BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig13266

Length=1161
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009769969.1|  PREDICTED: uncharacterized protein LOC104220...    291   6e-92   Nicotiana sylvestris
ref|XP_009769968.1|  PREDICTED: uncharacterized protein LOC104220...    286   6e-90   Nicotiana sylvestris
ref|XP_009615934.1|  PREDICTED: uncharacterized protein LOC104108...    286   9e-90   Nicotiana tomentosiformis
ref|XP_009615933.1|  PREDICTED: uncharacterized protein LOC104108...    281   9e-88   Nicotiana tomentosiformis
ref|XP_006360111.1|  PREDICTED: uncharacterized protein LOC102579806    233   2e-69   
ref|XP_004244170.1|  PREDICTED: uncharacterized protein LOC101263...    226   1e-66   Solanum lycopersicum
ref|XP_010324338.1|  PREDICTED: uncharacterized protein LOC101263...    225   3e-66   Solanum lycopersicum
ref|XP_011097947.1|  PREDICTED: uncharacterized protein LOC105176...    221   1e-64   Sesamum indicum [beniseed]
ref|XP_011097948.1|  PREDICTED: uncharacterized protein LOC105176...    211   5e-61   Sesamum indicum [beniseed]
emb|CDP05826.1|  unnamed protein product                                211   6e-61   Coffea canephora [robusta coffee]
gb|AFX67022.1|  hypothetical protein                                    206   3e-59   Solanum tuberosum [potatoes]
ref|XP_010267849.1|  PREDICTED: uncharacterized protein LOC104604963    198   9e-56   Nelumbo nucifera [Indian lotus]
gb|EYU33580.1|  hypothetical protein MIMGU_mgv1a010110mg                196   4e-55   Erythranthe guttata [common monkey flower]
ref|XP_011048250.1|  PREDICTED: uncharacterized protein LOC105142...    173   2e-46   Populus euphratica
ref|XP_011048249.1|  PREDICTED: uncharacterized protein LOC105142...    172   2e-46   Populus euphratica
ref|XP_002316956.1|  hypothetical protein POPTR_0011s13360g             169   3e-45   Populus trichocarpa [western balsam poplar]
ref|XP_012070703.1|  PREDICTED: uncharacterized protein LOC105632857    167   2e-44   Jatropha curcas
gb|ABK93511.1|  unknown                                                 167   2e-44   Populus trichocarpa [western balsam poplar]
gb|KHG00183.1|  hypothetical protein F383_20411                         166   7e-44   Gossypium arboreum [tree cotton]
ref|XP_006370583.1|  hypothetical protein POPTR_0001s44020g             164   3e-43   
ref|XP_008789186.1|  PREDICTED: uncharacterized protein LOC103706755    162   2e-42   Phoenix dactylifera
ref|XP_010092273.1|  hypothetical protein L484_021134                   161   3e-42   
ref|XP_006452123.1|  hypothetical protein CICLE_v10008955mg             160   8e-42   Citrus clementina [clementine]
gb|KHG12371.1|  HEAT repeat-containing 8                                156   2e-40   Gossypium arboreum [tree cotton]
gb|KJB81865.1|  hypothetical protein B456_013G165300                    154   9e-40   Gossypium raimondii
gb|KJB45630.1|  hypothetical protein B456_007G317200                    154   1e-39   Gossypium raimondii
gb|AFK40032.1|  unknown                                                 154   2e-39   Lotus japonicus
ref|XP_010062936.1|  PREDICTED: uncharacterized protein LOC104450...    153   4e-39   Eucalyptus grandis [rose gum]
gb|AFK40544.1|  unknown                                                 152   7e-39   Lotus japonicus
ref|XP_010910123.1|  PREDICTED: uncharacterized protein LOC105036081    152   9e-39   Elaeis guineensis
ref|XP_010694294.1|  PREDICTED: uncharacterized protein LOC104907109    151   1e-38   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_011030911.1|  PREDICTED: uncharacterized protein LOC105130...    152   1e-38   Populus euphratica
ref|XP_002283181.1|  PREDICTED: uncharacterized protein LOC100265933    150   6e-38   Vitis vinifera
ref|XP_010062934.1|  PREDICTED: uncharacterized protein LOC104450...    149   8e-38   Eucalyptus grandis [rose gum]
ref|XP_011030912.1|  PREDICTED: uncharacterized protein LOC105130...    148   2e-37   Populus euphratica
gb|KJB45631.1|  hypothetical protein B456_007G317200                    147   7e-37   Gossypium raimondii
ref|XP_007021147.1|  Uncharacterized protein TCM_031178                 141   1e-34   
ref|XP_003527303.2|  PREDICTED: uncharacterized protein LOC100782462    140   2e-34   Glycine max [soybeans]
ref|XP_008813171.1|  PREDICTED: uncharacterized protein LOC103723874    139   9e-34   
emb|CBI20469.3|  unnamed protein product                                137   1e-33   Vitis vinifera
ref|XP_003539571.1|  PREDICTED: uncharacterized protein LOC100795...    137   1e-33   Glycine max [soybeans]
ref|XP_009385062.1|  PREDICTED: uncharacterized protein LOC103972444    137   1e-33   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004151972.1|  PREDICTED: uncharacterized protein LOC101218021    137   2e-33   Cucumis sativus [cucumbers]
gb|KEH30768.1|  transmembrane protein, putative                         137   3e-33   Medicago truncatula
gb|AGV54826.1|  hypothetical protein                                    136   4e-33   Phaseolus vulgaris [French bean]
ref|XP_007133044.1|  hypothetical protein PHAVU_011G146700g             136   5e-33   Phaseolus vulgaris [French bean]
ref|XP_004294319.1|  PREDICTED: uncharacterized protein LOC101314638    136   6e-33   Fragaria vesca subsp. vesca
ref|XP_010448280.1|  PREDICTED: uncharacterized protein LOC104730767    135   1e-32   Camelina sativa [gold-of-pleasure]
ref|XP_008454597.1|  PREDICTED: uncharacterized protein LOC103494...    134   2e-32   Cucumis melo [Oriental melon]
ref|NP_200265.1|  uncharacterized protein                               134   3e-32   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010443028.1|  PREDICTED: uncharacterized protein LOC104725975    132   8e-32   Camelina sativa [gold-of-pleasure]
ref|XP_008359297.1|  PREDICTED: uncharacterized protein LOC103423006    132   1e-31   
ref|XP_010482859.1|  PREDICTED: uncharacterized protein LOC104761470    131   2e-31   Camelina sativa [gold-of-pleasure]
gb|KHN27993.1|  hypothetical protein glysoja_007725                     130   3e-31   Glycine soja [wild soybean]
ref|XP_002864339.1|  hypothetical protein ARALYDRAFT_495534             130   3e-31   Arabidopsis lyrata subsp. lyrata
ref|XP_006594801.1|  PREDICTED: uncharacterized protein LOC100779229    130   5e-31   Glycine max [soybeans]
ref|XP_008226793.1|  PREDICTED: uncharacterized protein LOC103326356    130   6e-31   Prunus mume [ume]
gb|KHN38595.1|  hypothetical protein glysoja_040149                     128   1e-30   Glycine soja [wild soybean]
ref|XP_006280901.1|  hypothetical protein CARUB_v10026894mg             128   2e-30   Capsella rubella
ref|XP_009355556.1|  PREDICTED: uncharacterized protein LOC103946557    128   4e-30   Pyrus x bretschneideri [bai li]
ref|XP_008365896.1|  PREDICTED: uncharacterized protein LOC103429531    126   1e-29   
ref|XP_008454598.1|  PREDICTED: uncharacterized protein LOC103494...    125   2e-29   Cucumis melo [Oriental melon]
ref|XP_006592890.1|  PREDICTED: uncharacterized protein LOC100795...    124   5e-29   
gb|KFK27065.1|  hypothetical protein AALP_AA8G329900                    124   5e-29   Arabis alpina [alpine rockcress]
ref|XP_002530912.1|  conserved hypothetical protein                     121   1e-28   
ref|XP_009393345.1|  PREDICTED: uncharacterized protein LOC103979052    121   1e-27   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002443952.1|  hypothetical protein SORBIDRAFT_07g004990          119   4e-27   Sorghum bicolor [broomcorn]
ref|XP_006401561.1|  hypothetical protein EUTSA_v10014255mg             119   5e-27   Eutrema salsugineum [saltwater cress]
ref|XP_006452122.1|  hypothetical protein CICLE_v10008955mg             117   8e-27   
ref|XP_011095782.1|  PREDICTED: uncharacterized protein LOC105175132    114   2e-26   Sesamum indicum [beniseed]
ref|XP_010928571.1|  PREDICTED: uncharacterized protein LOC105050...    117   3e-26   
ref|XP_010928579.1|  PREDICTED: uncharacterized protein LOC105050...    116   5e-26   Elaeis guineensis
ref|XP_009402591.1|  PREDICTED: uncharacterized protein LOC103986...    114   3e-25   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009402588.1|  PREDICTED: uncharacterized protein LOC103986...    114   4e-25   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006659890.1|  PREDICTED: uncharacterized protein LOC102713016    111   7e-25   
ref|XP_007211764.1|  hypothetical protein PRUPE_ppa009590mg             109   1e-23   
gb|KCW70086.1|  hypothetical protein EUGRSUZ_F03390                     105   3e-23   Eucalyptus grandis [rose gum]
ref|XP_010520882.1|  PREDICTED: uncharacterized protein LOC104799894    108   3e-23   Tarenaya hassleriana [spider flower]
ref|XP_003573409.1|  PREDICTED: uncharacterized protein LOC100845511    107   5e-23   Brachypodium distachyon [annual false brome]
ref|XP_009127082.1|  PREDICTED: uncharacterized protein LOC103851954    105   2e-22   Brassica rapa
emb|CDY68666.1|  BnaAnng27970D                                          104   2e-22   Brassica napus [oilseed rape]
ref|XP_009119980.1|  PREDICTED: uncharacterized protein LOC103844909    105   3e-22   Brassica rapa
emb|CDY42460.1|  BnaA10g08360D                                          104   5e-22   Brassica napus [oilseed rape]
gb|KJB45632.1|  hypothetical protein B456_007G317300                    105   5e-22   Gossypium raimondii
gb|EPS66227.1|  hypothetical protein M569_08551                         104   6e-22   Genlisea aurea
emb|CDY63696.1|  BnaCnng42470D                                          103   2e-21   Brassica napus [oilseed rape]
gb|EAZ05807.1|  hypothetical protein OsI_28043                          101   2e-21   Oryza sativa Indica Group [Indian rice]
gb|AFK42977.1|  unknown                                                 101   3e-21   Medicago truncatula
ref|XP_008678238.1|  PREDICTED: uncharacterized protein LOC103653035    102   3e-21   
ref|NP_001144178.1|  uncharacterized protein LOC100277035               101   8e-21   Zea mays [maize]
gb|AFW56882.1|  hypothetical protein ZEAMMB73_730622                    101   8e-21   
dbj|BAJ88294.1|  predicted protein                                      100   9e-21   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|NP_001061135.1|  Os08g0179900                                       100   1e-20   
gb|AFW56883.1|  hypothetical protein ZEAMMB73_730622                  99.8    3e-20   
emb|CDY64929.1|  BnaCnng45510D                                        98.6    5e-20   Brassica napus [oilseed rape]
ref|XP_008452336.1|  PREDICTED: uncharacterized protein LOC103493396  98.6    9e-20   Cucumis melo [Oriental melon]
ref|XP_004972711.1|  PREDICTED: uncharacterized protein LOC101763830  97.1    2e-19   Setaria italica
gb|KHN36752.1|  hypothetical protein glysoja_001483                   95.1    5e-19   Glycine soja [wild soybean]
ref|XP_006851190.1|  PREDICTED: uncharacterized protein LOC18440997   92.0    1e-17   Amborella trichopoda
ref|XP_011048251.1|  PREDICTED: uncharacterized protein LOC105142...  90.5    3e-17   Populus euphratica
dbj|BAK00216.1|  predicted protein                                    90.1    4e-17   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|ACF82614.1|  unknown                                               87.8    4e-17   Zea mays [maize]
gb|EEE58521.1|  hypothetical protein OsJ_09808                        89.0    1e-16   Oryza sativa Japonica Group [Japonica rice]
gb|ABF94497.1|  expressed protein                                     87.0    6e-16   Oryza sativa Japonica Group [Japonica rice]
gb|EMT06766.1|  hypothetical protein F775_27558                       85.9    1e-15   
ref|XP_004149934.1|  PREDICTED: uncharacterized protein LOC101211780  85.5    3e-15   Cucumis sativus [cucumbers]
gb|ABR26041.1|  unknown                                               79.7    4e-14   Oryza sativa Indica Group [Indian rice]
gb|KDO74400.1|  hypothetical protein CISIN_1g021190mg                 80.1    7e-14   Citrus sinensis [apfelsine]
ref|XP_004985312.1|  PREDICTED: uncharacterized protein LOC101783230  80.5    1e-13   Setaria italica
gb|EEE68150.1|  hypothetical protein OsJ_26259                        77.4    1e-13   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006452121.1|  hypothetical protein CICLE_v10008955mg           77.0    5e-13   
gb|EMT30710.1|  hypothetical protein F775_11491                       77.0    8e-13   
gb|EAY88928.1|  hypothetical protein OsI_10413                        77.8    1e-12   Oryza sativa Indica Group [Indian rice]
ref|NP_001049294.1|  Os03g0201000                                     77.8    2e-12   
tpg|DAA43934.1|  TPA: hypothetical protein ZEAMMB73_179991            76.6    2e-12   
ref|XP_004987122.1|  PREDICTED: uncharacterized protein LOC101758268  74.7    6e-12   
ref|XP_010229018.1|  PREDICTED: uncharacterized protein LOC100829035  73.9    2e-11   Brachypodium distachyon [annual false brome]
gb|EMS62049.1|  hypothetical protein TRIUR3_22897                     71.2    6e-11   Triticum urartu
gb|ABK21444.1|  unknown                                               72.0    1e-10   Picea sitchensis
gb|KDP39008.1|  hypothetical protein JCGZ_00765                       65.9    2e-09   Jatropha curcas
ref|XP_006649578.1|  PREDICTED: uncharacterized protein LOC102707381  67.0    7e-09   Oryza brachyantha
ref|XP_002961012.1|  hypothetical protein SELMODRAFT_437468           64.7    3e-08   Selaginella moellendorffii
ref|XP_012071198.1|  PREDICTED: uncharacterized protein LOC105633231  60.8    9e-08   Jatropha curcas
ref|XP_002468323.1|  hypothetical protein SORBIDRAFT_01g043800        62.4    1e-07   
ref|XP_002966997.1|  hypothetical protein SELMODRAFT_439861           62.0    3e-07   Selaginella moellendorffii
gb|ACJ85791.1|  unknown                                               55.5    2e-06   Medicago truncatula
ref|XP_007149673.1|  hypothetical protein PHAVU_005G0894000g          53.5    2e-05   Phaseolus vulgaris [French bean]
ref|XP_002530913.1|  conserved hypothetical protein                   51.6    5e-05   



>ref|XP_009769969.1| PREDICTED: uncharacterized protein LOC104220737 isoform X2 [Nicotiana 
sylvestris]
Length=325

 Score =   291 bits (745),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 181/315 (57%), Positives = 217/315 (69%), Gaps = 11/315 (3%)
 Frame = +1

Query  94    ITVANSGFRGIASEHPVSSAARKvvrpvsvsgissssDHLKssavsasqstavDGAPVQW  273
             +TVANSGFR + +EHPV +AAR VVRPVSVS I+SSS+ +KS  V        D +PVQ 
Sbjct  16    VTVANSGFRSVTAEHPVFTAARNVVRPVSVSAITSSSEDVKSGVVHGGSI---DVSPVQ-  71

Query  274   PCRELDGWEFAGGDEEEMVAAGEPLPRLIFGGAPSLQEAKEATFDLKDALHKVYNMSTPP  453
                E D WE AGG+E+ MV +GEPLPR++FGGAPSLQEA EAT DLKDAL KVY +S P 
Sbjct  72    KMSEFDDWEMAGGEEDMMVKSGEPLPRVVFGGAPSLQEATEATSDLKDALEKVY-LSPPA  130

Query  454   SDCGSTNGAAQVNNDHsppsnsssenAIAHGAPKHAIRAFKFLYENAAAQTVVASIASDP  633
             S  GS    + +       +   SE  +   APKHAI+AF+FL E  AAQ+VVASIA DP
Sbjct  131   SYGGSCISGSSLL--PFSKACVVSETVVTPSAPKHAIQAFRFLSETPAAQSVVASIACDP  188

Query  634   NVWNAVLANPELQEFLVSQKTSAYVLDGEYSVEESIAETDFLRYSSPRNDDLTSEDGSPK  813
             NVW AVL NP LQEFLVSQKTSA   D +  ++ES+A+TD    SSPR+    SE    K
Sbjct  189   NVWTAVLQNPALQEFLVSQKTSASFPDSDQKMDESVADTDSFSQSSPRSAFSKSEAEESK  248

Query  814   PGNGFTDFLQNIK----VAVLDMMNCLSDFFQNLFGGHKVFADADGSAKTSVVDRAWGAS  981
               N FT FLQN+K      V+DMM+ LSD+F NLFGG+KVF +ADGSAK    ++  GAS
Sbjct  249   SKNSFTGFLQNVKRTVTQTVIDMMSSLSDYFNNLFGGNKVFIEADGSAKLGAAEKTLGAS  308

Query  982   FMGLAIMAIMVVVLK  1026
             F+GLAIMAIMVVVLK
Sbjct  309   FIGLAIMAIMVVVLK  323



>ref|XP_009769968.1| PREDICTED: uncharacterized protein LOC104220737 isoform X1 [Nicotiana 
sylvestris]
Length=328

 Score =   286 bits (732),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 181/318 (57%), Positives = 217/318 (68%), Gaps = 14/318 (4%)
 Frame = +1

Query  94    ITVANSGFRGIASEHPVSSAARKvvrpvsvsgissssDHLKssavsasqstavDGAPVQW  273
             +TVANSGFR + +EHPV +AAR VVRPVSVS I+SSS+ +KS  V        D +PVQ 
Sbjct  16    VTVANSGFRSVTAEHPVFTAARNVVRPVSVSAITSSSEDVKSGVVHGGSI---DVSPVQ-  71

Query  274   PCRELDGWEFAGGDEEEMVAAGEPLPRLIFGGAPSLQEAKEATFDLKDALHKVYNMSTPP  453
                E D WE AGG+E+ MV +GEPLPR++FGGAPSLQEA EAT DLKDAL KVY +S P 
Sbjct  72    KMSEFDDWEMAGGEEDMMVKSGEPLPRVVFGGAPSLQEATEATSDLKDALEKVY-LSPPA  130

Query  454   SDCGSTNGAAQVNNDHsppsnsssenAIAHGAPKHAIRAFKFLYENAAAQTVVASIASDP  633
             S  GS    + +       +   SE  +   APKHAI+AF+FL E  AAQ+VVASIA DP
Sbjct  131   SYGGSCISGSSLL--PFSKACVVSETVVTPSAPKHAIQAFRFLSETPAAQSVVASIACDP  188

Query  634   NVWNAVLANPELQEFLVSQKTS---AYVLDGEYSVEESIAETDFLRYSSPRNDDLTSEDG  804
             NVW AVL NP LQEFLVSQKTS   A   D +  ++ES+A+TD    SSPR+    SE  
Sbjct  189   NVWTAVLQNPALQEFLVSQKTSEKCASFPDSDQKMDESVADTDSFSQSSPRSAFSKSEAE  248

Query  805   SPKPGNGFTDFLQNIK----VAVLDMMNCLSDFFQNLFGGHKVFADADGSAKTSVVDRAW  972
               K  N FT FLQN+K      V+DMM+ LSD+F NLFGG+KVF +ADGSAK    ++  
Sbjct  249   ESKSKNSFTGFLQNVKRTVTQTVIDMMSSLSDYFNNLFGGNKVFIEADGSAKLGAAEKTL  308

Query  973   GASFMGLAIMAIMVVVLK  1026
             GASF+GLAIMAIMVVVLK
Sbjct  309   GASFIGLAIMAIMVVVLK  326



>ref|XP_009615934.1| PREDICTED: uncharacterized protein LOC104108568 isoform X2 [Nicotiana 
tomentosiformis]
Length=327

 Score =   286 bits (731),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 177/317 (56%), Positives = 217/317 (68%), Gaps = 13/317 (4%)
 Frame = +1

Query  94    ITVANSGFRGIASEHPVSSAARKvvrpvsvsgissssDHLKssavsasqstavDGAPVQW  273
             +TVANSGFR + +EHPV +AAR VVRPVSVS I+SSS+ +KS  V        D + VQ 
Sbjct  16    VTVANSGFRSVTAEHPVYTAARNVVRPVSVSAITSSSEDVKSGVVHGGSV---DVSSVQK  72

Query  274   PCRELDGWEFAGGDEEEMVAAGEPLPRLIFGGAPSLQEAKEATFDLKDALHKVYNMSTPP  453
                E D WE AGG+E+ +V +GEPLPR++FGGAPSLQEA EAT DLKDAL KVY +S P 
Sbjct  73    ILSEFDDWEMAGGEEDMIVKSGEPLPRVVFGGAPSLQEATEATSDLKDALEKVY-LSQPA  131

Query  454   SDCGST--NGAAQVNNDHsppsnsssenAIAHGAPKHAIRAFKFLYENAAAQTVVASIAS  627
             SD G +  +G++ +       +   S+  +   APKHAI+AF+FL E  AAQ+VVASIA 
Sbjct  132   SDYGGSCISGSSLL---PFSKACVVSKTVVTPSAPKHAIQAFRFLSETPAAQSVVASIAC  188

Query  628   DPNVWNAVLANPELQEFLVSQKTSAYVLDGEYSVEESIAETDFLRYSSPRNDDLTSEDGS  807
             DPNVW AVL NP LQEFL SQKTSA   D +  ++ES+A+TD    SSPRN     E   
Sbjct  189   DPNVWTAVLQNPALQEFLESQKTSASFPDLDQKMDESVADTDSFSQSSPRNAFSKYEAEE  248

Query  808   PKPGNGFTDFLQN----IKVAVLDMMNCLSDFFQNLFGGHKVFADADGSAKTSVVDRAWG  975
              K  N FT FLQN    +   V++MM+ LSD+F NLFGG KVF +ADGSAK   V++  G
Sbjct  249   SKSKNSFTGFLQNVTHTVTQTVINMMSSLSDYFNNLFGGTKVFIEADGSAKLGAVEKTLG  308

Query  976   ASFMGLAIMAIMVVVLK  1026
             ASF+GLAIMAIMVVVLK
Sbjct  309   ASFIGLAIMAIMVVVLK  325



>ref|XP_009615933.1| PREDICTED: uncharacterized protein LOC104108568 isoform X1 [Nicotiana 
tomentosiformis]
Length=330

 Score =   281 bits (718),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 177/320 (55%), Positives = 217/320 (68%), Gaps = 16/320 (5%)
 Frame = +1

Query  94    ITVANSGFRGIASEHPVSSAARKvvrpvsvsgissssDHLKssavsasqstavDGAPVQW  273
             +TVANSGFR + +EHPV +AAR VVRPVSVS I+SSS+ +KS  V        D + VQ 
Sbjct  16    VTVANSGFRSVTAEHPVYTAARNVVRPVSVSAITSSSEDVKSGVVHGGSV---DVSSVQK  72

Query  274   PCRELDGWEFAGGDEEEMVAAGEPLPRLIFGGAPSLQEAKEATFDLKDALHKVYNMSTPP  453
                E D WE AGG+E+ +V +GEPLPR++FGGAPSLQEA EAT DLKDAL KVY +S P 
Sbjct  73    ILSEFDDWEMAGGEEDMIVKSGEPLPRVVFGGAPSLQEATEATSDLKDALEKVY-LSQPA  131

Query  454   SDCGST--NGAAQVNNDHsppsnsssenAIAHGAPKHAIRAFKFLYENAAAQTVVASIAS  627
             SD G +  +G++ +       +   S+  +   APKHAI+AF+FL E  AAQ+VVASIA 
Sbjct  132   SDYGGSCISGSSLL---PFSKACVVSKTVVTPSAPKHAIQAFRFLSETPAAQSVVASIAC  188

Query  628   DPNVWNAVLANPELQEFLVSQKTS---AYVLDGEYSVEESIAETDFLRYSSPRNDDLTSE  798
             DPNVW AVL NP LQEFL SQKTS   A   D +  ++ES+A+TD    SSPRN     E
Sbjct  189   DPNVWTAVLQNPALQEFLESQKTSEKCASFPDLDQKMDESVADTDSFSQSSPRNAFSKYE  248

Query  799   DGSPKPGNGFTDFLQN----IKVAVLDMMNCLSDFFQNLFGGHKVFADADGSAKTSVVDR  966
                 K  N FT FLQN    +   V++MM+ LSD+F NLFGG KVF +ADGSAK   V++
Sbjct  249   AEESKSKNSFTGFLQNVTHTVTQTVINMMSSLSDYFNNLFGGTKVFIEADGSAKLGAVEK  308

Query  967   AWGASFMGLAIMAIMVVVLK  1026
               GASF+GLAIMAIMVVVLK
Sbjct  309   TLGASFIGLAIMAIMVVVLK  328



>ref|XP_006360111.1| PREDICTED: uncharacterized protein LOC102579806 [Solanum tuberosum]
Length=328

 Score =   233 bits (595),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 154/300 (51%), Positives = 195/300 (65%), Gaps = 7/300 (2%)
 Frame = +1

Query  106  NSGFRGIASEHPVSSAARKvvrpvsvsgissssDHLKssavsasqstavDGAPVQWPCRE  285
            NSGFR + +EHPV +AAR V RPVS+SGISS+S+ +KS+ V+AS   + D + V     +
Sbjct  20   NSGFRSVTAEHPVYAAARNVARPVSISGISSTSEDVKSAMVTASHGGSSDVSYVPKMVSD  79

Query  286  LDGWEFAGGDEEEMVAAGEPLPRLIFGGAPSLQEAKEATFDLKDALHKVYNMSTPPSDCG  465
             D WE AGG+EE MV  GEPLPRL+FGGAPSLQEA EAT DLKDAL  VY   +  ++  
Sbjct  80   FDDWEMAGGEEEMMVNPGEPLPRLVFGGAPSLQEATEATSDLKDAL--VYLSGS--ANGY  135

Query  466  STNGAAQVNNDHsppsnsssenAIAHGAPKHAIRAFKFLYENAAAQTVVASIASDPNVWN  645
              +  +  ++     +   SE  +    PKHA++A++ L E  AAQ VVASIA DPNVWN
Sbjct  136  GGSCISGSSSSPVSKACVVSETIVTKSVPKHAVQAYRVLSEIPAAQNVVASIACDPNVWN  195

Query  646  AVLANPELQEFLVSQKTS---AYVLDGEYSVEESIAETDFLRYSSPRNDDLTSEDGSPKP  816
            AVL NP LQ+FL SQ++S   A   D +   +ES+A+T     SSP      S+    K 
Sbjct  196  AVLQNPALQDFLESQRSSEKCASFPDSDQEKDESVADTASFSESSPWKPFSESKAEESKS  255

Query  817  GNGFTDFLQNIKVAVLDMMNCLSDFFQNLFGGHKVFADADGSAKTSVVDRAWGASFMGLA  996
            GN FT FLQN+   V+DMM+ LSDFF NLFGG+K F DADGSAK   V++  GASFM LA
Sbjct  256  GNFFTSFLQNVTQTVVDMMDSLSDFFNNLFGGNKFFVDADGSAKFGAVEKTLGASFMALA  315



>ref|XP_004244170.1| PREDICTED: uncharacterized protein LOC101263228 isoform X2 [Solanum 
lycopersicum]
Length=332

 Score =   226 bits (576),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 152/304 (50%), Positives = 195/304 (64%), Gaps = 11/304 (4%)
 Frame = +1

Query  106  NSGFRGIASEHPVSSAARKvvrpvsvsgissssDHLKssavsasqstavDGAPVQWPCRE  285
            NSGFR + +EHP+ +AAR V RPVS+SG+SS+S+ +KS  V+AS   ++D + V     +
Sbjct  20   NSGFRSVTAEHPLYAAARNVARPVSISGLSSTSEDVKSGMVTASHGGSLDVSHVPKMVSD  79

Query  286  LDGWEFAGGDEEEMVAAGEPLPRLIFGGAPSLQEAKEATFDLKDALHKVYNMSTPPSDCG  465
             D WE AGG+EE MV  GEPLPRL+FGGAPSLQEA EAT DLKDAL  VY   +  ++  
Sbjct  80   FDDWEMAGGEEEMMVNPGEPLPRLVFGGAPSLQEATEATSDLKDAL--VYLSGS--ANGN  135

Query  466  STNGAAQVNNDHsppsnsssenAIAHGAPKHAIRAFKFLYENAAAQTVVASIASDPNVWN  645
              +  +  ++     +   SE  +    PKHA++A++ L E  AAQ VVASIA DPNVWN
Sbjct  136  GGSCISGSSSSPVSKACVVSETIVTKSVPKHAVQAYRVLSEIPAAQNVVASIACDPNVWN  195

Query  646  AVLANPELQEFLVSQKTS---AYVLDGEYSVEESIAETDFLRYSSPRNDDLTSEDGSPKP  816
            AVL NP LQ+FL SQ++S   A   D +   +ES+A TD+   SSP      S+    K 
Sbjct  196  AVLQNPALQDFLESQRSSEKCASFPDSDQERDESVANTDYFSESSPLKAVPESKAEESKS  255

Query  817  GNGFTDFLQNIKVAVL----DMMNCLSDFFQNLFGGHKVFADADGSAKTSVVDRAWGASF  984
            GN FT FLQN+   V     DMM+ LSDFF NLFGG+K F DADG+AK   V++  GASF
Sbjct  256  GNTFTSFLQNVTQTVTQTVVDMMDSLSDFFNNLFGGNKFFVDADGTAKFGAVEKTLGASF  315

Query  985  MGLA  996
            M LA
Sbjct  316  MALA  319



>ref|XP_010324338.1| PREDICTED: uncharacterized protein LOC101263228 isoform X1 [Solanum 
lycopersicum]
Length=334

 Score =   225 bits (573),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 152/306 (50%), Positives = 195/306 (64%), Gaps = 13/306 (4%)
 Frame = +1

Query  106  NSGFRGIASEHPVSSAARKvvrpvsvsgissssDHLKssavsasqstavDGAPVQWPCRE  285
            NSGFR + +EHP+ +AAR V RPVS+SG+SS+S+ +KS  V+AS   ++D + V     +
Sbjct  20   NSGFRSVTAEHPLYAAARNVARPVSISGLSSTSEDVKSGMVTASHGGSLDVSHVPKMVSD  79

Query  286  LDGWEFAGGDEEEMVAAGEPLPRLIFGGAPSLQEAKEATFDLKDALHKVYNMSTPPSDCG  465
             D WE AGG+EE MV  GEPLPRL+FGGAPSLQEA EAT DLKDAL  VY   +  ++  
Sbjct  80   FDDWEMAGGEEEMMVNPGEPLPRLVFGGAPSLQEATEATSDLKDAL--VYLSGS--ANGN  135

Query  466  STNGAAQVNNDHsppsnsssenAIAHGAPKHAIRAFKFLYENAAAQTVVASIASDPNVWN  645
              +  +  ++     +   SE  +    PKHA++A++ L E  AAQ VVASIA DPNVWN
Sbjct  136  GGSCISGSSSSPVSKACVVSETIVTKSVPKHAVQAYRVLSEIPAAQNVVASIACDPNVWN  195

Query  646  AVLANPELQEFLVSQKTS-----AYVLDGEYSVEESIAETDFLRYSSPRNDDLTSEDGSP  810
            AVL NP LQ+FL SQ++S     A   D +   +ES+A TD+   SSP      S+    
Sbjct  196  AVLQNPALQDFLESQRSSEKFAGASFPDSDQERDESVANTDYFSESSPLKAVPESKAEES  255

Query  811  KPGNGFTDFLQNIKVAVL----DMMNCLSDFFQNLFGGHKVFADADGSAKTSVVDRAWGA  978
            K GN FT FLQN+   V     DMM+ LSDFF NLFGG+K F DADG+AK   V++  GA
Sbjct  256  KSGNTFTSFLQNVTQTVTQTVVDMMDSLSDFFNNLFGGNKFFVDADGTAKFGAVEKTLGA  315

Query  979  SFMGLA  996
            SFM LA
Sbjct  316  SFMALA  321



>ref|XP_011097947.1| PREDICTED: uncharacterized protein LOC105176746 isoform X1 [Sesamum 
indicum]
Length=317

 Score =   221 bits (562),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 144/324 (44%), Positives = 191/324 (59%), Gaps = 36/324 (11%)
 Frame = +1

Query  94    ITVANSGFRGIASEH-PVSSAARKvvrpvsvsgissssDHLKssavsasqstavDGAPVQ  270
             IT A+ G RGIA+EH  VSSAAR+       +        + S             A VQ
Sbjct  15    ITAASGGLRGIAAEHYSVSSAARRAASIRPPAATVEDVKLVTSQVE----------AGVQ  64

