BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig13246

Length=723
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CDP08875.1|  unnamed protein product                                276   2e-86   Coffea canephora [robusta coffee]
ref|XP_006339456.1|  PREDICTED: shaggy-related protein kinase the...    275   1e-85   Solanum tuberosum [potatoes]
ref|XP_004229833.1|  PREDICTED: shaggy-related protein kinase eps...    274   1e-85   Solanum lycopersicum
gb|AAT81407.1|  shaggy-related protein kinase 6                         273   2e-85   Solanum peruvianum [Peruvian tomato]
dbj|BAO02525.1|  predicted Shaggy-like kinase ortholog                  271   5e-85   Nicotiana alata [flowering tobacco]
ref|XP_009602858.1|  PREDICTED: shaggy-related protein kinase eps...    271   2e-84   Nicotiana tomentosiformis
ref|XP_009610982.1|  PREDICTED: shaggy-related protein kinase eps...    270   3e-84   Nicotiana tomentosiformis
emb|CAA05328.1|  shaggy-like kinase 111                                 270   4e-84   Nicotiana tabacum [American tobacco]
ref|XP_009790920.1|  PREDICTED: shaggy-related protein kinase eps...    270   5e-84   Nicotiana sylvestris
ref|XP_009773710.1|  PREDICTED: shaggy-related protein kinase eps...    268   2e-83   Nicotiana sylvestris
emb|CAA11860.1|  shaggy-like kinase 91                                  268   2e-83   Nicotiana tabacum [American tobacco]
emb|CAA05329.1|  shaggy-like kinase 59                                  268   2e-83   Nicotiana tabacum [American tobacco]
emb|CAA11861.1|  shaggy kinase 6                                        266   1e-82   Petunia x hybrida [garden petunia]
ref|XP_002272112.1|  PREDICTED: shaggy-related protein kinase theta     263   2e-81   Vitis vinifera
ref|XP_006375323.1|  hypothetical protein POPTR_0014s07120g             259   1e-80   
ref|XP_002320754.2|  hypothetical protein POPTR_0014s07120g             259   8e-80   Populus trichocarpa [western balsam poplar]
ref|XP_011093165.1|  PREDICTED: shaggy-related protein kinase alpha     258   1e-79   Sesamum indicum [beniseed]
ref|XP_011035087.1|  PREDICTED: shaggy-related protein kinase theta     257   6e-79   Populus euphratica
ref|XP_006345509.1|  PREDICTED: shaggy-related protein kinase the...    253   2e-77   Solanum tuberosum [potatoes]
ref|XP_012083467.1|  PREDICTED: shaggy-related protein kinase the...    251   8e-77   Jatropha curcas
ref|XP_011091732.1|  PREDICTED: shaggy-related protein kinase alp...    248   1e-75   Sesamum indicum [beniseed]
ref|XP_010255498.1|  PREDICTED: shaggy-related protein kinase eps...    248   2e-75   Nelumbo nucifera [Indian lotus]
ref|XP_010278583.1|  PREDICTED: shaggy-related protein kinase eps...    246   6e-75   Nelumbo nucifera [Indian lotus]
gb|AFK41443.1|  unknown                                                 236   3e-74   Medicago truncatula
ref|XP_002511803.1|  Glycogen synthase kinase-3 beta, putative          244   5e-74   Ricinus communis
ref|XP_004240041.1|  PREDICTED: shaggy-related protein kinase eps...    244   6e-74   Solanum lycopersicum
gb|KDO86034.1|  hypothetical protein CISIN_1g011138mg                   237   9e-74   Citrus sinensis [apfelsine]
ref|XP_011023409.1|  PREDICTED: shaggy-related protein kinase the...    241   1e-73   Populus euphratica
emb|CAA11862.1|  shaggy kinase 7                                        243   1e-73   Petunia x hybrida [garden petunia]
ref|XP_011023410.1|  PREDICTED: shaggy-related protein kinase the...    241   6e-73   Populus euphratica
gb|KDO86033.1|  hypothetical protein CISIN_1g011138mg                   236   2e-72   Citrus sinensis [apfelsine]
ref|XP_003528879.1|  PREDICTED: shaggy-related protein kinase the...    239   3e-72   Glycine max [soybeans]
ref|XP_007051908.1|  Shaggy-like protein kinase 32 isoform 1            240   8e-72   
dbj|BAD95891.1|  Ser/Thr protein kinase                                 236   7e-71   Lotus japonicus
ref|XP_006445137.1|  hypothetical protein CICLE_v10020026mg             236   8e-71   
gb|KDO86031.1|  hypothetical protein CISIN_1g011138mg                   236   1e-70   Citrus sinensis [apfelsine]
ref|XP_010671733.1|  PREDICTED: shaggy-related protein kinase eps...    234   2e-70   Beta vulgaris subsp. vulgaris [field beet]
gb|EYU32069.1|  hypothetical protein MIMGU_mgv1a006024mg                233   6e-70   Erythranthe guttata [common monkey flower]
ref|XP_007134960.1|  hypothetical protein PHAVU_010G090200g             233   6e-70   Phaseolus vulgaris [French bean]
ref|XP_003623822.1|  Shaggy-related protein kinase                      232   2e-69   Medicago truncatula
ref|XP_009340624.1|  PREDICTED: shaggy-related protein kinase the...    229   2e-68   Pyrus x bretschneideri [bai li]
ref|XP_008383272.1|  PREDICTED: shaggy-related protein kinase theta     229   3e-68   
ref|XP_008460173.1|  PREDICTED: shaggy-related protein kinase theta     229   4e-68   Cucumis melo [Oriental melon]
ref|XP_008232743.1|  PREDICTED: shaggy-related protein kinase the...    228   5e-68   Prunus mume [ume]
ref|XP_007051910.1|  Shaggy-like protein kinase 32 isoform 3            227   9e-68   
ref|XP_004144981.1|  PREDICTED: shaggy-related protein kinase theta     227   1e-67   Cucumis sativus [cucumbers]
ref|XP_010540275.1|  PREDICTED: shaggy-related protein kinase the...    227   1e-67   Tarenaya hassleriana [spider flower]
ref|XP_004492676.1|  PREDICTED: shaggy-related protein kinase the...    227   2e-67   Cicer arietinum [garbanzo]
ref|XP_003521276.1|  PREDICTED: shaggy-related protein kinase theta     227   2e-67   Glycine max [soybeans]
ref|XP_003552357.1|  PREDICTED: shaggy-related protein kinase the...    226   3e-67   Glycine max [soybeans]
emb|CAC08564.1|  wound-induced GSK-3-like protein                       226   3e-67   Medicago sativa subsp. x varia
ref|XP_003534597.1|  PREDICTED: shaggy-related protein kinase theta     225   6e-67   Glycine max [soybeans]
gb|KHN27286.1|  Shaggy-related protein kinase theta                     225   6e-67   Glycine soja [wild soybean]
ref|XP_007139956.1|  hypothetical protein PHAVU_008G072800g             225   6e-67   Phaseolus vulgaris [French bean]
gb|KHN29413.1|  Shaggy-related protein kinase theta                     224   1e-66   Glycine soja [wild soybean]
ref|XP_010919260.1|  PREDICTED: shaggy-related protein kinase NtK...    223   1e-66   Elaeis guineensis
ref|XP_007218957.1|  hypothetical protein PRUPE_ppa003552mg             226   2e-66   
gb|KEH18946.1|  shaggy-like kinase                                      224   2e-66   Medicago truncatula
ref|XP_010090625.1|  Shaggy-related protein kinase theta                224   3e-66   
ref|XP_010919259.1|  PREDICTED: shaggy-related protein kinase eps...    223   8e-66   Elaeis guineensis
ref|XP_004510856.1|  PREDICTED: shaggy-related protein kinase the...    221   5e-65   Cicer arietinum [garbanzo]
ref|XP_008385705.1|  PREDICTED: shaggy-related protein kinase the...    219   2e-64   Malus domestica [apple tree]
ref|XP_010523040.1|  PREDICTED: shaggy-related protein kinase theta     219   3e-64   Tarenaya hassleriana [spider flower]
gb|ACU17807.1|  unknown                                                 208   1e-63   Glycine max [soybeans]
ref|XP_008799541.1|  PREDICTED: shaggy-related protein kinase alp...    217   1e-63   Phoenix dactylifera
ref|XP_008799540.1|  PREDICTED: shaggy-related protein kinase alp...    217   1e-63   
ref|XP_010940878.1|  PREDICTED: shaggy-related protein kinase eps...    217   1e-63   Elaeis guineensis
ref|XP_006375322.1|  shaggy-related protein kinase theta                213   2e-62   Populus trichocarpa [western balsam poplar]
ref|XP_002465046.1|  hypothetical protein SORBIDRAFT_01g031220          213   2e-62   Sorghum bicolor [broomcorn]
ref|XP_008803034.1|  PREDICTED: shaggy-related protein kinase eps...    213   4e-62   Phoenix dactylifera
ref|XP_006396267.1|  hypothetical protein EUTSA_v10028631mg             213   6e-62   Eutrema salsugineum [saltwater cress]
ref|NP_001065093.1|  Os10g0521700                                       212   7e-62   
dbj|BAJ93751.1|  predicted protein                                      212   7e-62   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_011023408.1|  PREDICTED: shaggy-related protein kinase NtK...    212   8e-62   Populus euphratica
gb|EEC67328.1|  hypothetical protein OsI_34360                          213   2e-61   Oryza sativa Indica Group [Indian rice]
ref|NP_191981.1|  Shaggy-related protein kinase theta                   211   2e-61   Arabidopsis thaliana [mouse-ear cress]
gb|KJB22348.1|  hypothetical protein B456_004G042400                    210   4e-61   Gossypium raimondii
ref|XP_002872933.1|  hypothetical protein ARALYDRAFT_490498             209   1e-60   
ref|XP_010933863.1|  PREDICTED: shaggy-related protein kinase eps...    209   2e-60   Elaeis guineensis
ref|XP_006661970.1|  PREDICTED: shaggy-related protein kinase the...    208   3e-60   Oryza brachyantha
ref|XP_007051909.1|  Shaggy-like protein kinase 32 isoform 2            206   5e-60   
ref|XP_008660602.1|  PREDICTED: shaggy-related protein kinase alp...    207   5e-60   Zea mays [maize]
emb|CAA58595.1|  Petunia Shaggy kinase 6                                206   8e-60   Petunia x hybrida [garden petunia]
ref|XP_010053665.1|  PREDICTED: shaggy-related protein kinase eps...    206   1e-59   Eucalyptus grandis [rose gum]
ref|XP_010255499.1|  PREDICTED: shaggy-related protein kinase eps...    205   4e-59   
ref|XP_010419626.1|  PREDICTED: shaggy-related protein kinase the...    200   6e-59   Camelina sativa [gold-of-pleasure]
ref|XP_004983886.1|  PREDICTED: LOW QUALITY PROTEIN: shaggy-relat...    204   9e-59   
gb|ABR17117.1|  unknown                                                 202   2e-58   Picea sitchensis
ref|XP_003574217.1|  PREDICTED: shaggy-related protein kinase alp...    203   2e-58   Brachypodium distachyon [annual false brome]
ref|XP_009134534.1|  PREDICTED: shaggy-related protein kinase theta     202   4e-58   Brassica rapa
emb|CDX74346.1|  BnaA03g27010D                                          202   4e-58   
gb|ABK24428.1|  unknown                                                 202   4e-58   Picea sitchensis
ref|XP_008657609.1|  PREDICTED: shaggy-related protein kinase alp...    202   6e-58   
emb|CDY07202.1|  BnaCnng02170D                                          202   8e-58   
ref|XP_010427333.1|  PREDICTED: shaggy-related protein kinase the...    202   1e-57   Camelina sativa [gold-of-pleasure]
ref|XP_008344049.1|  PREDICTED: shaggy-related protein kinase eps...    199   4e-57   
ref|XP_006289072.1|  hypothetical protein CARUB_v10002475mg             200   4e-57   Capsella rubella
ref|XP_009111468.1|  PREDICTED: shaggy-related protein kinase theta     200   5e-57   Brassica rapa
ref|XP_009393923.1|  PREDICTED: shaggy-related protein kinase eps...    199   9e-57   
ref|XP_004306833.1|  PREDICTED: shaggy-related protein kinase the...    199   1e-56   Fragaria vesca subsp. vesca
ref|XP_009393922.1|  PREDICTED: shaggy-related protein kinase eps...    199   1e-56   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009400715.1|  PREDICTED: shaggy-related protein kinase eta...    198   2e-56   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002301334.1|  hypothetical protein POPTR_0002s15640g             197   2e-56   
emb|CDY51144.1|  BnaA09g51790D                                          198   2e-56   Brassica napus [oilseed rape]
sp|O04160.2|KSGT_BRANA  RecName: Full=Shaggy-related protein kina...    197   2e-56   Brassica napus [oilseed rape]
ref|XP_010456251.1|  PREDICTED: shaggy-related protein kinase theta     197   5e-56   Camelina sativa [gold-of-pleasure]
emb|CDX91895.1|  BnaC03g31970D                                          196   1e-55   
gb|KJB41234.1|  hypothetical protein B456_007G096100                    195   2e-55   Gossypium raimondii
gb|KFK30649.1|  hypothetical protein AALP_AA6G009500                    195   3e-55   Arabis alpina [alpine rockcress]
ref|XP_002991115.1|  hypothetical protein SELMODRAFT_451471             190   2e-53   Selaginella moellendorffii
ref|XP_009412822.1|  PREDICTED: shaggy-related protein kinase alp...    187   2e-52   Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB41237.1|  hypothetical protein B456_007G096100                    184   3e-51   Gossypium raimondii
ref|XP_002987888.1|  GSK3/shaggy-like protein kinase                    182   9e-51   Selaginella moellendorffii
ref|XP_006857847.2|  PREDICTED: shaggy-related protein kinase eps...    181   1e-50   
gb|KHG02100.1|  Shaggy-related protein kinase theta                     181   3e-50   Gossypium arboreum [tree cotton]
ref|XP_009412821.1|  PREDICTED: shaggy-related protein kinase alp...    181   7e-50   Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB24672.1|  hypothetical protein B456_004G156700                    179   7e-50   Gossypium raimondii
gb|KJB24673.1|  hypothetical protein B456_004G156700                    179   8e-50   Gossypium raimondii
gb|KHG02099.1|  Shaggy-related protein kinase theta                     180   9e-50   Gossypium arboreum [tree cotton]
ref|XP_001762052.1|  predicted protein                                  179   1e-49   
gb|AAQ23109.1|  shaggy-related protein kinase 4                         179   2e-49   Physcomitrella patens
gb|KJB24671.1|  hypothetical protein B456_004G156700                    179   2e-49   Gossypium raimondii
ref|XP_001765207.1|  predicted protein                                  177   4e-49   
gb|KJB41235.1|  hypothetical protein B456_007G096100                    177   7e-49   Gossypium raimondii
emb|CDY19757.1|  BnaA09g04100D                                          176   1e-48   Brassica napus [oilseed rape]
emb|CDX87033.1|  BnaC09g03480D                                          176   1e-48   
ref|XP_001781582.1|  predicted protein                                  175   3e-48   
gb|AAQ23108.1|  shaggy-related protein kinase 3                         175   3e-48   Physcomitrella patens
gb|AAQ23107.1|  shaggy-related protein kinase 2                         175   4e-48   Physcomitrella patens
ref|XP_001763265.1|  predicted protein                                  175   4e-48   
gb|KJB22347.1|  hypothetical protein B456_004G042400                    175   4e-48   Gossypium raimondii
ref|XP_011079505.1|  PREDICTED: shaggy-related protein kinase alp...    174   6e-48   Sesamum indicum [beniseed]
gb|KJB45482.1|  hypothetical protein B456_007G308500                    170   8e-48   Gossypium raimondii
gb|ABR68632.1|  RIM11-like protein                                      174   9e-48   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009111716.1|  PREDICTED: shaggy-related protein kinase alp...    173   1e-47   Brassica rapa
ref|XP_001763270.1|  predicted protein                                  174   1e-47   
ref|XP_001781586.1|  predicted protein                                  173   2e-47   
gb|ACU14009.1|  unknown                                                 165   4e-47   Glycine max [soybeans]
gb|AAQ23111.1|  shaggy-related protein kinase 1                         172   4e-47   Physcomitrella patens
gb|KJB45480.1|  hypothetical protein B456_007G308500                    170   5e-47   Gossypium raimondii
gb|AEQ94156.1|  shaggy-related protein kinase                           166   5e-47   Elaeis guineensis
gb|AEQ94143.1|  putative Glycogen synthase kinase 3                     167   5e-47   Elaeis guineensis
ref|XP_010455024.1|  PREDICTED: shaggy-related protein kinase alp...    171   1e-46   Camelina sativa [gold-of-pleasure]
ref|XP_012088843.1|  PREDICTED: shaggy-related protein kinase alpha     171   1e-46   Jatropha curcas
gb|EPS63877.1|  hypothetical protein M569_10905                         171   1e-46   Genlisea aurea
ref|XP_006289925.1|  hypothetical protein CARUB_v10003541mg             170   2e-46   Capsella rubella
gb|KJB45479.1|  hypothetical protein B456_007G308500                    170   2e-46   Gossypium raimondii
gb|ACJ83284.1|  unknown                                                 163   2e-46   Medicago truncatula
ref|XP_007031229.1|  Shaggy-related kinase 11, 11 isoform 1             170   2e-46   
ref|XP_006394905.1|  hypothetical protein EUTSA_v10004319mg             170   3e-46   Eutrema salsugineum [saltwater cress]
gb|EPS68300.1|  hypothetical protein M569_06467                         170   3e-46   Genlisea aurea
ref|NP_568486.1|  Shaggy-related protein kinase alpha                   169   3e-46   Arabidopsis thaliana [mouse-ear cress]
emb|CAA04265.1|  shaggy-like kinase alpha                               169   3e-46   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010674528.1|  PREDICTED: shaggy-related protein kinase alpha     169   3e-46   Beta vulgaris subsp. vulgaris [field beet]
emb|CAA53181.1|  shaggy related kinase                                  169   3e-46   Arabidopsis thaliana [mouse-ear cress]
gb|KCW78018.1|  hypothetical protein EUGRSUZ_D02249                     169   4e-46   Eucalyptus grandis [rose gum]
gb|KCW84977.1|  hypothetical protein EUGRSUZ_B01797                     166   4e-46   Eucalyptus grandis [rose gum]
ref|XP_010546768.1|  PREDICTED: shaggy-related protein kinase alpha     169   4e-46   Tarenaya hassleriana [spider flower]
ref|XP_010493927.1|  PREDICTED: shaggy-related protein kinase alp...    169   4e-46   Camelina sativa [gold-of-pleasure]
ref|XP_006382290.1|  hypothetical protein POPTR_0005s00710g             169   4e-46   Populus trichocarpa [western balsam poplar]
emb|CDX80585.1|  BnaC07g28590D                                          169   4e-46   
ref|XP_010421531.1|  PREDICTED: shaggy-related protein kinase alp...    169   5e-46   Camelina sativa [gold-of-pleasure]
ref|XP_010524830.1|  PREDICTED: shaggy-related protein kinase alp...    169   5e-46   Tarenaya hassleriana [spider flower]
ref|XP_007031504.1|  Shaggy-like kinase 13 isoform 1                    169   6e-46   
ref|XP_002512564.1|  Glycogen synthase kinase-3 beta, putative          168   6e-46   
gb|KDO86865.1|  hypothetical protein CISIN_1g015632mg                   166   6e-46   Citrus sinensis [apfelsine]
ref|XP_007031506.1|  Shaggy-like kinase 13 isoform 3                    169   6e-46   
gb|EYU46859.1|  hypothetical protein MIMGU_mgv1a007395mg                169   6e-46   Erythranthe guttata [common monkey flower]
ref|XP_002874323.1|  hypothetical protein ARALYDRAFT_489503             168   9e-46   
gb|EPS73818.1|  hypothetical protein M569_00937                         168   9e-46   Genlisea aurea
ref|XP_008803035.1|  PREDICTED: shaggy-related protein kinase eps...    169   9e-46   Phoenix dactylifera
ref|XP_004495628.1|  PREDICTED: glycogen synthase kinase-3 homolo...    168   9e-46   
ref|NP_001242406.1|  uncharacterized protein LOC100788612               168   1e-45   
ref|XP_011039006.1|  PREDICTED: shaggy-related protein kinase alpha     168   1e-45   Populus euphratica
ref|XP_006576226.1|  PREDICTED: uncharacterized protein LOC100788...    168   1e-45   
gb|KDO45354.1|  hypothetical protein CISIN_1g015298mg                   167   1e-45   Citrus sinensis [apfelsine]
ref|XP_003554602.1|  PREDICTED: shaggy-related protein kinase alp...    168   1e-45   Glycine max [soybeans]
gb|KHG02936.1|  Shaggy-related protein kinase alpha                     168   1e-45   Gossypium arboreum [tree cotton]
gb|ABK93098.1|  unknown                                                 168   1e-45   Populus trichocarpa [western balsam poplar]
gb|KDO45355.1|  hypothetical protein CISIN_1g015298mg                   167   1e-45   Citrus sinensis [apfelsine]
ref|XP_002319468.1|  Glycogen synthase kinase-3 MsK-1 family protein    168   1e-45   Populus trichocarpa [western balsam poplar]
ref|XP_004495625.1|  PREDICTED: glycogen synthase kinase-3 homolo...    168   2e-45   
ref|XP_010660897.1|  PREDICTED: shaggy-related protein kinase eps...    167   2e-45   
gb|EMT29598.1|  Shaggy-related protein kinase theta                     169   2e-45   
ref|XP_011092192.1|  PREDICTED: shaggy-related protein kinase alpha     167   2e-45   Sesamum indicum [beniseed]
ref|XP_002280673.1|  PREDICTED: shaggy-related protein kinase alpha     167   2e-45   Vitis vinifera
ref|XP_010660896.1|  PREDICTED: shaggy-related protein kinase eps...    167   2e-45   Vitis vinifera
ref|XP_006444574.1|  hypothetical protein CICLE_v10020852mg             166   2e-45   
gb|KDO86864.1|  hypothetical protein CISIN_1g015632mg                   166   2e-45   Citrus sinensis [apfelsine]
ref|XP_002515218.1|  Glycogen synthase kinase-3 beta, putative          167   2e-45   Ricinus communis
gb|ERN02393.1|  hypothetical protein AMTR_s00096p00102520               166   2e-45   Amborella trichopoda
gb|KDO66112.1|  hypothetical protein CISIN_1g0141741mg                  163   3e-45   Citrus sinensis [apfelsine]
ref|XP_006841582.1|  PREDICTED: glycogen synthase kinase-3 homolo...    167   3e-45   Amborella trichopoda
gb|KDO66115.1|  hypothetical protein CISIN_1g0141741mg                  163   3e-45   Citrus sinensis [apfelsine]
gb|KDO45353.1|  hypothetical protein CISIN_1g015298mg                   167   3e-45   Citrus sinensis [apfelsine]
ref|XP_007205270.1|  hypothetical protein PRUPE_ppa006473mg             167   3e-45   Prunus persica
ref|XP_006480288.1|  PREDICTED: shaggy-related protein kinase alp...    167   4e-45   Citrus sinensis [apfelsine]
ref|XP_010042192.1|  PREDICTED: shaggy-related protein kinase alpha     167   4e-45   Eucalyptus grandis [rose gum]
gb|ABY60447.1|  serine/threonine protein kinase                         167   4e-45   Adonis aestivalis var. palaestina
ref|XP_009151155.1|  PREDICTED: shaggy-related protein kinase alpha     166   4e-45   Brassica rapa
ref|XP_010091400.1|  Glycogen synthase kinase-3-MsK-3-like protein      167   5e-45   Morus notabilis
ref|XP_010910596.1|  PREDICTED: shaggy-related protein kinase alp...    166   5e-45   Elaeis guineensis
gb|KDO66111.1|  hypothetical protein CISIN_1g0141741mg                  161   5e-45   Citrus sinensis [apfelsine]
ref|XP_010921357.1|  PREDICTED: shaggy-related protein kinase alpha     166   5e-45   
ref|XP_011003165.1|  PREDICTED: shaggy-related protein kinase alp...    166   5e-45   Populus euphratica
ref|XP_011097427.1|  PREDICTED: shaggy-related protein kinase eps...    166   6e-45   Sesamum indicum [beniseed]
ref|XP_011622016.1|  PREDICTED: shaggy-related protein kinase eps...    166   6e-45   Amborella trichopoda
ref|XP_008781189.1|  PREDICTED: shaggy-related protein kinase alp...    166   6e-45   Phoenix dactylifera
ref|XP_009775930.1|  PREDICTED: shaggy-related protein kinase NtK...    166   6e-45   Nicotiana sylvestris
ref|XP_010276519.1|  PREDICTED: shaggy-related protein kinase alpha     166   6e-45   Nelumbo nucifera [Indian lotus]
ref|XP_010270906.1|  PREDICTED: shaggy-related protein kinase alp...    166   6e-45   Nelumbo nucifera [Indian lotus]
gb|KHN16033.1|  Glycogen synthase kinase-3 like MsK-1                   166   6e-45   Glycine soja [wild soybean]
ref|XP_009629200.1|  PREDICTED: shaggy-related protein kinase NtK...    166   6e-45   Nicotiana tomentosiformis
ref|XP_004230343.1|  PREDICTED: shaggy-related protein kinase NtK-1     166   6e-45   Solanum lycopersicum
ref|XP_010251221.1|  PREDICTED: shaggy-related protein kinase eps...    165   7e-45   Nelumbo nucifera [Indian lotus]
ref|XP_007145031.1|  hypothetical protein PHAVU_007G204000g             166   7e-45   Phaseolus vulgaris [French bean]
ref|XP_006588432.1|  PREDICTED: glycogen synthase kinase-3 isofor...    166   7e-45   Glycine max [soybeans]
gb|AFH00876.1|  glycogen synthase kinase-3                              166   7e-45   Glycine soja [wild soybean]
ref|XP_006444573.1|  hypothetical protein CICLE_v10020852mg             166   7e-45   
ref|XP_006428242.1|  hypothetical protein CICLE_v10013624mg             167   7e-45   
ref|NP_001274855.1|  Shaggy-like protein kinase NtK-1                   166   7e-45   Solanum tuberosum [potatoes]
gb|ACQ91102.1|  glycogen synthase kinase                                166   7e-45   Glycine max [soybeans]
emb|CAA58594.1|  Petunia Shaggy kinase 4                                166   7e-45   Petunia x hybrida [garden petunia]
ref|XP_008793304.1|  PREDICTED: shaggy-related protein kinase alp...    166   7e-45   
ref|XP_002279596.1|  PREDICTED: shaggy-related protein kinase alp...    166   8e-45   Vitis vinifera
ref|XP_008246288.1|  PREDICTED: shaggy-related protein kinase alpha     166   8e-45   Prunus mume [ume]
ref|XP_011023844.1|  PREDICTED: shaggy-related protein kinase alpha     166   8e-45   Populus euphratica
ref|XP_011040636.1|  PREDICTED: shaggy-related protein kinase alp...    166   8e-45   Populus euphratica
ref|XP_010270905.1|  PREDICTED: shaggy-related protein kinase alp...    166   8e-45   Nelumbo nucifera [Indian lotus]
ref|XP_002302794.1|  Glycogen synthase kinase-3 MsK-3 family protein    166   9e-45   Populus trichocarpa [western balsam poplar]
ref|XP_010251218.1|  PREDICTED: shaggy-related protein kinase eps...    165   1e-44   Nelumbo nucifera [Indian lotus]
ref|XP_006446534.1|  hypothetical protein CICLE_v10015323mg             166   1e-44   Citrus clementina [clementine]
ref|XP_010097328.1|  Shaggy-related protein kinase alpha                167   1e-44   
ref|XP_007031230.1|  Shaggy-related kinase 11, 11 isoform 2             165   1e-44   
ref|XP_010251217.1|  PREDICTED: shaggy-related protein kinase eps...    165   1e-44   Nelumbo nucifera [Indian lotus]
gb|EYU38392.1|  hypothetical protein MIMGU_mgv1a007572mg                165   2e-44   Erythranthe guttata [common monkey flower]
ref|XP_004252662.1|  PREDICTED: shaggy-related protein kinase eps...    165   2e-44   Solanum lycopersicum
ref|XP_006364003.1|  PREDICTED: shaggy-related protein kinase eps...    165   2e-44   Solanum tuberosum [potatoes]
gb|EYU34726.1|  hypothetical protein MIMGU_mgv1a007335mg                165   2e-44   Erythranthe guttata [common monkey flower]
ref|XP_004252661.1|  PREDICTED: shaggy-related protein kinase eps...    165   2e-44   Solanum lycopersicum
ref|XP_008381452.1|  PREDICTED: glycogen synthase kinase-3 homolo...    165   2e-44   
emb|CDP15204.1|  unnamed protein product                                165   2e-44   Coffea canephora [robusta coffee]
ref|XP_008230580.1|  PREDICTED: shaggy-related protein kinase eps...    164   3e-44   Prunus mume [ume]
ref|XP_007215466.1|  hypothetical protein PRUPE_ppa006497mg             164   3e-44   
ref|XP_008795404.1|  PREDICTED: shaggy-related protein kinase the...    164   4e-44   
emb|CAN64359.1|  hypothetical protein VITISV_041427                     165   4e-44   Vitis vinifera
ref|XP_003555781.1|  PREDICTED: glycogen synthase kinase-3 homolo...    164   4e-44   Glycine max [soybeans]
emb|CDY27737.1|  BnaA05g31460D                                          166   5e-44   Brassica napus [oilseed rape]
ref|XP_009759533.1|  PREDICTED: shaggy-related protein kinase eps...    164   6e-44   Nicotiana sylvestris
ref|XP_002873682.1|  kinase family protein                              164   6e-44   
ref|XP_009598967.1|  PREDICTED: shaggy-related protein kinase eps...    164   6e-44   Nicotiana tomentosiformis
ref|XP_010070089.1|  PREDICTED: shaggy-related protein kinase alp...    164   6e-44   
ref|XP_006338576.1|  PREDICTED: shaggy-related protein kinase eps...    164   6e-44   Solanum tuberosum [potatoes]
ref|XP_006338577.1|  PREDICTED: shaggy-related protein kinase eps...    163   6e-44   Solanum tuberosum [potatoes]
ref|XP_009363099.1|  PREDICTED: glycogen synthase kinase-3 homolo...    163   7e-44   Pyrus x bretschneideri [bai li]
ref|XP_010070081.1|  PREDICTED: shaggy-related protein kinase alp...    164   7e-44   Eucalyptus grandis [rose gum]
ref|NP_196968.2|  Shaggy-related protein kinase 13                      163   8e-44   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010432712.1|  PREDICTED: shaggy-related protein kinase gam...    163   8e-44   Camelina sativa [gold-of-pleasure]
emb|CAB87631.1|  protein kinase MSK-3-like                              163   8e-44   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010486058.1|  PREDICTED: shaggy-related protein kinase gam...    163   8e-44   Camelina sativa [gold-of-pleasure]
ref|XP_010941497.1|  PREDICTED: shaggy-related protein kinase alpha     163   8e-44   
ref|XP_006408022.1|  hypothetical protein EUTSA_v10020835mg             163   9e-44   Eutrema salsugineum [saltwater cress]
ref|XP_008443540.1|  PREDICTED: shaggy-related protein kinase eps...    163   9e-44   Cucumis melo [Oriental melon]
ref|NP_001242661.1|  glycogen synthase kinase-3                         163   9e-44   
ref|XP_006408021.1|  hypothetical protein EUTSA_v10020835mg             163   9e-44   Eutrema salsugineum [saltwater cress]
ref|XP_004494455.1|  PREDICTED: glycogen synthase kinase-3 homolo...    162   9e-44   
gb|AAM62970.1|  shaggy related protein kinase ASK-GAMMA                 163   1e-43   Arabidopsis thaliana [mouse-ear cress]
emb|CDP02094.1|  unnamed protein product                                163   1e-43   Coffea canephora [robusta coffee]
ref|XP_009366055.1|  PREDICTED: shaggy-related protein kinase alp...    163   1e-43   Pyrus x bretschneideri [bai li]
emb|CDY05202.1|  BnaC05g46010D                                          163   1e-43   
ref|NP_001042602.1|  Os01g0252100                                       163   1e-43   
gb|ABR16348.1|  unknown                                                 163   1e-43   Picea sitchensis
gb|KJB24670.1|  hypothetical protein B456_004G156700                    163   1e-43   Gossypium raimondii
ref|NP_187235.1|  Shaggy-related protein kinase gamma                   163   1e-43   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009147201.1|  PREDICTED: shaggy-related protein kinase gamma     162   1e-43   Brassica rapa
ref|XP_003591238.1|  Glycogen synthase kinase                           162   1e-43   Medicago truncatula
ref|XP_009335521.1|  PREDICTED: shaggy-related protein kinase alpha     163   1e-43   Pyrus x bretschneideri [bai li]
ref|XP_008363964.1|  PREDICTED: shaggy-related protein kinase alpha     162   1e-43   
gb|KJB49765.1|  hypothetical protein B456_008G136600                    162   1e-43   Gossypium raimondii
gb|KHG00969.1|  Glycogen synthase kinase-3 MsK-3                        162   2e-43   
ref|XP_008812956.1|  PREDICTED: shaggy-related protein kinase alp...    162   2e-43   
emb|CDY49981.1|  BnaC03g34380D                                          162   2e-43   
ref|XP_004304635.1|  PREDICTED: shaggy-related protein kinase eps...    162   2e-43   
sp|P51137.1|MSK1_MEDSA  RecName: Full=Glycogen synthase kinase-3 ...    162   2e-43   
ref|XP_006470301.1|  PREDICTED: shaggy-related protein kinase eps...    163   2e-43   
ref|XP_007051226.1|  Shaggy-related kinase 11, 11 isoform 1             162   2e-43   
ref|XP_003518657.1|  PREDICTED: glycogen synthase kinase-3 homolo...    162   2e-43   
ref|XP_009134851.1|  PREDICTED: shaggy-related protein kinase gamma     162   2e-43   
ref|XP_006588497.1|  PREDICTED: uncharacterized protein LOC100817...    162   2e-43   
sp|P51139.2|MSK3_MEDSA  RecName: Full=Glycogen synthase kinase-3 ...    162   2e-43   
ref|XP_002882438.1|  hypothetical protein ARALYDRAFT_477878             162   2e-43   
sp|Q40518.1|MSK1_TOBAC  RecName: Full=Shaggy-related protein kina...    162   2e-43   
ref|XP_010464137.1|  PREDICTED: shaggy-related protein kinase gamma     162   2e-43   
emb|CAA48472.1|  protein kinase                                         162   2e-43   
ref|XP_010550142.1|  PREDICTED: shaggy-related protein kinase eps...    162   2e-43   
ref|XP_009383704.1|  PREDICTED: shaggy-related protein kinase alpha     162   2e-43   
ref|NP_001269276.1|  glycogen synthase kinase-3 homolog MsK-1-like      162   2e-43   
gb|ABB55385.1|  Ser/Thr protein kinase-like                             162   2e-43   
ref|XP_009334099.1|  PREDICTED: shaggy-related protein kinase eps...    162   2e-43   
ref|XP_010492276.1|  PREDICTED: shaggy-related protein kinase eps...    162   2e-43   
gb|EYU34725.1|  hypothetical protein MIMGU_mgv1a007335mg                162   2e-43   
ref|XP_006287860.1|  hypothetical protein CARUB_v10001087mg             162   2e-43   
ref|XP_010420109.1|  PREDICTED: shaggy-related protein kinase eps...    162   3e-43   
dbj|BAO02534.1|  predicted Shaggy-like kinase ortholog                  153   3e-43   
ref|XP_004135570.1|  PREDICTED: shaggy-related protein kinase alpha     162   3e-43   
ref|XP_008450520.1|  PREDICTED: shaggy-related protein kinase NtK-1     162   3e-43   
ref|XP_006399977.1|  hypothetical protein EUTSA_v10013689mg             162   3e-43   
ref|XP_010248490.1|  PREDICTED: shaggy-related protein kinase eps...    162   3e-43   
ref|XP_010523730.1|  PREDICTED: shaggy-related protein kinase bet...    162   3e-43   
gb|AES82237.2|  glycogen synthase kinase                                161   3e-43   
ref|XP_008357735.1|  PREDICTED: shaggy-related protein kinase eps...    161   3e-43   
ref|XP_010938176.1|  PREDICTED: shaggy-related protein kinase alp...    161   4e-43   
gb|ACJ85178.1|  unknown                                                 161   4e-43   
ref|XP_004141099.2|  PREDICTED: shaggy-related protein kinase eps...    161   4e-43   
ref|XP_004148581.1|  PREDICTED: glycogen synthase kinase-3 homolo...    161   4e-43   
ref|XP_004232308.1|  PREDICTED: shaggy-related protein kinase eps...    161   4e-43   
ref|XP_008778092.1|  PREDICTED: shaggy-related protein kinase alp...    161   4e-43   
ref|XP_009757512.1|  PREDICTED: shaggy-related protein kinase NtK-1     161   4e-43   
ref|XP_010453592.1|  PREDICTED: shaggy-related protein kinase eps...    161   5e-43   
ref|XP_009617298.1|  PREDICTED: shaggy-related protein kinase NtK-1     161   6e-43   
gb|KHN00229.1|  Glycogen synthase kinase-3 like MsK-3                   163   6e-43   
ref|XP_006299606.1|  hypothetical protein CARUB_v10015785mg             161   6e-43   
ref|XP_003626019.1|  Protein kinase, putative                           161   7e-43   
ref|XP_010038314.1|  PREDICTED: shaggy-related protein kinase alp...    160   7e-43   
gb|AFK38277.1|  unknown                                                 160   7e-43   
ref|XP_006643997.1|  PREDICTED: shaggy-related protein kinase alp...    160   9e-43   
ref|XP_010108792.1|  Shaggy-related protein kinase epsilon              167   9e-43   
ref|XP_003626020.1|  Protein kinase, putative                           161   1e-42   
emb|CDX78587.1|  BnaA03g04990D                                          160   1e-42   
ref|XP_009131419.1|  PREDICTED: shaggy-related protein kinase eps...    160   1e-42   
emb|CDX70574.1|  BnaC03g06580D                                          160   1e-42   
ref|XP_003566380.1|  PREDICTED: shaggy-related protein kinase alpha     160   1e-42   
ref|XP_008343189.1|  PREDICTED: glycogen synthase kinase-3 homolo...    159   1e-42   
emb|CDM82575.1|  unnamed protein product                                160   1e-42   
dbj|BAF36565.1|  Shaggy-like kinase                                     160   1e-42   
ref|XP_011466950.1|  PREDICTED: glycogen synthase kinase-3 homolo...    160   1e-42   
ref|XP_008388444.1|  PREDICTED: shaggy-related protein kinase alpha     160   1e-42   
ref|XP_012082965.1|  PREDICTED: shaggy-related protein kinase alp...    160   2e-42   
gb|ABG74911.1|  AtSK12-like protein                                     160   2e-42   
ref|XP_009382471.1|  PREDICTED: shaggy-related protein kinase alp...    160   2e-42   
ref|XP_011087526.1|  PREDICTED: shaggy-related protein kinase NtK...    159   2e-42   
dbj|BAJ34573.1|  unnamed protein product                                159   2e-42   
ref|XP_006650852.1|  PREDICTED: shaggy-related protein kinase alp...    159   3e-42   
ref|XP_009382470.1|  PREDICTED: shaggy-related protein kinase alp...    159   3e-42   
ref|XP_009403747.1|  PREDICTED: shaggy-related protein kinase alp...    159   3e-42   
ref|XP_008353866.1|  PREDICTED: glycogen synthase kinase-3 homolo...    159   3e-42   
gb|EMT32435.1|  Glycogen synthase kinase-3-MsK-3-like protein           159   3e-42   
ref|XP_004495878.1|  PREDICTED: glycogen synthase kinase-3 homolo...    159   3e-42   
emb|CBI39647.3|  unnamed protein product                                158   3e-42   
gb|KHG20282.1|  Shaggy-related protein kinase theta                     159   4e-42   
ref|XP_007140965.1|  hypothetical protein PHAVU_008G156000g             159   4e-42   
ref|XP_008227813.1|  PREDICTED: glycogen synthase kinase-3 homolo...    159   4e-42   
ref|XP_009386339.1|  PREDICTED: shaggy-related protein kinase alp...    159   4e-42   
dbj|BAD95892.1|  Ser/Thr protein kinase                                 158   6e-42   
gb|AAB61055.1|  Similar to shaggy related protein kinase. Belongs...    159   7e-42   
ref|XP_010679446.1|  PREDICTED: shaggy-related protein kinase NtK-1     158   8e-42   
ref|XP_007221484.1|  hypothetical protein PRUPE_ppa006462mg             157   1e-41   
sp|P51138.1|MSK2_MEDSA  RecName: Full=Glycogen synthase kinase-3 ...    157   1e-41   
ref|XP_009384996.1|  PREDICTED: shaggy-related protein kinase alp...    157   1e-41   
ref|XP_002526438.1|  conserved hypothetical protein                     150   1e-41   
ref|XP_009384446.1|  PREDICTED: shaggy-related protein kinase alp...    157   2e-41   
ref|XP_011087528.1|  PREDICTED: shaggy-related protein kinase alp...    156   2e-41   
emb|CBI37005.3|  unnamed protein product                                156   2e-41   
tpg|DAA53953.1|  TPA: putative glycogen synthase kinase family pr...    154   2e-41   
gb|ABR17316.1|  unknown                                                 157   3e-41   
gb|AES61591.2|  glycogen synthase kinase                                156   3e-41   
ref|XP_003591340.1|  Glycogen synthase kinase-3-like protein            156   3e-41   
gb|EMS49677.1|  Glycogen synthase kinase-3-like protein MsK-3           157   3e-41   
gb|AFN42826.1|  GSK3-like protein                                       155   5e-41   
tpg|DAA53950.1|  TPA: putative glycogen synthase kinase family pr...    155   7e-41   
gb|AFW79696.1|  putative glycogen synthase kinase family protein        155   8e-41   
ref|NP_001148880.1|  glycogen synthase kinase-3 MsK-3                   155   8e-41   
ref|XP_011628612.1|  PREDICTED: shaggy-related protein kinase kappa     155   9e-41   
gb|AEN14336.1|  hypothetical protein rf1-C1-g7                          155   9e-41   
ref|XP_002455378.1|  hypothetical protein SORBIDRAFT_03g009580          155   9e-41   
tpg|DAA53951.1|  TPA: putative glycogen synthase kinase family pr...    154   1e-40   
ref|NP_001150105.1|  LOC100283734                                       154   1e-40   
ref|XP_006654010.1|  PREDICTED: shaggy-related protein kinase alp...    154   2e-40   
gb|AAT85177.1|  putative glycogen synthase kinase                       153   2e-40   
gb|ERN20048.1|  hypothetical protein AMTR_s00071p00186380               155   2e-40   
ref|XP_004960405.1|  PREDICTED: shaggy-related protein kinase alp...    154   2e-40   
tpg|DAA53952.1|  TPA: putative glycogen synthase kinase family pr...    155   2e-40   
gb|ABK24513.1|  unknown                                                 154   2e-40   
ref|XP_008672929.1|  PREDICTED: LOC100283734 isoform X1                 155   2e-40   
gb|EAY96448.1|  hypothetical protein OsI_18343                          154   3e-40   
ref|XP_004967857.1|  PREDICTED: shaggy-related protein kinase alp...    154   3e-40   
ref|XP_003569078.1|  PREDICTED: shaggy-related protein kinase alp...    153   4e-40   
emb|CDX78658.1|  BnaA03g05700D                                          155   5e-40   
ref|NP_001054564.1|  Os05g0134000                                       153   5e-40   
gb|AAY98510.1|  glycogen synthase kinase                                153   6e-40   
gb|AFW57486.1|  putative glycogen synthase kinase family protein        151   6e-40   
dbj|BAJ99594.1|  predicted protein                                      153   7e-40   
ref|XP_010255500.1|  PREDICTED: shaggy-related protein kinase the...    152   8e-40   
gb|ABG29426.1|  GSK-like kinase 1                                       152   1e-39   
emb|CDP17018.1|  unnamed protein product                                152   1e-39   
gb|EMT09676.1|  Shaggy-related protein kinase alpha                     152   1e-39   
ref|XP_002440537.1|  hypothetical protein SORBIDRAFT_09g002710          152   1e-39   
gb|ABC94949.1|  GSK-like kinase                                         152   2e-39   
gb|ABK24355.1|  unknown                                                 151   2e-39   
ref|XP_010245513.1|  PREDICTED: shaggy-related protein kinase kap...    152   2e-39   
ref|NP_001288361.1|  uncharacterized protein LOC103641344               152   2e-39   
ref|XP_008662920.1|  PREDICTED: shaggy-related protein kinase alp...    152   2e-39   
ref|XP_010245511.1|  PREDICTED: shaggy-related protein kinase kap...    152   2e-39   
gb|ABG29424.1|  GSK-like kinase 1D                                      151   2e-39   
gb|EMS62368.1|  Shaggy-related protein kinase alpha                     152   2e-39   
emb|CDO97626.1|  unnamed protein product                                147   2e-39   
ref|XP_010493929.1|  PREDICTED: shaggy-related protein kinase alp...    150   2e-39   
ref|XP_010251219.1|  PREDICTED: shaggy-related protein kinase eps...    150   3e-39   
gb|ACJ85155.1|  unknown                                                 144   4e-39   
gb|KHN00323.1|  Glycogen synthase kinase-3 like MsK-2                   150   5e-39   
ref|XP_006382289.1|  hypothetical protein POPTR_0005s00710g             150   5e-39   
ref|XP_009401663.1|  PREDICTED: shaggy-related protein kinase gamma     150   5e-39   
emb|CBI22011.3|  unnamed protein product                                149   6e-39   
gb|ACJ85100.1|  unknown                                                 146   6e-39   
gb|KGN65982.1|  hypothetical protein Csa_1G560660                       150   6e-39   
gb|KFK35315.1|  hypothetical protein AALP_AA5G268300                    150   7e-39   
ref|XP_008366455.1|  PREDICTED: shaggy-related protein kinase kap...    146   7e-39   
gb|KHN26183.1|  Glycogen synthase kinase-3 like MsK-1                   149   7e-39   
ref|XP_010657061.1|  PREDICTED: shaggy-related protein kinase eta...    150   8e-39   
gb|KDO86866.1|  hypothetical protein CISIN_1g015632mg                   149   9e-39   
ref|XP_010671741.1|  PREDICTED: shaggy-related protein kinase the...    149   1e-38   
ref|XP_009131508.1|  PREDICTED: shaggy-related protein kinase eps...    147   1e-38   
ref|XP_006588498.1|  PREDICTED: uncharacterized protein LOC100817...    149   1e-38   
gb|ADE76936.1|  unknown                                                 149   1e-38   
ref|NP_974471.1|  shaggy-related protein kinase beta                    150   1e-38   
ref|XP_006389512.1|  hypothetical protein POPTR_0022s00480g             144   1e-38   
gb|KDO39707.1|  hypothetical protein CISIN_1g014595mg                   147   1e-38   
dbj|BAO02536.1|  predicted Shaggy-like kinase ortholog                  141   2e-38   
gb|ABC94947.1|  GSK-like kinase                                         149   2e-38   
gb|ABG29422.1|  GSK-like kinase 1A                                      149   2e-38   
gb|EPS67477.1|  shaggy kinase 7                                         149   2e-38   
ref|XP_006402514.1|  hypothetical protein EUTSA_v10005969mg             149   2e-38   
ref|XP_010245514.1|  PREDICTED: shaggy-related protein kinase kap...    148   2e-38   
gb|KHN33940.1|  Shaggy-related protein kinase zeta                      149   3e-38   
ref|XP_003527338.1|  PREDICTED: shaggy-related protein kinase zet...    149   3e-38   
ref|XP_009400716.1|  PREDICTED: shaggy-related protein kinase alp...    149   3e-38   
ref|XP_010652295.1|  PREDICTED: shaggy-related protein kinase alp...    148   3e-38   
ref|XP_010510261.1|  PREDICTED: shaggy-related protein kinase zeta      148   4e-38   
ref|XP_010414192.1|  PREDICTED: shaggy-related protein kinase zet...    148   4e-38   
gb|KJB16216.1|  hypothetical protein B456_002G218100                    146   4e-38   
gb|KDO39709.1|  hypothetical protein CISIN_1g014595mg                   148   4e-38   
ref|XP_007041206.1|  Shaggy-like protein kinase 41 isoform 3            146   4e-38   
ref|XP_010469777.1|  PREDICTED: shaggy-related protein kinase zet...    148   4e-38   
gb|ABG29423.1|  GSK-like kinase 1B                                      148   4e-38   
ref|XP_011047893.1|  PREDICTED: shaggy-related protein kinase kappa     144   4e-38   
gb|KCW84976.1|  hypothetical protein EUGRSUZ_B01797                     147   4e-38   
gb|KDO39706.1|  hypothetical protein CISIN_1g014595mg                   147   5e-38   
ref|XP_010424046.1|  PREDICTED: shaggy-related protein kinase the...    142   5e-38   
ref|XP_003591341.1|  Glycogen synthase kinase-3-like protein            147   6e-38   
ref|NP_001242506.1|  uncharacterized protein LOC100817819               147   6e-38   
ref|XP_006431595.1|  hypothetical protein CICLE_v10001277mg             148   6e-38   
ref|XP_006294432.1|  hypothetical protein CARUB_v10023447mg             147   7e-38   
gb|KFK31745.1|  hypothetical protein AALP_AA6G153600                    147   8e-38   
ref|XP_010910153.1|  PREDICTED: shaggy-related protein kinase kap...    147   9e-38   
gb|AFK46922.1|  unknown                                                 146   1e-37   
gb|KJB16218.1|  hypothetical protein B456_002G218100                    146   1e-37   
ref|XP_006307671.1|  hypothetical protein CARUB_v10009298mg             147   1e-37   
ref|XP_004300628.1|  PREDICTED: shaggy-related protein kinase kappa     147   1e-37   
ref|XP_007148030.1|  hypothetical protein PHAVU_006G1745000g            142   1e-37   
gb|ACJ84778.1|  unknown                                                 139   1e-37   
gb|KJB16217.1|  hypothetical protein B456_002G218100                    146   1e-37   
ref|XP_003540001.1|  PREDICTED: shaggy-related protein kinase zet...    147   2e-37   
emb|CDY65303.1|  BnaCnng46510D                                          147   2e-37   
ref|NP_001241073.1|  uncharacterized protein LOC100799387               146   2e-37   
ref|XP_012066688.1|  PREDICTED: shaggy-related protein kinase kappa     146   2e-37   
gb|KHN34245.1|  Shaggy-related protein kinase zeta                      147   2e-37   
gb|KEH23337.1|  shaggy-like kinase                                      145   3e-37   
ref|XP_007041204.1|  Shaggy-like protein kinase 41 isoform 1            146   3e-37   
ref|XP_010096433.1|  Shaggy-related protein kinase kappa                146   3e-37   
emb|CDY52332.1|  BnaA09g38810D                                          146   3e-37   
gb|EYU35065.1|  hypothetical protein MIMGU_mgv1a0059282mg               139   3e-37   
emb|CAA64408.1|  shaggy-like kinase dzeta                               145   3e-37   
ref|NP_180655.1|  Shaggy-related protein kinase zeta                    145   3e-37   
ref|XP_007222549.1|  hypothetical protein PRUPE_ppa006218mg             146   3e-37   
gb|ACJ84750.1|  unknown                                                 145   3e-37   
gb|AAM65084.1|  putative shaggy-like protein kinase dzeta               145   3e-37   
gb|KJB16220.1|  hypothetical protein B456_002G218100                    145   3e-37   
ref|XP_004485912.1|  PREDICTED: shaggy-related protein kinase eta...    145   3e-37   
ref|XP_010682019.1|  PREDICTED: shaggy-related protein kinase kap...    145   3e-37   
gb|AFK40474.1|  unknown                                                 145   3e-37   
gb|KJB16215.1|  hypothetical protein B456_002G218100                    145   3e-37   
ref|XP_008802921.1|  PREDICTED: shaggy-related protein kinase kap...    145   3e-37   
gb|ABC94948.1|  GSK-like kinase                                         145   4e-37   
ref|XP_007136978.1|  hypothetical protein PHAVU_009G089900g             145   4e-37   
ref|XP_003522493.1|  PREDICTED: shaggy-related protein kinase eta...    145   4e-37   
dbj|BAJ89558.1|  predicted protein                                      145   4e-37   
ref|XP_001784146.1|  predicted protein                                  145   4e-37   
ref|XP_008802919.1|  PREDICTED: shaggy-related protein kinase kap...    145   4e-37   
ref|XP_003526266.1|  PREDICTED: shaggy-related protein kinase eta...    144   4e-37   
gb|KDO63405.1|  hypothetical protein CISIN_1g014750mg                   144   5e-37   
gb|AAM77397.1|  GSK-like kinase                                         144   5e-37   
gb|KJB47882.1|  hypothetical protein B456_008G045800                    144   5e-37   
gb|KDO63403.1|  hypothetical protein CISIN_1g014750mg                   144   6e-37   
ref|XP_009355333.1|  PREDICTED: shaggy-related protein kinase kappa     145   6e-37   
ref|XP_007132829.1|  hypothetical protein PHAVU_011G128000g             145   6e-37   
ref|XP_002881146.1|  hypothetical protein ARALYDRAFT_902112             144   7e-37   
gb|AGV54503.1|  shaggy-related protein kinase eta-like protein          144   7e-37   
ref|XP_004147888.1|  PREDICTED: shaggy-related protein kinase kappa     145   8e-37   
gb|KFK42959.1|  hypothetical protein AALP_AA1G061200                    144   8e-37   
gb|EMS50777.1|  Glycogen synthase kinase-3-like protein MsK-3           144   8e-37   



