
              S           + LPP I RELL+
Sbjct  351   LSHEISEDSYKFLQTLPPEIARELLM  376



>ref|WP_025002795.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Prevotella 
dentasini]
Length=547

 Score =   268 bits (686),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 158/381 (41%), Positives = 228/381 (60%), Gaps = 21/381 (6%)
 Frame = +3

Query  78    ELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHTFGQPLAHFL  257
             E+S LQK R+ Y+P+LP  LQGT V+++ G+ T + D      I +LFP+T+G PL  F+
Sbjct  2     EISALQKERAAYQPKLPKALQGT-VKIQEGEPTQSVDNQ--EDIKKLFPNTYGMPLIEFV  58

Query  258   RASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNSTllgflggse  437
              ++        +T    + VG++  G Q+PGGHN I GL+D +K  NP S L GFL G  
Sbjct  59    PSN--------VTNGKKVNVGVILSGGQAPGGHNVISGLFDEIKKLNPESRLYGFLMGPG  110

Query  438   glfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLKLDGLVIVGG  617
             GL     +EIT+D +  Y+N GG+DM+G  + ++   EQ    L     L +  +VI+GG
Sbjct  111   GLVNHNYIEITEDYVQNYRNTGGFDMIGSGRTKLEEEEQFEKGLEVIRELNIHAIVIIGG  170

Query  618   VTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICKVNSQLISNVC  797
               SNT+A  LAE +A  K   +V+G P T++GDLKN  +ET+ GFDT  K  S LI N+ 
Sbjct  171   DDSNTNACVLAEYYAAKKYGVQVIGCPKTIDGDLKNDQIETSFGFDTATKTYSGLIGNIE  230

Query  798   TDALSAEKYYYFIRLMGRKTSHVALECTLQSHPNMVILAEEVAASKLTLFDITKQVCDAV  977
              D  S+ KY++F++LMGR  SH+ALEC LQ+ PN+ +++EE+ A   TL DI + + + V
Sbjct  231   RDCNSSRKYWHFVKLMGRSASHIALECALQTQPNICLISEEIQARDKTLNDIVEYIANIV  290

Query  978   QARAEQDKYHGVILLPEGLIESIPEIYALLKEIHVL----------LREGVSANNISSQL  1127
               RA Q K +GV+L+PEGLIE +P I  L++E++ L          L+E      I + L
Sbjct  291   AYRANQGKNYGVVLVPEGLIEFVPAIGRLIQELNDLLAEHGADYKDLKEEAQREYILAHL  350

Query  1128  SPWASALFEFLPPFIRRELLL  1190
             S    A FE LP  + R+L L
Sbjct  351   SAANKATFETLPEGVARQLSL  371



>ref|WP_015708501.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Treponema 
primitia]
 gb|AEF85844.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Treponema 
primitia ZAS-2]
Length=551

 Score =   268 bits (686),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 161/384 (42%), Positives = 237/384 (62%), Gaps = 22/384 (6%)
 Frame = +3

Query  78    ELSDLQKLRSQYRPELPPCLQ--GTTVRVEFGDATTAADPSGGHTISRLFPHTFGQPLAH  251
             ++S LQK R  Y+P+LP  L      + V+ G+ T A   + G  +   F  T+G+P+A 
Sbjct  2     DISALQKARYSYKPKLPASLSLPVNEIAVKLGEPTEAI--ADGDALKAFFNRTYGKPIAT  59

Query  252   FLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNSTllgflgg  431
             F++ +        IT    + VG++  G Q+PGGHN I GLYD LK  N  S LLG LGG
Sbjct  60    FVKGANDS-----ITRK--LTVGVILSGGQAPGGHNVIAGLYDGLKKGNAASRLLGLLGG  112

Query  432   seglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLKLDGLVIV  611
               GL   K++EIT  ++  Y+N GG+DM+G  + +I + EQ  A+L     L LD +VI+
Sbjct  113   PSGLIDNKSVEITGPMMDIYRNTGGFDMIGSGRTKIETPEQFAASLENAKKLGLDAVVII  172

Query  612   GGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICKVNSQLISN  791
             GG  SNT+AA LAE F +     +V+G P T++GDLKN+ +E + GFDT  K  S+LI N
Sbjct  173   GGDDSNTNAALLAEYFLDRGSGIQVIGCPKTIDGDLKNEHIEISFGFDTAVKTYSELIGN  232