Query  271   WPCRELDGWEFAGGDEEEMVAAGEPLPRLIFGGAPSLQEAKEATFDLKDALHKVYNMSTP  450
              PC E+D W FAGG+EE +V   +P+PR++FGG P+LQEA+EAT +L  AL K Y +S+P
Sbjct  65    RPCLEMDDWVFAGGEEEAVVGVADPMPRVVFGGVPTLQEAREATSELTAALDKTY-LSSP  123

Query  451   PS-DC-----GSTNGAAQVNNDHsppsnsssenAI--AHGAPKHAIRAFKFLYENAAAQT  606
              S  C     G    ++ +++  +  + +     I  A   P  AI AF+FL E++AAQ 
Sbjct  124   NSVGCEGSFVGDHGSSSPLSDKQAAETKACVTTGIAVAPAVPAPAIMAFRFLSESSAAQN  183

Query  607   VVASIASDPNVWNAVLANPELQEFLVSQKTSAYVLDGEYSVEESIAETDFLRYSSPRNDD  786
             VVASIA DPNVWNAVL N ELQEFL SQKTS   ++      E +A+TD L  +   ND 
Sbjct  184   VVASIACDPNVWNAVLQNQELQEFLQSQKTSCSSMNLNL---ELVADTDNLDQAKTFND-  239

Query  787   LTSEDGSPKPGNGFTDFLQNIKVAVLDMMNCLSDFFQNLFGG---HKVFADADGSAKTSV  957
                   S K  +G+ DFLQ I+  ++ MM+ LSDFFQN FGG   ++V  D+DG+A+  V
Sbjct  240   ------SSKHASGYKDFLQKIRCTIVGMMSGLSDFFQNFFGGKGTNRVVVDSDGTAR--V  291

Query  958   VDRAW-GASFMGLAIMAIMVVVLK  1026
                 W  ASFMGLA+MAI+V+VLK
Sbjct  292   TGDTWMEASFMGLAVMAILVIVLK  315



>ref|XP_011097948.1| PREDICTED: uncharacterized protein LOC105176746 isoform X2 [Sesamum 
indicum]
Length=304

 Score =   211 bits (536),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 141/324 (44%), Positives = 184/324 (57%), Gaps = 49/324 (15%)
 Frame = +1

Query  94    ITVANSGFRGIASEH-PVSSAARKvvrpvsvsgissssDHLKssavsasqstavDGAPVQ  270
             IT A+ G RGIA+EH  VSSAAR+       +        + S             A VQ
Sbjct  15    ITAASGGLRGIAAEHYSVSSAARRAASIRPPAATVEDVKLVTSQVE----------AGVQ  64

Query  271   WPCRELDGWEFAGGDEEEMVAAGEPLPRLIFGGAPSLQEAKEATFDLKDALHKVYNMSTP  450
              PC E+D W FAGG+EE +V   +P+PR++FGG P+LQEA+EAT +L  AL K Y +S+P
Sbjct  65    RPCLEMDDWVFAGGEEEAVVGVADPMPRVVFGGVPTLQEAREATSELTAALDKTY-LSSP  123

Query  451   PS-DC-----GSTNGAAQVNNDHsppsnsssenAI--AHGAPKHAIRAFKFLYENAAAQT  606
              S  C     G    ++ +++  +  + +     I  A   P  AI AF+FL E++AAQ 
Sbjct  124   NSVGCEGSFVGDHGSSSPLSDKQAAETKACVTTGIAVAPAVPAPAIMAFRFLSESSAAQN  183

Query  607   VVASIASDPNVWNAVLANPELQEFLVSQKTSAYVLDGEYSVEESIAETDFLRYSSPRNDD  786
             VVASIA DPNVWNAVL N ELQEFL SQKT                 TD L  +   ND 
Sbjct  184   VVASIACDPNVWNAVLQNQELQEFLQSQKT----------------YTDNLDQAKTFND-  226

Query  787   LTSEDGSPKPGNGFTDFLQNIKVAVLDMMNCLSDFFQNLFGG---HKVFADADGSAKTSV  957
                   S K  +G+ DFLQ I+  ++ MM+ LSDFFQN FGG   ++V  D+DG+A+  V
Sbjct  227   ------SSKHASGYKDFLQKIRCTIVGMMSGLSDFFQNFFGGKGTNRVVVDSDGTAR--V  278

Query  958   VDRAW-GASFMGLAIMAIMVVVLK  1026
                 W  ASFMGLA+MAI+V+VLK
Sbjct  279   TGDTWMEASFMGLAVMAILVIVLK  302



>emb|CDP05826.1| unnamed protein product [Coffea canephora]
Length=326

 Score =   211 bits (537),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 143/315 (45%), Positives = 193/315 (61%), Gaps = 15/315 (5%)
 Frame = +1

Query  100   VANSGFRGIASEHPVSSAARKvvrpvsvsgissssDHLKssavsasqstavDGAPVQWPC  279
             V N G RGI  +HP S+A RKV+RPV+     S+ +++K +AV+       D +PVQ PC
Sbjct  18    VLNGGLRGIVPDHPASTAMRKVLRPVTGLASPSAPENVKEAAVAI------DVSPVQKPC  71

Query  280   RELDGWEFAGGDEEEMVAAGEPLPRLIFGGAPSLQEAKEATFDLKDALHKVYNMSTPPSD  459
              E D WE AGG+E+    +G   PRL+FGGAPS+ EAKEAT++LK+AL KVY +S P + 
Sbjct  72    WEFDDWELAGGEEDLFGGSGVSTPRLVFGGAPSIAEAKEATYELKEALEKVY-LSAPSTP  130

Query  460   CGSTNGAAQVNNDHsppsnsssenAIAHGAPKHAIRAFKFLYENAAAQTVVASIASDPNV  639
                 +G ++  ++        +   I   APKHAI+AF FL E+ A Q+VVASIASDPNV
Sbjct  131   KTGLSGLSR--SEVPETKACVTSETILAPAPKHAIQAFTFLNESPAVQSVVASIASDPNV  188

Query  640   WNAVLANPELQEFLVSQKTSAYVLDGEYSVEESIAETDF---LRYSSPRNDDLTSEDGSP  810
             WNAVL NP LQ+++ SQK  A     +   + S A++D        S  +D   SE G  
Sbjct  189   WNAVLLNPTLQDYIQSQKMGAPSSTTDQYEKGSTADSDIPSPRSPRSVSSDRAESEYGES  248

Query  811   KPGNGFTDFLQNIKVAVLDMMNCLSDFFQNLFGGH---KVFADADGSAKTSVVDRAWGAS  981
                  F +  Q +K+ V+DMMN LSD+FQ LFGG+   K  AD +G+  +  VD+A G S
Sbjct  249   NSTGRFMELWQELKLTVVDMMNSLSDYFQALFGGYSNNKGAADTNGNVFSGFVDKALGPS  308

Query  982   FMGLAIMAIMVVVLK  1026
              MGLA+M I+VVVLK
Sbjct  309   LMGLAVMVIVVVVLK  323



>gb|AFX67022.1| hypothetical protein [Solanum tuberosum]
Length=324

 Score =   206 bits (525),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 152/293 (52%), Positives = 182/293 (62%), Gaps = 21/293 (7%)
 Frame = +1

Query  106  NSGFRGIASEHPVSSAARKvvrpvsvsgissssDHLKssavsasqstavDGAPVQWPCRE  285
            NSGFR +  EHPV +AAR V RPVS+SGISS+S+ +KS+ V+AS   + D + V     +
Sbjct  20   NSGFRSVTVEHPVYAAARNVPRPVSISGISSTSEDVKSAMVTASHGGSSDVSYVPKMVSD  79

Query  286  LDGWEFAGGDEEEMVAAGEPLPRLIFGGAPSLQEAKEATFDLKDALHKVYNMSTPPSDCG  465
             D WE AGG+EE MV  GEPLPRL+FGGAPSLQEA EAT DLKDAL  VY MS      G
Sbjct  80   FDDWEMAGGEEEMMVNPGEPLPRLVFGGAPSLQEATEATSDLKDAL--VY-MS------G  130

Query  466  STNGAAQVNNDHsppsnsssenAIAH-----GAPKHAIRAFKFLYENAAAQTVVASIASD  630
            S NG        S  S  S    ++        PKHA++A++ L E  AAQ VVASIA D
Sbjct  131  SANGYGGSCISGSCSSPVSKACVVSETIVTKSVPKHAVQAYRILSEIPAAQNVVASIACD  190

Query  631  PNVWNAVLANPELQEFLVSQKTS---AYVLDGEYSVEESIAETDFLRYSSPRNDDLTSED  801
            PNVWNAVL NP LQ+FL SQ+ S   A   D +   +ES+A+T     SSP      S+ 
Sbjct  191  PNVWNAVLQNPALQDFLESQRYSEKCASFPDSDQEKDESVADTASFSESSPWKPFSESKA  250

Query  802  GSPKPGNGFTDFLQN----IKVAVLDMMNCLSDFFQNLFGGHKVFADADGSAK  948
               K GN FT FLQN    +   V+ MM+ LSDFF NLFGG+K F DADGSAK
Sbjct  251  EESKSGNSFTSFLQNVTQTVTQTVVSMMDSLSDFFNNLFGGNKFFVDADGSAK  303



>ref|XP_010267849.1| PREDICTED: uncharacterized protein LOC104604963 [Nelumbo nucifera]
Length=339

 Score =   198 bits (503),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 114/260 (44%), Positives = 160/260 (62%), Gaps = 7/260 (3%)
 Frame = +1

Query  265   VQWPCRELDGWEFAGGDEEEMVAAGEPLPRLIFGGAPSLQEAKEATFDLKDALHKVYNMS  444
             VQ P  E+D WEFAG DEE ++ +  P+PR++FGG P+L+EAKEAT DLKDAL KVY  S
Sbjct  79    VQRPSWEIDDWEFAGDDEELLLDSMNPMPRIVFGGVPTLEEAKEATSDLKDALEKVYFSS  138

Query  445   TPPSDCGSTNGAAQVNNDH-----sppsnsssenAIAHGAPKHAIRAFKFLYENAAAQTV  609
             +  S C       Q +  +     +    +S        AP HA++AFK L E+A AQ+V
Sbjct  139   SNASGCIDPVAVVQESTKNSEFPETKVCVTSETTVSRPSAPIHALQAFKLLKESAEAQSV  198

Query  610   VASIASDPNVWNAVLANPELQEFLVSQKTSAYVLDGEYSVEESIAETDFL-RYSSPRNDD  786
             VAS+ SD NVW+AV+ N E+ EFL SQ TSA  L  + +V +S A+  F    SS    D
Sbjct  199   VASLVSDKNVWDAVMKNEEVVEFLQSQHTSADRLGMDVNVNKSFADGKFNGEESSESIYD  258

Query  787   LTSEDGSPKPGNGFTDFLQNIKVAVLDMMNCLSDFFQNLFGGHKVFADADGSAKTSVVDR  966
                ED     G+GF  ++ N+K+ V+ M++ +S+FF ++ GG  +  D +G+  T+ V+R
Sbjct  259   EVDEDHRENRGDGFMGWINNVKLTVMKMVSSVSEFFHHILGGD-ISVDGNGNGTTATVER  317

Query  967   AWGASFMGLAIMAIMVVVLK  1026
                +SFM LA++AIMVVVLK
Sbjct  318   TITSSFMALAVLAIMVVVLK  337



>gb|EYU33580.1| hypothetical protein MIMGU_mgv1a010110mg [Erythranthe guttata]
Length=322

 Score =   196 bits (497),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 135/317 (43%), Positives = 187/317 (59%), Gaps = 22/317 (7%)
 Frame = +1

Query  103   ANSGFRGIASEH-PVSSAARKvvrpvsvsgissssDHLKssavsasqstavDGAPVQWPC  279
             A  G R I++EH P S +AR     VS    +S+ + +K  A S        G  +Q PC
Sbjct  17    AAGGLRSISAEHFPASVSAR---WAVSARTAASTPEEVKLVASSN------SGVGMQRPC  67

Query  280   RELDGWEFAGGDEEEMVAAG-EPLPRLIFGGAPSLQEAKEATFDLKDALHKVYNMSTPPS  456
              E+D W FAG +EE+M AA  +P+PRL+F G P++QEAKEAT +L  AL K Y   +PPS
Sbjct  68    SEMDDWVFAGVEEEQMAAAAADPIPRLVFAGVPTIQEAKEATSELSVALEKAY--LSPPS  125

Query  457   DCG---STNGAAQVNNDHsppsnsssenAIAHGAPKHAIRAFKFLYENAAAQTVVASIAS  627
               G   S  G    +   S      +  ++++  P  AI AF+ L+E+  A+ VVASIA 
Sbjct  126   SIGYEGSIIGDGDSSLSVSDKQIIENSGSVSNAVPATAIMAFRLLHESPMAKNVVASIAC  185

Query  628   DPNVWNAVLANPELQEFLVSQKTSAYVLDGEYSVEESIAETDFLRYSSPRN-DDLTSEDG  804
             DPNVWNAV  N ELQ FL SQ  S  V   E S  E   +++ + +S+P++ D  +SE+G
Sbjct  186   DPNVWNAVRQNQELQGFLQSQGAS-LVFSDENSYTELAEDSEPIDHSTPKSVDSSSSENG  244

Query  805   SPKPGNGFTDFLQNIKVAVLDMMNCLSDFFQNLF---GGHKVFADADGSAKTSVVDRAWG  975
                P N FT+  Q IK +V+DMM+ LSD+FQ+ F   GG+ V  ++DG+A  S  +    
Sbjct  245   EAGPANVFTNVFQKIKNSVVDMMSSLSDYFQSFFGGKGGNGVTLNSDGTANLS-AETVMQ  303

Query  976   ASFMGLAIMAIMVVVLK  1026
              SFMGLAIMAI+V++LK
Sbjct  304   GSFMGLAIMAILVILLK  320



>ref|XP_011048250.1| PREDICTED: uncharacterized protein LOC105142358 isoform X2 [Populus 
euphratica]
Length=325

 Score =   173 bits (438),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 109/270 (40%), Positives = 159/270 (59%), Gaps = 20/270 (7%)
 Frame = +1

Query  259   APVQWPCRELDGWEFAGGDEEEMVA-AGEPLPRLIFGGAP-SLQEAKEATFDLKDALHKV  432
             A VQ P  ELD WEFAGG EEE V  + EP+ R++FGGAP SLQEA+ ATF+LKDAL KV
Sbjct  60    ATVQRPSWELDEWEFAGGVEEETVVHSAEPVARVVFGGAPPSLQEAEAATFELKDALQKV  119

Query  433   YNMSTPPSDCGSTNGAAQVN-------NDHsppsnsssenAIAHGAPKHAIRAFKFLYEN  591
             Y +S+P S   S+ G +Q++       +D     +    +      PK+A++AF  L E+
Sbjct  120   Y-LSSPNSGTASSVGGSQLSGLPLLRKSDSLETKDCIPCDPTGAPVPKYAMQAFSLLNES  178

Query  592   AAAQTVVASIASDPNVWNAVLANPELQEFLVSQKTSAYVLDGEYSVEESIAETDFLRYSS  771
                QTVVA++ASDPNVWNAV  N  LQ+FL SQ T+    + +  V ++ ++      SS
Sbjct  179   PKIQTVVAAVASDPNVWNAVWENEALQDFLQSQNTNTQSSEAKEFVRDTYSQDAV---SS  235

Query  772   PRNDDLTSEDGSPKPGNG-FTDFLQNIKVAVLDMMNCLSDFFQNLF----GGHKVFADAD  936
              +  +L+ ++   +       D + N+K+ V+DM+  +S +FQ +F      H   A+  
Sbjct  236   KKFTELSDDESEAQSSQTELVDIINNVKLTVVDMVTNVSAYFQKIFSFSSAEHTPAANER  295

Query  937   GSAKTSVVDRAWGASFMGLAIMAIMVVVLK  1026
               A T  +++  GAS MGLA++ IMVVVL+
Sbjct  296   AGAAT--IEKTIGASLMGLAVIVIMVVVLR  323



>ref|XP_011048249.1| PREDICTED: uncharacterized protein LOC105142358 isoform X1 [Populus 
euphratica]
Length=326

 Score =   172 bits (437),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 112/277 (40%), Positives = 159/277 (57%), Gaps = 33/277 (12%)
 Frame = +1

Query  259   APVQWPCRELDGWEFAGGDEEEMVA-AGEPLPRLIFGGAP-SLQEAKEATFDLKDALHKV  432
             A VQ P  ELD WEFAGG EEE V  + EP+ R++FGGAP SLQEA+ ATF+LKDAL KV
Sbjct  60    ATVQRPSWELDEWEFAGGVEEETVVHSAEPVARVVFGGAPPSLQEAEAATFELKDALQKV  119

Query  433   YNMSTPPSDCGSTNGAAQVN-------NDHsppsnsssenAIAHGAPKHAIRAFKFLYEN  591
             Y +S+P S   S+ G +Q++       +D     +    +      PK+A++AF  L E+
Sbjct  120   Y-LSSPNSGTASSVGGSQLSGLPLLRKSDSLETKDCIPCDPTGAPVPKYAMQAFSLLNES  178

Query  592   AAAQTVVASIASDPNVWNAVLANPELQEFLVSQKTSAYVLDGE--------YSVEESIAE  747
                QTVVA++ASDPNVWNAV  N  LQ+FL SQ T+ Y    E        YS +++++ 
Sbjct  179   PKIQTVVAAVASDPNVWNAVWENEALQDFLQSQNTT-YTQSSEAKEFVRDTYS-QDAVSS  236

Query  748   TDFLRYSSPRNDDLTSEDGSPKPGNGFTDFLQNIKVAVLDMMNCLSDFFQNLF----GGH  915
               F   S   ++  +S+           D + N+K+ V+DM+  +S +FQ +F      H
Sbjct  237   KKFTELSDDESEAQSSQ-------TELVDIINNVKLTVVDMVTNVSAYFQKIFSFSSAEH  289

Query  916   KVFADADGSAKTSVVDRAWGASFMGLAIMAIMVVVLK  1026
                A+    A T  +++  GAS MGLA++ IMVVVL+
Sbjct  290   TPAANERAGAAT--IEKTIGASLMGLAVIVIMVVVLR  324



>ref|XP_002316956.1| hypothetical protein POPTR_0011s13360g [Populus trichocarpa]
 gb|EEE97568.1| hypothetical protein POPTR_0011s13360g [Populus trichocarpa]
Length=326

 Score =   169 bits (429),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 118/273 (43%), Positives = 158/273 (58%), Gaps = 25/273 (9%)
 Frame = +1

Query  259   APVQWPCRELDGWEFAGGDEEEMVA-AGEPLPRLIF-GGAPSLQEAKEATFDLKDALHKV  432
             A +Q P  E+D WE AGG EEEMV  + EP+ R++F G  PSLQEAK AT +LKDAL KV
Sbjct  60    AGMQRPAWEVDEWELAGGVEEEMVVDSAEPVARVVFWGSPPSLQEAKAATCELKDALQKV  119

Query  433   YNMSTPPSDCGSTNGAAQV------NNDHsppsnsssenAIAHGAPKHAIRAFKFLYENA  594
             Y +S+P    GS+ G +Q+      N+D    +   S +      PK+A++AF  L E+ 
Sbjct  120   Y-LSSPNLGTGSSLGGSQLSGHPLTNSDFLETNGCISCDPNRAPVPKYAMQAFSLLNESP  178

Query  595   AAQTVVASIASDPNVWNAVLANPELQEFLVSQKTSA-YVLDGEYSVEESIAETDF--LRY  765
               QTVVA++ASDPNVWNAV  N  LQE L SQ T+  YV D      ES+ +TD      
Sbjct  179   KIQTVVAALASDPNVWNAVWENEALQELLQSQNTNKEYVAD-----NESVGDTDSQDAAV  233

Query  766   SSPRNDDLTSEDGSPKPGNGFT---DFLQNIKVAVLDMMNCLSDFFQNLF---GGHKVFA  927
             SS +  +L+  D   + GN  T   D + NIK+ V+DM+  +S +FQ +F          
Sbjct  234   SSKKLTELS--DDESETGNSQTRLMDVINNIKLTVVDMVTNVSAYFQKIFSFSSAEHTPD  291

Query  928   DADGSAKTSVVDRAWGASFMGLAIMAIMVVVLK  1026
              AD +A  S  ++  GAS M LA+M IMVVVL+
Sbjct  292   AADENAGLSTTEKTLGASLMALAVMVIMVVVLR  324



>ref|XP_012070703.1| PREDICTED: uncharacterized protein LOC105632857 [Jatropha curcas]
 gb|KDP39009.1| hypothetical protein JCGZ_00766 [Jatropha curcas]
Length=316

 Score =   167 bits (423),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 116/267 (43%), Positives = 150/267 (56%), Gaps = 30/267 (11%)
 Frame = +1

Query  265   VQWPCRELDGWEFAGGDEEEMVAAGEPLPRLIFGGAPSLQEAKEATFDLKDALHKVYNMS  444
             VQ P  EL+ WE AGG+EE ++ + EP+PR++FG  PSL EAK AT DLKDAL KVY +S
Sbjct  65    VQKPAWELEDWELAGGEEELLIESSEPMPRVVFGAPPSLNEAKAATADLKDALEKVY-LS  123

Query  445   TPP-------SDCGSTNGAAQV-NNDHsppsnsssenAIAHGAPKHAIRAFKFLYENAAA  600
             +P              +G + V N+D        +++  A+ APK A+ AFK L E+  A
Sbjct  124   SPAHSGAGGSFGSSRLSGLSLVTNSDDLDTKRCIADDLRANSAPKCAVTAFKLLNESPEA  183

Query  601   QTVVASIASDPNVWNAVLANPELQEFLVSQKTSAYVLDGEYSVEESIAETDFLRYSSPRN  780
             QTVVASIASDPNVW+AV  N  LQEFL SQKT+A + D                  SPR 
Sbjct  184   QTVVASIASDPNVWDAVWKNVALQEFLQSQKTNAELQDP----------------GSPRA  227

Query  781   DDLTSEDGS--PKPGNGFTDFLQNIKVAVLDMMNCLSDFFQNLFG---GHKVFADADGSA  945
                 S+D S   K  N   D  +NIK  V +M+N +S   Q +FG        + AD  +
Sbjct  228   FTELSDDSSETEKSENKPIDIFENIKQTVAEMVNSVSSMIQQIFGFATAENTSSAADEDS  287

Query  946   KTSVVDRAWGASFMGLAIMAIMVVVLK  1026
             + +  D+  GASFM LA+M I VVVLK
Sbjct  288   QPTFFDKTLGASFMALAVMVIAVVVLK  314



>gb|ABK93511.1| unknown [Populus trichocarpa]
Length=325

 Score =   167 bits (424),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 115/272 (42%), Positives = 160/272 (59%), Gaps = 22/272 (8%)
 Frame = +1

Query  256   GAPVQWPCRELDGWEFAGGDEEEMVA-AGEPLPRLIFGGAP-SLQEAKEATFDLKDALHK  429
              A VQ P  ELD WEFAGG EEE V  + EP+ R++FGGAP SLQEA+ ATF+L DA  K
Sbjct  59    AATVQRPSWELDEWEFAGGLEEETVVHSAEPVARVVFGGAPPSLQEAEAATFELNDAFQK  118

Query  430   VYNMSTPPSDCGSTNGAAQVN-------NDHsppsnsssenAIAHGAPKHAIRAFKFLYE  588
             VY +S+P S  GS+ G +Q++       ++     +    +      PK+A++AF  L E
Sbjct  119   VY-LSSPNSGTGSSVGGSQLSGLPLLRKSESLETKDCIPCDPTGAPVPKYAMQAFSLLNE  177

Query  589   NAAAQTVVASIASDPNVWNAVLANPELQEFLVSQKTSAYVLDGEYSVEESIAETDFLRYS  768
             +   QTVVA++ASDPNVWNAV  N  LQ+FL SQ T  Y    E   +E + +TDF    
Sbjct  178   SPKIQTVVAAVASDPNVWNAVWENEALQDFLQSQNT--YTQSSE--AKEFVRDTDFQDAV  233

Query  769   SPRN----DDLTSEDGSPKPGNGFTDFLQNIKVAVLDMMNCLSDFFQNL--FGGHKVFAD  930
             S +N     D  SE GS +      D + N+K+ V+D++  LS +FQ +  F   +    
Sbjct  234   SSKNLAELSDDESEAGSSQ--TELVDIINNVKLTVVDLVTNLSAYFQKIFSFSSAEHTPA  291

Query  931   ADGSAKTSVVDRAWGASFMGLAIMAIMVVVLK  1026
             A+ SA  + +++  GAS MGLA++ IMVVVL+
Sbjct  292   ANESAGAATIEKTIGASLMGLAVIVIMVVVLR  323



>gb|KHG00183.1| hypothetical protein F383_20411 [Gossypium arboreum]
Length=316

 Score =   166 bits (419),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 102/251 (41%), Positives = 156/251 (62%), Gaps = 16/251 (6%)
 Frame = +1

Query  286   LDGWEFAGGDEEEMVAA----GEPLPRLIFGGAPSLQEAKEATFDLKDALHKVYNMSTPP  453
             +D WEFAGG EEE+  A    GEP+PR++FGGAP+L+EAKEA  DLKDAL K Y  S   
Sbjct  76    VDDWEFAGGIEEEVPTAISGGGEPMPRVLFGGAPTLEEAKEAASDLKDALDKAYLSSLNS  135

Query  454   SDCGSTNGAAQVNNDHsppsnsssenAIAHGAPKHAIRAFKFLYENAAAQTVVASIASDP  633
             +D   ++ A+ ++ +     +  + +A A   PK A++AFK L E+ A Q++VASIA+DP
Sbjct  136   TDDTRSSRASLLSEE---TKDCVAYDAKATLLPKPAVQAFKLLNESPAVQSMVASIAADP  192

Query  634   NVWNAVLANPELQEFLVSQKTSAYVLDGEYSVEESIAETDFLRYSSPRNDDLTSEDGSPK  813
             NVWNAVL NP   +F+ S KT+ Y+ +G  S +    E+  ++      ++    +   +
Sbjct  193   NVWNAVLHNPAYMDFIGSHKTN-YIFEGNRSRQG--CESTLVKI-----EEYFEANEGKE  244

Query  814   PGNGFTDFLQNIKVAVLDMMNCLSDFFQNLFGGHKVFADADGSAKTSVVDRAWGASFMGL  993
              GN F++FL+N+K +V+++ N  +DF Q LF       + + +   + +++  GAS MGL
Sbjct  245   VGNPFSEFLENLKSSVVEVANKATDFLQCLFTIPTAGMEKE-NGGLNYLEKTIGASLMGL  303

Query  994   AIMAIMVVVLK  1026
             A+M IMVV+LK
Sbjct  304   AVMVIMVVLLK  314



>ref|XP_006370583.1| hypothetical protein POPTR_0001s44020g [Populus trichocarpa]
 gb|ERP67152.1| hypothetical protein POPTR_0001s44020g [Populus trichocarpa]
Length=325

 Score =   164 bits (416),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 114/276 (41%), Positives = 161/276 (58%), Gaps = 30/276 (11%)
 Frame = +1

Query  256   GAPVQWPCRELDGWEFAGGDEEEMVA-AGEPLPRLIFGGAP-SLQEAKEATFDLKDALHK  429
              A VQ P  ELD WEFAGG EEE V  + EP+ R++FGGAP SLQEA+ ATF+L DA  K
Sbjct  59    AATVQRPSWELDEWEFAGGLEEETVVHSAEPVARVVFGGAPPSLQEAEAATFELNDAFQK  118

Query  430   VYNMSTPPSDCGSTNGAAQVN-------NDHsppsnsssenAIAHGAPKHAIRAFKFLYE  588
             VY +S+P S  GS+ G +Q++       ++     +    +      PK+A++AF  L E
Sbjct  119   VY-LSSPNSGTGSSVGGSQLSGLPLLRKSESLETKDCIPCDPTGAPVPKYAMQAFSLLNE  177

Query  589   NAAAQTVVASIASDPNVWNAVLANPELQEFLVSQKTSAYVLDGEYSVEESIAETDFLRYS  768
             +   QTVVA++ASDPNVWNAV  N  LQ+FL SQ T  Y    E   +E + +TDF    
Sbjct  178   SPKIQTVVAAVASDPNVWNAVWENEALQDFLQSQNT--YTQSSE--AKEFVRDTDFQDAV  233

Query  769   SPRN----DDLTSEDGSPKPGNGFTDFLQNIKVAVLDMMNCLSDFFQNLFGGHKVFADAD  936
             S +N     D  SE GS +      D + N+K+ V+D++  +S +FQ +F     F+ A+
Sbjct  234   SSKNLAELSDDESEAGSSQ--TELVDIINNVKLTVVDLVTNVSAYFQKIFS----FSSAE  287

Query  937   GS------AKTSVVDRAWGASFMGLAIMAIMVVVLK  1026
              +      A  + +++  GAS MGLA++ IMVVVL+
Sbjct  288   HTPAANEIAGAATIEKTIGASLMGLAVIVIMVVVLR  323



>ref|XP_008789186.1| PREDICTED: uncharacterized protein LOC103706755 [Phoenix dactylifera]
Length=316

 Score =   162 bits (409),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 105/273 (38%), Positives = 146/273 (53%), Gaps = 38/273 (14%)
 Frame = +1

Query  253   DGAPVQ------WPCRELDGWEFAGGDEEEMVAAGEPLPRLIFGGAPSLQEAKEATFDLK  414
             D  PVQ      W   E+D WEFAGG+EEE+ A+  P PRL+FG  P+L+EAKEAT DLK
Sbjct  65    DALPVQEIQQASW---EIDDWEFAGGEEEELHASLHPAPRLVFGPVPTLEEAKEATADLK  121

Query  415   DALHKVYNMSTPPSDCGSTNGAAQVNNDHsppsnsssenAIAHGAPKHAIRAFKFLYENA  594
             DA+ + Y   +         G A   N            A     PKH ++AF  L+ + 
Sbjct  122   DAVERAYFSPSIEVSLEGVQGCASCEN-----------VAPLQSMPKHVVQAFSLLHGSP  170

Query  595   AAQTVVASIASDPNVWNAVLANPELQEFLVSQKTSAYVLDGEYSVEESIAET----DFLR  762
              AQ VVAS+A+D NVW+AV+ N ++ EF  +Q++     +   + EES+AE     +FL 
Sbjct  171   EAQNVVASLAADKNVWDAVMKNEKVMEFYRTQQSVVLQPETNVAFEESVAENVCTKEFLE  230

Query  763   Y-SSPRNDDLTSEDGSPKPGNGFTDFLQNIKVAVLDMMNCLSDFFQNLFGGHKVFADADG  939
                +P  D  TS          F + + NIK  V +M+N LS+F Q+LFG       +  
Sbjct  231   SPKTPAEDSQTSV---------FAEIVGNIKRKVTEMVNHLSNFLQDLFGTSTGAQSSTS  281

Query  940   SAKTSV----VDRAWGASFMGLAIMAIMVVVLK  1026
             + +T      VD A GASF+ LAI AI+VV++K
Sbjct  282   TKRTGTTGPNVDGAIGASFIALAIAAILVVLVK  314



>ref|XP_010092273.1| hypothetical protein L484_021134 [Morus notabilis]
 gb|EXB50907.1| hypothetical protein L484_021134 [Morus notabilis]
Length=325

 Score =   161 bits (408),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 104/256 (41%), Positives = 149/256 (58%), Gaps = 19/256 (7%)
 Frame = +1

Query  253  DGAPVQWPCRELDGWEFAGGDEEEMVAAGEPLPRLIFGGAPSLQEAKEATFDLKDALHKV  432
            D  P+Q P  E+DGWE     ++ ++  GEPLPR++F GAPS  EAKEAT +LKDAL KV
Sbjct  65   DVPPIQMPAWEMDGWE-----DDLVMTDGEPLPRVVFAGAPSFDEAKEATIELKDALDKV  119

Query  433  YNMSTPPSDCGSTNGAAQVN-----NDHsppsnsssenAIAHG--APKHAIRAFKFLYEN  591
            Y      S+ G    A Q++     +D +  + +        G   P HA++AFKFL  +
Sbjct  120  YLSPHESSESGEVVAANQLSGLSLCSDPNSETKTCLIVDTGRGRPVPNHALKAFKFLSRS  179

Query  592  AAAQTVVASIASDPNVWNAVLANPELQEFLVSQKT--SAYVLDGEYSVEESIAETDFLRY  765
            + AQTVVAS+A+D NVWNAV+ NP LQ+F+ + K   S   L G YS + S+A+ +F   
Sbjct  180  SEAQTVVASLATDLNVWNAVMQNPVLQDFMQANKNSWSPNSLYG-YSPKNSVADPEFQEQ  238

Query  766  SSPRNDDLTSED-GSPKPGNGFTDFLQNIKVAVLDMMNCLSDFFQNLFGGHKVFADADGS  942
              P N + +SE   +    N F   L+N KV V+++++ LS  FQN+FG     +D + +
Sbjct  239  VFPENVEKSSEGMETGDSENWFMSMLENFKVTVVELVSNLSSSFQNIFG---FSSDVNEN  295

