BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig13251

Length=1211
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009757548.1|  PREDICTED: heparanase-like protein 3               288   5e-88   Nicotiana sylvestris
ref|XP_009625836.1|  PREDICTED: heparanase-like protein 3               283   4e-86   Nicotiana tomentosiformis
ref|XP_002263173.1|  PREDICTED: heparanase-like protein 3               280   2e-84   Vitis vinifera
emb|CBI25561.3|  unnamed protein product                                277   1e-83   Vitis vinifera
ref|XP_006359499.1|  PREDICTED: heparanase-like protein 3-like          277   1e-83   Solanum tuberosum [potatoes]
emb|CAN81917.1|  hypothetical protein VITISV_038549                     277   8e-83   Vitis vinifera
ref|XP_004242732.1|  PREDICTED: heparanase-like protein 3               275   9e-83   Solanum lycopersicum
ref|XP_007013614.1|  Glucuronidase 3 isoform 2                          274   2e-82   
ref|XP_007013613.1|  Glucuronidase 3 isoform 1                          275   6e-82   
ref|XP_011017900.1|  PREDICTED: heparanase-like protein 3 isoform X1    266   3e-79   Populus euphratica
ref|XP_011078541.1|  PREDICTED: heparanase-like protein 3               265   5e-79   Sesamum indicum [beniseed]
ref|XP_006389405.1|  hypothetical protein POPTR_0025s00410g             264   1e-78   
gb|KDO73427.1|  hypothetical protein CISIN_1g008762mg                   264   1e-78   Citrus sinensis [apfelsine]
emb|CDP10485.1|  unnamed protein product                                264   2e-78   Coffea canephora [robusta coffee]
ref|XP_011081531.1|  PREDICTED: heparanase-like protein 3               262   7e-78   Sesamum indicum [beniseed]
ref|XP_007011804.1|  Glucuronidase 3 isoform 2                          260   2e-77   
ref|XP_010533116.1|  PREDICTED: heparanase-like protein 3               261   2e-77   Tarenaya hassleriana [spider flower]
ref|XP_002283260.2|  PREDICTED: heparanase-like protein 3               260   3e-77   
ref|XP_010250274.1|  PREDICTED: heparanase-like protein 3               260   4e-77   Nelumbo nucifera [Indian lotus]
ref|XP_007011803.1|  Glucuronidase 3 isoform 1                          260   5e-77   
gb|KDO73428.1|  hypothetical protein CISIN_1g008762mg                   259   7e-77   Citrus sinensis [apfelsine]
ref|XP_006453123.1|  hypothetical protein CICLE_v10007919mg             259   8e-77   Citrus clementina [clementine]
ref|XP_010099859.1|  Heparanase-like protein 3                          258   1e-76   Morus notabilis
ref|XP_007224283.1|  hypothetical protein PRUPE_ppa019445mg             255   1e-75   
ref|XP_008219534.1|  PREDICTED: heparanase-like protein 3 isoform X1    256   2e-75   Prunus mume [ume]
ref|XP_008219535.1|  PREDICTED: heparanase-like protein 3 isoform X2    256   2e-75   Prunus mume [ume]
gb|EYU20239.1|  hypothetical protein MIMGU_mgv1a026019mg                254   5e-75   Erythranthe guttata [common monkey flower]
ref|XP_011036604.1|  PREDICTED: heparanase-like protein 3 isoform X2    253   9e-75   Populus euphratica
ref|XP_010648741.1|  PREDICTED: heparanase-like protein 3               253   2e-74   Vitis vinifera
gb|KDP33563.1|  hypothetical protein JCGZ_07134                         252   3e-74   Jatropha curcas
gb|KJB23650.1|  hypothetical protein B456_004G108900                    253   3e-74   Gossypium raimondii
ref|XP_011036603.1|  PREDICTED: heparanase-like protein 3 isoform X1    253   3e-74   Populus euphratica
ref|XP_003542659.1|  PREDICTED: heparanase-like protein 3-like          252   3e-74   Glycine max [soybeans]
gb|KJB23649.1|  hypothetical protein B456_004G108900                    252   5e-74   Gossypium raimondii
ref|XP_012076507.1|  PREDICTED: heparanase-like protein 3               251   7e-74   
gb|KFK22707.1|  hypothetical protein AALP_AAs49083U000200               251   7e-74   Arabis alpina [alpine rockcress]
ref|XP_002515478.1|  heparanase, putative                               250   1e-73   
ref|XP_010687865.1|  PREDICTED: heparanase-like protein 3               251   2e-73   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_011020240.1|  PREDICTED: heparanase-like protein 3               251   2e-73   Populus euphratica
gb|AFK40288.1|  unknown                                                 249   4e-73   Lotus japonicus
ref|XP_010440690.1|  PREDICTED: heparanase-like protein 3               249   5e-73   Camelina sativa [gold-of-pleasure]
ref|XP_006483407.1|  PREDICTED: heparanase-like protein 3-like is...    246   5e-73   
ref|XP_010450341.1|  PREDICTED: heparanase-like protein 3               249   7e-73   Camelina sativa [gold-of-pleasure]
gb|KHN15030.1|  Heparanase-like protein 3                               248   8e-73   Glycine soja [wild soybean]
gb|EYU34947.1|  hypothetical protein MIMGU_mgv1a004017mg                249   9e-73   Erythranthe guttata [common monkey flower]
ref|XP_006283483.1|  hypothetical protein CARUB_v10004531mg             249   9e-73   Capsella rubella
ref|XP_008457259.1|  PREDICTED: LOW QUALITY PROTEIN: heparanase-l...    248   1e-72   Cucumis melo [Oriental melon]
gb|EYU34948.1|  hypothetical protein MIMGU_mgv1a004017mg                248   1e-72   Erythranthe guttata [common monkey flower]
gb|KDO61807.1|  hypothetical protein CISIN_1g037212mg                   248   2e-72   Citrus sinensis [apfelsine]
ref|XP_009355782.1|  PREDICTED: heparanase-like protein 3               248   2e-72   Pyrus x bretschneideri [bai li]
ref|XP_009358543.1|  PREDICTED: heparanase-like protein 3               248   2e-72   Pyrus x bretschneideri [bai li]
ref|XP_008394121.1|  PREDICTED: heparanase-like protein 3 isoform X2    248   2e-72   Malus domestica [apple tree]
gb|KHG18266.1|  hypothetical protein F383_21213                         247   2e-72   Gossypium arboreum [tree cotton]
gb|KCW83013.1|  hypothetical protein EUGRSUZ_C04395                     245   2e-72   Eucalyptus grandis [rose gum]
ref|XP_003533856.1|  PREDICTED: heparanase-like protein 3-like          247   2e-72   Glycine max [soybeans]
ref|XP_006483406.1|  PREDICTED: heparanase-like protein 3-like is...    248   2e-72   Citrus sinensis [apfelsine]
ref|XP_008336960.1|  PREDICTED: heparanase-like protein 3               248   2e-72   
ref|XP_004508419.1|  PREDICTED: heparanase-like protein 3-like          247   3e-72   Cicer arietinum [garbanzo]
ref|XP_004139281.1|  PREDICTED: heparanase-like protein 3               247   4e-72   Cucumis sativus [cucumbers]
ref|NP_001241969.1|  uncharacterized protein LOC100792087 precursor     246   4e-72   
ref|XP_006450373.1|  hypothetical protein CICLE_v10010401mg             247   4e-72   
ref|XP_010050122.1|  PREDICTED: heparanase-like protein 3               246   7e-72   Eucalyptus grandis [rose gum]
ref|XP_002324878.2|  hypothetical protein POPTR_0018s02050g             247   8e-72   
emb|CBI21126.3|  unnamed protein product                                252   1e-71   Vitis vinifera
ref|NP_851093.1|  glucuronidase 3                                       245   1e-71   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009792772.1|  PREDICTED: heparanase-like protein 3 isoform X2    246   1e-71   Nicotiana sylvestris
ref|XP_007203617.1|  hypothetical protein PRUPE_ppa003883mg             245   2e-71   Prunus persica
ref|XP_009338385.1|  PREDICTED: heparanase-like protein 3               245   2e-71   Pyrus x bretschneideri [bai li]
ref|XP_006338978.1|  PREDICTED: heparanase-like protein 3-like          244   3e-71   Solanum tuberosum [potatoes]
ref|XP_010927353.1|  PREDICTED: heparanase-like protein 3 isoform X1    244   3e-71   Elaeis guineensis
ref|XP_003546578.1|  PREDICTED: heparanase-like protein 3-like          244   3e-71   Glycine max [soybeans]
ref|XP_004488517.1|  PREDICTED: heparanase-like protein 3-like          244   4e-71   Cicer arietinum [garbanzo]
ref|XP_002533671.1|  heparanase, putative                               244   6e-71   Ricinus communis
emb|CDY12398.1|  BnaC08g08070D                                          243   7e-71   Brassica napus [oilseed rape]
emb|CDY47561.1|  BnaA08g07260D                                          243   8e-71   Brassica napus [oilseed rape]
ref|XP_004249602.1|  PREDICTED: heparanase-like protein 3               243   9e-71   Solanum lycopersicum
ref|XP_012081145.1|  PREDICTED: heparanase-like protein 3 isoform X1    243   1e-70   Jatropha curcas
ref|XP_008242878.1|  PREDICTED: heparanase-like protein 3               243   1e-70   Prunus mume [ume]
ref|XP_002870409.1|  glycosyl hydrolase family 79 N-terminal doma...    243   2e-70   Arabidopsis lyrata subsp. lyrata
ref|XP_006381082.1|  hypothetical protein POPTR_0006s06100g             243   2e-70   
ref|XP_006381083.1|  hypothetical protein POPTR_0006s06100g             243   2e-70   
ref|XP_008385022.1|  PREDICTED: heparanase-like protein 3               241   7e-70   
gb|ACJ85786.1|  unknown                                                 231   7e-70   Medicago truncatula
gb|EAY99897.1|  hypothetical protein OsI_21892                          240   8e-70   Oryza sativa Indica Group [Indian rice]
ref|XP_009363939.1|  PREDICTED: heparanase-like protein 3               240   1e-69   Pyrus x bretschneideri [bai li]
ref|XP_009108062.1|  PREDICTED: heparanase-like protein 3               240   2e-69   Brassica rapa
emb|CDP18206.1|  unnamed protein product                                233   2e-69   Coffea canephora [robusta coffee]
gb|KEH37925.1|  glycoside hydrolase family 79 amino-terminal doma...    238   8e-69   Medicago truncatula
gb|EAZ36024.1|  hypothetical protein OsJ_20330                          238   8e-69   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009623092.1|  PREDICTED: heparanase-like protein 3               238   1e-68   Nicotiana tomentosiformis
ref|XP_009393723.1|  PREDICTED: heparanase-like protein 3               238   1e-68   Musa acuminata subsp. malaccensis [pisang utan]
gb|KHG18442.1|  hypothetical protein F383_07597                         238   1e-68   Gossypium arboreum [tree cotton]
ref|XP_010665516.1|  PREDICTED: heparanase-like protein 3 isoform X2    238   1e-68   Beta vulgaris subsp. vulgaris [field beet]
gb|EPS67583.1|  hypothetical protein M569_07189                         237   2e-68   Genlisea aurea
ref|XP_007155084.1|  hypothetical protein PHAVU_003G171800g             236   2e-68   Phaseolus vulgaris [French bean]
ref|XP_007138475.1|  hypothetical protein PHAVU_009G212400g             237   3e-68   Phaseolus vulgaris [French bean]
ref|XP_010665510.1|  PREDICTED: heparanase-like protein 3 isoform X1    238   4e-68   
gb|KJB64650.1|  hypothetical protein B456_010G059600                    230   5e-68   Gossypium raimondii
ref|NP_198344.2|  glucuronidase 3                                       231   1e-67   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001056967.1|  Os06g0179000                                       234   2e-67   
ref|XP_008801893.1|  PREDICTED: heparanase-like protein 3 isoform X1    235   2e-67   Phoenix dactylifera
emb|CDP13545.1|  unnamed protein product                                233   4e-67   Coffea canephora [robusta coffee]
ref|XP_004954253.1|  PREDICTED: heparanase-like protein 3-like          234   4e-67   Setaria italica
ref|XP_003561019.1|  PREDICTED: heparanase-like protein 3               233   5e-67   Brachypodium distachyon [annual false brome]
gb|KJB64651.1|  hypothetical protein B456_010G059600                    231   6e-67   Gossypium raimondii
gb|EMT29716.1|  Heparanase-like protein 3                               231   1e-66   
dbj|BAB10787.1|  unnamed protein product                                232   1e-66   Arabidopsis thaliana [mouse-ear cress]
gb|KJB64649.1|  hypothetical protein B456_010G059600                    232   1e-66   Gossypium raimondii
gb|EPS66918.1|  hypothetical protein M569_07858                         231   2e-66   Genlisea aurea
ref|XP_004964694.1|  PREDICTED: heparanase-like protein 3-like          232   2e-66   Setaria italica
ref|XP_010906003.1|  PREDICTED: heparanase-like protein 3               231   4e-66   Elaeis guineensis
ref|XP_008394120.1|  PREDICTED: heparanase-like protein 3 isoform X1    231   6e-66   Malus domestica [apple tree]
ref|XP_003609474.1|  Heparanase-like protein                            230   6e-66   Medicago truncatula
ref|XP_006648064.1|  PREDICTED: heparanase-like protein 3-like          231   6e-66   Oryza brachyantha
gb|EAY87898.1|  hypothetical protein OsI_09318                          230   9e-66   Oryza sativa Indica Group [Indian rice]
ref|NP_001048420.1|  Os02g0802200                                       230   1e-65   
gb|ERN14303.1|  hypothetical protein AMTR_s00033p00188330               230   1e-65   Amborella trichopoda
gb|KCW81361.1|  hypothetical protein EUGRSUZ_C02742                     227   1e-65   Eucalyptus grandis [rose gum]
ref|XP_006852836.2|  PREDICTED: heparanase-like protein 3               229   1e-65   
dbj|BAJ90636.1|  predicted protein                                      228   3e-65   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010048937.1|  PREDICTED: heparanase-like protein 3 isoform X1    228   4e-65   Eucalyptus grandis [rose gum]
ref|XP_010100865.1|  Heparanase-like protein 3                          226   3e-64   
ref|XP_002452991.1|  hypothetical protein SORBIDRAFT_04g036200          223   3e-63   Sorghum bicolor [broomcorn]
ref|XP_009792771.1|  PREDICTED: heparanase-like protein 3 isoform X1    223   7e-63   Nicotiana sylvestris
gb|KJB27356.1|  hypothetical protein B456_004G293000                    222   1e-62   Gossypium raimondii
gb|KJB27355.1|  hypothetical protein B456_004G293000                    221   1e-62   Gossypium raimondii
dbj|BAJ89245.1|  predicted protein                                      221   3e-62   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_011457618.1|  PREDICTED: heparanase-like protein 3               219   1e-61   Fragaria vesca subsp. vesca
ref|XP_002437942.1|  hypothetical protein SORBIDRAFT_10g005260          217   8e-61   Sorghum bicolor [broomcorn]
ref|XP_010048935.1|  PREDICTED: heparanase-like protein 3               217   9e-61   Eucalyptus grandis [rose gum]
ref|NP_001152083.1|  heparanase-like protein 3 precursor                217   1e-60   Zea mays [maize]
ref|NP_001132339.1|  uncharacterized protein LOC100193781 precursor     216   1e-60   Zea mays [maize]
gb|ACF81144.1|  unknown                                                 216   1e-60   Zea mays [maize]
ref|XP_009409980.1|  PREDICTED: heparanase-like protein 3               216   1e-60   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006403100.1|  hypothetical protein EUTSA_v10003449mg             216   2e-60   
ref|XP_010048933.1|  PREDICTED: heparanase-like protein 3 isoform X1    215   4e-60   Eucalyptus grandis [rose gum]
ref|XP_007155083.1|  hypothetical protein PHAVU_003G171800g             212   4e-59   Phaseolus vulgaris [French bean]
ref|NP_001183276.1|  uncharacterized protein LOC100501670 precursor     208   4e-58   
gb|AFW73900.1|  hypothetical protein ZEAMMB73_176333                    209   5e-58   
ref|XP_003570329.1|  PREDICTED: heparanase-like protein 3               206   7e-57   Brachypodium distachyon [annual false brome]
ref|XP_010552799.1|  PREDICTED: heparanase-like protein 2               191   2e-51   
dbj|BAB08480.1|  unnamed protein product                                190   5e-51   Arabidopsis thaliana [mouse-ear cress]
ref|NP_200933.2|  glucuronidase 1                                       190   7e-51   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006281918.1|  hypothetical protein CARUB_v10028123mg             189   2e-50   Capsella rubella
ref|XP_002866422.1|  glycosyl hydrolase family 79 N-terminal doma...    189   2e-50   
gb|ACR10240.1|  heparanase                                              189   2e-50   Oryza sativa Indica Group [Indian rice]
ref|NP_001067122.1|  Os12g0578400                                       188   3e-50   
gb|EEE53489.1|  hypothetical protein OsJ_36644                          189   3e-50   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006664141.1|  PREDICTED: heparanase-like protein 1-like is...    188   4e-50   Oryza brachyantha
ref|XP_009395254.1|  PREDICTED: heparanase-like protein 1               187   5e-50   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010457069.1|  PREDICTED: heparanase-like protein 2               187   7e-50   Camelina sativa [gold-of-pleasure]
ref|XP_006354764.1|  PREDICTED: heparanase-like protein 2-like is...    186   1e-49   Solanum tuberosum [potatoes]
emb|CDY02161.1|  BnaA03g40060D                                          186   2e-49   
ref|XP_010483789.1|  PREDICTED: heparanase-like protein 2               186   2e-49   Camelina sativa [gold-of-pleasure]
ref|XP_010443938.1|  PREDICTED: heparanase-like protein 2               186   3e-49   Camelina sativa [gold-of-pleasure]
ref|XP_009136454.1|  PREDICTED: heparanase-like protein 2               185   4e-49   
ref|XP_004235980.1|  PREDICTED: heparanase-like protein 1               185   5e-49   Solanum lycopersicum
ref|XP_006394524.1|  hypothetical protein EUTSA_v10003960mg             184   9e-49   Eutrema salsugineum [saltwater cress]
gb|EEC69565.1|  hypothetical protein OsI_38868                          189   9e-49   Oryza sativa Indica Group [Indian rice]
ref|XP_010904949.1|  PREDICTED: heparanase-like protein 1               183   2e-48   
ref|XP_008792775.1|  PREDICTED: heparanase-like protein 2               184   2e-48   
ref|XP_004241591.1|  PREDICTED: heparanase-like protein 2               183   2e-48   Solanum lycopersicum
ref|XP_006345162.1|  PREDICTED: heparanase-like protein 1-like          183   2e-48   Solanum tuberosum [potatoes]
gb|KGN51965.1|  hypothetical protein Csa_5G606560                       182   3e-48   Cucumis sativus [cucumbers]
ref|XP_011656257.1|  PREDICTED: heparanase-like protein 1               182   3e-48   Cucumis sativus [cucumbers]
emb|CDP15923.1|  unnamed protein product                                172   3e-48   Coffea canephora [robusta coffee]
ref|XP_010936395.1|  PREDICTED: heparanase-like protein 2               182   3e-48   Elaeis guineensis
gb|EMS63819.1|  Heparanase-like protein 2                               182   4e-48   Triticum urartu
ref|XP_009612848.1|  PREDICTED: heparanase-like protein 2               182   4e-48   Nicotiana tomentosiformis
gb|EMT24030.1|  Heparanase-like protein 2                               181   8e-48   
ref|XP_009801838.1|  PREDICTED: heparanase-like protein 2 isoform X1    182   8e-48   Nicotiana sylvestris
gb|ACJ85515.1|  unknown                                                 178   8e-48   Medicago truncatula
gb|ACV84153.1|  heparanase                                              181   9e-48   Oryza sativa Indica Group [Indian rice]
ref|XP_010259074.1|  PREDICTED: heparanase-like protein 1               181   1e-47   Nelumbo nucifera [Indian lotus]
ref|XP_009783167.1|  PREDICTED: heparanase-like protein 2               181   1e-47   Nicotiana sylvestris
ref|XP_009595357.1|  PREDICTED: heparanase-like protein 2 isoform X2    181   1e-47   Nicotiana tomentosiformis
ref|XP_006574932.1|  PREDICTED: heparanase-like protein 2-like          181   1e-47   
ref|XP_009595353.1|  PREDICTED: heparanase-like protein 2 isoform X1    181   1e-47   Nicotiana tomentosiformis
ref|XP_010068782.1|  PREDICTED: heparanase-like protein 1               180   2e-47   Eucalyptus grandis [rose gum]
ref|XP_003558511.1|  PREDICTED: heparanase-like protein 1               180   3e-47   Brachypodium distachyon [annual false brome]
ref|XP_010258147.1|  PREDICTED: heparanase-like protein 1 isoform X2    180   3e-47   Nelumbo nucifera [Indian lotus]
ref|XP_003614012.1|  Heparanase-like protein                            179   3e-47   
ref|XP_010546175.1|  PREDICTED: heparanase-like protein 1 isoform X2    179   3e-47   Tarenaya hassleriana [spider flower]
ref|NP_001049350.1|  Os03g0211700                                       180   3e-47   
gb|KHN02016.1|  Heparanase-like protein 2                               180   3e-47   Glycine soja [wild soybean]
dbj|BAJ84826.1|  predicted protein                                      180   3e-47   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KEH33103.1|  glycoside hydrolase family 79 amino-terminal doma...    180   3e-47   Medicago truncatula
dbj|BAJ96463.1|  predicted protein                                      180   3e-47   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010106651.1|  Heparanase-like protein 1                          180   3e-47   
gb|KHN04137.1|  Heparanase-like protein 1                               180   4e-47   Glycine soja [wild soybean]
ref|XP_003527099.1|  PREDICTED: heparanase-like protein 1-like is...    180   4e-47   Glycine max [soybeans]
ref|XP_007157647.1|  hypothetical protein PHAVU_002G087100g             173   5e-47   Phaseolus vulgaris [French bean]
ref|XP_010258149.1|  PREDICTED: heparanase-like protein 1 isoform X4    179   6e-47   Nelumbo nucifera [Indian lotus]
gb|AES96970.2|  glycoside hydrolase family 79 amino-terminal doma...    179   6e-47   Medicago truncatula
ref|XP_010258148.1|  PREDICTED: heparanase-like protein 1 isoform X3    179   6e-47   Nelumbo nucifera [Indian lotus]
ref|XP_008446419.1|  PREDICTED: heparanase-like protein 1               179   6e-47   Cucumis melo [Oriental melon]
ref|XP_010546171.1|  PREDICTED: heparanase-like protein 1 isoform X1    179   7e-47   Tarenaya hassleriana [spider flower]
gb|KHN18337.1|  Heparanase-like protein 1                               179   7e-47   Glycine soja [wild soybean]
ref|XP_006574930.1|  PREDICTED: heparanase-like protein 2-like is...    179   7e-47   Glycine max [soybeans]
ref|XP_011012392.1|  PREDICTED: heparanase-like protein 2               179   7e-47   Populus euphratica
ref|XP_010258146.1|  PREDICTED: heparanase-like protein 1 isoform X1    179   7e-47   
gb|KHN02019.1|  Heparanase-like protein 2                               179   8e-47   Glycine soja [wild soybean]
ref|XP_003549557.1|  PREDICTED: heparanase-like protein 1-like is...    179   9e-47   Glycine max [soybeans]
dbj|BAJ97884.1|  predicted protein                                      179   1e-46   Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CDP00405.1|  unnamed protein product                                178   1e-46   Coffea canephora [robusta coffee]
ref|XP_002315010.1|  hypothetical protein POPTR_0010s16820g             178   1e-46   
emb|CAB62595.1|  putative protein                                       178   1e-46   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003525455.1|  PREDICTED: heparanase-like protein 1-like is...    178   1e-46   
ref|XP_006399265.1|  hypothetical protein EUTSA_v10013186mg             178   1e-46   Eutrema salsugineum [saltwater cress]
ref|NP_196400.2|  glucuronidase 2                                       178   1e-46   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004508698.1|  PREDICTED: heparanase-like protein 2-like is...    179   1e-46   Cicer arietinum [garbanzo]
gb|KEH33104.1|  glycoside hydrolase family 79 amino-terminal doma...    178   2e-46   Medicago truncatula
ref|XP_006649618.1|  PREDICTED: heparanase-like protein 2-like          178   2e-46   
emb|CDX69989.1|  BnaA10g23380D                                          177   2e-46   
gb|KDO54584.1|  hypothetical protein CISIN_1g008834mg                   174   2e-46   Citrus sinensis [apfelsine]
ref|XP_007157579.1|  hypothetical protein PHAVU_002G081000g             177   2e-46   Phaseolus vulgaris [French bean]
ref|XP_004299326.1|  PREDICTED: heparanase-like protein 1               178   2e-46   Fragaria vesca subsp. vesca
ref|XP_004508697.1|  PREDICTED: heparanase-like protein 2-like is...    178   2e-46   Cicer arietinum [garbanzo]
emb|CBI15157.3|  unnamed protein product                                177   2e-46   Vitis vinifera
ref|XP_006348811.1|  PREDICTED: heparanase-like protein 2-like          178   2e-46   
ref|XP_002976895.1|  hypothetical protein SELMODRAFT_105931             177   2e-46   
ref|XP_006289223.1|  hypothetical protein CARUB_v10002679mg             177   3e-46   
tpg|DAA55153.1|  TPA: hypothetical protein ZEAMMB73_112407              174   3e-46   
ref|XP_009122405.1|  PREDICTED: heparanase-like protein 1 isoform X1    177   3e-46   Brassica rapa
ref|XP_002284470.1|  PREDICTED: heparanase-like protein 1               177   3e-46   Vitis vinifera
emb|CDX99032.1|  BnaC09g48030D                                          177   3e-46   
ref|XP_009397277.1|  PREDICTED: heparanase-like protein 1               177   3e-46   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002871291.1|  hypothetical protein ARALYDRAFT_350042             177   4e-46   
ref|XP_010678425.1|  PREDICTED: heparanase-like protein 2               177   5e-46   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006440691.1|  hypothetical protein CICLE_v10019304mg             177   5e-46   
ref|XP_008661167.1|  PREDICTED: heparanase-like protein 1               176   6e-46   Zea mays [maize]
ref|XP_006578556.1|  PREDICTED: heparanase-like protein 1-like is...    177   6e-46   Glycine max [soybeans]
ref|XP_004239465.2|  PREDICTED: heparanase-like protein 2               176   7e-46   
gb|KHN36951.1|  Heparanase-like protein 1                               176   8e-46   Glycine soja [wild soybean]
gb|KDO54583.1|  hypothetical protein CISIN_1g008834mg                   174   9e-46   Citrus sinensis [apfelsine]
emb|CAD42650.1|  putative heparanase                                    176   9e-46   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_007045929.1|  Heparanase, putative                               176   9e-46   
ref|XP_010491400.1|  PREDICTED: heparanase-like protein 1               176   9e-46   Camelina sativa [gold-of-pleasure]
gb|KDO54582.1|  hypothetical protein CISIN_1g008834mg                   174   1e-45   Citrus sinensis [apfelsine]
ref|XP_004137422.1|  PREDICTED: heparanase-like protein 1               176   1e-45   Cucumis sativus [cucumbers]
ref|XP_006440690.1|  hypothetical protein CICLE_v10019304mg             177   1e-45   
ref|XP_008447189.1|  PREDICTED: heparanase-like protein 1               176   1e-45   Cucumis melo [Oriental melon]
ref|XP_003578591.1|  PREDICTED: heparanase-like protein 1               176   1e-45   Brachypodium distachyon [annual false brome]
ref|XP_010936349.1|  PREDICTED: heparanase-like protein 1 isoform X2    176   2e-45   Elaeis guineensis
ref|XP_002514696.1|  Heparanase-2, putative                             175   2e-45   Ricinus communis
ref|XP_004962990.1|  PREDICTED: heparanase-like protein 2-like          175   2e-45   Setaria italica
gb|ACG44916.1|  heparanase-like protein 2 precursor                     175   2e-45   Zea mays [maize]
ref|NP_001145968.1|  uncharacterized protein LOC100279495 precursor     175   2e-45   Zea mays [maize]
ref|XP_011070960.1|  PREDICTED: heparanase-like protein 2 isoform X1    175   2e-45   Sesamum indicum [beniseed]
gb|KJB84192.1|  hypothetical protein B456_N009300                       175   2e-45   Gossypium raimondii
ref|XP_010046621.1|  PREDICTED: heparanase-like protein 2               175   2e-45   Eucalyptus grandis [rose gum]
ref|XP_010452749.1|  PREDICTED: heparanase-like protein 1               175   2e-45   Camelina sativa [gold-of-pleasure]
ref|XP_010936348.1|  PREDICTED: heparanase-like protein 1 isoform X1    176   2e-45   
gb|KJB84191.1|  hypothetical protein B456_N009200                       174   2e-45   Gossypium raimondii
ref|XP_008672060.1|  PREDICTED: uncharacterized protein LOC100192...    175   2e-45   Zea mays [maize]
gb|KEH31989.1|  glycoside hydrolase family 79 amino-terminal doma...    176   2e-45   Medicago truncatula
ref|XP_008672059.1|  PREDICTED: uncharacterized protein LOC100192...    175   3e-45   Zea mays [maize]
ref|XP_006438800.1|  hypothetical protein CICLE_v10033641mg             174   3e-45   
gb|KHG13978.1|  hypothetical protein F383_01956                         174   3e-45   Gossypium arboreum [tree cotton]
ref|NP_001130921.1|  uncharacterized protein LOC100192026 precursor     175   3e-45   Zea mays [maize]
ref|XP_010423168.1|  PREDICTED: heparanase-like protein 1 isoform X4    174   3e-45   Camelina sativa [gold-of-pleasure]
ref|XP_010423167.1|  PREDICTED: heparanase-like protein 1 isoform X3    174   4e-45   Camelina sativa [gold-of-pleasure]
ref|XP_006477619.1|  PREDICTED: heparanase-like protein 1-like is...    174   4e-45   Citrus sinensis [apfelsine]
ref|XP_010423164.1|  PREDICTED: heparanase-like protein 1 isoform X1    174   4e-45   Camelina sativa [gold-of-pleasure]
gb|KEH31990.1|  glycoside hydrolase family 79 amino-terminal doma...    174   4e-45   Medicago truncatula
ref|XP_010423166.1|  PREDICTED: heparanase-like protein 1 isoform X2    174   4e-45   Camelina sativa [gold-of-pleasure]
gb|KEH31988.1|  glycoside hydrolase family 79 amino-terminal doma...    174   4e-45   Medicago truncatula
gb|KJB50981.1|  hypothetical protein B456_008G196400                    171   5e-45   Gossypium raimondii
ref|XP_009761177.1|  PREDICTED: heparanase-like protein 2               174   6e-45   Nicotiana sylvestris
tpg|DAA47199.1|  TPA: hypothetical protein ZEAMMB73_798346              177   6e-45   
gb|KEH33101.1|  glycoside hydrolase family 79 amino-terminal doma...    173   6e-45   Medicago truncatula
ref|XP_002468296.1|  hypothetical protein SORBIDRAFT_01g043180          174   7e-45   Sorghum bicolor [broomcorn]
ref|XP_007209868.1|  hypothetical protein PRUPE_ppa003813mg             174   7e-45   Prunus persica
ref|XP_007037487.1|  Glucuronidase 2 isoform 1                          173   7e-45   
ref|XP_004985229.1|  PREDICTED: heparanase-like protein 1-like is...    173   8e-45   Setaria italica
tpg|DAA47198.1|  TPA: hypothetical protein ZEAMMB73_798346              177   8e-45   
ref|XP_008805083.1|  PREDICTED: heparanase-like protein 2               173   8e-45   Phoenix dactylifera
ref|XP_006483691.1|  PREDICTED: heparanase-like protein 2-like          173   9e-45   
gb|KDO83095.1|  hypothetical protein CISIN_1g041499mg                   173   9e-45   Citrus sinensis [apfelsine]
ref|XP_008340307.1|  PREDICTED: heparanase-like protein 2               172   1e-44   
gb|KJB33257.1|  hypothetical protein B456_006G004300                    172   1e-44   
ref|XP_010246686.1|  PREDICTED: heparanase-like protein 3               161   1e-44   
ref|XP_007209866.1|  hypothetical protein PRUPE_ppa003804mg             172   2e-44   
ref|XP_002442385.1|  hypothetical protein SORBIDRAFT_08g019250          172   2e-44   
ref|XP_006658769.1|  PREDICTED: heparanase-like protein 1-like          172   2e-44   
gb|KJB74088.1|  hypothetical protein B456_011G271100                    172   3e-44   
ref|XP_011075654.1|  PREDICTED: heparanase-like protein 2               171   3e-44   
ref|XP_011013079.1|  PREDICTED: heparanase-like protein 1 isoform X1    171   4e-44   
gb|KJB74280.1|  hypothetical protein B456_011G285000                    171   4e-44   
gb|KJB84293.1|  hypothetical protein B456_N016700                       171   5e-44   
gb|KJB50982.1|  hypothetical protein B456_008G196400                    171   5e-44   
ref|XP_009631958.1|  PREDICTED: heparanase-like protein 2               171   5e-44   
gb|EMT13371.1|  Heparanase-like protein 1                               169   5e-44   
ref|XP_008647415.1|  PREDICTED: uncharacterized protein LOC100193...    169   5e-44   
gb|KJB74286.1|  hypothetical protein B456_011G285200                    171   6e-44   
ref|XP_011660285.1|  PREDICTED: heparanase-like protein 1               171   6e-44   
ref|XP_012080342.1|  PREDICTED: heparanase-like protein 1               171   6e-44   
gb|AGV40186.2|  heparanase 1-like protein                               171   6e-44   
gb|KHG12946.1|  hypothetical protein F383_07365                         170   6e-44   
ref|XP_010927354.1|  PREDICTED: heparanase-like protein 3 isoform X2    169   7e-44   
gb|ERM99894.1|  hypothetical protein AMTR_s00110p00044140               171   7e-44   
ref|XP_006837041.2|  PREDICTED: heparanase-like protein 1 isoform X2    171   8e-44   
ref|XP_010923582.1|  PREDICTED: heparanase-like protein 2 isoform X1    171   8e-44   
ref|XP_010923583.1|  PREDICTED: heparanase-like protein 2 isoform X2    171   8e-44   
ref|XP_012067747.1|  PREDICTED: heparanase-like protein 2               170   1e-43   
ref|XP_001767170.1|  predicted protein                                  170   2e-43   
ref|XP_008785952.1|  PREDICTED: heparanase-like protein 2 isoform X1    170   2e-43   
ref|XP_008785953.1|  PREDICTED: heparanase-like protein 2 isoform X2    169   2e-43   
ref|XP_008453243.1|  PREDICTED: heparanase-like protein 1               169   2e-43   
ref|XP_011072824.1|  PREDICTED: heparanase-like protein 1 isoform X1    169   2e-43   
gb|EEE67528.1|  hypothetical protein OsJ_24994                          168   3e-43   
ref|XP_011072825.1|  PREDICTED: heparanase-like protein 1 isoform X2    169   3e-43   
dbj|BAJ97219.1|  predicted protein                                      169   3e-43   
ref|XP_007155261.1|  hypothetical protein PHAVU_003G186600g             169   3e-43   
ref|XP_006374165.1|  hypothetical protein POPTR_0015s03440g             169   3e-43   
gb|KJB38700.1|  hypothetical protein B456_006G267500                    169   3e-43   
gb|EAZ04591.1|  hypothetical protein OsI_26741                          169   3e-43   
ref|XP_008221534.1|  PREDICTED: heparanase-like protein 2               169   3e-43   
ref|XP_008239880.1|  PREDICTED: heparanase-like protein 1               169   4e-43   
ref|NP_001060182.1|  Os07g0598400                                       169   4e-43   
gb|EYU28837.1|  hypothetical protein MIMGU_mgv1a026758mg                168   5e-43   
sp|Q9LRC8.1|BAGLU_SCUBA  RecName: Full=Baicalin-beta-D-glucuronid...    168   6e-43   
ref|XP_009399121.1|  PREDICTED: heparanase-like protein 1               168   6e-43   
gb|KJB84361.1|  hypothetical protein B456_N0210001                      165   7e-43   
emb|CDY23075.1|  BnaC07g31120D                                          167   1e-42   
ref|XP_011621075.1|  PREDICTED: heparanase-like protein 1 isoform X1    167   1e-42   
gb|KDO54577.1|  hypothetical protein CISIN_1g008834mg                   167   2e-42   
ref|XP_010030437.1|  PREDICTED: heparanase-like protein 1               166   3e-42   
ref|XP_002512114.1|  Heparanase precursor, putative                     166   3e-42   
ref|XP_009339108.1|  PREDICTED: heparanase-like protein 1 isoform X1    165   8e-42   
ref|XP_008374597.1|  PREDICTED: heparanase-like protein 1               164   1e-41   
ref|XP_007226518.1|  hypothetical protein PRUPE_ppa025624mg             164   2e-41   
ref|XP_008438923.1|  PREDICTED: heparanase-like protein 2               164   2e-41   
ref|XP_010037191.1|  PREDICTED: heparanase-like protein 2               164   2e-41   
ref|XP_012068345.1|  PREDICTED: heparanase-like protein 2               162   6e-41   
ref|XP_008801894.1|  PREDICTED: heparanase-like protein 3 isoform X2    162   7e-41   
ref|XP_009338656.1|  PREDICTED: heparanase-like protein 1 isoform X1    162   8e-41   
ref|XP_008393204.1|  PREDICTED: heparanase-like protein 1               162   8e-41   
gb|KDP41275.1|  hypothetical protein JCGZ_15682                         160   1e-40   
gb|EEE65202.1|  hypothetical protein OsJ_20331                          164   1e-40   
gb|EYU43518.1|  hypothetical protein MIMGU_mgv1a004063mg                161   2e-40   
ref|XP_002274743.1|  PREDICTED: heparanase-like protein 2               160   5e-40   
emb|CBI27258.3|  unnamed protein product                                160   5e-40   
ref|XP_001769830.1|  predicted protein                                  160   5e-40   
ref|XP_002862345.1|  hypothetical protein ARALYDRAFT_497509             158   8e-40   
gb|EMS65630.1|  Heparanase-like protein 3                               158   2e-39   
ref|XP_010048938.1|  PREDICTED: heparanase-like protein 3 isoform X2    158   2e-39   
gb|KJB74274.1|  hypothetical protein B456_011G2845001                   151   2e-39   
ref|XP_004140375.1|  PREDICTED: heparanase-like protein 1               158   2e-39   
gb|KGN51001.1|  hypothetical protein Csa_5G390000                       158   2e-39   
gb|KCW86528.1|  hypothetical protein EUGRSUZ_B03174                     157   6e-39   
emb|CDP17495.1|  unnamed protein product                                157   7e-39   
ref|XP_004298393.1|  PREDICTED: heparanase-like protein 2               155   1e-38   
emb|CAN63833.1|  hypothetical protein VITISV_009131                     157   2e-38   
gb|EMT25528.1|  Heparanase-like protein 3                               154   3e-38   
ref|XP_011651069.1|  PREDICTED: heparanase-like protein 2 isoform X1    154   4e-38   
ref|XP_004134497.1|  PREDICTED: heparanase-like protein 2 isoform X2    154   6e-38   
gb|KGN53270.1|  hypothetical protein Csa_4G043860                       154   6e-38   
gb|EPS63505.1|  heparanase-like protein 1                               153   7e-38   
gb|EMS60649.1|  Heparanase-like protein 3                               154   8e-38   
ref|XP_002991234.1|  hypothetical protein SELMODRAFT_133227             150   2e-36   
ref|XP_009801842.1|  PREDICTED: heparanase-like protein 1 isoform X2    149   2e-36   
ref|XP_006837042.1|  PREDICTED: heparanase-like protein 2               149   3e-36   
ref|XP_002991174.1|  hypothetical protein SELMODRAFT_133100             149   4e-36   
ref|XP_001770123.1|  predicted protein                                  148   6e-36   
ref|XP_008658727.1|  PREDICTED: heparanase-like protein 3 isoform X1    147   2e-35   
ref|XP_011070961.1|  PREDICTED: heparanase-like protein 1 isoform X2    145   3e-35   
ref|XP_001774747.1|  predicted protein                                  145   6e-35   
gb|EWM24999.1|  heparanase-like protein 3                               144   2e-34   
ref|XP_002980613.1|  hypothetical protein SELMODRAFT_52894              143   2e-34   
ref|XP_002976894.1|  hypothetical protein SELMODRAFT_32458              141   1e-33   
ref|XP_009394623.1|  PREDICTED: heparanase-like protein 2               137   4e-32   
ref|XP_010048934.1|  PREDICTED: heparanase-like protein 3 isoform X2    131   2e-30   
ref|XP_010688437.1|  PREDICTED: heparanase-like protein 3               130   4e-30   
gb|KJB33259.1|  hypothetical protein B456_006G004500                    122   2e-27   
ref|XP_006581996.1|  PREDICTED: heparanase-like protein 1-like is...    120   1e-26   
ref|XP_008647414.1|  PREDICTED: uncharacterized protein LOC100193...    118   5e-26   
gb|KJB33253.1|  hypothetical protein B456_006G004200                    117   1e-25   
ref|XP_010096576.1|  Heparanase-like protein 2                          116   2e-25   
gb|KJB60459.1|  hypothetical protein B456_009G305800                    117   3e-25   
gb|KCW81359.1|  hypothetical protein EUGRSUZ_C02741                     115   6e-25   
gb|KJB33258.1|  hypothetical protein B456_006G004400                    114   2e-24   
gb|KCW81358.1|  hypothetical protein EUGRSUZ_C02740                     113   4e-24   
ref|XP_012081146.1|  PREDICTED: heparanase-like protein 3 isoform X2    110   2e-23   
gb|EAY89013.1|  hypothetical protein OsI_10495                          111   3e-23   
ref|XP_010258412.1|  PREDICTED: heparanase-like protein 1               103   6e-23   
gb|AAC62790.1|  T2L5.7 gene product                                     103   2e-22   
gb|EAZ26032.1|  hypothetical protein OsJ_09885                          107   5e-22   
ref|XP_006600562.1|  PREDICTED: heparanase-like protein 1-like is...    105   2e-21   
gb|AFW64121.1|  hypothetical protein ZEAMMB73_054082                    100   9e-21   
ref|XP_006374166.1|  hypothetical protein POPTR_0015s03440g             101   4e-20   
ref|XP_006655848.1|  PREDICTED: heparanase-like protein 3-like          100   8e-20   
ref|XP_008793957.1|  PREDICTED: heparanase-like protein 3             99.0    2e-19   
ref|XP_005777839.1|  hypothetical protein EMIHUDRAFT_52085            97.8    2e-19   
ref|XP_005794527.1|  hypothetical protein EMIHUDRAFT_194815           98.6    5e-19   
ref|XP_004146543.1|  PREDICTED: heparanase-like protein 1             95.5    5e-18   
gb|AFW64122.1|  hypothetical protein ZEAMMB73_054082                  89.7    8e-17   
ref|XP_002297572.1|  predicted protein                                88.2    2e-15   
tpg|DAA57914.1|  TPA: hypothetical protein ZEAMMB73_865151            84.3    4e-15   
tpg|DAA57913.1|  TPA: hypothetical protein ZEAMMB73_865151            84.7    2e-14   
gb|AGZ89196.1|  MLOC_36964-like protein                               77.8    5e-14   
ref|XP_011459847.1|  PREDICTED: heparanase-like protein 3             83.2    6e-14   
gb|ACN26863.1|  unknown                                               83.2    6e-14   
ref|NP_851092.1|  glucuronidase 3                                     82.0    1e-13   
gb|AES91669.2|  glycoside hydrolase family 79 amino-terminal doma...  75.9    2e-13   
gb|AGZ89219.1|  MLOC_36964-like protein                               75.9    3e-13   
gb|AGZ89188.1|  MLOC_36964-like protein                               75.5    4e-13   
ref|XP_003609472.1|  Heparanase-like protein                          75.1    4e-13   
gb|AGZ89193.1|  MLOC_36964-like protein                               75.1    4e-13   
emb|CDP15922.1|  unnamed protein product                              75.9    1e-12   
ref|XP_009036441.1|  hypothetical protein AURANDRAFT_3240             77.8    2e-12   
emb|CBY37768.1|  unnamed protein product                              76.6    1e-11   
emb|CDP15413.1|  unnamed protein product                              72.0    1e-11   
ref|XP_004508702.1|  PREDICTED: heparanase-like protein 2-like is...  75.9    2e-11   
emb|CBY24752.1|  unnamed protein product                              75.9    2e-11   
gb|KHN48723.1|  Heparanase-like protein 2                             74.7    4e-11   
ref|XP_007037489.1|  Glucuronidase 2 isoform 3                        73.9    6e-11   
ref|XP_006601533.1|  PREDICTED: heparanase-like protein 1-like        70.1    2e-10   
gb|ABR16706.1|  unknown                                               72.0    2e-10   
gb|EMS53277.1|  Heparanase-like protein 1                             70.5    8e-10   
gb|EMT08055.1|  Heparanase-like protein 1                             70.5    9e-10   
gb|AFW77131.1|  hypothetical protein ZEAMMB73_462319                  69.3    1e-09   
emb|CBY12660.1|  unnamed protein product                              64.7    1e-08   
gb|ACR35726.1|  unknown                                               62.8    1e-08   
emb|CBY33809.1|  unnamed protein product                              63.2    4e-08   
ref|XP_008467028.1|  PREDICTED: heparanase-like protein 2             60.8    2e-07   
gb|EYU22381.1|  hypothetical protein MIMGU_mgv1a008019mg              60.1    2e-06   
gb|KEH33102.1|  glycoside hydrolase family 79 amino-terminal doma...  58.9    4e-06   
ref|XP_001747086.1|  hypothetical protein                             55.5    6e-05   
ref|XP_011013080.1|  PREDICTED: heparanase-like protein 1 isoform X2  53.9    2e-04   



>ref|XP_009757548.1| PREDICTED: heparanase-like protein 3 [Nicotiana sylvestris]
Length=538

 Score =   288 bits (738),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 146/230 (63%), Positives = 170/230 (74%), Gaps = 34/230 (15%)
 Frame = +1

Query  313  SWFLQ--MRLWILVLGVFNVSLISGSETLGDKGSVYVDGKSRIGRTDSDFICATLDWWPP  486
            S FLQ  M +WI +   F++ LI G   +  +GSV++DGK+ IGRTD++FICATLDWWPP
Sbjct  3    SLFLQKGMLVWICL---FSLRLICGYSEVA-QGSVFIDGKNAIGRTDNNFICATLDWWPP  58

Query  487  EKCDYGTCAWGHASLLNLDLSNIIFLNAIKAFSPLKIRLGGTLQDKVVYQTKDDRVPCTS  666
            EKCDYGTCAW HAS LNLDL+NIIFLNAIKAFSPLKIRLGGTLQDKV+Y+T+D + PC S
Sbjct  59   EKCDYGTCAWDHASFLNLDLNNIIFLNAIKAFSPLKIRLGGTLQDKVIYETEDHKQPCVS  118

Query  667  FVSNTSEIFSFSQGCLPLSRWDELNVFFNKSG*PTRFIPCPAYICQHs*lyvsslrvllr  846
            FV NTSE+F F+ GCLPLSRWDELN FFNKSG                            
Sbjct  119  FVKNTSEMFGFTSGCLPLSRWDELNAFFNKSG----------------------------  150

Query  847  AVIIFGLNALTGRSIRSDASAVGAWDSTNAESLMKYTVEKGYTIHGWELG  996
            A IIFGLNAL GRS+  D  +VGAWDS+NAESL++YTV+KGY IHGWELG
Sbjct  151  ASIIFGLNALYGRSVHPDGLSVGAWDSSNAESLIRYTVKKGYAIHGWELG  200



>ref|XP_009625836.1| PREDICTED: heparanase-like protein 3 [Nicotiana tomentosiformis]
Length=538

 Score =   283 bits (725),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 142/229 (62%), Positives = 168/229 (73%), Gaps = 30/229 (13%)
 Frame = +1

Query  313  SWFLQMRLWILVLGVFNVSLISGSETLGDKGSVYVDGKSRIGRTDSDFICATLDWWPPEK  492
            S FLQ  + + +  +F++ LI G   +  +GSV++DGK+ IGR D++FICATLDWWPPEK
Sbjct  3    SLFLQKGVLVWIC-LFSLRLICGYSEVA-QGSVFIDGKNAIGRIDNNFICATLDWWPPEK  60

Query  493  CDYGTCAWGHASLLNLDLSNIIFLNAIKAFSPLKIRLGGTLQDKVVYQTKDDRVPCTSFV  672
            CDYGTCAW HAS LNLDL+NIIFLNAIKAFSPLKIRLGGTLQDKV+YQT+D + PC SFV
Sbjct  61   CDYGTCAWDHASFLNLDLNNIIFLNAIKAFSPLKIRLGGTLQDKVIYQTEDHKQPCVSFV  120

Query  673  SNTSEIFSFSQGCLPLSRWDELNVFFNKSG*PTRFIPCPAYICQHs*lyvsslrvllrAV  852
             NTSE+F F+ GCLPLSRWDELN FFNKSG                            A 
Sbjct  121  QNTSEMFGFTPGCLPLSRWDELNAFFNKSG----------------------------AS  152

Query  853  IIFGLNALTGRSIRSDASAVGAWDSTNAESLMKYTVEKGYTIHGWELGK  999
            IIFGLNAL GRS+  D  ++GAWDS+NAESL++YTV+KGY IHGWELG 
Sbjct  153  IIFGLNALYGRSVHPDGLSMGAWDSSNAESLIRYTVKKGYIIHGWELGN  201



>ref|XP_002263173.1| PREDICTED: heparanase-like protein 3 [Vitis vinifera]
Length=559

 Score =   280 bits (715),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 135/231 (58%), Positives = 165/231 (71%), Gaps = 32/231 (14%)
 Frame = +1

Query  316  WFLQMRLWILVLGVFNVSLISGSETLGD---KGSVYVDGKSRIGRTDSDFICATLDWWPP  486
            W + +  W+ V   ++ S ++     G    +G+V++DGK+ IG+ D+DF+CATLDWWPP
Sbjct  10   WLMGLCFWVFVFS-YSFSTVNADTAGGGANVEGTVFIDGKAHIGKIDNDFVCATLDWWPP  68

Query  487  EKCDYGTCAWGHASLLNLDLSNIIFLNAIKAFSPLKIRLGGTLQDKVVYQTKDDRVPCTS  666
            EKCDYGTC+WGHASLLNLDL+N I LNAIKAF+PLK+RLGGTLQDKV+Y T+D R+PCT 
Sbjct  69   EKCDYGTCSWGHASLLNLDLNNKILLNAIKAFTPLKLRLGGTLQDKVIYDTEDHRLPCTH  128

Query  667  FVSNTSEIFSFSQGCLPLSRWDELNVFFNKSG*PTRFIPCPAYICQHs*lyvsslrvllr  846
            FV NTS++F F+QGCLPL RWDELN FF  SG                            
Sbjct  129  FVQNTSQLFGFTQGCLPLYRWDELNTFFKNSG----------------------------  160

Query  847  AVIIFGLNALTGRSIRSDASAVGAWDSTNAESLMKYTVEKGYTIHGWELGK  999
            AVIIFGLNAL+GRSIR D SAVGAWDS+NAESL++YTV+KGY I  WELG 
Sbjct  161  AVIIFGLNALSGRSIRPDGSAVGAWDSSNAESLIRYTVKKGYDISAWELGN  211



>emb|CBI25561.3| unnamed protein product [Vitis vinifera]
Length=533

 Score =   277 bits (708),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 130/200 (65%), Positives = 153/200 (77%), Gaps = 28/200 (14%)
 Frame = +1

Query  400  KGSVYVDGKSRIGRTDSDFICATLDWWPPEKCDYGTCAWGHASLLNLDLSNIIFLNAIKA  579
            +G+V++DGK+ IG+ D+DF+CATLDWWPPEKCDYGTC+WGHASLLNLDL+N I LNAIKA
Sbjct  29   EGTVFIDGKAHIGKIDNDFVCATLDWWPPEKCDYGTCSWGHASLLNLDLNNKILLNAIKA  88

Query  580  FSPLKIRLGGTLQDKVVYQTKDDRVPCTSFVSNTSEIFSFSQGCLPLSRWDELNVFFNKS  759
            F+PLK+RLGGTLQDKV+Y T+D R+PCT FV NTS++F F+QGCLPL RWDELN FF  S
Sbjct  89   FTPLKLRLGGTLQDKVIYDTEDHRLPCTHFVQNTSQLFGFTQGCLPLYRWDELNTFFKNS  148

Query  760  G*PTRFIPCPAYICQHs*lyvsslrvllrAVIIFGLNALTGRSIRSDASAVGAWDSTNAE  939
            G                            AVIIFGLNAL+GRSIR D SAVGAWDS+NAE
Sbjct  149  G----------------------------AVIIFGLNALSGRSIRPDGSAVGAWDSSNAE  180

Query  940  SLMKYTVEKGYTIHGWELGK  999
            SL++YTV+KGY I  WELG 
Sbjct  181  SLIRYTVKKGYDISAWELGN  200



>ref|XP_006359499.1| PREDICTED: heparanase-like protein 3-like [Solanum tuberosum]
Length=536

 Score =   277 bits (708),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 138/229 (60%), Positives = 163/229 (71%), Gaps = 32/229 (14%)
 Frame = +1

Query  313  SWFLQMRLWILVLGVFNVSLISGSETLGDKGSVYVDGKSRIGRTDSDFICATLDWWPPEK  492
            S FLQ  + + +  +F++  I G+     +G+V++DGK  IGR D  FICATLDWWPPEK
Sbjct  3    SLFLQKGVLVWLF-LFSLRFICGTTA---QGTVFIDGKIAIGRIDKHFICATLDWWPPEK  58

Query  493  CDYGTCAWGHASLLNLDLSNIIFLNAIKAFSPLKIRLGGTLQDKVVYQTKDDRVPCTSFV  672
            CDYGTCAW H+S LNLDL+NIIFLNAIKAFSPLKIRLGGTLQDKV+YQT+D + PC SFV
Sbjct  59   CDYGTCAWDHSSFLNLDLNNIIFLNAIKAFSPLKIRLGGTLQDKVIYQTEDHKQPCVSFV  118

Query  673  SNTSEIFSFSQGCLPLSRWDELNVFFNKSG*PTRFIPCPAYICQHs*lyvsslrvllrAV  852
             NT+E+F F+ GCLPLSRWDELN FFNKSG                            A 
Sbjct  119  RNTTEMFGFTPGCLPLSRWDELNAFFNKSG----------------------------AS  150

Query  853  IIFGLNALTGRSIRSDASAVGAWDSTNAESLMKYTVEKGYTIHGWELGK  999
            IIFGLNAL GRS+  D  +VGAWD +NAESL++YTV+KGY IHGWELG 
Sbjct  151  IIFGLNALYGRSVHPDGLSVGAWDPSNAESLIRYTVKKGYDIHGWELGN  199



>emb|CAN81917.1| hypothetical protein VITISV_038549 [Vitis vinifera]
Length=636

 Score =   277 bits (709),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 134/230 (58%), Positives = 166/230 (72%), Gaps = 32/230 (14%)
 Frame = +1

Query  316  WFLQMRLWILVLGVFNVSLISGSETLGD---KGSVYVDGKSRIGRTDSDFICATLDWWPP  486
            W + +  W+ V G ++ S ++     G    +G+V++DGK+ IG+ D+DF+CATLDWWPP
Sbjct  6    WLMGLCFWVFVFG-YSFSTVNADTAGGGANVEGTVFIDGKAHIGKIDNDFVCATLDWWPP  64

Query  487  EKCDYGTCAWGHASLLNLDLSNIIFLNAIKAFSPLKIRLGGTLQDKVVYQTKDDRVPCTS  666
            EKCDYGTC+WGHASLL+LDL++ I LNAIKAF+PLK+RLGGTLQDKV+Y T+D R+PCT 
Sbjct  65   EKCDYGTCSWGHASLLSLDLNDKILLNAIKAFTPLKLRLGGTLQDKVIYDTEDHRLPCTH  124

Query  667  FVSNTSEIFSFSQGCLPLSRWDELNVFFNKSG*PTRFIPCPAYICQHs*lyvsslrvllr  846
            FV NTS++F F+QGCLPL RWDELN FF  SG                            
Sbjct  125  FVQNTSQLFGFTQGCLPLYRWDELNTFFKNSG----------------------------  156

Query  847  AVIIFGLNALTGRSIRSDASAVGAWDSTNAESLMKYTVEKGYTIHGWELG  996
            AVIIFGLNAL+GRSIR D SAVGAWDS+NAESL++YTV+KGY I  WELG
Sbjct  157  AVIIFGLNALSGRSIRPDGSAVGAWDSSNAESLIRYTVKKGYDISAWELG  206



>ref|XP_004242732.1| PREDICTED: heparanase-like protein 3 [Solanum lycopersicum]
Length=536

 Score =   275 bits (702),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 137/228 (60%), Positives = 165/228 (72%), Gaps = 32/228 (14%)
 Frame = +1

Query  313  SWFLQMRLWILVLGVFNVSLISGSETLGDKGSVYVDGKSRIGRTDSDFICATLDWWPPEK  492
            S FLQ  + + +  +F++  I G++    +G+V++DGK  IGR D  FICATLDWWPPEK
Sbjct  3    SLFLQKGVLVWLF-LFSLRFICGTKA---QGTVFIDGKIAIGRIDRHFICATLDWWPPEK  58

Query  493  CDYGTCAWGHASLLNLDLSNIIFLNAIKAFSPLKIRLGGTLQDKVVYQTKDDRVPCTSFV  672
            CDYGTCAW ++S LNLDL+NIIFLNAIKAFSPLKIRLGGTLQDKV+YQT+D + PC SFV
Sbjct  59   CDYGTCAWDYSSFLNLDLNNIIFLNAIKAFSPLKIRLGGTLQDKVIYQTEDHQQPCVSFV  118

Query  673  SNTSEIFSFSQGCLPLSRWDELNVFFNKSG*PTRFIPCPAYICQHs*lyvsslrvllrAV  852
             NT+E+F F+ GCLPLSRWDELN FFNKSG                            A 
Sbjct  119  RNTTEMFGFTPGCLPLSRWDELNAFFNKSG----------------------------AS  150

Query  853  IIFGLNALTGRSIRSDASAVGAWDSTNAESLMKYTVEKGYTIHGWELG  996
            IIFGLNAL GRS+  D+ +VGAWD +NAESL++YTV+KGY IHGWELG
Sbjct  151  IIFGLNALYGRSVHPDSLSVGAWDPSNAESLIRYTVKKGYDIHGWELG  198



>ref|XP_007013614.1| Glucuronidase 3 isoform 2 [Theobroma cacao]
 gb|EOY31233.1| Glucuronidase 3 isoform 2 [Theobroma cacao]
Length=554

 Score =   274 bits (701),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 132/199 (66%), Positives = 152/199 (76%), Gaps = 28/199 (14%)
 Frame = +1

Query  400  KGSVYVDGKSRIGRTDSDFICATLDWWPPEKCDYGTCAWGHASLLNLDLSNIIFLNAIKA  579
            +G+V++DGK+ IG  D DFICATLDWWPPEKCDYGTC+WG A LLNLDLSN IFLNA+KA
Sbjct  40   EGTVFIDGKAPIGSIDDDFICATLDWWPPEKCDYGTCSWGLAGLLNLDLSNNIFLNAVKA  99

Query  580  FSPLKIRLGGTLQDKVVYQTKDDRVPCTSFVSNTSEIFSFSQGCLPLSRWDELNVFFNKS  759
            FSPLKIRLGGTLQDKV+Y T D+R PCT FV +TSE+F F+QGCLP++RWDELN FF K+
Sbjct  100  FSPLKIRLGGTLQDKVIYDTDDNREPCTPFVKSTSEMFGFTQGCLPMNRWDELNAFFAKA  159

Query  760  G*PTRFIPCPAYICQHs*lyvsslrvllrAVIIFGLNALTGRSIRSDASAVGAWDSTNAE  939
            G                            A +IFGLNALTGRSI+SD SAVGAW+ TNAE
Sbjct  160  G----------------------------AKVIFGLNALTGRSIKSDDSAVGAWNYTNAE  191