>emb|CDP08875.1| unnamed protein product [Coffea canephora]
Length=469

 Score =   276 bits (705),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 139/195 (71%), Positives = 164/195 (84%), Gaps = 3/195 (2%)
 Frame = +1

Query  145  MNVMRRLKSVASGRSSVSDPQGGDSSIKRVKVAQDFDQRIAGKPESEEICTTAPMHEAAS  324
            MNVMRRLKS+ASGRSSVSDP  GDS IKRVK+ Q+ D R+  + ES E CTTA     AS
Sbjct  1    MNVMRRLKSIASGRSSVSDP-SGDSGIKRVKIEQEADWRVGLESESVEKCTTASEQNMAS  59

Query  325  TSQEDASGIS-LVARSEKSGYEELPKEMHEMKIKDDKSD-NQNNLKDMEPVVITGNGTET  498
            TS E A+  S +VAR  KSGY+ELP+EMH+MKI+DDKSD +++ +KD+EP +++GNGTET
Sbjct  60   TSAEPAASTSKVVARPVKSGYDELPREMHDMKIRDDKSDTHEDTMKDLEPAIVSGNGTET  119

Query  499  GQIIVTTVGGRNGEQKQVLSYMAERVVGTGSFGVVFQAKCLESGEAVAIKKVLXDRRYXN  678
            GQIIVTT GGRNGE+KQ LSYMAERVVGTGSFGVVFQAKCLE+G +VAIKKVL DRRY N
Sbjct  120  GQIIVTTAGGRNGEEKQTLSYMAERVVGTGSFGVVFQAKCLETGHSVAIKKVLQDRRYKN  179

Query  679  RELQIMRMLEHPNVV  723
            RELQIMR+L++PNVV
Sbjct  180  RELQIMRLLDNPNVV  194



>ref|XP_006339456.1| PREDICTED: shaggy-related protein kinase theta-like [Solanum 
tuberosum]
Length=475

 Score =   275 bits (702),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 143/201 (71%), Positives = 164/201 (82%), Gaps = 9/201 (4%)
 Frame = +1

Query  145  MNVMRRLKSVASGRSSVSDPQGGDSSIKRVKVAQDFDQRIAGKPESEEICTTA--PMHEA  318
            MNVMRRLKS+ASGRSSVSDP GGDSSIKRVKV ++ DQR+ G+ + EE CTT   P  + 
Sbjct  1    MNVMRRLKSIASGRSSVSDP-GGDSSIKRVKVEKEVDQRVVGETQMEERCTTTTVPKEDM  59

Query  319  ASTSQEDA--SGISLVARSEKSGYEELPKEMHEMKIKDDKSDN----QNNLKDMEPVVIT  480
            ASTS+E    S  ++  R E S  +ELPKEMHEMKIKD+K+D     ++NLKDMEP V++
Sbjct  60   ASTSKETTARSTSAMDTRPENSELDELPKEMHEMKIKDEKADKADSLEDNLKDMEPAVVS  119

Query  481  GNGTETGQIIVTTVGGRNGEQKQVLSYMAERVVGTGSFGVVFQAKCLESGEAVAIKKVLX  660
            GNGTETGQIIVTTV GRNG +KQ LSYMAERVVGTGSFGVVFQAKCLE+GE+VAIKKVL 
Sbjct  120  GNGTETGQIIVTTVSGRNGLEKQTLSYMAERVVGTGSFGVVFQAKCLETGESVAIKKVLQ  179

Query  661  DRRYXNRELQIMRMLEHPNVV  723
            DRRY NRELQIMR L+HPNVV
Sbjct  180  DRRYKNRELQIMRTLDHPNVV  200



>ref|XP_004229833.1| PREDICTED: shaggy-related protein kinase epsilon [Solanum lycopersicum]
Length=475

 Score =   274 bits (701),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 143/201 (71%), Positives = 163/201 (81%), Gaps = 9/201 (4%)
 Frame = +1

Query  145  MNVMRRLKSVASGRSSVSDPQGGDSSIKRVKVAQDFDQRIAGKPESEEICTTA--PMHEA  318
            MNVMRRLKS+ASGRSSVSDP GGDSSIKRVKV ++ DQR+ G+ + EE CTT   P  + 
Sbjct  1    MNVMRRLKSIASGRSSVSDP-GGDSSIKRVKVEKEVDQRVVGETQMEEGCTTTTVPKEDM  59

Query  319  ASTSQEDASGIS--LVARSEKSGYEELPKEMHEMKIKDDKSDN----QNNLKDMEPVVIT  480
            ASTS E  +G +  +  R E S  +ELPKEMHEMKIKD+K D      +NLKDMEP V++
Sbjct  60   ASTSMETTAGSTSTMDIRLENSELDELPKEMHEMKIKDEKDDKADSLDDNLKDMEPAVVS  119

Query  481  GNGTETGQIIVTTVGGRNGEQKQVLSYMAERVVGTGSFGVVFQAKCLESGEAVAIKKVLX  660
            GNGTETGQIIVTTV GRNG++KQ LSYMAERVVGTGSFGVVFQAKCLE+GE+VAIKKVL 
Sbjct  120  GNGTETGQIIVTTVSGRNGQEKQTLSYMAERVVGTGSFGVVFQAKCLETGESVAIKKVLQ  179

Query  661  DRRYXNRELQIMRMLEHPNVV  723
            DRRY NRELQIMR L+HPNVV
Sbjct  180  DRRYKNRELQIMRTLDHPNVV  200



>gb|AAT81407.1| shaggy-related protein kinase 6 [Solanum peruvianum]
Length=475

 Score =   273 bits (699),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 144/201 (72%), Positives = 166/201 (83%), Gaps = 9/201 (4%)
 Frame = +1

Query  145  MNVMRRLKSVASGRSSVSDPQGGDSSIKRVKVAQDFDQRIAGKPESEEICTTA--PMHEA  318
            MNVMRRLKS+ASGRSSVSDP GGDSSIKRVKV ++ DQR+ G+ + EE CTT   P  + 
Sbjct  1    MNVMRRLKSIASGRSSVSDP-GGDSSIKRVKVEKEVDQRVVGETQMEEGCTTTTVPKEDM  59

Query  319  ASTSQEDASGIS--LVARSEKSGYEELPKEMHEMKIK---DDKSDN-QNNLKDMEPVVIT  480
            ASTS+E  +G +  +  R E S  +ELPKEMHEMKIK   DDK+D+  +NLKDMEP V++
Sbjct  60   ASTSKETTAGSTSTMDTRLENSELDELPKEMHEMKIKGEKDDKADSLDDNLKDMEPAVVS  119

Query  481  GNGTETGQIIVTTVGGRNGEQKQVLSYMAERVVGTGSFGVVFQAKCLESGEAVAIKKVLX  660
            GNGTETGQIIVTTV GRNG++KQ LSYMAERVVGTGSFGVVFQAKCLE+GE+VAIKKVL 
Sbjct  120  GNGTETGQIIVTTVSGRNGQEKQTLSYMAERVVGTGSFGVVFQAKCLETGESVAIKKVLQ  179

Query  661  DRRYXNRELQIMRMLEHPNVV  723
            DRRY NRELQIMR L+HPNVV
Sbjct  180  DRRYKNRELQIMRTLDHPNVV  200



>dbj|BAO02525.1| predicted Shaggy-like kinase ortholog, partial [Nicotiana alata]
Length=415

 Score =   271 bits (692),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 143/197 (73%), Positives = 166/197 (84%), Gaps = 5/197 (3%)
 Frame = +1

Query  145  MNVMRRLKSVASGRSSVSDPQGGDSSIKRVKVAQDFDQRIAGKPESEEICTTA-PMHEAA  321
            MNVMRRLKS+ASGRSSVSDP GGDSSIKRVKV Q+ DQR+ G+ + EE CTT  P  + A
Sbjct  1    MNVMRRLKSIASGRSSVSDP-GGDSSIKRVKVEQEVDQRVVGETQMEERCTTTVPKEDMA  59

Query  322  STSQEDASGIS--LVARSEKSGYEELPKEMHEMKIKDDKSD-NQNNLKDMEPVVITGNGT  492
            STS+   +G +  +  R E S ++ELPKEMHEMKIKD+K+D +++NLKDMEP V++GNGT
Sbjct  60   STSKGTTTGSTSTMDTRPENSEFDELPKEMHEMKIKDEKADSHEDNLKDMEPAVVSGNGT  119

Query  493  ETGQIIVTTVGGRNGEQKQVLSYMAERVVGTGSFGVVFQAKCLESGEAVAIKKVLXDRRY  672
            ETGQIIVTTV GRNG+QKQ LSYMAERVVGTGSFG VFQAKCLE+GE+VAIKKVL DRRY
Sbjct  120  ETGQIIVTTVSGRNGQQKQTLSYMAERVVGTGSFGTVFQAKCLETGESVAIKKVLQDRRY  179

Query  673  XNRELQIMRMLEHPNVV  723
             NRELQIMR L+HPNVV
Sbjct  180  KNRELQIMRTLDHPNVV  196



>ref|XP_009602858.1| PREDICTED: shaggy-related protein kinase epsilon [Nicotiana tomentosiformis]
 emb|CAA69899.1| NSK6 [Nicotiana tabacum]
Length=471

 Score =   271 bits (692),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 143/197 (73%), Positives = 166/197 (84%), Gaps = 5/197 (3%)
 Frame = +1

Query  145  MNVMRRLKSVASGRSSVSDPQGGDSSIKRVKVAQDFDQRIAGKPESEEICTT-APMHEAA  321
            MNVMRRLKS+ASGRSSVSDP GGDSSIKRVKV Q+ DQR+ G+ + EE CTT  P  + A
Sbjct  1    MNVMRRLKSIASGRSSVSDP-GGDSSIKRVKVEQEVDQRVVGETQMEERCTTIVPKEDMA  59

Query  322  STSQEDASGIS--LVARSEKSGYEELPKEMHEMKIKDDKSD-NQNNLKDMEPVVITGNGT  492
            STS+   +G +  +  R E S ++ELPKEMHEMKIKD+K+D +++NLKDMEP V++GNGT
Sbjct  60   STSKGTTTGSTSTMDTRPENSEFDELPKEMHEMKIKDEKADSHEDNLKDMEPAVVSGNGT  119