Query  943  AKTSVVDRAWGASFMG  990
             K++  D   GASFMG
Sbjct  296  IKSTATDITLGASFMG  311



>ref|XP_006452123.1| hypothetical protein CICLE_v10008955mg [Citrus clementina]
 ref|XP_006475259.1| PREDICTED: uncharacterized protein LOC102621279 isoform X1 [Citrus 
sinensis]
 gb|ESR65363.1| hypothetical protein CICLE_v10008955mg [Citrus clementina]
 gb|KDO74399.1| hypothetical protein CISIN_1g021190mg [Citrus sinensis]
Length=316

 Score =   160 bits (405),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 107/259 (41%), Positives = 154/259 (59%), Gaps = 25/259 (10%)
 Frame = +1

Query  286   LDGWEFAGGDEEEMVAAGEPLPRLIFGGAPSLQEAKEATFDLKDALHKVY--NMSTPPSD  459
             +D WEFAGG ++      EP+PR++FGGAPSL+E KEAT +LKDAL KVY  + ++  S+
Sbjct  69    VDDWEFAGGVDD---LPAEPMPRVVFGGAPSLEETKEATAELKDALDKVYLSSSNSNTSE  125

Query  460   CGSTNGAAQV-------NNDHsppsnsssenAIAHGAPKHAIRAFKFLYENAAAQTVVAS  618
              G      +V       N++H+   +  + +  +   PK AI+AFK L E+ AAQ+VVAS
Sbjct  126   HGDPFVVGEVSSMPLLANSEHTETKSCITYDLKSASVPKPAIQAFKLLSESPAAQSVVAS  185

Query  619   IASDPNVWNAVLANPELQEFLVSQKTSAYVLDGEYSVEESIAETDFLRYSSPRNDDLTSE  798
             IA DP VWNAV+ N  L EF+ SQKT+  + D     +ES+   +    SS   D   +E
Sbjct  186   IACDPAVWNAVVKNDALVEFVQSQKTNDMLQD-----QESLKIFEAASDSSQFGD---TE  237

Query  799   DGSPKPGNGFTDFLQNIKVAVLDMMNCLSDFFQNLFG---GHKVFADADGSAKTSVVDRA  969
             + S   G+   D L+ IK  V+DM+N ++ F QN+FG     K  ++AD    T  +D+ 
Sbjct  238   NQSADSGSFPMDVLETIKNKVVDMVNNVTGFLQNIFGFAAADKTSSEADAGGFT--IDKT  295

Query  970   WGASFMGLAIMAIMVVVLK  1026
              G +F GLA+M I+VV+LK
Sbjct  296   LGTAFTGLAMMVIVVVLLK  314



>gb|KHG12371.1| HEAT repeat-containing 8 [Gossypium arboreum]
Length=317

 Score =   156 bits (395),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 104/257 (40%), Positives = 143/257 (56%), Gaps = 29/257 (11%)
 Frame = +1

Query  286   LDGWEFAGGDEEEMVAAG--------EPLPRLIFGGAPSLQEAKEATFDLKDALHKVYNM  441
             +D WEFAG  E+E    G        EP+ R++F G PSL+EAKEAT DLKDAL KVY  
Sbjct  78    VDDWEFAGDFEQEAALEGSIAASGRPEPIARVLFSGVPSLEEAKEATNDLKDALDKVYLS  137

Query  442   STPPSDCGSTNGAAQVNNDHsppsnsssenAIAHGAPKHAIRAFKFLYENAAAQTVVASI  621
             S   S+     G + ++N        +     A   PK AI+AFK L E+ A Q+VVASI
Sbjct  138   SPKYSETVQVTGVSSLSNTEETKDCVAYNIE-ATSVPKPAIQAFKLLNESPAVQSVVASI  196

Query  622   ASDPNVWNAVLANPELQEFLVSQKTSAYVLDGEYSVEESIAETDFLRYSSPRNDDLTSE-  798
             ASDPNVWNAVL N    +F+ SQ+TS                  F    SPR+   + + 
Sbjct  197   ASDPNVWNAVLNNSAYMDFIKSQQTS----------------DKFEFLGSPRSSVSSVKL  240

Query  799   DGSPKPGNGFTDFLQNIKVAVLDMMNCLSDFFQNLFGGHKVFAD-ADGSAKTSVVDRAWG  975
             + +   G+ F+ F+Q IK +V++M++  +DF  +LF      AD A  +A ++ +D+  G
Sbjct  241   EENEDSGDSFSAFIQKIKTSVVEMVSKTTDFLHSLFSLPS--ADKAKENAGSNNMDKTIG  298

Query  976   ASFMGLAIMAIMVVVLK  1026
             AS MGLA+M  MVV+LK
Sbjct  299   ASLMGLAVMVTMVVLLK  315



>gb|KJB81865.1| hypothetical protein B456_013G165300 [Gossypium raimondii]
Length=316

 Score =   154 bits (390),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 102/259 (39%), Positives = 148/259 (57%), Gaps = 32/259 (12%)
 Frame = +1

Query  286   LDGWEFAGGDEEEMVAA----GEPLPRLIFGGAPSLQEAKEATFDLKDALHKVYNMSTPP  453
             +D WEFAGG EEE+  A    GEP+PR++FG AP+L++AKEA  DLKDAL K Y  S   
Sbjct  76    VDDWEFAGGVEEEVPTAISGGGEPMPRVLFGVAPTLEQAKEAASDLKDALDKAYLSSLDS  135

Query  454   SDCGSTNGAAQVNNDHsppsnsssenAIAHGAPKHAIRAFKFLYENAAAQTVVASIASDP  633
             +D      ++  +       +  + +A A   PK A++AFK L E+ A Q++VASIA+DP
Sbjct  136   TD---DTRSSCSSLLSEETKDCVAYDAKATLLPKPAVQAFKLLNESPAVQSMVASIAADP  192

Query  634   NVWNAVLANPELQEFLVSQKTSAYVLDGEYSVEESIAETDFLRYSSPRNDDLTS------  795
             NVWNAVL NP   +F+ S KT+ Y+               F    SPR  + TS      
Sbjct  193   NVWNAVLHNPAYMDFIGSHKTN-YI---------------FKENRSPRGCESTSVKIEEY  236

Query  796   --EDGSPKPGNGFTDFLQNIKVAVLDMMNCLSDFFQNLFGGHKVFADADGSAKTSVVDRA  969
                +   + GN F++FL+N+K +V+++ N  +DF Q+LF       + +     + +++ 
Sbjct  237   FEANEGKEVGNPFSEFLENLKSSVVEVANKATDFLQSLFTIPTAGMEKENGG-LNYLEKT  295

Query  970   WGASFMGLAIMAIMVVVLK  1026
              GAS MGLA+M IMVV+LK
Sbjct  296   IGASLMGLAVMVIMVVLLK  314



>gb|KJB45630.1| hypothetical protein B456_007G317200 [Gossypium raimondii]
Length=317

 Score =   154 bits (389),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 104/260 (40%), Positives = 144/260 (55%), Gaps = 35/260 (13%)
 Frame = +1

Query  286   LDGWEFAGGDEEEMVAAG--------EPLPRLIFGGAPSLQEAKEATFDLKDALHKVYNM  441
             +D WEFAG  E+E    G        EP+ R++F GAPSL+EAKEAT DLKDAL KVY  
Sbjct  78    VDDWEFAGDFEQEAALEGSIAASGRPEPIARVLFSGAPSLEEAKEATNDLKDALDKVYLS  137

Query  442   STPPSDCGSTNGAAQVNNDHsppsnsssenAIAHGAPKHAIRAFKFLYENAAAQTVVASI  621
             S   S+     G + ++N        +     A   PK AI+AFK L E+ A Q+VVASI
Sbjct  138   SPQYSEMVQVTGVSSLSNTEETKDCVAYNIE-ATSVPKPAIQAFKLLNESPAVQSVVASI  196

Query  622   ASDPNVWNAVLANPELQEFLVSQKTSAYVLDGEYSVEESIAETDFLRYSSPRNDDLT---  792
             ASDP+VW+AVL N    +F+ SQ+T+                  F    SPR+   +   
Sbjct  197   ASDPHVWDAVLNNSAYMDFIKSQQTN----------------DKFEFPGSPRSSVSSVKL  240

Query  793   --SEDGSPKPGNGFTDFLQNIKVAVLDMMNCLSDFFQNLFGGHKVFADADGSAKTSVVDR  966
               +EDG    G  F+ F+Q IK +V++M++  +DF  +LF    V   A  +A ++ +D+
Sbjct  241   EENEDG----GESFSAFIQKIKTSVVEMVSKTTDFLHSLFSLPSV-DKAKENAGSNNMDK  295

Query  967   AWGASFMGLAIMAIMVVVLK  1026
               GAS MGLA+M IMVV++K
Sbjct  296   TIGASLMGLAVMVIMVVLVK  315



>gb|AFK40032.1| unknown [Lotus japonicus]
Length=324

 Score =   154 bits (388),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 103/264 (39%), Positives = 152/264 (58%), Gaps = 29/264 (11%)
 Frame = +1

Query  283   ELDGWEFA-GGDEEEMVAAGEPLPRLIFGGAPSLQEAKEATFDLKDALHKVYNMSTPPSD  459
             +L  WEFA  GD   +++AGEP+PR++FG  PS QEAKEAT +LKDA+ K+Y +S+  S 
Sbjct  72    DLSDWEFADAGDL--VISAGEPMPRVVFGEVPSFQEAKEATIELKDAIEKMY-LSSDSSQ  128

Query  460   CGSTNGAAQVNNDHsppsnsssenAIAHGA------PKHAIRAFKFLYENAAAQTVVASI  621
                +    Q++          +++    GA      PKHAI+AF+ L  ++  QTVVASI
Sbjct  129   YEESFPDNQISVLPHTLFEPVNKSCDVEGAISNLSVPKHAIQAFELLSASSEVQTVVASI  188

Query  622   ASDPNVWNAVLANPELQEFLVSQKTSAYVLDGEYSVEESIAETDFLRYSSPRNDDLTSED  801
             ASD NVW AV+ NP +  F  SQ+T A     ++  E + A+   L      +DD  +  
Sbjct  189   ASDSNVWKAVMQNPAVSSFFQSQQTVA-----DFEAEGTTAKVVEL-----TDDDTVTGS  238

Query  802   GSPKPGNG----FTDFLQNIKVAVLDMMNCLSDFFQNLF---GGHKVFADADGSAKTSVV  960
               P+  +G    F   LQN+K+ V +M++ +S++ QN+F      K   DADG+ K +V+
Sbjct  239   EEPEIHSGIAFDFIGLLQNLKLTVAEMVSRVSNYLQNIFPTGEKEKSSGDADGNTKANVM  298

Query  961   D--RAWGASFMGLAIMAIMVVVLK  1026
             D     G SFMGLA++ IMVV++K
Sbjct  299   DNMNVMGGSFMGLAMLVIMVVLVK  322



>ref|XP_010062936.1| PREDICTED: uncharacterized protein LOC104450186 isoform X2 [Eucalyptus 
grandis]
 gb|KCW70085.1| hypothetical protein EUGRSUZ_F03390 [Eucalyptus grandis]
Length=322

 Score =   153 bits (386),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 109/256 (43%), Positives = 145/256 (57%), Gaps = 24/256 (9%)
 Frame = +1

Query  256  GAPVQWPCRELDGWEFAGGDEEEMVAAGEPLPRLIFGGAPSLQEAKEATFDLKDALHKVY  435
            G   Q    E+D W+F GG EE++V  G+P+ R++FGG PS +EAK AT DLKDA+ KVY
Sbjct  66   GKAAQMAAWEVDDWDF-GGLEEKLV--GQPMGRVVFGGVPSFEEAKAATDDLKDAIDKVY  122

Query  436  NMSTP--------PSDCGSTNGAAQVNNDHsppsnsssenAIAHGAPKHAIRAFKFLYEN  591
              ST         P+D  S  G   + N     S+   E       PKHA+ AFK L ++
Sbjct  123  LSSTNITGWEGQLPADQAS--GLPVLTNSVETQSSVIGEALATFPVPKHAVEAFKLLTQS  180

Query  592  AAAQTVVASIASDPNVWNAVLANPELQEFLVSQKTSAYVLDGEYSVEESIAETDFLRYSS  771
              AQTVVASIASD +VW+A L N  LQ+FL SQ +S      E  VE+S  +     + S
Sbjct  181  PEAQTVVASIASDQDVWDAFLKNKALQDFLQSQNSSIQFPYMEPKVEKSADDAFSDDWKS  240

Query  772  PRNDDLTSEDGSPKPGNGFTDFLQNIKVAVLDMMNCLSDFFQNLF---GGHKVFADADGS  942
            PR D+ TSE G     NGF  FLQNIK+ V  M++ +S F  ++F      K+ +++DG+
Sbjct  241  PRVDEETSEGGHK---NGFMSFLQNIKLRVEQMVSNISSFLADIFTPPSVEKMSSNSDGN  297

Query  943  AKTSVVDRAWGASFMG  990
            A  +V     GASFMG
Sbjct  298  AGLAV-----GASFMG  308



>gb|AFK40544.1| unknown [Lotus japonicus]
Length=324

 Score =   152 bits (385),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 102/264 (39%), Positives = 151/264 (57%), Gaps = 29/264 (11%)
 Frame = +1

Query  283   ELDGWEFA-GGDEEEMVAAGEPLPRLIFGGAPSLQEAKEATFDLKDALHKVYNMSTPPSD  459
             +L  WEFA  GD   +++AGEP+PR++FG  PS QEAKEAT +LKDA+ K+Y +S+  S 
Sbjct  72    DLSDWEFADAGDL--VISAGEPMPRVVFGEVPSFQEAKEATIELKDAIEKMY-LSSDSSQ  128

Query  460   CGSTNGAAQVNNDHsppsnsssenAIAHGA------PKHAIRAFKFLYENAAAQTVVASI  621
                +    Q++          +++    GA      PKHAI+AF+ L  ++  QTVVASI
Sbjct  129   YEESFPDNQISVLPHTLFEPVNKSCDVEGAISNLSVPKHAIQAFELLSASSEVQTVVASI  188

Query  622   ASDPNVWNAVLANPELQEFLVSQKTSAYVLDGEYSVEESIAETDFLRYSSPRNDDLTSED  801
             ASD NVW AV+ NP +  F  SQ+T A     ++  E + A+   L      +DD  +  
Sbjct  189   ASDSNVWKAVMQNPAVNSFFQSQQTMA-----DFEAEGTTAKVVEL-----TDDDTVTGS  238

Query  802   GSPKPGNG----FTDFLQNIKVAVLDMMNCLSDFFQNLF---GGHKVFADADGSAKTSVV  960
               P+  +G    F   LQN+K+ V +M++ +S++ QN+F      K   D DG+ K +V+
Sbjct  239   EEPEIHSGIAFDFIGLLQNLKLTVAEMVSRVSNYLQNIFPTGEKEKSSGDTDGNTKANVM  298

Query  961   D--RAWGASFMGLAIMAIMVVVLK  1026
             D     G SFMGLA++ IMVV++K
Sbjct  299   DSMNVMGGSFMGLAMLVIMVVLVK  322



>ref|XP_010910123.1| PREDICTED: uncharacterized protein LOC105036081 [Elaeis guineensis]
Length=318

 Score =   152 bits (383),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 97/265 (37%), Positives = 143/265 (54%), Gaps = 33/265 (12%)
 Frame = +1

Query  265   VQWPCRELDGWEFAGGDEEEMVAAGEPLPRLIFGGAPSLQEAKEATFDLKDALHKVYNMS  444
             +Q    E+D WEFAGG+EEE++ +  P PR++FG  P+L+EAKEAT DLKDA+ +VY   
Sbjct  74    IQRSSWEIDEWEFAGGEEEELLDSLHPAPRVVFGPVPTLEEAKEATADLKDAVERVYFSP  133

Query  445   TPPSDCGSTNGAAQVNNDHsppsnsssenAIAHGAPKHAIRAFKFLYENAAAQTVVASIA  624
             +         G     N            A+    PKH ++AF  L  +  AQ VVAS+A
Sbjct  134   STEVSLEGVQGCTSREN-----------VALVQSMPKHVVQAFSLLQGSPEAQDVVASLA  182

Query  625   SDPNVWNAVLANPELQEFLVSQKTSAYVLDGEYSV--EESIAETDFLRY-----SSPRND  783
             +D NVW+AV+ N ++ EF  +Q++   VL  E +V  EES+ E +  +       SP  D
Sbjct  183   ADKNVWDAVMKNEKVMEFYRTQQS--VVLQAETNVDFEESVGENECTKEYPESPKSPAGD  240

Query  784   DLTSEDGSPKPGNGFTDFLQNIKVAVLDMMNCLSDFFQNLF----GGHKVFADADGSAKT  951
               TS          FT+ + +IK+ V +M++ +S+F Q+L     G     +     +  
Sbjct  241   SQTSV---------FTEIMGHIKLKVTEMVSHISNFLQDLLGTSTGAQSSSSTKSTGSIG  291

Query  952   SVVDRAWGASFMGLAIMAIMVVVLK  1026
             S VD A GASF+ LAI  I+VV++K
Sbjct  292   SNVDVAVGASFIALAIATILVVLVK  316



>ref|XP_010694294.1| PREDICTED: uncharacterized protein LOC104907109 [Beta vulgaris 
subsp. vulgaris]
Length=295

 Score =   151 bits (382),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 100/250 (40%), Positives = 141/250 (56%), Gaps = 32/250 (13%)
 Frame = +1

Query  265  VQWPCRELDGWEFAGGDEEEMVAAGEPL-PRLIFGGAPSLQEAKEATFDLKDALHKVYNM  441
            VQ P  E+D WEFAGG+++ +V     + PRL+FG  P+ +E KEAT +LKDAL KVY +
Sbjct  60   VQRPAWEIDDWEFAGGEDDFVVDRINSVKPRLVFGPVPTFEETKEATSELKDALDKVY-L  118

Query  442  STPPSDCGSTNGAAQVNNDHsppsnsssenAIAHGAP--KHAIRAFKFLYENAAAQTVVA  615
            S+P S  GS    + ++   +          I H +P  K A++AFK L EN AAQTVVA
Sbjct  119  SSPKS-SGSVESFSALHETKA---------CITHESPVPKSAMQAFKLLKENPAAQTVVA  168

Query  616  SIASDPNVWNAVLANPELQEFLVSQKTSAYVLDGEYSVEESIAETDFLRYSSPRNDDLTS  795
            SIA DPNVWNAV+ NP L EFL S+K S      E+  EE           SP+++  ++
Sbjct  169  SIACDPNVWNAVMQNPTLMEFLDSEKKSTAFKRPEFESEE-----------SPKSEVDST  217

Query  796  EDGSPKPGNGFTDFLQNIKVAVLDMMNCLSDFFQNLFGG---HKVFADADGSAKTSVVDR  966
            +   P+  +G    L+N+K+ V+DM+  L++  Q+ F      K     DGS+++     
Sbjct  218  DSSDPEGLHGLMAMLENVKLTVVDMVQNLTNLVQSWFASPELDKRSEATDGSSRSIFA--  275

Query  967  AWGASFMGLA  996
              G SFM LA
Sbjct  276  --GGSFMALA  283



>ref|XP_011030911.1| PREDICTED: uncharacterized protein LOC105130206 isoform X1 [Populus 
euphratica]
Length=331

 Score =   152 bits (383),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 109/274 (40%), Positives = 154/274 (56%), Gaps = 22/274 (8%)
 Frame = +1

Query  259   APVQWPCRELDGWEFAGGDEEEMVA-AGEPLPRLIFGGAP-SLQEAKEATFDLKDALHKV  432
             A +Q P  E+D WE +GG EEEMV  + EP+ R++F  AP SLQEAK AT +LKDAL KV
Sbjct  60    AGMQRPAWEVDEWELSGGVEEEMVVDSAEPVARVVFWDAPPSLQEAKAATCELKDALQKV  119

Query  433   YNMSTPPSDCGSTNGAAQVNNDHsppsnsssenAIAHG---APKHAIRAFKFLYENAAAQ  603
             Y +S+P    GS+ G +Q++      S +    +        PK+A++AF  L E+   Q
Sbjct  120   Y-LSSPNLGTGSSLGGSQLSGHSLTNSETKGCISCDPNRAPVPKYAMQAFSLLNESPKIQ  178

Query  604   TVVASIASDPNVWNAVLANPELQEFLVSQKTSAYVLDGEYSV--EESIAETDF--LRYSS  771
             TVVA++ASDPNVWNAV  N  LQE L SQ  +   +  + SV   ES+ +TD      SS
Sbjct  179   TVVAALASDPNVWNAVWENEALQELLQSQNANKESVADKESVADNESVGDTDSQDAAVSS  238

Query  772   PRNDDLT---SEDGSPKPGNGFTDFLQNIKVAVLDMMNCLSDFFQNLFGGHKVFADADGS  942
              +  +L+   SE G+ +   G  D + N+K+ V+DM+   S +F+ +F         D +
Sbjct  239   KKLTELSDDESETGNSQ--TGLKDVINNVKLTVVDMVTNASAYFKKIFSFSSAEHTPDAA  296

Query  943   ------AKTSVVDRAWGASFMGLAIMAIMVVVLK  1026
                   A +S  +   G S M LA+M IMVVVL+
Sbjct  297   DENAENAGSSTFEMTLG-SLMALAVMVIMVVVLR  329



>ref|XP_002283181.1| PREDICTED: uncharacterized protein LOC100265933 [Vitis vinifera]
Length=339

 Score =   150 bits (379),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 119/328 (36%), Positives = 169/328 (52%), Gaps = 41/328 (13%)
 Frame = +1

Query  94   ITVANSGFRGIAS----EHPVSSAARKvvrpvsvsgissssDHLKssavsasqstavDGA  261
            + V N+G RG  +    E P+++AARK   PVS    S+       S             
Sbjct  15   VGVVNAGLRGAPAVQPVEQPMAAAARKATVPVSSVISSAKLGDAPVS-------------  61

Query  262  PVQWPCRELDGWEFAGGDEEEMVAAGEPLPRLIFGGAPSLQEAKEATFDLKDALHKVYNM  441
             VQ P  ELD WEFA  +EE  +  GEPLPR++FGG P+LQEAKEAT +LKDAL ++Y  
Sbjct  62   -VQRPSWELDDWEFASVEEEINIGTGEPLPRVVFGGVPTLQEAKEATSELKDALDQLYLS  120

Query  442  STPPSDCGSTN-GAAQV-NNDHsppsnsssenA-IAHGAPKHAIRAFKFLYENAAAQTVV  612
             +     G    G  Q+ N+DH       +         P HAI+AF +L ++ AAQ VV
Sbjct  121  PSRSIRSGVQQLGLLQIANSDHLETKACVATTENTVATVPAHAIQAFAYLKDSPAAQNVV  180

Query  613  ASIASDPNVWNAVLANPELQEFLVSQKTSAYVLDGEYSVEESIAETDFLRYSSPRNDDLT  792
            ASIASDPNVW+AV+ N  L EFL +QKT A       + EES+A+T F    +P++ + +
Sbjct  181  ASIASDPNVWSAVMQNEALVEFLQAQKTCAPYPSMGLNAEESVADTGFQDQEAPKSFEDS  240

Query  793  SEDG----------SPKPGNGFTD-----FLQNIKVAVLDMMN-CLSDFFQNLFGGH---  915
            S++G          +PK     +D      L +   ++L+ M   L++   N+FG     
Sbjct  241  SDEGDSGSRFQNKETPKSFEDSSDAGDSGSLSSWFASLLETMKLSLAEIVGNIFGRPAAD  300

Query  916  -KVFADADGSAKTSVVDRAWGASFMGLA  996
             K   D++   +  V++   GAS  GLA
Sbjct  301  VKSSPDSNEKPEGQVMNMGLGASLTGLA  328



>ref|XP_010062934.1| PREDICTED: uncharacterized protein LOC104450186 isoform X1 [Eucalyptus 
grandis]
Length=323

 Score =   149 bits (377),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 108/257 (42%), Positives = 145/257 (56%), Gaps = 25/257 (10%)
 Frame = +1

Query  256  GAPVQWPCRELDGWEFAGGDEEEMVAAGEPLPRLIFGGAPSLQEAKEATFDLKDALHKVY  435
            G   Q    E+D W+F GG EE++V  G+P+ R++FGG PS +EAK AT DLKDA+ KVY
Sbjct  66   GKAAQMAAWEVDDWDF-GGLEEKLV--GQPMGRVVFGGVPSFEEAKAATDDLKDAIDKVY  122

Query  436  NMSTP--------PSDCGSTNGAAQVNNDHsppsnsssenAIAHGAPKHAIRAFKFLYEN  591
              ST         P+D  S  G   + N     S+   E       PKHA+ AFK L ++
Sbjct  123  LSSTNITGWEGQLPADQAS--GLPVLTNSVETQSSVIGEALATFPVPKHAVEAFKLLTQS  180

Query  592  AAAQTVVASIASDPNVWNAVLANPELQEFLVSQKTSAYVLD-GEYSVEESIAETDFLRYS  768
              AQTVVASIASD +VW+A L N  LQ+FL SQ ++       E  VE+S  +     + 
Sbjct  181  PEAQTVVASIASDQDVWDAFLKNKALQDFLQSQNSTGIQFPYMEPKVEKSADDAFSDDWK  240

Query  769  SPRNDDLTSEDGSPKPGNGFTDFLQNIKVAVLDMMNCLSDFFQNLF---GGHKVFADADG  939
            SPR D+ TSE G     NGF  FLQNIK+ V  M++ +S F  ++F      K+ +++DG
Sbjct  241  SPRVDEETSEGGHK---NGFMSFLQNIKLRVEQMVSNISSFLADIFTPPSVEKMSSNSDG  297

Query  940  SAKTSVVDRAWGASFMG  990
            +A  +V     GASFMG
Sbjct  298  NAGLAV-----GASFMG  309



>ref|XP_011030912.1| PREDICTED: uncharacterized protein LOC105130206 isoform X2 [Populus 
euphratica]
Length=325

 Score =   148 bits (374),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 109/273 (40%), Positives = 152/273 (56%), Gaps = 26/273 (10%)
 Frame = +1

Query  259   APVQWPCRELDGWEFAGGDEEEMVA-AGEPLPRLIFGGAP-SLQEAKEATFDLKDALHKV  432
             A +Q P  E+D WE +GG EEEMV  + EP+ R++F  AP SLQEAK AT +LKDAL KV
Sbjct  60    AGMQRPAWEVDEWELSGGVEEEMVVDSAEPVARVVFWDAPPSLQEAKAATCELKDALQKV  119

Query  433   YNMSTPPSDCGSTNGAAQVNNDHsppsnsssenAIAHG---APKHAIRAFKFLYENAAAQ  603
             Y +S+P    GS+ G +Q++      S +    +        PK+A++AF  L E+   Q
Sbjct  120   Y-LSSPNLGTGSSLGGSQLSGHSLTNSETKGCISCDPNRAPVPKYAMQAFSLLNESPKIQ  178

Query  604   TVVASIASDPNVWNAVLANPELQEFLVSQKTSA-YVLDGEYSVEESIAETDF--LRYSSP  774
             TVVA++ASDPNVWNAV  N  LQE L SQ  +   V D      ES+ +TD      SS 
Sbjct  179   TVVAALASDPNVWNAVWENEALQELLQSQNANKESVAD-----NESVGDTDSQDAAVSSK  233

Query  775   RNDDLT---SEDGSPKPGNGFTDFLQNIKVAVLDMMNCLSDFFQNLFGGHKVFADADGS-  942
             +  +L+   SE G+ +   G  D + N+K+ V+DM+   S +F+ +F         D + 
Sbjct  234   KLTELSDDESETGNSQ--TGLKDVINNVKLTVVDMVTNASAYFKKIFSFSSAEHTPDAAD  291

Query  943   -----AKTSVVDRAWGASFMGLAIMAIMVVVLK  1026
                  A +S  +   G S M LA+M IMVVVL+
Sbjct  292   ENAENAGSSTFEMTLG-SLMALAVMVIMVVVLR  323



>gb|KJB45631.1| hypothetical protein B456_007G317200 [Gossypium raimondii]
Length=315

 Score =   147 bits (370),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 103/260 (40%), Positives = 143/260 (55%), Gaps = 37/260 (14%)
 Frame = +1

Query  286   LDGWEFAGGDEEEMVAAG--------EPLPRLIFGGAPSLQEAKEATFDLKDALHKVYNM  441
             +D WEFAG  E+E    G        EP+ R++F GAPSL+EAKEAT DLKDAL KVY  
Sbjct  78    VDDWEFAGDFEQEAALEGSIAASGRPEPIARVLFSGAPSLEEAKEATNDLKDALDKVYLS  137

Query  442   STPPSDCGSTNGAAQVNNDHsppsnsssenAIAHGAPKHAIRAFKFLYENAAAQTVVASI  621
             S   S+     G + ++N        +     A   PK AI+AFK L E+ A  +VVASI
Sbjct  138   SPQYSEMVQVTGVSSLSNTEETKDCVAYNIE-ATSVPKPAIQAFKLLNESPA--SVVASI  194

Query  622   ASDPNVWNAVLANPELQEFLVSQKTSAYVLDGEYSVEESIAETDFLRYSSPRNDDLT---  792
             ASDP+VW+AVL N    +F+ SQ+T+                  F    SPR+   +   
Sbjct  195   ASDPHVWDAVLNNSAYMDFIKSQQTN----------------DKFEFPGSPRSSVSSVKL  238

Query  793   --SEDGSPKPGNGFTDFLQNIKVAVLDMMNCLSDFFQNLFGGHKVFADADGSAKTSVVDR  966
               +EDG    G  F+ F+Q IK +V++M++  +DF  +LF    V   A  +A ++ +D+
Sbjct  239   EENEDG----GESFSAFIQKIKTSVVEMVSKTTDFLHSLFSLPSV-DKAKENAGSNNMDK  293

Query  967   AWGASFMGLAIMAIMVVVLK  1026
               GAS MGLA+M IMVV++K
Sbjct  294   TIGASLMGLAVMVIMVVLVK  313



>ref|XP_007021147.1| Uncharacterized protein TCM_031178 [Theobroma cacao]
 gb|EOY12672.1| Uncharacterized protein TCM_031178 [Theobroma cacao]
Length=355

 Score =   141 bits (356),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 109/299 (36%), Positives = 151/299 (51%), Gaps = 60/299 (20%)
 Frame = +1

Query  265   VQWPCRELDGWEFAGGDEEE--MVAA-----GEPLPRLIFGGAPSLQEAKEATFDLKDAL  423
             V W     D WEFAGG EEE  MV +     GEP+ R++FGG PS +EAKEAT DLKDAL
Sbjct  70    VGW--ETFDDWEFAGGVEEEVAMVGSTASGGGEPMARVLFGGVPSHEEAKEATADLKDAL  127

Query  424   HKVYNMSTPPSDCGSTNGAAQVNNDHsppsnsssenAIAHGAPKHAIRAFKFLYENAAAQ  603
              KVY +S+P S   +      + +      +  + N  A   PK AI+AFK   E+   Q
Sbjct  128   DKVY-LSSPNSADTAQACPLTLLSYPEETKDCVACNVKATSVPKPAIQAFKLFNESPQVQ  186

Query  604   T----------------------------------VVASIASDPNVWNAVLANPELQEFL  681
             T                                  VV S+A+D NVWNAVL N    EF+
Sbjct  187   TSRRVSFLDSCALGNVRCVFAIISCPPVGFLHIVSVVTSLAADQNVWNAVLNNSAYMEFV  246

Query  682   VSQKTSAYVLD--GEYSVEESIAETDFLRYSSPRNDDLTSEDGSPKPGNGFTDFLQNIKV  855
              SQKT+  + D     S E S+   +++  S P++            GN F++FL  +K 
Sbjct  247   QSQKTNDELEDHGSPRSSESSVKLEEYVDASHPKDS-----------GNQFSNFLLKVKT  295

Query  856   AVLDMMNCLSDFFQNLFGGHKVFADADGSAKT--SVVDRAWGASFMGLAIMAIMVVVLK  1026
              V++++N  +DF Q+LF       +A+G+A +  S  D+  GAS MGLA+M IMVV++K
Sbjct  296   TVIELVNKATDFLQSLFTLPSA-ENAEGNAGSTFSSFDKTIGASLMGLAVMVIMVVLVK  353



>ref|XP_003527303.2| PREDICTED: uncharacterized protein LOC100782462 [Glycine max]
Length=316

 Score =   140 bits (353),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 102/260 (39%), Positives = 149/260 (57%), Gaps = 25/260 (10%)
 Frame = +1

Query  289   DGWEFAGGDEEEMVAAGEPLPRLIFGGAPSLQEAKEATFDLKDALHKVYNMSTPPSDCGS  468
             D W+FA  ++ E+V     +PR++FG  P+L EAKEAT +LKDA+ +VY +    S   S
Sbjct  66    DDWDFA--EDGELV-----VPRMVFGSVPTLDEAKEATAELKDAIDQVY-LCPETSQYSS  117