Query  792   VCTDALSAEKYYYFIRLMGRKTSHVALECTLQSHPNMVILAEEVAASKLTLFDITKQVCD  971
             +  DA SA+KY++FI+LMGR  SH+ALEC LQ+ PN+ +++EEV A KL+L  +  Q+CD
Sbjct  233   IERDANSAKKYWHFIKLMGRSASHIALECALQTQPNITLVSEEVEAKKLSLGQVVDQICD  292

Query  972   AVQARAEQDKYHGVILLPEGLIESIPEIYALLKEIHVLLREGVS-----------ANNIS  1118
             AV  RA+  +  GV+L+PEGL+E IPE+  L++E++ ++ E              ++ + 
Sbjct  293   AVVKRADNKENFGVVLVPEGLVEFIPEMKKLIEELNDIMAENEKDFSGLKNFSEQSDWLV  352

Query  1119  SQLSPWASALFEFLPPFIRRELLL  1190
             +QLS  ++ LF  LP  I +ELL+
Sbjct  353   TQLSDPSAYLFRSLPEEIAKELLM  376



>ref|WP_022406493.1| diphosphate-fructose-6-phosphate 1-phosphotransferase [Prevotella 
sp. CAG:485]
 emb|CDE07571.1| diphosphate-fructose-6-phosphate 1-phosphotransferase [Prevotella 
sp. CAG:485]
Length=551

 Score =   268 bits (686),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 160/389 (41%), Positives = 234/389 (60%), Gaps = 19/389 (5%)
 Frame = +3

Query  84    SDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHTFGQPLAHFLRA  263
             S LQK R  Y+P+LP  LQG  V+V++G  TT+        I+RLFPHT+G P+    R 
Sbjct  4     SALQKAREAYQPKLPRALQGA-VKVKYGSKTTSCGDE--EEIARLFPHTYGMPVVEMERD  60

Query  264   SAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNSTllgflggsegl  443
             S+  P      E P   VGI+  G Q+PGGHN + G++D +K  N    L GFL G  G 
Sbjct  61    SS--PKR---VEEP-FNVGIILSGGQAPGGHNVVSGIFDGIKRINSECRLYGFLMGPSGF  114

Query  444   fAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLKLDGLVIVGGVT  623
                + +E+T + +  Y+N GG+D++G  + ++ + EQ +  LT    L +  LVI+GG  
Sbjct  115   INHQYMELTANYIQQYRNTGGFDIIGSGRTKLETIEQFDKGLTILQELNIKALVIIGGDD  174

Query  624   SNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICKVNSQLISNVCTD  803
             SNT+AA LAE + E     +V+GVP T++GDLKN+++ET+ GFDT CKV S++I N+  D
Sbjct  175   SNTNAAVLAEYYKEIGADVQVIGVPKTIDGDLKNKWIETSFGFDTACKVYSEMIGNIQRD  234

Query  804   ALSAEKYYYFIRLMGRKTSHVALECTLQSHPNMVILAEEVAASKLTLFDITKQVCDAVQA  983
               S++KYY+FI+LMGR  SH+ALEC LQ+ PN+ I++EEV A ++TL +I  Q+   +  
Sbjct  235   CNSSKKYYHFIKLMGRSASHIALECALQTQPNICIISEEVQAKRMTLDNIVSQIAYFIAE  294

Query  984   RAEQDKYHGVILLPEGLIESIPEIYALLKEIHVLLREGVSA----------NNISSQLSP  1133
             RA+     G +L+PEGLIE IP +  L++E++ +L E                + S LSP
Sbjct  295   RAKIGWNFGTVLIPEGLIEFIPSMKKLIEELNDILAEHSEEIAQYEEIEKLQKVHSYLSP  354

Query  1134  WASALFEFLPPFIRRELLLYPESDDSAQL  1220
               + LF+ LP  I  EL L  +S  + Q+
Sbjct  355   ANAELFKSLPKHIALELCLDRDSHGNVQV  383



>dbj|BAK07581.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=560

 Score =   269 bits (687),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 160/386 (41%), Positives = 231/386 (60%), Gaps = 12/386 (3%)
 Frame = +3