Query  493  ETGQIIVTTVGGRNGEQKQVLSYMAERVVGTGSFGVVFQAKCLESGEAVAIKKVLXDRRY  672
            ETGQIIVTTV GRNG+QKQ LSYMAERVVGTGSFG VFQAKCLE+GE+VAIKKVL DRRY
Sbjct  120  ETGQIIVTTVSGRNGQQKQTLSYMAERVVGTGSFGTVFQAKCLETGESVAIKKVLQDRRY  179

Query  673  XNRELQIMRMLEHPNVV  723
             NRELQIMR L+HPNVV
Sbjct  180  KNRELQIMRTLDHPNVV  196



>ref|XP_009610982.1| PREDICTED: shaggy-related protein kinase epsilon-like [Nicotiana 
tomentosiformis]
Length=469

 Score =   270 bits (691),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 134/195 (69%), Positives = 164/195 (84%), Gaps = 3/195 (2%)
 Frame = +1

Query  145  MNVMRRLKSVASGRSSVSDPQGGDSSIKRVKVAQDFDQRIAGKPESEEICTTAPMHEAAS  324
            MNVMRRLKS+ASGRSSVSDP GGD S+K+V V Q+ D R+ G+ + EE CT AP  +  S
Sbjct  1    MNVMRRLKSIASGRSSVSDP-GGDFSLKKVTVEQEVDHRVDGETQLEEQCTIAPKQDVTS  59

Query  325  TSQEDA-SGISLVARSEKSGYEELPKEMHEMKIKDDKSD-NQNNLKDMEPVVITGNGTET  498
            TS+E     +++  R EKS YEELPKEM+EMKI+D+K++ +++++KDMEP V++GNGTET
Sbjct  60   TSEESTVCTLNVDTRPEKSRYEELPKEMNEMKIRDEKTNGHEDDIKDMEPAVVSGNGTET  119

Query  499  GQIIVTTVGGRNGEQKQVLSYMAERVVGTGSFGVVFQAKCLESGEAVAIKKVLXDRRYXN  678
            GQIIVTT+ GRNG QK+ LSYMAERVVGTGSFGVVFQAKCLE+GE+VAIKKVL DRRY N
Sbjct  120  GQIIVTTLSGRNGRQKKTLSYMAERVVGTGSFGVVFQAKCLETGESVAIKKVLQDRRYKN  179

Query  679  RELQIMRMLEHPNVV  723
            RELQI+RML+HPNVV
Sbjct  180  RELQIVRMLDHPNVV  194



>emb|CAA05328.1| shaggy-like kinase 111 [Nicotiana tabacum]
Length=469

 Score =   270 bits (690),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 134/195 (69%), Positives = 164/195 (84%), Gaps = 3/195 (2%)
 Frame = +1

Query  145  MNVMRRLKSVASGRSSVSDPQGGDSSIKRVKVAQDFDQRIAGKPESEEICTTAPMHEAAS  324
            MNVMRRLKS+ASGRSSVSDP GGD S+K+V V Q+ D R+ G+ + EE CT AP  +  S
Sbjct  1    MNVMRRLKSIASGRSSVSDP-GGDFSLKKVTVEQEVDHRVDGETQLEEQCTIAPKQDVTS  59

Query  325  TSQEDA-SGISLVARSEKSGYEELPKEMHEMKIKDDKSD-NQNNLKDMEPVVITGNGTET  498
            TS+E     +++  R EKS YEELPKEM+EMKI+D+K++ +++++KDMEP V++GNGTET
Sbjct  60   TSEESTVCTLNVDTRPEKSRYEELPKEMNEMKIRDEKTNGHEDDIKDMEPAVVSGNGTET  119

Query  499  GQIIVTTVGGRNGEQKQVLSYMAERVVGTGSFGVVFQAKCLESGEAVAIKKVLXDRRYXN  678
            GQIIVTT+ GRNG QK+ LSYMAERVVGTGSFGVVFQAKCLE+GE+VAIKKVL DRRY N
Sbjct  120  GQIIVTTLSGRNGRQKKTLSYMAERVVGTGSFGVVFQAKCLETGESVAIKKVLQDRRYKN  179

Query  679  RELQIMRMLEHPNVV  723
            RELQI+RML+HPNVV
Sbjct  180  RELQIVRMLDHPNVV  194



>ref|XP_009790920.1| PREDICTED: shaggy-related protein kinase epsilon-like [Nicotiana 
sylvestris]
Length=471

 Score =   270 bits (690),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 140/197 (71%), Positives = 161/197 (82%), Gaps = 5/197 (3%)
 Frame = +1

Query  145  MNVMRRLKSVASGRSSVSDPQGGDSSIKRVKVAQDFDQRIAGKPESEEICTTAPMHE---  315
            MNVMRRLKS+ASGRSSVSDP GGDSSIKRVKV Q+ DQR+ G+ + EE CTT    E   
Sbjct  1    MNVMRRLKSIASGRSSVSDP-GGDSSIKRVKVEQEVDQRLVGETQMEERCTTTFPKEDMP  59

Query  316  AASTSQEDASGISLVARSEKSGYEELPKEMHEMKIKDDKSD-NQNNLKDMEPVVITGNGT  492
            + S      S  ++  R E S ++ELPKEMHEMKIKD+K+D +++NLKDMEP V++GNGT
Sbjct  60   STSKGTTTGSTSTMDTRPENSEFDELPKEMHEMKIKDEKTDSHEDNLKDMEPAVVSGNGT  119

Query  493  ETGQIIVTTVGGRNGEQKQVLSYMAERVVGTGSFGVVFQAKCLESGEAVAIKKVLXDRRY  672
            ETGQIIVTTV GRNG+QKQ LSYMAERVVGTGSFG VFQAKCLE+GE+VAIKKVL DRRY
Sbjct  120  ETGQIIVTTVSGRNGQQKQTLSYMAERVVGTGSFGTVFQAKCLETGESVAIKKVLQDRRY  179

Query  673  XNRELQIMRMLEHPNVV  723
             NRELQIMR L+HPNVV
Sbjct  180  KNRELQIMRTLDHPNVV  196



>ref|XP_009773710.1| PREDICTED: shaggy-related protein kinase epsilon-like [Nicotiana 
sylvestris]
Length=469

 Score =   268 bits (686),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 134/195 (69%), Positives = 168/195 (86%), Gaps = 3/195 (2%)
 Frame = +1

Query  145  MNVMRRLKSVASGRSSVSDPQGGDSSIKRVKVAQDFDQRIAGKPESEEICTTAPMHEA-A  321
            MNVMRRLKS+ASGRSSVSDP GGD S+KRVKV Q+ D R+ G+ +SEE CT AP  +  +
Sbjct  1    MNVMRRLKSIASGRSSVSDP-GGDFSLKRVKVEQEVDHRVDGETQSEEQCTIAPKQDVIS  59

Query  322  STSQEDASGISLVARSEKSGYEELPKEMHEMKIKDDKSD-NQNNLKDMEPVVITGNGTET  498
            ++S+   + +++  R EKSGYEELPKEM+EMKI+DDK++  ++++KDMEP V++GNGTET
Sbjct  60   TSSESTTTTLNVDTRPEKSGYEELPKEMNEMKIRDDKTNGREDDIKDMEPAVVSGNGTET  119

Query  499  GQIIVTTVGGRNGEQKQVLSYMAERVVGTGSFGVVFQAKCLESGEAVAIKKVLXDRRYXN  678
            GQIIVTT+ GRNG+QK+ LSYMAERVVGTGSFGVVFQAKCLE+G++VAIKKVL DRRY N
Sbjct  120  GQIIVTTLSGRNGQQKKTLSYMAERVVGTGSFGVVFQAKCLETGDSVAIKKVLQDRRYKN  179

Query  679  RELQIMRMLEHPNVV  723
            RELQI+R+L+HPNVV
Sbjct  180  RELQIVRILDHPNVV  194



>emb|CAA11860.1| shaggy-like kinase 91 [Nicotiana tabacum]
Length=471

 Score =   268 bits (686),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 139/197 (71%), Positives = 160/197 (81%), Gaps = 5/197 (3%)
 Frame = +1

Query  145  MNVMRRLKSVASGRSSVSDPQGGDSSIKRVKVAQDFDQRIAGKPESEEICTTAPMHE---  315
            MNVMRRLKS+ASGRSSVSDP GGDSSIKRVKV Q+ DQR+ G+ + EE CTT    E   
Sbjct  1    MNVMRRLKSIASGRSSVSDP-GGDSSIKRVKVEQEVDQRLVGETQMEERCTTTFPKEDMP  59

Query  316  AASTSQEDASGISLVARSEKSGYEELPKEMHEMKIKDDKSD-NQNNLKDMEPVVITGNGT  492
            + S      S  ++  R E S ++ELPKEMHEMKIKD+K+D +++NLKDMEP V++GNGT
Sbjct  60   STSKGTTTGSTSTMDTRPENSEFDELPKEMHEMKIKDEKTDSHEDNLKDMEPAVVSGNGT  119

Query  493  ETGQIIVTTVGGRNGEQKQVLSYMAERVVGTGSFGVVFQAKCLESGEAVAIKKVLXDRRY  672
            ETGQIIVTTV GRNG+QKQ LSYMAERVVGTGSFG VFQAKCLE+GE+VAIKKVL DRRY
Sbjct  120  ETGQIIVTTVSGRNGQQKQTLSYMAERVVGTGSFGTVFQAKCLETGESVAIKKVLQDRRY  179

Query  673  XNRELQIMRMLEHPNVV  723
             NRELQIMR  +HPNVV
Sbjct  180  KNRELQIMRTFDHPNVV  196



>emb|CAA05329.1| shaggy-like kinase 59 [Nicotiana tabacum]
Length=469

 Score =   268 bits (686),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 137/195 (70%), Positives = 167/195 (86%), Gaps = 3/195 (2%)
 Frame = +1

Query  145  MNVMRRLKSVASGRSSVSDPQGGDSSIKRVKVAQDFDQRIAGKPESEEICTTAPMHEAAS  324
            MNVMRRLKS+ASGRSSVSDP GGD S+KRVKV Q+ D R+ G+ +SEE CT AP  +  S
Sbjct  1    MNVMRRLKSIASGRSSVSDP-GGDFSLKRVKVEQEVDHRVDGETQSEEQCTIAPKQDVTS  59

Query  325  TSQEDASG-ISLVARSEKSGYEELPKEMHEMKIKDDKSD-NQNNLKDMEPVVITGNGTET  498
            TS E  +  +++  R EKSGYEELPKEM+EMKI+DDK++  ++++KDMEP V++GNGTET
Sbjct  60   TSSESTTTTLNVDTRPEKSGYEELPKEMNEMKIRDDKTNGREDDIKDMEPAVVSGNGTET  119

Query  499  GQIIVTTVGGRNGEQKQVLSYMAERVVGTGSFGVVFQAKCLESGEAVAIKKVLXDRRYXN  678
            GQIIVTT+ GRNG+QK+ LSYMAERVVGTGSFGVVFQAKCLE+G++VAIKKVL DRRY N
Sbjct  120  GQIIVTTLSGRNGQQKKTLSYMAERVVGTGSFGVVFQAKCLETGDSVAIKKVLQDRRYKN  179

Query  679  RELQIMRMLEHPNVV  723
            RELQI+R+L+HPNVV
Sbjct  180  RELQIVRILDHPNVV  194



>emb|CAA11861.1| shaggy kinase 6 [Petunia x hybrida]
Length=470

 Score =   266 bits (681),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 137/197 (70%), Positives = 164/197 (83%), Gaps = 6/197 (3%)
 Frame = +1

Query  145  MNVMRRLKSVASGRSSVSDPQGGDSSIKRVKVAQDFDQRIAGKPESEEICTT-APMHEAA  321
            MNVMRRLKS+ SGRSS+SDP GGDSSIKRVKV Q+  +R+ G  + ++ CTT AP  + A
Sbjct  1    MNVMRRLKSITSGRSSISDP-GGDSSIKRVKVEQEI-ERVVGDTQMDDRCTTTAPKEDMA  58

Query  322  STSQED--ASGISLVARSEKSGYEELPKEMHEMKIKDDKSD-NQNNLKDMEPVVITGNGT  492
            STS++   AS  ++  R E S  +ELPKE+HEMKIKD+++D +++NLKDMEP V++GNG 
Sbjct  59   STSKDTTTASTSTMDTRPENSEVDELPKELHEMKIKDERTDSHEDNLKDMEPAVVSGNGA  118

Query  493  ETGQIIVTTVGGRNGEQKQVLSYMAERVVGTGSFGVVFQAKCLESGEAVAIKKVLXDRRY  672
            ETGQIIVTTV GRNG+QKQ LSYMAERVVGTGSFGVVFQAKCLE+GE+VAIKKVL DRRY
Sbjct  119  ETGQIIVTTVSGRNGQQKQTLSYMAERVVGTGSFGVVFQAKCLETGESVAIKKVLQDRRY  178

Query  673  XNRELQIMRMLEHPNVV  723
             NRELQIMR L+HPNVV
Sbjct  179  KNRELQIMRTLDHPNVV  195



>ref|XP_002272112.1| PREDICTED: shaggy-related protein kinase theta [Vitis vinifera]
 emb|CBI38764.3| unnamed protein product [Vitis vinifera]
Length=468

 Score =   263 bits (672),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 135/196 (69%), Positives = 163/196 (83%), Gaps = 6/196 (3%)
 Frame = +1

Query  145  MNVMRRLKSVASGRSSVSDPQGGDSSIKRVKVAQDFDQRIAGKPESEEICTTAPMHEAAS  324
            MNVMRRLKS+ASGRSSVSDP GGDSS KR KV Q+ +Q++A +  S E  T+   H  AS
Sbjct  1    MNVMRRLKSIASGRSSVSDP-GGDSSTKRAKVDQEAEQKVADETHSVEKSTSLEQH-MAS  58

Query  325  TSQEDA---SGISLVARSEKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTE  495
            TSQE A   S +S +AR+E+SGY++LPKEMH+MKI+D+K D  ++ KD EP V++G+GTE
Sbjct  59   TSQETAASTSNVSSIARTEQSGYDQLPKEMHDMKIRDEKVDPHDD-KDAEPTVVSGSGTE  117

Query  496  TGQIIVTTVGGRNGEQKQVLSYMAERVVGTGSFGVVFQAKCLESGEAVAIKKVLXDRRYX  675
            TGQII TT+GGRNG+ KQ +SYMAERVVGTGSFGVVFQAKCLE+GEAVAIKKVL D+RY 
Sbjct  118  TGQIIATTIGGRNGQPKQTVSYMAERVVGTGSFGVVFQAKCLETGEAVAIKKVLQDKRYK  177

Query  676  NRELQIMRMLEHPNVV  723
            NRELQIMR+L+HPNVV
Sbjct  178  NRELQIMRVLDHPNVV  193



>ref|XP_006375323.1| hypothetical protein POPTR_0014s07120g [Populus trichocarpa]
 gb|ERP53120.1| hypothetical protein POPTR_0014s07120g [Populus trichocarpa]
Length=391

 Score =   259 bits (661),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 129/196 (66%), Positives = 157/196 (80%), Gaps = 4/196 (2%)
 Frame = +1

Query  145  MNVMRRLKSVASGRSSVSDPQGGDSSIKRVKVAQDFDQRIAGKPESEEICTTAPMHEAAS  324
            MNVMRRLKS+ASGR+S+S   GGD+  KR KV Q+ +Q+I G+    E   T      AS
Sbjct  1    MNVMRRLKSIASGRTSISSDPGGDAVTKRAKVDQEMEQKIDGESYLVERSVTEQEQHMAS  60

Query  325  TSQEDA---SGISLVARSEKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTE  495
            TSQE+A   S ++ V R+EK GY++LPKEMHEMKI+DDK+ N +  KDME  +++GNGTE
Sbjct  61   TSQENAASASNVTSVTRTEKPGYDQLPKEMHEMKIRDDKNTNHDE-KDMEAAIVSGNGTE  119

Query  496  TGQIIVTTVGGRNGEQKQVLSYMAERVVGTGSFGVVFQAKCLESGEAVAIKKVLXDRRYX  675
            TGQII TTVGGRNG+ KQ++SYMAERVVGTGSFGVV+QAKCLE+GEAVAIKKVL D+RY 
Sbjct  120  TGQIIATTVGGRNGQPKQIISYMAERVVGTGSFGVVYQAKCLETGEAVAIKKVLQDKRYK  179

Query  676  NRELQIMRMLEHPNVV  723
            NRELQIMR+L+HPNVV
Sbjct  180  NRELQIMRLLDHPNVV  195



>ref|XP_002320754.2| hypothetical protein POPTR_0014s07120g [Populus trichocarpa]
 gb|EEE99069.2| hypothetical protein POPTR_0014s07120g [Populus trichocarpa]
Length=473

 Score =   259 bits (662),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 129/196 (66%), Positives = 157/196 (80%), Gaps = 4/196 (2%)
 Frame = +1

Query  145  MNVMRRLKSVASGRSSVSDPQGGDSSIKRVKVAQDFDQRIAGKPESEEICTTAPMHEAAS  324
            MNVMRRLKS+ASGR+S+S   GGD+  KR KV Q+ +Q+I G+    E   T      AS
Sbjct  1    MNVMRRLKSIASGRTSISSDPGGDAVTKRAKVDQEMEQKIDGESYLVERSVTEQEQHMAS  60

Query  325  TSQEDA---SGISLVARSEKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTE  495
            TSQE+A   S ++ V R+EK GY++LPKEMHEMKI+DDK+ N +  KDME  +++GNGTE
Sbjct  61   TSQENAASASNVTSVTRTEKPGYDQLPKEMHEMKIRDDKNTNHDE-KDMEAAIVSGNGTE  119

Query  496  TGQIIVTTVGGRNGEQKQVLSYMAERVVGTGSFGVVFQAKCLESGEAVAIKKVLXDRRYX  675
            TGQII TTVGGRNG+ KQ++SYMAERVVGTGSFGVV+QAKCLE+GEAVAIKKVL D+RY 
Sbjct  120  TGQIIATTVGGRNGQPKQIISYMAERVVGTGSFGVVYQAKCLETGEAVAIKKVLQDKRYK  179

Query  676  NRELQIMRMLEHPNVV  723
            NRELQIMR+L+HPNVV
Sbjct  180  NRELQIMRLLDHPNVV  195



>ref|XP_011093165.1| PREDICTED: shaggy-related protein kinase alpha [Sesamum indicum]
Length=469

 Score =   258 bits (660),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 133/195 (68%), Positives = 154/195 (79%), Gaps = 3/195 (2%)
 Frame = +1

Query  145  MNVMRRLKSVASGRSSVSDPQGGDSSIKRVKVAQDFDQRIAGKPESEEICTTAPMHEAAS  324
            MN+MRRLKS+ASGRSSVSDP G DSSIKRVKV Q+ D R +   E+ E C  AP     S
Sbjct  1    MNMMRRLKSIASGRSSVSDPVG-DSSIKRVKVEQELDHRDSCDVETGENCLQAPEQHMES  59

Query  325  TSQEDASGISLV-ARSEKSGYEELPKEMHEMKIKDDKSDNQN-NLKDMEPVVITGNGTET  498
             S E  +  S V  + EKSGY+ELPKEMHEMKI+DDK+DN   N+KDME  +++GNGTE 
Sbjct  60   NSLEAVASTSNVHGKPEKSGYDELPKEMHEMKIRDDKTDNHEANVKDMESTIVSGNGTEA  119

Query  499  GQIIVTTVGGRNGEQKQVLSYMAERVVGTGSFGVVFQAKCLESGEAVAIKKVLXDRRYXN  678
            GQIIVT++GG NG+ KQ +SYMAERVVGTGSFGVV+QAK LE+GE+VAIKKVL DRRY N
Sbjct  120  GQIIVTSIGGHNGQPKQTMSYMAERVVGTGSFGVVYQAKWLETGESVAIKKVLQDRRYKN  179

Query  679  RELQIMRMLEHPNVV  723
            RELQIMRML HPNVV
Sbjct  180  RELQIMRMLNHPNVV  194



>ref|XP_011035087.1| PREDICTED: shaggy-related protein kinase theta [Populus euphratica]
Length=473

 Score =   257 bits (656),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 128/196 (65%), Positives = 157/196 (80%), Gaps = 4/196 (2%)
 Frame = +1

Query  145  MNVMRRLKSVASGRSSVSDPQGGDSSIKRVKVAQDFDQRIAGKPESEEICTTAPMHEAAS  324
            MNVMRRLKS+ASGR+S+S   GGD+  KR KV Q+ + +I G+    E   T      AS
Sbjct  1    MNVMRRLKSIASGRTSISSDPGGDAVTKRAKVDQEMEPKIDGESYLVERSVTDQEQHMAS  60

Query  325  TSQEDA---SGISLVARSEKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTE  495
            TSQE+A   S ++ V R+EKSGY++LPKEMHEMKI+DDK+ N +  KDME  +++GNGTE
Sbjct  61   TSQENAASASNVTSVTRTEKSGYDQLPKEMHEMKIRDDKNTNHDE-KDMEAAIVSGNGTE  119

Query  496  TGQIIVTTVGGRNGEQKQVLSYMAERVVGTGSFGVVFQAKCLESGEAVAIKKVLXDRRYX  675
            TGQII TTVGGRNG+ KQ++SYMAERVVGTGSFGVV+QAKCLE+GEAVAIKKVL D+RY 
Sbjct  120  TGQIIATTVGGRNGQPKQIISYMAERVVGTGSFGVVYQAKCLETGEAVAIKKVLQDKRYK  179

Query  676  NRELQIMRMLEHPNVV  723
            NRELQ+MR+L+HPNVV
Sbjct  180  NRELQVMRILDHPNVV  195



>ref|XP_006345509.1| PREDICTED: shaggy-related protein kinase theta-like [Solanum 
tuberosum]
Length=465

 Score =   253 bits (645),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 132/195 (68%), Positives = 159/195 (82%), Gaps = 7/195 (4%)
 Frame = +1

Query  145  MNVMRRLKSVASGRSSVSDPQGGDSSIKRVKVAQDFDQRIAGKPESEEICTTAPMHEAAS  324
            MNVMRRLKS+ASGRSSVSDP GGD S+KR+K+ Q  D R+  + + EE CT AP  +  S
Sbjct  1    MNVMRRLKSIASGRSSVSDP-GGDISLKRLKIEQKVDHRVDIEIQMEERCTIAPKDDVTS  59

Query  325  TSQ-EDASGISLVARSEKSGYEELPKEMHEMKIKDDKS-DNQNNLKDMEPVVITGNGTET  498
            TS+  DAS +++  R EKSG +ELP   +EM+I++  S D++++LKDMEP V++GNGTET
Sbjct  60   TSEGSDASTLTVDTRQEKSGKKELP---NEMRIREKNSYDHEDDLKDMEPTVVSGNGTET  116

Query  499  GQIIVTTVGGRNGEQKQVLSYMAERVVGTGSFGVVFQAKCLESGEAVAIKKVLXDRRYXN  678
            GQIIVTT+ GRNG QKQ LSYMAERVVGTGSFGVVFQAKCLE+GE+VAIKKVL DRRY N
Sbjct  117  GQIIVTTLSGRNG-QKQTLSYMAERVVGTGSFGVVFQAKCLETGESVAIKKVLQDRRYKN  175

Query  679  RELQIMRMLEHPNVV  723
            RELQIMRML+HPN V
Sbjct  176  RELQIMRMLDHPNAV  190



>ref|XP_012083467.1| PREDICTED: shaggy-related protein kinase theta-like [Jatropha 
curcas]
 gb|KDP28680.1| hypothetical protein JCGZ_14451 [Jatropha curcas]
Length=474

 Score =   251 bits (642),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 130/196 (66%), Positives = 154/196 (79%), Gaps = 4/196 (2%)
 Frame = +1

Query  145  MNVMRRLKSVASGRSSVSDPQGGDSSIKRVKVAQDFDQRIAGKPESEEICTTAPMHEAAS  324
            MNVMRRLKS+ASGR+S+S   GGDS  KRVKV QD D +I G+   +E   T      AS
Sbjct  1    MNVMRRLKSIASGRTSISSDPGGDSLTKRVKVDQDTDHKIDGELIQDERSATGMEQHMAS  60

Query  325  TSQEDASGIS---LVARSEKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTE  495
            TS E+A+  S    + R+EKSGY++LPKEM EMKI+D+K+ N +  KDME  +++GNGTE
Sbjct  61   TSLENAASTSDATSMTRTEKSGYDQLPKEMREMKIRDEKNANHDE-KDMEAAIVSGNGTE  119

Query  496  TGQIIVTTVGGRNGEQKQVLSYMAERVVGTGSFGVVFQAKCLESGEAVAIKKVLXDRRYX  675
            TGQII TTVGGRNG+ KQ +S+MAERVVGTGSFGVV+QAKCLESGEAVAIKKVL DRRY 
Sbjct  120  TGQIIATTVGGRNGKPKQTISFMAERVVGTGSFGVVYQAKCLESGEAVAIKKVLQDRRYK  179

Query  676  NRELQIMRMLEHPNVV  723
            NRELQIMR+L HPNVV
Sbjct  180  NRELQIMRLLNHPNVV  195



>ref|XP_011091732.1| PREDICTED: shaggy-related protein kinase alpha-like [Sesamum 
indicum]
Length=460

 Score =   248 bits (633),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 127/195 (65%), Positives = 155/195 (79%), Gaps = 12/195 (6%)
 Frame = +1

Query  145  MNVMRRLKSVASGRSSVSDPQGGDSSIKRVKVAQDFDQRIAGKPESEEICTTAPM-HEAA  321
            MN+MRRLKS+ASGRSSVSDP GGDSSIKRVKV Q+ DQ++  + ++ E C   P+ H  A
Sbjct  1    MNMMRRLKSIASGRSSVSDP-GGDSSIKRVKVEQEIDQKVDCEVDTGEKCVRVPVVHMEA  59

Query  322  STSQEDASGISLVARSEKSGYEELPKEMHEMKIKDDKSDNQNNL-KDMEPVVITGNGTET  498
                      S+ A +  S    LPKEMHEMKI++DK+D+ +++ KDMEP V++GNGTET
Sbjct  60   K---------SMGAVASTSDVHVLPKEMHEMKIREDKTDDHDDIGKDMEPTVVSGNGTET  110

Query  499  GQIIVTTVGGRNGEQKQVLSYMAERVVGTGSFGVVFQAKCLESGEAVAIKKVLXDRRYXN  678
            GQIIVT++GGRNG+ KQ +SYMAERVVGTGSFGVV+QAKCLE+GE+VAIKKVL DRRY N
Sbjct  111  GQIIVTSIGGRNGQPKQTMSYMAERVVGTGSFGVVYQAKCLETGESVAIKKVLQDRRYKN  170

Query  679  RELQIMRMLEHPNVV  723
            RELQIMR+L HPNVV
Sbjct  171  RELQIMRLLNHPNVV  185



>ref|XP_010255498.1| PREDICTED: shaggy-related protein kinase epsilon isoform X1 [Nelumbo 
nucifera]
Length=469

 Score =   248 bits (632),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 126/196 (64%), Positives = 153/196 (78%), Gaps = 5/196 (3%)
 Frame = +1

Query  145  MNVMRRLKSVASGRSSVSDPQGGDSSIKRVKVAQDFDQRIAGKPESEEICTTAPMHEAAS  324
            M+VMRRLKS+ASGRSSVSDP GGDS  KR KV Q+ +Q    +    E  +       AS
Sbjct  1    MHVMRRLKSIASGRSSVSDP-GGDSGSKRAKVDQEMEQNATNETHLMEKTSIGLEQHVAS  59

Query  325  TSQE---DASGISLVARSEKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTE  495
            TS E     S IS+ +++EKSGY++LPKEMHEMKI+DDK++N ++ KD E  ++ GNGTE
Sbjct  60   TSIETDVSTSNISITSKTEKSGYDQLPKEMHEMKIRDDKTENHDD-KDAEATIVNGNGTE  118

Query  496  TGQIIVTTVGGRNGEQKQVLSYMAERVVGTGSFGVVFQAKCLESGEAVAIKKVLXDRRYX  675
             GQII TT+GGRNG+ KQ +SYMAERVVGTGSFGVVFQAKC+E+GEAVAIKKVL D+RY 
Sbjct  119  AGQIIATTIGGRNGQPKQTISYMAERVVGTGSFGVVFQAKCVETGEAVAIKKVLQDKRYK  178

Query  676  NRELQIMRMLEHPNVV  723
            NRELQIMR+L+HPNVV
Sbjct  179  NRELQIMRLLDHPNVV  194



>ref|XP_010278583.1| PREDICTED: shaggy-related protein kinase epsilon-like [Nelumbo 
nucifera]
Length=469

 Score =   246 bits (629),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 128/196 (65%), Positives = 158/196 (81%), Gaps = 5/196 (3%)
 Frame = +1

Query  145  MNVMRRLKSVASGRSSVSDPQGGDSSIKRVKVAQDFDQRIAGKPESEEICTTAPMHEAAS  324
            M+VMRRLKS+ASGRSS+SDP GGDS  KR KV Q+ +Q + G+ +S E  T       +S
Sbjct  1    MHVMRRLKSIASGRSSISDP-GGDSGSKRAKVDQETEQNVTGETQSVEKTTVGLEQHISS  59

Query  325  TSQE-DASG--ISLVARSEKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTE  495
             S E DAS   IS  +++EKSG+++LPKEMHEMKI+DDK+++ ++ KDME  VI GNGTE
Sbjct  60   ASLEADASTSTISSNSKTEKSGFDQLPKEMHEMKIRDDKTESHDD-KDMEAAVINGNGTE  118

Query  496  TGQIIVTTVGGRNGEQKQVLSYMAERVVGTGSFGVVFQAKCLESGEAVAIKKVLXDRRYX  675
            TGQII TT+GG+NG+ KQ +SYMAERVVGTGSFGVVFQAKC+E+GEAVAIKKVL D+RY 
Sbjct  119  TGQIISTTIGGKNGQPKQTISYMAERVVGTGSFGVVFQAKCVETGEAVAIKKVLQDKRYK  178

Query  676  NRELQIMRMLEHPNVV  723
            NRELQIMR+ +HPNVV
Sbjct  179  NRELQIMRLFDHPNVV  194



>gb|AFK41443.1| unknown [Medicago truncatula]
Length=195

 Score =   236 bits (601),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 123/200 (62%), Positives = 150/200 (75%), Gaps = 14/200 (7%)
 Frame = +1

Query  145  MNVMRRLKSVASGRSSVSDPQGGDSSIKRVKVAQDFDQRIAGKPESEEIC--------TT  300
            MN+MRRLKS+ASGR+SVS   GGDS+ KR K    FD    GK E+EE            
Sbjct  1    MNMMRRLKSIASGRTSVSSDPGGDSTTKRAK----FDLETEGK-ENEETNRGERGGNNQD  55

Query  301  APMHEAASTSQEDASGISLVARSEKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVIT  480
              +     TS    S +S VA++EKSG+++LPKE+HEMKIKDDKS N NN KDME  V+ 
Sbjct  56   KYVDAVEETSSSCNSNVSAVAKTEKSGFDQLPKELHEMKIKDDKSKN-NNEKDMEATVVN  114

Query  481  GNGTETGQIIVTTVGGRNGEQKQVLSYMAERVVGTGSFGVVFQAKCLESGEAVAIKKVLX  660
            GNGTETGQII T++GGR+G+ K+++SYMAERVVGTGSFGVV+QAKC+E+GE+VAIKKVL 
Sbjct  115  GNGTETGQIITTSIGGRDGQPKRIISYMAERVVGTGSFGVVYQAKCVETGESVAIKKVLQ  174