Query  469   TNG--AAQVNNDHsppsnsssenAIAH-GAPKHAIRAFKFLYENAAAQTVVASIASDPNV  639
               G  +A     + P + S   +AI+   APKHAI+AF  L  +  AQ VVAS+A DPNV
Sbjct  118   PGGQVSALSPTLYGPVNRSCVIDAISDPTAPKHAIQAFHLLSTSREAQAVVASLACDPNV  177

Query  640   WNAVLANPELQEFLVSQKTSAYVLDGEYSVE-ESIAETDFLRYSSPRNDDLTSEDGSPKP  816
             WNAV+ N  +  F  SQ++ A     E S E + ++        SP   + ++E     P
Sbjct  178   WNAVMENSAVSSFFQSQQSVAGFGAAENSEEVDKLSSCASETVESPEKLEGSAES---HP  234

Query  817   GNGFTDF---LQNIKVAVLDMMNCLSDFFQNLFGG-----HKVFADADGSAKTSVVDR--  966
             GN F DF   LQN+K+ V+++++ LS F QN+F        K+  DADG+ K S +D   
Sbjct  235   GNMFDDFMGLLQNVKLTVIELVSRLSGFLQNIFPTPDAMREKMSFDADGNTKASFMDSKI  294

Query  967   AWGASFMGLAIMAIMVVVLK  1026
             + G +F+GLA++ IMV+V K
Sbjct  295   SMGGTFIGLAVLVIMVIVTK  314



>ref|XP_008813171.1| PREDICTED: uncharacterized protein LOC103723874 [Phoenix dactylifera]
Length=342

 Score =   139 bits (350),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 100/261 (38%), Positives = 137/261 (52%), Gaps = 27/261 (10%)
 Frame = +1

Query  265   VQWPCRELDGWEFAGGDEEEMVAAGEPLPRLIFGGAPSLQEAKEATFDLKDALHKVYNMS  444
             +Q P  E+D W FAG +EE+++ +  P PRL+FG  P+L+EAK AT +LKDA+ KVY  S
Sbjct  100   IQLPAWEIDDWVFAG-EEEDLLDSLHPAPRLVFGPVPTLEEAKAATAELKDAVEKVYFSS  158

Query  445   TPPSDCGSTNGAAQVN-------NDHsppsnsssenAIAHGAPKHAIRAFKFLYENAAAQ  603
             +  + C ST G    +               + S+N+     P H I+ F  L  N  AQ
Sbjct  159   S--TTCDSTVGGLGASLQSPVCLEGSETKGCTMSKNSTLFSTPNHVIQMFSLLQGNPEAQ  216

Query  604   TVVASIASDPNVWNAVLANPELQEFLVSQKTSAYVLDGEYSVEESIAETDFLRYSSPRND  783
              VVASIASD NVWNAV+ NP+++EF  +Q++   VL  E  VE S +      +      
Sbjct  217   NVVASIASDENVWNAVMNNPKVKEFYKTQQS--VVLPSETVVESSESPESSEAHP-----  269

Query  784   DLTSEDGSPKPGNGFTDFLQNIKVAVLDMMNCLSDFFQNLFGGHKVFADADGSAKTSVVD  963
                S D   +    F DF+QN K+ V  M+  LSDF QN  G       + GS   S  D
Sbjct  270   ---SRDSYQRSRTRFMDFMQNFKLKVSKMVANLSDFLQNYMG------TSTGSHCNSSAD  320

Query  964   RAWGASFMGLAIMAIMVVVLK  1026
                  SF+ LAI  I+V++LK
Sbjct  321   -VVQKSFVALAIATILVILLK  340



>emb|CBI20469.3| unnamed protein product [Vitis vinifera]
Length=281

 Score =   137 bits (345),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 98/230 (43%), Positives = 126/230 (55%), Gaps = 22/230 (10%)
 Frame = +1

Query  94   ITVANSGFRGIAS----EHPVSSAARKvvrpvsvsgissssDHLKssavsasqstavDGA  261
            + V N+G RG  +    E P+++AARK   PVS    S+       S             
Sbjct  61   VGVVNAGLRGAPAVQPVEQPMAAAARKATVPVSSVISSAKLGDAPVS-------------  107

Query  262  PVQWPCRELDGWEFAGGDEEEMVAAGEPLPRLIFGGAPSLQEAKEATFDLKDALHKVYNM  441
             VQ P  ELD WEFA  +EE  +  GEPLPR++FGG P+LQEAKEAT +LKDAL ++Y  
Sbjct  108  -VQRPSWELDDWEFASVEEEINIGTGEPLPRVVFGGVPTLQEAKEATSELKDALDQLYLS  166

Query  442  STPPSDCGSTN-GAAQV-NNDHsppsnsssenA-IAHGAPKHAIRAFKFLYENAAAQTVV  612
             +     G    G  Q+ N+DH       +         P HAI+AF +L ++ AAQ VV
Sbjct  167  PSRSIRSGVQQLGLLQIANSDHLETKACVATTENTVATVPAHAIQAFAYLKDSPAAQNVV  226

Query  613  ASIASDPNVWNAVLANPELQEFLVSQKTSA-YVLDGEYSVEESIAETDFL  759
            ASIASDPNVW+AV+ N  L EFL +QKT A Y   G  + E  I E +FL
Sbjct  227  ASIASDPNVWSAVMQNEALVEFLQAQKTCAPYPSMGLNAEESVILEPEFL  276



>ref|XP_003539571.1| PREDICTED: uncharacterized protein LOC100795500 isoform X1 [Glycine 
max]
Length=274

 Score =   137 bits (345),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 92/260 (35%), Positives = 141/260 (54%), Gaps = 38/260 (15%)
 Frame = +1

Query  289   DGWEFAGGDEEEMVAAGEPLPRLIFGGAPSLQEAKEATFDLKDALHKVYNMSTPPSDCGS  468
             D WE A G EE+    GE   R++ G  PS+QEAK AT +LK A+HKVY +S+  S+C  
Sbjct  37    DDWEVADGGEED----GEGAARVVLGDVPSIQEAKAATAELKHAIHKVY-LSSNSSECDG  91

Query  469   TNGAAQVN----NDHsppsnsssenAIAH-GAPKHAIRAFKFLYENAAAQTVVASIASDP  633
              + + QV+    +     + S    AI +  AP  A++AF+ L E+  AQ+VVASIA DP
Sbjct  92    CSLSGQVSVVSPSHTELENKSHFTEAITYPSAPNRALQAFQLLSESPEAQSVVASIACDP  151

Query  634   NVWNAVLANPELQEFLVSQKTSAYVLDGEYSVEESIAETDFLRYSSPRNDDLTSEDGSPK  813
             N+WNA+  NP LQ+F  S +T+ + ++G +  ++ +   DFL   S              
Sbjct  152   NIWNAIAQNPTLQDFFQSHQTADFEVEGTH--DQRVG--DFLYSDSVY------------  195

Query  814   PGNGFTD---FLQNIKVAVLDMMNCLSDFFQNLFG-----GHKVFADADGSAKTSVVD-R  966
                 F D    L N+   V +M++ +S++ QN+FG           DA G+ K + VD  
Sbjct  196   ---AFVDSLNILHNVNFTVTEMVSSVSNYLQNMFGFLTGQTSSAVIDARGNTKANFVDPI  252

Query  967   AWGASFMGLAIMAIMVVVLK  1026
               G +F+G A++ +MV++LK
Sbjct  253   TMGGTFLGFAVLVVMVIMLK  272



>ref|XP_009385062.1| PREDICTED: uncharacterized protein LOC103972444 [Musa acuminata 
subsp. malaccensis]
Length=297

 Score =   137 bits (346),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 95/264 (36%), Positives = 138/264 (52%), Gaps = 35/264 (13%)
 Frame = +1

Query  253   DGAP-VQWPCRELDGWEFAGGDEEE---MVAAGEPLPRLIFGGAPSLQEAKEATFDLKDA  420
             + AP +Q    E D WE A  +EEE    + +  P PRL+FG   SL+EAKEAT DLKDA
Sbjct  61    EAAPEIQGLAWEFDDWEVADWEEEEKDVTLDSLHPAPRLVFGPVASLEEAKEATSDLKDA  120

Query  421   LHKVYNMSTPPSDCGSTNGAAQVNNDHsppsnsssenAIAHGAPKHAIRAFKFLYENAAA  600
             L  VY  STP ++  +     +  +  +         +I   AP+H ++AF  L  +   
Sbjct  121   LDMVY--STPDTNESTVQSPQESTHSEAS--------SIVPSAPRHVVQAFSLLRGSPEV  170

Query  601   QTVVASIASDPNVWNAVLANPELQEFLVSQKTSAYVLDGEYSVEESIAETDFLRYSSPRN  780
             Q VVAS+ASD NVWNAV+ N ++ EF V+ ++ A  L+ E  V                 
Sbjct  171   QDVVASLASDENVWNAVMKNEKVMEFYVTHQSIA--LNSESDVA----------------  212

Query  781   DDLTSEDGSPKPGNGFTDFLQNIKVAVLDMMNCLSDFFQNLFG--GHKVFADADGSAKTS  954
             DD  S      P + F+DF+ N+KV V+ M++ ++ FFQ +    G    + +  + K  
Sbjct  213   DDCESSTAETTPNSVFSDFVHNVKVKVVAMVSNITSFFQEILQTLGRSSSSTSTNTDK-P  271

Query  955   VVDRAWGASFMGLAIMAIMVVVLK  1026
              VD   G+SFM LAI  I+VV+L+
Sbjct  272   FVDFTIGSSFMALAIATILVVLLR  295



>ref|XP_004151972.1| PREDICTED: uncharacterized protein LOC101218021 [Cucumis sativus]
 gb|KGN57942.1| hypothetical protein Csa_3G402460 [Cucumis sativus]
Length=317

 Score =   137 bits (345),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 97/249 (39%), Positives = 132/249 (53%), Gaps = 21/249 (8%)
 Frame = +1

Query  265  VQWPCRELDGWEFAGGDEEEMVAAGEPLPRLIFGGAPSLQEAKEATFDLKDALHKVYNMS  444
            V  P  E D WEFA  + +  + +    PR++FG  PS +EAKEAT ++K+AL KVY  S
Sbjct  69   VHKPTWEFDDWEFANFENDMGMDSVGFKPRIVFGAVPSFEEAKEATTEVKEALDKVYLSS  128

Query  445  TPPSDCGSTNGAAQVNNDHsppsnsssenAIAH--GAPKHAIRAFKFLYENAAAQTVVAS  618
            +P SD   +N    +N      S  S+E ++      P+HAI+AFK L E+A AQTVVAS
Sbjct  129  SPESD--GSNMIVPINRKIESVSCLSNETSLQSQTSVPQHAIQAFKLLKESAEAQTVVAS  186

Query  619  IASDPNVWNAVLANPELQEFLVSQKTSAYVLDGEY--SVEESIAETDFLRYSSPRNDDLT  792
            IASDPNVWNA+L N  L+ FL S +T+  V   E    VEE  A   +     P+N+   
Sbjct  187  IASDPNVWNAMLGNEALKSFLQSYQTNKIVEYHELPEGVEE--APVSYRVGEQPQNEST-  243

Query  793  SEDGSPKPGNGFTDFLQNIKVAVLDMMNCLSDFFQNLFGGHKVFADADGSAKT---SVVD  963
                     NGF   L+NIK ++ D++   S F Q +FG          +  T   S  +
Sbjct  244  ---------NGFQKMLENIKTSIDDVLTKASSFIQIIFGSSPAEVSGRNNEATSGFSTAE  294

Query  964  RAWGASFMG  990
             A G+S MG
Sbjct  295  IAMGSSIMG  303



>gb|KEH30768.1| transmembrane protein, putative [Medicago truncatula]
Length=305

 Score =   137 bits (344),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 114/321 (36%), Positives = 167/321 (52%), Gaps = 43/321 (13%)
 Frame = +1

Query  94    ITVANSGFRGIASEHPVSSAARKvvrpvsvsgissssDHLKssavsasqstavDGAPVQW  273
             I VA SGFRG    +P   A ++  R  + S     S   K++          D  P+  
Sbjct  16    IGVARSGFRGTTVTYP---AEKQWSRNRASSPTRVISQGTKTA----------DVKPLHT  62

Query  274   PCRE-LDGWEFAGGDEEEM-VAAGEPLPRLIFGGAPSLQEAKEATFDLKDALHKVYNMST  447
                E L+ WEFA  DE ++ +++GEP PR++FG  P+L+EA+EAT +LKDA+ ++Y +S 
Sbjct  63    SVSEDLNDWEFA--DEGDLFMSSGEPTPRMVFGEVPTLKEAEEATAELKDAIDQIY-LSP  119

Query  448   PPSDCGSTNGAAQVNNDHsppsnsssenAIAHGAPKHAIRAFKFLYENAAAQTVVASIAS  627
               S   +++  ++V+       +   E        KHAI AF+ L  +  AQTVV SIA 
Sbjct  120   ANSQIENSSPGSEVSVLSPYSKDCLVEAISNPSVSKHAIHAFQLLSSSVEAQTVVQSIAC  179

Query  628   DPNVWNAVLANPELQEFLVSQKTSAYVLDGEYSVEESIAETDFLRYSSPRNDDLTSEDGS  807
             DPN+WNAV+ NP +  F  SQ         + +   + A + F           +     
Sbjct  180   DPNIWNAVMQNPAVTSFFESQL-------ADSTNGAAFAGSGFAETPEKEEKPES-----  227

Query  808   PKPGNGFTDF---LQNIKVAVLDMMNCLSDFFQNLF---GGHKVFADADGSAKTSVVD--  963
              + GN F DF   LQN+K+ V +M++ +S+FFQN+F      K  ADADG    S +D  
Sbjct  228   -QSGNVF-DFMGILQNLKLTVTEMVSRMSNFFQNIFPTVEKDKSSADADGG---SFMDYK  282

Query  964   RAWGASFMGLAIMAIMVVVLK  1026
                G SFMGLA+M IMVV++K
Sbjct  283   NVMGTSFMGLAVMVIMVVLMK  303



>gb|AGV54826.1| hypothetical protein [Phaseolus vulgaris]
Length=309

 Score =   136 bits (343),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 92/258 (36%), Positives = 143/258 (55%), Gaps = 29/258 (11%)
 Frame = +1

Query  289   DGWEFAGGDEEEMVAAGEPLPRLIFGGAPSLQEAKEATFDLKDALHKVY------NMSTP  450
             D W+FA  ++ ++V     +PR++FG AP+ +EAKEAT +LKDA+ +VY        S+P
Sbjct  67    DDWDFA--EDGDLV-----VPRMVFGSAPTFEEAKEATTELKDAIDQVYLSPDSSKYSSP  119

Query  451   PSDCGSTNGAAQVNNDHsppsnsssenAIAHGAPKHAIRAFKFLYENAAAQTVVASIASD  630
               +  + +       + S   ++ S  ++    P HAI+AF  L  +  AQ VVAS+ASD
Sbjct  120   GDEVSTLSPTLYEPVNRSCVFDTISNPSV----PNHAIQAFNLLSTSHEAQAVVASLASD  175

Query  631   PNVWNAVLANPELQEFLVSQKTSAYVLDGEYSVEESIAETDFL---RYSSPRNDDLTSED  801
             PNVWNAV+ NP +  F  SQ+T A    GE    E + +          +P   + T+E 
Sbjct  176   PNVWNAVMENPAVYRFFQSQQTVADF--GEVETTEKVEKLSTCASEEIETPDKREATAES  233

Query  802   GSPKPGNGFTDFLQNIKVAVLDMMNCLSDFFQNLFGG---HKVFADADGSAKTSVVDRAW  972
                   + F  FLQN+K+ V ++++ +SDF QN+F      K+  DA G+ K +++    
Sbjct  234   DLGSMFSDFIGFLQNLKLTVTELVSSVSDFLQNIFPSPDTQKMAGDAVGNNKANLM----  289

Query  973   GASFMGLAIMAIMVVVLK  1026
             G +FMGLA++ IMV+V K
Sbjct  290   GGTFMGLAVLVIMVIVTK  307



>ref|XP_007133044.1| hypothetical protein PHAVU_011G146700g [Phaseolus vulgaris]
 gb|ESW05038.1| hypothetical protein PHAVU_011G146700g [Phaseolus vulgaris]
Length=309

 Score =   136 bits (342),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 92/258 (36%), Positives = 143/258 (55%), Gaps = 29/258 (11%)
 Frame = +1

Query  289   DGWEFAGGDEEEMVAAGEPLPRLIFGGAPSLQEAKEATFDLKDALHKVY------NMSTP  450
             D W+FA  ++ ++V     +PR++FG AP+ +EAKEAT +LKDA+ +VY        S+P
Sbjct  67    DDWDFA--EDGDLV-----VPRMVFGSAPTFEEAKEATTELKDAIDQVYLSPDSSKYSSP  119

Query  451   PSDCGSTNGAAQVNNDHsppsnsssenAIAHGAPKHAIRAFKFLYENAAAQTVVASIASD  630
               +  + +       + S   ++ S  ++    P HAI+AF  L  +  AQ VVAS+ASD
Sbjct  120   GDEVSTLSPTLYEPVNRSCVFDTISNPSV----PNHAIQAFNLLSTSHEAQAVVASLASD  175

Query  631   PNVWNAVLANPELQEFLVSQKTSAYVLDGEYSVEESIAETDFL---RYSSPRNDDLTSED  801
             PNVWNAV+ NP +  F  SQ+T A    GE    E + +          +P   + T+E 
Sbjct  176   PNVWNAVMENPVVYRFFQSQQTVADF--GEVETTEKVEKLSTCASEEIETPDKREATAES  233

Query  802   GSPKPGNGFTDFLQNIKVAVLDMMNCLSDFFQNLFGG---HKVFADADGSAKTSVVDRAW  972
                   + F  FLQN+K+ V ++++ +SDF QN+F      K+  DA G+ K +++    
Sbjct  234   DLGSMFSDFIGFLQNLKLTVTELVSSVSDFLQNIFPSPDTQKMAGDAVGNNKANLM----  289

Query  973   GASFMGLAIMAIMVVVLK  1026
             G +FMGLA++ IMV+V K
Sbjct  290   GGTFMGLAVLVIMVIVTK  307



>ref|XP_004294319.1| PREDICTED: uncharacterized protein LOC101314638 [Fragaria vesca 
subsp. vesca]
Length=313

 Score =   136 bits (342),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 89/255 (35%), Positives = 140/255 (55%), Gaps = 29/255 (11%)
 Frame = +1

Query  295   WEFAGGDEEEMVAAGEPLPRLIFGGAPSLQEAKEATFDLKDALHKVYNMSTP-------P  453
             W+  GG++E +++AGEP+PR++FG APS +EAKEAT +LKDAL K Y +S+P       P
Sbjct  75    WQVVGGEDELVMSAGEPMPRVVFGAAPSFKEAKEATAELKDALDKAY-LSSPKITELEDP  133

Query  454   SDCGSTNGAAQVNNDHsppsnsssenAIAHGAPKHAIRAFKFLYENAAAQTVVASIASDP  633
             +     +G +  +N  +   +           P+HA +AF+ L  +  AQ VVASIASDP
Sbjct  134   TAADKVSGQSLFSNPGAETESVLVTRT---SVPQHAYKAFELLSRSPEAQNVVASIASDP  190

Query  634   NVWNAVLANPELQEFLVSQKT---SAYVLDGEYSVEESIAETDFL-RYSSPRNDDLTSED  801
             NVWNA++ N  +++F+ SQK      Y    +  V   ++  +    + S ++ DL    
Sbjct  191   NVWNAMIENSAVKQFMESQKNLNQDPYDSASDSEVFNPVSSKEVKEEFDSSQSFDLE---  247

Query  802   GSPKPGNGFTDFLQNIKVAVLDMMNCLSDFFQNLFGGHKVFADADGSAKTSVVDRAWGAS  981
                   + F  F+  +K+ V  +++ LS + QN+F         +GS +T +      + 
Sbjct  248   ------HLFNGFVDKVKLTVNTIVSNLSTYIQNIFEPPADDNGDNGSPRTVI-----ASG  296

Query  982   FMGLAIMAIMVVVLK  1026
             FMGLAIM +MVV+LK
Sbjct  297   FMGLAIMVVMVVLLK  311



>ref|XP_010448280.1| PREDICTED: uncharacterized protein LOC104730767 [Camelina sativa]
Length=305

 Score =   135 bits (339),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 104/264 (39%), Positives = 139/264 (53%), Gaps = 36/264 (14%)
 Frame = +1

Query  253   DGAPVQWPCRELDGWEFAGGDEEEMVAAGEPLPRLIFGGAPSLQEAKEATFDLKDALHKV  432
             DG  +Q P    D WEFA   EEE     EP+PR++F   PSL+EAKEAT DLK+A++ V
Sbjct  70    DGMVMQRPV--WDDWEFA---EEE-----EPIPRVVFSKPPSLEEAKEATEDLKEAINMV  119

Query  433   YNMSTPPSDCGSTNGAAQVNNDHspps------nsssenAIAHGAPKHAIRAFKFLYENA  594
             Y MS+P S   +  G+    ND    S       SS   A+    P+ A++AF FL EN 
Sbjct  120   Y-MSSPNSSSAAIEGS----NDGGSVSKMLSGFQSSENRAVESAVPQVALKAFAFLSENT  174

Query  595   AAQTVVASIASDPNVWNAVLANPELQEFLVSQKTSAYVLDGEYSVEESIAETDFLRYSSP  774
             AAQTVVASIASDP VW+AV+ N +L +FL +  T+A           S  E+D     S 
Sbjct  175   AAQTVVASIASDPKVWDAVMENKDLMKFLQTNSTAAS----------SQVESDN-DDQSE  223

Query  775   RNDDLTSEDGSPKPGNGFTDFLQNIKVAVLDMMNCLSDFFQNLFGGHKVFADADGSAKTS  954
             R+     E    KP     + LQ++K+ V+ MM  +S +F  LFG      +     +T 
Sbjct  224   RSSTTECEVMEEKPLE-ILEILQDVKLKVVRMMENVSSYFGGLFGLGSETEEGKDKKQTL  282

Query  955   VVDRAWGASFMGLAIMAIMVVVLK  1026
               D     S  GLA++ I +VVLK
Sbjct  283   FND---PRSLFGLAVVVIFMVVLK  303



>ref|XP_008454597.1| PREDICTED: uncharacterized protein LOC103494971 isoform X1 [Cucumis 
melo]
Length=315

 Score =   134 bits (338),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 95/249 (38%), Positives = 134/249 (54%), Gaps = 21/249 (8%)
 Frame = +1

Query  265  VQWPCRELDGWEFAGGDEEEMVAAGEPLPRLIFGGAPSLQEAKEATFDLKDALHKVYNMS  444
            V  P  E D WEFA  + +  + +    PR++FG  PS  EAKEAT ++K+AL KVY   
Sbjct  67   VHKPTWEFDDWEFANFENDMGMDSVGLKPRIVFGAVPSFDEAKEATMEVKEALDKVYLSP  126

Query  445  TPPSDCGSTNGAAQVNNDHsppsnsssenAIA--HGAPKHAIRAFKFLYENAAAQTVVAS  618
            +P SD   +N    +N      S  S+E ++   +  P+HAI+AFK L E+A AQTVVAS
Sbjct  127  SPESD--GSNLIVPLNRKIESVSCLSNETSLQSQNSVPQHAIQAFKLLKESAEAQTVVAS  184

Query  619  IASDPNVWNAVLANPELQEFLVSQKTSAYVLDGEYS--VEESIAETDFLRYSSPRNDDLT  792
            IASDPNVWNA+L N  L+ FL S + +  V   E +  VEE  A   +     P+N+   
Sbjct  185  IASDPNVWNAMLGNEALKSFLQSYQNNKVVEYHELTEGVEE--ASVGYSIGEQPQNESR-  241

Query  793  SEDGSPKPGNGFTDFLQNIKVAVLDMMNCLSDFFQNLFG---GHKVFADADGSAKTSVVD  963
                     N F   L+NIK ++ DM+   S F QN+FG         + + ++  S  +
Sbjct  242  ---------NVFQKMLENIKTSIDDMLAKASSFIQNIFGPPPAEVSGGNDEATSGFSTAE  292

Query  964  RAWGASFMG  990
            +A G+S MG
Sbjct  293  KAMGSSIMG  301



>ref|NP_200265.1| uncharacterized protein [Arabidopsis thaliana]
 dbj|BAB09333.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAL25598.1| AT5g54540/MRB17_4 [Arabidopsis thaliana]
 gb|AAM19986.1| AT5g54540/MRB17_4 [Arabidopsis thaliana]
 gb|AED96508.1| uncharacterized protein AT5G54540 [Arabidopsis thaliana]
Length=297

 Score =   134 bits (336),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 102/261 (39%), Positives = 139/261 (53%), Gaps = 32/261 (12%)
 Frame = +1

Query  253   DGAPVQWPCRELDGWEFAGGDEEEMVAAGEPLPRLIFGGAPSLQEAKEATFDLKDALHKV  432
             DG  +Q P    D WEFA    EE     EP+PR++F   PSL+EAKEAT DLK+A++ V
Sbjct  64    DGMIMQRPV--WDDWEFA----EE-----EPIPRVVFSKPPSLEEAKEATEDLKEAINLV  112

Query  433   YNMSTPPSDC---GSTNGAAQVNNDHsppsnsssenAIAHGAPKHAIRAFKFLYENAAAQ  603
             Y MS+P S     GS +G +   +       SS   A+    P+ A++AF FL EN AAQ
Sbjct  113   Y-MSSPKSSAAMEGSNDGGSV--SKMLSGFQSSENRAVESAVPQVALQAFAFLSENTAAQ  169

Query  604   TVVASIASDPNVWNAVLANPELQEFLVSQKTSAYVLDGEYSVEESIAETDFLRYSSPRND  783
             TVVASIASDP VW+AV+ N +L +FL + KT+            S  E+D     S R+ 
Sbjct  170   TVVASIASDPKVWDAVMENKDLMKFLQTNKTAV----------SSQVESDN-DDQSERSS  218

Query  784   DLTSEDGSPKPGNGFTDFLQNIKVAVLDMMNCLSDFFQNLFGGHKVFADADGSAKTSVVD  963
                 E    KP     + LQ++K+  + +M  +S +F +LFG   V  D     +T   D
Sbjct  219   TTECEVVETKPME-LLEILQDMKLKAVRLMENVSSYFGDLFGLGSVTEDGKDKKQTLFND  277

Query  964   RAWGASFMGLAIMAIMVVVLK  1026
                  S  GLA++ I +VVLK
Sbjct  278   ---PRSLFGLAVVVIFMVVLK  295



>ref|XP_010443028.1| PREDICTED: uncharacterized protein LOC104725975 [Camelina sativa]
Length=305

 Score =   132 bits (333),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 102/264 (39%), Positives = 137/264 (52%), Gaps = 36/264 (14%)
 Frame = +1

Query  253   DGAPVQWPCRELDGWEFAGGDEEEMVAAGEPLPRLIFGGAPSLQEAKEATFDLKDALHKV  432
             DG  +Q P    D WEFA   EEE     EP+PR++F   PSL+EAKEAT DLK+A++ V
Sbjct  70    DGMVMQRPV--WDDWEFA---EEE-----EPIPRVVFSKPPSLEEAKEATEDLKEAINMV  119

Query  433   YNMSTPPSDCGSTNGAAQVNND------HsppsnsssenAIAHGAPKHAIRAFKFLYENA  594
             Y MS+P S   +  G+    ND            SS   A+    P+ A++AF FL EN 
Sbjct  120   Y-MSSPNSSSAAIEGS----NDGGSVSKMLSGLQSSENRAVESAVPQAALQAFAFLSENT  174

Query  595   AAQTVVASIASDPNVWNAVLANPELQEFLVSQKTSAYVLDGEYSVEESIAETDFLRYSSP  774
             AAQTVVASIA DP VW+AV+ N +L +FL +  T+A           S  E+D     S 
Sbjct  175   AAQTVVASIACDPKVWDAVMENKDLMKFLKTNNTAAS----------SQVESDN-DDQSE  223

Query  775   RNDDLTSEDGSPKPGNGFTDFLQNIKVAVLDMMNCLSDFFQNLFGGHKVFADADGSAKTS  954
             R+     E    KP     + LQ++K+ V+ MM  +S +F  LFG      +     +T 
Sbjct  224   RSSTTECEVMEEKPLE-ILEILQDVKLKVVRMMENVSSYFGGLFGLGSETEEGKDKKQTL  282

Query  955   VVDRAWGASFMGLAIMAIMVVVLK  1026
               D     S  GLA++ I +VVLK
Sbjct  283   FND---PRSLFGLAVVVIFMVVLK  303



>ref|XP_008359297.1| PREDICTED: uncharacterized protein LOC103423006 [Malus domestica]
Length=312

 Score =   132 bits (332),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 88/239 (37%), Positives = 132/239 (55%), Gaps = 20/239 (8%)
 Frame = +1

Query  295  WEFAGGDEEEMV-AAGEPLPRLIFGGAPSLQEAKEATFDLKDALHKVYNMSTPPSDCGST  471
            W+  G   +++V + GEP+PR++F  APS +EAKEAT +LKDAL KVY  S   +D G  
Sbjct  77   WQVVGAGXDDLVMSGGEPMPRVVFDAAPSFKEAKEATAELKDALDKVYLSSPKSTDFGEQ  136

Query  472  NGAAQVNN----DHsppsnsssenAIAHGAPKHAIRAFKFLYENAAAQTVVASIASDPNV  639
            + A  V       +  P    S        PKHA+RAF+ L +++ AQ VVASIASDPN+
Sbjct  137  SAADNVAGLSLITNPEPEEMESLLLTRTSVPKHALRAFEMLSQSSEAQNVVASIASDPNI  196

Query  640  WNAVLANPELQEFLVSQKTSAYVLDGEYSVEESIAETDFLRYSSPRNDDLTSEDGSPKPG  819
            WNA++ N E+++F+ ++  + Y       +EE  A+TD + +    ++   S+      G
Sbjct  197  WNAMMENSEVKQFMANKNYNHY-------MEEYAADTDPVSHKKLEDESEKSDXLEDMLG  249

Query  820  NGFTDFLQNIKVAVLDMMNCLSDFFQNLFGGHKVFADADGSAKTSVVDRAWGASFMGLA  996
                 F++ IK+ V   ++ LS F QN+F       +ADG    SVV     ++FMGLA
Sbjct  250  G----FVKKIKMTVEKWVSDLSSFIQNIFEPPAGETEADGGNTKSVV----ASAFMGLA  300



>ref|XP_010482859.1| PREDICTED: uncharacterized protein LOC104761470 [Camelina sativa]
Length=306

 Score =   131 bits (330),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 102/264 (39%), Positives = 139/264 (53%), Gaps = 36/264 (14%)
 Frame = +1

Query  253   DGAPVQWPCRELDGWEFAGGDEEEMVAAGEPLPRLIFGGAPSLQEAKEATFDLKDALHKV  432
             DG  +Q P    D WEFA   EEE     EP+PR++F   PSL+EAKEAT DLK+A++ V
Sbjct  71    DGMVMQRPV--WDDWEFA---EEE-----EPIPRVVFSKPPSLEEAKEATEDLKEAINMV  120

Query  433   YNMSTPPSDCGSTNGAAQVNND------HsppsnsssenAIAHGAPKHAIRAFKFLYENA  594
             Y MS+P     S++ A + +ND            SS   A+    P+ A++AF FL EN 
Sbjct  121   Y-MSSP----NSSSAAIERSNDGGSVSKMISGLQSSENRAVESPVPQVALQAFAFLSENT  175

Query  595   AAQTVVASIASDPNVWNAVLANPELQEFLVSQKTSAYVLDGEYSVEESIAETDFLRYSSP  774
             AAQTVVASIA DP VW+AV+ N +L +FL +  T+A           S  E+D     S 
Sbjct  176   AAQTVVASIACDPKVWDAVMENKDLMKFLKTNNTAAS----------SQVESDN-DDQSE  224

Query  775   RNDDLTSEDGSPKPGNGFTDFLQNIKVAVLDMMNCLSDFFQNLFGGHKVFADADGSAKTS  954
             R+     E    KP     + LQ++K+ V+ MM  +S +F  LFG      +     +T 
Sbjct  225   RSSTTECEVMEEKPLE-ILEILQDVKLKVVRMMENVSSYFGGLFGLGSETEEGKDKKQTL  283

Query  955   VVDRAWGASFMGLAIMAIMVVVLK  1026
               D     S  GLA++ I +VVLK
Sbjct  284   FND---PRSLFGLAVVVIFMVVLK  304



>gb|KHN27993.1| hypothetical protein glysoja_007725 [Glycine soja]
Length=275

 Score =   130 bits (328),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 90/262 (34%), Positives = 142/262 (54%), Gaps = 38/262 (15%)
 Frame = +1

Query  283   ELDGWEFAGGDEEEMVAAGEPLPRLIFGGAPSLQEAKEATFDLKDALHKVYNMSTPPSDC  462
             E+   + A  D+E+    GE   R++ G  PS+QEAK AT +LK A+HKVY +S+  S+C
Sbjct  36    EVSPLQAAAWDDED----GEGAARVVLGDVPSIQEAKAATAELKHAIHKVY-LSSNSSEC  90

