BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig13259

Length=1487
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009795521.1|  PREDICTED: photosystem I reaction center sub...    318   9e-103   Nicotiana sylvestris
ref|XP_009621208.1|  PREDICTED: photosystem I reaction center sub...    318   2e-102   Nicotiana tomentosiformis
ref|XP_004241054.2|  PREDICTED: photosystem I reaction center sub...    312   2e-100   
ref|XP_006356675.1|  PREDICTED: photosystem I reaction center sub...    310   1e-99    Solanum tuberosum [potatoes]
ref|XP_009799304.1|  PREDICTED: photosystem I reaction center sub...    310   2e-99    Nicotiana sylvestris
ref|XP_011071575.1|  PREDICTED: photosystem I reaction center sub...    310   2e-99    Sesamum indicum [beniseed]
ref|XP_008376830.1|  PREDICTED: photosystem I reaction center sub...    309   5e-99    Malus domestica [apple tree]
gb|EYU41499.1|  hypothetical protein MIMGU_mgv1a013699mg                308   8e-99    Erythranthe guttata [common monkey flower]
ref|XP_011090732.1|  PREDICTED: photosystem I reaction center sub...    308   9e-99    Sesamum indicum [beniseed]
ref|XP_009366924.1|  PREDICTED: photosystem I reaction center sub...    308   1e-98    Pyrus x bretschneideri [bai li]
ref|XP_008340966.1|  PREDICTED: photosystem I reaction center sub...    308   1e-98    Malus domestica [apple tree]
ref|XP_007143239.1|  hypothetical protein PHAVU_007G055900g             306   6e-98    Phaseolus vulgaris [French bean]
gb|AGV54746.1|  photosystem I reaction center subunit II chloropl...    306   6e-98    Phaseolus vulgaris [French bean]
ref|XP_004296896.1|  PREDICTED: photosystem I reaction center sub...    306   7e-98    Fragaria vesca subsp. vesca
ref|XP_003556041.1|  PREDICTED: photosystem I reaction center sub...    306   8e-98    Glycine max [soybeans]
ref|XP_010277521.1|  PREDICTED: photosystem I reaction center sub...    306   8e-98    Nelumbo nucifera [Indian lotus]
ref|XP_008224535.1|  PREDICTED: photosystem I reaction center sub...    306   9e-98    Prunus mume [ume]
ref|XP_010035248.1|  PREDICTED: photosystem I reaction center sub...    305   2e-97    Eucalyptus grandis [rose gum]
ref|XP_006419899.1|  hypothetical protein CICLE_v10005892mg             305   2e-97    Citrus clementina [clementine]
ref|XP_009588197.1|  PREDICTED: photosystem I reaction center sub...    304   4e-97    Nicotiana tomentosiformis
gb|EYU45647.1|  hypothetical protein MIMGU_mgv1a013850mg                303   5e-97    Erythranthe guttata [common monkey flower]
ref|NP_001275862.1|  PSI reaction center subunit II                     303   7e-97    Citrus sinensis [apfelsine]
ref|NP_001235355.1|  photosystem I subunit PsaD                         303   1e-96    Glycine max [soybeans]
gb|ABK96621.1|  unknown                                                 301   5e-96    Populus trichocarpa x Populus deltoides
ref|XP_002516772.1|  Photosystem I reaction center subunit II, ch...    301   7e-96    Ricinus communis
ref|XP_002281825.1|  PREDICTED: photosystem I reaction center sub...    300   1e-95    Vitis vinifera
ref|XP_009344083.1|  PREDICTED: photosystem I reaction center sub...    298   6e-95    Pyrus x bretschneideri [bai li]
ref|XP_002315779.1|  photosystem I 20kD family protein                  297   1e-94    Populus trichocarpa [western balsam poplar]
emb|CDO99040.1|  unnamed protein product                                298   1e-94    Coffea canephora [robusta coffee]
ref|XP_003610706.1|  Photosystem I reaction center subunit II           297   1e-94    Medicago truncatula
emb|CDY21916.1|  BnaC09g00220D                                          300   2e-94    Brassica napus [oilseed rape]
ref|XP_004511355.1|  PREDICTED: photosystem I reaction center sub...    296   4e-94    Cicer arietinum [garbanzo]
gb|AFK43504.1|  unknown                                                 296   4e-94    Lotus japonicus
ref|XP_010935005.1|  PREDICTED: photosystem I reaction center sub...    296   4e-94    Elaeis guineensis
ref|XP_004134141.1|  PREDICTED: photosystem I reaction center sub...    296   6e-94    Cucumis sativus [cucumbers]
ref|XP_011026306.1|  PREDICTED: photosystem I reaction center sub...    295   6e-94    Populus euphratica
ref|XP_010108011.1|  Photosystem I reaction center subunit II           295   9e-94    
ref|XP_007050585.1|  Photosystem I subunit D-2                          295   2e-93    
ref|XP_010256006.1|  PREDICTED: photosystem I reaction center sub...    295   2e-93    Nelumbo nucifera [Indian lotus]
ref|XP_002311618.2|  photosystem I 20kD family protein                  294   2e-93    Populus trichocarpa [western balsam poplar]
ref|XP_009111256.1|  PREDICTED: photosystem I reaction center sub...    294   2e-93    Brassica rapa
ref|XP_009396832.1|  PREDICTED: photosystem I reaction center sub...    296   3e-93    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010474926.1|  PREDICTED: photosystem I reaction center sub...    294   3e-93    Camelina sativa [gold-of-pleasure]
ref|XP_008802683.1|  PREDICTED: photosystem I reaction center sub...    294   4e-93    Phoenix dactylifera
ref|XP_011021547.1|  PREDICTED: photosystem I reaction center sub...    293   4e-93    Populus euphratica
ref|XP_006306434.1|  hypothetical protein CARUB_v10012376mg             293   6e-93    Capsella rubella
ref|XP_011015859.1|  PREDICTED: photosystem I reaction center sub...    292   1e-92    Populus euphratica
ref|XP_008438687.1|  PREDICTED: photosystem I reaction center sub...    292   1e-92    Cucumis melo [Oriental melon]
ref|XP_006288687.1|  hypothetical protein CARUB_v10001997mg             292   1e-92    Capsella rubella
gb|EPS62726.1|  hypothetical protein M569_12065                         290   6e-92    Genlisea aurea
ref|XP_002892148.1|  hypothetical protein ARALYDRAFT_887465             290   1e-91    Arabidopsis lyrata subsp. lyrata
ref|XP_010430302.1|  PREDICTED: photosystem I reaction center sub...    290   1e-91    Camelina sativa [gold-of-pleasure]
ref|XP_010422538.1|  PREDICTED: photosystem I reaction center sub...    290   1e-91    Camelina sativa [gold-of-pleasure]
ref|XP_010481602.1|  PREDICTED: photosystem I reaction center sub...    289   2e-91    
gb|KJB23065.1|  hypothetical protein B456_004G079200                    291   2e-91    Gossypium raimondii
ref|NP_171812.1|  photosystem I reaction center subunit D-2             289   3e-91    Arabidopsis thaliana [mouse-ear cress]
ref|NP_001062511.1|  Os08g0560900                                       288   5e-91    
gb|KFK42673.1|  hypothetical protein AALP_AA1G025000                    288   5e-91    Arabis alpina [alpine rockcress]
ref|XP_007034724.1|  Photosystem I subunit D-2                          288   5e-91    Theobroma cacao [chocolate]
ref|XP_006838247.1|  PREDICTED: photosystem I reaction center sub...    288   7e-91    Amborella trichopoda
ref|XP_010474916.1|  PREDICTED: photosystem I reaction center sub...    289   8e-91    Camelina sativa [gold-of-pleasure]
ref|XP_010522735.1|  PREDICTED: photosystem I reaction center sub...    287   1e-90    Tarenaya hassleriana [spider flower]
gb|AFV94477.1|  photosystem I reaction center subunit II                286   2e-90    Saccharum hybrid cultivar GT28
ref|XP_006396500.1|  hypothetical protein EUTSA_v10029178mg             288   2e-90    
gb|AAM66066.1|  putative photosystem I reaction center subunit II...    286   2e-90    Arabidopsis thaliana [mouse-ear cress]
ref|NP_192186.1|  photosystem I subunit D-1                             286   2e-90    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002278284.1|  PREDICTED: photosystem I reaction center sub...    286   3e-90    Vitis vinifera
ref|NP_001275788.1|  PSI reaction center subunit II                     286   3e-90    Citrus sinensis [apfelsine]
ref|XP_009400838.1|  PREDICTED: photosystem I reaction center sub...    286   4e-90    Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB46980.1|  hypothetical protein B456_008G004100                    286   5e-90    Gossypium raimondii
ref|XP_010542866.1|  PREDICTED: photosystem I reaction center sub...    285   6e-90    Tarenaya hassleriana [spider flower]
ref|XP_006444053.1|  hypothetical protein CICLE_v10022248mg             285   6e-90    Citrus clementina [clementine]
ref|XP_002520727.1|  Photosystem I reaction center subunit II, ch...    285   2e-89    Ricinus communis
ref|XP_002872810.1|  hypothetical protein ARALYDRAFT_490280             284   2e-89    
ref|XP_010681150.1|  PREDICTED: photosystem I reaction center sub...    284   3e-89    Beta vulgaris subsp. vulgaris [field beet]
emb|CAA32182.1|  unnamed protein product                                284   3e-89    Spinacia oleracea
emb|CAA68728.1|  unnamed protein product                                284   3e-89    Spinacia oleracea
gb|KFK30882.1|  hypothetical protein AALP_AA6G038200                    283   4e-89    Arabis alpina [alpine rockcress]
ref|XP_004981348.1|  PREDICTED: photosystem I reaction center sub...    285   1e-88    
sp|P12353.2|PSAD_SPIOL  RecName: Full=Photosystem I reaction cent...    282   1e-88    Spinacia oleracea
ref|XP_012092226.1|  PREDICTED: photosystem I reaction center sub...    282   1e-88    Jatropha curcas
emb|CAB52677.1|  photosystem I subunit II precursor                     281   2e-88    Arabidopsis thaliana [mouse-ear cress]
emb|CAN61448.1|  hypothetical protein VITISV_024141                     280   3e-88    Vitis vinifera
ref|XP_010456951.1|  PREDICTED: photosystem I reaction center sub...    281   4e-88    Camelina sativa [gold-of-pleasure]
ref|XP_010424650.1|  PREDICTED: photosystem I reaction center sub...    280   4e-88    Camelina sativa [gold-of-pleasure]
sp|P36213.1|PSAD_HORVU  RecName: Full=Photosystem I reaction cent...    276   2e-86    Hordeum vulgare [barley]
ref|XP_010424649.1|  PREDICTED: photosystem I reaction center sub...    277   2e-86    
pdb|2WSC|D  Chain D, Improved Model Of Plant Photosystem I              276   2e-86    Spinacia oleracea
ref|XP_003564108.1|  PREDICTED: photosystem I reaction center sub...    275   4e-86    Brachypodium distachyon [annual false brome]
ref|NP_001130880.1|  photosystem I reaction center subunit II           275   6e-86    Zea mays [maize]
gb|ACN40159.1|  unknown                                                 273   9e-86    Picea sitchensis
pdb|3LW5|D  Chain D, Improved Model Of Plant Photosystem I              271   2e-85    unidentified
gb|AFW67274.1|  photosystem I reaction center subunit II                274   3e-85    
gb|ACG41754.1|  photosystem I reaction center subunit II                273   4e-85    Zea mays [maize]
gb|ACG25364.1|  photosystem I reaction center subunit II                273   4e-85    Zea mays [maize]
gb|ABK21314.1|  unknown                                                 272   2e-84    Picea sitchensis
emb|CAA54744.1|  psaD                                                   270   6e-84    Spinacia oleracea
ref|XP_010474917.1|  PREDICTED: photosystem I reaction center sub...    270   3e-83    
gb|ABK21867.1|  unknown                                                 269   3e-83    Picea sitchensis
gb|KJB28316.1|  hypothetical protein B456_005G042000                    269   4e-83    Gossypium raimondii
pdb|4RKU|D  Chain D, Crystal Structure Of Plant Photosystem I At ...    264   1e-82    Pisum sativum [garden pea]
pdb|2O01|D  Chain D, The Structure Of A Plant Photosystem I Super...    264   1e-82    Arabidopsis thaliana [mouse-ear cress]
gb|KDO68707.1|  hypothetical protein CISIN_1g047658mg                   264   2e-81    Citrus sinensis [apfelsine]
ref|XP_002991814.1|  hypothetical protein SELMODRAFT_26984              261   3e-81    
gb|KHN02708.1|  Photosystem I reaction center subunit II, chlorop...    262   2e-80    Glycine soja [wild soybean]
gb|ACF05868.1|  chloroplast photosystem I protein                       259   3e-80    Populus tremula [European aspen]
gb|ACF05859.1|  chloroplast photosystem I protein                       259   4e-80    Populus tremula [European aspen]
gb|ACF05876.1|  chloroplast photosystem I protein                       258   4e-80    Populus tremula [European aspen]
gb|ACF05884.1|  chloroplast photosystem I protein                       258   5e-80    Populus tremula [European aspen]
gb|ACF05871.1|  chloroplast photosystem I protein                       258   5e-80    Populus tremula [European aspen]
gb|ACF05855.1|  chloroplast photosystem I protein                       258   5e-80    Populus tremula [European aspen]
ref|XP_001751403.1|  predicted protein                                  257   2e-79    
ref|XP_001768962.1|  predicted protein                                  257   2e-79    
ref|XP_001752431.1|  predicted protein                                  258   4e-79    
ref|XP_001765579.1|  predicted protein                                  254   2e-78    
ref|XP_007226637.1|  hypothetical protein PRUPE_ppa022366mg             250   2e-76    
gb|ABK96248.1|  unknown                                                 247   9e-76    Populus trichocarpa x Populus deltoides
ref|XP_003592408.1|  Photosystem I reaction center subunit II           245   1e-74    
gb|EMS56878.1|  Photosystem I reaction center subunit II, chlorop...    240   4e-73    Triticum urartu
emb|CAL25356.1|  photosystem I reaction center subunit II               236   7e-72    Platanus x hispanica [London plane tree]
ref|XP_005647040.1|  PSI-D1 precursor                                   235   1e-70    Coccomyxa subellipsoidea C-169
ref|XP_002992973.1|  hypothetical protein SELMODRAFT_448960             252   3e-70    
gb|KIZ01091.1|  Photosystem I reaction center subunit II, chlorop...    229   1e-68    Monoraphidium neglectum
ref|XP_007511428.1|  predicted protein                                  230   1e-68    Bathycoccus prasinos
ref|XP_002953316.1|  hypothetical protein VOLCADRAFT_121148             229   1e-68    Volvox carteri f. nagariensis
ref|XP_012077668.1|  PREDICTED: PHD finger protein ING1                 228   2e-67    Jatropha curcas
gb|KIZ02718.1|  Photosystem I reaction center subunit II, chlorop...    225   3e-67    Monoraphidium neglectum
ref|XP_002504652.1|  photosystem I subunit II, chloroplast precursor    227   3e-67    Micromonas commoda
ref|XP_003063552.1|  photosystem I subunit II, chloroplast precursor    227   4e-67    Micromonas pusilla CCMP1545
ref|XP_011400522.1|  Photosystem I reaction center subunit II, ch...    225   7e-67    Auxenochlorella protothecoides
emb|CEG01861.1|  Photosystem I PsaD                                     224   1e-66    Ostreococcus tauri
ref|XP_002518170.1|  Inhibitor of growth protein, putative              225   3e-66    
ref|XP_001697722.1|  photosystem I reaction center subunit II, 20...    223   5e-66    Chlamydomonas reinhardtii
ref|XP_009785672.1|  PREDICTED: PHD finger protein ING1 isoform X1      224   6e-66    Nicotiana sylvestris
ref|XP_005847397.1|  hypothetical protein CHLNCDRAFT_35549              222   7e-66    Chlorella variabilis
ref|XP_006420512.1|  hypothetical protein CICLE_v10005726mg             224   1e-65    Citrus clementina [clementine]
ref|XP_006492151.1|  PREDICTED: PHD finger protein ING1-like            223   2e-65    Citrus sinensis [apfelsine]
ref|XP_004247811.1|  PREDICTED: PHD finger protein ING1                 222   5e-65    Solanum lycopersicum
ref|XP_007034499.1|  RING/FYVE/PHD zinc finger superfamily protei...    221   2e-64    Theobroma cacao [chocolate]
ref|XP_006340915.1|  PREDICTED: PHD finger protein ING1-like            220   2e-64    Solanum tuberosum [potatoes]
ref|XP_001421350.1|  psaD, PSI-D, subunit II, photosystem I protein     218   3e-64    Ostreococcus lucimarinus CCE9901
gb|ACJ84468.1|  unknown                                                 219   5e-64    Medicago truncatula
gb|AFK44120.1|  unknown                                                 219   5e-64    Medicago truncatula
emb|CDO99386.1|  unnamed protein product                                218   1e-63    Coffea canephora [robusta coffee]
ref|XP_003535966.1|  PREDICTED: PHD finger protein ING1-like isof...    218   3e-63    Glycine max [soybeans]
ref|XP_009785673.1|  PREDICTED: PHD finger protein ING1 isoform X2      214   2e-62    Nicotiana sylvestris
ref|XP_007145429.1|  hypothetical protein PHAVU_007G238400g             215   3e-62    Phaseolus vulgaris [French bean]
ref|XP_003555720.1|  PREDICTED: PHD finger protein ING1-like            213   1e-61    Glycine max [soybeans]
gb|ACU19192.1|  unknown                                                 212   3e-61    Glycine max [soybeans]
ref|XP_011091384.1|  PREDICTED: PHD finger protein ING1 isoform X1      211   7e-61    Sesamum indicum [beniseed]
ref|XP_010264003.1|  PREDICTED: PHD finger protein ING1                 211   8e-61    Nelumbo nucifera [Indian lotus]
ref|XP_004497737.1|  PREDICTED: PHD finger protein ING1-like            212   2e-60    Cicer arietinum [garbanzo]
sp|Q9T4W8.1|PSAD_CYAPA  RecName: Full=Photosystem I reaction cent...    208   4e-60    Cyanophora paradoxa
gb|KJB28066.1|  hypothetical protein B456_005G039000                    208   4e-60    Gossypium raimondii
ref|XP_011091386.1|  PREDICTED: PHD finger protein ING1 isoform X2      209   5e-60    Sesamum indicum [beniseed]
gb|KJB28062.1|  hypothetical protein B456_005G039000                    208   8e-60    Gossypium raimondii
ref|XP_006589054.1|  PREDICTED: PHD finger protein ING1-like isof...    207   3e-59    Glycine max [soybeans]
gb|AFK33325.1|  unknown                                                 207   3e-59    Lotus japonicus
ref|YP_005088653.1|  photosystem I subunit II                           202   7e-59    Phaeocystis antarctica
ref|XP_004134022.1|  PREDICTED: PHD finger protein ING1 isoform X1      206   8e-59    Cucumis sativus [cucumbers]
ref|YP_008145427.1|  photosystem I subunit II                           202   1e-58    Phaeocystis globosa
gb|KHN48841.1|  PHD finger protein ING1                                 205   1e-58    Glycine soja [wild soybean]
ref|YP_007947808.1|  photosystem I subunit II                           201   3e-58    Pyropia haitanensis
gb|AFC39948.1|  photosystem I subunit II                                200   5e-58    Porphyra umbilicalis
gb|AJO68451.1|  photosystem I subunit II                                200   7e-58    Gracilariopsis lemaneiformis
ref|NP_053889.1|  photosystem I subunit II                              199   8e-58    Porphyra purpurea
ref|XP_002285610.1|  PREDICTED: PHD finger protein ING1                 202   9e-58    Vitis vinifera
gb|AIA20054.1|  photosystem I subunit II                                199   1e-57    Pyropia perforata
ref|YP_009027562.1|  photosystem I subunit II                           199   1e-57    Pyropia perforata
gb|AIA21307.1|  photosystem I subunit II                                199   2e-57    Pyropia kanakaensis
gb|AIA21513.1|  photosystem I subunit II                                198   3e-57    Pyropia fucicola
ref|YP_009019626.1|  photosystem I reaction center subunit II           197   4e-57    Gracilaria salicornia
ref|YP_001293570.1|  photosystem I subunit II                           197   5e-57    Rhodomonas salina
ref|YP_007627400.1|  photosystem I subunit II                           197   5e-57    Chondrus crispus [carageen]
ref|XP_007227566.1|  hypothetical protein PRUPE_ppa010764mg             201   6e-57    Prunus persica
ref|XP_009609788.1|  PREDICTED: PHD finger protein ING1-like            196   6e-57    Nicotiana tomentosiformis
ref|YP_008965721.1|  photosystem I reaction center subunit II           197   8e-57    Porphyridium purpureum
ref|NP_050759.1|  photosystem I subunit II                              197   8e-57    Guillardia theta
ref|YP_536961.1|  photosystem I subunit II                              196   1e-56    Pyropia yezoensis
ref|YP_008144865.1|  photosystem I reaction center subunit II           196   1e-56    Grateloupia taiwanensis
ref|WP_008312724.1|  PsaD                                               196   2e-56    Leptolyngbya sp. PCC 6406
gb|EYU43804.1|  hypothetical protein MIMGU_mgv1a012611mg                199   2e-56    Erythranthe guttata [common monkey flower]
ref|YP_001936347.1|  photosystem I subunit II                           196   2e-56    Heterosigma akashiwo
gb|AHY04349.1|  photosystem I reaction center subunit II                196   2e-56    Chrysochromulina sp. CCMP291
ref|XP_008438417.1|  PREDICTED: PHD finger protein ING1                 199   3e-56    Cucumis melo [Oriental melon]
ref|WP_015145740.1|  PsaD                                               195   4e-56    Pleurocapsales
ref|YP_004376584.1|  photosystem I ferredoxin-binding protein           194   8e-56    Fistulifera solaris
ref|YP_063618.1|  photosystem I subunit II                              194   9e-56    Gracilaria tenuistipitata var. liui
ref|YP_003734986.1|  photosystem I protein subunit II                   194   1e-55    Durinskia baltica
ref|YP_003734548.1|  ferredoxin-binding protein II                      194   1e-55    Kryptoperidinium foliaceum
ref|XP_009362046.1|  PREDICTED: PHD finger protein ING1-like            197   1e-55    Pyrus x bretschneideri [bai li]
ref|XP_009377447.1|  PREDICTED: PHD finger protein ING1-like            197   2e-55    Pyrus x bretschneideri [bai li]
ref|WP_009769007.1|  PsaD protein                                       193   2e-55    Oscillatoriales cyanobacterium JSC-12
ref|WP_018400163.1|  Photosystem I reaction center subunit II           193   2e-55    filamentous cyanobacterium ESFC-1
ref|XP_011650900.1|  PREDICTED: PHD finger protein ING1 isoform X2      195   3e-55    Cucumis sativus [cucumbers]
ref|YP_009029026.1|  photosystem I reaction center subunit II           192   3e-55    Cylindrotheca closterium
ref|XP_008362239.1|  PREDICTED: PHD finger protein ING1-like            196   4e-55    Malus domestica [apple tree]
ref|XP_011464224.1|  PREDICTED: PHD finger protein ING1 isoform X2      196   4e-55    Fragaria vesca subsp. vesca
ref|XP_002304691.1|  PHD finger family protein                          196   4e-55    Populus trichocarpa [western balsam poplar]
ref|WP_026795097.1|  MULTISPECIES: Photosystem I reaction center ...    192   5e-55    Planktothrix
ref|YP_277398.1|  photosystem I subunit II                              192   5e-55    Emiliania huxleyi
ref|WP_023068767.1|  photosystem I reaction center subunit II           192   5e-55    Lyngbya aestuarii
ref|YP_009028878.1|  photosystem I reaction center subunit II           192   7e-55    Coscinodiscus radiatus
ref|XP_010069086.1|  PREDICTED: PHD finger protein ING1                 195   7e-55    Eucalyptus grandis [rose gum]
ref|WP_009787700.1|  photosystem I subunit II                           192   7e-55    Lyngbya sp. PCC 8106
gb|ABK96014.1|  unknown                                                 190   7e-55    Populus trichocarpa [western balsam poplar]
ref|YP_009029191.1|  photosystem I reaction center subunit II           191   8e-55    Didymosphenia geminata
ref|YP_005089671.1|  psaD gene product                                  191   9e-55    Ulnaria acus
ref|YP_009092872.1|  photosystem I subunit II                           191   1e-54    Chaetoceros simplex
ref|YP_009059209.1|  photosystem I reaction center subunit II           191   1e-54    Eunotia naegelii
ref|YP_874394.1|  photosystem I ferredoxin-binding protein              191   1e-54    Phaeodactylum tricornutum
ref|YP_009093339.1|  photosystem I subunit II                           191   1e-54    Cerataulina daemon
ref|XP_004299213.1|  PREDICTED: PHD finger protein ING1 isoform X1      195   1e-54    Fragaria vesca subsp. vesca
gb|KJB28067.1|  hypothetical protein B456_005G039000                    193   2e-54    Gossypium raimondii
ref|WP_015173693.1|  photosystem I protein PsaD                         191   2e-54    Geitlerinema sp. PCC 7407
ref|WP_035996822.1|  Photosystem I reaction center subunit II           191   2e-54    [Leptolyngbya] sp. JSC-1
ref|YP_009029302.1|  photosystem I reaction center subunit II           190   3e-54    Leptocylindrus danicus
ref|XP_011020717.1|  PREDICTED: PHD finger protein ING1                 194   3e-54    Populus euphratica
ref|XP_007034500.1|  RING/FYVE/PHD zinc finger superfamily protei...    193   4e-54    Theobroma cacao [chocolate]
ref|NP_043647.1|  photosystem I subunit II                              190   4e-54    Trieres chinensis
ref|WP_006616635.1|  MULTISPECIES: photosystem I protein PsaD           190   4e-54    Arthrospira
ref|YP_009093018.1|  photosystem I subunit II                           189   4e-54    Rhizosolenia imbricata
ref|YP_007878240.1|  photosystem I subunit II                           189   6e-54    Calliarthron tuberculosum
ref|WP_026788324.1|  MULTISPECIES: Photosystem I reaction center ...    189   7e-54    Planktothrix
ref|XP_008224073.1|  PREDICTED: PHD finger protein ING1 isoform X1      192   7e-54    Prunus mume [ume]
ref|WP_016872271.1|  MULTISPECIES: Photosystem I reaction center ...    189   7e-54    Fischerella thermalis
ref|YP_009029445.1|  photosystem I reaction center subunit II           189   8e-54    Lithodesmium undulatum
ref|WP_028824843.1|  Photosystem I reaction center subunit II           189   9e-54    
gb|EHC11738.1|  photosystem I protein PsaD                              189   1e-53    Fischerella thermalis
gb|KJB33357.1|  hypothetical protein B456_006G054900                    192   1e-53    Gossypium raimondii
gb|AFR24825.1|  photosystem I reaction center subunit II                188   2e-53    uncultured Pelagomonas
ref|WP_039725494.1|  MULTISPECIES: Photosystem I reaction center ...    188   2e-53    Lyngbya confervoides
ref|WP_008189408.1|  PsaD                                               188   2e-53    Moorea producens
ref|YP_874547.1|  photosystem I ferredoxin-binding protein              188   2e-53    Thalassiosira pseudonana
ref|WP_013323038.1|  photosystem I protein PsaD                         188   2e-53    Cyanothece sp. PCC 7822
ref|WP_017715328.1|  Photosystem I reaction center subunit II           187   3e-53    Oscillatoria sp. PCC 10802
ref|YP_003002181.1|  photosystem I reaction center subunit II           187   3e-53    Aureoumbra lagunensis
ref|WP_017304392.1|  Photosystem I reaction center subunit II           187   3e-53    Spirulina subsalsa
ref|WP_015195039.1|  photosystem I protein PsaD                         187   3e-53    Stanieria cyanosphaera
ref|YP_009093191.1|  photosystem I subunit II                           187   3e-53    Roundia cardiophora
ref|YP_009093464.1|  photosystem I subunit II                           187   3e-53    Conticribra weissflogii
gb|EMT14162.1|  Photosystem I reaction center subunit II, chlorop...    186   4e-53    
sp|O96800.1|PSAD_SKECO  RecName: Full=Photosystem I reaction cent...    187   4e-53    Skeletonema costatum
ref|WP_017300022.1|  Photosystem I reaction center subunit II           187   4e-53    Nodosilinea nodulosa
ref|WP_041622790.1|  Photosystem I reaction center subunit II           187   4e-53    Oscillatoria nigro-viridis
ref|YP_009051089.1|  photosystem I subunit II                           187   5e-53    Galdieria sulphuraria
ref|YP_009122184.1|  photosystem I reaction center subunit II           187   5e-53    Vertebrata lanosa
ref|YP_003002042.1|  photosystem I reaction center subunit II           187   6e-53    Aureococcus anophagefferens
gb|AFZ10051.1|  photosystem I protein PsaD                              187   6e-53    Oscillatoria nigro-viridis PCC 7112
ref|WP_016876091.1|  Photosystem I reaction center subunit II           186   7e-53    Chlorogloeopsis fritschii
ref|WP_016924991.1|  Photosystem I reaction center subunit II           186   7e-53    Prochlorothrix hollandica
ref|WP_016866973.1|  Photosystem I reaction center subunit II           186   7e-53    Fischerella muscicola
ref|YP_009028619.1|  photosystem I reaction center subunit II           186   8e-53    Asterionella formosa
ref|WP_019505782.1|  Photosystem I reaction center subunit II           186   1e-52    Pleurocapsa sp. PCC 7319
gb|AIR75448.1|  photosystem I subunit II                                186   1e-52    Cyclotella sp. L04_2
gb|ACF86694.1|  unknown                                                 184   2e-52    Zea mays [maize]
ref|WP_036530202.1|  Photosystem I reaction center subunit II           185   2e-52    Neosynechococcus sphagnicola
gb|EDX77926.1|  photosystem I reaction center subunit II                185   3e-52    Coleofasciculus chthonoplastes PCC 7420
ref|WP_017662216.1|  Photosystem I reaction center subunit II           185   3e-52    Geitlerinema sp. PCC 7105
ref|WP_044204978.1|  Photosystem I reaction center subunit II           185   3e-52    Coleofasciculus chthonoplastes
ref|XP_008812924.1|  PREDICTED: PHD finger protein ING1-like isof...    187   3e-52    Phoenix dactylifera
gb|KCW60797.1|  hypothetical protein EUGRSUZ_H03534                     186   4e-52    Eucalyptus grandis [rose gum]
ref|WP_010871317.1|  photosystem I reaction center subunit II           184   4e-52    Synechocystis
ref|WP_017321535.1|  Photosystem I reaction center subunit II           184   5e-52    cyanobacterium PCC 7702
ref|WP_011613167.1|  photosystem I protein PsaD                         184   5e-52    Trichodesmium erythraeum
ref|WP_015124443.1|  PsaD                                               184   5e-52    Synechococcus sp. PCC 6312
ref|WP_017309650.1|  Photosystem I reaction center subunit II           184   6e-52    Fischerella sp. PCC 9339
ref|WP_015222401.1|  photosystem I protein PsaD                         184   7e-52    
ref|WP_007356552.1|  MULTISPECIES: photosystem I protein PsaD           184   9e-52    Kamptonema
ref|WP_006632802.1|  photosystem I protein PsaD                         183   1e-51    Microcoleus vaginatus
ref|WP_026721381.1|  Photosystem I reaction center subunit II           183   1e-51    Hapalosiphonaceae
ref|WP_026733629.1|  Photosystem I reaction center subunit II           183   1e-51    Fischerella sp. PCC 9605
ref|WP_028947468.1|  Photosystem I reaction center subunit II           183   1e-51    Synechocystis sp. PCC 6714
ref|YP_002327575.1|  PSI reaction center subunit II                     183   2e-51    Vaucheria litorea
ref|YP_009028747.1|  photosystem I reaction center subunit II           182   2e-51    Asterionellopsis glacialis
ref|WP_007305646.1|  Photosystem I protein PsaD                         182   2e-51    Crocosphaera watsonii
ref|WP_016859046.1|  Photosystem I reaction center subunit II           182   3e-51    Fischerella muscicola
ref|WP_015182846.1|  PsaD                                               182   3e-51    Microcoleus sp. PCC 7113
ref|WP_035986603.1|  Photosystem I reaction center subunit II           182   3e-51    Leptolyngbya sp. KIOST-1
ref|WP_015956499.1|  photosystem I protein PsaD                         182   4e-51    
ref|WP_017288063.1|  Photosystem I reaction center subunit II           182   4e-51    
ref|XP_008777019.1|  PREDICTED: PHD finger protein ING1-like isof...    184   5e-51    
ref|WP_006530712.1|  PsaD                                               181   5e-51    
ref|WP_017292752.1|  Photosystem I reaction center subunit II           182   5e-51    
dbj|BAQ65157.1|  photosystem I subunit II PsaD                          181   6e-51    
ref|WP_002738785.1|  photosystem I reaction center subunit II           181   7e-51    
ref|WP_045358736.1|  Photosystem I reaction center subunit II           181   8e-51    
ref|WP_002796771.1|  Photosystem I reaction center subunit II           181   8e-51    
ref|XP_010550846.1|  PREDICTED: PHD finger protein ING1                 184   8e-51    
ref|WP_011377824.1|  MULTISPECIES: photosystem I reaction center ...    181   9e-51    
ref|WP_012629607.1|  photosystem I protein PsaD                         181   1e-50    
dbj|BAQ62449.1|  photosystem I subunit II PsaD                          181   1e-50    
ref|WP_012593753.1|  MULTISPECIES: photosystem I protein PsaD           181   1e-50    
ref|WP_015221061.1|  photosystem I protein PsaD                         180   2e-50    
ref|WP_006509381.1|  PsaD                                               180   2e-50    
ref|WP_045055932.1|  Photosystem I reaction center subunit II           180   2e-50    
ref|YP_004072560.1|  photosystem I reaction center subunit II           179   3e-50    
ref|WP_015157762.1|  PsaD                                               179   3e-50    
ref|WP_002740397.1|  MULTISPECIES: photosystem I reaction center ...    179   3e-50    
gb|AFY74121.1|  PsaD                                                    179   4e-50    
gb|KJB28065.1|  hypothetical protein B456_005G039000                    181   8e-50    
ref|XP_009390107.1|  PREDICTED: PHD finger protein ING1 isoform X1      181   1e-49    
ref|WP_012165369.1|  photosystem I protein PsaD                         177   1e-49    
ref|WP_015231048.1|  PsaD                                               177   1e-49    
ref|WP_010468189.1|  photosystem I protein PsaD                         177   1e-49    
ref|WP_009544162.1|  MULTISPECIES: photosystem I protein PsaD           177   2e-49    
ref|WP_041918842.1|  Photosystem I reaction center subunit II           177   2e-49    
ref|NP_849051.1|  photosystem I subunit II                              177   3e-49    
ref|WP_041039117.1|  Photosystem I reaction center subunit II           177   3e-49    
gb|KHN31619.1|  PHD finger protein ING1                                 181   3e-49    
gb|AFZ29137.1|  photosystem I protein PsaD                              177   4e-49    
gb|ACB50691.1|  photosystem I reaction center subunit II                177   4e-49    
ref|WP_015224168.1|  photosystem I protein PsaD                         176   4e-49    
ref|XP_007034502.1|  RING/FYVE/PHD zinc finger superfamily protei...    179   4e-49    
ref|WP_024124772.1|  photosystem I subunit II PsaD                      176   5e-49    
ref|WP_039754673.1|  Photosystem I reaction center subunit II           176   6e-49    
gb|AIA61184.1|  photosystem I subunit II (chloroplast)                  175   1e-48    
ref|XP_010918839.1|  PREDICTED: PHD finger protein ING1                 178   1e-48    
ref|WP_015151596.1|  PsaD                                               176   1e-48    
gb|KJB33358.1|  hypothetical protein B456_006G054900                    176   1e-48    
sp|P23076.3|PSAD_SYNP6  RecName: Full=Photosystem I reaction cent...    175   1e-48    
ref|NP_001104945.1|  photosystem I subunit d1                           174   1e-48    
ref|WP_036477609.1|  Photosystem I reaction center subunit II           175   1e-48    
ref|WP_027844942.1|  Photosystem I reaction center subunit II           175   2e-48    
ref|XP_009390117.1|  PREDICTED: PHD finger protein ING1 isoform X2      177   2e-48    
ref|WP_010314860.1|  photosystem I protein PsaD                         174   2e-48    
ref|XP_008812921.1|  PREDICTED: PHD finger protein ING1-like isof...    177   3e-48    
gb|KJB33359.1|  hypothetical protein B456_006G054900                    176   3e-48    
gb|EDX84590.1|  photosystem I reaction center subunit II                175   3e-48    
ref|WP_011057561.1|  photosystem I reaction center subunit II           174   3e-48    
ref|XP_006854339.1|  PREDICTED: PHD finger protein ING1                 177   3e-48    
ref|WP_038016768.1|  Photosystem I reaction center subunit II           174   3e-48    
pdb|1JB0|D  Chain D, Crystal Structure Of Photosystem I: A Photos...    174   3e-48    
ref|XP_008812920.1|  PREDICTED: PHD finger protein ING1-like isof...    177   4e-48    
ref|NP_566742.1|  PHD finger protein ING1                               177   4e-48    
ref|WP_017317314.1|  Photosystem I reaction center subunit II           174   4e-48    
ref|NP_045207.1|  photosystem I subunit II                              173   7e-48    
prf||1510177A  photosystem II                                           173   8e-48 
emb|CDX85182.1|  BnaC07g07240D                                          176   9e-48    
ref|WP_009626149.1|  photosystem I protein PsaD                         173   9e-48    
ref|WP_006910658.1|  photosystem I reaction center subunit II           173   9e-48    
ref|WP_008272575.1|  photosystem I subunit II                           173   9e-48    
gb|KIE10409.1|  Photosystem I reaction center subunit II                173   1e-47    
ref|WP_022606580.1|  PsaD                                               173   1e-47    
ref|WP_017744641.1|  Photosystem I reaction center subunit II           172   1e-47    
gb|KHG19241.1|  PHD finger ING1 -like protein                           174   1e-47    
ref|WP_013192195.1|  photosystem I protein PsaD                         172   2e-47    
ref|XP_009102538.1|  PREDICTED: PHD finger protein ING1                 175   2e-47    
gb|KFK39701.1|  hypothetical protein AALP_AA3G277600                    175   2e-47    
gb|EPS59284.1|  hypothetical protein M569_15524                         170   4e-47    
ref|WP_023071664.1|  photosystem i protein                              171   4e-47    
gb|KIJ85471.1|  Photosystem I reaction center subunit II                171   5e-47    
gb|AIM52729.1|  photosystem I reaction center subunit II                171   6e-47    
ref|WP_010994505.1|  photosystem I reaction center subunit II           171   6e-47    
ref|WP_026032399.1|  Photosystem I reaction center subunit II           170   8e-47    
gb|KJB28063.1|  hypothetical protein B456_005G039000                    172   9e-47    
ref|XP_010497891.1|  PREDICTED: photosystem I reaction center sub...    168   9e-47    
ref|WP_038547798.1|  Photosystem I reaction center subunit II           170   1e-46    
ref|WP_006042180.1|  photosystem I reaction center subunit II (PsaD)    170   1e-46    
ref|YP_002049251.1|  Photosystem I reaction center subunit II (PsaD)    170   1e-46    
ref|WP_041430107.1|  Photosystem I reaction center subunit II           169   1e-46    
ref|WP_025781322.1|  Photosystem I reaction center subunit II           170   1e-46    
gb|AAD38699.1|AF148503_2  photosystem I accessory protein D             169   1e-46    
gb|AII42441.1|  Photosystem I reaction center subunit II                170   2e-46    
ref|WP_009633578.1|  PsaD                                               170   2e-46    
ref|WP_010311728.1|  photosystem I protein PsaD                         169   2e-46    
sp|P56596.1|PSAD_NOSS8  RecName: Full=Photosystem I reaction cent...    169   2e-46    
ref|WP_040933357.1|  Photosystem I reaction center subunit II           169   2e-46    
ref|WP_028953660.1|  Photosystem I reaction center subunit II           169   2e-46    
ref|WP_029637180.1|  Photosystem I reaction center subunit II [         169   2e-46    
ref|WP_040944569.1|  Photosystem I reaction center subunit II           169   2e-46    
ref|WP_006173380.1|  photosystem I reaction center subunit II (PsaD)    169   2e-46    
ref|WP_019477882.1|  MULTISPECIES: Photosystem I reaction center ...    169   2e-46    
ref|WP_038000832.1|  Photosystem I reaction center subunit II           168   5e-46    
ref|WP_019493410.1|  Photosystem I reaction center subunit II           168   5e-46    
ref|WP_006198574.1|  photosystem I reaction center subunit II           168   5e-46    
ref|WP_028083790.1|  Photosystem I reaction center subunit II           168   5e-46    
ref|WP_016953057.1|  Photosystem I reaction center subunit II           168   6e-46    
ref|WP_011932371.1|  photosystem I reaction center subunit II           168   6e-46    
ref|WP_007099913.1|  photosystem I reaction center subunit II (PsaD)    168   6e-46    
ref|WP_040938870.1|  Photosystem I reaction center subunit II           168   6e-46    
ref|WP_011321384.1|  photosystem I reaction center subunit II           168   6e-46    
ref|WP_019502597.1|  hypothetical protein                               167   7e-46    
ref|WP_044290906.1|  Photosystem I reaction center subunit II           168   8e-46    
gb|EAQ68518.1|  photosystem I reaction center subunit II (PsaD)         167   9e-46    
ref|WP_015215982.1|  photosystem I protein PsaD                         167   1e-45    
gb|KDO43053.1|  hypothetical protein CISIN_1g025753mg                   171   1e-45    
ref|WP_006275750.1|  MULTISPECIES: Photosystem I protein PsaD           167   1e-45    
gb|AFY55101.1|  PsaD                                                    167   2e-45    
ref|WP_028090681.1|  Photosystem I reaction center subunit II           166   2e-45    
ref|XP_010689994.1|  PREDICTED: PHD finger protein ING1 isoform X2      169   2e-45    
ref|XP_010689988.1|  PREDICTED: PHD finger protein ING1 isoform X1      169   3e-45    
ref|WP_043694980.1|  Photosystem I reaction center subunit II           166   3e-45    
ref|WP_035831507.1|  Photosystem I reaction center subunit II           166   3e-45    
ref|YP_007476277.1|  photosystem I reaction center subunit II (fe...    166   4e-45    
ref|WP_036900706.1|  Photosystem I reaction center subunit II           166   5e-45    
ref|WP_011377212.1|  photosystem I protein PsaD                         165   6e-45    
ref|WP_011618423.1|  photosystem I reaction center subunit II           165   6e-45    
ref|YP_003289238.1|  Photosystem I reaction center subunit II           165   6e-45    
ref|WP_015079642.1|  MULTISPECIES: photosystem I protein PsaD           165   8e-45    
ref|WP_015136451.1|  PsaD                                               165   8e-45    
ref|WP_032521962.1|  Photosystem I reaction center subunit II           165   9e-45    
ref|WP_011128902.1|  photosystem I reaction center subunit II (PsaD)    165   9e-45    
ref|WP_011433827.1|  photosystem I reaction center subunit II           165   1e-44    
ref|WP_015112247.1|  photosystem I protein PsaD                         164   1e-44    
ref|WP_041225999.1|  Photosystem I reaction center subunit II           164   1e-44    
gb|AFZ12711.1|  photosystem I protein PsaD                              165   1e-44    
ref|XP_010466802.1|  PREDICTED: PHD finger protein ING1-like            167   1e-44    
ref|WP_025927078.1|  Photosystem I reaction center subunit II           164   2e-44    
ref|WP_025915179.1|  Photosystem I reaction center subunit II           164   2e-44    
ref|WP_011363412.1|  MULTISPECIES: photosystem I reaction center ...    164   2e-44    
ref|WP_025954911.1|  Photosystem I reaction center subunit II           164   2e-44    
ref|WP_025956224.1|  Photosystem I reaction center subunit II           164   2e-44    
gb|AHF62815.1|  photosystem I reaction center subunit II (PsaD)         164   2e-44    
ref|WP_011863680.1|  MULTISPECIES: photosystem I protein PsaD           164   2e-44    
gb|ABE11137.1|  photosystem I protein PsaD                              164   2e-44    
ref|WP_025937671.1|  MULTISPECIES: Photosystem I reaction center ...    164   3e-44    
ref|WP_032526300.1|  Photosystem I reaction center subunit II           164   3e-44    
ref|WP_011131077.1|  photosystem I protein PsaD                         163   3e-44    
ref|XP_006298381.1|  hypothetical protein CARUB_v10014450mg             167   3e-44    
ref|WP_019474331.1|  MULTISPECIES: Photosystem I reaction center ...    163   4e-44    
ref|WP_032513725.1|  Photosystem I reaction center subunit II           163   4e-44    
ref|WP_006516877.1|  PsaD protein                                       163   4e-44    
ref|WP_042851104.1|  Photosystem I reaction center subunit II           163   4e-44    
ref|WP_045867605.1|  Photosystem I reaction center subunit II           163   4e-44    
ref|WP_011819190.1|  photosystem I protein PsaD                         163   5e-44    
ref|WP_036911259.1|  MULTISPECIES: Photosystem I reaction center ...    163   5e-44    
ref|WP_032517906.1|  Photosystem I reaction center subunit II           163   5e-44    
sp|P23808.1|PSAD_MICDP  RecName: Full=Photosystem I reaction cent...    162   5e-44    
ref|WP_025930967.1|  Photosystem I reaction center subunit II           163   5e-44    
ref|WP_025889562.1|  MULTISPECIES: Photosystem I reaction center ...    163   5e-44    
ref|WP_012196249.1|  photosystem I protein PsaD                         163   5e-44    
ref|WP_015208523.1|  PsaD                                               162   6e-44    
ref|WP_035155503.1|  Photosystem I reaction center subunit II           162   6e-44    
ref|XP_006418791.1|  hypothetical protein EUTSA_v10002653mg             166   6e-44    
ref|WP_036919402.1|  MULTISPECIES: Photosystem I reaction center ...    162   6e-44    
ref|WP_015109263.1|  PsaD                                               162   7e-44    
ref|WP_011133206.1|  photosystem I protein PsaD                         162   1e-43    
ref|WP_012411433.1|  photosystem I protein PsaD                         162   1e-43    
ref|WP_025928909.1|  Photosystem I reaction center subunit II           162   1e-43    
ref|YP_005090043.1|  psaD gene product                                  161   2e-43    
ref|WP_011826874.1|  photosystem I protein PsaD                         161   2e-43    
ref|WP_011821058.1|  photosystem I protein PsaD                         161   2e-43    
ref|WP_002807018.1|  MULTISPECIES: photosystem I reaction center ...    161   2e-43    
ref|WP_024544608.1|  Photosystem I reaction center subunit II           161   2e-43    
ref|WP_011936501.1|  photosystem I reaction center subunit II           161   2e-43    
ref|WP_025934063.1|  Photosystem I reaction center subunit II           161   2e-43    
ref|WP_025943071.1|  Photosystem I reaction center subunit II           161   2e-43    
ref|WP_015127985.1|  photosystem I protein PsaD                         160   4e-43    
ref|WP_025943458.1|  Photosystem I reaction center subunit II           160   5e-43    
ref|XP_007034501.1|  RING/FYVE/PHD zinc finger superfamily protei...    162   5e-43    
ref|WP_017651861.1|  Photosystem I reaction center subunit II           160   6e-43    
ref|WP_009788961.1|  photosystem I reaction center subunit II (PsaD)    160   6e-43    
ref|YP_006639027.1|  photosystem I ferredoxin-binding protein           159   6e-43    
ref|WP_012306311.1|  MULTISPECIES: photosystem I subunit II             160   7e-43    
ref|WP_011360689.1|  photosystem I reaction center subunit II (PsaD)    160   7e-43    
ref|WP_025935474.1|  Photosystem I reaction center subunit II           160   7e-43    
ref|WP_011125882.1|  MULTISPECIES: photosystem I protein PsaD           159   9e-43    
gb|AAB51150.1|  subunit II of photosystem I                             158   1e-42    
ref|XP_010488512.1|  PREDICTED: PHD finger protein ING1                 162   2e-42    
ref|WP_037220235.1|  Photosystem I reaction center subunit II           158   2e-42    
ref|XP_002883498.1|  hypothetical protein ARALYDRAFT_479934             161   3e-42    
gb|AAP79147.1|  photosystem I protein PsaD                              162   3e-42    
ref|WP_011143690.1|  photosystem I reaction center subunit II           157   1e-41    
ref|WP_038014855.1|  Photosystem I reaction center subunit II           157   1e-41    
ref|XP_006649386.1|  PREDICTED: PHD finger protein ING1-like            159   2e-41    
ref|XP_008777020.1|  PREDICTED: PHD finger protein ING1-like isof...    157   3e-41    
emb|CDN13363.1|  photosystem I subunit II (PsaD)                        155   3e-41    
ref|NP_001048939.1|  Os03g0143600                                       159   4e-41    
ref|XP_010513292.1|  PREDICTED: PHD finger protein ING1-like            158   4e-41    
gb|ACF24542.1|  photosystem I reaction center subunit II                159   6e-41    
ref|WP_015156676.1|  MULTISPECIES: photosystem I protein PsaD           154   1e-40    
ref|WP_023171757.1|  photosystem I protein PsaD                         154   1e-40    
gb|EAY88500.1|  hypothetical protein OsI_09971                          156   3e-40    
ref|WP_015134252.1|  photosystem I protein PsaD                         152   3e-40    
ref|WP_015164131.1|  photosystem I protein PsaD                         153   3e-40    
gb|ABC98753.1|  photosystem I reaction center subunit II                152   4e-40    
ref|WP_041438839.1|  Photosystem I reaction center subunit II           152   6e-40    
ref|WP_040054753.1|  Photosystem I reaction center subunit II           151   1e-39    
emb|CBI26230.3|  unnamed protein product                                149   6e-39    
ref|WP_017327440.1|  hypothetical protein                               149   6e-39    
ref|WP_012953669.1|  photosystem I reaction center subunit II PsaD      148   1e-38    
ref|XP_004985739.1|  PREDICTED: PHD finger protein ING1-like            151   2e-38    
ref|XP_008224074.1|  PREDICTED: PHD finger protein ING1 isoform X2      150   3e-38    
ref|WP_008235951.1|  photosystem I subunit II (PsaD)                    146   5e-38    
ref|WP_008224714.1|  photosystem I subunit II (PsaD)                    146   6e-38    
ref|XP_010933237.1|  PREDICTED: PHD finger protein ING1-like            150   7e-38    
ref|XP_003558832.1|  PREDICTED: PHD finger protein ING1                 149   1e-37    
ref|NP_001148845.1|  inhibitor of growth protein 5                      147   8e-37    
ref|XP_008658601.1|  PREDICTED: inhibitor of growth protein 5 iso...    148   1e-36    
ref|XP_008658602.1|  PREDICTED: inhibitor of growth protein 5 iso...    147   1e-36    
gb|KEI67811.1|  PsaD                                                    140   2e-36    
gb|AJW30886.1|  photosystem I subunit II (PsaD)                         142   2e-36    
dbj|BAK07845.1|  predicted protein                                      145   3e-36    
dbj|BAJ97745.1|  predicted protein                                      145   3e-36    
ref|WP_038654413.1|  Photosystem I reaction center subunit II           140   8e-36    
gb|ABR17867.1|  unknown                                                 142   2e-35    
ref|WP_011295494.1|  photosystem I protein PsaD                         139   2e-35    
emb|CDY22079.1|  BnaA09g01080D                                          138   7e-35    
ref|YP_003795447.1|  photosystem I subunit II                           135   3e-34    