Query  661  DRRYXNRELQIMRMLEHPNV  720
            D+RY NRELQ+MRMLEH NV
Sbjct  175  DKRYKNRELQVMRMLEHTNV  194



>ref|XP_002511803.1| Glycogen synthase kinase-3 beta, putative [Ricinus communis]
 gb|EEF50472.1| Glycogen synthase kinase-3 beta, putative [Ricinus communis]
Length=474

 Score =   244 bits (623),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 124/196 (63%), Positives = 154/196 (79%), Gaps = 4/196 (2%)
 Frame = +1

Query  145  MNVMRRLKSVASGRSSVSDPQGGDSSIKRVKVAQDFDQRIAGKPESEEICTTAPMHEAAS  324
            MN+MRRLKS+ASGR+S+S   GGDS  KRVKV Q+ +Q+I G+  S+E   T      AS
Sbjct  1    MNMMRRLKSIASGRTSISSDPGGDSLTKRVKVDQETEQKIDGEVYSDERNATGLEQHMAS  60

Query  325  TSQEDASGIS---LVARSEKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTE  495
            TS E+ +  S    V ++EKSG+++LPKEMHEM+IKDDK+ + +  KDME  +++G GTE
Sbjct  61   TSLENPASTSNSASVVKTEKSGFDQLPKEMHEMRIKDDKTTSHDE-KDMEAAIVSGTGTE  119

Query  496  TGQIIVTTVGGRNGEQKQVLSYMAERVVGTGSFGVVFQAKCLESGEAVAIKKVLXDRRYX  675
            TG II TT+GGRNG+ KQ +S+MAERVVGTGSFGVV+QAKCLE+GEAVAIKKVL DRRY 
Sbjct  120  TGHIIATTLGGRNGQPKQTISFMAERVVGTGSFGVVYQAKCLETGEAVAIKKVLQDRRYK  179

Query  676  NRELQIMRMLEHPNVV  723
            NRELQIMR+L HPNVV
Sbjct  180  NRELQIMRLLGHPNVV  195



>ref|XP_004240041.1| PREDICTED: shaggy-related protein kinase epsilon [Solanum lycopersicum]
Length=466

 Score =   244 bits (622),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 128/195 (66%), Positives = 157/195 (81%), Gaps = 6/195 (3%)
 Frame = +1

Query  145  MNVMRRLKSVASGRSSVSDPQGGDSSIKRVKVAQDFDQRIAGKPESEEICTTAPMHEAAS  324
            MNVMRRLKS+ASGRSS+SDP G D S+KR+K  Q+ D R+  + + EE CT A   +  S
Sbjct  1    MNVMRRLKSIASGRSSISDP-GVDISLKRLKNEQEVDHRVDIEFQMEERCTIASKDDVTS  59

Query  325  TSQ-EDASGISLVARSEKSGYEELPKEMHEMKIKDDKS-DNQNNLKDMEPVVITGNGTET  498
            TS+  DAS +++  R EKSG EELP   +EM+I++  S D++++LKDMEP V++GNGTET
Sbjct  60   TSEGSDASTLTVDTRQEKSGKEELP---NEMRIREKSSYDHEDDLKDMEPTVVSGNGTET  116

Query  499  GQIIVTTVGGRNGEQKQVLSYMAERVVGTGSFGVVFQAKCLESGEAVAIKKVLXDRRYXN  678
            GQIIVTT+  RNG++KQ LSYMAERVVGTGSFGVVFQAKCLE+GE+VAIKKVL DRRY N
Sbjct  117  GQIIVTTLSDRNGQKKQTLSYMAERVVGTGSFGVVFQAKCLETGESVAIKKVLQDRRYKN  176

Query  679  RELQIMRMLEHPNVV  723
            RELQIMRML+H NVV
Sbjct  177  RELQIMRMLDHTNVV  191



>gb|KDO86034.1| hypothetical protein CISIN_1g011138mg [Citrus sinensis]
Length=272

 Score =   237 bits (605),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 119/196 (61%), Positives = 153/196 (78%), Gaps = 6/196 (3%)
 Frame = +1

Query  145  MNVMRRLKSVASGRSSVSDPQGGDSSIKRVKVAQDFDQRIAGKPESEEICTTAPMHEAAS  324
            MNVMRRLKS+ASGR+S+S   GGDS IKR KV ++ +  + G+    E   ++     AS
Sbjct  1    MNVMRRLKSIASGRTSISSDPGGDSGIKRAKVDKELE--VNGEANLVERSASSLEQHMAS  58

Query  325  TSQEDASGIS---LVARSEKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTE  495
            TS E  +  S    VAR+E+SG+++LPKEM+EM+I+D+K+ N ++ KD+EP ++ GNGTE
Sbjct  59   TSLEPVASTSEAATVARTERSGFDQLPKEMNEMRIRDEKNVNHDD-KDLEPSIVNGNGTE  117

Query  496  TGQIIVTTVGGRNGEQKQVLSYMAERVVGTGSFGVVFQAKCLESGEAVAIKKVLXDRRYX  675
             GQ+I TTVGGRNG+ KQ +SYMAERVVGTGSFGVVFQAKCLE+G++VAIKKVL D+RY 
Sbjct  118  AGQVIATTVGGRNGQPKQTISYMAERVVGTGSFGVVFQAKCLETGDSVAIKKVLQDKRYK  177

Query  676  NRELQIMRMLEHPNVV  723
            NRELQIMR+L HPNVV
Sbjct  178  NRELQIMRLLNHPNVV  193



>ref|XP_011023409.1| PREDICTED: shaggy-related protein kinase theta-like isoform X2 
[Populus euphratica]
Length=419

 Score =   241 bits (616),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 122/196 (62%), Positives = 155/196 (79%), Gaps = 4/196 (2%)
 Frame = +1

Query  145  MNVMRRLKSVASGRSSVSDPQGGDSSIKRVKVAQDFDQRIAGKPESEEICTTAPMHEAAS  324
            MNVMRRLKS+ASGR+S+S   GGD   KR KV Q+ ++++  +    E   T      AS
Sbjct  1    MNVMRRLKSMASGRTSISSDPGGDVGTKRAKVDQEIERKVDQESYLVERSVTDQEQHMAS  60

Query  325  TSQEDA---SGISLVARSEKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTE  495
            TSQE+A   S I+ VAR+EKSGY++LPKEMH+MKI+D+K+   +  K++E V+++GNGTE
Sbjct  61   TSQENAASTSNITSVARTEKSGYDQLPKEMHQMKIRDEKTTFHDE-KEVEAVIVSGNGTE  119

Query  496  TGQIIVTTVGGRNGEQKQVLSYMAERVVGTGSFGVVFQAKCLESGEAVAIKKVLXDRRYX  675
            TGQII TTVGGRNG+ KQ +SYMAE +VGTGSFGVV+QAKCLE+GEAVAIKKVL D+RY 
Sbjct  120  TGQIIATTVGGRNGQPKQTISYMAEHMVGTGSFGVVYQAKCLETGEAVAIKKVLQDKRYK  179

Query  676  NRELQIMRMLEHPNVV  723
            NRELQ+MR+L+HPNVV
Sbjct  180  NRELQVMRILDHPNVV  195



>emb|CAA11862.1| shaggy kinase 7 [Petunia x hybrida]
Length=459

 Score =   243 bits (619),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 124/192 (65%), Positives = 153/192 (80%), Gaps = 9/192 (5%)
 Frame = +1

Query  151  VMRRLKSVASGRSSVSDPQGGDSSIKRVKVAQDFDQRIAGKPESEEICTTAPMHEAASTS  330
            +MRR+KS+ASGRSSVSDP GGD ++KR KV QD D  + G+ +SEE C+ A   + +S S
Sbjct  1    MMRRIKSIASGRSSVSDP-GGDLNLKRAKVEQDVDNMVDGETQSEERCSIANKQDVSSKS  59

Query  331  QEDASGISLVARSEKSGYEELPKEMHEMKIKDDKS-DNQNNLKDMEPVVITGNGTETGQI  507
            +   +    V         ELPKE++EMKI+D+KS D++++ KDMEP V++GNGTETGQI
Sbjct  60   KRSTASTLNVD-------NELPKELNEMKIRDEKSGDHEDDTKDMEPAVVSGNGTETGQI  112

Query  508  IVTTVGGRNGEQKQVLSYMAERVVGTGSFGVVFQAKCLESGEAVAIKKVLXDRRYXNREL  687
            IVTT+ GRNG++KQ LSYMAERVVGTGSFGVVFQAKCLE+GE+VAIKKVL DRRY NREL
Sbjct  113  IVTTMSGRNGQKKQTLSYMAERVVGTGSFGVVFQAKCLETGESVAIKKVLQDRRYKNREL  172

Query  688  QIMRMLEHPNVV  723
            Q+MRMLEHPNVV
Sbjct  173  QMMRMLEHPNVV  184



>ref|XP_011023410.1| PREDICTED: shaggy-related protein kinase theta-like isoform X3 
[Populus euphratica]
Length=468

 Score =   241 bits (615),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 122/196 (62%), Positives = 155/196 (79%), Gaps = 4/196 (2%)
 Frame = +1

Query  145  MNVMRRLKSVASGRSSVSDPQGGDSSIKRVKVAQDFDQRIAGKPESEEICTTAPMHEAAS  324
            MNVMRRLKS+ASGR+S+S   GGD   KR KV Q+ ++++  +    E   T      AS
Sbjct  1    MNVMRRLKSMASGRTSISSDPGGDVGTKRAKVDQEIERKVDQESYLVERSVTDQEQHMAS  60

Query  325  TSQEDA---SGISLVARSEKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTE  495
            TSQE+A   S I+ VAR+EKSGY++LPKEMH+MKI+D+K+   +  K++E V+++GNGTE
Sbjct  61   TSQENAASTSNITSVARTEKSGYDQLPKEMHQMKIRDEKTTFHDE-KEVEAVIVSGNGTE  119

Query  496  TGQIIVTTVGGRNGEQKQVLSYMAERVVGTGSFGVVFQAKCLESGEAVAIKKVLXDRRYX  675
            TGQII TTVGGRNG+ KQ +SYMAE +VGTGSFGVV+QAKCLE+GEAVAIKKVL D+RY 
Sbjct  120  TGQIIATTVGGRNGQPKQTISYMAEHMVGTGSFGVVYQAKCLETGEAVAIKKVLQDKRYK  179

Query  676  NRELQIMRMLEHPNVV  723
            NRELQ+MR+L+HPNVV
Sbjct  180  NRELQVMRILDHPNVV  195



>gb|KDO86033.1| hypothetical protein CISIN_1g011138mg [Citrus sinensis]
Length=349

 Score =   236 bits (603),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 119/196 (61%), Positives = 153/196 (78%), Gaps = 6/196 (3%)
 Frame = +1

Query  145  MNVMRRLKSVASGRSSVSDPQGGDSSIKRVKVAQDFDQRIAGKPESEEICTTAPMHEAAS  324
            MNVMRRLKS+ASGR+S+S   GGDS IKR KV ++ +  + G+    E   ++     AS
Sbjct  1    MNVMRRLKSIASGRTSISSDPGGDSGIKRAKVDKELE--VNGEANLVERSASSLEQHMAS  58

Query  325  TSQEDASGIS---LVARSEKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTE  495
            TS E  +  S    VAR+E+SG+++LPKEM+EM+I+D+K+ N ++ KD+EP ++ GNGTE
Sbjct  59   TSLEPVASTSEAATVARTERSGFDQLPKEMNEMRIRDEKNVNHDD-KDLEPSIVNGNGTE  117

Query  496  TGQIIVTTVGGRNGEQKQVLSYMAERVVGTGSFGVVFQAKCLESGEAVAIKKVLXDRRYX  675
             GQ+I TTVGGRNG+ KQ +SYMAERVVGTGSFGVVFQAKCLE+G++VAIKKVL D+RY 
Sbjct  118  AGQVIATTVGGRNGQPKQTISYMAERVVGTGSFGVVFQAKCLETGDSVAIKKVLQDKRYK  177

Query  676  NRELQIMRMLEHPNVV  723
            NRELQIMR+L HPNVV
Sbjct  178  NRELQIMRLLNHPNVV  193



>ref|XP_003528879.1| PREDICTED: shaggy-related protein kinase theta-like [Glycine 
max]
 gb|KHN04626.1| Shaggy-related protein kinase theta [Glycine soja]
Length=470

 Score =   239 bits (610),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 124/200 (62%), Positives = 153/200 (77%), Gaps = 12/200 (6%)
 Frame = +1

Query  145  MNVMRRLKSVASGRSSVSDPQGGDSSIKRVKVAQDFDQRIAGKPES-----EEICTTA--  303
            MN+MRRLKS+ASGR+S+S   GGDS+ KR K    F+    GK +      E ICT    
Sbjct  1    MNMMRRLKSIASGRTSISSDPGGDSNSKRAK----FEPETEGKADEKTNTIETICTDQEQ  56

Query  304  PMHEAASTSQEDASGISLVARSEKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITG  483
            P+  +  TS    S +S VAR+EKSG++ELPKE++EMKI+D+KS N NN KD+E  V++G
Sbjct  57   PIDTSKETSNVGTSDVSTVARTEKSGFDELPKELNEMKIRDEKSKN-NNEKDIEATVVSG  115

Query  484  NGTETGQIIVTTVGGRNGEQKQVLSYMAERVVGTGSFGVVFQAKCLESGEAVAIKKVLXD  663
            NGTETGQII T +GGR+G+ KQ +SYMAERVVGTGSFGVVFQAKCLE+GE+VAIKKVL D
Sbjct  116  NGTETGQIITTAIGGRDGQPKQTISYMAERVVGTGSFGVVFQAKCLETGESVAIKKVLQD  175

Query  664  RRYXNRELQIMRMLEHPNVV  723
            RRY NRELQ+MR ++HPNVV
Sbjct  176  RRYKNRELQVMRTVDHPNVV  195



>ref|XP_007051908.1| Shaggy-like protein kinase 32 isoform 1 [Theobroma cacao]
 gb|EOX96065.1| Shaggy-like protein kinase 32 isoform 1 [Theobroma cacao]
Length=532

 Score =   240 bits (612),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 130/216 (60%), Positives = 155/216 (72%), Gaps = 8/216 (4%)
 Frame = +1

Query  97   GRFSWLKGREKGA----SENMNVMRRLKSVASGRSSVSDPQGGDSSIKRVKVAQDFDQRI  264
            G F  L+ ++ G     S+ MNVMRRLKS+ASGRSS+S   GGDS  KR KV Q  + ++
Sbjct  43   GEFRRLRSKKSGLGSVKSKTMNVMRRLKSIASGRSSISSDPGGDSGTKRAKVDQQAECKV  102

Query  265  AGKPESEEICTTAPMHEAASTSQE---DASGISLVARSEKSGYEELPKEMHEMKIKDDKS  435
              +    E  TT      ASTS E     S ++ VAR EKSG ++LP EMHEM+I+D+K+
Sbjct  103  HEESNLVERSTTGLEQHMASTSLETVASTSNVTSVARMEKSGVDQLPNEMHEMRIRDEKT  162

Query  436  DNQNNLKDMEPVVITGNGTETGQIIVTTVGGRNGEQKQVLSYMAERVVGTGSFGVVFQAK  615
             N +  KD+E  VI GNGTETGQII T VGGRNG+ KQ +SYMAERVVGTGSFGVVFQAK
Sbjct  163  ANHDE-KDVEATVINGNGTETGQIISTVVGGRNGQPKQTISYMAERVVGTGSFGVVFQAK  221

Query  616  CLESGEAVAIKKVLXDRRYXNRELQIMRMLEHPNVV  723
            CLE GE+VAIKKVL D+RY NRELQIMR+L HPNVV
Sbjct  222  CLERGESVAIKKVLQDKRYKNRELQIMRILNHPNVV  257



>dbj|BAD95891.1| Ser/Thr protein kinase [Lotus japonicus]
Length=467

 Score =   236 bits (601),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 118/200 (59%), Positives = 155/200 (78%), Gaps = 15/200 (8%)
 Frame = +1

Query  145  MNVMRRLKSVASGRSSVSDPQGGDSSIKRVKVAQDFDQRI-------AGKPESEEICTTA  303
            MN+MRRLKS+ASGR+S+S   GGDS+ KR K+ Q+ ++++        GK + + +    
Sbjct  1    MNMMRRLKSIASGRTSISSDPGGDSNSKRAKLDQETEKKVNEETKTLGGKDQEQHV----  56

Query  304  PMHEAASTSQEDASGISLVARSEKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITG  483
               +A+  S    S +S VA++EKSG++ELPKE+HEMKIKD+KS N NN KD+E  +++G
Sbjct  57   ---DASKESTVGTSDVSTVAKTEKSGFDELPKELHEMKIKDEKSKN-NNEKDIEASIVSG  112

Query  484  NGTETGQIIVTTVGGRNGEQKQVLSYMAERVVGTGSFGVVFQAKCLESGEAVAIKKVLXD  663
            NGTETGQII T +GGR+G+ KQ +SYMAERVVGTGSFGVVFQAKCLE+GEAVAIKKVL D
Sbjct  113  NGTETGQIITTAIGGRDGQPKQTISYMAERVVGTGSFGVVFQAKCLETGEAVAIKKVLQD  172

Query  664  RRYXNRELQIMRMLEHPNVV  723
            +RY NRELQ+MR ++HPN+V
Sbjct  173  KRYKNRELQVMRTVDHPNIV  192



>ref|XP_006445137.1| hypothetical protein CICLE_v10020026mg [Citrus clementina]
 ref|XP_006445138.1| hypothetical protein CICLE_v10020026mg [Citrus clementina]
 ref|XP_006491022.1| PREDICTED: shaggy-related protein kinase theta-like [Citrus sinensis]
 gb|ESR58377.1| hypothetical protein CICLE_v10020026mg [Citrus clementina]
 gb|ESR58378.1| hypothetical protein CICLE_v10020026mg [Citrus clementina]
 gb|KDO86032.1| hypothetical protein CISIN_1g011138mg [Citrus sinensis]
Length=468

 Score =   236 bits (601),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 119/196 (61%), Positives = 153/196 (78%), Gaps = 6/196 (3%)
 Frame = +1

Query  145  MNVMRRLKSVASGRSSVSDPQGGDSSIKRVKVAQDFDQRIAGKPESEEICTTAPMHEAAS  324
            MNVMRRLKS+ASGR+S+S   GGDS IKR KV ++ +  + G+    E   ++     AS
Sbjct  1    MNVMRRLKSIASGRTSISSDPGGDSGIKRAKVDKELE--VNGEANLVERSASSLEQHMAS  58

Query  325  TSQEDASGIS---LVARSEKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTE  495
            TS E  +  S    VAR+E+SG+++LPKEM+EM+I+D+K+ N ++ KD+EP ++ GNGTE
Sbjct  59   TSLEPVASTSEAATVARTERSGFDQLPKEMNEMRIRDEKNVNHDD-KDLEPSIVNGNGTE  117

Query  496  TGQIIVTTVGGRNGEQKQVLSYMAERVVGTGSFGVVFQAKCLESGEAVAIKKVLXDRRYX  675
             GQ+I TTVGGRNG+ KQ +SYMAERVVGTGSFGVVFQAKCLE+G++VAIKKVL D+RY 
Sbjct  118  AGQVIATTVGGRNGQPKQTISYMAERVVGTGSFGVVFQAKCLETGDSVAIKKVLQDKRYK  177

Query  676  NRELQIMRMLEHPNVV  723
            NRELQIMR+L HPNVV
Sbjct  178  NRELQIMRLLNHPNVV  193



>gb|KDO86031.1| hypothetical protein CISIN_1g011138mg [Citrus sinensis]
Length=492

 Score =   236 bits (601),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 119/196 (61%), Positives = 153/196 (78%), Gaps = 6/196 (3%)
 Frame = +1

Query  145  MNVMRRLKSVASGRSSVSDPQGGDSSIKRVKVAQDFDQRIAGKPESEEICTTAPMHEAAS  324
            MNVMRRLKS+ASGR+S+S   GGDS IKR KV ++ +  + G+    E   ++     AS
Sbjct  1    MNVMRRLKSIASGRTSISSDPGGDSGIKRAKVDKELE--VNGEANLVERSASSLEQHMAS  58

Query  325  TSQEDASGIS---LVARSEKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTE  495
            TS E  +  S    VAR+E+SG+++LPKEM+EM+I+D+K+ N ++ KD+EP ++ GNGTE
Sbjct  59   TSLEPVASTSEAATVARTERSGFDQLPKEMNEMRIRDEKNVNHDD-KDLEPSIVNGNGTE  117

Query  496  TGQIIVTTVGGRNGEQKQVLSYMAERVVGTGSFGVVFQAKCLESGEAVAIKKVLXDRRYX  675
             GQ+I TTVGGRNG+ KQ +SYMAERVVGTGSFGVVFQAKCLE+G++VAIKKVL D+RY 
Sbjct  118  AGQVIATTVGGRNGQPKQTISYMAERVVGTGSFGVVFQAKCLETGDSVAIKKVLQDKRYK  177

Query  676  NRELQIMRMLEHPNVV  723
            NRELQIMR+L HPNVV
Sbjct  178  NRELQIMRLLNHPNVV  193



>ref|XP_010671733.1| PREDICTED: shaggy-related protein kinase epsilon isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=469

 Score =   234 bits (598),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 120/196 (61%), Positives = 149/196 (76%), Gaps = 5/196 (3%)
 Frame = +1

Query  145  MNVMRRLKSVASGRSSVSDPQGGDSSIKRVKVAQDFDQRIAGKPESEEICTTAPMHEAAS  324
            MNVMRRLKS+ASGR+S+SDP GGD S KR KV Q+ +     +   +E CTT      AS
Sbjct  1    MNVMRRLKSIASGRTSISDP-GGDCSTKRAKVEQETEGSFTDESHPDERCTTEVEQHVAS  59

Query  325  TSQE---DASGISLVARSEKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTE  495
            TS E     S +S + R++K+ Y++LP EMH MKI+++K+D  ++ KDME   ++G+GTE
Sbjct  60   TSMEQISSTSDVSSIDRTQKADYDKLPTEMHGMKIQENKADKGDD-KDMEAAFVSGSGTE  118

Query  496  TGQIIVTTVGGRNGEQKQVLSYMAERVVGTGSFGVVFQAKCLESGEAVAIKKVLXDRRYX  675
             GQII TT+GGRNG+ KQ +SYMAERVVGTGSFGVVFQAKCLE+GE VAIKKVL D+RY 
Sbjct  119  AGQIITTTMGGRNGQPKQTVSYMAERVVGTGSFGVVFQAKCLENGEQVAIKKVLQDKRYK  178

Query  676  NRELQIMRMLEHPNVV  723
            NREL IMR+LEHPNVV
Sbjct  179  NRELSIMRLLEHPNVV  194



>gb|EYU32069.1| hypothetical protein MIMGU_mgv1a006024mg [Erythranthe guttata]
Length=461

 Score =   233 bits (594),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 124/200 (62%), Positives = 153/200 (77%), Gaps = 21/200 (11%)
 Frame = +1

Query  145  MNVMRRLKSVASGRSSVSDPQGGDSSIKRVKVAQDFDQRI------AGKPESEEICTTAP  306
            MN+MRRLKS+ASGRSSVSDP GGDS +KRVKV Q+ D  +      AG+  + +   T P
Sbjct  1    MNMMRRLKSIASGRSSVSDP-GGDSDMKRVKVEQEIDHMVVCEVDNAGERYTRQ---TEP  56

Query  307  MHEAASTSQEDASGISLVARSEKSGYEELPKEMHEMKIKDDKSDNQN-NLKDMEPVVITG  483
              E+ ST           A +  S  +ELPKEMHEMKI++DK+D+ + N K+MEP V++G
Sbjct  57   HFESDSTG----------AIASTSDVQELPKEMHEMKIREDKTDDSDENGKEMEPTVVSG  106

Query  484  NGTETGQIIVTTVGGRNGEQKQVLSYMAERVVGTGSFGVVFQAKCLESGEAVAIKKVLXD  663
            +GTETGQIIVT++GGRNG+ KQ +SYMAERVVGTGSFGVV+QAKCLE+GE+VAIKKVL D
Sbjct  107  SGTETGQIIVTSIGGRNGQPKQTMSYMAERVVGTGSFGVVYQAKCLETGESVAIKKVLQD  166

Query  664  RRYXNRELQIMRMLEHPNVV  723
            RRY NRELQIM++L HPNVV
Sbjct  167  RRYKNRELQIMQLLNHPNVV  186



>ref|XP_007134960.1| hypothetical protein PHAVU_010G090200g [Phaseolus vulgaris]
 gb|ESW06954.1| hypothetical protein PHAVU_010G090200g [Phaseolus vulgaris]
Length=469

 Score =   233 bits (595),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 121/196 (62%), Positives = 151/196 (77%), Gaps = 5/196 (3%)
 Frame = +1

Query  145  MNVMRRLKSVASGRSSVSDPQGGDSSIKRVKVAQDFDQRIAGKPESEEICTT---APMHE  315
            MN+MRRLKS+ASGR+S+S   GGDS+ KR K  Q+ + +   K    E  +T    P+ +
Sbjct  1    MNMMRRLKSIASGRTSISSDPGGDSNSKRAKFEQETEVKAVEKTNIVEKVSTDQDQPV-D  59

Query  316  AASTSQEDASGISLVARSEKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTE  495
            A   +    S +S  AR+EKSGY+ELPKE++EMKI+D+KS N NN KDME  V++GNGTE
Sbjct  60   ALKETTVGTSDVSTAARTEKSGYDELPKELNEMKIRDEKSKN-NNEKDMEATVVSGNGTE  118

Query  496  TGQIIVTTVGGRNGEQKQVLSYMAERVVGTGSFGVVFQAKCLESGEAVAIKKVLXDRRYX  675
            TGQII T +GGR+G+ KQ +SYMAERVVGTGSFGVVFQAKCLE+GEAVAIKKVL D+RY 
Sbjct  119  TGQIITTAIGGRDGQPKQTISYMAERVVGTGSFGVVFQAKCLETGEAVAIKKVLQDKRYK  178

Query  676  NRELQIMRMLEHPNVV  723
            NRELQ+MR ++HPNVV
Sbjct  179  NRELQVMRTVDHPNVV  194



>ref|XP_003623822.1| Shaggy-related protein kinase [Medicago truncatula]
 gb|AES80040.1| shaggy-like kinase [Medicago truncatula]
Length=470

 Score =   232 bits (591),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 123/201 (61%), Positives = 151/201 (75%), Gaps = 14/201 (7%)
 Frame = +1

Query  145  MNVMRRLKSVASGRSSVSDPQGGDSSIKRVKVAQDFDQRIAGKPESEEIC--------TT  300
            MN+MRRLKS+ASGR+SVS   GGDS+ KR K    FD    GK E+EE            
Sbjct  1    MNMMRRLKSIASGRTSVSSDPGGDSTTKRAK----FDLETEGK-ENEETNRGERGGNNQD  55

Query  301  APMHEAASTSQEDASGISLVARSEKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVIT  480
              +     TS    S +S VA++EKSG+++LPKE+HEMKIKDDKS N NN KDME  V+ 
Sbjct  56   KYVDAVEETSSSCNSNVSAVAKTEKSGFDQLPKELHEMKIKDDKSKN-NNEKDMEATVVN  114

Query  481  GNGTETGQIIVTTVGGRNGEQKQVLSYMAERVVGTGSFGVVFQAKCLESGEAVAIKKVLX  660
            GNGTETGQII T++GGR+G+ K+++SYMAERVVGTGSFGVV+QAKC+E+GE+VAIKKVL 
Sbjct  115  GNGTETGQIITTSIGGRDGQPKRIISYMAERVVGTGSFGVVYQAKCVETGESVAIKKVLQ  174

Query  661  DRRYXNRELQIMRMLEHPNVV  723
            D+RY NRELQ+MRMLEH NV+
Sbjct  175  DKRYKNRELQVMRMLEHTNVL  195



>ref|XP_009340624.1| PREDICTED: shaggy-related protein kinase theta-like [Pyrus x 
bretschneideri]
Length=474

 Score =   229 bits (585),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 121/200 (61%), Positives = 151/200 (76%), Gaps = 8/200 (4%)
 Frame = +1

Query  145  MNVMRRLKSVASGRSSVSDPQGGDSSIKRVKVAQDFDQRIAGKPESEEICTTAPMHEAAS  324
            MN+MRRLKS+ASGR+SVS   G DS+ KR KV Q+ +++   +  + E  +T      AS
Sbjct  1    MNMMRRLKSIASGRTSVSSDPGIDSTTKRAKVDQETEKKANKQSNTVEGSSTGLEQHMAS  60

Query  325  TSQE---DASGISLVARSE----KSGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITG  483
            TS E     S +S V ++E    KS  ++LPKEMHEMKI+D+K+++ ++ KDME  +I G
Sbjct  61   TSLETGASTSSVSSVGKTETKEDKSSNDQLPKEMHEMKIRDEKANHHDD-KDMEETIING  119

Query  484  NGTETGQIIVTTVGGRNGEQKQVLSYMAERVVGTGSFGVVFQAKCLESGEAVAIKKVLXD  663
            NGTETG II TTVGGRNG+ KQ +SYMAER+VGTGSFGVVFQAKCLE+GEAVAIKKVL D
Sbjct  120  NGTETGHIIATTVGGRNGQPKQTISYMAERIVGTGSFGVVFQAKCLETGEAVAIKKVLQD  179

Query  664  RRYXNRELQIMRMLEHPNVV  723
            +RY NRELQIMR L+HPNVV
Sbjct  180  KRYKNRELQIMRFLDHPNVV  199



>ref|XP_008383272.1| PREDICTED: shaggy-related protein kinase theta [Malus domestica]
Length=474

 Score =   229 bits (583),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 122/200 (61%), Positives = 150/200 (75%), Gaps = 8/200 (4%)
 Frame = +1

Query  145  MNVMRRLKSVASGRSSVSDPQGGDSSIKRVKVAQDFDQRIAGKPESEEICTTAPMHEAAS  324
            MN+MRRLKS+ASGR+SVS   G DS+ KR K+ QD +++   +P + E   T       S
Sbjct  1    MNMMRRLKSIASGRTSVSSDPGIDSATKRAKMDQDNEKKANKQPNTVERSATGLEQHMTS  60

Query  325  TSQEDASGISLV-------ARSEKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITG  483
            TS E A+  S V        +  KS Y++LPKEMHEMKI+D+K+++ ++ KDME  +I G
Sbjct  61   TSVETAASTSSVSSVAKTETKEVKSSYDQLPKEMHEMKIRDEKANHHDD-KDMEETIING  119

Query  484  NGTETGQIIVTTVGGRNGEQKQVLSYMAERVVGTGSFGVVFQAKCLESGEAVAIKKVLXD  663
            NGTETG II TTVGG+NG+ KQ +SYMAERVVGTGSFGVVFQAKCLESGEAVAIKKVL D
Sbjct  120  NGTETGHIIATTVGGQNGQPKQTISYMAERVVGTGSFGVVFQAKCLESGEAVAIKKVLQD  179

Query  664  RRYXNRELQIMRMLEHPNVV  723
            +RY NRELQIMR+L+HPNVV
Sbjct  180  KRYKNRELQIMRLLDHPNVV  199



>ref|XP_008460173.1| PREDICTED: shaggy-related protein kinase theta [Cucumis melo]
Length=469

 Score =   229 bits (583),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 118/196 (60%), Positives = 150/196 (77%), Gaps = 5/196 (3%)
 Frame = +1

Query  145  MNVMRRLKSVASGRSSVSDPQGGDSSIKRVKVAQDFDQRIAGKPESEEICTTAPMHEAAS  324
            MN+MRRLKS+ASGR+S+S   GGD  IKR KV  + ++++ G         +    ++AS
Sbjct  1    MNMMRRLKSIASGRTSISSDPGGDFGIKRAKVDLETERKVGGVSNDVGRGASGLELDSAS  60