Query  463   GSTNGAAQVN----NDHsppsnsssenAIAH-GAPKHAIRAFKFLYENAAAQTVVASIAS  627
                + + QV+    +     + S    AI +  AP  A++AF+ L E+  AQ+VVASIA 
Sbjct  91    DGCSLSGQVSVVSPSHTELENKSHFTEAITYPSAPNRALQAFQLLSESPEAQSVVASIAC  150

Query  628   DPNVWNAVLANPELQEFLVSQKTSAYVLDGEYSVEESIAETDFLRYSSPRNDDLTSEDGS  807
             DPN+WNA+  NP LQ+F  S +T+ + ++G +  ++ +   DFL   S            
Sbjct  151   DPNIWNAIAQNPTLQDFFQSHQTADFEVEGTH--DQRVG--DFLYSDSVY----------  196

Query  808   PKPGNGFTD---FLQNIKVAVLDMMNCLSDFFQNLFG-----GHKVFADADGSAKTSVVD  963
                   F D    L N+   V +M++ +S++ QN+FG           DA G+ K + VD
Sbjct  197   -----AFVDSLNILHNVNFTVTEMVSSVSNYLQNMFGFLTGQTSSAVIDARGNTKANFVD  251

Query  964   -RAWGASFMGLAIMAIMVVVLK  1026
                 G +F+GLA++ +MV++LK
Sbjct  252   PITMGGTFLGLAVLVVMVIMLK  273



>ref|XP_002864339.1| hypothetical protein ARALYDRAFT_495534 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH40598.1| hypothetical protein ARALYDRAFT_495534 [Arabidopsis lyrata subsp. 
lyrata]
Length=297

 Score =   130 bits (328),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 102/268 (38%), Positives = 139/268 (52%), Gaps = 46/268 (17%)
 Frame = +1

Query  253   DGAPVQWPCRELDGWEFAGGDEEEMVAAGEPLPRLIFGGAPSLQEAKEATFDLKDALHKV  432
             DG  +Q P    D WEFA    EE     EP+PR++F   PSL+EAKEAT DLK+A++ V
Sbjct  64    DGMIMQRPV--WDDWEFA----EE-----EPIPRVVFSKPPSLEEAKEATEDLKEAINMV  112

Query  433   YNMSTPPSDC---GSTNGAAQVNNDHsppsnsssenAIAHGAPKHAIRAFKFLYENAAAQ  603
             Y MS+P S     GS +G A   +       SS   A+    P+ A++AF FL EN AAQ
Sbjct  113   Y-MSSPKSSAAMEGSNDGGAV--SKMLSGFQSSENRAVESAVPQVALQAFAFLSENTAAQ  169

Query  604   TVVASIASDPNVWNAVLANPELQEFLVSQKTSAYVLDGEYSVEESIAETDFLRYSSPRND  783
             TVVASIA DP VW+AV+ N +L +FL +  T+A           S  E+D        ND
Sbjct  170   TVVASIACDPKVWDAVMENKDLMKFLQTNNTAA----------SSQVESD--------ND  211

Query  784   DLTSEDGS-------PKPGNGFTDFLQNIKVAVLDMMNCLSDFFQNLFGGHKVFADADGS  942
             D +    +        KP     + LQ++K+  + +M  +S +F +LFG   V  D    
Sbjct  212   DQSEHSSTTECEVMETKPME-LLEILQDMKLKAVRLMENVSSYFGDLFGLGSVTEDGKDK  270

Query  943   AKTSVVDRAWGASFMGLAIMAIMVVVLK  1026
              +T   D     S  GLA++ I +VVLK
Sbjct  271   KQTLFND---PRSLFGLAVVVIFMVVLK  295



>ref|XP_006594801.1| PREDICTED: uncharacterized protein LOC100779229 [Glycine max]
Length=282

 Score =   130 bits (326),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 87/259 (34%), Positives = 139/259 (54%), Gaps = 36/259 (14%)
 Frame = +1

Query  283   ELDGWEFAGGDEEEMVAAGEPLPRLIFGGAPSLQEAKEATFDLKDALHKVYNMSTPPSDC  462
             ++D WE A G        GE  PR++ GG PS QEA  AT +LK A+ K+Y +S+  S+C
Sbjct  47    DVDDWEVADG--------GEGTPRVVLGGVPSFQEATSATTELKHAIDKIY-LSSNSSEC  97

Query  463   GSTNGAAQVN-----NDHsppsnsssenAIAHGAPKHAIRAFKFLYENAAAQTVVASIAS  627
                + +  V+     +      +  +E  +       A++AF+ L E   AQ+VVASIA 
Sbjct  98    DGCSLSGHVSVMSPSHSELENKSRVTEAILNPSESNRALQAFQLLSECPEAQSVVASIAC  157

Query  628   DPNVWNAVLANPELQEFLVSQKTSAYVLDGEYSVEESIAETDFLRYSSPRNDDLTSEDGS  807
             DPN+WNA++ NP LQ+F  SQ+T+      ++ VEE+    D    + P +D + +   S
Sbjct  158   DPNIWNAIVQNPALQDFFQSQQTA------DFEVEET---HDQRLGNLPYSDSVYAFIDS  208

Query  808   PKPGNGFTDFLQNIKVAVLDMMNCLSDFFQNLFG-----GHKVFADADGSAKTSVVDR-A  969
                     + LQN+K  V +M++ + ++ QN+FG           DA G+ K + +D   
Sbjct  209   -------LNVLQNVKFTVSEMLSRVPNYLQNMFGFLSGQTSSAVIDARGNTKANFIDPIT  261

Query  970   WGASFMGLAIMAIMVVVLK  1026
              G +FMGLA++ +MV++LK
Sbjct  262   MGGTFMGLAVLVVMVIMLK  280



>ref|XP_008226793.1| PREDICTED: uncharacterized protein LOC103326356 [Prunus mume]
Length=313

 Score =   130 bits (327),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 95/253 (38%), Positives = 143/253 (57%), Gaps = 25/253 (10%)
 Frame = +1

Query  295   WEFAGGDEEEMV-AAGEPLPRLIFGGAPSLQEAKEATFDLKDALHKVYNMSTPPSD----  459
             W+  G  +EE+V +AGEP+PR++F  APS +EA+EAT +LKDAL KVY +S+P S     
Sbjct  75    WQVVGAADEELVMSAGEPMPRVVFDAAPSFKEAREATTELKDALDKVY-LSSPKSTEFGK  133

Query  460   ---CGSTNGAAQVNNDHsppsnsssenAIAHGAPKHAIRAFKFLYENAAAQTVVASIASD  630
                    +G +Q+ N       S      +   PKHA +AF+ L  +  AQ VVASIASD
Sbjct  134   QSAADKVSGLSQITNPEPEEVESLILTRTS--VPKHAFQAFEMLSRSTEAQNVVASIASD  191

Query  631   PNVWNAVLANPELQEFLVSQKTSAYVLDGEYSVEESIAETDFLRYSSPRN-DDLTSEDGS  807
             PN+WNA++ N  +++FL S K +  + + EY     +++T+     SP+  +D    DG 
Sbjct  192   PNIWNAMMENSAVKQFLESNK-NYKLYEPEY-----VSDTELSDPVSPKKREDKDKSDGF  245

Query  808   PKPGNGFTDFLQNIKVAVLDMMNCLSDFFQNLFGGHKVFADADGSAKTSVVDRAWGASFM  987
                 +G   F+Q IK+ V   +  LS + QN+F       +AD +  T  V     ++FM
Sbjct  246   EAVLHG---FVQKIKLTVDRWVGDLSTYVQNIFPSPAENGNADENGNTKTV----ASAFM  298

Query  988   GLAIMAIMVVVLK  1026
             GLA+M +MVV++K
Sbjct  299   GLAVMVVMVVLMK  311



>gb|KHN38595.1| hypothetical protein glysoja_040149 [Glycine soja]
Length=246

 Score =   128 bits (322),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 95/250 (38%), Positives = 136/250 (54%), Gaps = 32/250 (13%)
 Frame = +1

Query  355   LIFGGAPSLQEAKEATFDLKDALHKVYNMSTPPSDCGSTNG---------AAQVN----N  495
             ++FG  P+  EAKEAT +LKDA+ +VY   +P S   S+ G           QV+     
Sbjct  1     MVFGSVPTFAEAKEATAELKDAIDQVY--LSPESSQYSSRGGQVSALSPTGGQVSALSPT  58

Query  496   DHsppsnsssenAIA-HGAPKHAIRAFKFLYENAAAQTVVASIASDPNVWNAVLANPELQ  672
              + P + S   +AI+   APKHAI+AF  L  +  AQ VVAS+A DPNVWNAV+ NP + 
Sbjct  59    LYEPVNRSCVVDAISDSSAPKHAIQAFHLLSTSREAQAVVASLACDPNVWNAVMENPAVS  118

Query  673   EFLVSQKTSAYVLDGEYSVEE--SIAETDFLRYSSPRNDDLTSEDGSPKPGNG---FTDF  837
              F  SQ++ A  L    + EE    +        SP    +++E     PGNG   F D 
Sbjct  119   SFFQSQQSVAD-LGAAGNTEELDKFSSCTSETVESPEKLGVSAES---HPGNGIFDFMDL  174

Query  838   LQNIKVAVLDMMNCLSDFFQNLFG-----GHKVFADADGSAKTSVVDR--AWGASFMGLA  996
             LQN+K+ V+++++ +S F QN+F        K+  D DG+ K S +D   + G +F GLA
Sbjct  175   LQNVKLTVIELVSRVSGFLQNIFPPPDAMKEKMSGDVDGNTKASFMDSKISMGGTFTGLA  234

Query  997   IMAIMVVVLK  1026
             I+ IMV+V K
Sbjct  235   IIVIMVIVTK  244



>ref|XP_006280901.1| hypothetical protein CARUB_v10026894mg [Capsella rubella]
 gb|EOA13799.1| hypothetical protein CARUB_v10026894mg [Capsella rubella]
Length=291

 Score =   128 bits (322),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 102/265 (38%), Positives = 136/265 (51%), Gaps = 47/265 (18%)
 Frame = +1

Query  253   DGAPVQWPCRELDGWEFAGGDEEEMVAAGEPLPRLIFGGAPSLQEAKEATFDLKDALHKV  432
             DG  VQ P    D WEFA    EE     EP+PR++F   PSL+EAKEAT DLK+A++ V
Sbjct  65    DGMAVQRPV--WDDWEFA----EE-----EPIPRVVFSKPPSLEEAKEATEDLKEAINMV  113

Query  433   YNMSTPPSDC---GSTNGAAQVNNDHsppsnsssenAIAHGAPKHAIRAFKFLYENAAAQ  603
             Y M++P S     GS+N    V+         S   +     P+ A++AF FL EN AAQ
Sbjct  114   Y-MTSPKSSAAMEGSSNDGGSVSK------MLSGFQSSEKAVPQVALQAFSFLSENTAAQ  166

Query  604   TVVASIASDPNVWNAVLANPELQEFLVSQKTSAYVLDGEYSVEESIAETDFLRYSSPRND  783
             TVVASIA DP VW+AV+ N +L +FL +  T+A           S  E+D        ND
Sbjct  167   TVVASIACDPKVWDAVMENKDLMKFLQTNNTAA----------SSQVESD--------ND  208

Query  784   DLTS----EDGSPKPGNGFTDFLQNIKVAVLDMMNCLSDFFQNLFGGHKVFADADGSAKT  951
             D  S    E    KP     + LQ++K+ V+ MM  +S +F  LFG      D     +T
Sbjct  209   DQFSTTECEVIEEKPLE-ILEILQDMKLKVVRMMENVSSYFGGLFGLGSETEDGKDKKQT  267

Query  952   SVVDRAWGASFMGLAIMAIMVVVLK  1026
                D     +  GLA++ I +VVLK
Sbjct  268   LFND---PRTLFGLAVVVIFMVVLK  289



>ref|XP_009355556.1| PREDICTED: uncharacterized protein LOC103946557 [Pyrus x bretschneideri]
Length=312

 Score =   128 bits (321),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 87/239 (36%), Positives = 126/239 (53%), Gaps = 20/239 (8%)
 Frame = +1

Query  295  WEFAGGDEEEMV-AAGEPLPRLIFGGAPSLQEAKEATFDLKDALHKVYNMSTPPSDCGST  471
            W+  G  E+++V + GEP PR++F  APS +EAKEAT +LKDAL KVY  S   +D G  
Sbjct  77   WQVVGAGEDDLVMSGGEPTPRVVFDAAPSFKEAKEATAELKDALDKVYLSSPKSTDFGEV  136

Query  472  NGAAQVNN----DHsppsnsssenAIAHGAPKHAIRAFKFLYENAAAQTVVASIASDPNV  639
            + A  V       +  P    S        PKHA+ AF+ L  ++ AQ VVASIASDPN+
Sbjct  137  SAADNVAGLSLITNPEPEEMESLLLTRTSVPKHALHAFEMLSRSSEAQNVVASIASDPNI  196

Query  640  WNAVLANPELQEFLVSQKTSAYVLDGEYSVEESIAETDFLRYSSPRNDDLTSEDGSPKPG  819
            WNA++ N  +++F+ ++  + Y+   EY+ +        L   S ++D L    G     
Sbjct  197  WNAMMENSAVKQFMANKNYNRYM--EEYAADTYPVSHKKLEDESEKSDRLEDMLGG----  250

Query  820  NGFTDFLQNIKVAVLDMMNCLSDFFQNLFGGHKVFADADGSAKTSVVDRAWGASFMGLA  996
                 F+Q IK+ V   ++  S F QN+F       +ADG    SVV     ++FMGLA
Sbjct  251  -----FVQKIKLTVEKWVSDFSSFIQNIFEPPAAETEADGGNTKSVV----ASAFMGLA  300



>ref|XP_008365896.1| PREDICTED: uncharacterized protein LOC103429531 [Malus domestica]
Length=307

 Score =   126 bits (317),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 86/241 (36%), Positives = 125/241 (52%), Gaps = 24/241 (10%)
 Frame = +1

Query  295  WEFAGGDEEEMV-AAGEPLPRLIFGGAPSLQEAKEATFDLKDALHKVYNMSTPPSDCGST  471
            W+  G  E+++V + GEP+PR++F  APS +EAKEAT +LKDAL KVY  S   +D G  
Sbjct  72   WQVVGAGEDDLVMSGGEPMPRVVFDAAPSFKEAKEATAELKDALDKVYLSSPKSTDLGEP  131

Query  472  NGAAQ------VNNDHsppsnsssenAIAHGAPKHAIRAFKFLYENAAAQTVVASIASDP  633
            + AA       + N       S      +   PKHA+ AF+ L   + AQ VVASI SDP
Sbjct  132  SAAADAAGLPLIKNPEPEEMESLLLTRTS--VPKHALHAFEMLSRCSEAQNVVASITSDP  189

Query  634  NVWNAVLANPELQEFLVSQKTSAYVLDGEYSVEESIAETDFLRYSSPRNDDLTSEDGSPK  813
            N+W A++ N  +++F+ ++  + Y    E++     A    L   S ++D L    G   
Sbjct  190  NIWXAMMENSAVKQFMANKNYNLYTX--EHAAXTYPASPKKLEDESEKSDSLEDMLGG--  245

Query  814  PGNGFTDFLQNIKVAVLDMMNCLSDFFQNLFGGHKVFADADGSAKTSVVDRAWGASFMGL  993
                   F+Q IK+ V   +N LS F QN+F      A+ADG    + V     ++FMGL
Sbjct  246  -------FMQKIKLTVDKWVNDLSSFIQNIFEPPAAEAEADGGNTGAAV----ASAFMGL  294

Query  994  A  996
            A
Sbjct  295  A  295



>ref|XP_008454598.1| PREDICTED: uncharacterized protein LOC103494971 isoform X2 [Cucumis 
melo]
Length=295

 Score =   125 bits (315),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 90/248 (36%), Positives = 126/248 (51%), Gaps = 39/248 (16%)
 Frame = +1

Query  265  VQWPCRELDGWEFAGGDEEEMVAAGEPLPRLIFGGAPSLQEAKEATFDLKDAL-HKVYNM  441
            V  P  E D WEFA  + +  + +    PR++FG  PS  EAKEAT ++K+AL  K+ ++
Sbjct  67   VHKPTWEFDDWEFANFENDMGMDSVGLKPRIVFGAVPSFDEAKEATMEVKEALDKKIESV  126

Query  442  STPPSDCGSTNGAAQVNNDHsppsnsssenAIAHGAPKHAIRAFKFLYENAAAQTVVASI  621
            S     C S   + Q  N                  P+HAI+AFK L E+A AQTVVASI
Sbjct  127  S-----CLSNETSLQSQNS----------------VPQHAIQAFKLLKESAEAQTVVASI  165

Query  622  ASDPNVWNAVLANPELQEFLVSQKTSAYVLDGEYS--VEESIAETDFLRYSSPRNDDLTS  795
            ASDPNVWNA+L N  L+ FL S + +  V   E +  VEE  A   +     P+N+    
Sbjct  166  ASDPNVWNAMLGNEALKSFLQSYQNNKVVEYHELTEGVEE--ASVGYSIGEQPQNESR--  221

Query  796  EDGSPKPGNGFTDFLQNIKVAVLDMMNCLSDFFQNLFG---GHKVFADADGSAKTSVVDR  966
                    N F   L+NIK ++ DM+   S F QN+FG         + + ++  S  ++
Sbjct  222  --------NVFQKMLENIKTSIDDMLAKASSFIQNIFGPPPAEVSGGNDEATSGFSTAEK  273

Query  967  AWGASFMG  990
            A G+S MG
Sbjct  274  AMGSSIMG  281



>ref|XP_006592890.1| PREDICTED: uncharacterized protein LOC100795500 isoform X2 [Glycine 
max]
Length=258

 Score =   124 bits (310),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 86/253 (34%), Positives = 130/253 (51%), Gaps = 40/253 (16%)
 Frame = +1

Query  289   DGWEFAGGDEEEMVAAGEPLPRLIFGGAPSLQEAKEATFDLKDALHKVYNMSTPPSDCGS  468
             D WE A G EE+    GE   R++ G  PS+QEAK AT +LK A+H        PS    
Sbjct  37    DDWEVADGGEED----GEGAARVVLGDVPSIQEAKAATAELKHAIHNGQVSVVSPSHTEL  92

Query  469   TNGAAQVNNDHsppsnsssenAIAH-GAPKHAIRAFKFLYENAAAQTVVASIASDPNVWN  645
              N +                 AI +  AP  A++AF+ L E+  AQ+VVASIA DPN+WN
Sbjct  93    ENKS-------------HFTEAITYPSAPNRALQAFQLLSESPEAQSVVASIACDPNIWN  139

Query  646   AVLANPELQEFLVSQKTSAYVLDGEYSVEESIAETDFLRYSSPRNDDLTSEDGSPKPGNG  825
             A+  NP LQ+F  S +T+ + ++G +  ++ +   DFL YS      + S          
Sbjct  140   AIAQNPTLQDFFQSHQTADFEVEGTH--DQRVG--DFL-YSDSVYAFVDS----------  184

Query  826   FTDFLQNIKVAVLDMMNCLSDFFQNLFG-----GHKVFADADGSAKTSVVD-RAWGASFM  987
               + L N+   V +M++ +S++ QN+FG           DA G+ K + VD    G +F+
Sbjct  185   -LNILHNVNFTVTEMVSSVSNYLQNMFGFLTGQTSSAVIDARGNTKANFVDPITMGGTFL  243

Query  988   GLAIMAIMVVVLK  1026
             G A++ +MV++LK
Sbjct  244   GFAVLVVMVIMLK  256



>gb|KFK27065.1| hypothetical protein AALP_AA8G329900 [Arabis alpina]
Length=296

 Score =   124 bits (312),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 96/246 (39%), Positives = 130/246 (53%), Gaps = 29/246 (12%)
 Frame = +1

Query  289   DGWEFAGGDEEEMVAAGEPLPRLIFGGAPSLQEAKEATFDLKDALHKVYNMSTPPSDCGS  468
             D WEFA    EE     EP+PR++F   P+LQEAKEAT DLK+A++ VY + +P S   S
Sbjct  78    DDWEFA----EE-----EPIPRVVFSKPPTLQEAKEATEDLKEAINMVY-IKSPTSKEDS  127

Query  469   TNGAAQVNNDHsppsnsssenAIAHGAPKHAIRAFKFLYENAAAQTVVASIASDPNVWNA  648
               G++   +   P   SS   AI    P+ A++AF FL EN AAQTVVASIASDP VW+A
Sbjct  128   NEGSSV--SKMFPSFQSSENRAIESAVPQVALQAFAFLSENTAAQTVVASIASDPKVWDA  185

Query  649   VLANPELQEFLVSQKTSAYVLDGEYSVEESIAETDFLRYSSPRNDDLTSEDGSPKPGNGF  828
             V+ N +L +FL S  T          V     E D    S   +  L  E+ S       
Sbjct  186   VMENKDLMKFLESNNT----------VASPQVEADDDDQSEDSSTTLCEEEKS----IDL  231

Query  829   TDFLQNIKVAVLDMMNCLSDFFQNLFGGHKVFADADGSAKTSVVDRAWGASFMGLAIMAI  1008
              + LQ++K+  + +M  +S +F  LFG   V  D +   +T   D     S  GLA++ I
Sbjct  232   LEILQDMKLKAVRLMENVSSYFGGLFGFGSVAEDGEEKKQTFFND---PRSLFGLAVVVI  288

Query  1009  MVVVLK  1026
              +VVLK
Sbjct  289   FMVVLK  294



>ref|XP_002530912.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF31461.1| conserved hypothetical protein [Ricinus communis]
Length=198

 Score =   121 bits (303),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 72/144 (50%), Positives = 91/144 (63%), Gaps = 18/144 (13%)
 Frame = +1

Query  268  QWPCREL-DGWEFAGGDEEEMVAAGEPLPRLIFGGAPSLQEAKEATFDLKDALHKVYNMS  444
            Q P  E+ D WE AG +E E +   EPLPRL+FGG PSL+EAK AT ++KDAL KVY +S
Sbjct  65   QGPAFEVSDDWEIAGFEESEELQLIEPLPRLVFGGPPSLEEAKAATSEVKDALEKVY-LS  123

Query  445  TPPSDCGSTNGAAQVNNDHsppsnsssenAIAHGAPKHAIRAFKFLYENAAAQTVVASIA  624
            +P  +  S      + +D           A A  AP HAI+AF  L  +  AQT+VASIA
Sbjct  124  SPGLETTSC-----IISD-----------ARASSAPTHAIKAFTLLNRSPQAQTIVASIA  167

Query  625  SDPNVWNAVLANPELQEFLVSQKT  696
            +DPNVW+AVL N  LQE+L+SQ T
Sbjct  168  TDPNVWDAVLKNGALQEYLLSQNT  191



>ref|XP_009393345.1| PREDICTED: uncharacterized protein LOC103979052 [Musa acuminata 
subsp. malaccensis]
Length=313

 Score =   121 bits (303),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 92/255 (36%), Positives = 120/255 (47%), Gaps = 42/255 (16%)
 Frame = +1

Query  286   LDGW-EFAGGDEEEMVAAGEPLPRLIFGGAPSLQEAKEATFDLKDALHKVYNMSTPPSDC  462
              DGW E+  G   + V   +P PRL+FG  P+L+EAKEAT DL DA  KVY    PPS  
Sbjct  91    FDGWAEYEQGITLDPV---QPAPRLVFGSIPTLEEAKEATSDLIDAFDKVY----PPSHN  143

Query  463   GSTNGAAQVNNDHsppsnsssenAIAHGAPKHAIRAFKFLYENAAAQTVVASIASDPNVW  642
                   A  +  H          +I    P+H +  F  L  +   QTVVASIASD NVW
Sbjct  144   VPAIEVAHKSAHHEAS-------SIIPSMPRHVVETFSLLQRSPEVQTVVASIASDENVW  196

Query  643   NAVLANPELQEFLVSQKTSAYVLDGE--YSVEESIAETDFLRYSSPRNDDLTSEDGSPKP  816
             NAV  N ++ EF    KT   V+  E   + E  +AE D     +  N            
Sbjct  197   NAVTKNEKVMEFY---KTHLSVVHPEPIVTTEVPVAENDHGSSCAKANK-----------  242

Query  817   GNGFTDFLQNIKVAVLDMMNCLSDFFQNLFGGHKVFADADGSAKTSVVDRAW-----GAS  981
              + F+DFL N+K  V+DM   +S   Q  FG      ++ G++     D  +     GAS
Sbjct  243   SSAFSDFLHNVKNKVVDMACNISSLLQEHFG------NSSGTSSPKTPDGPFAQFPMGAS  296

Query  982   FMGLAIMAIMVVVLK  1026
              M LAI  IMVV+ K
Sbjct  297   LMTLAITVIMVVLFK  311



>ref|XP_002443952.1| hypothetical protein SORBIDRAFT_07g004990 [Sorghum bicolor]
 gb|EES13447.1| hypothetical protein SORBIDRAFT_07g004990 [Sorghum bicolor]
Length=313

 Score =   119 bits (299),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 97/273 (36%), Positives = 138/273 (51%), Gaps = 38/273 (14%)
 Frame = +1

Query  259   APVQWPCR-ELDGWEFAGGDEEEMVAAGEPL----------PRLIFGGAPSLQEAKEATF  405
             A  QW    ELD WEFA   ++   AA              PRL+F   PS +EA+EAT 
Sbjct  60    ATAQWAASWELDDWEFADWRDDSAAAAVVVAEREATAAAAKPRLVFA-PPSREEAEEATS  118

Query  406   DLKDALHKVYNMSTPPSDCGSTNGAAQVNNDHsppsnsssenAIAHGAPKHAIRAFKFLY  585
             +L+DA+ + Y   TP           +V  +     N  + +AI    P H ++AF  L 
Sbjct  119   ELRDAIERAYFNETP----------VEVVKEQDKEFNKQATDAIIPSMPGHVVQAFTLLK  168

Query  586   ENAAAQTVVASIASDPNVWNAVLANPELQEFLVSQKTSAYVLDGEYSVEESIAETDFLRY  765
              +  AQ+VVAS+ASD NVW AVL N ++ EF  + +T+   L   +  E +  E      
Sbjct  169   SSPEAQSVVASLASDRNVWEAVLKNEKVMEFYKNHQTT---LVETFPEEAATVE------  219

Query  766   SSPRN-DDLTSEDGSPK---PGNGFTDFLQNIKVAVLDMMNCLSDFFQNLF--GGHKVFA  927
              SP N +D TSE+ S      G+ F+DF+ N K  V+D++  ++DFF++LF   G +  A
Sbjct  220   -SPGNFEDATSENASNTELPTGSPFSDFVDNAKKRVMDVIYNITDFFKDLFDSAGAQDGA  278

Query  928   DADGSAKTSVVDRAWGASFMGLAIMAIMVVVLK  1026
                     S  + A G SFM LAI  I+VV+LK
Sbjct  279   GPSAEKGPSAAEMALGGSFMALAIGVILVVLLK  311



>ref|XP_006401561.1| hypothetical protein EUTSA_v10014255mg [Eutrema salsugineum]
 gb|ESQ43014.1| hypothetical protein EUTSA_v10014255mg [Eutrema salsugineum]
Length=292

 Score =   119 bits (298),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 93/246 (38%), Positives = 124/246 (50%), Gaps = 32/246 (13%)
 Frame = +1

Query  289   DGWEFAGGDEEEMVAAGEPLPRLIFGGAPSLQEAKEATFDLKDALHKVYNMSTPPSDCGS  468
             D WEFA   EEE       +PR++F   PSLQEAKEAT DLK+A++ VY         GS
Sbjct  77    DDWEFA---EEEPT-----IPRVVFSKPPSLQEAKEATEDLKEAINLVYIE-------GS  121

Query  469   TNGAAQVNNDHsppsnsssenAIAHGAPKHAIRAFKFLYENAAAQTVVASIASDPNVWNA  648
               G +   +       +S   A+    P+ A++AF FL ENAAAQ+VVASIASDP VW+A
Sbjct  122   NEGGSV--SKMLSSFQASENRAVESAVPQVALQAFAFLSENAAAQSVVASIASDPKVWDA  179

Query  649   VLANPELQEFLVSQKTSAYVLDGEYSVEESIAETDFLRYSSPRNDDLTSEDGSPKPGNGF  828
             V+ N +L +FL +  T          V  S  ETD     S  +    SED   KP    
Sbjct  180   VMENKDLMKFLETNNT----------VGSSQVETDN-DEKSEDSSTTESEDSEAKPIE-L  227

Query  829   TDFLQNIKVAVLDMMNCLSDFFQNLFGGHKVFADADGSAKTSVVDRAWGASFMGLAIMAI  1008
              + L+++K+  L +M  +S +F  LF       D     +T   D     S  GLA+  I
Sbjct  228   LEILRDMKLKALRLMENVSSYFGGLFRSESFTEDGKEKKQTLYND---PRSLFGLAVCVI  284

Query  1009  MVVVLK  1026
              +VVLK
Sbjct  285   FMVVLK  290



>ref|XP_006452122.1| hypothetical protein CICLE_v10008955mg [Citrus clementina]
 gb|ESR65362.1| hypothetical protein CICLE_v10008955mg [Citrus clementina]
 gb|KDO74401.1| hypothetical protein CISIN_1g021190mg [Citrus sinensis]
Length=224

 Score =   117 bits (292),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 70/147 (48%), Positives = 95/147 (65%), Gaps = 12/147 (8%)
 Frame = +1

Query  286  LDGWEFAGGDEEEMVAAGEPLPRLIFGGAPSLQEAKEATFDLKDALHKVY--NMSTPPSD  459
            +D WEFAGG ++      EP+PR++FGGAPSL+E KEAT +LKDAL KVY  + ++  S+
Sbjct  69   VDDWEFAGGVDD---LPAEPMPRVVFGGAPSLEETKEATAELKDALDKVYLSSSNSNTSE  125

Query  460  CGSTNGAAQV-------NNDHsppsnsssenAIAHGAPKHAIRAFKFLYENAAAQTVVAS  618
             G      +V       N++H+   +  + +  +   PK AI+AFK L E+ AAQ+VVAS
Sbjct  126  HGDPFVVGEVSSMPLLANSEHTETKSCITYDLKSASVPKPAIQAFKLLSESPAAQSVVAS  185

Query  619  IASDPNVWNAVLANPELQEFLVSQKTS  699
            IA DP VWNAV+ N  L EF+ SQKTS
Sbjct  186  IACDPAVWNAVVKNDALVEFVQSQKTS  212



>ref|XP_011095782.1| PREDICTED: uncharacterized protein LOC105175132 [Sesamum indicum]
Length=198

 Score =   114 bits (286),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 90/208 (43%), Positives = 107/208 (51%), Gaps = 40/208 (19%)
 Frame = +1

Query  94   ITVANSGFRGIASEH-PVSSAARKvvrpvsvsgissssDHLKssavsasqstavDGAPVQ  270
            ITVAN GFR I  EH PV SA  K       +  S                     A VQ
Sbjct  11   ITVANGGFRAITLEHCPVFSATVKAASSRPEASQSQ--------------------AGVQ  50

Query  271  WPCRELDGWEFAGGDEEEMVAAGEPLPRLIFGGAPSLQEAKEATFDLKDALHKVYNMSTP  450
                E+D W FAG   E +V+A + +PR++FGG P+LQEAKEAT DL  AL KVY  S  
Sbjct  51   MTSSEMDDWVFAGEKAEPVVSAVDQMPRVVFGGRPTLQEAKEATSDLTVALEKVYLSSIH  110

Query  451  PSD------------CGSTNGAAQVNNDHsppsnsssenAIAHGAPKHAIRAFKFLYENA  594
             S             C S + +  + N        +SE A+A   P HA  AF+FLYE++
Sbjct  111  SSAGSEVSFAKSLYPCLSVSSSQLIENK-------ASERAVAPAVPAHAFMAFQFLYESS  163

Query  595  AAQTVVASIASDPNVWNAVLANPELQEF  678
            AAQ VVASIA D NVWNAVL N ELQ F
Sbjct  164  AAQDVVASIACDQNVWNAVLHNQELQGF  191



>ref|XP_010928571.1| PREDICTED: uncharacterized protein LOC105050305 isoform X1 [Elaeis 
guineensis]
Length=312

 Score =   117 bits (292),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 92/261 (35%), Positives = 127/261 (49%), Gaps = 45/261 (17%)
 Frame = +1

Query  313   DEEEMVAAGEPLPRLIFGGAPSLQEAKEATFDLKDALHKVY----------------NMS  444
             +++E+  +  P PRL+FG  P+L+EAK AT +LKDAL KVY                ++ 
Sbjct  72    EKKELFDSLYPAPRLVFGRVPTLEEAKAATAELKDALEKVYFSSSTTSDSTRSGLGASLQ  131

Query  445   TPPSDCGS-TNGAAQVNNDHsppsnsssenAIAHGAPKHAIRAFKFLYENAAAQTVVASI  621
             +P    GS T G     N            +     P +AI+ F  L  N  AQ VVASI
Sbjct  132   SPVCLEGSETKGCTMSKN------------STLSSTPNYAIQMFSLLQGNPKAQNVVASI  179