>ref|XP_009795521.1| PREDICTED: photosystem I reaction center subunit II, chloroplastic 
[Nicotiana sylvestris]
 sp|P29302.1|PSAD_NICSY RecName: Full=Photosystem I reaction center subunit II, chloroplastic; 
AltName: Full=Photosystem I 20 kDa subunit; Short=PSI-D; 
Flags: Precursor [Nicotiana sylvestris]
 emb|CAA42623.1| PSI-D2 [Nicotiana sylvestris]
Length=204

 Score =   318 bits (815),  Expect = 9e-103, Method: Compositional matrix adjust.
 Identities = 174/213 (82%), Positives = 181/213 (85%), Gaps = 9/213 (4%)
 Frame = +3

Query  675   MAMAAQASLFASPLSaakpaadrvaaPWKQSLHCFSVVPRGLNKSTTAPCRPIRamaeet  854
             MAMA QASLF   LSA K +A     PWKQSL  FS  P+ L  + +AP RPIRAMAEE 
Sbjct  1     MAMATQASLFTPALSAPKSSA-----PWKQSLASFS--PKQLKSTVSAP-RPIRAMAEEA  52

Query  855   teaptkeaPVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTG  1034
                  +  PVGFTPP LDPNTPSPIFGGSTGGLLRKAQVEEFYVITW SPKEQIFEMPTG
Sbjct  53    ATKEAEA-PVGFTPPQLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWESPKEQIFEMPTG  111

Query  1035  GAAIMREGANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKV  1214
             GAAIMREGANLLKLARKEQCLALGTRLRSKYKINY+FYRVFPNGEVQYLHPKDGVYPEKV
Sbjct  112   GAAIMREGANLLKLARKEQCLALGTRLRSKYKINYRFYRVFPNGEVQYLHPKDGVYPEKV  171

Query  1215  NAGREGVGQNMRSIGKNISPIEVKFTGKQVYDL  1313
             NAGR+GVGQN RSIGKN SPIEVKFTGKQVYDL
Sbjct  172   NAGRQGVGQNFRSIGKNKSPIEVKFTGKQVYDL  204



>ref|XP_009621208.1| PREDICTED: photosystem I reaction center subunit II, chloroplastic 
[Nicotiana tomentosiformis]
Length=207

 Score =   318 bits (814),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 178/215 (83%), Positives = 185/215 (86%), Gaps = 10/215 (5%)
 Frame = +3

Query  675   MAMAAQASLFASPLSaakpaadrvaaPWKQSLHCFSVVPRGLNKSTTAPCRPIRamaeet  854
             MAMA QASLF   LSA K ++     PWKQSL  FS  P+ L  + +AP RPIRAMAEE 
Sbjct  1     MAMATQASLFTPALSAPKSSS-----PWKQSLASFS--PKQLKSTVSAP-RPIRAMAEEA  52

Query  855   teaptkea--PVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMP  1028
               A TKEA  PVGFTPP LDPNTPSPIFGGSTGGLLRKAQVEEFYVITW SPKEQIFEMP
Sbjct  53    AAAATKEAEAPVGFTPPQLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWESPKEQIFEMP  112

Query  1029  TGGAAIMREGANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPE  1208
             TGGAAIMREGANLLKLARKEQCLALGTRLRSKYKINY+FYRVFPNGEVQYLHPKDGVYPE
Sbjct  113   TGGAAIMREGANLLKLARKEQCLALGTRLRSKYKINYRFYRVFPNGEVQYLHPKDGVYPE  172

Query  1209  KVNAGREGVGQNMRSIGKNISPIEVKFTGKQVYDL  1313
             KVNAGR+GVGQN RSIGKN SPIEVKFTGKQVYDL
Sbjct  173   KVNAGRQGVGQNFRSIGKNKSPIEVKFTGKQVYDL  207



>ref|XP_004241054.2| PREDICTED: photosystem I reaction center subunit II, chloroplastic 
[Solanum lycopersicum]
 sp|P12372.1|PSAD_SOLLC RecName: Full=Photosystem I reaction center subunit II, chloroplastic; 
AltName: Full=Photosystem I 20 kDa subunit; Short=PSI-D; 
Flags: Precursor [Solanum lycopersicum]
 gb|AAA34185.1| photosystem I subunit II protein precursor [Solanum lycopersicum]
 prf||1601516A photosystem I reaction center II
Length=208

 Score =   312 bits (800),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 172/214 (80%), Positives = 178/214 (83%), Gaps = 7/214 (3%)
 Frame = +3

Query  675   MAMAAQASLFASPLSaakpaadrvaaPWKQSLHCFSVVPRGLNKSTTAPCRPIRamaeet  854
             MAMA QASLF  PLS  K        PWKQSL  FS  P+ L KST +  RPIRAMAEE 
Sbjct  1     MAMATQASLFTPPLSVPKSTTA----PWKQSLVSFST-PKQL-KSTVSVTRPIRAMAEEA  54

Query  855   teaptke-aPVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPT  1031
               A  ++ AP GFTPP LDPNTPSPIFGGSTGGLLRKAQVEEFYVITW SPKEQIFEMPT
Sbjct  55    PAATEEKPAPAGFTPPQLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWESPKEQIFEMPT  114

Query  1032  GGAAIMREGANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEK  1211
             GGAAIMR+G NLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEK
Sbjct  115   GGAAIMRQGPNLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEK  174

Query  1212  VNAGREGVGQNMRSIGKNISPIEVKFTGKQVYDL  1313
             VN GREGVGQN RSIGKN S IEVKFTGKQVYD+
Sbjct  175   VNPGREGVGQNFRSIGKNKSAIEVKFTGKQVYDI  208



>ref|XP_006356675.1| PREDICTED: photosystem I reaction center subunit II, chloroplastic-like 
[Solanum tuberosum]
 emb|CAD89270.1| putative photosystem I reaction centre PSI-D subunit precursor 
[Solanum tuberosum]
Length=207

 Score =   310 bits (795),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 173/214 (81%), Positives = 178/214 (83%), Gaps = 8/214 (4%)
 Frame = +3

Query  675   MAMAAQASLFASPLSaakpaadrvaaPWKQSLHCFSVVPRGLNKSTTAPCRPIRamaeet  854
             MAMA QASLF   LS  K  A     PWKQSL  FS  P+ L KST +  RPIRAMAEE 
Sbjct  1     MAMATQASLFTPALSVPKSTA-----PWKQSLLSFST-PKQL-KSTVSVTRPIRAMAEEA  53

Query  855   teaptke-aPVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPT  1031
               A  ++ AP GFTPP LDPNTPSPIFGGSTGGLLRKAQVEEFYVITW SPKEQIFEMPT
Sbjct  54    PAATEEKPAPAGFTPPQLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWESPKEQIFEMPT  113

Query  1032  GGAAIMREGANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEK  1211
             GGAAIMREG NLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEK
Sbjct  114   GGAAIMREGPNLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEK  173

Query  1212  VNAGREGVGQNMRSIGKNISPIEVKFTGKQVYDL  1313
             VN GREGVGQN RSIGKN S IEVKFTGKQVYD+
Sbjct  174   VNPGREGVGQNFRSIGKNKSAIEVKFTGKQVYDI  207



>ref|XP_009799304.1| PREDICTED: photosystem I reaction center subunit II, chloroplastic-like 
[Nicotiana sylvestris]
 dbj|BAA02871.1| PSI-D1 precursor [Nicotiana sylvestris]
Length=214

 Score =   310 bits (795),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 171/217 (79%), Positives = 184/217 (85%), Gaps = 7/217 (3%)
 Frame = +3

Query  675   MAMAAQASLFASPLSaakpaadrvaaPWKQSLHCFSVVPRGLNKSTTAPCRPIRamaeet  854
             MAMA+QASLF   +S +K A  RV APWKQS   FS  P+ L+KS  A  RPI+AMA E 
Sbjct  1     MAMASQASLFTPSISTSKTADPRVVAPWKQSASSFSA-PK-LSKSVVA-YRPIKAMAVEK  57

Query  855   teaptk----eaPVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFE  1022
              ++ TK     APVGFTPP LDP+TPSPIFGGSTGGLLRKAQV+EFYVITW SPKEQIFE
Sbjct  58    AQSATKEAEPAAPVGFTPPQLDPSTPSPIFGGSTGGLLRKAQVDEFYVITWESPKEQIFE  117

Query  1023  MPTGGAAIMREGANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVY  1202
             MPTGGAAIMREG NLLKLARKEQCLALGTRLRSKYKINY+FYRVFPNGEVQYLHPKDGVY
Sbjct  118   MPTGGAAIMREGPNLLKLARKEQCLALGTRLRSKYKINYRFYRVFPNGEVQYLHPKDGVY  177

Query  1203  PEKVNAGREGVGQNMRSIGKNISPIEVKFTGKQVYDL  1313
             PEKVN GR+GVGQN RSIGKN SPIEVKFTGKQVYD+
Sbjct  178   PEKVNPGRQGVGQNFRSIGKNKSPIEVKFTGKQVYDI  214



>ref|XP_011071575.1| PREDICTED: photosystem I reaction center subunit II, chloroplastic-like 
[Sesamum indicum]
Length=213

 Score =   310 bits (795),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 171/214 (80%), Positives = 178/214 (83%), Gaps = 2/214 (1%)
 Frame = +3

Query  675   MAMAAQASLFASPLSaakpaadrvaaPWKQSLHCFSVVPRGLNKSTTAPCRPIRamaeet  854
             MAMA QASLF   LSAAKPA    A PWKQS+  FS     +    +   RPIRAMAEE 
Sbjct  1     MAMATQASLFTPTLSAAKPADRVAA-PWKQSIAQFSTPKAPIKGVASVSHRPIRAMAEEA  59

Query  855   teaptk-eaPVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPT  1031
               A  + EAP GFTPP LDPNTPSPIFGGSTGGLLRKAQVEEFYVITW SPKEQ+FEMPT
Sbjct  60    PAATKEPEAPAGFTPPELDPNTPSPIFGGSTGGLLRKAQVEEFYVITWDSPKEQVFEMPT  119

Query  1032  GGAAIMREGANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEK  1211
             GGAAIMR+G NLLKLARKEQCLALGTRLRSKYKI YQFYRVFPNGEVQYLHPKDGVYPEK
Sbjct  120   GGAAIMRQGPNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPNGEVQYLHPKDGVYPEK  179

Query  1212  VNAGREGVGQNMRSIGKNISPIEVKFTGKQVYDL  1313
             VN GR GVGQNMRSIGKN+SPIEVKFTGKQVYDL
Sbjct  180   VNPGRTGVGQNMRSIGKNVSPIEVKFTGKQVYDL  213



>ref|XP_008376830.1| PREDICTED: photosystem I reaction center subunit II, chloroplastic-like 
[Malus domestica]
Length=212

 Score =   309 bits (791),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 170/213 (80%), Positives = 176/213 (83%), Gaps = 1/213 (0%)
 Frame = +3

Query  675   MAMAAQASLFASPLSaakpaadrvaaPWKQSLHCFSVVPRGLNKSTTAPCRPIRamaeet  854
             MAMA QASLF    SA K  ADR   PWKQS+    + P+ L  ST    R I A AEE 
Sbjct  1     MAMATQASLFTPTPSAPKTTADRTTTPWKQSVSSSFMAPKPLKLSTARTMR-INASAEEK  59

Query  855   teaptkeaPVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTG  1034
             T  PTKEAPVGFTPP LDP TPSPIFGGSTGGLLRKAQ EEFYVITW SPKEQIFEMPTG
Sbjct  60    TVTPTKEAPVGFTPPELDPTTPSPIFGGSTGGLLRKAQEEEFYVITWESPKEQIFEMPTG  119

Query  1035  GAAIMREGANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKV  1214
             GAAIMREG NLLKLARKEQCLALGTRLRSKYKI YQFYRVFPNGEVQYLHPKDGVYPEKV
Sbjct  120   GAAIMREGPNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPNGEVQYLHPKDGVYPEKV  179

Query  1215  NAGREGVGQNMRSIGKNISPIEVKFTGKQVYDL  1313
             N GR+GVGQN RSIGKN+SPIEVKFTGKQVYD+
Sbjct  180   NPGRQGVGQNFRSIGKNVSPIEVKFTGKQVYDI  212



>gb|EYU41499.1| hypothetical protein MIMGU_mgv1a013699mg [Erythranthe guttata]
Length=212

 Score =   308 bits (790),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 167/214 (78%), Positives = 176/214 (82%), Gaps = 3/214 (1%)
 Frame = +3

Query  675   MAMAAQASLFASPLSaakpaadrvaaPWKQSLHCFSVVPRGLNKSTTAPCRPIRamaeet  854
             MAMA QASLF   LS  K      A PWKQSL  FS V + +  ++    RPIRAMA+E 
Sbjct  1     MAMATQASLFTPTLSGPKSGDRAAA-PWKQSLAQFSAV-KPMKGASAVSHRPIRAMADEA  58

Query  855   teaptk-eaPVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPT  1031
               A  + EAP GFTPP LDP+TPSPIFGGSTGGLLRKAQVEEFYVITW SPKEQ+FEMPT
Sbjct  59    PAATKEPEAPAGFTPPELDPSTPSPIFGGSTGGLLRKAQVEEFYVITWESPKEQVFEMPT  118

Query  1032  GGAAIMREGANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEK  1211
             GGAAIMR+G NLLKLARKEQCLALGTRLRSKYKI YQFYRVFPNGEVQYLHPKDGVYPEK
Sbjct  119   GGAAIMRQGPNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPNGEVQYLHPKDGVYPEK  178

Query  1212  VNAGREGVGQNMRSIGKNISPIEVKFTGKQVYDL  1313
             VNAGR GVG NMRSIGKN SPIEVKFTGKQVYDL
Sbjct  179   VNAGRTGVGLNMRSIGKNASPIEVKFTGKQVYDL  212



>ref|XP_011090732.1| PREDICTED: photosystem I reaction center subunit II, chloroplastic-like 
[Sesamum indicum]
Length=215

 Score =   308 bits (790),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 172/217 (79%), Positives = 180/217 (83%), Gaps = 6/217 (3%)
 Frame = +3

Query  675   MAMAAQASLFASPLSaakpaadrvaaPWKQSLHCFSVVPRGLNKSTTAPCRPIRamaeet  854
             MAMA QASLF   LS  K A   VA PWKQSL  FS  P+ +  ++    RPIRAMAEE 
Sbjct  1     MAMATQASLFTPTLSGPKSADRVVA-PWKQSLAQFST-PKPMKVASAVAHRPIRAMAEEA  58

Query  855   teaptk-eaPVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPT  1031
               A  + EAP GFTPP LDPNTPSPIFGGSTGGLLRKAQVEEFYVITW SPKEQ+FEMPT
Sbjct  59    PPATKEPEAPAGFTPPELDPNTPSPIFGGSTGGLLRKAQVEEFYVITWESPKEQVFEMPT  118

Query  1032  GGAAIMREGANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEK  1211
             GGAAIMR+G NLLKLARKEQCLALGTRLRSKYKI YQFYRVFPNGEVQYLHPKDGVYPEK
Sbjct  119   GGAAIMRQGPNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPNGEVQYLHPKDGVYPEK  178

Query  1212  VNAGREGVG---QNMRSIGKNISPIEVKFTGKQVYDL  1313
             VNAGR GVG   QNMRSIGKN+SPIEVKFTGKQVYDL
Sbjct  179   VNAGRTGVGQNMQNMRSIGKNVSPIEVKFTGKQVYDL  215



>ref|XP_009366924.1| PREDICTED: photosystem I reaction center subunit II, chloroplastic-like 
[Pyrus x bretschneideri]
Length=213

 Score =   308 bits (789),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 163/213 (77%), Positives = 173/213 (81%), Gaps = 0/213 (0%)
 Frame = +3

Query  675   MAMAAQASLFASPLSaakpaadrvaaPWKQSLHCFSVVPRGLNKSTTAPCRPIRamaeet  854
             MAMA QASLF    S  K  ADR  APWKQS+    + P+ L  STT   R   +  E+T
Sbjct  1     MAMATQASLFTPTPSVPKTIADRTTAPWKQSVSSSFMAPKPLKLSTTRTMRINASAEEKT  60

Query  855   teaptkeaPVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTG  1034
                  +EAPVGFTPP LDP TPSPIFGGSTGGLLRKAQ EEFYVITW SPKEQIFEMPTG
Sbjct  61    VTPTKEEAPVGFTPPELDPTTPSPIFGGSTGGLLRKAQEEEFYVITWESPKEQIFEMPTG  120

Query  1035  GAAIMREGANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKV  1214
             GAAIMREG NLLKLARKEQCLALGTRLRSKYKI YQFYRVFPNGEVQYLHPKDGVYPEKV
Sbjct  121   GAAIMREGPNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPNGEVQYLHPKDGVYPEKV  180

Query  1215  NAGREGVGQNMRSIGKNISPIEVKFTGKQVYDL  1313
             N GR+GVGQN RSIGKN++PIEVKFTGKQVYD+
Sbjct  181   NPGRQGVGQNFRSIGKNVNPIEVKFTGKQVYDI  213



>ref|XP_008340966.1| PREDICTED: photosystem I reaction center subunit II, chloroplastic-like 
[Malus domestica]
Length=213

 Score =   308 bits (789),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 163/213 (77%), Positives = 173/213 (81%), Gaps = 0/213 (0%)
 Frame = +3

Query  675   MAMAAQASLFASPLSaakpaadrvaaPWKQSLHCFSVVPRGLNKSTTAPCRPIRamaeet  854
             MAMA QASLF    S  K  ADR  APWKQS+    + P+ L  STT   R   +  E+T
Sbjct  1     MAMATQASLFTPTPSVPKTTADRTTAPWKQSVSSSFMPPKPLKLSTTRTMRINASAEEKT  60

Query  855   teaptkeaPVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTG  1034
                  +EAPVGFTPP LDP TPSPIFGGSTGGLLRKAQ EEFYVITW SPKEQIFEMPTG
Sbjct  61    VTTTKEEAPVGFTPPELDPTTPSPIFGGSTGGLLRKAQEEEFYVITWESPKEQIFEMPTG  120

Query  1035  GAAIMREGANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKV  1214
             GAAIMREG NLLKLARKEQCLALGTRLRSKYKI YQFYRVFPNGEVQYLHPKDGVYPEKV
Sbjct  121   GAAIMREGPNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPNGEVQYLHPKDGVYPEKV  180

Query  1215  NAGREGVGQNMRSIGKNISPIEVKFTGKQVYDL  1313
             N GR+GVGQN RSIGKN++PIEVKFTGKQVYD+
Sbjct  181   NPGRQGVGQNFRSIGKNVNPIEVKFTGKQVYDI  213



>ref|XP_007143239.1| hypothetical protein PHAVU_007G055900g [Phaseolus vulgaris]
 gb|ESW15233.1| hypothetical protein PHAVU_007G055900g [Phaseolus vulgaris]
Length=207

 Score =   306 bits (784),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 170/213 (80%), Positives = 175/213 (82%), Gaps = 6/213 (3%)
 Frame = +3

Query  675   MAMAAQASLFASPLSaakpaadrvaaPWKQSLHCFSVVPRGLNKSTTAPCRPIRamaeet  854
             MAMA QASLF  P S  K +      PWKQS       P+ L  S T     IRA A+ET
Sbjct  1     MAMATQASLFTPPFSGLKLSDRASV-PWKQSPTFSFTSPKPLKLSKT-----IRAAADET  54

Query  855   teaptkeaPVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTG  1034
              EA TKEAPVGFTPP LDPNTPSPIFGGSTGGLLRKAQVEEFYVITW SPKEQIFEMPTG
Sbjct  55    AEAATKEAPVGFTPPELDPNTPSPIFGGSTGGLLRKAQVEEFYVITWESPKEQIFEMPTG  114

Query  1035  GAAIMREGANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKV  1214
             GAAIMREG NLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKV
Sbjct  115   GAAIMREGPNLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKV  174

Query  1215  NAGREGVGQNMRSIGKNISPIEVKFTGKQVYDL  1313
             N GR+GVGQN RSIGKN+SPIEVKFTGKQ YDL
Sbjct  175   NPGRQGVGQNFRSIGKNVSPIEVKFTGKQPYDL  207



>gb|AGV54746.1| photosystem I reaction center subunit II chloroplastic-like protein 
[Phaseolus vulgaris]
Length=207

 Score =   306 bits (783),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 171/213 (80%), Positives = 176/213 (83%), Gaps = 6/213 (3%)
 Frame = +3

Query  675   MAMAAQASLFASPLSaakpaadrvaaPWKQSLHCFSVVPRGLNKSTTAPCRPIRamaeet  854
             MAMA QASLF  P S  KP+      PWKQS       P+ L  S T     IRA A+ET
Sbjct  1     MAMATQASLFTPPFSGLKPSDRASV-PWKQSPTFSFTSPKPLKLSKT-----IRAAADET  54

Query  855   teaptkeaPVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTG  1034
              EA TKEAPVGFTPP LDPNTPSPIFGGSTGGLLRKAQVEEFYVITW SPKEQIFEMPTG
Sbjct  55    AEAATKEAPVGFTPPELDPNTPSPIFGGSTGGLLRKAQVEEFYVITWESPKEQIFEMPTG  114

Query  1035  GAAIMREGANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKV  1214
             GAAIMREG NLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKV
Sbjct  115   GAAIMREGPNLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKV  174

Query  1215  NAGREGVGQNMRSIGKNISPIEVKFTGKQVYDL  1313
             N GR+GVGQN RSIGKN+SPIEVKFTGKQ YDL
Sbjct  175   NPGRQGVGQNFRSIGKNVSPIEVKFTGKQPYDL  207



>ref|XP_004296896.1| PREDICTED: photosystem I reaction center subunit II, chloroplastic-like 
[Fragaria vesca subsp. vesca]
Length=205

 Score =   306 bits (783),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 161/216 (75%), Positives = 169/216 (78%), Gaps = 14/216 (6%)
 Frame = +3

Query  675   MAMAAQASLFASPLSaakpaadrvaaPWKQSLHCFSVVPRGLNKSTTAPCRPIRamaeet  854
             MAMA QA+LF    SA          PWKQS+    + P+ L  ST A  RP+R  A E 
Sbjct  1     MAMATQATLFTPTASA----------PWKQSVTSTFMAPKSLTLSTVA-SRPMRISAAEE  49

Query  855   te---aptkeaPVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEM  1025
                      EAPVGFTPP LDP TPSPIFGGSTGGLLRKAQ EEFYVITW SPKEQIFEM
Sbjct  50    KTVAPTKEAEAPVGFTPPELDPTTPSPIFGGSTGGLLRKAQEEEFYVITWESPKEQIFEM  109

Query  1026  PTGGAAIMREGANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYP  1205
             PTGGAAIMREG NLLKLARKEQCLALGTRLRSKYKI YQFYRVFPNGEVQYLHPKDGVYP
Sbjct  110   PTGGAAIMREGPNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPNGEVQYLHPKDGVYP  169

Query  1206  EKVNAGREGVGQNMRSIGKNISPIEVKFTGKQVYDL  1313
             EKVN GR+GVGQN RSIGKN+SPIEVKFTGKQVYD+
Sbjct  170   EKVNPGRQGVGQNFRSIGKNVSPIEVKFTGKQVYDI  205



>ref|XP_003556041.1| PREDICTED: photosystem I reaction center subunit II, chloroplastic-like 
[Glycine max]
 gb|KHN15781.1| Photosystem I reaction center subunit II, chloroplastic [Glycine 
soja]
Length=203

 Score =   306 bits (783),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 164/213 (77%), Positives = 173/213 (81%), Gaps = 10/213 (5%)
 Frame = +3

Query  675   MAMAAQASLFASPLSaakpaadrvaaPWKQSLHCFSVVPRGLNKSTTAPCRPIRamaeet  854
             MAMA QASLF  PLS  KP+    A PWKQS          L+ ST+ P +  R +    
Sbjct  1     MAMATQASLFTPPLSGLKPSDRATA-PWKQS--------STLSFSTSKPLKFSRTIRAAA  51

Query  855   teaptkeaPVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTG  1034
             T+  T+  PVGFTPP LDPNTPSPIFGGSTGGLLRKAQVEEFYVITW SPKEQIFEMPTG
Sbjct  52    TDQTTEA-PVGFTPPELDPNTPSPIFGGSTGGLLRKAQVEEFYVITWDSPKEQIFEMPTG  110

Query  1035  GAAIMREGANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKV  1214
             GAAIMREG NLLKLARKEQCLALGTRLRSKYKI YQFYRVFPNGEVQYLHPKDGVYPEKV
Sbjct  111   GAAIMREGPNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPNGEVQYLHPKDGVYPEKV  170

Query  1215  NAGREGVGQNMRSIGKNISPIEVKFTGKQVYDL  1313
             NAGR+GVGQN RSIGKN+SPIEVKFTGKQ YDL
Sbjct  171   NAGRQGVGQNFRSIGKNVSPIEVKFTGKQPYDL  203



>ref|XP_010277521.1| PREDICTED: photosystem I reaction center subunit II, chloroplastic 
[Nelumbo nucifera]
Length=213

 Score =   306 bits (783),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 166/216 (77%), Positives = 173/216 (80%), Gaps = 6/216 (3%)
 Frame = +3

Query  675   MAMAAQASLFASPLSaakpaadrvaaPWKQSLHCFSVV-PRGLNKSTTAPCRPIRamaee  851
             MAMA QA+LF   LSA K     +  PWK S    S + PR LN S     R IRA A +
Sbjct  1     MAMATQAALFTPTLSAPKSGNRALV-PWKPSSTSLSFISPRPLNLSVAQ--RTIRAAAAD  57

Query  852   tteap--tkeaPVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEM  1025
                      EAPVGFTPP LDPNTPSPIFGGSTGGLLRKAQVEEFYVITW SPKEQIFEM
Sbjct  58    EKTEAPPAAEAPVGFTPPELDPNTPSPIFGGSTGGLLRKAQVEEFYVITWESPKEQIFEM  117

Query  1026  PTGGAAIMREGANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYP  1205
             PTGGAAIMR+G NLLKLARKEQCLALGTRLRSKYKI YQFYRVFPNGEVQYLHPKDGVYP
Sbjct  118   PTGGAAIMRQGPNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPNGEVQYLHPKDGVYP  177

Query  1206  EKVNAGREGVGQNMRSIGKNISPIEVKFTGKQVYDL  1313
             EKVNAGR+GVGQN RSIGKN+SPIEVKFTGKQVYDL
Sbjct  178   EKVNAGRQGVGQNFRSIGKNVSPIEVKFTGKQVYDL  213



>ref|XP_008224535.1| PREDICTED: photosystem I reaction center subunit II, chloroplastic-like 
[Prunus mume]
Length=213

 Score =   306 bits (783),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 165/213 (77%), Positives = 176/213 (83%), Gaps = 0/213 (0%)
 Frame = +3

Query  675   MAMAAQASLFASPLSaakpaadrvaaPWKQSLHCFSVVPRGLNKSTTAPCRPIRamaeet  854
             MAMA QA+LF    SA K + +R   PWKQS+    + P+ L  S+T     I A AEE 
Sbjct  1     MAMATQATLFTPTPSAPKTSVERSTVPWKQSVSSSFMAPKPLMLSSTTRTMRINAAAEEK  60

Query  855   teaptkeaPVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTG  1034
             T AP KEAPVGFTPP LDP TPSPIFGGSTGGLLRKAQ EEFYVITW SPKEQIFEMPTG
Sbjct  61    TVAPPKEAPVGFTPPELDPTTPSPIFGGSTGGLLRKAQEEEFYVITWESPKEQIFEMPTG  120

Query  1035  GAAIMREGANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKV  1214
             GAAIMREG NLLKLARKEQCLALGTRLRSKYKI YQFYRVFPNGEVQYLHPKDGVYPEKV
Sbjct  121   GAAIMREGPNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPNGEVQYLHPKDGVYPEKV  180

Query  1215  NAGREGVGQNMRSIGKNISPIEVKFTGKQVYDL  1313
             N GR+GVGQN RSIGKN++PIEVKFTGKQVYD+
Sbjct  181   NPGRQGVGQNFRSIGKNVNPIEVKFTGKQVYDI  213



>ref|XP_010035248.1| PREDICTED: photosystem I reaction center subunit II, chloroplastic-like 
[Eucalyptus grandis]
 gb|KCW84226.1| hypothetical protein EUGRSUZ_B01088 [Eucalyptus grandis]
Length=214

 Score =   305 bits (781),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 164/215 (76%), Positives = 171/215 (80%), Gaps = 3/215 (1%)
 Frame = +3

Query  675   MAMAAQASLFASPLSaakpaadrvaaPWKQSLH--CFSVVPRGLNKSTTAPCRPIRamae  848
             MAMA QASLF   L+A K   DRV APWKQS     F+  P+    S     R   A   
Sbjct  1     MAMATQASLFTPALAAPKSGVDRVIAPWKQSASSLAFAATPKAAKSSPRTAIR-AAAAEG  59

Query  849   etteaptkeaPVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMP  1028
             +      +EAPVGFTPP LDPNTPSPIFGGSTGGLLRKAQVEEFYVITW SPKEQIFEMP
Sbjct  60    KAEAPVKEEAPVGFTPPELDPNTPSPIFGGSTGGLLRKAQVEEFYVITWESPKEQIFEMP  119

Query  1029  TGGAAIMREGANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPE  1208
             TGGAAIMREG NLLKLARKEQCLALGTRLRSKYKI YQFYRVFPNGEVQYLHPKDGVYPE
Sbjct  120   TGGAAIMREGPNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPNGEVQYLHPKDGVYPE  179

Query  1209  KVNAGREGVGQNMRSIGKNISPIEVKFTGKQVYDL  1313
             KVN GR+GVGQN RSIGKN+SPIEVKFTGKQ YDL
Sbjct  180   KVNKGRQGVGQNFRSIGKNVSPIEVKFTGKQPYDL  214



>ref|XP_006419899.1| hypothetical protein CICLE_v10005892mg [Citrus clementina]
 ref|XP_006489366.1| PREDICTED: photosystem I reaction center subunit II, chloroplastic 
[Citrus sinensis]
 dbj|BAF80470.1| PSI reaction center subunit II [Citrus sinensis]
 dbj|BAF80477.1| PSI reaction center subunit II [Citrus sinensis]
 gb|ESR33139.1| hypothetical protein CICLE_v10005892mg [Citrus clementina]
 gb|KDO74646.1| hypothetical protein CISIN_1g028581mg [Citrus sinensis]
Length=207

 Score =   305 bits (780),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 171/215 (80%), Positives = 178/215 (83%), Gaps = 8/215 (4%)
 Frame = +3

Query  669   ISMAMAAQASLFASPLSaakpaadrvaaPWKQSLHCFSVVPRGLNKSTTAPCRPIRamae  848
             ++MA   QASLFA     A  +  + +APWKQS   FSV P   N   T     I+AMAE
Sbjct  1     MAMAATTQASLFAP----ANFSTTKSSAPWKQS-SSFSVRPLKHNAPRT---NTIKAMAE  52

Query  849   etteaptkeaPVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMP  1028
               TE PTKEAPVGFTPP LDPNTPSPIFGGSTGGLLRKAQVEEFYVITW SPKEQIFEMP
Sbjct  53    GKTETPTKEAPVGFTPPELDPNTPSPIFGGSTGGLLRKAQVEEFYVITWESPKEQIFEMP  112

Query  1029  TGGAAIMREGANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPE  1208
             TGGAAIMREG NLLKLARKEQCLALGTRLRSKYKI YQFYRVFPNGEVQYLHPKDGVYPE
Sbjct  113   TGGAAIMREGPNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPNGEVQYLHPKDGVYPE  172

Query  1209  KVNAGREGVGQNMRSIGKNISPIEVKFTGKQVYDL  1313
             KVN GREGVGQN RSIGKN+SPIEVKFTGKQVYDL
Sbjct  173   KVNPGREGVGQNYRSIGKNVSPIEVKFTGKQVYDL  207



>ref|XP_009588197.1| PREDICTED: photosystem I reaction center subunit II, chloroplastic-like 
[Nicotiana tomentosiformis]
Length=209

 Score =   304 bits (778),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 166/217 (76%), Positives = 178/217 (82%), Gaps = 12/217 (6%)
 Frame = +3

Query  675   MAMAAQASLFASPLSaakpaadrvaaPWKQSLHCFSVVPRGLNKSTTAPCRPIRamaeet  854
             MAMA+QASLF   +S  K AA     PWKQS+  FS  P+      T   RPI+A A+E 
Sbjct  1     MAMASQASLFTPSISGPKTAA-----PWKQSVSSFSA-PKPSKSGVT--YRPIKATADEK  52

Query  855   teaptk----eaPVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFE  1022
              ++ TK     APVGFTPP LDP+TPSPIFGGSTGGLLRKAQVEEFYVITW SPKEQIFE
Sbjct  53    AQSATKEAELAAPVGFTPPQLDPSTPSPIFGGSTGGLLRKAQVEEFYVITWESPKEQIFE  112

Query  1023  MPTGGAAIMREGANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVY  1202
             MPTGGAAIMREG NLLKLARKEQCLALGTRLRSKYKINY+FYRVFPNGEVQYLHPKDGVY
Sbjct  113   MPTGGAAIMREGPNLLKLARKEQCLALGTRLRSKYKINYRFYRVFPNGEVQYLHPKDGVY  172

Query  1203  PEKVNAGREGVGQNMRSIGKNISPIEVKFTGKQVYDL  1313
             PEKVN GR+GVGQN RSIGKN SPIEVKFTGKQVYD+
Sbjct  173   PEKVNPGRQGVGQNFRSIGKNKSPIEVKFTGKQVYDI  209



>gb|EYU45647.1| hypothetical protein MIMGU_mgv1a013850mg [Erythranthe guttata]
Length=209

 Score =   303 bits (777),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 168/215 (78%), Positives = 180/215 (84%), Gaps = 8/215 (4%)
 Frame = +3

Query  675   MAMAAQASLFASPLSaakpaadrvaaPWKQSLHCFSVVPRGLNKSTTAPCRPIRamaeet  854
             MAMA QA+LFA+ +SA + AA     PWKQSL  FS   + + KS  A  RPIRAMAE+ 
Sbjct  1     MAMATQATLFAATISADRVAA-----PWKQSLAQFSTATKPIIKSA-ATHRPIRAMAEDA  54

Query  855   teaptke--aPVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMP  1028
               A TKE  AP GFTPP LDP TPSPIFGGSTGGLLRKAQVEEFYVITW SPKEQ+FEMP
Sbjct  55    PAAATKEPEAPAGFTPPELDPTTPSPIFGGSTGGLLRKAQVEEFYVITWESPKEQVFEMP  114

Query  1029  TGGAAIMREGANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPE  1208
             TGGAAIMR+G NLLKLARKEQCLALGT+LRSKYKI YQFYRVFPNGEVQYLHPKDGVYPE
Sbjct  115   TGGAAIMRQGPNLLKLARKEQCLALGTKLRSKYKIKYQFYRVFPNGEVQYLHPKDGVYPE  174

Query  1209  KVNAGREGVGQNMRSIGKNISPIEVKFTGKQVYDL  1313
             KVN GR GVG NMRSIGKN+SPIEVKFTGKQVY+L
Sbjct  175   KVNPGRTGVGLNMRSIGKNVSPIEVKFTGKQVYEL  209



>ref|NP_001275862.1| PSI reaction center subunit II [Citrus sinensis]
 dbj|BAF80475.1| PSI reaction center subunit II [Citrus sinensis]
Length=207

 Score =   303 bits (777),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 170/215 (79%), Positives = 178/215 (83%), Gaps = 8/215 (4%)
 Frame = +3

Query  669   ISMAMAAQASLFASPLSaakpaadrvaaPWKQSLHCFSVVPRGLNKSTTAPCRPIRamae  848
             ++MA   QASLFA     A  +  + +APWKQS   FSV P   N   T     I+AMAE
Sbjct  1     MAMAATTQASLFAP----ANFSTTKSSAPWKQS-SSFSVRPLKHNAPRT---NTIKAMAE  52

Query  849   etteaptkeaPVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMP  1028
               TE PTKEAPVGFTPP LDPNTPSPIFGGSTGGLLRKAQVEEFYVITW SPKEQIFEMP
Sbjct  53    GKTETPTKEAPVGFTPPELDPNTPSPIFGGSTGGLLRKAQVEEFYVITWESPKEQIFEMP  112

Query  1029  TGGAAIMREGANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPE  1208
             TGGAAIMREG NLLKLARKEQCLALGTRLRSKYKI YQFYRVFPNGEVQYLHPKDGVYPE
Sbjct  113   TGGAAIMREGPNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPNGEVQYLHPKDGVYPE  172

Query  1209  KVNAGREGVGQNMRSIGKNISPIEVKFTGKQVYDL  1313
             KVN GREGVGQN RSIGKN+SPIEVKFTGKQVYD+
Sbjct  173   KVNPGREGVGQNYRSIGKNVSPIEVKFTGKQVYDV  207



>ref|NP_001235355.1| photosystem I subunit PsaD [Glycine max]
 gb|ABQ63097.1| photosystem I subunit PsaD [Glycine max]
 gb|ACU14192.1| unknown [Glycine max]
Length=210

 Score =   303 bits (775),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 161/213 (76%), Positives = 167/213 (78%), Gaps = 3/213 (1%)
 Frame = +3

Query  675   MAMAAQASLFASPLSaakpaadrvaaPWKQSLHCFSVVPRGLNKSTTAPCRPIRamaeet  854
             MAMA QASL   PLS  K +      PWKQ+       P+ L  S T   R   A     
Sbjct  1     MAMATQASLLTPPLSGLKASDRASV-PWKQNSSLSFSSPKPLKFSRT--IRAAAADETTE  57

Query  855   teaptkeaPVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTG  1034
               A  + APVGFTPP LDPNTPSPIFGGSTGGLLRKAQVEEFYVITW SPKEQIFEMPTG
Sbjct  58    APAKVEAAPVGFTPPELDPNTPSPIFGGSTGGLLRKAQVEEFYVITWDSPKEQIFEMPTG  117

Query  1035  GAAIMREGANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKV  1214
             GAAIMREG NLLKLARKEQCLALGTRLRSKYKI YQFYRVFPNGEVQYLHPKDGVYPEKV
Sbjct  118   GAAIMREGPNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPNGEVQYLHPKDGVYPEKV  177

Query  1215  NAGREGVGQNMRSIGKNISPIEVKFTGKQVYDL  1313
             NAGR+GVGQN RSIGKN+SPIEVKFTGKQ YDL
Sbjct  178   NAGRQGVGQNFRSIGKNVSPIEVKFTGKQPYDL  210



>gb|ABK96621.1| unknown [Populus trichocarpa x Populus deltoides]
Length=201

 Score =   301 bits (770),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 156/213 (73%), Positives = 168/213 (79%), Gaps = 14/213 (7%)
 Frame = +3

Query  681   MAAQASLFASPLSaakpaadrvaaPWKQS--LHCFSVVPRGLNKSTTAPCRPIRamaeet  854
             MAAQASLF  P  +   ++++  APWKQS  L   +V P+   K   A    ++      
Sbjct  1     MAAQASLFTPPTLSTLKSSNQAIAPWKQSSFLPISNVKPQRTMKVAAAEETAVKEA----  56

Query  855   teaptkeaPVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTG  1034
                     PVGFTPP LDP+TPSPIFGGSTGGLLRKAQVEEFYVITW SPKEQIFEMPTG
Sbjct  57    --------PVGFTPPELDPSTPSPIFGGSTGGLLRKAQVEEFYVITWDSPKEQIFEMPTG  108

Query  1035  GAAIMREGANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKV  1214
             GAAIMREG NLLKLARKEQCLALGTRLRSKYKI YQFYRVFPNGEVQYLHPKDGVYPEKV
Sbjct  109   GAAIMREGPNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPNGEVQYLHPKDGVYPEKV  168

Query  1215  NAGREGVGQNMRSIGKNISPIEVKFTGKQVYDL  1313
             N GR+GVGQN RSIGKN+SPIEVKFTGKQVYDL
Sbjct  169   NPGRQGVGQNFRSIGKNVSPIEVKFTGKQVYDL  201



>ref|XP_002516772.1| Photosystem I reaction center subunit II, chloroplast precursor, 
putative [Ricinus communis]
 gb|EEF45386.1| Photosystem I reaction center subunit II, chloroplast precursor, 
putative [Ricinus communis]
Length=208

 Score =   301 bits (770),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 156/213 (73%), Positives = 168/213 (79%), Gaps = 5/213 (2%)
 Frame = +3

Query  675   MAMAAQASLFASPLSaakpaadrvaaPWKQSLHCFSVVPRGLNKSTTAPCRPIRamaeet  854
             MAMA QASLF     +   +++    PWKQS   F  +P    +  +   + I+A A E 
Sbjct  1     MAMATQASLFTPTTLSTPKSSNHAIVPWKQS--SFLSIPTAKPRKYSIAQKTIKAAAAEG  58

Query  855   teaptkeaPVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTG  1034
                     PVGFTPP LDP+TPSPIFGGSTGGLLRKAQVEEFYVITW SPKEQIFEMPTG
Sbjct  59    KTKEA---PVGFTPPELDPSTPSPIFGGSTGGLLRKAQVEEFYVITWDSPKEQIFEMPTG  115

Query  1035  GAAIMREGANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKV  1214
             GAAIMR+G NLLKLARKEQCLALGTRLRSKYKI YQFYRVFPNGEVQYLHPKDGVYPEKV
Sbjct  116   GAAIMRQGPNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPNGEVQYLHPKDGVYPEKV  175

Query  1215  NAGREGVGQNMRSIGKNISPIEVKFTGKQVYDL  1313
             N GREGVGQN RSIGKN+SPIEVKFTGKQVYDL
Sbjct  176   NPGREGVGQNFRSIGKNVSPIEVKFTGKQVYDL  208



>ref|XP_002281825.1| PREDICTED: photosystem I reaction center subunit II, chloroplastic 
[Vitis vinifera]
 emb|CAN62373.1| hypothetical protein VITISV_036477 [Vitis vinifera]
Length=204

 Score =   300 bits (768),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 161/213 (76%), Positives = 168/213 (79%), Gaps = 9/213 (4%)
 Frame = +3

Query  675   MAMAAQASLFASPLSaakpaadrvaaPWKQSLHCFSVVPRGLNKSTTAPCRPIRamaeet  854
             MAMA QASLF   LS  +        PWK S       P+ L KS+ AP   IRAMAEE 
Sbjct  1     MAMATQASLFTPTLSGDRVTV-----PWKSSSSLSFTTPK-LPKSSVAPRTTIRAMAEEA  54

Query  855   teaptkeaPVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTG  1034
                     PVGFTPP LDPNTPSPIFGGSTGGLLRKAQVEEFYVITW SPKEQIFEMPTG
Sbjct  55    PTKEA---PVGFTPPELDPNTPSPIFGGSTGGLLRKAQVEEFYVITWDSPKEQIFEMPTG  111

Query  1035  GAAIMREGANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKV  1214
             GAAIMR+G NLLKLARKEQCLALGTRLRSKYKI YQFYRVFPNGEVQYLHPKDGVYPEKV
Sbjct  112   GAAIMRQGPNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPNGEVQYLHPKDGVYPEKV  171

Query  1215  NAGREGVGQNMRSIGKNISPIEVKFTGKQVYDL  1313
             N GR+GVG N RSIGKN++PIEVKFTGKQ YDL
Sbjct  172   NPGRQGVGVNFRSIGKNVNPIEVKFTGKQAYDL  204



>ref|XP_009344083.1| PREDICTED: photosystem I reaction center subunit II, chloroplastic-like 
[Pyrus x bretschneideri]
Length=210

 Score =   298 bits (764),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 167/211 (79%), Positives = 174/211 (82%), Gaps = 1/211 (0%)
 Frame = +3

Query  681   MAAQASLFASPLSaakpaadrvaaPWKQSLHCFSVVPRGLNKSTTAPCRPIRamaeette  860
             MA QASLF    SA K  ADR  APW+QS+    +  + L  ST    R I A AEE T 
Sbjct  1     MATQASLFTPTPSAPKTPADRTTAPWRQSVFSSFMALKPLKLSTARTVR-INASAEEKTV  59

Query  861   aptkeaPVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGA  1040
              PTKEAPVGFTPP LDP TPSPIFGGSTGGLLRKAQ EEFYVITW SPKEQIFEMPTGGA
Sbjct  60    TPTKEAPVGFTPPELDPTTPSPIFGGSTGGLLRKAQEEEFYVITWESPKEQIFEMPTGGA  119

Query  1041  AIMREGANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNA  1220
             AIMREG NLLKLARKEQCLALGTRLRSKYKI YQFYRVFPNGEVQYLHPKDGVYPEKVN 
Sbjct  120   AIMREGPNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPNGEVQYLHPKDGVYPEKVNP  179

Query  1221  GREGVGQNMRSIGKNISPIEVKFTGKQVYDL  1313
             GR+GVGQN RSIGKN+SPIEVKFTGKQVYD+
Sbjct  180   GRQGVGQNFRSIGKNVSPIEVKFTGKQVYDI  210



>ref|XP_002315779.1| photosystem I 20kD family protein [Populus trichocarpa]
 gb|ABK95430.1| unknown [Populus trichocarpa]
 gb|ABK95668.1| unknown [Populus trichocarpa]
 gb|EEF01950.1| photosystem I 20kD family protein [Populus trichocarpa]
Length=201

 Score =   297 bits (761),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 153/213 (72%), Positives = 166/213 (78%), Gaps = 14/213 (7%)
 Frame = +3

Query  681   MAAQASLFASPLSaakpaadrvaaPWKQS--LHCFSVVPRGLNKSTTAPCRPIRamaeet  854
             MAAQASLF  P  +   ++++   PWKQ+  L   +V P+   K   A    ++      
Sbjct  1     MAAQASLFTPPTLSTLKSSNQAFVPWKQASFLPISNVKPQRTMKVAAAEETAVKEA----  56

Query  855   teaptkeaPVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTG  1034
                     PVGFTPP LDP+TPSPIFGGSTGGLLRKAQVEEFYVITW SPKEQIFEMPTG
Sbjct  57    --------PVGFTPPELDPSTPSPIFGGSTGGLLRKAQVEEFYVITWDSPKEQIFEMPTG  108

Query  1035  GAAIMREGANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKV  1214
             GAAIMREG NLLKLARKEQCLALGTRLRSKYKI YQFYRVFPNGEVQYLHPKDGVYPEKV
Sbjct  109   GAAIMREGPNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPNGEVQYLHPKDGVYPEKV  168

Query  1215  NAGREGVGQNMRSIGKNISPIEVKFTGKQVYDL  1313
             N GR+GVGQN RSIGKN+SPIEVKFTGKQ YDL
Sbjct  169   NPGRQGVGQNFRSIGKNVSPIEVKFTGKQAYDL  201



>emb|CDO99040.1| unnamed protein product [Coffea canephora]
Length=205

 Score =   298 bits (762),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 160/213 (75%), Positives = 169/213 (79%), Gaps = 8/213 (4%)
 Frame = +3

Query  675   MAMAAQASLFASPLSaakpaadrvaaPWKQSLHCFSVVPRGLNKSTTAPCRPIRamaeet  854
             MAMA QASLF   LS+          PWKQS       P+ +   T    R IRAMAEE 
Sbjct  1     MAMATQASLFTPTLSSPSDRVTV---PWKQSSLVAFASPKPIK--TNMATRTIRAMAEEA  55

Query  855   teaptkeaPVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTG  1034
             + A     P GFTPP LDPNTPSPIF GSTGGLLRKAQVEEFYVITW SPKEQIFEMPTG
Sbjct  56    STAAA---PAGFTPPQLDPNTPSPIFAGSTGGLLRKAQVEEFYVITWDSPKEQIFEMPTG  112

Query  1035  GAAIMREGANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKV  1214
             GAAIMR+G NLLKLARKEQCLALGTRLRSKYKI+YQFYRVFPNGEVQYLHPKDGVYPEKV
Sbjct  113   GAAIMRQGPNLLKLARKEQCLALGTRLRSKYKISYQFYRVFPNGEVQYLHPKDGVYPEKV  172

Query  1215  NAGREGVGQNMRSIGKNISPIEVKFTGKQVYDL  1313
             N GR+GVG N+RSIGKNISPIEVKFTGKQVY+L
Sbjct  173   NPGRQGVGLNLRSIGKNISPIEVKFTGKQVYEL  205



>ref|XP_003610706.1| Photosystem I reaction center subunit II [Medicago truncatula]
 gb|AES93664.1| photosystem I reaction center subunit II [Medicago truncatula]
 gb|AFK47938.1| unknown [Medicago truncatula]
Length=209

 Score =   297 bits (761),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 159/217 (73%), Positives = 168/217 (77%), Gaps = 12/217 (6%)
 Frame = +3

Query  675   MAMAAQASLFASPLSaakpaadrvaaPWKQ--SLHCFSVVPRGLNKSTT--APCRPIRam  842
             MAMA QASLF  PLS+ K        PWKQ  +L   S+ P      TT  +        
Sbjct  1     MAMATQASLFTPPLSSPK--------PWKQPSTLSFISLKPIKFTTKTTKISAADEKTEA  52