Query  69    LARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHTFGQPLA  248
             LA   S++Q  R  +   LP  L+      +   +T A  P     I++LFP  +GQP  
Sbjct  19    LASVYSEVQTSRIAHMLPLPSVLRSHFTLADGPASTAAGCPD---EIAKLFPCLYGQP--  73

Query  249   HFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNSTllgflg  428
                 +++ VP A+ +   P +++G+V  G Q+PGGHN I G++D L+     ST+ GF G
Sbjct  74    ----SASVVPTAEPVASKP-LKIGVVLSGGQAPGGHNVICGIFDYLQERAKGSTMYGFKG  128

Query  429   gseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLKLDGLVI  608
             G  G+   K +E+T D +  Y+NQGG+DM+   +D+I + EQ   A      L LDGLV+
Sbjct  129   GPAGVMKGKYVELTADFVYPYRNQGGFDMICSGRDKIETPEQFKQAEDTVNRLDLDGLVV  188

Query  609   VGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICKVNSQLIS  788
             +GG  SNT+A  L E F      T+V+G P T++GDLK + V T+ GFDT CK+ S++I 
Sbjct  189   IGGDDSNTNACLLGEYFRGRNLKTRVIGCPKTIDGDLKCKEVPTSFGFDTACKIYSEMIG  248

Query  789   NVCTDALSAEKYYYFIRLMGRKTSHVALECTLQSHPNMVILAEEVAASKLTLFDITKQVC  968
             NV TDA S  KYY+F+RLMGR  SH+ LEC LQ+HPN+ ++ EEVA  K TL ++T  + 
Sbjct  249   NVMTDARSTGKYYHFVRLMGRAASHITLECALQTHPNVALIGEEVAEKKETLKNVTDYIT  308

Query  969   DAVQARAEQDKYHGVILLPEGLIESIPEIYALLKEIHVLLREGV--SANNISSQLSPWAS  1142
             D V  RAE    +GV+L+PEGLI+ IPEI  L+ E++ +L   V   A    S+L P + 
Sbjct  309   DVVCKRAELGYNYGVVLIPEGLIDFIPEIQKLIAELNEILAHDVVDEAGAWKSKLEPASR  368

Query  1143  ALFEFLPPFIRRELLLYPESDDSAQL  1220
              LF+FLP  I+ +LLL  +   + Q+
Sbjct  369   QLFDFLPKTIQEQLLLERDPHGNVQV  394



>ref|WP_008861193.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Barnesiella 
intestinihominis]
 gb|EJZ66519.1| diphosphate-fructose-6-phosphate 1-phosphotransferase [Barnesiella 
intestinihominis YIT 11860]
Length=549

 Score =   268 bits (686),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 150/379 (40%), Positives = 229/379 (60%), Gaps = 21/379 (6%)
 Frame = +3

Query  84    SDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHTFGQPLAHFLRA  263
             S LQ  R+ Y+P+LP  ++     VE     + AD      I++LFP+T+G P+  F  A
Sbjct  4     SALQTARASYQPKLPEAIKNGVTIVEGKATQSVADQ---EAIAKLFPNTYGMPVLRFEAA  60

Query  264   SAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNSTllgflggsegl  443
             + K        E+PAI VG++  G Q+PGGHN I GL+D LK  N  S L GFL G  GL
Sbjct  61    AKK--------EYPAINVGVILSGGQAPGGHNVISGLFDGLKALNKESRLFGFLLGPGGL  112

Query  444   fAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLKLDGLVIVGGVT  623
                K +E+T DI+  Y+N GG+D++G  + ++ + +Q ++ L     L +  +VI+GG  
Sbjct  113   IEHKYMELTADIIDDYRNTGGFDIIGSGRTKLETKDQFDSGLEIIKELGIKAVVIIGGDD  172

Query  624   SNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICKVNSQLISNVCTD  803
             SNT+A  LAE + +     +V+G P T++GDLKN+ +E++ GFDT CKV S++I N+  D
Sbjct  173   SNTNACVLAEYYKQIGAGVQVIGCPKTIDGDLKNEMIESSFGFDTACKVYSEVIGNIQRD  232

Query  804   ALSAEKYYYFIRLMGRKTSHVALECTLQSHPNMVILAEEVAASKLTLFDITKQVCDAVQA  983
               SA+KY++FI+LMGR  SH+ALEC LQ+ PN+ +++EE+ A ++TL D+   + + V A
Sbjct  233   CNSAKKYWHFIKLMGRSASHIALECALQTQPNICLISEEIEAKQMTLDDVVNYIAEIVAA  292