Query  325  TSQEDA---SGISLVARSEKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTE  495
            TS ++A   S IS +A +EKSG++ LP+EM EM+I+D+KS++    KD+EP V+ GNGTE
Sbjct  61   TSLDNAASTSNISSIAGAEKSGFDHLPREMREMRIRDEKSNHDE--KDLEPAVVNGNGTE  118

Query  496  TGQIIVTTVGGRNGEQKQVLSYMAERVVGTGSFGVVFQAKCLESGEAVAIKKVLXDRRYX  675
             GQII TTVGGRNG+ KQ +SYMAERVVGTGSFGVVFQAKCLE+ EAVAIKKVL D+RY 
Sbjct  119  AGQIIATTVGGRNGKPKQTISYMAERVVGTGSFGVVFQAKCLETNEAVAIKKVLQDKRYK  178

Query  676  NRELQIMRMLEHPNVV  723
            NRELQIMRML+H N+V
Sbjct  179  NRELQIMRMLDHSNIV  194



>ref|XP_008232743.1| PREDICTED: shaggy-related protein kinase theta-like [Prunus mume]
Length=474

 Score =   228 bits (582),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 120/200 (60%), Positives = 147/200 (74%), Gaps = 8/200 (4%)
 Frame = +1

Query  145  MNVMRRLKSVASGRSSVSDPQGGDSSIKRVKVAQDFDQRIAGKPESEEICTTAPMHEAAS  324
            MN+MRRLKS+ASGR+SVS   G DS  KR KV Q+ +++   +  + E   T+       
Sbjct  1    MNMMRRLKSIASGRTSVSSEPGVDSITKRAKVDQETEKKANKQSNTVEKSATSLEQHTVP  60

Query  325  TSQEDASGISLV-------ARSEKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITG  483
            TS E  +  S V       A+ EKS Y++LPKEM+EMKI+D+K++N +  KDME  VI G
Sbjct  61   TSLETVASTSDVSSIAKTEAKEEKSSYDQLPKEMNEMKIRDEKANNHDE-KDMEETVING  119

Query  484  NGTETGQIIVTTVGGRNGEQKQVLSYMAERVVGTGSFGVVFQAKCLESGEAVAIKKVLXD  663
            NGTETG II TTVGGRNG+ KQ +SYMAERVVGTGSFGVVFQAKCLE+ +AVAIKKVL D
Sbjct  120  NGTETGHIIATTVGGRNGQPKQTISYMAERVVGTGSFGVVFQAKCLETSDAVAIKKVLQD  179

Query  664  RRYXNRELQIMRMLEHPNVV  723
            +RY NRELQIMR+L+HPNVV
Sbjct  180  KRYKNRELQIMRLLDHPNVV  199



>ref|XP_007051910.1| Shaggy-like protein kinase 32 isoform 3, partial [Theobroma cacao]
 gb|EOX96067.1| Shaggy-like protein kinase 32 isoform 3, partial [Theobroma cacao]
Length=454

 Score =   227 bits (579),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 128/219 (58%), Positives = 149/219 (68%), Gaps = 27/219 (12%)
 Frame = +1

Query  145  MNVMRRLKSVASGRSSVS-DP----------------------QGGDSSIKRVKVAQDFD  255
            MNVMRRLKS+ASGRSS+S DP                      QGGDS  KR KV Q  +
Sbjct  1    MNVMRRLKSIASGRSSISSDPSVDKIMMTTIYMPCSLSYDAKYQGGDSGTKRAKVDQQAE  60

Query  256  QRIAGKPESEEICTTAPMHEAASTSQE---DASGISLVARSEKSGYEELPKEMHEMKIKD  426
             ++  +    E  TT      ASTS E     S ++ VAR EKSG ++LP EMHEM+I+D
Sbjct  61   CKVHEESNLVERSTTGLEQHMASTSLETVASTSNVTSVARMEKSGVDQLPNEMHEMRIRD  120

Query  427  DKSDNQNNLKDMEPVVITGNGTETGQIIVTTVGGRNGEQKQVLSYMAERVVGTGSFGVVF  606
            +K+ N +  KD+E  VI GNGTETGQII T VGGRNG+ KQ +SYMAERVVGTGSFGVVF
Sbjct  121  EKTANHDE-KDVEATVINGNGTETGQIISTVVGGRNGQPKQTISYMAERVVGTGSFGVVF  179

Query  607  QAKCLESGEAVAIKKVLXDRRYXNRELQIMRMLEHPNVV  723
            QAKCLE GE+VAIKKVL D+RY NRELQIMR+L HPNVV
Sbjct  180  QAKCLERGESVAIKKVLQDKRYKNRELQIMRILNHPNVV  218



>ref|XP_004144981.1| PREDICTED: shaggy-related protein kinase theta [Cucumis sativus]
 gb|KGN46198.1| hypothetical protein Csa_6G074020 [Cucumis sativus]
Length=469

 Score =   227 bits (579),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 120/198 (61%), Positives = 149/198 (75%), Gaps = 9/198 (5%)
 Frame = +1

Query  145  MNVMRRLKSVASGRSSVSDPQGGDSSIKRVKVAQDFDQRIAGKPESEEICTTAPMHEAAS  324
            MN+MRRLKS+ASGR+S+S   GGD  IKR KV Q+ +Q++ G   S+++   A      S
Sbjct  1    MNMMRRLKSIASGRTSISSDPGGDFGIKRAKVDQETEQKVGGV--SDDVGRAASGLGLDS  58

Query  325  TSQE-----DASGISLVARSEKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNG  489
            +S         S IS +A +EKSG++ LP+EM EM+IKD+KS++    KD+EP V+ GNG
Sbjct  59   SSSSLDNVASTSNISSIAGAEKSGFDHLPREMREMRIKDEKSNHDE--KDLEPAVVNGNG  116

Query  490  TETGQIIVTTVGGRNGEQKQVLSYMAERVVGTGSFGVVFQAKCLESGEAVAIKKVLXDRR  669
            TE GQII TTVGGRNG+ KQ +SYMAERVVGTGSFGVVFQAKCLE+ EAVAIKKVL D+R
Sbjct  117  TEAGQIIATTVGGRNGKPKQTISYMAERVVGTGSFGVVFQAKCLETNEAVAIKKVLQDKR  176

Query  670  YXNRELQIMRMLEHPNVV  723
            Y NRELQIMRML+H N+V
Sbjct  177  YKNRELQIMRMLDHSNIV  194



>ref|XP_010540275.1| PREDICTED: shaggy-related protein kinase theta-like [Tarenaya 
hassleriana]
Length=467

 Score =   227 bits (579),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 118/194 (61%), Positives = 147/194 (76%), Gaps = 3/194 (2%)
 Frame = +1

Query  145  MNVMRRLKSVASGRSSVSDPQGGDSSIKRVKVAQDFDQRIAGKPESEEICTTAPMHEAAS  324
            MNVMRRLKS+ASGR+S+S  QGGD  +KRVKV Q+ +Q I G+P   +   T      A 
Sbjct  1    MNVMRRLKSIASGRTSISSXQGGDYGLKRVKVDQEIEQ-ICGEPMQVDQNDTDLEQNPAG  59

Query  325  TSQEDASGISL-VARSEKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTETG  501
            T QE+ +G S   A +EKS YE+LP  M E + +D++ +N +  KDME  +I G+GTETG
Sbjct  60   TLQENVAGTSNDPAAAEKSTYEQLPDAMQETRTRDERHNNHDE-KDMETTIINGSGTETG  118

Query  502  QIIVTTVGGRNGEQKQVLSYMAERVVGTGSFGVVFQAKCLESGEAVAIKKVLXDRRYXNR  681
            Q+I TTVGGR+G+ KQ +SYMA+RVVGTGSFGVVFQAKCLE+GE VAIKKVL D+RY NR
Sbjct  119  QVITTTVGGRDGKPKQTISYMAQRVVGTGSFGVVFQAKCLETGEQVAIKKVLQDKRYKNR  178

Query  682  ELQIMRMLEHPNVV  723
            ELQIMR+L+HPNVV
Sbjct  179  ELQIMRVLDHPNVV  192



>ref|XP_004492676.1| PREDICTED: shaggy-related protein kinase theta-like [Cicer arietinum]
Length=472

 Score =   227 bits (578),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 117/200 (59%), Positives = 153/200 (77%), Gaps = 10/200 (5%)
 Frame = +1

Query  145  MNVMRRLKSVASGRSSVSDPQGGDSSIKRVKVAQDFDQRIAGKPESEEICTTAPMHE-AA  321
            MN+MRRLKS+ASGR+S+S   GGDS+ KR K  Q+ +++     E+  +     + E   
Sbjct  1    MNMMRRLKSIASGRTSISSDPGGDSTTKRAKFDQETERK--DNEETNRVERGGNIREKYV  58

Query  322  STSQED------ASGISLVARSEKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITG  483
              SQED      +S +S+V ++EKS  ++LPKE+HEMKIKD+KS N NN KDME  ++ G
Sbjct  59   DASQEDTSDTFNSSNVSMVNKTEKSSCDQLPKELHEMKIKDEKSKN-NNEKDMEATIVNG  117

Query  484  NGTETGQIIVTTVGGRNGEQKQVLSYMAERVVGTGSFGVVFQAKCLESGEAVAIKKVLXD  663
            NGTETGQII T++GGR+G+ K+++SYMAERVVGTGSFGVV+QAKC+E+GEAVAIKKVL D
Sbjct  118  NGTETGQIITTSIGGRDGQPKRIISYMAERVVGTGSFGVVYQAKCIETGEAVAIKKVLQD  177

Query  664  RRYXNRELQIMRMLEHPNVV  723
            +RY NRELQ+MRMLEH NV+
Sbjct  178  KRYKNRELQVMRMLEHTNVL  197



>ref|XP_003521276.1| PREDICTED: shaggy-related protein kinase theta [Glycine max]
Length=470

 Score =   227 bits (578),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 118/196 (60%), Positives = 151/196 (77%), Gaps = 4/196 (2%)
 Frame = +1

Query  145  MNVMRRLKSVASGRSSVSDPQGGDSSIKRVKVAQDFDQRIAGKPESEE-ICTTAP--MHE  315
            MN+MRRLKS+ASGR+S+S   GGDS+ KR K   + + +   K  + E ICT     +  
Sbjct  1    MNMMRRLKSIASGRTSISSDPGGDSNSKRAKFEPETEVKADEKTNTTETICTDQEQLIDT  60

Query  316  AASTSQEDASGISLVARSEKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTE  495
            +  TS    S +S VAR+EKSG+EELPKE++EMKI+D+KS N N+ KD+E  V++GNGTE
Sbjct  61   SKETSNVGTSDVSTVARTEKSGFEELPKELNEMKIRDEKSKN-NSEKDIEATVVSGNGTE  119

Query  496  TGQIIVTTVGGRNGEQKQVLSYMAERVVGTGSFGVVFQAKCLESGEAVAIKKVLXDRRYX  675
            TGQII T +GGR+G+ KQ +SYMAERVVGTGSFG+VFQAKCLE+GE+VAIKKVL DRRY 
Sbjct  120  TGQIITTAIGGRDGQPKQTISYMAERVVGTGSFGIVFQAKCLETGESVAIKKVLQDRRYK  179

Query  676  NRELQIMRMLEHPNVV  723
            NRELQ+MR +++ NVV
Sbjct  180  NRELQVMRTVDNSNVV  195



>ref|XP_003552357.1| PREDICTED: shaggy-related protein kinase theta-like [Glycine 
max]
 gb|KHN24281.1| Shaggy-related protein kinase theta [Glycine soja]
Length=467

 Score =   226 bits (576),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 113/193 (59%), Positives = 144/193 (75%), Gaps = 1/193 (1%)
 Frame = +1

Query  145  MNVMRRLKSVASGRSSVSDPQGGDSSIKRVKVAQDFDQRIAGKPESEEICTTAPMHEAAS  324
            MN+MRRLKS+ASGR+SVS   GGD + KRVK  Q+ + ++  +    E C         +
Sbjct  1    MNMMRRLKSIASGRTSVSSDPGGDCTTKRVKFDQETEGKVNEETYPNERCGKDQEQYVDA  60

Query  325  TSQEDASGISLVARSEKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTETGQ  504
              +   S +  VAR+EKSG+++LPKE++EMKI DDK  N NN KDME  ++ GNGTETGQ
Sbjct  61   LKESVNSNVPSVARTEKSGFDQLPKELNEMKIGDDKGKN-NNKKDMEATIVNGNGTETGQ  119

Query  505  IIVTTVGGRNGEQKQVLSYMAERVVGTGSFGVVFQAKCLESGEAVAIKKVLXDRRYXNRE  684
            I  T +GGR+G+ K+ +SYMAERVVGTGSFGVV+QAKCLE+GEAVAIKKVL D+RY NRE
Sbjct  120  ITTTVIGGRDGQPKRTISYMAERVVGTGSFGVVYQAKCLETGEAVAIKKVLQDKRYKNRE  179

Query  685  LQIMRMLEHPNVV  723
            LQ+MRML+H NV+
Sbjct  180  LQVMRMLDHTNVL  192



>emb|CAC08564.1| wound-induced GSK-3-like protein [Medicago sativa subsp. x varia]
Length=468

 Score =   226 bits (576),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 118/198 (60%), Positives = 149/198 (75%), Gaps = 10/198 (5%)
 Frame = +1

Query  145  MNVMRRLKSVASGRSSVSDPQGGDSSIKRVKVAQDFDQRIAGKP----ESEEICTTAPMH  312
            MN+MRRLKS+ASGR+S+S   GGDS+ KRVK+ Q+ ++   G         E C  A   
Sbjct  1    MNMMRRLKSIASGRTSISSDPGGDSNSKRVKLDQETEKVYEGINSLGRNDREQCVDASKE  60

Query  313  EAASTSQEDASGISLVARSEK-SGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNG  489
             +  TS E    +S   ++EK SG++ELPKE+HEMKI+D+KS N NN KD+E   ++GNG
Sbjct  61   ASVGTSNE----VSTETKTEKKSGFDELPKELHEMKIRDEKSKN-NNEKDIEATTVSGNG  115

Query  490  TETGQIIVTTVGGRNGEQKQVLSYMAERVVGTGSFGVVFQAKCLESGEAVAIKKVLXDRR  669
            TETGQII TT+ GR+G+ KQ +SYMAERVVGTGSFGVVFQAKCLE+ EAVAIKKVL D+R
Sbjct  116  TETGQIITTTIAGRDGQPKQTISYMAERVVGTGSFGVVFQAKCLETNEAVAIKKVLQDKR  175

Query  670  YXNRELQIMRMLEHPNVV  723
            Y NRELQ+MRM++HPN+V
Sbjct  176  YKNRELQVMRMVDHPNIV  193



>ref|XP_003534597.1| PREDICTED: shaggy-related protein kinase theta [Glycine max]
Length=460

 Score =   225 bits (574),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 119/195 (61%), Positives = 146/195 (75%), Gaps = 12/195 (6%)
 Frame = +1

Query  145  MNVMRRLKSVASGRSSVSDPQGGDSSIKRVKVAQDFDQRIAGKPESEEICTTAPMHEAAS  324
            MNVMRRLKS+ASGR+S+S   GGD + KR K    FDQ   GK   E    T P +E   
Sbjct  1    MNVMRRLKSIASGRTSISSDPGGDCTTKRAK----FDQDTEGKVNEE----TYP-NERCG  51

Query  325  TSQEDA--SGISLVARSEKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTET  498
              QE    S +  V R+EKSGY++LPKE++EMKI DDK  N NN KDME  +++GNGTET
Sbjct  52   KDQEHHVDSNVPSVPRTEKSGYDQLPKELNEMKIGDDKGKN-NNEKDMEATIVSGNGTET  110

Query  499  GQIIVTTVGGRNGEQKQVLSYMAERVVGTGSFGVVFQAKCLESGEAVAIKKVLXDRRYXN  678
            G+II T +GGR+G+ K+ +SY+AERVVGTGSFGVV+QAKCLE+GEAVAIKKVL D+RY N
Sbjct  111  GEIITTAIGGRDGQPKRTISYIAERVVGTGSFGVVYQAKCLETGEAVAIKKVLQDKRYKN  170

Query  679  RELQIMRMLEHPNVV  723
            RELQ+MRML+H NV+
Sbjct  171  RELQVMRMLDHTNVL  185



>gb|KHN27286.1| Shaggy-related protein kinase theta [Glycine soja]
Length=470

 Score =   225 bits (574),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 117/196 (60%), Positives = 151/196 (77%), Gaps = 4/196 (2%)
 Frame = +1

Query  145  MNVMRRLKSVASGRSSVSDPQGGDSSIKRVKVAQDFDQRIAGKPESEE-ICTTAP--MHE  315
            MN+MRRLKS+ASGR+S+S   GGD++ KR K   + + +   K  + E ICT     +  
Sbjct  1    MNMMRRLKSIASGRTSISSDPGGDNNSKRAKFEPETEVKADEKTNTTETICTDQEQLIDT  60

Query  316  AASTSQEDASGISLVARSEKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTE  495
            +  TS    S +S VAR+EKSG+EELPKE++EMKI+D+KS N N+ KD+E  V++GNGTE
Sbjct  61   SKETSNVGTSDVSTVARTEKSGFEELPKELNEMKIRDEKSKN-NSEKDIEATVVSGNGTE  119

Query  496  TGQIIVTTVGGRNGEQKQVLSYMAERVVGTGSFGVVFQAKCLESGEAVAIKKVLXDRRYX  675
            TGQII T +GGR+G+ KQ +SYMAERVVGTGSFG+VFQAKCLE+GE+VAIKKVL DRRY 
Sbjct  120  TGQIITTAIGGRDGQPKQTISYMAERVVGTGSFGIVFQAKCLETGESVAIKKVLQDRRYK  179

Query  676  NRELQIMRMLEHPNVV  723
            NRELQ+MR +++ NVV
Sbjct  180  NRELQVMRTVDNSNVV  195



>ref|XP_007139956.1| hypothetical protein PHAVU_008G072800g [Phaseolus vulgaris]
 gb|ESW11950.1| hypothetical protein PHAVU_008G072800g [Phaseolus vulgaris]
Length=466

 Score =   225 bits (574),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 113/193 (59%), Positives = 147/193 (76%), Gaps = 2/193 (1%)
 Frame = +1

Query  145  MNVMRRLKSVASGRSSVSDPQGGDSSIKRVKVAQDFDQRIAGKPESEEICTTAPMHEAAS  324
            MN+MRRLKS+ASGR+SVS   G D + KR K  Q  ++++  +  S E C         +
Sbjct  1    MNMMRRLKSIASGRTSVSSDPGSDFTTKRPKFDQGTEEKVNEETYSNEKCGKDQEQYGDA  60

Query  325  TSQEDASGISLVARSEKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTETGQ  504
            +++ D S ++  ARSEKSGY++LPKE++EMKI DDK  N NN KDME  ++ GNGTETGQ
Sbjct  61   STESDHSNVA-TARSEKSGYDQLPKELNEMKIGDDKGKN-NNEKDMEATIVNGNGTETGQ  118

Query  505  IIVTTVGGRNGEQKQVLSYMAERVVGTGSFGVVFQAKCLESGEAVAIKKVLXDRRYXNRE  684
            II T +GGR+G+ K+ +SYMAERVVGTGSFGVV+QAKC+E+GEAVAIKKVL D+RY NRE
Sbjct  119  IITTAIGGRDGQPKRTISYMAERVVGTGSFGVVYQAKCIETGEAVAIKKVLQDKRYKNRE  178

Query  685  LQIMRMLEHPNVV  723
            LQ+MR+L+H NV+
Sbjct  179  LQVMRILDHANVL  191



>gb|KHN29413.1| Shaggy-related protein kinase theta [Glycine soja]
Length=460

 Score =   224 bits (571),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 119/195 (61%), Positives = 145/195 (74%), Gaps = 12/195 (6%)
 Frame = +1

Query  145  MNVMRRLKSVASGRSSVSDPQGGDSSIKRVKVAQDFDQRIAGKPESEEICTTAPMHEAAS  324
            MNVMRRLKS+ASGR+S+S   GGD + KR K    FDQ   GK   E    T P +E   
Sbjct  1    MNVMRRLKSIASGRTSISSDPGGDCTTKRAK----FDQDTEGKVNEE----TYP-NERCG  51

Query  325  TSQEDA--SGISLVARSEKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTET  498
              QE    S +  V R+EKSGY +LPKE++EMKI DDK  N NN KDME  +++GNGTET
Sbjct  52   KDQEHHVDSNVPSVPRTEKSGYYQLPKELNEMKIGDDKGKN-NNEKDMEATIVSGNGTET  110

Query  499  GQIIVTTVGGRNGEQKQVLSYMAERVVGTGSFGVVFQAKCLESGEAVAIKKVLXDRRYXN  678
            G+II T +GGR+G+ K+ +SY+AERVVGTGSFGVV+QAKCLE+GEAVAIKKVL D+RY N
Sbjct  111  GEIITTAIGGRDGQPKRTISYIAERVVGTGSFGVVYQAKCLETGEAVAIKKVLQDKRYKN  170

Query  679  RELQIMRMLEHPNVV  723
            RELQ+MRML+H NV+
Sbjct  171  RELQVMRMLDHTNVL  185



>ref|XP_010919260.1| PREDICTED: shaggy-related protein kinase NtK-1 isoform X2 [Elaeis 
guineensis]
Length=403

 Score =   223 bits (567),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 116/201 (58%), Positives = 145/201 (72%), Gaps = 15/201 (7%)
 Frame = +1

Query  145  MNVMRRLKSVASGRSSVSDPQGGDSSIKRVKVAQDFDQRIAGKPES--------EEICTT  300
            M++MRRLKS+ASGRSS+SDP GGD   KR K  QD    ++ +P          ++  T+
Sbjct  1    MHMMRRLKSIASGRSSISDP-GGDPGTKRAKFDQDGAGEVSSEPHLVEDKAVGLDQNMTS  59

Query  301  APMHEAASTSQEDASGISLVARSEKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVIT  480
              +H  ASTS  D       AR+E +  ++LPKEMHEM IKDDK ++ N  KD E  +++
Sbjct  60   THLHLDASTSNMDPP-----ARTEDAAVDQLPKEMHEMTIKDDKVEDHNE-KDTEGTMVS  113

Query  481  GNGTETGQIIVTTVGGRNGEQKQVLSYMAERVVGTGSFGVVFQAKCLESGEAVAIKKVLX  660
            GNGTE GQII TT+GGRNG+ KQ +SYMAERVVGTGSFG+VFQAKC+E+GE VAIKKVL 
Sbjct  114  GNGTERGQIIATTIGGRNGQPKQTISYMAERVVGTGSFGIVFQAKCVETGETVAIKKVLQ  173

Query  661  DRRYXNRELQIMRMLEHPNVV  723
            D+RY NRELQIM +L+HPNVV
Sbjct  174  DKRYKNRELQIMHLLDHPNVV  194



>ref|XP_007218957.1| hypothetical protein PRUPE_ppa003552mg [Prunus persica]
 gb|EMJ20156.1| hypothetical protein PRUPE_ppa003552mg [Prunus persica]
Length=566

 Score =   226 bits (577),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 119/200 (60%), Positives = 146/200 (73%), Gaps = 8/200 (4%)
 Frame = +1

Query  145  MNVMRRLKSVASGRSSVSDPQGGDSSIKRVKVAQDFDQRIAGKPESEEICTTAPMHEAAS  324
            MN+MRRLKS+ASGR+SVS   G DS  KR K  Q+ +++   +  + E   T+       
Sbjct  93   MNMMRRLKSIASGRTSVSSEPGVDSITKRAKFDQETEKKANKQSNTVEKSATSLEQHTVP  152

Query  325  TSQEDASGISLV-------ARSEKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITG  483
            TS E  +  S V       A+ EKS Y++LPKEM+EMKI+D+K++N +  KDME  VI G
Sbjct  153  TSLETVASTSDVSSIAKTEAKEEKSSYDQLPKEMNEMKIRDEKANNHDE-KDMEETVING  211

Query  484  NGTETGQIIVTTVGGRNGEQKQVLSYMAERVVGTGSFGVVFQAKCLESGEAVAIKKVLXD  663
            NGTETG II TTVGGRNG+ KQ +SYMAERVVGTGSFGVVFQAKCLE+ +AVAIKKVL D
Sbjct  212  NGTETGHIIATTVGGRNGQPKQTISYMAERVVGTGSFGVVFQAKCLETSDAVAIKKVLQD  271

Query  664  RRYXNRELQIMRMLEHPNVV  723
            +RY NRELQIMR+L+HPNVV
Sbjct  272  KRYKNRELQIMRLLDHPNVV  291



>gb|KEH18946.1| shaggy-like kinase [Medicago truncatula]
Length=468

 Score =   224 bits (571),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 115/198 (58%), Positives = 152/198 (77%), Gaps = 10/198 (5%)
 Frame = +1

Query  145  MNVMRRLKSVASGRSSVSDPQGGDSSIKRVKVAQDFDQRIAG-----KPESEEICTTAPM  309
            MN+MRRLKS+ASGR+S+S   GGDS+ KRVK+ Q+ ++   G     + + E+   ++  
Sbjct  1    MNMMRRLKSIASGRTSISSDPGGDSNSKRVKLDQETEKAYEGTNTLDRNDREQRVDSS--  58

Query  310  HEAASTSQEDASGISLVARSEKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNG  489
            +EA   +  + S I+     +KSG++ELPKE+HEMKI+D+KS N NN KD+E   ++GNG
Sbjct  59   NEATVGTSNEVSAIT--KTEKKSGFDELPKELHEMKIRDEKSKN-NNEKDIEATTVSGNG  115

Query  490  TETGQIIVTTVGGRNGEQKQVLSYMAERVVGTGSFGVVFQAKCLESGEAVAIKKVLXDRR  669
            TETGQII TT+ GR+G+ KQ +SYMAERVVGTGSFGVVFQAKCLE+ EAVAIKKVL D+R
Sbjct  116  TETGQIITTTIAGRDGQPKQTISYMAERVVGTGSFGVVFQAKCLETNEAVAIKKVLQDKR  175

Query  670  YXNRELQIMRMLEHPNVV  723
            Y NRELQ+MRM++HPN+V
Sbjct  176  YKNRELQVMRMVDHPNIV  193



>ref|XP_010090625.1| Shaggy-related protein kinase theta [Morus notabilis]
 gb|EXB40229.1| Shaggy-related protein kinase theta [Morus notabilis]
Length=503

 Score =   224 bits (572),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 118/204 (58%), Positives = 148/204 (73%), Gaps = 13/204 (6%)
 Frame = +1

Query  145  MNVMRRLKSVASGRSSVSDPQGGDSSIKRVKVAQDFDQRIAGKPESEEICTTAPMHEAAS  324
            M +MRRLKS+ASGR+S+S   G D+S KR KV Q+ +Q +  K    E           S
Sbjct  1    MYMMRRLKSIASGRTSISSDPGVDTSTKRAKVDQETEQ-VNPKSNGAEAIAANIEQNVPS  59

Query  325  TSQEDASGISLVAR-----------SEKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEPV  471
            TS E+ +  S+ +            +E+SGY++LPKEMHEMKI+D++S N ++ KD+E  
Sbjct  60   TSLENVACTSIASSMVKPEAKADDVAERSGYDQLPKEMHEMKIRDERS-NSHDEKDVEAT  118

Query  472  VITGNGTETGQIIVTTVGGRNGEQKQVLSYMAERVVGTGSFGVVFQAKCLESGEAVAIKK  651
            VI G+GTE GQII TTVGGRNG+ KQ +SYMAERVVGTGSFGVVFQAKCLESGEAVAIKK
Sbjct  119  VINGHGTEAGQIIATTVGGRNGQPKQTISYMAERVVGTGSFGVVFQAKCLESGEAVAIKK  178

Query  652  VLXDRRYXNRELQIMRMLEHPNVV  723
            VL D+RY NRELQ+MR+L+HPNV+
Sbjct  179  VLQDKRYKNRELQVMRLLDHPNVI  202



>ref|XP_010919259.1| PREDICTED: shaggy-related protein kinase epsilon isoform X1 [Elaeis 
guineensis]
Length=469

 Score =   223 bits (567),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 116/201 (58%), Positives = 145/201 (72%), Gaps = 15/201 (7%)
 Frame = +1

Query  145  MNVMRRLKSVASGRSSVSDPQGGDSSIKRVKVAQDFDQRIAGKPES--------EEICTT  300
            M++MRRLKS+ASGRSS+SDP GGD   KR K  QD    ++ +P          ++  T+
Sbjct  1    MHMMRRLKSIASGRSSISDP-GGDPGTKRAKFDQDGAGEVSSEPHLVEDKAVGLDQNMTS  59

Query  301  APMHEAASTSQEDASGISLVARSEKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVIT  480
              +H  ASTS  D       AR+E +  ++LPKEMHEM IKDDK ++ N  KD E  +++
Sbjct  60   THLHLDASTSNMDPP-----ARTEDAAVDQLPKEMHEMTIKDDKVEDHNE-KDTEGTMVS  113

Query  481  GNGTETGQIIVTTVGGRNGEQKQVLSYMAERVVGTGSFGVVFQAKCLESGEAVAIKKVLX  660
            GNGTE GQII TT+GGRNG+ KQ +SYMAERVVGTGSFG+VFQAKC+E+GE VAIKKVL 
Sbjct  114  GNGTERGQIIATTIGGRNGQPKQTISYMAERVVGTGSFGIVFQAKCVETGETVAIKKVLQ  173

Query  661  DRRYXNRELQIMRMLEHPNVV  723
            D+RY NRELQIM +L+HPNVV
Sbjct  174  DKRYKNRELQIMHLLDHPNVV  194



>ref|XP_004510856.1| PREDICTED: shaggy-related protein kinase theta-like [Cicer arietinum]
Length=467

 Score =   221 bits (562),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 117/199 (59%), Positives = 152/199 (76%), Gaps = 13/199 (7%)
 Frame = +1

Query  145  MNVMRRLKSVASGRSSVSDPQGGDSSIKRVKVAQDFDQR------IAGKPESEEICTTAP  306
            MN+MRRLKS+ASGR+S+S   GGDS+ KR K+ Q+ +         +G+ + E+      
Sbjct  1    MNMMRRLKSIASGRTSISSDPGGDSNSKRAKLDQETENNGNEETNTSGRNDREQRV----  56

Query  307  MHEAASTSQEDASGISLVARSEKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGN  486
              +A+  +    S +S V ++EKSG+++LPKE+HEMKI+D+KS N NN KD+    ++GN
Sbjct  57   --DASKETTVGTSTVSTVTKTEKSGFDQLPKELHEMKIRDEKSKN-NNEKDVAAATVSGN  113

Query  487  GTETGQIIVTTVGGRNGEQKQVLSYMAERVVGTGSFGVVFQAKCLESGEAVAIKKVLXDR  666
            GTETGQII TT+GGR+G+ KQ +SYMAERVVGTGSFGVVFQAKCLE+GEAVAIKKVL D+
Sbjct  114  GTETGQIITTTIGGRDGQPKQTISYMAERVVGTGSFGVVFQAKCLETGEAVAIKKVLQDK  173

Query  667  RYXNRELQIMRMLEHPNVV  723
            RY NRELQ+MRM+EHPNVV
Sbjct  174  RYKNRELQVMRMVEHPNVV  192



>ref|XP_008385705.1| PREDICTED: shaggy-related protein kinase theta-like [Malus domestica]
Length=474

 Score =   219 bits (559),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 119/200 (60%), Positives = 148/200 (74%), Gaps = 8/200 (4%)
 Frame = +1

Query  145  MNVMRRLKSVASGRSSVSDPQGGDSSIKRVKVAQDFDQRIAGKPESEEICTTAPMHEAAS  324
            MN+MRRLKS+ASGR+SVS   G DS+ KR KV Q+ +++   +  + E   T      AS
Sbjct  1    MNMMRRLKSIASGRTSVSSDPGIDSTTKRAKVDQENEKKANKQSNTVEGSATGLEQHMAS  60