Query  843   aeetteaptkeaPVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFE  1022
             A  TT+     APVGFTPP LDPNTPSPIFGGSTGGLLRKAQVEEFYVITW SPKEQIFE
Sbjct  53    ASVTTKEEAPAAPVGFTPPELDPNTPSPIFGGSTGGLLRKAQVEEFYVITWESPKEQIFE  112

Query  1023  MPTGGAAIMREGANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVY  1202
             MPTGGAAIMREG NLLKLARKEQCLALG RLRSKYKI YQFYRVFPNGEVQYLHPKDGVY
Sbjct  113   MPTGGAAIMREGPNLLKLARKEQCLALGNRLRSKYKIKYQFYRVFPNGEVQYLHPKDGVY  172

Query  1203  PEKVNAGREGVGQNMRSIGKNISPIEVKFTGKQVYDL  1313
             PEKVN GR+GVGQN RSIGKN+SPIEVKFTGKQ +D+
Sbjct  173   PEKVNPGRQGVGQNFRSIGKNVSPIEVKFTGKQPFDV  209



>emb|CDY21916.1| BnaC09g00220D [Brassica napus]
Length=281

 Score =   300 bits (767),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 160/219 (73%), Positives = 172/219 (79%), Gaps = 17/219 (8%)
 Frame = +3

Query  681   MAAQAS-LFASPLSaakpaadrvaaPWKQSLHCFSVVPRGLNKSTTAPCRPIRamaeett  857
             MAAQAS LF+S ++ A  +         + LH F+   R   +S + P   IRA   ++ 
Sbjct  1     MAAQASGLFSSAVTTAATSGV-------KKLHLFTTTHRP--RSLSFPKTAIRAEKTDSA  51

Query  858   eap-------tkeaPVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQI  1016
              A         +EAPVGFTPP LDPNTPSPIF GSTGGLLRKAQVEEFYVITW SPKEQI
Sbjct  52    AAAAAPAAAVKEEAPVGFTPPQLDPNTPSPIFAGSTGGLLRKAQVEEFYVITWNSPKEQI  111

Query  1017  FEMPTGGAAIMREGANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDG  1196
             FEMPTGGAAIMREG NLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDG
Sbjct  112   FEMPTGGAAIMREGPNLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDG  171

Query  1197  VYPEKVNAGREGVGQNMRSIGKNISPIEVKFTGKQVYDL  1313
             VYPEK NAGREGVGQNMRSIGKN+SPIEVKFTGKQ YDL
Sbjct  172   VYPEKANAGREGVGQNMRSIGKNVSPIEVKFTGKQSYDL  210



>ref|XP_004511355.1| PREDICTED: photosystem I reaction center subunit II, chloroplastic-like 
[Cicer arietinum]
Length=215

 Score =   296 bits (759),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 159/223 (71%), Positives = 168/223 (75%), Gaps = 18/223 (8%)
 Frame = +3

Query  675   MAMAAQASLFASPLSaakpaadrvaaPWKQSLHCFSVVPRGLNKSTTAPCRPIRamaeet  854
             MAMA QASLF  PLS  K        PWKQ      +  + +  +T +P   IR  A   
Sbjct  1     MAMATQASLFTPPLSTPK--------PWKQPSTLSFITLKPIKFTTASPRTTIRTAASAD  52

Query  855   teapt----------keaPVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSP  1004
              +  T            APVGFTPP LDPNTPSPIFGGSTGGLLRKAQVEEFYVITW SP
Sbjct  53    DKTETPVKTEKAPAPAPAPVGFTPPELDPNTPSPIFGGSTGGLLRKAQVEEFYVITWDSP  112

Query  1005  KEQIFEMPTGGAAIMREGANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLH  1184
             KEQIFEMPTGGAAIMREG NLLKLARKEQCLALGTRLRSKYKI YQFYRVFPNGEVQYLH
Sbjct  113   KEQIFEMPTGGAAIMREGPNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPNGEVQYLH  172

Query  1185  PKDGVYPEKVNAGREGVGQNMRSIGKNISPIEVKFTGKQVYDL  1313
             PKDGVYPEKVN GREGVGQN RSIGKN++PIEVKFTGKQ YD+
Sbjct  173   PKDGVYPEKVNPGREGVGQNFRSIGKNVNPIEVKFTGKQPYDV  215



>gb|AFK43504.1| unknown [Lotus japonicus]
Length=210

 Score =   296 bits (758),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 160/228 (70%), Positives = 169/228 (74%), Gaps = 33/228 (14%)
 Frame = +3

Query  675   MAMAAQASLFASPLSaakpaadrvaaPWKQS--LHCFSVVP-------------RGLNKS  809
             MAMA QASLF+ PLS    A      PWKQS  L   +  P             R  ++ 
Sbjct  1     MAMATQASLFSPPLSGRVSA------PWKQSPTLSFTNTKPLKFTTSPRTTTTIRAADEK  54

Query  810   TTAPCRPIRamaeetteaptkeaPVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVI  989
             T AP             A  + APVGFTPP LDPNTPSPIFGGSTGGLLRKAQVEEFYVI
Sbjct  55    TEAPV------------ATKEAAPVGFTPPELDPNTPSPIFGGSTGGLLRKAQVEEFYVI  102

Query  990   TWTSPKEQIFEMPTGGAAIMREGANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGE  1169
             TW SPKEQIFEMPTGGAAIMREG NLLKLARKEQCLALGTRLRSKYKI YQFYRVFPNGE
Sbjct  103   TWESPKEQIFEMPTGGAAIMREGPNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPNGE  162

Query  1170  VQYLHPKDGVYPEKVNAGREGVGQNMRSIGKNISPIEVKFTGKQVYDL  1313
             VQYLHPKDGVYPEKVN GR+GVGQN RSIGKN+SPIEVKFTG+Q YD+
Sbjct  163   VQYLHPKDGVYPEKVNPGRQGVGQNFRSIGKNVSPIEVKFTGRQPYDV  210



>ref|XP_010935005.1| PREDICTED: photosystem I reaction center subunit II, chloroplastic-like 
[Elaeis guineensis]
Length=210

 Score =   296 bits (758),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 157/215 (73%), Positives = 167/215 (78%), Gaps = 7/215 (3%)
 Frame = +3

Query  675   MAMAAQASLFASPL--SaakpaadrvaaPWKQSLHCFSVVPRGLNKSTTAPCRPIRamae  848
             MAMA QASLF  P   ++   A    A PW  S   F+  PR L  ST  P     A  +
Sbjct  1     MAMATQASLFTPPTLSASKPAAPRSAAIPWTNS--PFAATPRPLTLSTNTPRN---ATFK  55

Query  849   etteaptkeaPVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMP  1028
              +      EAP GFTPP LDPNTPSPIFGGSTGGLLRKAQVEEFYVITW SPKEQIFEMP
Sbjct  56    VSATEEKTEAPAGFTPPQLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWDSPKEQIFEMP  115

Query  1029  TGGAAIMREGANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPE  1208
             TGGAAIMR+G NLLKLARKEQCLALGTRLRSKYKI YQFYRVFPNGEVQYLHPKDGVYPE
Sbjct  116   TGGAAIMRQGPNLLKLARKEQCLALGTRLRSKYKIQYQFYRVFPNGEVQYLHPKDGVYPE  175

Query  1209  KVNAGREGVGQNMRSIGKNISPIEVKFTGKQVYDL  1313
             KVN GR+GVG N RSIGKN+SPIEVKFTGK+V+DL
Sbjct  176   KVNPGRQGVGLNFRSIGKNVSPIEVKFTGKRVFDL  210



>ref|XP_004134141.1| PREDICTED: photosystem I reaction center subunit II, chloroplastic 
[Cucumis sativus]
 sp|P32869.1|PSAD_CUCSA RecName: Full=Photosystem I reaction center subunit II, chloroplastic; 
AltName: Full=PS I subunit 5; AltName: Full=Photosystem 
I 20 kDa subunit; Short=PSI-D; Flags: Precursor [Cucumis 
sativus]
 gb|KGN56995.1| hypothetical protein Csa_3G147780 [Cucumis sativus]
 prf||1710320A photosystem I 20kD protein
Length=207

 Score =   296 bits (757),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 154/213 (72%), Positives = 166/213 (78%), Gaps = 6/213 (3%)
 Frame = +3

Query  675   MAMAAQASLFASPLSaakpaadrvaaPWKQSLHCFSVVPRGLNKSTTAPCRPIRamaeet  854
             MAMA QA+LF   LS  K     +  PWKQS     +  +   K+ ++     R+     
Sbjct  1     MAMATQATLFTPSLSTPKSTGISI--PWKQSSTLSFLTSKPHLKAASSS----RSFKVSA  54

Query  855   teaptkeaPVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTG  1034
                 + EAP GF+PP LDP+TPSPIF GSTGGLLRKAQVEEFYVITW SPKEQIFEMPTG
Sbjct  55    EAETSVEAPAGFSPPELDPSTPSPIFAGSTGGLLRKAQVEEFYVITWESPKEQIFEMPTG  114

Query  1035  GAAIMREGANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKV  1214
             GAAIMREG NLLKLARKEQCLALGTRLRSKYKI YQFYRVFPNGEVQYLHPKDGVYPEKV
Sbjct  115   GAAIMREGPNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPNGEVQYLHPKDGVYPEKV  174

Query  1215  NAGREGVGQNMRSIGKNISPIEVKFTGKQVYDL  1313
             N GREGVGQN RSIGKN+SPIEVKFTGKQVYDL
Sbjct  175   NPGREGVGQNFRSIGKNVSPIEVKFTGKQVYDL  207



>ref|XP_011026306.1| PREDICTED: photosystem I reaction center subunit II, chloroplastic-like 
[Populus euphratica]
Length=203

 Score =   295 bits (756),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 156/213 (73%), Positives = 164/213 (77%), Gaps = 10/213 (5%)
 Frame = +3

Query  675   MAMAAQASLFASPLSaakpaadrvaaPWKQSLHCFSVVPRGLNKSTTAPCRPIRamaeet  854
             MAMA QASLF     +   ++++   PWKQS          L  S     R  +  A E 
Sbjct  1     MAMATQASLFTPTTLSTLKSSNQTIVPWKQSTF--------LPISNVKAQRSFKVAAAEE  52

Query  855   teaptkeaPVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTG  1034
             T       PVGFTPP LDP+TPSPIFGGSTGGLLRKAQVEEFYVITW SPKEQIFEMPTG
Sbjct  53    TATKEA--PVGFTPPELDPSTPSPIFGGSTGGLLRKAQVEEFYVITWDSPKEQIFEMPTG  110

Query  1035  GAAIMREGANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKV  1214
             GAAIMREG NLLKLARKEQCLALGTRLRSKYKI YQFYRVFPNGEVQYLHPKDGVYPEKV
Sbjct  111   GAAIMREGPNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPNGEVQYLHPKDGVYPEKV  170

Query  1215  NAGREGVGQNMRSIGKNISPIEVKFTGKQVYDL  1313
             N GR+GVGQN RSIGKN SPIEVKFTGKQVYDL
Sbjct  171   NPGRQGVGQNFRSIGKNASPIEVKFTGKQVYDL  203



>ref|XP_010108011.1| Photosystem I reaction center subunit II [Morus notabilis]
 gb|EXC17576.1| Photosystem I reaction center subunit II [Morus notabilis]
Length=215

 Score =   295 bits (756),  Expect = 9e-94, Method: Compositional matrix adjust.
 Identities = 164/215 (76%), Positives = 175/215 (81%), Gaps = 2/215 (1%)
 Frame = +3

Query  675   MAMAAQASLFASPLSaakpaadrvaaPWKQSLHCFSVVPR--GLNKSTTAPCRPIRamae  848
             MA  A  +LF   LSA K     VA  WKQSL      P+   L++ ++     +RA AE
Sbjct  1     MATQATTTLFTPTLSAPKAGDRGVAVTWKQSLTSSFTTPKPFKLSRPSSGSSTIVRAAAE  60

Query  849   etteaptkeaPVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMP  1028
             E T+APTKEAPVGFTPP LDPNTPSPIFGGSTGGLLRKAQVEEFYVITW SPKEQIFEM 
Sbjct  61    EATKAPTKEAPVGFTPPELDPNTPSPIFGGSTGGLLRKAQVEEFYVITWDSPKEQIFEMV  120

Query  1029  TGGAAIMREGANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPE  1208
             TGGAAIMR+G NLLKLARKEQCLALGTRLRSKYKI YQFYRVFPNGEVQYLHPKDGVYPE
Sbjct  121   TGGAAIMRQGPNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPNGEVQYLHPKDGVYPE  180

Query  1209  KVNAGREGVGQNMRSIGKNISPIEVKFTGKQVYDL  1313
             KVN GR+GVGQN RSIGKN+SPIEVKFTGKQ YDL
Sbjct  181   KVNPGRQGVGQNFRSIGKNVSPIEVKFTGKQPYDL  215



>ref|XP_007050585.1| Photosystem I subunit D-2 [Theobroma cacao]
 gb|EOX94742.1| Photosystem I subunit D-2 [Theobroma cacao]
Length=204

 Score =   295 bits (754),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 157/211 (74%), Positives = 166/211 (79%), Gaps = 7/211 (3%)
 Frame = +3

Query  681   MAAQASLFASPLSaakpaadrvaaPWKQSLHCFSVVPRGLNKSTTAPCRPIRamaeette  860
             MA QA LF   +S  K        PWK S       P+ LN S       IRA A +   
Sbjct  1     MATQAGLFTPTISTPKSLV-----PWKPSWSFSFATPKSLNLSMAHST--IRAAAADQEA  53

Query  861   aptkeaPVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGA  1040
             A  +EAPVGFTPP LDPNTPSP+F GSTGGLLRKAQVEEFYVITW SP+EQIFEMPTGGA
Sbjct  54    ATKEEAPVGFTPPELDPNTPSPMFSGSTGGLLRKAQVEEFYVITWDSPREQIFEMPTGGA  113

Query  1041  AIMREGANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNA  1220
             AIMR+G NLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVN 
Sbjct  114   AIMRQGPNLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNP  173

Query  1221  GREGVGQNMRSIGKNISPIEVKFTGKQVYDL  1313
             GR+GVGQN RSIGKN+SPIEVKFTGKQVYDL
Sbjct  174   GRQGVGQNFRSIGKNVSPIEVKFTGKQVYDL  204



>ref|XP_010256006.1| PREDICTED: photosystem I reaction center subunit II, chloroplastic 
[Nelumbo nucifera]
Length=212

 Score =   295 bits (754),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 162/215 (75%), Positives = 168/215 (78%), Gaps = 5/215 (2%)
 Frame = +3

Query  675   MAMAAQASLFASPLSaakpaadrvaaPWK-QSLHCFSVVPRGLNKSTTAPCRPIRamaee  851
             MAMA QA LF   LS        +  PWK  S     + PR LN S     R IRA A +
Sbjct  1     MAMATQAGLFTPTLSTPNSGNRALV-PWKPSSSSLSFLSPRPLNLSLAH--RTIRASAAD  57

Query  852   tteapt-keaPVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMP  1028
                     EAPVGFTPP LDPNTPSPIFGGSTGGLLRKAQVEEFYVITW SPKEQIFEMP
Sbjct  58    GKTEAPPAEAPVGFTPPELDPNTPSPIFGGSTGGLLRKAQVEEFYVITWDSPKEQIFEMP  117

Query  1029  TGGAAIMREGANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPE  1208
             TGGAAIMR+G NLLKLARKEQCLALGTRLRSKYKI YQFYRVFPNGEVQYLHPKDGVYPE
Sbjct  118   TGGAAIMRQGPNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPNGEVQYLHPKDGVYPE  177

Query  1209  KVNAGREGVGQNMRSIGKNISPIEVKFTGKQVYDL  1313
             KVN GR+GVGQN RSIGKN+SPIEVKFTGKQVYDL
Sbjct  178   KVNPGRQGVGQNFRSIGKNVSPIEVKFTGKQVYDL  212



>ref|XP_002311618.2| photosystem I 20kD family protein [Populus trichocarpa]
 gb|EEE88985.2| photosystem I 20kD family protein [Populus trichocarpa]
Length=204

 Score =   294 bits (753),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 157/213 (74%), Positives = 167/213 (78%), Gaps = 9/213 (4%)
 Frame = +3

Query  675   MAMAAQASLFASPLSaakpaadrvaaPWKQSLHCFSVVPRGLNKSTTAPCRPIRamaeet  854
             MAMA QASLF     +   ++++   PWKQS    S +P     S     R  +  A E 
Sbjct  1     MAMATQASLFTPTTLSTLKSSNQTIVPWKQS----SFLPI----SNVKAQRSFKVAAVEG  52

Query  855   teaptkeaPVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTG  1034
               A  +  PVGFTPP LDP+TPSPIFGGSTGGLLRKAQVEEFYVITW SPKEQIFEMPTG
Sbjct  53    KTATKEA-PVGFTPPELDPSTPSPIFGGSTGGLLRKAQVEEFYVITWDSPKEQIFEMPTG  111

Query  1035  GAAIMREGANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKV  1214
             GAAIMREG NLLKLARKEQCLALGTRLRSKYKI YQFYRVFPNGEVQYLHPKDGVYPEKV
Sbjct  112   GAAIMREGPNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPNGEVQYLHPKDGVYPEKV  171

Query  1215  NAGREGVGQNMRSIGKNISPIEVKFTGKQVYDL  1313
             N GR+GVGQN RSIGKN SPIEVKFTGKQVYDL
Sbjct  172   NPGRQGVGQNFRSIGKNASPIEVKFTGKQVYDL  204



>ref|XP_009111256.1| PREDICTED: photosystem I reaction center subunit II-1, chloroplastic 
[Brassica rapa]
Length=208

 Score =   294 bits (753),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 160/217 (74%), Positives = 172/217 (79%), Gaps = 15/217 (7%)
 Frame = +3

Query  681   MAAQAS-LFASPLSaakpaadrvaaPWKQSLHCFSVVPRGLNKSTTAPCRPIRamaeett  857
             MAAQAS LF+S ++ A  +         + LH F+   R   +S + P   IRA   ++ 
Sbjct  1     MAAQASGLFSSAVTTAATSGV-------KKLHLFTTSHR--PRSLSFPKTAIRAEKADSA  51

Query  858   eap-----tkeaPVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFE  1022
              A       +EAPVGFTPP LDPNTPSPIF GSTGGLLRKAQVEEFYVITW SPKEQIFE
Sbjct  52    AAAPAAAVKEEAPVGFTPPQLDPNTPSPIFAGSTGGLLRKAQVEEFYVITWNSPKEQIFE  111

Query  1023  MPTGGAAIMREGANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVY  1202
             MPTGGAAIMREG NLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVY
Sbjct  112   MPTGGAAIMREGPNLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVY  171

Query  1203  PEKVNAGREGVGQNMRSIGKNISPIEVKFTGKQVYDL  1313
             PEK NAGREGVGQNMRSIGKN+SPIEVKFTGKQ YDL
Sbjct  172   PEKANAGREGVGQNMRSIGKNVSPIEVKFTGKQSYDL  208



>ref|XP_009396832.1| PREDICTED: photosystem I reaction center subunit II, chloroplastic-like 
[Musa acuminata subsp. malaccensis]
Length=259

 Score =   296 bits (757),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 160/224 (71%), Positives = 175/224 (78%), Gaps = 12/224 (5%)
 Frame = +3

Query  651   LASTFFISMAMAAQASLFASP--LSaakpaadrvaaPWKQS-LHCFSVVPRGLNKSTTAP  821
             ++S    SMA + QASLF  P  L ++KP+A R   PWK + L   ++  RG +      
Sbjct  45    VSSFITTSMATSPQASLFTPPAALPSSKPSAPRSLLPWKHTPLTAGAMSLRGAS------  98

Query  822   CRPIRamaeetteaptkeaPVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTS  1001
                 R  A E       EAP GFTPP LDP+TPSPIFGGSTGGLLRKAQVEEFYVITW S
Sbjct  99    ---FRVSATEEKTEAAPEAPAGFTPPQLDPSTPSPIFGGSTGGLLRKAQVEEFYVITWDS  155

Query  1002  PKEQIFEMPTGGAAIMREGANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYL  1181
             PKEQ+FEMPTGGAAIMR+G NLLKLARKEQCLALGTRLRSKYKI YQFYRVFPNGEVQYL
Sbjct  156   PKEQVFEMPTGGAAIMRQGPNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPNGEVQYL  215

Query  1182  HPKDGVYPEKVNAGREGVGQNMRSIGKNISPIEVKFTGKQVYDL  1313
             HPKDGVYPEKVN GR+GVGQNMRSIGKN+SPIEVKFTGKQVYDL
Sbjct  216   HPKDGVYPEKVNPGRQGVGQNMRSIGKNVSPIEVKFTGKQVYDL  259



>ref|XP_010474926.1| PREDICTED: photosystem I reaction center subunit II-2, chloroplastic 
[Camelina sativa]
Length=207

 Score =   294 bits (752),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 148/187 (79%), Positives = 156/187 (83%), Gaps = 3/187 (2%)
 Frame = +3

Query  762   QSLHCFSVV--PRGLNKSTTA-PCRPIRamaeetteaptkeaPVGFTPPTLDPNTPSPIF  932
             + LH FS    P+ L+ + TA       + +     A  +EAPVGFTPP LDPNTPSPIF
Sbjct  21    KKLHLFSTSHRPKSLSYTKTAIRAEKTDSSSAAPATAVKEEAPVGFTPPQLDPNTPSPIF  80

Query  933   GGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLARKEQCLALGTR  1112
              GSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREG NLLKLARKEQCLALGTR
Sbjct  81    AGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGPNLLKLARKEQCLALGTR  140

Query  1113  LRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVGQNMRSIGKNISPIEVKFT  1292
             LRSKYKI YQFYRVFPNGEVQYLHPKDGVYPEK N GREGVGQNMRSIGKN+SPIEVKFT
Sbjct  141   LRSKYKIKYQFYRVFPNGEVQYLHPKDGVYPEKANPGREGVGQNMRSIGKNVSPIEVKFT  200

Query  1293  GKQVYDL  1313
             GKQ YDL
Sbjct  201   GKQSYDL  207



>ref|XP_008802683.1| PREDICTED: photosystem I reaction center subunit II, chloroplastic-like 
[Phoenix dactylifera]
Length=209

 Score =   294 bits (752),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 157/215 (73%), Positives = 166/215 (77%), Gaps = 8/215 (4%)
 Frame = +3

Query  675   MAMAAQASLFASPL--SaakpaadrvaaPWKQSLHCFSVVPRGLNKSTTAPCRPIRamae  848
             MAMA QASLF  P   ++   A    A PW +S   F+  PR L  S      P  A  +
Sbjct  1     MAMATQASLFTPPTLPASKPAAPRSAAIPWTKS--PFAASPRPLTLSIA----PRNATIK  54

Query  849   etteaptkeaPVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMP  1028
              +      EAP GFTPP LDPNTPSPIFGGSTGGLLRKAQVEEFYVITW SPKEQIFEMP
Sbjct  55    VSATEEKTEAPAGFTPPQLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWDSPKEQIFEMP  114

Query  1029  TGGAAIMREGANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPE  1208
             TGGAAIMR+G NLLKLARKEQCLALGTRLRSKYKI YQFYRVFPNGEVQYLHPKDGV+PE
Sbjct  115   TGGAAIMRQGPNLLKLARKEQCLALGTRLRSKYKITYQFYRVFPNGEVQYLHPKDGVFPE  174

Query  1209  KVNAGREGVGQNMRSIGKNISPIEVKFTGKQVYDL  1313
             KVN GR+GVG N RSIGKN SPIEVKFTGKQVYDL
Sbjct  175   KVNPGRQGVGVNFRSIGKNASPIEVKFTGKQVYDL  209



>ref|XP_011021547.1| PREDICTED: photosystem I reaction center subunit II, chloroplastic-like 
[Populus euphratica]
Length=201

 Score =   293 bits (751),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 157/211 (74%), Positives = 167/211 (79%), Gaps = 10/211 (5%)
 Frame = +3

Query  681   MAAQASLFASPLSaakpaadrvaaPWKQSLHCFSVVPRGLNKSTTAPCRPIRamaeette  860
             MA QASLF     +A  ++++  APWK  L  F      L  S   P R ++  A E T 
Sbjct  1     MATQASLFTPTALSALKSSNQAIAPWK--LSSF------LPISNVKPQRTMKVAAAEETA  52

Query  861   aptkeaPVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGA  1040
                   PVGFTPP LDP+TPSPIFGGSTGGLLRKAQVEEFYVITW SPKEQIFEMPTGGA
Sbjct  53    VKEA--PVGFTPPELDPSTPSPIFGGSTGGLLRKAQVEEFYVITWDSPKEQIFEMPTGGA  110

Query  1041  AIMREGANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNA  1220
             AIMREG NLLKLARKEQCLALGTRLRSKYKI YQFYRVFPNGEVQYLHPKDGVYPEKVN 
Sbjct  111   AIMREGPNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPNGEVQYLHPKDGVYPEKVNP  170

Query  1221  GREGVGQNMRSIGKNISPIEVKFTGKQVYDL  1313
             GR+GVGQN RSIGKN+SPIEVKFTGKQVYDL
Sbjct  171   GRQGVGQNFRSIGKNVSPIEVKFTGKQVYDL  201



>ref|XP_006306434.1| hypothetical protein CARUB_v10012376mg [Capsella rubella]
 gb|EOA39332.1| hypothetical protein CARUB_v10012376mg [Capsella rubella]
Length=206

 Score =   293 bits (750),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 147/187 (79%), Positives = 156/187 (83%), Gaps = 3/187 (2%)
 Frame = +3

Query  762   QSLHCFSVV--PRGLNKSTTA-PCRPIRamaeetteaptkeaPVGFTPPTLDPNTPSPIF  932
             + LH FS    P+ L+ + TA       + +     A  ++APVGFTPP LDPNTPSPIF
Sbjct  20    KKLHLFSTSHRPKSLSFTKTAIRAEKTDSSSGAPAAAVKEDAPVGFTPPQLDPNTPSPIF  79

Query  933   GGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLARKEQCLALGTR  1112
              GSTGGLLRKAQVEEFYVITW SPKEQIFEMPTGGAAIMREG NLLKLARKEQCLALGTR
Sbjct  80    AGSTGGLLRKAQVEEFYVITWNSPKEQIFEMPTGGAAIMREGPNLLKLARKEQCLALGTR  139

Query  1113  LRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVGQNMRSIGKNISPIEVKFT  1292
             LRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEK N GREGVGQNMRSIGKN+SPIEVKFT
Sbjct  140   LRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKANPGREGVGQNMRSIGKNVSPIEVKFT  199

Query  1293  GKQVYDL  1313
             GKQ YDL
Sbjct  200   GKQSYDL  206



>ref|XP_011015859.1| PREDICTED: photosystem I reaction center subunit II, chloroplastic-like 
[Populus euphratica]
Length=203

 Score =   292 bits (748),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 157/213 (74%), Positives = 167/213 (78%), Gaps = 10/213 (5%)
 Frame = +3

Query  675   MAMAAQASLFASPLSaakpaadrvaaPWKQSLHCFSVVPRGLNKSTTAPCRPIRamaeet  854
             MAMA QASLF     +   ++++   PWKQS    S +P    K+  +            
Sbjct  1     MAMATQASLFTPTTLSTLKSSNQTIVPWKQS----SFLPISNVKAQRS------FKVAAA  50

Query  855   teaptkeaPVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTG  1034
              E  TKEAPVGFTPP LDP+TPSPIFGGSTGGLLRKAQVEEFYVITW SPKEQIFEMPTG
Sbjct  51    EETATKEAPVGFTPPELDPSTPSPIFGGSTGGLLRKAQVEEFYVITWDSPKEQIFEMPTG  110

Query  1035  GAAIMREGANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKV  1214
             GAAIMREG NLLKLARKE CLALGTRLRSKYKI YQFYRVFPNGEVQYLHPKDGVYPEKV
Sbjct  111   GAAIMREGPNLLKLARKELCLALGTRLRSKYKIKYQFYRVFPNGEVQYLHPKDGVYPEKV  170

Query  1215  NAGREGVGQNMRSIGKNISPIEVKFTGKQVYDL  1313
             N GR+GVGQN RSIGKN SPIEVKFTGKQVYDL
Sbjct  171   NPGRQGVGQNFRSIGKNASPIEVKFTGKQVYDL  203



>ref|XP_008438687.1| PREDICTED: photosystem I reaction center subunit II, chloroplastic 
[Cucumis melo]
Length=207

 Score =   292 bits (748),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 156/213 (73%), Positives = 166/213 (78%), Gaps = 6/213 (3%)
 Frame = +3

Query  675   MAMAAQASLFASPLSaakpaadrvaaPWKQSLHCFSVVPRGLNKSTTAPCRPIRamaeet  854
             MAMA QA+LF   LS  K +A  +  PWKQS    S +    +  T +  R ++  AE  
Sbjct  1     MAMATQATLFTPSLSTPKSSAISI--PWKQS-PTLSFLTSKPHLKTASSSRSLKVSAEAE  57

Query  855   teaptkeaPVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTG  1034
                       GFTPP LDP+TPSPIF GSTGGLLRKAQVEEFYVITW SPKEQIFEMPTG
Sbjct  58    AAVEAP---AGFTPPELDPSTPSPIFAGSTGGLLRKAQVEEFYVITWESPKEQIFEMPTG  114

Query  1035  GAAIMREGANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKV  1214
             GAAIMREG NLLKLARKEQCLALGTRLRSKYKI YQFYRVFPNGEVQYLHPKDGVYPEKV
Sbjct  115   GAAIMREGPNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPNGEVQYLHPKDGVYPEKV  174

Query  1215  NAGREGVGQNMRSIGKNISPIEVKFTGKQVYDL  1313
             N GREGVGQN RSIGKN+SPIEVKFTGKQVYDL
Sbjct  175   NPGREGVGQNFRSIGKNVSPIEVKFTGKQVYDL  207



>ref|XP_006288687.1| hypothetical protein CARUB_v10001997mg [Capsella rubella]
 gb|EOA21585.1| hypothetical protein CARUB_v10001997mg [Capsella rubella]
Length=202

 Score =   292 bits (747),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 137/145 (94%), Positives = 138/145 (95%), Gaps = 0/145 (0%)
 Frame = +3

Query  879   PVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREG  1058
             PVGFTPP LDPNTPSPIF GSTGGLLRKAQVEEFYVITW SPKEQIFEMPTGGAAIMREG
Sbjct  58    PVGFTPPQLDPNTPSPIFAGSTGGLLRKAQVEEFYVITWNSPKEQIFEMPTGGAAIMREG  117

Query  1059  ANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVG  1238
              NLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEK N GREGVG
Sbjct  118   PNLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKANPGREGVG  177

Query  1239  QNMRSIGKNISPIEVKFTGKQVYDL  1313
             QNMRSIGKN+SPIEVKFTGKQ YDL
Sbjct  178   QNMRSIGKNVSPIEVKFTGKQSYDL  202



>gb|EPS62726.1| hypothetical protein M569_12065 [Genlisea aurea]
Length=196

 Score =   290 bits (742),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 157/214 (73%), Positives = 166/214 (78%), Gaps = 19/214 (9%)
 Frame = +3

Query  675   MAMAAQASLFASPLSaakpaadrvaaPWKQSLHCFSVVPRGLNK-STTAPCRPIRamaee  851
             MAMA Q +LFAS LS A          WKQ        PR L K S +   RP+  +   
Sbjct  1     MAMATQTTLFASTLSGA----------WKQP------SPRKLPKLSGSISHRPL--IRAM  42

Query  852   tteaptkeaPVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPT  1031
               EA       GFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITW SPKEQ+FEMPT
Sbjct  43    AEEAAVAAPAAGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWESPKEQVFEMPT  102

Query  1032  GGAAIMREGANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEK  1211
             GGAAIMREG NLLKLARKEQCLALGTRLRSKYKINY+FYRVFPNGEVQYLHP+DGVYPEK
Sbjct  103   GGAAIMREGPNLLKLARKEQCLALGTRLRSKYKINYRFYRVFPNGEVQYLHPRDGVYPEK  162

Query  1212  VNAGREGVGQNMRSIGKNISPIEVKFTGKQVYDL  1313
             VNAGR GVGQN RSIGKN+SPIEVKFTGKQ YD+
Sbjct  163   VNAGRTGVGQNFRSIGKNVSPIEVKFTGKQTYDV  196



>ref|XP_002892148.1| hypothetical protein ARALYDRAFT_887465 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH68407.1| hypothetical protein ARALYDRAFT_887465 [Arabidopsis lyrata subsp. 
lyrata]
Length=205

 Score =   290 bits (741),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 146/185 (79%), Positives = 152/185 (82%), Gaps = 1/185 (1%)
 Frame = +3

Query  762   QSLHCFSVVPRGLNKS-TTAPCRPIRamaeetteaptkeaPVGFTPPTLDPNTPSPIFGG  938
             + LH FS   R  + S T    R  +  +     A  +EAPVGFTPP LDPNTPSPIF G
Sbjct  21    KKLHLFSTSHRLKSLSFTKTAIRAEKTESSSAAPAVKEEAPVGFTPPQLDPNTPSPIFAG  80

Query  939   STGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLARKEQCLALGTRLR  1118
             STGGLLRKAQVEEFYVITW SPKEQIFEMPTGGAAIMREG NLLKLARKEQCLALGTRLR
Sbjct  81    STGGLLRKAQVEEFYVITWNSPKEQIFEMPTGGAAIMREGPNLLKLARKEQCLALGTRLR  140

Query  1119  SKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVGQNMRSIGKNISPIEVKFTGK  1298
             SKYKI YQFYRVFPNGEVQYLHPKDGVYPEK N GREGVG NMRSIGKN+SPIEVKFTGK
Sbjct  141   SKYKITYQFYRVFPNGEVQYLHPKDGVYPEKANPGREGVGLNMRSIGKNVSPIEVKFTGK  200

Query  1299  QVYDL  1313
             Q YDL
Sbjct  201   QSYDL  205



>ref|XP_010430302.1| PREDICTED: photosystem I reaction center subunit II-1, chloroplastic-like 
[Camelina sativa]
Length=213

 Score =   290 bits (742),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 136/145 (94%), Positives = 137/145 (94%), Gaps = 0/145 (0%)
 Frame = +3

Query  879   PVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREG  1058
             PVGFTPP LDPNTPSPIF GSTGGLLRKAQVEEFYVITW SPKEQIFEMPTGGAAIMREG
Sbjct  69    PVGFTPPELDPNTPSPIFAGSTGGLLRKAQVEEFYVITWNSPKEQIFEMPTGGAAIMREG  128

Query  1059  ANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVG  1238
              NLLKLARKEQCLALGTRLRSKYKI YQFYRVFPNGEVQYLHPKDGVYPEK N GREGVG
Sbjct  129   PNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPNGEVQYLHPKDGVYPEKANPGREGVG  188

Query  1239  QNMRSIGKNISPIEVKFTGKQVYDL  1313
             QNMRSIGKN+SPIEVKFTGKQ YDL
Sbjct  189   QNMRSIGKNVSPIEVKFTGKQSYDL  213



>ref|XP_010422538.1| PREDICTED: photosystem I reaction center subunit II-1, chloroplastic 
[Camelina sativa]
Length=210

 Score =   290 bits (741),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 136/145 (94%), Positives = 137/145 (94%), Gaps = 0/145 (0%)
 Frame = +3

Query  879   PVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREG  1058
             PVGFTPP LDPNTPSPIF GSTGGLLRKAQVEEFYVITW SPKEQIFEMPTGGAAIMREG
Sbjct  66    PVGFTPPELDPNTPSPIFAGSTGGLLRKAQVEEFYVITWNSPKEQIFEMPTGGAAIMREG  125

Query  1059  ANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVG  1238
              NLLKLARKEQCLALGTRLRSKYKI YQFYRVFPNGEVQYLHPKDGVYPEK N GREGVG
Sbjct  126   PNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPNGEVQYLHPKDGVYPEKANPGREGVG  185

Query  1239  QNMRSIGKNISPIEVKFTGKQVYDL  1313
             QNMRSIGKN+SPIEVKFTGKQ YDL
Sbjct  186   QNMRSIGKNVSPIEVKFTGKQSYDL  210



>ref|XP_010481602.1| PREDICTED: photosystem I reaction center subunit II-2, chloroplastic-like 
[Camelina sativa]
Length=206

 Score =   289 bits (740),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 136/144 (94%), Positives = 137/144 (95%), Gaps = 0/144 (0%)
 Frame = +3

Query  879   PVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREG  1058
             PVGFTPP LDPNTPSPIF GSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREG
Sbjct  63    PVGFTPPQLDPNTPSPIFAGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREG  122

Query  1059  ANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVG  1238
              NLLKLARKEQCLALGTRLRSKYKI YQFYRVFPNGEVQYLHPKDGVYPEK N GREGVG
Sbjct  123   PNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPNGEVQYLHPKDGVYPEKANPGREGVG  182

Query  1239  QNMRSIGKNISPIEVKFTGKQVYD  1310
             QNMRSIGKN+SPIEVKFTGKQ YD
Sbjct  183   QNMRSIGKNVSPIEVKFTGKQSYD  206



>gb|KJB23065.1| hypothetical protein B456_004G079200 [Gossypium raimondii]
Length=250

 Score =   291 bits (744),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 162/220 (74%), Positives = 173/220 (79%), Gaps = 8/220 (4%)
 Frame = +3

Query  660   TFFISMAMAAQASLFASPLSaakpaadrvaaPWKQSLHCFSVVPRGLNKSTTAPCRPIRa  839
             T  IS+ MA QA LF   ++ +K  A     PW  S       P+ +N S  A    +RA
Sbjct  37    TPIISIPMATQAGLFTPTITTSKSLA-----PWNPSSPFSLATPKSINFSM-AQRTSVRA  90

Query  840   maeetteap--tkeaPVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQ  1013
              A +   A   TKEAPVGFTPP LDPNTPSPIFGGSTGGLLRKAQVEEFYVITW SPKEQ
Sbjct  91    AAADEAAAAAATKEAPVGFTPPELDPNTPSPIFGGSTGGLLRKAQVEEFYVITWDSPKEQ  150

Query  1014  IFEMPTGGAAIMREGANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKD  1193
             IFEMPTGGAAIMR+G NLLKLARKEQCLALGTRLRSKYKI YQFYRVFPNGEVQYLHPKD
Sbjct  151   IFEMPTGGAAIMRQGPNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPNGEVQYLHPKD  210

Query  1194  GVYPEKVNAGREGVGQNMRSIGKNISPIEVKFTGKQVYDL  1313
             GVYPEKVN GR+GVGQN RSIGKN+SPIEVKFTGKQVYDL
Sbjct  211   GVYPEKVNPGRQGVGQNFRSIGKNVSPIEVKFTGKQVYDL  250



>ref|NP_171812.1| photosystem I reaction center subunit D-2 [Arabidopsis thaliana]
 sp|Q9SA56.1|PSAD2_ARATH RecName: Full=Photosystem I reaction center subunit II-2, chloroplastic; 
AltName: Full=Photosystem I 20 kDa subunit 2; Short=PSI-D2; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AAD25795.1|AC006550_3 Strong similarity to gb|X14017 photosystem I reaction centre 
subunit II precursor (psaD) from Spinacia oleracea. ESTs gb|R30423, 
gb|T42998, gb|Z18178, gb|T14133, gb|N65521, gb|T42498, 
gb|T41918, gb|N38024, gb|R65109, gb|T43849, gb|AA394388, 
gb|T20925 and gb|N65696 come from this gene [Arabidopsis thaliana]
 gb|AAG40059.1|AF324708_1 At1g03130 [Arabidopsis thaliana]
 gb|AAG48776.1|AF332413_1 putative photosystem I reaction center subunit II precursor [Arabidopsis 
thaliana]
 gb|AAK62620.1| At1g03130/F10O3_4 [Arabidopsis thaliana]
 gb|AAM63823.1| putative photosystem I reaction center subunit II precursor [Arabidopsis 
thaliana]
 gb|AAN38693.1| At1g03130/F10O3_4 [Arabidopsis thaliana]
 gb|AEE27534.1| photosystem I reaction center subunit D-2 [Arabidopsis thaliana]
Length=204

 Score =   289 bits (739),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 145/184 (79%), Positives = 149/184 (81%), Gaps = 0/184 (0%)
 Frame = +3

Query  762   QSLHCFSVVPRGLNKSTTAPCRPIRamaeetteaptkeaPVGFTPPTLDPNTPSPIFGGS  941
             + LH FS   R  + S T            +     KEAPVGFTPP LDPNTPSPIF GS
Sbjct  21    KKLHLFSSSHRPKSLSFTKTAIRAEKTESSSAAPAVKEAPVGFTPPQLDPNTPSPIFAGS  80

Query  942   TGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLARKEQCLALGTRLRS  1121
             TGGLLRKAQVEEFYVITW SPKEQIFEMPTGGAAIMREG NLLKLARKEQCLALGTRLRS
Sbjct  81    TGGLLRKAQVEEFYVITWNSPKEQIFEMPTGGAAIMREGPNLLKLARKEQCLALGTRLRS  140

Query  1122  KYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVGQNMRSIGKNISPIEVKFTGKQ  1301
             KYKI YQFYRVFPNGEVQYLHPKDGVYPEK N GREGVG NMRSIGKN+SPIEVKFTGKQ
Sbjct  141   KYKITYQFYRVFPNGEVQYLHPKDGVYPEKANPGREGVGLNMRSIGKNVSPIEVKFTGKQ  200

Query  1302  VYDL  1313
              YDL
Sbjct  201   SYDL  204



>ref|NP_001062511.1| Os08g0560900 [Oryza sativa Japonica Group]
 gb|AAO72568.1| chloroplast photosystem I reaction center subunit II precursor-like 
protein [Oryza sativa Japonica Group]
 dbj|BAD13214.1| putative photosystem I reaction center subunit II, chloroplast 
precursor (Photosystem I 20 kDa subunit) (PSI-D) [Oryza sativa 
Japonica Group]
 dbj|BAF24425.1| Os08g0560900 [Oryza sativa Japonica Group]
 gb|EAZ08015.1| hypothetical protein OsI_30281 [Oryza sativa Indica Group]
 gb|EAZ43663.1| hypothetical protein OsJ_28289 [Oryza sativa Japonica Group]
 dbj|BAG88105.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG99984.1| unnamed protein product [Oryza sativa Japonica Group]
Length=203

 Score =   288 bits (737),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 134/145 (92%), Positives = 139/145 (96%), Gaps = 0/145 (0%)
 Frame = +3

Query  879   PVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREG  1058
             P GF PP LDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQ+FEMPTGGAAIMREG
Sbjct  59    PAGFVPPQLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQVFEMPTGGAAIMREG  118

Query  1059  ANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVG  1238
              NLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNAGR+GVG
Sbjct  119   PNLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNAGRQGVG  178

Query  1239  QNMRSIGKNISPIEVKFTGKQVYDL  1313
             QN RSIGKN+SPIEVKFTGK V+D+
Sbjct  179   QNFRSIGKNVSPIEVKFTGKNVFDI  203



>gb|KFK42673.1| hypothetical protein AALP_AA1G025000 [Arabis alpina]
Length=204

 Score =   288 bits (737),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 135/145 (93%), Positives = 136/145 (94%), Gaps = 0/145 (0%)
 Frame = +3

Query  879   PVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREG  1058
             PVGFTPP LDPNTPSPIF GSTGGLLRKAQVEEFYVITW SPKEQIFEMPTGGAAIMREG
Sbjct  60    PVGFTPPQLDPNTPSPIFAGSTGGLLRKAQVEEFYVITWNSPKEQIFEMPTGGAAIMREG  119

Query  1059  ANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVG  1238
              NLLKLARKEQCLALGTRLRSKYKI YQFYRVFPNGEVQYLHPKDGVYPEK N GREGVG
Sbjct  120   PNLLKLARKEQCLALGTRLRSKYKITYQFYRVFPNGEVQYLHPKDGVYPEKANPGREGVG  179

Query  1239  QNMRSIGKNISPIEVKFTGKQVYDL  1313
              NMRSIGKN+SPIEVKFTGKQ YDL
Sbjct  180   LNMRSIGKNVSPIEVKFTGKQSYDL  204



>ref|XP_007034724.1| Photosystem I subunit D-2 [Theobroma cacao]
 gb|EOY05650.1| Photosystem I subunit D-2 [Theobroma cacao]
Length=210

 Score =   288 bits (737),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 161/213 (76%), Positives = 172/213 (81%), Gaps = 3/213 (1%)
 Frame = +3

Query  675   MAMAAQASLFASPLSaakpaadrvaaPWKQSLHCFSVVPRGLNKSTTAPCRPIRamaeet  854
             MAMA Q SLF     +A  ++DRVA PWKQ+   F  +P        AP       AEE 
Sbjct  1     MAMATQTSLFTPATLSAPKSSDRVAVPWKQA--SFVTLP-SFKSQKFAPRTIKAEAAEEK  57

Query  855   teaptkeaPVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTG  1034
              E  TKEAPVGFTPP LDP+TPSPIF GSTGGLLRKAQVEEFYVITW SPKEQIFEMPTG
Sbjct  58    AETATKEAPVGFTPPELDPSTPSPIFAGSTGGLLRKAQVEEFYVITWDSPKEQIFEMPTG  117

Query  1035  GAAIMREGANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKV  1214
             GAAIMR+G NLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKV
Sbjct  118   GAAIMRQGPNLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKV  177

Query  1215  NAGREGVGQNMRSIGKNISPIEVKFTGKQVYDL  1313
             N GR+GVG N R+IGKN++PIEVKFTGKQVYDL
Sbjct  178   NPGRQGVGLNFRNIGKNVNPIEVKFTGKQVYDL  210



>ref|XP_006838247.1| PREDICTED: photosystem I reaction center subunit II, chloroplastic 
[Amborella trichopoda]
 gb|ERN00816.1| hypothetical protein AMTR_s00103p00041210 [Amborella trichopoda]
Length=202

 Score =   288 bits (736),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 136/145 (94%), Positives = 139/145 (96%), Gaps = 0/145 (0%)
 Frame = +3

Query  879   PVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREG  1058
             PVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITW SPKEQIFEMPTGGAAIMREG
Sbjct  58    PVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWDSPKEQIFEMPTGGAAIMREG  117

Query  1059  ANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVG  1238
              NLLKLARKEQCLALGTRLRSKYKI YQFYRVFPNGEVQYLHPKDGVYPEKVN GR+GVG
Sbjct  118   PNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPNGEVQYLHPKDGVYPEKVNPGRQGVG  177

Query  1239  QNMRSIGKNISPIEVKFTGKQVYDL  1313
              N RS+GKNISPIEVKFTGKQVYD+
Sbjct  178   LNFRSVGKNISPIEVKFTGKQVYDV  202



>ref|XP_010474916.1| PREDICTED: photosystem I reaction center subunit II-2, chloroplastic-like 
isoform X1 [Camelina sativa]
Length=247

 Score =   289 bits (740),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 135/145 (93%), Positives = 136/145 (94%), Gaps = 0/145 (0%)
 Frame = +3

Query  879   PVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREG  1058
             PVGFTPP LDPNTPSPIF GSTGGLLRKAQVEEFYVITW SPKEQIFEMPTGGAAIMRE 
Sbjct  103   PVGFTPPQLDPNTPSPIFAGSTGGLLRKAQVEEFYVITWNSPKEQIFEMPTGGAAIMRER  162

Query  1059  ANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVG  1238
              NLLKLARKEQCLALGTRLRSKYKI YQFYRVFPNGEVQYLHPKDGVYPEK N GREGVG
Sbjct  163   PNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPNGEVQYLHPKDGVYPEKANPGREGVG  222

Query  1239  QNMRSIGKNISPIEVKFTGKQVYDL  1313
             QNMRSIGKN+SPIEVKFTGKQ YDL
Sbjct  223   QNMRSIGKNVSPIEVKFTGKQSYDL  247



>ref|XP_010522735.1| PREDICTED: photosystem I reaction center subunit II-2, chloroplastic 
[Tarenaya hassleriana]
Length=207

 Score =   287 bits (735),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 136/144 (94%), Positives = 137/144 (95%), Gaps = 0/144 (0%)
 Frame = +3

Query  882   VGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGA  1061
             VGFTPP LDPNTPSPIF GSTGGLLRKAQVEEFYVITW SPKEQIFEMPTGGAAIMREG 
Sbjct  64    VGFTPPQLDPNTPSPIFAGSTGGLLRKAQVEEFYVITWNSPKEQIFEMPTGGAAIMREGP  123

Query  1062  NLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVGQ  1241
             NLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEK N GR+GVGQ
Sbjct  124   NLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKANPGRQGVGQ  183

Query  1242  NMRSIGKNISPIEVKFTGKQVYDL  1313
             NMRSIGKN SPIEVKFTGKQVYDL
Sbjct  184   NMRSIGKNASPIEVKFTGKQVYDL  207



>gb|AFV94477.1| photosystem I reaction center subunit II [Saccharum hybrid cultivar 
GT28]
Length=200

 Score =   286 bits (733),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 133/145 (92%), Positives = 138/145 (95%), Gaps = 0/145 (0%)
 Frame = +3

Query  879   PVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREG  1058
             P GF PP LDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQ+FEMPTGGAAIMREG
Sbjct  56    PKGFVPPQLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQVFEMPTGGAAIMREG  115

Query  1059  ANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVG  1238
              NLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNAGR+GVG
Sbjct  116   PNLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNAGRQGVG  175

Query  1239  QNMRSIGKNISPIEVKFTGKQVYDL  1313
             QN RSIGKN+SPIEVKFTGK  +D+
Sbjct  176   QNFRSIGKNVSPIEVKFTGKNTFDI  200



>ref|XP_006396500.1| hypothetical protein EUTSA_v10029178mg [Eutrema salsugineum]
 gb|ESQ37953.1| hypothetical protein EUTSA_v10029178mg [Eutrema salsugineum]
Length=237

 Score =   288 bits (736),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 156/220 (71%), Positives = 169/220 (77%), Gaps = 20/220 (9%)
 Frame = +3

Query  681   MAAQAS-LFASPLSaakpaadrvaaPWKQSLHCFSVV--PRGLNKSTTAPCRPIRamaee  851
             MA QA+ +F+S ++ A  +         + LH F+    PR L+ + TA    IRA   +
Sbjct  29    MATQAAGIFSSAITTAATSDV-------KKLHFFTTTHRPRSLSFTKTA----IRAEKTD  77

Query  852   tte------aptkeaPVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQ  1013
             +           KEAPVGFTPP LDPNTPSPIF GSTGGLLRKAQVEEFYVITW SPKEQ
Sbjct  78    SAAAAAPAVKKEKEAPVGFTPPQLDPNTPSPIFAGSTGGLLRKAQVEEFYVITWNSPKEQ  137

Query  1014  IFEMPTGGAAIMREGANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKD  1193
             IFEMPTGGAAIMREG NLLKLARKEQCLALGTRLRSKYKI YQFYRVFPNGEVQYLHPKD
Sbjct  138   IFEMPTGGAAIMREGPNLLKLARKEQCLALGTRLRSKYKITYQFYRVFPNGEVQYLHPKD  197

Query  1194  GVYPEKVNAGREGVGQNMRSIGKNISPIEVKFTGKQVYDL  1313
             GVYPEK N GREGVG NMRSIGKN+SPIEVKFTGKQ YDL
Sbjct  198   GVYPEKANPGREGVGLNMRSIGKNVSPIEVKFTGKQSYDL  237



>gb|AAM66066.1| putative photosystem I reaction center subunit II precursor [Arabidopsis 
thaliana]
Length=208

 Score =   286 bits (733),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 135/145 (93%), Positives = 136/145 (94%), Gaps = 0/145 (0%)
 Frame = +3

Query  879   PVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREG  1058
             PVGFTPP LDPNTPSPIF GSTGGLLRKAQVEEFYVITW SPKEQIFEMPTGGAAIMREG
Sbjct  64    PVGFTPPQLDPNTPSPIFAGSTGGLLRKAQVEEFYVITWNSPKEQIFEMPTGGAAIMREG  123

Query  1059  ANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVG  1238
              NLLKLARKEQCLALGTRLRSKYKI YQFYRVFPNGEVQYLHPKDGVYPEK N GREGVG
Sbjct  124   PNLLKLARKEQCLALGTRLRSKYKITYQFYRVFPNGEVQYLHPKDGVYPEKANPGREGVG  183

Query  1239  QNMRSIGKNISPIEVKFTGKQVYDL  1313
              NMRSIGKN+SPIEVKFTGKQ YDL
Sbjct  184   LNMRSIGKNVSPIEVKFTGKQSYDL  208



>ref|NP_192186.1| photosystem I subunit D-1 [Arabidopsis thaliana]
 sp|Q9S7H1.1|PSAD1_ARATH RecName: Full=Photosystem I reaction center subunit II-1, chloroplastic; 
AltName: Full=Photosystem I 20 kDa subunit 1; Short=PSI-D1; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AAG40026.1|AF324675_1 AT4g02770 [Arabidopsis thaliana]
 gb|AAG41469.1|AF326887_1 putative photosystem I reaction center subunit II precursor [Arabidopsis 
thaliana]
 gb|AAK63862.1|AF389290_1 AT4g02770/T5J8_7 [Arabidopsis thaliana]
 gb|AAD15351.1| putative photosystem I reaction center subunit II precursor [Arabidopsis 
thaliana]
 emb|CAB52676.1| photosystem I subunit II precursor [Arabidopsis thaliana]
 emb|CAB77762.1| putative photosystem I reaction center subunit II precursor [Arabidopsis 
thaliana]
 gb|AAL32590.1| Unknown protein [Arabidopsis thaliana]
 gb|AAM10233.1| unknown protein [Arabidopsis thaliana]
 gb|AAM26726.1| AT4g02770/T5J8_7 [Arabidopsis thaliana]
 gb|AAM44987.1| putative photosystem I reaction center subunit II precursor [Arabidopsis 
thaliana]
 gb|AEE82228.1| photosystem I subunit D-1 [Arabidopsis thaliana]
Length=208

 Score =   286 bits (733),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 135/145 (93%), Positives = 136/145 (94%), Gaps = 0/145 (0%)
 Frame = +3

Query  879   PVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREG  1058
             PVGFTPP LDPNTPSPIF GSTGGLLRKAQVEEFYVITW SPKEQIFEMPTGGAAIMREG
Sbjct  64    PVGFTPPQLDPNTPSPIFAGSTGGLLRKAQVEEFYVITWNSPKEQIFEMPTGGAAIMREG  123

Query  1059  ANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVG  1238
              NLLKLARKEQCLALGTRLRSKYKI YQFYRVFPNGEVQYLHPKDGVYPEK N GREGVG
Sbjct  124   PNLLKLARKEQCLALGTRLRSKYKITYQFYRVFPNGEVQYLHPKDGVYPEKANPGREGVG  183

Query  1239  QNMRSIGKNISPIEVKFTGKQVYDL  1313
              NMRSIGKN+SPIEVKFTGKQ YDL
Sbjct  184   LNMRSIGKNVSPIEVKFTGKQSYDL  208



>ref|XP_002278284.1| PREDICTED: photosystem I reaction center subunit II, chloroplastic 
[Vitis vinifera]
 emb|CBI28699.3| unnamed protein product [Vitis vinifera]
Length=204

 Score =   286 bits (732),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 159/211 (75%), Positives = 166/211 (79%), Gaps = 7/211 (3%)
 Frame = +3

Query  681   MAAQASLFASPLSaakpaadrvaaPWKQSLHCFSVVPRGLNKSTTAPCRPIRamaeette  860
             MA QA L          +      PWK S        + +N       R I+AMAEE TE
Sbjct  1     MATQAGLLTPTTITTPKSRSLTLVPWKPSSFSSFSTSKPIN-------RAIKAMAEEKTE  53

Query  861   aptkeaPVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGA  1040
             AP KEAPVGFTPP LDPNTPSPIFGGSTGGLLRKAQVEEFYVITW SPKEQIFEMPTGGA
Sbjct  54    APVKEAPVGFTPPELDPNTPSPIFGGSTGGLLRKAQVEEFYVITWESPKEQIFEMPTGGA  113

Query  1041  AIMREGANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNA  1220
             AIMR+G NLLKLARKEQCLALGTRLRSKYKI YQFYRVFPNGEVQYLHPKDGVYPEKVN 
Sbjct  114   AIMRQGPNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPNGEVQYLHPKDGVYPEKVNP  173

Query  1221  GREGVGQNMRSIGKNISPIEVKFTGKQVYDL  1313
             GR+GVGQN RSIGKN+SPIEVKFTGKQ YDL
Sbjct  174   GRQGVGQNFRSIGKNVSPIEVKFTGKQAYDL  204



>ref|NP_001275788.1| PSI reaction center subunit II [Citrus sinensis]
 dbj|BAF80479.1| PSI reaction center subunit II [Citrus sinensis]
Length=209

 Score =   286 bits (732),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 156/212 (74%), Positives = 164/212 (77%), Gaps = 4/212 (2%)
 Frame = +3

Query  681   MAAQASLFASPLSaakpaadrvaaPWKQSLHCFSVVPRGLNKSTTAPCRPIRamaeette  860
             MA QA LF +P       +     PWK +       P+ L  S     R +RA   E   
Sbjct  1     MATQAGLF-TPSITTTKTSKLPLNPWKPTSSFSFTSPKPLTFSMGQ--RTVRAAGAEGKT  57

Query  861   ap-tkeaPVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGG  1037
                TKEAPVGFTPP LDPNTPSPIFGGSTGGLLRKAQVEEFYVITW SPKEQIFEMPTGG
Sbjct  58    EAPTKEAPVGFTPPQLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWESPKEQIFEMPTGG  117

Query  1038  AAIMREGANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVN  1217
             AAIMR+G NLLKLARKEQCLALGTRLRSKYKI YQFYRVFPNGEVQYLHPKDGVYPEKVN
Sbjct  118   AAIMRQGPNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPNGEVQYLHPKDGVYPEKVN  177

Query  1218  AGREGVGQNMRSIGKNISPIEVKFTGKQVYDL  1313
              GR+GVG N RSIGKN+SPIEVKFTGKQVYDL
Sbjct  178   PGRQGVGLNYRSIGKNVSPIEVKFTGKQVYDL  209



>ref|XP_009400838.1| PREDICTED: photosystem I reaction center subunit II, chloroplastic-like 
[Musa acuminata subsp. malaccensis]
Length=207

 Score =   286 bits (731),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 134/143 (94%), Positives = 138/143 (97%), Gaps = 0/143 (0%)
 Frame = +3

Query  885   GFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGAN  1064
             GFTPP LDPNTPSPIFGGSTGGLLRKAQVEEFYVITW SPKEQ+FEMPTGGAAIMR+G N
Sbjct  65    GFTPPQLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWDSPKEQVFEMPTGGAAIMRQGPN  124

Query  1065  LLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVGQN  1244
             LLKLARKEQCLALGTRLRSKYKI YQFYRVFPNGEVQYLHPKDGVYPEKVN GR+GVGQN
Sbjct  125   LLKLARKEQCLALGTRLRSKYKIKYQFYRVFPNGEVQYLHPKDGVYPEKVNPGRQGVGQN  184

Query  1245  MRSIGKNISPIEVKFTGKQVYDL  1313
             MRSIGKN+SPIEVKFTGKQVYDL
Sbjct  185   MRSIGKNVSPIEVKFTGKQVYDL  207



>gb|KJB46980.1| hypothetical protein B456_008G004100 [Gossypium raimondii]
Length=210

 Score =   286 bits (731),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 135/145 (93%), Positives = 139/145 (96%), Gaps = 0/145 (0%)
 Frame = +3

Query  879   PVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREG  1058
             PVGFTPP LDPNTPSPIFGGSTGGLLRKAQVEEFYVITW SPKEQ+FEMPTGGAAIMR+G
Sbjct  66    PVGFTPPELDPNTPSPIFGGSTGGLLRKAQVEEFYVITWDSPKEQVFEMPTGGAAIMRQG  125

Query  1059  ANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVG  1238
              NLLKLARKEQCLALGTRLRSKYKI YQFYRVFPNGEVQYLHPKDGVYPEKVN GR+GVG
Sbjct  126   PNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPNGEVQYLHPKDGVYPEKVNPGRQGVG  185

Query  1239  QNMRSIGKNISPIEVKFTGKQVYDL  1313
             QN RSIGKN+SPIEVKFTGKQVYDL
Sbjct  186   QNFRSIGKNVSPIEVKFTGKQVYDL  210



>ref|XP_010542866.1| PREDICTED: photosystem I reaction center subunit II-1, chloroplastic-like 
[Tarenaya hassleriana]
Length=206

 Score =   285 bits (730),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 135/144 (94%), Positives = 137/144 (95%), Gaps = 0/144 (0%)
 Frame = +3

Query  882   VGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGA  1061
             VGFTPP LDPNTPSPIF GSTGGLLRKAQVEEFYVITW SPKEQIFEMPTGGAAIMREG 
Sbjct  63    VGFTPPQLDPNTPSPIFAGSTGGLLRKAQVEEFYVITWNSPKEQIFEMPTGGAAIMREGP  122

Query  1062  NLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVGQ  1241
             NLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEK N GR+GVGQ
Sbjct  123   NLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKANPGRQGVGQ  182

Query  1242  NMRSIGKNISPIEVKFTGKQVYDL  1313
             NMRSIGKN+SPIEVKFTGKQ YDL
Sbjct  183   NMRSIGKNVSPIEVKFTGKQPYDL  206



>ref|XP_006444053.1| hypothetical protein CICLE_v10022248mg [Citrus clementina]
 dbj|BAF80471.1| PSI reaction center subunit II [Citrus sinensis]
 dbj|BAF80473.1| PSI reaction center subunit II [Citrus sinensis]
 gb|ESR57293.1| hypothetical protein CICLE_v10022248mg [Citrus clementina]
Length=209

 Score =   285 bits (730),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 157/212 (74%), Positives = 166/212 (78%), Gaps = 4/212 (2%)
 Frame = +3

Query  681   MAAQASLFASPLSaakpaadrvaaPWKQSLHCFSVVPRGLNKSTTAPCRPIRamaeette  860
             MA QA LF +P       +  +  PWK +       P+ L  S     R +RA A E   
Sbjct  1     MATQAGLF-TPSIITTKTSKLLLNPWKPTSSFSFTSPKPLTFSMAQ--RTVRAAAAEEKT  57

Query  861   ap-tkeaPVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGG  1037
                TKEAPVGFTPP LDPNTPSPIFGGSTGGLLRKAQVEEFYVITW SPKEQIFEMPTGG
Sbjct  58    EAPTKEAPVGFTPPQLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWESPKEQIFEMPTGG  117

Query  1038  AAIMREGANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVN  1217
             AAIMR+G NLLKLARKEQCLALGTRLRSKYKI YQFYRVFPNGEVQYLHPKDGVYPEKVN
Sbjct  118   AAIMRQGPNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPNGEVQYLHPKDGVYPEKVN  177

Query  1218  AGREGVGQNMRSIGKNISPIEVKFTGKQVYDL  1313
              GR+GVG N RSIGKN+SPIEVKFTGKQVYDL
Sbjct  178   PGRQGVGVNYRSIGKNVSPIEVKFTGKQVYDL  209



>ref|XP_002520727.1| Photosystem I reaction center subunit II, chloroplast precursor, 
putative [Ricinus communis]
 gb|EEF41689.1| Photosystem I reaction center subunit II, chloroplast precursor, 
putative [Ricinus communis]
Length=209

 Score =   285 bits (728),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 134/145 (92%), Positives = 139/145 (96%), Gaps = 0/145 (0%)
 Frame = +3

Query  879   PVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREG  1058
             PVGFTPP LDP+TPSPIFGGSTGGLLRKAQVEEFYVITW SPKEQIFEMPTGGAAIMR+G
Sbjct  65    PVGFTPPELDPSTPSPIFGGSTGGLLRKAQVEEFYVITWDSPKEQIFEMPTGGAAIMRQG  124

Query  1059  ANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVG  1238
              NLLKLARKEQCLALGTRLRSKYKI YQFYRVFPNGEVQYLHPKDGVYPEKVN GR+GVG
Sbjct  125   PNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPNGEVQYLHPKDGVYPEKVNPGRQGVG  184

Query  1239  QNMRSIGKNISPIEVKFTGKQVYDL  1313
             QN RSIGKN+SPIEVKFTGKQVYD+
Sbjct  185   QNFRSIGKNVSPIEVKFTGKQVYDI  209



>ref|XP_002872810.1| hypothetical protein ARALYDRAFT_490280 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH49069.1| hypothetical protein ARALYDRAFT_490280 [Arabidopsis lyrata subsp. 
lyrata]
Length=206

 Score =   284 bits (727),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 146/186 (78%), Positives = 155/186 (83%), Gaps = 3/186 (2%)
 Frame = +3

Query  762   QSLHCFSVV--PRGLNKSTTAPCRPIRamaeetteaptkeaPVGFTPPTLDPNTPSPIFG  935
             + LH FS    P+ L+ + T+  R  +  ++       KEAPVGFTPP LDPNTPSPIF 
Sbjct  22    KKLHFFSTTHRPKSLSFTKTS-IRAEKTDSKAAAAPAVKEAPVGFTPPQLDPNTPSPIFA  80

Query  936   GSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLARKEQCLALGTRL  1115
             GSTGGLLRKAQVEEFYVITW SPKEQIFEMPTGGAAIMREG NLLKLARKEQCLALGTRL
Sbjct  81    GSTGGLLRKAQVEEFYVITWNSPKEQIFEMPTGGAAIMREGPNLLKLARKEQCLALGTRL  140

Query  1116  RSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVGQNMRSIGKNISPIEVKFTG  1295
             RSKYKI YQFYRVFPNGEVQYLHPKDGVYPEK N GREGVG NMRSIGKN+SPIEVKFTG
Sbjct  141   RSKYKITYQFYRVFPNGEVQYLHPKDGVYPEKANPGREGVGLNMRSIGKNVSPIEVKFTG  200

Query  1296  KQVYDL  1313
             KQ YDL
Sbjct  201   KQSYDL  206



>ref|XP_010681150.1| PREDICTED: photosystem I reaction center subunit II, chloroplastic-like 
[Beta vulgaris subsp. vulgaris]
Length=217

 Score =   284 bits (727),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 134/143 (94%), Positives = 136/143 (95%), Gaps = 0/143 (0%)
 Frame = +3

Query  885   GFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGAN  1064
             GFTPP LDPNTPSPIF GSTGGLLRKAQVEEFYVITW SPKEQIFEMPTGGAAIMREG N
Sbjct  75    GFTPPELDPNTPSPIFAGSTGGLLRKAQVEEFYVITWESPKEQIFEMPTGGAAIMREGPN  134

Query  1065  LLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVGQN  1244
             LLKLARKEQCLALGTRLRSKYKI YQFYRVFPNGEVQYLHPKDGVYPEKVN GR+GVGQN
Sbjct  135   LLKLARKEQCLALGTRLRSKYKIKYQFYRVFPNGEVQYLHPKDGVYPEKVNPGRQGVGQN  194

Query  1245  MRSIGKNISPIEVKFTGKQVYDL  1313
             MRSIGKN+SPIEVKFTGKQ YDL
Sbjct  195   MRSIGKNVSPIEVKFTGKQAYDL  217



>emb|CAA32182.1| unnamed protein product [Spinacia oleracea]
Length=212

 Score =   284 bits (726),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 161/215 (75%), Positives = 172/215 (80%), Gaps = 5/215 (2%)
 Frame = +3

Query  675   MAMAAQASLFA-SPLSaakpaadrvaaPWKQ-SLHCFSVVPRGLNKSTTAPCRPIRamae  848
             MAMA QA+LF+ S LS+AKP   R+   +KQ S   F+  P   + S  A      A  +
Sbjct  1     MAMATQATLFSPSSLSSAKPIDTRLTTSFKQPSALSFASKPASRHHSIRAAAA---AEGK  57

Query  849   etteaptkeaPVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMP  1028
               T   TKEAP GFTPP LDPNTPSPIF GSTGGLLRKAQVEEFYVITW SPKEQIFEMP
Sbjct  58    AATPTETKEAPKGFTPPELDPNTPSPIFAGSTGGLLRKAQVEEFYVITWESPKEQIFEMP  117

Query  1029  TGGAAIMREGANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPE  1208
             TGGAAIMREG NLLKLARKEQCLALGTRLRSKYKI YQFYRVFP+GEVQYLHPKDGVYPE
Sbjct  118   TGGAAIMREGPNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPSGEVQYLHPKDGVYPE  177

Query  1209  KVNAGREGVGQNMRSIGKNISPIEVKFTGKQVYDL  1313
             KVN GR+GVG NMRSIGKN+SPIEVKFTGKQ YDL
Sbjct  178   KVNPGRQGVGLNMRSIGKNVSPIEVKFTGKQPYDL  212



>emb|CAA68728.1| unnamed protein product [Spinacia oleracea]
Length=212

 Score =   284 bits (726),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 160/215 (74%), Positives = 171/215 (80%), Gaps = 5/215 (2%)
 Frame = +3

Query  675   MAMAAQASLFA-SPLSaakpaadrvaaPWKQ-SLHCFSVVPRGLNKSTTAPCRPIRamae  848
             MAMA QA+LF+ S LS+AKP   R+   +KQ S   F+  P   + S  A      A  +
Sbjct  1     MAMATQATLFSPSSLSSAKPIDTRLTTSFKQPSAVTFASKPASRHHSIRAAAA---AEGK  57

Query  849   etteaptkeaPVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMP  1028
                   TKEAP GFTPP LDPNTPSPIF GSTGGLLRKAQVEEFYVITW SPKEQIFEMP
Sbjct  58    RAAATETKEAPKGFTPPELDPNTPSPIFAGSTGGLLRKAQVEEFYVITWESPKEQIFEMP  117

Query  1029  TGGAAIMREGANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPE  1208
             TGGAAIMREG NLLKLARKEQCLALGTRLRSKYKI YQFYRVFP+GEVQYLHPKDGVYPE
Sbjct  118   TGGAAIMREGPNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPSGEVQYLHPKDGVYPE  177

Query  1209  KVNAGREGVGQNMRSIGKNISPIEVKFTGKQVYDL  1313
             KVN GR+GVG NMRSIGKN+SPIEVKFTGKQ YDL
Sbjct  178   KVNPGRQGVGLNMRSIGKNVSPIEVKFTGKQPYDL  212



>gb|KFK30882.1| hypothetical protein AALP_AA6G038200 [Arabis alpina]
Length=207

 Score =   283 bits (725),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 134/144 (93%), Positives = 135/144 (94%), Gaps = 0/144 (0%)
 Frame = +3

Query  882   VGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGA  1061
             VGFTPP LDPNTPSPIF GSTGGLLRKAQVEEFYVITW SPKEQIFEMPTGGAAIMREG 
Sbjct  64    VGFTPPQLDPNTPSPIFAGSTGGLLRKAQVEEFYVITWNSPKEQIFEMPTGGAAIMREGP  123

Query  1062  NLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVGQ  1241
             NLLKLARKEQCLALGTRLRSKYKI YQFYRVFPNGEVQYLHPKDGVYPEK N GREGVG 
Sbjct  124   NLLKLARKEQCLALGTRLRSKYKITYQFYRVFPNGEVQYLHPKDGVYPEKANPGREGVGL  183

Query  1242  NMRSIGKNISPIEVKFTGKQVYDL  1313
             NMRSIGKN+SPIEVKFTGKQ YDL
Sbjct  184   NMRSIGKNVSPIEVKFTGKQSYDL  207



>ref|XP_004981348.1| PREDICTED: photosystem I reaction center subunit II, chloroplastic-like 
[Setaria italica]
Length=275

 Score =   285 bits (728),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 133/145 (92%), Positives = 138/145 (95%), Gaps = 0/145 (0%)
 Frame = +3

Query  879   PVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREG  1058
             P GF PP LDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQ+FEMPTGGAAIMREG
Sbjct  131   PKGFVPPQLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQVFEMPTGGAAIMREG  190

Query  1059  ANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVG  1238
              NLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNAGR+GVG
Sbjct  191   PNLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNAGRQGVG  250

Query  1239  QNMRSIGKNISPIEVKFTGKQVYDL  1313
             QN RSIGKN+SPIEVKFTGK  +D+
Sbjct  251   QNFRSIGKNVSPIEVKFTGKNTFDI  275



>sp|P12353.2|PSAD_SPIOL RecName: Full=Photosystem I reaction center subunit II, chloroplastic; 
AltName: Full=Photosystem I 20 kDa subunit; Short=PSI-D; 
Flags: Precursor [Spinacia oleracea]
Length=212

 Score =   282 bits (721),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 160/215 (74%), Positives = 171/215 (80%), Gaps = 5/215 (2%)
 Frame = +3

Query  675   MAMAAQASLFA-SPLSaakpaadrvaaPWKQ-SLHCFSVVPRGLNKSTTAPCRPIRamae  848
             MAMA QA+LF+ S LS+AKP   R+   +KQ S   F+  P   + S  A      A  +
Sbjct  1     MAMATQATLFSPSSLSSAKPIDTRLTTSFKQPSAVTFASKPASRHHSIRAAAA---AEGK  57

Query  849   etteaptkeaPVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMP  1028
                   TKEAP GFTPP LDPNTPSPIF GSTGGLLRKAQVEEFYVITW SPKEQIFEMP
Sbjct  58    AAAATETKEAPKGFTPPELDPNTPSPIFAGSTGGLLRKAQVEEFYVITWESPKEQIFEMP  117

Query  1029  TGGAAIMREGANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPE  1208
             TGGAAIMREG NLLKLARKEQCLALGTRLRSKYKI YQFYRVFP+GEVQYLHPKDGVYPE
Sbjct  118   TGGAAIMREGPNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPSGEVQYLHPKDGVYPE  177

Query  1209  KVNAGREGVGQNMRSIGKNISPIEVKFTGKQVYDL  1313
             KVN GR+GVG NMRSIGKN+SPIEVKFTGKQ YDL
Sbjct  178   KVNPGRQGVGLNMRSIGKNVSPIEVKFTGKQPYDL  212



>ref|XP_012092226.1| PREDICTED: photosystem I reaction center subunit II, chloroplastic 
[Jatropha curcas]
 gb|KDP21451.1| hypothetical protein JCGZ_21922 [Jatropha curcas]
Length=205

 Score =   282 bits (721),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 133/145 (92%), Positives = 137/145 (94%), Gaps = 0/145 (0%)
 Frame = +3

Query  879   PVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREG  1058
             PVGFTPP LDPNTPSPIF GSTGGLLRKAQVEEFYVITW SPKEQIFEMPTGGAAIMR+G
Sbjct  61    PVGFTPPELDPNTPSPIFSGSTGGLLRKAQVEEFYVITWDSPKEQIFEMPTGGAAIMRQG  120

Query  1059  ANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVG  1238
              NLLKLARKEQCLALGTRLRSKYKI YQFYRVFPNGEVQYLHPKDGVYPEKVN GR+GVG
Sbjct  121   PNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPNGEVQYLHPKDGVYPEKVNPGRQGVG  180

Query  1239  QNMRSIGKNISPIEVKFTGKQVYDL  1313
              N RSIGKN+SPIEVKFTGKQVYD+
Sbjct  181   LNFRSIGKNVSPIEVKFTGKQVYDI  205



>emb|CAB52677.1| photosystem I subunit II precursor [Arabidopsis thaliana]
Length=204

 Score =   281 bits (720),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 141/184 (77%), Positives = 147/184 (80%), Gaps = 0/184 (0%)
 Frame = +3

Query  762   QSLHCFSVVPRGLNKSTTAPCRPIRamaeetteaptkeaPVGFTPPTLDPNTPSPIFGGS  941
             + LH FS   R  + S T            +     KEAPVGFTPP LDPNTPSPIF GS
Sbjct  21    KKLHLFSSSHRPKSLSFTKTAIRAEKTESSSAAPAVKEAPVGFTPPQLDPNTPSPIFAGS  80

Query  942   TGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLARKEQCLALGTRLRS  1121
             TGGLLRKAQVEEFYVITW SPKEQIFEMPTGGAAIMREG NLLKLARKEQCLALGTRLRS
Sbjct  81    TGGLLRKAQVEEFYVITWNSPKEQIFEMPTGGAAIMREGPNLLKLARKEQCLALGTRLRS  140

Query  1122  KYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVGQNMRSIGKNISPIEVKFTGKQ  1301
             K+KI YQFYRVFPNGEVQYLHPKDG+YPEK N GREG G NMRSIGKN+SPIEVKF GKQ
Sbjct  141   KFKITYQFYRVFPNGEVQYLHPKDGIYPEKANPGREGFGLNMRSIGKNVSPIEVKFPGKQ  200

Query  1302  VYDL  1313
              YDL
Sbjct  201   SYDL  204



>emb|CAN61448.1| hypothetical protein VITISV_024141 [Vitis vinifera]
Length=183

 Score =   280 bits (716),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 133/143 (93%), Positives = 136/143 (95%), Gaps = 0/143 (0%)
 Frame = +3

Query  879   PVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREG  1058
             PVGFTPP LDPNTPSPIFGGSTGGLLRKAQVEEFYVITW SPKEQIFEMPTGGAAIMR+G
Sbjct  41    PVGFTPPELDPNTPSPIFGGSTGGLLRKAQVEEFYVITWESPKEQIFEMPTGGAAIMRQG  100

Query  1059  ANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVG  1238
              NLLKLARKEQCLALGTRLRSKYKI YQFYRVFPNGEVQYLHPKDGVYPEKVN GR+GVG
Sbjct  101   PNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPNGEVQYLHPKDGVYPEKVNPGRQGVG  160

Query  1239  QNMRSIGKNISPIEVKFTGKQVY  1307
             QN RSIGKN+SPIEVKFTGKQ Y
Sbjct  161   QNFRSIGKNVSPIEVKFTGKQAY  183



>ref|XP_010456951.1| PREDICTED: photosystem I reaction center subunit II-1, chloroplastic-like, 
partial [Camelina sativa]
Length=205

 Score =   281 bits (718),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 132/140 (94%), Positives = 133/140 (95%), Gaps = 0/140 (0%)
 Frame = +3

Query  879   PVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREG  1058
             PVGFTPP LDPNTPSPIF GSTGGLLRKAQVEEFYVITW SPKEQIFEMPTGGAAIMREG
Sbjct  66    PVGFTPPELDPNTPSPIFAGSTGGLLRKAQVEEFYVITWNSPKEQIFEMPTGGAAIMREG  125

Query  1059  ANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVG  1238
              NLLKLARKEQCLALGTRLRSKYKI YQFYRVFPNGEVQYLHPKDGVYPEK N GREGVG
Sbjct  126   PNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPNGEVQYLHPKDGVYPEKANPGREGVG  185

Query  1239  QNMRSIGKNISPIEVKFTGK  1298
             QNMRSIGKN+SPIEVKFTGK
Sbjct  186   QNMRSIGKNVSPIEVKFTGK  205



>ref|XP_010424650.1| PREDICTED: photosystem I reaction center subunit II-1, chloroplastic-like, 
partial [Camelina sativa]
Length=205

 Score =   280 bits (717),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 132/140 (94%), Positives = 133/140 (95%), Gaps = 0/140 (0%)
 Frame = +3

Query  879   PVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREG  1058
             PVGFTPP LDPNTPSPIF GSTGGLLRKAQVEEFYVITW SPKEQIFEMPTGGAAIMREG
Sbjct  66    PVGFTPPELDPNTPSPIFAGSTGGLLRKAQVEEFYVITWNSPKEQIFEMPTGGAAIMREG  125

Query  1059  ANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVG  1238
              NLLKLARKEQCLALGTRLRSKYKI YQFYRVFPNGEVQYLHPKDGVYPEK N GREGVG
Sbjct  126   PNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPNGEVQYLHPKDGVYPEKANPGREGVG  185

Query  1239  QNMRSIGKNISPIEVKFTGK  1298
             QNMRSIGKN+SPIEVKFTGK
Sbjct  186   QNMRSIGKNVSPIEVKFTGK  205



>sp|P36213.1|PSAD_HORVU RecName: Full=Photosystem I reaction center subunit II, chloroplastic; 
AltName: Full=Photosystem I 20 kDa subunit; Short=PSI-D; 
Flags: Precursor [Hordeum vulgare]
 gb|AAA18567.1| PSI-D subunit [Hordeum vulgare subsp. vulgare]
 dbj|BAK07564.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=205

 Score =   276 bits (707),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 129/143 (90%), Positives = 135/143 (94%), Gaps = 0/143 (0%)
 Frame = +3

Query  885   GFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGAN  1064
             GF PP LDP+TPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQ+FEMPTGGAAIMREG N
Sbjct  63    GFVPPQLDPSTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQVFEMPTGGAAIMREGPN  122

Query  1065  LLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVGQN  1244
             LLKLARKEQCLALG RLRSKYKI YQFYRVFPNGEVQYLHPKDGVYPEKVNAGR+GVGQN
Sbjct  123   LLKLARKEQCLALGNRLRSKYKIAYQFYRVFPNGEVQYLHPKDGVYPEKVNAGRQGVGQN  182

Query  1245  MRSIGKNISPIEVKFTGKQVYDL  1313
              RSIGKN+SPIEVKFTGK  +D+
Sbjct  183   FRSIGKNVSPIEVKFTGKNSFDI  205



>ref|XP_010424649.1| PREDICTED: photosystem I reaction center subunit II-1, chloroplastic-like 
[Camelina sativa]
Length=230

 Score =   277 bits (709),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 130/138 (94%), Positives = 131/138 (95%), Gaps = 0/138 (0%)
 Frame = +3

Query  879   PVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREG  1058
             PVGFTPP LDPNTPSPIF GSTGGLLRKAQVEEFYVITW SPKEQIFEMPTGGAAIMREG
Sbjct  66    PVGFTPPELDPNTPSPIFAGSTGGLLRKAQVEEFYVITWNSPKEQIFEMPTGGAAIMREG  125

Query  1059  ANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVG  1238
              NLLKLARKEQCLALGTRLRSKYKI YQFYRVFPNGEVQYLHPKDGVYPEK N GREGVG
Sbjct  126   PNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPNGEVQYLHPKDGVYPEKANPGREGVG  185

Query  1239  QNMRSIGKNISPIEVKFT  1292
             QNMRSIGKN+SPIEVKFT
Sbjct  186   QNMRSIGKNVSPIEVKFT  203



>pdb|2WSC|D Chain D, Improved Model Of Plant Photosystem I
 pdb|2WSE|D Chain D, Improved Model Of Plant Photosystem I
 pdb|2WSF|D Chain D, Improved Model Of Plant Photosystem I
Length=212

 Score =   276 bits (707),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 131/142 (92%), Positives = 134/142 (94%), Gaps = 0/142 (0%)
 Frame = +3

Query  888   FTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANL  1067
             FTPP LDPNTPSPIF GSTGGLLRKAQVEEFYVITW SPKEQIFEMPTGGAAIMREG NL
Sbjct  71    FTPPELDPNTPSPIFAGSTGGLLRKAQVEEFYVITWESPKEQIFEMPTGGAAIMREGPNL  130

Query  1068  LKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVGQNM  1247
             LKLARKEQCLALGTRLRSKYKI YQFYRVFP+GEVQYLHPKDGVYPEKVN GR+GVG NM
Sbjct  131   LKLARKEQCLALGTRLRSKYKIKYQFYRVFPSGEVQYLHPKDGVYPEKVNPGRQGVGLNM  190

Query  1248  RSIGKNISPIEVKFTGKQVYDL  1313
             RSIGKN+SPIEVKFTGKQ YDL
Sbjct  191   RSIGKNVSPIEVKFTGKQPYDL  212



>ref|XP_003564108.1| PREDICTED: photosystem I reaction center subunit II, chloroplastic 
[Brachypodium distachyon]
Length=204

 Score =   275 bits (704),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 128/143 (90%), Positives = 135/143 (94%), Gaps = 0/143 (0%)
 Frame = +3

Query  885   GFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGAN  1064
             GF PP LDP+TPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQ+FEMPTGGAAIMREG N
Sbjct  62    GFVPPQLDPSTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQVFEMPTGGAAIMREGPN  121

Query  1065  LLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVGQN  1244
             LLKLARKEQCLALG RLRSKYKI YQFYRVFP+GEVQYLHPKDGVYPEKVNAGR+GVGQN
Sbjct  122   LLKLARKEQCLALGNRLRSKYKIAYQFYRVFPSGEVQYLHPKDGVYPEKVNAGRQGVGQN  181

Query  1245  MRSIGKNISPIEVKFTGKQVYDL  1313
              RSIGKN+SPIEVKFTGK  +D+
Sbjct  182   FRSIGKNVSPIEVKFTGKNTFDV  204



>ref|NP_001130880.1| photosystem I reaction center subunit II [Zea mays]
 gb|ACF79256.1| unknown [Zea mays]
 gb|ACG34065.1| photosystem I reaction center subunit II [Zea mays]
 gb|ACR35291.1| unknown [Zea mays]
 tpg|DAA52067.1| TPA: photosystem I reaction center subunit II [Zea mays]
Length=199

 Score =   275 bits (702),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 128/144 (89%), Positives = 134/144 (93%), Gaps = 0/144 (0%)
 Frame = +3

Query  879   PVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREG  1058
             P GF  P LDP+TPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQ+FEMPTGGAAIMREG
Sbjct  56    PKGFVAPQLDPSTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQVFEMPTGGAAIMREG  115

Query  1059  ANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVG  1238
              NLLKLARKEQCLALGTRLRSKYKI YQFYRVFPNGEVQYLHPKDGVYPEKVN GREGVG
Sbjct  116   PNLLKLARKEQCLALGTRLRSKYKITYQFYRVFPNGEVQYLHPKDGVYPEKVNPGREGVG  175

Query  1239  QNMRSIGKNISPIEVKFTGKQVYD  1310
             QN RSIGKN++PI+VKFTGK  +D
Sbjct  176   QNFRSIGKNVNPIDVKFTGKATFD  199



>gb|ACN40159.1| unknown [Picea sitchensis]
Length=161

 Score =   273 bits (698),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 129/145 (89%), Positives = 135/145 (93%), Gaps = 0/145 (0%)
 Frame = +3

Query  879   PVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREG  1058
             PVGFTPP L P+TPSPIFGGSTGGLLRKAQVEEFYVITW SPKEQIFEMPTGGAAIMREG
Sbjct  17    PVGFTPPELKPDTPSPIFGGSTGGLLRKAQVEEFYVITWESPKEQIFEMPTGGAAIMREG  76

Query  1059  ANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVG  1238
              NLLKLARKEQCLALGTRLRSKYKI YQFYRVFPNGEVQYLHPKDGVYPEKVN GR+GVG
Sbjct  77    PNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPNGEVQYLHPKDGVYPEKVNPGRKGVG  136

Query  1239  QNMRSIGKNISPIEVKFTGKQVYDL  1313
              N RSIGKN++P +VKFTGKQ YD+
Sbjct  137   VNFRSIGKNVNPSQVKFTGKQTYDV  161



>pdb|3LW5|D Chain D, Improved Model Of Plant Photosystem I
Length=138

 Score =   271 bits (693),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 130/137 (95%), Positives = 132/137 (96%), Gaps = 0/137 (0%)
 Frame = +3

Query  903   LDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLAR  1082
             LDPNTPSPIFGGSTGGLLRKAQVEEFYVITW SPKEQIFEMPTGGAAIMREG NLLKLAR
Sbjct  2     LDPNTPSPIFGGSTGGLLRKAQVEEFYVITWDSPKEQIFEMPTGGAAIMREGPNLLKLAR  61

Query  1083  KEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVGQNMRSIGK  1262
             KEQCLALGTRLRSKYKI YQFYRVFPNGEVQYLHPKDGVYPEKVNAGR+GVGQN RSIGK
Sbjct  62    KEQCLALGTRLRSKYKIKYQFYRVFPNGEVQYLHPKDGVYPEKVNAGRQGVGQNFRSIGK  121

Query  1263  NISPIEVKFTGKQVYDL  1313
             N+SPIEVKFTGKQ YDL
Sbjct  122   NVSPIEVKFTGKQPYDL  138



>gb|AFW67274.1| photosystem I reaction center subunit II [Zea mays]
Length=236

 Score =   274 bits (701),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 127/144 (88%), Positives = 133/144 (92%), Gaps = 0/144 (0%)
 Frame = +3

Query  879   PVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREG  1058
             P GF  P LDP+TPSPIFGGSTGGLLRKAQVEEFYVITW SPKEQ+FEMPTGGAAIMREG
Sbjct  93    PKGFVAPQLDPSTPSPIFGGSTGGLLRKAQVEEFYVITWVSPKEQVFEMPTGGAAIMREG  152

Query  1059  ANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVG  1238
              NLLKLARKEQCLALGTRLRSKYKI YQFYRVFPNGEVQYLHPKDGVYPEKVN GREGVG
Sbjct  153   PNLLKLARKEQCLALGTRLRSKYKITYQFYRVFPNGEVQYLHPKDGVYPEKVNPGREGVG  212

Query  1239  QNMRSIGKNISPIEVKFTGKQVYD  1310
             QN RSIGKN++PI+VKFTGK  +D
Sbjct  213   QNFRSIGKNVNPIDVKFTGKSTFD  236



>gb|ACG41754.1| photosystem I reaction center subunit II [Zea mays]
Length=199

 Score =   273 bits (697),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 127/144 (88%), Positives = 133/144 (92%), Gaps = 0/144 (0%)
 Frame = +3

Query  879   PVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREG  1058
             P GF  P LDP+TPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQ+FEMPTGGAAIMREG
Sbjct  56    PKGFVAPQLDPSTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQVFEMPTGGAAIMREG  115

Query  1059  ANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVG  1238
              NLLKLAR EQCLALGTRLRSKYKI YQFYRVFPNGEVQYLHPKDGVYPEKVN GREGVG
Sbjct  116   PNLLKLARNEQCLALGTRLRSKYKITYQFYRVFPNGEVQYLHPKDGVYPEKVNPGREGVG  175

Query  1239  QNMRSIGKNISPIEVKFTGKQVYD  1310
             QN RSIGKN++PI+VKFTGK  +D
Sbjct  176   QNFRSIGKNVNPIDVKFTGKATFD  199



>gb|ACG25364.1| photosystem I reaction center subunit II [Zea mays]
 gb|ACG45485.1| photosystem I reaction center subunit II [Zea mays]
Length=204

 Score =   273 bits (697),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 127/144 (88%), Positives = 133/144 (92%), Gaps = 0/144 (0%)
 Frame = +3

Query  879   PVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREG  1058
             P GF  P LDP+TPSPIFGGSTGGLLRKAQVEEFYVITW SPKEQ+FEMPTGGAAIMREG
Sbjct  61    PKGFVAPQLDPSTPSPIFGGSTGGLLRKAQVEEFYVITWVSPKEQVFEMPTGGAAIMREG  120

Query  1059  ANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVG  1238
              NLLKLARKEQCLALGTRLRSKYKI YQFYRVFPNGEVQYLHPKDGVYPEKVN GREGVG
Sbjct  121   PNLLKLARKEQCLALGTRLRSKYKITYQFYRVFPNGEVQYLHPKDGVYPEKVNPGREGVG  180

Query  1239  QNMRSIGKNISPIEVKFTGKQVYD  1310
             QN RSIGKN++PI+VKFTGK  +D
Sbjct  181   QNFRSIGKNVNPIDVKFTGKSTFD  204



>gb|ABK21314.1| unknown [Picea sitchensis]
 gb|ABK24570.1| unknown [Picea sitchensis]
 gb|ABK26950.1| unknown [Picea sitchensis]
 gb|ABR17153.1| unknown [Picea sitchensis]
Length=234

 Score =   272 bits (696),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 129/145 (89%), Positives = 135/145 (93%), Gaps = 0/145 (0%)
 Frame = +3

Query  879   PVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREG  1058
             PVGFTPP L P+TPSPIFGGSTGGLLRKAQVEEFYVITW SPKEQIFEMPTGGAAIMREG
Sbjct  90    PVGFTPPELKPDTPSPIFGGSTGGLLRKAQVEEFYVITWESPKEQIFEMPTGGAAIMREG  149

Query  1059  ANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVG  1238
              NLLKLARKEQCLALGTRLRSKYKI YQFYRVFPNGEVQYLHPKDGVYPEKVN GR+GVG
Sbjct  150   PNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPNGEVQYLHPKDGVYPEKVNPGRKGVG  209

Query  1239  QNMRSIGKNISPIEVKFTGKQVYDL  1313
              N RSIGKN++P +VKFTGKQ YD+
Sbjct  210   VNFRSIGKNVNPSQVKFTGKQTYDV  234



>emb|CAA54744.1| psaD [Spinacia oleracea]
Length=211

 Score =   270 bits (691),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 130/142 (92%), Positives = 133/142 (94%), Gaps = 1/142 (1%)
 Frame = +3

Query  888   FTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANL  1067
             FTPP LDPNTPSPIF GSTG LLRKAQVEEFYVITW SPKEQIFEMPTGGAAIMREG NL
Sbjct  71    FTPPELDPNTPSPIFAGSTG-LLRKAQVEEFYVITWESPKEQIFEMPTGGAAIMREGPNL  129

Query  1068  LKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVGQNM  1247
             LKLARKEQCLALGTRLRSKYKI YQFYRVFP+GEVQYLHPKDGVYPEKVN GR+GVG NM
Sbjct  130   LKLARKEQCLALGTRLRSKYKIKYQFYRVFPSGEVQYLHPKDGVYPEKVNPGRQGVGLNM  189

Query  1248  RSIGKNISPIEVKFTGKQVYDL  1313
             RSIGKN+SPIEVKFTGKQ YDL
Sbjct  190   RSIGKNVSPIEVKFTGKQPYDL  211



>ref|XP_010474917.1| PREDICTED: photosystem I reaction center subunit II-2, chloroplastic-like 
isoform X2 [Camelina sativa]
Length=241

 Score =   270 bits (689),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 126/135 (93%), Positives = 127/135 (94%), Gaps = 0/135 (0%)
 Frame = +3

Query  879   PVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREG  1058
             PVGFTPP LDPNTPSPIF GSTGGLLRKAQVEEFYVITW SPKEQIFEMPTGGAAIMRE 
Sbjct  103   PVGFTPPQLDPNTPSPIFAGSTGGLLRKAQVEEFYVITWNSPKEQIFEMPTGGAAIMRER  162

Query  1059  ANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVG  1238
              NLLKLARKEQCLALGTRLRSKYKI YQFYRVFPNGEVQYLHPKDGVYPEK N GREGVG
Sbjct  163   PNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPNGEVQYLHPKDGVYPEKANPGREGVG  222

Query  1239  QNMRSIGKNISPIEV  1283
             QNMRSIGKN+SPIEV
Sbjct  223   QNMRSIGKNVSPIEV  237



>gb|ABK21867.1| unknown [Picea sitchensis]
Length=234

 Score =   269 bits (688),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 128/145 (88%), Positives = 134/145 (92%), Gaps = 0/145 (0%)
 Frame = +3

Query  879   PVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREG  1058
             PVGFTPP L P+TPSPIFGGSTGGLLRKAQVEEFYVITW SPKEQIFEMPTGGAAIMREG
Sbjct  90    PVGFTPPELKPDTPSPIFGGSTGGLLRKAQVEEFYVITWESPKEQIFEMPTGGAAIMREG  149

Query  1059  ANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVG  1238
              NLLKLARKEQCLALGTRLRSKYKI YQFYRVFPNGEVQYLHPKDGVY EKVN GR+GVG
Sbjct  150   PNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPNGEVQYLHPKDGVYQEKVNPGRKGVG  209

Query  1239  QNMRSIGKNISPIEVKFTGKQVYDL  1313
              N RSIGKN++P +VKFTGKQ YD+
Sbjct  210   VNFRSIGKNVNPSQVKFTGKQTYDV  234



>gb|KJB28316.1| hypothetical protein B456_005G042000 [Gossypium raimondii]
Length=228

 Score =   269 bits (687),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 148/212 (70%), Positives = 158/212 (75%), Gaps = 19/212 (9%)
 Frame = +3

Query  675   MAMAAQASLFA-----SPLSaakpaadrvaaPWKQSLHCFS-----VVPRGLNKSTTAPC  824
             MAMA QASLF      +P S  + AA     P   ++  F      + PR +    T   
Sbjct  1     MAMATQASLFTPSTLRTPKSGDRIAAVLRKQPPFLTVPSFKSPKSIIAPRTIKAEATE--  58

Query  825   RPIRamaeetteaptkeaPVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSP  1004
                    E+     TKEAPVGFTPP LDPNTPSPIFGGSTGGLLRKAQVEEFYVITW SP
Sbjct  59    -------EKAETTATKEAPVGFTPPELDPNTPSPIFGGSTGGLLRKAQVEEFYVITWESP  111

Query  1005  KEQIFEMPTGGAAIMREGANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLH  1184
             KEQIFEMPTGGAAIMR+G NLLKLARKEQCLALGTRLRSKYKI YQFYRVFPNGEVQYLH
Sbjct  112   KEQIFEMPTGGAAIMRQGPNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPNGEVQYLH  171

Query  1185  PKDGVYPEKVNAGREGVGQNMRSIGKNISPIE  1280
             PKDGVYPEKVN GR+GVGQN RSIGKN+SPIE
Sbjct  172   PKDGVYPEKVNPGRQGVGQNFRSIGKNVSPIE  203



>pdb|4RKU|D Chain D, Crystal Structure Of Plant Photosystem I At 3 Angstrom 
Resolution
Length=137

 Score =   264 bits (675),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 127/137 (93%), Positives = 130/137 (95%), Gaps = 0/137 (0%)
 Frame = +3

Query  891   TPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLL  1070
             TPP LDPNTPSPIFGGSTGGLLRKAQVEEFYVITW SPKEQIFEMPTGGAAIMREG NLL
Sbjct  1     TPPELDPNTPSPIFGGSTGGLLRKAQVEEFYVITWESPKEQIFEMPTGGAAIMREGPNLL  60

Query  1071  KLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVGQNMR  1250
             KLARKEQCLALGTRLRSKYKI YQFYRVFP+GEVQYLHPKDGVYPEKVN GR+GVG N R
Sbjct  61    KLARKEQCLALGTRLRSKYKIKYQFYRVFPSGEVQYLHPKDGVYPEKVNPGRQGVGVNFR  120

Query  1251  SIGKNISPIEVKFTGKQ  1301
             SIGKN+SPIEVKFTGKQ
Sbjct  121   SIGKNVSPIEVKFTGKQ  137



>pdb|2O01|D Chain D, The Structure Of A Plant Photosystem I Supercomplex 
At 3.4 Angstrom Resolution
Length=138

 Score =   264 bits (675),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 127/137 (93%), Positives = 130/137 (95%), Gaps = 0/137 (0%)
 Frame = +3

Query  903   LDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLAR  1082
             LDPNTPSPIF GSTGGLLRKAQVEEFYVITW SPKEQIFEMPTGGAAIMREG NLLKLAR
Sbjct  2     LDPNTPSPIFAGSTGGLLRKAQVEEFYVITWESPKEQIFEMPTGGAAIMREGPNLLKLAR  61

Query  1083  KEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVGQNMRSIGK  1262
             KEQCLALGTRLRSKYKI YQFYRVFP+GEVQYLHPKDGVYPEKVN GR+GVG NMRSIGK
Sbjct  62    KEQCLALGTRLRSKYKIKYQFYRVFPSGEVQYLHPKDGVYPEKVNPGRQGVGLNMRSIGK  121

Query  1263  NISPIEVKFTGKQVYDL  1313
             N+SPIEVKFTGKQ YDL
Sbjct  122   NVSPIEVKFTGKQPYDL  138



>gb|KDO68707.1| hypothetical protein CISIN_1g047658mg [Citrus sinensis]
Length=229

 Score =   264 bits (675),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 148/211 (70%), Positives = 159/211 (75%), Gaps = 4/211 (2%)
 Frame = +3

Query  681   MAAQASLFASPLSaakpaadrvaaPWKQSLHCFSVVPRGLNKSTTAPCRPIRamaeette  860
             MA QA LF +P       +  +  PWK +       P+ L  S     R +RA A E   
Sbjct  1     MATQAGLF-TPSIITTKTSKLLLNPWKPTSSFSFTSPKPLTFSMAQ--RTVRAAAAEEKT  57

Query  861   ap-tkeaPVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGG  1037
                TKEAPVGFTPP LDPNTPSPIFGGSTGGLLRKAQVEEFYVITW SPKEQIFEMPTGG
Sbjct  58    EAPTKEAPVGFTPPQLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWESPKEQIFEMPTGG  117

Query  1038  AAIMREGANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVN  1217
             AAIMR+G NLLKLARKEQCLALGTRLRSKYKI YQFYRVFPNGEVQYLHPKDGVYPEKVN
Sbjct  118   AAIMRQGPNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPNGEVQYLHPKDGVYPEKVN  177

Query  1218  AGREGVGQNMRSIGKNISPIEVKFTGKQVYD  1310
              GR+GVG N RSIGKN+SPIE K   K+ + 
Sbjct  178   PGRQGVGVNYRSIGKNVSPIEHKTELKKFHK  208