Query  940  SLMKYTVEKGYTIHGWELG  996
            SL++YTVEK YTIHGWELG
Sbjct  192  SLIRYTVEKNYTIHGWELG  210



>ref|XP_007013613.1| Glucuronidase 3 isoform 1 [Theobroma cacao]
 gb|EOY31232.1| Glucuronidase 3 isoform 1 [Theobroma cacao]
Length=615

 Score =   275 bits (702),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 132/199 (66%), Positives = 152/199 (76%), Gaps = 28/199 (14%)
 Frame = +1

Query  400  KGSVYVDGKSRIGRTDSDFICATLDWWPPEKCDYGTCAWGHASLLNLDLSNIIFLNAIKA  579
            +G+V++DGK+ IG  D DFICATLDWWPPEKCDYGTC+WG A LLNLDLSN IFLNA+KA
Sbjct  40   EGTVFIDGKAPIGSIDDDFICATLDWWPPEKCDYGTCSWGLAGLLNLDLSNNIFLNAVKA  99

Query  580  FSPLKIRLGGTLQDKVVYQTKDDRVPCTSFVSNTSEIFSFSQGCLPLSRWDELNVFFNKS  759
            FSPLKIRLGGTLQDKV+Y T D+R PCT FV +TSE+F F+QGCLP++RWDELN FF K+
Sbjct  100  FSPLKIRLGGTLQDKVIYDTDDNREPCTPFVKSTSEMFGFTQGCLPMNRWDELNAFFAKA  159

Query  760  G*PTRFIPCPAYICQHs*lyvsslrvllrAVIIFGLNALTGRSIRSDASAVGAWDSTNAE  939
            G                            A +IFGLNALTGRSI+SD SAVGAW+ TNAE
Sbjct  160  G----------------------------AKVIFGLNALTGRSIKSDDSAVGAWNYTNAE  191

Query  940  SLMKYTVEKGYTIHGWELG  996
            SL++YTVEK YTIHGWELG
Sbjct  192  SLIRYTVEKNYTIHGWELG  210



>ref|XP_011017900.1| PREDICTED: heparanase-like protein 3 isoform X1 [Populus euphratica]
 ref|XP_011017901.1| PREDICTED: heparanase-like protein 3 isoform X2 [Populus euphratica]
Length=547

 Score =   266 bits (679),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 130/235 (55%), Positives = 163/235 (69%), Gaps = 34/235 (14%)
 Frame = +1

Query  310  HSWFLQMRLWILVLGVFNVSLISGSETLGD------KGSVYVDGKSRIGRTDSDFICATL  471
             +W + + L + ++    +S+ S S   G+      +G+V++DGKS IG+ D + ICATL
Sbjct  5    QNWQMGLCLLVYIISCCFISVSSQSAVAGNDNSSVVEGTVFIDGKSSIGKIDENSICATL  64

Query  472  DWWPPEKCDYGTCAWGHASLLNLDLSNIIFLNAIKAFSPLKIRLGGTLQDKVVYQTKDDR  651
            DWWPPEKCDYGTC+W HASL+NLDL+N I LNAIKAFSPLKIR+GGTLQDKV+Y T+D++
Sbjct  65   DWWPPEKCDYGTCSWDHASLINLDLNNSILLNAIKAFSPLKIRIGGTLQDKVIYDTEDNK  124

Query  652  VPCTSFVSNTSEIFSFSQGCLPLSRWDELNVFFNKSG*PTRFIPCPAYICQHs*lyvssl  831
             PC  FV NT E+F F+QGCLPL RWDELN FF KSG                       
Sbjct  125  QPCVQFVKNTREMFGFTQGCLPLHRWDELNAFFKKSG-----------------------  161

Query  832  rvllrAVIIFGLNALTGRSIRSDASAVGAWDSTNAESLMKYTVEKGYTIHGWELG  996
                 A IIFGLNALTGRS++SD SAVGAW+ +NAES + YTV+K Y+I+GWELG
Sbjct  162  -----AEIIFGLNALTGRSMKSDGSAVGAWNYSNAESFISYTVKKNYSIYGWELG  211



>ref|XP_011078541.1| PREDICTED: heparanase-like protein 3 [Sesamum indicum]
Length=537

 Score =   265 bits (677),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 130/229 (57%), Positives = 160/229 (70%), Gaps = 30/229 (13%)
 Frame = +1

Query  313  SWFLQMRLWILVLGVFNVSLISGSETLGDKGSVYVDGKSRIGRTDSDFICATLDWWPPEK  492
            S+ L    W+LV  +  +  +   ET+  +G V+VDGKS I +TD DFICATLDWWPPEK
Sbjct  3    SFVLPKAWWVLVCVLCCIGDVKAGETV--EGIVFVDGKSPIAKTDEDFICATLDWWPPEK  60

Query  493  CDYGTCAWGHASLLNLDLSNIIFLNAIKAFSPLKIRLGGTLQDKVVYQTKDDRVPCTSFV  672
            CDYGTC+WGHASLLNLDL N +FLNA+KAFSPLKIRLGGTLQDKV+YQT+D   PC  F 
Sbjct  61   CDYGTCSWGHASLLNLDLKNSVFLNAVKAFSPLKIRLGGTLQDKVIYQTEDKPEPCIPFA  120

Query  673  SNTSEIFSFSQGCLPLSRWDELNVFFNKSG*PTRFIPCPAYICQHs*lyvsslrvllrAV  852
             N+S++F F+ GCLPL+RWDELN FFN+SG                            A+
Sbjct  121  KNSSQMFGFTGGCLPLARWDELNSFFNQSG----------------------------AL  152

Query  853  IIFGLNALTGRSIRSDASAVGAWDSTNAESLMKYTVEKGYTIHGWELGK  999
            +IFGLNAL G+SI+ + +A G WDS+NA SL++YTV KGY I+GWELG 
Sbjct  153  VIFGLNALKGKSIQPNNTATGPWDSSNAASLIRYTVRKGYNIYGWELGN  201



>ref|XP_006389405.1| hypothetical protein POPTR_0025s00410g [Populus trichocarpa]
 gb|ERP48319.1| hypothetical protein POPTR_0025s00410g [Populus trichocarpa]
Length=547

 Score =   264 bits (674),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 129/235 (55%), Positives = 163/235 (69%), Gaps = 34/235 (14%)
 Frame = +1

Query  310  HSWFLQMRLWILVLGVFNVSLISGSETLGD------KGSVYVDGKSRIGRTDSDFICATL  471
             +W + + L + ++    +S+ S S   G+      +G+V++DGKS IG+ D + ICATL
Sbjct  5    QNWQMGLCLLVCIISCCFISVSSQSAVAGNDNNSVVEGTVFIDGKSSIGKIDENSICATL  64

Query  472  DWWPPEKCDYGTCAWGHASLLNLDLSNIIFLNAIKAFSPLKIRLGGTLQDKVVYQTKDDR  651
            DWWPPEKCDYGTC+W HASL+NLDL+N I LNAIKAFSPLKIR+GGTLQDKV+Y T+D++
Sbjct  65   DWWPPEKCDYGTCSWDHASLINLDLNNSILLNAIKAFSPLKIRIGGTLQDKVIYDTEDNK  124

Query  652  VPCTSFVSNTSEIFSFSQGCLPLSRWDELNVFFNKSG*PTRFIPCPAYICQHs*lyvssl  831
             PC  FV NT E+F F+QGCLP+ RWDELN FF KSG                       
Sbjct  125  QPCVQFVKNTREMFGFTQGCLPMYRWDELNAFFKKSG-----------------------  161

Query  832  rvllrAVIIFGLNALTGRSIRSDASAVGAWDSTNAESLMKYTVEKGYTIHGWELG  996
                 A IIFGLNALTGRS++SD SAVGAW+ +NAES + YTV+K Y+I+GWELG
Sbjct  162  -----AEIIFGLNALTGRSMKSDGSAVGAWNYSNAESFISYTVKKNYSIYGWELG  211



>gb|KDO73427.1| hypothetical protein CISIN_1g008762mg [Citrus sinensis]
Length=554

 Score =   264 bits (675),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 126/197 (64%), Positives = 149/197 (76%), Gaps = 21/197 (11%)
 Frame = +1

Query  406  SVYVDGKSRIGRTDSDFICATLDWWPPEKCDYGTCAWGHASLLNLDLSNIIFLNAIKAFS  585
            +V++D +S IGRTD DF+CATLDWWPPEKCDYGTC+W  ASLLNLDL++ I LNA+KAFS
Sbjct  45   NVFIDRRSVIGRTDDDFVCATLDWWPPEKCDYGTCSWDRASLLNLDLNSNILLNAVKAFS  104

Query  586  PLKIRLGGTLQDKVVYQTKDDRVPCTSFVSNTSEIFSFSQGCLPLSRWDELNVFFNKSG*  765
            PLKIRLGGTLQDKV+Y T+D+R PC  FV N+SE+F F+QGCLP+ RWDELN FF KSG 
Sbjct  105  PLKIRLGGTLQDKVIYDTEDNRQPCKQFVKNSSEMFGFTQGCLPMHRWDELNAFFKKSG-  163

Query  766  PTRFIPCPAYICQHs*lyvsslrvllrAVIIFGLNALTGRSIRSDASAVGAWDSTNAESL  945
                 PC  +                RA I+FGLNALTGRSI++D S  GAWD TNAES 
Sbjct  164  ----CPCIQF----------------RAKIVFGLNALTGRSIQNDGSVKGAWDYTNAESF  203

Query  946  MKYTVEKGYTIHGWELG  996
            + YTV+K Y+IHGWELG
Sbjct  204  ISYTVKKNYSIHGWELG  220



>emb|CDP10485.1| unnamed protein product [Coffea canephora]
Length=543

 Score =   264 bits (674),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 131/200 (66%), Positives = 147/200 (74%), Gaps = 29/200 (15%)
 Frame = +1

Query  400  KGSVYVDGKSRIGRTDSDFICATLDWWPPEKCDYGTCAWGHASLLNLDLSNIIFLNAIKA  579
            +G V+VDG S IG  D DFICATLDWWPPEKCDYGTC+W HASLLNLDL NIIFLNA+KA
Sbjct  37   QGFVFVDGISAIGEIDDDFICATLDWWPPEKCDYGTCSWDHASLLNLDLDNIIFLNAVKA  96

Query  580  FSPLKIRLGGTLQDKVVYQTKDDRVPCTSFVSNTSEIFSFSQGCLPLSRWDELNVFFNKS  759
            FSPLKIRLGGTLQD V+YQT+ ++  C SFV N+SE+F F+QGCLP SRWDELN FF KS
Sbjct  97   FSPLKIRLGGTLQDNVIYQTQSNQ-RCHSFVKNSSELFGFTQGCLPSSRWDELNSFFKKS  155

Query  760  G*PTRFIPCPAYICQHs*lyvsslrvllrAVIIFGLNALTGRSIRSDASAVGAWDSTNAE  939
            G                            A IIFGLNAL GR IRSD SAVGAWDS+NAE
Sbjct  156  G----------------------------AEIIFGLNALNGRRIRSDGSAVGAWDSSNAE  187

Query  940  SLMKYTVEKGYTIHGWELGK  999
            + ++YTVEKGY I+GWELG 
Sbjct  188  AFIRYTVEKGYNIYGWELGN  207



>ref|XP_011081531.1| PREDICTED: heparanase-like protein 3 [Sesamum indicum]
Length=549

 Score =   262 bits (670),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 128/226 (57%), Positives = 156/226 (69%), Gaps = 29/226 (13%)
 Frame = +1

Query  322  LQMRLWILVLGVFNVSLISGSETLGDKGSVYVDGKSRIGRTDSDFICATLDWWPPEKCDY  501
            L + LW+ +    + +++S S  + + G+V++DG S IG  D DFICAT+DWWPP KCDY
Sbjct  24   LGLSLWLYLASHGSTTVVSQSPAVAN-GTVHIDGASSIGMIDDDFICATMDWWPPTKCDY  82

Query  502  GTCAWGHASLLNLDLSNIIFLNAIKAFSPLKIRLGGTLQDKVVYQTKDDRVPCTSFVSNT  681
            GTC+WG ASLLNLDLSN I LNAIKAFSPLK+RLGGTLQDKV YQT DD  PC  FV N+
Sbjct  83   GTCSWGSASLLNLDLSNKILLNAIKAFSPLKLRLGGTLQDKVRYQTTDDPRPCNQFVRNS  142

Query  682  SEIFSFSQGCLPLSRWDELNVFFNKSG*PTRFIPCPAYICQHs*lyvsslrvllrAVIIF  861
            SE+F F++GCLP+SRWDELN FF  +G                            A +IF
Sbjct  143  SEMFGFTEGCLPMSRWDELNNFFKMAG----------------------------AEVIF  174

Query  862  GLNALTGRSIRSDASAVGAWDSTNAESLMKYTVEKGYTIHGWELGK  999
            GLNALTGR+I SD ++ GAWD  NAESL+++TV  GYTIHGWELG 
Sbjct  175  GLNALTGRTIGSDGTSTGAWDPRNAESLIRHTVNSGYTIHGWELGN  220



>ref|XP_007011804.1| Glucuronidase 3 isoform 2 [Theobroma cacao]
 gb|EOY29423.1| Glucuronidase 3 isoform 2 [Theobroma cacao]
Length=513

 Score =   260 bits (664),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 121/199 (61%), Positives = 149/199 (75%), Gaps = 28/199 (14%)
 Frame = +1

Query  403  GSVYVDGKSRIGRTDSDFICATLDWWPPEKCDYGTCAWGHASLLNLDLSNIIFLNAIKAF  582
            G+V ++G + IG+TD +FICATLDWWPPEKCDYGTC+WG ASLLNLDL+N I LNAIKAF
Sbjct  38   GTVVINGTASIGKTDDNFICATLDWWPPEKCDYGTCSWGRASLLNLDLANPILLNAIKAF  97

Query  583  SPLKIRLGGTLQDKVVYQTKDDRVPCTSFVSNTSEIFSFSQGCLPLSRWDELNVFFNKSG  762
            SPLKIR+GGTLQD V+Y+TK D+ PC  F  N+SEIF FS+GCLP+SRWDELN+FF K+G
Sbjct  98   SPLKIRMGGTLQDNVIYETKGDKNPCVPFPKNSSEIFGFSKGCLPMSRWDELNIFFKKAG  157

Query  763  *PTRFIPCPAYICQHs*lyvsslrvllrAVIIFGLNALTGRSIRSDASAVGAWDSTNAES  942
                                        A+++FGLNAL+GR+I  D SA+GAW+S+NAE 
Sbjct  158  ----------------------------AMVVFGLNALSGRTIGPDGSAIGAWNSSNAEL  189

Query  943  LMKYTVEKGYTIHGWELGK  999
            L++YTV KGYTI+GWELG 
Sbjct  190  LIRYTVNKGYTIYGWELGN  208



>ref|XP_010533116.1| PREDICTED: heparanase-like protein 3 [Tarenaya hassleriana]
Length=547

 Score =   261 bits (666),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 127/228 (56%), Positives = 156/228 (68%), Gaps = 29/228 (13%)
 Frame = +1

Query  316  WFLQMRLWILVLGVFNVSLISGSETLGDKGSVYVDGKSRIGRTDSDFICATLDWWPPEKC  495
            W + + LW+ VL     S  S S   G  G+VYVDG++ +GRTDSDF+CATLDWWPPEKC
Sbjct  7    WQMGLFLWVFVLAGVICSGESSSVDSG-VGTVYVDGRAAVGRTDSDFVCATLDWWPPEKC  65

Query  496  DYGTCAWGHASLLNLDLSNIIFLNAIKAFSPLKIRLGGTLQDKVVYQTKDDRVPCTSFVS  675
            DYGTC+W HASLLNLDLSN I  NAIKAF+PLKIRLGGTLQD VVY+T + + PC  F  
Sbjct  66   DYGTCSWDHASLLNLDLSNNILQNAIKAFAPLKIRLGGTLQDIVVYETPELKQPCVPFTR  125

Query  676  NTSEIFSFSQGCLPLSRWDELNVFFNKSG*PTRFIPCPAYICQHs*lyvsslrvllrAVI  855
            N+S +F F++GCLP+ RWDE+N FF ++G                            A +
Sbjct  126  NSSVLFGFTEGCLPMRRWDEINAFFQRTG----------------------------AEV  157

Query  856  IFGLNALTGRSIRSDASAVGAWDSTNAESLMKYTVEKGYTIHGWELGK  999
            +FGLNAL+GR ++ D SAVGAWD TNAES ++YT +K YTIHGWELG 
Sbjct  158  VFGLNALSGRKVQPDGSAVGAWDYTNAESFIRYTAQKNYTIHGWELGN  205



>ref|XP_002283260.2| PREDICTED: heparanase-like protein 3 [Vitis vinifera]
Length=532

 Score =   260 bits (665),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 121/200 (61%), Positives = 149/200 (75%), Gaps = 28/200 (14%)
 Frame = +1

Query  397  DKGSVYVDGKSRIGRTDSDFICATLDWWPPEKCDYGTCAWGHASLLNLDLSNIIFLNAIK  576
            ++GSV+++G+  IG TD DFICATLDWWPP+KCDYGTC+WG ASLLNLDLSN I LNAIK
Sbjct  20   EEGSVFINGRVAIGSTDDDFICATLDWWPPDKCDYGTCSWGRASLLNLDLSNKILLNAIK  79

Query  577  AFSPLKIRLGGTLQDKVVYQTKDDRVPCTSFVSNTSEIFSFSQGCLPLSRWDELNVFFNK  756
            AFSPLK+R+GGTLQDKV+YQ   D+ PC  FV N+SE+F FS+GCLP+SRWDELN+FF +
Sbjct  80   AFSPLKVRMGGTLQDKVIYQRTSDQNPCAQFVKNSSEMFGFSEGCLPMSRWDELNLFFRE  139

Query  757  SG*PTRFIPCPAYICQHs*lyvsslrvllrAVIIFGLNALTGRSIRSDASAVGAWDSTNA  936
            +G                            AV+IFGLNAL+GR+I  D  A GAW+S++A
Sbjct  140  AG----------------------------AVVIFGLNALSGRTIGLDGLAAGAWNSSDA  171

Query  937  ESLMKYTVEKGYTIHGWELG  996
            ESL++Y+  KGYTIHGWELG
Sbjct  172  ESLIRYSANKGYTIHGWELG  191



>ref|XP_010250274.1| PREDICTED: heparanase-like protein 3 [Nelumbo nucifera]
Length=551

 Score =   260 bits (665),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 125/231 (54%), Positives = 160/231 (69%), Gaps = 34/231 (15%)
 Frame = +1

Query  319  FLQMRLWILVLGVFNVSL----ISGSETLGDKGSVYVDGKSRIGRTDSDFICATLDWWPP  486
            FL +  W++     ++++    +SG  T+  +G+V ++G + IGR D DFICAT+DWWPP
Sbjct  7    FLGLYFWVVFCIYSSITVESQNVSGGGTI--EGTVLINGSASIGRIDDDFICATMDWWPP  64

Query  487  EKCDYGTCAWGHASLLNLDLSNIIFLNAIKAFSPLKIRLGGTLQDKVVYQTKDDRVPCTS  666
            EKCDYGTC+WGHAS+LNLDL+N + LNA+KAFSPLK+RLGGTLQDKV+Y T     PCT 
Sbjct  65   EKCDYGTCSWGHASMLNLDLNNTVLLNAVKAFSPLKLRLGGTLQDKVIYDTGSPPQPCTQ  124

Query  667  FVSNTSEIFSFSQGCLPLSRWDELNVFFNKSG*PTRFIPCPAYICQHs*lyvsslrvllr  846
            FV N+SE+F F+QGCLP+SRWDELN FF K+G                            
Sbjct  125  FVKNSSELFGFTQGCLPMSRWDELNNFFKKAG----------------------------  156

Query  847  AVIIFGLNALTGRSIRSDASAVGAWDSTNAESLMKYTVEKGYTIHGWELGK  999
            A++IFGLNAL GR++ SD SA+G WD TNA SL++YTV KGY I+GWELG 
Sbjct  157  ALVIFGLNALNGRNLSSDGSALGPWDYTNAASLIRYTVNKGYVIYGWELGN  207



>ref|XP_007011803.1| Glucuronidase 3 isoform 1 [Theobroma cacao]
 gb|EOY29422.1| Glucuronidase 3 isoform 1 [Theobroma cacao]
Length=549

 Score =   260 bits (664),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 121/199 (61%), Positives = 149/199 (75%), Gaps = 28/199 (14%)
 Frame = +1

Query  403  GSVYVDGKSRIGRTDSDFICATLDWWPPEKCDYGTCAWGHASLLNLDLSNIIFLNAIKAF  582
            G+V ++G + IG+TD +FICATLDWWPPEKCDYGTC+WG ASLLNLDL+N I LNAIKAF
Sbjct  38   GTVVINGTASIGKTDDNFICATLDWWPPEKCDYGTCSWGRASLLNLDLANPILLNAIKAF  97

Query  583  SPLKIRLGGTLQDKVVYQTKDDRVPCTSFVSNTSEIFSFSQGCLPLSRWDELNVFFNKSG  762
            SPLKIR+GGTLQD V+Y+TK D+ PC  F  N+SEIF FS+GCLP+SRWDELN+FF K+G
Sbjct  98   SPLKIRMGGTLQDNVIYETKGDKNPCVPFPKNSSEIFGFSKGCLPMSRWDELNIFFKKAG  157

Query  763  *PTRFIPCPAYICQHs*lyvsslrvllrAVIIFGLNALTGRSIRSDASAVGAWDSTNAES  942
                                        A+++FGLNAL+GR+I  D SA+GAW+S+NAE 
Sbjct  158  ----------------------------AMVVFGLNALSGRTIGPDGSAIGAWNSSNAEL  189

Query  943  LMKYTVEKGYTIHGWELGK  999
            L++YTV KGYTI+GWELG 
Sbjct  190  LIRYTVNKGYTIYGWELGN  208



>gb|KDO73428.1| hypothetical protein CISIN_1g008762mg [Citrus sinensis]
Length=547

 Score =   259 bits (663),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 123/197 (62%), Positives = 145/197 (74%), Gaps = 28/197 (14%)
 Frame = +1

Query  406  SVYVDGKSRIGRTDSDFICATLDWWPPEKCDYGTCAWGHASLLNLDLSNIIFLNAIKAFS  585
            +V++D +S IGRTD DF+CATLDWWPPEKCDYGTC+W  ASLLNLDL++ I LNA+KAFS
Sbjct  45   NVFIDRRSVIGRTDDDFVCATLDWWPPEKCDYGTCSWDRASLLNLDLNSNILLNAVKAFS  104

Query  586  PLKIRLGGTLQDKVVYQTKDDRVPCTSFVSNTSEIFSFSQGCLPLSRWDELNVFFNKSG*  765
            PLKIRLGGTLQDKV+Y T+D+R PC  FV N+SE+F F+QGCLP+ RWDELN FF KSG 
Sbjct  105  PLKIRLGGTLQDKVIYDTEDNRQPCKQFVKNSSEMFGFTQGCLPMHRWDELNAFFKKSG-  163

Query  766  PTRFIPCPAYICQHs*lyvsslrvllrAVIIFGLNALTGRSIRSDASAVGAWDSTNAESL  945
                                       A I+FGLNALTGRSI++D S  GAWD TNAES 
Sbjct  164  ---------------------------AKIVFGLNALTGRSIQNDGSVKGAWDYTNAESF  196

Query  946  MKYTVEKGYTIHGWELG  996
            + YTV+K Y+IHGWELG
Sbjct  197  ISYTVKKNYSIHGWELG  213



>ref|XP_006453123.1| hypothetical protein CICLE_v10007919mg [Citrus clementina]
 ref|XP_006474380.1| PREDICTED: heparanase-like protein 3-like [Citrus sinensis]
 gb|ESR66363.1| hypothetical protein CICLE_v10007919mg [Citrus clementina]
Length=547

 Score =   259 bits (663),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 123/197 (62%), Positives = 145/197 (74%), Gaps = 28/197 (14%)
 Frame = +1

Query  406  SVYVDGKSRIGRTDSDFICATLDWWPPEKCDYGTCAWGHASLLNLDLSNIIFLNAIKAFS  585
            +V++D +S IGRTD DF+CATLDWWPPEKCDYGTC+W  ASLLNLDL++ I LNA+KAFS
Sbjct  45   NVFIDRRSVIGRTDDDFVCATLDWWPPEKCDYGTCSWDRASLLNLDLNSNILLNAVKAFS  104

Query  586  PLKIRLGGTLQDKVVYQTKDDRVPCTSFVSNTSEIFSFSQGCLPLSRWDELNVFFNKSG*  765
            PLKIRLGGTLQDKV+Y T+D+R PC  FV N+SE+F F+QGCLP+ RWDELN FF KSG 
Sbjct  105  PLKIRLGGTLQDKVIYDTEDNRQPCKQFVKNSSEMFGFTQGCLPMHRWDELNAFFKKSG-  163

Query  766  PTRFIPCPAYICQHs*lyvsslrvllrAVIIFGLNALTGRSIRSDASAVGAWDSTNAESL  945
                                       A I+FGLNALTGRSI++D S  GAWD TNAES 
Sbjct  164  ---------------------------AKIVFGLNALTGRSIQNDGSVKGAWDYTNAESF  196

Query  946  MKYTVEKGYTIHGWELG  996
            + YTV+K Y+IHGWELG
Sbjct  197  ISYTVKKNYSIHGWELG  213



>ref|XP_010099859.1| Heparanase-like protein 3 [Morus notabilis]
 gb|EXB80736.1| Heparanase-like protein 3 [Morus notabilis]
Length=536

 Score =   258 bits (660),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 123/221 (56%), Positives = 159/221 (72%), Gaps = 29/221 (13%)
 Frame = +1

Query  340  ILVLGVFNVSLISGS-ETLGDKGSVYVDGKSRIGRTDSDFICATLDWWPPEKCDYGTCAW  516
            +L LG+++ +  S S  +   +G+V+V+G + IGR D DF+CAT+DWWPP+KCD+GTC+W
Sbjct  8    VLCLGIYHWTHSSSSVASKTQRGTVFVNGTAPIGRIDDDFVCATIDWWPPDKCDFGTCSW  67

Query  517  GHASLLNLDLSNIIFLNAIKAFSPLKIRLGGTLQDKVVYQTKDDRVPCTSFVSNTSEIFS  696
            G ASLLNLDL++ I +NAI+AFS LKIRLGGTLQDKV+Y+T+D++ PCT FV   S++  
Sbjct  68   GTASLLNLDLNDPILVNAIRAFSSLKIRLGGTLQDKVIYETQDNKQPCTPFVKKDSDLLG  127

Query  697  FSQGCLPLSRWDELNVFFNKSG*PTRFIPCPAYICQHs*lyvsslrvllrAVIIFGLNAL  876
            FSQGCLP+SRWDELN FFN++G                            AV++FGLNAL
Sbjct  128  FSQGCLPMSRWDELNTFFNRTG----------------------------AVVVFGLNAL  159

Query  877  TGRSIRSDASAVGAWDSTNAESLMKYTVEKGYTIHGWELGK  999
             GR+I S  SA GAW+S+NAESLM+YTV KGY IHGWELG 
Sbjct  160  RGRTIDSQGSATGAWNSSNAESLMRYTVNKGYKIHGWELGN  200



>ref|XP_007224283.1| hypothetical protein PRUPE_ppa019445mg, partial [Prunus persica]
 gb|EMJ25482.1| hypothetical protein PRUPE_ppa019445mg, partial [Prunus persica]
Length=511

 Score =   255 bits (652),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 119/199 (60%), Positives = 149/199 (75%), Gaps = 28/199 (14%)
 Frame = +1

Query  400  KGSVYVDGKSRIGRTDSDFICATLDWWPPEKCDYGTCAWGHASLLNLDLSNIIFLNAIKA  579
            +G+++V+G + IG  D DF+CAT+DWWPP+KCDYGTC+WG ASLLNLDL N I LNAIKA
Sbjct  13   EGTLFVNGTAAIGFIDDDFVCATIDWWPPQKCDYGTCSWGSASLLNLDLDNAILLNAIKA  72

Query  580  FSPLKIRLGGTLQDKVVYQTKDDRVPCTSFVSNTSEIFSFSQGCLPLSRWDELNVFFNKS  759
            FSPLKIRLGGTLQDKV+YQT++ + P TSF+ + SE+F F+QG LP+SRWD+LN+FF K+
Sbjct  73   FSPLKIRLGGTLQDKVIYQTEESQQPSTSFLKDGSELFGFTQGYLPMSRWDQLNIFFKKT  132

Query  760  G*PTRFIPCPAYICQHs*lyvsslrvllrAVIIFGLNALTGRSIRSDASAVGAWDSTNAE  939
            G                            AV+IFGLNAL GR+I S  +AVGAW+S+NAE
Sbjct  133  G----------------------------AVVIFGLNALRGRTISSQGAAVGAWNSSNAE  164

Query  940  SLMKYTVEKGYTIHGWELG  996
            SL++YTV+KGY IHGWELG
Sbjct  165  SLIRYTVKKGYRIHGWELG  183



>ref|XP_008219534.1| PREDICTED: heparanase-like protein 3 isoform X1 [Prunus mume]
Length=535

 Score =   256 bits (653),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 119/199 (60%), Positives = 150/199 (75%), Gaps = 28/199 (14%)
 Frame = +1

Query  400  KGSVYVDGKSRIGRTDSDFICATLDWWPPEKCDYGTCAWGHASLLNLDLSNIIFLNAIKA  579
            +G+++V+G + IG  D DF+CAT+DWWPP+KCDYGTC+WG ASLLNLDL N I LNAIKA
Sbjct  37   EGTLFVNGTAAIGFIDDDFVCATIDWWPPQKCDYGTCSWGSASLLNLDLDNAILLNAIKA  96

Query  580  FSPLKIRLGGTLQDKVVYQTKDDRVPCTSFVSNTSEIFSFSQGCLPLSRWDELNVFFNKS  759
            FSPLKIRLGGTLQDKV+YQT++ + P TSF+ + SE+F F+QG LP+SRWD+LN+FFNK+
Sbjct  97   FSPLKIRLGGTLQDKVIYQTEESQQPSTSFLKDGSELFGFTQGYLPMSRWDQLNIFFNKT  156

Query  760  G*PTRFIPCPAYICQHs*lyvsslrvllrAVIIFGLNALTGRSIRSDASAVGAWDSTNAE  939
            G                            AV+IFGLNAL GR+I S  +AVGAW+S+NAE
Sbjct  157  G----------------------------AVVIFGLNALRGRTINSQGAAVGAWNSSNAE  188

Query  940  SLMKYTVEKGYTIHGWELG  996
            SL++YTV++GY IHGWELG
Sbjct  189  SLIRYTVKRGYRIHGWELG  207



>ref|XP_008219535.1| PREDICTED: heparanase-like protein 3 isoform X2 [Prunus mume]
Length=534

 Score =   256 bits (653),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 119/199 (60%), Positives = 150/199 (75%), Gaps = 28/199 (14%)
 Frame = +1

Query  400  KGSVYVDGKSRIGRTDSDFICATLDWWPPEKCDYGTCAWGHASLLNLDLSNIIFLNAIKA  579
            +G+++V+G + IG  D DF+CAT+DWWPP+KCDYGTC+WG ASLLNLDL N I LNAIKA
Sbjct  37   EGTLFVNGTAAIGFIDDDFVCATIDWWPPQKCDYGTCSWGSASLLNLDLDNAILLNAIKA  96

Query  580  FSPLKIRLGGTLQDKVVYQTKDDRVPCTSFVSNTSEIFSFSQGCLPLSRWDELNVFFNKS  759
            FSPLKIRLGGTLQDKV+YQT++ + P TSF+ + SE+F F+QG LP+SRWD+LN+FFNK+
Sbjct  97   FSPLKIRLGGTLQDKVIYQTEESQQPSTSFLKDGSELFGFTQGYLPMSRWDQLNIFFNKT  156

Query  760  G*PTRFIPCPAYICQHs*lyvsslrvllrAVIIFGLNALTGRSIRSDASAVGAWDSTNAE  939
            G                            AV+IFGLNAL GR+I S  +AVGAW+S+NAE
Sbjct  157  G----------------------------AVVIFGLNALRGRTINSQGAAVGAWNSSNAE  188

Query  940  SLMKYTVEKGYTIHGWELG  996
            SL++YTV++GY IHGWELG
Sbjct  189  SLIRYTVKRGYRIHGWELG  207



>gb|EYU20239.1| hypothetical protein MIMGU_mgv1a026019mg [Erythranthe guttata]
Length=544

 Score =   254 bits (650),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 122/200 (61%), Positives = 145/200 (73%), Gaps = 28/200 (14%)
 Frame = +1

Query  400  KGSVYVDGKSRIGRTDSDFICATLDWWPPEKCDYGTCAWGHASLLNLDLSNIIFLNAIKA  579
             G+V++D  S IG TD DFICAT+DWWPP KCDYGTC+WG ASLLNLDLSN I +NAI+A
Sbjct  31   NGTVHIDVSSSIGFTDEDFICATMDWWPPTKCDYGTCSWGTASLLNLDLSNKILVNAIRA  90

Query  580  FSPLKIRLGGTLQDKVVYQTKDDRVPCTSFVSNTSEIFSFSQGCLPLSRWDELNVFFNKS  759
            FSPLKIR+GGTLQDKV+YQT DD  PC+ F+ N+SE+F F+QGCLPLSRWD+LN FFN +
Sbjct  91   FSPLKIRIGGTLQDKVIYQTADDPTPCSQFLRNSSEMFGFTQGCLPLSRWDDLNNFFNMT  150

Query  760  G*PTRFIPCPAYICQHs*lyvsslrvllrAVIIFGLNALTGRSIRSDASAVGAWDSTNAE  939
            G                            A IIFGLNAL GR+I SD S  GAW+S+NAE
Sbjct  151  G----------------------------AEIIFGLNALNGRTIGSDGSCTGAWNSSNAE  182

Query  940  SLMKYTVEKGYTIHGWELGK  999
            SL+++TV  GYTI+GWELG 
Sbjct  183  SLIRHTVNSGYTIYGWELGN  202



>ref|XP_011036604.1| PREDICTED: heparanase-like protein 3 isoform X2 [Populus euphratica]
Length=520

 Score =   253 bits (647),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 120/200 (60%), Positives = 149/200 (75%), Gaps = 30/200 (15%)
 Frame = +1

Query  400  KGSVYVDGKSRIGRTDSDFICATLDWWPPEKCDYGTCAWGHASLLNLDLSNIIFLNAIKA  579
            +G+V+++G + IGRTD DFICATLDWWPP+KCDYGTC+WG AS LNLDL+N I LNAIKA
Sbjct  12   QGTVFINGTAPIGRTDHDFICATLDWWPPDKCDYGTCSWGKASFLNLDLTNPILLNAIKA  71

Query  580  FSPLKIRLGGTLQDKVVYQTKDDRVPCTSFVSNTSEIFSFSQGCLPLSRWDELNVFFNKS  759
            F+PLKIRLGGTLQDKV Y+   +  PC +FV ++SE+F FSQGCLP+SRWDELN FF ++
Sbjct  72   FAPLKIRLGGTLQDKVTYERLGE--PCPTFVKSSSEMFGFSQGCLPMSRWDELNNFFKQA  129

Query  760  G*PTRFIPCPAYICQHs*lyvsslrvllrAVIIFGLNALTGRSIRSDASAVGAWDSTNAE  939
            G                            AV++FGLNAL+GR+I +D SAVGAW+S++AE
Sbjct  130  G----------------------------AVVLFGLNALSGRTIAADGSAVGAWNSSDAE  161

Query  940  SLMKYTVEKGYTIHGWELGK  999
             LM+Y+V KGYTIHGWELG 
Sbjct  162  FLMRYSVNKGYTIHGWELGN  181



>ref|XP_010648741.1| PREDICTED: heparanase-like protein 3 [Vitis vinifera]
Length=567

 Score =   253 bits (647),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 124/225 (55%), Positives = 154/225 (68%), Gaps = 31/225 (14%)
 Frame = +1

Query  334  LWILVLGVFNV---SLISGSETLGDKGSVYVDGKSRIGRTDSDFICATLDWWPPEKCDYG  504
            LW+ ++   ++   S  SG     ++G V+++G+  IG TD DF+CATLDWWPP+KCDYG
Sbjct  12   LWVCLMSQSSIPVASQRSGGSGNVEEGRVFINGRVAIGSTDDDFVCATLDWWPPDKCDYG  71

Query  505  TCAWGHASLLNLDLSNIIFLNAIKAFSPLKIRLGGTLQDKVVYQTKDDRVPCTSFVSNTS  684
            TC+WG ASLLNLDL+N I  NAIKAFS LKIR+GGTLQDKV+YQ   D+ PC  FV N+S
Sbjct  72   TCSWGRASLLNLDLTNKILFNAIKAFSSLKIRMGGTLQDKVIYQRTGDQQPCAQFVKNSS  131

Query  685  EIFSFSQGCLPLSRWDELNVFFNKSG*PTRFIPCPAYICQHs*lyvsslrvllrAVIIFG  864
            E+F FS+GCLP+SRWDELN FF  +G                            AV+IFG
Sbjct  132  EMFGFSEGCLPMSRWDELNQFFRDAG----------------------------AVVIFG  163

Query  865  LNALTGRSIRSDASAVGAWDSTNAESLMKYTVEKGYTIHGWELGK  999
            LNAL+GRSI  D  A GAW+ ++AESL++YTV KGYTIHGWELG 
Sbjct  164  LNALSGRSIGMDGLATGAWNGSDAESLIQYTVNKGYTIHGWELGN  208



>gb|KDP33563.1| hypothetical protein JCGZ_07134 [Jatropha curcas]
Length=539

 Score =   252 bits (644),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 123/227 (54%), Positives = 160/227 (70%), Gaps = 34/227 (15%)
 Frame = +1

Query  319  FLQMRLWILVLGVFNVSLISGSETLGDKGSVYVDGKSRIGRTDSDFICATLDWWPPEKCD  498
            F+ + LW+ +  V   S+ + S+++   G+V+++G+  IG TD DFICATLDWWPP+KCD
Sbjct  9    FMFVCLWLSL--VHKNSVFAASKSV--DGTVFINGRDSIGETDEDFICATLDWWPPDKCD  64

Query  499  YGTCAWGHASLLNLDLSNIIFLNAIKAFSPLKIRLGGTLQDKVVYQTKDDRVPCTSFVSN  678
            YGTC+WG ASLLN+DLSN I +NA++AFSPLKIR+GGTLQDKV Y+TK +  PC SF+ +
Sbjct  65   YGTCSWGKASLLNVDLSNPILVNAVRAFSPLKIRMGGTLQDKVTYETKGE--PCPSFIKS  122

Query  679  TSEIFSFSQGCLPLSRWDELNVFFNKSG*PTRFIPCPAYICQHs*lyvsslrvllrAVII  858
             S++F FSQGCLP++RWD+LN FF ++G                            A +I
Sbjct  123  NSDMFGFSQGCLPMTRWDQLNSFFKQAG----------------------------AAVI  154

Query  859  FGLNALTGRSIRSDASAVGAWDSTNAESLMKYTVEKGYTIHGWELGK  999
            FGLNAL GR+I S+ SAVGAWD  NAESL++YTV KGY IHGWELG 
Sbjct  155  FGLNALKGRTIASNGSAVGAWDPRNAESLIRYTVNKGYKIHGWELGN  201



>gb|KJB23650.1| hypothetical protein B456_004G108900 [Gossypium raimondii]
Length=546

 Score =   253 bits (645),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 130/220 (59%), Positives = 161/220 (73%), Gaps = 28/220 (13%)
 Frame = +1

Query  337  WILVLGVFNVSLISGSETLGDKGSVYVDGKSRIGRTDSDFICATLDWWPPEKCDYGTCAW  516
            +I +L  +++S +S       +G+V++DGK+ IGR D DFICATLDWWPPEKCDYGTC+W
Sbjct  9    FISLLNFYSLSFVSSQADASAEGTVFIDGKAPIGRIDDDFICATLDWWPPEKCDYGTCSW  68

Query  517  GHASLLNLDLSNIIFLNAIKAFSPLKIRLGGTLQDKVVYQTKDDRVPCTSFVSNTSEIFS  696
            G A LLNLDL+  +FLNA+KAFSPLKIRLGGTLQDKV+Y + D+++PCTSFV NTSE+F 
Sbjct  69   GLAGLLNLDLNKNLFLNAVKAFSPLKIRLGGTLQDKVIYDSDDNQLPCTSFVKNTSEMFG  128

Query  697  FSQGCLPLSRWDELNVFFNKSG*PTRFIPCPAYICQHs*lyvsslrvllrAVIIFGLNAL  876
            F+QGCLP++RWD+LN FF K+G                            A +IFGLNAL
Sbjct  129  FTQGCLPMNRWDDLNSFFQKAG----------------------------AKVIFGLNAL  160

Query  877  TGRSIRSDASAVGAWDSTNAESLMKYTVEKGYTIHGWELG  996
             GR+I SD SAVGAW+ TNAES M+YTV+K YTIHGWELG
Sbjct  161  AGRTIASDGSAVGAWNYTNAESFMQYTVDKNYTIHGWELG  200



>ref|XP_011036603.1| PREDICTED: heparanase-like protein 3 isoform X1 [Populus euphratica]
Length=563

 Score =   253 bits (646),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 120/200 (60%), Positives = 149/200 (75%), Gaps = 30/200 (15%)
 Frame = +1

Query  400  KGSVYVDGKSRIGRTDSDFICATLDWWPPEKCDYGTCAWGHASLLNLDLSNIIFLNAIKA  579
            +G+V+++G + IGRTD DFICATLDWWPP+KCDYGTC+WG AS LNLDL+N I LNAIKA
Sbjct  55   QGTVFINGTAPIGRTDHDFICATLDWWPPDKCDYGTCSWGKASFLNLDLTNPILLNAIKA  114

Query  580  FSPLKIRLGGTLQDKVVYQTKDDRVPCTSFVSNTSEIFSFSQGCLPLSRWDELNVFFNKS  759
            F+PLKIRLGGTLQDKV Y+   +  PC +FV ++SE+F FSQGCLP+SRWDELN FF ++
Sbjct  115  FAPLKIRLGGTLQDKVTYERLGE--PCPTFVKSSSEMFGFSQGCLPMSRWDELNNFFKQA  172

Query  760  G*PTRFIPCPAYICQHs*lyvsslrvllrAVIIFGLNALTGRSIRSDASAVGAWDSTNAE  939
            G                            AV++FGLNAL+GR+I +D SAVGAW+S++AE
Sbjct  173  G----------------------------AVVLFGLNALSGRTIAADGSAVGAWNSSDAE  204

Query  940  SLMKYTVEKGYTIHGWELGK  999
             LM+Y+V KGYTIHGWELG 
Sbjct  205  FLMRYSVNKGYTIHGWELGN  224



>ref|XP_003542659.1| PREDICTED: heparanase-like protein 3-like [Glycine max]
 gb|KHN47116.1| Heparanase-like protein 3 [Glycine soja]
Length=524

 Score =   252 bits (643),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 128/228 (56%), Positives = 153/228 (67%), Gaps = 31/228 (14%)
 Frame = +1

Query  319  FLQMRLWILV--LGVFNVSLISGSETLGDKGSVYVDGKSRIGRTDSDFICATLDWWPPEK  492
             L + LW+ +  L       + G E    KG V V GK+ IGR D D +CATLDWWPP+K
Sbjct  7    LLGLCLWMYLSSLSFIGAGAVYGREGEVVKGIVLVHGKTAIGRIDDDSVCATLDWWPPQK  66

Query  493  CDYGTCAWGHASLLNLDLSNIIFLNAIKAFSPLKIRLGGTLQDKVVYQTKDDRVPCTSFV  672
            CDYG C+WGHASLLNLDL+N I LNA+KAFSPLKIRLGGTLQDKV+Y T+D R PCT FV
Sbjct  67   CDYGKCSWGHASLLNLDLNNKILLNAVKAFSPLKIRLGGTLQDKVMYGTEDCRQPCTPFV  126

Query  673  SNTSEIFSFSQGCLPLSRWDELNVFFNKSG*PTRFIPCPAYICQHs*lyvsslrvllrAV  852
             N +E+F F+QGCLP+ RWDELN FF K+G                            A 
Sbjct  127  LNANEMFGFTQGCLPMYRWDELNSFFQKAG----------------------------AK  158

Query  853  IIFGLNALTGRSIRSDASAVGAWDSTNAESLMKYTVEKGYTIHGWELG  996
            ++FGLNAL G+S++S  SAVG W+ TNAESL++YTV K YTIHGWELG
Sbjct  159  VVFGLNALAGKSMKS-GSAVGPWNYTNAESLIRYTVRKKYTIHGWELG  205



>gb|KJB23649.1| hypothetical protein B456_004G108900 [Gossypium raimondii]
Length=554

 Score =   252 bits (644),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 130/220 (59%), Positives = 161/220 (73%), Gaps = 28/220 (13%)
 Frame = +1

Query  337  WILVLGVFNVSLISGSETLGDKGSVYVDGKSRIGRTDSDFICATLDWWPPEKCDYGTCAW  516
            +I +L  +++S +S       +G+V++DGK+ IGR D DFICATLDWWPPEKCDYGTC+W
Sbjct  9    FISLLNFYSLSFVSSQADASAEGTVFIDGKAPIGRIDDDFICATLDWWPPEKCDYGTCSW  68

Query  517  GHASLLNLDLSNIIFLNAIKAFSPLKIRLGGTLQDKVVYQTKDDRVPCTSFVSNTSEIFS  696
            G A LLNLDL+  +FLNA+KAFSPLKIRLGGTLQDKV+Y + D+++PCTSFV NTSE+F 
Sbjct  69   GLAGLLNLDLNKNLFLNAVKAFSPLKIRLGGTLQDKVIYDSDDNQLPCTSFVKNTSEMFG  128

Query  697  FSQGCLPLSRWDELNVFFNKSG*PTRFIPCPAYICQHs*lyvsslrvllrAVIIFGLNAL  876
            F+QGCLP++RWD+LN FF K+G                            A +IFGLNAL
Sbjct  129  FTQGCLPMNRWDDLNSFFQKAG----------------------------AKVIFGLNAL  160

Query  877  TGRSIRSDASAVGAWDSTNAESLMKYTVEKGYTIHGWELG  996
             GR+I SD SAVGAW+ TNAES M+YTV+K YTIHGWELG
Sbjct  161  AGRTIASDGSAVGAWNYTNAESFMQYTVDKNYTIHGWELG  200



>ref|XP_012076507.1| PREDICTED: heparanase-like protein 3 [Jatropha curcas]
Length=530

 Score =   251 bits (641),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 122/221 (55%), Positives = 157/221 (71%), Gaps = 34/221 (15%)
 Frame = +1

Query  334  LWILVLGVFNVSLISGSETLGDKGSVYVDGKSRIGRTDSDFICATLDWWPPEKCDYGTCA  513
            LW+ +  V   S+ + S+++   G+V+++G+  IG TD DFICATLDWWPP+KCDYGTC+
Sbjct  5    LWLSL--VHKNSVFAASKSV--DGTVFINGRDSIGETDEDFICATLDWWPPDKCDYGTCS  60

Query  514  WGHASLLNLDLSNIIFLNAIKAFSPLKIRLGGTLQDKVVYQTKDDRVPCTSFVSNTSEIF  693
            WG ASLLN+DLSN I +NA++AFSPLKIR+GGTLQDKV Y+TK +  PC SF+ + S++F
Sbjct  61   WGKASLLNVDLSNPILVNAVRAFSPLKIRMGGTLQDKVTYETKGE--PCPSFIKSNSDMF  118

Query  694  SFSQGCLPLSRWDELNVFFNKSG*PTRFIPCPAYICQHs*lyvsslrvllrAVIIFGLNA  873
             FSQGCLP++RWD+LN FF ++G                            A +IFGLNA
Sbjct  119  GFSQGCLPMTRWDQLNSFFKQAG----------------------------AAVIFGLNA  150

Query  874  LTGRSIRSDASAVGAWDSTNAESLMKYTVEKGYTIHGWELG  996
            L GR+I S+ SAVGAWD  NAESL++YTV KGY IHGWELG
Sbjct  151  LKGRTIASNGSAVGAWDPRNAESLIRYTVNKGYKIHGWELG  191



>gb|KFK22707.1| hypothetical protein AALP_AAs49083U000200 [Arabis alpina]
Length=535

 Score =   251 bits (642),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 118/222 (53%), Positives = 152/222 (68%), Gaps = 28/222 (13%)
 Frame = +1

Query  331  RLWILVLGVFNVSLISGSETLGDKGSVYVDGKSRIGRTDSDFICATLDWWPPEKCDYGTC  510
            ++W++++ V+ V     S    DKG+V V G++ +G  D DFICATLDWWPPEKCDYGTC
Sbjct  5    QIWLIIVSVWFVGCTVSSSAGEDKGTVVVYGRAAVGIVDEDFICATLDWWPPEKCDYGTC  64

Query  511  AWGHASLLNLDLSNIIFLNAIKAFSPLKIRLGGTLQDKVVYQTKDDRVPCTSFVSNTSEI  690
            AW HAS+LNLDL+NIIF NAIKAF+PLKIR+GGTLQD V+Y+T D + PC  F  N+S I
Sbjct  65   AWDHASILNLDLNNIIFQNAIKAFAPLKIRIGGTLQDLVIYETPDLKQPCVPFTKNSSVI  124

Query  691  FSFSQGCLPLSRWDELNVFFNKSG*PTRFIPCPAYICQHs*lyvsslrvllrAVIIFGLN  870
            F F++GCLP+ RWDELN FF ++G                            A +IFGLN
Sbjct  125  FGFTEGCLPMRRWDELNAFFRRTG----------------------------AKVIFGLN  156

Query  871  ALTGRSIRSDASAVGAWDSTNAESLMKYTVEKGYTIHGWELG  996
            AL+GRSI+ +  A+GAWD TNAES +++T +  +TI GWELG
Sbjct  157  ALSGRSIKPNGEAIGAWDYTNAESFIRFTAQNNHTIDGWELG  198



>ref|XP_002515478.1| heparanase, putative [Ricinus communis]
 gb|EEF46927.1| heparanase, putative [Ricinus communis]
Length=527

 Score =   250 bits (639),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 120/199 (60%), Positives = 145/199 (73%), Gaps = 30/199 (15%)
 Frame = +1

Query  400  KGSVYVDGKSRIGRTDSDFICATLDWWPPEKCDYGTCAWGHASLLNLDLSNIIFLNAIKA  579
            +G+V+++G + IG TD+DFICATLDWWP +KCDYGTC+WG AS LNLDL N I LNAIKA
Sbjct  14   EGTVFINGTASIGTTDNDFICATLDWWPTDKCDYGTCSWGRASFLNLDLRNPILLNAIKA  73

Query  580  FSPLKIRLGGTLQDKVVYQTKDDRVPCTSFVSNTSEIFSFSQGCLPLSRWDELNVFFNKS  759
            FSPLKIR+GGTLQDKVVY+ K +  PC  F+ N+SE+F FSQGCLP++RWD+LN FF ++
Sbjct  74   FSPLKIRMGGTLQDKVVYEIKGE--PCPLFIKNSSEMFGFSQGCLPMTRWDDLNNFFKQA  131

Query  760  G*PTRFIPCPAYICQHs*lyvsslrvllrAVIIFGLNALTGRSIRSDASAVGAWDSTNAE  939
            G                            A +IFGLNAL GR+I SD SA GAWDS+NAE
Sbjct  132  G----------------------------ATVIFGLNALRGRTIASDGSAFGAWDSSNAE  163

Query  940  SLMKYTVEKGYTIHGWELG  996
            SL++YTV KGY IHGWELG
Sbjct  164  SLIQYTVNKGYKIHGWELG  182



>ref|XP_010687865.1| PREDICTED: heparanase-like protein 3 [Beta vulgaris subsp. vulgaris]
Length=546

 Score =   251 bits (640),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 129/212 (61%), Positives = 156/212 (74%), Gaps = 31/212 (15%)
 Frame = +1

Query  370  LISGSETLG---DKGSVYVDGKSRIGRTDSDFICATLDWWPPEKCDYGTCAWGHASLLNL  540
             +S S  LG   +KG VY++G++ IG TD DFICATLDWWPPEKCDYGTCAWGHASLLNL
Sbjct  23   FVSTSPVLGRKREKGRVYINGRAAIGETDEDFICATLDWWPPEKCDYGTCAWGHASLLNL  82

Query  541  DLSNIIFLNAIKAFSPLKIRLGGTLQDKVVYQTKDDRVPCTSFVSNTSEIFSFSQGCLPL  720
            DL+N +FL AIKAFSPLKIRLGGTLQDKVVY+++D ++PC  F + T+E+F F+ GCLP+
Sbjct  83   DLNNQLFLKAIKAFSPLKIRLGGTLQDKVVYESEDSKLPCIPFSNKTTEMFGFTPGCLPM  142

Query  721  SRWDELNVFFNKSG*PTRFIPCPAYICQHs*lyvsslrvllrAVIIFGLNALTGRSIRSD  900
             RWDELN FFNK+G                            A+++FGLNAL GRSI+ D
Sbjct  143  KRWDELNAFFNKAG----------------------------ALVVFGLNALAGRSIQPD  174

Query  901  ASAVGAWDSTNAESLMKYTVEKGYTIHGWELG  996
             SA GAWD +NAESL++YTVEKGY I+GWELG
Sbjct  175  GSATGAWDPSNAESLVRYTVEKGYDIYGWELG  206



>ref|XP_011020240.1| PREDICTED: heparanase-like protein 3 [Populus euphratica]
Length=559

 Score =   251 bits (640),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 129/199 (65%), Positives = 151/199 (76%), Gaps = 28/199 (14%)
 Frame = +1

Query  400  KGSVYVDGKSRIGRTDSDFICATLDWWPPEKCDYGTCAWGHASLLNLDLSNIIFLNAIKA  579
            +G+V++DGK+ IG+TD DFICATLDWWPPEKCDYGTC+W HASL+NLDL+N I LNAIKA
Sbjct  41   EGTVFIDGKTSIGKTDEDFICATLDWWPPEKCDYGTCSWDHASLINLDLNNNILLNAIKA  100

Query  580  FSPLKIRLGGTLQDKVVYQTKDDRVPCTSFVSNTSEIFSFSQGCLPLSRWDELNVFFNKS  759
            FSPLKIRLGGTLQDKV+Y T+D++ PC  FV NTSE+F F+QGCLP+ RWDELN FF KS
Sbjct  101  FSPLKIRLGGTLQDKVIYDTEDNKQPCVQFVKNTSEMFGFTQGCLPMYRWDELNAFFKKS  160

Query  760  G*PTRFIPCPAYICQHs*lyvsslrvllrAVIIFGLNALTGRSIRSDASAVGAWDSTNAE  939
            G                            A IIFGLNALTGRSI+SD SAVGAW+ TNAE
Sbjct  161  G----------------------------AEIIFGLNALTGRSIKSDGSAVGAWNYTNAE  192

Query  940  SLMKYTVEKGYTIHGWELG  996
            S + YTV+K Y+I+GWELG
Sbjct  193  SFISYTVKKNYSIYGWELG  211



>gb|AFK40288.1| unknown [Lotus japonicus]
Length=529

 Score =   249 bits (636),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 123/203 (61%), Positives = 144/203 (71%), Gaps = 29/203 (14%)
 Frame = +1

Query  388  TLGDKGSVYVDGKSRIGRTDSDFICATLDWWPPEKCDYGTCAWGHASLLNLDLSNIIFLN  567
            TL +KG+V +DGKS IG  D DF+CATLDWWPPEKCDYG C+WG ASLLNLDL+N IFLN
Sbjct  22   TLSEKGTVTIDGKSAIGNIDDDFVCATLDWWPPEKCDYGRCSWGLASLLNLDLNNKIFLN  81

Query  568  AIKAFSPLKIRLGGTLQDKVVYQTKDDRVPCTSFVSNTSEIFSFSQGCLPLSRWDELNVF  747
            A+KAFSPLK+RLGG+LQDKV Y T+D   PCT FV   SE+F F++GCLP++RWDELN F
Sbjct  82   AVKAFSPLKLRLGGSLQDKVNYGTEDYHRPCTPFVRKQSEMFGFTEGCLPMNRWDELNKF  141

Query  748  FNKSG*PTRFIPCPAYICQHs*lyvsslrvllrAVIIFGLNALTGRSIRSDASAVGAWDS  927
            F KSG                            A IIFGLNAL G+SI+S  SA+G W+ 
Sbjct  142  FAKSG----------------------------AKIIFGLNALAGKSIQS-GSAIGPWNY  172

Query  928  TNAESLMKYTVEKGYTIHGWELG  996
            TNAES ++YTV K Y IHGWELG
Sbjct  173  TNAESFIRYTVGKNYAIHGWELG  195



>ref|XP_010440690.1| PREDICTED: heparanase-like protein 3 [Camelina sativa]
Length=536

 Score =   249 bits (636),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 119/228 (52%), Positives = 152/228 (67%), Gaps = 33/228 (14%)
 Frame = +1

Query  316  WFLQMRLWILVLGVFNVSLISGSETLGDKGSVYVDGKSRIGRTDSDFICATLDWWPPEKC  495
            WF+     +L L VF     + S T+ + G V+V G++ +G  D DFICATLDWWPPEKC
Sbjct  7    WFI-----VLFLCVFQFLDYTVSSTVEENGKVFVYGRAAVGTIDEDFICATLDWWPPEKC  61

Query  496  DYGTCAWGHASLLNLDLSNIIFLNAIKAFSPLKIRLGGTLQDKVVYQTKDDRVPCTSFVS  675
            DYGTC+W HAS+LNLDL+NII  NAIKAF+PLKIR+GGTLQD V+Y+T D + PC  F  
Sbjct  62   DYGTCSWDHASILNLDLNNIILQNAIKAFAPLKIRIGGTLQDLVIYETPDQQQPCLPFTK  121

Query  676  NTSEIFSFSQGCLPLSRWDELNVFFNKSG*PTRFIPCPAYICQHs*lyvsslrvllrAVI  855
            N+S IF ++QGCLP+ RWDELN FF K+G                            A +
Sbjct  122  NSSIIFGYTQGCLPMRRWDELNAFFRKTG----------------------------AKV  153

Query  856  IFGLNALTGRSIRSDASAVGAWDSTNAESLMKYTVEKGYTIHGWELGK  999
            IFGLNAL+GRSI+ +  A+GAWDSTNAES +++T +  +T+ GWELG 
Sbjct  154  IFGLNALSGRSIKPNGEAIGAWDSTNAESFIRFTAQNNHTVDGWELGN  201



>ref|XP_006483407.1| PREDICTED: heparanase-like protein 3-like isoform X2 [Citrus 
sinensis]
Length=430

 Score =   246 bits (628),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 118/200 (59%), Positives = 142/200 (71%), Gaps = 28/200 (14%)
 Frame = +1

Query  400  KGSVYVDGKSRIGRTDSDFICATLDWWPPEKCDYGTCAWGHASLLNLDLSNIIFLNAIKA  579
            +G+V+++G   I +TD +FICATLDWWPP+KCDYGTC+WG ASLLNLDL N I L A+KA
Sbjct  47   EGTVFINGTVAIAKTDDNFICATLDWWPPDKCDYGTCSWGRASLLNLDLGNPILLKAVKA  106

Query  580  FSPLKIRLGGTLQDKVVYQTKDDRVPCTSFVSNTSEIFSFSQGCLPLSRWDELNVFFNKS  759
            FSPLKIR+GGTLQDK VY++K    PCT FV N SE+F FS+GCL + RWDELN+FF ++
Sbjct  107  FSPLKIRMGGTLQDKAVYESKGIDEPCTPFVKNNSELFGFSEGCLTMRRWDELNIFFRRA  166

Query  760  G*PTRFIPCPAYICQHs*lyvsslrvllrAVIIFGLNALTGRSIRSDASAVGAWDSTNAE  939
            G                            AV+ FGLNAL GR I+SD SA GAWDS+NAE
Sbjct  167  G----------------------------AVVTFGLNALRGRIIQSDGSARGAWDSSNAE  198