Query  325  TSQEDASGISLV-------ARSEKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITG  483
            TS E A+  S V        + +KS  ++LPKEMHEMKI+D+K+++ ++ KDME  +I G
Sbjct  61   TSLETAASTSSVSSVGKTETKEDKSSNDQLPKEMHEMKIRDEKANHHDD-KDMEETIING  119

Query  484  NGTETGQIIVTTVGGRNGEQKQVLSYMAERVVGTGSFGVVFQAKCLESGEAVAIKKVLXD  663
            NGTETG II T VGG+NG+ KQ +SYMAERVVGTGSFGVVFQAKCLE+GEAVAIKKVL D
Sbjct  120  NGTETGHIIATKVGGQNGQPKQTISYMAERVVGTGSFGVVFQAKCLETGEAVAIKKVLQD  179

Query  664  RRYXNRELQIMRMLEHPNVV  723
            +RY NRELQIMR L+HPNVV
Sbjct  180  KRYKNRELQIMRFLDHPNVV  199



>ref|XP_010523040.1| PREDICTED: shaggy-related protein kinase theta [Tarenaya hassleriana]
Length=467

 Score =   219 bits (557),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 114/194 (59%), Positives = 143/194 (74%), Gaps = 3/194 (2%)
 Frame = +1

Query  145  MNVMRRLKSVASGRSSVSDPQGGDSSIKRVKVAQDFDQRIAGKPESEEICTTAPMHEAAS  324
            MNVMRRLKS+ASGR+S+S   GGD  +KR KV Q+ +++I G+P   +   +     AA 
Sbjct  1    MNVMRRLKSIASGRTSISSDPGGDYGLKRAKVDQE-NEQICGEPMQVDQNVSGLEQNAAI  59

Query  325  TSQEDASGISL-VARSEKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTETG  501
              QE  +G S   A +EK  YE+LP  M EM+I+D+++ N    KDME  ++ GNGTETG
Sbjct  60   ILQESVAGASNDPAAAEKPAYEKLPDVMLEMRIRDERNANSEE-KDMETTIVNGNGTETG  118

Query  502  QIIVTTVGGRNGEQKQVLSYMAERVVGTGSFGVVFQAKCLESGEAVAIKKVLXDRRYXNR  681
            Q+I TTVGGR+G  KQ +SYMA+RVVGTGSFGVVFQAKCLE+GE VAIKKVL D+RY NR
Sbjct  119  QVITTTVGGRDGMPKQTISYMAQRVVGTGSFGVVFQAKCLETGEQVAIKKVLQDKRYKNR  178

Query  682  ELQIMRMLEHPNVV  723
            ELQIMR+L+HPN V
Sbjct  179  ELQIMRLLDHPNAV  192



>gb|ACU17807.1| unknown [Glycine max]
Length=173

 Score =   208 bits (529),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 105/181 (58%), Positives = 132/181 (73%), Gaps = 8/181 (4%)
 Frame = +1

Query  145  MNVMRRLKSVASGRSSVSDPQGGDSSIKRVKVAQDFDQRIAGKPESEEICTTAPMHEAAS  324
            MNVMRRLKS+ASGR+S+S   GGD + KR K  QD + ++  +    E C     H   S
Sbjct  1    MNVMRRLKSIASGRTSISSDPGGDCTTKRAKFDQDTEGKVNEETYPNERCGKDQEHHVDS  60

Query  325  TSQEDASGISLVARSEKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTETGQ  504
                    +  V R+EKSGY++LPKE++EMKI DDK  N NN KDME  +++GNGTETG+
Sbjct  61   N-------VPSVPRTEKSGYDQLPKELNEMKIGDDKGKN-NNEKDMEATIVSGNGTETGE  112

Query  505  IIVTTVGGRNGEQKQVLSYMAERVVGTGSFGVVFQAKCLESGEAVAIKKVLXDRRYXNRE  684
            II T +GGR+G+ K+ +SY+AERVVGTGSFGVV+QAKCLE+GEAVAIKKVL D+RY NRE
Sbjct  113  IITTAIGGRDGQPKRTISYIAERVVGTGSFGVVYQAKCLETGEAVAIKKVLQDKRYKNRE  172

Query  685  L  687
            L
Sbjct  173  L  173



>ref|XP_008799541.1| PREDICTED: shaggy-related protein kinase alpha-like isoform X2 
[Phoenix dactylifera]
Length=469

 Score =   217 bits (552),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 119/205 (58%), Positives = 144/205 (70%), Gaps = 23/205 (11%)
 Frame = +1

Query  145  MNVMRRLKSVASGRSSVSDPQGGDSSIKRVKVAQDFDQRIAGKPESEEIC----------  294
            M++MRRLKS+ASGRSS+SDP GGD   KR K    FDQ  AG+  SE+            
Sbjct  1    MHMMRRLKSIASGRSSISDP-GGDPGTKRAK----FDQDGAGEVSSEQHLVEDKSVGLDH  55

Query  295  --TTAPMHEAASTSQEDASGISLVARSEKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEP  468
              T+  +   ASTS  D       AR+E +  ++LPKEMHEM IKDDK ++ N  KD E 
Sbjct  56   NMTSTHLPLDASTSNMDPP-----ARTEDAAVDQLPKEMHEMTIKDDKVEDHNE-KDTEG  109

Query  469  VVITGNGTETGQIIVTTVGGRNGEQKQVLSYMAERVVGTGSFGVVFQAKCLESGEAVAIK  648
             ++ GNGTE GQII TT+GGRNG+ KQ +SYMAERVVGTGSFG+VFQAKC+E+GE VAIK
Sbjct  110  TMMIGNGTERGQIIATTIGGRNGQPKQTISYMAERVVGTGSFGIVFQAKCVETGETVAIK  169

Query  649  KVLXDRRYXNRELQIMRMLEHPNVV  723
            KVL D+RY NRELQIM +L+HPNVV
Sbjct  170  KVLQDKRYKNRELQIMHLLDHPNVV  194



>ref|XP_008799540.1| PREDICTED: shaggy-related protein kinase alpha-like isoform X1 
[Phoenix dactylifera]
Length=474

 Score =   217 bits (553),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 119/205 (58%), Positives = 144/205 (70%), Gaps = 23/205 (11%)
 Frame = +1

Query  145  MNVMRRLKSVASGRSSVSDPQGGDSSIKRVKVAQDFDQRIAGKPESEEIC----------  294
            M++MRRLKS+ASGRSS+SDP GGD   KR K    FDQ  AG+  SE+            
Sbjct  1    MHMMRRLKSIASGRSSISDP-GGDPGTKRAK----FDQDGAGEVSSEQHLVEDKSVGLDH  55

Query  295  --TTAPMHEAASTSQEDASGISLVARSEKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEP  468
              T+  +   ASTS  D       AR+E +  ++LPKEMHEM IKDDK ++ N  KD E 
Sbjct  56   NMTSTHLPLDASTSNMDPP-----ARTEDAAVDQLPKEMHEMTIKDDKVEDHNE-KDTEG  109

Query  469  VVITGNGTETGQIIVTTVGGRNGEQKQVLSYMAERVVGTGSFGVVFQAKCLESGEAVAIK  648
             ++ GNGTE GQII TT+GGRNG+ KQ +SYMAERVVGTGSFG+VFQAKC+E+GE VAIK
Sbjct  110  TMMIGNGTERGQIIATTIGGRNGQPKQTISYMAERVVGTGSFGIVFQAKCVETGETVAIK  169

Query  649  KVLXDRRYXNRELQIMRMLEHPNVV  723
            KVL D+RY NRELQIM +L+HPNVV
Sbjct  170  KVLQDKRYKNRELQIMHLLDHPNVV  194



>ref|XP_010940878.1| PREDICTED: shaggy-related protein kinase epsilon-like [Elaeis 
guineensis]
Length=469

 Score =   217 bits (552),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 117/205 (57%), Positives = 151/205 (74%), Gaps = 23/205 (11%)
 Frame = +1

Query  145  MNVMRRLKSVASGRSSVSDPQGGDSSIKRVKVAQDFDQRIAGKPESE------------E  288
            MNVMRRLKSVASGRSSVSDP GGDS +K+VKV QD    + GK  +E            +
Sbjct  1    MNVMRRLKSVASGRSSVSDP-GGDSGMKKVKVEQD----VEGKESTEHSVVEDKAMGLKQ  55

Query  289  ICTTAPMHEAASTSQEDASGISLVARSEKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEP  468
            + T+A +   ASTS +  +      R++ +G ++LPKEM+EM I++DK+D  NN KD++ 
Sbjct  56   LTTSAHLDSDASTSSKGTT-----TRAKNAGIDQLPKEMYEMTIRNDKADG-NNDKDVKA  109

Query  469  VVITGNGTETGQIIVTTVGGRNGEQKQVLSYMAERVVGTGSFGVVFQAKCLESGEAVAIK  648
             V+ GNGTETG +I  T+GG+NG+ KQ +SYMA+ VVGTGSFGVVFQAKCL +GEAVAIK
Sbjct  110  TVLKGNGTETGHLITATIGGQNGQPKQTVSYMADCVVGTGSFGVVFQAKCLGTGEAVAIK  169

Query  649  KVLXDRRYXNRELQIMRMLEHPNVV  723
            KVL D+R+ NRELQIM++L+HPNVV
Sbjct  170  KVLQDKRFKNRELQIMQLLDHPNVV  194



>ref|XP_006375322.1| shaggy-related protein kinase theta [Populus trichocarpa]
 gb|ERP53119.1| shaggy-related protein kinase theta [Populus trichocarpa]
Length=438

 Score =   213 bits (543),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 106/160 (66%), Positives = 129/160 (81%), Gaps = 4/160 (3%)
 Frame = +1

Query  253  DQRIAGKPESEEICTTAPMHEAASTSQEDA---SGISLVARSEKSGYEELPKEMHEMKIK  423
            +Q+I G+    E   T      ASTSQE+A   S ++ V R+EK GY++LPKEMHEMKI+
Sbjct  2    EQKIDGESYLVERSVTEQEQHMASTSQENAASASNVTSVTRTEKPGYDQLPKEMHEMKIR  61

Query  424  DDKSDNQNNLKDMEPVVITGNGTETGQIIVTTVGGRNGEQKQVLSYMAERVVGTGSFGVV  603
            DDK+ N +  KDME  +++GNGTETGQII TTVGGRNG+ KQ++SYMAERVVGTGSFGVV
Sbjct  62   DDKNTNHDE-KDMEAAIVSGNGTETGQIIATTVGGRNGQPKQIISYMAERVVGTGSFGVV  120

Query  604  FQAKCLESGEAVAIKKVLXDRRYXNRELQIMRMLEHPNVV  723
            +QAKCLE+GEAVAIKKVL D+RY NRELQIMR+L+HPNVV
Sbjct  121  YQAKCLETGEAVAIKKVLQDKRYKNRELQIMRLLDHPNVV  160



>ref|XP_002465046.1| hypothetical protein SORBIDRAFT_01g031220 [Sorghum bicolor]
 gb|EER92044.1| hypothetical protein SORBIDRAFT_01g031220 [Sorghum bicolor]
Length=470

 Score =   213 bits (543),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 118/197 (60%), Positives = 144/197 (73%), Gaps = 6/197 (3%)
 Frame = +1

Query  145  MNVMRRLKSVASGRSSVSDPQGGDSSIKRVKVAQDFDQRIAGKPESEEICTTAPMHEAAS  324
            M++MRRLKS+ASGRSSVSDP GGDS  KR K  QD    I  +P   E        E++S
Sbjct  1    MHMMRRLKSIASGRSSVSDP-GGDSGSKRPKFEQDGAGDIVIEPHLTEEKPVRIDQESSS  59

Query  325  TSQEDASGISLV----ARSEKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGT  492
            +S  DA   +      A++E+ G + LPKEM++M I DDK+D  N+ K+ E V + GNGT
Sbjct  60   SSNRDAEASTSTSMKPAKTEEPGADILPKEMNDMTISDDKADGHND-KEGEGVTLDGNGT  118

Query  493  ETGQIIVTTVGGRNGEQKQVLSYMAERVVGTGSFGVVFQAKCLESGEAVAIKKVLXDRRY  672
            ETGQIIVTT+GG NG+ KQ +SYMAERVVGTGSFGVVFQAKCLE+GE VAIKKVL D+RY
Sbjct  119  ETGQIIVTTIGGHNGKPKQKVSYMAERVVGTGSFGVVFQAKCLETGETVAIKKVLQDKRY  178

Query  673  XNRELQIMRMLEHPNVV  723
             NRELQ M++L+HPNVV
Sbjct  179  KNRELQTMQLLDHPNVV  195



>ref|XP_008803034.1| PREDICTED: shaggy-related protein kinase epsilon-like isoform 
X1 [Phoenix dactylifera]
Length=468

 Score =   213 bits (542),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 114/201 (57%), Positives = 148/201 (74%), Gaps = 15/201 (7%)
 Frame = +1

Query  145  MNVMRRLKSVASGRSSVSDPQGGDSSIKRVKVAQDFDQRIAGKPES--------EEICTT  300
            MNVMRRLKS+ASGRSSVSDP GGDSS+K+VKV QD + +   +           E++ T+
Sbjct  1    MNVMRRLKSIASGRSSVSDP-GGDSSMKKVKVEQDVEGKECTEHSVVENKAMGLEQLTTS  59

Query  301  APMHEAASTSQEDASGISLVARSEKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVIT  480
            A +   ASTS +  +      R + +G ++L KEMHEM I++DK+D  N+ K+++  VI 
Sbjct  60   AHLDSDASTSSKGPT-----TRLKNAGIDQLSKEMHEMTIRNDKADGHND-KNVKATVIK  113

Query  481  GNGTETGQIIVTTVGGRNGEQKQVLSYMAERVVGTGSFGVVFQAKCLESGEAVAIKKVLX  660
            G  TETG +I TT+GG+NG+ KQ +SYMA+RVVGTGSFGVV QAKCL +GEAVAIKKVL 
Sbjct  114  GKSTETGHLITTTIGGQNGQPKQTISYMADRVVGTGSFGVVLQAKCLGTGEAVAIKKVLQ  173

Query  661  DRRYXNRELQIMRMLEHPNVV  723
            D+RY NRELQIM++L+HPNVV
Sbjct  174  DKRYKNRELQIMQLLDHPNVV  194



>ref|XP_006396267.1| hypothetical protein EUTSA_v10028631mg [Eutrema salsugineum]
 gb|ESQ37720.1| hypothetical protein EUTSA_v10028631mg [Eutrema salsugineum]
Length=473

 Score =   213 bits (541),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 113/195 (58%), Positives = 146/195 (75%), Gaps = 4/195 (2%)
 Frame = +1

Query  145  MNVMRRLKSVASGRSSVSDPQGGDSSIKRVKVAQDFDQRIAGKP-ESEEICTTAPMHEAA  321
            MNVMRRLKS+ASGR+S+S   GGD  +KR K+ QD ++ + G P + +       M  A 
Sbjct  1    MNVMRRLKSIASGRTSISSDPGGDYGLKRAKLDQD-NENLCGDPMQVDHNSACFEMKIAD  59

Query  322  STSQEDASGISLV-ARSEKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTET  498
              SQE  +G S V A +EKS  ++LP+ M EM+I+D+++ N+   KDME  ++ G+GTET
Sbjct  60   MVSQESVAGTSNVPAVTEKSVDDQLPEVMIEMRIRDERNANREE-KDMETTIVNGSGTET  118

Query  499  GQIIVTTVGGRNGEQKQVLSYMAERVVGTGSFGVVFQAKCLESGEAVAIKKVLXDRRYXN  678
            GQ+I TTVGGR+G+ KQ +SYMA+RVVGTGSFGVVFQAKCLE+GE VAIKKVL D+RY N
Sbjct  119  GQVITTTVGGRDGKPKQTISYMAQRVVGTGSFGVVFQAKCLETGEQVAIKKVLQDKRYKN  178

Query  679  RELQIMRMLEHPNVV  723
            RELQIMR+ +HPNVV
Sbjct  179  RELQIMRLQDHPNVV  193



>ref|NP_001065093.1| Os10g0521700 [Oryza sativa Japonica Group]
 gb|AAM92301.1| putative shaggy-like kinase [Oryza sativa Japonica Group]
 gb|AAP54673.1| Shaggy-related protein kinase theta, putative, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF27007.1| Os10g0521700 [Oryza sativa Japonica Group]
 gb|EEE51283.1| hypothetical protein OsJ_32193 [Oryza sativa Japonica Group]
Length=469

 Score =   212 bits (540),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 117/199 (59%), Positives = 146/199 (73%), Gaps = 11/199 (6%)
 Frame = +1

Query  145  MNVMRRLKSVASGRSSVSDPQGGDSSIKRVKVAQDFDQRIAGKPESEEICTTAPMH--EA  318
            M++MRRLKS+ASGRSSVSDP GGDS  KR K  QD    I  +P    +    PM   + 
Sbjct  1    MHMMRRLKSIASGRSSVSDP-GGDSGTKRPKFDQDGAGDIVIEPH---LTDDKPMRVDQE  56

Query  319  ASTSQEDASGISLVA----RSEKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGN  486
            +S+S  DA   +  +    R+E++G + LPKEM+EM I DDK D  N+ K+ E V++  N
Sbjct  57   SSSSHRDAEASTSTSKNPGRTEEAGADILPKEMNEMTISDDKVDGHND-KESEGVIVNAN  115

Query  487  GTETGQIIVTTVGGRNGEQKQVLSYMAERVVGTGSFGVVFQAKCLESGEAVAIKKVLXDR  666
            GTETGQIIVT++GG+NG+ KQ +SYMAERVVGTGSFGVVFQAKCLE+GE VAIKKVL D+
Sbjct  116  GTETGQIIVTSIGGQNGKPKQKVSYMAERVVGTGSFGVVFQAKCLETGETVAIKKVLQDK  175

Query  667  RYXNRELQIMRMLEHPNVV  723
            RY NRELQ M++L+HPNVV
Sbjct  176  RYKNRELQTMQLLDHPNVV  194



>dbj|BAJ93751.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=468

 Score =   212 bits (540),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 116/198 (59%), Positives = 144/198 (73%), Gaps = 10/198 (5%)
 Frame = +1

Query  145  MNVMRRLKSVASGRSSVSDPQGGDSSIKRVKVAQDFDQRIAGKPESEEICTTAPMH-EAA  321
            M++MRRLKS+ASGRSSVSDP GGDS  KR K  QD    I  +P   +     PMH +  
Sbjct  1    MHMMRRLKSIASGRSSVSDP-GGDSGSKRPKFDQDGLGDIVIQPHLSD---DKPMHLDQE  56

Query  322  STSQEDASGISLV----ARSEKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNG  489
            S+S  DA   +      A++E +G  +LPK MH+M I D+K D  NN K+ E +++ GNG
Sbjct  57   SSSHRDAEASTSTSMNPAKAEDTG-ADLPKGMHDMTINDNKVDGHNNDKEAEGIIVDGNG  115

Query  490  TETGQIIVTTVGGRNGEQKQVLSYMAERVVGTGSFGVVFQAKCLESGEAVAIKKVLXDRR  669
            TE GQIIVTT+GG+NG+ KQ +SYMAERVVGTGSFGVV+QAKCLE+GE VAIKKVL D+R
Sbjct  116  TEAGQIIVTTIGGQNGKPKQKVSYMAERVVGTGSFGVVYQAKCLETGETVAIKKVLQDKR  175

Query  670  YXNRELQIMRMLEHPNVV  723
            Y NRELQ M++L+HPNVV
Sbjct  176  YKNRELQTMQLLDHPNVV  193



>ref|XP_011023408.1| PREDICTED: shaggy-related protein kinase NtK-1-like isoform X1 
[Populus euphratica]
Length=454

 Score =   212 bits (539),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 107/175 (61%), Positives = 137/175 (78%), Gaps = 4/175 (2%)
 Frame = +1

Query  208  GGDSSIKRVKVAQDFDQRIAGKPESEEICTTAPMHEAASTSQEDA---SGISLVARSEKS  378
            GGD   KR KV Q+ ++++  +    E   T      ASTSQE+A   S I+ VAR+EKS
Sbjct  8    GGDVGTKRAKVDQEIERKVDQESYLVERSVTDQEQHMASTSQENAASTSNITSVARTEKS  67

Query  379  GYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTETGQIIVTTVGGRNGEQKQVLS  558
            GY++LPKEMH+MKI+D+K+   +  K++E V+++GNGTETGQII TTVGGRNG+ KQ +S
Sbjct  68   GYDQLPKEMHQMKIRDEKTTFHDE-KEVEAVIVSGNGTETGQIIATTVGGRNGQPKQTIS  126

Query  559  YMAERVVGTGSFGVVFQAKCLESGEAVAIKKVLXDRRYXNRELQIMRMLEHPNVV  723
            YMAE +VGTGSFGVV+QAKCLE+GEAVAIKKVL D+RY NRELQ+MR+L+HPNVV
Sbjct  127  YMAEHMVGTGSFGVVYQAKCLETGEAVAIKKVLQDKRYKNRELQVMRILDHPNVV  181



>gb|EEC67328.1| hypothetical protein OsI_34360 [Oryza sativa Indica Group]
Length=525

 Score =   213 bits (541),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 117/199 (59%), Positives = 146/199 (73%), Gaps = 11/199 (6%)
 Frame = +1

Query  145  MNVMRRLKSVASGRSSVSDPQGGDSSIKRVKVAQDFDQRIAGKPESEEICTTAPMH--EA  318
            M++MRRLKS+ASGRSSVSDP GGDS  KR K  QD    I  +P    +    PM   + 
Sbjct  1    MHMMRRLKSIASGRSSVSDP-GGDSGTKRPKFDQDGAGDIVIEPH---LTDDKPMRVDQE  56

Query  319  ASTSQEDASGISLVA----RSEKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGN  486
            +S+S  DA   +  +    R+E++G + LPKEM+EM I DDK D  N+ K+ E V++  N
Sbjct  57   SSSSHRDAEASTSTSKNPGRTEEAGADILPKEMNEMTISDDKVDGHND-KESEGVIVNAN  115

Query  487  GTETGQIIVTTVGGRNGEQKQVLSYMAERVVGTGSFGVVFQAKCLESGEAVAIKKVLXDR  666
            GTETGQIIVT++GG+NG+ KQ +SYMAERVVGTGSFGVVFQAKCLE+GE VAIKKVL D+
Sbjct  116  GTETGQIIVTSIGGQNGKPKQKVSYMAERVVGTGSFGVVFQAKCLETGETVAIKKVLQDK  175

Query  667  RYXNRELQIMRMLEHPNVV  723
            RY NRELQ M++L+HPNVV
Sbjct  176  RYKNRELQTMQLLDHPNVV  194


 Score = 70.9 bits (172),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 30/40 (75%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = +1

Query  604  FQAKCLESGEAVAIKKVLXDRRYXNRELQIMRMLEHPNVV  723
            +QAKCLE+GE VAIKKVL D+RY NRELQ M++L+HPNVV
Sbjct  246  YQAKCLETGETVAIKKVLQDKRYKNRELQTMQLLDHPNVV  285



>ref|NP_191981.1| Shaggy-related protein kinase theta [Arabidopsis thaliana]
 sp|Q96287.3|KSG8_ARATH RecName: Full=Shaggy-related protein kinase theta; AltName: Full=ASK-theta 
[Arabidopsis thaliana]
 emb|CAA69156.1| Shaggy-like kinase tetha [Arabidopsis thaliana]
 gb|AAC13616.1| protein kinase [Arabidopsis thaliana]
 emb|CAB80881.1| Shaggy related protein kinase tetha [Arabidopsis thaliana]
 gb|AAL32976.1| AT4g00720/F6N23_11 [Arabidopsis thaliana]
 gb|AAM70590.1| AT4g00720/F6N23_11 [Arabidopsis thaliana]
 dbj|BAE98364.1| Shaggy related protein kinase theta [Arabidopsis thaliana]
 gb|AEE81925.1| Shaggy-related protein kinase theta [Arabidopsis thaliana]
Length=472

 Score =   211 bits (537),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 113/194 (58%), Positives = 145/194 (75%), Gaps = 3/194 (2%)
 Frame = +1

Query  145  MNVMRRLKSVASGRSSVSDPQGGDSSIKRVKVAQDFDQRIAGKPESEEICTTAPMHEAAS  324
            MNVMRRLKS+ASGR+S+S   GGD ++KR K+ Q+ D       + ++  +   M +A  
Sbjct  1    MNVMRRLKSIASGRTSISSDPGGDYALKRAKLDQENDNLCVDPMQVDQNSSCFEM-KADV  59

Query  325  TSQEDASGISLV-ARSEKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTETG  501
             SQE  +G S V A SEK   ++LP  M EMKI+D+++ N+ + KDME  V+ G+GTETG
Sbjct  60   LSQESVAGTSNVPAVSEKPVDDQLPDVMIEMKIRDERNANRED-KDMETTVVNGSGTETG  118

Query  502  QIIVTTVGGRNGEQKQVLSYMAERVVGTGSFGVVFQAKCLESGEAVAIKKVLXDRRYXNR  681
            Q+I TTVGGR+G+ KQ +SYMA+RVVGTGSFGVVFQAKCLE+GE VAIKKVL D+RY NR
Sbjct  119  QVITTTVGGRDGKPKQTISYMAQRVVGTGSFGVVFQAKCLETGEQVAIKKVLQDKRYKNR  178

Query  682  ELQIMRMLEHPNVV  723
            ELQIMR+ +HPNVV
Sbjct  179  ELQIMRLQDHPNVV  192



>gb|KJB22348.1| hypothetical protein B456_004G042400 [Gossypium raimondii]
Length=469

 Score =   210 bits (535),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 123/200 (62%), Positives = 148/200 (74%), Gaps = 13/200 (7%)
 Frame = +1

Query  145  MNVMRRLKSVASGRSSVSDPQGGDSSIKRVKVAQDFDQRIAGKPESE----EICTTAPMH  312
            MNVMRRLKS+ASGRSS+S   GGDSS KR KV Q+     +G+   E    E  T++  H
Sbjct  1    MNVMRRLKSIASGRSSISSDPGGDSSSKRAKVDQE-----SGRSRRESNLVESSTSSREH  55

Query  313  EAASTSQE---DASGISLVARSEKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITG  483
              ASTSQE     S +  VAR +    ++LP EM EM+I+D+K+ + ++ KD E  VI G
Sbjct  56   NMASTSQETVASTSRVPSVARQQNLVVDQLPNEMREMRIRDEKTVSHDD-KDPEATVING  114

Query  484  NGTETGQIIVTTVGGRNGEQKQVLSYMAERVVGTGSFGVVFQAKCLESGEAVAIKKVLXD  663
            NGTETGQII TTVGG+NG+ KQ +SYMAERVVGTGSFGVVFQAKCLE+GE VAIKKVL D
Sbjct  115  NGTETGQIISTTVGGQNGQPKQTMSYMAERVVGTGSFGVVFQAKCLETGEPVAIKKVLQD  174

Query  664  RRYXNRELQIMRMLEHPNVV  723
            +RY NRELQIMR+L+HPNVV
Sbjct  175  KRYKNRELQIMRVLDHPNVV  194



>ref|XP_002872933.1| hypothetical protein ARALYDRAFT_490498 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH49192.1| hypothetical protein ARALYDRAFT_490498 [Arabidopsis lyrata subsp. 
lyrata]
Length=472

 Score =   209 bits (532),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 111/194 (57%), Positives = 146/194 (75%), Gaps = 3/194 (2%)
 Frame = +1

Query  145  MNVMRRLKSVASGRSSVSDPQGGDSSIKRVKVAQDFDQRIAGKPESEEICTTAPMHEAAS  324
            MNVMRRLKS+ASGR+S+S   GGD ++KR K+ Q+ D   A   + ++  +   M +A  
Sbjct  1    MNVMRRLKSIASGRTSISSDPGGDYALKRAKLDQENDNLCADPMQVDQNSSCFEM-KADI  59

Query  325  TSQEDASGISLV-ARSEKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTETG  501
             S E  +G S V A SEK+  ++LP+ M +M+I+D+++ N+   KDME  V+ G+GTETG
Sbjct  60   LSHESVAGTSNVPAASEKTVDDQLPEVMIDMRIRDERNANREE-KDMETTVVNGSGTETG  118

Query  502  QIIVTTVGGRNGEQKQVLSYMAERVVGTGSFGVVFQAKCLESGEAVAIKKVLXDRRYXNR  681
            Q+I TTVGGR+G+ KQ +SYMA+RVVGTGSFGVVFQAKCLE+GE VAIKKVL D+RY NR
Sbjct  119  QVITTTVGGRDGKPKQTISYMAQRVVGTGSFGVVFQAKCLETGEQVAIKKVLQDKRYKNR  178

Query  682  ELQIMRMLEHPNVV  723
            ELQIMR+ +HPNVV
Sbjct  179  ELQIMRLQDHPNVV  192



>ref|XP_010933863.1| PREDICTED: shaggy-related protein kinase epsilon-like [Elaeis 
guineensis]
Length=469

 Score =   209 bits (531),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 113/201 (56%), Positives = 138/201 (69%), Gaps = 15/201 (7%)
 Frame = +1

Query  145  MNVMRRLKSVASGRSSVSDPQGGDSSIKRVKVAQDFDQRIAGKPE--------SEEICTT  300
            M +MRRLKS+ASGRSS+SDP GGD   KR K  QD    +   P          ++  T+
Sbjct  1    MQMMRRLKSIASGRSSISDP-GGDPGTKRPKFDQDGAGEVFTGPHLVADKAISVDKNTTS  59

Query  301  APMHEAASTSQEDASGISLVARSEKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVIT  480
              +H  A+ S  D+S     AR+  +  ++LP EMH M I+DDK +  N  K+ E  ++ 
Sbjct  60   THLHLDANMSNGDSS-----ARTGHAAVDQLPNEMHVMTIRDDKVEGHNE-KETEGTMVN  113

Query  481  GNGTETGQIIVTTVGGRNGEQKQVLSYMAERVVGTGSFGVVFQAKCLESGEAVAIKKVLX  660
            GNGTETGQII TT+GGRNGE KQ +SYMAE VVGTGSFGVVFQAKC+ESGE VAIKKVL 
Sbjct  114  GNGTETGQIIATTIGGRNGEPKQTISYMAEHVVGTGSFGVVFQAKCVESGETVAIKKVLQ  173

Query  661  DRRYXNRELQIMRMLEHPNVV  723
            D+RY NRELQIM +L+HPNVV
Sbjct  174  DKRYKNRELQIMHLLDHPNVV  194



>ref|XP_006661970.1| PREDICTED: shaggy-related protein kinase theta-like [Oryza brachyantha]
Length=469

 Score =   208 bits (529),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 116/199 (58%), Positives = 143/199 (72%), Gaps = 11/199 (6%)
 Frame = +1

Query  145  MNVMRRLKSVASGRSSVSDPQGGDSSIKRVKVAQDFDQRIAGKPESEEICTTAPMH--EA  318
            M +MRRLKS+ASGRSSVSDP GGDS  KR K  QD    I  +P    +    PM   + 
Sbjct  1    MIMMRRLKSIASGRSSVSDP-GGDSGTKRPKFDQDGAGDIVIEPH---LTDDKPMRVDQE  56

Query  319  ASTSQEDASGISLVA----RSEKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGN  486
             S+S  DA   +  +    R+E++G   LPKEM++M I DDK D +N+ K+ E +++ G 
Sbjct  57   PSSSHRDAEASTSTSKNPGRTEEAGANILPKEMNDMTISDDKVDGRND-KESEGIIVNGT  115

Query  487  GTETGQIIVTTVGGRNGEQKQVLSYMAERVVGTGSFGVVFQAKCLESGEAVAIKKVLXDR  666
            G ETGQIIVTT+GG+NG+ KQ +SYMAERVVGTGSFGVVFQAKCLESGE VAIKKVL D+
Sbjct  116  GAETGQIIVTTIGGQNGKPKQKVSYMAERVVGTGSFGVVFQAKCLESGETVAIKKVLQDK  175