>ref|XP_002991814.1| hypothetical protein SELMODRAFT_26984, partial [Selaginella moellendorffii]
 gb|EFJ07076.1| hypothetical protein SELMODRAFT_26984, partial [Selaginella moellendorffii]
Length=147

 Score =   261 bits (666),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 123/145 (85%), Positives = 133/145 (92%), Gaps = 0/145 (0%)
 Frame = +3

Query  879   PVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREG  1058
             P GFTPP L P+TPSPIFGGSTGGLLRKAQVEEFYVITW S KEQIFEMPTGGAAIMR G
Sbjct  3     PAGFTPPELKPDTPSPIFGGSTGGLLRKAQVEEFYVITWESGKEQIFEMPTGGAAIMRSG  62

Query  1059  ANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVG  1238
              NLLKLARKEQCLALGT+LRSK+KINYQFYRVFPNGEVQYLHPKDGVYPEKVN GR+GVG
Sbjct  63    PNLLKLARKEQCLALGTQLRSKFKINYQFYRVFPNGEVQYLHPKDGVYPEKVNPGRKGVG  122

Query  1239  QNMRSIGKNISPIEVKFTGKQVYDL  1313
              N+RSIGKN +P+++KFTGK  YD+
Sbjct  123   VNLRSIGKNCNPVDLKFTGKAAYDV  147



>gb|KHN02708.1| Photosystem I reaction center subunit II, chloroplastic [Glycine 
soja]
Length=241

 Score =   262 bits (669),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 126/136 (93%), Positives = 128/136 (94%), Gaps = 0/136 (0%)
 Frame = +3

Query  906   DPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLARK  1085
             D   PSPIFGGSTGGLLRKAQVEEFYVITW SPKEQIFEMPTGGAAIMREG NLLKLARK
Sbjct  29    DHRGPSPIFGGSTGGLLRKAQVEEFYVITWDSPKEQIFEMPTGGAAIMREGPNLLKLARK  88

Query  1086  EQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVGQNMRSIGKN  1265
             EQCLALGTRLRSKYKI YQFYRVFPNGEVQYLHPKDGVYPEKVNAGR+GVGQN RSIGKN
Sbjct  89    EQCLALGTRLRSKYKIKYQFYRVFPNGEVQYLHPKDGVYPEKVNAGRQGVGQNFRSIGKN  148

Query  1266  ISPIEVKFTGKQVYDL  1313
             +SPIEVKFTGKQ YDL
Sbjct  149   VSPIEVKFTGKQPYDL  164


 Score =   154 bits (388),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 72/77 (94%), Positives = 74/77 (96%), Gaps = 0/77 (0%)
 Frame = +3

Query  1083  KEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVGQNMRSIGK  1262
             KEQCLALGTRLRSKYKI YQFYRVFPNGEVQYLHPKDGVYPEKVNAGR+GVGQN RSIGK
Sbjct  165   KEQCLALGTRLRSKYKIKYQFYRVFPNGEVQYLHPKDGVYPEKVNAGRQGVGQNFRSIGK  224

Query  1263  NISPIEVKFTGKQVYDL  1313
             N+SPIEVKFTGKQ YDL
Sbjct  225   NVSPIEVKFTGKQPYDL  241



>gb|ACF05868.1| chloroplast photosystem I protein, partial [Populus tremula]
 gb|ACF05879.1| chloroplast photosystem I protein, partial [Populus tremula]
 gb|ACF05880.1| chloroplast photosystem I protein, partial [Populus tremula]
Length=167

 Score =   259 bits (661),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 123/132 (93%), Positives = 125/132 (95%), Gaps = 0/132 (0%)
 Frame = +3

Query  879   PVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREG  1058
             PVGFTPP LDP+TPSPIFGGSTGGLLRKAQVEEFYVITW SPKEQIFEMPTGGAAIMREG
Sbjct  36    PVGFTPPELDPSTPSPIFGGSTGGLLRKAQVEEFYVITWDSPKEQIFEMPTGGAAIMREG  95

Query  1059  ANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVG  1238
              NLLKLARKEQCLALGTRLRSKYKI YQFYRVFPNGEVQYLHPKDGVYPEKVN GR+GVG
Sbjct  96    PNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPNGEVQYLHPKDGVYPEKVNPGRQGVG  155

Query  1239  QNMRSIGKNISP  1274
             QN RSIGKN SP
Sbjct  156   QNFRSIGKNASP  167



>gb|ACF05859.1| chloroplast photosystem I protein, partial [Populus tremula]
 gb|ACF05860.1| chloroplast photosystem I protein, partial [Populus tremula]
 gb|ACF05869.1| chloroplast photosystem I protein, partial [Populus tremula]
 gb|ACF05870.1| chloroplast photosystem I protein, partial [Populus tremula]
 gb|ACF05873.1| chloroplast photosystem I protein, partial [Populus tremula]
 gb|ACF05875.1| chloroplast photosystem I protein, partial [Populus tremula]
 gb|ACF05877.1| chloroplast photosystem I protein, partial [Populus tremula]
 gb|ACF05885.1| chloroplast photosystem I protein, partial [Populus tremula]
Length=167

 Score =   259 bits (661),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 123/132 (93%), Positives = 125/132 (95%), Gaps = 0/132 (0%)
 Frame = +3

Query  879   PVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREG  1058
             PVGFTPP LDP+TPSPIFGGSTGGLLRKAQVEEFYVITW SPKEQIFEMPTGGAAIMREG
Sbjct  36    PVGFTPPELDPSTPSPIFGGSTGGLLRKAQVEEFYVITWDSPKEQIFEMPTGGAAIMREG  95

Query  1059  ANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVG  1238
              NLLKLARKEQCLALGTRLRSKYKI YQFYRVFPNGEVQYLHPKDGVYPEKVN GR+GVG
Sbjct  96    PNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPNGEVQYLHPKDGVYPEKVNPGRQGVG  155

Query  1239  QNMRSIGKNISP  1274
             QN RSIGKN SP
Sbjct  156   QNFRSIGKNASP  167



>gb|ACF05876.1| chloroplast photosystem I protein, partial [Populus tremula]
 gb|ACF05886.1| chloroplast photosystem I protein, partial [Populus tremula]
Length=167

 Score =   258 bits (660),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 123/132 (93%), Positives = 125/132 (95%), Gaps = 0/132 (0%)
 Frame = +3

Query  879   PVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREG  1058
             PVGFTPP LDP+TPSPIFGGSTGGLLRKAQVEEFYVITW SPKEQIFEMPTGGAAIMREG
Sbjct  36    PVGFTPPELDPSTPSPIFGGSTGGLLRKAQVEEFYVITWDSPKEQIFEMPTGGAAIMREG  95

Query  1059  ANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVG  1238
              NLLKLARKEQCLALGTRLRSKYKI YQFYRVFPNGEVQYLHPKDGVYPEKVN GR+GVG
Sbjct  96    PNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPNGEVQYLHPKDGVYPEKVNPGRQGVG  155

Query  1239  QNMRSIGKNISP  1274
             QN RSIGKN SP
Sbjct  156   QNFRSIGKNASP  167



>gb|ACF05884.1| chloroplast photosystem I protein, partial [Populus tremula]
Length=167

 Score =   258 bits (660),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 123/132 (93%), Positives = 125/132 (95%), Gaps = 0/132 (0%)
 Frame = +3

Query  879   PVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREG  1058
             PVGFTPP LDP+TPSPIFGGSTGGLLRKAQVEEFYVITW SPKEQIFEMPTGGAAIMREG
Sbjct  36    PVGFTPPELDPSTPSPIFGGSTGGLLRKAQVEEFYVITWDSPKEQIFEMPTGGAAIMREG  95

Query  1059  ANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVG  1238
              NLLKLARKEQCLALGTRLRSKYKI YQFYRVFPNGEVQYLHPKDGVYPEKVN GR+GVG
Sbjct  96    PNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPNGEVQYLHPKDGVYPEKVNPGRQGVG  155

Query  1239  QNMRSIGKNISP  1274
             QN RSIGKN SP
Sbjct  156   QNFRSIGKNASP  167



>gb|ACF05871.1| chloroplast photosystem I protein, partial [Populus tremula]
Length=167

 Score =   258 bits (660),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 123/132 (93%), Positives = 125/132 (95%), Gaps = 0/132 (0%)
 Frame = +3

Query  879   PVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREG  1058
             PVGFTPP LDP+TPSPIFGGSTGGLLRKAQVEEFYVITW SPKEQIFEMPTGGAAIMREG
Sbjct  36    PVGFTPPELDPSTPSPIFGGSTGGLLRKAQVEEFYVITWESPKEQIFEMPTGGAAIMREG  95

Query  1059  ANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVG  1238
              NLLKLARKEQCLALGTRLRSKYKI YQFYRVFPNGEVQYLHPKDGVYPEKVN GR+GVG
Sbjct  96    PNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPNGEVQYLHPKDGVYPEKVNPGRQGVG  155

Query  1239  QNMRSIGKNISP  1274
             QN RSIGKN SP
Sbjct  156   QNFRSIGKNASP  167



>gb|ACF05855.1| chloroplast photosystem I protein, partial [Populus tremula]
 gb|ACF05856.1| chloroplast photosystem I protein, partial [Populus tremula]
 gb|ACF05857.1| chloroplast photosystem I protein, partial [Populus tremula]
 gb|ACF05858.1| chloroplast photosystem I protein, partial [Populus tremula]
 gb|ACF05861.1| chloroplast photosystem I protein, partial [Populus tremula]
 gb|ACF05862.1| chloroplast photosystem I protein, partial [Populus tremula]
 gb|ACF05863.1| chloroplast photosystem I protein, partial [Populus tremula]
 gb|ACF05864.1| chloroplast photosystem I protein, partial [Populus tremula]
 gb|ACF05865.1| chloroplast photosystem I protein, partial [Populus tremula]
 gb|ACF05866.1| chloroplast photosystem I protein, partial [Populus tremula]
 gb|ACF05867.1| chloroplast photosystem I protein, partial [Populus tremula]
 gb|ACF05872.1| chloroplast photosystem I protein, partial [Populus tremula]
 gb|ACF05874.1| chloroplast photosystem I protein, partial [Populus tremula]
 gb|ACF05878.1| chloroplast photosystem I protein, partial [Populus tremula]
 gb|ACF05881.1| chloroplast photosystem I protein, partial [Populus tremula]
 gb|ACF05882.1| chloroplast photosystem I protein, partial [Populus tremula]
 gb|ACF05883.1| chloroplast photosystem I protein, partial [Populus tremula]
 gb|ACF05887.1| chloroplast photosystem I protein, partial [Populus tremula]
 gb|ACF05888.1| chloroplast photosystem I protein, partial [Populus tremula]
 gb|ACF05889.1| chloroplast photosystem I protein, partial [Populus tremula]
 gb|ACF05890.1| chloroplast photosystem I protein, partial [Populus tremula]
 gb|ACF05891.1| chloroplast photosystem I protein, partial [Populus tremula]
 gb|ACF05892.1| chloroplast photosystem I protein, partial [Populus tremula]
Length=167

 Score =   258 bits (660),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 123/132 (93%), Positives = 125/132 (95%), Gaps = 0/132 (0%)
 Frame = +3

Query  879   PVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREG  1058
             PVGFTPP LDP+TPSPIFGGSTGGLLRKAQVEEFYVITW SPKEQIFEMPTGGAAIMREG
Sbjct  36    PVGFTPPELDPSTPSPIFGGSTGGLLRKAQVEEFYVITWDSPKEQIFEMPTGGAAIMREG  95

Query  1059  ANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVG  1238
              NLLKLARKEQCLALGTRLRSKYKI YQFYRVFPNGEVQYLHPKDGVYPEKVN GR+GVG
Sbjct  96    PNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPNGEVQYLHPKDGVYPEKVNPGRQGVG  155

Query  1239  QNMRSIGKNISP  1274
             QN RSIGKN SP
Sbjct  156   QNFRSIGKNASP  167



>ref|XP_001751403.1| predicted protein [Physcomitrella patens]
 gb|EDQ83720.1| predicted protein [Physcomitrella patens]
Length=166

 Score =   257 bits (656),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 122/145 (84%), Positives = 129/145 (89%), Gaps = 0/145 (0%)
 Frame = +3

Query  879   PVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREG  1058
             P GFTPPTL+ +TP+PIFGGSTGGLLRKAQVEEFYVITW SPKEQIFEMPTGGAAIMR G
Sbjct  22    PKGFTPPTLNADTPAPIFGGSTGGLLRKAQVEEFYVITWESPKEQIFEMPTGGAAIMRSG  81

Query  1059  ANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVG  1238
              NLLKLARKEQCLALG RLR+K+KI YQFYRVFPNGEVQYLHPKDGVYPEKVNAGR  VG
Sbjct  82    PNLLKLARKEQCLALGARLRTKFKIQYQFYRVFPNGEVQYLHPKDGVYPEKVNAGRSPVG  141

Query  1239  QNMRSIGKNISPIEVKFTGKQVYDL  1313
              N RSIGKN +P E+KF  KQ YDL
Sbjct  142   VNNRSIGKNANPAELKFAQKQAYDL  166



>ref|XP_001768962.1| predicted protein [Physcomitrella patens]
 gb|EDQ66316.1| predicted protein [Physcomitrella patens]
Length=166

 Score =   257 bits (656),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 122/145 (84%), Positives = 129/145 (89%), Gaps = 0/145 (0%)
 Frame = +3

Query  879   PVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREG  1058
             P GFTPPTL+ +TP+PIFGGSTGGLLRKAQVEEFYVITW SPKEQIFEMPTGGAAIMR G
Sbjct  22    PKGFTPPTLNADTPAPIFGGSTGGLLRKAQVEEFYVITWESPKEQIFEMPTGGAAIMRSG  81

Query  1059  ANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVG  1238
              NLLKLARKEQCLALG RLR+K+KI YQFYRVFPNGEVQYLHPKDGVYPEKVNAGR  VG
Sbjct  82    PNLLKLARKEQCLALGARLRTKFKIQYQFYRVFPNGEVQYLHPKDGVYPEKVNAGRSPVG  141

Query  1239  QNMRSIGKNISPIEVKFTGKQVYDL  1313
              N RSIGKN +P E+KF  KQ YDL
Sbjct  142   VNNRSIGKNANPAELKFAHKQAYDL  166



>ref|XP_001752431.1| predicted protein [Physcomitrella patens]
 gb|EDQ82670.1| predicted protein [Physcomitrella patens]
Length=210

 Score =   258 bits (658),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 121/145 (83%), Positives = 129/145 (89%), Gaps = 0/145 (0%)
 Frame = +3

Query  879   PVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREG  1058
             P GFTPPTL+ +TP+PIFGGSTGGLLRKAQVEEFYVITW SPKEQIFEMPTGGAAIMR G
Sbjct  66    PKGFTPPTLNADTPAPIFGGSTGGLLRKAQVEEFYVITWESPKEQIFEMPTGGAAIMRSG  125

Query  1059  ANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVG  1238
              NLLKLARKEQCLALG RLR+K+KI YQFYRVFPNGEVQYLHPKDGVYPEKVNAGR  VG
Sbjct  126   PNLLKLARKEQCLALGARLRTKFKIQYQFYRVFPNGEVQYLHPKDGVYPEKVNAGRTAVG  185

Query  1239  QNMRSIGKNISPIEVKFTGKQVYDL  1313
              N RSIG+N +P E+KF  KQ YDL
Sbjct  186   VNNRSIGQNANPAELKFAHKQAYDL  210



>ref|XP_001765579.1| predicted protein [Physcomitrella patens]
 gb|EDQ69629.1| predicted protein, partial [Physcomitrella patens]
Length=156

 Score =   254 bits (648),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 121/143 (85%), Positives = 128/143 (90%), Gaps = 0/143 (0%)
 Frame = +3

Query  885   GFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGAN  1064
             GFTPPTL+ +TP+PIFGGSTGGLLRKAQVEEFYVITW SPKEQIFEMPTGGAAIMR G N
Sbjct  14    GFTPPTLNADTPAPIFGGSTGGLLRKAQVEEFYVITWESPKEQIFEMPTGGAAIMRSGPN  73

Query  1065  LLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVGQN  1244
             LLKLARKEQCLALG RLR+K+KI YQFYRVFPNGEVQYLHPKDGVYPEKVNAGR  VG N
Sbjct  74    LLKLARKEQCLALGARLRTKFKIQYQFYRVFPNGEVQYLHPKDGVYPEKVNAGRSPVGVN  133

Query  1245  MRSIGKNISPIEVKFTGKQVYDL  1313
              RSIGKN +P E+KF  KQ YDL
Sbjct  134   NRSIGKNANPAELKFAQKQAYDL  156



>ref|XP_007226637.1| hypothetical protein PRUPE_ppa022366mg [Prunus persica]
 gb|EMJ27836.1| hypothetical protein PRUPE_ppa022366mg [Prunus persica]
Length=192

 Score =   250 bits (638),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 143/211 (68%), Positives = 155/211 (73%), Gaps = 19/211 (9%)
 Frame = +3

Query  681   MAAQASLFASPLSaakpaadrvaaPWKQSLHCFSVVPRGLNKSTTAPCRPIRamaeette  860
             MA QA+LF    SA K + +R   PWKQS+    + P+ L  S+T     I A AEE T 
Sbjct  1     MATQATLFTPTPSAPKTSVERSTVPWKQSVSSSFMAPKPLKLSSTTRTMRINAAAEEKTV  60

Query  861   aptkeaPVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGA  1040
             AP KEAPVGFTPP LDP TPSPIFGGSTGGLLRKAQ EEF                    
Sbjct  61    APPKEAPVGFTPPELDPTTPSPIFGGSTGGLLRKAQEEEFL-------------------  101

Query  1041  AIMREGANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNA  1220
             +IMREG NLLKLARKEQCLALGTRLRSKYKI YQFYRVFPNGEVQYLHPKDGVYPEKVN 
Sbjct  102   SIMREGPNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPNGEVQYLHPKDGVYPEKVNP  161

Query  1221  GREGVGQNMRSIGKNISPIEVKFTGKQVYDL  1313
             GR+GVGQN RSIGKN++PIEVKFTGKQVYD+
Sbjct  162   GRQGVGQNFRSIGKNVNPIEVKFTGKQVYDI  192



>gb|ABK96248.1| unknown [Populus trichocarpa x Populus deltoides]
Length=166

 Score =   247 bits (631),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 120/134 (90%), Positives = 122/134 (91%), Gaps = 0/134 (0%)
 Frame = +3

Query  912   NTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLARKEQ  1091
               P   F  STGGLLRKAQVEEFYVITW SPKEQIFEMPTGGAAIMREG NLLKLARKEQ
Sbjct  33    RVPHHQFLVSTGGLLRKAQVEEFYVITWDSPKEQIFEMPTGGAAIMREGPNLLKLARKEQ  92

Query  1092  CLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVGQNMRSIGKNIS  1271
             CLALGTRLRSKYKI YQFYRVFPNGEVQYLHPKDGVYPEKVN GR+GVGQN RSIGKN+S
Sbjct  93    CLALGTRLRSKYKIKYQFYRVFPNGEVQYLHPKDGVYPEKVNPGRQGVGQNFRSIGKNVS  152

Query  1272  PIEVKFTGKQVYDL  1313
             PIEVKFTGKQVYDL
Sbjct  153   PIEVKFTGKQVYDL  166



>ref|XP_003592408.1| Photosystem I reaction center subunit II [Medicago truncatula]
 gb|AES62659.1| photosystem I reaction center subunit II [Medicago truncatula]
Length=193

 Score =   245 bits (626),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 133/213 (62%), Positives = 147/213 (69%), Gaps = 20/213 (9%)
 Frame = +3

Query  675   MAMAAQASLFASPLSaakpaadrvaaPWKQSLHCFSVVPRGLNKSTTAPCRPIRamaeet  854
             MAMA Q +LF  P   +    + V+ PWKQS       P     + ++  +         
Sbjct  1     MAMATQTTLFTPPF-FSAKPNEHVSVPWKQSPTLSFTNPNLFKLTISSNIK------TAA  53

Query  855   teaptkeaPVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTG  1034
                   EAPVGFTPP LDPNTPSPIF              EF+VITW SPKEQIFE+  G
Sbjct  54    VTEEATEAPVGFTPPELDPNTPSPIFS-------------EFHVITWDSPKEQIFEIANG  100

Query  1035  GAAIMREGANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKV  1214
             GAAIMREG NLLKLARKEQCLALGTRLRSKYKI YQFYRVFPNGEVQYLHPKDGVYPEKV
Sbjct  101   GAAIMREGPNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPNGEVQYLHPKDGVYPEKV  160

Query  1215  NAGREGVGQNMRSIGKNISPIEVKFTGKQVYDL  1313
             N GR+GVGQN  SIGKN+SPIEVKF+GKQVY+L
Sbjct  161   NLGRQGVGQNFGSIGKNVSPIEVKFSGKQVYEL  193



>gb|EMS56878.1| Photosystem I reaction center subunit II, chloroplastic [Triticum 
urartu]
Length=156

 Score =   240 bits (612),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 113/124 (91%), Positives = 118/124 (95%), Gaps = 0/124 (0%)
 Frame = +3

Query  942   TGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLARKEQCLALGTRLRS  1121
             TGGLLRKAQVEEFYVITWTSPKEQ+FEMPTGGAAIMREG NLLKLARKEQCLALG RLRS
Sbjct  33    TGGLLRKAQVEEFYVITWTSPKEQVFEMPTGGAAIMREGPNLLKLARKEQCLALGNRLRS  92

Query  1122  KYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVGQNMRSIGKNISPIEVKFTGKQ  1301
             KYKI YQFYRVFPNGEVQYLHPKDGVYPEKVNAGR+GVGQN RSIGKN+SPIEVKFTGK 
Sbjct  93    KYKIAYQFYRVFPNGEVQYLHPKDGVYPEKVNAGRQGVGQNFRSIGKNVSPIEVKFTGKN  152

Query  1302  VYDL  1313
              +D+
Sbjct  153   SFDI  156



>emb|CAL25356.1| photosystem I reaction center subunit II [Platanus x acerifolia]
Length=122

 Score =   236 bits (601),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 113/122 (93%), Positives = 116/122 (95%), Gaps = 0/122 (0%)
 Frame = +3

Query  948   GLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLARKEQCLALGTRLRSKY  1127
             GLLRKAQVEEFYVITW SPKEQIFEMPTGGAAIMR+G NLLKLARKEQCLALGTRLRSKY
Sbjct  1     GLLRKAQVEEFYVITWDSPKEQIFEMPTGGAAIMRQGPNLLKLARKEQCLALGTRLRSKY  60

Query  1128  KINYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVGQNMRSIGKNISPIEVKFTGKQVY  1307
             KI YQFYRVFPNGEVQYLHPKDGVYPEKVN GR+GVGQN RSIGKN +PIEVKFTGKQVY
Sbjct  61    KIKYQFYRVFPNGEVQYLHPKDGVYPEKVNPGRQGVGQNFRSIGKNANPIEVKFTGKQVY  120

Query  1308  DL  1313
             DL
Sbjct  121   DL  122



>ref|XP_005647040.1| PSI-D1 precursor [Coccomyxa subellipsoidea C-169]
 gb|EIE22496.1| PSI-D1 precursor [Coccomyxa subellipsoidea C-169]
Length=192

 Score =   235 bits (599),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 111/145 (77%), Positives = 124/145 (86%), Gaps = 1/145 (1%)
 Frame = +3

Query  882   VGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGA  1061
               + PPTLDP+TPSPIFGGSTGGLLRKAQ+EEFYVITW + KEQ+FEMPTGGAAIMR G 
Sbjct  48    AAWKPPTLDPSTPSPIFGGSTGGLLRKAQIEEFYVITWDAKKEQVFEMPTGGAAIMRSGP  107

Query  1062  NLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVGQ  1241
             NLLKLARKEQCLAL T+LR+K+K + Q YRVFP+GEVQYLHPKDGVYPEKVNAGR  VG 
Sbjct  108   NLLKLARKEQCLALLTQLRNKFKTDGQIYRVFPDGEVQYLHPKDGVYPEKVNAGRTAVGA  167

Query  1242  NMRSIGKNISPIEVKFTGK-QVYDL  1313
               RSIGKN +P+ VKFTGK   YD+
Sbjct  168   KDRSIGKNTNPVAVKFTGKLGTYDV  192



>ref|XP_002992973.1| hypothetical protein SELMODRAFT_448960 [Selaginella moellendorffii]
 gb|EFJ05919.1| hypothetical protein SELMODRAFT_448960 [Selaginella moellendorffii]
Length=976

 Score =   252 bits (644),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 117/137 (85%), Positives = 127/137 (93%), Gaps = 0/137 (0%)
 Frame = +3

Query  903   LDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLAR  1082
             L P+TPSPIFGGSTGGLLRKAQVEEFYVITW S KEQIFEMPTGGAAIMR G NLLKLAR
Sbjct  840   LKPDTPSPIFGGSTGGLLRKAQVEEFYVITWESGKEQIFEMPTGGAAIMRSGPNLLKLAR  899

Query  1083  KEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVGQNMRSIGK  1262
             KEQCLALGT+LRSK+KINYQFYRVFPNGEVQYLHPKDGVYPEKVN GR+GVG N+RSIGK
Sbjct  900   KEQCLALGTQLRSKFKINYQFYRVFPNGEVQYLHPKDGVYPEKVNPGRKGVGVNLRSIGK  959

Query  1263  NISPIEVKFTGKQVYDL  1313
             N +P+++KFTGK  YD+
Sbjct  960   NCNPVDLKFTGKAAYDV  976



>gb|KIZ01091.1| Photosystem I reaction center subunit II, chloroplastic [Monoraphidium 
neglectum]
Length=187

 Score =   229 bits (585),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 108/138 (78%), Positives = 121/138 (88%), Gaps = 0/138 (0%)
 Frame = +3

Query  885   GFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGAN  1064
              FT PTL+P+TPSPIFGGSTGGLL+KAQVEEFYVITW S KEQIFEMP GGAAIMR+G N
Sbjct  45    AFTAPTLNPDTPSPIFGGSTGGLLKKAQVEEFYVITWESAKEQIFEMPLGGAAIMRKGPN  104

Query  1065  LLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVGQN  1244
             LLKLARKE CLAL T+LR+K+KI   FYRV+P GEV+YLHPKDGVYPEKVNAGR G  QN
Sbjct  105   LLKLARKEHCLALTTQLRNKFKIQPAFYRVYPTGEVEYLHPKDGVYPEKVNAGRIGENQN  164

Query  1245  MRSIGKNISPIEVKFTGK  1298
              R IG+N++PI+VKFTGK
Sbjct  165   FRRIGENVNPIKVKFTGK  182



>ref|XP_007511428.1| predicted protein [Bathycoccus prasinos]
 emb|CCO17549.1| predicted protein [Bathycoccus prasinos]
Length=199

 Score =   230 bits (586),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 108/142 (76%), Positives = 120/142 (85%), Gaps = 0/142 (0%)
 Frame = +3

Query  888   FTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANL  1067
             ++ P LDPNTPSPIFGGSTGGLLRKAQVEEFYV+TW + KEQIFEMPTGGAAIMR+G NL
Sbjct  58    WSAPKLDPNTPSPIFGGSTGGLLRKAQVEEFYVLTWEAKKEQIFEMPTGGAAIMRKGPNL  117

Query  1068  LKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVGQNM  1247
             LKLARKEQC+AL T  R+K   N   YRVFP+GEVQYLHPKDGVYPEKVNAGR G  QNM
Sbjct  118   LKLARKEQCMALVTTFRAKKIANGCIYRVFPSGEVQYLHPKDGVYPEKVNAGRVGANQNM  177

Query  1248  RSIGKNISPIEVKFTGKQVYDL  1313
             RSIGKN +P+ VKF GK  +D+
Sbjct  178   RSIGKNTNPVNVKFQGKGTFDV  199



>ref|XP_002953316.1| hypothetical protein VOLCADRAFT_121148 [Volvox carteri f. nagariensis]
 gb|EFJ45626.1| hypothetical protein VOLCADRAFT_121148 [Volvox carteri f. nagariensis]
Length=179

 Score =   229 bits (584),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 106/137 (77%), Positives = 123/137 (90%), Gaps = 0/137 (0%)
 Frame = +3

Query  888   FTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANL  1067
             +TPPTL+P+TPSPIFGGSTGGLLRKAQ EEFYVITW S KEQIFEMPTGGAAIMR+G NL
Sbjct  36    WTPPTLNPDTPSPIFGGSTGGLLRKAQQEEFYVITWDSKKEQIFEMPTGGAAIMRQGPNL  95

Query  1068  LKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVGQNM  1247
             LK A+KEQCLAL T+LR+K+K+   FYRVFP+G+VQYLHP DGVYPEKVNAGR GV QN 
Sbjct  96    LKFAKKEQCLALTTQLRTKFKLTPAFYRVFPDGKVQYLHPADGVYPEKVNAGRVGVNQNF  155

Query  1248  RSIGKNISPIEVKFTGK  1298
             R IG+N++PI+VKF+G+
Sbjct  156   RRIGQNVNPIKVKFSGR  172



>ref|XP_012077668.1| PREDICTED: PHD finger protein ING1 [Jatropha curcas]
 gb|KDP33374.1| hypothetical protein JCGZ_12923 [Jatropha curcas]
Length=240

 Score =   228 bits (581),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 130/184 (71%), Positives = 153/184 (83%), Gaps = 9/184 (5%)
 Frame = +2

Query  92   MSFIDEFETNLEVLPNILQKKYGLMRDLDRSLQEVQRQNDQRCQLEVEDMKQRIKSGNIA  271
            MSF+DEF+ NLE LPNILQKKY L+RDLD+SLQE+QRQN+QRC+ E+ED+K+ +K GNI 
Sbjct  1    MSFLDEFQANLESLPNILQKKYALLRDLDKSLQEIQRQNEQRCEQEIEDIKRGVKVGNIT  60

Query  272  SDSSLIKFSDDALDEQKHAIRIADEKVALAIQAYDLVDTHIQQLDQYLKKFDEELRRVAE  451
             D+SLI+FSD+ LDEQKH+IRIADEKVALA+QAYDLVD HIQQLDQYLKKFDEELRR  E
Sbjct  61   PDTSLIRFSDETLDEQKHSIRIADEKVALAVQAYDLVDAHIQQLDQYLKKFDEELRR--E  118

Query  452  RENAVATGSTTSNVDNNVksgrsgdsskggrkkTRL-------ATATPAANPTGMDLDLP  610
            RENA AT S  S+VD + KSGR G+S +GGRKKTRL        TA  +ANPTGM+LD P
Sbjct  119  RENAAATASPGSSVDGSAKSGRGGESGRGGRKKTRLATAAAEATTAATSANPTGMELDCP  178

Query  611  VDPS  622
            VDP+
Sbjct  179  VDPN  182



>gb|KIZ02718.1| Photosystem I reaction center subunit II, chloroplastic [Monoraphidium 
neglectum]
Length=169

 Score =   225 bits (574),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 107/137 (78%), Positives = 121/137 (88%), Gaps = 0/137 (0%)
 Frame = +3

Query  888   FTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANL  1067
             F+ PTL+P+TPSPIFGGSTGGLL+KAQVEEFYVITW S KEQIFEMP GGAAIMR+G NL
Sbjct  28    FSAPTLNPDTPSPIFGGSTGGLLKKAQVEEFYVITWESAKEQIFEMPLGGAAIMRKGPNL  87

Query  1068  LKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVGQNM  1247
             LKLARKE CLAL T+LR+K+KI   FYRV+P GEV+YLHPKDGVYPEKVNAGR G  QN 
Sbjct  88    LKLARKEHCLALTTQLRNKFKIQPAFYRVYPTGEVEYLHPKDGVYPEKVNAGRIGENQNF  147

Query  1248  RSIGKNISPIEVKFTGK  1298
             R IG+N++PI+VKFTGK
Sbjct  148   RRIGENVNPIKVKFTGK  164



>ref|XP_002504652.1| photosystem I subunit II, chloroplast precursor [Micromonas sp. 
RCC299]
 gb|ACO65910.1| photosystem I subunit II, chloroplast precursor [Micromonas sp. 
RCC299]
Length=216

 Score =   227 bits (578),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 107/141 (76%), Positives = 118/141 (84%), Gaps = 0/141 (0%)
 Frame = +3

Query  888   FTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANL  1067
             ++PP L+PNTPSPIFGGSTGGLLRKAQVEEFYV+TW +PKE IFEMPTGGAAIMR+G NL
Sbjct  61    WSPPKLNPNTPSPIFGGSTGGLLRKAQVEEFYVLTWEAPKEMIFEMPTGGAAIMRKGPNL  120

Query  1068  LKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVGQNM  1247
             LKLARKEQCLAL   +R+K KIN   YRVFP+GEVQYLHPKDGVYPEKVN GR G   NM
Sbjct  121   LKLARKEQCLALLNSMRAKNKINGCVYRVFPSGEVQYLHPKDGVYPEKVNKGRVGANNNM  180

Query  1248  RSIGKNISPIEVKFTGKQVYD  1310
             RSIGKN +P  +KF GK   D
Sbjct  181   RSIGKNANPASIKFGGKMYKD  201



>ref|XP_003063552.1| photosystem I subunit II, chloroplast precursor [Micromonas pusilla 
CCMP1545]
 gb|EEH51925.1| photosystem I subunit II, chloroplast precursor [Micromonas pusilla 
CCMP1545]
Length=225

 Score =   227 bits (578),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 107/141 (76%), Positives = 118/141 (84%), Gaps = 0/141 (0%)
 Frame = +3

Query  888   FTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANL  1067
             ++PP L+PNTPSPIFGGSTGGLLRKAQVEEFYV+TW +PKE IFEMPTGGAAIMR+G NL
Sbjct  70    WSPPKLNPNTPSPIFGGSTGGLLRKAQVEEFYVLTWEAPKEMIFEMPTGGAAIMRKGPNL  129

Query  1068  LKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVGQNM  1247
             LKLARKEQCLAL   +R+K KIN   YRVFP+GEVQYLHPKDGVYPEKVN GR G   NM
Sbjct  130   LKLARKEQCLALLNSMRAKNKINGCVYRVFPSGEVQYLHPKDGVYPEKVNKGRVGANNNM  189

Query  1248  RSIGKNISPIEVKFTGKQVYD  1310
             RSIGKN +P  +KF GK   D
Sbjct  190   RSIGKNANPASIKFGGKLGSD  210



>ref|XP_011400522.1| Photosystem I reaction center subunit II, chloroplastic [Auxenochlorella 
protothecoides]
 gb|KFM27539.1| Photosystem I reaction center subunit II, chloroplastic [Auxenochlorella 
protothecoides]
Length=199

 Score =   225 bits (574),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 106/142 (75%), Positives = 120/142 (85%), Gaps = 0/142 (0%)
 Frame = +3

Query  888   FTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANL  1067
             F+PPTLDP+TPSP FGGSTGGLLRKAQVEEF+VITW S KEQ+FEMPT GAAIMREG NL
Sbjct  56    FSPPTLDPDTPSPTFGGSTGGLLRKAQVEEFHVITWNSKKEQVFEMPTAGAAIMREGPNL  115

Query  1068  LKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVGQNM  1247
             LKL+RKEQCLAL T+LR+K+KI+   YRVFPNGE QYLHPKDGVYPEKVN GR+ V    
Sbjct  116   LKLSRKEQCLALLTQLRTKFKIDGAIYRVFPNGETQYLHPKDGVYPEKVNPGRKEVNAVF  175

Query  1248  RSIGKNISPIEVKFTGKQVYDL  1313
             R IG N +P +VKFTGK  Y++
Sbjct  176   RRIGSNTNPAKVKFTGKPTYEV  197



>emb|CEG01861.1| Photosystem I PsaD [Ostreococcus tauri]
Length=188

 Score =   224 bits (572),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 107/140 (76%), Positives = 117/140 (84%), Gaps = 0/140 (0%)
 Frame = +3

Query  879   PVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREG  1058
             P  +T P LDPNTPSPIFGGSTGGLLRKAQVEEFYV+TW + KE IFEMPTGGAAIMR+G
Sbjct  43    PAVWTAPKLDPNTPSPIFGGSTGGLLRKAQVEEFYVLTWEAKKEAIFEMPTGGAAIMRKG  102

Query  1059  ANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVG  1238
              NLLKLARKEQCLAL    RSK K++   YRVFP+GEVQYLHPKDGVYPEKVN GR G  
Sbjct  103   PNLLKLARKEQCLALLNTFRSKMKLDGCIYRVFPSGEVQYLHPKDGVYPEKVNKGRVGAN  162

Query  1239  QNMRSIGKNISPIEVKFTGK  1298
             QNMRSIGKN +P ++KF GK
Sbjct  163   QNMRSIGKNTNPAKIKFQGK  182



>ref|XP_002518170.1| Inhibitor of growth protein, putative [Ricinus communis]
 gb|EEF44303.1| Inhibitor of growth protein, putative [Ricinus communis]
Length=242

 Score =   225 bits (574),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 128/186 (69%), Positives = 154/186 (83%), Gaps = 11/186 (6%)
 Frame = +2

Query  92   MSFIDEFETNLEVLPNILQKKYGLMRDLDRSLQEVQRQNDQRCQLEVEDMKQRIKSGNIA  271
            MSF+DEF+ NLE LPNILQKKY L+RDLD+SLQE+QRQN+QRC+ E+ED+K+ +K+GNI 
Sbjct  1    MSFLDEFQANLESLPNILQKKYALLRDLDKSLQEIQRQNEQRCEREIEDIKRGVKAGNIT  60

Query  272  SDSSLIKFSDDALDEQKHAIRIADEKVALAIQAYDLVDTHIQQLDQYLKKFDEELRRVAE  451
             D+SLI+FSDDALDEQKH+IRIADEKV LA+QAYDLVD HIQQLDQYLKKFDEELRR  E
Sbjct  61   PDTSLIRFSDDALDEQKHSIRIADEKVTLAVQAYDLVDAHIQQLDQYLKKFDEELRR--E  118

Query  452  RENAVATGSTTSNVDNNVksgrsgdsskggrkkTRL---------ATATPAANPTGMDLD  604
            RE+A AT   +S++D + K+GRS D  +GGRKKTRL         ATA  +ANPTGM+LD
Sbjct  119  RESATATALPSSSLDGSAKTGRSSDGGRGGRKKTRLATASAVTEAATAATSANPTGMELD  178

Query  605  LPVDPS  622
             PVDP+
Sbjct  179  CPVDPN  184



>ref|XP_001697722.1| photosystem I reaction center subunit II, 20 kDa [Chlamydomonas 
reinhardtii]
 sp|Q39615.1|PSAD_CHLRE RecName: Full=Photosystem I reaction center subunit II, chloroplastic; 
AltName: Full=Photosystem I 20 kDa subunit; Short=PSI-D; 
Flags: Precursor [Chlamydomonas reinhardtii]
 gb|AAL73208.1|AF335592_1 photosystem I subunit [Chlamydomonas reinhardtii]
 emb|CAA56122.1| psaD [Chlamydomonas reinhardtii]
 emb|CAA52440.1| PSI reaction center, subunit II [Chlamydomonas reinhardtii]
 gb|EDO99874.1| photosystem I reaction center subunit II, 20 kDa [Chlamydomonas 
reinhardtii]
Length=196

 Score =   223 bits (568),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 103/139 (74%), Positives = 122/139 (88%), Gaps = 0/139 (0%)
 Frame = +3

Query  888   FTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANL  1067
             +T PTL+P+TPSPIFGGSTGGLLRKAQ EEFYVITW + KEQIFEMPTGGAAIMR+G NL
Sbjct  53    WTVPTLNPDTPSPIFGGSTGGLLRKAQTEEFYVITWEAKKEQIFEMPTGGAAIMRQGPNL  112

Query  1068  LKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVGQNM  1247
             LK  +KEQCLAL T+LR+K+K+   FYRVFP+G+VQYLHP DGVYPEKVNAGR G  QNM
Sbjct  113   LKFGKKEQCLALTTQLRNKFKLTPCFYRVFPDGKVQYLHPADGVYPEKVNAGRVGANQNM  172

Query  1248  RSIGKNISPIEVKFTGKQV  1304
             R IG+N++PI+VKF+G+ +
Sbjct  173   RRIGQNVNPIKVKFSGRMM  191



>ref|XP_009785672.1| PREDICTED: PHD finger protein ING1 isoform X1 [Nicotiana sylvestris]
Length=239

 Score =   224 bits (571),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 129/184 (70%), Positives = 146/184 (79%), Gaps = 10/184 (5%)
 Frame = +2

Query  92   MSFIDEFETNLEVLPNILQKKYGLMRDLDRSLQEVQRQNDQRCQLEVEDMKQRIKSGNIA  271
            MSFIDEF+ N+E LPN L++KY L+RDLD+SLQ VQRQN+QRC+ E+EDM QRIK+GN+ 
Sbjct  1    MSFIDEFQANIEALPNHLRRKYALLRDLDKSLQGVQRQNEQRCEKEIEDMIQRIKAGNVT  60

Query  272  SDSSLIKFSDDALDEQKHAIRIADEKVALAIQAYDLVDTHIQQLDQYLKKFDEELRRVAE  451
             DSSLIKFSDDALDEQKHAIRIADEKVALA QAYDLVD HIQQLDQYLKKFDEELRR  E
Sbjct  61   PDSSLIKFSDDALDEQKHAIRIADEKVALASQAYDLVDAHIQQLDQYLKKFDEELRR--E  118

Query  452  RENAVATGSTTSNVDNNVksgrsgdsskggrkkTRL-------ATATPAANPTGMDLDLP  610
            R+ AV TG+  + V+NN          KGGRKKTRL       ATA  AA P+GMDLDLP
Sbjct  119  RDVAVVTGTPATTVENN-GKSGRSGEGKGGRKKTRLATAAAATATAAAAATPSGMDLDLP  177

Query  611  VDPS  622
            VDP+
Sbjct  178  VDPN  181



>ref|XP_005847397.1| hypothetical protein CHLNCDRAFT_35549 [Chlorella variabilis]
 gb|EFN55295.1| hypothetical protein CHLNCDRAFT_35549 [Chlorella variabilis]
Length=186

 Score =   222 bits (566),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 105/140 (75%), Positives = 119/140 (85%), Gaps = 0/140 (0%)
 Frame = +3

Query  879   PVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREG  1058
             P  + PP LD + PSPIFGGSTGGLLR+AQVEEF+VITW + KEQIFEMPTGGAAIMR+G
Sbjct  42    PKPWAPPALDASAPSPIFGGSTGGLLRQAQVEEFHVITWEAKKEQIFEMPTGGAAIMRQG  101

Query  1059  ANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVG  1238
              NLLKLARKEQCLAL T+LR+K+K +   YRVFPNGEVQYLHPKDGVYPEKVNAGR G  
Sbjct  102   PNLLKLARKEQCLALLTQLRTKFKTDGFIYRVFPNGEVQYLHPKDGVYPEKVNAGRSGDN  161

Query  1239  QNMRSIGKNISPIEVKFTGK  1298
              NMR IG+N +P ++KFTGK
Sbjct  162   TNMRRIGQNTNPSQIKFTGK  181



>ref|XP_006420512.1| hypothetical protein CICLE_v10005726mg [Citrus clementina]
 gb|ESR33752.1| hypothetical protein CICLE_v10005726mg [Citrus clementina]
 gb|KDO43052.1| hypothetical protein CISIN_1g025753mg [Citrus sinensis]
Length=246

 Score =   224 bits (570),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 126/190 (66%), Positives = 152/190 (80%), Gaps = 15/190 (8%)
 Frame = +2

Query  92   MSFIDEFETNLEVLPNILQKKYGLMRDLDRSLQEVQRQNDQRCQLEVEDMKQRIKSGNIA  271
            MSF+DEF+ NLE LPNILQKKY L+RDLD+SLQE+QRQN+QRC+ E+ED+ + I++GNI 
Sbjct  1    MSFLDEFQANLESLPNILQKKYALLRDLDKSLQEIQRQNEQRCEQEIEDLMREIRAGNIT  60

Query  272  SDSSLIKFSDDALDEQKHAIRIADEKVALAIQAYDLVDTHIQQLDQYLKKFDEELRRVAE  451
             ++SLI+FSDDALDEQKH+IRIADEKVALA+QAYDLVDTHIQQLDQYLK FDEELRR  E
Sbjct  61   PNTSLIRFSDDALDEQKHSIRIADEKVALAVQAYDLVDTHIQQLDQYLKNFDEELRR--E  118

Query  452  RENAVATGSTTSNVDNNVksgrsgdsskggrkkTRL-------------ATATPAANPTG  592
            R++   T S   ++D + KSGRS +  +GGRKKTRL             A ATP ANPTG
Sbjct  119  RDSVATTASPAPSLDGSTKSGRSSEGGRGGRKKTRLATAAAAAAAAVTEAAATPVANPTG  178

Query  593  MDLDLPVDPS  622
            M+LDLPVDP+
Sbjct  179  MELDLPVDPN  188



>ref|XP_006492151.1| PREDICTED: PHD finger protein ING1-like [Citrus sinensis]
Length=246

 Score =   223 bits (569),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 126/190 (66%), Positives = 151/190 (79%), Gaps = 15/190 (8%)
 Frame = +2

Query  92   MSFIDEFETNLEVLPNILQKKYGLMRDLDRSLQEVQRQNDQRCQLEVEDMKQRIKSGNIA  271
            MSF+DEF+ NLE LPNILQKKY L+RDLD+SLQE+QRQN+QRC+ E+ED+ + I++GNI 
Sbjct  1    MSFLDEFQANLESLPNILQKKYALLRDLDKSLQEIQRQNEQRCEQEIEDLMREIRAGNIT  60

Query  272  SDSSLIKFSDDALDEQKHAIRIADEKVALAIQAYDLVDTHIQQLDQYLKKFDEELRRVAE  451
             ++SLI+FSDDALDEQKH+IRIADEKVALA+QAYDLVDTHIQQLDQYLK FDEELRR  E
Sbjct  61   PNTSLIRFSDDALDEQKHSIRIADEKVALAVQAYDLVDTHIQQLDQYLKNFDEELRR--E  118

Query  452  RENAVATGSTTSNVDNNVksgrsgdsskggrkkTRL-------------ATATPAANPTG  592
            R++   T S    +D + KSGRS +  +GGRKKTRL             A ATP ANPTG
Sbjct  119  RDSVATTASPAPTLDGSTKSGRSSEGGRGGRKKTRLATAAAAAAAAVTEAAATPVANPTG  178

Query  593  MDLDLPVDPS  622
            M+LDLPVDP+
Sbjct  179  MELDLPVDPN  188



>ref|XP_004247811.1| PREDICTED: PHD finger protein ING1 [Solanum lycopersicum]
Length=236

 Score =   222 bits (565),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 125/181 (69%), Positives = 143/181 (79%), Gaps = 7/181 (4%)
 Frame = +2

Query  92   MSFIDEFETNLEVLPNILQKKYGLMRDLDRSLQEVQRQNDQRCQLEVEDMKQRIKSGNIA  271
            MSFI+EF+ N+E LPN L++KY L+RDLD+SLQ VQ QN+QRC  E+EDM QRIK+GN+ 
Sbjct  1    MSFIEEFQANIEALPNHLRRKYALLRDLDKSLQGVQTQNEQRCDKEIEDMIQRIKAGNVT  60

Query  272  SDSSLIKFSDDALDEQKHAIRIADEKVALAIQAYDLVDTHIQQLDQYLKKFDEELRRVAE  451
             DSSLIKFSDDALDEQKHAIRIADEKVALA QAYDLVD HIQQLDQYLKKFDE+LRR  E
Sbjct  61   PDSSLIKFSDDALDEQKHAIRIADEKVALASQAYDLVDAHIQQLDQYLKKFDEDLRR--E  118

Query  452  RENAVATGSTTSNVDNNVksgrsgdsskggrkkTRL----ATATPAANPTGMDLDLPVDP  619
            R+ AV TG+  + V+NNV         KGGRKKTRL    A    AA P+GMDLDLPVDP
Sbjct  119  RDTAVVTGAPATTVENNV-KSGRSGEGKGGRKKTRLATAAAATATAATPSGMDLDLPVDP  177

Query  620  S  622
            +
Sbjct  178  N  178



>ref|XP_007034499.1| RING/FYVE/PHD zinc finger superfamily protein isoform 1 [Theobroma 
cacao]
 gb|EOY05425.1| RING/FYVE/PHD zinc finger superfamily protein isoform 1 [Theobroma 
cacao]
Length=247

 Score =   221 bits (562),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 126/190 (66%), Positives = 152/190 (80%), Gaps = 15/190 (8%)
 Frame = +2

Query  92   MSFIDEFETNLEVLPNILQKKYGLMRDLDRSLQEVQRQNDQRCQLEVEDMKQRIKSGNIA  271
            MSFIDEF+ +LE LPNILQKKY LMRDLD+SLQE+ RQN+QRC+ E+ED+++ +++GNI 
Sbjct  1    MSFIDEFQADLEALPNILQKKYALMRDLDKSLQEIVRQNEQRCEQEIEDIRRGVRAGNIT  60

Query  272  SDSSLIKFSDDALDEQKHAIRIADEKVALAIQAYDLVDTHIQQLDQYLKKFDEELRRVAE  451
             D+SL++FSD+ALDEQKH+IRIADEKVALAIQAYDLVD+HIQQLDQYLKK DEELRR  E
Sbjct  61   PDTSLLRFSDEALDEQKHSIRIADEKVALAIQAYDLVDSHIQQLDQYLKKSDEELRR--E  118

Query  452  RENAVATGSTTSNVDNNVksgrsgdsskggrkkTRL-------------ATATPAANPTG  592
            RENA AT S+  + D+  KSGR  +S +GGRKKTRL               A  AANPTG
Sbjct  119  RENAAATASSGPSPDSTTKSGRPSESGRGGRKKTRLATAAAAAAAAAATEVAAAAANPTG  178

Query  593  MDLDLPVDPS  622
            M+LDLPVDP+
Sbjct  179  MELDLPVDPN  188



>ref|XP_006340915.1| PREDICTED: PHD finger protein ING1-like [Solanum tuberosum]
Length=236

 Score =   220 bits (561),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 124/181 (69%), Positives = 142/181 (78%), Gaps = 7/181 (4%)
 Frame = +2