Query  984   RAEQDKYHGVILLPEGLIESIPEIYALLKEIH----------VLLREGVSANNISSQLSP  1133
             RA +    G +L+PEGLIE IP +  L+ E++           ++++    N I   LSP
Sbjct  293   RAAKGNNFGTVLIPEGLIEFIPAMKRLIAELNDYLAANGSEFAMIKKSEQINYIIKHLSP  352

Query  1134  WASALFEFLPPFIRRELLL  1190
               SA++  LP  + R+L L
Sbjct  353   ENSAIYASLPEGVARQLTL  371



>ref|WP_042282134.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Candidatus 
Protochlamydia sp. R18]
Length=545

 Score =   268 bits (685),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 160/370 (43%), Positives = 234/370 (63%), Gaps = 23/370 (6%)
 Frame = +3

Query  144   TTVRVEFGDATTAADPSGGHTISRLFPHTFGQPLAHFLRASAKVPDAQIITEHPAIRVGI  323
             + +   F  +   +DP+    +   FP TF QP+  F R + K        E   ++VG+
Sbjct  26    SVIVANFEKSICLSDPA----LQEQFPQTFQQPIITFRRGNKK--------EATPLKVGV  73

Query  324   VFCGRQSPGGHNAIWGLYDALKVHNPNSTllgflggseglfAQKTLEITDDILATYKNQG  503
             V  G Q+PGGHN I GL+DALK  +P S LLGFL G  G+    ++E+T  ++ +Y+NQG
Sbjct  74    VLSGGQAPGGHNVIAGLFDALKQIHPESILLGFLDGPLGILKNTSIELTKMVIDSYRNQG  133

Query  504   GYDMLGRTKDQIRSTEQVNAALTACTSLKLDGLVIVGGVTSNTDaaylaeafaeaKCPTK  683
             G+DM+G  + +I +  Q+ AA+    +L LDGLVI+GG  SNT+AA LAE F +A   T 
Sbjct  134   GFDMIGSGRTKIETPAQLEAAMLTVQTLSLDGLVIIGGDDSNTNAAILAEYFKQAGVKTS  193

Query  684   VVGVPVTLNGDLKNQFVETNVGFDTICKVNSQLISNVCTDALSAEKYYYFIRLMGRKTSH  863
             V+GVP T++GDLKN+F++ + GFDT  K+ ++ I N+  DALSA+KYY+FI+LMGR  SH
Sbjct  194   VIGVPKTIDGDLKNEFIDISFGFDTASKIYAECIGNILKDALSAKKYYHFIKLMGRSASH  253

Query  864   VALECTLQSHPNMVILAEEVAASKLTLFDITKQVCDAVQARAEQDKYHGVILLPEGLIES  1043
             +ALEC L +HPN+V ++EEVA  K TL +I  Q+   +  RAE++ ++GV+L+PEGLIES
Sbjct  254   LALECALLTHPNLVFISEEVAEKKQTLQEIVGQITTMICKRAEKNLHYGVVLIPEGLIES  313

Query  1044  IPEIYALLKEIHVLL---REGVSA--------NNISSQLSPWASALFEFLPPFIRRELLL  1190
             I EI AL+++++ LL    E +          N I SQL+   +  F  LP  +R +LLL
Sbjct  314   ISEIGALIQKLNELLFSHSEKIEELLIPEEKDNYIISQLTSNEAKTFLALPKEVRDQLLL  373

Query  1191  YPESDDSAQL  1220
               +S  + Q+
Sbjct  374   ERDSHGNVQV  383



>ref|WP_021892263.1| diphosphate-fructose-6-phosphate 1-phosphotransferase [Bacteroides 
sp. CAG:20]
 emb|CCX94843.1| diphosphate-fructose-6-phosphate 1-phosphotransferase [Bacteroides 
sp. CAG:20]
Length=549

 Score =   268 bits (685),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 150/379 (40%), Positives = 229/379 (60%), Gaps = 21/379 (6%)
 Frame = +3

Query  84    SDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHTFGQPLAHFLRA  263
             S LQ  R+ Y+P+LP  ++     VE     + AD      I++LFP+T+G P+  F  A
Sbjct  4     SALQTARASYQPKLPEAIKNGVTIVEGKATQSVADQ---EAIAKLFPNTYGMPVLRFEAA  60