Query  940  SLMKYTVEKGYTIHGWELGK  999
            SLM+YTV KGY I+GWELG 
Sbjct  199  SLMRYTVNKGYKIYGWELGN  218



>ref|XP_010450341.1| PREDICTED: heparanase-like protein 3 [Camelina sativa]
Length=536

 Score =   249 bits (635),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 119/228 (52%), Positives = 152/228 (67%), Gaps = 33/228 (14%)
 Frame = +1

Query  316  WFLQMRLWILVLGVFNVSLISGSETLGDKGSVYVDGKSRIGRTDSDFICATLDWWPPEKC  495
            WF+     +L L VF     + S T+ + G V+V G++ +G  D DFICATLDWWPPEKC
Sbjct  7    WFI-----VLFLCVFQFLDYTVSSTVEENGKVFVYGRAAVGTIDEDFICATLDWWPPEKC  61

Query  496  DYGTCAWGHASLLNLDLSNIIFLNAIKAFSPLKIRLGGTLQDKVVYQTKDDRVPCTSFVS  675
            DYGTC+W HAS+LNLDL+NII  NAIKAF+PLKIR+GGTLQD V+Y+T D + PC  F  
Sbjct  62   DYGTCSWDHASILNLDLNNIILQNAIKAFAPLKIRIGGTLQDLVIYETLDQQQPCLPFTK  121

Query  676  NTSEIFSFSQGCLPLSRWDELNVFFNKSG*PTRFIPCPAYICQHs*lyvsslrvllrAVI  855
            N+S IF ++QGCLP+ RWDELN FF K+G                            A +
Sbjct  122  NSSIIFGYTQGCLPMRRWDELNAFFRKTG----------------------------AKV  153

Query  856  IFGLNALTGRSIRSDASAVGAWDSTNAESLMKYTVEKGYTIHGWELGK  999
            IFGLNAL+GRSI+ +  A+GAWDSTNAES +++T +  +T+ GWELG 
Sbjct  154  IFGLNALSGRSIKPNGEAIGAWDSTNAESFIRFTAQNNHTVDGWELGN  201



>gb|KHN15030.1| Heparanase-like protein 3 [Glycine soja]
Length=525

 Score =   248 bits (634),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 125/221 (57%), Positives = 149/221 (67%), Gaps = 29/221 (13%)
 Frame = +1

Query  334  LWILVLGVFNVSLISGSETLGDKGSVYVDGKSRIGRTDSDFICATLDWWPPEKCDYGTCA  513
            +++  L    V  + G E    +G V V GK+ IGR D D ICATLDWWP +KCDYG C+
Sbjct  14   MYLACLSFIGVGAVYGREGEVLEGIVLVHGKTAIGRIDDDSICATLDWWPSQKCDYGKCS  73

Query  514  WGHASLLNLDLSNIIFLNAIKAFSPLKIRLGGTLQDKVVYQTKDDRVPCTSFVSNTSEIF  693
            WGHASLLNLDL+N I LNA+KAFSPLKIRLGGTLQDKV+Y T+D R PCT FV N +E+F
Sbjct  74   WGHASLLNLDLNNKILLNAVKAFSPLKIRLGGTLQDKVIYGTEDCRQPCTPFVLNANEMF  133

Query  694  SFSQGCLPLSRWDELNVFFNKSG*PTRFIPCPAYICQHs*lyvsslrvllrAVIIFGLNA  873
             F+QGCLP+ RWDELN FF K+G                              ++FGLNA
Sbjct  134  GFTQGCLPMYRWDELNSFFQKAG----------------------------VKVVFGLNA  165

Query  874  LTGRSIRSDASAVGAWDSTNAESLMKYTVEKGYTIHGWELG  996
            L G+SI+S  SAVG W+ TNAESL++YTV K YTIHGWELG
Sbjct  166  LAGKSIKS-GSAVGPWNYTNAESLIRYTVRKKYTIHGWELG  205



>gb|EYU34947.1| hypothetical protein MIMGU_mgv1a004017mg [Erythranthe guttata]
Length=549

 Score =   249 bits (635),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 121/224 (54%), Positives = 157/224 (70%), Gaps = 30/224 (13%)
 Frame = +1

Query  334  LWILVLGVFNVSLISGSE-TLGDKGSVYVDGKSRIGRTDSDFICATLDWWPPEKCDYGTC  510
            +W LV  V   S I   + ++  +G+V +DG+S I  TD +F+CATLDWWP  KCDYG C
Sbjct  5    VWFLVFVVCGCSFICDVKGSVSVEGTVVIDGESPIAETDENFVCATLDWWPSAKCDYGNC  64

Query  511  AWGHASLLNLDLSNIIFLNAIKAFSPLKIRLGGTLQDKVVYQTKDDR-VPCTSFVSNTSE  687
            +WG+ASL NLDL N++FLNA+KAFSPLKIRLGGTLQDKV+YQT+D++  PCT FV N+S 
Sbjct  65   SWGNASLFNLDLKNVVFLNAVKAFSPLKIRLGGTLQDKVIYQTEDNKQQPCTPFVQNSSR  124

Query  688  IFSFSQGCLPLSRWDELNVFFNKSG*PTRFIPCPAYICQHs*lyvsslrvllrAVIIFGL  867
            +F F++ CLPL+RWDELN FFN+SG                            A++IFGL
Sbjct  125  LFGFTEACLPLARWDELNSFFNQSG----------------------------ALVIFGL  156

Query  868  NALTGRSIRSDASAVGAWDSTNAESLMKYTVEKGYTIHGWELGK  999
            NAL G+SI+++  A G WDSTNA SL++YT++KGY I+GWELG 
Sbjct  157  NALHGKSIQANNVATGPWDSTNAASLIRYTIKKGYNIYGWELGN  200



>ref|XP_006283483.1| hypothetical protein CARUB_v10004531mg [Capsella rubella]
 gb|EOA16381.1| hypothetical protein CARUB_v10004531mg [Capsella rubella]
Length=544

 Score =   249 bits (635),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 119/228 (52%), Positives = 150/228 (66%), Gaps = 28/228 (12%)
 Frame = +1

Query  316  WFLQMRLWILVLGVFNVSLISGSETLGDKGSVYVDGKSRIGRTDSDFICATLDWWPPEKC  495
            WF ++  ++  +  F    +S +    + G V+V G++ +G  D DFICATLDWWPPEKC
Sbjct  10   WFFKVLFFLCCVLQFLDYTVSSAVEEDNTGKVFVYGRAAVGTIDEDFICATLDWWPPEKC  69

Query  496  DYGTCAWGHASLLNLDLSNIIFLNAIKAFSPLKIRLGGTLQDKVVYQTKDDRVPCTSFVS  675
            DYGTC+W HAS+LNLDL+NIIF NAIKAF+PLKIR+GGTLQD V+Y+T D + PC  F  
Sbjct  70   DYGTCSWDHASILNLDLNNIIFQNAIKAFAPLKIRIGGTLQDLVIYETPDQKQPCVPFTQ  129

Query  676  NTSEIFSFSQGCLPLSRWDELNVFFNKSG*PTRFIPCPAYICQHs*lyvsslrvllrAVI  855
            N+S IF ++QGCLP+ RW ELN FF+K+G                            A I
Sbjct  130  NSSIIFGYTQGCLPMHRWGELNAFFSKTG----------------------------AKI  161

Query  856  IFGLNALTGRSIRSDASAVGAWDSTNAESLMKYTVEKGYTIHGWELGK  999
            IFGLNAL+GRSI     AVGAWDSTNAES ++YT +  YT+ GWELG 
Sbjct  162  IFGLNALSGRSINPKGEAVGAWDSTNAESFIRYTAQSNYTVDGWELGN  209



>ref|XP_008457259.1| PREDICTED: LOW QUALITY PROTEIN: heparanase-like protein 3 [Cucumis 
melo]
Length=538

 Score =   248 bits (634),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 117/200 (59%), Positives = 139/200 (70%), Gaps = 28/200 (14%)
 Frame = +1

Query  400  KGSVYVDGKSRIGRTDSDFICATLDWWPPEKCDYGTCAWGHASLLNLDLSNIIFLNAIKA  579
            +G V++DGKS IGR D DF+CATLDWWPPEKCDYGTC+WG ASLLNLDL N I LNA+K 
Sbjct  31   RGRVFIDGKSAIGRIDEDFVCATLDWWPPEKCDYGTCSWGQASLLNLDLGNNILLNAVKE  90

Query  580  FSPLKIRLGGTLQDKVVYQTKDDRVPCTSFVSNTSEIFSFSQGCLPLSRWDELNVFFNKS  759
            F PLK+RLGGTLQDK++Y T+D R PC  F  N SE+F F+QGCLP +RWD+LN FF K 
Sbjct  91   FKPLKLRLGGTLQDKLIYDTEDHREPCIYFSRNASELFGFTQGCLPTNRWDQLNDFFKKG  150

Query  760  G*PTRFIPCPAYICQHs*lyvsslrvllrAVIIFGLNALTGRSIRSDASAVGAWDSTNAE  939
            G                            A IIFGLNAL GR I ++  ++GAW+ TNAE
Sbjct  151  G----------------------------AKIIFGLNALNGREIAANGCSIGAWNYTNAE  182

Query  940  SLMKYTVEKGYTIHGWELGK  999
             L++YTV+K YTIHGWELG 
Sbjct  183  MLIRYTVKKNYTIHGWELGN  202



>gb|EYU34948.1| hypothetical protein MIMGU_mgv1a004017mg [Erythranthe guttata]
Length=540

 Score =   248 bits (634),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 121/224 (54%), Positives = 157/224 (70%), Gaps = 30/224 (13%)
 Frame = +1

Query  334  LWILVLGVFNVSLISGSE-TLGDKGSVYVDGKSRIGRTDSDFICATLDWWPPEKCDYGTC  510
            +W LV  V   S I   + ++  +G+V +DG+S I  TD +F+CATLDWWP  KCDYG C
Sbjct  5    VWFLVFVVCGCSFICDVKGSVSVEGTVVIDGESPIAETDENFVCATLDWWPSAKCDYGNC  64

Query  511  AWGHASLLNLDLSNIIFLNAIKAFSPLKIRLGGTLQDKVVYQTKDDR-VPCTSFVSNTSE  687
            +WG+ASL NLDL N++FLNA+KAFSPLKIRLGGTLQDKV+YQT+D++  PCT FV N+S 
Sbjct  65   SWGNASLFNLDLKNVVFLNAVKAFSPLKIRLGGTLQDKVIYQTEDNKQQPCTPFVQNSSR  124

Query  688  IFSFSQGCLPLSRWDELNVFFNKSG*PTRFIPCPAYICQHs*lyvsslrvllrAVIIFGL  867
            +F F++ CLPL+RWDELN FFN+SG                            A++IFGL
Sbjct  125  LFGFTEACLPLARWDELNSFFNQSG----------------------------ALVIFGL  156

Query  868  NALTGRSIRSDASAVGAWDSTNAESLMKYTVEKGYTIHGWELGK  999
            NAL G+SI+++  A G WDSTNA SL++YT++KGY I+GWELG 
Sbjct  157  NALHGKSIQANNVATGPWDSTNAASLIRYTIKKGYNIYGWELGN  200



>gb|KDO61807.1| hypothetical protein CISIN_1g037212mg [Citrus sinensis]
Length=551

 Score =   248 bits (633),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 118/199 (59%), Positives = 142/199 (71%), Gaps = 28/199 (14%)
 Frame = +1

Query  400  KGSVYVDGKSRIGRTDSDFICATLDWWPPEKCDYGTCAWGHASLLNLDLSNIIFLNAIKA  579
            +G+V+++G   I +TD +FICATLDWWPP+KCDYGTC+WG ASLLNLDL N I L A+KA
Sbjct  37   EGTVFINGTVAIAKTDDNFICATLDWWPPDKCDYGTCSWGRASLLNLDLGNPILLKAVKA  96

Query  580  FSPLKIRLGGTLQDKVVYQTKDDRVPCTSFVSNTSEIFSFSQGCLPLSRWDELNVFFNKS  759
            FSPLKIR+GGTLQDK VY++K    PCT FV N SE+F FS+GCL + RWDELN+FF ++
Sbjct  97   FSPLKIRMGGTLQDKAVYESKGIDEPCTPFVKNNSELFGFSEGCLTMRRWDELNIFFRRA  156

Query  760  G*PTRFIPCPAYICQHs*lyvsslrvllrAVIIFGLNALTGRSIRSDASAVGAWDSTNAE  939
            G                            AV+ FGLNAL GR I+SD SA GAWDS+NAE
Sbjct  157  G----------------------------AVVTFGLNALRGRIIQSDGSARGAWDSSNAE  188

Query  940  SLMKYTVEKGYTIHGWELG  996
            SLM+YTV KGY I+GWELG
Sbjct  189  SLMRYTVNKGYKIYGWELG  207



>ref|XP_009355782.1| PREDICTED: heparanase-like protein 3 [Pyrus x bretschneideri]
Length=533

 Score =   248 bits (632),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 122/204 (60%), Positives = 146/204 (72%), Gaps = 28/204 (14%)
 Frame = +1

Query  388  TLGDKGSVYVDGKSRIGRTDSDFICATLDWWPPEKCDYGTCAWGHASLLNLDLSNIIFLN  567
            +L  + +++V+  + IG TD DFICAT+DWWPP+KCDYGTC+WG ASLLNLDL N IFLN
Sbjct  33   SLSTEETLFVNKTAAIGATDDDFICATIDWWPPQKCDYGTCSWGSASLLNLDLDNAIFLN  92

Query  568  AIKAFSPLKIRLGGTLQDKVVYQTKDDRVPCTSFVSNTSEIFSFSQGCLPLSRWDELNVF  747
            AIKAFSPLKIRLGGTLQDKV Y T   + P TSFV + S++F FSQG LP+ RWD+LN F
Sbjct  93   AIKAFSPLKIRLGGTLQDKVTYLTDGSQPPSTSFVKDGSQLFGFSQGYLPMPRWDQLNSF  152

Query  748  FNKSG*PTRFIPCPAYICQHs*lyvsslrvllrAVIIFGLNALTGRSIRSDASAVGAWDS  927
            FNK+                            RA+IIFGLNAL GR+I S+ +A GAW+S
Sbjct  153  FNKT----------------------------RAIIIFGLNALIGRNIDSNGAATGAWNS  184

Query  928  TNAESLMKYTVEKGYTIHGWELGK  999
            TNAESL++YTV KGYTIHGWELG 
Sbjct  185  TNAESLIRYTVNKGYTIHGWELGN  208



>ref|XP_009358543.1| PREDICTED: heparanase-like protein 3 [Pyrus x bretschneideri]
Length=542

 Score =   248 bits (632),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 116/199 (58%), Positives = 142/199 (71%), Gaps = 28/199 (14%)
 Frame = +1

Query  400  KGSVYVDGKSRIGRTDSDFICATLDWWPPEKCDYGTCAWGHASLLNLDLSNIIFLNAIKA  579
            +G+V ++G+  IG+ D DFICATLDWWPPEKCDYGTC+WG ASLLNLDL N I LNAIKA
Sbjct  35   EGTVRINGRDAIGKIDDDFICATLDWWPPEKCDYGTCSWGRASLLNLDLKNTILLNAIKA  94

Query  580  FSPLKIRLGGTLQDKVVYQTKDDRVPCTSFVSNTSEIFSFSQGCLPLSRWDELNVFFNKS  759
            FSPLK+RLGGTLQDKV+Y T D++  C +F  +TSE+F F+QGCLP+ RWDEL+ FF K+
Sbjct  95   FSPLKLRLGGTLQDKVIYATPDNKQSCNAFRKSTSEMFGFTQGCLPMRRWDELSSFFQKA  154

Query  760  G*PTRFIPCPAYICQHs*lyvsslrvllrAVIIFGLNALTGRSIRSDASAVGAWDSTNAE  939
            G                            A IIFGLNALTGR+I S+ +A GAWD TN+E
Sbjct  155  G----------------------------AKIIFGLNALTGRTINSNGTATGAWDYTNSE  186

Query  940  SLMKYTVEKGYTIHGWELG  996
            S ++Y V+  YT+HGWELG
Sbjct  187  SFIRYNVKNNYTVHGWELG  205



>ref|XP_008394121.1| PREDICTED: heparanase-like protein 3 isoform X2 [Malus domestica]
Length=533

 Score =   248 bits (632),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 120/204 (59%), Positives = 146/204 (72%), Gaps = 28/204 (14%)
 Frame = +1

Query  388  TLGDKGSVYVDGKSRIGRTDSDFICATLDWWPPEKCDYGTCAWGHASLLNLDLSNIIFLN  567
            +L  + +++V+  + IG TD DFICAT+DWWPP+KCDYGTC+WG ASLLNLDL N IFLN
Sbjct  33   SLSTEETLFVNKTAAIGATDDDFICATIDWWPPQKCDYGTCSWGSASLLNLDLDNAIFLN  92

Query  568  AIKAFSPLKIRLGGTLQDKVVYQTKDDRVPCTSFVSNTSEIFSFSQGCLPLSRWDELNVF  747
            AIKAF+PLKIRLGGTLQDKV Y     + P TSFV + S++F FSQG LP+ RWD+LN F
Sbjct  93   AIKAFAPLKIRLGGTLQDKVTYLADGSQPPSTSFVKDGSQLFGFSQGYLPMPRWDQLNSF  152

Query  748  FNKSG*PTRFIPCPAYICQHs*lyvsslrvllrAVIIFGLNALTGRSIRSDASAVGAWDS  927
            FNK+G                            AVIIFGLNAL GR+I S+ +A GAW+S
Sbjct  153  FNKTG----------------------------AVIIFGLNALIGRNIDSNGAATGAWNS  184

Query  928  TNAESLMKYTVEKGYTIHGWELGK  999
            TNAE+L++YTV+KGYTIHGWELG 
Sbjct  185  TNAETLIRYTVDKGYTIHGWELGN  208



>gb|KHG18266.1| hypothetical protein F383_21213 [Gossypium arboreum]
Length=519

 Score =   247 bits (630),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 126/199 (63%), Positives = 150/199 (75%), Gaps = 28/199 (14%)
 Frame = +1

Query  400  KGSVYVDGKSRIGRTDSDFICATLDWWPPEKCDYGTCAWGHASLLNLDLSNIIFLNAIKA  579
            +G+V++DGK+ IGR D DFICATLDWWPPEKCDYGTC+WG A LLNLDL+  +FLNA+KA
Sbjct  7    EGTVFIDGKAPIGRIDDDFICATLDWWPPEKCDYGTCSWGLAGLLNLDLNKNLFLNAVKA  66

Query  580  FSPLKIRLGGTLQDKVVYQTKDDRVPCTSFVSNTSEIFSFSQGCLPLSRWDELNVFFNKS  759
            FSPLKIRLGGTLQDKV+Y T D+++PCTSFV NTSE+F F+QGCLP++RWD+LN FF K+
Sbjct  67   FSPLKIRLGGTLQDKVIYDTDDNQLPCTSFVKNTSEMFGFTQGCLPMNRWDDLNSFFQKA  126

Query  760  G*PTRFIPCPAYICQHs*lyvsslrvllrAVIIFGLNALTGRSIRSDASAVGAWDSTNAE  939
            G                            A +IFGLNAL GR+I  D SAVGAW+ TNAE
Sbjct  127  G----------------------------ARVIFGLNALAGRTIAPDGSAVGAWNYTNAE  158

Query  940  SLMKYTVEKGYTIHGWELG  996
            S M+YTV+K YTIHGWELG
Sbjct  159  SFMQYTVDKNYTIHGWELG  177



>gb|KCW83013.1| hypothetical protein EUGRSUZ_C04395 [Eucalyptus grandis]
Length=461

 Score =   245 bits (626),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 128/229 (56%), Positives = 149/229 (65%), Gaps = 32/229 (14%)
 Frame = +1

Query  319  FLQMRLWILVLGVFNVSLISGSETLGDKGSVYVD---GKSRIGRTDSDFICATLDWWPPE  489
            FL +  W+ +      S  S   + G++G+V V    GKS I   D DF+CATLDWWPPE
Sbjct  7    FLGLCFWVCMFCCGAASADSRGSS-GEEGTVQVTVSVGKSAIAEIDDDFVCATLDWWPPE  65

Query  490  KCDYGTCAWGHASLLNLDLSNIIFLNAIKAFSPLKIRLGGTLQDKVVYQTKDDRVPCTSF  669
            KCDYG C+W  ASLLNLDLSN I LNA+KAFSPLKIRLGGTLQDKV+Y T D + PCTSF
Sbjct  66   KCDYGVCSWHRASLLNLDLSNKILLNAVKAFSPLKIRLGGTLQDKVLYNTPDLKQPCTSF  125

Query  670  VSNTSEIFSFSQGCLPLSRWDELNVFFNKSG*PTRFIPCPAYICQHs*lyvsslrvllrA  849
            V N+S +F F+QGCLP++RWD LN FF +SG                            A
Sbjct  126  VKNSSALFGFTQGCLPMARWDRLNAFFKESG----------------------------A  157

Query  850  VIIFGLNALTGRSIRSDASAVGAWDSTNAESLMKYTVEKGYTIHGWELG  996
             IIFGLNAL GR+I     AVGAWDSTNAES ++YTV K YTI GWELG
Sbjct  158  KIIFGLNALNGRTISPQGPAVGAWDSTNAESFIRYTVSKNYTIFGWELG  206



>ref|XP_003533856.1| PREDICTED: heparanase-like protein 3-like [Glycine max]
 gb|KHN48130.1| Heparanase-like protein 3 [Glycine soja]
Length=538

 Score =   247 bits (631),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 120/199 (60%), Positives = 142/199 (71%), Gaps = 29/199 (15%)
 Frame = +1

Query  400  KGSVYVDGKSRIGRTDSDFICATLDWWPPEKCDYGTCAWGHASLLNLDLSNIIFLNAIKA  579
            +GSV +DGK+ IG  D DF+CATLDWWPPEKCDYG C+WG ASLLNLDL+N IFLNA+KA
Sbjct  36   QGSVAIDGKAVIGTIDEDFVCATLDWWPPEKCDYGRCSWGLASLLNLDLNNKIFLNAVKA  95

Query  580  FSPLKIRLGGTLQDKVVYQTKDDRVPCTSFVSNTSEIFSFSQGCLPLSRWDELNVFFNKS  759
            FSPLK+RLGG+LQDK++Y T+D+  PCT FV N SE+FSF+QGCLP+ RWDELN FF K+
Sbjct  96   FSPLKLRLGGSLQDKLIYGTEDNHQPCTPFVKNPSEMFSFTQGCLPMDRWDELNYFFEKA  155

Query  760  G*PTRFIPCPAYICQHs*lyvsslrvllrAVIIFGLNALTGRSIRSDASAVGAWDSTNAE  939
            G                            A IIFGLNAL G+SI    SA G W+ TNAE
Sbjct  156  G----------------------------AKIIFGLNALAGKSIHG-GSAKGPWNYTNAE  186

Query  940  SLMKYTVEKGYTIHGWELG  996
            S ++YTV  GYTI+GWELG
Sbjct  187  SFIRYTVRNGYTIYGWELG  205



>ref|XP_006483406.1| PREDICTED: heparanase-like protein 3-like isoform X1 [Citrus 
sinensis]
Length=561

 Score =   248 bits (633),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 118/199 (59%), Positives = 142/199 (71%), Gaps = 28/199 (14%)
 Frame = +1

Query  400  KGSVYVDGKSRIGRTDSDFICATLDWWPPEKCDYGTCAWGHASLLNLDLSNIIFLNAIKA  579
            +G+V+++G   I +TD +FICATLDWWPP+KCDYGTC+WG ASLLNLDL N I L A+KA
Sbjct  47   EGTVFINGTVAIAKTDDNFICATLDWWPPDKCDYGTCSWGRASLLNLDLGNPILLKAVKA  106

Query  580  FSPLKIRLGGTLQDKVVYQTKDDRVPCTSFVSNTSEIFSFSQGCLPLSRWDELNVFFNKS  759
            FSPLKIR+GGTLQDK VY++K    PCT FV N SE+F FS+GCL + RWDELN+FF ++
Sbjct  107  FSPLKIRMGGTLQDKAVYESKGIDEPCTPFVKNNSELFGFSEGCLTMRRWDELNIFFRRA  166

Query  760  G*PTRFIPCPAYICQHs*lyvsslrvllrAVIIFGLNALTGRSIRSDASAVGAWDSTNAE  939
            G                            AV+ FGLNAL GR I+SD SA GAWDS+NAE
Sbjct  167  G----------------------------AVVTFGLNALRGRIIQSDGSARGAWDSSNAE  198

Query  940  SLMKYTVEKGYTIHGWELG  996
            SLM+YTV KGY I+GWELG
Sbjct  199  SLMRYTVNKGYKIYGWELG  217



>ref|XP_008336960.1| PREDICTED: heparanase-like protein 3 [Malus domestica]
Length=542

 Score =   248 bits (632),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 116/199 (58%), Positives = 142/199 (71%), Gaps = 28/199 (14%)
 Frame = +1

Query  400  KGSVYVDGKSRIGRTDSDFICATLDWWPPEKCDYGTCAWGHASLLNLDLSNIIFLNAIKA  579
            +G+V ++G+  IG+ D DFICATLDWWPPEKCDYGTC+WG ASLLNLDL N I LNAIKA
Sbjct  35   EGTVRINGRDAIGKIDDDFICATLDWWPPEKCDYGTCSWGRASLLNLDLKNTILLNAIKA  94

Query  580  FSPLKIRLGGTLQDKVVYQTKDDRVPCTSFVSNTSEIFSFSQGCLPLSRWDELNVFFNKS  759
            FSPLK+RLGGTLQDKV+Y T D++  C +F  +TSE+F F+QGCLP+ RWDEL+ FF K+
Sbjct  95   FSPLKLRLGGTLQDKVIYATPDNKQSCNAFRKSTSEMFGFTQGCLPMRRWDELSSFFQKA  154

Query  760  G*PTRFIPCPAYICQHs*lyvsslrvllrAVIIFGLNALTGRSIRSDASAVGAWDSTNAE  939
            G                            A IIFGLNALTGR+I S+ +A GAWD TN+E
Sbjct  155  G----------------------------AKIIFGLNALTGRTINSNGTATGAWDYTNSE  186

Query  940  SLMKYTVEKGYTIHGWELG  996
            S ++Y V+  YT+HGWELG
Sbjct  187  SFIRYNVKNNYTVHGWELG  205



>ref|XP_004508419.1| PREDICTED: heparanase-like protein 3-like [Cicer arietinum]
Length=527

 Score =   247 bits (630),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 122/226 (54%), Positives = 153/226 (68%), Gaps = 34/226 (15%)
 Frame = +1

Query  334  LWILVLGVFN-VSLISGSETLGD----KGSVYVDGKSRIGRTDSDFICATLDWWPPEKCD  498
            LW+ ++  F+ +  ++GS    D    KG V + GKS IG+ D+DF+CAT+DWWPP+KCD
Sbjct  12   LWMYLISCFSFIGGVNGSRNESDSSAVKGVVVIHGKSSIGKIDNDFVCATIDWWPPQKCD  71

Query  499  YGTCAWGHASLLNLDLSNIIFLNAIKAFSPLKIRLGGTLQDKVVYQTKDDRVPCTSFVSN  678
            YG C+WGHASLLNLDL+N I LNAI+AFSPLKIRLGGTLQDKV+Y+TK++R  CT FV N
Sbjct  72   YGKCSWGHASLLNLDLNNKILLNAIRAFSPLKIRLGGTLQDKVIYETKENRQTCTPFVLN  131

Query  679  TSEIFSFSQGCLPLSRWDELNVFFNKSG*PTRFIPCPAYICQHs*lyvsslrvllrAVII  858
            +  +F FS GCLP+ RWDELN FF K+G                              +I
Sbjct  132  SKVMFGFSHGCLPMKRWDELNSFFQKAG----------------------------VNVI  163

Query  859  FGLNALTGRSIRSDASAVGAWDSTNAESLMKYTVEKGYTIHGWELG  996
            FGLNALTGRS +   +AVG W+  NAES ++YTV + YTIHGWELG
Sbjct  164  FGLNALTGRSFKY-GTAVGPWNYANAESFIRYTVRRNYTIHGWELG  208



>ref|XP_004139281.1| PREDICTED: heparanase-like protein 3 [Cucumis sativus]
Length=539

 Score =   247 bits (630),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 118/199 (59%), Positives = 138/199 (69%), Gaps = 28/199 (14%)
 Frame = +1

Query  400  KGSVYVDGKSRIGRTDSDFICATLDWWPPEKCDYGTCAWGHASLLNLDLSNIIFLNAIKA  579
            +G V +DGKS IGR D DF+CATLDWWPPEKCDYGTC+WG ASLLNLDL N I LNA+K 
Sbjct  31   RGRVLIDGKSAIGRIDEDFVCATLDWWPPEKCDYGTCSWGQASLLNLDLGNNILLNAVKE  90

Query  580  FSPLKIRLGGTLQDKVVYQTKDDRVPCTSFVSNTSEIFSFSQGCLPLSRWDELNVFFNKS  759
            F PLK+RLGGTLQDK++Y T+D + PC     NTSE+F FSQGCLP +RWD+LN FF K 
Sbjct  91   FKPLKLRLGGTLQDKIIYDTEDHQEPCIYLSKNTSELFGFSQGCLPTNRWDQLNDFFKKG  150

Query  760  G*PTRFIPCPAYICQHs*lyvsslrvllrAVIIFGLNALTGRSIRSDASAVGAWDSTNAE  939
            G                            A IIFGLNAL GR I ++  +VGAW+ TNAE
Sbjct  151  G----------------------------AKIIFGLNALNGRQIAANGCSVGAWNYTNAE  182

Query  940  SLMKYTVEKGYTIHGWELG  996
             L++YTV+K YTIHGWELG
Sbjct  183  MLIRYTVKKNYTIHGWELG  201



>ref|NP_001241969.1| uncharacterized protein LOC100792087 precursor [Glycine max]
 gb|ACU20377.1| unknown [Glycine max]
Length=525

 Score =   246 bits (629),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 124/221 (56%), Positives = 149/221 (67%), Gaps = 29/221 (13%)
 Frame = +1

Query  334  LWILVLGVFNVSLISGSETLGDKGSVYVDGKSRIGRTDSDFICATLDWWPPEKCDYGTCA  513
            +++  L    V  + G E    +G V V GK+ IGR D D ICATLDWWP +KCDYG C+
Sbjct  14   MYLACLSFIGVGAVYGREGEVLEGIVLVHGKTAIGRIDDDSICATLDWWPSQKCDYGKCS  73

Query  514  WGHASLLNLDLSNIIFLNAIKAFSPLKIRLGGTLQDKVVYQTKDDRVPCTSFVSNTSEIF  693
            WGHASLLNLDL+N I LNA+KAFSPLKIRLGGTL+DKV+Y T+D R PCT FV N +E+F
Sbjct  74   WGHASLLNLDLNNKILLNAVKAFSPLKIRLGGTLRDKVIYGTEDCRQPCTPFVLNANEMF  133

Query  694  SFSQGCLPLSRWDELNVFFNKSG*PTRFIPCPAYICQHs*lyvsslrvllrAVIIFGLNA  873
             F+QGCLP+ RWDELN FF K+G                              ++FGLNA
Sbjct  134  GFTQGCLPMYRWDELNSFFQKAG----------------------------VKVVFGLNA  165

Query  874  LTGRSIRSDASAVGAWDSTNAESLMKYTVEKGYTIHGWELG  996
            L G+SI+S  SAVG W+ TNAESL++YTV K YTIHGWELG
Sbjct  166  LAGKSIKS-GSAVGPWNYTNAESLIRYTVRKKYTIHGWELG  205



>ref|XP_006450373.1| hypothetical protein CICLE_v10010401mg [Citrus clementina]
 gb|ESR63613.1| hypothetical protein CICLE_v10010401mg [Citrus clementina]
Length=551

 Score =   247 bits (631),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 118/199 (59%), Positives = 142/199 (71%), Gaps = 28/199 (14%)
 Frame = +1

Query  400  KGSVYVDGKSRIGRTDSDFICATLDWWPPEKCDYGTCAWGHASLLNLDLSNIIFLNAIKA  579
            +G+V+++G   I +TD +FICATLDWWPP+KCDYGTC+WG ASLLNLDL N I L A+KA
Sbjct  37   EGTVFINGTVAIAKTDDNFICATLDWWPPDKCDYGTCSWGRASLLNLDLGNPILLKAVKA  96

Query  580  FSPLKIRLGGTLQDKVVYQTKDDRVPCTSFVSNTSEIFSFSQGCLPLSRWDELNVFFNKS  759
            FSPLKIR+GGTLQDK VY++K    PCT FV N SE+F FS+GCL + RWDELN+FF ++
Sbjct  97   FSPLKIRMGGTLQDKAVYESKGIDEPCTPFVKNNSELFGFSEGCLTMRRWDELNIFFRRA  156

Query  760  G*PTRFIPCPAYICQHs*lyvsslrvllrAVIIFGLNALTGRSIRSDASAVGAWDSTNAE  939
            G                            AV+ FGLNAL GR I+SD SA GAWDS+NAE
Sbjct  157  G----------------------------AVVTFGLNALRGRIIQSDGSARGAWDSSNAE  188

Query  940  SLMKYTVEKGYTIHGWELG  996
            SLM+YTV KGY I+GWELG
Sbjct  189  SLMRYTVNKGYKIYGWELG  207



>ref|XP_010050122.1| PREDICTED: heparanase-like protein 3 [Eucalyptus grandis]
 gb|KCW83012.1| hypothetical protein EUGRSUZ_C04395 [Eucalyptus grandis]
Length=542

 Score =   246 bits (628),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 128/230 (56%), Positives = 149/230 (65%), Gaps = 32/230 (14%)
 Frame = +1

Query  319  FLQMRLWILVLGVFNVSLISGSETLGDKGSVYVD---GKSRIGRTDSDFICATLDWWPPE  489
            FL +  W+ +      S  S   + G++G+V V    GKS I   D DF+CATLDWWPPE
Sbjct  7    FLGLCFWVCMFCCGAASADSRGSS-GEEGTVQVTVSVGKSAIAEIDDDFVCATLDWWPPE  65

Query  490  KCDYGTCAWGHASLLNLDLSNIIFLNAIKAFSPLKIRLGGTLQDKVVYQTKDDRVPCTSF  669
            KCDYG C+W  ASLLNLDLSN I LNA+KAFSPLKIRLGGTLQDKV+Y T D + PCTSF
Sbjct  66   KCDYGVCSWHRASLLNLDLSNKILLNAVKAFSPLKIRLGGTLQDKVLYNTPDLKQPCTSF  125

Query  670  VSNTSEIFSFSQGCLPLSRWDELNVFFNKSG*PTRFIPCPAYICQHs*lyvsslrvllrA  849
            V N+S +F F+QGCLP++RWD LN FF +SG                            A
Sbjct  126  VKNSSALFGFTQGCLPMARWDRLNAFFKESG----------------------------A  157

Query  850  VIIFGLNALTGRSIRSDASAVGAWDSTNAESLMKYTVEKGYTIHGWELGK  999
             IIFGLNAL GR+I     AVGAWDSTNAES ++YTV K YTI GWELG 
Sbjct  158  KIIFGLNALNGRTISPQGPAVGAWDSTNAESFIRYTVSKNYTIFGWELGN  207



>ref|XP_002324878.2| hypothetical protein POPTR_0018s02050g [Populus trichocarpa]
 gb|EEF03443.2| hypothetical protein POPTR_0018s02050g [Populus trichocarpa]
Length=563

 Score =   247 bits (630),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 117/200 (59%), Positives = 146/200 (73%), Gaps = 30/200 (15%)
 Frame = +1

Query  400  KGSVYVDGKSRIGRTDSDFICATLDWWPPEKCDYGTCAWGHASLLNLDLSNIIFLNAIKA  579
            +G+V+++G + IG TD DFICATLDWWPP+KCDYGTC+WG AS LNLDL+N I LNAIKA
Sbjct  55   EGTVFINGTAPIGTTDHDFICATLDWWPPDKCDYGTCSWGKASFLNLDLTNPILLNAIKA  114

Query  580  FSPLKIRLGGTLQDKVVYQTKDDRVPCTSFVSNTSEIFSFSQGCLPLSRWDELNVFFNKS  759
            FSPLKIR+GGTLQDKV Y+   +  PC +FV ++ E+F FSQGCLP+SRWDELN FF ++
Sbjct  115  FSPLKIRMGGTLQDKVTYERLGE--PCPTFVKSSPEMFGFSQGCLPMSRWDELNNFFKQA  172

Query  760  G*PTRFIPCPAYICQHs*lyvsslrvllrAVIIFGLNALTGRSIRSDASAVGAWDSTNAE  939
            G                            AV++FGLNAL+GR+  +D SAVGAW+S++AE
Sbjct  173  G----------------------------AVVLFGLNALSGRTTAADGSAVGAWNSSDAE  204

Query  940  SLMKYTVEKGYTIHGWELGK  999
             LM+Y+V KGYTIHGWELG 
Sbjct  205  FLMRYSVNKGYTIHGWELGN  224



>emb|CBI21126.3| unnamed protein product [Vitis vinifera]
Length=887

 Score =   252 bits (644),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 119/201 (59%), Positives = 144/201 (72%), Gaps = 28/201 (14%)
 Frame = +1

Query  397  DKGSVYVDGKSRIGRTDSDFICATLDWWPPEKCDYGTCAWGHASLLNLDLSNIIFLNAIK  576
            ++G V+++G+  IG TD DF+CATLDWWPP+KCDYGTC+WG ASLLNLDL+N I  NAIK
Sbjct  20   EEGRVFINGRVAIGSTDDDFVCATLDWWPPDKCDYGTCSWGRASLLNLDLTNKILFNAIK  79

Query  577  AFSPLKIRLGGTLQDKVVYQTKDDRVPCTSFVSNTSEIFSFSQGCLPLSRWDELNVFFNK  756
            AFS LKIR+GGTLQDKV+YQ   D+ PC  FV N+SE+F FS+GCLP+SRWDELN FF  
Sbjct  80   AFSSLKIRMGGTLQDKVIYQRTGDQQPCAQFVKNSSEMFGFSEGCLPMSRWDELNQFFRD  139

Query  757  SG*PTRFIPCPAYICQHs*lyvsslrvllrAVIIFGLNALTGRSIRSDASAVGAWDSTNA  936
            +G                            AV+IFGLNAL+GRSI  D  A GAW+ ++A
Sbjct  140  AG----------------------------AVVIFGLNALSGRSIGMDGLATGAWNGSDA  171

Query  937  ESLMKYTVEKGYTIHGWELGK  999
            ESL++YTV KGYTIHGWELG 
Sbjct  172  ESLIQYTVNKGYTIHGWELGN  192


 Score =   120 bits (302),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 52/69 (75%), Positives = 62/69 (90%), Gaps = 0/69 (0%)
 Frame = +1

Query  397  DKGSVYVDGKSRIGRTDSDFICATLDWWPPEKCDYGTCAWGHASLLNLDLSNIIFLNAIK  576
            ++GSV+++G+  IG TD DFICATLDWWPP+KCDYGTC+WG ASLLNLDLSN I LNAIK
Sbjct  444  EEGSVFINGRVAIGSTDDDFICATLDWWPPDKCDYGTCSWGRASLLNLDLSNKILLNAIK  503

Query  577  AFSPLKIRL  603
            AFSPLK+R+
Sbjct  504  AFSPLKVRM  512


 Score = 77.0 bits (188),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 34/51 (67%), Positives = 43/51 (84%), Gaps = 0/51 (0%)
 Frame = +1

Query  847  AVIIFGLNALTGRSIRSDASAVGAWDSTNAESLMKYTVEKGYTIHGWELGK  999
            AV+IFGLNAL+GR+I  D  A GAW+S++AESL++Y+  KGYTIHGWELG 
Sbjct  521  AVVIFGLNALSGRTIGLDGLAAGAWNSSDAESLIRYSANKGYTIHGWELGN  571



>ref|NP_851093.1| glucuronidase 3 [Arabidopsis thaliana]
 sp|Q9FZP1.2|HPSE3_ARATH RecName: Full=Heparanase-like protein 3; Flags: Precursor [Arabidopsis 
thaliana]
 dbj|BAF01139.1| hypothetical protein [Arabidopsis thaliana]
 gb|AED93923.1| glucuronidase 3 [Arabidopsis thaliana]
Length=536

 Score =   245 bits (626),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 115/227 (51%), Positives = 151/227 (67%), Gaps = 28/227 (12%)
 Frame = +1

Query  319  FLQMRLWILVLGVFNVSLISGSETLGDKGSVYVDGKSRIGRTDSDFICATLDWWPPEKCD  498
            + Q+   +L L VF     + S  + + G+V+V G++ +G  D DFICATLDWWPPEKCD
Sbjct  3    YRQILAIVLFLCVFQFLDCTVSSAVEENGTVFVYGRAAVGTIDEDFICATLDWWPPEKCD  62

Query  499  YGTCAWGHASLLNLDLSNIIFLNAIKAFSPLKIRLGGTLQDKVVYQTKDDRVPCTSFVSN  678
            YG+C+W HAS+LNLDL+N+I  NAIKAF+PLKIR+GGTLQD V+Y+T D + PC  F  N
Sbjct  63   YGSCSWDHASILNLDLNNVILQNAIKAFAPLKIRIGGTLQDIVIYETPDSKQPCLPFTKN  122

Query  679  TSEIFSFSQGCLPLSRWDELNVFFNKSG*PTRFIPCPAYICQHs*lyvsslrvllrAVII  858
            +S +F ++QGCLP+ RWDELN FF K+G                              +I
Sbjct  123  SSILFGYTQGCLPMRRWDELNAFFRKTG----------------------------TKVI  154

Query  859  FGLNALTGRSIRSDASAVGAWDSTNAESLMKYTVEKGYTIHGWELGK  999
            FGLNAL+GRSI+S+  A+GAW+ TNAES +++T E  YTI GWELG 
Sbjct  155  FGLNALSGRSIKSNGEAIGAWNYTNAESFIRFTAENNYTIDGWELGN  201



>ref|XP_009792772.1| PREDICTED: heparanase-like protein 3 isoform X2 [Nicotiana sylvestris]
Length=546

 Score =   246 bits (627),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 116/200 (58%), Positives = 141/200 (71%), Gaps = 28/200 (14%)
 Frame = +1

Query  397  DKGSVYVDGKSRIGRTDSDFICATLDWWPPEKCDYGTCAWGHASLLNLDLSNIIFLNAIK  576
            +KGS+Y+DG + I + D DFICATLDWWP  KCDYGTC+WG++SLLNLDLSN + LNAI+
Sbjct  38   EKGSIYIDGSAAIAKIDEDFICATLDWWPSNKCDYGTCSWGNSSLLNLDLSNKVLLNAIR  97

Query  577  AFSPLKIRLGGTLQDKVVYQTKDDRVPCTSFVSNTSEIFSFSQGCLPLSRWDELNVFFNK  756
            AFSPLKIRLGGTLQDK+VYQT     PC+ F+ N  E+F F+QGCLPLSRWDELN FF K
Sbjct  98   AFSPLKIRLGGTLQDKIVYQTAHYEQPCSPFLLNNKELFGFTQGCLPLSRWDELNQFFKK  157

Query  757  SG*PTRFIPCPAYICQHs*lyvsslrvllrAVIIFGLNALTGRSIRSDASAVGAWDSTNA  936
            +G                            A + FGLNAL G++I  + SA+G WDS+NA
Sbjct  158  TG----------------------------AKVTFGLNALNGKTIAPNGSALGDWDSSNA  189

Query  937  ESLMKYTVEKGYTIHGWELG  996
            ES ++YTV +GYTI GWELG
Sbjct  190  ESFIRYTVSRGYTILGWELG  209



>ref|XP_007203617.1| hypothetical protein PRUPE_ppa003883mg [Prunus persica]
 gb|EMJ04816.1| hypothetical protein PRUPE_ppa003883mg [Prunus persica]
Length=542

 Score =   245 bits (626),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 120/232 (52%), Positives = 156/232 (67%), Gaps = 32/232 (14%)
 Frame = +1

Query  310  HSWFLQMRLWILVLGVFNVSLISGSETLGD---KGSVYVDGKSRIGRTDSDFICATLDWW  480
            H W + +  W+    +  +  ++ S+  G    +G+V+V+GK  IG+ D DFICATLDWW
Sbjct  4    HFWQMGLYFWVCFSAISFIHSVN-SQGFGGGSIEGTVHVNGKDAIGKIDDDFICATLDWW  62

Query  481  PPEKCDYGTCAWGHASLLNLDLSNIIFLNAIKAFSPLKIRLGGTLQDKVVYQTKDDRVPC  660
            PPEKCDYGTC+W  AS LNL+LS+II LNA+KAFSPLK+RLGGTLQDKV+Y T D++  C
Sbjct  63   PPEKCDYGTCSWVRASFLNLNLSSIILLNAVKAFSPLKLRLGGTLQDKVLYATPDNKQRC  122

Query  661  TSFVSNTSEIFSFSQGCLPLSRWDELNVFFNKSG*PTRFIPCPAYICQHs*lyvsslrvl  840
              F  +T+E+F F+ GCLP++RWDELN FF KSG                          
Sbjct  123  VPFQKSTTEMFGFTPGCLPMNRWDELNSFFQKSG--------------------------  156

Query  841  lrAVIIFGLNALTGRSIRSDASAVGAWDSTNAESLMKYTVEKGYTIHGWELG  996
              A IIFGLNALTGR+I S+ +A GAWD  N+ES ++Y+V+K YT+HGWELG
Sbjct  157  --AKIIFGLNALTGRTIHSNGTATGAWDYKNSESFIRYSVKKNYTVHGWELG  206



>ref|XP_009338385.1| PREDICTED: heparanase-like protein 3 [Pyrus x bretschneideri]
Length=542

 Score =   245 bits (626),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 115/199 (58%), Positives = 141/199 (71%), Gaps = 28/199 (14%)
 Frame = +1

Query  400  KGSVYVDGKSRIGRTDSDFICATLDWWPPEKCDYGTCAWGHASLLNLDLSNIIFLNAIKA  579
            +G+V ++G+  IG+ D DFICATLDWWPPEKCDYGTC+WG ASLLNLDL N I LNAIKA
Sbjct  35   EGTVRINGRDAIGKIDDDFICATLDWWPPEKCDYGTCSWGRASLLNLDLKNTILLNAIKA  94

Query  580  FSPLKIRLGGTLQDKVVYQTKDDRVPCTSFVSNTSEIFSFSQGCLPLSRWDELNVFFNKS  759
            FSPLK+RLGGTLQDKV+Y T D++  C +F  +TSE+F F+QGCLP+ RWDEL+ FF K+
Sbjct  95   FSPLKLRLGGTLQDKVIYATPDNKQSCNAFRKSTSEMFGFTQGCLPMRRWDELSSFFQKA  154

Query  760  G*PTRFIPCPAYICQHs*lyvsslrvllrAVIIFGLNALTGRSIRSDASAVGAWDSTNAE  939
            G                            A IIFGLNALTGR+I  + +A GAWD TN+E
Sbjct  155  G----------------------------AKIIFGLNALTGRTINLNGTATGAWDYTNSE  186

Query  940  SLMKYTVEKGYTIHGWELG  996
            S ++Y V+  YT+HGWELG
Sbjct  187  SFIRYNVKNNYTVHGWELG  205



>ref|XP_006338978.1| PREDICTED: heparanase-like protein 3-like [Solanum tuberosum]
Length=541

 Score =   244 bits (624),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 115/207 (56%), Positives = 144/207 (70%), Gaps = 29/207 (14%)
 Frame = +1

Query  379  GSETLGDKGSVYVDGKSRIGRTDSDFICATLDWWPPEKCDYGTCAWGHASLLNLDLSNII  558
              E + ++G +Y+DG S I + D DFICATLDWWPP KCDYGTC+WG+ASLLNLDLSN +
Sbjct  26   AEEDIVEEGILYIDGFSSIAKIDEDFICATLDWWPPSKCDYGTCSWGNASLLNLDLSNKV  85

Query  559  FLNAIKAFSPLKIRLGGTLQDKVVYQTKDDRVPCTSFVSNTSEIFSFSQGCLPLSRWDEL  738
            F NAI+AFSPL IRLGGTLQD+++YQTK D+ PCT F+ + +E+  F+QGCLP SRWDEL
Sbjct  86   FFNAIRAFSPLTIRLGGTLQDRLIYQTKHDKQPCTPFLHDDTELLKFTQGCLPFSRWDEL  145

Query  739  NVFFNKSG*PTRFIPCPAYICQHs*lyvsslrvllrAVIIFGLNALTGRSIRSDA-SAVG  915
            N FF ++G                            A + FGLN L G+ I SD  +A+G
Sbjct  146  NEFFKRTG----------------------------AKVTFGLNTLNGKKIASDGRTALG  177

Query  916  AWDSTNAESLMKYTVEKGYTIHGWELG  996
             WDS+NA SL++YTV +GYTIHGWELG
Sbjct  178  DWDSSNAASLIRYTVSRGYTIHGWELG  204



>ref|XP_010927353.1| PREDICTED: heparanase-like protein 3 isoform X1 [Elaeis guineensis]
Length=543

 Score =   244 bits (624),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 121/202 (60%), Positives = 139/202 (69%), Gaps = 29/202 (14%)
 Frame = +1

Query  394  GDKGSVYVDGKSRIGRTDSDFICATLDWWPPEKCDYGTCAWGHASLLNLDLSNIIFLNAI  573
            G +G+  VDG + I  TD DFICATLDWWPPEKCDYGTC+WG ASLLNLDLSN + LNA+
Sbjct  36   GSEGTAVVDGTTPIAVTDDDFICATLDWWPPEKCDYGTCSWGLASLLNLDLSNKVLLNAV  95

Query  574  KAFSPLKIRLGGTLQDKVVYQTKDDRVPCTSFVSNTSEIFSFSQGCLPLSRWDELNVFFN  753
            K FSPLK+RLGG+LQDKV+Y   D + PCT FV NTSE+F F+QGCLP+ RWDELN FF 
Sbjct  96   KEFSPLKLRLGGSLQDKVIYGV-DTQQPCTPFVKNTSEMFGFTQGCLPMQRWDELNDFFK  154

Query  754  KSG*PTRFIPCPAYICQHs*lyvsslrvllrAVIIFGLNALTGRSIRSDASAVGAWDSTN  933
            K+G                            AVIIFGLNAL GR    D S  G W+S+N
Sbjct  155  KAG----------------------------AVIIFGLNALNGRVRLRDGSLGGPWNSSN  186

Query  934  AESLMKYTVEKGYTIHGWELGK  999
            AES ++YTV KGYTIHGWELG 
Sbjct  187  AESFIRYTVNKGYTIHGWELGN  208



>ref|XP_003546578.1| PREDICTED: heparanase-like protein 3-like [Glycine max]
 gb|KHN37477.1| Heparanase-like protein 3 [Glycine soja]
Length=538

 Score =   244 bits (624),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 125/236 (53%), Positives = 156/236 (66%), Gaps = 33/236 (14%)
 Frame = +1

Query  292  QVPTMGHSWFLQMRLWILVLGVFNVSLISGSETLGDKGSVYVDGKSRIGRTDSDFICATL  471
            ++  +G   +L +  +  + G  N+  + G  TL  +G+V +D K  IG  D DF+CATL
Sbjct  4    RIRLLGICLWLHLTCFTFIFG--NIVSVRGDATL--QGTVAIDDKVVIGTIDDDFVCATL  59

Query  472  DWWPPEKCDYGTCAWGHASLLNLDLSNIIFLNAIKAFSPLKIRLGGTLQDKVVYQTKDDR  651
            DWWPPEKCDYG C+WG ASLLNLDL+N IFLNA+KAFSPLK+RLGG+LQDKV+Y T+D+ 
Sbjct  60   DWWPPEKCDYGRCSWGLASLLNLDLNNKIFLNAVKAFSPLKLRLGGSLQDKVIYGTEDNH  119

Query  652  VPCTSFVSNTSEIFSFSQGCLPLSRWDELNVFFNKSG*PTRFIPCPAYICQHs*lyvssl  831
             PCT FV N SE+F F+QGCLP+ RWDELN FF K+G                       
Sbjct  120  QPCTPFVKNPSEMFGFTQGCLPMDRWDELNYFFEKAG-----------------------  156

Query  832  rvllrAVIIFGLNALTGRSIRSDASAVGAWDSTNAESLMKYTVEKGYTIHGWELGK  999
                 A IIFGLNAL G+SI S  SA G W+ TNAES ++YTV  GY+I+GWELG 
Sbjct  157  -----AKIIFGLNALAGKSIHS-GSAKGPWNYTNAESFIRYTVGNGYSIYGWELGN  206



>ref|XP_004488517.1| PREDICTED: heparanase-like protein 3-like [Cicer arietinum]
Length=536

 Score =   244 bits (623),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 119/199 (60%), Positives = 139/199 (70%), Gaps = 29/199 (15%)
 Frame = +1

Query  400  KGSVYVDGKSRIGRTDSDFICATLDWWPPEKCDYGTCAWGHASLLNLDLSNIIFLNAIKA  579
            KGSV +DG S IG  D DF+CATLDWWPPEKCDYG C+WG ASLLNLDL+N IFLNA+KA
Sbjct  35   KGSVIIDGNSVIGNIDDDFVCATLDWWPPEKCDYGRCSWGLASLLNLDLNNKIFLNAVKA  94

Query  580  FSPLKIRLGGTLQDKVVYQTKDDRVPCTSFVSNTSEIFSFSQGCLPLSRWDELNVFFNKS  759
            FSPLK+RLGG+LQDKV+Y T+D   PCT F+   SE+F F+QGCLP+ RWDELN FF K+
Sbjct  95   FSPLKLRLGGSLQDKVIYGTEDYNQPCTPFIRKESEMFGFTQGCLPMPRWDELNDFFQKA  154

Query  760  G*PTRFIPCPAYICQHs*lyvsslrvllrAVIIFGLNALTGRSIRSDASAVGAWDSTNAE  939
            G                            A ++FGLNALTG+SI S  SA G W+ TNAE
Sbjct  155  G----------------------------AKVVFGLNALTGKSIHS-GSATGPWNYTNAE  185

Query  940  SLMKYTVEKGYTIHGWELG  996
            S ++YTV K Y IHGWELG
Sbjct  186  SFIQYTVGKNYAIHGWELG  204



>ref|XP_002533671.1| heparanase, putative [Ricinus communis]
 gb|EEF28717.1| heparanase, putative [Ricinus communis]
Length=551

 Score =   244 bits (622),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 126/199 (63%), Positives = 145/199 (73%), Gaps = 28/199 (14%)
 Frame = +1

Query  400  KGSVYVDGKSRIGRTDSDFICATLDWWPPEKCDYGTCAWGHASLLNLDLSNIIFLNAIKA  579
            +G+V++DGKS IG+ D DFICATLDWWPPEKCDYGTC+W HASL+NLDL+N I LNA+KA
Sbjct  38   QGTVFIDGKSFIGKIDEDFICATLDWWPPEKCDYGTCSWDHASLINLDLNNNILLNAVKA  97

Query  580  FSPLKIRLGGTLQDKVVYQTKDDRVPCTSFVSNTSEIFSFSQGCLPLSRWDELNVFFNKS  759
            FSPLKIRLGGTLQDKV+Y T D+  PC  FV NT+E+F F+QGCLP+ RWDELN FF KS
Sbjct  98   FSPLKIRLGGTLQDKVIYDTDDNHEPCKQFVRNTTEMFGFTQGCLPMYRWDELNAFFKKS  157

Query  760  G*PTRFIPCPAYICQHs*lyvsslrvllrAVIIFGLNALTGRSIRSDASAVGAWDSTNAE  939
            G                            A IIFGLNALTGRSI+SD SA GAW+  NA+
Sbjct  158  G----------------------------AKIIFGLNALTGRSIQSDGSAAGAWNYANAQ  189

Query  940  SLMKYTVEKGYTIHGWELG  996
            S + YTV K YTIHGWELG
Sbjct  190  SFISYTVNKNYTIHGWELG  208



>emb|CDY12398.1| BnaC08g08070D [Brassica napus]
Length=536

 Score =   243 bits (621),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 116/226 (51%), Positives = 152/226 (67%), Gaps = 29/226 (13%)
 Frame = +1

Query  325  QMRLWILVLGVFNV-SLISGSETLGDKGSVYVDGKSRIGRTDSDFICATLDWWPPEKCDY  501
            Q+ + +L L VF        S  + +KG+V+V G++ +G  D DFICATLDWWPP+KCDY
Sbjct  5    QLSMIVLFLWVFQFPDKTVVSSAVEEKGTVFVYGRAAVGTVDEDFICATLDWWPPQKCDY  64

Query  502  GTCAWGHASLLNLDLSNIIFLNAIKAFSPLKIRLGGTLQDKVVYQTKDDRVPCTSFVSNT  681
            GTCAW HAS+LNLDL+N IF NAI+ F+PLKIR+GGTLQD V+Y+T D + PC  F  NT
Sbjct  65   GTCAWDHASILNLDLNNTIFQNAIREFAPLKIRIGGTLQDLVIYETPDQKQPCLPFTQNT  124

Query  682  SEIFSFSQGCLPLSRWDELNVFFNKSG*PTRFIPCPAYICQHs*lyvsslrvllrAVIIF  861
            S +F ++QGCLP+ RW++LN FF+K+G                            A +IF
Sbjct  125  SLLFGYTQGCLPMRRWNQLNDFFSKTG----------------------------AKVIF  156

Query  862  GLNALTGRSIRSDASAVGAWDSTNAESLMKYTVEKGYTIHGWELGK  999
            GLNAL+GRSI+S+  AVGAWD TNAES ++Y V+  +T+ GWELG 
Sbjct  157  GLNALSGRSIQSNGEAVGAWDYTNAESFIRYIVQNNHTVDGWELGN  202



>emb|CDY47561.1| BnaA08g07260D [Brassica napus]
Length=536

 Score =   243 bits (621),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 116/226 (51%), Positives = 153/226 (68%), Gaps = 29/226 (13%)
 Frame = +1

Query  325  QMRLWILVLGVFNVS-LISGSETLGDKGSVYVDGKSRIGRTDSDFICATLDWWPPEKCDY  501
            Q+ + +L L VF  +     S  + +KG+V+V G++ +G  D DFICATLDWWPP+KCDY
Sbjct  5    QISVIVLFLWVFQFADKTVVSSAVEEKGTVFVYGRAAVGTVDEDFICATLDWWPPQKCDY  64

Query  502  GTCAWGHASLLNLDLSNIIFLNAIKAFSPLKIRLGGTLQDKVVYQTKDDRVPCTSFVSNT  681
            GTCAW HAS+LNLDL+N IF NAI+ F+PLKIR+GGTLQD V+Y+T D + PC  F  NT
Sbjct  65   GTCAWDHASILNLDLNNTIFQNAIREFAPLKIRIGGTLQDLVIYETPDQKQPCLPFTQNT  124

Query  682  SEIFSFSQGCLPLSRWDELNVFFNKSG*PTRFIPCPAYICQHs*lyvsslrvllrAVIIF  861
            S +F ++QGCLP+ RW++LN FF+K+G                            A +IF
Sbjct  125  SLLFGYTQGCLPMRRWNQLNDFFSKTG----------------------------AKVIF  156

Query  862  GLNALTGRSIRSDASAVGAWDSTNAESLMKYTVEKGYTIHGWELGK  999
            GLNAL+GRSI+S+  AVGAWD TNAES ++Y V+  +T+ GWELG 
Sbjct  157  GLNALSGRSIQSNGEAVGAWDYTNAESFIQYIVQNNHTVDGWELGN  202



>ref|XP_004249602.1| PREDICTED: heparanase-like protein 3 [Solanum lycopersicum]
Length=542

 Score =   243 bits (621),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 117/210 (56%), Positives = 145/210 (69%), Gaps = 29/210 (14%)
 Frame = +1