Query  92   MSFIDEFETNLEVLPNILQKKYGLMRDLDRSLQEVQRQNDQRCQLEVEDMKQRIKSGNIA  271
            MSFI+EF+ N+E LPN L++KY L+RDLD+SLQ VQ QN+QRC  E+EDM QRIK+GN+ 
Sbjct  1    MSFIEEFQANIEALPNHLRRKYALLRDLDKSLQGVQTQNEQRCDKEIEDMIQRIKAGNVT  60

Query  272  SDSSLIKFSDDALDEQKHAIRIADEKVALAIQAYDLVDTHIQQLDQYLKKFDEELRRVAE  451
             DSSLIKFSDDALDEQKHAIRIADEKVALA QAYDLVD HIQQLDQYLKKFDE+LRR  E
Sbjct  61   PDSSLIKFSDDALDEQKHAIRIADEKVALASQAYDLVDAHIQQLDQYLKKFDEDLRR--E  118

Query  452  RENAVATGSTTSNVDNNVksgrsgdsskggrkkTRL----ATATPAANPTGMDLDLPVDP  619
            R+ AV TG+  +  +NNV         KGGRKKTRL    A    AA P+GMDLDLPVDP
Sbjct  119  RDTAVVTGAPATTAENNV-KSGRSGEGKGGRKKTRLATAAAATATAATPSGMDLDLPVDP  177

Query  620  S  622
            +
Sbjct  178  N  178



>ref|XP_001421350.1| psaD, PSI-D, subunit II, photosystem I protein [Ostreococcus 
lucimarinus CCE9901]
 gb|ABO99643.1| psaD, PSI-D, subunit II, photosystem I protein [Ostreococcus 
lucimarinus CCE9901]
Length=192

 Score =   218 bits (556),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 104/137 (76%), Positives = 115/137 (84%), Gaps = 0/137 (0%)
 Frame = +3

Query  888   FTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANL  1067
             +T P L+PNTPSPIFGGSTGGLLRKAQVEEFYV+TW + KE IFEMPTGGAAIMR+G NL
Sbjct  50    WTAPKLNPNTPSPIFGGSTGGLLRKAQVEEFYVLTWEAKKEAIFEMPTGGAAIMRKGPNL  109

Query  1068  LKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVGQNM  1247
             LKLARKEQCLAL    R+K K++   YRVFP+GEVQYLHPKDGVYPEKVN GR G  QNM
Sbjct  110   LKLARKEQCLALLNNFRAKMKLDGCIYRVFPSGEVQYLHPKDGVYPEKVNKGRVGANQNM  169

Query  1248  RSIGKNISPIEVKFTGK  1298
             RSIGKN +P  +KF GK
Sbjct  170   RSIGKNTNPASIKFQGK  186



>gb|ACJ84468.1| unknown [Medicago truncatula]
 gb|KEH41192.1| PHD finger-like protein [Medicago truncatula]
Length=247

 Score =   219 bits (559),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 121/193 (63%), Positives = 149/193 (77%), Gaps = 20/193 (10%)
 Frame = +2

Query  92   MSFIDEFETNLEVLPNILQKKYGLMRDLDRSLQEVQRQNDQRCQLEVEDMKQRIKSGNIA  271
            MSF++EF+ NL+ LPNIL KKY L+RDLD+SLQ+ QRQN+QRC+ E+ED+++ ++SGNIA
Sbjct  1    MSFLEEFQANLDSLPNILHKKYALLRDLDKSLQDNQRQNEQRCEQEIEDIRRGVRSGNIA  60

Query  272  SDSSLIKFSDDALDEQKHAIRIADEKVALAIQAYDLVDTHIQQLDQYLKKFDEELRRVAE  451
             D+S+I+FSD+ALDEQKH+IRIADEKVALA+QAYDLVDTHIQQLDQYLKKFDEELRR  E
Sbjct  61   PDTSVIRFSDEALDEQKHSIRIADEKVALAVQAYDLVDTHIQQLDQYLKKFDEELRR--E  118

Query  452  RENAVATGSTTSNVDNNVksgrsgdsskggrkkTRLATAT----------------PAAN  583
            RENA  TG+ TS+ D N       +  +GGRKKTR A +                  +AN
Sbjct  119  RENAAITGAPTSSPDGNT--KSGKEGGRGGRKKTRQAASVQTATAAAMAAATEALATSAN  176

Query  584  PTGMDLDLPVDPS  622
            PTGMDLDLPVDP+
Sbjct  177  PTGMDLDLPVDPN  189



>gb|AFK44120.1| unknown [Medicago truncatula]
Length=247

 Score =   219 bits (559),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 121/193 (63%), Positives = 148/193 (77%), Gaps = 20/193 (10%)
 Frame = +2

Query  92   MSFIDEFETNLEVLPNILQKKYGLMRDLDRSLQEVQRQNDQRCQLEVEDMKQRIKSGNIA  271
            MSF++EF+ NL+ LPNIL KKY L+RDLD+SLQ+ QRQN+QRC+ E+ED+++ ++SGNIA
Sbjct  1    MSFLEEFQANLDSLPNILHKKYALLRDLDKSLQDNQRQNEQRCEQEIEDIRRGVRSGNIA  60

Query  272  SDSSLIKFSDDALDEQKHAIRIADEKVALAIQAYDLVDTHIQQLDQYLKKFDEELRRVAE  451
             D+S+I+FSD+ALDEQKH+IRIADEKVALA+QAYDLVDTHIQQLDQYLKKFDEELRR  E
Sbjct  61   PDTSVIRFSDEALDEQKHSIRIADEKVALAVQAYDLVDTHIQQLDQYLKKFDEELRR--E  118

Query  452  RENAVATGSTTSNVDNNVksgrsgdsskggrkkTRLATAT----------------PAAN  583
            RENA  TG+ TS+ D N       +  +GGRKKTR A +                   AN
Sbjct  119  RENAAITGAPTSSPDGNT--KSGKEGGRGGRKKTRQAASVQTATAAAMAAATEALATFAN  176

Query  584  PTGMDLDLPVDPS  622
            PTGMDLDLPVDP+
Sbjct  177  PTGMDLDLPVDPN  189



>emb|CDO99386.1| unnamed protein product [Coffea canephora]
Length=249

 Score =   218 bits (556),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 121/193 (63%), Positives = 140/193 (73%), Gaps = 19/193 (10%)
 Frame = +2

Query  92   MSFIDEFETNLEVLPNILQKKYGLMRDLDRSLQEVQRQNDQRCQLEVEDMKQRIKSGNIA  271
            MSFID+F+ NLEVLPNILQKKY L+RDLD+SL E+QRQN+QRC  E+EDMK RIK G + 
Sbjct  1    MSFIDDFQANLEVLPNILQKKYALLRDLDKSLHEIQRQNEQRCGQEIEDMKNRIKDGGVT  60

Query  272  SDSSLIKFSDDALDEQKHAIRIADEKVALAIQAYDLVDTHIQQLDQYLKKFDEELRRVAE  451
             DSS +KFSD+ALDEQKHAIRIADEK+ALA+QAYDLVD HIQQLDQYLKK DEE+RR  E
Sbjct  61   PDSSFMKFSDEALDEQKHAIRIADEKIALALQAYDLVDAHIQQLDQYLKKLDEEIRR--E  118

Query  452  RENAVATGSTTSNVDNNVksgrsgdsskggrkkTRL----------------ATATPAAN  583
             +   +TGS    VDNNV        S  GRKKTRL                A  T + N
Sbjct  119  GDTVASTGSAAPAVDNNV-KSGKAGESSRGRKKTRLATATAAAAAAAAAAAAAATTTSTN  177

Query  584  PTGMDLDLPVDPS  622
            PTG++LDLPVDP+
Sbjct  178  PTGVELDLPVDPN  190



>ref|XP_003535966.1| PREDICTED: PHD finger protein ING1-like isoform X1 [Glycine max]
Length=242

 Score =   218 bits (554),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 117/186 (63%), Positives = 147/186 (79%), Gaps = 11/186 (6%)
 Frame = +2

Query  92   MSFIDEFETNLEVLPNILQKKYGLMRDLDRSLQEVQRQNDQRCQLEVEDMKQRIKSGNIA  271
            MSF++EF+ NL+ LP ILQKKY L+RDLD+SL ++QRQN+QRC+ E+ED+++ ++SGNI 
Sbjct  1    MSFLEEFQANLDSLPVILQKKYALLRDLDKSLHDIQRQNEQRCEQEIEDIRRGVRSGNIT  60

Query  272  SDSSLIKFSDDALDEQKHAIRIADEKVALAIQAYDLVDTHIQQLDQYLKKFDEELRRVAE  451
             D+S+I+FSD+ALDEQ H+IR+ADEKVALA+QAYDLVDTHIQ LDQYLK+F EE+RR  E
Sbjct  61   PDTSVIRFSDEALDEQNHSIRVADEKVALAVQAYDLVDTHIQHLDQYLKRFGEEIRR--E  118

Query  452  RENAVATGSTTSNVDNNVksgr--sgdsskggrkkTRLATATPA-------ANPTGMDLD  604
            RENA  TG   S  + N KSGR     + +GGRKKTR  T TPA       ANPTGMDL+
Sbjct  119  RENAAITGVPASGSEGNTKSGRGNESGTGRGGRKKTRQTTVTPAATEAQATANPTGMDLE  178

Query  605  LPVDPS  622
            LPVDP+
Sbjct  179  LPVDPN  184



>ref|XP_009785673.1| PREDICTED: PHD finger protein ING1 isoform X2 [Nicotiana sylvestris]
Length=199

 Score =   214 bits (544),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 104/137 (76%), Positives = 119/137 (87%), Gaps = 2/137 (1%)
 Frame = +2

Query  92   MSFIDEFETNLEVLPNILQKKYGLMRDLDRSLQEVQRQNDQRCQLEVEDMKQRIKSGNIA  271
            MSFIDEF+ N+E LPN L++KY L+RDLD+SLQ VQRQN+QRC+ E+EDM QRIK+GN+ 
Sbjct  1    MSFIDEFQANIEALPNHLRRKYALLRDLDKSLQGVQRQNEQRCEKEIEDMIQRIKAGNVT  60

Query  272  SDSSLIKFSDDALDEQKHAIRIADEKVALAIQAYDLVDTHIQQLDQYLKKFDEELRRVAE  451
             DSSLIKFSDDALDEQKHAIRIADEKVALA QAYDLVD HIQQLDQYLKKFDEELRR  E
Sbjct  61   PDSSLIKFSDDALDEQKHAIRIADEKVALASQAYDLVDAHIQQLDQYLKKFDEELRR--E  118

Query  452  RENAVATGSTTSNVDNN  502
            R+ AV TG+  + V+NN
Sbjct  119  RDVAVVTGTPATTVENN  135



>ref|XP_007145429.1| hypothetical protein PHAVU_007G238400g [Phaseolus vulgaris]
 gb|ESW17423.1| hypothetical protein PHAVU_007G238400g [Phaseolus vulgaris]
Length=242

 Score =   215 bits (547),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 117/186 (63%), Positives = 144/186 (77%), Gaps = 11/186 (6%)
 Frame = +2

Query  92   MSFIDEFETNLEVLPNILQKKYGLMRDLDRSLQEVQRQNDQRCQLEVEDMKQRIKSGNIA  271
            MSF++EF+ NL+ LP ILQKKY L+RDLD+SLQ++QRQN+QRC+ E+ED+++ ++SGNI 
Sbjct  1    MSFLEEFQANLDSLPVILQKKYALLRDLDKSLQDIQRQNEQRCEHEIEDIRRGVRSGNIT  60

Query  272  SDSSLIKFSDDALDEQKHAIRIADEKVALAIQAYDLVDTHIQQLDQYLKKFDEELRRVAE  451
             D+S+I+FSD+ALDEQKH+IR+ADEKVALA+QAYDLVDTHIQQLDQYLKKFDEELRR  E
Sbjct  61   PDTSVIRFSDEALDEQKHSIRVADEKVALAVQAYDLVDTHIQQLDQYLKKFDEELRR--E  118

Query  452  RENAVATGSTTSNVDNNVk-sgrsgdsskggrkkTRLAT--------ATPAANPTGMDLD  604
            RENA  TG   S  + N K    +   +  GRKKTR  T        A   A PTGMDLD
Sbjct  119  RENAAITGVPASGPEGNTKPGRGNESGTGRGRKKTRQTTLVTAAATEAQTTAKPTGMDLD  178

Query  605  LPVDPS  622
            LPVDP+
Sbjct  179  LPVDPN  184



>ref|XP_003555720.1| PREDICTED: PHD finger protein ING1-like [Glycine max]
Length=239

 Score =   213 bits (542),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 112/183 (61%), Positives = 143/183 (78%), Gaps = 8/183 (4%)
 Frame = +2

Query  92   MSFIDEFETNLEVLPNILQKKYGLMRDLDRSLQEVQRQNDQRCQLEVEDMKQRIKSGNIA  271
            MSF++EF  NL+ LP IL+KKY L+RDLD+SLQ+++RQN+QRC+ E+ED+K+ ++SGNI 
Sbjct  1    MSFLEEFHANLDSLPVILRKKYTLLRDLDKSLQDIKRQNEQRCEQEIEDIKRGVRSGNIT  60

Query  272  SDSSLIKFSDDALDEQKHAIRIADEKVALAIQAYDLVDTHIQQLDQYLKKFDEELRRVAE  451
             D+S I+FSD+ALDEQKH+IR+ADEKVALA+QAYDLVDT+IQQLDQYLKKFDEE+RR  E
Sbjct  61   PDTSAIRFSDEALDEQKHSIRVADEKVALAVQAYDLVDTNIQQLDQYLKKFDEEIRR--E  118

Query  452  RENAVATGSTTSNVDNNVksgrsgdssk------ggrkkTRLATATPAANPTGMDLDLPV  613
            RENA  TG   S  + N KSGR  +S          R+ T +  A   +NPTGMDL+LPV
Sbjct  119  RENAAITGVPASGPEGNTKSGRGNESGTGRGGRKKTRQTTMVTEAQATSNPTGMDLELPV  178

Query  614  DPS  622
            DP+
Sbjct  179  DPN  181



>gb|ACU19192.1| unknown [Glycine max]
Length=239

 Score =   212 bits (539),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 112/183 (61%), Positives = 142/183 (78%), Gaps = 8/183 (4%)
 Frame = +2

Query  92   MSFIDEFETNLEVLPNILQKKYGLMRDLDRSLQEVQRQNDQRCQLEVEDMKQRIKSGNIA  271
            MSF++EF  NL+ LP IL+KKY L+RDLD+SLQ+++RQN+QRC+ E+ED+K+ ++SGNI 
Sbjct  1    MSFLEEFHANLDSLPVILRKKYTLLRDLDKSLQDIKRQNEQRCEQEIEDIKRGVRSGNIT  60

Query  272  SDSSLIKFSDDALDEQKHAIRIADEKVALAIQAYDLVDTHIQQLDQYLKKFDEELRRVAE  451
             D+S I+FSD+ALDEQKH+IR+ADEKVALA+QAYDLVDT+IQQLDQYLKKFDEE+RR  E
Sbjct  61   PDTSAIRFSDEALDEQKHSIRVADEKVALAVQAYDLVDTNIQQLDQYLKKFDEEIRR--E  118

Query  452  RENAVATGSTTSNVDNNVksgrsgdssk------ggrkkTRLATATPAANPTGMDLDLPV  613
            RENA  TG   S  + N KSGR  +S          R+ T +  A    NPTGMDL+LPV
Sbjct  119  RENAAITGVPASGPEGNTKSGRGNESGTGRGGRKKTRQTTMVTEAQATPNPTGMDLELPV  178

Query  614  DPS  622
            DP+
Sbjct  179  DPN  181



>ref|XP_011091384.1| PREDICTED: PHD finger protein ING1 isoform X1 [Sesamum indicum]
Length=247

 Score =   211 bits (537),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 128/191 (67%), Positives = 153/191 (80%), Gaps = 16/191 (8%)
 Frame = +2

Query  92   MSFIDEFETNLEVLPNILQKKYGLMRDLDRSLQEVQRQNDQRCQLEVEDMKQRIKSGNIA  271
            MS  +EF+ N+E LPNILQ+KY L+RDLD+SLQE+QRQN+QRC+ E++DMK+ IKSGNI 
Sbjct  1    MSISEEFQANIEALPNILQRKYALLRDLDKSLQEIQRQNEQRCEQEIDDMKRGIKSGNIT  60

Query  272  SDSSLIKFSDDALDEQKHAIRIADEKVALAIQAYDLVDTHIQQLDQYLKKFDEELRRVAE  451
             +SSL+KFSDDALDEQKHAIRIADEKVALA+QAYDLVD HIQQLDQYLKKFDE+LRR AE
Sbjct  61   PNSSLLKFSDDALDEQKHAIRIADEKVALAVQAYDLVDAHIQQLDQYLKKFDEDLRR-AE  119

Query  452  RENAVATGSTTSNVDNNVksgrsgdsskggrkkTRL--------------ATATPAANPT  589
            R+   A+G T+  +DNNVK+GRSG++S  GRKKTRL              A A  AAN T
Sbjct  120  RDTMAASG-TSPTLDNNVKAGRSGETSNRGRKKTRLATATAAASASATAAAAAATAANST  178

Query  590  GMDLDLPVDPS  622
             M+LDLPVDP+
Sbjct  179  SMELDLPVDPN  189



>ref|XP_010264003.1| PREDICTED: PHD finger protein ING1 [Nelumbo nucifera]
Length=232

 Score =   211 bits (536),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 122/177 (69%), Positives = 149/177 (84%), Gaps = 3/177 (2%)
 Frame = +2

Query  92   MSFIDEFETNLEVLPNILQKKYGLMRDLDRSLQEVQRQNDQRCQLEVEDMKQRIKSGNIA  271
            MSF+++F+ +LE LP +LQ++Y LMR+LD+SLQE+QRQN+QRC+ E+ED+K+ +KSGNI 
Sbjct  1    MSFMEDFQASLESLPTMLQRQYSLMRNLDKSLQEIQRQNEQRCEQEIEDIKRGVKSGNIT  60

Query  272  SDSSLIKFSDDALDEQKHAIRIADEKVALAIQAYDLVDTHIQQLDQYLKKFDEELRRVAE  451
             D+SLI+FSD AL+EQKH IRIADEKVALAIQAYDLVD HIQQLDQYLK+FDEELRR  E
Sbjct  61   PDASLIRFSDYALEEQKHCIRIADEKVALAIQAYDLVDAHIQQLDQYLKRFDEELRR--E  118

Query  452  RENAVATGSTTSNVDNNVksgrsgdsskggrkkTRLATATPAANPTGMDLDLPVDPS  622
            R+ A A G T  N+D +VKSGR  +SSK GRKKTRLA+A  AA P  MDLDLPVDP+
Sbjct  119  RDLASAGGVTAPNLDISVKSGRGSESSKRGRKKTRLASAA-AAEPPSMDLDLPVDPN  174



>ref|XP_004497737.1| PREDICTED: PHD finger protein ING1-like [Cicer arietinum]
Length=293

 Score =   212 bits (539),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 119/191 (62%), Positives = 145/191 (76%), Gaps = 16/191 (8%)
 Frame = +2

Query  92   MSFIDEFETNLEVLPNILQKKYGLMRDLDRSLQEVQRQNDQRCQLEVEDMKQRIKSGNIA  271
            MSF++EF+ NL+ LPNIL KKY L+RDLD+SL + QRQN+QRC+ E+ED+++ ++SGNI 
Sbjct  47   MSFLEEFQANLDSLPNILHKKYALLRDLDKSLHDNQRQNEQRCEQEIEDIRRGVRSGNIT  106

Query  272  SDSSLIKFSDDALDEQKHAIRIADEKVALAIQAYDLVDTHIQQLDQYLKKFDEELRRVAE  451
             D+ +I+FSD+ALDEQKH+IRIADEKVALA+QAYDLVDTHIQQLDQYLKKFDEELRR  E
Sbjct  107  PDTLVIRFSDEALDEQKHSIRIADEKVALAVQAYDLVDTHIQQLDQYLKKFDEELRR--E  164

Query  452  RENAVATGSTTSNVDNNVksgrsgdsskggrkkTR--------------LATATPAANPT  589
            RENA  TG   S  D N KSG+  +  +GGRKKTR                    +ANPT
Sbjct  165  RENAAITGVPASIPDGNTKSGKGNEGGRGGRKKTRQTQTASVATAAAAAAEALATSANPT  224

Query  590  GMDLDLPVDPS  622
            GMDLDLPVDP+
Sbjct  225  GMDLDLPVDPN  235



>sp|Q9T4W8.1|PSAD_CYAPA RecName: Full=Photosystem I reaction center subunit II, cyanelle; 
AltName: Full=Photosystem I 20 kDa subunit; Short=PSI-D; 
Flags: Precursor [Cyanophora paradoxa]
 emb|CAB64901.1| photosystem I reaction centre subunit II precursor [Cyanophora 
paradoxa]
Length=220

 Score =   208 bits (530),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 95/145 (66%), Positives = 118/145 (81%), Gaps = 1/145 (1%)
 Frame = +3

Query  879   PVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREG  1058
             P  F+ PTL+ N P+PIFGGSTGGLLRKA+VEEFY ITWT   E +FE+PTGGAAIMR G
Sbjct  71    PKPFSVPTLNLNAPTPIFGGSTGGLLRKAEVEEFYSITWTGKSETVFELPTGGAAIMRAG  130

Query  1059  ANLLKLARKEQCLALGTRLRSKYKI-NYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGV  1235
              NLL+LARKEQC+ALG +L+ K+KI +Y+ YRV+P+GEVQ+LHPKDGV+PEKVN GR  V
Sbjct  131   ENLLRLARKEQCIALGAQLKDKFKITDYKIYRVYPSGEVQFLHPKDGVFPEKVNPGRVAV  190

Query  1236  GQNMRSIGKNISPIEVKFTGKQVYD  1310
             G N R IG+N  P ++KF G++ +D
Sbjct  191   GSNKRRIGQNPDPAKLKFKGQETFD  215



>gb|KJB28066.1| hypothetical protein B456_005G039000 [Gossypium raimondii]
Length=207

 Score =   208 bits (529),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 124/182 (68%), Positives = 148/182 (81%), Gaps = 10/182 (5%)
 Frame = +2

Query  98   FIDEFETNLEVLPNILQKKYGLMRDLDRSLQEVQRQNDQRCQLEVEDMKQRIKSGNIASD  277
            FIDEF+ +LE LPNILQKKY LMRDLD+SLQE+ RQN+QRC+ E+EDMK+ +++GNI  D
Sbjct  4    FIDEFQADLEALPNILQKKYALMRDLDKSLQEIVRQNEQRCEQEIEDMKRGLRAGNITPD  63

Query  278  SSLIKFSDDALDEQKHAIRIADEKVALAIQAYDLVDTHIQQLDQYLKKFDEELRRVAERE  457
            +SL++FS++ALDEQKH++RIADEKVALAIQAYDLVD+HIQQLDQYLKK  EELRR  ERE
Sbjct  64   TSLLRFSEEALDEQKHSVRIADEKVALAIQAYDLVDSHIQQLDQYLKKSGEELRR--ERE  121

Query  458  NAVATGSTTSNVDNNVksgrsgdsskggrkkTRL-------ATATPAANPTGMDLDLPVD  616
            N  AT S T   D   KSGRSG+S +GGRKKTRL         A  AANPTG++LDLPVD
Sbjct  122  N-TATASPTQTPDGTTKSGRSGESGRGGRKKTRLATAAAATEVAASAANPTGVELDLPVD  180

Query  617  PS  622
            P+
Sbjct  181  PN  182



>ref|XP_011091386.1| PREDICTED: PHD finger protein ING1 isoform X2 [Sesamum indicum]
Length=246

 Score =   209 bits (532),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 127/191 (66%), Positives = 152/191 (80%), Gaps = 17/191 (9%)
 Frame = +2

Query  92   MSFIDEFETNLEVLPNILQKKYGLMRDLDRSLQEVQRQNDQRCQLEVEDMKQRIKSGNIA  271
            MS  +EF+ N+E LPNILQ+KY L+RDLD+SLQE+QRQN+QRC+ E++DMK+ IKSGNI 
Sbjct  1    MSISEEFQANIEALPNILQRKYALLRDLDKSLQEIQRQNEQRCEQEIDDMKRGIKSGNIT  60

Query  272  SDSSLIKFSDDALDEQKHAIRIADEKVALAIQAYDLVDTHIQQLDQYLKKFDEELRRVAE  451
             +SSL+KFSDDALDEQKHAIRIADEKVALA+QAYDLVD HIQQLDQYLKKFDE+LRR  E
Sbjct  61   PNSSLLKFSDDALDEQKHAIRIADEKVALAVQAYDLVDAHIQQLDQYLKKFDEDLRR--E  118

Query  452  RENAVATGSTTSNVDNNVksgrsgdsskggrkkTRL--------------ATATPAANPT  589
            R+   A+G T+  +DNNVK+GRSG++S  GRKKTRL              A A  AAN T
Sbjct  119  RDTMAASG-TSPTLDNNVKAGRSGETSNRGRKKTRLATATAAASASATAAAAAATAANST  177

Query  590  GMDLDLPVDPS  622
             M+LDLPVDP+
Sbjct  178  SMELDLPVDPN  188



>gb|KJB28062.1| hypothetical protein B456_005G039000 [Gossypium raimondii]
Length=240

 Score =   208 bits (530),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 124/182 (68%), Positives = 148/182 (81%), Gaps = 10/182 (5%)
 Frame = +2

Query  98   FIDEFETNLEVLPNILQKKYGLMRDLDRSLQEVQRQNDQRCQLEVEDMKQRIKSGNIASD  277
            FIDEF+ +LE LPNILQKKY LMRDLD+SLQE+ RQN+QRC+ E+EDMK+ +++GNI  D
Sbjct  4    FIDEFQADLEALPNILQKKYALMRDLDKSLQEIVRQNEQRCEQEIEDMKRGLRAGNITPD  63

Query  278  SSLIKFSDDALDEQKHAIRIADEKVALAIQAYDLVDTHIQQLDQYLKKFDEELRRVAERE  457
            +SL++FS++ALDEQKH++RIADEKVALAIQAYDLVD+HIQQLDQYLKK  EELRR  ERE
Sbjct  64   TSLLRFSEEALDEQKHSVRIADEKVALAIQAYDLVDSHIQQLDQYLKKSGEELRR--ERE  121

Query  458  NAVATGSTTSNVDNNVksgrsgdsskggrkkTRL-------ATATPAANPTGMDLDLPVD  616
            N  AT S T   D   KSGRSG+S +GGRKKTRL         A  AANPTG++LDLPVD
Sbjct  122  N-TATASPTQTPDGTTKSGRSGESGRGGRKKTRLATAAAATEVAASAANPTGVELDLPVD  180

Query  617  PS  622
            P+
Sbjct  181  PN  182



>ref|XP_006589054.1| PREDICTED: PHD finger protein ING1-like isoform X2 [Glycine max]
Length=236

 Score =   207 bits (526),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 113/186 (61%), Positives = 142/186 (76%), Gaps = 17/186 (9%)
 Frame = +2

Query  92   MSFIDEFETNLEVLPNILQKKYGLMRDLDRSLQEVQRQNDQRCQLEVEDMKQRIKSGNIA  271
            MSF++EF+ NL+ LP ILQKKY L+RDLD+SL ++QRQN+QRC+ E+ED+++ ++SGNI 
Sbjct  1    MSFLEEFQANLDSLPVILQKKYALLRDLDKSLHDIQRQNEQRCEQEIEDIRRGVRSGNIT  60

Query  272  SDSSLIKFSDDALDEQKHAIRIADEKVALAIQAYDLVDTHIQQLDQYLKKFDEELRRVAE  451
             D+S+I+FSD+ALDEQ H+IR+ADEKVALA+QAYDLVDTHIQ LDQYLK+F        E
Sbjct  61   PDTSVIRFSDEALDEQNHSIRVADEKVALAVQAYDLVDTHIQHLDQYLKRF--------E  112

Query  452  RENAVATGSTTSNVDNNVksgrs--gdsskggrkkTRLATATPA-------ANPTGMDLD  604
            RENA  TG   S  + N KSGR     + +GGRKKTR  T TPA       ANPTGMDL+
Sbjct  113  RENAAITGVPASGSEGNTKSGRGNESGTGRGGRKKTRQTTVTPAATEAQATANPTGMDLE  172

Query  605  LPVDPS  622
            LPVDP+
Sbjct  173  LPVDPN  178



>gb|AFK33325.1| unknown [Lotus japonicus]
Length=245

 Score =   207 bits (526),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 115/189 (61%), Positives = 138/189 (73%), Gaps = 14/189 (7%)
 Frame = +2

Query  92   MSFIDEFETNLEVLPNILQKKYGLMRDLDRSLQEVQRQNDQRCQLEVEDMKQRIKSGNIA  271
            MSF++EF+ NL+ LP ILQKKY L+RDLD+SL ++QRQN+QRCQ EVED+++ ++ GNI 
Sbjct  1    MSFLEEFQANLDSLPVILQKKYSLLRDLDKSLHDIQRQNEQRCQQEVEDIRRGVRLGNIT  60

Query  272  SDSSLIKFSDDALDEQKHAIRIADEKVALAIQAYDLVDTHIQQLDQYLKKFDEELRRVAE  451
             D S I+FSD+ALDEQKH+IRIADEKVALA+QAYDLVDTHIQQLDQYLKKFDEELRR  E
Sbjct  61   PDVSAIRFSDEALDEQKHSIRIADEKVALAVQAYDLVDTHIQQLDQYLKKFDEELRR--E  118

Query  452  RENAVATGSTTSNVDNNVksgrsgdsskggrkkTRLATAT------------PAANPTGM  595
            RENA   G  +S  D   KSGR      G +K  +   A              + NPTGM
Sbjct  119  RENAAIAGVPSSGPDATTKSGRGESGRGGRKKSRQTTLAAAAAAATATDAQPTSVNPTGM  178

Query  596  DLDLPVDPS  622
            DLDLPVDP+
Sbjct  179  DLDLPVDPN  187



>ref|YP_005088653.1| photosystem I subunit II [Phaeocystis antarctica]
 gb|AEK26757.1| photosystem I subunit II [Phaeocystis antarctica]
Length=141

 Score =   202 bits (514),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 96/137 (70%), Positives = 110/137 (80%), Gaps = 1/137 (1%)
 Frame = +3

Query  903   LDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLAR  1082
             LD    SP FGGSTGG LR A+ EE Y ITWTS KEQIFEMPT G+AIM++G NLL LA+
Sbjct  5     LDLQIASPTFGGSTGGWLRAAETEEKYAITWTSKKEQIFEMPTSGSAIMQKGENLLYLAK  64

Query  1083  KEQCLALGTRLRSKYKIN-YQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVGQNMRSIG  1259
             KEQCLALGT+LR+ +KIN Y+ YR+FPN EVQYLHPKDGV+PEK+NAGR GVG  M SIG
Sbjct  65    KEQCLALGTQLRTSFKINDYKIYRIFPNSEVQYLHPKDGVFPEKLNAGRLGVGNVMHSIG  124

Query  1260  KNISPIEVKFTGKQVYD  1310
             KN  P+ VKFTGK  +D
Sbjct  125   KNAQPVNVKFTGKNTFD  141



>ref|XP_004134022.1| PREDICTED: PHD finger protein ING1 isoform X1 [Cucumis sativus]
 ref|XP_011650897.1| PREDICTED: PHD finger protein ING1 isoform X1 [Cucumis sativus]
 ref|XP_011650898.1| PREDICTED: PHD finger protein ING1 isoform X1 [Cucumis sativus]
 ref|XP_011650899.1| PREDICTED: PHD finger protein ING1 isoform X1 [Cucumis sativus]
 gb|KGN56782.1| hypothetical protein Csa_3G133330 [Cucumis sativus]
Length=239

 Score =   206 bits (523),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 114/183 (62%), Positives = 139/183 (76%), Gaps = 8/183 (4%)
 Frame = +2

Query  92   MSFIDEFETNLEVLPNILQKKYGLMRDLDRSLQEVQRQNDQRCQLEVEDMKQRIKSGNIA  271
            MSF++EF+ NLE LPNILQKKY L+ DLD+SLQ + +QN+QRC+ E+ED+K+ +K GNI 
Sbjct  1    MSFLEEFQANLESLPNILQKKYALLHDLDQSLQGLVKQNEQRCEQEIEDIKRGVKCGNIT  60

Query  272  SDSSLIKFSDDALDEQKHAIRIADEKVALAIQAYDLVDTHIQQLDQYLKKFDEELRRVAE  451
             D+SLI+FSD+ALDEQKH+IRIADEKVALA+QAYDLVDTHIQQLDQYLK FDE+LR   E
Sbjct  61   PDTSLIRFSDEALDEQKHSIRIADEKVALAVQAYDLVDTHIQQLDQYLKNFDEKLRH--E  118

Query  452  RENAVATGSTTSNVDNNVks------grsgdsskggrkkTRLATATPAANPTGMDLDLPV  613
            R  A ATG   S+VD N KS      GR G   + G+       A   ANPTGM+L+LPV
Sbjct  119  RGTAAATGLPASSVDVNTKSGRGTEGGRGGRKKRNGQAAAATTEAPTTANPTGMELELPV  178

Query  614  DPS  622
            DP+
Sbjct  179  DPN  181



>ref|YP_008145427.1| photosystem I subunit II (chloroplast) [Phaeocystis globosa]
 gb|AGO44889.1| photosystem I subunit II (chloroplast) [Phaeocystis globosa]
Length=141

 Score =   202 bits (513),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 95/137 (69%), Positives = 110/137 (80%), Gaps = 1/137 (1%)
 Frame = +3

Query  903   LDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLAR  1082
             LD    SP FGGSTGG LR A+ EE Y ITWTS KEQIFEMPT G+AIM++G NLL LA+
Sbjct  5     LDLQIASPTFGGSTGGWLRAAETEEKYAITWTSKKEQIFEMPTSGSAIMQKGENLLYLAK  64

Query  1083  KEQCLALGTRLRSKYKIN-YQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVGQNMRSIG  1259
             KEQCLALGT+LR+ +K+N Y+ YR+FPN EVQYLHPKDGV+PEK+NAGR GVG  M SIG
Sbjct  65    KEQCLALGTQLRTSFKVNDYKIYRIFPNSEVQYLHPKDGVFPEKLNAGRLGVGNVMHSIG  124

Query  1260  KNISPIEVKFTGKQVYD  1310
             KN  P+ VKFTGK  +D
Sbjct  125   KNAQPVNVKFTGKNTFD  141



>gb|KHN48841.1| PHD finger protein ING1, partial [Glycine soja]
Length=236

 Score =   205 bits (521),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 112/180 (62%), Positives = 140/180 (78%), Gaps = 11/180 (6%)
 Frame = +2

Query  110  FETNLEVLPNILQKKYGLMRDLDRSLQEVQRQNDQRCQLEVEDMKQRIKSGNIASDSSLI  289
            F  +L+ LP ILQKKY L+RDLD+SL ++QRQN+QRC+ E+ED+++ ++SGNI  D+S+I
Sbjct  1    FSADLDSLPVILQKKYALLRDLDKSLHDIQRQNEQRCEQEIEDIRRGVRSGNITPDTSVI  60

Query  290  KFSDDALDEQKHAIRIADEKVALAIQAYDLVDTHIQQLDQYLKKFDEELRRVAERENAVA  469
            +FSD+ALDEQ H+IR+ADEKVALA+QAYDLVDTHIQ LDQYLK+F EE+RR  ERENA  
Sbjct  61   RFSDEALDEQNHSIRVADEKVALAVQAYDLVDTHIQHLDQYLKRFGEEIRR--ERENAAI  118

Query  470  TGSTTSNVDNNVksgrs--gdsskggrkkTRLATATPA-------ANPTGMDLDLPVDPS  622
            TG   S  + N KSGR     + +GGRKKTR  T TPA       ANPTGMDL+LPVDP+
Sbjct  119  TGVPASGSEGNTKSGRGNESGTGRGGRKKTRQTTVTPAATEAQATANPTGMDLELPVDPN  178



>ref|YP_007947808.1| photosystem I subunit II (chloroplast) [Pyropia haitanensis]
 gb|AGG37057.1| photosystem I subunit II (chloroplast) [Pyropia haitanensis]
Length=141

 Score =   201 bits (510),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 95/140 (68%), Positives = 110/140 (79%), Gaps = 1/140 (1%)
 Frame = +3

Query  894   PPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLK  1073
             P T++ N PSP FGGSTGG LR A+VEE Y ITWT   E  FEMPTGG A MR G NLL 
Sbjct  2     PDTINLNMPSPTFGGSTGGWLRAAEVEEKYAITWTGKNESKFEMPTGGTATMRNGENLLY  61

Query  1074  LARKEQCLALGTRLRSKYKI-NYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVGQNMR  1250
             LA+KEQCLALGT+L+SK+KI +Y+ YRVFPNGEVQYLHPKDGV+PEKVNAGR  V     
Sbjct  62    LAKKEQCLALGTQLKSKFKISDYKIYRVFPNGEVQYLHPKDGVFPEKVNAGRASVNSVDH  121

Query  1251  SIGKNISPIEVKFTGKQVYD  1310
             SIG+N++P++VKFT K  YD
Sbjct  122   SIGRNVNPVDVKFTNKATYD  141



>gb|AFC39948.1| photosystem I subunit II [Porphyra umbilicalis]
Length=141

 Score =   200 bits (509),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 94/140 (67%), Positives = 110/140 (79%), Gaps = 1/140 (1%)
 Frame = +3

Query  894   PPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLK  1073
             P T++ N PSP FGGSTGG LR A+VEE Y ITWT   E  FEMPTGG A MR+G NLL 
Sbjct  2     PDTINLNMPSPTFGGSTGGWLRAAEVEEKYAITWTGKNESKFEMPTGGTATMRDGENLLY  61

Query  1074  LARKEQCLALGTRLRSKYKI-NYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVGQNMR  1250
             LA+KEQCLALGT+L+ K+KI +Y+ YRVFPNGEVQYLHPKDGV+PEKVNAGR+ +     
Sbjct  62    LAKKEQCLALGTQLKGKFKISDYKIYRVFPNGEVQYLHPKDGVFPEKVNAGRDSINSVDH  121

Query  1251  SIGKNISPIEVKFTGKQVYD  1310
             SIGKN++P+ VKFT K  YD
Sbjct  122   SIGKNVNPVNVKFTNKATYD  141



>gb|AJO68451.1| photosystem I subunit II (chloroplast) [Gracilariopsis lemaneiformis]
Length=141

 Score =   200 bits (508),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 94/138 (68%), Positives = 112/138 (81%), Gaps = 1/138 (1%)
 Frame = +3

Query  900   TLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLA  1079
             T+D   PSP FGGSTGG LR A++EE Y ITWTS +EQIFEMPTGG+AIMREG NLL LA
Sbjct  4     TIDLKMPSPTFGGSTGGWLRSAEIEEKYAITWTSKQEQIFEMPTGGSAIMREGNNLLYLA  63

Query  1080  RKEQCLALGTRLRSKYKI-NYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVGQNMRSI  1256
             +KEQCLAL ++L +K+KI +++ YR+FPNGEVQYLHPKDGV+PEKVNAGR  VG    SI
Sbjct  64    KKEQCLALSSQLNTKFKITDFKIYRIFPNGEVQYLHPKDGVFPEKVNAGRSSVGNISHSI  123

Query  1257  GKNISPIEVKFTGKQVYD  1310
             GKN +P+  KFTGK  Y+
Sbjct  124   GKNKNPVNEKFTGKATYE  141



>ref|NP_053889.1| photosystem I subunit II [Porphyra purpurea]
 sp|P51279.1|PSAD_PORPU RecName: Full=Photosystem I reaction center subunit II; AltName: 
Full=Photosystem I 16 kDa polypeptide; Short=PSI-D (chloroplast) 
[Porphyra purpurea]
 gb|AAC08165.1| Photosystem I reaction centre subunit II (chloroplast) [Porphyra 
purpurea]
Length=141

 Score =   199 bits (507),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 95/140 (68%), Positives = 109/140 (78%), Gaps = 1/140 (1%)
 Frame = +3

Query  894   PPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLK  1073
             P T++ N PSP FGGSTGG LR A+VEE Y ITWT   E  FEMPTGG A MR+G NLL 
Sbjct  2     PDTINLNMPSPTFGGSTGGWLRAAEVEEKYAITWTGKNESKFEMPTGGTATMRDGENLLY  61

Query  1074  LARKEQCLALGTRLRSKYKI-NYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVGQNMR  1250
             LA+KEQCLALGT+L+ K+KI +Y+ YRVFPNGEVQYLHPKDGV+PEKVNAGR  +     
Sbjct  62    LAKKEQCLALGTQLKGKFKISDYKIYRVFPNGEVQYLHPKDGVFPEKVNAGRASINSVDH  121

Query  1251  SIGKNISPIEVKFTGKQVYD  1310
             SIGKN++PI VKFT K  YD
Sbjct  122   SIGKNVNPINVKFTNKATYD  141



>ref|XP_002285610.1| PREDICTED: PHD finger protein ING1 [Vitis vinifera]
 emb|CBI33330.3| unnamed protein product [Vitis vinifera]
Length=235

 Score =   202 bits (515),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 118/175 (67%), Positives = 142/175 (81%), Gaps = 8/175 (5%)
 Frame = +2

Query  116  TNLEVLPNILQKKYGLMRDLDRSLQEVQRQNDQRCQLEVEDMKQRIKSGNIASDSSLIKF  295
            ++LE LPN+LQ+KY L+RDLD+SLQE+QRQN+QRC+ E+ED+KQ +KSGNI  D SLI+F
Sbjct  5    SDLESLPNVLQRKYALLRDLDKSLQEIQRQNEQRCEQEIEDIKQGVKSGNITPDPSLIRF  64

Query  296  SDDALDEQKHAIRIADEKVALAIQAYDLVDTHIQQLDQYLKKFDEELRRVAERENAVATG  475
            SD+ALDEQKH+IRIADEKVALA+QAYDLVDTHIQQLDQYL+KFDE++RR  ER+    TG
Sbjct  65   SDEALDEQKHSIRIADEKVALAVQAYDLVDTHIQQLDQYLRKFDEDIRR--ERDGIAGTG  122

Query  476  STTSNVDNNVksgrsgdsskggrkkTRL------ATATPAANPTGMDLDLPVDPS  622
                  D+  KSGR  +SS+GGRKKTRL      A  T AANPT MDLDLPVDP+
Sbjct  123  LPAPIPDSGTKSGRGSESSRGGRKKTRLAAAAAAAPVTAAANPTSMDLDLPVDPN  177



>gb|AIA20054.1| photosystem I subunit II [Pyropia perforata]
Length=141

 Score =   199 bits (505),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 96/140 (69%), Positives = 109/140 (78%), Gaps = 1/140 (1%)
 Frame = +3

Query  894   PPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLK  1073
             P T++ N PSP FGGSTGG LR A+VEE Y ITWT   +  FEMPTGG A MR G NLL 
Sbjct  2     PDTINLNMPSPTFGGSTGGWLRAAEVEEKYAITWTGKSDSKFEMPTGGTATMRNGENLLY  61

Query  1074  LARKEQCLALGTRLRSKYKI-NYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVGQNMR  1250
             LA+KEQCLALGT+L+ K+KI +Y+ YRVFPNGEVQYLHPKDGV+PEKVNAGR  V     
Sbjct  62    LAKKEQCLALGTQLKIKFKISDYKIYRVFPNGEVQYLHPKDGVFPEKVNAGRASVNSVNH  121

Query  1251  SIGKNISPIEVKFTGKQVYD  1310
             SIGKNI+PI+VKFT K  YD
Sbjct  122   SIGKNINPIDVKFTNKTTYD  141



>ref|YP_009027562.1| photosystem I subunit II [Pyropia perforata]
 gb|AGQ17098.1| photosystem I subunit II [Pyropia perforata]
 gb|AHB35056.1| photosystem I subunit II (chloroplast) [Pyropia perforata]
 gb|AHB35265.1| photosystem I subunit II (chloroplast) [Pyropia perforata]
 gb|AIA19427.1| photosystem I subunit II [Pyropia perforata]
 gb|AIA19636.1| photosystem I subunit II [Pyropia perforata]
 gb|AIA19845.1| photosystem I subunit II [Pyropia perforata]
 gb|AIA20263.1| photosystem I subunit II [Pyropia perforata]
 gb|AIA20472.1| photosystem I subunit II [Pyropia perforata]
 gb|AIA20681.1| photosystem I subunit II [Pyropia perforata]
 gb|AIA20890.1| photosystem I subunit II [Pyropia perforata]
 gb|AIA21099.1| photosystem I subunit II [Pyropia perforata]
Length=141

 Score =   199 bits (505),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 96/140 (69%), Positives = 109/140 (78%), Gaps = 1/140 (1%)
 Frame = +3

Query  894   PPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLK  1073
             P T++ N PSP FGGSTGG LR A+VEE Y ITWT   +  FEMPTGG A MR G NLL 
Sbjct  2     PDTINLNMPSPTFGGSTGGWLRAAEVEEKYAITWTGKSDSKFEMPTGGTATMRNGENLLY  61

Query  1074  LARKEQCLALGTRLRSKYKI-NYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVGQNMR  1250
             LA+KEQCLALGT+L+ K+KI +Y+ YRVFPNGEVQYLHPKDGV+PEKVNAGR  V     
Sbjct  62    LAKKEQCLALGTQLKIKFKISDYKIYRVFPNGEVQYLHPKDGVFPEKVNAGRASVNSVNH  121

Query  1251  SIGKNISPIEVKFTGKQVYD  1310
             SIGKNI+PI+VKFT K  YD
Sbjct  122   SIGKNINPIDVKFTNKATYD  141



>gb|AIA21307.1| photosystem I subunit II [Pyropia kanakaensis]
Length=141

 Score =   199 bits (505),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 95/140 (68%), Positives = 109/140 (78%), Gaps = 1/140 (1%)
 Frame = +3

Query  894   PPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLK  1073
             P T++ N PSP FGGSTGG LR A+VEE Y ITWT   E  FEMPTGG A MR G NLL 
Sbjct  2     PDTINLNMPSPTFGGSTGGWLRAAEVEEKYAITWTGKNESKFEMPTGGTATMRNGENLLY  61

Query  1074  LARKEQCLALGTRLRSKYKI-NYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVGQNMR  1250
             LA+KEQCLALGT+L+ K+KI +Y+ YRVFPNGEVQYLHPKDGV+PEKVNAGR  V     
Sbjct  62    LAKKEQCLALGTQLKIKFKISDYKIYRVFPNGEVQYLHPKDGVFPEKVNAGRASVNSVDH  121

Query  1251  SIGKNISPIEVKFTGKQVYD  1310
             SIGKN++P++VKFT K  YD
Sbjct  122   SIGKNVNPVDVKFTNKATYD  141



>gb|AIA21513.1| photosystem I subunit II [Pyropia fucicola]
Length=141

 Score =   198 bits (503),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 94/140 (67%), Positives = 109/140 (78%), Gaps = 1/140 (1%)
 Frame = +3

Query  894   PPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLK  1073
             P T++ N PSP FGGSTGG LR A+VEE Y ITWT   E  FEMPTGG A MR G NLL 
Sbjct  2     PDTINLNMPSPTFGGSTGGWLRAAEVEEKYAITWTGKNESKFEMPTGGTATMRNGENLLY  61

Query  1074  LARKEQCLALGTRLRSKYKI-NYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVGQNMR  1250
             LA+KEQCLALGT+L+SK+KI +Y+ YRVFPNGEVQYLHPKDGV+PEKVNAGR  V     
Sbjct  62    LAKKEQCLALGTQLKSKFKISDYKIYRVFPNGEVQYLHPKDGVFPEKVNAGRASVNSVDH  121

Query  1251  SIGKNISPIEVKFTGKQVYD  1310
             SIG+N++P++VKF  K  YD
Sbjct  122   SIGQNVNPVDVKFMNKATYD  141



>ref|YP_009019626.1| photosystem I reaction center subunit II (chloroplast) [Gracilaria 
salicornia]
 gb|AHH24594.1| photosystem I reaction center subunit II (chloroplast) [Gracilaria 
salicornia]
Length=141

 Score =   197 bits (502),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 94/138 (68%), Positives = 113/138 (82%), Gaps = 1/138 (1%)
 Frame = +3

Query  900   TLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLA  1079
             T+D   PSP FGGSTGG LR A++EE Y ITWTS KEQIFEMPTGGAAIM+EG NLL LA
Sbjct  4     TIDLKMPSPTFGGSTGGWLRSAEIEEKYAITWTSKKEQIFEMPTGGAAIMQEGNNLLYLA  63

Query  1080  RKEQCLALGTRLRSKYKI-NYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVGQNMRSI  1256
             RKEQCLALGT+L++++KI +++ YR+FPN EVQYLHPKDGV+PEKVNAGR G+G    SI
Sbjct  64    RKEQCLALGTQLKTQFKITDFKIYRIFPNSEVQYLHPKDGVFPEKVNAGRVGIGNIDHSI  123

Query  1257  GKNISPIEVKFTGKQVYD  1310
             G+N +P+  KFT K  Y+
Sbjct  124   GENDNPVNKKFTVKATYE  141



>ref|YP_001293570.1| photosystem I subunit II [Rhodomonas salina]
 gb|ABO70759.1| photosystem I subunit II [Rhodomonas salina]
Length=141

 Score =   197 bits (502),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 94/134 (70%), Positives = 112/134 (84%), Gaps = 1/134 (1%)
 Frame = +3

Query  900   TLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLA  1079
             TL+   PSP F GSTGG LR A+VEE Y ITWTSPKEQ+FEMPTGGAAIMR+G NLL LA
Sbjct  4     TLNLQIPSPTFEGSTGGWLRAAEVEEKYAITWTSPKEQVFEMPTGGAAIMRQGENLLYLA  63

Query  1080  RKEQCLALGTRLRSKYKI-NYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVGQNMRSI  1256
             RKEQCLAL T++++ +KI +Y+ YR+FP+GEVQYLHPKDGV+PEKVNAGR GVG    SI
Sbjct  64    RKEQCLALATQVKNSFKITDYKVYRIFPSGEVQYLHPKDGVFPEKVNAGRVGVGNVSHSI  123

Query  1257  GKNISPIEVKFTGK  1298
             GKN++P ++KFT K
Sbjct  124   GKNLNPAQIKFTSK  137



>ref|YP_007627400.1| photosystem I subunit II [Chondrus crispus]
 emb|CCP38147.1| photosystem I subunit II [Chondrus crispus]
Length=141

 Score =   197 bits (502),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 94/138 (68%), Positives = 110/138 (80%), Gaps = 1/138 (1%)
 Frame = +3