Query  622   ASDPNVWNAVLANPELQEFLVSQK--TSAYVLDGEYSVEESIAETDFLRYSSPRNDDLTS  795
             ASD NVWNAV+ NP++++F  +Q+  + A VL  E  VE S +      +  P  D   S
Sbjct  180   ASDENVWNAVMNNPKVKQFYETQQSISPAVVLPSETVVESSESPESSEAH--PSQDSYQS  237

Query  796   EDGSPKPGNGFTDFLQNIKVAVLDMMNCLSDFFQNLF----GGHKVFADADGSAKTSVVD  963
                       F DF+QN K+ V  M+  LSDFFQ+      GGH         A ++   
Sbjct  238   SR------TRFMDFVQNFKLKVSKMVVNLSDFFQDYMGTSTGGHSSMGTGIHHADSNA--  289

Query  964   RAWGASFMGLAIMAIMVVVLK  1026
              A   SF+ LAI  I+V++LK
Sbjct  290   DAVQKSFVALAIATILVILLK  310



>ref|XP_010928579.1| PREDICTED: uncharacterized protein LOC105050305 isoform X2 [Elaeis 
guineensis]
Length=308

 Score =   116 bits (290),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 91/259 (35%), Positives = 126/259 (49%), Gaps = 45/259 (17%)
 Frame = +1

Query  313   DEEEMVAAGEPLPRLIFGGAPSLQEAKEATFDLKDALHKVY----------------NMS  444
             +++E+  +  P PRL+FG  P+L+EAK AT +LKDAL KVY                ++ 
Sbjct  72    EKKELFDSLYPAPRLVFGRVPTLEEAKAATAELKDALEKVYFSSSTTSDSTRSGLGASLQ  131

Query  445   TPPSDCGS-TNGAAQVNNDHsppsnsssenAIAHGAPKHAIRAFKFLYENAAAQTVVASI  621
             +P    GS T G     N            +     P +AI+ F  L  N  AQ VVASI
Sbjct  132   SPVCLEGSETKGCTMSKN------------STLSSTPNYAIQMFSLLQGNPKAQNVVASI  179

Query  622   ASDPNVWNAVLANPELQEFLVSQKTSAYVLDGEYSVEESIAETDFLRYSSPRNDDLTSED  801
             ASD NVWNAV+ NP++++F  +Q++   VL  E  VE S +      +  P  D   S  
Sbjct  180   ASDENVWNAVMNNPKVKQFYETQQS--MVLPSETVVESSESPESSEAH--PSQDSYQSSR  235

Query  802   GSPKPGNGFTDFLQNIKVAVLDMMNCLSDFFQNLF----GGHKVFADADGSAKTSVVDRA  969
                     F DF+QN K+ V  M+  LSDFFQ+      GGH         A ++    A
Sbjct  236   ------TRFMDFVQNFKLKVSKMVVNLSDFFQDYMGTSTGGHSSMGTGIHHADSNA--DA  287

Query  970   WGASFMGLAIMAIMVVVLK  1026
                SF+ LAI  I+V++LK
Sbjct  288   VQKSFVALAIATILVILLK  306



>ref|XP_009402591.1| PREDICTED: uncharacterized protein LOC103986335 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=307

 Score =   114 bits (285),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 92/262 (35%), Positives = 137/262 (52%), Gaps = 31/262 (12%)
 Frame = +1

Query  265   VQWPCRELDGWEFAG-GDEEEMVA--AGEPLPRLIFGGAPSLQEAKEATFDLKDALHKVY  435
             +  P  ++  WEF+G G EE+ V   +  P PRL+ G  PSL+EAKEAT DLKDAL KV 
Sbjct  67    IHGPAGDIHDWEFSGWGREEQEVVLDSLHPAPRLVCGPVPSLEEAKEATSDLKDALEKV-  125

Query  436   NMSTPPSDCGSTNGAA-QVNNDHsppsnsssenAIAHGAPKHAIRAFKFLYENAAAQTVV  612
             N ST      STN +A +V  + +    S    ++    P+  ++AF  L  +  AQ VV
Sbjct  126   NFST------STNESAIKVPFESTCYEASYVIPSM----PRRVVQAFSLLQGSPEAQDVV  175

Query  613   ASIASDPNVWNAVLANPELQEFLVSQKTSAYVLDGEYSVEESIAETDFLRYSSPRNDDLT  792
             AS+ASD NVW+AV+ N ++ EF    +T   +L  E +    +   D     +PR+    
Sbjct  176   ASLASDKNVWDAVMRNEKVMEFF---RTHQSILHPESNAATEVPLAD----GNPRSSTAE  228

Query  793   SEDGSPKPGNGFTDFLQNIKVAVLDMMNCLSDFFQNLFGGHKVFADADGSAKTSVVDRA-  969
             +   S      F  F++NIKV + +M++ +S F Q L G     + +     +   D + 
Sbjct  229   ATTNS-----AFAHFVRNIKVILAEMVSNISSFLQELLGTSPGTSSSPSIKTSHNTDLSA  283

Query  970   ---WGASFMGLAIMAIMVVVLK  1026
                 GASF+ LA+  I+VV+LK
Sbjct  284   NFDMGASFVALAVATILVVLLK  305



>ref|XP_009402588.1| PREDICTED: uncharacterized protein LOC103986335 isoform X1 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009402589.1| PREDICTED: uncharacterized protein LOC103986335 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=308

 Score =   114 bits (284),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 92/262 (35%), Positives = 138/262 (53%), Gaps = 30/262 (11%)
 Frame = +1

Query  265   VQWPCRELDGWEFAG-GDEEEMVA--AGEPLPRLIFGGAPSLQEAKEATFDLKDALHKVY  435
             +  P  ++  WEF+G G EE+ V   +  P PRL+ G  PSL+EAKEAT DLKDAL KV 
Sbjct  67    IHGPAGDIHDWEFSGWGREEQEVVLDSLHPAPRLVCGPVPSLEEAKEATSDLKDALEKV-  125

Query  436   NMSTPPSDCGSTNGAA-QVNNDHsppsnsssenAIAHGAPKHAIRAFKFLYENAAAQTVV  612
             N ST      STN +A +V  + +    S    ++    P+  ++AF  L  +  AQ VV
Sbjct  126   NFST------STNESAIKVPFESTCYEASYVIPSM----PRRVVQAFSLLQGSPEAQDVV  175

Query  613   ASIASDPNVWNAVLANPELQEFLVSQKTSAYVLDGEYSVEESIAETDFLRYSSPRNDDLT  792
             AS+ASD NVW+AV+ N ++ EF  + ++   VL  E +    +   D     +PR+    
Sbjct  176   ASLASDKNVWDAVMRNEKVMEFFRTHQS--IVLHPESNAATEVPLAD----GNPRSSTAE  229

Query  793   SEDGSPKPGNGFTDFLQNIKVAVLDMMNCLSDFFQNLFGGHKVFADADGSAKTSVVDRA-  969
             +   S      F  F++NIKV + +M++ +S F Q L G     + +     +   D + 
Sbjct  230   ATTNS-----AFAHFVRNIKVILAEMVSNISSFLQELLGTSPGTSSSPSIKTSHNTDLSA  284

Query  970   ---WGASFMGLAIMAIMVVVLK  1026
                 GASF+ LA+  I+VV+LK
Sbjct  285   NFDMGASFVALAVATILVVLLK  306



>ref|XP_006659890.1| PREDICTED: uncharacterized protein LOC102713016 [Oryza brachyantha]
Length=236

 Score =   111 bits (278),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 86/256 (34%), Positives = 128/256 (50%), Gaps = 31/256 (12%)
 Frame = +1

Query  286   LDGWEFA-----GGDEEEMVAAGEPLPRLIFGGAPSLQEAKEATFDLKDALHKVYNMSTP  450
             +D WEFA     G  E E+ AAG+P  RL+F   PS +EA+ AT +L+DA+ +VY    P
Sbjct  1     MDDWEFADWRDVGAAEPEVTAAGKP--RLVFA-PPSREEAEVATTELRDAIDRVYFNEAP  57

Query  451   PSDCGSTNGAAQVNNDHsppsnsssenAIAHGAPKHAIRAFKFLYENAAAQTVVASIASD  630
                        +V  +     +    +AI    P H ++AF  L  +  AQ VVAS+ASD
Sbjct  58    ----------VEVVKEQDKDLSKLGADAIIPAMPGHVVQAFTLLKSSPEAQGVVASLASD  107

Query  631   PNVWNAVLANPELQEFLVSQKTSAYVLDGEYSVEESIAETDFLRYSSPRNDDLTSED---  801
              NVW AVL N ++ EF  + + S       Y+  E  A  +    S  +  D  SE+   
Sbjct  108   KNVWEAVLKNEKVMEFYKTHQQSLV-----YTFPEDTATVE----SPEKLVDAASENVHL  158

Query  802   GSPKPGNGFTDFLQNIKVAVLDMMNCLSDFFQNLFGGHKVFADADGSAKT-SVVDRAWGA  978
             G    G  F DF+ N K  V+D+++ ++ FFQ++F        + G   + S  + A G 
Sbjct  159   GEKPTGFPFADFVDNAKKTVIDIVDNITHFFQDMFRKPDENQASTGKGGSHSFAEMAAGG  218

Query  979   SFMGLAIMAIMVVVLK  1026
             SF+ LAI  I+V++ K
Sbjct  219   SFVALAIGVILVILFK  234



>ref|XP_007211764.1| hypothetical protein PRUPE_ppa009590mg [Prunus persica]
 gb|EMJ12963.1| hypothetical protein PRUPE_ppa009590mg [Prunus persica]
Length=285

 Score =   109 bits (272),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 65/157 (41%), Positives = 91/157 (58%), Gaps = 16/157 (10%)
 Frame = +1

Query  295  WEFAGGDEEEMV-AAGEPLPRLIFGGAPSLQEAKEATFDLKDALHKVYNMSTPPSD----  459
            W+  G   EE+V +AGEP+PR++F  APS +EA+EAT +LKDAL K+Y +S+P S     
Sbjct  75   WQVVGAAGEELVMSAGEPMPRVVFDAAPSFKEAREATTELKDALDKIY-LSSPKSTEFGE  133

Query  460  ---CGSTNGAAQVNNDHsppsnsssenAIAHGAPKHAIRAFKFLYENAAAQTVVASIASD  630
                   +G +Q+ N       S      +   PKHA +AF+ L  +  AQ VVASIASD
Sbjct  134  QSATDKVSGLSQIMNPEPEEVESLLLTRTS--VPKHAFQAFEMLSRSTEAQNVVASIASD  191

Query  631  PNVWNAVLANPELQEFLVSQK-----TSAYVLDGEYS  726
            PN+WNA++ N  +++FL S K        Y  D E+S
Sbjct  192  PNIWNAMMENSAVKQFLKSNKDYNLYEPKYASDTEFS  228



>gb|KCW70086.1| hypothetical protein EUGRSUZ_F03390 [Eucalyptus grandis]
Length=194

 Score =   105 bits (263),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 68/150 (45%), Positives = 91/150 (61%), Gaps = 11/150 (7%)
 Frame = +1

Query  550  PKHAIRAFKFLYENAAAQTVVASIASDPNVWNAVLANPELQEFLVSQKTSAYVLDGEYSV  729
            PKHA+ AFK L ++  AQTVVASIASD +VW+A L N  LQ+FL SQ +S      E  V
Sbjct  39   PKHAVEAFKLLTQSPEAQTVVASIASDQDVWDAFLKNKALQDFLQSQNSSIQFPYMEPKV  98

Query  730  EESIAETDFLRYSSPRNDDLTSEDGSPKPGNGFTDFLQNIKVAVLDMMNCLSDFFQNLF-  906
            E+S  +     + SPR D+ TSE G     NGF  FLQNIK+ V  M++ +S F  ++F 
Sbjct  99   EKSADDAFSDDWKSPRVDEETSEGGH---KNGFMSFLQNIKLRVEQMVSNISSFLADIFT  155

Query  907  --GGHKVFADADGSAKTSVVDRAWGASFMG  990
                 K+ +++DG+A  +V     GASFMG
Sbjct  156  PPSVEKMSSNSDGNAGLAV-----GASFMG  180



>ref|XP_010520882.1| PREDICTED: uncharacterized protein LOC104799894 [Tarenaya hassleriana]
Length=320

 Score =   108 bits (270),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 85/232 (37%), Positives = 124/232 (53%), Gaps = 33/232 (14%)
 Frame = +1

Query  253  DGAPVQWPCRELDGWEFAGGDEEEMVAAGEPLPRLIFGGAPSLQEAKEATFDLKDALHKV  432
            D A VQ P    D WEFAG +EE      EP+ R++F G P+LQEAK+AT DLK+A+  V
Sbjct  65   DVAVVQKPV--WDDWEFAGVEEELGGGG-EPIARVVFSGPPTLQEAKDATEDLKEAIDMV  121

Query  433  Y---NMSTP---PSDCGSTNGAAQVNNDHsppsnsssenAIAHGAPKHAIRAFKFLYENA  594
            Y     ++P   P   G  +G  +             ++ ++   PK A++AF FL E+ 
Sbjct  122  YLSSQKTSPMEGPVAAGPVSGILRSVQSSENDVFKGVQSRVSP-VPKVALQAFAFLSESP  180

Query  595  AAQTVVASIASDPNVWNAVLANPELQEFLVSQKTSAYVLDGEYSVEESIAETDFLRYSSP  774
            AAQ+VVASIASDP VW+AV+ N +L EFL S KT A++ D E                SP
Sbjct  181  AAQSVVASIASDPKVWDAVMENKDLVEFLESNKTGAHLHDNE----------------SP  224

Query  775  RNDDLTSEDGSPKPGNGFTD-------FLQNIKVAVLDMMNCLSDFFQNLFG  909
            ++DD        +      +       FL+++K+ V+D+++ +S +F  LFG
Sbjct  225  KDDDQYESSVVSESEVTTEEKTKEPWGFLEDMKLKVVDLVHNVSAYFGGLFG  276



>ref|XP_003573409.1| PREDICTED: uncharacterized protein LOC100845511 [Brachypodium 
distachyon]
Length=313

 Score =   107 bits (268),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 83/259 (32%), Positives = 129/259 (50%), Gaps = 31/259 (12%)
 Frame = +1

Query  283   ELDGWEFA-----GGDEEEMVAAGEPLPRLIFGGAPSLQEAKEATFDLKDALHKVYNMST  447
             E+D WEFA        E E  A G P  RL+F   PS +EA+EAT +L++A+ +VY   T
Sbjct  73    EVDDWEFADWRDVAVSEAEETAVGRP--RLVFA-PPSQEEAQEATTELREAIDRVYFNET  129

Query  448   PPSDCGSTNGAAQVNNDHsppsnsssenAIAHGAPKHAIRAFKFLYENAAAQTVVASIAS  627
             P           ++  +     N    +AI    P H ++AF  L  ++ AQ+VVAS+AS
Sbjct  130   P----------IEIVKEQDKELNKLGVDAIIPAMPGHVVQAFTLLKSSSEAQSVVASLAS  179

Query  628   DPNVWNAVLANPELQEFLVS-QKTSAYVLDGEYSVEESIAETDFLRYSSPRNDDLTSEDG  804
             D NVW+AVL N  + EF  + Q+T  +    +    ES  + +          +L +   
Sbjct  180   DKNVWDAVLKNERVMEFYKNHQQTLVHTFPEDSGTVESPEKFEGASQEYASRGELPT--T  237

Query  805   SPKPGNGFTDFLQNIKVAVLDMMNCLSDFFQNLF-----GGHKVFADADGSAKTSVVDRA  969
             SP      +DF+ N K  V+++++ ++ FFQ++F      G +  +     +  S  + A
Sbjct  238   SP-----LSDFVDNAKKTVMEIVDNITHFFQDVFRNPAEAGDRPSSSTGKGSPPSFAEMA  292

Query  970   WGASFMGLAIMAIMVVVLK  1026
              G SFM LAI  I+VV+ K
Sbjct  293   AGGSFMALAIAVILVVLFK  311



>ref|XP_009127082.1| PREDICTED: uncharacterized protein LOC103851954 [Brassica rapa]
Length=296

 Score =   105 bits (263),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 80/246 (33%), Positives = 124/246 (50%), Gaps = 28/246 (11%)
 Frame = +1

Query  289   DGWEFAGGDEEEMVAAGEPLPRLIFGGAPSLQEAKEATFDLKDALHKVYNMSTPPSDCGS  468
             D WEFA       V     +PR +F   PSL+EAKEAT DLKDA++ VY   +  ++ GS
Sbjct  77    DDWEFAE------VETTTTIPRFVFSKPPSLEEAKEATDDLKDAINMVYTEGS--NEAGS  128

Query  469   TNGAAQVNNDHsppsnsssenAIAHGAPKHAIRAFKFLYENAAAQTVVASIASDPNVWNA  648
              +    +++ H          A+    P+ A+ AF FL E++AAQ+VVASIASDP VW+A
Sbjct  129   VS--RMLSSFHLSDKR-----AVESAVPQVALNAFAFLSESSAAQSVVASIASDPKVWDA  181

Query  649   VLANPELQEFLVSQKTSAYVLDGEYSVEESIAETDFLRYSSPRNDDLTSEDGSPKPGNGF  828
             V+ N +L +FL +  T+A       S +   A+ D     S   +     +  P      
Sbjct  182   VMENSDLMKFLDTNTTAA-------STQVEAADNDDKAEDSSETESEEDSEAKPIQ---L  231

Query  829   TDFLQNIKVAVLDMMNCLSDFFQNLFGGHKVFADADGSAKTSVVDRAWGASFMGLAIMAI  1008
              + L+++K+  + +M  +S +F  LF       + +   +T + D     S  GLA+  I
Sbjct  232   LEILEDMKLKAVQLMENVSSYFGGLFRSESFTENGEERKRTLLND---PTSLFGLAVCVI  288

Query  1009  MVVVLK  1026
              +VV+K
Sbjct  289   FMVVMK  294



>emb|CDY68666.1| BnaAnng27970D [Brassica napus]
Length=228

 Score =   104 bits (259),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 79/246 (32%), Positives = 125/246 (51%), Gaps = 29/246 (12%)
 Frame = +1

Query  289   DGWEFAGGDEEEMVAAGEPLPRLIFGGAPSLQEAKEATFDLKDALHKVYNMSTPPSDCGS  468
             D WEFA  +          +PR++F   PSLQEAKEAT DLKDA++ VY   +   + GS
Sbjct  10    DDWEFAEVE-------TTTIPRVVFSKPPSLQEAKEATDDLKDAINLVYTEGS--YEAGS  60

Query  469   TNGAAQVNNDHsppsnsssenAIAHGAPKHAIRAFKFLYENAAAQTVVASIASDPNVWNA  648
              +    +++ H          A+    P+ ++ AF FL E++AAQ+VVASIASDP VW+A
Sbjct  61    VSR--MLSSFHLSDKR-----AVESAVPQVSLNAFAFLSESSAAQSVVASIASDPKVWDA  113

Query  649   VLANPELQEFLVSQKTSAYVLDGEYSVEESIAETDFLRYSSPRNDDLTSEDGSPKPGNGF  828
             V+ N +L +FL +  T+A       S +   A+ D     S  ++     +  P      
Sbjct  114   VMENNDLMKFLDTNTTAA-------STQAEAADNDDKAEDSSESESEEDSEAKPI---QL  163

Query  829   TDFLQNIKVAVLDMMNCLSDFFQNLFGGHKVFADADGSAKTSVVDRAWGASFMGLAIMAI  1008
              + L+++K+  + +M  +S +F  LF       + +   +T + D     S  GLA+  I
Sbjct  164   LEILEDMKLKAVQLMENVSSYFGGLFRSESFTENGEERKRTLLND---PTSLFGLAVCVI  220

Query  1009  MVVVLK  1026
              +VV+K
Sbjct  221   FMVVMK  226



>ref|XP_009119980.1| PREDICTED: uncharacterized protein LOC103844909 [Brassica rapa]
Length=289

 Score =   105 bits (261),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 86/258 (33%), Positives = 132/258 (51%), Gaps = 33/258 (13%)
 Frame = +1

Query  253   DGAPVQWPCRELDGWEFAGGDEEEMVAAGEPLPRLIFGGAPSLQEAKEATFDLKDALHKV  432
             D   ++ P  E D WEFA  + +        +PR++F   PSLQEAKEAT DLKDAL+  
Sbjct  63    DAVVMRKPVWE-DEWEFAEVETK-------TIPRVVFDKPPSLQEAKEATDDLKDALNMA  114

Query  433   YNMSTPPSDCGSTNGAAQVNNDHsppsnsssenAIAHGAPKHAIRAFKFLYENAAAQTVV  612
             Y   +  ++ GS   +   ++ H   +      A+    P+ A++AF FL EN AAQ+VV
Sbjct  115   YMEGS--NEVGSV--SRMFSSFHPSENR-----AVESAVPQVALKAFAFLSENTAAQSVV  165

Query  613   ASIASDPNVWNAVLANPELQEFLVSQKTSAYVLDGEYSVEESIAETDFLRYSSPRNDDLT  792
             ASIASDP VW+AV+ N +L +FL            E +   +  E D    S   ++  +
Sbjct  166   ASIASDPKVWDAVMENKDLMKFL------------ETNTALTTVEADNDDKSELSSETES  213

Query  793   SEDGSPKPGNGFTDFLQNIKVAVLDMMNCLSDFFQNLFGGHKVFADADGSAKTSVVDRAW  972
              E+   KP N   + L+++K+  + MM  +S +F  LF   + F +     K  +++   
Sbjct  214   EEESEAKPIN-LMEILRDMKLKAVQMMENVSSYFGGLF-RTETFTEGGQERKRMLLNDP-  270

Query  973   GASFMGLAIMAIMVVVLK  1026
               +  GLA+  I +VVLK
Sbjct  271   -TTLFGLAVCVIFMVVLK  287



>emb|CDY42460.1| BnaA10g08360D [Brassica napus]
Length=293

 Score =   104 bits (259),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 88/266 (33%), Positives = 131/266 (49%), Gaps = 45/266 (17%)
 Frame = +1

Query  253   DGAPVQWPCRELDGWEFAGGDEEEMVAAGEPLPRLIFGGAPSLQEAKEATFDLKDALHKV  432
             D   ++ P  E D WEFA  + +        +PR++F   PSLQEAKEAT DLKDAL+  
Sbjct  63    DAVVMRKPVWE-DEWEFAEVETKT-------IPRVVFDKPPSLQEAKEATDDLKDALNMA  114

Query  433   YNMSTPPSDCGSTNGAAQVNNDHsppsnsssenAIAHGAPKHAIRAFKFLYENAAAQTVV  612
             Y   +  ++ GS +               S   A+    P+ A++AF FL EN AAQ+VV
Sbjct  115   YMEGS--NEVGSVS-------RMFSSFQPSENRAVESAVPQVALKAFAFLSENTAAQSVV  165

Query  613   ASIASDPNVWNAVLANPELQEFLVSQKTSAYVLDGEYSVEESIAETDFLRYSSPRNDD--  786
             ASIASDP VW+AV+ N +L +FL   +T++       +VE               NDD  
Sbjct  166   ASIASDPKVWDAVMENKDLMKFL---ETNSKNFPASTTVEAD-------------NDDKS  209

Query  787   ------LTSEDGSPKPGNGFTDFLQNIKVAVLDMMNCLSDFFQNLFGGHKVFADADGSAK  948
                    + E+   KP N   + L+++K+  + MM  +S +F  LF   + F +     K
Sbjct  210   ELSSETESEEESEAKPIN-LMEILRDMKLKAVQMMENVSSYFGGLF-RTETFTEGGQERK  267

Query  949   TSVVDRAWGASFMGLAIMAIMVVVLK  1026
               +++     +  GLA+  I +VVLK
Sbjct  268   RMLLNDP--TTLFGLAVCVIFMVVLK  291



>gb|KJB45632.1| hypothetical protein B456_007G317300 [Gossypium raimondii]
Length=368

 Score =   105 bits (262),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 76/204 (37%), Positives = 103/204 (50%), Gaps = 29/204 (14%)
 Frame = +1

Query  286  LDGWEFAGGDEEEMVA---------AGEPLPRLIFGGAPSLQEAKEATFDLKDALHKVYN  438
            +D WE +GG  E  VA          GEP+  ++FGG PSL+EAKEA  DLKDAL  VY 
Sbjct  70   VDDWELSGGIVEHEVALEGSSDASGQGEPIAGVLFGGVPSLEEAKEAIADLKDALDMVYL  129

Query  439  MSTPPSDCGSTNGAAQVNNDHsppsnsssenAIAHGAPKHAIRAFKFLYENAAAQTVVAS  618
               P  D    +  + V+N                 APK AI+AFK L E+A  Q+VV+S
Sbjct  130  SPPPYGDTARDSAVSLVSNPEETSKG-------CASAPKPAIQAFKLLSESADVQSVVSS  182

Query  619  IASDPNVWNAVLANPELQEFLVSQKTSAYVLDGEYSVEESIAETDFLRYSSPRNDDLTSE  798
            I +DPNV NAVL N    +F+  Q         E+ VEES   ++     SP   +   E
Sbjct  183  IVADPNVRNAVLNNSAYMDFIQYQAHC-----DEFEVEESTEGSE-----SPVKLEEYYE  232

Query  799  DGSPKPGNGFTDFLQNIKVAVLDM  870
            + S  P +G   +L  IK +V+++
Sbjct  233  EDSKDPSSG---YLHKIKTSVVEL  253



>gb|EPS66227.1| hypothetical protein M569_08551, partial [Genlisea aurea]
Length=299

 Score =   104 bits (259),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 98/286 (34%), Positives = 126/286 (44%), Gaps = 73/286 (26%)
 Frame = +1

Query  265   VQWPCRELDGWEFAGGDEEEMVAAGEPLPRLIFGGAPSLQEAKEATFDLKDALHKVYNMS  444
             V  P  E+D W  +G +EE  V   EP+PR++FGG P+LQEA+EAT +L           
Sbjct  53    VATPAPEIDDWILSG-EEEIPVTNSEPMPRVVFGGVPTLQEAEEATSELS----------  101

Query  445   TPPSDCGSTNGAAQVNNDHsppsnsssenAIAHGAPKHAIRAFKFLYENAAAQT------  606
                S    T+G+                       P  A+ AF+FL E+ A Q       
Sbjct  102   ---SLSIGTSGSL---------------------LPAPALMAFRFLNESPAVQVRALTKF  137

Query  607   ---------------------VVASIASDPNVWNAVLANPELQEFLVSQKTSAYVLDGEY  723
                                  VVASIASDPNVW AVL N   Q++L S  T+      + 
Sbjct  138   QILEFFCCLLEINFKFSIFQNVVASIASDPNVWQAVLQNSVFQDYLKSSDTACETSSTQK  197

Query  724   SVEESIAETDFLRYSSPRNDDLTSEDGSPKP-GNGFT----DFLQNIKVAVLDMMNCLSD  888
             S+++ I E  F+    P    L   D  P+  G+G T    +F   IK A+ DMM  LSD
Sbjct  198   SIKQ-IFEACFIAGWFPAA-LLQEGDSVPEAEGDGRTSDDGNFFDRIKRALCDMMTTLSD  255

Query  889   FFQNLFGGHKVFADADGSAKTSVVDRAWGASFMGLAIMAIMVVVLK  1026
             FF  LFGG  +  D  G   TS           GLA+M I VVVLK
Sbjct  256   FFGRLFGGG-IDIDFKG---TSFYGIGSQNVVFGLALMVITVVVLK  297



>emb|CDY63696.1| BnaCnng42470D [Brassica napus]
Length=358

 Score =   103 bits (257),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 80/246 (33%), Positives = 125/246 (51%), Gaps = 26/246 (11%)
 Frame = +1

Query  289   DGWEFAGGDEEEMVAAGEPLPRLIFGGAPSLQEAKEATFDLKDALHKVYNMSTPPSDCGS  468
             D WEFA    E        +PR++F   PSL+EAKEAT DLKDA++ VY   +  ++ GS
Sbjct  137   DDWEFA----EVETTTTTTIPRVVFSKPPSLEEAKEATDDLKDAINMVYTEGS--NEAGS  190

Query  469   TNGAAQVNNDHsppsnsssenAIAHGAPKHAIRAFKFLYENAAAQTVVASIASDPNVWNA  648
                +  +++ H          A+    P+ A+ AF FL E++AAQ+VVASIASDP VW+A
Sbjct  191   V--SRMLSSFHLSDKR-----AVESAVPQVALNAFAFLSESSAAQSVVASIASDPKVWDA  243

Query  649   VLANPELQEFLVSQKTSAYVLDGEYSVEESIAETDFLRYSSPRNDDLTSEDGSPKPGNGF  828
             V+ N +L +FL +  T+A       S +   A+ D     S   +     +  P      
Sbjct  244   VMENNDLMKFLDTNTTAA-------STQVEAADNDDKAEDSSETESEEDGEAKPIQ---L  293

Query  829   TDFLQNIKVAVLDMMNCLSDFFQNLFGGHKVFADADGSAKTSVVDRAWGASFMGLAIMAI  1008
              + L+++K+  + +M  +S +F  LF       + +   +T + D     S  GLA+  I
Sbjct  294   LEILEDMKLKAVQLMENVSSYFGGLFRLESFTENGEERKRTLLND---PTSLFGLAVCVI  350

Query  1009  MVVVLK  1026
              +VV+K
Sbjct  351   FMVVMK  356



>gb|EAZ05807.1| hypothetical protein OsI_28043 [Oryza sativa Indica Group]
Length=240

 Score =   101 bits (252),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 86/256 (34%), Positives = 129/256 (50%), Gaps = 43/256 (17%)
 Frame = +1

Query  283   ELDGWEFA-----GGDEEEMVAAGEPLPRLIFGGAPSLQEAKEATFDLKDALHKVYNMST  447
             E+D WEFA      G E E+ AAG+P  RL+F   PS +EA+EAT +L+DA+ +VY    
Sbjct  18    EVDDWEFADWRDVAGAEPEVTAAGKP--RLVFA-PPSREEAEEATTELRDAIDRVYFSEA  74

Query  448   PPSDCGSTNGAAQVNNDHsppsnsssenAIAHGAPKHAIRAFKFLYENAAAQTVVASIAS  627
             P           +V  +     +    +AI    P H ++AF  L  +  AQ VVAS+AS
Sbjct  75    P----------IEVVKEQDKDLSKLGADAIIPAMPGHVMQAFTLLKSSPEAQGVVASLAS  124

Query  628   DPNVWNAVLANPELQEFLVSQKTSAYVLDGEYSVEESIAETDFLRYSSPRNDDLTSEDGS  807
             D NVW+AVL N ++ EF  + + S       Y+  E  A       S  +  D +SE+ S
Sbjct  125   DKNVWDAVLKNEKVMEFYKTHQQSLV-----YTFPEGTASV----VSPEKLADASSENSS  175

Query  808   P--KPGNG-FTDFLQNIKVAVLDMMNCLSDFFQNLFGGHKVFADADGSAKTSVVDRAWGA  978
                KP +  F DF+ N +  V+D++N +++FFQ++F             +        G 
Sbjct  176   SGEKPESSPFADFMDNARKTVIDIVNNITNFFQDMF-------------RKPNEAEILGG  222

Query  979   SFMGLAIMAIMVVVLK  1026
             SFM LAI  I++++ K
Sbjct  223   SFMALAIAVILLIMFK  238



>gb|AFK42977.1| unknown [Medicago truncatula]
Length=241

 Score =   101 bits (251),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 74/201 (37%), Positives = 109/201 (54%), Gaps = 18/201 (9%)
 Frame = +1

Query  94   ITVANSGFRGIASEHPVSSAARKvvrpvsvsgissssDHLKssavsasqstavDGAPVQW  273
            I VA SGFRG    +P   A ++  R  + S     S   K++          D  P+  
Sbjct  16   IGVARSGFRGTTVTYP---AEKQWSRNRASSPTRVISQGTKTA----------DVKPLHT  62

Query  274  PCRE-LDGWEFAGGDEEEM-VAAGEPLPRLIFGGAPSLQEAKEATFDLKDALHKVYNMST  447
               E L+ WEFA  DE ++ +++GEP PR++FG  P+L+EA+EAT +LKDA+ ++Y +S 
Sbjct  63   SVSEDLNDWEFA--DEGDLFMSSGEPTPRMVFGEVPTLKEAEEATAELKDAIDQIY-LSP  119

Query  448  PPSDCGSTNGAAQVNNDHsppsnsssenAIAHGAPKHAIRAFKFLYENAAAQTVVASIAS  627
              S   +++  ++V+       +   E        KHAI AF+ L  +  AQTVV SIA 
Sbjct  120  ANSQIENSSPGSEVSVLSPYSKDCLVEAISNPSVSKHAIHAFQLLSSSVEAQTVVQSIAC  179

Query  628  DPNVWNAVLANPELQEFLVSQ  690
            DPN+WNAV+ NP +  F  SQ
Sbjct  180  DPNIWNAVMQNPAVTSFFESQ  200



>ref|XP_008678238.1| PREDICTED: uncharacterized protein LOC103653035 [Zea mays]
 gb|AFW61103.1| hypothetical protein ZEAMMB73_425084 [Zea mays]
Length=314