Query  373  ISGSETLGDKGSVYVDGKSRIGRTDSDFICATLDWWPPEKCDYGTCAWGHASLLNLDLSN  552
            IS +  + ++G +Y+DG S I + D DFICATLDWWPP KCDYGTC+WG+ASLLNLDLSN
Sbjct  25   ISRAGDIVEEGILYIDGVSSIAKIDKDFICATLDWWPPTKCDYGTCSWGNASLLNLDLSN  84

Query  553  IIFLNAIKAFSPLKIRLGGTLQDKVVYQTKDDRVPCTSFVSNTSEIFSFSQGCLPLSRWD  732
             + +NAI+AFSPL IRLGGTLQDK++YQT  D+ PC  F  + +E+F F+QGCLPLSRWD
Sbjct  85   KVLVNAIRAFSPLTIRLGGTLQDKLIYQTMHDKQPCLPFFHDDTELFKFTQGCLPLSRWD  144

Query  733  ELNVFFNKSG*PTRFIPCPAYICQHs*lyvsslrvllrAVIIFGLNALTGRSIRSDA-SA  909
            ELN FF K+G                            A + FGLN L G+ I SD  +A
Sbjct  145  ELNEFFKKTG----------------------------AKVTFGLNTLNGKKIASDGRTA  176

Query  910  VGAWDSTNAESLMKYTVEKGYTIHGWELGK  999
            +G WDS+NAESL++YTV +GY IHGWELG 
Sbjct  177  LGDWDSSNAESLIRYTVSRGYNIHGWELGN  206



>ref|XP_012081145.1| PREDICTED: heparanase-like protein 3 isoform X1 [Jatropha curcas]
 gb|KDP30214.1| hypothetical protein JCGZ_16996 [Jatropha curcas]
Length=555

 Score =   243 bits (621),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 132/236 (56%), Positives = 164/236 (69%), Gaps = 39/236 (17%)
 Frame = +1

Query  322  LQMRLWI----LVLGVFNVS---LISGSETLGD----KGSVYVDGKSRIGRTDSDFICAT  468
            +  ++W+     V+ +F+ S   +IS +   GD    +G+V+++G++ IG+ D DFICAT
Sbjct  1    MGFQIWLKGLCFVVSLFSYSFVFVISQTVVAGDGSVVEGTVFINGRTSIGKIDEDFICAT  60

Query  469  LDWWPPEKCDYGTCAWGHASLLNLDLSNIIFLNAIKAFSPLKIRLGGTLQDKVVYQTKDD  648
            LDWWPPEKCDYGTC+W HASL+NLDL+N I LNAIKAFSPLKIRLGGTLQDKV+Y T+D+
Sbjct  61   LDWWPPEKCDYGTCSWDHASLINLDLNNNILLNAIKAFSPLKIRLGGTLQDKVIYDTEDN  120

Query  649  RVPCTSFVSNTSEIFSFSQGCLPLSRWDELNVFFNKSG*PTRFIPCPAYICQHs*lyvss  828
            + PC  FV +TSE+F F+QGCLP+ RWDELN FF KSG                      
Sbjct  121  QEPCKQFVKSTSEMFGFTQGCLPMYRWDELNAFFKKSG----------------------  158

Query  829  lrvllrAVIIFGLNALTGRSIRSDASAVGAWDSTNAESLMKYTVEKGYTIHGWELG  996
                  A IIFGLNAL GRSI+ D SA GAWD TNAES + YTV+K Y+IHGWELG
Sbjct  159  ------AKIIFGLNALAGRSIQPDGSAAGAWDYTNAESFISYTVKKNYSIHGWELG  208



>ref|XP_008242878.1| PREDICTED: heparanase-like protein 3 [Prunus mume]
Length=542

 Score =   243 bits (620),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 119/232 (51%), Positives = 153/232 (66%), Gaps = 32/232 (14%)
 Frame = +1

Query  310  HSWFLQMRLWILVLGVFNVSLISGSETLGD---KGSVYVDGKSRIGRTDSDFICATLDWW  480
            H W + +  W+     F+      S+  G    +G+V+V+GK  IG+ D DFICATLDWW
Sbjct  4    HFWPMGLCFWV-CFSAFSFIHSVNSQGFGGGSIEGTVHVNGKDAIGKIDDDFICATLDWW  62

Query  481  PPEKCDYGTCAWGHASLLNLDLSNIIFLNAIKAFSPLKIRLGGTLQDKVVYQTKDDRVPC  660
            PPEKCDYGTC+WG AS LNL+L + I LNA+KAFSPLK+RLGGTLQDKV+Y T D++  C
Sbjct  63   PPEKCDYGTCSWGRASFLNLNLGSSILLNAVKAFSPLKLRLGGTLQDKVIYATPDNKQRC  122

Query  661  TSFVSNTSEIFSFSQGCLPLSRWDELNVFFNKSG*PTRFIPCPAYICQHs*lyvsslrvl  840
              F  +T+E+F F+ GCLP++RWDELN FF KSG                          
Sbjct  123  VPFQKSTTEMFGFTPGCLPMNRWDELNSFFQKSG--------------------------  156

Query  841  lrAVIIFGLNALTGRSIRSDASAVGAWDSTNAESLMKYTVEKGYTIHGWELG  996
              A +IFGLNALTGR+I S+ +A GAWD  N+ES ++Y+V+K YT+HGWELG
Sbjct  157  --AKLIFGLNALTGRTIHSNGTATGAWDYKNSESFIRYSVKKNYTVHGWELG  206



>ref|XP_002870409.1| glycosyl hydrolase family 79 N-terminal domain-containing protein 
[Arabidopsis lyrata subsp. lyrata]
 gb|EFH46668.1| glycosyl hydrolase family 79 N-terminal domain-containing protein 
[Arabidopsis lyrata subsp. lyrata]
Length=536

 Score =   243 bits (619),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 116/225 (52%), Positives = 150/225 (67%), Gaps = 30/225 (13%)
 Frame = +1

Query  331  RLWILVL--GVFNVSLISGSETLGDKGSVYVDGKSRIGRTDSDFICATLDWWPPEKCDYG  504
            ++WI+VL   VF     + S  + + G+V V G++ +G  D DFICATLDWWPPEKCDYG
Sbjct  5    QIWIIVLFLCVFQFLDCTVSSAVEETGTVSVYGRAAVGTIDEDFICATLDWWPPEKCDYG  64

Query  505  TCAWGHASLLNLDLSNIIFLNAIKAFSPLKIRLGGTLQDKVVYQTKDDRVPCTSFVSNTS  684
            TC+W HAS+LNLDL+N I  NAIKAF+PLKIR+GGTLQD V+Y+T D + PC  F  N+S
Sbjct  65   TCSWDHASILNLDLNNTILQNAIKAFAPLKIRIGGTLQDIVIYETPDQKQPCLPFTKNSS  124

Query  685  EIFSFSQGCLPLSRWDELNVFFNKSG*PTRFIPCPAYICQHs*lyvsslrvllrAVIIFG  864
             +F ++QGCLP+ RWDELN FF K+G                            A +IFG
Sbjct  125  ILFGYTQGCLPMRRWDELNAFFRKTG----------------------------ARVIFG  156

Query  865  LNALTGRSIRSDASAVGAWDSTNAESLMKYTVEKGYTIHGWELGK  999
            LNAL+GRSI+ +  A+GAWD TNAES +++T +  +TI GWELG 
Sbjct  157  LNALSGRSIKPNGEAIGAWDYTNAESFIRFTAQNNHTIDGWELGN  201



>ref|XP_006381082.1| hypothetical protein POPTR_0006s06100g [Populus trichocarpa]
 gb|ERP58879.1| hypothetical protein POPTR_0006s06100g [Populus trichocarpa]
Length=554

 Score =   243 bits (619),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 126/199 (63%), Positives = 147/199 (74%), Gaps = 28/199 (14%)
 Frame = +1

Query  400  KGSVYVDGKSRIGRTDSDFICATLDWWPPEKCDYGTCAWGHASLLNLDLSNIIFLNAIKA  579
            +G+V++DGK+ IG+ D DFICATLDWWPPEKCDYGTC+W  ASL+NLDL+N I LNAIKA
Sbjct  33   EGTVFIDGKTSIGKIDEDFICATLDWWPPEKCDYGTCSWDQASLINLDLNNNILLNAIKA  92

Query  580  FSPLKIRLGGTLQDKVVYQTKDDRVPCTSFVSNTSEIFSFSQGCLPLSRWDELNVFFNKS  759
            FSPLKIRLGGTLQDKV+Y T+D++ PC  FV NTSE+F F+QGCLP+ RWDELN FF KS
Sbjct  93   FSPLKIRLGGTLQDKVIYDTEDNKQPCVQFVKNTSEMFGFTQGCLPMYRWDELNAFFKKS  152

Query  760  G*PTRFIPCPAYICQHs*lyvsslrvllrAVIIFGLNALTGRSIRSDASAVGAWDSTNAE  939
            G                            A IIFGLNAL GRSI SD SAVGAW+ TNAE
Sbjct  153  G----------------------------AEIIFGLNALAGRSITSDGSAVGAWNYTNAE  184

Query  940  SLMKYTVEKGYTIHGWELG  996
            S + YTV+K Y+I+GWELG
Sbjct  185  SFISYTVKKNYSIYGWELG  203



>ref|XP_006381083.1| hypothetical protein POPTR_0006s06100g [Populus trichocarpa]
 gb|ERP58880.1| hypothetical protein POPTR_0006s06100g [Populus trichocarpa]
Length=562

 Score =   243 bits (619),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 126/199 (63%), Positives = 147/199 (74%), Gaps = 28/199 (14%)
 Frame = +1

Query  400  KGSVYVDGKSRIGRTDSDFICATLDWWPPEKCDYGTCAWGHASLLNLDLSNIIFLNAIKA  579
            +G+V++DGK+ IG+ D DFICATLDWWPPEKCDYGTC+W  ASL+NLDL+N I LNAIKA
Sbjct  41   EGTVFIDGKTSIGKIDEDFICATLDWWPPEKCDYGTCSWDQASLINLDLNNNILLNAIKA  100

Query  580  FSPLKIRLGGTLQDKVVYQTKDDRVPCTSFVSNTSEIFSFSQGCLPLSRWDELNVFFNKS  759
            FSPLKIRLGGTLQDKV+Y T+D++ PC  FV NTSE+F F+QGCLP+ RWDELN FF KS
Sbjct  101  FSPLKIRLGGTLQDKVIYDTEDNKQPCVQFVKNTSEMFGFTQGCLPMYRWDELNAFFKKS  160

Query  760  G*PTRFIPCPAYICQHs*lyvsslrvllrAVIIFGLNALTGRSIRSDASAVGAWDSTNAE  939
            G                            A IIFGLNAL GRSI SD SAVGAW+ TNAE
Sbjct  161  G----------------------------AEIIFGLNALAGRSITSDGSAVGAWNYTNAE  192

Query  940  SLMKYTVEKGYTIHGWELG  996
            S + YTV+K Y+I+GWELG
Sbjct  193  SFISYTVKKNYSIYGWELG  211



>ref|XP_008385022.1| PREDICTED: heparanase-like protein 3 [Malus domestica]
Length=542

 Score =   241 bits (615),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 113/199 (57%), Positives = 142/199 (71%), Gaps = 28/199 (14%)
 Frame = +1

Query  400  KGSVYVDGKSRIGRTDSDFICATLDWWPPEKCDYGTCAWGHASLLNLDLSNIIFLNAIKA  579
            +G+V ++G+  I + D DFICATLDWWPPEKCDYGTC+WG ASLLNLDL+N I LNAIKA
Sbjct  35   EGTVRINGRDAIAKIDDDFICATLDWWPPEKCDYGTCSWGRASLLNLDLNNAILLNAIKA  94

Query  580  FSPLKIRLGGTLQDKVVYQTKDDRVPCTSFVSNTSEIFSFSQGCLPLSRWDELNVFFNKS  759
            FSPLK+RLGGTLQDKV+Y T D++  C +F  +TSE+F F+QGCLP++RWDEL+ FF K+
Sbjct  95   FSPLKLRLGGTLQDKVIYATPDNKQSCDAFQKSTSEMFGFTQGCLPMNRWDELSSFFQKA  154

Query  760  G*PTRFIPCPAYICQHs*lyvsslrvllrAVIIFGLNALTGRSIRSDASAVGAWDSTNAE  939
            G                            A IIFGLNALTGR+I S+ +A G WD TN+E
Sbjct  155  G----------------------------AKIIFGLNALTGRTINSNGTATGDWDYTNSE  186

Query  940  SLMKYTVEKGYTIHGWELG  996
            S ++Y+V+   T+HGWELG
Sbjct  187  SFIRYSVKNNXTVHGWELG  205



>gb|ACJ85786.1| unknown [Medicago truncatula]
Length=224

 Score =   231 bits (589),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 123/221 (56%), Positives = 142/221 (64%), Gaps = 29/221 (13%)
 Frame = +1

Query  337  WILVLGVFNVSLISGSETLGDKGSVYVDGKSRIGRTDSDFICATLDWWPPEKCDYGTCAW  516
            W     V  VS  SG +    KG+V +DG S IG  D DFICATLDWWPP+KCDYGTC+W
Sbjct  15   WFSFFVVNTVSDESGYDEDVKKGNVVIDGSSVIGNIDDDFICATLDWWPPQKCDYGTCSW  74

Query  517  GHASLLNLDLSNIIFLNAIKAFSPLKIRLGGTLQDKVVYQTKDDRVPCTSFVSNTSEIFS  696
            G ASLLNLDL+N IFLNA+KAFSPLK+RLGG+LQD +VY T D   PCT FV N SE+F 
Sbjct  75   GLASLLNLDLNNKIFLNAVKAFSPLKLRLGGSLQDLLVYGTDDYNKPCTPFVRNASEMFG  134

Query  697  FSQGCLPLSRWDELNVFFNKSG*PTRFIPCPAYICQHs*lyvsslrvllrAVIIFGLNAL  876
            FSQGCLP+ RWDELN FF K+G                            A IIFGLNAL
Sbjct  135  FSQGCLPMPRWDELNHFFQKAG----------------------------AKIIFGLNAL  166

Query  877  TGRSIRSDASAVGAWDSTNAESLMKYTVEKGYTIHGWELGK  999
             G+S+    +    W+ TNAES ++YTV K Y IHGWELG 
Sbjct  167  YGKSVHRGHTER-PWNYTNAESFIQYTVGKNYDIHGWELGN  206



>gb|EAY99897.1| hypothetical protein OsI_21892 [Oryza sativa Indica Group]
 gb|ACR10238.1| heparanase [Oryza sativa Indica Group]
Length=525

 Score =   240 bits (613),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 118/198 (60%), Positives = 132/198 (67%), Gaps = 28/198 (14%)
 Frame = +1

Query  403  GSVYVDGKSRIGRTDSDFICATLDWWPPEKCDYGTCAWGHASLLNLDLSNIIFLNAIKAF  582
            G   VDG+  I  TD DF+CAT+DWWPP+KCDYGTC+WG ASLLNLDLSN I LNAI+AF
Sbjct  27   GVAGVDGRRAIAATDEDFVCATMDWWPPDKCDYGTCSWGLASLLNLDLSNKILLNAIRAF  86

Query  583  SPLKIRLGGTLQDKVVYQTKDDRVPCTSFVSNTSEIFSFSQGCLPLSRWDELNVFFNKSG  762
            SPLK+RLGG+LQDK+VY T D   PC  FV NTSE+F F+QGCLPL RWDELN FF KSG
Sbjct  87   SPLKLRLGGSLQDKLVYGTGDGGGPCAPFVKNTSEMFGFTQGCLPLHRWDELNAFFQKSG  146

Query  763  *PTRFIPCPAYICQHs*lyvsslrvllrAVIIFGLNALTGRSIRSDASAVGAWDSTNAES  942
                                        A I+FGLNAL GR    D S  G WD TNA S
Sbjct  147  ----------------------------ARIVFGLNALNGRVPLPDGSMGGPWDYTNAAS  178

Query  943  LMKYTVEKGYTIHGWELG  996
            L++YT  KGY IHGWELG
Sbjct  179  LIRYTASKGYKIHGWELG  196



>ref|XP_009363939.1| PREDICTED: heparanase-like protein 3 [Pyrus x bretschneideri]
Length=542

 Score =   240 bits (613),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 112/194 (58%), Positives = 139/194 (72%), Gaps = 28/194 (14%)
 Frame = +1

Query  415  VDGKSRIGRTDSDFICATLDWWPPEKCDYGTCAWGHASLLNLDLSNIIFLNAIKAFSPLK  594
            ++G+  I + D DFICATLDWWPPEKCDYGTC+WG ASLLNLDL+N I LNAIKAFSPLK
Sbjct  40   INGRDAIAKIDDDFICATLDWWPPEKCDYGTCSWGRASLLNLDLNNTILLNAIKAFSPLK  99

Query  595  IRLGGTLQDKVVYQTKDDRVPCTSFVSNTSEIFSFSQGCLPLSRWDELNVFFNKSG*PTR  774
            +RLGGTLQDKV+Y T D++  C +F  +TSE+F F+QGCLP++RWDEL+ FF K+G    
Sbjct  100  LRLGGTLQDKVIYATPDNKQSCDAFQKSTSEMFGFTQGCLPMNRWDELSSFFQKAG----  155

Query  775  FIPCPAYICQHs*lyvsslrvllrAVIIFGLNALTGRSIRSDASAVGAWDSTNAESLMKY  954
                                    A IIFGLNALTGR+I S+ +A G WD TN+ES ++Y
Sbjct  156  ------------------------AKIIFGLNALTGRAINSNGTATGDWDYTNSESFIRY  191

Query  955  TVEKGYTIHGWELG  996
            +V+  YT+HGWELG
Sbjct  192  SVKNNYTVHGWELG  205



>ref|XP_009108062.1| PREDICTED: heparanase-like protein 3 [Brassica rapa]
Length=536

 Score =   240 bits (612),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 115/226 (51%), Positives = 152/226 (67%), Gaps = 29/226 (13%)
 Frame = +1

Query  325  QMRLWILVLGVFNVS-LISGSETLGDKGSVYVDGKSRIGRTDSDFICATLDWWPPEKCDY  501
            Q+ + +L L VF  +     S  + +KG+V+V  ++ +G  D DFICATLDWWPP+KCDY
Sbjct  5    QISVIVLFLWVFQFADKTVVSSAVEEKGTVFVYERAAVGTLDEDFICATLDWWPPQKCDY  64

Query  502  GTCAWGHASLLNLDLSNIIFLNAIKAFSPLKIRLGGTLQDKVVYQTKDDRVPCTSFVSNT  681
            GTCAW HAS+LNLDL+N IF NAI+ F+PLKIR+GGTLQD V+Y+T D + PC  F  NT
Sbjct  65   GTCAWDHASILNLDLNNTIFQNAIREFAPLKIRIGGTLQDLVIYETPDQKQPCLPFTQNT  124

Query  682  SEIFSFSQGCLPLSRWDELNVFFNKSG*PTRFIPCPAYICQHs*lyvsslrvllrAVIIF  861
            S +F ++QGCLP+ RW++LN FF+K+G                            A +IF
Sbjct  125  SLLFGYTQGCLPMRRWNQLNDFFSKTG----------------------------AKVIF  156

Query  862  GLNALTGRSIRSDASAVGAWDSTNAESLMKYTVEKGYTIHGWELGK  999
            GLNAL+GRSI+S+  AVGAWD TNAES ++Y V+  +T+ GWELG 
Sbjct  157  GLNALSGRSIQSNGEAVGAWDYTNAESFIQYIVQNNHTVDGWELGN  202



>emb|CDP18206.1| unnamed protein product [Coffea canephora]
Length=299

 Score =   233 bits (593),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 126/218 (58%), Positives = 149/218 (68%), Gaps = 25/218 (11%)
 Frame = +1

Query  361   NVSLISGSETLGDKGS----VYVDGKSRIGRTDSDFICATLDWWPPEKCDYGTCAWGHAS  528
             N S+   S  + D G+    V+VDG S IG  D  FICATLDWW PEK DYGTC+W HAS
Sbjct  12    NSSIFVYSVIVKDIGTAQDLVFVDGISTIGEIDDAFICATLDWWLPEKYDYGTCSWDHAS  71

Query  529   LLNLDLSNIIFLNAIKAFSPLKIRLGGTLQDKVVYQTKDDRVPCTSFVSNTSEIFSFSQG  708
             LLN DL+NII LNA+KAFS LKIRLGGTLQD V+YQT+ ++  C SFV N+SE+F F+QG
Sbjct  72    LLNQDLNNIILLNAVKAFSLLKIRLGGTLQDNVIYQTQSNQ-RCHSFVKNSSELFGFAQG  130

Query  709   CLPLSRWDELNVFFNKSG*PTRFIPCPAYICQHs*lyvsslrvllrAVIIFGLNALTGRS  888
             CLP SR DELN FF KSG          Y+  +           L  + +FGLNAL GR 
Sbjct  131   CLPSSRRDELNSFFKKSG----------YVRSN----------TLVRLKLFGLNALNGRR  170

Query  889   IRSDASAVGAWDSTNAESLMKYTVEKGYTIHGWELGKI  1002
             IRSD S VGAWDS+N E+ ++YTVEKGY I+GWELG I
Sbjct  171   IRSDGSTVGAWDSSNVEAFIRYTVEKGYNIYGWELGNI  208



>gb|KEH37925.1| glycoside hydrolase family 79 amino-terminal domain protein [Medicago 
truncatula]
Length=537

 Score =   238 bits (607),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 126/234 (54%), Positives = 148/234 (63%), Gaps = 40/234 (17%)
 Frame = +1

Query  328  MRLWILVLGVF-----------NVSLISGSETLGDKGSVYVDGKSRIGRTDSDFICATLD  474
            M  WI +L ++            VS  SG +    KG+V +DG S IG  D DFICATLD
Sbjct  1    MGSWIQILSIYYLAWFSFFVVNTVSDESGYDEDVKKGNVVIDGSSVIGNIDDDFICATLD  60

Query  475  WWPPEKCDYGTCAWGHASLLNLDLSNIIFLNAIKAFSPLKIRLGGTLQDKVVYQTKDDRV  654
            WWPP+KCDYGTC+WG ASLLNLDL+N IFLNA+KAFSPLK+RLGG+LQD +VY T D   
Sbjct  61   WWPPQKCDYGTCSWGLASLLNLDLNNKIFLNAVKAFSPLKLRLGGSLQDLLVYGTDDYNK  120

Query  655  PCTSFVSNTSEIFSFSQGCLPLSRWDELNVFFNKSG*PTRFIPCPAYICQHs*lyvsslr  834
            PCT FV N SE+F FSQGCLP+ RWDELN FF K+G                        
Sbjct  121  PCTPFVRNASEMFGFSQGCLPMPRWDELNHFFQKAG------------------------  156

Query  835  vllrAVIIFGLNALTGRSIRSDASAVGAWDSTNAESLMKYTVEKGYTIHGWELG  996
                A IIFGLNAL G+S+    +  G W+ TNAES ++YTV K Y IHGWELG
Sbjct  157  ----AKIIFGLNALYGKSVHRGHTE-GPWNYTNAESFIQYTVGKNYDIHGWELG  205



>gb|EAZ36024.1| hypothetical protein OsJ_20330 [Oryza sativa Japonica Group]
Length=525

 Score =   238 bits (606),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 117/198 (59%), Positives = 131/198 (66%), Gaps = 28/198 (14%)
 Frame = +1

Query  403  GSVYVDGKSRIGRTDSDFICATLDWWPPEKCDYGTCAWGHASLLNLDLSNIIFLNAIKAF  582
            G   VDG+  I  TD DF+CAT+DWWPP+KCDYGTC+WG ASLLNLDLSN I LNAI+AF
Sbjct  27   GVAGVDGRRAIAATDEDFVCATMDWWPPDKCDYGTCSWGLASLLNLDLSNKILLNAIRAF  86

Query  583  SPLKIRLGGTLQDKVVYQTKDDRVPCTSFVSNTSEIFSFSQGCLPLSRWDELNVFFNKSG  762
            SPLK+RLGG+LQDK+VY T +   PC  FV NTSEIF F+QGCLP  RWDELN FF KSG
Sbjct  87   SPLKLRLGGSLQDKLVYGTGNGGGPCPPFVKNTSEIFGFTQGCLPFHRWDELNAFFQKSG  146

Query  763  *PTRFIPCPAYICQHs*lyvsslrvllrAVIIFGLNALTGRSIRSDASAVGAWDSTNAES  942
                                        A I+FGLNAL GR    D S  G WD TNA S
Sbjct  147  ----------------------------ARIVFGLNALNGRVPLPDGSMGGPWDYTNAAS  178

Query  943  LMKYTVEKGYTIHGWELG  996
            L++YT  KGY IHGWELG
Sbjct  179  LIRYTASKGYKIHGWELG  196



>ref|XP_009623092.1| PREDICTED: heparanase-like protein 3 [Nicotiana tomentosiformis]
Length=537

 Score =   238 bits (607),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 113/200 (57%), Positives = 139/200 (70%), Gaps = 28/200 (14%)
 Frame = +1

Query  397  DKGSVYVDGKSRIGRTDSDFICATLDWWPPEKCDYGTCAWGHASLLNLDLSNIIFLNAIK  576
            ++G++Y+DG + I + D DFICATLDWWP  KCDYGTC+WG++SLLNLDLSN + LNAI+
Sbjct  29   EEGTLYIDGSAAIAKIDEDFICATLDWWPSNKCDYGTCSWGNSSLLNLDLSNKVLLNAIR  88

Query  577  AFSPLKIRLGGTLQDKVVYQTKDDRVPCTSFVSNTSEIFSFSQGCLPLSRWDELNVFFNK  756
            AFSPLKIRLGGTLQDK+VYQT     PC+ F  N +E F F+QGCLPLSRWDELN  F K
Sbjct  89   AFSPLKIRLGGTLQDKIVYQTAHYEQPCSPFFLNNTESFGFTQGCLPLSRWDELNEIFKK  148

Query  757  SG*PTRFIPCPAYICQHs*lyvsslrvllrAVIIFGLNALTGRSIRSDASAVGAWDSTNA  936
            +G                            A + FGLNAL G++I  + SA+G WDS+NA
Sbjct  149  TG----------------------------AKVTFGLNALNGKTIAPNGSALGDWDSSNA  180

Query  937  ESLMKYTVEKGYTIHGWELG  996
            ES ++YTV +GYTI GWELG
Sbjct  181  ESFIRYTVSRGYTILGWELG  200



>ref|XP_009393723.1| PREDICTED: heparanase-like protein 3 [Musa acuminata subsp. malaccensis]
Length=548

 Score =   238 bits (607),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 114/186 (61%), Positives = 134/186 (72%), Gaps = 28/186 (15%)
 Frame = +1

Query  442  TDSDFICATLDWWPPEKCDYGTCAWGHASLLNLDLSNIIFLNAIKAFSPLKIRLGGTLQD  621
            TD DF+CATLDWWPPEKCDYGTC+WG AS+LNLDLSN I LNA+KAFSPLK+RLGG+LQD
Sbjct  73   TDEDFVCATLDWWPPEKCDYGTCSWGLASMLNLDLSNPILLNAVKAFSPLKLRLGGSLQD  132

Query  622  KVVYQTKDDRVPCTSFVSNTSEIFSFSQGCLPLSRWDELNVFFNKSG*PTRFIPCPAYIC  801
            KV+Y T + + PC  F+ NTSE+F FSQGCLP+SRWDELN FF+++G             
Sbjct  133  KVIYDTGNPQRPCVPFLKNTSEMFGFSQGCLPMSRWDELNEFFDEAG-------------  179

Query  802  QHs*lyvsslrvllrAVIIFGLNALTGRSIRSDASAVGAWDSTNAESLMKYTVEKGYTIH  981
                           A+IIFGLNAL GR   SD S  G W+ TNA SL++YTV+KGYTIH
Sbjct  180  ---------------ALIIFGLNALNGRVPESDGSLGGPWNYTNAASLIRYTVDKGYTIH  224

Query  982  GWELGK  999
            GWELG 
Sbjct  225  GWELGN  230



>gb|KHG18442.1| hypothetical protein F383_07597 [Gossypium arboreum]
Length=545

 Score =   238 bits (606),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 128/214 (60%), Positives = 153/214 (71%), Gaps = 31/214 (14%)
 Frame = +1

Query  364  VSLISGSETLGD---KGSVYVDGKSRIGRTDSDFICATLDWWPPEKCDYGTCAWGHASLL  534
            VSL + +   GD   +G+VY+DGK+ IG  D DF+CATLDWWPPEKCDYGTC+WGHA LL
Sbjct  16   VSLQAVAAAEGDAIVEGTVYIDGKAPIGTIDDDFVCATLDWWPPEKCDYGTCSWGHAGLL  75

Query  535  NLDLSNIIFLNAIKAFSPLKIRLGGTLQDKVVYQTKDDRVPCTSFVSNTSEIFSFSQGCL  714
            NLDL+N IFLNA+KAFSPLKIRLGG+LQDKV+Y T D++ PCTSFV + SE+F F++GCL
Sbjct  76   NLDLNNNIFLNAVKAFSPLKIRLGGSLQDKVIYGTDDNQEPCTSFVKDPSEMFGFTKGCL  135

Query  715  PLSRWDELNVFFNKSG*PTRFIPCPAYICQHs*lyvsslrvllrAVIIFGLNALTGRSIR  894
            P+ RWDELN FF K+G                            A II GLNAL G+SI+
Sbjct  136  PMKRWDELNAFFAKAG----------------------------AKIIVGLNALAGKSIK  167

Query  895  SDASAVGAWDSTNAESLMKYTVEKGYTIHGWELG  996
               SAVGAW+ TNAES ++YTVEK Y IHGWELG
Sbjct  168  PGGSAVGAWNYTNAESFIRYTVEKNYKIHGWELG  201



>ref|XP_010665516.1| PREDICTED: heparanase-like protein 3 isoform X2 [Beta vulgaris 
subsp. vulgaris]
Length=543

 Score =   238 bits (606),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 112/196 (57%), Positives = 139/196 (71%), Gaps = 29/196 (15%)
 Frame = +1

Query  409  VYVDGKSRIGRTDSDFICATLDWWPPEKCDYGTCAWGHASLLNLDLSNIIFLNAIKAFSP  588
            VY +  + IG TD D+ICATLDWWP +KCDY +C+WG ASLLNLDL+NII  NA+KAFSP
Sbjct  43   VYFNTTAEIGETDDDYICATLDWWPSDKCDYDSCSWGMASLLNLDLNNIILSNAVKAFSP  102

Query  589  LKIRLGGTLQDKVVYQTKDDRVPCTSFVSNTSEIFSFSQGCLPLSRWDELNVFFNKSG*P  768
            LKIR+GGTLQDK++YQT   + PCT FVSN+S++  FSQGCL ++RWD LN FF ++G  
Sbjct  103  LKIRMGGTLQDKLIYQTNQQK-PCTPFVSNSSQLLGFSQGCLSMARWDRLNSFFKETG--  159

Query  769  TRFIPCPAYICQHs*lyvsslrvllrAVIIFGLNALTGRSIRSDASAVGAWDSTNAESLM  948
                                      AV+ FGLNAL GR++ SD SAVGAWD +NAESL+
Sbjct  160  --------------------------AVVTFGLNALAGRTMNSDGSAVGAWDPSNAESLL  193

Query  949  KYTVEKGYTIHGWELG  996
            +YT+ KGY I+GWELG
Sbjct  194  RYTINKGYNIYGWELG  209



>gb|EPS67583.1| hypothetical protein M569_07189, partial [Genlisea aurea]
Length=534

 Score =   237 bits (605),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 116/201 (58%), Positives = 139/201 (69%), Gaps = 29/201 (14%)
 Frame = +1

Query  400  KGSVYVDGKSRIGRTDSDFICATLDWWPPEKCDYGTCAWGHASLLNLDLSNIIFLNAIKA  579
            +G V V G S +  TD DF+CATLDWWPPEKCDYGTCAW HAS+LNLDL N + +NA+KA
Sbjct  26   EGIVVVGGLSPVAVTDEDFVCATLDWWPPEKCDYGTCAWDHASILNLDLKNPLLVNAVKA  85

Query  580  FSPLKIRLGGTLQDKVVYQTKDDRVPCTSFVS-NTSEIFSFSQGCLPLSRWDELNVFFNK  756
            FSPLKIRLGGTLQDKV+YQT+D   PCT F S N S +F FSQGCLPL+RWD+L+ FF +
Sbjct  86   FSPLKIRLGGTLQDKVMYQTEDKSRPCTPFFSKNPSLLFGFSQGCLPLTRWDQLHSFFRQ  145

Query  757  SG*PTRFIPCPAYICQHs*lyvsslrvllrAVIIFGLNALTGRSIRSDASAVGAWDSTNA  936
            SG                            A++IFGLNAL G+SI +D +A G WD +NA
Sbjct  146  SG----------------------------ALVIFGLNALHGKSIHNDNTATGPWDPSNA  177

Query  937  ESLMKYTVEKGYTIHGWELGK  999
             SL+KYTV  GY ++GWELG 
Sbjct  178  ASLIKYTVNNGYNVYGWELGN  198



>ref|XP_007155084.1| hypothetical protein PHAVU_003G171800g [Phaseolus vulgaris]
 gb|ESW27078.1| hypothetical protein PHAVU_003G171800g [Phaseolus vulgaris]
Length=524

 Score =   236 bits (603),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 122/221 (55%), Positives = 145/221 (66%), Gaps = 30/221 (14%)
 Frame = +1

Query  334  LWILVLGVFNVSLISGSETLGDKGSVYVDGKSRIGRTDSDFICATLDWWPPEKCDYGTCA  513
            +++  L    V  + G     +KG V V GKS IGR D+DFICATLDWWPP+KCDYG C+
Sbjct  14   MYLASLSFIGVGAVYGRGGAVEKGIVLVHGKSAIGRIDNDFICATLDWWPPQKCDYGKCS  73

Query  514  WGHASLLNLDLSNIIFLNAIKAFSPLKIRLGGTLQDKVVYQTKDDRVPCTSFVSNTSEIF  693
            WG ASLLNLDL++   LNAIKAFS LK+RLGGTLQDKV+Y T+D+R PCT FV    E+F
Sbjct  74   WGQASLLNLDLNSKTLLNAIKAFSSLKLRLGGTLQDKVIYGTEDNRQPCTPFVK-ADEMF  132

Query  694  SFSQGCLPLSRWDELNVFFNKSG*PTRFIPCPAYICQHs*lyvsslrvllrAVIIFGLNA  873
             F+ GCLP+SRWDELN FF K+G                               IFGLNA
Sbjct  133  GFTGGCLPMSRWDELNSFFQKAG----------------------------VKAIFGLNA  164

Query  874  LTGRSIRSDASAVGAWDSTNAESLMKYTVEKGYTIHGWELG  996
            L G+SI+S   AVG W+ TNAESL++YTV K Y IHGWELG
Sbjct  165  LAGKSIKS-GFAVGPWNYTNAESLIRYTVRKKYHIHGWELG  204



>ref|XP_007138475.1| hypothetical protein PHAVU_009G212400g [Phaseolus vulgaris]
 gb|ESW10469.1| hypothetical protein PHAVU_009G212400g [Phaseolus vulgaris]
Length=536

 Score =   237 bits (604),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 116/199 (58%), Positives = 138/199 (69%), Gaps = 29/199 (15%)
 Frame = +1

Query  400  KGSVYVDGKSRIGRTDSDFICATLDWWPPEKCDYGTCAWGHASLLNLDLSNIIFLNAIKA  579
            KG+V +D K+ IG TD+DF+CATLDWWPP+KCDYG C+WG ASLLNLDL+N IFLNA+KA
Sbjct  36   KGTVAIDDKAVIGTTDADFVCATLDWWPPQKCDYGKCSWGLASLLNLDLNNKIFLNAVKA  95

Query  580  FSPLKIRLGGTLQDKVVYQTKDDRVPCTSFVSNTSEIFSFSQGCLPLSRWDELNVFFNKS  759
            FSPLK+RLGG+LQDK+ Y T D   PCT FV   SE+F F+QGCLP+ RWDEL+ FF K+
Sbjct  96   FSPLKLRLGGSLQDKLTYGTDDYHQPCTPFVKKDSEMFGFTQGCLPVKRWDELHNFFEKA  155

Query  760  G*PTRFIPCPAYICQHs*lyvsslrvllrAVIIFGLNALTGRSIRSDASAVGAWDSTNAE  939
            G                            A IIFGLNAL G+SI    SA G W+STNAE
Sbjct  156  G----------------------------AKIIFGLNALAGKSIHG-GSATGPWNSTNAE  186

Query  940  SLMKYTVEKGYTIHGWELG  996
            S ++Y V  GYTI+GWELG
Sbjct  187  SFIRYNVRNGYTIYGWELG  205



>ref|XP_010665510.1| PREDICTED: heparanase-like protein 3 isoform X1 [Beta vulgaris 
subsp. vulgaris]
Length=604

 Score =   238 bits (606),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 112/196 (57%), Positives = 139/196 (71%), Gaps = 29/196 (15%)
 Frame = +1

Query  409  VYVDGKSRIGRTDSDFICATLDWWPPEKCDYGTCAWGHASLLNLDLSNIIFLNAIKAFSP  588
            VY +  + IG TD D+ICATLDWWP +KCDY +C+WG ASLLNLDL+NII  NA+KAFSP
Sbjct  43   VYFNTTAEIGETDDDYICATLDWWPSDKCDYDSCSWGMASLLNLDLNNIILSNAVKAFSP  102

Query  589  LKIRLGGTLQDKVVYQTKDDRVPCTSFVSNTSEIFSFSQGCLPLSRWDELNVFFNKSG*P  768
            LKIR+GGTLQDK++YQT   + PCT FVSN+S++  FSQGCL ++RWD LN FF ++G  
Sbjct  103  LKIRMGGTLQDKLIYQTNQQK-PCTPFVSNSSQLLGFSQGCLSMARWDRLNSFFKETG--  159

Query  769  TRFIPCPAYICQHs*lyvsslrvllrAVIIFGLNALTGRSIRSDASAVGAWDSTNAESLM  948
                                      AV+ FGLNAL GR++ SD SAVGAWD +NAESL+
Sbjct  160  --------------------------AVVTFGLNALAGRTMNSDGSAVGAWDPSNAESLL  193

Query  949  KYTVEKGYTIHGWELG  996
            +YT+ KGY I+GWELG
Sbjct  194  RYTINKGYNIYGWELG  209



>gb|KJB64650.1| hypothetical protein B456_010G059600 [Gossypium raimondii]
Length=341

 Score =   230 bits (587),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 127/214 (59%), Positives = 152/214 (71%), Gaps = 31/214 (14%)
 Frame = +1

Query  364  VSLISGSETLGD---KGSVYVDGKSRIGRTDSDFICATLDWWPPEKCDYGTCAWGHASLL  534
            VSL + +   GD   +G+VY+DGK+ IG  D DF+CATLDWWPPEKCDYGTC+WG A LL
Sbjct  16   VSLQAVAAAEGDAIVEGTVYIDGKAPIGIIDDDFVCATLDWWPPEKCDYGTCSWGLAGLL  75

Query  535  NLDLSNIIFLNAIKAFSPLKIRLGGTLQDKVVYQTKDDRVPCTSFVSNTSEIFSFSQGCL  714
            NLDL+N IFLNA+KAFSPLKIRLGG+LQDKV+Y T D++ PCTSFV + SE+F F++GCL
Sbjct  76   NLDLNNNIFLNAVKAFSPLKIRLGGSLQDKVIYGTDDNQEPCTSFVKDPSEMFGFTKGCL  135

Query  715  PLSRWDELNVFFNKSG*PTRFIPCPAYICQHs*lyvsslrvllrAVIIFGLNALTGRSIR  894
            P+ RWDELN FF K+G                            A II GLNAL G+SI+
Sbjct  136  PMKRWDELNAFFAKAG----------------------------AKIIVGLNALAGKSIK  167

Query  895  SDASAVGAWDSTNAESLMKYTVEKGYTIHGWELG  996
               SAVGAW+ TNAES ++YTVEK Y IHGWELG
Sbjct  168  PGGSAVGAWNYTNAESFIRYTVEKNYKIHGWELG  201



>ref|NP_198344.2| glucuronidase 3 [Arabidopsis thaliana]
 gb|AED93924.1| glucuronidase 3 [Arabidopsis thaliana]
Length=382

 Score =   231 bits (588),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 109/227 (48%), Positives = 148/227 (65%), Gaps = 28/227 (12%)
 Frame = +1

Query  319  FLQMRLWILVLGVFNVSLISGSETLGDKGSVYVDGKSRIGRTDSDFICATLDWWPPEKCD  498
            + Q+   +L L VF     + S  + + G+V+V G++ +G  D DFICATLDWWPPEKCD
Sbjct  3    YRQILAIVLFLCVFQFLDCTVSSAVEENGTVFVYGRAAVGTIDEDFICATLDWWPPEKCD  62

Query  499  YGTCAWGHASLLNLDLSNIIFLNAIKAFSPLKIRLGGTLQDKVVYQTKDDRVPCTSFVSN  678
            YG+C+W HAS+LNLDL+ ++ ++   AF+PLKIR+GGTLQD V+Y+T D + PC  F  N
Sbjct  63   YGSCSWDHASILNLDLTIVVPISKNTAFAPLKIRIGGTLQDIVIYETPDSKQPCLPFTKN  122

Query  679  TSEIFSFSQGCLPLSRWDELNVFFNKSG*PTRFIPCPAYICQHs*lyvsslrvllrAVII  858
            +S +F ++QGCLP+ RWDELN FF K+G                              +I
Sbjct  123  SSILFGYTQGCLPMRRWDELNAFFRKTG----------------------------TKVI  154

Query  859  FGLNALTGRSIRSDASAVGAWDSTNAESLMKYTVEKGYTIHGWELGK  999
            FGLNAL+GRSI+S+  A+GAW+ TNAES +++T E  YTI GWELG 
Sbjct  155  FGLNALSGRSIKSNGEAIGAWNYTNAESFIRFTAENNYTIDGWELGN  201



>ref|NP_001056967.1| Os06g0179000 [Oryza sativa Japonica Group]
 dbj|BAD72300.1| putative beta-glucuronidase precursor [Oryza sativa Japonica 
Group]
 dbj|BAF18881.1| Os06g0179000 [Oryza sativa Japonica Group]
 dbj|BAG89440.1| unnamed protein product [Oryza sativa Japonica Group]
Length=526

 Score =   234 bits (598),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 117/199 (59%), Positives = 131/199 (66%), Gaps = 29/199 (15%)
 Frame = +1

Query  403  GSVYVDGKSRIGRTDSDFICATLDWWPPEKCDYGTCAWGHASLLNLDLSNIIFLNAIKA-  579
            G   VDG+  I  TD DF+CAT+DWWPP+KCDYGTC+WG ASLLNLDLSN I LNAI+  
Sbjct  27   GVAGVDGRRAIAATDEDFVCATMDWWPPDKCDYGTCSWGLASLLNLDLSNKILLNAIRGT  86

Query  580  FSPLKIRLGGTLQDKVVYQTKDDRVPCTSFVSNTSEIFSFSQGCLPLSRWDELNVFFNKS  759
            FSPLK+RLGG+LQDK+VY T D   PC  FV NTSE+F F+QGCLPL RWDELN FF KS
Sbjct  87   FSPLKLRLGGSLQDKLVYGTGDGGGPCAPFVKNTSEMFGFTQGCLPLHRWDELNAFFQKS  146

Query  760  G*PTRFIPCPAYICQHs*lyvsslrvllrAVIIFGLNALTGRSIRSDASAVGAWDSTNAE  939
            G                            A I+FGLNAL GR    D S  G WD TNA 
Sbjct  147  G----------------------------ARIVFGLNALNGRVPLPDGSMGGPWDYTNAA  178

Query  940  SLMKYTVEKGYTIHGWELG  996
            SL++YT  KGY IHGWELG
Sbjct  179  SLIRYTASKGYKIHGWELG  197



>ref|XP_008801893.1| PREDICTED: heparanase-like protein 3 isoform X1 [Phoenix dactylifera]
Length=548

 Score =   235 bits (599),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 116/195 (59%), Positives = 132/195 (68%), Gaps = 29/195 (15%)
 Frame = +1

Query  415  VDGKSRIGRTDSDFICATLDWWPPEKCDYGTCAWGHASLLNLDLSNIIFLNAIKAFSPLK  594
            +DG + I  TD DFICATLDWWPPEKCDYGTC+WG AS+LNL+LSN I LNA+K FSPLK
Sbjct  48   IDGTTPIAVTDDDFICATLDWWPPEKCDYGTCSWGLASMLNLNLSNKILLNAVKEFSPLK  107

Query  595  IRLGGTLQDKVVYQTKDDRVPCTSFVSNTSEIFSFSQGCLPLSRWDELNVFFNKSG*PTR  774
            +RLGG+LQD V+Y T D + PCT FV N SE+F F+QGCLP+ RWDELN FFNKSG    
Sbjct  108  LRLGGSLQDMVIYGT-DPQQPCTPFVKNNSEMFGFTQGCLPMHRWDELNAFFNKSG----  162

Query  775  FIPCPAYICQHs*lyvsslrvllrAVIIFGLNALTGRSIRSDASAVGAWDSTNAESLMKY  954
                                    A+IIFGLNAL GR    D S  G W+STNA S + Y
Sbjct  163  ------------------------ALIIFGLNALNGRVPLPDGSLGGPWNSTNAASFIHY  198

Query  955  TVEKGYTIHGWELGK  999
            TV KGY IHGWELG 
Sbjct  199  TVNKGYAIHGWELGN  213



>emb|CDP13545.1| unnamed protein product [Coffea canephora]
Length=514

 Score =   233 bits (594),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 112/200 (56%), Positives = 139/200 (70%), Gaps = 29/200 (15%)
 Frame = +1

Query  400  KGSVYVDGKSRIGRTDSDFICATLDWWPPEKCDYGTCAWGHASLLNLDLSNIIFLNAIKA  579
            +GS+++DG + +G TD +FICATLDWWPPEKCDYG+C+WG+ASLLNLDLSN + LNA+KA
Sbjct  31   QGSLFIDGSASVGSTDENFICATLDWWPPEKCDYGSCSWGNASLLNLDLSNKVLLNAVKA  90

Query  580  FSPLKIRLGGTLQDKVVYQTKDDRVPCTSFVSNTSEIFSFSQGCLPLSRWDELNVFFNKS  759
            FSPLKIRLGGTLQDKVVYQ  D    C  FV  + E+F F++GCLP+SRWDELN FF  +
Sbjct  91   FSPLKIRLGGTLQDKVVYQNADGPRSCNEFV-RSMEMFGFTEGCLPMSRWDELNKFFTLA  149

Query  760  G*PTRFIPCPAYICQHs*lyvsslrvllrAVIIFGLNALTGRSIRSDASAVGAWDSTNAE  939
            G                            A +IFGLNAL GR+I    + +G W+S+NAE
Sbjct  150  G----------------------------AEVIFGLNALHGRTIGPGNNVIGPWNSSNAE  181

Query  940  SLMKYTVEKGYTIHGWELGK  999
            SL++YTV   YTI+GWELG 
Sbjct  182  SLIRYTVSNNYTIYGWELGN  201



>ref|XP_004954253.1| PREDICTED: heparanase-like protein 3-like [Setaria italica]
Length=538

 Score =   234 bits (596),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 114/198 (58%), Positives = 131/198 (66%), Gaps = 28/198 (14%)
 Frame = +1

Query  406  SVYVDGKSRIGRTDSDFICATLDWWPPEKCDYGTCAWGHASLLNLDLSNIIFLNAIKAFS  585
            +V VD +S +  TD DF+CATLDWWPP+KCDYGTC+WG ASLLNL+LSN I LNA+KAFS
Sbjct  36   AVVVDARSAVAATDDDFVCATLDWWPPDKCDYGTCSWGRASLLNLNLSNKILLNAVKAFS  95

Query  586  PLKIRLGGTLQDKVVYQTKDDRVPCTSFVSNTSEIFSFSQGCLPLSRWDELNVFFNKSG*  765
            PLK+RLGG+LQD ++Y T D    CT FV NTS +F FSQGCLPL+RWDELN FF KSG 
Sbjct  96   PLKLRLGGSLQDMLIYDTGDSHQSCTPFVKNTSAMFGFSQGCLPLNRWDELNAFFQKSG-  154

Query  766  PTRFIPCPAYICQHs*lyvsslrvllrAVIIFGLNALTGRSIRSDASAVGAWDSTNAESL  945
                                       A IIFGLNAL GR    D S  G W+ TNA S 
Sbjct  155  ---------------------------AKIIFGLNALNGRVPMPDGSLGGPWNYTNAASF  187

Query  946  MKYTVEKGYTIHGWELGK  999
            ++Y V KGY IHGWELG 
Sbjct  188  IRYAVNKGYDIHGWELGN  205



>ref|XP_003561019.1| PREDICTED: heparanase-like protein 3 [Brachypodium distachyon]
Length=538

 Score =   233 bits (595),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 116/202 (57%), Positives = 129/202 (64%), Gaps = 29/202 (14%)
 Frame = +1

Query  394  GDKGSVYVDGKSRIGRTDSDFICATLDWWPPEKCDYGTCAWGHASLLNLDLSNIIFLNAI  573
            G  G V VD +  I  TD DF+CATLDWWPPEKCDYGTC+WGHA LLNLDLSN I LNA+
Sbjct  33   GTAGVVSVDARRAIASTDEDFVCATLDWWPPEKCDYGTCSWGHAGLLNLDLSNKILLNAV  92

Query  574  KAFSPLKIRLGGTLQDKVVYQTKDDRVPCTSFV-SNTSEIFSFSQGCLPLSRWDELNVFF  750
            +AFSPLK+RLGGTLQDKVVY   D   PC  F+  N SE+F F+Q CLP  RWDELN FF
Sbjct  93   RAFSPLKLRLGGTLQDKVVYGAGDSGQPCKPFLKGNGSELFGFTQACLPQRRWDELNAFF  152

Query  751  NKSG*PTRFIPCPAYICQHs*lyvsslrvllrAVIIFGLNALTGRSIRSDASAVGAWDST  930
             KSG                            A I+FGLNAL GR    D S  G WD +
Sbjct  153  QKSG----------------------------ATIVFGLNALNGRVRLPDGSMGGDWDIS  184

Query  931  NAESLMKYTVEKGYTIHGWELG  996
            NA S ++YTV KGY IHGWELG
Sbjct  185  NAASFIRYTVSKGYKIHGWELG  206



>gb|KJB64651.1| hypothetical protein B456_010G059600 [Gossypium raimondii]
Length=451

 Score =   231 bits (588),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 127/214 (59%), Positives = 152/214 (71%), Gaps = 31/214 (14%)
 Frame = +1

Query  364  VSLISGSETLGD---KGSVYVDGKSRIGRTDSDFICATLDWWPPEKCDYGTCAWGHASLL  534
            VSL + +   GD   +G+VY+DGK+ IG  D DF+CATLDWWPPEKCDYGTC+WG A LL
Sbjct  16   VSLQAVAAAEGDAIVEGTVYIDGKAPIGIIDDDFVCATLDWWPPEKCDYGTCSWGLAGLL  75

Query  535  NLDLSNIIFLNAIKAFSPLKIRLGGTLQDKVVYQTKDDRVPCTSFVSNTSEIFSFSQGCL  714
            NLDL+N IFLNA+KAFSPLKIRLGG+LQDKV+Y T D++ PCTSFV + SE+F F++GCL
Sbjct  76   NLDLNNNIFLNAVKAFSPLKIRLGGSLQDKVIYGTDDNQEPCTSFVKDPSEMFGFTKGCL  135

Query  715  PLSRWDELNVFFNKSG*PTRFIPCPAYICQHs*lyvsslrvllrAVIIFGLNALTGRSIR  894
            P+ RWDELN FF K+G                            A II GLNAL G+SI+
Sbjct  136  PMKRWDELNAFFAKAG----------------------------AKIIVGLNALAGKSIK  167

Query  895  SDASAVGAWDSTNAESLMKYTVEKGYTIHGWELG  996
               SAVGAW+ TNAES ++YTVEK Y IHGWELG
Sbjct  168  PGGSAVGAWNYTNAESFIRYTVEKNYKIHGWELG  201



>gb|EMT29716.1| Heparanase-like protein 3 [Aegilops tauschii]
Length=501

 Score =   231 bits (590),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 116/218 (53%), Positives = 139/218 (64%), Gaps = 28/218 (13%)
 Frame = +1

Query  343  LVLGVFNVSLISGSETLGDKGSVYVDGKSRIGRTDSDFICATLDWWPPEKCDYGTCAWGH  522
            L L V  V +++G     + G+V VDG+  I  T  DF+CATLDWWPP+KCDYGTC+WG+
Sbjct  4    LRLLVGAVLVVAGRGAAAESGAVTVDGRRAIASTGEDFVCATLDWWPPDKCDYGTCSWGN  63

Query  523  ASLLNLDLSNIIFLNAIKAFSPLKIRLGGTLQDKVVYQTKDDRVPCTSFVSNTSEIFSFS  702
            ASLLNLDLSN I LNAIKAFSPL +RLGG+LQDKVVY T D   PC  F  + SE+F F+
Sbjct  64   ASLLNLDLSNKILLNAIKAFSPLVLRLGGSLQDKVVYGTADRPGPCAPFNRSKSEMFGFT  123

Query  703  QGCLPLSRWDELNVFFNKSG*PTRFIPCPAYICQHs*lyvsslrvllrAVIIFGLNALTG  882
            QGCLP+ RWD+LN FF KSG                            A I+FGLNAL G
Sbjct  124  QGCLPMPRWDDLNAFFEKSG----------------------------AKIVFGLNALNG  155

Query  883  RSIRSDASAVGAWDSTNAESLMKYTVEKGYTIHGWELG  996
            R      +  G WD+TNA S ++YT  KGY I+GWELG
Sbjct  156  RVPLQGGAMGGNWDTTNAASFIRYTAGKGYKIYGWELG  193



>dbj|BAB10787.1| unnamed protein product [Arabidopsis thaliana]
Length=536

 Score =   232 bits (592),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 109/226 (48%), Positives = 148/226 (65%), Gaps = 28/226 (12%)
 Frame = +1

Query  319  FLQMRLWILVLGVFNVSLISGSETLGDKGSVYVDGKSRIGRTDSDFICATLDWWPPEKCD  498
            + Q+   +L L VF     + S  + + G+V+V G++ +G  D DFICATLDWWPPEKCD
Sbjct  3    YRQILAIVLFLCVFQFLDCTVSSAVEENGTVFVYGRAAVGTIDEDFICATLDWWPPEKCD  62

Query  499  YGTCAWGHASLLNLDLSNIIFLNAIKAFSPLKIRLGGTLQDKVVYQTKDDRVPCTSFVSN  678
            YG+C+W HAS+LNLDL+ ++ ++   AF+PLKIR+GGTLQD V+Y+T D + PC  F  N
Sbjct  63   YGSCSWDHASILNLDLTIVVPISKNTAFAPLKIRIGGTLQDIVIYETPDSKQPCLPFTKN  122

Query  679  TSEIFSFSQGCLPLSRWDELNVFFNKSG*PTRFIPCPAYICQHs*lyvsslrvllrAVII  858
            +S +F ++QGCLP+ RWDELN FF K+G                              +I
Sbjct  123  SSILFGYTQGCLPMRRWDELNAFFRKTG----------------------------TKVI  154

Query  859  FGLNALTGRSIRSDASAVGAWDSTNAESLMKYTVEKGYTIHGWELG  996
            FGLNAL+GRSI+S+  A+GAW+ TNAES +++T E  YTI GWELG
Sbjct  155  FGLNALSGRSIKSNGEAIGAWNYTNAESFIRFTAENNYTIDGWELG  200



>gb|KJB64649.1| hypothetical protein B456_010G059600 [Gossypium raimondii]
Length=545

 Score =   232 bits (592),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 127/214 (59%), Positives = 152/214 (71%), Gaps = 31/214 (14%)
 Frame = +1

Query  364  VSLISGSETLGD---KGSVYVDGKSRIGRTDSDFICATLDWWPPEKCDYGTCAWGHASLL  534
            VSL + +   GD   +G+VY+DGK+ IG  D DF+CATLDWWPPEKCDYGTC+WG A LL
Sbjct  16   VSLQAVAAAEGDAIVEGTVYIDGKAPIGIIDDDFVCATLDWWPPEKCDYGTCSWGLAGLL  75

Query  535  NLDLSNIIFLNAIKAFSPLKIRLGGTLQDKVVYQTKDDRVPCTSFVSNTSEIFSFSQGCL  714
            NLDL+N IFLNA+KAFSPLKIRLGG+LQDKV+Y T D++ PCTSFV + SE+F F++GCL
Sbjct  76   NLDLNNNIFLNAVKAFSPLKIRLGGSLQDKVIYGTDDNQEPCTSFVKDPSEMFGFTKGCL  135

Query  715  PLSRWDELNVFFNKSG*PTRFIPCPAYICQHs*lyvsslrvllrAVIIFGLNALTGRSIR  894
            P+ RWDELN FF K+G                            A II GLNAL G+SI+
Sbjct  136  PMKRWDELNAFFAKAG----------------------------AKIIVGLNALAGKSIK  167

Query  895  SDASAVGAWDSTNAESLMKYTVEKGYTIHGWELG  996
               SAVGAW+ TNAES ++YTVEK Y IHGWELG
Sbjct  168  PGGSAVGAWNYTNAESFIRYTVEKNYKIHGWELG  201



>gb|EPS66918.1| hypothetical protein M569_07858, partial [Genlisea aurea]
Length=523

 Score =   231 bits (590),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 113/203 (56%), Positives = 138/203 (68%), Gaps = 31/203 (15%)
 Frame = +1

Query  400  KGSVYVDGKSR-IGRTDSDFICATLDWWPPEKCDYGTCAWGHASLLNLDLSNIIFLNAIK  576
            KG++Y+DG +  I   D DFICAT+DWWPP KCDYGTC+WG+ASLLNLDL++ + +NA+K
Sbjct  21   KGTLYIDGAAPPIATVDEDFICATMDWWPPTKCDYGTCSWGNASLLNLDLTSSLLVNAVK  80

Query  577  AFSPLKIRLGGTLQDKVVYQTKDD--RVPCTSFVSNTSEIFSFSQGCLPLSRWDELNVFF  750
            AFSPLK+RLGGTLQD V YQT DD    PC  FVSN+SE+F F+ GCL LSRWDELN FF
Sbjct  81   AFSPLKLRLGGTLQDNVRYQTADDDSSTPCNEFVSNSSEMFGFTSGCLSLSRWDELNNFF  140

Query  751  NKSG*PTRFIPCPAYICQHs*lyvsslrvllrAVIIFGLNALTGRSIRSDASAVGAWDST  930
             K+G                            A ++FGLN L GR I SD +  GAWD T
Sbjct  141  KKTG----------------------------ANVVFGLNGLAGRHIGSDGTCTGAWDPT  172

Query  931  NAESLMKYTVEKGYTIHGWELGK  999
            NA SL+++TV+ GY +HGWELG 
Sbjct  173  NALSLIRHTVDNGYPVHGWELGN  195



>ref|XP_004964694.1| PREDICTED: heparanase-like protein 3-like [Setaria italica]
Length=572

 Score =   232 bits (592),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 112/193 (58%), Positives = 127/193 (66%), Gaps = 28/193 (15%)
 Frame = +1

Query  418  DGKSRIGRTDSDFICATLDWWPPEKCDYGTCAWGHASLLNLDLSNIIFLNAIKAFSPLKI  597
            DG+  +  T  DF+CATLDWWPP+KCDYGTCAWG A LLNLDLSN + LNAI+AFSPLK+
Sbjct  39   DGRRAVAATGEDFVCATLDWWPPDKCDYGTCAWGRAGLLNLDLSNKVLLNAIRAFSPLKL  98

Query  598  RLGGTLQDKVVYQTKDDRVPCTSFVSNTSEIFSFSQGCLPLSRWDELNVFFNKSG*PTRF  777
            RLGG+LQDKVVY T D   PCT FV N S++  F+QGCLPL RWDELN FF KSG     
Sbjct  99   RLGGSLQDKVVYGTADLGRPCTPFVKNASQMLGFTQGCLPLRRWDELNAFFQKSG-----  153