Query  900   TLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLA  1079
             T++   PSP FGGSTGG LR A++EE Y ITWTS  EQIFEMPTGGAAIMREG NLL LA
Sbjct  4     TINFKMPSPTFGGSTGGWLRSAEIEEKYAITWTSKSEQIFEMPTGGAAIMREGDNLLYLA  63

Query  1080  RKEQCLALGTRLRSKYKI-NYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVGQNMRSI  1256
             +KEQCLAL  +LR  +KI +++ YR+FPNGEVQYLHPKDGV+PEKVN GREGVG    SI
Sbjct  64    KKEQCLALSAQLRKSFKIRDFKIYRIFPNGEVQYLHPKDGVFPEKVNPGREGVGNISHSI  123

Query  1257  GKNISPIEVKFTGKQVYD  1310
             GKN +P+  KFTG+  Y+
Sbjct  124   GKNENPVNTKFTGRGTYE  141



>ref|XP_007227566.1| hypothetical protein PRUPE_ppa010764mg [Prunus persica]
 gb|EMJ28765.1| hypothetical protein PRUPE_ppa010764mg [Prunus persica]
Length=237

 Score =   201 bits (510),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 116/182 (64%), Positives = 144/182 (79%), Gaps = 8/182 (4%)
 Frame = +2

Query  92   MSFIDEFETNLEVLPNILQKKYGLMRDLDRSLQEVQRQNDQRCQLEVEDMKQRIKSGNIA  271
            MSF++EF  NLE LPNIL + Y ++R+LD+SLQ++QRQN+QRC+ E+ED+K+ IKSGNI 
Sbjct  1    MSFLEEFNANLESLPNILARHYAVLRNLDKSLQDIQRQNEQRCEQEIEDIKREIKSGNIT  60

Query  272  SDSSLIKFSDDALDEQKHAIRIADEKVALAIQAYDLVDTHIQQLDQYLKKFDEELRRVAE  451
             D+SLI+FSD+ALDEQKH+I IADEKV LA++AYDLVDTHIQQLDQYLK F+EELR   E
Sbjct  61   PDTSLIRFSDEALDEQKHSIGIADEKVMLAVRAYDLVDTHIQQLDQYLKTFEEELR---E  117

Query  452  RENAVATGSTTSNVDNNVksgrsgdsskggrkkTRL-----ATATPAANPTGMDLDLPVD  616
            R+  VA+     +VD   K GRS +  +GGRKKTRL     ATAT A NPT MDLD+PVD
Sbjct  118  RDTVVASALPAPSVDTGAKPGRSSEGGRGGRKKTRLATATAATATAAVNPTAMDLDIPVD  177

Query  617  PS  622
            P+
Sbjct  178  PN  179



>ref|XP_009609788.1| PREDICTED: PHD finger protein ING1-like, partial [Nicotiana tomentosiformis]
Length=118

 Score =   196 bits (499),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 95/117 (81%), Positives = 106/117 (91%), Gaps = 0/117 (0%)
 Frame = +2

Query  92   MSFIDEFETNLEVLPNILQKKYGLMRDLDRSLQEVQRQNDQRCQLEVEDMKQRIKSGNIA  271
            MSFIDEF+ N+E LPN L++KY L+RDLD+SLQ VQRQN+QRC+ E+EDM QRIK+GN+ 
Sbjct  1    MSFIDEFQANIEALPNHLRRKYALLRDLDKSLQGVQRQNEQRCEKEIEDMIQRIKAGNVT  60

Query  272  SDSSLIKFSDDALDEQKHAIRIADEKVALAIQAYDLVDTHIQQLDQYLKKFDEELRR  442
             DSSLIKFSDDALDEQKHAIRIADEKVALA QAYDLVD HIQQLDQYLKKFDEELRR
Sbjct  61   PDSSLIKFSDDALDEQKHAIRIADEKVALASQAYDLVDAHIQQLDQYLKKFDEELRR  117



>ref|YP_008965721.1| photosystem I reaction center subunit II (chloroplast) [Porphyridium 
purpureum]
 dbj|BAO23697.1| photosystem I reaction center subunit II (chloroplast) [Porphyridium 
purpureum]
Length=142

 Score =   197 bits (500),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 94/139 (68%), Positives = 112/139 (81%), Gaps = 1/139 (1%)
 Frame = +3

Query  900   TLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLA  1079
             T++   PSP FGGSTGG LR A+ EE Y ITWT  KE+IFE+PTGGAAIMREG NLL LA
Sbjct  4     TINLQMPSPTFGGSTGGWLRAAETEEKYAITWTGKKEEIFEIPTGGAAIMREGDNLLYLA  63

Query  1080  RKEQCLALGTRLRSKYKI-NYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVGQNMRSI  1256
             RKEQCLALGT+LR+ +KI +Y+ YR+FP GEVQYLHPKDGV+PEKVN GR G+    R+I
Sbjct  64    RKEQCLALGTQLRNSFKISDYKIYRIFPTGEVQYLHPKDGVFPEKVNEGRVGINNVSRNI  123

Query  1257  GKNISPIEVKFTGKQVYDL  1313
             GKN +PI VKFTGK  +++
Sbjct  124   GKNPNPISVKFTGKSTFEV  142



>ref|NP_050759.1| photosystem I subunit II (chloroplast) [Guillardia theta]
 sp|O78502.1|PSAD_GUITH RecName: Full=Photosystem I reaction center subunit II; AltName: 
Full=Photosystem I 16 kDa polypeptide; Short=PSI-D (chloroplast) 
[Guillardia theta]
 gb|AAC35693.1| PSI ferredoxin-binding protein II (chloroplast) [Guillardia theta]
Length=141

 Score =   197 bits (500),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 94/138 (68%), Positives = 112/138 (81%), Gaps = 1/138 (1%)
 Frame = +3

Query  900   TLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLA  1079
             TL+   PSP F GSTGG LR A+ EE Y ITWTSPKEQ+FEMPTGGAAIMR+G NLL LA
Sbjct  4     TLNLQIPSPTFEGSTGGWLRAAETEEKYAITWTSPKEQVFEMPTGGAAIMRKGENLLYLA  63

Query  1080  RKEQCLALGTRLRSKYKI-NYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVGQNMRSI  1256
             RKEQCLALGT++++ +KI +Y+ YR+FP+GEVQYLHPKDGV+PEKVN GR GVG    SI
Sbjct  64    RKEQCLALGTQVKTSFKITDYKIYRIFPSGEVQYLHPKDGVFPEKVNPGRIGVGNVSHSI  123

Query  1257  GKNISPIEVKFTGKQVYD  1310
             GKN++P ++KFT K   D
Sbjct  124   GKNLNPAQIKFTNKSFCD  141



>ref|YP_536961.1| photosystem I subunit II [Pyropia yezoensis]
 sp|Q1XDK7.1|PSAD_PYRYE RecName: Full=Photosystem I reaction center subunit II; AltName: 
Full=Photosystem I 16 kDa polypeptide; Short=PSI-D (chloroplast) 
[Pyropia yezoensis]
 dbj|BAE92404.1| Photosystem I reaction centre subunit II [Pyropia yezoensis]
 gb|AGH27605.1| photosystem I subunit II (chloroplast) [Pyropia yezoensis]
Length=141

 Score =   196 bits (499),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 94/140 (67%), Positives = 108/140 (77%), Gaps = 1/140 (1%)
 Frame = +3

Query  894   PPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLK  1073
             P T++ N PSP FGGSTGG LR A+VEE Y ITWT   E  FEMPTGG A MR G NLL 
Sbjct  2     PDTINLNMPSPTFGGSTGGWLRAAEVEEKYAITWTGKNESKFEMPTGGTATMRNGENLLY  61

Query  1074  LARKEQCLALGTRLRSKYKI-NYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVGQNMR  1250
             LA+KEQCLALGT+L+SK+KI +Y+ YRVFPNGEVQYLHPKDGV+PEKVN GR  V     
Sbjct  62    LAKKEQCLALGTQLKSKFKISDYKIYRVFPNGEVQYLHPKDGVFPEKVNTGRASVNSVDH  121

Query  1251  SIGKNISPIEVKFTGKQVYD  1310
             SIG+NI+P++VKF  K  YD
Sbjct  122   SIGQNINPVDVKFMNKATYD  141



>ref|YP_008144865.1| photosystem I reaction center subunit II [Grateloupia taiwanensis]
 gb|AGO19836.1| photosystem I reaction center subunit II [Grateloupia taiwanensis]
Length=133

 Score =   196 bits (498),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 93/132 (70%), Positives = 108/132 (82%), Gaps = 1/132 (1%)
 Frame = +3

Query  918   PSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLARKEQCL  1097
             PSP FGGSTGG LR A++EE Y ITWTS  EQIFEMPTGGAAIMREG NLL LA+KEQCL
Sbjct  2     PSPTFGGSTGGWLRAAEIEEKYAITWTSKSEQIFEMPTGGAAIMREGNNLLYLAKKEQCL  61

Query  1098  ALGTRLRSKYKI-NYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVGQNMRSIGKNISP  1274
             AL T+LR+K+KI +++ YR+FP+GEVQYLHPKDGV+PEK N GRE VG    SIGKN +P
Sbjct  62    ALSTQLRAKFKITDFKIYRIFPDGEVQYLHPKDGVFPEKANPGRESVGNIQHSIGKNDNP  121

Query  1275  IEVKFTGKQVYD  1310
             +  KFTGK  Y+
Sbjct  122   VNKKFTGKATYE  133



>ref|WP_008312724.1| PsaD [Leptolyngbya sp. PCC 6406]
Length=142

 Score =   196 bits (498),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 93/134 (69%), Positives = 110/134 (82%), Gaps = 3/134 (2%)
 Frame = +3

Query  921   SPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLARKEQCLA  1100
             +PIFGGSTGGLL KA VEE Y ITWTS +EQ+FE+PTGGAAIM EG NLL LARKEQCLA
Sbjct  9     TPIFGGSTGGLLTKAAVEEKYAITWTSTQEQVFELPTGGAAIMNEGENLLYLARKEQCLA  68

Query  1101  LGTRLRSKYK---INYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVGQNMRSIGKNIS  1271
             LGT+LR+K+K   ++Y+ YR++PNGE QYLHP DGV+PEKVN GRE VG   RSIGKN  
Sbjct  69    LGTQLRTKFKPKIVDYKIYRIYPNGETQYLHPADGVFPEKVNEGREAVGSVSRSIGKNPD  128

Query  1272  PIEVKFTGKQVYDL  1313
             P  VKF+GK+ Y++
Sbjct  129   PSTVKFSGKEPYEV  142



>gb|EYU43804.1| hypothetical protein MIMGU_mgv1a012611mg [Erythranthe guttata]
Length=245

 Score =   199 bits (507),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 120/189 (63%), Positives = 148/189 (78%), Gaps = 14/189 (7%)
 Frame = +2

Query  92   MSFIDEFETNLEVLPNILQKKYGLMRDLDRSLQEVQRQNDQRCQLEVEDMKQRIKSGNIA  271
            MS  DEF+ ++E LPNILQ+KY L+RDLD+SLQE+QRQN+QRC+ E++DMK+ IKSG+I 
Sbjct  1    MSISDEFQADIEALPNILQRKYALLRDLDKSLQEIQRQNEQRCEQEIDDMKRGIKSGSIT  60

Query  272  SDSSLIKFSDDALDEQKHAIRIADEKVALAIQAYDLVDTHIQQLDQYLKKFDEELRRVAE  451
             +SSL+KFSDDALDEQKHAIRIADEKVALA+Q YDLVDTHIQQLDQ LKKFDE+LRR  E
Sbjct  61   PNSSLLKFSDDALDEQKHAIRIADEKVALAVQVYDLVDTHIQQLDQCLKKFDEDLRR--E  118

Query  452  RENAVATGSTTSNVDNNVksgrsgdsskggrkkTRL------------ATATPAANPTGM  595
            RE     GS  +  ++NVKSG+SG++S  GRKKTRL            A+A   AN + M
Sbjct  119  REAIATAGSPPAPENSNVKSGKSGETSNRGRKKTRLATATAAASASASASAAATANSSSM  178

Query  596  DLDLPVDPS  622
            +LD+PVDP+
Sbjct  179  ELDIPVDPN  187



>ref|YP_001936347.1| photosystem I subunit II [Heterosigma akashiwo]
 gb|ABV65953.1| photosystem I reaction center subunit II [Heterosigma akashiwo]
 gb|ABV70094.1| photosystem I reaction center subunit II [Heterosigma akashiwo]
Length=139

 Score =   196 bits (498),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 98/138 (71%), Positives = 114/138 (83%), Gaps = 2/138 (1%)
 Frame = +3

Query  900   TLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLA  1079
             TL+  T SPIFGGSTGG LR A++EE YVITW+S KEQ+FEMPTGGAAIM +G NLL LA
Sbjct  2     TLNLQTFSPIFGGSTGGWLRAAEIEEKYVITWSSSKEQLFEMPTGGAAIMLQGENLLYLA  61

Query  1080  RKEQCLALGTRLRSKYKIN-YQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVGQNMRSI  1256
             RKEQCLALGT+LRS +KIN Y+ YR+FPNGE+QYLHPKDGV+PEKVN GR  VG    SI
Sbjct  62    RKEQCLALGTQLRS-FKINDYKIYRLFPNGEIQYLHPKDGVFPEKVNPGRLAVGSRNFSI  120

Query  1257  GKNISPIEVKFTGKQVYD  1310
             GKN +P+ VKF+GK  +D
Sbjct  121   GKNPNPVSVKFSGKGTFD  138



>gb|AHY04349.1| photosystem I reaction center subunit II (chloroplast) [Chrysochromulina 
sp. CCMP291]
Length=141

 Score =   196 bits (497),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 94/137 (69%), Positives = 108/137 (79%), Gaps = 1/137 (1%)
 Frame = +3

Query  903   LDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLAR  1082
             L+   PSP FGGSTGG LR A+ EE Y ITWTS KEQIFEMPT GAAIM+ G NLL LA+
Sbjct  5     LNLQIPSPTFGGSTGGWLRSAETEEKYAITWTSKKEQIFEMPTSGAAIMKSGENLLYLAK  64

Query  1083  KEQCLALGTRLRSKYKI-NYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVGQNMRSIG  1259
             KEQCLALGT+LR+ +KI +Y+ YR+FPN EVQYLHPKDG++PEK+N GR GVG    SIG
Sbjct  65    KEQCLALGTQLRTLFKISDYKIYRIFPNSEVQYLHPKDGIFPEKLNQGRVGVGNVGHSIG  124

Query  1260  KNISPIEVKFTGKQVYD  1310
             KN  P+ VKFTGK  YD
Sbjct  125   KNPQPVSVKFTGKSTYD  141



>ref|XP_008438417.1| PREDICTED: PHD finger protein ING1 [Cucumis melo]
 ref|XP_008438418.1| PREDICTED: PHD finger protein ING1 [Cucumis melo]
 ref|XP_008438419.1| PREDICTED: PHD finger protein ING1 [Cucumis melo]
 ref|XP_008438420.1| PREDICTED: PHD finger protein ING1 [Cucumis melo]
Length=239

 Score =   199 bits (505),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 112/183 (61%), Positives = 137/183 (75%), Gaps = 8/183 (4%)
 Frame = +2

Query  92   MSFIDEFETNLEVLPNILQKKYGLMRDLDRSLQEVQRQNDQRCQLEVEDMKQRIKSGNIA  271
            MSF++EF+ NLE LPNILQKKY L+ DLD+SLQ + +QN+QRC+ E+ED+K+ +K GNI 
Sbjct  1    MSFLEEFQANLESLPNILQKKYALLHDLDQSLQGLVKQNEQRCEQEIEDIKRGVKCGNIT  60

Query  272  SDSSLIKFSDDALDEQKHAIRIADEKVALAIQAYDLVDTHIQQLDQYLKKFDEELRRVAE  451
             D+SLI+FSD+ALDEQKH+IRIADEKVALA+QAYDLVDTHIQQLDQYLK FDE+LR   E
Sbjct  61   PDTSLIRFSDEALDEQKHSIRIADEKVALAVQAYDLVDTHIQQLDQYLKNFDEKLRH--E  118

Query  452  RENAVATGSTTSNVDNNVks------grsgdsskggrkkTRLATATPAANPTGMDLDLPV  613
            R  A ATG   S+VD N KS      GR G   +  +       A   A PTGM+L+LPV
Sbjct  119  RGTAAATGLPASSVDGNTKSGRGTEGGRGGRKKRNAQAAASTTEAPTTATPTGMELELPV  178

Query  614  DPS  622
            DP+
Sbjct  179  DPN  181



>ref|WP_015145740.1| PsaD [Pleurocapsa minor]
 gb|AFY79442.1| PsaD [Pleurocapsa sp. PCC 7327]
Length=142

 Score =   195 bits (496),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 94/133 (71%), Positives = 107/133 (80%), Gaps = 3/133 (2%)
 Frame = +3

Query  924   PIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLARKEQCLAL  1103
             P FGGSTGGLL KA VEE Y ITWTSPKEQ+FEMPTGGAAIM EG NLL LARKEQCLAL
Sbjct  10    PKFGGSTGGLLTKADVEEKYAITWTSPKEQVFEMPTGGAAIMNEGENLLYLARKEQCLAL  69

Query  1104  GTRLRSKYK---INYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVGQNMRSIGKNISP  1274
             G +LR+K+K    NY+ YR++PNGE+QYLHP DGV+PEKVN GR  VG+  RSIGKN  P
Sbjct  70    GAQLRTKFKPKIENYKIYRIYPNGEIQYLHPADGVFPEKVNEGRVAVGKKDRSIGKNPEP  129

Query  1275  IEVKFTGKQVYDL  1313
               +KF+GK  YD+
Sbjct  130   ATLKFSGKMPYDV  142



>ref|YP_004376584.1| photosystem I ferredoxin-binding protein (chloroplast) [Fistulifera 
solaris]
 dbj|BAK18950.1| photosystem I ferredoxin-binding protein (chloroplast) [Fistulifera 
solaris]
Length=139

 Score =   194 bits (493),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 97/137 (71%), Positives = 109/137 (80%), Gaps = 2/137 (1%)
 Frame = +3

Query  900   TLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLA  1079
             TL+  TP P FGGSTGG LR A+VEE Y ITWTSPKEQIFEMPTGGAAIMR G NLL LA
Sbjct  2     TLNLQTPFPTFGGSTGGWLRAAEVEEKYAITWTSPKEQIFEMPTGGAAIMRNGENLLYLA  61

Query  1080  RKEQCLALGTRLRSKYKIN-YQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVGQNMRSI  1256
             RKEQCLALGT+LR+ +KIN Y+ YR+FP+GEVQYLHPKDGV+PEKVN GR  V     SI
Sbjct  62    RKEQCLALGTQLRT-FKINDYKIYRIFPSGEVQYLHPKDGVFPEKVNPGRSAVNSRQFSI  120

Query  1257  GKNISPIEVKFTGKQVY  1307
             GKN +P  +KF+G   Y
Sbjct  121   GKNPNPASIKFSGTTTY  137



>ref|YP_063618.1| photosystem I subunit II [Gracilaria tenuistipitata var. liui]
 gb|AAT79693.1| photosystem I reaction center subunit II [Gracilaria tenuistipitata 
var. liui]
Length=141

 Score =   194 bits (493),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 93/138 (67%), Positives = 109/138 (79%), Gaps = 1/138 (1%)
 Frame = +3

Query  900   TLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLA  1079
             T+D   PSP FGGSTGG LR A++EE Y ITWTS +EQIFEMP GGAAIMREG NLL LA
Sbjct  4     TIDLKMPSPTFGGSTGGWLRSAEIEEKYAITWTSKQEQIFEMPIGGAAIMREGNNLLYLA  63

Query  1080  RKEQCLALGTRLRSKYKI-NYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVGQNMRSI  1256
             RKEQCLAL T+L+ ++KI +++ YR+FPN EVQYLHPKDGV+PEKVN GR G+G    SI
Sbjct  64    RKEQCLALSTQLKMQFKIKDFKIYRIFPNSEVQYLHPKDGVFPEKVNPGRVGIGNIDHSI  123

Query  1257  GKNISPIEVKFTGKQVYD  1310
             GKN  P+  KFTGK  Y+
Sbjct  124   GKNEDPVNKKFTGKATYE  141



>ref|YP_003734986.1| photosystem I protein subunit II [Durinskia baltica]
 gb|ADI40201.1| photosystem I protein subunit II [Durinskia baltica]
Length=139

 Score =   194 bits (492),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 95/137 (69%), Positives = 106/137 (77%), Gaps = 0/137 (0%)
 Frame = +3

Query  900   TLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLA  1079
             TL+  TP P FGGSTGG LR A+VEE Y ITWTS KEQIFEMPTGGAAIMR G NLL LA
Sbjct  2     TLNLQTPFPTFGGSTGGWLRSAEVEEKYAITWTSSKEQIFEMPTGGAAIMRNGENLLYLA  61

Query  1080  RKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVGQNMRSIG  1259
             RKEQCLALGT+LR+    NY+ YR+FP+GEVQYLHPKDGV+PEKVN GR  +     SIG
Sbjct  62    RKEQCLALGTQLRTFKINNYKIYRIFPSGEVQYLHPKDGVFPEKVNPGRVAMNSRDFSIG  121

Query  1260  KNISPIEVKFTGKQVYD  1310
             KN  P  +KF+GK  YD
Sbjct  122   KNPDPASIKFSGKTTYD  138



>ref|YP_003734548.1| ferredoxin-binding protein II [Kryptoperidinium foliaceum]
 gb|ADI40333.1| ferredoxin-binding protein II [Kryptoperidinium foliaceum]
Length=139

 Score =   194 bits (492),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 95/137 (69%), Positives = 106/137 (77%), Gaps = 0/137 (0%)
 Frame = +3

Query  900   TLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLA  1079
             TL+  TP P FGGSTGG LR A+VEE Y ITWTS KEQIFEMPTGGAAIMR G NLL LA
Sbjct  2     TLNLQTPFPTFGGSTGGWLRAAEVEEKYAITWTSSKEQIFEMPTGGAAIMRNGENLLYLA  61

Query  1080  RKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVGQNMRSIG  1259
             RKEQCLALGT+LR+    NY+ YR+FP+GEVQYLHPKDGV+PEKVN GR        SIG
Sbjct  62    RKEQCLALGTQLRTFKINNYKIYRIFPSGEVQYLHPKDGVFPEKVNPGRVAANSRDFSIG  121

Query  1260  KNISPIEVKFTGKQVYD  1310
             KN +P  +KF+GK  YD
Sbjct  122   KNPNPASIKFSGKTTYD  138



>ref|XP_009362046.1| PREDICTED: PHD finger protein ING1-like [Pyrus x bretschneideri]
Length=237

 Score =   197 bits (500),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 116/182 (64%), Positives = 143/182 (79%), Gaps = 8/182 (4%)
 Frame = +2

Query  92   MSFIDEFETNLEVLPNILQKKYGLMRDLDRSLQEVQRQNDQRCQLEVEDMKQRIKSGNIA  271
            MSF++EF  NLE LPNIL K Y +MR LDRSLQ+ QRQN+QRC+ E+ED+K+ IKSGNI 
Sbjct  1    MSFLEEFNANLESLPNILAKNYSVMRTLDRSLQDNQRQNEQRCEQEIEDIKREIKSGNIT  60

Query  272  SDSSLIKFSDDALDEQKHAIRIADEKVALAIQAYDLVDTHIQQLDQYLKKFDEELRRVAE  451
             D+SLI+FSD+ALDEQKH++ IADEKV LA++AYDLVDTHIQQLDQYLK F+EELR   E
Sbjct  61   PDTSLIRFSDEALDEQKHSVGIADEKVLLAVRAYDLVDTHIQQLDQYLKNFEEELR---E  117

Query  452  RENAVATGSTTSNVDNNVksgrsgdsskggrkkTRL-----ATATPAANPTGMDLDLPVD  616
            R++A A+     N D+  KSG+S +  +GGRKKTRL     A AT + NPT MDLD+PVD
Sbjct  118  RDSAAASALPAPNPDSGAKSGKSSEGGRGGRKKTRLATAAAAAATASVNPTAMDLDIPVD  177

Query  617  PS  622
            P+
Sbjct  178  PN  179



>ref|XP_009377447.1| PREDICTED: PHD finger protein ING1-like [Pyrus x bretschneideri]
Length=237

 Score =   197 bits (500),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 114/182 (63%), Positives = 144/182 (79%), Gaps = 8/182 (4%)
 Frame = +2

Query  92   MSFIDEFETNLEVLPNILQKKYGLMRDLDRSLQEVQRQNDQRCQLEVEDMKQRIKSGNIA  271
            MSF++EF  NLE LPNIL K Y +MR LD+SLQ++QRQN+QRC+ E+ED+K+ IKSGNI 
Sbjct  1    MSFLEEFNANLESLPNILAKNYSVMRTLDQSLQDIQRQNEQRCEQEIEDIKREIKSGNIT  60

Query  272  SDSSLIKFSDDALDEQKHAIRIADEKVALAIQAYDLVDTHIQQLDQYLKKFDEELRRVAE  451
             D+SLI+FSD+ALDEQKH++ IADEKV LA++AYD+VDTHIQQLDQYLK F+EELR   E
Sbjct  61   PDTSLIRFSDEALDEQKHSVGIADEKVLLAVRAYDMVDTHIQQLDQYLKTFEEELR---E  117

Query  452  RENAVATGSTTSNVDNNVksgrsgdsskggrkkTRL-----ATATPAANPTGMDLDLPVD  616
            R++A A+     N D+  KSG+S +  +GGRKKTRL     A AT + NPT MDLD+PVD
Sbjct  118  RDSAAASALPAPNPDSGAKSGKSSEGGRGGRKKTRLATAAAAAATASVNPTAMDLDIPVD  177

Query  617  PS  622
            P+
Sbjct  178  PN  179



>ref|WP_009769007.1| PsaD protein [Oscillatoriales cyanobacterium JSC-12]
 gb|EKQ66743.1| PsaD protein [Oscillatoriales cyanobacterium JSC-12]
Length=139

 Score =   193 bits (490),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 90/129 (70%), Positives = 107/129 (83%), Gaps = 0/129 (0%)
 Frame = +3

Query  924   PIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLARKEQCLAL  1103
             PIFGGSTGGLL KA VEE Y ITW+SPKEQ+FEMPT GAA+MR+G NLL LARKEQCLAL
Sbjct  10    PIFGGSTGGLLTKALVEEKYAITWSSPKEQVFEMPTAGAAVMRQGDNLLYLARKEQCLAL  69

Query  1104  GTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVGQNMRSIGKNISPIEV  1283
             GT+L++K+KI+Y+ YRVFPNG++QYLHP DGVYPEKVN GR  V    R+IGKN  P ++
Sbjct  70    GTQLKTKFKIDYKIYRVFPNGDIQYLHPADGVYPEKVNPGRVAVNSVPRNIGKNPDPAKL  129

Query  1284  KFTGKQVYD  1310
             KF+G   Y+
Sbjct  130   KFSGVAPYN  138



>ref|WP_018400163.1| Photosystem I reaction center subunit II [filamentous cyanobacterium 
ESFC-1]
Length=142

 Score =   193 bits (490),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 92/133 (69%), Positives = 108/133 (81%), Gaps = 3/133 (2%)
 Frame = +3

Query  924   PIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLARKEQCLAL  1103
             P FGGSTGGLL KA+VEE Y ITWTSPKEQ+FEMPTGGAAIM EG N+L+LARKEQCLAL
Sbjct  10    PKFGGSTGGLLTKAKVEEKYAITWTSPKEQVFEMPTGGAAIMNEGENMLELARKEQCLAL  69

Query  1104  GTRLRSKYK---INYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVGQNMRSIGKNISP  1274
             GT+LR+K+K    +Y+ YR++PNGE+QYLHP DGV+PEKVN GR  VG+  R IG N  P
Sbjct  70    GTQLRTKFKPKMEDYKIYRIYPNGEIQYLHPADGVFPEKVNEGRPYVGKKDRKIGDNPEP  129

Query  1275  IEVKFTGKQVYDL  1313
               VKF+GK  YD+
Sbjct  130   ATVKFSGKAPYDV  142



>ref|XP_011650900.1| PREDICTED: PHD finger protein ING1 isoform X2 [Cucumis sativus]
Length=211

 Score =   195 bits (496),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 95/137 (69%), Positives = 115/137 (84%), Gaps = 2/137 (1%)
 Frame = +2

Query  92   MSFIDEFETNLEVLPNILQKKYGLMRDLDRSLQEVQRQNDQRCQLEVEDMKQRIKSGNIA  271
            MSF++EF+ NLE LPNILQKKY L+ DLD+SLQ + +QN+QRC+ E+ED+K+ +K GNI 
Sbjct  1    MSFLEEFQANLESLPNILQKKYALLHDLDQSLQGLVKQNEQRCEQEIEDIKRGVKCGNIT  60

Query  272  SDSSLIKFSDDALDEQKHAIRIADEKVALAIQAYDLVDTHIQQLDQYLKKFDEELRRVAE  451
             D+SLI+FSD+ALDEQKH+IRIADEKVALA+QAYDLVDTHIQQLDQYLK FDE+LR   E
Sbjct  61   PDTSLIRFSDEALDEQKHSIRIADEKVALAVQAYDLVDTHIQQLDQYLKNFDEKLRH--E  118

Query  452  RENAVATGSTTSNVDNN  502
            R  A ATG   S+VD N
Sbjct  119  RGTAAATGLPASSVDVN  135



>ref|YP_009029026.1| photosystem I reaction center subunit II (chloroplast) [Cylindrotheca 
closterium]
 gb|AGH28565.1| photosystem I reaction center subunit II (chloroplast) (chloroplast) 
[Cylindrotheca closterium]
Length=139

 Score =   192 bits (489),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 96/137 (70%), Positives = 107/137 (78%), Gaps = 0/137 (0%)
 Frame = +3

Query  900   TLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLA  1079
             TL+  TP P FGGSTGG LR A+VEE Y ITWTS KEQIFEMPTGGAAIMR G NLL LA
Sbjct  2     TLNLQTPFPTFGGSTGGWLRSAEVEEKYAITWTSAKEQIFEMPTGGAAIMRNGENLLYLA  61

Query  1080  RKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVGQNMRSIG  1259
             RKEQCLALGT+LR+    NY+ YR+FP+GEVQYLHPKDGV+PEKVN GR  VG    SIG
Sbjct  62    RKEQCLALGTQLRTFKINNYKIYRIFPSGEVQYLHPKDGVFPEKVNPGRISVGSRDFSIG  121

Query  1260  KNISPIEVKFTGKQVYD  1310
             KN +P  +KF+G   YD
Sbjct  122   KNPNPALIKFSGIATYD  138



>ref|XP_008362239.1| PREDICTED: PHD finger protein ING1-like [Malus domestica]
 ref|XP_008362240.1| PREDICTED: PHD finger protein ING1-like [Malus domestica]
Length=237

 Score =   196 bits (498),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 114/182 (63%), Positives = 143/182 (79%), Gaps = 8/182 (4%)
 Frame = +2

Query  92   MSFIDEFETNLEVLPNILQKKYGLMRDLDRSLQEVQRQNDQRCQLEVEDMKQRIKSGNIA  271
            MSF++EF  NLE LPNIL K Y +MR LD+SLQ++QRQN+QRC+ E+ED+K+ IKSGNI 
Sbjct  1    MSFLEEFNANLESLPNILAKNYSVMRTLDQSLQDIQRQNEQRCEQEIEDIKREIKSGNIT  60

Query  272  SDSSLIKFSDDALDEQKHAIRIADEKVALAIQAYDLVDTHIQQLDQYLKKFDEELRRVAE  451
             D+SLI+FSD+ALDEQKH+I IADEKV LA++AYDLVDTHIQQLDQYLK F+EELR   E
Sbjct  61   PDTSLIRFSDEALDEQKHSIGIADEKVLLAVRAYDLVDTHIQQLDQYLKTFEEELR---E  117

Query  452  RENAVATGSTTSNVDNNVksgrsgdsskggrkkTRL-----ATATPAANPTGMDLDLPVD  616
            R++A A+     + D+  KSG+S +  +GGRKKTRL     A A  + NPT MDLD+PVD
Sbjct  118  RDSAAASALPAPSPDSGAKSGKSSEGGRGGRKKTRLATAAAAAAIASVNPTAMDLDIPVD  177

Query  617  PS  622
            P+
Sbjct  178  PN  179



>ref|XP_011464224.1| PREDICTED: PHD finger protein ING1 isoform X2 [Fragaria vesca 
subsp. vesca]
Length=243

 Score =   196 bits (498),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 102/186 (55%), Positives = 127/186 (68%), Gaps = 9/186 (5%)
 Frame = +2

Query  92   MSFIDEFETNLEVLPNILQKKYGLMRDLDRSLQEVQRQNDQRCQLEVEDMKQRIKSGNIA  271
            MSF++EF  NLE LPNILQ+ Y ++R+LD+SLQ++QRQN+QRC+ E+ED+K+ IKSGNI 
Sbjct  1    MSFLEEFHANLESLPNILQRHYAVLRNLDKSLQDIQRQNEQRCEQEIEDIKREIKSGNIT  60

Query  272  SDSSLIKFSDDALDEQKHAIRIADEKVALAIQAYDLVDTHIQQLDQYLKKFDEELRRVAE  451
             DSSLI+FSD+ALDEQKH+I IADEKV LA++AYDLVDTHIQQLDQYLKK   ELR  A 
Sbjct  61   PDSSLIRFSDEALDEQKHSIGIADEKVMLAVRAYDLVDTHIQQLDQYLKKIGAELRPDAV  120

Query  452  RENAVATGSTTSNVDNNVksgrsgdsskggrkkTRLATATPA---------ANPTGMDLD  604
              +A+   S      +           K  +       A P          ANPTGMDLD
Sbjct  121  AASAMPAPSLDGTAKSGRSGEGGRGGRKKKQATVTAPEAAPVPATATVPAPANPTGMDLD  180

Query  605  LPVDPS  622
            +PVDP+
Sbjct  181  IPVDPN  186



>ref|XP_002304691.1| PHD finger family protein [Populus trichocarpa]
 gb|EEE79670.1| PHD finger family protein [Populus trichocarpa]
Length=246

 Score =   196 bits (498),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 105/188 (56%), Positives = 134/188 (71%), Gaps = 14/188 (7%)
 Frame = +2

Query  95   SFIDEFETNLEVLPNILQKKYGLMRDLDRSLQEVQRQNDQRCQLEVEDMKQRIKSGNIAS  274
            SF+DEF+ NLE LPNILQKKY L+RDLD+SLQE+QRQN+QRC+ E+ED+K+ +K+GNI  
Sbjct  3    SFVDEFQANLEALPNILQKKYSLLRDLDKSLQEIQRQNEQRCEQEIEDIKRGVKAGNITP  62

Query  275  DSSLIKFSDDALDEQKHAIRIADEKVALAIQAYDLVDTHIQQLDQYLKKFDEELRRVAER  454
            ++SLI+FSD+ALDEQKH+IRIADEK+ALA+QAYDLVD HIQQLDQ+LK  DE+ RR  ER
Sbjct  63   NTSLIRFSDEALDEQKHSIRIADEKMALAVQAYDLVDAHIQQLDQFLKLCDEDNRR--ER  120

Query  455  ENAV------------ATGSTTSNVDNNVksgrsgdsskggrkkTRLATATPAANPTGMD  598
            + A              T S   +        ++   +     +T +A AT  AN TGM 
Sbjct  121  DTAAAAPALLASSLDGGTKSGRGSESGRGGRKKTRLVAAEEATETEVAVATTFANTTGMQ  180

Query  599  LDLPVDPS  622
            LDLPVDP+
Sbjct  181  LDLPVDPN  188



>ref|WP_026795097.1| MULTISPECIES: Photosystem I reaction center subunit II [Planktothrix]
Length=142

 Score =   192 bits (488),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 92/133 (69%), Positives = 105/133 (79%), Gaps = 3/133 (2%)
 Frame = +3

Query  924   PIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLARKEQCLAL  1103
             P FGGSTGGLL KA VEE Y ITWTS KEQ+FEMPTGGAAIM EG NL+ LARKEQCLAL
Sbjct  10    PKFGGSTGGLLTKALVEEKYAITWTSSKEQVFEMPTGGAAIMNEGDNLMYLARKEQCLAL  69

Query  1104  GTRLRSKYK---INYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVGQNMRSIGKNISP  1274
             GT+LRSK+K    NY+ YRVFPNGE +YLHPKDGV+PEKVN GR+ V     +IG N+ P
Sbjct  70    GTQLRSKFKPKIDNYKIYRVFPNGETEYLHPKDGVFPEKVNEGRQSVNSVAHNIGSNVDP  129

Query  1275  IEVKFTGKQVYDL  1313
             ++VKFT K   D+
Sbjct  130   VKVKFTTKTTSDV  142



>ref|YP_277398.1| photosystem I subunit II [Emiliania huxleyi]
 gb|AAU81920.1| photosystem I subunit II [Emiliania huxleyi]
 gb|AAX13897.1| photosystem I subunit II [Emiliania huxleyi]
 gb|AEI29557.1| photosystem I subunit II [Emiliania huxleyi]
Length=142

 Score =   192 bits (488),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 93/142 (65%), Positives = 111/142 (78%), Gaps = 1/142 (1%)
 Frame = +3

Query  888   FTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANL  1067
              T   L+   P+P FGGSTGG LR A++EE Y ITWTS KEQIFEMPT GAAIM++G NL
Sbjct  1     MTSDVLNLQIPTPTFGGSTGGWLRAAEIEEKYAITWTSKKEQIFEMPTSGAAIMQKGENL  60

Query  1068  LKLARKEQCLALGTRLRSKYKI-NYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVGQN  1244
             L LA+KEQCLAL T+LR+ +KI +Y+ YR+FPN EVQYLHPKDGV+PEK+N GR GVG  
Sbjct  61    LYLAKKEQCLALSTQLRTLFKISDYKIYRIFPNSEVQYLHPKDGVFPEKLNEGRIGVGNV  120

Query  1245  MRSIGKNISPIEVKFTGKQVYD  1310
               SIGKN +P+ VKFTGK  +D
Sbjct  121   GYSIGKNPNPVNVKFTGKNTFD  142



>ref|WP_023068767.1| photosystem I reaction center subunit II [Lyngbya aestuarii]
 gb|ERT04980.1| photosystem I reaction center subunit II [Lyngbya aestuarii BL 
J]
Length=142

 Score =   192 bits (488),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 90/133 (68%), Positives = 111/133 (83%), Gaps = 3/133 (2%)
 Frame = +3

Query  924   PIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLARKEQCLAL  1103
             PIFGGSTGGLL KA++EE Y ITWTSPKEQ+FEMPTGGAAIM EG NLL LARKEQCLAL
Sbjct  10    PIFGGSTGGLLSKAEIEEKYAITWTSPKEQVFEMPTGGAAIMNEGENLLYLARKEQCLAL  69

Query  1104  GTRLRSKYK---INYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVGQNMRSIGKNISP  1274
             GT+LR+K+K    +++ YR++PNGE++YLHPKDGV+PEKVN GR+  G+  R+IG N  P
Sbjct  70    GTQLRTKFKPKMEDFKIYRIYPNGEMEYLHPKDGVFPEKVNEGRDFYGKIERNIGSNPDP  129

Query  1275  IEVKFTGKQVYDL  1313
              +VKF+GK  Y++
Sbjct  130   AKVKFSGKATYEV  142



>ref|YP_009028878.1| photosystem I reaction center subunit II (chloroplast) [Coscinodiscus 
radiatus]
 gb|AGH28422.1| photosystem I reaction center subunit II (chloroplast) (chloroplast) 
[Coscinodiscus radiatus]
Length=139

 Score =   192 bits (487),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 95/138 (69%), Positives = 110/138 (80%), Gaps = 2/138 (1%)
 Frame = +3

Query  900   TLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLA  1079
             TL+  TP P FGGSTGG LR A+VEE Y ITWTS KEQIFEMPTGGAAIMR G NLL LA
Sbjct  2     TLNLQTPFPTFGGSTGGWLRAAEVEEKYAITWTSKKEQIFEMPTGGAAIMRNGENLLYLA  61

Query  1080  RKEQCLALGTRLRSKYKIN-YQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVGQNMRSI  1256
             RKEQCLALGT+LR+ +KIN Y+ YR+FP+GEVQYLHPKDGV+PEKVN GR+ +     SI
Sbjct  62    RKEQCLALGTQLRT-FKINDYKIYRIFPSGEVQYLHPKDGVFPEKVNPGRKAINSRNFSI  120

Query  1257  GKNISPIEVKFTGKQVYD  1310
             GKN +P  +KF+G   Y+
Sbjct  121   GKNPNPASIKFSGNTTYE  138



>ref|XP_010069086.1| PREDICTED: PHD finger protein ING1 [Eucalyptus grandis]
 gb|KCW57312.1| hypothetical protein EUGRSUZ_H001091 [Eucalyptus grandis]
Length=232

 Score =   195 bits (495),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 111/184 (60%), Positives = 144/184 (78%), Gaps = 17/184 (9%)
 Frame = +2

Query  92   MSFIDEFETNLEVLPNILQKKYGLMRDLDRSLQEVQRQNDQRCQLEVEDMKQRIKSGNIA  271
            MSF+DEF+ +LE LPNILQKKY L+RDLD+SL++++RQN+QRC+ E+E++KQ +KSGN  
Sbjct  1    MSFLDEFQADLEALPNILQKKYALLRDLDKSLEDLRRQNEQRCEQEIEEIKQGVKSGNT-  59

Query  272  SDSSLIKFSDDALDEQKHAIRIADEKVALAIQAYDLVDTHIQQLDQYLKKFDEELRRVAE  451
                   FSD+ LDEQ+H+IRIADEKVALA+ AYDLVDTHIQQLDQYLKK +EELRR  +
Sbjct  60   -------FSDEVLDEQRHSIRIADEKVALAVHAYDLVDTHIQQLDQYLKKCNEELRR--D  110

Query  452  RENAVATGSTTSNVDNNVksgrsgdsskggrkkTRLAT-----ATPAA--NPTGMDLDLP  610
            +E+    G ++S+VD + K GR  +S +GGRK TRLAT     AT AA  NP GM+LD+P
Sbjct  111  KESVPPEGISSSSVDASTKPGRGSESGRGGRKNTRLATQAATEATNAASTNPPGMELDIP  170

Query  611  VDPS  622
            +DP+
Sbjct  171  IDPN  174



>ref|WP_009787700.1| photosystem I subunit II [Lyngbya sp. PCC 8106]
 gb|EAW33738.1| photosystem I subunit II [Lyngbya sp. PCC 8106]
Length=142

 Score =   192 bits (487),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 90/133 (68%), Positives = 111/133 (83%), Gaps = 3/133 (2%)
 Frame = +3

Query  924   PIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLARKEQCLAL  1103
             PIFGGSTGGLL KA++EE Y ITWTSPKEQ+FEMPTGGAAIM EG NLL LARKEQCLAL
Sbjct  10    PIFGGSTGGLLSKAEIEEKYAITWTSPKEQVFEMPTGGAAIMNEGENLLYLARKEQCLAL  69

Query  1104  GTRLRSKYK---INYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVGQNMRSIGKNISP  1274
             GT+LR+K+K    +++ YR++PNGE++YLHPKDGV+PEKVN GR+  G+  R+IG N  P
Sbjct  70    GTQLRTKFKPKIEDFKIYRIYPNGEMEYLHPKDGVFPEKVNEGRDFYGKIERNIGANPDP  129

Query  1275  IEVKFTGKQVYDL  1313
              +VKF+GK  Y++
Sbjct  130   AKVKFSGKATYEV  142



>gb|ABK96014.1| unknown [Populus trichocarpa]
Length=97

 Score =   190 bits (483),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 91/97 (94%), Positives = 92/97 (95%), Gaps = 0/97 (0%)
 Frame = +3

Query  1023  MPTGGAAIMREGANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVY  1202
             MPTGGAAIMREG NLLKLARKEQCLALGTRLRSKYKI YQFYRVFPNGEVQYLHPKDGVY
Sbjct  1     MPTGGAAIMREGPNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPNGEVQYLHPKDGVY  60

Query  1203  PEKVNAGREGVGQNMRSIGKNISPIEVKFTGKQVYDL  1313
             PEKVN GR+GVGQN RSIGKN SPIEVKFTGKQVYDL
Sbjct  61    PEKVNPGRQGVGQNFRSIGKNASPIEVKFTGKQVYDL  97



>ref|YP_009029191.1| photosystem I reaction center subunit II (chloroplast) [Didymosphenia 
geminata]
 gb|AGH28722.1| photosystem I reaction center subunit II (chloroplast) (chloroplast) 
[Didymosphenia geminata]
Length=139

 Score =   191 bits (486),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 96/138 (70%), Positives = 109/138 (79%), Gaps = 2/138 (1%)
 Frame = +3

Query  900   TLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLA  1079
             TL+  TP P FGGSTGG LR A+VEE Y ITWTSPKEQIFEMPTGGAAIMR G NLL LA
Sbjct  2     TLNLQTPFPTFGGSTGGWLRAAEVEEKYAITWTSPKEQIFEMPTGGAAIMRNGENLLYLA  61

Query  1080  RKEQCLALGTRLRSKYKIN-YQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVGQNMRSI  1256
             RKEQCLALGT+LR+ +KIN Y+ YR+FP+GEVQYLHPKDGV+PEKVN GR  V     SI
Sbjct  62    RKEQCLALGTQLRT-FKINDYKIYRIFPSGEVQYLHPKDGVFPEKVNPGRTAVNSRQFSI  120

Query  1257  GKNISPIEVKFTGKQVYD  1310
             GKN +P  +KF+    Y+
Sbjct  121   GKNPNPASIKFSSFTTYE  138



>ref|YP_005089671.1| psaD gene product (chloroplast) [Ulnaria acus]
 gb|AEX37796.1| photosystem I subunit II (chloroplast) [Ulnaria acus]
Length=139

 Score =   191 bits (486),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 95/137 (69%), Positives = 105/137 (77%), Gaps = 0/137 (0%)
 Frame = +3

Query  900   TLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLA  1079
             TL+  TP P FGGSTGG LR A+VEE Y ITWTS KEQIFEMPTGGAAIMR G NLL LA
Sbjct  2     TLNLQTPFPTFGGSTGGWLRSAEVEEKYAITWTSTKEQIFEMPTGGAAIMRNGENLLYLA  61

Query  1080  RKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVGQNMRSIG  1259
             RKEQCLALGT+LR+    NY+ YR+FP+GEVQYLHPKDGV+PEKVN GR  V     SIG
Sbjct  62    RKEQCLALGTQLRTFKINNYKIYRIFPSGEVQYLHPKDGVFPEKVNPGRSAVNSREFSIG  121

Query  1260  KNISPIEVKFTGKQVYD  1310
             KN  P  VKF+G   Y+
Sbjct  122   KNPEPASVKFSGIATYE  138



>ref|YP_009092872.1| photosystem I subunit II (chloroplast) [Chaetoceros simplex]
 gb|AIR75263.1| photosystem I subunit II (chloroplast) [Chaetoceros simplex]
Length=139

 Score =   191 bits (486),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 96/138 (70%), Positives = 109/138 (79%), Gaps = 2/138 (1%)
 Frame = +3

Query  900   TLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLA  1079
             TL+  TP P FGGSTGG LR A+VEE Y ITWTS KEQIFEMPTGGAAIMR G NLL LA
Sbjct  2     TLNLQTPFPTFGGSTGGWLRSAEVEEKYAITWTSKKEQIFEMPTGGAAIMRNGENLLYLA  61

Query  1080  RKEQCLALGTRLRSKYKIN-YQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVGQNMRSI  1256
             RKEQCLALGT+LR+ +KIN Y+ YR+FP+GEVQYLHPKDGV+PEKVN GR  V     SI
Sbjct  62    RKEQCLALGTQLRT-FKINDYKIYRIFPSGEVQYLHPKDGVFPEKVNPGRTSVNSRDFSI  120

Query  1257  GKNISPIEVKFTGKQVYD  1310
             GKN +P  +KF+G   Y+
Sbjct  121   GKNPNPASIKFSGTTTYE  138



>ref|YP_009059209.1| photosystem I reaction center subunit II (chloroplast) [Eunotia 
naegelii]
 gb|AHI51156.1| photosystem I reaction center subunit II (chloroplast) [Eunotia 
naegelii]
Length=139

 Score =   191 bits (486),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 95/137 (69%), Positives = 106/137 (77%), Gaps = 0/137 (0%)
 Frame = +3

Query  900   TLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLA  1079
             TL+  TP P FGGSTGG LR A+VEE Y ITWTS KEQIFEMPTGGAAIMR G NLL LA
Sbjct  2     TLNLQTPFPTFGGSTGGWLRAAEVEEKYAITWTSSKEQIFEMPTGGAAIMRNGENLLYLA  61

Query  1080  RKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVGQNMRSIG  1259
             RKEQCLALGT+LR+    NY+ YR+FP+GEVQYLHPKDGV+PEKVN GR  V     SIG
Sbjct  62    RKEQCLALGTQLRTFKINNYKIYRIFPSGEVQYLHPKDGVFPEKVNPGRTSVNSRGFSIG  121

Query  1260  KNISPIEVKFTGKQVYD  1310
             KN +P  VKF+G   Y+
Sbjct  122   KNPNPASVKFSGINTYE  138



>ref|YP_874394.1| photosystem I ferredoxin-binding protein [Phaeodactylum tricornutum]
 gb|ABK20617.1| photosystem I ferredoxin-binding protein [Phaeodactylum tricornutum]
Length=139

 Score =   191 bits (485),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 96/138 (70%), Positives = 109/138 (79%), Gaps = 2/138 (1%)
 Frame = +3

Query  900   TLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLA  1079
             TL+  TP P FGGSTGG LR A+VEE Y ITWTSPKEQIFEMP GGAAIMR G NLL LA
Sbjct  2     TLNLQTPFPTFGGSTGGWLRSAEVEEKYAITWTSPKEQIFEMPIGGAAIMRSGENLLYLA  61

Query  1080  RKEQCLALGTRLRSKYKIN-YQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVGQNMRSI  1256
             RKEQCLALGT+LR+ +KIN Y+ YR+FP+GEVQYLHPKDGV+PEKVN GR  V     SI
Sbjct  62    RKEQCLALGTQLRT-FKINDYKIYRIFPSGEVQYLHPKDGVFPEKVNPGRTAVNNRDFSI  120