Query  264   SAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNSTllgflggsegl  443
             + K        E+PAI VG++  G Q+PGGHN I GL+D LK  N  S L GFL G  GL
Sbjct  61    AKK--------EYPAINVGVILSGGQAPGGHNVISGLFDGLKALNKESRLFGFLLGPGGL  112

Query  444   fAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLKLDGLVIVGGVT  623
                K +E+T DI+  Y+N GG+D++G  + ++ + +Q ++ L     L +  +VI+GG  
Sbjct  113   IEHKYMELTADIIDDYRNTGGFDIIGSGRTKLETKDQFDSGLEIIKELGIKAVVIIGGDD  172

Query  624   SNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICKVNSQLISNVCTD  803
             SNT+A  LAE + +     +V+G P T++GDLKN+ +E++ GFDT CKV S++I N+  D
Sbjct  173   SNTNACVLAEYYKQIGAGVQVIGCPKTIDGDLKNEMIESSFGFDTACKVYSEVIGNIQRD  232

Query  804   ALSAEKYYYFIRLMGRKTSHVALECTLQSHPNMVILAEEVAASKLTLFDITKQVCDAVQA  983
               SA+KY++FI+LMGR  SH+ALEC LQ+ PN+ +++EE+ A ++TL D+   + + V A
Sbjct  233   CNSAKKYWHFIKLMGRSASHIALECALQTQPNICLISEEIEAKQMTLDDVVNYIAEIVAA  292

Query  984   RAEQDKYHGVILLPEGLIESIPEIYALLKEIH----------VLLREGVSANNISSQLSP  1133
             RA +    G +L+PEGLIE IP +  L+ E++           ++++    N I   LSP
Sbjct  293   RAAKGNNFGTVLIPEGLIEFIPAMKRLIAELNDYLAANGSEFAMIKKSEQINYIIKHLSP  352

Query  1134  WASALFEFLPPFIRRELLL  1190
               SA++  LP  + R+L L
Sbjct  353   ENSAIYASLPEGVARQLTL  371



>ref|XP_006656840.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit beta-like [Oryza brachyantha]
Length=565

 Score =   268 bits (686),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 163/376 (43%), Positives = 230/376 (61%), Gaps = 12/376 (3%)
 Frame = +3

Query  69    LARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHTFGQPLA  248
             LA   S++Q  R ++   LP  L+      + G A++AA   G   I++LFP+ FGQP  
Sbjct  24    LASVYSEVQTSRLKHALPLPSVLRSPFALAD-GPASSAAGNPG--EIAKLFPNLFGQP--  78

Query  249   HFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNSTllgflg  428
                 + + VP  +  +  P ++VG+V  G Q+PGGHN I G++D L+     S + GF G
Sbjct  79    ----SVSLVPSPEPASTRP-LKVGVVLSGGQAPGGHNVICGIFDYLQERAKGSIMYGFKG  133

Query  429   gseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLKLDGLVI  608
             G  G+   K +E+T D +  Y+NQGG+DM+   +D+I + EQ   A      L LDGLV+
Sbjct  134   GPAGVMKCKYVELTADYVYPYRNQGGFDMICSGRDKIETPEQFKQAEDTVNKLDLDGLVV  193

Query  609   VGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICKVNSQLIS  788
             +GG  SNT+A  LAE F      T+V+G P T++GDLK + V T+ GFDT CK+ S++I 
Sbjct  194   IGGDDSNTNACLLAEYFRGKNMKTRVIGCPKTIDGDLKCKEVPTSFGFDTACKIYSEMIG  253

Query  789   NVCTDALSAEKYYYFIRLMGRKTSHVALECTLQSHPNMVILAEEVAASKLTLFDITKQVC  968
             NV TDA S  KYY+F+RLMGR  SH+ LEC LQ+HPN+ ++ EEVAA K TL  +T  + 
Sbjct  254   NVMTDARSTGKYYHFVRLMGRAASHITLECALQTHPNVALIGEEVAAKKETLKSVTDYIT  313