 Score =   102 bits (254),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 90/279 (32%), Positives = 136/279 (49%), Gaps = 47/279 (17%)
 Frame = +1

Query  259   APVQWPCR-ELDGWEFA---------GGDEEEMVAAGEPLPRLIFGGAPSLQEAKEATFD  408
             A  QW    ELD WEFA             E    A    PRL+F   PS +EA+EAT +
Sbjct  58    AAAQWAASWELDDWEFADWRDDAAAAAAVVEREATAAAAKPRLVFA-PPSREEAEEATTE  116

Query  409   LKDALHKVYNMSTPPSDCGSTNGAAQVNNDHsppsnsssenAIAHGAPKHAIRAFKFLYE  588
             L+DA+ + Y   +P           +V  +     N  + +A+    P H ++AF  L  
Sbjct  117   LRDAVERAYFNESP----------VEVVKEQDKEFNKLATDAMIPSMPGHVVQAFTLLKS  166

Query  589   NAAAQTVVASIASDPNVWNAVLANPELQEFLVSQKTSAYVLDGEYSVEESIAETDFLRYS  768
             +  AQ+VVAS+ASD NVW+AVL N ++ EF  + +T+      + S  E++      +  
Sbjct  167   STEAQSVVASLASDRNVWDAVLKNEKVMEFYKTHQTTLV----QTSPNEAVTVELPGKLE  222

Query  769   SPRNDDLTSEDGSPKPGNGFTDFLQNIKVAVLDMMNCLSDFFQNLFGGHKVFADADGSAK  948
                +++ +S +     G  F+DF+ N K  V+D+++ ++DFF++LF         D SAK
Sbjct  223   DAASENTSSGELPAGSGLSFSDFVDNAKKTVMDVVHNITDFFKDLF---------DDSAK  273

Query  949   T-------------SVVDRAWGASFMGLAIMAIMVVVLK  1026
             T             S+ D A G SFM LAI  I+VV+ K
Sbjct  274   TQTGAGPSAAEKGPSMADMAVGGSFMALAIAVILVVMFK  312



>ref|NP_001144178.1| uncharacterized protein LOC100277035 [Zea mays]
 gb|ACG38484.1| hypothetical protein [Zea mays]
Length=315

 Score =   101 bits (251),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 93/273 (34%), Positives = 135/273 (49%), Gaps = 37/273 (14%)
 Frame = +1

Query  259   APVQWPCR-ELDGWEFAG-GD-------EEEMVAAGEPLPRLIFGGAPSLQEAKEATFDL  411
             A  QW    ELD WEFA  GD        E    A    PRL+F   PS +EA+EAT +L
Sbjct  61    AAAQWAASWELDDWEFADCGDVTPAAVVAEREATAAAAKPRLVFA-PPSREEAEEATTEL  119

Query  412   KDALHKVYNMSTPPSDCGSTNGAAQVNNDHsppsnsssenAIAHGAPKHAIRAFKFLYEN  591
             +DA+ + Y   +P           +V  + +   N  + +AI    P H ++AF  L  +
Sbjct  120   RDAIGRAYFNESP----------VEVVKEQNKEFNKLATDAIIPSMPGHVVQAFTLLKSS  169

Query  592   AAAQTVVASIASDPNVWNAVLANPELQEFLVSQKTSAYVLDGEYSVEESIAETDFLRYSS  771
               AQ+VVAS+ASD NVW+AVL N ++ EF  + +T+       +  E + AE      S 
Sbjct  170   TEAQSVVASLASDRNVWDAVLKNEKVMEFYKTHQTTPV---QTFPEEAATAE------SP  220

Query  772   PRNDDLTSEDGS-----PKPGNGFTDFLQNIKVAVLDMMNCLSDFFQNLFGGH---KVFA  927
              + +D TSE+ S        G  F DF+ N K  V+D+++ ++DFF++LF      +  A
Sbjct  221   GKFEDATSENASNSELPTGSGASFADFVDNAKKKVMDVVHNITDFFRDLFNDSAEAQTGA  280

Query  928   DADGSAKTSVVDRAWGASFMGLAIMAIMVVVLK  1026
                     S  + A G SFM L I  I+VV+ K
Sbjct  281   GPSAEKGFSATEMAVGGSFMALTIAVILVVLFK  313



>gb|AFW56882.1| hypothetical protein ZEAMMB73_730622 [Zea mays]
Length=315

 Score =   101 bits (251),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 93/273 (34%), Positives = 134/273 (49%), Gaps = 37/273 (14%)
 Frame = +1

Query  259   APVQWPCR-ELDGWEFAG-GD-------EEEMVAAGEPLPRLIFGGAPSLQEAKEATFDL  411
             A  QW    ELD WEFA  GD        E    A    PRL+F   PS +EA+EAT +L
Sbjct  61    AAAQWAASWELDDWEFADCGDVAPAAVVAEREATAAAAKPRLVFA-PPSREEAEEATTEL  119

Query  412   KDALHKVYNMSTPPSDCGSTNGAAQVNNDHsppsnsssenAIAHGAPKHAIRAFKFLYEN  591
             +DA+ + Y   +P           +V  +     N  + +AI    P H ++AF  L  +
Sbjct  120   RDAIGRAYFNESP----------VEVVKEQDKEFNKLATDAIIPSMPGHVVQAFTLLKSS  169

Query  592   AAAQTVVASIASDPNVWNAVLANPELQEFLVSQKTSAYVLDGEYSVEESIAETDFLRYSS  771
               AQ+VVAS+ASD NVW+AVL N ++ EF  + +T+       +  E + AE      S 
Sbjct  170   TEAQSVVASLASDRNVWDAVLKNEKVMEFYKTHQTTPV---QTFPEEAATAE------SP  220

Query  772   PRNDDLTSEDGSPK-----PGNGFTDFLQNIKVAVLDMMNCLSDFFQNLFGGH---KVFA  927
              + +D TSE+ S        G  F DF+ N K  V+D+++ ++DFF++LF      +  A
Sbjct  221   GKFEDATSENASNSELPTGSGASFADFVDNAKKKVMDVVHNITDFFRDLFNDSAEAQTGA  280

Query  928   DADGSAKTSVVDRAWGASFMGLAIMAIMVVVLK  1026
                     S  + A G SFM L I  I+VV+ K
Sbjct  281   GPSAEKGFSATEMAVGGSFMALTIAVILVVLFK  313



>dbj|BAJ88294.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK00328.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK05236.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ89280.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=304

 Score =   100 bits (250),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 84/259 (32%), Positives = 131/259 (51%), Gaps = 24/259 (9%)
 Frame = +1

Query  268   QWPCRELDGWEFAGGDEEEMVAAGEPL----PRLIFGGAPSLQEAKEATFDLKDALHKVY  435
             QW   E+D WEFA    E   +  +      PRL+F   PS +EA+EAT +L++A+ +VY
Sbjct  62    QWASWEVDDWEFADWRSESATSEADVAVVGGPRLVFA-PPSREEAEEATAELREAIDRVY  120

Query  436   NMSTPPSDCGSTNGAAQVNNDHsppsnsssenAIAHGAPKHAIRAFKFLYENAAAQTVVA  615
                TP           +   +H    +    +A+    P H ++AF  L  +  AQ+VVA
Sbjct  121   FPETP----------VEAVKEHDQELSKLGADALIPAMPGHVVQAFTLLKSSPEAQSVVA  170

Query  616   SIASDPNVWNAVLANPELQEFLVSQKTSAYVLDGEYSVEESIAETDFLRYSSPRNDDLTS  795
             S+ASD NVW+AVL N  + EF  S + +        +  E    TD +   SP   +  S
Sbjct  171   SLASDKNVWDAVLKNERVMEFYRSHQQTLI-----NTFPEGTDSTDSVE--SPEKFEEAS  223

Query  796   EDGSPKPGNGFTDFLQNIKVAVLDMMNCLSDFFQNLFGGHKVFADADGSA--KTSVVDRA  969
              + +    + F+DF+ N K  +++M++ +++FFQ+LF          GS+  K S  + A
Sbjct  224   TEYALPTASPFSDFVDNAKKTMIEMVDNITNFFQDLFHNPAEAEAGPGSSSKKHSFAEMA  283

Query  970   WGASFMGLAIMAIMVVVLK  1026
              G SFM LA+  I+VV+ K
Sbjct  284   AGGSFMALAMAVILVVLFK  302



>ref|NP_001061135.1| Os08g0179900 [Oryza sativa Japonica Group]
 dbj|BAD17035.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF23049.1| Os08g0179900 [Oryza sativa Japonica Group]
Length=300

 Score =   100 bits (250),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 87/262 (33%), Positives = 130/262 (50%), Gaps = 44/262 (17%)
 Frame = +1

Query  268   QWPCR-ELDGWEFA-----GGDEEEMVAAGEPLPRLIFGGAPSLQEAKEATFDLKDALHK  429
             QW    E+D WEFA        E E+ AAG+P  RL+F   PS +EA+EAT +L+DA+ +
Sbjct  72    QWASSWEVDDWEFADWRDVAAAEPEVTAAGKP--RLVFA-PPSREEAEEATTELRDAIDR  128

Query  430   VYNMSTPPSDCGSTNGAAQVNNDHsppsnsssenAIAHGAPKHAIRAFKFLYENAAAQTV  609
             VY    P           +V  +     +    +AI    P H ++AF  L  +  AQ V
Sbjct  129   VYFSEAP----------IEVVKEQDKDLSKLGADAIIPAMPGHVMQAFTLLKSSPEAQGV  178

Query  610   VASIASDPNVWNAVLANPELQEFLVSQKTSAYVLDGEYSVEESIAETDFLRYSSPRNDDL  789
             VAS+ASD NVW+AVL N ++ EF  + + S       Y+  E  A       S  +  D 
Sbjct  179   VASLASDKNVWDAVLKNEKVMEFYKTHQQSLV-----YTFPEGTASV----VSPEKLADA  229

Query  790   TSEDGSP--KPGNG-FTDFLQNIKVAVLDMMNCLSDFFQNLFGGHKVFADADGSAKTSVV  960
             +SE+ S   KP +  F DF+ N +  V+D++N +++FFQ++F             +    
Sbjct  230   SSENSSSGEKPESSPFADFMDNARKTVIDIVNNITNFFQDMF-------------RKPNE  276

Query  961   DRAWGASFMGLAIMAIMVVVLK  1026
                 G SFM LAI  I++++ K
Sbjct  277   AEILGGSFMALAIAVILLIMFK  298



>gb|AFW56883.1| hypothetical protein ZEAMMB73_730622 [Zea mays]
Length=313

 Score = 99.8 bits (247),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 93/273 (34%), Positives = 133/273 (49%), Gaps = 39/273 (14%)
 Frame = +1

Query  259   APVQWPCR-ELDGWEFAG-GD-------EEEMVAAGEPLPRLIFGGAPSLQEAKEATFDL  411
             A  QW    ELD WEFA  GD        E    A    PRL+F   PS +EA+EAT +L
Sbjct  61    AAAQWAASWELDDWEFADCGDVAPAAVVAEREATAAAAKPRLVFA-PPSREEAEEATTEL  119

Query  412   KDALHKVYNMSTPPSDCGSTNGAAQVNNDHsppsnsssenAIAHGAPKHAIRAFKFLYEN  591
             +DA+ + Y   +P           +V  +     N  + +AI    P H ++AF  L  +
Sbjct  120   RDAIGRAYFNESP----------VEVVKEQDKEFNKLATDAIIPSMPGHVVQAFTLLKSS  169

Query  592   AAAQTVVASIASDPNVWNAVLANPELQEFLVSQKTSAYVLDGEYSVEESIAETDFLRYSS  771
               AQ+VVAS+ASD NVW+AVL N ++ EF  + +T        +  E + AE      S 
Sbjct  170   TEAQSVVASLASDRNVWDAVLKNEKVMEFYKTHQTIQT-----FPEEAATAE------SP  218

Query  772   PRNDDLTSEDGSPK-----PGNGFTDFLQNIKVAVLDMMNCLSDFFQNLFGGH---KVFA  927
              + +D TSE+ S        G  F DF+ N K  V+D+++ ++DFF++LF      +  A
Sbjct  219   GKFEDATSENASNSELPTGSGASFADFVDNAKKKVMDVVHNITDFFRDLFNDSAEAQTGA  278

Query  928   DADGSAKTSVVDRAWGASFMGLAIMAIMVVVLK  1026
                     S  + A G SFM L I  I+VV+ K
Sbjct  279   GPSAEKGFSATEMAVGGSFMALTIAVILVVLFK  311



>emb|CDY64929.1| BnaCnng45510D [Brassica napus]
Length=289

 Score = 98.6 bits (244),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 85/258 (33%), Positives = 125/258 (48%), Gaps = 33/258 (13%)
 Frame = +1

Query  253   DGAPVQWPCRELDGWEFAGGDEEEMVAAGEPLPRLIFGGAPSLQEAKEATFDLKDALHKV  432
             D   ++ P  E D WEFA  + +        +PR++F   PSLQEAKEAT DLKDAL   
Sbjct  63    DAVVMRKPVWE-DEWEFAEVETK-------TIPRVVFDKPPSLQEAKEATDDLKDAL---  111

Query  433   YNMSTPPSDCGSTNGAAQVNNDHsppsnsssenAIAHGAPKHAIRAFKFLYENAAAQTVV  612
              NM+     C   +      +        S   A+    P+ A++AF FL EN AAQ+VV
Sbjct  112   -NMA-----CMEGSNEVGSVSRMFSSFQPSENRAVESAVPQVALKAFAFLSENTAAQSVV  165

Query  613   ASIASDPNVWNAVLANPELQEFLVSQKTSAYVLDGEYSVEESIAETDFLRYSSPRNDDLT  792
              SIASDP VW+AV+ N +L +FL            E +   +  E D    S   ++  +
Sbjct  166   TSIASDPKVWDAVMENKDLMKFL------------ETNTASTKDEADNDDKSELSSETES  213

Query  793   SEDGSPKPGNGFTDFLQNIKVAVLDMMNCLSDFFQNLFGGHKVFADADGSAKTSVVDRAW  972
              ED   KP     + L+++K+  + MM  +S +F  LF   + F +     K  +++   
Sbjct  214   EEDSEEKPIQ-LMEILRDMKLKAVQMMENVSSYFGGLF-RTETFTEGGQERKRMLLNDP-  270

Query  973   GASFMGLAIMAIMVVVLK  1026
               +  GLA+  I +VVLK
Sbjct  271   -TTLFGLAVCVIFMVVLK  287



>ref|XP_008452336.1| PREDICTED: uncharacterized protein LOC103493396 [Cucumis melo]
Length=326

 Score = 98.6 bits (244),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 81/283 (29%), Positives = 135/283 (48%), Gaps = 56/283 (20%)
 Frame = +1

Query  301   FAGGDEEEMVAAGEPLPRLIFGGAPSLQEAKEATFDLKDALHKVYNMSTPPSDCGSTNGA  480
             F   + E ++ AGEP+PRL+F   P+L+E+KEAT DLK+ L  +Y  S PP    S+  +
Sbjct  57    FFTYETELVMEAGEPVPRLVFDRVPNLEESKEATADLKEVLDAMYLESEPP---FSSEIS  113

Query  481   AQVNNDHsppsnsssenAIAHGAP--KHAIRAFKFLYENAAAQTVVASIASDPNVWNAVL  654
               ++++            I    P  KH  +AF+ L  +   Q  VAS A+D  V+ AVL
Sbjct  114   LPLHSE------------IVGDGPGVKHVHQAFRLLCNSPEIQNAVASAAADQKVYEAVL  161

Query  655   ANPELQEFLVSQKTSAYV---LDGEYSVEESIAETDFLRYSSPRNDDL------------  789
              N E+++ + S + S+      D E  ++E  ++   ++ S  R D +            
Sbjct  162   ENSEVKKLIQSYQISSDTNEEKDEENVIQEEESKASEMKMSRNRKDFVVKMVKNILSHLP  221

Query  790   ---------------TSEDGSPKPGN---GFTDFLQNIKVAVLDMMNCLSDFFQNLFG--  909
                            + E+ + K GN   GF + L+N+K +V++M+  + ++  N  G  
Sbjct  222   GLFGSSVVENSSGSDSKENSTMKGGNFGSGFVEKLRNLKNSVVEMVTKIPNYLPNFHGSS  281

Query  910   ----GHKVFADADGSAKTSVVDRAWGASFMGLAIMAIMVVVLK  1026
                      +D   ++++SV +   G S  GLAIM IM+VV K
Sbjct  282   SSASESVSGSDHKENSQSSVPELDIGTSLTGLAIMVIMIVVFK  324



>ref|XP_004972711.1| PREDICTED: uncharacterized protein LOC101763830 [Setaria italica]
Length=310

 Score = 97.1 bits (240),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 90/268 (34%), Positives = 136/268 (51%), Gaps = 34/268 (13%)
 Frame = +1

Query  259   APVQWPCR-ELDGWEFAGGDEE--------EMVAAGEPLPRLIFGGAPSLQEAKEATFDL  411
             A  QW    ELD WEFA   ++           AA    PRL+F   PS +EA+EAT +L
Sbjct  63    AAAQWAASWELDDWEFADWRDDAASVVVAEREAAAAAAKPRLVFA-PPSREEAEEATTEL  121

Query  412   KDALHKVYNMSTPPSDCGSTNGAAQVNNDHsppsnsssenAIAHGAPKHAIRAFKFLYEN  591
             +DA+ + Y   +P           +V  +     N  + +AI    P H ++AF  L  +
Sbjct  122   RDAIERAYFNESP----------VEVVKEQDKELNKLATDAIIPSMPGHVVQAFTLLKSS  171

Query  592   AAAQTVVASIASDPNVWNAVLANPELQEFLVSQKTSAYVLDGEYSVEESIAETDFLRYSS  771
               AQ+VVAS+ASD NVW+AVL N ++ EF  + +T+   L   +  E +  E      S 
Sbjct  172   PEAQSVVASLASDRNVWDAVLKNEKVMEFYKTHQTT---LVQTFPEEAATVE------SP  222

Query  772   PRNDDLTSEDGSPKPGNGFTDFLQNIKVAVLDMMNCLSDFFQNLF-GGHKVFADADGSAK  948
              + +D TSE+     G+ F DF+   K  ++D+++ ++ FFQ+L     +  A A  SA+
Sbjct  223   EKFEDATSENAP--TGSPFADFVDKAKKTMMDVVDNITHFFQDLLHPPAEAQAGAGSSAE  280

Query  949   T--SVVDRAWGASFMGLAIMAIMVVVLK  1026
                S+ + A G SFM L I  I+VV+ K
Sbjct  281   KGPSLAEMAVGGSFMALTIAVILVVLFK  308



>gb|KHN36752.1| hypothetical protein glysoja_001483 [Glycine soja]
Length=259

 Score = 95.1 bits (235),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 59/163 (36%), Positives = 94/163 (58%), Gaps = 22/163 (13%)
 Frame = +1

Query  556   HAIRAFKFLYENAAAQTVVASIASDPNVWNAVLANPELQEFLVSQKTSAYVLDGEYSVEE  735
              A++AF+ L E   AQ+VVASIA DPN+WNA++ NP LQ+F  SQ+T+      ++ VEE
Sbjct  111   RALQAFQLLSECPEAQSVVASIACDPNIWNAIVQNPALQDFFQSQQTA------DFEVEE  164

Query  736   SIAETDFLRYSSPRNDDLTSEDGSPKPGNGFTDFLQNIKVAVLDMMNCLSDFFQNLFG--  909
             +    D    + P +D + +   S        + LQN+K  V +M++ + ++ QN+FG  
Sbjct  165   T---HDQRLGNLPYSDSVYAFIDS-------LNVLQNVKFTVSEMLSRVPNYLQNMFGFL  214

Query  910   ---GHKVFADADGSAKTSVVD-RAWGASFMGLAIMAIMVVVLK  1026
                      DA G+ K + +D    G +FMGLA++ +MV++LK
Sbjct  215   SGQTSSAVIDARGNTKANFMDPITMGGTFMGLAVLVVMVIMLK  257



>ref|XP_006851190.1| PREDICTED: uncharacterized protein LOC18440997 [Amborella trichopoda]
 gb|ERN12771.1| hypothetical protein AMTR_s00043p00195000 [Amborella trichopoda]
Length=317

 Score = 92.0 bits (227),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 81/261 (31%), Positives = 129/261 (49%), Gaps = 38/261 (15%)
 Frame = +1

Query  283   ELDGWEFAGGDEEEMVAAGEPLPRLIFGGAPSLQEAKEATFDLKDALHKVYNMSTPPSDC  462
             E++ WEFAG +EE       PLPR++FG AP+ +E +EA  DLKDA  K Y  ++     
Sbjct  80    EVEDWEFAGVEEEY------PLPRVVFGSAPTQKEVEEAASDLKDAFEKAYLSTSTTVSS  133

Query  463   GS-------TNGAAQVN-NDHsppsnsssenAIAHGAPK-HAIRAFKFLYENAAAQTVVA  615
                       N +   N  D    +  +S+NA+A  + + + ++AF  L EN+  Q +V 
Sbjct  134   EVSSDFMHGVNSSMPFNLEDSETKACVTSQNAVAFPSMQSNVMQAFSLLKENSDVQNIVT  193

Query  616   SIASDPNVWNAVLANPELQEFLVSQKTSAYVLDGEYSVEESIAETDFLRYSSPRNDDLTS  795
             S+A+D +VW AVL N ++ EF       A+   G   +E  +AE       +   ++L  
Sbjct  194   SLATDKSVWEAVLKNEKVVEF-----CQAHQQRGASPIE--MAE-------NLGTEELFR  239

Query  796   EDGSPKPGN---GFTDFLQNIKVAVLDMMNCLSDFFQNLFG-GHKVFADADGSAKTSVVD  963
             EDG    GN          N ++  +++M+ +S+FF +  G G K   D+ G      ++
Sbjct  240   EDGDKPFGNWGESLKGLFDNARLKAMELMSTISEFFHSFLGIGSKDSNDSSGVFFNKTIE  299

Query  964   RAWGASFMGLAIMAIMVVVLK  1026
              A    FM LA   I+VV++K
Sbjct  300   YA----FM-LAFAVIIVVLMK  315



>ref|XP_011048251.1| PREDICTED: uncharacterized protein LOC105142358 isoform X3 [Populus 
euphratica]
Length=279

 Score = 90.5 bits (223),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 56/127 (44%), Positives = 77/127 (61%), Gaps = 10/127 (8%)
 Frame = +1

Query  259  APVQWPCRELDGWEFAGGDEEEMVA-AGEPLPRLIFGGAP-SLQEAKEATFDLKDALHKV  432
            A VQ P  ELD WEFAGG EEE V  + EP+ R++FGGAP SLQEA+ ATF+LKDAL KV
Sbjct  60   ATVQRPSWELDEWEFAGGVEEETVVHSAEPVARVVFGGAPPSLQEAEAATFELKDALQKV  119

Query  433  YNMSTPPSDCGSTNGAAQVN-------NDHsppsnsssenAIAHGAPKHAIRAFKFLYEN  591
            Y +S+P S   S+ G +Q++       +D     +    +      PK+A++AF  L E+
Sbjct  120  Y-LSSPNSGTASSVGGSQLSGLPLLRKSDSLETKDCIPCDPTGAPVPKYAMQAFSLLNES  178

Query  592  AAAQTVV  612
               Q ++
Sbjct  179  PKIQVLI  185



>dbj|BAK00216.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=285

 Score = 90.1 bits (222),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 78/239 (33%), Positives = 114/239 (48%), Gaps = 30/239 (13%)
 Frame = +1

Query  352   RLIFGGAPSLQEAKEATFDLKDALH----KVYNMSTPPSDCGSTNGAAQVNNDH-----s  504
             R +FG  PS  EA  AT DL+DA      + +      S  G T  A +   DH     S
Sbjct  61    REVFGPVPSHDEAMAATLDLRDAFEIAKTESHGARLDMSHDGPTKVAQETLQDHPHSEAS  120

Query  505   ppsnsssenAIAHGAPKHAIRAFKFLYENAAAQTVVASIASDPNVWNAVLANPELQEFLV  684
                  +   ++A G+    I AF  L ++  AQ VVAS+ASD NVW AV+ N +L EF  
Sbjct  121   MHEEKNDNLSVASGSSARVIEAFTMLQDSPEAQDVVASLASDKNVWEAVMKNKKLVEFYK  180

Query  685   SQKTSAYVLDGEYSVEESIAETDFLRYSSPRNDDLTSEDGSPKPGNGFTDFLQNIKVAVL  864
             +  + +  +  E   E+S AE+     S   N  L        PG+ F+D++Q +K  V 
Sbjct  181   TNLSESSSVTDE--AEQSDAES-----SQSSNAVL--------PGDAFSDYIQKMKAFVS  225

Query  865   DMMNCLSDFFQNLFGGHKVFADADGSAKTSVVDRAWG-----ASFMGLAIMAIMVVVLK  1026
             +M+  LS   Q+L         + G  KT +V+         +SF+ LAI +I+VV+LK
Sbjct  226   EMVTNLSSIMQDLVATSDE-GQSKGRLKTLIVNTKKDFVNGPSSFVLLAIASILVVLLK  283



>gb|ACF82614.1| unknown [Zea mays]
Length=161

 Score = 87.8 bits (216),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 59/167 (35%), Positives = 88/167 (53%), Gaps = 17/167 (10%)
 Frame = +1

Query  550   PKHAIRAFKFLYENAAAQTVVASIASDPNVWNAVLANPELQEFLVSQKTSAYVLDGEYSV  729
             P H ++AF  L  +  AQ+VVAS+ASD NVW+AVL N ++ EF  + +T+       +  
Sbjct  2     PGHVVQAFTLLKSSTEAQSVVASLASDRNVWDAVLKNEKVMEFYKTHQTTPV---QTFPE  58

Query  730   EESIAETDFLRYSSPRNDDLTSEDGSPK-----PGNGFTDFLQNIKVAVLDMMNCLSDFF  894
             E + AE      S  + +D TSE+ S        G  F DF+ N K  V+D+++ ++DFF
Sbjct  59    EAATAE------SPGKFEDATSENASNSELPTGSGASFADFVDNAKKKVMDVVHNITDFF  112

Query  895   QNLFGGH---KVFADADGSAKTSVVDRAWGASFMGLAIMAIMVVVLK  1026
             ++LF      +  A        S  + A G SFM L I  I+VV+ K
Sbjct  113   RDLFNDSAEAQTGAGPSAEKGFSATEMAVGGSFMALTIAVILVVLFK  159



>gb|EEE58521.1| hypothetical protein OsJ_09808 [Oryza sativa Japonica Group]
Length=279

 Score = 89.0 bits (219),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 76/232 (33%), Positives = 119/232 (51%), Gaps = 24/232 (10%)
 Frame = +1

Query  352   RLIFGGAPSLQEAKEATFDLKDALHKVYNMSTPPSDCGSTNGAAQ--VNNDHsppsnsss  525
             R +FG  P+ +EA  AT DLK++     +    P   G  +   +  +++  S   ++  
Sbjct  63    REVFGPVPTHEEAMAATLDLKESFQFAKSAQLEPLPSGDLDVPTKGLIHSKTSEHEDNHE  122

Query  526   enAIAHGAPKHAIRAFKFLYENAAAQTVVASIASDPNVWNAVLANPELQEFLVSQKTSAY  705
              + ++ GAP   ++AF  L ++  AQ VVAS+ASD NVWNAV+ N ++ +F    KT A 
Sbjct  123   ISLVSSGAPGRVVQAFTMLQDSPEAQEVVASLASDQNVWNAVMRNEKVMKFY---KTYAT  179

Query  706   VLDGEYSVEESIAETDFLRYSSPRNDDLTSEDGSPKPGNGFTDFLQNIKVAVLDMMNCLS  885
              L+ E  VE S  E+D ++ S        SE GS   G  F  +++ +K  V +MM  LS
Sbjct  180   KLN-EDEVEGS--ESDSVQNS--------SELGS--AGEAFMCYVEKMKALVSEMMTNLS  226

Query  886   DFFQNLFGGHKVFADADGSAKTSVVDRAWG-----ASFMGLAIMAIMVVVLK  1026
                Q+L         + G  KT ++D         ++F+ LAI +IMVV+LK
Sbjct  227   SIMQDLVATSDE-GQSKGKLKTMILDSKKDFANAPSAFVLLAIASIMVVLLK  277



>gb|ABF94497.1| expressed protein [Oryza sativa Japonica Group]
Length=288

 Score = 87.0 bits (214),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 77/241 (32%), Positives = 119/241 (49%), Gaps = 33/241 (14%)
 Frame = +1

Query  352   RLIFGGAPSLQEAKEATFDLKDALHKVYNMSTPPSDCG-----------STNGAAQVNND  498
             R +FG  P+ +EA  AT DLK++     +    P   G           S +    +++ 
Sbjct  63    REVFGPVPTHEEAMAATLDLKESFQFAKSAQLEPLPSGDLDVPTKGLVHSESSQGLIHSK  122

Query  499   HsppsnsssenAIAHGAPKHAIRAFKFLYENAAAQTVVASIASDPNVWNAVLANPELQEF  678
              S   ++   + ++ GAP   ++AF  L ++  AQ VVAS+ASD NVWNAV+ N ++ +F
Sbjct  123   TSEHEDNHEISLVSSGAPGRVVQAFTMLQDSPEAQEVVASLASDQNVWNAVMRNEKVMKF  182

Query  679   LVSQKTSAYVLDGEYSVEESIAETDFLRYSSPRNDDLTSEDGSPKPGNGFTDFLQNIKVA  858
                 KT A  L+ E  VE S  E+D ++ S        SE GS   G  F  +++ +K  
Sbjct  183   Y---KTYATKLN-EDEVEGS--ESDSVQNS--------SELGS--AGEAFMCYVEKMKAL  226

Query  859   VLDMMNCLSDFFQNLFGGHKVFADADGSAKTSVVDRAWG-----ASFMGLAIMAIMVVVL  1023
             V +MM  LS   Q+L         + G  KT ++D         ++F+ LAI +IMVV+L
Sbjct  227   VSEMMTNLSSIMQDLVATSDE-GQSKGKLKTMILDSKKDFANAPSAFVLLAIASIMVVLL  285

Query  1024  K  1026
             K
Sbjct  286   K  286



>gb|EMT06766.1| hypothetical protein F775_27558 [Aegilops tauschii]
Length=251

 Score = 85.9 bits (211),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 62/204 (30%), Positives = 100/204 (49%), Gaps = 19/204 (9%)
 Frame = +1

Query  421   LHKVYNMSTPPSDCGSTNGAAQVNNDHsppsnsssenAIAHGAPKHAIRAFKFLYENAAA  600
             + +VY   TP           +V  +H    +    +A+    P H ++AF  L  +  A
Sbjct  63    VQRVYFKETP----------VEVVKEHDQELSKLGADALIPAMPGHVVQAFTLLKSSPEA  112

Query  601   QTVVASIASDPNVWNAVLANPELQEFLVSQKTSAYVLDGEYSVEESIAETDFLRYSSPRN  780
             Q+VVAS+ASD NVW+AVL N  + EF  S + +        +  E    TD +   SP  
Sbjct  113   QSVVASLASDKNVWDAVLKNERVMEFYKSHQQTLV-----NTFPEGTDSTDSVE--SPEK  165

Query  781   DDLTSEDGSPKPGNGFTDFLQNIKVAVLDMMNCLSDFFQNLFGGHKVFADADGSA--KTS  954
              +  S + +    +  +DF+ N K  +++M++ +++FFQ+LF          GS+  K S
Sbjct  166   FEEASPEYALPTASPLSDFVDNAKKTMMEMVDNITNFFQDLFHNPAEAEAGPGSSSKKPS  225

Query  955   VVDRAWGASFMGLAIMAIMVVVLK  1026
               + A G SFM LA+  I+VV+ K
Sbjct  226   FAEMAAGGSFMALAMAVILVVLFK  249



>ref|XP_004149934.1| PREDICTED: uncharacterized protein LOC101211780 [Cucumis sativus]
 gb|KGN56181.1| hypothetical protein Csa_3G094000 [Cucumis sativus]
Length=320

 Score = 85.5 bits (210),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 88/280 (31%), Positives = 130/280 (46%), Gaps = 57/280 (20%)
 Frame = +1

Query  313   DEEEMVA-AGEPLPRLIFGGAPSLQEAKEATFDLKDALHKVYNMSTPPSDCGSTNGAAQV  489
             DE E+V  AGEP+PRL+F    +L+E+KE+T DLK+AL  +Y  S  P    S+  +  +
Sbjct  54    DETELVMEAGEPVPRLVFDRFINLEESKESTADLKEALDAMYLESEFP---FSSEISLPL  110

Query  490   NNDHsppsnsssenAIAHGAP--KHAIRAFKFLYENAAAQTVVASIASDPNVWNAVLANP  663
             N++            I H  P  KH  +AF  L      Q VVAS A+D  V  AV  NP
Sbjct  111   NSE------------IVHNRPGVKHVHQAFHLLCNFPEVQNVVASAAADLKVQEAVFENP  158