Query  778  IPCPAYICQHs*lyvsslrvllrAVIIFGLNALTGRSIRSDASAVGAWDSTNAESLMKYT  957
                                   A ++FGLNAL GR    D S  G WD TNA SL++YT
Sbjct  154  -----------------------AKVVFGLNALNGRVPLPDGSMGGPWDYTNAASLIRYT  190

Query  958  VEKGYTIHGWELG  996
              KGY IHGWELG
Sbjct  191  AYKGYQIHGWELG  203



>ref|XP_010906003.1| PREDICTED: heparanase-like protein 3 [Elaeis guineensis]
Length=545

 Score =   231 bits (589),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 116/200 (58%), Positives = 133/200 (67%), Gaps = 29/200 (15%)
 Frame = +1

Query  400  KGSVYVDGKSRIGRTDSDFICATLDWWPPEKCDYGTCAWGHASLLNLDLSNIIFLNAIKA  579
            +G+  +DG + I  TD DFICATLDWWPPEKCDYGTC+WG AS+LNL+LSN I LNA+K 
Sbjct  40   EGAAVIDGTTPIAVTDDDFICATLDWWPPEKCDYGTCSWGLASMLNLNLSNKILLNAVKE  99

Query  580  FSPLKIRLGGTLQDKVVYQTKDDRVPCTSFVSNTSEIFSFSQGCLPLSRWDELNVFFNKS  759
            FSPLK+RLGG+LQD V+Y   D   PCT FV NTSE+F F+QGCLP+ RWDELN FF KS
Sbjct  100  FSPLKLRLGGSLQDMVIYGM-DPHQPCTPFVKNTSEMFGFTQGCLPMHRWDELNNFFKKS  158

Query  760  G*PTRFIPCPAYICQHs*lyvsslrvllrAVIIFGLNALTGRSIRSDASAVGAWDSTNAE  939
                                        RAVIIFGLNAL GR    D S  G W+STNA 
Sbjct  159  ----------------------------RAVIIFGLNALNGRVPLPDGSLGGPWNSTNAA  190

Query  940  SLMKYTVEKGYTIHGWELGK  999
            S + +TV KGY IHGWELG 
Sbjct  191  SFIHHTVNKGYAIHGWELGN  210



>ref|XP_008394120.1| PREDICTED: heparanase-like protein 3 isoform X1 [Malus domestica]
Length=563

 Score =   231 bits (589),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 120/233 (52%), Positives = 146/233 (63%), Gaps = 58/233 (25%)
 Frame = +1

Query  388  TLGDKGSVYVDGKSRIGRTDSDFICATLDWWPPEKCDYGTCAWGHASLLNL---------  540
            +L  + +++V+  + IG TD DFICAT+DWWPP+KCDYGTC+WG ASLLNL         
Sbjct  33   SLSTEETLFVNKTAAIGATDDDFICATIDWWPPQKCDYGTCSWGSASLLNLHEIATCRKR  92

Query  541  ---------------------DLSNIIFLNAIKAFSPLKIRLGGTLQDKVVYQTKDDRVP  657
                                 DL N IFLNAIKAF+PLKIRLGGTLQDKV Y     + P
Sbjct  93   LCTKLQLSEKGYARNCNFQKKDLDNAIFLNAIKAFAPLKIRLGGTLQDKVTYLADGSQPP  152

Query  658  CTSFVSNTSEIFSFSQGCLPLSRWDELNVFFNKSG*PTRFIPCPAYICQHs*lyvsslrv  837
             TSFV + S++F FSQG LP+ RWD+LN FFNK+G                         
Sbjct  153  STSFVKDGSQLFGFSQGYLPMPRWDQLNSFFNKTG-------------------------  187

Query  838  llrAVIIFGLNALTGRSIRSDASAVGAWDSTNAESLMKYTVEKGYTIHGWELG  996
               AVIIFGLNAL GR+I S+ +A GAW+STNAE+L++YTV+KGYTIHGWELG
Sbjct  188  ---AVIIFGLNALIGRNIDSNGAATGAWNSTNAETLIRYTVDKGYTIHGWELG  237



>ref|XP_003609474.1| Heparanase-like protein [Medicago truncatula]
 gb|AES91671.1| glycoside hydrolase family 79 amino-terminal domain protein [Medicago 
truncatula]
Length=529

 Score =   230 bits (587),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 115/201 (57%), Positives = 137/201 (68%), Gaps = 31/201 (15%)
 Frame = +1

Query  400  KGSVYVDGKSRIGRTDSDFICATLDWWPPEKCDYGTCAWGHASLLNLDLSNIIFLNAIKA  579
            KG V + GK+ IGR D+DF+CATLDWWPP+KCD+G C+WGHASLLNLDL+N I LNAIKA
Sbjct  38   KGVVVIHGKAFIGRIDNDFVCATLDWWPPQKCDWGRCSWGHASLLNLDLNNKILLNAIKA  97

Query  580  FSPLKIRLGGTLQDKVVYQTKDDRVPCTSFVSNTSEI--FSFSQGCLPLSRWDELNVFFN  753
            FSPLKIRLGGTLQD V+Y T+D++  CT F  ++ E   F F++GCLP+ RWDELN FF 
Sbjct  98   FSPLKIRLGGTLQDMVIYGTEDNKQSCTPFALSSKEKIDFGFTKGCLPMQRWDELNSFFQ  157

Query  754  KSG*PTRFIPCPAYICQHs*lyvsslrvllrAVIIFGLNALTGRSIRSDASAVGAWDSTN  933
            K+G                              +IFGLNAL GRS  S  SAVG W+ TN
Sbjct  158  KAG----------------------------VKVIFGLNALAGRSFES-GSAVGPWNYTN  188

Query  934  AESLMKYTVEKGYTIHGWELG  996
            AES ++YTV K YTIHGWE G
Sbjct  189  AESFIRYTVAKKYTIHGWEFG  209



>ref|XP_006648064.1| PREDICTED: heparanase-like protein 3-like [Oryza brachyantha]
Length=549

 Score =   231 bits (588),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 114/197 (58%), Positives = 131/197 (66%), Gaps = 28/197 (14%)
 Frame = +1

Query  406  SVYVDGKSRIGRTDSDFICATLDWWPPEKCDYGTCAWGHASLLNLDLSNIIFLNAIKAFS  585
            +V VD +S I  TD DF+CATLDWWPP+KCDYGTC+WG A+LLNLDLSN I LNA+KAFS
Sbjct  36   AVVVDARSAIAVTDEDFVCATLDWWPPDKCDYGTCSWGLATLLNLDLSNKILLNAVKAFS  95

Query  586  PLKIRLGGTLQDKVVYQTKDDRVPCTSFVSNTSEIFSFSQGCLPLSRWDELNVFFNKSG*  765
            PLK+RLGG+LQD ++Y   D R  CT F  N+S +F F+QGCLPL RWDELNVFF KSG 
Sbjct  96   PLKLRLGGSLQDVLIYDNGDPRQLCTPFTKNSSAMFGFTQGCLPLHRWDELNVFFQKSG-  154

Query  766  PTRFIPCPAYICQHs*lyvsslrvllrAVIIFGLNALTGRSIRSDASAVGAWDSTNAESL  945
                                       A IIFGLNAL GR    D S  G W+ TNA S 
Sbjct  155  ---------------------------AKIIFGLNALNGRVPMPDGSLGGPWNYTNAASF  187

Query  946  MKYTVEKGYTIHGWELG  996
            ++YTV KGY IHGWELG
Sbjct  188  IRYTVSKGYDIHGWELG  204



>gb|EAY87898.1| hypothetical protein OsI_09318 [Oryza sativa Indica Group]
 gb|ACR10239.1| heparanase [Oryza sativa Indica Group]
Length=541

 Score =   230 bits (586),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 112/191 (59%), Positives = 129/191 (68%), Gaps = 28/191 (15%)
 Frame = +1

Query  424  KSRIGRTDSDFICATLDWWPPEKCDYGTCAWGHASLLNLDLSNIIFLNAIKAFSPLKIRL  603
            +S I  TD DF+CATLDWWPP+KCDYGTC+WG A+LLN+DLSN I LNA+KAFSPLK+RL
Sbjct  44   RSAIAVTDEDFVCATLDWWPPDKCDYGTCSWGLATLLNMDLSNKILLNAVKAFSPLKLRL  103

Query  604  GGTLQDKVVYQTKDDRVPCTSFVSNTSEIFSFSQGCLPLSRWDELNVFFNKSG*PTRFIP  783
            GG+LQD ++Y T D R PCT F  N+S +F F+QGCLPL RWDELN FF KSG       
Sbjct  104  GGSLQDVLIYDTGDPRQPCTPFTKNSSAMFGFTQGCLPLHRWDELNAFFQKSG-------  156

Query  784  CPAYICQHs*lyvsslrvllrAVIIFGLNALTGRSIRSDASAVGAWDSTNAESLMKYTVE  963
                                 A IIFGLNAL GR   SD S  G W+ TNA S ++YTV 
Sbjct  157  ---------------------AKIIFGLNALNGRVPMSDDSLGGPWNYTNAASFIRYTVS  195

Query  964  KGYTIHGWELG  996
            KGY IHGWELG
Sbjct  196  KGYDIHGWELG  206



>ref|NP_001048420.1| Os02g0802200 [Oryza sativa Japonica Group]
 dbj|BAD36026.1| putative beta-glucuronidase precursor [Oryza sativa Japonica 
Group]
 dbj|BAD36734.1| putative beta-glucuronidase precursor [Oryza sativa Japonica 
Group]
 dbj|BAF10334.1| Os02g0802200 [Oryza sativa Japonica Group]
 gb|EAZ24974.1| hypothetical protein OsJ_08752 [Oryza sativa Japonica Group]
 dbj|BAG98079.1| unnamed protein product [Oryza sativa Japonica Group]
Length=541

 Score =   230 bits (586),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 112/191 (59%), Positives = 129/191 (68%), Gaps = 28/191 (15%)
 Frame = +1

Query  424  KSRIGRTDSDFICATLDWWPPEKCDYGTCAWGHASLLNLDLSNIIFLNAIKAFSPLKIRL  603
            +S I  TD DF+CATLDWWPP+KCDYGTC+WG A+LLN+DLSN I LNA+KAFSPLK+RL
Sbjct  44   RSAIAVTDEDFVCATLDWWPPDKCDYGTCSWGLATLLNMDLSNKILLNAVKAFSPLKLRL  103

Query  604  GGTLQDKVVYQTKDDRVPCTSFVSNTSEIFSFSQGCLPLSRWDELNVFFNKSG*PTRFIP  783
            GG+LQD ++Y T D R PCT F  N+S +F F+QGCLPL RWDELN FF KSG       
Sbjct  104  GGSLQDVLIYDTGDPRQPCTPFTKNSSAMFGFTQGCLPLHRWDELNAFFQKSG-------  156

Query  784  CPAYICQHs*lyvsslrvllrAVIIFGLNALTGRSIRSDASAVGAWDSTNAESLMKYTVE  963
                                 A IIFGLNAL GR   SD S  G W+ TNA S ++YTV 
Sbjct  157  ---------------------AKIIFGLNALNGRVPMSDDSLGGPWNYTNAASFIRYTVS  195

Query  964  KGYTIHGWELG  996
            KGY IHGWELG
Sbjct  196  KGYDIHGWELG  206



>gb|ERN14303.1| hypothetical protein AMTR_s00033p00188330 [Amborella trichopoda]
Length=544

 Score =   230 bits (586),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 122/223 (55%), Positives = 144/223 (65%), Gaps = 34/223 (15%)
 Frame = +1

Query  340  ILVLGVFNVSLISGSETLGDKGSVYVDGKSRIGRTDSDFICATLDWWPPEKCDYGTCAWG  519
            + V G  NV   +G+ ++ + G V ++G S I  TD  FICAT+DWWPPEKCDYGTC+W 
Sbjct  16   VFVSGFLNVHCGNGNSSVVE-GEVLINGSSVIAETDGSFICATMDWWPPEKCDYGTCSWD  74

Query  520  HASLLNLDLSNIIFLNAIKAFSPLKIRLGGTLQDKVVYQTKDDRVPCT--SFVSNTSEIF  693
            HASLLNLDL+N I  NA+KAFSPLKIRLGGTLQDKVVY+ +   VPCT  SFV N SE+F
Sbjct  75   HASLLNLDLNNTILHNAVKAFSPLKIRLGGTLQDKVVYEMRG--VPCTPSSFVKNASEMF  132

Query  694  SFSQGCLPLSRWDELNVFFNKSG*PTRFIPCPAYICQHs*lyvsslrvllrAVIIFGLNA  873
             F+QGCLP+ RWDELN FF KSG                            A + FGLNA
Sbjct  133  GFTQGCLPIKRWDELNYFFKKSG----------------------------ARVYFGLNA  164

Query  874  LTGRSIRSDASAVGAWDSTNAESLMKYTVEKGYT-IHGWELGK  999
            L GR    D S  G W+STNA  L++YTV +GYT I GWELG 
Sbjct  165  LNGRVPLPDGSLGGPWNSTNAVGLIRYTVNRGYTAIRGWELGN  207



>gb|KCW81361.1| hypothetical protein EUGRSUZ_C02742 [Eucalyptus grandis]
Length=435

 Score =   227 bits (579),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 107/198 (54%), Positives = 135/198 (68%), Gaps = 28/198 (14%)
 Frame = +1

Query  403  GSVYVDGKSRIGRTDSDFICATLDWWPPEKCDYGTCAWGHASLLNLDLSNIIFLNAIKAF  582
            G ++++G + + +TD D+ICATLDWWPPEKCDYGTC+WG A+L  LDL N + LNA+KAF
Sbjct  34   GILFINGTASVAKTDDDYICATLDWWPPEKCDYGTCSWGRATLQTLDLKNTLLLNAVKAF  93

Query  583  SPLKIRLGGTLQDKVVYQTKDDRVPCTSFVSNTSEIFSFSQGCLPLSRWDELNVFFNKSG  762
            SPL+IR+GGTLQDKVVY+T+ D  PC  F  N+SE   FSQGCLPL+RWDELN FF ++G
Sbjct  94   SPLRIRIGGTLQDKVVYETQGDDRPCGIFTKNSSEFLGFSQGCLPLARWDELNSFFKQTG  153

Query  763  *PTRFIPCPAYICQHs*lyvsslrvllrAVIIFGLNALTGRSIRSDASAVGAWDSTNAES  942
                                        + + FGLNAL GR I SD+   G W+S+N ES
Sbjct  154  ----------------------------SAVTFGLNALYGRIIGSDSFVNGPWNSSNTES  185

Query  943  LMKYTVEKGYTIHGWELG  996
            L++YTV KGY+I GWELG
Sbjct  186  LIRYTVNKGYSILGWELG  203



>ref|XP_006852836.2| PREDICTED: heparanase-like protein 3 [Amborella trichopoda]
Length=537

 Score =   229 bits (585),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 122/223 (55%), Positives = 144/223 (65%), Gaps = 34/223 (15%)
 Frame = +1

Query  340  ILVLGVFNVSLISGSETLGDKGSVYVDGKSRIGRTDSDFICATLDWWPPEKCDYGTCAWG  519
            + V G  NV   +G+ ++ + G V ++G S I  TD  FICAT+DWWPPEKCDYGTC+W 
Sbjct  9    VFVSGFLNVHCGNGNSSVVE-GEVLINGSSVIAETDGSFICATMDWWPPEKCDYGTCSWD  67

Query  520  HASLLNLDLSNIIFLNAIKAFSPLKIRLGGTLQDKVVYQTKDDRVPCT--SFVSNTSEIF  693
            HASLLNLDL+N I  NA+KAFSPLKIRLGGTLQDKVVY+ +   VPCT  SFV N SE+F
Sbjct  68   HASLLNLDLNNTILHNAVKAFSPLKIRLGGTLQDKVVYEMRG--VPCTPSSFVKNASEMF  125

Query  694  SFSQGCLPLSRWDELNVFFNKSG*PTRFIPCPAYICQHs*lyvsslrvllrAVIIFGLNA  873
             F+QGCLP+ RWDELN FF KSG                            A + FGLNA
Sbjct  126  GFTQGCLPIKRWDELNYFFKKSG----------------------------ARVYFGLNA  157

Query  874  LTGRSIRSDASAVGAWDSTNAESLMKYTVEKGYT-IHGWELGK  999
            L GR    D S  G W+STNA  L++YTV +GYT I GWELG 
Sbjct  158  LNGRVPLPDGSLGGPWNSTNAVGLIRYTVNRGYTAIRGWELGN  200



>dbj|BAJ90636.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=524

 Score =   228 bits (582),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 112/200 (56%), Positives = 129/200 (65%), Gaps = 28/200 (14%)
 Frame = +1

Query  397  DKGSVYVDGKSRIGRTDSDFICATLDWWPPEKCDYGTCAWGHASLLNLDLSNIIFLNAIK  576
            D   V VDG+  I  T  DF+CATLDWWPPEKCDYGTC+WG ASLLNLDLSN I LNAI+
Sbjct  24   DARVVGVDGRRAIASTGEDFVCATLDWWPPEKCDYGTCSWGRASLLNLDLSNKILLNAIR  83

Query  577  AFSPLKIRLGGTLQDKVVYQTKDDRVPCTSFVSNTSEIFSFSQGCLPLSRWDELNVFFNK  756
            AFSPL +RLGG+LQDKVVY T D   PC  F  + SE+F F+QGCLP+ RWD+LN FF K
Sbjct  84   AFSPLVLRLGGSLQDKVVYGTADHGGPCAPFAKSESEMFGFTQGCLPMRRWDDLNAFFQK  143

Query  757  SG*PTRFIPCPAYICQHs*lyvsslrvllrAVIIFGLNALTGRSIRSDASAVGAWDSTNA  936
            SG                            A I+FGLNAL GR      +  GAW+ +NA
Sbjct  144  SG----------------------------AKIVFGLNALNGRVPLQGGAMGGAWNISNA  175

Query  937  ESLMKYTVEKGYTIHGWELG  996
             SL++YT  KGY IHGWELG
Sbjct  176  ASLIRYTAGKGYKIHGWELG  195



>ref|XP_010048937.1| PREDICTED: heparanase-like protein 3 isoform X1 [Eucalyptus grandis]
 gb|KCW81360.1| hypothetical protein EUGRSUZ_C02742 [Eucalyptus grandis]
Length=543

 Score =   228 bits (582),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 107/199 (54%), Positives = 135/199 (68%), Gaps = 28/199 (14%)
 Frame = +1

Query  403  GSVYVDGKSRIGRTDSDFICATLDWWPPEKCDYGTCAWGHASLLNLDLSNIIFLNAIKAF  582
            G ++++G + + +TD D+ICATLDWWPPEKCDYGTC+WG A+L  LDL N + LNA+KAF
Sbjct  34   GILFINGTASVAKTDDDYICATLDWWPPEKCDYGTCSWGRATLQTLDLKNTLLLNAVKAF  93

Query  583  SPLKIRLGGTLQDKVVYQTKDDRVPCTSFVSNTSEIFSFSQGCLPLSRWDELNVFFNKSG  762
            SPL+IR+GGTLQDKVVY+T+ D  PC  F  N+SE   FSQGCLPL+RWDELN FF ++G
Sbjct  94   SPLRIRIGGTLQDKVVYETQGDDRPCGIFTKNSSEFLGFSQGCLPLARWDELNSFFKQTG  153

Query  763  *PTRFIPCPAYICQHs*lyvsslrvllrAVIIFGLNALTGRSIRSDASAVGAWDSTNAES  942
                                        + + FGLNAL GR I SD+   G W+S+N ES
Sbjct  154  ----------------------------SAVTFGLNALYGRIIGSDSFVNGPWNSSNTES  185

Query  943  LMKYTVEKGYTIHGWELGK  999
            L++YTV KGY+I GWELG 
Sbjct  186  LIRYTVNKGYSILGWELGN  204



>ref|XP_010100865.1| Heparanase-like protein 3 [Morus notabilis]
 gb|EXB85444.1| Heparanase-like protein 3 [Morus notabilis]
Length=534

 Score =   226 bits (576),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 112/199 (56%), Positives = 132/199 (66%), Gaps = 46/199 (23%)
 Frame = +1

Query  400  KGSVYVDGKSRIGRTDSDFICATLDWWPPEKCDYGTCAWGHASLLNLDLSNIIFLNAIKA  579
            +G+V++DGKS IGR D DFICATLDWWPPEKCDYGTC+WG ASLLNL             
Sbjct  40   EGTVFIDGKSAIGRIDDDFICATLDWWPPEKCDYGTCSWGRASLLNL-------------  86

Query  580  FSPLKIRLGGTLQDKVVYQTKDDRVPCTSFVSNTSEIFSFSQGCLPLSRWDELNVFFNKS  759
                 IRLGGTLQDKV+Y+T+D++  CT FV NTSE+F F+QGCLPL+RWD+LN FF  S
Sbjct  87   -----IRLGGTLQDKVIYETEDNKQTCTPFVRNTSELFGFTQGCLPLNRWDQLNSFFKAS  141

Query  760  G*PTRFIPCPAYICQHs*lyvsslrvllrAVIIFGLNALTGRSIRSDASAVGAWDSTNAE  939
            G                            A IIFGLNAL GR+I+ D SA GAWD +NAE
Sbjct  142  G----------------------------AKIIFGLNALAGRTIQKDGSATGAWDYSNAE  173

Query  940  SLMKYTVEKGYTIHGWELG  996
            S ++YTV+K Y IHGWELG
Sbjct  174  SFIRYTVKKNYPIHGWELG  192



>ref|XP_002452991.1| hypothetical protein SORBIDRAFT_04g036200 [Sorghum bicolor]
 gb|EES05967.1| hypothetical protein SORBIDRAFT_04g036200 [Sorghum bicolor]
Length=540

 Score =   223 bits (569),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 119/221 (54%), Positives = 140/221 (63%), Gaps = 28/221 (13%)
 Frame = +1

Query  334  LWILVLGVFNVSLISGSETLGDKGSVYVDGKSRIGRTDSDFICATLDWWPPEKCDYGTCA  513
            +W L     + ++ + +       +V VD +S I  TD DF+CATLDWWPPEKCDYGTC+
Sbjct  14   VWALFWLAGSATVSTSTTAFAGSEAVVVDARSAIAVTDDDFVCATLDWWPPEKCDYGTCS  73

Query  514  WGHASLLNLDLSNIIFLNAIKAFSPLKIRLGGTLQDKVVYQTKDDRVPCTSFVSNTSEIF  693
            WG  SLLNL+LSN I +NA+KAFSPLK+RLGGTLQD V+Y T D R PCT FV NTS +F
Sbjct  74   WGLDSLLNLNLSNKILMNAVKAFSPLKLRLGGTLQDMVIYDTGDSRQPCTPFVKNTSAMF  133

Query  694  SFSQGCLPLSRWDELNVFFNKSG*PTRFIPCPAYICQHs*lyvsslrvllrAVIIFGLNA  873
             FSQGCLPL RWDELN FF K+G                              +IFGLNA
Sbjct  134  GFSQGCLPLHRWDELNAFFQKTG----------------------------PKVIFGLNA  165

Query  874  LTGRSIRSDASAVGAWDSTNAESLMKYTVEKGYTIHGWELG  996
            LTGR    D S  G W+ TNA S ++YTV KGY IHGWELG
Sbjct  166  LTGRVPMPDGSLGGPWNYTNAASFIRYTVNKGYDIHGWELG  206



>ref|XP_009792771.1| PREDICTED: heparanase-like protein 3 isoform X1 [Nicotiana sylvestris]
Length=550

 Score =   223 bits (567),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 114/204 (56%), Positives = 139/204 (68%), Gaps = 32/204 (16%)
 Frame = +1

Query  397  DKGSVYVDGKSRIGRTDSDFICATLDWWPPEKCDYGTCAWGHASLLNLDLS----NIIFL  564
            +KGS+Y+DG + I + D DFICATLDWWP  KCDYGTC+WG++SLLNL L     N + L
Sbjct  38   EKGSIYIDGSAAIAKIDEDFICATLDWWPSNKCDYGTCSWGNSSLLNLSLLQDLSNKVLL  97

Query  565  NAIKAFSPLKIRLGGTLQDKVVYQTKDDRVPCTSFVSNTSEIFSFSQGCLPLSRWDELNV  744
            NAI+AFSPLKIRLGGTLQDK+VYQT     PC+ F+ N  E+F F+QGCLPLSRWDELN 
Sbjct  98   NAIRAFSPLKIRLGGTLQDKIVYQTAHYEQPCSPFLLNNKELFGFTQGCLPLSRWDELNQ  157

Query  745  FFNKSG*PTRFIPCPAYICQHs*lyvsslrvllrAVIIFGLNALTGRSIRSDASAVGAWD  924
            FF K+G                            A + FGLNAL G++I  + SA+G WD
Sbjct  158  FFKKTG----------------------------AKVTFGLNALNGKTIAPNGSALGDWD  189

Query  925  STNAESLMKYTVEKGYTIHGWELG  996
            S+NAES ++YTV +GYTI GWELG
Sbjct  190  SSNAESFIRYTVSRGYTILGWELG  213



>gb|KJB27356.1| hypothetical protein B456_004G293000 [Gossypium raimondii]
Length=532

 Score =   222 bits (565),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 106/199 (53%), Positives = 134/199 (67%), Gaps = 46/199 (23%)
 Frame = +1

Query  403  GSVYVDGKSRIGRTDSDFICATLDWWPPEKCDYGTCAWGHASLLNLDLSNIIFLNAIKAF  582
            G+V+V+G + IG+TD +FICATLDWW P KCDYGTC+W  +SLLNL              
Sbjct  34   GTVFVNGTASIGKTDDNFICATLDWWAPNKCDYGTCSWERSSLLNL--------------  79

Query  583  SPLKIRLGGTLQDKVVYQTKDDRVPCTSFVSNTSEIFSFSQGCLPLSRWDELNVFFNKSG  762
                IR+GGTLQDKV+Y+TKDD+ PC  FV N+SE+F FS+GCLP+SRWD+LNVFF K+G
Sbjct  80   ----IRMGGTLQDKVIYETKDDKSPCAPFVKNSSEMFGFSKGCLPMSRWDQLNVFFKKAG  135

Query  763  *PTRFIPCPAYICQHs*lyvsslrvllrAVIIFGLNALTGRSIRSDASAVGAWDSTNAES  942
                                        A+++FGLNAL G++I SD SA GAW+S+NAES
Sbjct  136  ----------------------------AMVVFGLNALNGKAIGSDGSATGAWNSSNAES  167

Query  943  LMKYTVEKGYTIHGWELGK  999
            L++YTV KGY+IHGWELG 
Sbjct  168  LIRYTVNKGYSIHGWELGN  186



>gb|KJB27355.1| hypothetical protein B456_004G293000 [Gossypium raimondii]
Length=505

 Score =   221 bits (563),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 106/199 (53%), Positives = 134/199 (67%), Gaps = 46/199 (23%)
 Frame = +1

Query  403  GSVYVDGKSRIGRTDSDFICATLDWWPPEKCDYGTCAWGHASLLNLDLSNIIFLNAIKAF  582
            G+V+V+G + IG+TD +FICATLDWW P KCDYGTC+W  +SLLNL              
Sbjct  34   GTVFVNGTASIGKTDDNFICATLDWWAPNKCDYGTCSWERSSLLNL--------------  79

Query  583  SPLKIRLGGTLQDKVVYQTKDDRVPCTSFVSNTSEIFSFSQGCLPLSRWDELNVFFNKSG  762
                IR+GGTLQDKV+Y+TKDD+ PC  FV N+SE+F FS+GCLP+SRWD+LNVFF K+G
Sbjct  80   ----IRMGGTLQDKVIYETKDDKSPCAPFVKNSSEMFGFSKGCLPMSRWDQLNVFFKKAG  135

Query  763  *PTRFIPCPAYICQHs*lyvsslrvllrAVIIFGLNALTGRSIRSDASAVGAWDSTNAES  942
                                        A+++FGLNAL G++I SD SA GAW+S+NAES
Sbjct  136  ----------------------------AMVVFGLNALNGKAIGSDGSATGAWNSSNAES  167

Query  943  LMKYTVEKGYTIHGWELGK  999
            L++YTV KGY+IHGWELG 
Sbjct  168  LIRYTVNKGYSIHGWELGN  186



>dbj|BAJ89245.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=549

 Score =   221 bits (563),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 107/187 (57%), Positives = 122/187 (65%), Gaps = 28/187 (15%)
 Frame = +1

Query  439  RTDSDFICATLDWWPPEKCDYGTCAWGHASLLNLDLSNIIFLNAIKAFSPLKIRLGGTLQ  618
             TDS F+CATLDWWPPEKCDYGTCAWG A LLNLDLS+ I  NA+KAFSPL++RLGG+LQ
Sbjct  59   ETDSAFVCATLDWWPPEKCDYGTCAWGRAGLLNLDLSSKILQNAVKAFSPLRLRLGGSLQ  118

Query  619  DKVVYQTKDDRVPCTSFVSNTSEIFSFSQGCLPLSRWDELNVFFNKSG*PTRFIPCPAYI  798
            D VVY T D   PC+ F  NTS +F F+QGCLP+ RWDELN FF +SG            
Sbjct  119  DLVVYGTGDTGAPCSPFTKNTSAMFGFTQGCLPMHRWDELNAFFQESG------------  166

Query  799  CQHs*lyvsslrvllrAVIIFGLNALTGRSIRSDASAVGAWDSTNAESLMKYTVEKGYTI  978
                            A I+FGLNAL GR    D S  G WD TNA S ++YTV KGY I
Sbjct  167  ----------------AQIVFGLNALNGRVPMPDGSMGGPWDYTNAASFIQYTVSKGYDI  210

Query  979  HGWELGK  999
            +GWELG 
Sbjct  211  YGWELGN  217



>ref|XP_011457618.1| PREDICTED: heparanase-like protein 3 [Fragaria vesca subsp. vesca]
Length=559

 Score =   219 bits (559),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 105/202 (52%), Positives = 135/202 (67%), Gaps = 34/202 (17%)
 Frame = +1

Query  409  VYVDGKSRIGRTDSDFICATLDWWPPEKCDYGTCAWGHASLLNLDLSNIIFLNAIKAFSP  588
            + +DGK  I + D DFICATLDWWPPEKCDYGTC+WG  SLLNLDLSN I  NAIKAFSP
Sbjct  42   IRIDGKEAIAKVDEDFICATLDWWPPEKCDYGTCSWGKTSLLNLDLSNTILSNAIKAFSP  101

Query  589  LKIRLGGTLQDKVVYQTKDDRVPCT--SFVSNTS----EIFSFSQGCLPLSRWDELNVFF  750
            LK+RLGGTLQD+++Y T+D++ PC    FV N +    E+F F++ CLP+ RWDELN FF
Sbjct  102  LKLRLGGTLQDQIIYDTEDNKKPCPPIPFVENNTTLFGEMFGFNEACLPMKRWDELNSFF  161

Query  751  NKSG*PTRFIPCPAYICQHs*lyvsslrvllrAVIIFGLNALTGRSIRSDASAVGAWDST  930
             ++G                            A I+FGLN LTG++ +++  A+G WD T
Sbjct  162  LRTG----------------------------AKIVFGLNVLTGKTFKNNIPAIGDWDFT  193

Query  931  NAESLMKYTVEKGYTIHGWELG  996
            NAES ++YTV+  Y++ GWELG
Sbjct  194  NAESFIRYTVKNNYSVAGWELG  215



>ref|XP_002437942.1| hypothetical protein SORBIDRAFT_10g005260 [Sorghum bicolor]
 gb|EER89309.1| hypothetical protein SORBIDRAFT_10g005260 [Sorghum bicolor]
Length=554

 Score =   217 bits (553),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 109/203 (54%), Positives = 126/203 (62%), Gaps = 30/203 (15%)
 Frame = +1

Query  394  GDKGSVYVDGKSRIGRTDSDFICATLDWWPPEKCDYGTCAWGHASLLNLDLSNIIFLNAI  573
            G      VD +  +  T  DF+CATLDWWPP+KCDYGTCAWG A LLNLDLSN + LNA+
Sbjct  31   GQPAVATVDARRAVAATGEDFVCATLDWWPPDKCDYGTCAWGRAGLLNLDLSNKVLLNAV  90

Query  574  KAFS-PLKIRLGGTLQDKVVYQTKD-DRVPCTSFVSNTSEIFSFSQGCLPLSRWDELNVF  747
            +AFS PL +RLGG+LQ+KVVY T D    PC  F  N SE+  F+QGCLPL RWDELN F
Sbjct  91   RAFSPPLVLRLGGSLQNKVVYGTADLGGRPCAPFAKNASEMHGFTQGCLPLRRWDELNAF  150

Query  748  FNKSG*PTRFIPCPAYICQHs*lyvsslrvllrAVIIFGLNALTGRSIRSDASAVGAWDS  927
            F KSG                            A I+FGLNAL GR    D S  G WD 
Sbjct  151  FQKSG----------------------------AKIVFGLNALNGRVPLPDKSMGGPWDY  182

Query  928  TNAESLMKYTVEKGYTIHGWELG  996
            TNA +L++Y+V KGY IHGWELG
Sbjct  183  TNAAALIRYSVNKGYRIHGWELG  205



>ref|XP_010048935.1| PREDICTED: heparanase-like protein 3 [Eucalyptus grandis]
Length=551

 Score =   217 bits (553),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 109/199 (55%), Positives = 138/199 (69%), Gaps = 28/199 (14%)
 Frame = +1

Query  403  GSVYVDGKSRIGRTDSDFICATLDWWPPEKCDYGTCAWGHASLLNLDLSNIIFLNAIKAF  582
            G+V+++G + I +TD D+ICATLDWWPPEKCDY TC+WG A+LL LDL+N I +NA+KAF
Sbjct  42   GTVFINGTASIAKTDDDYICATLDWWPPEKCDYNTCSWGRATLLTLDLTNTILINAVKAF  101

Query  583  SPLKIRLGGTLQDKVVYQTKDDRVPCTSFVSNTSEIFSFSQGCLPLSRWDELNVFFNKSG  762
            SPL+IR+GGTLQDKVVY+ + D+  C  F  N+SE   FSQGCLPL+RWDELN FF ++G
Sbjct  102  SPLRIRMGGTLQDKVVYEKQGDQSTCNIFTKNSSEFLGFSQGCLPLARWDELNSFFKQTG  161

Query  763  *PTRFIPCPAYICQHs*lyvsslrvllrAVIIFGLNALTGRSIRSDASAVGAWDSTNAES  942
                                        + + FGLNAL GR+I SD S  G W+S+NAES
Sbjct  162  ----------------------------SAVTFGLNALYGRTIGSDGSVNGPWNSSNAES  193

Query  943  LMKYTVEKGYTIHGWELGK  999
            L++YTV KGY+I GWELG 
Sbjct  194  LIRYTVNKGYSILGWELGN  212



>ref|NP_001152083.1| heparanase-like protein 3 precursor [Zea mays]
 gb|ACG45701.1| heparanase-like protein 3 precursor [Zea mays]
Length=552

 Score =   217 bits (552),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 108/194 (56%), Positives = 124/194 (64%), Gaps = 30/194 (15%)
 Frame = +1

Query  418  DGKSRIGRTDSDFICATLDWWPPEKCDYGTCAWGHASLLNLDLSNIIFLNAIKAFS-PLK  594
            DG+  +  T  DF+CATLDWWPP+KCDYGTCAWG A LLNLDLSN + LNA++AFS PL 
Sbjct  38   DGRRAVAATGEDFVCATLDWWPPDKCDYGTCAWGRAGLLNLDLSNKVLLNAVRAFSPPLL  97

Query  595  IRLGGTLQDKVVYQTKDDRVPCTSFVSNTSEIFSFSQGCLPLSRWDELNVFFNKSG*PTR  774
            +RLGG+LQDKVVY     R PC  FV N SE+  FSQGCLPL RWD+LN FF +SG    
Sbjct  98   LRLGGSLQDKVVYGYGAGR-PCAPFVRNASEMHGFSQGCLPLRRWDDLNAFFRRSG----  152

Query  775  FIPCPAYICQHs*lyvsslrvllrAVIIFGLNALTGRSIRSDASAVGAWDSTNAESLMKY  954
                                    A ++FGLNAL GR    D S  G WD TNA SL++Y
Sbjct  153  ------------------------AKVVFGLNALNGRVPLPDGSMGGPWDYTNAASLIRY  188

Query  955  TVEKGYTIHGWELG  996
            T  KGY IHGWELG
Sbjct  189  TANKGYRIHGWELG  202



>ref|NP_001132339.1| uncharacterized protein LOC100193781 precursor [Zea mays]
 gb|ACG29680.1| heparanase-like protein 3 precursor [Zea mays]
Length=543

 Score =   216 bits (551),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 107/194 (55%), Positives = 122/194 (63%), Gaps = 29/194 (15%)
 Frame = +1

Query  418  DGKSRIGRTDSDFICATLDWWPPEKCDYGTCAWGHASLLNLDLSNIIFLNAIKAFS-PLK  594
            DG+  I  T  +F+CATLDWWPP+KCDYGTC WG A LLNLDLSN + LNA++AFS PL 
Sbjct  35   DGRRAIAATGENFVCATLDWWPPDKCDYGTCPWGRAGLLNLDLSNKVLLNAVRAFSPPLM  94

Query  595  IRLGGTLQDKVVYQTKDDRVPCTSFVSNTSEIFSFSQGCLPLSRWDELNVFFNKSG*PTR  774
            +RLGG+LQDKVVY T D   PC  F  N SE+  F+QGCL L RWDELN FF KSG    
Sbjct  95   LRLGGSLQDKVVYGTADLGRPCAPFAKNASEMHGFTQGCLTLRRWDELNAFFQKSG----  150

Query  775  FIPCPAYICQHs*lyvsslrvllrAVIIFGLNALTGRSIRSDASAVGAWDSTNAESLMKY  954
                                    A I+FG+NAL GR    D S  G WD TNA SL++Y
Sbjct  151  ------------------------ARIVFGINALNGRVPLPDGSMGGPWDYTNAASLIRY  186

Query  955  TVEKGYTIHGWELG  996
            T  KGY IHGWELG
Sbjct  187  TANKGYRIHGWELG  200



>gb|ACF81144.1| unknown [Zea mays]
 gb|AFW77132.1| heparanase-like protein 3 [Zea mays]
Length=543

 Score =   216 bits (551),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 107/194 (55%), Positives = 122/194 (63%), Gaps = 29/194 (15%)
 Frame = +1

Query  418  DGKSRIGRTDSDFICATLDWWPPEKCDYGTCAWGHASLLNLDLSNIIFLNAIKAFS-PLK  594
            DG+  I  T  +F+CATLDWWPP+KCDYGTC WG A LLNLDLSN + LNA++AFS PL 
Sbjct  35   DGRRAIAATGENFVCATLDWWPPDKCDYGTCPWGRAGLLNLDLSNKVLLNAVRAFSPPLM  94

Query  595  IRLGGTLQDKVVYQTKDDRVPCTSFVSNTSEIFSFSQGCLPLSRWDELNVFFNKSG*PTR  774
            +RLGG+LQDKVVY T D   PC  F  N SE+  F+QGCL L RWDELN FF KSG    
Sbjct  95   LRLGGSLQDKVVYGTADLGRPCAPFAKNASEMHGFTQGCLTLRRWDELNAFFQKSG----  150

Query  775  FIPCPAYICQHs*lyvsslrvllrAVIIFGLNALTGRSIRSDASAVGAWDSTNAESLMKY  954
                                    A I+FG+NAL GR    D S  G WD TNA SL++Y
Sbjct  151  ------------------------ARIVFGINALNGRVPLPDGSMGGPWDYTNAASLIRY  186

Query  955  TVEKGYTIHGWELG  996
            T  KGY IHGWELG
Sbjct  187  TANKGYRIHGWELG  200



>ref|XP_009409980.1| PREDICTED: heparanase-like protein 3 [Musa acuminata subsp. malaccensis]
Length=549

 Score =   216 bits (551),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 118/201 (59%), Positives = 140/201 (70%), Gaps = 28/201 (14%)
 Frame = +1

Query  397  DKGSVYVDGKSRIGRTDSDFICATLDWWPPEKCDYGTCAWGHASLLNLDLSNIIFLNAIK  576
            D  +V VDG + I  TD DF+CATLDWWPPEKCDYGTC+WG ASLLNL+LSN I LNA+K
Sbjct  37   DAVAVVVDGTAAIAVTDGDFVCATLDWWPPEKCDYGTCSWGLASLLNLNLSNPILLNAVK  96

Query  577  AFSPLKIRLGGTLQDKVVYQTKDDRVPCTSFVSNTSEIFSFSQGCLPLSRWDELNVFFNK  756
            AFSPLK+RLGG+LQDK++Y T D +  CT F+ +TSE+F F+QGCLP+SRWDELN FF K
Sbjct  97   AFSPLKLRLGGSLQDKIIYGTGDPKQSCTQFIKSTSEMFGFTQGCLPMSRWDELNEFFQK  156

Query  757  SG*PTRFIPCPAYICQHs*lyvsslrvllrAVIIFGLNALTGRSIRSDASAVGAWDSTNA  936
            +G                            AVIIFGLNAL GR   SD S  G W+ +NA
Sbjct  157  AG----------------------------AVIIFGLNALNGRVPLSDGSLGGPWNYSNA  188

Query  937  ESLMKYTVEKGYTIHGWELGK  999
             +L++YTV KGYTIHGWELG 
Sbjct  189  AALIRYTVNKGYTIHGWELGN  209



>ref|XP_006403100.1| hypothetical protein EUTSA_v10003449mg [Eutrema salsugineum]
 gb|ESQ44553.1| hypothetical protein EUTSA_v10003449mg [Eutrema salsugineum]
Length=529

 Score =   216 bits (549),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 110/228 (48%), Positives = 141/228 (62%), Gaps = 38/228 (17%)
 Frame = +1

Query  319  FLQMRLWILVLGVFNVS-LISGSETLGDKGSVYVDGKSRIGRTDSDFICATLDWWPPEKC  495
            + Q+ + +L L +F  S     S  + +KG+V V G++ +G  D DFICATLDWWPP+KC
Sbjct  3    YRQISVTVLFLCLFQFSDNTVVSSVVEEKGTVLVYGRAAVGTIDEDFICATLDWWPPQKC  62

Query  496  DYGTCAWGHASLLNLDLSNIIFLNAIKAFSPLKIRLGGTLQDKVVYQTKDDRVPCTSFVS  675
            DYGTCAW HAS+LNLDL+N I  NAIK         GGTLQD V+Y+T D + PC  F  
Sbjct  63   DYGTCAWDHASILNLDLNNTILQNAIK---------GGTLQDLVIYETPDQKQPCLPFTQ  113

Query  676  NTSEIFSFSQGCLPLSRWDELNVFFNKSG*PTRFIPCPAYICQHs*lyvsslrvllrAVI  855
            N+S +F ++QGCL L RW+ELN FF K+G                            A +
Sbjct  114  NSSLLFGYTQGCLSLRRWNELNAFFRKTG----------------------------AKV  145

Query  856  IFGLNALTGRSIRSDASAVGAWDSTNAESLMKYTVEKGYTIHGWELGK  999
            IFGLNAL+GRSI+ +  AVGAWD TNAES ++Y V+  +TI GWELG 
Sbjct  146  IFGLNALSGRSIKPNGEAVGAWDYTNAESFIQYIVQNNHTIDGWELGN  193



>ref|XP_010048933.1| PREDICTED: heparanase-like protein 3 isoform X1 [Eucalyptus grandis]
Length=544

 Score =   215 bits (547),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 106/199 (53%), Positives = 129/199 (65%), Gaps = 29/199 (15%)
 Frame = +1

Query  403  GSVYVDGKSRIGRTDSDFICATLDWWPPEKCDYGTCAWGHASLLNLDLSNIIFLNAIKAF  582
            GSV+++G + I   D DFICATLD+ PP+ C  GTC WG+A+L  LDLSN I LNAIKAF
Sbjct  36   GSVFINGSASIASIDDDFICATLDYGPPDVCHQGTC-WGNATLFTLDLSNPILLNAIKAF  94

Query  583  SPLKIRLGGTLQDKVVYQTKDDRVPCTSFVSNTSEIFSFSQGCLPLSRWDELNVFFNKSG  762
            SPLKIR+GGTLQDK++Y  + D  PC     +  E   FSQGCLP+SRWDELN FF ++G
Sbjct  95   SPLKIRMGGTLQDKLIYHVQGDEGPCKPQSIDGLEFLGFSQGCLPMSRWDELNEFFKRAG  154

Query  763  *PTRFIPCPAYICQHs*lyvsslrvllrAVIIFGLNALTGRSIRSDASAVGAWDSTNAES  942
                                        A++ FGLNAL GR++ SD S  G WDS+NAE 
Sbjct  155  ----------------------------AIVTFGLNALYGRTVNSDGSVHGPWDSSNAEI  186

Query  943  LMKYTVEKGYTIHGWELGK  999
            L++YTV KGYTIHGWELG 
Sbjct  187  LLRYTVNKGYTIHGWELGN  205



>ref|XP_007155083.1| hypothetical protein PHAVU_003G171800g [Phaseolus vulgaris]
 gb|ESW27077.1| hypothetical protein PHAVU_003G171800g [Phaseolus vulgaris]
Length=512

 Score =   212 bits (539),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 113/222 (51%), Positives = 135/222 (61%), Gaps = 42/222 (19%)
 Frame = +1

Query  334  LWILVLGVFNVSLISGSETLGDKGSVYVDGKSRIGRTDSDFICATLDWWPPEKCDYGTCA  513
            +++  L    V  + G     +KG V V GKS IGR D+DFICATLDWWPP+KCDYG C+
Sbjct  14   MYLASLSFIGVGAVYGRGGAVEKGIVLVHGKSAIGRIDNDFICATLDWWPPQKCDYGKCS  73

Query  514  WGHASLLNLDLSNIIFLNAIKAFSPLKIRLGGTLQDKVVYQTKDDRVPCTSFVSNTSEIF  693
            WG ASLLNLDL++   LNAIKAFS LK+RLGGTLQDKV+Y T+D+R PCT FV    E+F
Sbjct  74   WGQASLLNLDLNSKTLLNAIKAFSSLKLRLGGTLQDKVIYGTEDNRQPCTPFVK-ADEMF  132

Query  694  SFSQGCLPLSRWDELNVFFNKSG*PTRFIPCPAYICQHs*lyvsslrvllrAVIIFGLNA  873
             F+ GCLP+SR                                           IFGLNA
Sbjct  133  GFTGGCLPMSR----------------------------------------VKAIFGLNA  152

Query  874  LTGRSIRSDASAVGAWDSTNAESLMKYTVEKGYTIHGWELGK  999
            L G+SI+S   AVG W+ TNAESL++YTV K Y IHGWELG 
Sbjct  153  LAGKSIKS-GFAVGPWNYTNAESLIRYTVRKKYHIHGWELGN  193



>ref|NP_001183276.1| uncharacterized protein LOC100501670 precursor [Zea mays]
 gb|ACR36272.1| unknown [Zea mays]
Length=478

 Score =   208 bits (530),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 113/203 (56%), Positives = 131/203 (65%), Gaps = 30/203 (15%)
 Frame = +1

Query  394  GDKGSVYVDGKSRIGRTDSDFICATLDWWPPEKCDYGTCAWGHASLLNLDLSNIIFLNAI  573
            G   +V VD +S I  TD DF+CATLDWWPPEKCDYGTC+WG ASLLNL+LSN I +NA+
Sbjct  35   GGGEAVVVDARSAIAVTDDDFVCATLDWWPPEKCDYGTCSWGLASLLNLNLSNKILVNAV  94

Query  574  KAFSPLKIRLGGTLQDKVVYQTKDDR--VPCTSFVSNTSEIFSFSQGCLPLSRWDELNVF  747
            KAFSPLK+RLGG+LQD ++Y T D R   PC  FV N S +F FSQGCLPL RWDELN F
Sbjct  95   KAFSPLKLRLGGSLQDMLIYGTGDTRQQAPCAPFVKNASAMFGFSQGCLPLRRWDELNAF  154

Query  748  FNKSG*PTRFIPCPAYICQHs*lyvsslrvllrAVIIFGLNALTGRSIRSDASAVGAWDS  927
            F K+G                              I+FGLNAL GR    D S  G W+ 
Sbjct  155  FQKTG----------------------------PRIVFGLNALNGRVPMPDGSLGGPWNY  186

Query  928  TNAESLMKYTVEKGYTIHGWELG  996
            TNA S ++YTV KGY +HGWELG
Sbjct  187  TNAASFIRYTVSKGYDVHGWELG  209



>gb|AFW73900.1| hypothetical protein ZEAMMB73_176333 [Zea mays]
Length=540

 Score =   209 bits (533),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 113/203 (56%), Positives = 131/203 (65%), Gaps = 30/203 (15%)
 Frame = +1

Query  394  GDKGSVYVDGKSRIGRTDSDFICATLDWWPPEKCDYGTCAWGHASLLNLDLSNIIFLNAI  573
            G   +V VD +S I  TD DF+CATLDWWPPEKCDYGTC+WG ASLLNL+LSN I +NA+
Sbjct  35   GGGEAVVVDARSAIAVTDDDFVCATLDWWPPEKCDYGTCSWGLASLLNLNLSNKILVNAV  94

Query  574  KAFSPLKIRLGGTLQDKVVYQTKDDR--VPCTSFVSNTSEIFSFSQGCLPLSRWDELNVF  747
            KAFSPLK+RLGG+LQD ++Y T D R   PC  FV N S +F FSQGCLPL RWDELN F
Sbjct  95   KAFSPLKLRLGGSLQDMLIYGTGDTRQQAPCAPFVKNASAMFGFSQGCLPLRRWDELNAF  154

Query  748  FNKSG*PTRFIPCPAYICQHs*lyvsslrvllrAVIIFGLNALTGRSIRSDASAVGAWDS  927
            F K+G                              I+FGLNAL GR    D S  G W+ 
Sbjct  155  FQKTG----------------------------PRIVFGLNALNGRVPMPDGSLGGPWNY  186

Query  928  TNAESLMKYTVEKGYTIHGWELG  996
            TNA S ++YTV KGY +HGWELG
Sbjct  187  TNAASFIRYTVSKGYDVHGWELG  209



>ref|XP_003570329.1| PREDICTED: heparanase-like protein 3 [Brachypodium distachyon]
Length=541

 Score =   206 bits (525),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 113/194 (58%), Positives = 128/194 (66%), Gaps = 28/194 (14%)
 Frame = +1

Query  418  DGKSRIGRTDSDFICATLDWWPPEKCDYGTCAWGHASLLNLDLSNIIFLNAIKAFSPLKI  597
            D +S I  T+  F+CATLDWWPPEKCDYGTCAWG ASLLNL+L+N I LNA+KAFSPLK+
Sbjct  45   DARSAIAETEQAFVCATLDWWPPEKCDYGTCAWGLASLLNLNLNNKILLNAVKAFSPLKL  104

Query  598  RLGGTLQDKVVYQTKDDRVPCTSFVSNTSEIFSFSQGCLPLSRWDELNVFFNKSG*PTRF  777
            RLGG+LQD +VY T D   PCT F  N+S +FSFSQGCLP+ RWDELN FF KSG     
Sbjct  105  RLGGSLQDVLVYGTGDGPEPCTPFTFNSSVMFSFSQGCLPMHRWDELNAFFKKSG-----  159

Query  778  IPCPAYICQHs*lyvsslrvllrAVIIFGLNALTGRSIRSDASAVGAWDSTNAESLMKYT  957
                                   A IIFGLNAL GR    D S  G W+ TNA S ++YT
Sbjct  160  -----------------------AQIIFGLNALNGRVPMPDGSLGGPWNYTNAASFIRYT  196

Query  958  VEKGYTIHGWELGK  999
            V KGY IHGWELG 
Sbjct  197  VSKGYDIHGWELGN  210



>ref|XP_010552799.1| PREDICTED: heparanase-like protein 2, partial [Tarenaya hassleriana]
Length=516

 Score =   191 bits (486),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 100/229 (44%), Positives = 133/229 (58%), Gaps = 32/229 (14%)
 Frame = +1

Query  322  LQMRLWILVLGVFNVSLISGSETLGDKG--SVYVDGKSRIGRTDSDFICATLDWWPPEKC  495
            ++ +  + ++GV  V     +ETLG +    V ++G + I RTD DFICATLDWWP +KC
Sbjct  1    MEQKHAVYLIGVVVVLCGMAAETLGGETRVGVRIEGVTSIARTDDDFICATLDWWPTDKC  60

Query  496  DYGTCAWGHASLLNLDLSNIIFLNAIKAFSPLKIRLGGTLQDKVVYQTKDDRVPCTSFVS  675
            +YG C WG A L+NLDLSN I  NAIKAFSPL+IRLGG+LQD+V+Y+       C  F  
Sbjct  61   NYGQCPWGKAGLINLDLSNSILQNAIKAFSPLRIRLGGSLQDQVLYKIGKSVKNCPKFER  120

Query  676  NTSEIFSFSQGCLPLSRWDELNVFFNKSG*PTRFIPCPAYICQHs*lyvsslrvllrAVI  855
            N   +F F+ GCL + RWD+LN  FN++G                            A I
Sbjct  121  NDDGLFGFTDGCLTMDRWDQLNSLFNQTG----------------------------AKI  152

Query  856  IFGLNALTGRSIRSDASA--VGAWDSTNAESLMKYTVEKGYTIHGWELG  996
             FGLNAL G+          +G WD+ N+  LM+YT+EKGY+I  +ELG
Sbjct  153  TFGLNALFGKKKSETEEGLWIGDWDARNSHDLMRYTIEKGYSIDSYELG  201



>dbj|BAB08480.1| unnamed protein product [Arabidopsis thaliana]
Length=516

 Score =   190 bits (482),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 89/200 (45%), Positives = 120/200 (60%), Gaps = 28/200 (14%)
 Frame = +1

Query  397  DKGSVYVDGKSRIGRTDSDFICATLDWWPPEKCDYGTCAWGHASLLNLDLSNIIFLNAIK  576
            ++ ++ +DG  RI  TD +FICATLDWWPPEKC+Y  C WG+ASL+NL+L++ +   AI+
Sbjct  2    ERTTLVIDGSRRIAETDENFICATLDWWPPEKCNYDQCPWGYASLINLNLASPLLAKAIQ  61

Query  577  AFSPLKIRLGGTLQDKVVYQTKDDRVPCTSFVSNTSEIFSFSQGCLPLSRWDELNVFFNK  756
            AF  L+IR+GG+LQD+V+Y   D + PCT F      +F FS+GCL + RWDE+N FFN 
Sbjct  62   AFRTLRIRIGGSLQDQVIYDVGDLKTPCTQFKKTDDGLFGFSEGCLYMKRWDEVNHFFNA  121

Query  757  SG*PTRFIPCPAYICQHs*lyvsslrvllrAVIIFGLNALTGRSIRSDASAVGAWDSTNA  936
            +G                            A++ FGLNAL GR+  +  +  G WD TN 
Sbjct  122  TG----------------------------AIVTFGLNALHGRNKLNGTAWGGDWDHTNT  153

Query  937  ESLMKYTVEKGYTIHGWELG  996
            +  M YTV KGY I  WE G
Sbjct  154  QDFMNYTVSKGYAIDSWEFG  173



>ref|NP_200933.2| glucuronidase 1 [Arabidopsis thaliana]
 ref|NP_851238.1| glucuronidase 1 [Arabidopsis thaliana]
 sp|Q8L608.1|HPSE2_ARATH RecName: Full=Heparanase-like protein 2; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAM20587.1| putative protein [Arabidopsis thaliana]
 gb|AAO00963.1| putative protein [Arabidopsis thaliana]
 dbj|BAH20116.1| AT5G61250 [Arabidopsis thaliana]
 gb|AED97442.1| glucuronidase 1 [Arabidopsis thaliana]
 gb|AED97443.1| glucuronidase 1 [Arabidopsis thaliana]
Length=539

 Score =   190 bits (483),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 89/200 (45%), Positives = 120/200 (60%), Gaps = 28/200 (14%)
 Frame = +1

Query  397  DKGSVYVDGKSRIGRTDSDFICATLDWWPPEKCDYGTCAWGHASLLNLDLSNIIFLNAIK  576
            ++ ++ +DG  RI  TD +FICATLDWWPPEKC+Y  C WG+ASL+NL+L++ +   AI+
Sbjct  25   ERTTLVIDGSRRIAETDENFICATLDWWPPEKCNYDQCPWGYASLINLNLASPLLAKAIQ  84

Query  577  AFSPLKIRLGGTLQDKVVYQTKDDRVPCTSFVSNTSEIFSFSQGCLPLSRWDELNVFFNK  756
            AF  L+IR+GG+LQD+V+Y   D + PCT F      +F FS+GCL + RWDE+N FFN 
Sbjct  85   AFRTLRIRIGGSLQDQVIYDVGDLKTPCTQFKKTDDGLFGFSEGCLYMKRWDEVNHFFNA  144

Query  757  SG*PTRFIPCPAYICQHs*lyvsslrvllrAVIIFGLNALTGRSIRSDASAVGAWDSTNA  936
            +G                            A++ FGLNAL GR+  +  +  G WD TN 
Sbjct  145  TG----------------------------AIVTFGLNALHGRNKLNGTAWGGDWDHTNT  176

Query  937  ESLMKYTVEKGYTIHGWELG  996
            +  M YTV KGY I  WE G
Sbjct  177  QDFMNYTVSKGYAIDSWEFG  196



>ref|XP_006281918.1| hypothetical protein CARUB_v10028123mg [Capsella rubella]
 gb|EOA14816.1| hypothetical protein CARUB_v10028123mg [Capsella rubella]
Length=539

 Score =   189 bits (480),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 89/200 (45%), Positives = 118/200 (59%), Gaps = 28/200 (14%)
 Frame = +1

Query  397  DKGSVYVDGKSRIGRTDSDFICATLDWWPPEKCDYGTCAWGHASLLNLDLSNIIFLNAIK  576
            ++  + +DG  RI  TD +F+CATLDWWPPEKC+Y  C WG+ASL+NL+LS+ +   AI+
Sbjct  25   ERAIMVIDGARRIAETDENFVCATLDWWPPEKCNYDQCPWGYASLINLNLSSPLLAKAIQ  84

Query  577  AFSPLKIRLGGTLQDKVVYQTKDDRVPCTSFVSNTSEIFSFSQGCLPLSRWDELNVFFNK  756
            AF  L+IR+GG+LQD+V+Y   D + PCT F      +F FS+GCL + RWDELN FFN 
Sbjct  85   AFRTLRIRIGGSLQDQVIYDVGDLKTPCTQFKKTDDGLFGFSKGCLYMKRWDELNHFFNA  144

Query  757  SG*PTRFIPCPAYICQHs*lyvsslrvllrAVIIFGLNALTGRSIRSDASAVGAWDSTNA  936
            +G                            A++ FGLNAL GR   +  +  G WD +N 
Sbjct  145  TG----------------------------AIVTFGLNALYGRDKSTGNAWGGDWDHSNT  176

Query  937  ESLMKYTVEKGYTIHGWELG  996
            +  M YTV KGY I  WE G
Sbjct  177  QDFMNYTVSKGYAIDSWEFG  196



>ref|XP_002866422.1| glycosyl hydrolase family 79 N-terminal domain-containing protein 
[Arabidopsis lyrata subsp. lyrata]
 gb|EFH42681.1| glycosyl hydrolase family 79 N-terminal domain-containing protein 
[Arabidopsis lyrata subsp. lyrata]
Length=537

 Score =   189 bits (479),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 95/217 (44%), Positives = 126/217 (58%), Gaps = 31/217 (14%)
 Frame = +1

Query  355  VFNVSLISGSETLG---DKGSVYVDGKSRIGRTDSDFICATLDWWPPEKCDYGTCAWGHA  525
            VF +SL     T G   ++ ++ +DG   I  TD +F+CATLDWWPPEKC+Y  C WG+A
Sbjct  6    VFLISLFLLPVTFGSNMERTTLVIDGAHGIAETDENFVCATLDWWPPEKCNYDQCPWGYA  65

Query  526  SLLNLDLSNIIFLNAIKAFSPLKIRLGGTLQDKVVYQTKDDRVPCTSFVSNTSEIFSFSQ  705
            SL+NL+LS+ +   AI+AF  L+IR+GG+LQD+V+Y   D + PCT F      +F FS+
Sbjct  66   SLINLNLSSPLLAKAIQAFRTLRIRIGGSLQDQVIYDVGDLKTPCTQFEKTDDGLFGFSK  125