Query  1257  GKNISPIEVKFTGKQVYD  1310
             GKN +P  +KF+G   Y+
Sbjct  121   GKNPNPASIKFSGINTYE  138



>ref|YP_009093339.1| photosystem I subunit II (chloroplast) [Cerataulina daemon]
 gb|AIR76012.1| photosystem I subunit II (chloroplast) [Cerataulina daemon]
Length=139

 Score =   191 bits (485),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 96/138 (70%), Positives = 109/138 (79%), Gaps = 2/138 (1%)
 Frame = +3

Query  900   TLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLA  1079
             TL+  TP P FGGSTGG LR A+VEE Y ITWTS KEQIFEMPTGGAAIMR G NLL LA
Sbjct  2     TLNLQTPFPTFGGSTGGWLRAAEVEEKYAITWTSKKEQIFEMPTGGAAIMRNGENLLYLA  61

Query  1080  RKEQCLALGTRLRSKYKIN-YQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVGQNMRSI  1256
             RKEQCLALGT+LR+ +KIN Y+ YR+FP+GEVQYLHPKDGV+PEKVN GR  V     SI
Sbjct  62    RKEQCLALGTQLRT-FKINDYKIYRIFPSGEVQYLHPKDGVFPEKVNPGRTSVNSRDFSI  120

Query  1257  GKNISPIEVKFTGKQVYD  1310
             GKN +P  +KF+G   Y+
Sbjct  121   GKNPNPASIKFSGTTTYE  138



>ref|XP_004299213.1| PREDICTED: PHD finger protein ING1 isoform X1 [Fragaria vesca 
subsp. vesca]
Length=245

 Score =   195 bits (495),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 106/191 (55%), Positives = 134/191 (70%), Gaps = 17/191 (9%)
 Frame = +2

Query  92   MSFIDEFETNLEVLPNILQKKYGLMRDLDRSLQEVQRQNDQRCQLEVEDMKQRIKSGNIA  271
            MSF++EF  NLE LPNILQ+ Y ++R+LD+SLQ++QRQN+QRC+ E+ED+K+ IKSGNI 
Sbjct  1    MSFLEEFHANLESLPNILQRHYAVLRNLDKSLQDIQRQNEQRCEQEIEDIKREIKSGNIT  60

Query  272  SDSSLIKFSDDALDEQKHAIRIADEKVALAIQAYDLVDTHIQQLDQYLKKFDEELRRVAE  451
             DSSLI+FSD+ALDEQKH+I IADEKV LA++AYDLVDTHIQQLDQYLKK   ELR  ++
Sbjct  61   PDSSLIRFSDEALDEQKHSIGIADEKVMLAVRAYDLVDTHIQQLDQYLKKIGAELRPASD  120

Query  452  RENAVATGSTTSNVDNNVksgrsgdsskggrkkTRLATAT-------PA-------ANPT  589
               AVA  +  +   +             G +K + AT T       PA       ANPT
Sbjct  121  ---AVAASAMPAPSLDGTAKSGRSGEGGRGGRKKKQATVTAPEAAPVPATATVPAPANPT  177

Query  590  GMDLDLPVDPS  622
            GMDLD+PVDP+
Sbjct  178  GMDLDIPVDPN  188



>gb|KJB28067.1| hypothetical protein B456_005G039000 [Gossypium raimondii]
Length=201

 Score =   193 bits (490),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 95/136 (70%), Positives = 114/136 (84%), Gaps = 3/136 (2%)
 Frame = +2

Query  98   FIDEFETNLEVLPNILQKKYGLMRDLDRSLQEVQRQNDQRCQLEVEDMKQRIKSGNIASD  277
            FIDEF+ +LE LPNILQKKY LMRDLD+SLQE+ RQN+QRC+ E+EDMK+ +++GNI  D
Sbjct  4    FIDEFQADLEALPNILQKKYALMRDLDKSLQEIVRQNEQRCEQEIEDMKRGLRAGNITPD  63

Query  278  SSLIKFSDDALDEQKHAIRIADEKVALAIQAYDLVDTHIQQLDQYLKKFDEELRRVAERE  457
            +SL++FS++ALDEQKH++RIADEKVALAIQAYDLVD+HIQQLDQYLKK  EELRR  ERE
Sbjct  64   TSLLRFSEEALDEQKHSVRIADEKVALAIQAYDLVDSHIQQLDQYLKKSGEELRR--ERE  121

Query  458  NAVATGSTTSNVDNNV  505
            N  AT S T   D   
Sbjct  122  N-TATASPTQTPDGTT  136



>ref|WP_015173693.1| photosystem I protein PsaD [Geitlerinema sp. PCC 7407]
 gb|AFY68129.1| photosystem I protein PsaD [Geitlerinema sp. PCC 7407]
Length=142

 Score =   191 bits (485),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 91/133 (68%), Positives = 106/133 (80%), Gaps = 3/133 (2%)
 Frame = +3

Query  921   SPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLARKEQCLA  1100
             +PIFGGSTGGLL KA+VEE Y ITWTS K+Q+FEMPTGGAA+M EG NLL LARKEQCLA
Sbjct  9     TPIFGGSTGGLLTKAEVEEKYAITWTSKKQQVFEMPTGGAAVMNEGENLLYLARKEQCLA  68

Query  1101  LGTRLRSKYK---INYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVGQNMRSIGKNIS  1271
             LG +LR+K+K    +Y+ YRVFPNGE+QYLHPKDGV+PEKVN GR  V  N R IG N  
Sbjct  69    LGAQLRTKFKPKMEDYKIYRVFPNGEIQYLHPKDGVFPEKVNEGRTSVNHNPRKIGDNPQ  128

Query  1272  PIEVKFTGKQVYD  1310
             P +VKF+G   Y+
Sbjct  129   PAKVKFSGTPTYE  141



>ref|WP_035996822.1| Photosystem I reaction center subunit II [Leptolyngbya sp. JSC-1]
Length=142

 Score =   191 bits (484),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 92/133 (69%), Positives = 105/133 (79%), Gaps = 3/133 (2%)
 Frame = +3

Query  921   SPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLARKEQCLA  1100
             +PIFGGSTGGLL KA  EE Y ITWTS KEQ+FEMPTGGAA+MR+G NLL LARKEQC+A
Sbjct  9     TPIFGGSTGGLLSKADEEEKYAITWTSSKEQVFEMPTGGAAVMRQGENLLYLARKEQCIA  68

Query  1101  LGTRLRSKYK---INYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVGQNMRSIGKNIS  1271
             LG +LRSK+K    +Y+ YRVFP+GE+QYLHP DGV+PEKVN GR  V    RSIG+N  
Sbjct  69    LGAQLRSKFKPKIEDYKIYRVFPSGEIQYLHPADGVFPEKVNEGRAAVNSVPRSIGQNPQ  128

Query  1272  PIEVKFTGKQVYD  1310
             P  VKFTGK  YD
Sbjct  129   PATVKFTGKNTYD  141



>ref|YP_009029302.1| photosystem I reaction center subunit II (chloroplast) [Leptocylindrus 
danicus]
 gb|AGH28833.1| photosystem I reaction center subunit II (chloroplast) (chloroplast) 
[Leptocylindrus danicus]
Length=139

 Score =   190 bits (482),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 95/138 (69%), Positives = 108/138 (78%), Gaps = 2/138 (1%)
 Frame = +3

Query  900   TLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLA  1079
             TL+  TP P FGGSTGG LR A+VEE Y ITWTSPKEQIFEMPTGGAA+MR G NLL LA
Sbjct  2     TLNLQTPFPTFGGSTGGWLRAAEVEEKYAITWTSPKEQIFEMPTGGAAVMRNGENLLYLA  61

Query  1080  RKEQCLALGTRLRSKYKIN-YQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVGQNMRSI  1256
             RKEQCLALGT+LR  +KIN Y+ YR+FP+GEVQYLHPKDGV+PEK N GR  V     SI
Sbjct  62    RKEQCLALGTQLRG-FKINGYKIYRIFPSGEVQYLHPKDGVFPEKANPGRTSVNSRGFSI  120

Query  1257  GKNISPIEVKFTGKQVYD  1310
             GKN +P  +KF+G   Y+
Sbjct  121   GKNPNPASIKFSGISTYE  138



>ref|XP_011020717.1| PREDICTED: PHD finger protein ING1 [Populus euphratica]
Length=246

 Score =   194 bits (492),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 106/188 (56%), Positives = 135/188 (72%), Gaps = 14/188 (7%)
 Frame = +2

Query  95   SFIDEFETNLEVLPNILQKKYGLMRDLDRSLQEVQRQNDQRCQLEVEDMKQRIKSGNIAS  274
            SF+DEF+ NLE LPNILQKKY L+RDLD+SLQE+QRQN+QRC+ E+ED+K+ +K+GNI  
Sbjct  3    SFVDEFQANLEALPNILQKKYSLLRDLDKSLQEIQRQNEQRCEQEIEDIKRGVKAGNITP  62

Query  275  DSSLIKFSDDALDEQKHAIRIADEKVALAIQAYDLVDTHIQQLDQYLKKFDEELRRVAER  454
            ++SLI+FSD+ALDEQKH+IRIADEK+ALA+QAYDLVD HIQQLDQ+LK  D + RR  ER
Sbjct  63   NTSLIRFSDEALDEQKHSIRIADEKMALAVQAYDLVDAHIQQLDQFLKLCDVDNRR--ER  120

Query  455  ENAVAT---------GST---TSNVDNNVksgrsgdsskggrkkTRLATATPAANPTGMD  598
            + A A          GST     +        ++   +     +T +A AT  AN TGM 
Sbjct  121  DTAAAAPALLASSLDGSTKSGRGSESGRGGRKKTRLVAAEEATETEVAVATTFANTTGMQ  180

Query  599  LDLPVDPS  622
            LDLPVDP+
Sbjct  181  LDLPVDPN  188



>ref|XP_007034500.1| RING/FYVE/PHD zinc finger superfamily protein isoform 2 [Theobroma 
cacao]
 gb|EOY05426.1| RING/FYVE/PHD zinc finger superfamily protein isoform 2 [Theobroma 
cacao]
Length=237

 Score =   193 bits (491),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 116/190 (61%), Positives = 142/190 (75%), Gaps = 25/190 (13%)
 Frame = +2

Query  92   MSFIDEFETNLEVLPNILQKKYGLMRDLDRSLQEVQRQNDQRCQLEVEDMKQRIKSGNIA  271
            MSFIDEF+ +LE LPNILQKKY LMRDLD+SLQE+ RQN+QRC+ E+ED+++ +++GNI 
Sbjct  1    MSFIDEFQADLEALPNILQKKYALMRDLDKSLQEIVRQNEQRCEQEIEDIRRGVRAGNIT  60

Query  272  SDSSLIKFSDDALDEQKHAIRIADEKVALAIQAYDLVDTHIQQLDQYLKKFDEELRRVAE  451
             D+SL++FSD+ALDEQKH+IRIADEK          VD+HIQQLDQYLKK DEELRR  E
Sbjct  61   PDTSLLRFSDEALDEQKHSIRIADEK----------VDSHIQQLDQYLKKSDEELRR--E  108

Query  452  RENAVATGSTTSNVDNNVksgrsgdsskggrkkTRL-------------ATATPAANPTG  592
            RENA AT S+  + D+  KSGR  +S +GGRKKTRL               A  AANPTG
Sbjct  109  RENAAATASSGPSPDSTTKSGRPSESGRGGRKKTRLATAAAAAAAAAATEVAAAAANPTG  168

Query  593  MDLDLPVDPS  622
            M+LDLPVDP+
Sbjct  169  MELDLPVDPN  178



>ref|NP_043647.1| photosystem I subunit II [Odontella sinensis]
 sp|P49481.1|PSAD_ODOSI RecName: Full=Photosystem I reaction center subunit II; AltName: 
Full=Photosystem I 16 kDa polypeptide; Short=PSI-D (chloroplast) 
[Odontella sinensis]
 emb|CAA91679.1| PSI, ferredoxin-binding protein II [Odontella sinensis]
Length=139

 Score =   190 bits (482),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 96/138 (70%), Positives = 109/138 (79%), Gaps = 2/138 (1%)
 Frame = +3

Query  900   TLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLA  1079
             TL+  TP P FGGSTGG LR A+VEE Y ITWTS KEQIFEMPTGGAAIMR G NLL LA
Sbjct  2     TLNLQTPFPTFGGSTGGWLRAAEVEEKYAITWTSKKEQIFEMPTGGAAIMRNGENLLYLA  61

Query  1080  RKEQCLALGTRLRSKYKIN-YQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVGQNMRSI  1256
             RKEQCLALGT+LR+ +KIN Y+ YR+FP+GEVQYLHPKDGV+PEKVN GR  V     SI
Sbjct  62    RKEQCLALGTQLRT-FKINDYKIYRIFPSGEVQYLHPKDGVFPEKVNPGRTSVNSRGFSI  120

Query  1257  GKNISPIEVKFTGKQVYD  1310
             GKN +P  +KF+G   Y+
Sbjct  121   GKNPNPASIKFSGITTYE  138



>ref|WP_006616635.1| MULTISPECIES: photosystem I protein PsaD [Arthrospira]
 gb|EDZ95101.1| photosystem I protein PsaD [Arthrospira maxima CS-328]
 dbj|BAI90809.1| photosystem I reaction center subunit II [Arthrospira platensis 
NIES-39]
 emb|CCE16228.1| Photosystem I reaction center subunit II (Photosystem I 16 kDa 
polypeptide) (PSI-D) [Arthrospira sp. PCC 8005]
 gb|EKD05964.1| photosystem I protein PsaD [Arthrospira platensis C1]
 emb|CDM94815.1| Photosystem I reaction center subunit II (Photosystem I 16 kDa 
polypeptide) (PSI-D) [Arthrospira sp. PCC 8005]
 gb|KDR56251.1| Photosystem I reaction center subunit II [Arthrospira platensis 
str. Paraca]
Length=142

 Score =   190 bits (482),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 92/133 (69%), Positives = 108/133 (81%), Gaps = 3/133 (2%)
 Frame = +3

Query  921   SPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLARKEQCLA  1100
             +P FGGSTGGLL KAQVEE Y ITWTS KEQ+FEMPTGGAAIM EG NLL LARKEQCLA
Sbjct  9     APKFGGSTGGLLTKAQVEEKYAITWTSTKEQVFEMPTGGAAIMNEGENLLYLARKEQCLA  68

Query  1101  LGTRLRSKYK---INYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVGQNMRSIGKNIS  1271
             LGT+LR+K+K    +++ YR+FPNGE++YLHPKDGV+PEKVN GRE  G+  R IG N +
Sbjct  69    LGTQLRTKFKPKIEDFKIYRIFPNGEMEYLHPKDGVFPEKVNEGREFNGKIDRKIGDNPN  128

Query  1272  PIEVKFTGKQVYD  1310
             P  VKF+GK  Y+
Sbjct  129   PASVKFSGKATYE  141



>ref|YP_009093018.1| photosystem I subunit II (chloroplast) [Rhizosolenia imbricata]
 gb|AIR75691.1| photosystem I subunit II (chloroplast) [Rhizosolenia imbricata]
Length=139

 Score =   189 bits (481),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 94/137 (69%), Positives = 107/137 (78%), Gaps = 0/137 (0%)
 Frame = +3

Query  900   TLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLA  1079
             TL+  TP P FGGSTGG LR A+VEE Y ITWTS KEQIFEMPTGGAAIMR G NLL LA
Sbjct  2     TLNLQTPFPTFGGSTGGWLRSAEVEEKYAITWTSKKEQIFEMPTGGAAIMRNGENLLYLA  61

Query  1080  RKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVGQNMRSIG  1259
             RKEQCLALGT+LR+    NY+ YR+FP+GEVQYLHPKDGV+PEKVN GR  V     SIG
Sbjct  62    RKEQCLALGTQLRTFKLNNYKIYRIFPSGEVQYLHPKDGVFPEKVNPGRIPVNSRPFSIG  121

Query  1260  KNISPIEVKFTGKQVYD  1310
             KN +P+ +KF+G   Y+
Sbjct  122   KNPNPVSIKFSGINTYE  138



>ref|YP_007878240.1| photosystem I subunit II (chloroplast) [Calliarthron tuberculosum]
 gb|AGA63851.1| photosystem I subunit II (chloroplast) [Calliarthron tuberculosum]
Length=141

 Score =   189 bits (481),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 93/138 (67%), Positives = 108/138 (78%), Gaps = 1/138 (1%)
 Frame = +3

Query  900   TLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLA  1079
             T++   PSP FGGSTGG LR A+VEE Y ITW S KEQIFEMPTGGAAIMRE  NLL L+
Sbjct  4     TINFQMPSPTFGGSTGGWLRSAEVEEKYAITWNSKKEQIFEMPTGGAAIMREDDNLLYLS  63

Query  1080  RKEQCLALGTRLRSKYKI-NYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVGQNMRSI  1256
             RKEQCLAL ++L SK+KI + + YR+FP+GEVQYLHPKDGV PEKVN+GR GVG    SI
Sbjct  64    RKEQCLALSSQLLSKFKIRDCKIYRIFPSGEVQYLHPKDGVVPEKVNSGRIGVGNIDHSI  123

Query  1257  GKNISPIEVKFTGKQVYD  1310
             GKN  P+  KFTG+  Y+
Sbjct  124   GKNTEPVNKKFTGQNTYE  141



>ref|WP_026788324.1| MULTISPECIES: Photosystem I reaction center subunit II [Planktothrix]
Length=142

 Score =   189 bits (480),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 91/133 (68%), Positives = 104/133 (78%), Gaps = 3/133 (2%)
 Frame = +3

Query  924   PIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLARKEQCLAL  1103
             P FGGSTGGLL KA VEE Y ITWTS KEQ+FEMPTGGAAIM EG NL+ LA KEQCLAL
Sbjct  10    PKFGGSTGGLLTKALVEEKYAITWTSSKEQVFEMPTGGAAIMNEGDNLMYLALKEQCLAL  69

Query  1104  GTRLRSKYK---INYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVGQNMRSIGKNISP  1274
             GT+LRSK+K    NY+ YRVFPNGE +YLHPKDGV+PEKVN GR+ V     +IG N+ P
Sbjct  70    GTQLRSKFKPKIDNYKIYRVFPNGETEYLHPKDGVFPEKVNEGRQSVNSVAHNIGSNVDP  129

Query  1275  IEVKFTGKQVYDL  1313
             ++VKFT K   D+
Sbjct  130   VKVKFTTKTTSDV  142



>ref|XP_008224073.1| PREDICTED: PHD finger protein ING1 isoform X1 [Prunus mume]
Length=237

 Score =   192 bits (489),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 114/182 (63%), Positives = 141/182 (77%), Gaps = 8/182 (4%)
 Frame = +2

Query  92   MSFIDEFETNLEVLPNILQKKYGLMRDLDRSLQEVQRQNDQRCQLEVEDMKQRIKSGNIA  271
            MSF++EF  NLE LPNIL + Y ++R LD+SLQ++QRQN+QRC+ E+ED+K+ IKSGNI 
Sbjct  1    MSFLEEFNANLESLPNILARHYAVLRSLDKSLQDIQRQNEQRCEQEIEDIKREIKSGNIT  60

Query  272  SDSSLIKFSDDALDEQKHAIRIADEKVALAIQAYDLVDTHIQQLDQYLKKFDEELRRVAE  451
             D+SLI+FSD+ALDEQKH+I IADEKV LA++AYDLVDTHIQQLDQYLK F+EELR   E
Sbjct  61   PDTSLIRFSDEALDEQKHSIGIADEKVMLAVRAYDLVDTHIQQLDQYLKTFEEELR---E  117

Query  452  RENAVATGSTTSNVDNNVksgrsgdsskggrkkTRL-----ATATPAANPTGMDLDLPVD  616
            R+   A+     + D   K GRS +  +GGRKKTRL     ATAT A NPT MDLD+PVD
Sbjct  118  RDTVAASALPAPSADTGAKPGRSSEGGRGGRKKTRLATATAATATAAVNPTAMDLDIPVD  177

Query  617  PS  622
            P+
Sbjct  178  PN  179



>ref|WP_016872271.1| MULTISPECIES: Photosystem I reaction center subunit II [Fischerella]
Length=142

 Score =   189 bits (480),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 92/131 (70%), Positives = 109/131 (83%), Gaps = 2/131 (2%)
 Frame = +3

Query  921   SPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLARKEQCLA  1100
             +PIFGGSTGGLL+KA+VEE Y ITWTSPKEQ+FEMPTGGAAIMR+G NLL LARKEQC+A
Sbjct  9     TPIFGGSTGGLLKKAEVEEKYAITWTSPKEQVFEMPTGGAAIMRQGQNLLYLARKEQCIA  68

Query  1101  LGTRLRSKYKI-NYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVGQNMRSIGKNISPI  1277
             LG +LR K+KI +Y+ YR++PNGE  Y+HP DGV+PEKVN GRE V  N R IG+N SP 
Sbjct  69    LGGQLR-KFKITDYKIYRIYPNGETVYIHPADGVFPEKVNQGREKVRYNDRRIGQNPSPS  127

Query  1278  EVKFTGKQVYD  1310
             +VKF+G   YD
Sbjct  128   KVKFSGIATYD  138



>ref|YP_009029445.1| photosystem I reaction center subunit II (chloroplast) [Lithodesmium 
undulatum]
 gb|AGH28976.1| photosystem I reaction center subunit II (chloroplast) (chloroplast) 
[Lithodesmium undulatum]
Length=139

 Score =   189 bits (480),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 97/138 (70%), Positives = 108/138 (78%), Gaps = 2/138 (1%)
 Frame = +3

Query  900   TLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLA  1079
             TL+  TP P FGGSTGG LR A+VEE Y ITWTS KEQIFEMPTGGAAIMR G NLL LA
Sbjct  2     TLNLQTPFPTFGGSTGGWLRAAEVEEKYAITWTSNKEQIFEMPTGGAAIMRNGENLLYLA  61

Query  1080  RKEQCLALGTRLRSKYKIN-YQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVGQNMRSI  1256
             RKEQCLALGT+LR+ +KIN Y+ YR+FP+GEVQYLHPKDGV PEKVN GR  V     SI
Sbjct  62    RKEQCLALGTQLRT-FKINDYKIYRIFPSGEVQYLHPKDGVSPEKVNPGRTAVNSRGFSI  120

Query  1257  GKNISPIEVKFTGKQVYD  1310
             GKN +P  VKF+G   Y+
Sbjct  121   GKNPNPASVKFSGISTYE  138



>ref|WP_028824843.1| Photosystem I reaction center subunit II [Proteobacteria bacterium 
JGI 0000113-P07]
Length=139

 Score =   189 bits (479),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 94/138 (68%), Positives = 108/138 (78%), Gaps = 2/138 (1%)
 Frame = +3

Query  900   TLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLA  1079
             TLD    +PIFGGSTGG LR AQ+EE Y ITW+S K QIFEMPTGGAAIMR G NLL LA
Sbjct  2     TLDSQIQTPIFGGSTGGWLRAAQIEEKYAITWSSAKSQIFEMPTGGAAIMRTGQNLLYLA  61

Query  1080  RKEQCLALGTRLRSKYKIN-YQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVGQNMRSI  1256
             RKEQCLALGT+LR+ +KIN Y+ YR+FP+GEVQYLHPKDGV+PEK N GR        SI
Sbjct  62    RKEQCLALGTQLRT-FKINDYKIYRIFPSGEVQYLHPKDGVFPEKSNEGRVQANNRQFSI  120

Query  1257  GKNISPIEVKFTGKQVYD  1310
             GKN +PI VKF+GK  ++
Sbjct  121   GKNPNPIAVKFSGKGTFE  138



>gb|EHC11738.1| photosystem I protein PsaD [Fischerella sp. JSC-11]
Length=159

 Score =   189 bits (480),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 96/142 (68%), Positives = 112/142 (79%), Gaps = 4/142 (3%)
 Frame = +3

Query  888   FTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANL  1067
             F   TL   TP  IFGGSTGGLL+KA+VEE Y ITWTSPKEQ+FEMPTGGAAIMR+G NL
Sbjct  17    FMAETLSGQTP--IFGGSTGGLLKKAEVEEKYAITWTSPKEQVFEMPTGGAAIMRQGQNL  74

Query  1068  LKLARKEQCLALGTRLRSKYKI-NYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVGQN  1244
             L LARKEQC+ALG +LR K+KI +Y+ YR++PNGE  Y+HP DGV+PEKVN GRE V  N
Sbjct  75    LYLARKEQCIALGGQLR-KFKITDYKIYRIYPNGETVYIHPADGVFPEKVNQGREKVRYN  133

Query  1245  MRSIGKNISPIEVKFTGKQVYD  1310
              R IG+N SP +VKF+G   YD
Sbjct  134   DRRIGQNPSPSKVKFSGIATYD  155



>gb|KJB33357.1| hypothetical protein B456_006G054900 [Gossypium raimondii]
Length=239

 Score =   192 bits (487),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 119/189 (63%), Positives = 142/189 (75%), Gaps = 22/189 (12%)
 Frame = +2

Query  92   MSFIDEFETNLEVLPNILQKKYGLMRDLDRSLQEVQRQNDQRCQLEVEDMKQRIKSGNIA  271
            MSFID+F+ +LE LPNILQKKY LMRDLD+SLQE+ RQN+QRC+ E+ED+K+ +++ NI 
Sbjct  1    MSFIDQFQADLEALPNILQKKYALMRDLDKSLQEIVRQNEQRCEQEIEDIKRGLRAENI-  59

Query  272  SDSSLIKFSDDALDEQKHAIRIADEKVALAIQAYDLVDTHIQQLDQYLKKFDEELRRVAE  451
                  +FSD+ALDEQKH IRIADEKVALAIQ YDLVD+HIQQLDQYLK  DEELRR  E
Sbjct  60   ------RFSDEALDEQKHGIRIADEKVALAIQTYDLVDSHIQQLDQYLKMSDEELRR--E  111

Query  452  RENAVATGSTTSNVDNNVksgrsgdsskggrkkTRL------------ATATPAANPTGM  595
            RENA AT S   + ++  KSGRS +S +GGRKKTRL              A  A NPTGM
Sbjct  112  RENA-ATASPVPSPNSTTKSGRSNESGRGGRKKTRLATAAAAAAAATEVAAAAAENPTGM  170

Query  596  DLDLPVDPS  622
            +LDLPVDP+
Sbjct  171  ELDLPVDPN  179



>gb|AFR24825.1| photosystem I reaction center subunit II [uncultured Pelagomonas]
Length=139

 Score =   188 bits (477),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 93/138 (67%), Positives = 108/138 (78%), Gaps = 2/138 (1%)
 Frame = +3

Query  900   TLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLA  1079
             TLD    +PIFGGSTGG LR AQ+EE Y ITW+S K QIFEMPTGGAAIMR G NLL LA
Sbjct  2     TLDSQIQTPIFGGSTGGWLRAAQIEEKYAITWSSAKSQIFEMPTGGAAIMRTGQNLLYLA  61

Query  1080  RKEQCLALGTRLRSKYKIN-YQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVGQNMRSI  1256
             RKEQCLALGT+LR+ +KIN Y+ YR+FP+GEVQYLHPKDGV+PEK N GR        SI
Sbjct  62    RKEQCLALGTQLRT-FKINDYKIYRIFPSGEVQYLHPKDGVFPEKSNEGRVQANNRQFSI  120

Query  1257  GKNISPIEVKFTGKQVYD  1310
             GKN +P+ VKF+GK  ++
Sbjct  121   GKNPNPVAVKFSGKGTFE  138



>ref|WP_039725494.1| MULTISPECIES: Photosystem I reaction center subunit II [Oscillatoriophycideae]
 gb|KIF13826.1| Photosystem I reaction center subunit II [Aphanocapsa montana 
BDHKU210001]
 gb|KIF38764.1| Photosystem I reaction center subunit II [Lyngbya confervoides 
BDU141951]
Length=142

 Score =   188 bits (477),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 89/134 (66%), Positives = 107/134 (80%), Gaps = 3/134 (2%)
 Frame = +3

Query  921   SPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLARKEQCLA  1100
             +P FGGSTGGLL  A VEE Y ITWTS KEQ+FEMPTGG+AIM EG NLL LARKEQCLA
Sbjct  9     TPKFGGSTGGLLTAAAVEEKYAITWTSSKEQVFEMPTGGSAIMNEGENLLYLARKEQCLA  68

Query  1101  LGTRLRSKYK---INYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVGQNMRSIGKNIS  1271
             LG +LR+K+K    +Y+ YR++P+GE QYLHP DGV+PEKVN GRE V +N RSIGKN  
Sbjct  69    LGAQLRTKFKPRIQDYKIYRIYPSGETQYLHPADGVFPEKVNEGRESVNRNDRSIGKNPD  128

Query  1272  PIEVKFTGKQVYDL  1313
             P  +KF+GK+ Y++
Sbjct  129   PATIKFSGKEPYEV  142



>ref|WP_008189408.1| PsaD [Moorea producens]
 gb|EGJ29445.1| PsaD [Moorea producens 3L]
Length=142

 Score =   188 bits (477),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 90/134 (67%), Positives = 108/134 (81%), Gaps = 3/134 (2%)
 Frame = +3

Query  921   SPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLARKEQCLA  1100
             +PIFGGSTGGLL KA+VEE Y ITWTS KEQ+FEMPTGGAAIM EG NLL LARKEQCLA
Sbjct  9     TPIFGGSTGGLLTKAEVEEKYAITWTSSKEQVFEMPTGGAAIMNEGENLLYLARKEQCLA  68

Query  1101  LGTRLRSKYK---INYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVGQNMRSIGKNIS  1271
             LGT+LR+K+K    +Y+ YRV+PNGE+Q+LHP DGV+PEKVN GR   G+  R+IG N  
Sbjct  69    LGTQLRTKFKPKIEDYKIYRVYPNGEIQFLHPADGVFPEKVNEGRPYAGKIDRNIGSNPE  128

Query  1272  PIEVKFTGKQVYDL  1313
             P  +KF+GK  Y++
Sbjct  129   PATIKFSGKAAYEV  142



>ref|YP_874547.1| photosystem I ferredoxin-binding protein [Thalassiosira pseudonana]
 ref|XP_002297531.1| predicted protein [Thalassiosira pseudonana CCMP1335]
 gb|ABK20770.1| photosystem I ferredoxin-binding protein [Thalassiosira pseudonana]
 gb|EED86171.1| predicted protein [Thalassiosira pseudonana CCMP1335]
Length=139

 Score =   188 bits (477),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 95/138 (69%), Positives = 108/138 (78%), Gaps = 2/138 (1%)
 Frame = +3

Query  900   TLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLA  1079
             TL+  TP P FGGSTGG LR A+VEE Y ITWTS KEQIFEMPTGGAAIMR G NLL LA
Sbjct  2     TLNLKTPFPTFGGSTGGWLRAAEVEEKYAITWTSTKEQIFEMPTGGAAIMRNGENLLYLA  61

Query  1080  RKEQCLALGTRLRSKYKIN-YQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVGQNMRSI  1256
             RKEQCLAL T+LR+ +KIN Y+ YR+FP+GEVQYLHPKDGV+PEKVN GR  V     SI
Sbjct  62    RKEQCLALSTQLRT-FKINDYKIYRIFPSGEVQYLHPKDGVFPEKVNPGRTSVNSRGFSI  120

Query  1257  GKNISPIEVKFTGKQVYD  1310
             GKN +P  +KF+G   Y+
Sbjct  121   GKNPNPASIKFSGITTYE  138



>ref|WP_013323038.1| photosystem I protein PsaD [Cyanothece sp. PCC 7822]
 gb|ADN14945.1| photosystem I protein PsaD [Cyanothece sp. PCC 7822]
Length=141

 Score =   188 bits (477),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 90/133 (68%), Positives = 106/133 (80%), Gaps = 3/133 (2%)
 Frame = +3

Query  924   PIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLARKEQCLAL  1103
             P FGGSTGGLL KA +EE Y ITWTSPKEQ+FE+PTGGAAIM EG NLL LARKEQC+AL
Sbjct  9     PKFGGSTGGLLSKANLEEKYAITWTSPKEQVFELPTGGAAIMNEGDNLLYLARKEQCIAL  68

Query  1104  GTRLRSKYK---INYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVGQNMRSIGKNISP  1274
             G + RSK+K    NY+ YR+FPNGE++YLHP DGV+PEKVN GR   G+  RSIGKN  P
Sbjct  69    GGQFRSKFKPKIDNYKIYRIFPNGEIEYLHPADGVFPEKVNEGRAYNGKKDRSIGKNPEP  128

Query  1275  IEVKFTGKQVYDL  1313
               +KF+GK+ YD+
Sbjct  129   ATLKFSGKKPYDV  141



>ref|WP_017715328.1| Photosystem I reaction center subunit II [Oscillatoria sp. PCC 
10802]
Length=142

 Score =   187 bits (476),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 88/134 (66%), Positives = 108/134 (81%), Gaps = 3/134 (2%)
 Frame = +3

Query  921   SPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLARKEQCLA  1100
             +PIFGGSTGGLL KA+VEE Y ITWTS KEQ+FEMPTGGAAIM +G NLL LARKEQCLA
Sbjct  9     TPIFGGSTGGLLTKAEVEEKYAITWTSSKEQVFEMPTGGAAIMHQGQNLLYLARKEQCLA  68

Query  1101  LGTRLRSKYK---INYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVGQNMRSIGKNIS  1271
             LG +LR+K+K    +Y+ YR++ NGE+QYLHP DGV+PEKVN GR  VG+  R+IG N  
Sbjct  69    LGAQLRTKFKPKIEDYKIYRIYANGEIQYLHPNDGVFPEKVNEGRASVGKKDRNIGSNPQ  128

Query  1272  PIEVKFTGKQVYDL  1313
             P  VKF+G++ Y++
Sbjct  129   PATVKFSGQRTYEV  142



>ref|YP_003002181.1| photosystem I reaction center subunit II (chloroplast) [Aureoumbra 
lagunensis]
 gb|ACS36893.1| photosystem I reaction center subunit II (chloroplast) [Aureoumbra 
lagunensis]
Length=139

 Score =   187 bits (476),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 92/137 (67%), Positives = 107/137 (78%), Gaps = 0/137 (0%)
 Frame = +3

Query  900   TLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLA  1079
             TLD    +PIF GSTGG LR AQVEE Y ITW S K QIFEMPTGGAAIMR G NLL LA
Sbjct  2     TLDSQIQTPIFEGSTGGWLRAAQVEEKYAITWGSSKSQIFEMPTGGAAIMRTGQNLLYLA  61

Query  1080  RKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVGQNMRSIG  1259
             RKEQCLALGT+LR+    +Y+ YR+FP+GEVQYLHPKDGV+PEK N GR  VG+   SIG
Sbjct  62    RKEQCLALGTQLRTFKITDYKIYRIFPSGEVQYLHPKDGVFPEKSNEGRIQVGKRDFSIG  121

Query  1260  KNISPIEVKFTGKQVYD  1310
             KN +P+ VKF+GK+ ++
Sbjct  122   KNPNPVTVKFSGKESFE  138



>ref|WP_017304392.1| Photosystem I reaction center subunit II [Spirulina subsalsa]
Length=142

 Score =   187 bits (476),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 90/133 (68%), Positives = 105/133 (79%), Gaps = 3/133 (2%)
 Frame = +3

Query  924   PIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLARKEQCLAL  1103
             P FGGSTGGLL KA VEE Y ITWTS KEQ+FEMPTGGAAIM EG NLL LARKEQCLAL
Sbjct  10    PKFGGSTGGLLTKADVEEKYAITWTSSKEQVFEMPTGGAAIMNEGENLLYLARKEQCLAL  69

Query  1104  GTRLRSKYK---INYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVGQNMRSIGKNISP  1274
             GT+LR+K+K    +Y+ YR++PNGE QYLHP DGV+PEKVN GR   G+  R+IG N  P
Sbjct  70    GTQLRTKFKPKIEDYKIYRIYPNGETQYLHPADGVFPEKVNEGRPFAGKKDRNIGSNPEP  129

Query  1275  IEVKFTGKQVYDL  1313
             + +KF+GK  YD+
Sbjct  130   VTIKFSGKAPYDV  142



>ref|WP_015195039.1| photosystem I protein PsaD [Stanieria cyanosphaera]
 gb|AFZ37380.1| photosystem I protein PsaD [Stanieria cyanosphaera PCC 7437]
Length=142

 Score =   187 bits (476),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 89/134 (66%), Positives = 107/134 (80%), Gaps = 3/134 (2%)
 Frame = +3

Query  921   SPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLARKEQCLA  1100
             +P FGGSTGGLL KAQVEE Y ITWTSPKEQ+FEMPTGGAA M EG N+L LARKEQC+A
Sbjct  9     APQFGGSTGGLLYKAQVEEKYAITWTSPKEQVFEMPTGGAATMNEGDNILYLARKEQCIA  68

Query  1101  LGTRLRSKYK---INYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVGQNMRSIGKNIS  1271
             +G +LR+K+K    NY+ YR++PNGEVQYLHP DGV+PEKVN GRE  G+  R IG N +
Sbjct  69    MGAQLRTKFKPKIENYKIYRIYPNGEVQYLHPADGVFPEKVNEGREYNGKIDRKIGDNPN  128

Query  1272  PIEVKFTGKQVYDL  1313
             P  +KF+GK  Y++
Sbjct  129   PATIKFSGKATYEV  142



>ref|YP_009093191.1| photosystem I subunit II (chloroplast) [Roundia cardiophora]
 gb|AIR75864.1| photosystem I subunit II (chloroplast) [Roundia cardiophora]
Length=139

 Score =   187 bits (476),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 95/138 (69%), Positives = 108/138 (78%), Gaps = 2/138 (1%)
 Frame = +3

Query  900   TLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLA  1079
             TL+  TP P FGGSTGG LR A+VEE Y ITWTS KEQIFEMPTGGAAIMR G NLL LA
Sbjct  2     TLNLKTPFPTFGGSTGGWLRAAEVEEKYAITWTSSKEQIFEMPTGGAAIMRNGENLLYLA  61

Query  1080  RKEQCLALGTRLRSKYKIN-YQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVGQNMRSI  1256
             RKEQCLAL T+LR+ +KIN Y+ YR+FP+GEVQYLHPKDGV+PEKVN GR  V     SI
Sbjct  62    RKEQCLALSTQLRT-FKINDYKIYRIFPSGEVQYLHPKDGVFPEKVNPGRVSVNSRGFSI  120

Query  1257  GKNISPIEVKFTGKQVYD  1310
             GKN +P  +KF+G   Y+
Sbjct  121   GKNPNPASIKFSGITTYE  138



>ref|YP_009093464.1| photosystem I subunit II (chloroplast) [Thalassiosira weissflogii]
 gb|AIR76137.1| photosystem I subunit II (chloroplast) [Thalassiosira weissflogii]
Length=139

 Score =   187 bits (475),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 94/138 (68%), Positives = 107/138 (78%), Gaps = 2/138 (1%)
 Frame = +3

Query  900   TLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLA  1079
             TL+  TP P FGGSTGG LR A+VEE Y ITWTS KEQIFEMPTGGAAIMR G NLL LA
Sbjct  2     TLNLKTPFPTFGGSTGGWLRAAEVEEKYAITWTSSKEQIFEMPTGGAAIMRNGENLLYLA  61

Query  1080  RKEQCLALGTRLRSKYKIN-YQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVGQNMRSI  1256
             RKEQCLAL T+LR+ +KIN Y+ YR+FP+GEVQYLHPKDGV+PEKVN GR  +     SI
Sbjct  62    RKEQCLALSTQLRT-FKINDYKIYRIFPSGEVQYLHPKDGVFPEKVNPGRTSINSRGFSI  120

Query  1257  GKNISPIEVKFTGKQVYD  1310
             GKN  P  +KF+G   Y+
Sbjct  121   GKNPEPASIKFSGITTYE  138



>gb|EMT14162.1| Photosystem I reaction center subunit II, chloroplastic [Aegilops 
tauschii]
Length=97

 Score =   186 bits (471),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 87/97 (90%), Positives = 91/97 (94%), Gaps = 0/97 (0%)
 Frame = +3

Query  1023  MPTGGAAIMREGANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVY  1202
             MPTGGAAIMREG NLLKLARKEQCLALG RLRSKYKI YQFYRVFPNGEVQYLHPKDGVY
Sbjct  1     MPTGGAAIMREGPNLLKLARKEQCLALGNRLRSKYKIAYQFYRVFPNGEVQYLHPKDGVY  60

Query  1203  PEKVNAGREGVGQNMRSIGKNISPIEVKFTGKQVYDL  1313
             PEKVNAGR+GVGQN RSIGKN+SPIEVKFTGK  +D+
Sbjct  61    PEKVNAGRQGVGQNFRSIGKNVSPIEVKFTGKNSFDI  97



>sp|O96800.1|PSAD_SKECO RecName: Full=Photosystem I reaction center subunit II; AltName: 
Full=Photosystem I 16 kDa polypeptide; Short=PSI-D (chloroplast) 
[Skeletonema costatum]
 emb|CAA10621.1| PSI ferredoxin-binding protein II [Skeletonema costatum]
Length=139

 Score =   187 bits (475),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 94/138 (68%), Positives = 108/138 (78%), Gaps = 2/138 (1%)
 Frame = +3

Query  900   TLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLA  1079
             TL+  TP P FGGSTGG LR A+VEE Y ITWTS KEQIFEMPTGG+AIMR G NLL LA
Sbjct  2     TLNLKTPFPTFGGSTGGWLRAAEVEEKYAITWTSAKEQIFEMPTGGSAIMRNGENLLYLA  61

Query  1080  RKEQCLALGTRLRSKYKIN-YQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVGQNMRSI  1256
             RKEQCLAL T+LR+ +KIN Y+ YR+FP+GEVQYLHPKDGV+PEKVN GR  V     SI
Sbjct  62    RKEQCLALSTQLRT-FKINDYKIYRIFPSGEVQYLHPKDGVFPEKVNPGRTSVNSRGFSI  120

Query  1257  GKNISPIEVKFTGKQVYD  1310
             GKN +P  +KF+G   Y+
Sbjct  121   GKNPNPASIKFSGITTYE  138



>ref|WP_017300022.1| Photosystem I reaction center subunit II [Nodosilinea nodulosa]
Length=142

 Score =   187 bits (475),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 90/134 (67%), Positives = 106/134 (79%), Gaps = 3/134 (2%)
 Frame = +3

Query  921   SPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLARKEQCLA  1100
             +PIFGGSTGGLL KAQVEE Y ITWTSPK+Q+FEMPTGGAA M EG NLL LARKEQCLA
Sbjct  9     TPIFGGSTGGLLTKAQVEEKYAITWTSPKKQVFEMPTGGAAFMNEGENLLYLARKEQCLA  68

Query  1101  LGTRLRSKYK---INYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVGQNMRSIGKNIS  1271
             LGT+LR+K+K    +Y+ YRV+P+GE QYLHP DGV+PEKVN GR  V    R+IG N  
Sbjct  69    LGTQLRTKFKPRIDDYKVYRVYPSGETQYLHPADGVFPEKVNEGRGPVNSVARNIGANPD  128

Query  1272  PIEVKFTGKQVYDL  1313
             P  +KF+GK  Y++
Sbjct  129   PATIKFSGKATYEV  142



>ref|WP_041622790.1| Photosystem I reaction center subunit II [Oscillatoria nigro-viridis]
Length=141

 Score =   187 bits (475),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 92/131 (70%), Positives = 109/131 (83%), Gaps = 2/131 (2%)
 Frame = +3

Query  924   PIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLARKEQCLAL  1103
             P+FGGSTGGLL KA VEE Y ITWTSPKEQ+FEMP+GGAAIMR+G NLL L RKEQC+AL
Sbjct  10    PLFGGSTGGLLTKALVEEKYAITWTSPKEQVFEMPSGGAAIMRQGDNLLHLPRKEQCIAL  69

Query  1104  -GTRLRSKYKI-NYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVGQNMRSIGKNISPI  1277
              G +LR+K+KI NY+ YRVFP+G  +YLHPKDGV+PEKVN GR   G+  R+IG N +PI
Sbjct  70    GGQQLRAKFKITNYKIYRVFPDGSTEYLHPKDGVFPEKVNEGRPYNGKIDRNIGSNPNPI  129

Query  1278  EVKFTGKQVYD  1310
             +VKFTGK+ YD
Sbjct  130   KVKFTGKKTYD  140



>ref|YP_009051089.1| photosystem I subunit II [Galdieria sulphuraria]
 ref|XP_005705023.1| [pt] photosystem I subunit II [Galdieria sulphuraria]
 gb|ADO32968.1| photosystem I 20kDa subunit [Galdieria sulphuraria]
 gb|EME28503.1| [pt] photosystem I subunit II [Galdieria sulphuraria]
 gb|AIG92532.1| photosystem I subunit II [Galdieria sulphuraria]
Length=141

 Score =   187 bits (475),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 88/138 (64%), Positives = 107/138 (78%), Gaps = 1/138 (1%)
 Frame = +3

Query  900   TLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLA  1079
             TL+   PSP FGGSTGG LR A+ EE Y ITW S  E++FEMPT GAA+MR G NLL  A
Sbjct  4     TLNLKMPSPSFGGSTGGWLRSAENEEKYAITWISKNEEVFEMPTAGAALMRSGENLLYFA  63

Query  1080  RKEQCLALGTRLRSKYKI-NYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVGQNMRSI  1256
             RKEQCL+LGT+L++++KI NY+ YRVFPNGE+QYLHPKDGV+PEKVN GR+ +    RSI
Sbjct  64    RKEQCLSLGTQLKTQFKIDNYKIYRVFPNGEIQYLHPKDGVFPEKVNEGRKAINTLTRSI  123

Query  1257  GKNISPIEVKFTGKQVYD  1310
             GKN  P+ VKF  KQ ++
Sbjct  124   GKNPDPVVVKFINKQTFE  141



>ref|YP_009122184.1| photosystem I reaction center subunit II [Vertebrata lanosa]
 gb|AJH65942.1| photosystem I reaction center subunit II [Vertebrata lanosa]
Length=143

 Score =   187 bits (474),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 88/138 (64%), Positives = 108/138 (78%), Gaps = 1/138 (1%)
 Frame = +3

Query  900   TLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLA  1079
             T++   PSP FGGSTGG LR A+VEE Y ITW S  + IFEMPTGG+AIM EG NLL LA
Sbjct  4     TINFKIPSPTFGGSTGGWLRSAEVEEKYAITWNSKNKDIFEMPTGGSAIMAEGDNLLYLA  63

Query  1080  RKEQCLALGTRLRSKYKIN-YQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVGQNMRSI  1256
             +KEQCLAL  +L+SK+KIN ++ YR+FPNGEVQYLHPKDGV+PEKVN GR G+G    +I
Sbjct  64    KKEQCLALSNQLKSKFKINDFKIYRIFPNGEVQYLHPKDGVFPEKVNEGRVGIGYIEHNI  123

Query  1257  GKNISPIEVKFTGKQVYD  1310
             G+N +P+  KFTG+  Y+
Sbjct  124   GQNTNPVNKKFTGQATYE  141



>ref|YP_003002042.1| photosystem I reaction center subunit II [Aureococcus anophagefferens]
 gb|ACS36806.1| photosystem I reaction center subunit II [Aureococcus anophagefferens]
Length=139

 Score =   187 bits (474),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 89/137 (65%), Positives = 105/137 (77%), Gaps = 0/137 (0%)
 Frame = +3

Query  900   TLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLA  1079
             TLD    +P+FGGSTGG LR AQ+EE Y ITW+S K QIFEMPTGGAAIMR G NLL LA
Sbjct  2     TLDSQIQTPLFGGSTGGWLRAAQIEEKYAITWSSSKSQIFEMPTGGAAIMRTGQNLLYLA  61

Query  1080  RKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVGQNMRSIG  1259
             RKEQCLALGT+LR+    +Y+ YR+FP+GEVQYLHPKDGV+PEK N GR        SIG
Sbjct  62    RKEQCLALGTQLRTFKITDYKIYRIFPSGEVQYLHPKDGVFPEKSNEGRVQANNRQFSIG  121

Query  1260  KNISPIEVKFTGKQVYD  1310
             KN +P+ VKF+GK  ++
Sbjct  122   KNPNPVAVKFSGKGTFE  138



>gb|AFZ10051.1| photosystem I protein PsaD [Oscillatoria nigro-viridis PCC 7112]
Length=154

 Score =   187 bits (475),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 92/131 (70%), Positives = 109/131 (83%), Gaps = 2/131 (2%)
 Frame = +3

Query  924   PIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLARKEQCLAL  1103
             P+FGGSTGGLL KA VEE Y ITWTSPKEQ+FEMP+GGAAIMR+G NLL L RKEQC+AL
Sbjct  23    PLFGGSTGGLLTKALVEEKYAITWTSPKEQVFEMPSGGAAIMRQGDNLLHLPRKEQCIAL  82

Query  1104  -GTRLRSKYKI-NYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVGQNMRSIGKNISPI  1277
              G +LR+K+KI NY+ YRVFP+G  +YLHPKDGV+PEKVN GR   G+  R+IG N +PI
Sbjct  83    GGQQLRAKFKITNYKIYRVFPDGSTEYLHPKDGVFPEKVNEGRPYNGKIDRNIGSNPNPI  142

Query  1278  EVKFTGKQVYD  1310
             +VKFTGK+ YD
Sbjct  143   KVKFTGKKTYD  153



>ref|WP_016876091.1| Photosystem I reaction center subunit II [Chlorogloeopsis fritschii]
Length=142

 Score =   186 bits (473),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 88/131 (67%), Positives = 109/131 (83%), Gaps = 2/131 (2%)
 Frame = +3

Query  921   SPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLARKEQCLA  1100
             +PIFGGSTGGLL+KA+VEE Y ITWTSPKEQ+FEMPTGGAA MR+G NLL LARKEQC+A
Sbjct  9     TPIFGGSTGGLLKKAEVEEKYAITWTSPKEQVFEMPTGGAAKMRQGQNLLYLARKEQCIA  68

Query  1101  LGTRLRSKYKI-NYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVGQNMRSIGKNISPI  1277
             LG++LR ++KI +Y+ YR++PNGE  Y+HP DGV+PEKVN GR+ V  N R IG+N SP 
Sbjct  69    LGSQLR-RFKITDYKIYRIYPNGETAYIHPADGVFPEKVNQGRQKVRYNDRRIGQNPSPA  127

Query  1278  EVKFTGKQVYD  1310
             ++KF+G   YD
Sbjct  128   KLKFSGTATYD  138



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 4548849841987