Query  969   DAVQARAEQDKYHGVILLPEGLIESIPEIYALLKEIHVLLREGV--SANNISSQLSPWAS  1142
             D V  RAE    +GVIL+PEGLI+ IPE+  L+ E++ +L   V   A    S+L P + 
Sbjct  314   DIVCKRAELGYNYGVILIPEGLIDFIPEVQKLIAELNEILAHDVVDEAGAWKSKLQPESR  373

Query  1143  ALFEFLPPFIRRELLL  1190
              LF+FLP  I+ +LLL
Sbjct  374   LLFDFLPKTIQEQLLL  389



>gb|KJB67269.1| hypothetical protein B456_010G184300 [Gossypium raimondii]
Length=566

 Score =   268 bits (685),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 161/387 (42%), Positives = 233/387 (60%), Gaps = 12/387 (3%)
 Frame = +3

Query  69    LARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHTFGQPLA  248
             LA   S++Q  R  +   +P  L+     V+   ++ A +P     I++LFP+ FGQP  
Sbjct  23    LASVYSEVQTSRIDHALPVPSVLRSPFKIVDGPASSAAGNPD---EIAKLFPNLFGQP--  77

Query  249   HFLRASAKVPDA-QIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNSTllgfl  425
                 +S  VP+    I     +++G+V  G Q+PGGHN I G++D L+   P STL GF 
Sbjct  78    ----SSMLVPNGVDNIGSDQKLKIGVVLSGGQAPGGHNVISGIFDYLQERAPGSTLYGFK  133

Query  426   ggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLKLDGLV  605
             GG  G+   K +E+T D +  Y+NQGG+DM+   +D+I + EQ   A      L LDGLV
Sbjct  134   GGPAGIMKGKYVELTADYIYPYRNQGGFDMICSGRDKIETPEQFKQAEETAAKLDLDGLV  193

Query  606   IVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICKVNSQLI  785
             ++GG  SNT+A  LAE F      T+V+G P T++GDLK + V T+ GFDT CK+ +++I
Sbjct  194   VIGGDDSNTNACLLAENFRSKNLKTRVIGCPKTIDGDLKCKEVPTSFGFDTACKIYAEMI  253

Query  786   SNVCTDALSAEKYYYFIRLMGRKTSHVALECTLQSHPNMVILAEEVAASKLTLFDITKQV  965
              NV  DA S  KYY+F+RLMGR  SH+ LEC LQ+HPN+ I+ EEVAA KLTL ++T  +
Sbjct  254   GNVMIDARSTGKYYHFVRLMGRAASHITLECALQTHPNITIIGEEVAAKKLTLKNVTDYM  313

Query  966   CDAVQARAEQDKYHGVILLPEGLIESIPEIYALLKEIHVLLREGVSANN--ISSQLSPWA  1139
              D +  RAE    +GVIL+PEGLI+ IPE+  L+ E++ +L   V   N     +L+  +
Sbjct  314   VDVICKRAELGYNYGVILIPEGLIDFIPEVQQLIAELNEILAHDVVDENGLWKKKLTDQS  373

Query  1140  SALFEFLPPFIRRELLLYPESDDSAQL  1220
               LFEFLP  I+ +L+L  +   + Q+
Sbjct  374   LKLFEFLPQAIQEQLMLERDPHGNVQV  400



>gb|KJB42857.1| hypothetical protein B456_007G170900 [Gossypium raimondii]
Length=568

 Score =   268 bits (685),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 161/390 (41%), Positives = 233/390 (60%), Gaps = 12/390 (3%)
 Frame = +3

Query  57    SDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHTFG  236
             S F L  +  D Q  R  + P LP  L+     V+    T A +P+    I+ LFP+ +G
Sbjct  21    SRFLLPSDYGDFQTNRLNHTPPLPSILKNPFQVVDGHPTTAAGNPN---EIANLFPNLYG  77

Query  237   QPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNSTll  416
             QP    +   ++V       +  +++VG+VF G Q+PGGHN I G++D L+     STL 
Sbjct  78    QPSVSLVPGQSEV-------KGQSLKVGVVFSGGQAPGGHNVITGIFDYLQERARGSTLY  130

Query  417   gflggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLKLD  596
             GF GG  G+ + K +++T D++  Y+NQGG+ M+  ++D+I + EQ+  A      L LD
Sbjct  131   GFKGGPAGIMSCKYVKLTADLIYPYRNQGGFHMICSSRDKIETPEQLKQAEETVKKLDLD  190