Query  706  GCLPLSRWDELNVFFNKSG*PTRFIPCPAYICQHs*lyvsslrvllrAVIIFGLNALTGR  885
            GCL + RWDELN FF+ +G                            A++ FGLNAL GR
Sbjct  126  GCLYMKRWDELNRFFHATG----------------------------AIVTFGLNALHGR  157

Query  886  SIRSDASAVGAWDSTNAESLMKYTVEKGYTIHGWELG  996
               +  +  G WD TN +  M YTV KGY I  WELG
Sbjct  158  DKLNGTAWGGDWDHTNTQDFMNYTVSKGYAIDSWELG  194



>gb|ACR10240.1| heparanase [Oryza sativa Indica Group]
Length=539

 Score =   189 bits (479),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 98/224 (44%), Positives = 126/224 (56%), Gaps = 29/224 (13%)
 Frame = +1

Query  328  MRLWILVLGVFNVSLISGSETLGDKGSVYVDGKSRIGRTDSDFICATLDWWPPEKCDYGT  507
            MRLW L+  +     +  SE   D  ++ V G   I  T ++FICAT+DWWPPEKC+Y  
Sbjct  1    MRLWFLIPLLLCFPTLIRSEDYSDV-TIVVRGAETIASTSNEFICATIDWWPPEKCNYDQ  59

Query  508  CAWGHASLLNLDLSNIIFLNAIKAFSPLKIRLGGTLQDKVVYQTKDDRVPCTSFVSNTSE  687
            C WG AS+LNLDL+N +   AI+AFSPL+IRLGG+LQD+VVY T +   PCT F  ++S 
Sbjct  60   CPWGQASILNLDLTNPLLAKAIQAFSPLRIRLGGSLQDQVVYGTPNLGSPCTPFSKSSSG  119

Query  688  IFSFSQGCLPLSRWDELNVFFNKSG*PTRFIPCPAYICQHs*lyvsslrvllrAVIIFGL  867
            +F FSQGC+ + RWD +N  F  +G                            AV+ FGL
Sbjct  120  LFGFSQGCITMERWDAINKIFMDTG----------------------------AVVTFGL  151

Query  868  NALTGRSIRSDASAVGAWDSTNAESLMKYTVEKGYTIHGWELGK  999
            NAL GR         GAW+S+NA   M+YTV   Y I  WE G 
Sbjct  152  NALQGRQQMGRGVWGGAWNSSNAREFMEYTVSMNYPIDSWEFGN  195



>ref|NP_001067122.1| Os12g0578400 [Oryza sativa Japonica Group]
 gb|ABA99069.1| Heparanase-like protein 2 precursor, putative, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF30141.1| Os12g0578400 [Oryza sativa Japonica Group]
 dbj|BAG93793.1| unnamed protein product [Oryza sativa Japonica Group]
Length=539

 Score =   188 bits (478),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 98/224 (44%), Positives = 126/224 (56%), Gaps = 29/224 (13%)
 Frame = +1

Query  328  MRLWILVLGVFNVSLISGSETLGDKGSVYVDGKSRIGRTDSDFICATLDWWPPEKCDYGT  507
            MRLW L+  +     +  SE   D  ++ V G   I  T ++FICAT+DWWPPEKC+Y  
Sbjct  1    MRLWFLIPLLLCFPTLIRSEDYSDV-TIVVRGAETIASTSNEFICATIDWWPPEKCNYDQ  59

Query  508  CAWGHASLLNLDLSNIIFLNAIKAFSPLKIRLGGTLQDKVVYQTKDDRVPCTSFVSNTSE  687
            C WG AS+LNLDL+N +   AI+AFSPL+IRLGG+LQD+VVY T +   PCT F  ++S 
Sbjct  60   CPWGQASILNLDLTNPLLAKAIQAFSPLRIRLGGSLQDQVVYGTPNLGSPCTPFSKSSSG  119

Query  688  IFSFSQGCLPLSRWDELNVFFNKSG*PTRFIPCPAYICQHs*lyvsslrvllrAVIIFGL  867
            +F FSQGC+ + RWD +N  F  +G                            AV+ FGL
Sbjct  120  LFGFSQGCITMERWDAINKIFMDTG----------------------------AVVTFGL  151

Query  868  NALTGRSIRSDASAVGAWDSTNAESLMKYTVEKGYTIHGWELGK  999
            NAL GR         GAW+S+NA   M+YTV   Y I  WE G 
Sbjct  152  NALQGRQQMGRGVWGGAWNSSNAREFMEYTVSMNYPIDSWEFGN  195



>gb|EEE53489.1| hypothetical protein OsJ_36644 [Oryza sativa Japonica Group]
Length=567

 Score =   189 bits (480),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 98/224 (44%), Positives = 126/224 (56%), Gaps = 29/224 (13%)
 Frame = +1

Query  328  MRLWILVLGVFNVSLISGSETLGDKGSVYVDGKSRIGRTDSDFICATLDWWPPEKCDYGT  507
            MRLW L+  +     +  SE   D  ++ V G   I  T ++FICAT+DWWPPEKC+Y  
Sbjct  1    MRLWFLIPLLLCFPTLIRSEDYSDV-TIVVRGAETIASTSNEFICATIDWWPPEKCNYDQ  59

Query  508  CAWGHASLLNLDLSNIIFLNAIKAFSPLKIRLGGTLQDKVVYQTKDDRVPCTSFVSNTSE  687
            C WG AS+LNLDL+N +   AI+AFSPL+IRLGG+LQD+VVY T +   PCT F  ++S 
Sbjct  60   CPWGQASILNLDLTNPLLAKAIQAFSPLRIRLGGSLQDQVVYGTPNLGSPCTPFSKSSSG  119

Query  688  IFSFSQGCLPLSRWDELNVFFNKSG*PTRFIPCPAYICQHs*lyvsslrvllrAVIIFGL  867
            +F FSQGC+ + RWD +N  F  +G                            AV+ FGL
Sbjct  120  LFGFSQGCITMERWDAINKIFMDTG----------------------------AVVTFGL  151

Query  868  NALTGRSIRSDASAVGAWDSTNAESLMKYTVEKGYTIHGWELGK  999
            NAL GR         GAW+S+NA   M+YTV   Y I  WE G 
Sbjct  152  NALQGRQQMGRGVWGGAWNSSNAREFMEYTVSMNYPIDSWEFGN  195



>ref|XP_006664141.1| PREDICTED: heparanase-like protein 1-like isoform X1 [Oryza brachyantha]
 ref|XP_006664142.1| PREDICTED: heparanase-like protein 1-like isoform X2 [Oryza brachyantha]
Length=539

 Score =   188 bits (477),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 99/224 (44%), Positives = 126/224 (56%), Gaps = 29/224 (13%)
 Frame = +1

Query  328  MRLWILVLGVFNVSLISGSETLGDKGSVYVDGKSRIGRTDSDFICATLDWWPPEKCDYGT  507
            MRLW+L+     +  +  SE   D  ++ V G   I  T  +FICAT+DWWPPEKC+Y  
Sbjct  1    MRLWLLIPLALCLPTLIRSEDYSDV-TIVVRGSETIASTSDEFICATIDWWPPEKCNYDQ  59

Query  508  CAWGHASLLNLDLSNIIFLNAIKAFSPLKIRLGGTLQDKVVYQTKDDRVPCTSFVSNTSE  687
            C WG AS+LNLDL+N +   AI+AFSPL+IRLGG+LQD+V+Y T +   PCT F   +S 
Sbjct  60   CPWGQASILNLDLTNPLLAKAIQAFSPLRIRLGGSLQDQVLYGTPNLGSPCTPFSKVSSG  119

Query  688  IFSFSQGCLPLSRWDELNVFFNKSG*PTRFIPCPAYICQHs*lyvsslrvllrAVIIFGL  867
            +F FSQGC+ + RWD +N  F  +G                            AVI FGL
Sbjct  120  LFGFSQGCITMERWDAINNLFVNTG----------------------------AVITFGL  151

Query  868  NALTGRSIRSDASAVGAWDSTNAESLMKYTVEKGYTIHGWELGK  999
            NAL GR         GAW+S+NA  LM+YTV   Y I  WE G 
Sbjct  152  NALQGRQQMGKGVWGGAWNSSNALELMEYTVSMNYPIDSWEFGN  195



>ref|XP_009395254.1| PREDICTED: heparanase-like protein 1, partial [Musa acuminata 
subsp. malaccensis]
Length=509

 Score =   187 bits (475),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 98/213 (46%), Positives = 131/213 (62%), Gaps = 34/213 (16%)
 Frame = +1

Query  370  LISG-SETLGDKGSVYVDGKSRIGRTDSDFICATLDWWPPEKCDYGTCAWGHASLLNLDL  546
            L SG S TLG    V +   + I +TD +F+CAT+DWWPP+KC+YG C WG+AS+LNLDL
Sbjct  1    LFSGLSPTLGAT-VVSIKAVTTIAKTDDNFVCATMDWWPPDKCNYGMCPWGNASILNLDL  59

Query  547  SNIIFLNAIKAFSPLKIRLGGTLQDKVVYQTKDDRVPCTSFVSNTSEIFSFSQGCLPLSR  726
            +N I +NA+KAF  L+IR+GG+LQD+V+Y+  D    C  F  + + +F F++GCLP+ R
Sbjct  60   NNPILVNALKAFGSLRIRIGGSLQDQVLYEVGDGAHACPDFKIDKNGLFGFTEGCLPMQR  119

Query  727  WDELNVFFNKSG*PTRFIPCPAYICQHs*lyvsslrvllrAVIIFGLNALTGRSIRSDAS  906
            WDELN  FN +G                            ++I FGLNAL GRS +S++S
Sbjct  120  WDELNKLFNSTG----------------------------SIISFGLNALAGRS-KSNSS  150

Query  907  A---VGAWDSTNAESLMKYTVEKGYTIHGWELG  996
                 G WD TNA   +KYT+ K YTI  WELG
Sbjct  151  GNLYEGQWDPTNARDFIKYTLSKNYTIESWELG  183



>ref|XP_010457069.1| PREDICTED: heparanase-like protein 2 [Camelina sativa]
Length=538

 Score =   187 bits (475),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 89/200 (45%), Positives = 118/200 (59%), Gaps = 28/200 (14%)
 Frame = +1

Query  397  DKGSVYVDGKSRIGRTDSDFICATLDWWPPEKCDYGTCAWGHASLLNLDLSNIIFLNAIK  576
            ++  + +DG  RI  TD +F+CATLDWWPPEKC+Y  C WG+ASL+NL+L++ +   AI+
Sbjct  24   ERAIMVIDGARRISETDDNFVCATLDWWPPEKCNYDQCPWGYASLINLNLASPLLAKAIQ  83

Query  577  AFSPLKIRLGGTLQDKVVYQTKDDRVPCTSFVSNTSEIFSFSQGCLPLSRWDELNVFFNK  756
            AF  L+IR+GG+LQD+V+Y   D + PCT F      +F FS+GCL ++RWDELN FFN 
Sbjct  84   AFRTLRIRIGGSLQDQVIYDVGDLKTPCTQFKKTDDGLFGFSKGCLYMNRWDELNHFFNA  143

Query  757  SG*PTRFIPCPAYICQHs*lyvsslrvllrAVIIFGLNALTGRSIRSDASAVGAWDSTNA  936
            +G                            A++ FGLNAL GR   S  +  G WD  N 
Sbjct  144  TG----------------------------AIVTFGLNALYGRDKLSGNAWGGDWDHINT  175

Query  937  ESLMKYTVEKGYTIHGWELG  996
            +  M YTV KGY I  WE G
Sbjct  176  QDFMNYTVSKGYAIDSWEFG  195



>ref|XP_006354764.1| PREDICTED: heparanase-like protein 2-like isoform X1 [Solanum 
tuberosum]
 ref|XP_006354765.1| PREDICTED: heparanase-like protein 2-like isoform X2 [Solanum 
tuberosum]
 ref|XP_006354766.1| PREDICTED: heparanase-like protein 2-like isoform X3 [Solanum 
tuberosum]
Length=538

 Score =   186 bits (473),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 88/195 (45%), Positives = 114/195 (58%), Gaps = 28/195 (14%)
 Frame = +1

Query  415  VDGKSRIGRTDSDFICATLDWWPPEKCDYGTCAWGHASLLNLDLSNIIFLNAIKAFSPLK  594
            +DG  +I  TD +++CATLDWWP EKC+Y  C WG ASL+NLDLS+    N+I+AF+ L+
Sbjct  28   IDGTVKIAETDDNYVCATLDWWPKEKCNYNECPWGSASLINLDLSHPFLANSIQAFNHLR  87

Query  595  IRLGGTLQDKVVYQTKDDRVPCTSFVSNTSEIFSFSQGCLPLSRWDELNVFFNKSG*PTR  774
            +RLGG+LQ++++Y   +   PC  F     E+F FS GCL + RWDELN FFNK+G    
Sbjct  88   LRLGGSLQNRIIYDVGNLESPCHPFTKQGDELFGFSNGCLHMDRWDELNSFFNKTG----  143

Query  775  FIPCPAYICQHs*lyvsslrvllrAVIIFGLNALTGRSIRSDASAVGAWDSTNAESLMKY  954
                                    A++ FGLNAL GR   S     G WDS+NA   + Y
Sbjct  144  ------------------------ALVTFGLNALRGRQRTSKRVWEGNWDSSNAHDFIYY  179

Query  955  TVEKGYTIHGWELGK  999
            TV KGY IH WE G 
Sbjct  180  TVSKGYQIHSWEFGN  194



>emb|CDY02161.1| BnaA03g40060D [Brassica napus]
Length=532

 Score =   186 bits (472),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 88/200 (44%), Positives = 117/200 (59%), Gaps = 28/200 (14%)
 Frame = +1

Query  397  DKGSVYVDGKSRIGRTDSDFICATLDWWPPEKCDYGTCAWGHASLLNLDLSNIIFLNAIK  576
            ++ ++ +DG  +I   D +F+CATLDWWPPEKC+Y  C WG+ASL+NL+LS+ +   AI+
Sbjct  26   EQTTIVIDGTRQIAEIDENFVCATLDWWPPEKCNYDQCPWGYASLINLNLSSPLLAKAIQ  85

Query  577  AFSPLKIRLGGTLQDKVVYQTKDDRVPCTSFVSNTSEIFSFSQGCLPLSRWDELNVFFNK  756
            AF  L+IR+GG+LQD+VVY   D + PCT F      +F FS+GCL + RWDELN FF+ 
Sbjct  86   AFKTLRIRIGGSLQDQVVYDVGDLKTPCTQFKKTDDGLFGFSEGCLYMERWDELNRFFHA  145

Query  757  SG*PTRFIPCPAYICQHs*lyvsslrvllrAVIIFGLNALTGRSIRSDASAVGAWDSTNA  936
            +G                            A++ FGLNAL GR      +  G WD TN 
Sbjct  146  TG----------------------------AIVTFGLNALYGRKKLRGNAWGGEWDHTNT  177

Query  937  ESLMKYTVEKGYTIHGWELG  996
            +  M YTV KGY I  WE G
Sbjct  178  QDFMNYTVSKGYAIDSWEFG  197



>ref|XP_010483789.1| PREDICTED: heparanase-like protein 2 [Camelina sativa]
Length=539

 Score =   186 bits (472),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 88/200 (44%), Positives = 117/200 (59%), Gaps = 28/200 (14%)
 Frame = +1

Query  397  DKGSVYVDGKSRIGRTDSDFICATLDWWPPEKCDYGTCAWGHASLLNLDLSNIIFLNAIK  576
            ++  + +DG  RI  TD +F+CATLDWWPPEKC+Y  C WG+ASL+N++LS+ +   AI+
Sbjct  25   ERAIMVIDGARRIAETDDNFVCATLDWWPPEKCNYDQCPWGYASLINVNLSSPLLAKAIQ  84

Query  577  AFSPLKIRLGGTLQDKVVYQTKDDRVPCTSFVSNTSEIFSFSQGCLPLSRWDELNVFFNK  756
            AF  L+IR+GG+LQD+V+Y   D + PCT F      +F FS+GCL ++RWDELN FFN 
Sbjct  85   AFRTLRIRIGGSLQDQVIYDVGDLKTPCTQFKKTDDGLFGFSKGCLYMNRWDELNHFFNA  144

Query  757  SG*PTRFIPCPAYICQHs*lyvsslrvllrAVIIFGLNALTGRSIRSDASAVGAWDSTNA  936
            +G                            A++ FGLNAL GR      +  G WD  N 
Sbjct  145  TG----------------------------AIVTFGLNALYGRDKLGGNAWGGDWDHINT  176

Query  937  ESLMKYTVEKGYTIHGWELG  996
            +  M YTV KGY I  WE G
Sbjct  177  QDFMNYTVSKGYAIDSWEFG  196



>ref|XP_010443938.1| PREDICTED: heparanase-like protein 2 [Camelina sativa]
Length=538

 Score =   186 bits (471),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 89/200 (45%), Positives = 116/200 (58%), Gaps = 28/200 (14%)
 Frame = +1

Query  397  DKGSVYVDGKSRIGRTDSDFICATLDWWPPEKCDYGTCAWGHASLLNLDLSNIIFLNAIK  576
            ++  + +DG  RI  TD +F+CATLDWWPPEKC+Y  C W +ASL+NL+LS+ +   AI+
Sbjct  24   ERAIMVIDGARRIAETDDNFVCATLDWWPPEKCNYDQCPWAYASLINLNLSSPLLAKAIQ  83

Query  577  AFSPLKIRLGGTLQDKVVYQTKDDRVPCTSFVSNTSEIFSFSQGCLPLSRWDELNVFFNK  756
            AF  L+IR+GG+LQD+V+Y   D + PCT F      +F FS+GCL + RWDELN FFN 
Sbjct  84   AFRTLRIRIGGSLQDQVIYDVGDLKTPCTQFKKTDDGLFGFSKGCLYMKRWDELNHFFNG  143

Query  757  SG*PTRFIPCPAYICQHs*lyvsslrvllrAVIIFGLNALTGRSIRSDASAVGAWDSTNA  936
            +G                            A++ FGLNAL GR   S  +  G WD  N 
Sbjct  144  TG----------------------------AIVTFGLNALYGRDKLSGNAWGGDWDHINT  175

Query  937  ESLMKYTVEKGYTIHGWELG  996
            +  M YTV KGY I  WE G
Sbjct  176  QDFMNYTVSKGYAIDSWEFG  195



>ref|XP_009136454.1| PREDICTED: heparanase-like protein 2 [Brassica rapa]
 ref|XP_009136456.1| PREDICTED: heparanase-like protein 2 [Brassica rapa]
Length=541

 Score =   185 bits (470),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 86/200 (43%), Positives = 117/200 (59%), Gaps = 28/200 (14%)
 Frame = +1

Query  397  DKGSVYVDGKSRIGRTDSDFICATLDWWPPEKCDYGTCAWGHASLLNLDLSNIIFLNAIK  576
            ++ ++ +DG  +I   D +F+CATLDWWPPEKC+Y  C WG+ASL+NL+LS+ +   AI+
Sbjct  26   EQTTIVIDGTRQIAEIDENFVCATLDWWPPEKCNYDQCPWGYASLINLNLSSPLLAKAIQ  85

Query  577  AFSPLKIRLGGTLQDKVVYQTKDDRVPCTSFVSNTSEIFSFSQGCLPLSRWDELNVFFNK  756
            AF  L+IR+GG+LQD+V+Y   D + PCT F      +F FS+GCL + RWDELN FF+ 
Sbjct  86   AFKTLRIRIGGSLQDQVIYDVGDLKTPCTQFKKTDDGLFGFSEGCLYMERWDELNRFFHA  145

Query  757  SG*PTRFIPCPAYICQHs*lyvsslrvllrAVIIFGLNALTGRSIRSDASAVGAWDSTNA  936
            +G                            A++ FGLNAL GR      +  G WD TN 
Sbjct  146  TG----------------------------AIVTFGLNALYGREKLRGNAWGGEWDHTNT  177

Query  937  ESLMKYTVEKGYTIHGWELG  996
            +  M YTV KGY +  WE G
Sbjct  178  QDFMNYTVSKGYAVDSWEFG  197



>ref|XP_004235980.1| PREDICTED: heparanase-like protein 1 [Solanum lycopersicum]
 ref|XP_010318834.1| PREDICTED: heparanase-like protein 1 [Solanum lycopersicum]
 ref|XP_010318835.1| PREDICTED: heparanase-like protein 1 [Solanum lycopersicum]
 ref|XP_010318836.1| PREDICTED: heparanase-like protein 1 [Solanum lycopersicum]
Length=540

 Score =   185 bits (469),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 87/194 (45%), Positives = 119/194 (61%), Gaps = 28/194 (14%)
 Frame = +1

Query  415  VDGKSRIGRTDSDFICATLDWWPPEKCDYGTCAWGHASLLNLDLSNIIFLNAIKAFSPLK  594
            +D  +++  TD+++ICAT+DWWP EKC+Y  C WG AS+LNLDL++   +NAI+AF  L+
Sbjct  29   IDASTKVAWTDANYICATIDWWPKEKCNYKQCPWGSASILNLDLTHPYLVNAIRAFKGLR  88

Query  595  IRLGGTLQDKVVYQTKDDRVPCTSFVSNTSEIFSFSQGCLPLSRWDELNVFFNKSG*PTR  774
            +RLGG+LQD+V+Y   +   PC  F  +   +F FS+GCLP+ RWDELN  F K+G    
Sbjct  89   LRLGGSLQDQVIYGVGNLISPCRPFTQHKDGLFGFSKGCLPMQRWDELNNLFKKTG----  144

Query  775  FIPCPAYICQHs*lyvsslrvllrAVIIFGLNALTGRSIRSDASAVGAWDSTNAESLMKY  954
                                    A++ FGLNAL GR   +  + VG WDS+NA + +KY
Sbjct  145  ------------------------ALVTFGLNALYGRRQANRHAWVGNWDSSNALNFIKY  180

Query  955  TVEKGYTIHGWELG  996
            TV KGY IH WE G
Sbjct  181  TVAKGYHIHSWEFG  194



>ref|XP_006394524.1| hypothetical protein EUTSA_v10003960mg [Eutrema salsugineum]
 gb|ESQ31810.1| hypothetical protein EUTSA_v10003960mg [Eutrema salsugineum]
Length=540

 Score =   184 bits (468),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 88/200 (44%), Positives = 117/200 (59%), Gaps = 28/200 (14%)
 Frame = +1

Query  397  DKGSVYVDGKSRIGRTDSDFICATLDWWPPEKCDYGTCAWGHASLLNLDLSNIIFLNAIK  576
            ++ ++ +DG+ RI   D +F+CATLDWWPPEKC+Y  C WG+ASL+NL+LS+ +   AI+
Sbjct  26   EQTTIVIDGEHRIAEIDENFVCATLDWWPPEKCNYDQCPWGYASLINLNLSSPLLAKAIQ  85

Query  577  AFSPLKIRLGGTLQDKVVYQTKDDRVPCTSFVSNTSEIFSFSQGCLPLSRWDELNVFFNK  756
            AF  L+IRLGG+LQD+V+Y   D + PC+ F      +F FS+GCL + RW+ELN FFN 
Sbjct  86   AFKTLRIRLGGSLQDQVIYDVGDLKTPCSPFKKTDDGLFGFSKGCLYMDRWNELNRFFNS  145

Query  757  SG*PTRFIPCPAYICQHs*lyvsslrvllrAVIIFGLNALTGRSIRSDASAVGAWDSTNA  936
            +G                            A++ FGLNAL GR   S  S  G WD  N 
Sbjct  146  TG----------------------------AIVTFGLNALYGRDKLSGNSWGGDWDHINT  177

Query  937  ESLMKYTVEKGYTIHGWELG  996
            +  M YTV  GY I  WE G
Sbjct  178  QDFMNYTVSMGYAIDSWEFG  197



>gb|EEC69565.1| hypothetical protein OsI_38868 [Oryza sativa Indica Group]
Length=1237

 Score =   189 bits (480),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 98/223 (44%), Positives = 126/223 (57%), Gaps = 29/223 (13%)
 Frame = +1

Query  328  MRLWILVLGVFNVSLISGSETLGDKGSVYVDGKSRIGRTDSDFICATLDWWPPEKCDYGT  507
            MRLW L+  +     +  SE   D  ++ V G   I  T ++FICAT+DWWPPEKC+Y  
Sbjct  671  MRLWFLIPLLLCFPTLIRSEDYSDV-TIVVRGAETIASTSNEFICATIDWWPPEKCNYDQ  729

Query  508  CAWGHASLLNLDLSNIIFLNAIKAFSPLKIRLGGTLQDKVVYQTKDDRVPCTSFVSNTSE  687
            C WG AS+LNLDL+N +   AI+AFSPL+IRLGG+LQD+VVY T +   PCT F  ++S 
Sbjct  730  CPWGQASILNLDLTNPLLAKAIQAFSPLRIRLGGSLQDQVVYGTPNLGSPCTPFSKSSSG  789

Query  688  IFSFSQGCLPLSRWDELNVFFNKSG*PTRFIPCPAYICQHs*lyvsslrvllrAVIIFGL  867
            +F FSQGC+ + RWD +N  F  +G                            AV+ FGL
Sbjct  790  LFGFSQGCITMERWDAINKIFMDTG----------------------------AVVTFGL  821

Query  868  NALTGRSIRSDASAVGAWDSTNAESLMKYTVEKGYTIHGWELG  996
            NAL GR         GAW+S+NA   M+YTV   Y I  WE G
Sbjct  822  NALRGRQQMGRGVWGGAWNSSNAREFMEYTVSMNYPIDSWEFG  864



>ref|XP_010904949.1| PREDICTED: heparanase-like protein 1 [Elaeis guineensis]
Length=520

 Score =   183 bits (465),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 91/202 (45%), Positives = 121/202 (60%), Gaps = 29/202 (14%)
 Frame = +1

Query  394  GDKGSVYVDGKSRIGRTDSDFICATLDWWPPEKCDYGTCAWGHASLLNLDLSNIIFLNAI  573
            G+  +V V   ++I +TD +FICAT+DWWP EKC+Y    W ++S++NLDL+N I  NA+
Sbjct  21   GNMATVSVKAVTKIAKTDINFICATIDWWPKEKCNYNMSPWYNSSIINLDLNNTILFNAV  80

Query  574  KAFSPLKIRLGGTLQDKVVYQTKDDRVPCTSFVSNTSEIFSFSQGCLPLSRWDELNVFFN  753
            KAF  L+IRLGGTLQD+VVY+     V C +F  + +E+  F+ GCL  SRWDELN FFN
Sbjct  81   KAFKCLRIRLGGTLQDRVVYKVGRKPVKCENFKLDQNELLGFTTGCLNKSRWDELNAFFN  140

Query  754  KSG*PTRFIPCPAYICQHs*lyvsslrvllrAVIIFGLNALTGRSIRSDAS-AVGAWDST  930
            K+G                            A+I FGLNAL GR    + +  +G WDST
Sbjct  141  KTG----------------------------AIITFGLNALNGRKKAPEGNLYIGDWDST  172

Query  931  NAESLMKYTVEKGYTIHGWELG  996
            NA   ++YTV+K Y I  WE G
Sbjct  173  NARKFIRYTVKKNYKIEAWEFG  194



>ref|XP_008792775.1| PREDICTED: heparanase-like protein 2 [Phoenix dactylifera]
Length=536

 Score =   184 bits (466),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 91/202 (45%), Positives = 121/202 (60%), Gaps = 29/202 (14%)
 Frame = +1

Query  394  GDKGSVYVDGKSRIGRTDSDFICATLDWWPPEKCDYGTCAWGHASLLNLDLSNIIFLNAI  573
            GDK +V V   + I +TD +FICAT+DWWP EKC+Y  C W  AS++NLDL+N I  NAI
Sbjct  34   GDKVTVAVKAVTTIAKTDDNFICATIDWWPKEKCNYDICPWYSASIINLDLNNTIVFNAI  93

Query  574  KAFSPLKIRLGGTLQDKVVYQTKDDRVPCTSFVSNTSEIFSFSQGCLPLSRWDELNVFFN  753
            KAF  L+IRLGG+LQD+VVY+  ++   C  F  + + +F FS+GCL + RWDELN FFN
Sbjct  94   KAFKSLRIRLGGSLQDQVVYKIGEEPATCEDFKLDKNGLFGFSKGCLSMYRWDELNTFFN  153

Query  754  KSG*PTRFIPCPAYICQHs*lyvsslrvllrAVIIFGLNALTGRSIRSDAS-AVGAWDST  930
            K+G                             ++ FGLNAL GR    + +  +G WD+T
Sbjct  154  KTG----------------------------TILTFGLNALAGRKKSPEGNLYMGEWDAT  185

Query  931  NAESLMKYTVEKGYTIHGWELG  996
            NA   ++YTV K Y +  WELG
Sbjct  186  NARQFIQYTVLKNYKVESWELG  207



>ref|XP_004241591.1| PREDICTED: heparanase-like protein 2 [Solanum lycopersicum]
Length=539

 Score =   183 bits (465),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 86/195 (44%), Positives = 114/195 (58%), Gaps = 28/195 (14%)
 Frame = +1

Query  415  VDGKSRIGRTDSDFICATLDWWPPEKCDYGTCAWGHASLLNLDLSNIIFLNAIKAFSPLK  594
            +DG  +I  TD++++CATLDWWP EKC++  C WG  SL+NLDLS+    N+I+AF+ L+
Sbjct  29   IDGTVKIAETDNNYVCATLDWWPKEKCNHNDCPWGSTSLINLDLSHPFLANSIQAFNHLR  88

Query  595  IRLGGTLQDKVVYQTKDDRVPCTSFVSNTSEIFSFSQGCLPLSRWDELNVFFNKSG*PTR  774
            +RLGG+LQ++++Y   +   PC  F     E+F FS GCL + RWDELN FFNK+G    
Sbjct  89   LRLGGSLQNRIIYDVGNLESPCHPFTKQGDELFGFSNGCLRMDRWDELNSFFNKTG----  144

Query  775  FIPCPAYICQHs*lyvsslrvllrAVIIFGLNALTGRSIRSDASAVGAWDSTNAESLMKY  954
                                    A++ FGLNAL GR   S     G WDS+NA   + Y
Sbjct  145  ------------------------ALVTFGLNALRGRQRTSKRVWEGNWDSSNAHDFIDY  180

Query  955  TVEKGYTIHGWELGK  999
            TV KGY IH WE G 
Sbjct  181  TVSKGYQIHSWEFGN  195



>ref|XP_006345162.1| PREDICTED: heparanase-like protein 1-like [Solanum tuberosum]
Length=540

 Score =   183 bits (465),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 86/194 (44%), Positives = 119/194 (61%), Gaps = 28/194 (14%)
 Frame = +1

Query  415  VDGKSRIGRTDSDFICATLDWWPPEKCDYGTCAWGHASLLNLDLSNIIFLNAIKAFSPLK  594
            +D  +++  TD+++ICAT+DWWP EKC+Y  C WG AS++NLDL++    NAI+AF  L+
Sbjct  29   IDASTKVAWTDANYICATIDWWPKEKCNYKQCPWGSASIINLDLTHPYLENAIRAFKGLR  88

Query  595  IRLGGTLQDKVVYQTKDDRVPCTSFVSNTSEIFSFSQGCLPLSRWDELNVFFNKSG*PTR  774
            +RLGG+LQD+V+Y   + + PC+SF      +F FS+GCLP+ RWDELN  F K+G    
Sbjct  89   LRLGGSLQDQVIYGVGNLKSPCSSFTQQKDGLFGFSRGCLPMQRWDELNNLFKKTG----  144

Query  775  FIPCPAYICQHs*lyvsslrvllrAVIIFGLNALTGRSIRSDASAVGAWDSTNAESLMKY  954
                                    A++ FGLNAL GR   +  + VG WDS+NA   +KY
Sbjct  145  ------------------------ALVTFGLNALYGRQPTNRHAWVGNWDSSNALDFIKY  180

Query  955  TVEKGYTIHGWELG  996
            TV KGY I+ WE G
Sbjct  181  TVAKGYQINSWEFG  194



>gb|KGN51965.1| hypothetical protein Csa_5G606560 [Cucumis sativus]
Length=517

 Score =   182 bits (463),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 92/198 (46%), Positives = 114/198 (58%), Gaps = 30/198 (15%)
 Frame = +1

Query  409  VYVDGKSRIGRTDSDFICATLDWWPPEKCDYGTCAWGHASLLNLDLSNIIFLNAIKAFSP  588
            V V G + I +TD DFICATLDWWPP KCDYG C WG A + NLDL NII   AIK F+P
Sbjct  27   VSVKGVTTIAQTDDDFICATLDWWPPNKCDYGQCPWGKAGIPNLDLQNIILAEAIKEFNP  86

Query  589  LKIRLGGTLQDKVVYQTKDDRVPCTSFVSNTSEIFSFSQGCLPLSRWDELNVFFNKSG*P  768
            L+IR+GG+LQD+++Y+       C      +  +F FS+GCL + RWDELN FFNK+   
Sbjct  87   LRIRVGGSLQDQIIYRVGKSYKNCPEMRKQSDGLFGFSKGCLTMQRWDELNDFFNKTS--  144

Query  769  TRFIPCPAYICQHs*lyvsslrvllrAVIIFGLNALTGRSIRSDASA--VGAWDSTNAES  942
                                      A I FGLNAL G+   +D +   VG WDS NA  
Sbjct  145  --------------------------ARITFGLNALKGKKPANDGTINWVGDWDSQNARD  178

Query  943  LMKYTVEKGYTIHGWELG  996
            L++YT  KGY I  +ELG
Sbjct  179  LIRYTASKGYKIDSYELG  196



>ref|XP_011656257.1| PREDICTED: heparanase-like protein 1 [Cucumis sativus]
Length=514

 Score =   182 bits (463),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 92/198 (46%), Positives = 114/198 (58%), Gaps = 30/198 (15%)
 Frame = +1

Query  409  VYVDGKSRIGRTDSDFICATLDWWPPEKCDYGTCAWGHASLLNLDLSNIIFLNAIKAFSP  588
            V V G + I +TD DFICATLDWWPP KCDYG C WG A + NLDL NII   AIK F+P
Sbjct  24   VSVKGVTTIAQTDDDFICATLDWWPPNKCDYGQCPWGKAGIPNLDLQNIILAEAIKEFNP  83

Query  589  LKIRLGGTLQDKVVYQTKDDRVPCTSFVSNTSEIFSFSQGCLPLSRWDELNVFFNKSG*P  768
            L+IR+GG+LQD+++Y+       C      +  +F FS+GCL + RWDELN FFNK+   
Sbjct  84   LRIRVGGSLQDQIIYRVGKSYKNCPEMRKQSDGLFGFSKGCLTMQRWDELNDFFNKTS--  141

Query  769  TRFIPCPAYICQHs*lyvsslrvllrAVIIFGLNALTGRSIRSDASA--VGAWDSTNAES  942
                                      A I FGLNAL G+   +D +   VG WDS NA  
Sbjct  142  --------------------------ARITFGLNALKGKKPANDGTINWVGDWDSQNARD  175

Query  943  LMKYTVEKGYTIHGWELG  996
            L++YT  KGY I  +ELG
Sbjct  176  LIRYTASKGYKIDSYELG  193



>emb|CDP15923.1| unnamed protein product [Coffea canephora]
Length=155

 Score =   172 bits (437),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 84/123 (68%), Positives = 98/123 (80%), Gaps = 5/123 (4%)
 Frame = +1

Query  367  SLISGSETLGDKGS----VYVDGKSRIGRTDSDFICATLDWWPPEKCDYGTCAWGHASLL  534
            S+   SE + D G+    V+VDG S IG  D DFICATLDWWPPEKCDYGTC+W HASLL
Sbjct  34   SIFVYSEIVKDTGTAQGFVFVDGLSAIGEIDDDFICATLDWWPPEKCDYGTCSWDHASLL  93

Query  535  NLDLSNIIFLNAIKAFSPLKIRLGGTLQDKVVYQTKDDRVPCTSFVSNTSEIFSFSQGCL  714
            NLDL+NII LNA+KAFSPLKIRLGGTLQD V+YQT+ ++  C SFV N+SE+F F+QGCL
Sbjct  94   NLDLNNIILLNAVKAFSPLKIRLGGTLQDNVIYQTQSNQ-RCHSFVKNSSELFGFTQGCL  152

Query  715  PLS  723
            P S
Sbjct  153  PSS  155



>ref|XP_010936395.1| PREDICTED: heparanase-like protein 2 [Elaeis guineensis]
Length=527

 Score =   182 bits (463),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 91/202 (45%), Positives = 121/202 (60%), Gaps = 29/202 (14%)
 Frame = +1

Query  394  GDKGSVYVDGKSRIGRTDSDFICATLDWWPPEKCDYGTCAWGHASLLNLDLSNIIFLNAI  573
            GDK +V V   + I +TD  FICAT+DWWP EKC+Y  C W  +S+LNLDL+N I  NAI
Sbjct  25   GDKVTVSVKAVTTIAKTDDSFICATIDWWPKEKCNYDMCPWYSSSILNLDLNNTILFNAI  84

Query  574  KAFSPLKIRLGGTLQDKVVYQTKDDRVPCTSFVSNTSEIFSFSQGCLPLSRWDELNVFFN  753
            KAF  L+IRLGG+L+D+VVY+  ++   C  F  + + +F FS+GCL + RWDELN FFN
Sbjct  85   KAFKALRIRLGGSLEDQVVYKVGEEPATCEDFKLDKNGLFGFSEGCLSMCRWDELNAFFN  144

Query  754  KSG*PTRFIPCPAYICQHs*lyvsslrvllrAVIIFGLNALTGRSIRSDA-SAVGAWDST  930
            K+G                            +++ FGLNAL GR    +  S VG W++T
Sbjct  145  KTG----------------------------SILTFGLNALAGRKKAPEGNSYVGDWNTT  176

Query  931  NAESLMKYTVEKGYTIHGWELG  996
            NA   ++YTV K Y +  WELG
Sbjct  177  NARQFIEYTVLKNYKVESWELG  198



>gb|EMS63819.1| Heparanase-like protein 2 [Triticum urartu]
Length=504

 Score =   182 bits (462),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 94/224 (42%), Positives = 127/224 (57%), Gaps = 35/224 (16%)
 Frame = +1

Query  334  LWILVLGVFNVSLISGSETLGDKGSVYVDGKSRIGRTDSDFICATLDWWPPEKCDYGTCA  513
            L ILVL     ++ +G    G+K +V V   + I  TD DFICATLDWWP +KC+YG C 
Sbjct  11   LCILVLSGAPYAIAAG----GEKATVSVRAVTAISHTDDDFICATLDWWPRDKCNYGMCP  66

Query  514  WGHASLLNLDLSNIIFLNAIKAFSPLKIRLGGTLQDKVVYQTKDDRVPCTSFVSNTSEIF  693
            W ++S++NLDL + I  NA+KAF+ L+IRLGG+LQD++ Y+       C SF  N   +F
Sbjct  67   WHNSSIINLDLYSPILYNAVKAFNSLRIRLGGSLQDQITYKVGKHYADCPSFRRNDDRLF  126

Query  694  SFSQGCLPLSRWDELNVFFNKSG*PTRFIPCPAYICQHs*lyvsslrvllrAVIIFGLNA  873
             F+ GCL ++RWDELN+FF ++                               + FGLNA
Sbjct  127  GFTDGCLAMNRWDELNIFFRRTN----------------------------TTVTFGLNA  158

Query  874  LTGRSIRSDASA---VGAWDSTNAESLMKYTVEKGYTIHGWELG  996
            L GR   ++  +   VG WD  NA  LM+YTV KGY +  WELG
Sbjct  159  LRGRRKSAENGSTLHVGGWDGRNARDLMRYTVSKGYRVESWELG  202



>ref|XP_009612848.1| PREDICTED: heparanase-like protein 2 [Nicotiana tomentosiformis]
Length=516

 Score =   182 bits (462),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 100/227 (44%), Positives = 133/227 (59%), Gaps = 36/227 (16%)
 Frame = +1

Query  325  QMRLWILVLGVFNVSLISGSETLGDKGSVYVDGKSRIGRTDSDFICATLDWWPPEKCDYG  504
            + RL+ LVL VF+   +S ++ L     V V G + I +TD +FICATLDWWP  KCDY 
Sbjct  4    RTRLFCLVLLVFSCFCLSKADEL----KVMVKGVTSIAKTDDNFICATLDWWPENKCDYN  59

Query  505  TCAWGHASLLNLDLSNIIFLNAIKAFSPLKIRLGGTLQDKVVYQTKDDRVPCTSFVSNTS  684
             C WG A +LNLDL N I  NA+KAF+PL+IR+GG+LQD+V Y+       C++    + 
Sbjct  60   QCPWGKAGILNLDLKNKILTNAVKAFNPLRIRIGGSLQDQVYYKVGKFPKQCSNLEKKSD  119

Query  685  EIFSFSQGCLPLSRWDELNVFFNKSG*PTRFIPCPAYICQHs*lyvsslrvllrAVIIFG  864
             +F F++GCL ++RWDEL+  FNK+G                            A + F 
Sbjct  120  GLFGFAEGCLHMNRWDELHDLFNKTG----------------------------AALTFS  151

Query  865  LNALTGRSIRSDASAV---GAWDSTNAESLMKYTVEKGYTIHGWELG  996
            LNAL GR I+SD       G W+  NA+SLMKYTV+KGY I  +ELG
Sbjct  152  LNALLGR-IQSDEDDTLWEGDWNQYNAKSLMKYTVKKGYKIDSYELG  197



>gb|EMT24030.1| Heparanase-like protein 2 [Aegilops tauschii]
Length=507

 Score =   181 bits (459),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 88/204 (43%), Positives = 118/204 (58%), Gaps = 31/204 (15%)
 Frame = +1

Query  394  GDKGSVYVDGKSRIGRTDSDFICATLDWWPPEKCDYGTCAWGHASLLNLDLSNIIFLNAI  573
            G+K +V V   + I  TD DFICATLDWWP +KC+YG C W ++S++NLDL + I  NA+
Sbjct  26   GEKATVSVRAVTAISHTDDDFICATLDWWPRDKCNYGMCPWHNSSIINLDLYSPILYNAV  85

Query  574  KAFSPLKIRLGGTLQDKVVYQTKDDRVPCTSFVSNTSEIFSFSQGCLPLSRWDELNVFFN  753
            KAF+ L+IRLGG+LQD++ Y+       C SF  N   +F F+ GCL ++RWDELN+FF 
Sbjct  86   KAFNSLRIRLGGSLQDQITYKVGKHYADCPSFRRNDDRLFGFTDGCLAMNRWDELNIFFR  145

Query  754  KSG*PTRFIPCPAYICQHs*lyvsslrvllrAVIIFGLNALTGRSIRSDASA---VGAWD  924
            ++                               + FGLNAL GR   ++  +   VG WD
Sbjct  146  RTN----------------------------TTVTFGLNALRGRRKAAENGSTLHVGGWD  177

Query  925  STNAESLMKYTVEKGYTIHGWELG  996
              NA  LM+YTV KGY +  WELG
Sbjct  178  GRNARDLMRYTVSKGYRVESWELG  201



>ref|XP_009801838.1| PREDICTED: heparanase-like protein 2 isoform X1 [Nicotiana sylvestris]
 ref|XP_009801839.1| PREDICTED: heparanase-like protein 2 isoform X1 [Nicotiana sylvestris]
 ref|XP_009801840.1| PREDICTED: heparanase-like protein 2 isoform X1 [Nicotiana sylvestris]
 ref|XP_009801841.1| PREDICTED: heparanase-like protein 2 isoform X1 [Nicotiana sylvestris]
Length=539

 Score =   182 bits (461),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 84/197 (43%), Positives = 116/197 (59%), Gaps = 28/197 (14%)
 Frame = +1

Query  406  SVYVDGKSRIGRTDSDFICATLDWWPPEKCDYGTCAWGHASLLNLDLSNIIFLNAIKAFS  585
            ++ +D   +I  TD++++CATLDWWP EKCDY  C WG+ SL+NLDLS+    N+I+AF+
Sbjct  26   ALLIDATVKIAETDANYVCATLDWWPKEKCDYNDCPWGYTSLMNLDLSHPFLANSIQAFN  85

Query  586  PLKIRLGGTLQDKVVYQTKDDRVPCTSFVSNTSEIFSFSQGCLPLSRWDELNVFFNKSG*  765
            PL++RLGG+LQ++V+Y   +    C +F      +F FS+GCL ++RWDELN FF K+G 
Sbjct  86   PLRLRLGGSLQNRVIYDVGNLESRCHAFTKQEDGLFGFSKGCLHMNRWDELNSFFKKTG-  144

Query  766  PTRFIPCPAYICQHs*lyvsslrvllrAVIIFGLNALTGRSIRSDASAVGAWDSTNAESL  945
                                       A++ FGLNAL GR         G WDS+NA   
Sbjct  145  ---------------------------ALVTFGLNALHGRQRAGKRVWGGNWDSSNARDF  177

Query  946  MKYTVEKGYTIHGWELG  996
            + YT+ KGY IH WE G
Sbjct  178  INYTISKGYQIHSWEFG  194



>gb|ACJ85515.1| unknown [Medicago truncatula]
Length=372

 Score =   178 bits (451),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 97/228 (43%), Positives = 126/228 (55%), Gaps = 37/228 (16%)
 Frame = +1

Query  328  MRLW---ILVLGVFNVSLISGSETLGDKGSVYVDGKSRIGRTDSDFICATLDWWPPEKCD  498
            MRL+    L L    V+L    E     GS+ V+G      T  +FICAT+DWWP +KCD
Sbjct  1    MRLYHALFLFLASLQVALSQDIE----HGSLLVNGTQAKAETGDNFICATIDWWPHDKCD  56

Query  499  YGTCAWGHASLLNLDLSNIIFLNAIKAFSPLKIRLGGTLQDKVVYQTKDDRVPCTSFVSN  678
            YG C+WG++S++NLDLS+     AI+A  PL+IRLGG+LQD+VVY   + + PC      
Sbjct  57   YGHCSWGYSSVVNLDLSHPFLAKAIQALKPLRIRLGGSLQDQVVYDIGNLKSPCHPLQKM  116

Query  679  TSE--IFSFSQGCLPLSRWDELNVFFNKSG*PTRFIPCPAYICQHs*lyvsslrvllrAV  852
              +  +F FS+GCL + RWDELN FFN++G                            A+
Sbjct  117  NGQGWLFGFSKGCLHMKRWDELNQFFNQTG----------------------------AI  148

Query  853  IIFGLNALTGRSIRSDASAVGAWDSTNAESLMKYTVEKGYTIHGWELG  996
            + FGLNAL G+   S     G WD TNA   +KYTV KGY I  WELG
Sbjct  149  VTFGLNALRGKHQISHHVWEGVWDPTNAYDFIKYTVSKGYKIDAWELG  196



>gb|ACV84153.1| heparanase [Oryza sativa Indica Group]
Length=542

 Score =   181 bits (460),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 91/225 (40%), Positives = 129/225 (57%), Gaps = 29/225 (13%)
 Frame = +1

Query  322  LQMRLWILVLGVFNVSLISGSETLGDKGSVYVDGKSRIGRTDSDFICATLDWWPPEKCDY  501
            +++RL +LV    +    + S    ++ +V V G ++I  T+ ++ICAT+DWWPPEKC+Y
Sbjct  1    MEVRLLLLVFICLHALHWAASAQQPEEATVIVKGSTKIAETNKNYICATIDWWPPEKCNY  60

Query  502  GTCAWGHASLLNLDLSNIIFLNAIKAFSPLKIRLGGTLQDKVVYQTKDDRVPCTSFVSNT  681
              C WG +S+LNLDL +     AI+AF  L+IRLGG+LQD+VVY    +  PCT F + +
Sbjct  61   NQCPWGQSSILNLDLDHPFLAQAIQAFDNLRIRLGGSLQDRVVYDVGTNS-PCTPFTNIS  119

Query  682  SEIFSFSQGCLPLSRWDELNVFFNKSG*PTRFIPCPAYICQHs*lyvsslrvllrAVIIF  861
            + +F FS GCL + RWD+LN  F K+G                            A+I F
Sbjct  120  NGLFGFSDGCLSMDRWDKLNALFQKTG----------------------------AIITF  151

Query  862  GLNALTGRSIRSDASAVGAWDSTNAESLMKYTVEKGYTIHGWELG  996
            GLNAL GR     +   G W+STNA + +KYT+ KGY +  WE G
Sbjct  152  GLNALYGRYNVRRSFWAGKWNSTNAYNFVKYTISKGYPVDSWEYG  196



>ref|XP_010259074.1| PREDICTED: heparanase-like protein 1 [Nelumbo nucifera]
 ref|XP_010259082.1| PREDICTED: heparanase-like protein 1 [Nelumbo nucifera]
 ref|XP_010259088.1| PREDICTED: heparanase-like protein 1 [Nelumbo nucifera]
Length=539

 Score =   181 bits (460),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 92/218 (42%), Positives = 124/218 (57%), Gaps = 30/218 (14%)
 Frame = +1

Query  343  LVLGVFNVSLISGSETLGDKGSVYVDGKSRIGRTDSDFICATLDWWPPEKCDYGTCAWGH  522
            L+  V ++S I   E+     ++ V G   I  TD +FICATLDWWP +KC+Y  C WG 
Sbjct  7    LLFSVVSLSGICAQESA--LATIVVRGSKSIAETDHNFICATLDWWPHDKCNYNQCPWGE  64

Query  523  ASLLNLDLSNIIFLNAIKAFSPLKIRLGGTLQDKVVYQTKDDRVPCTSFVSNTSEIFSFS  702
            +S+LNLDLS+     AI+AF+PL+IR+GG+LQD+VVY     + PC  F      +F FS
Sbjct  65   SSVLNLDLSHPFLAKAIQAFNPLRIRIGGSLQDRVVYNVGTLKHPCHPFQKKPDGLFGFS  124

Query  703  QGCLPLSRWDELNVFFNKSG*PTRFIPCPAYICQHs*lyvsslrvllrAVIIFGLNALTG  882
             GCL ++RWDE+N  F+K+G                            A++ FGLNAL G
Sbjct  125  TGCLEMNRWDEINHLFSKTG----------------------------AIVTFGLNALYG  156

Query  883  RSIRSDASAVGAWDSTNAESLMKYTVEKGYTIHGWELG  996
            R         GAWD++NA+S M+YT+ KGY I  WE G
Sbjct  157  RHEIRRGVWGGAWDTSNAQSFMEYTISKGYQIDSWEFG  194



>ref|XP_009783167.1| PREDICTED: heparanase-like protein 2 [Nicotiana sylvestris]
Length=516

 Score =   181 bits (459),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 100/227 (44%), Positives = 132/227 (58%), Gaps = 36/227 (16%)
 Frame = +1

Query  325  QMRLWILVLGVFNVSLISGSETLGDKGSVYVDGKSRIGRTDSDFICATLDWWPPEKCDYG  504
            + RL+ LVL V +   +S S+ L     V V G + I +TD +FICATLDWWP  KCDY 
Sbjct  4    RTRLFCLVLLVSSCFCLSNSDEL----KVIVKGVTSIAKTDDNFICATLDWWPENKCDYN  59

Query  505  TCAWGHASLLNLDLSNIIFLNAIKAFSPLKIRLGGTLQDKVVYQTKDDRVPCTSFVSNTS  684
             C WG A +LNLDL N I  NA+KAF+PL+IR+GG+LQD+V Y+       C++F   + 
Sbjct  60   QCPWGKAGILNLDLKNKILTNAVKAFNPLRIRIGGSLQDQVYYKVGKFPKQCSNFEKKSD  119

Query  685  EIFSFSQGCLPLSRWDELNVFFNKSG*PTRFIPCPAYICQHs*lyvsslrvllrAVIIFG  864
             +F F++GCL ++RWDEL+  FNK+G                            A + F 
Sbjct  120  GLFGFAEGCLHMNRWDELHDLFNKTG----------------------------AALTFS  151

Query  865  LNALTGRSIRSDASAV---GAWDSTNAESLMKYTVEKGYTIHGWELG  996
            LNAL GR I+SD       G W+  NA+SLMKYT+ KGY I  +ELG
Sbjct  152  LNALLGR-IQSDEDDTLWEGDWNQFNAKSLMKYTIRKGYKIDSYELG  197



>ref|XP_009595357.1| PREDICTED: heparanase-like protein 2 isoform X2 [Nicotiana tomentosiformis]
Length=539

 Score =   181 bits (460),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 84/197 (43%), Positives = 116/197 (59%), Gaps = 28/197 (14%)
 Frame = +1

Query  406  SVYVDGKSRIGRTDSDFICATLDWWPPEKCDYGTCAWGHASLLNLDLSNIIFLNAIKAFS  585
            ++ +DG  +I  TD++++CATLDWWP EKC+Y  C WG+ SL+NLDLS+    N+IKAF+
Sbjct  26   ALVIDGTVKIAETDANYVCATLDWWPKEKCNYNECPWGYTSLMNLDLSHPFLANSIKAFN  85

Query  586  PLKIRLGGTLQDKVVYQTKDDRVPCTSFVSNTSEIFSFSQGCLPLSRWDELNVFFNKSG*  765
            PL++RLGG+LQ++V+Y   +    C  F      +F FS+GCL ++RWDELN FF K+G 
Sbjct  86   PLRLRLGGSLQNRVIYDVGNLESRCHPFTKQGDGLFGFSKGCLHMNRWDELNSFFKKTG-  144

Query  766  PTRFIPCPAYICQHs*lyvsslrvllrAVIIFGLNALTGRSIRSDASAVGAWDSTNAESL  945
                                       A++ FGLNAL GR         G WDS+NA   
Sbjct  145  ---------------------------ALVTFGLNALHGRQRTGKRLWGGNWDSSNAHDF  177

Query  946  MKYTVEKGYTIHGWELG  996
            + YT+ +GY IH WE G
Sbjct  178  INYTISRGYQIHSWEFG  194



>ref|XP_006574932.1| PREDICTED: heparanase-like protein 2-like [Glycine max]
Length=519

 Score =   181 bits (459),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 94/197 (48%), Positives = 115/197 (58%), Gaps = 31/197 (16%)
 Frame = +1

Query  415  VDGKSRIGRTDSDFICATLDWWPPEKCDYGTCAWGHASLLNLDLSNIIFLNAIKAFSPLK  594
            V G + I  TD +FICATLDWWP  KCDY  C WG A +LNLDL N I  NA+KAF+PL+
Sbjct  28   VKGVASIANTDDNFICATLDWWPANKCDYDQCPWGQAGILNLDLDNKILTNAVKAFNPLR  87

Query  595  IRLGGTLQDKVVYQTKDDRVPCTSFVSNTSEIFSFSQGCLPLSRWDELNVFFNKSG*PTR  774
            IRLGG+L+D++VYQ    +  C  F      +F FSQ CLP  RWDE+N FFNK+G    
Sbjct  88   IRLGGSLEDQIVYQFGKQK-KCPHFKKKADGLFGFSQACLPKVRWDEVNDFFNKTG----  142

Query  775  FIPCPAYICQHs*lyvsslrvllrAVIIFGLNALTGR--SIRSDASAVGAWDSTNAESLM  948
                                      +IFGLNALTG+  S     + VG W+  NA SLM
Sbjct  143  ------------------------VKLIFGLNALTGKRNSAEDKKNWVGNWNPKNAISLM  178

Query  949  KYTVEKGYTIHGWELGK  999
            KYT+ KGY I  +ELG+
Sbjct  179  KYTISKGYKIDSYELGR  195



>ref|XP_009595353.1| PREDICTED: heparanase-like protein 2 isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009595354.1| PREDICTED: heparanase-like protein 2 isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009595355.1| PREDICTED: heparanase-like protein 2 isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009595356.1| PREDICTED: heparanase-like protein 2 isoform X1 [Nicotiana tomentosiformis]
Length=556

 Score =   181 bits (460),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 84/197 (43%), Positives = 116/197 (59%), Gaps = 28/197 (14%)
 Frame = +1

Query  406  SVYVDGKSRIGRTDSDFICATLDWWPPEKCDYGTCAWGHASLLNLDLSNIIFLNAIKAFS  585
            ++ +DG  +I  TD++++CATLDWWP EKC+Y  C WG+ SL+NLDLS+    N+IKAF+
Sbjct  26   ALVIDGTVKIAETDANYVCATLDWWPKEKCNYNECPWGYTSLMNLDLSHPFLANSIKAFN  85

Query  586  PLKIRLGGTLQDKVVYQTKDDRVPCTSFVSNTSEIFSFSQGCLPLSRWDELNVFFNKSG*  765
            PL++RLGG+LQ++V+Y   +    C  F      +F FS+GCL ++RWDELN FF K+G 
Sbjct  86   PLRLRLGGSLQNRVIYDVGNLESRCHPFTKQGDGLFGFSKGCLHMNRWDELNSFFKKTG-  144

Query  766  PTRFIPCPAYICQHs*lyvsslrvllrAVIIFGLNALTGRSIRSDASAVGAWDSTNAESL  945
                                       A++ FGLNAL GR         G WDS+NA   
Sbjct  145  ---------------------------ALVTFGLNALHGRQRTGKRLWGGNWDSSNAHDF  177

Query  946  MKYTVEKGYTIHGWELG  996
            + YT+ +GY IH WE G
Sbjct  178  INYTISRGYQIHSWEFG  194



>ref|XP_010068782.1| PREDICTED: heparanase-like protein 1 [Eucalyptus grandis]
 gb|KCW64898.1| hypothetical protein EUGRSUZ_G02460 [Eucalyptus grandis]
Length=521

 Score =   180 bits (457),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 92/201 (46%), Positives = 119/201 (59%), Gaps = 32/201 (16%)
 Frame = +1

Query  406  SVYVDGKSRIGRTDSDFICATLDWWPPEKCDYGTCAWGHASLLNLDLSNIIFLNAIKAFS  585
            +V V G + + RTD +F+CATLDWWP +KCDYG C WG A ++NLDL N I  NAIKAF+
Sbjct  26   TVTVAGVTDVARTDDNFVCATLDWWPVDKCDYGQCPWGMAGIINLDLKNKILSNAIKAFN  85

Query  586  PLKIRLGGTLQDKVVYQTKDDRV--PCTSFVSNTSEIFSFSQGCLPLSRWDELNVFFNKS  759
            PL+IR+GG+LQD+V+Y+  D R    C  F    S +F FS+GCL + RWD+LN  FN++
Sbjct  86   PLRIRVGGSLQDQVIYKVGDARPVHKCPHFKKQPSGMFGFSRGCLTMDRWDQLNELFNET  145

Query  760  G*PTRFIPCPAYICQHs*lyvsslrvllrAVIIFGLNALTGRSIRSDASA--VGAWDSTN  933
            G                            A + FGLNAL GR    + S   +G WDS N
Sbjct  146  G----------------------------AALTFGLNALIGRHRSPNDSDHFIGDWDSQN  177

Query  934  AESLMKYTVEKGYTIHGWELG  996
            A  LM YT+ KGY +  +ELG
Sbjct  178  ARDLMSYTISKGYKMDSYELG  198



>ref|XP_003558511.1| PREDICTED: heparanase-like protein 1 [Brachypodium distachyon]
Length=544

 Score =   180 bits (457),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 89/207 (43%), Positives = 119/207 (57%), Gaps = 29/207 (14%)
 Frame = +1

Query  376  SGSETLGDKGSVYVDGKSRIGRTDSDFICATLDWWPPEKCDYGTCAWGHASLLNLDLSNI  555
            S S    ++ +V V G +RI  TD +++CAT+DWWPPEKC+Y  C WG +S+LNLDL + 
Sbjct  20   SASAQQPEEATVIVKGSNRIAETDENYVCATIDWWPPEKCNYNQCPWGQSSILNLDLDHP  79

Query  556  IFLNAIKAFSPLKIRLGGTLQDKVVYQTKDDRVPCTSFVSNTSEIFSFSQGCLPLSRWDE  735
                AI+AF  L+IRLGG+LQD+VVY    +  PC+ F + +S +F FS GCL + RWD+
Sbjct  80   FLAQAIQAFDNLRIRLGGSLQDRVVYDVGTNS-PCSPFTNMSSGLFGFSVGCLSMDRWDK  138