Query  667  RYXNRELQIMRMLEHPNVV  723
            RY NRELQ M++L+HPNVV
Sbjct  176  RYKNRELQTMQLLDHPNVV  194



>ref|XP_007051909.1| Shaggy-like protein kinase 32 isoform 2 [Theobroma cacao]
 gb|EOX96066.1| Shaggy-like protein kinase 32 isoform 2 [Theobroma cacao]
Length=436

 Score =   206 bits (525),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 110/176 (63%), Positives = 129/176 (73%), Gaps = 4/176 (2%)
 Frame = +1

Query  205  QGGDSSIKRVKVAQDFDQRIAGKPESEEICTTAPMHEAASTSQE---DASGISLVARSEK  375
            QGGDS  KR KV Q  + ++  +    E  TT      ASTS E     S ++ VAR EK
Sbjct  18   QGGDSGTKRAKVDQQAECKVHEESNLVERSTTGLEQHMASTSLETVASTSNVTSVARMEK  77

Query  376  SGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTETGQIIVTTVGGRNGEQKQVL  555
            SG ++LP EMHEM+I+D+K+ N +  KD+E  VI GNGTETGQII T VGGRNG+ KQ +
Sbjct  78   SGVDQLPNEMHEMRIRDEKTANHDE-KDVEATVINGNGTETGQIISTVVGGRNGQPKQTI  136

Query  556  SYMAERVVGTGSFGVVFQAKCLESGEAVAIKKVLXDRRYXNRELQIMRMLEHPNVV  723
            SYMAERVVGTGSFGVVFQAKCLE GE+VAIKKVL D+RY NRELQIMR+L HPNVV
Sbjct  137  SYMAERVVGTGSFGVVFQAKCLERGESVAIKKVLQDKRYKNRELQIMRILNHPNVV  192



>ref|XP_008660602.1| PREDICTED: shaggy-related protein kinase alpha-like [Zea mays]
 gb|AFW89914.1| putative glycogen synthase kinase family protein [Zea mays]
Length=470

 Score =   207 bits (527),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 113/197 (57%), Positives = 143/197 (73%), Gaps = 6/197 (3%)
 Frame = +1

Query  145  MNVMRRLKSVASGRSSVSDPQGGDSSIKRVKVAQDFDQRIAGKPESEEICTTAPMHEAAS  324
            M++MRRLKS+ASGRSSVSDP GGDS  KR K  QD    I  +P   E        E++S
Sbjct  1    MHMMRRLKSIASGRSSVSDP-GGDSGSKRPKFEQDGAGDIVIEPHLTEAKPVRIDQESSS  59

Query  325  TSQEDASGISLVA----RSEKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGT  492
            +S  DA   +  +    ++E+   + LPKE+++M I DDK+D+ N+ K+ E V + GNG 
Sbjct  60   SSNRDAEASTSTSMKPVKTEEPVADLLPKELNDMTISDDKADDHND-KEGEGVTLDGNGA  118

Query  493  ETGQIIVTTVGGRNGEQKQVLSYMAERVVGTGSFGVVFQAKCLESGEAVAIKKVLXDRRY  672
            ETGQIIVTT+GG NG+ KQ +SYMAERVVGTGSFG+VFQAKCLE+GE VAIKKVL D+RY
Sbjct  119  ETGQIIVTTIGGHNGKPKQKVSYMAERVVGTGSFGIVFQAKCLETGETVAIKKVLQDKRY  178

Query  673  XNRELQIMRMLEHPNVV  723
             NRELQ M++L+HPNVV
Sbjct  179  KNRELQTMQLLDHPNVV  195



>emb|CAA58595.1| Petunia Shaggy kinase 6 [Petunia x hybrida]
Length=414

 Score =   206 bits (523),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 101/138 (73%), Positives = 119/138 (86%), Gaps = 3/138 (2%)
 Frame = +1

Query  319  ASTSQED--ASGISLVARSEKSGYEELPKEMHEMKIKDDKSD-NQNNLKDMEPVVITGNG  489
            ASTS++   AS  ++  R E S  +ELPKE+HEMKIKD+++D +++NLKDMEP V++GNG
Sbjct  2    ASTSKDTTTASTSTMDTRPENSEVDELPKELHEMKIKDERTDSHEDNLKDMEPAVVSGNG  61

Query  490  TETGQIIVTTVGGRNGEQKQVLSYMAERVVGTGSFGVVFQAKCLESGEAVAIKKVLXDRR  669
             ETGQIIVTTV GRNG+QKQ LSYMAERVVGTGSFGVVFQAKCLE+GE+VAIKKVL DRR
Sbjct  62   AETGQIIVTTVSGRNGQQKQTLSYMAERVVGTGSFGVVFQAKCLETGESVAIKKVLQDRR  121

Query  670  YXNRELQIMRMLEHPNVV  723
            Y NRELQIMR L+HPNVV
Sbjct  122  YKNRELQIMRTLDHPNVV  139



>ref|XP_010053665.1| PREDICTED: shaggy-related protein kinase epsilon [Eucalyptus 
grandis]
 gb|KCW78017.1| hypothetical protein EUGRSUZ_D02249 [Eucalyptus grandis]
Length=468

 Score =   206 bits (525),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 114/195 (58%), Positives = 139/195 (71%), Gaps = 4/195 (2%)
 Frame = +1

Query  145  MNVMRRLKSVASGRSSVSDPQGGDSSIKRVKVAQDFDQR--IAGKPESEEICTTAPMHEA  318
            MN+MRR+KS+ASGR+S+S   GGDS  KRVKV Q+   R  +     S E   T      
Sbjct  1    MNMMRRIKSIASGRTSISSEPGGDSGTKRVKVDQEAHHRDNVDQLLHSVERGATGLEQHM  60

Query  319  ASTSQEDASGISLVARSEKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTET  498
            ASTS E  +G S  +   K   +++ +  HE +IKDDK+ + +  KD EP VI G+GTET
Sbjct  61   ASTSLEAVAGTSSKSSVSKHSDDQVHRGGHETRIKDDKAFHDD--KDCEPAVINGHGTET  118

Query  499  GQIIVTTVGGRNGEQKQVLSYMAERVVGTGSFGVVFQAKCLESGEAVAIKKVLXDRRYXN  678
            G II TTVGGR+G+ KQ +SYMAERVVGTGSFGVVFQAKCLE+GE VAIKKVL D+RY N
Sbjct  119  GHIITTTVGGRDGQPKQTISYMAERVVGTGSFGVVFQAKCLETGETVAIKKVLQDKRYKN  178

Query  679  RELQIMRMLEHPNVV  723
            RELQIMR+L+HPNVV
Sbjct  179  RELQIMRILDHPNVV  193



>ref|XP_010255499.1| PREDICTED: shaggy-related protein kinase epsilon isoform X2 [Nelumbo 
nucifera]
Length=460

 Score =   205 bits (521),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 102/166 (61%), Positives = 127/166 (77%), Gaps = 4/166 (2%)
 Frame = +1

Query  235  KVAQDFDQRIAGKPESEEICTTAPMHEAASTSQE---DASGISLVARSEKSGYEELPKEM  405
            KV Q+ +Q    +    E  +       ASTS E     S IS+ +++EKSGY++LPKEM
Sbjct  21   KVDQEMEQNATNETHLMEKTSIGLEQHVASTSIETDVSTSNISITSKTEKSGYDQLPKEM  80

Query  406  HEMKIKDDKSDNQNNLKDMEPVVITGNGTETGQIIVTTVGGRNGEQKQVLSYMAERVVGT  585
            HEMKI+DDK++N ++ KD E  ++ GNGTE GQII TT+GGRNG+ KQ +SYMAERVVGT
Sbjct  81   HEMKIRDDKTENHDD-KDAEATIVNGNGTEAGQIIATTIGGRNGQPKQTISYMAERVVGT  139

Query  586  GSFGVVFQAKCLESGEAVAIKKVLXDRRYXNRELQIMRMLEHPNVV  723
            GSFGVVFQAKC+E+GEAVAIKKVL D+RY NRELQIMR+L+HPNVV
Sbjct  140  GSFGVVFQAKCVETGEAVAIKKVLQDKRYKNRELQIMRLLDHPNVV  185



>ref|XP_010419626.1| PREDICTED: shaggy-related protein kinase theta-like [Camelina 
sativa]
Length=305

 Score =   200 bits (508),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 104/202 (51%), Positives = 144/202 (71%), Gaps = 14/202 (7%)
 Frame = +1

Query  145  MNVMRRLKSVASGRSSVSDPQGGDSSIKRVKVAQDFDQRIAGKPESEEICTTA-------  303
            MNVMRRLKS+ASGR+S+S   GGD  +KR K+ Q+ D   A   + ++  +++       
Sbjct  1    MNVMRRLKSIASGRTSISSDPGGDYGMKRAKLDQENDNLCADPMQVDQTSSSSSSDIKPD  60

Query  304  --PMHEAASTSQEDASGISLVARSEKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVI  477
              P+   A TS    +G  L  +     + +LP+ M +M+I+DD++ ++++ K+ME  ++
Sbjct  61   IFPLESVAGTS----NGHPLSDKPVDDHHHQLPEVMTDMRIRDDRNAHRDD-KEMETTIV  115

Query  478  TGNGTETGQIIVTTVGGRNGEQKQVLSYMAERVVGTGSFGVVFQAKCLESGEAVAIKKVL  657
             G+GTETGQ+I TTVGGR+G+ KQ +SYMA+RVVGTGSFGVVFQAKCLE+GE VAIKKVL
Sbjct  116  NGSGTETGQVITTTVGGRDGKPKQTISYMAQRVVGTGSFGVVFQAKCLETGEQVAIKKVL  175

Query  658  XDRRYXNRELQIMRMLEHPNVV  723
             D+RY NRELQIMR+ +HPNVV
Sbjct  176  QDKRYKNRELQIMRLQDHPNVV  197



>ref|XP_004983886.1| PREDICTED: LOW QUALITY PROTEIN: shaggy-related protein kinase 
theta-like [Setaria italica]
Length=470

 Score =   204 bits (519),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 114/200 (57%), Positives = 144/200 (72%), Gaps = 12/200 (6%)
 Frame = +1

Query  145  MNVMRRLKSVASGRSSVSDPQGGDSSIKRVKVAQDFDQRIAGKPESEEICTTAPM---HE  315
            M++MRRLKS+ASGRSSVSDP GGDS  KR K  QD    I  +P    +    PM    E
Sbjct  1    MHMMRRLKSIASGRSSVSDP-GGDSGSKRPKFEQDGAGDIVIEPH---LTDDKPMRIDQE  56

Query  316  AASTSQEDASGISLVA----RSEKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITG  483
            ++S+S  DA   +  +    ++E+ G + LPKEM++M I DDK+D  N+ K    ++  G
Sbjct  57   SSSSSNRDAEASTSTSMKPVKTEEPGTDLLPKEMNDMTISDDKADGHND-KRGGGLLFDG  115

Query  484  NGTETGQIIVTTVGGRNGEQKQVLSYMAERVVGTGSFGVVFQAKCLESGEAVAIKKVLXD  663
            NGTETG+IIVTT+GG NG+ KQ +SYMAERVVGTGSFGVVFQAKCLE+G+ VAIKKVL D
Sbjct  116  NGTETGKIIVTTIGGHNGKPKQKVSYMAERVVGTGSFGVVFQAKCLETGDTVAIKKVLQD  175

Query  664  RRYXNRELQIMRMLEHPNVV  723
            +RY NRELQ M++L+HPNVV
Sbjct  176  KRYKNRELQTMQLLDHPNVV  195



>gb|ABR17117.1| unknown [Picea sitchensis]
Length=424

 Score =   202 bits (514),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 114/204 (56%), Positives = 136/204 (67%), Gaps = 25/204 (12%)
 Frame = +1

Query  145  MNVMRRLKSVASGRSSVSDPQGGDSSIKRVKVAQDFDQRIAGKPESEEICTTAPMHEAAS  324
            MNVMRRL+S+ASGRSSV+DP GGD+  KR K   +            E  T+ P+   A 
Sbjct  1    MNVMRRLRSLASGRSSVTDP-GGDAGTKRAKFELE-----------READTSEPLGVVAR  48

Query  325  TS-----QEDASGIS------LVARSEKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEPV  471
            TS     Q+   G+       LV   E    + LPKEMHEMKIKDD  +N    K++ P 
Sbjct  49   TSEASHQQDVVVGLKGTLRNILVPEFENVDVDWLPKEMHEMKIKDDNVNNGG--KEIIPG  106

Query  472  VITGNGTETGQIIVTTVGGRNGEQKQVLSYMAERVVGTGSFGVVFQAKCLESGEAVAIKK  651
            V+ GNG ETG II TT+GG NG+ KQ +SYMAERVVGTGSFG+VFQAKCLE+ E VAIKK
Sbjct  107  VVNGNGMETGHIIATTIGGLNGQPKQTISYMAERVVGTGSFGIVFQAKCLETEEIVAIKK  166

Query  652  VLXDRRYXNRELQIMRMLEHPNVV  723
            VL D+RY NRELQIMRML+HPN+V
Sbjct  167  VLQDKRYKNRELQIMRMLDHPNIV  190



>ref|XP_003574217.1| PREDICTED: shaggy-related protein kinase alpha-like [Brachypodium 
distachyon]
Length=469

 Score =   203 bits (517),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 111/199 (56%), Positives = 145/199 (73%), Gaps = 11/199 (6%)
 Frame = +1

Query  145  MNVMRRLKSVASGRSSVSDPQGGDSSIKRVKVAQDFDQRIAGKPESEEICTTAPMH--EA  318
            M++MRRLKS+ASGRSSVSDP GGDS  KR K  Q+    I  +P+   +    PMH  + 
Sbjct  1    MHMMRRLKSIASGRSSVSDP-GGDSGSKRPKFDQEGSGDIVIEPQ---LSDDKPMHLDQE  56

Query  319  ASTSQEDASGISLV----ARSEKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGN  486
            +S+S  DA   +      A++E++G + LPK M++M I DD+ D   + KD E V++ GN
Sbjct  57   SSSSHRDADASTSTSMNPAKTEETGADLLPKGMNDMTISDDRVDGLTD-KDAEGVIVNGN  115

Query  487  GTETGQIIVTTVGGRNGEQKQVLSYMAERVVGTGSFGVVFQAKCLESGEAVAIKKVLXDR  666
            GTE GQIIVTT+GG+NG+ KQ +SYMAERVVGTGSFGVV+QAKCLE+GE  AIKKVL D+
Sbjct  116  GTEAGQIIVTTIGGQNGKPKQKVSYMAERVVGTGSFGVVYQAKCLETGETFAIKKVLQDK  175

Query  667  RYXNRELQIMRMLEHPNVV  723
            RY NRELQ M++L++PN+V
Sbjct  176  RYKNRELQTMQLLDNPNIV  194



>ref|XP_009134534.1| PREDICTED: shaggy-related protein kinase theta [Brassica rapa]
Length=468

 Score =   202 bits (515),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 107/197 (54%), Positives = 141/197 (72%), Gaps = 13/197 (7%)
 Frame = +1

Query  145  MNVMRRLKSVASGRSSVSDPQGGDSSIKRVKVAQDFDQRIAGKPESEEICTTAPMHEAAS  324
            MNVMRRLKS+ASGR+S+S   G DSS+KR K+ QD D   +G  +  ++  T  M     
Sbjct  1    MNVMRRLKSIASGRTSISSDPGVDSSLKRPKLDQDNDYLSSGGDDPMQVDQTTDM-----  55

Query  325  TSQEDASGISLVARSEKSGYEELPKEMHEMKIKDDKSDNQNNL----KDMEPVVITGNGT  492
             SQ+  +G S V        ++LP+ M++M++++++  + N      KDMEP ++ G GT
Sbjct  56   VSQDSVAGTSNVPPPA----DQLPEVMNDMRLREEEPPHANRRGHEDKDMEPPIVNGCGT  111

Query  493  ETGQIIVTTVGGRNGEQKQVLSYMAERVVGTGSFGVVFQAKCLESGEAVAIKKVLXDRRY  672
            ETGQ+I TTVGGR+G+ KQ +SYMA+RVVGTGSFGVVFQAKCLE+GE VAIKKVL D+RY
Sbjct  112  ETGQVITTTVGGRDGKPKQTISYMAQRVVGTGSFGVVFQAKCLETGEQVAIKKVLQDKRY  171

Query  673  XNRELQIMRMLEHPNVV  723
             NRELQIMR+ +HPNVV
Sbjct  172  KNRELQIMRLQDHPNVV  188



>emb|CDX74346.1| BnaA03g27010D [Brassica napus]
Length=468

 Score =   202 bits (515),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 107/197 (54%), Positives = 141/197 (72%), Gaps = 13/197 (7%)
 Frame = +1

Query  145  MNVMRRLKSVASGRSSVSDPQGGDSSIKRVKVAQDFDQRIAGKPESEEICTTAPMHEAAS  324
            MNVMRRLKS+ASGR+S+S   G DSS+KR K+ QD D   +G  +  ++  T  M     
Sbjct  1    MNVMRRLKSIASGRTSISSDPGVDSSLKRPKLDQDNDYLSSGGDDPMQVDQTTDM-----  55

Query  325  TSQEDASGISLVARSEKSGYEELPKEMHEMKIKDDKSDNQNNL----KDMEPVVITGNGT  492
             SQ+  +G S V        ++LP+ M++M++++++  + N      KDMEP ++ G GT
Sbjct  56   VSQDSVAGTSNVPPPA----DQLPEVMNDMRLREEEPPHANRRGEEDKDMEPPIVNGCGT  111

Query  493  ETGQIIVTTVGGRNGEQKQVLSYMAERVVGTGSFGVVFQAKCLESGEAVAIKKVLXDRRY  672
            ETGQ+I TTVGGR+G+ KQ +SYMA+RVVGTGSFGVVFQAKCLE+GE VAIKKVL D+RY
Sbjct  112  ETGQVITTTVGGRDGKPKQTISYMAQRVVGTGSFGVVFQAKCLETGEQVAIKKVLQDKRY  171

Query  673  XNRELQIMRMLEHPNVV  723
             NRELQIMR+ +HPNVV
Sbjct  172  KNRELQIMRLQDHPNVV  188



>gb|ABK24428.1| unknown [Picea sitchensis]
Length=471

 Score =   202 bits (515),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 114/204 (56%), Positives = 136/204 (67%), Gaps = 25/204 (12%)
 Frame = +1

Query  145  MNVMRRLKSVASGRSSVSDPQGGDSSIKRVKVAQDFDQRIAGKPESEEICTTAPMHEAAS  324
            MNVMRRL+S+ASGRSSV+DP GGD+  KR K   +            E  T+ P+   A 
Sbjct  1    MNVMRRLRSLASGRSSVTDP-GGDAGTKRAKFELE-----------READTSEPLGVVAR  48

Query  325  TS-----QEDASGIS------LVARSEKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEPV  471
            TS     Q+   G+       LV   E    + LPKEMHEMKIKDD  +N    K++ P 
Sbjct  49   TSEASHQQDVVVGLKGTLRNILVPEFENVDVDWLPKEMHEMKIKDDNVNNGG--KEIIPG  106

Query  472  VITGNGTETGQIIVTTVGGRNGEQKQVLSYMAERVVGTGSFGVVFQAKCLESGEAVAIKK  651
            V+ GNG ETG II TT+GG NG+ KQ +SYMAERVVGTGSFG+VFQAKCLE+ E VAIKK
Sbjct  107  VVNGNGMETGHIIATTIGGLNGQPKQTISYMAERVVGTGSFGIVFQAKCLETEEIVAIKK  166

Query  652  VLXDRRYXNRELQIMRMLEHPNVV  723
            VL D+RY NRELQIMRML+HPN+V
Sbjct  167  VLQDKRYKNRELQIMRMLDHPNIV  190



>ref|XP_008657609.1| PREDICTED: shaggy-related protein kinase alpha-like [Zea mays]
 tpg|DAA45977.1| TPA: putative glycogen synthase kinase family protein [Zea mays]
Length=473

 Score =   202 bits (514),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 113/197 (57%), Positives = 140/197 (71%), Gaps = 6/197 (3%)
 Frame = +1

Query  145  MNVMRRLKSVASGRSSVSDPQGGDSSIKRVKVAQDFDQRIAGKPESEEICTTAPMHEAAS  324
            M++MRRLKS+ASGRSSVSDP GGDS  KR K  QD    I  +P   E        E++S
Sbjct  1    MHMMRRLKSIASGRSSVSDP-GGDSGSKRPKFEQDGAGDIVMEPHLTEDKPVRIDQESSS  59

Query  325  TSQEDASGISLVA----RSEKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGT  492
            TS  DA   +  +    ++E++G + LPKEM+ M I DDK+D  N+ K+ E V + G GT
Sbjct  60   TSNRDAEASTSTSMKPVKTEEAGADLLPKEMNIMTISDDKADGHND-KEGEGVTLDGTGT  118

Query  493  ETGQIIVTTVGGRNGEQKQVLSYMAERVVGTGSFGVVFQAKCLESGEAVAIKKVLXDRRY  672
            ETGQIIVTT+GG NG+ KQ +SYMAE VVGTGSFG+VFQAKCLE+ E VAIKKVL D+RY
Sbjct  119  ETGQIIVTTIGGHNGKPKQKVSYMAELVVGTGSFGIVFQAKCLETDETVAIKKVLQDKRY  178

Query  673  XNRELQIMRMLEHPNVV  723
             NRELQ M++ +HPNVV
Sbjct  179  KNRELQTMQLHDHPNVV  195



>emb|CDY07202.1| BnaCnng02170D [Brassica napus]
Length=471

 Score =   202 bits (513),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 105/193 (54%), Positives = 141/193 (73%), Gaps = 2/193 (1%)
 Frame = +1

Query  145  MNVMRRLKSVASGRSSVSDPQGGDSSIKRVKVAQDFDQRIAGKPESEEICTTAPMHEAAS  324
            MNVMRRLKS+ASGR+S+S   GGD  +KR K+ QD D+      +  ++  T+    ++S
Sbjct  1    MNVMRRLKSIASGRTSISSDPGGDYGLKRAKLDQDNDKLCTAGDDPMQVDQTS-SSSSSS  59

Query  325  TSQEDASGISLVARSEKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTETGQ  504
                  S +   A +  +   +LP+ M +M+I+D+++ N+ + KDMEP V+ G+GTETGQ
Sbjct  60   QCVAGTSNVPPPAAAAATVDAQLPEVMTDMRIRDERNANRED-KDMEPTVVNGSGTETGQ  118

Query  505  IIVTTVGGRNGEQKQVLSYMAERVVGTGSFGVVFQAKCLESGEAVAIKKVLXDRRYXNRE  684
            +I TTVGGR+G+ KQ +SYMA+RVVGTGSFGVVFQAKCLE+GE VAIKKVL D+RY NRE
Sbjct  119  VITTTVGGRDGKPKQTISYMAQRVVGTGSFGVVFQAKCLETGEQVAIKKVLQDKRYKNRE  178

Query  685  LQIMRMLEHPNVV  723
            LQIMR+ +HPNVV
Sbjct  179  LQIMRLQDHPNVV  191



>ref|XP_010427333.1| PREDICTED: shaggy-related protein kinase theta-like [Camelina 
sativa]
Length=483

 Score =   202 bits (513),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 106/204 (52%), Positives = 140/204 (69%), Gaps = 12/204 (6%)
 Frame = +1

Query  145  MNVMRRLKSVASGRSSVSDPQGGDSSIKRVKVAQDFDQRIAGKPESEEICTTA-------  303
            MNVMRRLKS+ASGR+S+S   GGD  +KR K+ Q+ D   A  P   +  +++       
Sbjct  1    MNVMRRLKSIASGRTSISSDPGGDYGMKRAKLDQENDNMCAADPMQVDQTSSSSSSSDIK  60

Query  304  ----PMHEAASTSQEDASGISLVARSEKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEPV  471
                P+   A TS   A     V       + +LP+ M +M+I+DD++ N++  K+ME  
Sbjct  61   PDIFPLESVAGTSNGHALSDKTVDDHHHHHHHQLPEVMTDMRIRDDRNANRDE-KEMETT  119

Query  472  VITGNGTETGQIIVTTVGGRNGEQKQVLSYMAERVVGTGSFGVVFQAKCLESGEAVAIKK  651
            ++ G+GTETGQ+I TTVGGR+G+ KQ +SYMA+RVVGTGSFGVVFQAKCLE+GE VAIKK
Sbjct  120  IVNGSGTETGQVITTTVGGRDGKPKQTISYMAQRVVGTGSFGVVFQAKCLETGEQVAIKK  179

Query  652  VLXDRRYXNRELQIMRMLEHPNVV  723
            VL D+RY NRELQIMR+ +HPNVV
Sbjct  180  VLQDKRYKNRELQIMRLQDHPNVV  203



>ref|XP_008344049.1| PREDICTED: shaggy-related protein kinase epsilon-like [Malus 
domestica]
Length=460

 Score =   199 bits (507),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 107/179 (60%), Positives = 132/179 (74%), Gaps = 8/179 (4%)
 Frame = +1

Query  208  GGDSSIKRVKVAQDFDQRIAGKPESEEICTTAPMHEAASTSQEDASGISLV-------AR  366
            G DS+ KR K+ QD +++   +P + E   T       STS E A+  S V        +
Sbjct  8    GIDSATKRAKMDQDNEKKANKQPNTVERSATGLEQHMTSTSVETAASTSSVSSVAKTETK  67

Query  367  SEKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTETGQIIVTTVGGRNGEQK  546
              KS Y++LPKEMHEMKI+D+K+++ ++ KDME  +I GNGTETG II TTVGG+NG+ K
Sbjct  68   EVKSSYDQLPKEMHEMKIRDEKANHHDD-KDMEETIINGNGTETGHIIATTVGGQNGQPK  126

Query  547  QVLSYMAERVVGTGSFGVVFQAKCLESGEAVAIKKVLXDRRYXNRELQIMRMLEHPNVV  723
            Q +SYMAERVVGTGSFGVVFQAKCLESGEAVAIKKVL D+RY NRELQIMR+L+HPNVV
Sbjct  127  QTISYMAERVVGTGSFGVVFQAKCLESGEAVAIKKVLQDKRYKNRELQIMRLLDHPNVV  185



>ref|XP_006289072.1| hypothetical protein CARUB_v10002475mg [Capsella rubella]
 gb|EOA21970.1| hypothetical protein CARUB_v10002475mg [Capsella rubella]
Length=469

 Score =   200 bits (508),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 107/197 (54%), Positives = 140/197 (71%), Gaps = 12/197 (6%)
 Frame = +1

Query  145  MNVMRRLKSVASGRSSVSDPQGGDSSIKRVKVAQDFDQRIAGKPESEEICTT---APMHE  315
            MNVMRRLKS+ASGR+S+S   GGD  +KR K+ Q+ D   A   + ++  ++    P   
Sbjct  1    MNVMRRLKSIASGRTSISSDPGGDCGLKRAKLDQETDNFCADPMQVDQTSSSFDILPKES  60

Query  316  AASTSQEDASGISLVARSEKS-GYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGT  492
             A TS   A        SEK+    +LP+ M +M+I+D+++ N+   KDME  ++ G+GT
Sbjct  61   VAGTSNGHAV-------SEKTVDDHQLPEVMTDMRIRDERNANREE-KDMETTIVNGSGT  112

Query  493  ETGQIIVTTVGGRNGEQKQVLSYMAERVVGTGSFGVVFQAKCLESGEAVAIKKVLXDRRY  672
            ETGQ+I TTVGGR+G+ KQ +SYMA+RVVGTGSFGVVFQAKCLE+GE VAIKKVL D+RY
Sbjct  113  ETGQVITTTVGGRDGKPKQTISYMAQRVVGTGSFGVVFQAKCLETGEQVAIKKVLQDKRY  172

Query  673  XNRELQIMRMLEHPNVV  723
             NRELQIMR+ +HPNVV
Sbjct  173  KNRELQIMRLQDHPNVV  189



>ref|XP_009111468.1| PREDICTED: shaggy-related protein kinase theta [Brassica rapa]
Length=476

 Score =   200 bits (508),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 106/200 (53%), Positives = 139/200 (70%), Gaps = 11/200 (6%)
 Frame = +1

Query  145  MNVMRRLKSVASGRSSVSDPQGGDSSIKRVKVAQDFDQRIAGKPESEEICTTAP------  306
            MNVMRRLKS+ASGR+S+S   GGD  +KR K+ QD D+      +  ++  T+       
Sbjct  1    MNVMRRLKSIASGRTSISSDPGGDYGLKRAKLDQDNDKLCTAGDDPMQVDQTSSSSSSSR  60

Query  307  -MHEAASTSQEDASGISLVARSEKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITG  483
             M      SQE  +G S V     +   +   ++ E+ I+D+++ N+ + KDMEP V+ G
Sbjct  61   EMRNTDMVSQECVAGTSNVPPPAAATVND---QLPEVMIRDERNANRED-KDMEPTVVNG  116

Query  484  NGTETGQIIVTTVGGRNGEQKQVLSYMAERVVGTGSFGVVFQAKCLESGEAVAIKKVLXD  663
            +GTETGQ+I TTVGGR+G+ KQ +SYMA+RVVGTGSFGVVFQAKCLE+GE VAIKKVL D
Sbjct  117  SGTETGQVITTTVGGRDGKPKQTISYMAQRVVGTGSFGVVFQAKCLETGEQVAIKKVLQD  176

Query  664  RRYXNRELQIMRMLEHPNVV  723
            +RY NRELQIMR+ +HPNVV
Sbjct  177  KRYKNRELQIMRLQDHPNVV  196



>ref|XP_009393923.1| PREDICTED: shaggy-related protein kinase epsilon-like isoform 
X2 [Musa acuminata subsp. malaccensis]
Length=476

 Score =   199 bits (506),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 108/195 (55%), Positives = 138/195 (71%), Gaps = 4/195 (2%)
 Frame = +1

Query  145  MNVMRRLKSVASGRSSVSDPQGGDSSIKRVKVAQDFDQRIAGKPESEEICTTAPMHEAAS  324
            M++MRRLKS+ASGRSSVSDP GGD   KR K  Q+  + +  +   E+  +T     +  
Sbjct  1    MHMMRRLKSIASGRSSVSDP-GGDLGTKRAKFDQEGGEILTERHLVEDKVSTMDQRISLY  59

Query  325  TSQEDASGISL--VARSEKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTET  498
                DAS  S    AR E +  ++LP+EMH M I++DK D  N  K+++  +  G GT T
Sbjct  60   HLDLDASTSSTDPPARFEAATMDQLPREMHGMTIREDKPDGHNE-KELDGSMTNGKGTMT  118

Query  499  GQIIVTTVGGRNGEQKQVLSYMAERVVGTGSFGVVFQAKCLESGEAVAIKKVLXDRRYXN  678
            GQII TT+GGR+G+ KQ +SYMAER+VGTGSFGVVFQAKC+E+GEAVAIKKVL D+RY N
Sbjct  119  GQIIATTIGGRDGQPKQTISYMAERIVGTGSFGVVFQAKCVETGEAVAIKKVLQDKRYKN  178

Query  679  RELQIMRMLEHPNVV  723
            RELQIM +L+HPNVV
Sbjct  179  RELQIMLLLDHPNVV  193



>ref|XP_004306833.1| PREDICTED: shaggy-related protein kinase theta-like [Fragaria 
vesca subsp. vesca]
Length=470

 Score =   199 bits (505),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 116/198 (59%), Positives = 147/198 (74%), Gaps = 8/198 (4%)
 Frame = +1

Query  145  MNVMRRLKSVASGRSSVSDPQGGDSSIKRVKVAQDFDQRIAGKPESEEICTT-----APM  309
            MN+MRRLKS+ASGRSSVS   GGDSS KR K  Q  ++++ G+    E   T     +  
Sbjct  1    MNMMRRLKSIASGRSSVSSDPGGDSSSKRSKFDQQTEKKVIGQSNGVERSATDQNTKSTS  60