Query  597   GLVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICKVNS  776
             GLVI+GG  SNT+A  LAE F      T+V+G P T++GDLK + V  + GFDT CK+ S
Sbjct  191   GLVIIGGDDSNTNACLLAEYFRSKNMKTQVIGCPKTIDGDLKCKDVPISFGFDTACKIYS  250

Query  777   QLISNVCTDALSAEKYYYFIRLMGRKTSHVALECTLQSHPNMVILAEEVAASKLTLFDIT  956
             ++I NV  DA S  KYY+FIRLMGR  SH+ LEC LQ+HPN+ I+ EEVAA KLT+ ++T
Sbjct  251   EMIGNVMVDARSTGKYYHFIRLMGRAASHITLECALQTHPNIAIIGEEVAAKKLTMKNVT  310

Query  957   KQVCDAVQARAEQDKYHGVILLPEGLIESIPEIYALLKEIHVLLREGV--SANNISSQLS  1130
               + D +  R E    +GVI+LPEGLI+ IPE+  L+ E++ +L   V   A     +L 
Sbjct  311   NYIADIICKRMELGFNYGVIILPEGLIDFIPEVKQLIAELNEILAHDVVDEAGMWKRKLR  370

Query  1131  PWASALFEFLPPFIRRELLLYPESDDSAQL  1220
               +  LFEFLP  I+ +LLL  +   + Q+
Sbjct  371   SHSHDLFEFLPQSIQEQLLLERDPHGNVQV  400



>ref|XP_010035533.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit beta-like [Eucalyptus grandis]
 gb|KCW46957.1| hypothetical protein EUGRSUZ_K00768 [Eucalyptus grandis]
Length=566

 Score =   268 bits (684),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 155/380 (41%), Positives = 235/380 (62%), Gaps = 8/380 (2%)
 Frame = +3

Query  87    DLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHTFGQPLAHFLRAS  266
             ++Q+ R  +   LP  L+G+   V+   ++ A DP     +++LFP+ FGQP A  + ++
Sbjct  27    EVQRSRLHHPLPLPSVLRGSFHVVDGPPSSAAGDPD---EMAKLFPNLFGQPSASLVPST  83

Query  267   AKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNSTllgflggseglf  446
             +     +   +  A+++G+V  G Q+PGGHN I G++D L+ H   STL GF GG  G+ 
Sbjct  84    SSTGATK---DQKALKIGVVLSGGQAPGGHNVISGIFDYLQEHTSGSTLYGFRGGPAGIM  140

Query  447   AQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLKLDGLVIVGGVTS  626
               K +E++ + +  Y+NQGG+DML   +D+I + EQ   A      L LDGL+++GG  S
Sbjct  141   KCKYIELSSEFIYPYRNQGGFDMLCSGRDKIETPEQFKQAEETTKKLDLDGLLVIGGDDS  200

Query  627   NTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICKVNSQLISNVCTDA  806
             NT+A  LAE F      T+V+G P T++GDLK + V T+ GFDT CKV ++LI NV  D 
Sbjct  201   NTNACLLAENFRAKNMKTRVLGCPKTIDGDLKCKEVPTSFGFDTACKVYAELIGNVMVDC  260

Query  807   LSAEKYYYFIRLMGRKTSHVALECTLQSHPNMVILAEEVAASKLTLFDITKQVCDAVQAR  986
              S+ KYY+F+RLMGR  SH+ LEC LQ+HPN+ I+ EE+AA KLTL ++T  + + +  R
Sbjct  261   RSSGKYYHFVRLMGRAASHITLECALQTHPNITIIGEEMAAKKLTLKNVTDYITNIICKR  320

Query  987   AEQDKYHGVILLPEGLIESIPEIYALLKEIHVLLREGV--SANNISSQLSPWASALFEFL  1160
             ++    +GVILLPEGLI+ IPE+  L+ E++ +L   V   A     +L   +  LFEFL
Sbjct  321   SDIGYNYGVILLPEGLIDFIPEVQQLISELNEILAHDVIDEAGIWKKKLQSQSKELFEFL  380

Query  1161  PPFIRRELLLYPESDDSAQL  1220
             P  I+++LLL  +   + Q+
Sbjct  381   PQEIQKQLLLERDPHGNVQV  400



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3421465534246