Query  736  LNVFFNKSG*PTRFIPCPAYICQHs*lyvsslrvllrAVIIFGLNALTGRSIRSDASAVG  915
            LN  F K+G                            A+I FGLNAL GR     +   G
Sbjct  139  LNDLFQKTG----------------------------AIITFGLNALYGRHNVQRSVWTG  170

Query  916  AWDSTNAESLMKYTVEKGYTIHGWELG  996
             W+STNA   +KYT+ KGY +  WE G
Sbjct  171  KWNSTNAYDFLKYTISKGYQVESWEFG  197



>ref|XP_010258147.1| PREDICTED: heparanase-like protein 1 isoform X2 [Nelumbo nucifera]
Length=543

 Score =   180 bits (457),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 93/224 (42%), Positives = 127/224 (57%), Gaps = 31/224 (14%)
 Frame = +1

Query  328  MRLWILVLGVFNVSLISGSETLGDKGSVYVDGKSRIGRTDSDFICATLDWWPPEKCDYGT  507
            M+L++L+  + ++  I   ET     ++ V G + I  TD +FICAT+DWWP +KC+Y  
Sbjct  6    MKLFVLLF-LASLPGILAQETA--DATIVVKGSTIIAETDHNFICATIDWWPHDKCNYNQ  62

Query  508  CAWGHASLLNLDLSNIIFLNAIKAFSPLKIRLGGTLQDKVVYQTKDDRVPCTSFVSNTSE  687
            C WG +S+LNLDLS+    NAI+AF+PL+IR+GG+LQD+VVY       PC  F   +  
Sbjct  63   CPWGESSILNLDLSHPSLANAIQAFNPLRIRIGGSLQDQVVYNVGSLNSPCQPFQKKSDG  122

Query  688  IFSFSQGCLPLSRWDELNVFFNKSG*PTRFIPCPAYICQHs*lyvsslrvllrAVIIFGL  867
            +F FS GCL + RWDE+N  FNK+G                            A++ FGL
Sbjct  123  LFGFSMGCLNMDRWDEINHLFNKTG----------------------------AIMTFGL  154

Query  868  NALTGRSIRSDASAVGAWDSTNAESLMKYTVEKGYTIHGWELGK  999
            NAL GR         GAWDS NA+  ++YT+ KGY I  WE G 
Sbjct  155  NALYGRHQIRKGVWGGAWDSINAQDFIEYTISKGYEIDSWEFGN  198



>ref|XP_003614012.1| Heparanase-like protein [Medicago truncatula]
Length=505

 Score =   179 bits (455),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 90/197 (46%), Positives = 117/197 (59%), Gaps = 30/197 (15%)
 Frame = +1

Query  415  VDGKSRIGRTDSDFICATLDWWPPEKCDYGTCAWGHASLLNLDLSNIIFLNAIKAFSPLK  594
            V G + I  TD++FICATLDWWP  KCDY  C WG A +LNLDL N I  NA+KAF+PL+
Sbjct  26   VKGVTNIATTDNNFICATLDWWPENKCDYNQCPWGKAGILNLDLGNRILSNAVKAFNPLR  85

Query  595  IRLGGTLQDKVVYQTKDDRVPCTSFVSNTSEIFSFSQGCLPLSRWDELNVFFNKSG*PTR  774
            IRLGG+LQD+++YQ       C + +     +F FS+GCLP +RWD++N FFNK+G    
Sbjct  86   IRLGGSLQDQIIYQFGSHIKRCPNMIKIAGGLFGFSKGCLPQNRWDQVNDFFNKNG----  141

Query  775  FIPCPAYICQHs*lyvsslrvllrAVIIFGLNALTGRSIRS--DASAVGAWDSTNAESLM  948
                                      + FGLNAL G++I    + S +G W   NA SLM
Sbjct  142  ------------------------VKLTFGLNALIGKNISKVDNKSFLGDWRPANAISLM  177

Query  949  KYTVEKGYTIHGWELGK  999
            KYT+ KGY I  +ELG+
Sbjct  178  KYTISKGYKIDSYELGR  194



>ref|XP_010546175.1| PREDICTED: heparanase-like protein 1 isoform X2 [Tarenaya hassleriana]
Length=467

 Score =   179 bits (453),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 83/199 (42%), Positives = 116/199 (58%), Gaps = 28/199 (14%)
 Frame = +1

Query  400  KGSVYVDGKSRIGRTDSDFICATLDWWPPEKCDYGTCAWGHASLLNLDLSNIIFLNAIKA  579
            +  + +DG  R+  TD +F+CAT+DWWP +KC+Y  C WG++S++N+DLS+ +   AI+A
Sbjct  25   RARIIIDGTRRVSETDENFVCATIDWWPHDKCNYDQCPWGYSSVINMDLSHPLLAKAIQA  84

Query  580  FSPLKIRLGGTLQDKVVYQTKDDRVPCTSFVSNTSEIFSFSQGCLPLSRWDELNVFFNKS  759
            F PL+IR+GG+LQD+V+Y   + + PC  F    + +F FS+GCL + RWDELN F  ++
Sbjct  85   FGPLRIRIGGSLQDQVIYDVGNLKSPCHPFKKMDNGLFGFSKGCLHMKRWDELNTFLTET  144

Query  760  G*PTRFIPCPAYICQHs*lyvsslrvllrAVIIFGLNALTGRSIRSDASAVGAWDSTNAE  939
            G                            A++ FGLNAL GR      +  GAWD TNA 
Sbjct  145  G----------------------------AMVTFGLNALHGRHKLGGNAWGGAWDQTNAL  176

Query  940  SLMKYTVEKGYTIHGWELG  996
              M YTV KGY I  WE G
Sbjct  177  DFMNYTVSKGYRIDSWEFG  195



>ref|NP_001049350.1| Os03g0211700 [Oryza sativa Japonica Group]
 gb|ABF94603.1| Heparanase-like protein 2 precursor, putative, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF11264.1| Os03g0211700 [Oryza sativa Japonica Group]
Length=541

 Score =   180 bits (457),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 90/225 (40%), Positives = 128/225 (57%), Gaps = 29/225 (13%)
 Frame = +1

Query  322  LQMRLWILVLGVFNVSLISGSETLGDKGSVYVDGKSRIGRTDSDFICATLDWWPPEKCDY  501
            +++RL +LV    +  L + S    ++ +V V G ++I  T+ ++ICAT+DWWPPEKC+Y
Sbjct  1    MEVRLLLLVFICLHALLWAASAQQPEEATVIVKGSTKIAETNKNYICATIDWWPPEKCNY  60

Query  502  GTCAWGHASLLNLDLSNIIFLNAIKAFSPLKIRLGGTLQDKVVYQTKDDRVPCTSFVSNT  681
              C WG +S+LNLDL +     AI+AF  L+IRLGG+LQD+VVY    +  PC  F + +
Sbjct  61   NQCPWGQSSILNLDLDHPFLAQAIQAFDNLRIRLGGSLQDRVVYDVGTNS-PCAPFTNMS  119

Query  682  SEIFSFSQGCLPLSRWDELNVFFNKSG*PTRFIPCPAYICQHs*lyvsslrvllrAVIIF  861
            + +F FS GCL + RWD+LN  F K+G                            A+I F
Sbjct  120  NGLFGFSDGCLSMDRWDKLNALFQKTG----------------------------AIITF  151

Query  862  GLNALTGRSIRSDASAVGAWDSTNAESLMKYTVEKGYTIHGWELG  996
            GLNAL GR     +     W+STNA + +KYT+ KGY +  WE G
Sbjct  152  GLNALYGRYNVRRSFWASKWNSTNAYNFVKYTISKGYPVDSWEYG  196



>gb|KHN02016.1| Heparanase-like protein 2 [Glycine soja]
Length=518

 Score =   180 bits (456),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 94/196 (48%), Positives = 114/196 (58%), Gaps = 31/196 (16%)
 Frame = +1

Query  415  VDGKSRIGRTDSDFICATLDWWPPEKCDYGTCAWGHASLLNLDLSNIIFLNAIKAFSPLK  594
            V G + I  TD +FICATLDWWP  KCDY  C WG A +LNLDL N I  NA+KAF+PL+
Sbjct  28   VKGVASIANTDDNFICATLDWWPANKCDYDQCPWGQAGILNLDLDNKILTNAVKAFNPLR  87

Query  595  IRLGGTLQDKVVYQTKDDRVPCTSFVSNTSEIFSFSQGCLPLSRWDELNVFFNKSG*PTR  774
            IRLGG+L+D++VYQ    +  C  F      +F FSQ CLP  RWDE+N FFNK+G    
Sbjct  88   IRLGGSLEDQIVYQFGKQK-KCPHFKKKADGLFGFSQACLPKVRWDEVNDFFNKTG----  142

Query  775  FIPCPAYICQHs*lyvsslrvllrAVIIFGLNALTGR--SIRSDASAVGAWDSTNAESLM  948
                                      +IFGLNALTG+  S     + VG W+  NA SLM
Sbjct  143  ------------------------VKLIFGLNALTGKRNSAEDKKNWVGNWNPKNAISLM  178

Query  949  KYTVEKGYTIHGWELG  996
            KYT+ KGY I  +ELG
Sbjct  179  KYTISKGYKIDSYELG  194



>dbj|BAJ84826.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=537

 Score =   180 bits (457),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 90/198 (45%), Positives = 114/198 (58%), Gaps = 28/198 (14%)
 Frame = +1

Query  406  SVYVDGKSRIGRTDSDFICATLDWWPPEKCDYGTCAWGHASLLNLDLSNIIFLNAIKAFS  585
            +V V G   I  T  +FICATLDWWPPEKC+Y  C WG AS+LN+DL+N +   AI+AFS
Sbjct  26   TVIVRGSRTIAATSDEFICATLDWWPPEKCNYDQCPWGKASVLNMDLTNPLLAKAIQAFS  85

Query  586  PLKIRLGGTLQDKVVYQTKDDRVPCTSFVSNTSEIFSFSQGCLPLSRWDELNVFFNKSG*  765
            PL+IR+GG+LQD+VVYQT +   PC  F   +S +F FS+GC+ + RWD +N  F  +G 
Sbjct  86   PLRIRVGGSLQDQVVYQTPNLGSPCRPFTKASSGLFGFSKGCITMERWDAMNDLFLNTG-  144

Query  766  PTRFIPCPAYICQHs*lyvsslrvllrAVIIFGLNALTGRSIRSDASAVGAWDSTNAESL  945
                                       AVI FGLNAL GR         GAW+S+NA+  
Sbjct  145  ---------------------------AVITFGLNALRGRKQIRKGVWGGAWNSSNAQEF  177

Query  946  MKYTVEKGYTIHGWELGK  999
            M+YTV   Y I  WE G 
Sbjct  178  MEYTVSMNYPIDSWEFGN  195



>gb|KEH33103.1| glycoside hydrolase family 79 amino-terminal domain protein [Medicago 
truncatula]
Length=520

 Score =   180 bits (456),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 97/225 (43%), Positives = 126/225 (56%), Gaps = 31/225 (14%)
 Frame = +1

Query  328  MRLWILVLGVFNVSLISGSETLGDKGSVYVDGKSRIGRTDSDFICATLDWWPPEKCDYGT  507
            MRL  L L +F  SL        + G + V+G         +FICAT+DWWPPE C++G 
Sbjct  1    MRL-SLALFIFLASLQVTLSKDVEHGLILVNGAQAKAEIGDNFICATIDWWPPELCNFGV  59

Query  508  CAWGHASLLNLDLSNIIFLNAIKAFSPLKIRLGGTLQDKVVYQTKDDRVPCTSFVSNTSE  687
            C+WGH+S++NLDLS+ +   AI+A  PL+IRLGG+LQD+VVY   + + P   F      
Sbjct  60   CSWGHSSIVNLDLSHPLLAKAIQALKPLRIRLGGSLQDQVVYNVGNLKSPGHPFQKVKGG  119

Query  688  IFSFSQGCLPLSRWDELNVFFNKSG*PTRFIPCPAYICQHs*lyvsslrvllrAVIIFGL  867
               FS+G L + RWDELN FFNK+G                            A+++FGL
Sbjct  120  FLGFSEGSLHMQRWDELNHFFNKTG----------------------------AIVMFGL  151

Query  868  NALTGRSIRSDASAV--GAWDSTNAESLMKYTVEKGYTIHGWELG  996
            NAL+GR   S+ S V  GAWD TNA   +KYTV KGY I  WE G
Sbjct  152  NALSGRHKISNTSNVWEGAWDPTNAYDFIKYTVSKGYKIDAWEFG  196



>dbj|BAJ96463.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=537

 Score =   180 bits (456),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 90/197 (46%), Positives = 114/197 (58%), Gaps = 28/197 (14%)
 Frame = +1

Query  406  SVYVDGKSRIGRTDSDFICATLDWWPPEKCDYGTCAWGHASLLNLDLSNIIFLNAIKAFS  585
            +V V G   I  T  +FICATLDWWPPEKC+Y  C WG AS+LN+DL+N +   AI+AFS
Sbjct  26   TVIVRGSRTIAATSDEFICATLDWWPPEKCNYDQCPWGKASVLNMDLTNPLLAKAIQAFS  85

Query  586  PLKIRLGGTLQDKVVYQTKDDRVPCTSFVSNTSEIFSFSQGCLPLSRWDELNVFFNKSG*  765
            PL+IR+GG+LQD+VVYQT +   PC  F   +S +F FS+GC+ + RWD +N  F  +G 
Sbjct  86   PLRIRVGGSLQDQVVYQTPNLGSPCRPFTKASSGLFGFSKGCITMERWDAMNDLFLNTG-  144

Query  766  PTRFIPCPAYICQHs*lyvsslrvllrAVIIFGLNALTGRSIRSDASAVGAWDSTNAESL  945
                                       AVI FGLNAL GR         GAW+S+NA+  
Sbjct  145  ---------------------------AVITFGLNALRGRKQIRKGVWGGAWNSSNAQEF  177

Query  946  MKYTVEKGYTIHGWELG  996
            M+YTV   Y I  WE G
Sbjct  178  MEYTVSMNYPIDSWEFG  194



>ref|XP_010106651.1| Heparanase-like protein 1 [Morus notabilis]
 gb|EXC11030.1| Heparanase-like protein 1 [Morus notabilis]
Length=524

 Score =   180 bits (456),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 85/198 (43%), Positives = 117/198 (59%), Gaps = 28/198 (14%)
 Frame = +1

Query  403  GSVYVDGKSRIGRTDSDFICATLDWWPPEKCDYGTCAWGHASLLNLDLSNIIFLNAIKAF  582
             ++ VDG  R    D +FICAT+DWWP +KC+Y  C WG+ S +NL+LS+ +   AI+AF
Sbjct  27   ANIVVDGTERAAEVDENFICATMDWWPHDKCNYNQCPWGYTSAINLNLSHPLLTKAIQAF  86

Query  583  SPLKIRLGGTLQDKVVYQTKDDRVPCTSFVSNTSEIFSFSQGCLPLSRWDELNVFFNKSG  762
             PL+IR+GG+LQD+V+Y  +  ++ C  F      +F FS+GCL +SRWDELN+FFNK+G
Sbjct  87   KPLRIRVGGSLQDRVLYDLEGLKLRCHPFRKEKGGLFGFSRGCLRMSRWDELNLFFNKTG  146

Query  763  *PTRFIPCPAYICQHs*lyvsslrvllrAVIIFGLNALTGRSIRSDASAVGAWDSTNAES  942
                                        A++ FGLNAL GR +    +  G WDS+NA  
Sbjct  147  ----------------------------AIVTFGLNALYGRHVIDKTAWGGDWDSSNAYE  178

Query  943  LMKYTVEKGYTIHGWELG  996
             +KYTV KG+ I  WE G
Sbjct  179  FVKYTVSKGHKIDSWEFG  196



>gb|KHN04137.1| Heparanase-like protein 1 [Glycine soja]
Length=547

 Score =   180 bits (456),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 95/223 (43%), Positives = 125/223 (56%), Gaps = 29/223 (13%)
 Frame = +1

Query  328  MRLWILVLGVFNVSLISGSETLGDKGSVYVDGKSRIGRTDSDFICATLDWWPPEKCDYGT  507
            MR  I  L +F  SL +      + GS+ VDG      T  +FICAT+DWWP +KCDY  
Sbjct  1    MRFRI-ALFLFLASLQATLSQDIEHGSLLVDGAQTKAETGDNFICATIDWWPHDKCDYNH  59

Query  508  CAWGHASLLNLDLSNIIFLNAIKAFSPLKIRLGGTLQDKVVYQTKDDRVPCTSFVSNTSE  687
            C WG++S++NLDLS+     AI+A  PL+IRLGG+LQD+V+Y     + PC    S   E
Sbjct  60   CPWGYSSVVNLDLSHPFLAKAIQALKPLRIRLGGSLQDRVLYDVGSLKSPCHPLQSVKGE  119

Query  688  IFSFSQGCLPLSRWDELNVFFNKSG*PTRFIPCPAYICQHs*lyvsslrvllrAVIIFGL  867
            +F FS+GCL + RWDELN FFN++G                            A++ FGL
Sbjct  120  LFGFSKGCLHMKRWDELNQFFNETG----------------------------AIVTFGL  151

Query  868  NALTGRSIRSDASAVGAWDSTNAESLMKYTVEKGYTIHGWELG  996
            N L G+   S     GAWD TNA + ++YT+ KGY I  WELG
Sbjct  152  NLLHGKHQISHNVWEGAWDPTNAYNFIEYTISKGYKIDSWELG  194



>ref|XP_003527099.1| PREDICTED: heparanase-like protein 1-like isoform X1 [Glycine 
max]
 ref|XP_006581995.1| PREDICTED: heparanase-like protein 1-like isoform X2 [Glycine 
max]
Length=547

 Score =   180 bits (456),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 95/223 (43%), Positives = 125/223 (56%), Gaps = 29/223 (13%)
 Frame = +1

Query  328  MRLWILVLGVFNVSLISGSETLGDKGSVYVDGKSRIGRTDSDFICATLDWWPPEKCDYGT  507
            MR  I  L +F  SL +      + GS+ VDG      T  +FICAT+DWWP +KCDY  
Sbjct  1    MRFRI-ALFLFLASLQATLSQDIEHGSLLVDGAQTKAETGDNFICATIDWWPHDKCDYNH  59

Query  508  CAWGHASLLNLDLSNIIFLNAIKAFSPLKIRLGGTLQDKVVYQTKDDRVPCTSFVSNTSE  687
            C WG++S++NLDLS+     AI+A  PL+IRLGG+LQD+V+Y     + PC    S   E
Sbjct  60   CPWGYSSVVNLDLSHPFLAKAIQALKPLRIRLGGSLQDRVLYDVGSLKSPCHPLQSVKGE  119

Query  688  IFSFSQGCLPLSRWDELNVFFNKSG*PTRFIPCPAYICQHs*lyvsslrvllrAVIIFGL  867
            +F FS+GCL + RWDELN FFN++G                            A++ FGL
Sbjct  120  LFGFSKGCLHMKRWDELNQFFNETG----------------------------AIVTFGL  151

Query  868  NALTGRSIRSDASAVGAWDSTNAESLMKYTVEKGYTIHGWELG  996
            N L G+   S     GAWD TNA + ++YT+ KGY I  WELG
Sbjct  152  NLLHGKHQISHNVWEGAWDPTNAYNFIEYTISKGYKIDSWELG  194



>ref|XP_007157647.1| hypothetical protein PHAVU_002G087100g [Phaseolus vulgaris]
 ref|XP_007157648.1| hypothetical protein PHAVU_002G087100g [Phaseolus vulgaris]
 ref|XP_007157649.1| hypothetical protein PHAVU_002G087100g [Phaseolus vulgaris]
 gb|ESW29641.1| hypothetical protein PHAVU_002G087100g [Phaseolus vulgaris]
 gb|ESW29642.1| hypothetical protein PHAVU_002G087100g [Phaseolus vulgaris]
 gb|ESW29643.1| hypothetical protein PHAVU_002G087100g [Phaseolus vulgaris]
Length=276

 Score =   173 bits (439),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 87/200 (44%), Positives = 112/200 (56%), Gaps = 28/200 (14%)
 Frame = +1

Query  397  DKGSVYVDGKSRIGRTDSDFICATLDWWPPEKCDYGTCAWGHASLLNLDLSNIIFLNAIK  576
            + GS+ VDG      T  +FICAT+DWWP +KCDY  C WG++S++NLDLS      AI+
Sbjct  23   EHGSLLVDGAQTKAETGDNFICATIDWWPHDKCDYNHCPWGYSSVVNLDLSLPFLSKAIQ  82

Query  577  AFSPLKIRLGGTLQDKVVYQTKDDRVPCTSFVSNTSEIFSFSQGCLPLSRWDELNVFFNK  756
            A  PL+IRLGG+LQD+V+Y     + PC         +F FS+GCL + RWDELN FFN+
Sbjct  83   ALKPLRIRLGGSLQDQVLYDVGSLKSPCHPLQKIKGGLFGFSKGCLHMKRWDELNQFFNE  142

Query  757  SG*PTRFIPCPAYICQHs*lyvsslrvllrAVIIFGLNALTGRSIRSDASAVGAWDSTNA  936
            +G                            A++ FGLNAL G+   S     G WD TNA
Sbjct  143  TG----------------------------AIVTFGLNALHGKHQISHNVWEGTWDPTNA  174

Query  937  ESLMKYTVEKGYTIHGWELG  996
               +KYT+ KGY I  WELG
Sbjct  175  YDFIKYTISKGYKIDSWELG  194



>ref|XP_010258149.1| PREDICTED: heparanase-like protein 1 isoform X4 [Nelumbo nucifera]
Length=537

 Score =   179 bits (455),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 87/199 (44%), Positives = 114/199 (57%), Gaps = 28/199 (14%)
 Frame = +1

Query  403  GSVYVDGKSRIGRTDSDFICATLDWWPPEKCDYGTCAWGHASLLNLDLSNIIFLNAIKAF  582
             ++ V G + I  TD +FICAT+DWWP +KC+Y  C WG +S+LNLDLS+    NAI+AF
Sbjct  22   ATIVVKGSTIIAETDHNFICATIDWWPHDKCNYNQCPWGESSILNLDLSHPSLANAIQAF  81

Query  583  SPLKIRLGGTLQDKVVYQTKDDRVPCTSFVSNTSEIFSFSQGCLPLSRWDELNVFFNKSG  762
            +PL+IR+GG+LQD+VVY       PC  F   +  +F FS GCL + RWDE+N  FNK+G
Sbjct  82   NPLRIRIGGSLQDQVVYNVGSLNSPCQPFQKKSDGLFGFSMGCLNMDRWDEINHLFNKTG  141

Query  763  *PTRFIPCPAYICQHs*lyvsslrvllrAVIIFGLNALTGRSIRSDASAVGAWDSTNAES  942
                                        A++ FGLNAL GR         GAWDS NA+ 
Sbjct  142  ----------------------------AIMTFGLNALYGRHQIRKGVWGGAWDSINAQD  173

Query  943  LMKYTVEKGYTIHGWELGK  999
             ++YT+ KGY I  WE G 
Sbjct  174  FIEYTISKGYEIDSWEFGN  192



>gb|AES96970.2| glycoside hydrolase family 79 amino-terminal domain protein [Medicago 
truncatula]
Length=504

 Score =   179 bits (453),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 90/196 (46%), Positives = 116/196 (59%), Gaps = 30/196 (15%)
 Frame = +1

Query  415  VDGKSRIGRTDSDFICATLDWWPPEKCDYGTCAWGHASLLNLDLSNIIFLNAIKAFSPLK  594
            V G + I  TD++FICATLDWWP  KCDY  C WG A +LNLDL N I  NA+KAF+PL+
Sbjct  26   VKGVTNIATTDNNFICATLDWWPENKCDYNQCPWGKAGILNLDLGNRILSNAVKAFNPLR  85

Query  595  IRLGGTLQDKVVYQTKDDRVPCTSFVSNTSEIFSFSQGCLPLSRWDELNVFFNKSG*PTR  774
            IRLGG+LQD+++YQ       C + +     +F FS+GCLP +RWD++N FFNK+G    
Sbjct  86   IRLGGSLQDQIIYQFGSHIKRCPNMIKIAGGLFGFSKGCLPQNRWDQVNDFFNKNG----  141

Query  775  FIPCPAYICQHs*lyvsslrvllrAVIIFGLNALTGRSIRS--DASAVGAWDSTNAESLM  948
                                      + FGLNAL G++I    + S +G W   NA SLM
Sbjct  142  ------------------------VKLTFGLNALIGKNISKVDNKSFLGDWRPANAISLM  177

Query  949  KYTVEKGYTIHGWELG  996
            KYT+ KGY I  +ELG
Sbjct  178  KYTISKGYKIDSYELG  193



>ref|XP_010258148.1| PREDICTED: heparanase-like protein 1 isoform X3 [Nelumbo nucifera]
Length=540

 Score =   179 bits (454),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 87/199 (44%), Positives = 114/199 (57%), Gaps = 28/199 (14%)
 Frame = +1

Query  403  GSVYVDGKSRIGRTDSDFICATLDWWPPEKCDYGTCAWGHASLLNLDLSNIIFLNAIKAF  582
             ++ V G + I  TD +FICAT+DWWP +KC+Y  C WG +S+LNLDLS+    NAI+AF
Sbjct  25   ATIVVKGSTIIAETDHNFICATIDWWPHDKCNYNQCPWGESSILNLDLSHPSLANAIQAF  84

Query  583  SPLKIRLGGTLQDKVVYQTKDDRVPCTSFVSNTSEIFSFSQGCLPLSRWDELNVFFNKSG  762
            +PL+IR+GG+LQD+VVY       PC  F   +  +F FS GCL + RWDE+N  FNK+G
Sbjct  85   NPLRIRIGGSLQDQVVYNVGSLNSPCQPFQKKSDGLFGFSMGCLNMDRWDEINHLFNKTG  144

Query  763  *PTRFIPCPAYICQHs*lyvsslrvllrAVIIFGLNALTGRSIRSDASAVGAWDSTNAES  942
                                        A++ FGLNAL GR         GAWDS NA+ 
Sbjct  145  ----------------------------AIMTFGLNALYGRHQIRKGVWGGAWDSINAQD  176

Query  943  LMKYTVEKGYTIHGWELGK  999
             ++YT+ KGY I  WE G 
Sbjct  177  FIEYTISKGYEIDSWEFGN  195



>ref|XP_008446419.1| PREDICTED: heparanase-like protein 1 [Cucumis melo]
Length=517

 Score =   179 bits (453),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 91/198 (46%), Positives = 114/198 (58%), Gaps = 30/198 (15%)
 Frame = +1

Query  409  VYVDGKSRIGRTDSDFICATLDWWPPEKCDYGTCAWGHASLLNLDLSNIIFLNAIKAFSP  588
            V V G + I +TD DFICATLDWWPP KCDYG C WG A + NLDL NII   AIK F+P
Sbjct  27   VSVKGVTTIAQTDDDFICATLDWWPPNKCDYGQCPWGLAGIPNLDLQNIILAKAIKEFNP  86

Query  589  LKIRLGGTLQDKVVYQTKDDRVPCTSFVSNTSEIFSFSQGCLPLSRWDELNVFFNKSG*P  768
            L+IR+GG+LQD+++Y+  +    C      +  +F FS+GCL + RWDELN  FNK+   
Sbjct  87   LRIRIGGSLQDQIIYRVGNGYKKCPRMRKLSEGLFGFSKGCLTMQRWDELNDLFNKT---  143

Query  769  TRFIPCPAYICQHs*lyvsslrvllrAVIIFGLNALTGRSIRSDASA--VGAWDSTNAES  942
                                      A I FGLNAL G+   +D +   VG WDS NA  
Sbjct  144  -------------------------SARITFGLNALKGKKPANDGTINWVGDWDSQNARD  178

Query  943  LMKYTVEKGYTIHGWELG  996
            L++YT  KGY I  +ELG
Sbjct  179  LIRYTASKGYKIDSYELG  196



>ref|XP_010546171.1| PREDICTED: heparanase-like protein 1 isoform X1 [Tarenaya hassleriana]
 ref|XP_010546172.1| PREDICTED: heparanase-like protein 1 isoform X1 [Tarenaya hassleriana]
 ref|XP_010546173.1| PREDICTED: heparanase-like protein 1 isoform X1 [Tarenaya hassleriana]
 ref|XP_010546174.1| PREDICTED: heparanase-like protein 1 isoform X1 [Tarenaya hassleriana]
Length=538

 Score =   179 bits (454),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 83/199 (42%), Positives = 116/199 (58%), Gaps = 28/199 (14%)
 Frame = +1

Query  400  KGSVYVDGKSRIGRTDSDFICATLDWWPPEKCDYGTCAWGHASLLNLDLSNIIFLNAIKA  579
            +  + +DG  R+  TD +F+CAT+DWWP +KC+Y  C WG++S++N+DLS+ +   AI+A
Sbjct  25   RARIIIDGTRRVSETDENFVCATIDWWPHDKCNYDQCPWGYSSVINMDLSHPLLAKAIQA  84

Query  580  FSPLKIRLGGTLQDKVVYQTKDDRVPCTSFVSNTSEIFSFSQGCLPLSRWDELNVFFNKS  759
            F PL+IR+GG+LQD+V+Y   + + PC  F    + +F FS+GCL + RWDELN F  ++
Sbjct  85   FGPLRIRIGGSLQDQVIYDVGNLKSPCHPFKKMDNGLFGFSKGCLHMKRWDELNTFLTET  144

Query  760  G*PTRFIPCPAYICQHs*lyvsslrvllrAVIIFGLNALTGRSIRSDASAVGAWDSTNAE  939
            G                            A++ FGLNAL GR      +  GAWD TNA 
Sbjct  145  G----------------------------AMVTFGLNALHGRHKLGGNAWGGAWDQTNAL  176

Query  940  SLMKYTVEKGYTIHGWELG  996
              M YTV KGY I  WE G
Sbjct  177  DFMNYTVSKGYRIDSWEFG  195



>gb|KHN18337.1| Heparanase-like protein 1 [Glycine soja]
Length=534

 Score =   179 bits (454),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 88/200 (44%), Positives = 115/200 (58%), Gaps = 28/200 (14%)
 Frame = +1

Query  397  DKGSVYVDGKSRIGRTDSDFICATLDWWPPEKCDYGTCAWGHASLLNLDLSNIIFLNAIK  576
            + GSV VDG   I  TD +FICAT+DWWP +KCDY  C WG +S +NLDLS+  F  AI+
Sbjct  8    EHGSVLVDGIQAIAETDDNFICATIDWWPHDKCDYNYCPWGDSSAVNLDLSHPFFAKAIQ  67

Query  577  AFSPLKIRLGGTLQDKVVYQTKDDRVPCTSFVSNTSEIFSFSQGCLPLSRWDELNVFFNK  756
            A  PL+IR+GG+LQD+V+Y+    + PC  F      +F FS+GCL + RWDELN FF++
Sbjct  68   ALKPLRIRVGGSLQDQVLYEVGSLKSPCHPFQKMKGGLFGFSKGCLQMKRWDELNHFFDE  127

Query  757  SG*PTRFIPCPAYICQHs*lyvsslrvllrAVIIFGLNALTGRSIRSDASAVGAWDSTNA  936
            +G                            A++ FGLNAL GR   S     G WD +NA
Sbjct  128  TG----------------------------ALVTFGLNALRGRHQISHTVWGGDWDPSNA  159

Query  937  ESLMKYTVEKGYTIHGWELG  996
            +  + YT+ KGY I  WE G
Sbjct  160  KDFISYTISKGYKIDSWEFG  179



>ref|XP_006574930.1| PREDICTED: heparanase-like protein 2-like isoform X1 [Glycine 
max]
Length=513

 Score =   179 bits (453),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 94/196 (48%), Positives = 116/196 (59%), Gaps = 31/196 (16%)
 Frame = +1

Query  415  VDGKSRIGRTDSDFICATLDWWPPEKCDYGTCAWGHASLLNLDLSNIIFLNAIKAFSPLK  594
            V G + I  TD +FICATLDWWPP KCDY  C WG+A +LNLDL N IFLNA+KAF+PL+
Sbjct  27   VKGVTSIATTDENFICATLDWWPPNKCDYNDCPWGNAGILNLDLYNDIFLNAVKAFNPLR  86

Query  595  IRLGGTLQDKVVYQTKDDRVPCTSFVSNTSEIFSFSQGCLPLSRWDELNVFFNKSG*PTR  774
            IRLGG+L+D +VYQ    R  C  F      +F FS+GCLP  +WDE+N FFNK+G    
Sbjct  87   IRLGGSLEDWLVYQFGKQR-ECPLFQKKNDGLFGFSKGCLPKKKWDEINHFFNKTG----  141

Query  775  FIPCPAYICQHs*lyvsslrvllrAVIIFGLNALTGR--SIRSDASAVGAWDSTNAESLM  948
                                      + FGLNAL+G+  S     +  G WD TNA  LM
Sbjct  142  ------------------------VKLTFGLNALSGKKPSKEDKKNWKGDWDPTNAIDLM  177

Query  949  KYTVEKGYTIHGWELG  996
            +YT+ KGY I  +ELG
Sbjct  178  EYTISKGYNIDSYELG  193



>ref|XP_011012392.1| PREDICTED: heparanase-like protein 2 [Populus euphratica]
Length=520

 Score =   179 bits (453),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 99/213 (46%), Positives = 118/213 (55%), Gaps = 31/213 (15%)
 Frame = +1

Query  364  VSLISGSETLGDKGSVYVDGKSRIGRTDSDFICATLDWWPPEKCDYGTCAWGHASLLNLD  543
             SL   S    D   V+V G + I +TD +FICATLDWWP EKCDY  C WG A LLNLD
Sbjct  13   ASLCFSSLCAADDVKVFVKGVTSIAKTDDNFICATLDWWPSEKCDYNQCPWGKAGLLNLD  72

Query  544  LSNIIFLNAIKAFSPLKIRLGGTLQDKVVYQTKDDRVPCTSFVSNTSEIFSFSQGCLPLS  723
            L+N I  NAIKAF PL+IRLGG+LQD++VYQ  D       F      +F FS+G LP+ 
Sbjct  73   LNNKILANAIKAFDPLRIRLGGSLQDQLVYQVGDSIKKFPHFKKRDDGLFGFSEGSLPMG  132

Query  724  RWDELNVFFNKSG*PTRFIPCPAYICQHs*lyvsslrvllrAVIIFGLNALTGRSIRSDA  903
            RWD+LN  F ++                             A I FGLNAL G+  +SD 
Sbjct  133  RWDQLNDLFKQTN----------------------------AKITFGLNALIGKR-KSDN  163

Query  904  SA--VGAWDSTNAESLMKYTVEKGYTIHGWELG  996
            S   VG W+S NA   MKYT  KGY I  +ELG
Sbjct  164  STLWVGEWNSKNARDFMKYTASKGYKIDSYELG  196



>ref|XP_010258146.1| PREDICTED: heparanase-like protein 1 isoform X1 [Nelumbo nucifera]
Length=544

 Score =   179 bits (454),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 87/199 (44%), Positives = 114/199 (57%), Gaps = 28/199 (14%)
 Frame = +1

Query  403  GSVYVDGKSRIGRTDSDFICATLDWWPPEKCDYGTCAWGHASLLNLDLSNIIFLNAIKAF  582
             ++ V G + I  TD +FICAT+DWWP +KC+Y  C WG +S+LNLDLS+    NAI+AF
Sbjct  29   ATIVVKGSTIIAETDHNFICATIDWWPHDKCNYNQCPWGESSILNLDLSHPSLANAIQAF  88

Query  583  SPLKIRLGGTLQDKVVYQTKDDRVPCTSFVSNTSEIFSFSQGCLPLSRWDELNVFFNKSG  762
            +PL+IR+GG+LQD+VVY       PC  F   +  +F FS GCL + RWDE+N  FNK+G
Sbjct  89   NPLRIRIGGSLQDQVVYNVGSLNSPCQPFQKKSDGLFGFSMGCLNMDRWDEINHLFNKTG  148

Query  763  *PTRFIPCPAYICQHs*lyvsslrvllrAVIIFGLNALTGRSIRSDASAVGAWDSTNAES  942
                                        A++ FGLNAL GR         GAWDS NA+ 
Sbjct  149  ----------------------------AIMTFGLNALYGRHQIRKGVWGGAWDSINAQD  180

Query  943  LMKYTVEKGYTIHGWELGK  999
             ++YT+ KGY I  WE G 
Sbjct  181  FIEYTISKGYEIDSWEFGN  199



>gb|KHN02019.1| Heparanase-like protein 2 [Glycine soja]
Length=513

 Score =   179 bits (453),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 94/196 (48%), Positives = 116/196 (59%), Gaps = 31/196 (16%)
 Frame = +1

Query  415  VDGKSRIGRTDSDFICATLDWWPPEKCDYGTCAWGHASLLNLDLSNIIFLNAIKAFSPLK  594
            V G + I  TD +FICATLDWWPP KCDY  C WG+A +LNLDL N IFLNA+KAF+PL+
Sbjct  27   VKGVTSIATTDENFICATLDWWPPNKCDYNDCPWGNAGILNLDLYNDIFLNAVKAFNPLR  86

Query  595  IRLGGTLQDKVVYQTKDDRVPCTSFVSNTSEIFSFSQGCLPLSRWDELNVFFNKSG*PTR  774
            IRLGG+L+D +VYQ    R  C  F      +F FS+GCLP  +WDE+N FFNK+G    
Sbjct  87   IRLGGSLEDWLVYQFGKQR-ECPLFQKKNDGLFGFSKGCLPKKKWDEINHFFNKTG----  141

Query  775  FIPCPAYICQHs*lyvsslrvllrAVIIFGLNALTGR--SIRSDASAVGAWDSTNAESLM  948
                                      + FGLNAL+G+  S     +  G WD TNA  LM
Sbjct  142  ------------------------VKLTFGLNALSGKKPSKEDKKNWKGDWDPTNAIDLM  177

Query  949  KYTVEKGYTIHGWELG  996
            +YT+ KGY I  +ELG
Sbjct  178  EYTISKGYNIDSYELG  193



>ref|XP_003549557.1| PREDICTED: heparanase-like protein 1-like isoform X1 [Glycine 
max]
 ref|XP_006600561.1| PREDICTED: heparanase-like protein 1-like isoform X2 [Glycine 
max]
Length=547

 Score =   179 bits (453),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 88/200 (44%), Positives = 115/200 (58%), Gaps = 28/200 (14%)
 Frame = +1

Query  397  DKGSVYVDGKSRIGRTDSDFICATLDWWPPEKCDYGTCAWGHASLLNLDLSNIIFLNAIK  576
            + GSV VDG   I  TD +FICAT+DWWP +KCDY  C WG +S +NLDLS+  F  AI+
Sbjct  23   EHGSVLVDGIQAIAETDDNFICATIDWWPHDKCDYNYCPWGDSSAVNLDLSHPFFAKAIQ  82

Query  577  AFSPLKIRLGGTLQDKVVYQTKDDRVPCTSFVSNTSEIFSFSQGCLPLSRWDELNVFFNK  756
            A  PL+IR+GG+LQD+V+Y+    + PC  F      +F FS+GCL + RWDELN FF++
Sbjct  83   ALKPLRIRVGGSLQDQVLYEVGSLKSPCHPFQKMKGGLFGFSKGCLQMKRWDELNHFFDE  142

Query  757  SG*PTRFIPCPAYICQHs*lyvsslrvllrAVIIFGLNALTGRSIRSDASAVGAWDSTNA  936
            +G                            A++ FGLNAL GR   S     G WD +NA
Sbjct  143  TG----------------------------ALVTFGLNALRGRHQISHTVWGGDWDPSNA  174

Query  937  ESLMKYTVEKGYTIHGWELG  996
            +  + YT+ KGY I  WE G
Sbjct  175  KDFISYTISKGYKIDSWEFG  194



>dbj|BAJ97884.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=537

 Score =   179 bits (453),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 89/198 (45%), Positives = 114/198 (58%), Gaps = 28/198 (14%)
 Frame = +1

Query  406  SVYVDGKSRIGRTDSDFICATLDWWPPEKCDYGTCAWGHASLLNLDLSNIIFLNAIKAFS  585
            +V V G   I  T  +FICATLDWWPPEKC+Y  C WG AS+LN+DL+N +   AI+AFS
Sbjct  26   TVIVRGSRTIAATSDEFICATLDWWPPEKCNYDQCPWGKASVLNMDLTNPLLAKAIQAFS  85

Query  586  PLKIRLGGTLQDKVVYQTKDDRVPCTSFVSNTSEIFSFSQGCLPLSRWDELNVFFNKSG*  765
            PL+IR+GG+LQD+VVYQT +   PC  F   +S +F FS+GC+ + +WD +N  F  +G 
Sbjct  86   PLRIRVGGSLQDQVVYQTPNLGSPCRPFTKASSGLFGFSKGCITMEKWDAMNDLFLNTG-  144

Query  766  PTRFIPCPAYICQHs*lyvsslrvllrAVIIFGLNALTGRSIRSDASAVGAWDSTNAESL  945
                                       AVI FGLNAL GR         GAW+S+NA+  
Sbjct  145  ---------------------------AVITFGLNALRGRKQIRKGVWGGAWNSSNAQEF  177

Query  946  MKYTVEKGYTIHGWELGK  999
            M+YTV   Y I  WE G 
Sbjct  178  MEYTVSMNYPIDSWEFGN  195



>emb|CDP00405.1| unnamed protein product [Coffea canephora]
Length=522

 Score =   178 bits (452),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 90/202 (45%), Positives = 117/202 (58%), Gaps = 31/202 (15%)
 Frame = +1

Query  397  DKGSVYVDGKSRIGRTDSDFICATLDWWPPEKCDYGTCAWGHASLLNLDLSNIIFLNAIK  576
            ++  V V G + I +TD +FICATLDWWP +KCDY  C WG A +LNLDL N I  NAIK
Sbjct  31   EQVKVKVKGVTSIAKTDGNFICATLDWWPEDKCDYNQCPWGKAGILNLDLKNKILANAIK  90

Query  577  AFSPLKIRLGGTLQDKVVYQTKDDRVPCTSFVSNTSEIFSFSQGCLPLSRWDELNVFFNK  756
            AF+PL+IR+GG+L+D+VVY+    ++ C  F      +F FS+GCLP+ RWDELN  FNK
Sbjct  91   AFNPLRIRIGGSLEDQVVYKVGTMKI-CPRFQKRKGGLFGFSRGCLPMKRWDELNALFNK  149

Query  757  SG*PTRFIPCPAYICQHs*lyvsslrvllrAVIIFGLNALTGRS--IRSDASAVGAWDST  930
            +G                             ++ F LNAL GR   +  D   VG W++ 
Sbjct  150  TG----------------------------PLVTFSLNALIGRQNPVGGDILWVGDWNAQ  181

Query  931  NAESLMKYTVEKGYTIHGWELG  996
            NA   + YT+ KGY I  WELG
Sbjct  182  NARDFINYTISKGYKIDSWELG  203



>ref|XP_002315010.1| hypothetical protein POPTR_0010s16820g [Populus trichocarpa]
 gb|EEF01181.1| hypothetical protein POPTR_0010s16820g [Populus trichocarpa]
Length=518

 Score =   178 bits (452),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 102/222 (46%), Positives = 121/222 (55%), Gaps = 37/222 (17%)
 Frame = +1

Query  337  WILVLGVFNVSLISGSETLGDKGSVYVDGKSRIGRTDSDFICATLDWWPPEKCDYGTCAW  516
            WIL       SL   S    D   V+V G + I +TD +FICATLDWWP EKCDY  C W
Sbjct  10   WILA------SLCFSSLCAADDVKVFVQGVTSIAKTDDNFICATLDWWPSEKCDYNQCPW  63

Query  517  GHASLLNLDLSNIIFLNAIKAFSPLKIRLGGTLQDKVVYQTKDDRVPCTSFVSNTSEIFS  696
            G A LLNLDL+N I  NAIKAF PL+IRLGG+LQD++VYQ  D       F      +F 
Sbjct  64   GKAGLLNLDLNNKILANAIKAFDPLRIRLGGSLQDQLVYQVGDFIKKFPHFKKQDDGLFG  123

Query  697  FSQGCLPLSRWDELNVFFNKSG*PTRFIPCPAYICQHs*lyvsslrvllrAVIIFGLNAL  876
            FS+G LP+ RWD+LN  F ++                             A I FGLNAL
Sbjct  124  FSKGSLPMDRWDQLNDLFKQTN----------------------------AKITFGLNAL  155

Query  877  TGRSIRSDASA--VGAWDSTNAESLMKYTVEKGYTIHGWELG  996
             G+  +SD S   VG W+S NA   MKYT  KGY I  +ELG
Sbjct  156  IGKR-KSDNSTLWVGEWNSKNARDFMKYTASKGYKIDSYELG  196



>emb|CAB62595.1| putative protein [Arabidopsis thaliana]
Length=521

 Score =   178 bits (452),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 83/199 (42%), Positives = 113/199 (57%), Gaps = 28/199 (14%)
 Frame = +1

Query  400  KGSVYVDGKSRIGRTDSDFICATLDWWPPEKCDYGTCAWGHASLLNLDLSNIIFLNAIKA  579
            + S+ + G  R+  TD +F+CATLDWWP +KC+Y  C WG++S++N+DL+  +   AIKA
Sbjct  7    RASIVIQGARRVCETDENFVCATLDWWPHDKCNYDQCPWGYSSVINMDLTRPLLTKAIKA  66

Query  580  FSPLKIRLGGTLQDKVVYQTKDDRVPCTSFVSNTSEIFSFSQGCLPLSRWDELNVFFNKS  759
            F PL+IR+GG+LQD+V+Y   + + PC  F    S +F FS+GCL + RWDELN F   +
Sbjct  67   FKPLRIRIGGSLQDQVIYDVGNLKTPCRPFQKMNSGLFGFSKGCLHMKRWDELNSFLTAT  126

Query  760  G*PTRFIPCPAYICQHs*lyvsslrvllrAVIIFGLNALTGRSIRSDASAVGAWDSTNAE  939
            G                            AV+ FGLNAL GR      +  GAWD  N +
Sbjct  127  G----------------------------AVVTFGLNALRGRHKLRGKAWGGAWDHINTQ  158

Query  940  SLMKYTVEKGYTIHGWELG  996
              + YTV KGY I  WE G
Sbjct  159  DFLNYTVSKGYVIDSWEFG  177



>ref|XP_003525455.1| PREDICTED: heparanase-like protein 1-like isoform X1 [Glycine 
max]
 ref|XP_006579525.1| PREDICTED: heparanase-like protein 1-like isoform X2 [Glycine 
max]
Length=547

 Score =   178 bits (452),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 87/200 (44%), Positives = 115/200 (58%), Gaps = 28/200 (14%)
 Frame = +1

Query  397  DKGSVYVDGKSRIGRTDSDFICATLDWWPPEKCDYGTCAWGHASLLNLDLSNIIFLNAIK  576
            + GS+ VDG   I  TD +FICAT+DWWP +KCDY  C WG +S +NLDLS+  F  AI+
Sbjct  23   EHGSILVDGIQAIAETDDNFICATIDWWPHDKCDYNYCPWGDSSAVNLDLSHPFFAKAIQ  82

Query  577  AFSPLKIRLGGTLQDKVVYQTKDDRVPCTSFVSNTSEIFSFSQGCLPLSRWDELNVFFNK  756
            A  PL+IR+GG+LQD+V+Y+    + PC  F      +F FS+GCL + RWDELN FF++
Sbjct  83   ALKPLRIRVGGSLQDQVLYEVGSLKSPCHPFQKMKGGLFGFSKGCLQMKRWDELNHFFDE  142

Query  757  SG*PTRFIPCPAYICQHs*lyvsslrvllrAVIIFGLNALTGRSIRSDASAVGAWDSTNA  936
            +G                            A++ FGLNAL GR   S     G WD +NA
Sbjct  143  TG----------------------------ALVTFGLNALHGRHQISHTVWGGDWDPSNA  174

Query  937  ESLMKYTVEKGYTIHGWELG  996
            +  + YT+ KGY I  WE G
Sbjct  175  KDFINYTISKGYKIDSWEFG  194



>ref|XP_006399265.1| hypothetical protein EUTSA_v10013186mg [Eutrema salsugineum]
 gb|ESQ40718.1| hypothetical protein EUTSA_v10013186mg [Eutrema salsugineum]
Length=543

 Score =   178 bits (452),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 82/199 (41%), Positives = 115/199 (58%), Gaps = 28/199 (14%)
 Frame = +1

Query  400  KGSVYVDGKSRIGRTDSDFICATLDWWPPEKCDYGTCAWGHASLLNLDLSNIIFLNAIKA  579
              S+ ++G SRI  TD +F+CATLDWWP +KC+Y  C WG++S++N+DLS  +   A++A
Sbjct  28   HASIVIEGASRISETDENFVCATLDWWPHDKCNYDNCPWGYSSVINMDLSRPLLAKAVQA  87

Query  580  FSPLKIRLGGTLQDKVVYQTKDDRVPCTSFVSNTSEIFSFSQGCLPLSRWDELNVFFNKS  759
            F PL+IR+GG+LQD+V+Y   + + PC  F    S +F FS+GCL + RWDELN F  ++
Sbjct  88   FKPLRIRIGGSLQDQVIYDVGNLKTPCRPFRKMNSGLFGFSKGCLHMKRWDELNSFLTET  147

Query  760  G*PTRFIPCPAYICQHs*lyvsslrvllrAVIIFGLNALTGRSIRSDASAVGAWDSTNAE  939
            G                            A++ FGLNAL GR      +  GAW+  N +
Sbjct  148  G----------------------------AIVTFGLNALHGRHKLRGNAWGGAWNHINTQ  179

Query  940  SLMKYTVEKGYTIHGWELG  996
              + YTV KGY I  WE G
Sbjct  180  DFINYTVSKGYAIDSWEFG  198



>ref|NP_196400.2| glucuronidase 2 [Arabidopsis thaliana]
 sp|Q9FF10.1|HPSE1_ARATH RecName: Full=Heparanase-like protein 1; Flags: Precursor [Arabidopsis 
thaliana]
 dbj|BAB09947.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAU05468.1| At5g07830 [Arabidopsis thaliana]
 gb|AAU93572.1| At5g07830 [Arabidopsis thaliana]
 gb|AED91209.1| glucuronidase 2 [Arabidopsis thaliana]
Length=543

 Score =   178 bits (452),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 83/199 (42%), Positives = 113/199 (57%), Gaps = 28/199 (14%)
 Frame = +1

Query  400  KGSVYVDGKSRIGRTDSDFICATLDWWPPEKCDYGTCAWGHASLLNLDLSNIIFLNAIKA  579
            + S+ + G  R+  TD +F+CATLDWWP +KC+Y  C WG++S++N+DL+  +   AIKA
Sbjct  29   RASIVIQGARRVCETDENFVCATLDWWPHDKCNYDQCPWGYSSVINMDLTRPLLTKAIKA  88

Query  580  FSPLKIRLGGTLQDKVVYQTKDDRVPCTSFVSNTSEIFSFSQGCLPLSRWDELNVFFNKS  759
            F PL+IR+GG+LQD+V+Y   + + PC  F    S +F FS+GCL + RWDELN F   +
Sbjct  89   FKPLRIRIGGSLQDQVIYDVGNLKTPCRPFQKMNSGLFGFSKGCLHMKRWDELNSFLTAT  148

Query  760  G*PTRFIPCPAYICQHs*lyvsslrvllrAVIIFGLNALTGRSIRSDASAVGAWDSTNAE  939
            G                            AV+ FGLNAL GR      +  GAWD  N +
Sbjct  149  G----------------------------AVVTFGLNALRGRHKLRGKAWGGAWDHINTQ  180

Query  940  SLMKYTVEKGYTIHGWELG  996
              + YTV KGY I  WE G
Sbjct  181  DFLNYTVSKGYVIDSWEFG  199



>ref|XP_004508698.1| PREDICTED: heparanase-like protein 2-like isoform X2 [Cicer arietinum]
 ref|XP_004508699.1| PREDICTED: heparanase-like protein 2-like isoform X3 [Cicer arietinum]
 ref|XP_004508700.1| PREDICTED: heparanase-like protein 2-like isoform X4 [Cicer arietinum]
 ref|XP_004508701.1| PREDICTED: heparanase-like protein 2-like isoform X5 [Cicer arietinum]
Length=558

 Score =   179 bits (453),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 88/200 (44%), Positives = 112/200 (56%), Gaps = 28/200 (14%)
 Frame = +1

Query  397  DKGSVYVDGKSRIGRTDSDFICATLDWWPPEKCDYGTCAWGHASLLNLDLSNIIFLNAIK  576
            + G + VDG   I   D +FICAT+DWWP +KCDY  C WG++S++NLDLSN I   AI+
Sbjct  32   EHGLIVVDGVQAIAENDDNFICATIDWWPHDKCDYNYCPWGYSSVVNLDLSNPILAKAIQ  91

Query  577  AFSPLKIRLGGTLQDKVVYQTKDDRVPCTSFVSNTSEIFSFSQGCLPLSRWDELNVFFNK  756
               PL+IR+GG+LQD+VVY+    + PC  F      +F FS+GCL + RWDELN FFNK
Sbjct  92   GLKPLRIRIGGSLQDQVVYEVGSLQSPCHPFQKMKGGLFGFSKGCLHMKRWDELNHFFNK  151

Query  757  SG*PTRFIPCPAYICQHs*lyvsslrvllrAVIIFGLNALTGRSIRSDASAVGAWDSTNA  936
            +G                            A++ FGLNAL GR   +     G WD TN 
Sbjct  152  TG----------------------------AIVTFGLNALLGRHQINHTVWGGDWDPTNT  183

Query  937  ESLMKYTVEKGYTIHGWELG  996
              L+ YTV  GY I  WE G
Sbjct  184  YDLINYTVSNGYKIDSWEFG  203



>gb|KEH33104.1| glycoside hydrolase family 79 amino-terminal domain protein [Medicago 
truncatula]
Length=528

 Score =   178 bits (451),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 93/227 (41%), Positives = 131/227 (58%), Gaps = 33/227 (15%)
 Frame = +1

Query  328  MRLWILVLGVFNVSLISGSETLGDKGSVYVDGKSRIGRTDSDFICATLDWWPPEKCDYGT  507
            MRL++ +        ++ S+ + + G + V+G      T  +FICAT+DWWP +KC+ G 
Sbjct  1    MRLYLALFFFLTSLQVTLSKDI-EHGLLLVNGAQAKAETGDNFICATIDWWPHDKCNDGY  59

Query  508  CAWGHASLLNLDLSNIIFLNAIKAFSPLKIRLGGTLQDKVVYQTKDDRVPCTSFVSNTSE  687
            C+WGH+S++NLDLS+     AI+A  PL+IRLGG+LQD++VY   + + PC        +
Sbjct  60   CSWGHSSIVNLDLSHPFLAKAIQALKPLRIRLGGSLQDQIVYDIGNLKSPCHPLQKMNGQ  119

Query  688  --IFSFSQGCLPLSRWDELNVFFNKSG*PTRFIPCPAYICQHs*lyvsslrvllrAVIIF  861
              +F FS+GCL + RWDELN FFN++G                            A+++F
Sbjct  120  GWLFGFSKGCLHMKRWDELNQFFNQTG----------------------------AIVMF  151

Query  862  GLNALTGRSIRSDASAV--GAWDSTNAESLMKYTVEKGYTIHGWELG  996
            GLNAL+GR   S+ S V  GAWD TNA   +KYTV KGY I  WE G
Sbjct  152  GLNALSGRHKISNTSNVWEGAWDPTNAYDFIKYTVSKGYKIDAWEFG  198



>ref|XP_006649618.1| PREDICTED: heparanase-like protein 2-like [Oryza brachyantha]
Length=542

 Score =   178 bits (452),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 91/225 (40%), Positives = 127/225 (56%), Gaps = 29/225 (13%)
 Frame = +1

Query  322  LQMRLWILVLGVFNVSLISGSETLGDKGSVYVDGKSRIGRTDSDFICATLDWWPPEKCDY  501
            + +RL +LV    +    + ++   +  +V V G S+I  TD +++CAT+DWWPPEKC+Y
Sbjct  1    MAVRLLLLVFICLHAPRWAWAQQPEEAATVIVKGSSKIAETDKNYVCATIDWWPPEKCNY  60

Query  502  GTCAWGHASLLNLDLSNIIFLNAIKAFSPLKIRLGGTLQDKVVYQTKDDRVPCTSFVSNT  681
              C WG +S+LNLDL +     AI+AF  L+IRLGG+LQD+VVY    +  PCT F + +
Sbjct  61   NQCPWGQSSILNLDLDHPFLAQAIQAFDNLRIRLGGSLQDRVVYDVGTNS-PCTPFTNIS  119

Query  682  SEIFSFSQGCLPLSRWDELNVFFNKSG*PTRFIPCPAYICQHs*lyvsslrvllrAVIIF  861
            + +F FS GCL + RWD+LN  F K+G                            A+I F
Sbjct  120  NGLFGFSVGCLSMDRWDKLNDLFQKTG----------------------------AIITF  151

Query  862  GLNALTGRSIRSDASAVGAWDSTNAESLMKYTVEKGYTIHGWELG  996
            GLNAL GR     +   G W+STNA   +KYT+ KGY +  WE G
Sbjct  152  GLNALYGRYNVRRSFWAGKWNSTNAYDFVKYTISKGYPVDSWEYG  196



>emb|CDX69989.1| BnaA10g23380D [Brassica napus]
Length=519

 Score =   177 bits (450),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 83/199 (42%), Positives = 114/199 (57%), Gaps = 28/199 (14%)
 Frame = +1

Query  400  KGSVYVDGKSRIGRTDSDFICATLDWWPPEKCDYGTCAWGHASLLNLDLSNIIFLNAIKA  579
            + S+ + G SRI  TD +F+CATLDWWP +KC+Y  C WG++S++N+DLS  +   AI+A
Sbjct  29   RASIVIQGASRIAETDENFVCATLDWWPHDKCNYDNCPWGYSSVINMDLSRPLLTKAIQA  88

Query  580  FSPLKIRLGGTLQDKVVYQTKDDRVPCTSFVSNTSEIFSFSQGCLPLSRWDELNVFFNKS  759
            F PL+IR+GG+LQD+V+Y   + + PC  F    S +F FS+GCL + RWDEL+ F  KS
Sbjct  89   FKPLRIRIGGSLQDQVIYDVGNLQTPCHPFRKMNSGLFGFSKGCLHMKRWDELHSFLTKS  148

Query  760  G*PTRFIPCPAYICQHs*lyvsslrvllrAVIIFGLNALTGRSIRSDASAVGAWDSTNAE  939
            G                            A++ FGLNAL GR      +  GAW+  N +
Sbjct  149  G----------------------------AIVTFGLNALHGRHKLRGNAWGGAWNHVNTQ  180

Query  940  SLMKYTVEKGYTIHGWELG  996
              + YTV  GY I  WE G
Sbjct  181  DFINYTVSNGYVIDSWEFG  199



>gb|KDO54584.1| hypothetical protein CISIN_1g008834mg [Citrus sinensis]
Length=337

 Score =   174 bits (440),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 86/199 (43%), Positives = 117/199 (59%), Gaps = 30/199 (15%)
 Frame = +1

Query  406  SVYVDGKSRIGRTDSDFICATLDWWPPEKCDYGTCAWGHASLLNLDLSNIIFLNAIKAFS  585
            +++VD    +   D  FICAT+DWWP +KC+Y  C WG++S++NLDLS+ +  NAI+AF 
Sbjct  27   TIFVDATKTVATNDEHFICATVDWWPHDKCNYNHCPWGNSSVINLDLSHPLLANAIQAFQ  86

Query  586  PLKIRLGGTLQDKVVYQTKDDRVPCTSFVSNTSEIFSFSQGCLPLSRWDELNVFFNKSG*  765
             L+IR+GG+LQD+V+Y   D + PC  F      +F FS+GCL + RWDELN  FN++  
Sbjct  87   SLRIRIGGSLQDQVLYDVGDLKAPCHPFRKMKDGLFGFSKGCLHMQRWDELNQLFNRT--  144