Query  664   ELQEFLVSQKTSAYVLDGEY-----SVEESIAE--------TDFL---------------  759
             ++++F+ S +TS+   + E       VEES A          DF+               
Sbjct  159   DVKKFIQSFQTSSDTDEDEDEENVSQVEESKASEIKMTRNPKDFVVKMVKNVLSHFPHLF  218

Query  760   -----RYSSPRNDDLTSEDGSPKPGNGFTDFLQNIKVAVLDMMNCLSDFFQNLFG-----  909
                    SS  +D   S     K G+GF   L+N+K +V++M   + ++  N +G     
Sbjct  219   GSSVVEGSSGSDDKENSTMKGGKFGSGFVQKLRNLKSSVVEMATNIPNYLPNFYGSSSSA  278

Query  910   -GHKVFADADGSAKTSVVDRAWGASFMGLAIMAIMVVVLK  1026
                   +D   ++++SV     G S  GLAIM IM+ V K
Sbjct  279   SESVSGSDHKENSQSSVPGMGTGTSITGLAIMVIMIAVFK  318



>gb|ABR26041.1| unknown [Oryza sativa Indica Group]
Length=168

 Score = 79.7 bits (195),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 56/168 (33%), Positives = 85/168 (51%), Gaps = 25/168 (15%)
 Frame = +1

Query  532   AIAHGAPKHAIRAFKFLYENAAAQTVVASIASDPNVWNAVLANPELQEFLVSQKTSAYVL  711
             AI    P H ++AF  L  +  AQ VVAS+ASD NVW+AVL N ++ EF  + + S    
Sbjct  21    AIIPAMPGHVMQAFTLLKSSPEAQGVVASLASDKNVWDAVLKNEKVMEFYKTHQQSLV--  78

Query  712   DGEYSVEESIAETDFLRYSSPRNDDLTSEDGSP--KPGNG-FTDFLQNIKVAVLDMMNCL  882
                Y+  E  A       S  +  D +SE+ S   KP +  F DF+ N +  V+D++N +
Sbjct  79    ---YTFPEGTASV----VSPEKLADASSENSSSGEKPESSPFADFMDNARKTVIDIVNNI  131

Query  883   SDFFQNLFGGHKVFADADGSAKTSVVDRAWGASFMGLAIMAIMVVVLK  1026
             ++FFQ++F             +        G SFM LAI  I++++ K
Sbjct  132   TNFFQDMF-------------RKPNEAEILGGSFMALAIAVILLIMFK  166



>gb|KDO74400.1| hypothetical protein CISIN_1g021190mg [Citrus sinensis]
Length=219

 Score = 80.1 bits (196),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 56/152 (37%), Positives = 81/152 (53%), Gaps = 16/152 (11%)
 Frame = +1

Query  286  LDGWEFAGGDEEEMVAAGEPLPRLIFGGAPSLQEAKEATFDLKDALHKVYNMST------  447
            +D WEFAGG ++      EP+PR++FGGAPSL+E KEAT +LKDAL KVY  S+      
Sbjct  69   VDDWEFAGGVDD---LPAEPMPRVVFGGAPSLEETKEATAELKDALDKVYLSSSNSNTSE  125

Query  448  --PPSDCGSTNGAAQV-NNDHsppsnsssenAIAHGAPKHAIRAFKFLYENAAAQTVVAS  618
               P   G  +    + N++H+   +  + +  +   PK AI+AFK L E+ AAQ     
Sbjct  126  HGDPFVVGEVSSMPLLANSEHTETKSCITYDLKSASVPKPAIQAFKLLSESPAAQMTCFK  185

Query  619  IASDPNVWNAVLANPELQEFLVSQKTSAYVLD  714
            I +     +  L    +Q  LV+ KT    L+
Sbjct  186  IRN----LSKFLKQHLIQANLVTLKTKVLTLE  213



>ref|XP_004985312.1| PREDICTED: uncharacterized protein LOC101783230 [Setaria italica]
Length=310

 Score = 80.5 bits (197),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 74/259 (29%), Positives = 115/259 (44%), Gaps = 43/259 (17%)
 Frame = +1

Query  352   RLIFGGAPSLQEAKEATFDLKDALH------KVYNMSTP---------------------  450
             R +FG  P+ +EA  AT DL +A           ++ TP                     
Sbjct  59    REVFGPVPTHEEAMAATLDLSEAFEIAKAESHTADLDTPKKHFSITDQDNHAKVAQQIAL  118

Query  451   PSDCGSTNGAAQVNNDHsppsnsssenAIAHGAPKHAIRAFKFLYENAAAQTVVASIASD  630
             P    S      V+++ S   ++      A G P   ++AF  L+EN  AQ VVAS+ASD
Sbjct  119   PQSVESETPQVVVHSETSKKEDNYENLLAASGTPGRVVQAFTLLHENPEAQDVVASLASD  178

Query  631   PNVWNAVLANPELQEFLVSQKTSAYVLDGEYSVEESIA--ETDFLRYSSPRNDDLTSEDG  804
              NVW+AV+ N ++ +F    KT    L    S   S++  E +    +S ++ DL     
Sbjct  179   KNVWDAVMKNEKVLKFY---KTYESKLSQCSSAASSVSGDEAEDGDAASVQSTDL-----  230

Query  805   SPKPGNGFTDFLQNIKVAVLDMMNCLSDFFQNLFGGHKVFADADGSAKTSVVDRAWG---  975
              P  G    D+L+ I+  V +M+  LS+  Q+L           G  KT ++  +     
Sbjct  231   RPSTGESVKDYLEKIRALVFEMVTNLSNMMQDLVATSD-EGRCKGKIKTLIMSSSKDFPS  289

Query  976   --ASFMGLAIMAIMVVVLK  1026
               ++F+ LAI +IMVV+LK
Sbjct  290   APSAFVLLAIASIMVVLLK  308



>gb|EEE68150.1| hypothetical protein OsJ_26259 [Oryza sativa Japonica Group]
Length=143

 Score = 77.4 bits (189),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 54/162 (33%), Positives = 83/162 (51%), Gaps = 25/162 (15%)
 Frame = +1

Query  550   PKHAIRAFKFLYENAAAQTVVASIASDPNVWNAVLANPELQEFLVSQKTSAYVLDGEYSV  729
             P H ++AF  L  +  AQ VVAS+ASD NVW+AVL N ++ EF  + + S       Y+ 
Sbjct  2     PGHVMQAFTLLKSSPEAQGVVASLASDKNVWDAVLKNEKVMEFYKTHQQSLV-----YTF  56

Query  730   EESIAETDFLRYSSPRNDDLTSEDGSP--KPGNG-FTDFLQNIKVAVLDMMNCLSDFFQN  900
              E  A       S  +  D +SE+ S   KP +  F DF+ N +  V+D++N +++FFQ+
Sbjct  57    PEGTASV----VSPEKLADASSENSSSGEKPESSPFADFMDNARKTVIDIVNNITNFFQD  112

Query  901   LFGGHKVFADADGSAKTSVVDRAWGASFMGLAIMAIMVVVLK  1026
             +F             +        G SFM LAI  I++++ K
Sbjct  113   MF-------------RKPNEAEILGGSFMALAIAVILLIMFK  141



>ref|XP_006452121.1| hypothetical protein CICLE_v10008955mg [Citrus clementina]
 gb|ESR65361.1| hypothetical protein CICLE_v10008955mg [Citrus clementina]
 gb|KDO74402.1| hypothetical protein CISIN_1g021190mg [Citrus sinensis]
Length=181

 Score = 77.0 bits (188),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 48/115 (42%), Positives = 70/115 (61%), Gaps = 12/115 (10%)
 Frame = +1

Query  286  LDGWEFAGGDEEEMVAAGEPLPRLIFGGAPSLQEAKEATFDLKDALHKVY--NMSTPPSD  459
            +D WEFAGG ++      EP+PR++FGGAPSL+E KEAT +LKDAL KVY  + ++  S+
Sbjct  69   VDDWEFAGGVDD---LPAEPMPRVVFGGAPSLEETKEATAELKDALDKVYLSSSNSNTSE  125

Query  460  CGSTNGAAQV-------NNDHsppsnsssenAIAHGAPKHAIRAFKFLYENAAAQ  603
             G      +V       N++H+   +  + +  +   PK AI+AFK L E+ AAQ
Sbjct  126  HGDPFVVGEVSSMPLLANSEHTETKSCITYDLKSASVPKPAIQAFKLLSESPAAQ  180



>gb|EMT30710.1| hypothetical protein F775_11491 [Aegilops tauschii]
Length=222

 Score = 77.0 bits (188),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 57/163 (35%), Positives = 85/163 (52%), Gaps = 26/163 (16%)
 Frame = +1

Query  562   IRAFKFLYENAAAQTVVASIASDPNVWNAVLANPELQEFLVSQKTSAYVLDGEYSVEESI  741
             I AF  L+E+  AQ VVAS+ASD NVW AV+ N +L EF             + ++ ES 
Sbjct  76    IEAFTMLHESPEAQDVVASLASDKNVWEAVMKNKKLVEFY------------KTNLSESS  123

Query  742   AETDFLRYSSPRNDDLTSEDGSPKPGNGFTDFLQNIKVAVLDMMNCLSDFFQNLFGGHKV  921
             + TD    S   +    S +G   PG+ F+D++Q +K  V +M+  LS   Q+L      
Sbjct  124   SVTDEAELSDAESSQ--SSNGVVSPGDAFSDYIQMMKAFVSEMVTNLSSIMQDLVAT---  178

Query  922   FAD---ADGSAKTSVVDRAWG-----ASFMGLAIMAIMVVVLK  1026
              AD   + G  KT +++         +SF+ LAI +I+VV+LK
Sbjct  179   -ADEGQSKGMLKTLIINTKKDFTNGPSSFVLLAIASILVVLLK  220



>gb|EAY88928.1| hypothetical protein OsI_10413 [Oryza sativa Indica Group]
Length=327

 Score = 77.8 bits (190),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 62/169 (37%), Positives = 91/169 (54%), Gaps = 22/169 (13%)
 Frame = +1

Query  535   IAHGAPKHAIRAFKFLYENAAAQTVVASIASDPNVWNAVLANPELQEFLVSQKTSAYVLD  714
             ++ GAP   ++AF  L ++  AQ VVAS+ASD NVWNAV+ N ++ +F    KT A  L+
Sbjct  174   VSSGAPGRVVQAFTMLQDSPEAQEVVASLASDQNVWNAVMRNEKVMKFY---KTYATKLN  230

Query  715   GEYSVEESIAETDFLRYSSPRNDDLTSEDGSPKPGNGFTDFLQNIKVAVLDMMNCLSDFF  894
              E  VE S  E+D ++ S        SE GS   G  F  +++ +K  V +MM  LS   
Sbjct  231   -EDEVEGS--ESDSVQNS--------SELGS--AGEAFMCYVEKMKALVSEMMTNLSSIM  277

Query  895   QNLFGGHKVFADADGSAKTSVVDRAWG-----ASFMGLAIMAIMVVVLK  1026
             Q+L         + G  KT ++D         ++F+ LAI +IMVV+LK
Sbjct  278   QDLVATSD-EGQSKGKLKTMILDSKKDFANAPSAFVLLAIASIMVVLLK  325



>ref|NP_001049294.1| Os03g0201000 [Oryza sativa Japonica Group]
 gb|ABF94496.1| expressed protein [Oryza sativa Japonica Group]
 dbj|BAF11208.1| Os03g0201000 [Oryza sativa Japonica Group]
 dbj|BAG91353.1| unnamed protein product [Oryza sativa Japonica Group]
Length=327

 Score = 77.8 bits (190),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 62/169 (37%), Positives = 91/169 (54%), Gaps = 22/169 (13%)
 Frame = +1

Query  535   IAHGAPKHAIRAFKFLYENAAAQTVVASIASDPNVWNAVLANPELQEFLVSQKTSAYVLD  714
             ++ GAP   ++AF  L ++  AQ VVAS+ASD NVWNAV+ N ++ +F    KT A  L+
Sbjct  174   VSSGAPGRVVQAFTMLQDSPEAQEVVASLASDQNVWNAVMRNEKVMKFY---KTYATKLN  230

Query  715   GEYSVEESIAETDFLRYSSPRNDDLTSEDGSPKPGNGFTDFLQNIKVAVLDMMNCLSDFF  894
              E  VE S  E+D ++ S        SE GS   G  F  +++ +K  V +MM  LS   
Sbjct  231   -EDEVEGS--ESDSVQNS--------SELGS--AGEAFMCYVEKMKALVSEMMTNLSSIM  277

Query  895   QNLFGGHKVFADADGSAKTSVVDRAWG-----ASFMGLAIMAIMVVVLK  1026
             Q+L         + G  KT ++D         ++F+ LAI +IMVV+LK
Sbjct  278   QDLVATSD-EGQSKGKLKTMILDSKKDFANAPSAFVLLAIASIMVVLLK  325



>tpg|DAA43934.1| TPA: hypothetical protein ZEAMMB73_179991 [Zea mays]
Length=270

 Score = 76.6 bits (187),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 71/242 (29%), Positives = 112/242 (46%), Gaps = 22/242 (9%)
 Frame = +1

Query  352   RLIFGGAPSLQEAKEATFDLKDALHKVYNMSTPPSDCGSTNGAAQ-VNNDHsppsnssse  528
             R +FG  P+ +E+  AT DLKDA       S     C       + V    S   +++  
Sbjct  32    REVFGPVPTHEESMAATLDLKDAFEITMEASEAIMICPRNEWPKKYVVYGMSKKEDNNEN  91

Query  529   nAIAHGAPKHAIRAFKFLYENAAAQTVVASIASDPNVWNAVLANPELQEFLVSQKT----  696
               ++ G     ++AF  L E+  AQ VVAS+ASD NVW+AV+ N ++ +F  + ++    
Sbjct  92    LVVSSGTSGRVVQAFTLLQESPEAQVVVASLASDKNVWDAVMKNEKVIKFYKTYESNYLS  151

Query  697   -SAYVLDGEYSVEESIAETDFLRYSSPRNDD-----LTSEDGSPKP-GNGFTDFLQNIKV  855
              ++Y L  E S   S+A +     S    +D     L S    P+  G    D+L+ +K 
Sbjct  152   NTSYCLPTELSKCSSVASS----VSGHEVEDGEAASLQSNTYLPQSAGESVKDYLEKMKA  207

Query  856   AVLDMMNCLSDFFQNLFGGHKVFADADGSAKTSVVDRAWG-----ASFMGLAIMAIMVVV  1020
              V +MM  LS+  Q+L         + G  KT             ++F+ LA+ +IMVV+
Sbjct  208   LVSEMMANLSNIMQDLVATSD-EGRSKGEIKTLTTSSCKDFSNAPSAFVLLAVASIMVVL  266

Query  1021  LK  1026
             LK
Sbjct  267   LK  268



>ref|XP_004987122.1| PREDICTED: uncharacterized protein LOC101758268 [Setaria italica]
Length=224

 Score = 74.7 bits (182),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 54/168 (32%), Positives = 83/168 (49%), Gaps = 20/168 (12%)
 Frame = +1

Query  538   AHGAPKHAIRAFKFLYENAAAQTVVASIASDPNVWNAVLANPELQEFLVSQKTSAYVLDG  717
             A G P   ++AF  L+EN  AQ VVAS+ASD NVW+AV+ N ++ +F  +   ++ V   
Sbjct  70    ASGTPGRVVQAFTLLHENPEAQDVVASLASDKNVWDAVMKNEKVLKFYKTYDAASSVSGD  129

Query  718   EYSVEESIAETDFLRYSSPRNDDLTSEDGSPKPGNGFTDFLQNIKVAVLDMMNCLSDFFQ  897
             E   E+  A +            + S D  P  G    D+L+ I+  V +M+  LS+  Q
Sbjct  130   E--AEDGDAAS------------VQSTDLRPSTGESVKDYLEKIRALVFEMVTNLSNMMQ  175

Query  898   NLFGGHKVFADADGSAKTSVVDRAWG-----ASFMGLAIMAIMVVVLK  1026
             +L           G  KT ++  +       + F+ LAI +IMVV+LK
Sbjct  176   DLVATSD-EGRCKGKIKTLIMSTSKDFPSAPSVFVLLAIASIMVVLLK  222



>ref|XP_010229018.1| PREDICTED: uncharacterized protein LOC100829035 [Brachypodium 
distachyon]
Length=282

 Score = 73.9 bits (180),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 71/236 (30%), Positives = 109/236 (46%), Gaps = 25/236 (11%)
 Frame = +1

Query  352   RLIFGGAPSLQEAKEATFDLKDALH------KVYNMSTPPSDCGSTNGAAQVNNDHspps  513
             R +FG  P+ +EA  AT DL++A         V ++    +         +V+++     
Sbjct  59    REVFGPVPTYEEAMAATIDLREAFEIAKVESHVAHLEISKTKDAQETFQDRVHSESFKHE  118

Query  514   nsssenAIAHGAPKHAIRAFKFLYENAAAQTVVASIASDPNVWNAVLANPELQEFLVSQK  693
             +     +++ GA    I AF  L E+  AQ VVAS+ASD NVW AV+ N ++ +F    K
Sbjct  119   DKYENLSVSSGASGRVIEAFTMLQESPEAQDVVASLASDKNVWEAVMKNEKVLQFY---K  175

Query  694   TSAYVLDGEYSVEESIAETDFLRYSSPRNDDLTSEDGSPKPGNGFTDFLQNIKVAVLDMM  873
             T    L    SV E           S      +S   SP  G  F D+++ +K  V +M+
Sbjct  176   TCGTDLSESSSVTE----------DSDAESSQSSSVPSPGSGEAFKDYVEKMKAFVSEMV  225

Query  874   NCLSDFFQNLFGGHKVFADADGSAKTSVV----DRAWG-ASFMGLAIMAIMVVVLK  1026
               LS   Q+L         + G  KT ++    D A G ++F+ LAI +I VV+LK
Sbjct  226   TNLSSIMQDLVATSDK-GQSKGRLKTLIMNTKKDFANGPSTFVLLAIASIFVVLLK  280



>gb|EMS62049.1| hypothetical protein TRIUR3_22897 [Triticum urartu]
Length=215

 Score = 71.2 bits (173),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 58/206 (28%), Positives = 96/206 (47%), Gaps = 35/206 (17%)
 Frame = +1

Query  484   QVNNDHsppsnsssenAIAHGAPKHAIRAFKFLYENAAAQ--------------------  603
             +V  +H    +    +A+    P H ++AF  L  +  AQ                    
Sbjct  18    EVVKEHDQELSKLGADALIPAMPGHVVQAFTLLKSSPEAQLRHFPKAWHLVIRYLVSGEF  77

Query  604   TVVASIASDPNVWNAVLANPELQEFLVSQKTSAYVLDGEYSVEESIAETDFLRYSSPRND  783
             +VVAS+ASD NVW+AVL N  + EF  S + +        +  E    +D +   SP   
Sbjct  78    SVVASLASDKNVWDAVLKNERVMEFYKSHQQTLV-----NTFPEGTDSSDSVE--SPEKF  130

Query  784   DLTSEDGSPKPGNGFTDFLQNIKVAVLDMMNCLSDFFQNLFGGHKVFADADG-----SAK  948
             +  S + +    +  +DF+ N K  +++M++ +++FFQ+LF      A+A+      S K
Sbjct  131   EEASPEYALPTASPLSDFVDNAKKTMMEMVDNITNFFQDLFHNP---AEAEARPGSSSKK  187

Query  949   TSVVDRAWGASFMGLAIMAIMVVVLK  1026
              S  + A G SFM LA+  I+VV+ K
Sbjct  188   PSFAEMAAGGSFMALAMAVILVVLFK  213



>gb|ABK21444.1| unknown [Picea sitchensis]
Length=314

 Score = 72.0 bits (175),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 73/278 (26%), Positives = 113/278 (41%), Gaps = 62/278 (22%)
 Frame = +1

Query  274   PCRELDGWEFAGGDEE--EMVAAGEPLPRLIFGGAPSLQEAKEATFDLKDALHK------  429
             PC  LD WEF G DEE  +     +   RLIFG  P+ +E +E   D +DAL +      
Sbjct  70    PCWLLDDWEFTG-DEEGFQRHYDDDHHDRLIFGSVPTQKEVQEVVSDFQDALTQGIVPVS  128

Query  430   --------------VYNMSTPPSDCGSTNGAAQVNNDHsppsnsssenAIAHGAPKHAI-  564
                           VY  S   S CG+      VN D     +      I   A  + + 
Sbjct  129   GNFNDKTTLSSSSSVYKKSGNKS-CGTL-----VNLDQMERESHEDNYRIVQKAGHNNVC  182

Query  565   RAFKFLYENAAAQTVVASIASDPNVWNAVLANPELQEFLVSQKTSAYVLDGEYSVEESIA  744
              AF  L  N A Q +V S+ASD  VW A+L N ++ EF  S                   
Sbjct  183   EAFNLLQSNPAVQEMVISLASDKTVWEALLKNEKVTEFRQS-------------------  223

Query  745   ETDFLRYSSPRNDDLTSEDGSPKPG--NGFTDFLQNIKVAVLDMMNCLSDFFQNLFGGHK  918
                 L+    +  +L+ +   P P   N F   ++N K+ V++ +  +++     FG   
Sbjct  224   ----LQKDESKLRELSKDSDKPPPHQENHFMWVIENTKMKVMECIEKITELLNQYFG---  276

Query  919   VFADADGSAKTSV--VDRAWGASFMGLAIMAIMVVVLK  1026
              F D     K     ++R   AS M L++  ++++++K
Sbjct  277   -FVDEKDLFKKDEDPLERILRASLM-LSVAVLLMILVK  312



>gb|KDP39008.1| hypothetical protein JCGZ_00765 [Jatropha curcas]
Length=134

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 42/119 (35%), Positives = 63/119 (53%), Gaps = 18/119 (15%)
 Frame = +1

Query  346  LPRLIFGGAPSLQEAKEATFDLKDALHKVYNMSTPPSDCGSTNGAAQVNNDHsppsnsss  525
            +P ++F   PSL+EA+ AT D KDAL KVY   +P +   S       + +         
Sbjct  1    MPMVVFAPPPSLKEAEAATSDSKDALEKVYLSLSPRAKTESGGSFGIGSGET--------  52

Query  526  enAIAHGAPKHAIRAFKFLYENAAAQTVVASIASDPNVWNAVLANPELQEFLVSQKTSA  702
                      HA+ A  FL E++ AQ+VVA + SDP +W+A   N  +Q+F+ S+KT+A
Sbjct  53   ----------HAMAAIVFLNESSDAQSVVAFLVSDPKLWDAFRNNVAVQKFIKSRKTTA  101



>ref|XP_006649578.1| PREDICTED: uncharacterized protein LOC102707381 [Oryza brachyantha]
Length=338

 Score = 67.0 bits (162),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 53/170 (31%), Positives = 82/170 (48%), Gaps = 27/170 (16%)
 Frame = +1

Query  544   GAPKHAIRAFKFLYENAAAQTVVASIASDPNVWNAVLANPELQEFLVSQKTSAYVLDGEY  723
             GA +  ++AF  L+E+   Q VVAS+A D NVWNAV+ N ++ ++  + +T     + E 
Sbjct  185   GASERVVQAFTMLHESPETQDVVASLACDTNVWNAVMRNEKVMKYYKTYETKLSEDEVEG  244

Query  724   SVEESIAETDFLRYSSPRNDDLTSEDGSPKPGNGFTDFLQNIKVAVLDMMNCLSDFFQNL  903
             + E   A+               SE  +   G  F D+++ +K  V +M+  LS   Q+L
Sbjct  245   TGESGYAQNG-------------SEPATASAGEAFMDYVEKMKALVSEMVTNLSSIMQDL  291

Query  904   FGGHKVFADADGSAKTSV--------VDRAWGAS-FMGLAIMAIMVVVLK  1026
                  V    +G +K  V         D A   S F+ LAI +IMVV+LK
Sbjct  292   -----VATSNEGQSKGKVKIMTMYSQKDFATAPSAFVVLAIASIMVVLLK  336



>ref|XP_002961012.1| hypothetical protein SELMODRAFT_437468 [Selaginella moellendorffii]
 gb|EFJ38551.1| hypothetical protein SELMODRAFT_437468 [Selaginella moellendorffii]
Length=306

 Score = 64.7 bits (156),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 71/255 (28%), Positives = 101/255 (40%), Gaps = 46/255 (18%)
 Frame = +1

Query  289  DGWEFAGGDEEEMVAAGEPLPRLIFGGAPSLQEAKEATFDLKDALHKVYNMSTPP-----  453
            D W FAG +E       +    L+FG APS  E +EAT DL++AL   +    P      
Sbjct  59   DDWVFAGDEERSEYFVRD---HLVFGAAPSRDEVEEATADLQNALGMCFGEGLPTPALQQ  115

Query  454  -SDCGSTNGAAQVNNDHsppsnsssenAIAHGAPKHAIR------AFKFLYENAAAQTVV  612
             S   S  G + V+  H                     R      AF  L  +   Q VV
Sbjct  116  DSPVSSIRGPSSVHLGHPVVDWIEPHLVSHEPGNVQVCRRNEVAEAFSLLQNDPIVQGVV  175

Query  613  ASIASDPNVWNAVLANPELQEFLVSQKTSAY----VLDGEYSVEESIAETDFLRYSSPRN  780
             S+ASD  VW+AVLAN +++EF    + + Y      DGE   E S       +++ P  
Sbjct  176  MSVASDKAVWDAVLANEKVKEFRKKLQENGYESFVAGDGEVIQEGS-------KHTRP--  226

Query  781  DDLTSEDGSPKPGNGFTDFLQNI----KVAVLDMMNCLSDFFQNL--FGGHKVFADADGS  942
                    S +P     DFL  +    K A L +   L++   +   F  +K F+  DG 
Sbjct  227  --------SDQPNPNLVDFLAQLLDYSKNAYLRVKRMLTELLSSFLSFADNKFFSTKDG-  277

Query  943  AKTSVVDRAWGASFM  987
               +  D A  + FM
Sbjct  278  ---NFADPAIKSCFM  289



>ref|XP_012071198.1| PREDICTED: uncharacterized protein LOC105633231 [Jatropha curcas]
Length=117

 Score = 60.8 bits (146),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 40/114 (35%), Positives = 59/114 (52%), Gaps = 18/114 (16%)
 Frame = +1

Query  355  LIFGGAPSLQEAKEATFDLKDALHKVYNMSTPPSDCGSTNGAAQVNNDHsppsnsssenA  534
            ++F   PSL+EA+ AT D KDAL KVY   +P +   S       + +            
Sbjct  2    VVFAPPPSLKEAEAATSDSKDALEKVYLSLSPRAKTESGGSFGIGSGET-----------  50

Query  535  IAHGAPKHAIRAFKFLYENAAAQTVVASIASDPNVWNAVLANPELQEFLVSQKT  696
                   HA+ A  FL E++ AQ+VVA + SDP +W+A   N  +Q+F+ S+KT
Sbjct  51   -------HAMAAIVFLNESSDAQSVVAFLVSDPKLWDAFRNNVAVQKFIKSRKT  97



>ref|XP_002468323.1| hypothetical protein SORBIDRAFT_01g043800 [Sorghum bicolor]
 gb|EER95321.1| hypothetical protein SORBIDRAFT_01g043800 [Sorghum bicolor]
Length=239

 Score = 62.4 bits (150),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 68/241 (28%), Positives = 100/241 (41%), Gaps = 74/241 (31%)
 Frame = +1

Query  352   RLIFGGAPSLQEAKEATFDLKDALHKVYNMSTPPSDCGSTNGAAQVNNDHsppsnsssen  531
             R +FG  P+ +EA  AT DLKDA   +                                 
Sbjct  55    REVFGPVPTHEEALAATLDLKDAFEIL---------------------------------  81

Query  532   AIAHGAPKHAIRAFKFLYENAAAQTVVASIASDPNVWNAVLANPELQEFLVSQKTSAYVL  711
                     + + A   L    A Q VVAS+ASD NVW+AV+ N ++ +F       AY  
Sbjct  82    --------NRLLAMSILTNFVATQDVVASLASDKNVWDAVMKNEKVMKFY-----KAY--  126

Query  712   DGEYSVEESIAETDFLRYSSPRNDDLTSEDG-----------SPKPGNGFTDFLQNIKVA  858
             + + S   SIA       SS   D++  EDG           S   G    D+L+ +K  
Sbjct  127   ESKLSECSSIA-------SSVSGDEV--EDGEAASLRSNTYLSQSTGESVKDYLEKMKAL  177

Query  859   VLDMMNCLSDFFQNLFGGHKVFADADGSAKTSVVDRAWG-----ASFMGLAIMAIMVVVL  1023
             V +MM  LS+  Q+L         + G+ KT ++  +       ++F+ LAI +IMVV+L
Sbjct  178   VSEMMANLSNMMQDLVATSDE-GRSKGTIKTLIMSSSKDFPNAPSAFVLLAIASIMVVLL  236

Query  1024  K  1026
             K
Sbjct  237   K  237



>ref|XP_002966997.1| hypothetical protein SELMODRAFT_439861 [Selaginella moellendorffii]
 gb|EFJ31596.1| hypothetical protein SELMODRAFT_439861 [Selaginella moellendorffii]
Length=303

 Score = 62.0 bits (149),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 66/238 (28%), Positives = 95/238 (40%), Gaps = 41/238 (17%)
 Frame = +1

Query  289  DGWEFAGGDEEEMVAAGEPLPRLIFGGAPSLQEAKEATFDLKDALHKVYNMSTPP-----  453
            D W FAG +E       +    L+FG APS  E +EAT DL++AL   +    P      
Sbjct  59   DDWVFAGDEERSEYFVRD---HLVFGAAPSRDEVEEATADLQNALGMCFGEGLPTPALQQ  115

Query  454  -SDCGSTNGAAQVNNDHsppsnsssenAIAHGAPKHAIR------AFKFLYENAAAQTVV  612
             S   S  G + V+  H                     R      AF  L  +   Q VV
Sbjct  116  DSPVSSIRGPSSVHLGHPVVDWIEPHLVSHEPGNVQVCRRNEVAEAFSLLQNDPIVQGVV  175

Query  613  ASIASDPNVWNAVLANPELQEFLVSQKTSAY----VLDGEYSVEESIAETDFLRYSSPRN  780
             S+ASD  VW+AVLAN +++EF    + + Y      DGE   E         +++ P  
Sbjct  176  MSVASDKAVWDAVLANEKVKEFRKKLQENGYESFVAGDGEVIQEGG-------KHTRP--  226

Query  781  DDLTSEDGSPKPGNGFTDFLQNI----KVAVLDMMNCLSDFFQNLFGGHKVFADADGS  942
                    S +P     DFL  +    K A L +   L++   + F  +K F+  DG+
Sbjct  227  --------SDQPNPNLVDFLAQLLDYSKNAYLRVKRMLTELLSS-FLDNKFFSTKDGN  275



>gb|ACJ85791.1| unknown [Medicago truncatula]
Length=70

 Score = 55.5 bits (132),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 33/68 (49%), Positives = 45/68 (66%), Gaps = 8/68 (12%)
 Frame = +1

Query  838   LQNIKVAVLDMMNCLSDFFQNLF---GGHKVFADADGSAKTSVVD--RAWGASFMGLAIM  1002
             LQN+K+ V +M++ +S+FFQN+F      K  ADADG    S +D     G SFMGLA+M
Sbjct  4     LQNLKLTVTEMVSRMSNFFQNIFPTVEKDKSSADADGG---SFMDYKNVMGTSFMGLAVM  60

Query  1003  AIMVVVLK  1026
              IMVV++K
Sbjct  61    VIMVVLMK  68



>ref|XP_007149673.1| hypothetical protein PHAVU_005G0894000g, partial [Phaseolus vulgaris]
 gb|ESW21667.1| hypothetical protein PHAVU_005G0894000g, partial [Phaseolus vulgaris]
Length=87

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 30/90 (33%), Positives = 54/90 (60%), Gaps = 16/90 (18%)
 Frame = +1

Query  604  TVVASIASDPNVWNAVLANPELQEFLVSQKTSAYVLDGEYSVEESIAETDFLRYSSPRND  783
            +VVASIA DPN+WNA++ NP+LQ+F+ +Q+T+ + ++G  S+++ +             +
Sbjct  1    SVVASIACDPNIWNAMVKNPKLQDFVDAQQTAGFEVEG--SLDKKV-------------E  45

Query  784  DLTSEDGSPKPGNGFTDFLQNIKVAVLDMM  873
            DL   D      N   + L N+K+ V++M+
Sbjct  46   DLPYSDSVYSLIN-LMNILCNVKLTVVEMI  74



>ref|XP_002530913.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF31462.1| conserved hypothetical protein [Ricinus communis]
Length=58

 Score = 51.6 bits (122),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 27/56 (48%), Positives = 36/56 (64%), Gaps = 3/56 (5%)
 Frame = +1

Query  868   MMNCLSDFFQNLFG---GHKVFADADGSAKTSVVDRAWGASFMGLAIMAIMVVVLK  1026
             M+N +S F Q +FG      + A AD +A+ S +D+   ASFM LA+M IMVVVLK
Sbjct  1     MVNNVSTFVQQIFGYSPADNISAAADANARPSFIDKTMAASFMALAVMVIMVVVLK  56



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3165529136015