Query  766  PTRFIPCPAYICQHs*lyvsslrvllrAVIIFGLNALTGR-SIRSDASAVGAWDSTNAES  942
                                      RA++ FGLNAL GR +IR +A   GAWDS NA  
Sbjct  145  --------------------------RAIVSFGLNALHGRHNIRHNAWG-GAWDSNNARD  177

Query  943  LMKYTVEKGYTIHGWELGK  999
             +KYT+  GY I  WE G 
Sbjct  178  FLKYTISMGYQIDSWEYGN  196



>ref|XP_007157579.1| hypothetical protein PHAVU_002G081000g [Phaseolus vulgaris]
 gb|ESW29573.1| hypothetical protein PHAVU_002G081000g [Phaseolus vulgaris]
Length=515

 Score =   177 bits (450),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 91/196 (46%), Positives = 113/196 (58%), Gaps = 31/196 (16%)
 Frame = +1

Query  415  VDGKSRIGRTDSDFICATLDWWPPEKCDYGTCAWGHASLLNLDLSNIIFLNAIKAFSPLK  594
            V G + I  TD +FICAT+DWWPP KCDY  C WG A +LNLDL N I +NAIKAFSPL+
Sbjct  27   VKGVTHIATTDENFICATIDWWPPNKCDYNQCPWGEAGILNLDLFNDILINAIKAFSPLR  86

Query  595  IRLGGTLQDKVVYQTKDDRVPCTSFVSNTSEIFSFSQGCLPLSRWDELNVFFNKSG*PTR  774
            IRLGG+L+D++VYQ  ++   C      +  +F F +GCLP  RWDE+N F NK+G    
Sbjct  87   IRLGGSLEDQIVYQIGEEE-ECPVMKKKSDGLFGFGKGCLPRKRWDEVNEFLNKTG----  141

Query  775  FIPCPAYICQHs*lyvsslrvllrAVIIFGLNALTGR--SIRSDASAVGAWDSTNAESLM  948
                                        FGLNAL G+  S       VG WD TNA SLM
Sbjct  142  ------------------------VKFTFGLNALNGKENSKEDKVKWVGDWDPTNAISLM  177

Query  949  KYTVEKGYTIHGWELG  996
            +Y++ KGY I  +ELG
Sbjct  178  EYSISKGYKIDSYELG  193



>ref|XP_004299326.1| PREDICTED: heparanase-like protein 1 [Fragaria vesca subsp. vesca]
Length=540

 Score =   178 bits (451),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 90/199 (45%), Positives = 116/199 (58%), Gaps = 28/199 (14%)
 Frame = +1

Query  400  KGSVYVDGKSRIGRTDSDFICATLDWWPPEKCDYGTCAWGHASLLNLDLSNIIFLNAIKA  579
              SV VDG   I   D++F+CATLDWW  EKCDY  C WG AS+LNL+LS+ +   +I+A
Sbjct  24   HASVVVDGTVAIAHIDNNFVCATLDWWNHEKCDYNHCPWGSASVLNLNLSHPLLAKSIQA  83

Query  580  FSPLKIRLGGTLQDKVVYQTKDDRVPCTSFVSNTSEIFSFSQGCLPLSRWDELNVFFNKS  759
            F+ L+IR+GG+LQD+V+Y   D + PC  F      +F FS GCLP+SRWDELN FF+K+
Sbjct  84   FNQLRIRIGGSLQDQVLYGVGDLKYPCHPFRKQKGGLFGFSTGCLPMSRWDELNHFFSKT  143

Query  760  G*PTRFIPCPAYICQHs*lyvsslrvllrAVIIFGLNALTGRSIRSDASAVGAWDSTNAE  939
                                        R ++ F LNAL+GR  +     VG WDS NA 
Sbjct  144  ----------------------------RPLVTFSLNALSGRHHKGAGVWVGDWDSRNAY  175

Query  940  SLMKYTVEKGYTIHGWELG  996
              + YTV KGY I+ WELG
Sbjct  176  DFINYTVSKGYQINSWELG  194



>ref|XP_004508697.1| PREDICTED: heparanase-like protein 2-like isoform X1 [Cicer arietinum]
Length=572

 Score =   178 bits (452),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 88/200 (44%), Positives = 112/200 (56%), Gaps = 28/200 (14%)
 Frame = +1

Query  397  DKGSVYVDGKSRIGRTDSDFICATLDWWPPEKCDYGTCAWGHASLLNLDLSNIIFLNAIK  576
            + G + VDG   I   D +FICAT+DWWP +KCDY  C WG++S++NLDLSN I   AI+
Sbjct  46   EHGLIVVDGVQAIAENDDNFICATIDWWPHDKCDYNYCPWGYSSVVNLDLSNPILAKAIQ  105

Query  577  AFSPLKIRLGGTLQDKVVYQTKDDRVPCTSFVSNTSEIFSFSQGCLPLSRWDELNVFFNK  756
               PL+IR+GG+LQD+VVY+    + PC  F      +F FS+GCL + RWDELN FFNK
Sbjct  106  GLKPLRIRIGGSLQDQVVYEVGSLQSPCHPFQKMKGGLFGFSKGCLHMKRWDELNHFFNK  165

Query  757  SG*PTRFIPCPAYICQHs*lyvsslrvllrAVIIFGLNALTGRSIRSDASAVGAWDSTNA  936
            +G                            A++ FGLNAL GR   +     G WD TN 
Sbjct  166  TG----------------------------AIVTFGLNALLGRHQINHTVWGGDWDPTNT  197

Query  937  ESLMKYTVEKGYTIHGWELG  996
              L+ YTV  GY I  WE G
Sbjct  198  YDLINYTVSNGYKIDSWEFG  217



>emb|CBI15157.3| unnamed protein product [Vitis vinifera]
Length=513

 Score =   177 bits (449),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 83/197 (42%), Positives = 117/197 (59%), Gaps = 28/197 (14%)
 Frame = +1

Query  409  VYVDGKSRIGRTDSDFICATLDWWPPEKCDYGTCAWGHASLLNLDLSNIIFLNAIKAFSP  588
            + VDG + +  TD++FICATLDWWP +KC+Y  C WG++S++N+DLS+ +F  AI+AF  
Sbjct  27   IKVDGATTVAETDANFICATLDWWPHDKCNYNHCPWGYSSVINMDLSHPLFAKAIEAFKH  86

Query  589  LKIRLGGTLQDKVVYQTKDDRVPCTSFVSNTSEIFSFSQGCLPLSRWDELNVFFNKSG*P  768
            L+IR+GG+LQD+V+Y     R PC  F      +F FS+GCL +SRWDELN  F+++G  
Sbjct  87   LRIRIGGSLQDQVLYDIGSLRSPCHPFRKMNDGLFGFSKGCLRMSRWDELNRLFSQTG--  144

Query  769  TRFIPCPAYICQHs*lyvsslrvllrAVIIFGLNALTGRSIRSDASAVGAWDSTNAESLM  948
                                       ++ FGLNAL GR      +  G WDS+N ++ +
Sbjct  145  --------------------------VILTFGLNALYGRYQIRKGAWAGVWDSSNTQNFI  178

Query  949  KYTVEKGYTIHGWELGK  999
            KYT+ KGY I  WE G 
Sbjct  179  KYTISKGYQIDSWEFGN  195



>ref|XP_006348811.1| PREDICTED: heparanase-like protein 2-like [Solanum tuberosum]
Length=552

 Score =   178 bits (451),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 94/204 (46%), Positives = 120/204 (59%), Gaps = 33/204 (16%)
 Frame = +1

Query  397  DKGSVYVDGKSRIGRTDSDFICATLDWWPPEKCDYGTCAWGHASLLNLDLSNIIFLNAIK  576
            D+  V V G + I +TD +FICATLDWWP  KCDY  C WG A LLNLDL N I  NA+K
Sbjct  46   DELKVMVKGVTSIAQTDDNFICATLDWWPENKCDYNQCPWGKAGLLNLDLKNRILANAVK  105

Query  577  AFSPLKIRLGGTLQDKVVYQTKDDRVPCTSFVSNTSEIFSFSQGCLPLSRWDELNVFFNK  756
            AF+PL++R+GG+LQD+V Y+  +    C++F   +  +F FS GCL ++RWDEL+  FNK
Sbjct  106  AFNPLRLRIGGSLQDQVYYKVGNYPKNCSNFEKKSDGLFGFSDGCLHMNRWDELHDMFNK  165

Query  757  SG*PTRFIPCPAYICQHs*lyvsslrvllrAVIIFGLNALTGRSIRSDASA----VGAWD  924
            +G                            A I F  NAL GR I SD +     VG W+
Sbjct  166  TG----------------------------AAITFSFNALIGR-IPSDENNTTLWVGDWN  196

Query  925  STNAESLMKYTVEKGYTIHGWELG  996
              NA+SLMKYT+ KGY I  +ELG
Sbjct  197  HYNAKSLMKYTINKGYKIDSYELG  220



>ref|XP_002976895.1| hypothetical protein SELMODRAFT_105931 [Selaginella moellendorffii]
 gb|EFJ22005.1| hypothetical protein SELMODRAFT_105931 [Selaginella moellendorffii]
Length=505

 Score =   177 bits (449),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 87/194 (45%), Positives = 114/194 (59%), Gaps = 28/194 (14%)
 Frame = +1

Query  415  VDGKSRIGRTDSDFICATLDWWPPEKCDYGTCAWGHASLLNLDLSNIIFLNAIKAFSPLK  594
            ++  S + R   +FICATLDWWPPEKCDYG C+WG ASLLNLDL N   +NA+K  SPL 
Sbjct  8    INTTSPVARISENFICATLDWWPPEKCDYGYCSWGRASLLNLDLWNPRLVNAVKGLSPLL  67

Query  595  IRLGGTLQDKVVYQTKDDRVPCTSFVSNTSEIFSFSQGCLPLSRWDELNVFFNKSG*PTR  774
            +RLGG+LQD+++Y+      PC       S +F F+ GCL +SRW ELN FF K+G    
Sbjct  68   LRLGGSLQDQIIYEVGVRPGPCLPLQKQPSAMFGFTGGCLNMSRWTELNSFFEKTG----  123

Query  775  FIPCPAYICQHs*lyvsslrvllrAVIIFGLNALTGRSIRSDASAVGAWDSTNAESLMKY  954
                                    A++ FGLNAL GR+   D    G+W S+NA  LMK+
Sbjct  124  ------------------------ALVAFGLNALYGRTKFEDNGFKGSWKSSNARDLMKF  159

Query  955  TVEKGYTIHGWELG  996
            +++ G+ I  WELG
Sbjct  160  SLDHGFPIVAWELG  173



>ref|XP_006289223.1| hypothetical protein CARUB_v10002679mg [Capsella rubella]
 gb|EOA22121.1| hypothetical protein CARUB_v10002679mg [Capsella rubella]
Length=542

 Score =   177 bits (450),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 84/197 (43%), Positives = 112/197 (57%), Gaps = 28/197 (14%)
 Frame = +1

Query  406  SVYVDGKSRIGRTDSDFICATLDWWPPEKCDYGTCAWGHASLLNLDLSNIIFLNAIKAFS  585
            S+ V+G  R+  TD +F+CATLDWWP +KC+Y  C WG++S++N+DL+  +   AIKAF 
Sbjct  30   SIVVEGARRVSETDENFVCATLDWWPHDKCNYEQCPWGYSSVINMDLTRPLLSKAIKAFK  89

Query  586  PLKIRLGGTLQDKVVYQTKDDRVPCTSFVSNTSEIFSFSQGCLPLSRWDELNVFFNKSG*  765
            PL+IR+GG+LQD+V Y   + + PC  F    S +F FS+GCL + RWDELN F   +G 
Sbjct  90   PLRIRIGGSLQDQVTYDVGNLKTPCRPFGKMNSGLFGFSKGCLHMKRWDELNSFLTATG-  148

Query  766  PTRFIPCPAYICQHs*lyvsslrvllrAVIIFGLNALTGRSIRSDASAVGAWDSTNAESL  945
                                       AV+ FGLNAL GR      +  GAWD  N +  
Sbjct  149  ---------------------------AVVTFGLNALRGRHKLRGKAWGGAWDHVNTQDF  181

Query  946  MKYTVEKGYTIHGWELG  996
            + YTV KGY I  WE G
Sbjct  182  INYTVSKGYAIDSWEFG  198



>tpg|DAA55153.1| TPA: hypothetical protein ZEAMMB73_112407 [Zea mays]
Length=385

 Score =   174 bits (442),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 90/206 (44%), Positives = 117/206 (57%), Gaps = 29/206 (14%)
 Frame = +1

Query  382  SETLGDKGSVYVDGKSRIGRTDSDFICATLDWWPPEKCDYGTCAWGHASLLNLDLSNIIF  561
            SE   D  +V V G   I  T  +F+CAT+DWWPPEKC+Y  C W  AS+LNLDL+N + 
Sbjct  20   SEDYAD-ATVIVRGSETIASTSDEFVCATIDWWPPEKCNYDQCPWERASVLNLDLTNPLL  78

Query  562  LNAIKAFSPLKIRLGGTLQDKVVYQTKDDRVPCTSFVSNTSEIFSFSQGCLPLSRWDELN  741
              AI+AFSPL+IR+GG+LQD+V+Y T +  +PC  F   +S +F FSQGC+ L RWD++N
Sbjct  79   AKAIQAFSPLRIRVGGSLQDQVLYGTPNLGLPCDPFTKVSSGLFGFSQGCITLERWDDIN  138

Query  742  VFFNKSG*PTRFIPCPAYICQHs*lyvsslrvllrAVIIFGLNALTGRSIRSDASAVGAW  921
              F K+G                            AV+ FGLNAL GR         G W
Sbjct  139  DMFLKTG----------------------------AVVTFGLNALRGRQQTRKGVWGGPW  170

Query  922  DSTNAESLMKYTVEKGYTIHGWELGK  999
            +S+NA   ++YTV K Y I  WE G 
Sbjct  171  NSSNAREFIEYTVLKNYPIDSWEFGN  196



>ref|XP_009122405.1| PREDICTED: heparanase-like protein 1 isoform X1 [Brassica rapa]
 ref|XP_009122406.1| PREDICTED: heparanase-like protein 1 isoform X2 [Brassica rapa]
Length=544

 Score =   177 bits (450),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 83/199 (42%), Positives = 114/199 (57%), Gaps = 28/199 (14%)
 Frame = +1

Query  400  KGSVYVDGKSRIGRTDSDFICATLDWWPPEKCDYGTCAWGHASLLNLDLSNIIFLNAIKA  579
            + S+ + G SRI  TD +F+CATLDWWP +KC+Y  C WG++S++N+DLS  +   AI+A
Sbjct  29   RASIVIQGASRIAETDENFVCATLDWWPHDKCNYDNCPWGYSSVINMDLSRPLLTKAIQA  88

Query  580  FSPLKIRLGGTLQDKVVYQTKDDRVPCTSFVSNTSEIFSFSQGCLPLSRWDELNVFFNKS  759
            F PL+IR+GG+LQD+V+Y   + + PC  F    S +F FS+GCL + RWDEL+ F  KS
Sbjct  89   FKPLRIRIGGSLQDQVIYDVGNLQTPCHPFRKMNSGLFGFSKGCLHMKRWDELHNFLTKS  148

Query  760  G*PTRFIPCPAYICQHs*lyvsslrvllrAVIIFGLNALTGRSIRSDASAVGAWDSTNAE  939
            G                            A++ FGLNAL GR      +  GAW+  N +
Sbjct  149  G----------------------------AIVTFGLNALHGRHKLRGNAWGGAWNHVNTQ  180

Query  940  SLMKYTVEKGYTIHGWELG  996
              + YTV  GY I  WE G
Sbjct  181  DFINYTVSNGYVIDSWEFG  199



>ref|XP_002284470.1| PREDICTED: heparanase-like protein 1 [Vitis vinifera]
 ref|XP_010663309.1| PREDICTED: heparanase-like protein 1 [Vitis vinifera]
 ref|XP_010663310.1| PREDICTED: heparanase-like protein 1 [Vitis vinifera]
Length=539

 Score =   177 bits (450),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 83/196 (42%), Positives = 117/196 (60%), Gaps = 28/196 (14%)
 Frame = +1

Query  409  VYVDGKSRIGRTDSDFICATLDWWPPEKCDYGTCAWGHASLLNLDLSNIIFLNAIKAFSP  588
            + VDG + +  TD++FICATLDWWP +KC+Y  C WG++S++N+DLS+ +F  AI+AF  
Sbjct  27   IKVDGATTVAETDANFICATLDWWPHDKCNYNHCPWGYSSVINMDLSHPLFAKAIEAFKH  86

Query  589  LKIRLGGTLQDKVVYQTKDDRVPCTSFVSNTSEIFSFSQGCLPLSRWDELNVFFNKSG*P  768
            L+IR+GG+LQD+V+Y     R PC  F      +F FS+GCL +SRWDELN  F+++G  
Sbjct  87   LRIRIGGSLQDQVLYDIGSLRSPCHPFRKMNDGLFGFSKGCLRMSRWDELNRLFSQTG--  144

Query  769  TRFIPCPAYICQHs*lyvsslrvllrAVIIFGLNALTGRSIRSDASAVGAWDSTNAESLM  948
                                       ++ FGLNAL GR      +  G WDS+N ++ +
Sbjct  145  --------------------------VILTFGLNALYGRYQIRKGAWAGVWDSSNTQNFI  178

Query  949  KYTVEKGYTIHGWELG  996
            KYT+ KGY I  WE G
Sbjct  179  KYTISKGYQIDSWEFG  194



>emb|CDX99032.1| BnaC09g48030D [Brassica napus]
Length=543

 Score =   177 bits (450),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 83/199 (42%), Positives = 115/199 (58%), Gaps = 28/199 (14%)
 Frame = +1

Query  400  KGSVYVDGKSRIGRTDSDFICATLDWWPPEKCDYGTCAWGHASLLNLDLSNIIFLNAIKA  579
            + S+ + G SRI  TD +F+CATLDWWP +KC+Y  C WG++S++N+DLS  +   AI+A
Sbjct  28   RASIVIQGASRITETDENFVCATLDWWPHDKCNYDNCPWGYSSVINMDLSRPLLTKAIQA  87

Query  580  FSPLKIRLGGTLQDKVVYQTKDDRVPCTSFVSNTSEIFSFSQGCLPLSRWDELNVFFNKS  759
            F PL+IR+GG+LQD+V+Y   + + PC  F   +S +F FS+GCL + RWDEL+ F  KS
Sbjct  88   FKPLRIRIGGSLQDQVIYDVGNLQTPCHPFRKMSSGLFGFSKGCLHMKRWDELHSFLTKS  147

Query  760  G*PTRFIPCPAYICQHs*lyvsslrvllrAVIIFGLNALTGRSIRSDASAVGAWDSTNAE  939
            G                            A++ FGLNAL GR      +  GAW+  N +
Sbjct  148  G----------------------------AIVTFGLNALHGRHKLRGNAWGGAWNHVNTQ  179

Query  940  SLMKYTVEKGYTIHGWELG  996
              + YTV  GY I  WE G
Sbjct  180  DFINYTVSNGYAIDSWEFG  198



>ref|XP_009397277.1| PREDICTED: heparanase-like protein 1 [Musa acuminata subsp. malaccensis]
Length=538

 Score =   177 bits (449),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 84/197 (43%), Positives = 114/197 (58%), Gaps = 28/197 (14%)
 Frame = +1

Query  406  SVYVDGKSRIGRTDSDFICATLDWWPPEKCDYGTCAWGHASLLNLDLSNIIFLNAIKAFS  585
            ++ V G   +  TD  F+CATLDWWPP+KC+Y  C WG +S+LNLDL++    NAI+AF 
Sbjct  25   TIIVKGSDIVAETDDSFVCATLDWWPPQKCNYNQCPWGQSSVLNLDLTHPFLSNAIQAFE  84

Query  586  PLKIRLGGTLQDKVVYQTKDDRVPCTSFVSNTSEIFSFSQGCLPLSRWDELNVFFNKSG*  765
             L+IR+GG+LQD+VVY       PC  F   +  +F FS+GCL +SRWD+LN+ F ++G 
Sbjct  85   HLRIRIGGSLQDQVVYGVPTLGHPCLPFSKMSGGLFGFSEGCLSMSRWDKLNLLFQRTG-  143

Query  766  PTRFIPCPAYICQHs*lyvsslrvllrAVIIFGLNALTGRSIRSDASAVGAWDSTNAESL  945
                                       A+I FGLNAL GR    +   VG W+STNA   
Sbjct  144  ---------------------------AIITFGLNALNGRHPVHNGMWVGNWNSTNARDF  176

Query  946  MKYTVEKGYTIHGWELG  996
            +KYT+ +GY +  WE G
Sbjct  177  IKYTISRGYPVDSWEFG  193



>ref|XP_002871291.1| hypothetical protein ARALYDRAFT_350042 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH47550.1| hypothetical protein ARALYDRAFT_350042 [Arabidopsis lyrata subsp. 
lyrata]
Length=528

 Score =   177 bits (448),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 83/199 (42%), Positives = 113/199 (57%), Gaps = 28/199 (14%)
 Frame = +1

Query  400  KGSVYVDGKSRIGRTDSDFICATLDWWPPEKCDYGTCAWGHASLLNLDLSNIIFLNAIKA  579
            + S+ V+G  R+  TD +F+CATLDWWP +KC+Y  C WG++S++N+DL+  +   AI+A
Sbjct  7    RASIVVEGARRVCETDENFVCATLDWWPHDKCNYDQCPWGYSSVINMDLTRPLLTKAIQA  66

Query  580  FSPLKIRLGGTLQDKVVYQTKDDRVPCTSFVSNTSEIFSFSQGCLPLSRWDELNVFFNKS  759
            F PL+IR+GG+LQD+V Y   + + PC  F    S +F FS+GCL + RWDELN F   +
Sbjct  67   FKPLRIRIGGSLQDQVTYDVGNLKTPCRPFQKMNSGLFGFSKGCLHMKRWDELNSFLTAT  126

Query  760  G*PTRFIPCPAYICQHs*lyvsslrvllrAVIIFGLNALTGRSIRSDASAVGAWDSTNAE  939
            G                            AV+ FGLNAL GR      +  GAWD  N +
Sbjct  127  G----------------------------AVVTFGLNALRGRHKLRGKAWGGAWDHINTQ  158

Query  940  SLMKYTVEKGYTIHGWELG  996
              + YTV KGY I  WE G
Sbjct  159  DFINYTVSKGYVIDSWEFG  177



>ref|XP_010678425.1| PREDICTED: heparanase-like protein 2 [Beta vulgaris subsp. vulgaris]
 ref|XP_010678426.1| PREDICTED: heparanase-like protein 2 [Beta vulgaris subsp. vulgaris]
Length=544

 Score =   177 bits (448),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 83/194 (43%), Positives = 116/194 (60%), Gaps = 28/194 (14%)
 Frame = +1

Query  415  VDGKSRIGRTDSDFICATLDWWPPEKCDYGTCAWGHASLLNLDLSNIIFLNAIKAFSPLK  594
            V+G   +  TD +++CAT+DWWP  KCDY  C WG+AS++NL+LS+ +   A++AF+ L+
Sbjct  32   VNGGHVMAETDENYVCATVDWWPHTKCDYNQCPWGYASIMNLNLSHPLLAKAVQAFTHLR  91

Query  595  IRLGGTLQDKVVYQTKDDRVPCTSFVSNTSEIFSFSQGCLPLSRWDELNVFFNKSG*PTR  774
            +RLGG+L+D+VVY     ++PC  F   +S +F FS+GCL L RWD LN FF++SG    
Sbjct  92   VRLGGSLEDQVVYDVPSLKLPCHPFWKQSSGLFGFSRGCLHLGRWDALNHFFSQSG----  147

Query  775  FIPCPAYICQHs*lyvsslrvllrAVIIFGLNALTGRSIRSDASAVGAWDSTNAESLMKY  954
                                    A+I FG+NAL GR    +   +G WDS+NA   MKY
Sbjct  148  ------------------------AIITFGINALYGRKKSKNDVWIGPWDSSNAYDFMKY  183

Query  955  TVEKGYTIHGWELG  996
            T+ KGY I  WE G
Sbjct  184  TISKGYHIDSWEFG  197



>ref|XP_006440691.1| hypothetical protein CICLE_v10019304mg [Citrus clementina]
 gb|ESR53931.1| hypothetical protein CICLE_v10019304mg [Citrus clementina]
Length=543

 Score =   177 bits (448),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 86/198 (43%), Positives = 117/198 (59%), Gaps = 30/198 (15%)
 Frame = +1

Query  406  SVYVDGKSRIGRTDSDFICATLDWWPPEKCDYGTCAWGHASLLNLDLSNIIFLNAIKAFS  585
            +++VD    +   D  FICAT+DWWP +KC+Y  C WG++S++NLDLS+ +  NAI+AF 
Sbjct  27   TIFVDATKTVATNDEHFICATVDWWPHDKCNYNHCPWGNSSVINLDLSHPLLANAIQAFQ  86

Query  586  PLKIRLGGTLQDKVVYQTKDDRVPCTSFVSNTSEIFSFSQGCLPLSRWDELNVFFNKSG*  765
             L+IR+GG+LQD+V+Y   D + PC  F      +F FS+GCL + RWDELN  FN++G 
Sbjct  87   SLRIRIGGSLQDQVLYDVGDLKAPCHPFRKMKDGLFGFSKGCLHMQRWDELNQLFNRTG-  145

Query  766  PTRFIPCPAYICQHs*lyvsslrvllrAVIIFGLNALTGR-SIRSDASAVGAWDSTNAES  942
                                       A++ FGLNAL GR +IR +A   GAWDS NA  
Sbjct  146  ---------------------------AIVSFGLNALHGRHNIRHNAWG-GAWDSNNARD  177

Query  943  LMKYTVEKGYTIHGWELG  996
             +KYT+  GY I  WE G
Sbjct  178  FLKYTISMGYQIDSWEYG  195



>ref|XP_008661167.1| PREDICTED: heparanase-like protein 1 [Zea mays]
Length=540

 Score =   176 bits (447),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 95/225 (42%), Positives = 123/225 (55%), Gaps = 30/225 (13%)
 Frame = +1

Query  328  MRLWILVLGVFNVSLIS-GSETLGDKGSVYVDGKSRIGRTDSDFICATLDWWPPEKCDYG  504
            MRLW + L      L    SE   D  +V V G   I  T  +F+CAT+DWWPPEKC+Y 
Sbjct  1    MRLWCIFLLPLLCQLAGVRSEDYSDV-TVIVRGSETIASTSGEFVCATIDWWPPEKCNYD  59

Query  505  TCAWGHASLLNLDLSNIIFLNAIKAFSPLKIRLGGTLQDKVVYQTKDDRVPCTSFVSNTS  684
             C WG AS+LNLDL+N +   AI+AFSPL+IR+GG+LQD+V+Y T +  +PC  F   +S
Sbjct  60   QCPWGRASVLNLDLTNPLLAKAIQAFSPLRIRVGGSLQDQVLYGTPNLGLPCDPFTKVSS  119

Query  685  EIFSFSQGCLPLSRWDELNVFFNKSG*PTRFIPCPAYICQHs*lyvsslrvllrAVIIFG  864
             +F FSQGC+ L RWD++N  F  +G                            AV+ FG
Sbjct  120  GLFEFSQGCITLERWDDINDLFLNTG----------------------------AVVTFG  151

Query  865  LNALTGRSIRSDASAVGAWDSTNAESLMKYTVEKGYTIHGWELGK  999
            LNAL GR         G W+S+NA   ++YT  K Y I  WE G 
Sbjct  152  LNALQGRHQIRKGVWGGPWNSSNAREFIEYTASKNYPIDSWEFGN  196



>ref|XP_006578556.1| PREDICTED: heparanase-like protein 1-like isoform X1 [Glycine 
max]
 ref|XP_006578557.1| PREDICTED: heparanase-like protein 1-like isoform X2 [Glycine 
max]
Length=547

 Score =   177 bits (448),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 87/200 (44%), Positives = 114/200 (57%), Gaps = 28/200 (14%)
 Frame = +1

Query  397  DKGSVYVDGKSRIGRTDSDFICATLDWWPPEKCDYGTCAWGHASLLNLDLSNIIFLNAIK  576
            + GS+ VDG      T  +FICAT+DWWP +KCDY  C WG++S++NLDLS+     AI+
Sbjct  23   EHGSLLVDGAQTKAETGDNFICATIDWWPHDKCDYNHCPWGYSSVVNLDLSHPFLAKAIQ  82

Query  577  AFSPLKIRLGGTLQDKVVYQTKDDRVPCTSFVSNTSEIFSFSQGCLPLSRWDELNVFFNK  756
            A  PL+IRLGG+LQD+V+Y     + PC         +F FS+GCL + RWDELN FFN+
Sbjct  83   ALRPLRIRLGGSLQDQVLYDVGSLKSPCHPLQKVKGGLFGFSKGCLHMKRWDELNQFFNE  142

Query  757  SG*PTRFIPCPAYICQHs*lyvsslrvllrAVIIFGLNALTGRSIRSDASAVGAWDSTNA  936
            +G                            A++ FGLNAL G+   S     GAWD TNA
Sbjct  143  TG----------------------------AIVTFGLNALHGKHQISHNVWEGAWDPTNA  174

Query  937  ESLMKYTVEKGYTIHGWELG  996
               ++YT+ KGY I  WELG
Sbjct  175  YDFIEYTISKGYKIDSWELG  194



>ref|XP_004239465.2| PREDICTED: heparanase-like protein 2, partial [Solanum lycopersicum]
Length=513

 Score =   176 bits (446),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 93/204 (46%), Positives = 120/204 (59%), Gaps = 33/204 (16%)
 Frame = +1

Query  397  DKGSVYVDGKSRIGRTDSDFICATLDWWPPEKCDYGTCAWGHASLLNLDLSNIIFLNAIK  576
            D+  V V G + I +TD +FICATLDWWP  KCDY  C WG A +LNLDL N I  NA+K
Sbjct  7    DELKVVVKGVTSIAQTDDNFICATLDWWPENKCDYNQCPWGKAGILNLDLKNRILTNAVK  66

Query  577  AFSPLKIRLGGTLQDKVVYQTKDDRVPCTSFVSNTSEIFSFSQGCLPLSRWDELNVFFNK  756
            AF+PL++R+GG+LQD+V Y+  +    C++F   +  +F FS GCL ++RWDEL+  FNK
Sbjct  67   AFNPLRLRIGGSLQDQVYYKVGNYPKNCSNFEKKSDGLFGFSDGCLHMNRWDELHDMFNK  126

Query  757  SG*PTRFIPCPAYICQHs*lyvsslrvllrAVIIFGLNALTGRSIRSDASA----VGAWD  924
            +G                            A I F  NAL GR I SD +     VG W+
Sbjct  127  TG----------------------------AAITFSFNALIGR-IPSDENDTTLWVGDWN  157

Query  925  STNAESLMKYTVEKGYTIHGWELG  996
              NA+SLMKYT+ KGY I  +ELG
Sbjct  158  HYNAKSLMKYTLNKGYKIDSYELG  181



>gb|KHN36951.1| Heparanase-like protein 1 [Glycine soja]
Length=545

 Score =   176 bits (447),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 87/200 (44%), Positives = 114/200 (57%), Gaps = 28/200 (14%)
 Frame = +1

Query  397  DKGSVYVDGKSRIGRTDSDFICATLDWWPPEKCDYGTCAWGHASLLNLDLSNIIFLNAIK  576
            + GS+ VDG      T  +FICAT+DWWP +KCDY  C WG++S++NLDLS+     AI+
Sbjct  23   EHGSLLVDGAQTKAETGDNFICATIDWWPHDKCDYNHCPWGYSSVVNLDLSHPFLAKAIQ  82

Query  577  AFSPLKIRLGGTLQDKVVYQTKDDRVPCTSFVSNTSEIFSFSQGCLPLSRWDELNVFFNK  756
            A  PL+IRLGG+LQD+V+Y     + PC         +F FS+GCL + RWDELN FFN+
Sbjct  83   ALRPLRIRLGGSLQDQVLYDVGSLKSPCHPLQKVKGGLFGFSKGCLHMKRWDELNQFFNE  142

Query  757  SG*PTRFIPCPAYICQHs*lyvsslrvllrAVIIFGLNALTGRSIRSDASAVGAWDSTNA  936
            +G                            A++ FGLNAL G+   S     GAWD TNA
Sbjct  143  TG----------------------------AIVTFGLNALHGKHQISHNVWEGAWDPTNA  174

Query  937  ESLMKYTVEKGYTIHGWELG  996
               ++YT+ KGY I  WELG
Sbjct  175  YDFIEYTISKGYKIDSWELG  194



>gb|KDO54583.1| hypothetical protein CISIN_1g008834mg [Citrus sinensis]
Length=425

 Score =   174 bits (441),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 86/199 (43%), Positives = 117/199 (59%), Gaps = 30/199 (15%)
 Frame = +1

Query  406  SVYVDGKSRIGRTDSDFICATLDWWPPEKCDYGTCAWGHASLLNLDLSNIIFLNAIKAFS  585
            +++VD    +   D  FICAT+DWWP +KC+Y  C WG++S++NLDLS+ +  NAI+AF 
Sbjct  27   TIFVDATKTVATNDEHFICATVDWWPHDKCNYNHCPWGNSSVINLDLSHPLLANAIQAFQ  86

Query  586  PLKIRLGGTLQDKVVYQTKDDRVPCTSFVSNTSEIFSFSQGCLPLSRWDELNVFFNKSG*  765
             L+IR+GG+LQD+V+Y   D + PC  F      +F FS+GCL + RWDELN  FN++  
Sbjct  87   SLRIRIGGSLQDQVLYDVGDLKAPCHPFRKMKDGLFGFSKGCLHMQRWDELNQLFNRT--  144

Query  766  PTRFIPCPAYICQHs*lyvsslrvllrAVIIFGLNALTGR-SIRSDASAVGAWDSTNAES  942
                                      RA++ FGLNAL GR +IR +A   GAWDS NA  
Sbjct  145  --------------------------RAIVSFGLNALHGRHNIRHNAWG-GAWDSNNARD  177

Query  943  LMKYTVEKGYTIHGWELGK  999
             +KYT+  GY I  WE G 
Sbjct  178  FLKYTISMGYQIDSWEYGN  196



>emb|CAD42650.1| putative heparanase [Hordeum vulgare subsp. vulgare]
Length=537

 Score =   176 bits (446),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 87/197 (44%), Positives = 113/197 (57%), Gaps = 28/197 (14%)
 Frame = +1

Query  406  SVYVDGKSRIGRTDSDFICATLDWWPPEKCDYGTCAWGHASLLNLDLSNIIFLNAIKAFS  585
            +V V G   I  T  +FICAT+DWWPPEKC+Y  C WG AS+LN+DL+N +   AI+AFS
Sbjct  26   TVIVRGSKTIAATSDEFICATVDWWPPEKCNYDQCPWGKASILNMDLTNPLLAKAIQAFS  85

Query  586  PLKIRLGGTLQDKVVYQTKDDRVPCTSFVSNTSEIFSFSQGCLPLSRWDELNVFFNKSG*  765
            PL+IR+GG+LQD+VVY+T +   PC  F   +S +F FS+GC+ + RWD +N  F  +G 
Sbjct  86   PLRIRVGGSLQDQVVYETPNLGSPCRPFTKASSGLFGFSKGCITMERWDAMNDLFLNTG-  144

Query  766  PTRFIPCPAYICQHs*lyvsslrvllrAVIIFGLNALTGRSIRSDASAVGAWDSTNAESL  945
                                       AVI FGLNAL GR         GAW+ +NA+  
Sbjct  145  ---------------------------AVITFGLNALRGRKQIRKGVWGGAWNPSNAQEF  177

Query  946  MKYTVEKGYTIHGWELG  996
            M+YTV   Y I  WE G
Sbjct  178  MEYTVSMNYPIDSWEFG  194



>ref|XP_007045929.1| Heparanase, putative [Theobroma cacao]
 gb|EOY01761.1| Heparanase, putative [Theobroma cacao]
Length=523

 Score =   176 bits (445),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 91/198 (46%), Positives = 117/198 (59%), Gaps = 31/198 (16%)
 Frame = +1

Query  409  VYVDGKSRIGRTDSDFICATLDWWPPEKCDYGTCAWGHASLLNLDLSNIIFLNAIKAFSP  588
            V + G + I RTD +F+CATLDWWP EKC+Y  C WG A L NLDL N I  +AIKAF+P
Sbjct  28   VSIRGATTIARTDDNFVCATLDWWPTEKCNYNQCPWGKAGLFNLDLENKILASAIKAFNP  87

Query  589  LKIRLGGTLQDKVVYQTKDDRVPCTSFVSNTSEIFSFSQGCLPLSRWDELNVFFNKSG*P  768
            L++R+GG+LQD+VVY+  + +  CT F      +F FS+GCLP+ RWDELN  FN++G  
Sbjct  88   LRVRIGGSLQDQVVYKVGNVK-KCTQFKKVEGGLFGFSEGCLPMERWDELNNLFNRTG--  144

Query  769  TRFIPCPAYICQHs*lyvsslrvllrAVIIFGLNALTGRS-IRSDASA-VGAWDSTNAES  942
                                      A I FGLNAL GR+  ++D    VG W   N+  
Sbjct  145  --------------------------AKITFGLNALLGRNESKTDKGLWVGDWRVDNSRD  178

Query  943  LMKYTVEKGYTIHGWELG  996
            LMKY +EKGY I  +E G
Sbjct  179  LMKYNIEKGYKIDSYEFG  196



>ref|XP_010491400.1| PREDICTED: heparanase-like protein 1 [Camelina sativa]
Length=551

 Score =   176 bits (446),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 82/197 (42%), Positives = 113/197 (57%), Gaps = 28/197 (14%)
 Frame = +1

Query  406  SVYVDGKSRIGRTDSDFICATLDWWPPEKCDYGTCAWGHASLLNLDLSNIIFLNAIKAFS  585
            S+ ++G  R+  TD +F+CATLDWWP +KC+Y  C WG++S++N+DL+  +   AI+AF 
Sbjct  38   SIVIEGARRVSETDENFVCATLDWWPHDKCNYQQCPWGYSSVINMDLTRPLLSKAIQAFK  97

Query  586  PLKIRLGGTLQDKVVYQTKDDRVPCTSFVSNTSEIFSFSQGCLPLSRWDELNVFFNKSG*  765
            PL+IR+GG+LQD+V Y   + + PC  F    S +F FS+GCL + RWDEL+ F   +G 
Sbjct  98   PLRIRIGGSLQDQVTYDVGNLKTPCRPFRKMNSGLFGFSKGCLHMKRWDELHSFLTATG-  156

Query  766  PTRFIPCPAYICQHs*lyvsslrvllrAVIIFGLNALTGRSIRSDASAVGAWDSTNAESL  945
                                       AVI FGLNAL+GR      +  GAWD  N +  
Sbjct  157  ---------------------------AVITFGLNALSGRHKLRGKAWGGAWDHVNTQDF  189

Query  946  MKYTVEKGYTIHGWELG  996
            + YTV KGY I  WE G
Sbjct  190  INYTVSKGYAIDSWEFG  206



>gb|KDO54582.1| hypothetical protein CISIN_1g008834mg [Citrus sinensis]
Length=435

 Score =   174 bits (440),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 86/198 (43%), Positives = 117/198 (59%), Gaps = 30/198 (15%)
 Frame = +1

Query  406  SVYVDGKSRIGRTDSDFICATLDWWPPEKCDYGTCAWGHASLLNLDLSNIIFLNAIKAFS  585
            +++VD    +   D  FICAT+DWWP +KC+Y  C WG++S++NLDLS+ +  NAI+AF 
Sbjct  27   TIFVDATKTVATNDEHFICATVDWWPHDKCNYNHCPWGNSSVINLDLSHPLLANAIQAFQ  86

Query  586  PLKIRLGGTLQDKVVYQTKDDRVPCTSFVSNTSEIFSFSQGCLPLSRWDELNVFFNKSG*  765
             L+IR+GG+LQD+V+Y   D + PC  F      +F FS+GCL + RWDELN  FN++  
Sbjct  87   SLRIRIGGSLQDQVLYDVGDLKAPCHPFRKMKDGLFGFSKGCLHMQRWDELNQLFNRT--  144

Query  766  PTRFIPCPAYICQHs*lyvsslrvllrAVIIFGLNALTGR-SIRSDASAVGAWDSTNAES  942
                                      RA++ FGLNAL GR +IR +A   GAWDS NA  
Sbjct  145  --------------------------RAIVSFGLNALHGRHNIRHNAWG-GAWDSNNARD  177

Query  943  LMKYTVEKGYTIHGWELG  996
             +KYT+  GY I  WE G
Sbjct  178  FLKYTISMGYQIDSWEYG  195



>ref|XP_004137422.1| PREDICTED: heparanase-like protein 1 [Cucumis sativus]
 ref|XP_011650033.1| PREDICTED: heparanase-like protein 1 [Cucumis sativus]
 ref|XP_011650035.1| PREDICTED: heparanase-like protein 1 [Cucumis sativus]
 ref|XP_011650040.1| PREDICTED: heparanase-like protein 1 [Cucumis sativus]
 ref|XP_011650044.1| PREDICTED: heparanase-like protein 1 [Cucumis sativus]
 gb|KGN64031.1| hypothetical protein Csa_1G038980 [Cucumis sativus]
Length=536

 Score =   176 bits (445),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 83/200 (42%), Positives = 116/200 (58%), Gaps = 28/200 (14%)
 Frame = +1

Query  397  DKGSVYVDGKSRIGRTDSDFICATLDWWPPEKCDYGTCAWGHASLLNLDLSNIIFLNAIK  576
            +   + ++   ++  TD +FICATLDWWP +KCDY  C WG++S++NL+LS+ +   AI+
Sbjct  23   EHARIIINANEKVAETDYNFICATLDWWPHDKCDYNQCPWGYSSVINLNLSHPLLSKAIQ  82

Query  577  AFSPLKIRLGGTLQDKVVYQTKDDRVPCTSFVSNTSEIFSFSQGCLPLSRWDELNVFFNK  756
            AF  L+IR+GG+LQD+V+Y  +  + PC  F   +S +F FS+GCL L RWDELN  F++
Sbjct  83   AFHNLRIRIGGSLQDQVLYDVESLKTPCRPFQKISSGLFGFSKGCLHLYRWDELNHLFSR  142

Query  757  SG*PTRFIPCPAYICQHs*lyvsslrvllrAVIIFGLNALTGRSIRSDASAVGAWDSTNA  936
            +G                            A++ FGLNAL GR         G WDS+NA
Sbjct  143  TG----------------------------AIVTFGLNALYGRHKIGRIQWGGDWDSSNA  174

Query  937  ESLMKYTVEKGYTIHGWELG  996
               MKYT+ KGY I  WE G
Sbjct  175  RDFMKYTISKGYVIESWEFG  194



>ref|XP_006440690.1| hypothetical protein CICLE_v10019304mg [Citrus clementina]
 gb|ESR53930.1| hypothetical protein CICLE_v10019304mg [Citrus clementina]
Length=628

 Score =   177 bits (448),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 86/199 (43%), Positives = 117/199 (59%), Gaps = 30/199 (15%)
 Frame = +1

Query  406  SVYVDGKSRIGRTDSDFICATLDWWPPEKCDYGTCAWGHASLLNLDLSNIIFLNAIKAFS  585
            +++VD    +   D  FICAT+DWWP +KC+Y  C WG++S++NLDLS+ +  NAI+AF 
Sbjct  112  TIFVDATKTVATNDEHFICATVDWWPHDKCNYNHCPWGNSSVINLDLSHPLLANAIQAFQ  171

Query  586  PLKIRLGGTLQDKVVYQTKDDRVPCTSFVSNTSEIFSFSQGCLPLSRWDELNVFFNKSG*  765
             L+IR+GG+LQD+V+Y   D + PC  F      +F FS+GCL + RWDELN  FN++G 
Sbjct  172  SLRIRIGGSLQDQVLYDVGDLKAPCHPFRKMKDGLFGFSKGCLHMQRWDELNQLFNRTG-  230

Query  766  PTRFIPCPAYICQHs*lyvsslrvllrAVIIFGLNALTGR-SIRSDASAVGAWDSTNAES  942
                                       A++ FGLNAL GR +IR +A   GAWDS NA  
Sbjct  231  ---------------------------AIVSFGLNALHGRHNIRHNAWG-GAWDSNNARD  262

Query  943  LMKYTVEKGYTIHGWELGK  999
             +KYT+  GY I  WE G 
Sbjct  263  FLKYTISMGYQIDSWEYGN  281



>ref|XP_008447189.1| PREDICTED: heparanase-like protein 1 [Cucumis melo]
 ref|XP_008447267.1| PREDICTED: heparanase-like protein 1 [Cucumis melo]
 ref|XP_008447315.1| PREDICTED: heparanase-like protein 1 [Cucumis melo]
 ref|XP_008447359.1| PREDICTED: heparanase-like protein 1 [Cucumis melo]
 ref|XP_008447434.1| PREDICTED: heparanase-like protein 1 [Cucumis melo]
Length=536

 Score =   176 bits (445),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 82/200 (41%), Positives = 117/200 (59%), Gaps = 28/200 (14%)
 Frame = +1

Query  397  DKGSVYVDGKSRIGRTDSDFICATLDWWPPEKCDYGTCAWGHASLLNLDLSNIIFLNAIK  576
            +   + ++   ++  TD +FICATLDWWP +KCDY  C WG++S++NL+LS+ +   AI+
Sbjct  23   EHARIIINANEKVAETDYNFICATLDWWPHDKCDYNQCPWGYSSVINLNLSHPLLSKAIQ  82

Query  577  AFSPLKIRLGGTLQDKVVYQTKDDRVPCTSFVSNTSEIFSFSQGCLPLSRWDELNVFFNK  756
            AF  L+IR+GG+LQD+V+Y   + + PC  F   +S +F FS+GCL ++RWDELN  F++
Sbjct  83   AFHNLRIRIGGSLQDQVLYDVGNLKTPCRPFQKISSGLFGFSKGCLHMNRWDELNHLFSR  142

Query  757  SG*PTRFIPCPAYICQHs*lyvsslrvllrAVIIFGLNALTGRSIRSDASAVGAWDSTNA  936
            +G                            A++ FGLNAL GR         G WDS+NA
Sbjct  143  TG----------------------------AIVTFGLNALYGRHKIGRTQWGGDWDSSNA  174

Query  937  ESLMKYTVEKGYTIHGWELG  996
               MKYT+ KGY I  WE G
Sbjct  175  RDFMKYTITKGYVIESWEFG  194



>ref|XP_003578591.1| PREDICTED: heparanase-like protein 1 [Brachypodium distachyon]
Length=538

 Score =   176 bits (445),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 86/198 (43%), Positives = 114/198 (58%), Gaps = 28/198 (14%)
 Frame = +1

Query  406  SVYVDGKSRIGRTDSDFICATLDWWPPEKCDYGTCAWGHASLLNLDLSNIIFLNAIKAFS  585
            +V + G   I  T  +FICAT+DWWPPEKC+Y  C WG AS+LN+DL+N +   AI+AFS
Sbjct  26   TVIIRGSETIAATSDEFICATIDWWPPEKCNYDQCPWGKASVLNMDLTNPLLAKAIQAFS  85

Query  586  PLKIRLGGTLQDKVVYQTKDDRVPCTSFVSNTSEIFSFSQGCLPLSRWDELNVFFNKSG*  765
            PL+IR+GG+LQD+VVY T +   PC +F  ++S +F FS+GC+ + RWD +N  F  +G 
Sbjct  86   PLRIRVGGSLQDQVVYGTPNLGSPCRAFTKSSSGLFGFSKGCITMERWDAINDLFLNTG-  144

Query  766  PTRFIPCPAYICQHs*lyvsslrvllrAVIIFGLNALTGRSIRSDASAVGAWDSTNAESL  945
                                       AVI FGLNAL GR         GAW+S+NA+  
Sbjct  145  ---------------------------AVITFGLNALQGRKQIRKGVWGGAWNSSNAQEF  177

Query  946  MKYTVEKGYTIHGWELGK  999
            M+YT    Y I  WE G 
Sbjct  178  MEYTASMNYPIDSWEFGN  195



>ref|XP_010936349.1| PREDICTED: heparanase-like protein 1 isoform X2 [Elaeis guineensis]
Length=576

 Score =   176 bits (446),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 95/236 (40%), Positives = 124/236 (53%), Gaps = 37/236 (16%)
 Frame = +1

Query  289  GQVPTMGHSWFLQMRLWILVLGVFNVSLISGSETLGDKGSVYVDGKSRIGRTDSDFICAT  468
            G V  MGH          L+L VF  SL         + +V V G + +  TD +F+CAT
Sbjct  33   GLVEGMGHR---------LLLFVFLYSLPGILAQESAEATVIVKGSATVAETDKNFVCAT  83

Query  469  LDWWPPEKCDYGTCAWGHASLLNLDLSNIIFLNAIKAFSPLKIRLGGTLQDKVVYQTKDD  648
            +DWWPPEKC+Y  C WG +S LNLD+ +    NAIKAF  L+IR+GG+LQDKVVY   + 
Sbjct  84   IDWWPPEKCNYDQCPWGESSALNLDVDHPFLANAIKAFKSLRIRVGGSLQDKVVYGLSNL  143

Query  649  RVPCTSFVSNTSEIFSFSQGCLPLSRWDELNVFFNKSG*PTRFIPCPAYICQHs*lyvss  828
              PC  F      +F FSQGCL + RWD+LN  F K+G                      
Sbjct  144  GHPCLPFTKMEDGLFGFSQGCLSMDRWDKLNDLFRKTG----------------------  181

Query  829  lrvllrAVIIFGLNALTGRSIRSDASAVGAWDSTNAESLMKYTVEKGYTIHGWELG  996
                  A++ FGLNAL GR+   +    G W+STNA   ++YT+ K Y +  WE G
Sbjct  182  ------AIVTFGLNALHGRNHIRNKVWAGPWNSTNARDFIEYTISKQYPVDSWEFG  231



>ref|XP_002514696.1| Heparanase-2, putative [Ricinus communis]
 gb|EEF47802.1| Heparanase-2, putative [Ricinus communis]
Length=539

 Score =   175 bits (444),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 85/199 (43%), Positives = 115/199 (58%), Gaps = 28/199 (14%)
 Frame = +1

Query  400  KGSVYVDGKSRIGRTDSDFICATLDWWPPEKCDYGTCAWGHASLLNLDLSNIIFLNAIKA  579
              ++ VDG   +  TD +FICATLDWWP +KCDY  C WG++S+LNL+LS+ +   A++A
Sbjct  24   HATIVVDGTVTVAETDDNFICATLDWWPHDKCDYNQCPWGYSSVLNLNLSHPLLAKAMQA  83

Query  580  FSPLKIRLGGTLQDKVVYQTKDDRVPCTSFVSNTSEIFSFSQGCLPLSRWDELNVFFNKS  759
            F  L+IR+GG+LQD+V+Y   D + PC  F      +F FS+GCL ++RWDELN+ F+K+
Sbjct  84   FRHLRIRIGGSLQDRVLYDVGDLKFPCHPFRKMKDGLFGFSKGCLHMNRWDELNLLFSKT  143

Query  760  G*PTRFIPCPAYICQHs*lyvsslrvllrAVIIFGLNALTGRSIRSDASAVGAWDSTNAE  939
            G                            A++ F LNAL GR         GAWDS+NA 
Sbjct  144  G----------------------------AIVTFSLNALHGRHQIRRGVWGGAWDSSNAY  175

Query  940  SLMKYTVEKGYTIHGWELG  996
              M YTV KG+ I  WE G
Sbjct  176  DFMNYTVSKGHKIDSWEFG  194



>ref|XP_004962990.1| PREDICTED: heparanase-like protein 2-like [Setaria italica]
Length=540

 Score =   175 bits (444),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 88/198 (44%), Positives = 111/198 (56%), Gaps = 28/198 (14%)
 Frame = +1

Query  406  SVYVDGKSRIGRTDSDFICATLDWWPPEKCDYGTCAWGHASLLNLDLSNIIFLNAIKAFS  585
            +V V G   I  T  +F+CAT+DWWPPEKC+Y  C WG AS+LNLDL+N +   AI+AFS
Sbjct  27   TVIVRGSETIASTSDEFVCATIDWWPPEKCNYDQCPWGRASVLNLDLTNPLLAKAIQAFS  86

Query  586  PLKIRLGGTLQDKVVYQTKDDRVPCTSFVSNTSEIFSFSQGCLPLSRWDELNVFFNKSG*  765
            PL+IR+GG+LQD+V+Y T +   PC  F   +  +F FSQGC+ L RWD +N  F  +G 
Sbjct  87   PLRIRVGGSLQDQVLYGTPNLESPCDPFTKVSGGLFGFSQGCITLERWDAINDLFVNTG-  145

Query  766  PTRFIPCPAYICQHs*lyvsslrvllrAVIIFGLNALTGRSIRSDASAVGAWDSTNAESL  945
                                       AVI FGLNAL GR         G W+S+NA   
Sbjct  146  ---------------------------AVITFGLNALQGRQQIRRGVWGGPWNSSNAREF  178

Query  946  MKYTVEKGYTIHGWELGK  999
            M+YTV K Y I  WE G 
Sbjct  179  MEYTVSKDYPIDSWEFGN  196



>gb|ACG44916.1| heparanase-like protein 2 precursor [Zea mays]
 gb|ACN28738.1| unknown [Zea mays]
 tpg|DAA44037.1| TPA: heparanase-like protein 2 [Zea mays]
Length=541

 Score =   175 bits (444),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 85/200 (43%), Positives = 117/200 (59%), Gaps = 29/200 (15%)
 Frame = +1

Query  397  DKGSVYVDGKSRIGRTDSDFICATLDWWPPEKCDYGTCAWGHASLLNLDLSNIIFLNAIK  576
            D+ +V V G +RI  TD +++CAT+DWWPPEKC+Y  C WG AS+LNLDL +     AI+
Sbjct  26   DEATVIVKGSTRIAETDDNYVCATIDWWPPEKCNYNQCPWGQASILNLDLDHPFLAQAIQ  85

Query  577  AFSPLKIRLGGTLQDKVVYQTKDDRVPCTSFVSNTSEIFSFSQGCLPLSRWDELNVFFNK  756
            AF  L+IRLGG+LQD+VVY    +  PC+ F + ++ +F FS GCL + RWD+LN  F +
Sbjct  86   AFDHLRIRLGGSLQDRVVYDVGTES-PCSPFTNVSNALFGFSVGCLGMDRWDKLNDLFER  144

Query  757  SG*PTRFIPCPAYICQHs*lyvsslrvllrAVIIFGLNALTGRSIRSDASAVGAWDSTNA  936
            +G                            A++ FG+NAL GR     +   G W+STNA
Sbjct  145  TG----------------------------AIVTFGVNALYGRYNVRRSIWAGKWNSTNA  176

Query  937  ESLMKYTVEKGYTIHGWELG  996
               +KYT+ KGY +  WE G
Sbjct  177  YDFVKYTISKGYPVGSWEFG  196



>ref|NP_001145968.1| uncharacterized protein LOC100279495 precursor [Zea mays]
 gb|ACL52953.1| unknown [Zea mays]
Length=541

 Score =   175 bits (444),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 85/200 (43%), Positives = 117/200 (59%), Gaps = 29/200 (15%)
 Frame = +1

Query  397  DKGSVYVDGKSRIGRTDSDFICATLDWWPPEKCDYGTCAWGHASLLNLDLSNIIFLNAIK  576
            D+ +V V G +RI  TD +++CAT+DWWPPEKC+Y  C WG AS+LNLDL +     AI+
Sbjct  26   DEATVIVKGSTRIAETDDNYVCATIDWWPPEKCNYNQCPWGQASILNLDLDHPFLAQAIQ  85

Query  577  AFSPLKIRLGGTLQDKVVYQTKDDRVPCTSFVSNTSEIFSFSQGCLPLSRWDELNVFFNK  756
            AF  L+IRLGG+LQD+VVY    +  PC+ F + ++ +F FS GCL + RWD+LN  F +
Sbjct  86   AFDHLRIRLGGSLQDRVVYDVGTES-PCSPFTNVSNALFGFSVGCLGMDRWDKLNDLFER  144

Query  757  SG*PTRFIPCPAYICQHs*lyvsslrvllrAVIIFGLNALTGRSIRSDASAVGAWDSTNA  936
            +G                            A++ FG+NAL GR     +   G W+STNA
Sbjct  145  TG----------------------------AIVTFGVNALYGRYNVRRSIWAGKWNSTNA  176

Query  937  ESLMKYTVEKGYTIHGWELG  996
               +KYT+ KGY +  WE G
Sbjct  177  YDFVKYTISKGYPVGSWEFG  196



>ref|XP_011070960.1| PREDICTED: heparanase-like protein 2 isoform X1 [Sesamum indicum]
Length=514

 Score =   175 bits (443),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 91/196 (46%), Positives = 113/196 (58%), Gaps = 30/196 (15%)
 Frame = +1

Query  415  VDGKSRIGRTDSDFICATLDWWPPEKCDYGTCAWGHASLLNLDLSNIIFLNAIKAFSPLK  594
            V G + I +TD +FICATLDWWP  KC+Y  C WG A +LNLDL N I  NAIKAFSPL+
Sbjct  27   VRGVTSIAKTDENFICATLDWWPETKCNYNQCPWGKAGILNLDLENKILANAIKAFSPLR  86

Query  595  IRLGGTLQDKVVYQTKDDRVPCTSFVSNTSEIFSFSQGCLPLSRWDELNVFFNKSG*PTR  774
            IR+GG+LQD+V+Y+       C  F      +F FS+GCL ++RWD LN  FN++G    
Sbjct  87   IRIGGSLQDQVLYKVGTLAPKCPHFKRRDDGLFGFSKGCLDMNRWDLLNKLFNRTG----  142

Query  775  FIPCPAYICQHs*lyvsslrvllrAVIIFGLNALTGRSIRSDASA--VGAWDSTNAESLM  948
                                    A + FGLNALTGR    D ++  VG W+  NA   M
Sbjct  143  ------------------------ARLTFGLNALTGRKKSKDDNSLMVGNWNPRNAYEFM  178

Query  949  KYTVEKGYTIHGWELG  996
            KYTV KGY I  +ELG
Sbjct  179  KYTVSKGYKIDSYELG  194



>gb|KJB84192.1| hypothetical protein B456_N009300 [Gossypium raimondii]
Length=525

 Score =   175 bits (443),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 94/214 (44%), Positives = 123/214 (57%), Gaps = 35/214 (16%)
 Frame = +1

Query  364  VSLISGSETLGDKGSVYVDGKSRIGRTDSDFICATLDWWPPEKCDYGTCAWGHASLLNLD  543
            VS IS S T     +V + G + I  TD +F+CATLDWWP EKC+Y  C WG A +LNLD
Sbjct  13   VSQISLSST--QNVNVVIQGATPIAETDDNFVCATLDWWPTEKCNYNQCPWGKAGILNLD  70

Query  544  LSNIIFLNAIKAFSPLKIRLGGTLQDKVVYQTKDDRVPCTSFVSNTSEIFSFSQGCLPLS  723
            L     +NA+KAF+PL+I++GG+LQD+VVY     +  C +F+ N   +F FSQGCLP+ 
Sbjct  71   LKMKGLINAVKAFNPLRIKIGGSLQDQVVYGVGGVK-NCPNFIKNEDSLFGFSQGCLPME  129

Query  724  RWDELNVFFNKSG*PTRFIPCPAYICQHs*lyvsslrvllrAVIIFGLNALTGRSIRSDA  903
            RWD+LN FFN++G                              + FGLNAL GR+ RS+ 
Sbjct  130  RWDQLNNFFNQTG----------------------------VKVTFGLNALLGRN-RSEI  160

Query  904  SA---VGAWDSTNAESLMKYTVEKGYTIHGWELG  996
                 VG W S NA   MKYT+ KGY +  +E G
Sbjct  161  EKGLWVGDWQSQNAGDFMKYTISKGYKVDSYEFG  194



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3381054523999