Query  310  HEAASTSQEDASGISLVARSEKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNG  489
             E+A+++   +S   + A+ EKS  ++LPK+MH+MKI+D  + ++   KDME  +I+GNG
Sbjct  61   MESAASTSSASSIAKIEAKEEKSTVDQLPKDMHQMKIRDVHNHDE---KDMEETIISGNG  117

Query  490  TETGQIIVTTVGGRNGEQKQVLSYMAERVVGTGSFGVVFQAKCLESGEAVAIKKVLXDRR  669
            TETG II TTVGGRNG+ KQ +SYMAE VVGTGSFGVVFQAKCLE+GEAVAIKKVL D+R
Sbjct  118  TETGHIIATTVGGRNGQPKQTISYMAECVVGTGSFGVVFQAKCLETGEAVAIKKVLQDKR  177

Query  670  YXNRELQIMRMLEHPNVV  723
            Y NRELQIMR+L+H NVV
Sbjct  178  YKNRELQIMRLLDHSNVV  195



>ref|XP_009393922.1| PREDICTED: shaggy-related protein kinase epsilon-like isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=480

 Score =   199 bits (505),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 108/195 (55%), Positives = 138/195 (71%), Gaps = 4/195 (2%)
 Frame = +1

Query  145  MNVMRRLKSVASGRSSVSDPQGGDSSIKRVKVAQDFDQRIAGKPESEEICTTAPMHEAAS  324
            M++MRRLKS+ASGRSSVSDP GGD   KR K  Q+  + +  +   E+  +T     +  
Sbjct  1    MHMMRRLKSIASGRSSVSDP-GGDLGTKRAKFDQEGGEILTERHLVEDKVSTMDQRISLY  59

Query  325  TSQEDASGISL--VARSEKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTET  498
                DAS  S    AR E +  ++LP+EMH M I++DK D  N  K+++  +  G GT T
Sbjct  60   HLDLDASTSSTDPPARFEAATMDQLPREMHGMTIREDKPDGHNE-KELDGSMTNGKGTMT  118

Query  499  GQIIVTTVGGRNGEQKQVLSYMAERVVGTGSFGVVFQAKCLESGEAVAIKKVLXDRRYXN  678
            GQII TT+GGR+G+ KQ +SYMAER+VGTGSFGVVFQAKC+E+GEAVAIKKVL D+RY N
Sbjct  119  GQIIATTIGGRDGQPKQTISYMAERIVGTGSFGVVFQAKCVETGEAVAIKKVLQDKRYKN  178

Query  679  RELQIMRMLEHPNVV  723
            RELQIM +L+HPNVV
Sbjct  179  RELQIMLLLDHPNVV  193



>ref|XP_009400715.1| PREDICTED: shaggy-related protein kinase eta-like isoform X1 
[Musa acuminata subsp. malaccensis]
Length=471

 Score =   198 bits (504),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 108/200 (54%), Positives = 142/200 (71%), Gaps = 13/200 (7%)
 Frame = +1

Query  145  MNVMRRLKSVASGRSSVSDPQGGDSSIKRVKVAQDFDQRIAGKPESE-----EICTTAPM  309
            M++M+RLKS+ASGRSSVSDP GGD + KR K    FDQ   G+   E     ++ +T  +
Sbjct  1    MHMMQRLKSIASGRSSVSDP-GGDLTTKRAK----FDQEGGGEILVERHMVDDVASTVDL  55

Query  310  HEAASTSQEDASGISL--VARSEKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITG  483
            H ++S    DAS ++    AR E +  ++LP+EMH M I+D K+D      + +  +I G
Sbjct  56   HISSSHLNFDASTLTTEPPARFEGATMDQLPREMHGMTIRDIKTDGHIE-TEFDGTMING  114

Query  484  NGTETGQIIVTTVGGRNGEQKQVLSYMAERVVGTGSFGVVFQAKCLESGEAVAIKKVLXD  663
             GT TGQI+ T +GGR+G+ KQ +SYMAER+VGTGSFGVVFQAKC+E+GEAVAIKKVL D
Sbjct  115  KGTMTGQILATVIGGRDGQPKQTISYMAERIVGTGSFGVVFQAKCVETGEAVAIKKVLQD  174

Query  664  RRYXNRELQIMRMLEHPNVV  723
            +RY NRELQIM +L+HPNVV
Sbjct  175  KRYKNRELQIMLLLDHPNVV  194



>ref|XP_002301334.1| hypothetical protein POPTR_0002s15640g [Populus trichocarpa]
 gb|EEE80607.1| hypothetical protein POPTR_0002s15640g [Populus trichocarpa]
Length=412

 Score =   197 bits (500),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 93/138 (67%), Positives = 121/138 (88%), Gaps = 4/138 (3%)
 Frame = +1

Query  319  ASTSQEDA---SGISLVARSEKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNG  489
            ASTSQE+A   S I+ V R+EKSGY++LPKEMH+MKI+D+K+ + +  K++E  +++GNG
Sbjct  2    ASTSQENAASTSNITSVTRTEKSGYDQLPKEMHQMKIRDEKTTSHDE-KEVEAAIVSGNG  60

Query  490  TETGQIIVTTVGGRNGEQKQVLSYMAERVVGTGSFGVVFQAKCLESGEAVAIKKVLXDRR  669
            TETGQII TTVGG++G+ KQ +SY+AER+VGTGSFGVV+QAKCLE+GEAVAIKKVL D+R
Sbjct  61   TETGQIIATTVGGQDGQPKQTISYVAERMVGTGSFGVVYQAKCLETGEAVAIKKVLQDKR  120

Query  670  YXNRELQIMRMLEHPNVV  723
            Y NRELQ+MR+L+HPNVV
Sbjct  121  YKNRELQVMRLLDHPNVV  138



>emb|CDY51144.1| BnaA09g51790D [Brassica napus]
Length=478

 Score =   198 bits (504),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 106/200 (53%), Positives = 139/200 (70%), Gaps = 9/200 (5%)
 Frame = +1

Query  145  MNVMRRLKSVASGRSSVSDPQGGDSSIKRVKVAQDFDQRIAGKPESEEICTTAP------  306
            MNVMRRLKS+ASGR+S+S   GGD  +KR K+ QD D+      +  ++  T+       
Sbjct  1    MNVMRRLKSIASGRTSISSDPGGDYGLKRAKLDQDNDKLCTAGDDPMQVDQTSSSSSSSR  60

Query  307  -MHEAASTSQEDASGISLVARSEKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITG  483
             M      SQE  +G S V     +    +  ++ E+ I+D+++ N+ + KDMEP V+ G
Sbjct  61   EMRNTDMVSQECVAGTSNVPPPAAAA-ATVDTQLPEVMIRDERNANRED-KDMEPTVVNG  118

Query  484  NGTETGQIIVTTVGGRNGEQKQVLSYMAERVVGTGSFGVVFQAKCLESGEAVAIKKVLXD  663
            +GTETGQ+I TTVGGR+G+ KQ +SYMA+RVVGTGSFGVVFQAKCLE+GE VAIKKVL D
Sbjct  119  SGTETGQVITTTVGGRDGKPKQTISYMAQRVVGTGSFGVVFQAKCLETGEQVAIKKVLQD  178

Query  664  RRYXNRELQIMRMLEHPNVV  723
            +RY NRELQIMR+ +HPNVV
Sbjct  179  KRYKNRELQIMRLQDHPNVV  198



>sp|O04160.2|KSGT_BRANA RecName: Full=Shaggy-related protein kinase theta; AltName: Full=ASK-theta 
[Brassica napus]
 emb|CAA73214.1| shaggy-like protein kinase tetha [Brassica napus]
Length=468

 Score =   197 bits (502),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 105/195 (54%), Positives = 140/195 (72%), Gaps = 9/195 (5%)
 Frame = +1

Query  145  MNVMRRLKSVASGRSSVSDPQGGDSSIKRVKVAQDFDQRIAGKPESEEICTTAPMHEAAS  324
            MNVMRRLKS+ASGR+S+S   G DSS+KR K+ QD D   +   +  ++  +  M     
Sbjct  1    MNVMRRLKSIASGRTSISSDPGVDSSLKRPKLDQDNDNLSSRGDDPMQVDQSTDM---VV  57

Query  325  TSQEDASGISLVARSEKSGYEELPKEMHEMKIKDDK--SDNQNNLKDMEPVVITGNGTET  498
             SQ+  +G S V        ++LP+ M++M++++D+  ++     KDMEP ++ G GTET
Sbjct  58   VSQDTVAGTSNVPPPP----DQLPEVMNDMRLREDEPHANRGEEDKDMEPPIVNGCGTET  113

Query  499  GQIIVTTVGGRNGEQKQVLSYMAERVVGTGSFGVVFQAKCLESGEAVAIKKVLXDRRYXN  678
            GQ+I TTVGGR+G+ KQ +SYMA+RVVGTGSFGVVFQAKCLE+GE VAIKKVL D+RY N
Sbjct  114  GQVITTTVGGRDGKPKQTISYMAQRVVGTGSFGVVFQAKCLETGEQVAIKKVLQDKRYKN  173

Query  679  RELQIMRMLEHPNVV  723
            RELQIMR+ +HPNVV
Sbjct  174  RELQIMRLQDHPNVV  188



>ref|XP_010456251.1| PREDICTED: shaggy-related protein kinase theta [Camelina sativa]
Length=479

 Score =   197 bits (501),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 103/202 (51%), Positives = 143/202 (71%), Gaps = 12/202 (6%)
 Frame = +1

Query  145  MNVMRRLKSVASGRSSVSDPQGGDSSIKRVKVAQDFDQRIAGKPESEEICTTA-------  303
            MNVMRRLKS+ASGR+S+S   GGD  +KR K+ Q+ D   A   + ++  +++       
Sbjct  1    MNVMRRLKSIASGRTSISSDPGGDYGMKRAKLDQENDNLCADPMQVDQTSSSSSSDIKPD  60

Query  304  --PMHEAASTSQEDASGISLVARSEKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVI  477
              P+   A TS  +   +S     +   + +LP+ M +M+I+DD++  +++ K+ME  ++
Sbjct  61   IFPLESVAGTS--NGHPLSDKPVDDHHHHHQLPEVMTDMRIRDDRNAYRDD-KEMETTIV  117

Query  478  TGNGTETGQIIVTTVGGRNGEQKQVLSYMAERVVGTGSFGVVFQAKCLESGEAVAIKKVL  657
             G+GTETGQ+I TTVGGR+G+ KQ +SYMA+RVVGTGSFGVVFQAKCLE+GE VAIKKVL
Sbjct  118  NGSGTETGQVITTTVGGRDGKPKQTISYMAQRVVGTGSFGVVFQAKCLETGEQVAIKKVL  177

Query  658  XDRRYXNRELQIMRMLEHPNVV  723
             D+RY NRELQIMR+ +HPNVV
Sbjct  178  QDKRYKNRELQIMRLQDHPNVV  199



>emb|CDX91895.1| BnaC03g31970D [Brassica napus]
Length=466

 Score =   196 bits (498),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 108/198 (55%), Positives = 142/198 (72%), Gaps = 17/198 (9%)
 Frame = +1

Query  145  MNVMRRLKSVASGRSSVSDPQGGDSSIKRVKVAQDFDQRIAGKPESEEICTTAPMHEAAS  324
            MNVMRRLKS+ASGR+SVS   G DSS+KR K+ QD D  ++ + +        PM    S
Sbjct  1    MNVMRRLKSIASGRTSVSSDPGVDSSLKRPKLDQDNDN-LSSRGDD-------PMQVDQS  52

Query  325  T---SQEDASGISLVARSEKSGYEELPKEMHEMKIKDDK--SDNQNNLKDMEPVVITGNG  489
            T   SQ+  +G S V        ++LP+ M++M++++++  ++     KDMEP ++ G G
Sbjct  53   TDMVSQDSVAGTSNVPPPA----DQLPEVMNDMRLREEEPHANRGEEDKDMEPPIVNGCG  108

Query  490  TETGQIIVTTVGGRNGEQKQVLSYMAERVVGTGSFGVVFQAKCLESGEAVAIKKVLXDRR  669
            TETGQ+I TTVGGR+G+ KQ +SYMA+RVVGTGSFGVVFQAKCLE+GE VAIKKVL D+R
Sbjct  109  TETGQVITTTVGGRDGKPKQTISYMAQRVVGTGSFGVVFQAKCLETGEQVAIKKVLQDKR  168

Query  670  YXNRELQIMRMLEHPNVV  723
            Y NRELQIMR+ +HPNVV
Sbjct  169  YKNRELQIMRLQDHPNVV  186



>gb|KJB41234.1| hypothetical protein B456_007G096100 [Gossypium raimondii]
Length=470

 Score =   195 bits (496),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 115/196 (59%), Positives = 140/196 (71%), Gaps = 4/196 (2%)
 Frame = +1

Query  145  MNVMRRLKSVASGRSSVSDPQGGDSSIKRVKVAQDFDQRIAGKPESEEICTTAPMHEAAS  324
            MNVMRRLKS+ASGRSS S    GD+  KR KV Q+ + ++       E  TT      AS
Sbjct  1    MNVMRRLKSIASGRSSSSSDPSGDTGTKRAKVDQESECKVNEASNFVERSTTDREKHMAS  60

Query  325  TSQEDASGISLV---ARSEKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTE  495
            +S E  +  S V   AR+EK   + LP EMHEM+I+D+K+ + +  KDME  VI GNGTE
Sbjct  61   SSLETVASTSYVTSVARTEKPDVDLLPNEMHEMRIRDEKTADPDE-KDMEAPVINGNGTE  119

Query  496  TGQIIVTTVGGRNGEQKQVLSYMAERVVGTGSFGVVFQAKCLESGEAVAIKKVLXDRRYX  675
            TGQII  T+GGR+G+ KQ +SYMAERV+G GSFGVVFQAKCLE GE+VAIKKV  D+RY 
Sbjct  120  TGQIISATIGGRDGKPKQTISYMAERVIGRGSFGVVFQAKCLERGESVAIKKVPQDKRYK  179

Query  676  NRELQIMRMLEHPNVV  723
            NRELQIMR+L+HPNVV
Sbjct  180  NRELQIMRILDHPNVV  195



>gb|KFK30649.1| hypothetical protein AALP_AA6G009500 [Arabis alpina]
Length=471

 Score =   195 bits (495),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 108/204 (53%), Positives = 141/204 (69%), Gaps = 25/204 (12%)
 Frame = +1

Query  145  MNVMRRLKSVASGRSSVSDPQGGDSSIKRVKVAQDFDQRIAGKPESEEICTTAPMH----  312
            MNVMRRLKS+ASGR+S+S   GGD  +KR K+ Q          E+E   ++ PM     
Sbjct  1    MNVMRRLKSIASGRTSISSDPGGDYGLKRAKLDQ----------ENESSSSSDPMQVDQN  50

Query  313  ---EAASTSQEDASGIS---LVARSEKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEPV-  471
               +    SQE  +G S   +VA  +    ++LP+ M +M+I+D++++     KDME   
Sbjct  51   SEMKTEMVSQESVAGTSNVPVVANVD----DQLPEVMIDMRIRDERNNANREEKDMETTT  106

Query  472  VITGNGTETGQIIVTTVGGRNGEQKQVLSYMAERVVGTGSFGVVFQAKCLESGEAVAIKK  651
            V+ G+GTETGQ+I TTVGGR+G+ KQ +SYMA+RVVGTGSFGVVFQAKCLE+GE VAIKK
Sbjct  107  VVNGSGTETGQVITTTVGGRDGKPKQTISYMAQRVVGTGSFGVVFQAKCLETGEQVAIKK  166

Query  652  VLXDRRYXNRELQIMRMLEHPNVV  723
            VL D+RY NRELQIMR+ +HPNVV
Sbjct  167  VLQDKRYKNRELQIMRLQDHPNVV  190



>ref|XP_002991115.1| hypothetical protein SELMODRAFT_451471 [Selaginella moellendorffii]
 ref|XP_002991645.1| hypothetical protein SELMODRAFT_186226 [Selaginella moellendorffii]
 gb|EFJ07216.1| hypothetical protein SELMODRAFT_186226 [Selaginella moellendorffii]
 gb|EFJ07923.1| hypothetical protein SELMODRAFT_451471 [Selaginella moellendorffii]
Length=456

 Score =   190 bits (482),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 100/191 (52%), Positives = 129/191 (68%), Gaps = 17/191 (9%)
 Frame = +1

Query  151  VMRRLKSVASGRSSVSDPQGGDSSIKRVKVAQDFDQRIAGKPESEEICTTAPMHEAASTS  330
            +M+RL+++ASG SS +D Q G +  KR KV Q  +Q +A                 +S S
Sbjct  1    MMQRLRNLASGWSSTADTQLGGAGTKRAKVEQGEEQGMA-----------------SSVS  43

Query  331  QEDASGISLVARSEKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTETGQII  510
                      A    +  ++LP EMHEMKI+DDK+    + K++E  VI GNGTETG II
Sbjct  44   AAGLIANPRAATVNSNVVDQLPDEMHEMKIRDDKAATHIDEKEVEAAVIDGNGTETGHII  103

Query  511  VTTVGGRNGEQKQVLSYMAERVVGTGSFGVVFQAKCLESGEAVAIKKVLXDRRYXNRELQ  690
             TT+GGRNG+ KQ +SY+AERVVGTGSFG+VFQAKCLE+GE VAIKKVL D+RY NRELQ
Sbjct  104  ATTIGGRNGQPKQTISYVAERVVGTGSFGIVFQAKCLETGETVAIKKVLQDKRYKNRELQ  163

Query  691  IMRMLEHPNVV  723
            IMR+L+HP++V
Sbjct  164  IMRLLDHPSIV  174



>ref|XP_009412822.1| PREDICTED: shaggy-related protein kinase alpha-like isoform X2 
[Musa acuminata subsp. malaccensis]
Length=471

 Score =   187 bits (476),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 106/196 (54%), Positives = 140/196 (71%), Gaps = 5/196 (3%)
 Frame = +1

Query  145  MNVMRRLKSVASGRSSVSDPQGGDSSIKRVKVAQDFDQRIAGKPESEEICTTAPMHEAAS  324
            M++MRRLKS+ SGR S SDP GGD   K+ KV QD   +I  +P   E  +    H +A 
Sbjct  1    MHMMRRLKSITSGRPSSSDP-GGDYGTKKTKVDQDGGGKILVEPHMSEKKSIELDHCSAL  59

Query  325  TSQE-DASGISL--VARSEKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTE  495
                 DAS  S     + +++  ++LPKEM++M IK DK ++ +  K+ + +++ GNGTE
Sbjct  60   NQMNFDASSSSSDPPMKIQEATVDQLPKEMNDMTIKVDKVNDHDE-KENDGIMVNGNGTE  118

Query  496  TGQIIVTTVGGRNGEQKQVLSYMAERVVGTGSFGVVFQAKCLESGEAVAIKKVLXDRRYX  675
            TGQ IV T+GGRNG+ KQ +SYMAERVVGTGSFG+VFQAK +E+GEAVAIKKVL D+RY 
Sbjct  119  TGQTIVITIGGRNGQPKQTISYMAERVVGTGSFGMVFQAKLVETGEAVAIKKVLQDKRYK  178

Query  676  NRELQIMRMLEHPNVV  723
            NRELQIM++L+HPNVV
Sbjct  179  NRELQIMQLLKHPNVV  194



>gb|KJB41237.1| hypothetical protein B456_007G096100 [Gossypium raimondii]
Length=458

 Score =   184 bits (467),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 99/174 (57%), Positives = 124/174 (71%), Gaps = 4/174 (2%)
 Frame = +1

Query  211  GDSSIKRVKVAQDFDQRIAGKPESEEICTTAPMHEAASTSQE---DASGISLVARSEKSG  381
            GD+  KR KV Q+ + ++       E  TT      AS+S E     S ++ VAR+EK  
Sbjct  11   GDTGTKRAKVDQESECKVNEASNFVERSTTDREKHMASSSLETVASTSYVTSVARTEKPD  70

Query  382  YEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTETGQIIVTTVGGRNGEQKQVLSY  561
             + LP EMHEM+I+D+K+ + +  KDME  VI GNGTETGQII  T+GGR+G+ KQ +SY
Sbjct  71   VDLLPNEMHEMRIRDEKTADPDE-KDMEAPVINGNGTETGQIISATIGGRDGKPKQTISY  129

Query  562  MAERVVGTGSFGVVFQAKCLESGEAVAIKKVLXDRRYXNRELQIMRMLEHPNVV  723
            MAERV+G GSFGVVFQAKCLE GE+VAIKKV  D+RY NRELQIMR+L+HPNVV
Sbjct  130  MAERVIGRGSFGVVFQAKCLERGESVAIKKVPQDKRYKNRELQIMRILDHPNVV  183



>ref|XP_002987888.1| GSK3/shaggy-like protein kinase [Selaginella moellendorffii]
 ref|XP_002994033.1| hypothetical protein SELMODRAFT_163279 [Selaginella moellendorffii]
 gb|EFJ04915.1| hypothetical protein SELMODRAFT_163279 [Selaginella moellendorffii]
 gb|EFJ10962.1| GSK3/shaggy-like protein kinase [Selaginella moellendorffii]
Length=423

 Score =   182 bits (461),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 83/123 (67%), Positives = 107/123 (87%), Gaps = 1/123 (1%)
 Frame = +1

Query  355  LVARSEKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTETGQIIVTTVGGRN  534
            +V++   SG ++LP+EMHEMKI+DDK+D+ ++ K++E  V+ GNGTETG II TT+GGRN
Sbjct  20   VVSKVGGSGVDQLPEEMHEMKIRDDKTDHSDD-KELEATVVDGNGTETGHIIATTIGGRN  78

Query  535  GEQKQVLSYMAERVVGTGSFGVVFQAKCLESGEAVAIKKVLXDRRYXNRELQIMRMLEHP  714
            G+ KQ +SY+AERVVGTGSFG+VFQAKCLE+GE VAIKKVL D+RY NRELQIMR+L+HP
Sbjct  79   GQPKQTISYVAERVVGTGSFGIVFQAKCLETGETVAIKKVLQDKRYKNRELQIMRLLDHP  138

Query  715  NVV  723
            N+V
Sbjct  139  NIV  141



>ref|XP_006857847.2| PREDICTED: shaggy-related protein kinase epsilon [Amborella trichopoda]
Length=379

 Score =   181 bits (458),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 85/137 (62%), Positives = 109/137 (80%), Gaps = 1/137 (1%)
 Frame = +1

Query  313  EAASTSQEDASGISLVARSEKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGT  492
            EA +T    ++ +  +  +E  G ++LPKE+HEMKI+DDK+++ ++ KD E  V+ G GT
Sbjct  7    EANATDASASNAVVPLGTNENVGLDQLPKELHEMKIRDDKANSLDH-KDTEAAVVNGRGT  65

Query  493  ETGQIIVTTVGGRNGEQKQVLSYMAERVVGTGSFGVVFQAKCLESGEAVAIKKVLXDRRY  672
            E G II TTVGGRNG+ KQ +SYMAERVVG GSFGVVFQAKCLE+GEAVAIKKVL D+RY
Sbjct  66   EAGHIISTTVGGRNGQPKQTISYMAERVVGHGSFGVVFQAKCLETGEAVAIKKVLQDKRY  125

Query  673  XNRELQIMRMLEHPNVV  723
             NRELQ+MR+L+HPNV+
Sbjct  126  KNRELQVMRLLDHPNVI  142



>gb|KHG02100.1| Shaggy-related protein kinase theta [Gossypium arboreum]
Length=416

 Score =   181 bits (458),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 113/198 (57%), Positives = 137/198 (69%), Gaps = 7/198 (4%)
 Frame = +1

Query  145  MNVMRRLKSVASGRSSVSDPQGGDSSIKRVKVAQDFDQRIAGKPESEEICTTAPMHEAAS  324
            MNVMRRLKS+AS RSS+SD  G   + KR KV Q+ + +  G+    +  T+ P H  AS
Sbjct  1    MNVMRRLKSIASSRSSISDSGGDSFT-KRAKVDQEAEFKATGESNISDRSTSGPEHHMAS  59

Query  325  TSQEDASGISLVAR-----SEKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNG  489
            TS E A+  S  A      +EK   ++LP EMHEM+I+D+K+    + KD+   VI GNG
Sbjct  60   TSSETAASTSNAASSSSNITEKLDLDQLPNEMHEMRIRDEKTTGHYD-KDVGSNVINGNG  118

Query  490  TETGQIIVTTVGGRNGEQKQVLSYMAERVVGTGSFGVVFQAKCLESGEAVAIKKVLXDRR  669
            TE GQII T VGGR G  KQ +SYMAERVVGTGSFGVVFQAKC+E GE VAIKKVL D+R
Sbjct  119  TEAGQIITTVVGGRGGHPKQTISYMAERVVGTGSFGVVFQAKCMERGEPVAIKKVLQDKR  178

Query  670  YXNRELQIMRMLEHPNVV  723
            Y NRELQIM +L+HPN V
Sbjct  179  YKNRELQIMHLLDHPNTV  196



>ref|XP_009412821.1| PREDICTED: shaggy-related protein kinase alpha-like isoform X1 
[Musa acuminata subsp. malaccensis]
Length=477

 Score =   181 bits (459),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 106/202 (52%), Positives = 140/202 (69%), Gaps = 11/202 (5%)
 Frame = +1

Query  145  MNVMRRLKSVASGRSSVSDPQGGDSSIKRVKVAQDFDQRIAGKPESEEICTTAPMHEAAS  324
            M++MRRLKS+ SGR S SDP GGD   K+ KV QD   +I  +P   E  +    H +A 
Sbjct  1    MHMMRRLKSITSGRPSSSDP-GGDYGTKKTKVDQDGGGKILVEPHMSEKKSIELDHCSAL  59

Query  325  TSQE-DASGISL--VARSEKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTE  495
                 DAS  S     + +++  ++LPKEM++M IK DK ++ +  K+ + +++ GNGTE
Sbjct  60   NQMNFDASSSSSDPPMKIQEATVDQLPKEMNDMTIKVDKVNDHDE-KENDGIMVNGNGTE  118

Query  496  TGQIIVTTVGGRNGEQKQVLSYMAERVVGTGSFGVVF------QAKCLESGEAVAIKKVL  657
            TGQ IV T+GGRNG+ KQ +SYMAERVVGTGSFG+VF      QAK +E+GEAVAIKKVL
Sbjct  119  TGQTIVITIGGRNGQPKQTISYMAERVVGTGSFGMVFQCFFLYQAKLVETGEAVAIKKVL  178

Query  658  XDRRYXNRELQIMRMLEHPNVV  723
             D+RY NRELQIM++L+HPNVV
Sbjct  179  QDKRYKNRELQIMQLLKHPNVV  200



>gb|KJB24672.1| hypothetical protein B456_004G156700 [Gossypium raimondii]
Length=409

 Score =   179 bits (454),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 112/198 (57%), Positives = 135/198 (68%), Gaps = 7/198 (4%)
 Frame = +1

Query  145  MNVMRRLKSVASGRSSVSDPQGGDSSIKRVKVAQDFDQRIAGKPESEEICTTAPMHEAAS  324
            MNVMRRLKS+AS RSS+SD  G   + KR KV Q+ + +  G+    +  T  P H  AS
Sbjct  1    MNVMRRLKSIASSRSSISDSGGDSFT-KRAKVDQESEFKATGESNISDRSTPGPEHHMAS  59

Query  325  TSQEDASGISLVAR-----SEKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNG  489
            TS E  +  S  A      +EK   ++LP EMHEM+I+D+K+    + KD+   VI GNG
Sbjct  60   TSSETVASTSNAASSSSNITEKLDLDQLPNEMHEMRIRDEKTTGHYD-KDVGSNVINGNG  118

Query  490  TETGQIIVTTVGGRNGEQKQVLSYMAERVVGTGSFGVVFQAKCLESGEAVAIKKVLXDRR  669
            TE GQII T VGGR G  KQ +SYMAERVVGTGSFGVVFQAKC+E GE VAIKKVL D+R
Sbjct  119  TEAGQIITTVVGGRGGHPKQTISYMAERVVGTGSFGVVFQAKCMERGEHVAIKKVLQDKR  178

Query  670  YXNRELQIMRMLEHPNVV  723
            Y NRELQIM +L+HPN V
Sbjct  179  YKNRELQIMHLLDHPNTV  196



>gb|KJB24673.1| hypothetical protein B456_004G156700 [Gossypium raimondii]
Length=422

 Score =   179 bits (455),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 112/198 (57%), Positives = 135/198 (68%), Gaps = 7/198 (4%)
 Frame = +1

Query  145  MNVMRRLKSVASGRSSVSDPQGGDSSIKRVKVAQDFDQRIAGKPESEEICTTAPMHEAAS  324
            MNVMRRLKS+AS RSS+SD  G   + KR KV Q+ + +  G+    +  T  P H  AS
Sbjct  1    MNVMRRLKSIASSRSSISDSGGDSFT-KRAKVDQESEFKATGESNISDRSTPGPEHHMAS  59

Query  325  TSQEDASGISLVAR-----SEKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNG  489
            TS E  +  S  A      +EK   ++LP EMHEM+I+D+K+    + KD+   VI GNG
Sbjct  60   TSSETVASTSNAASSSSNITEKLDLDQLPNEMHEMRIRDEKTTGHYD-KDVGSNVINGNG  118

Query  490  TETGQIIVTTVGGRNGEQKQVLSYMAERVVGTGSFGVVFQAKCLESGEAVAIKKVLXDRR  669
            TE GQII T VGGR G  KQ +SYMAERVVGTGSFGVVFQAKC+E GE VAIKKVL D+R
Sbjct  119  TEAGQIITTVVGGRGGHPKQTISYMAERVVGTGSFGVVFQAKCMERGEHVAIKKVLQDKR  178

Query  670  YXNRELQIMRMLEHPNVV  723
            Y NRELQIM +L+HPN V
Sbjct  179  YKNRELQIMHLLDHPNTV  196



>gb|KHG02099.1| Shaggy-related protein kinase theta [Gossypium arboreum]
Length=471

 Score =   180 bits (457),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 113/198 (57%), Positives = 137/198 (69%), Gaps = 7/198 (4%)
 Frame = +1

Query  145  MNVMRRLKSVASGRSSVSDPQGGDSSIKRVKVAQDFDQRIAGKPESEEICTTAPMHEAAS  324
            MNVMRRLKS+AS RSS+SD  G   + KR KV Q+ + +  G+    +  T+ P H  AS
Sbjct  1    MNVMRRLKSIASSRSSISDSGGDSFT-KRAKVDQEAEFKATGESNISDRSTSGPEHHMAS  59

Query  325  TSQEDASGISLVAR-----SEKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNG  489
            TS E A+  S  A      +EK   ++LP EMHEM+I+D+K+    + KD+   VI GNG
Sbjct  60   TSSETAASTSNAASSSSNITEKLDLDQLPNEMHEMRIRDEKTTGHYD-KDVGSNVINGNG  118

Query  490  TETGQIIVTTVGGRNGEQKQVLSYMAERVVGTGSFGVVFQAKCLESGEAVAIKKVLXDRR  669
            TE GQII T VGGR G  KQ +SYMAERVVGTGSFGVVFQAKC+E GE VAIKKVL D+R
Sbjct  119  TEAGQIITTVVGGRGGHPKQTISYMAERVVGTGSFGVVFQAKCMERGEPVAIKKVLQDKR  178

Query  670  YXNRELQIMRMLEHPNVV  723
            Y NRELQIM +L+HPN V
Sbjct  179  YKNRELQIMHLLDHPNTV  196



>ref|XP_001762052.1| predicted protein [Physcomitrella patens]
 gb|EDQ73156.1| predicted protein [Physcomitrella patens]
Length=424

 Score =   179 bits (453),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 87/142 (61%), Positives = 110/142 (77%), Gaps = 8/142 (6%)
 Frame = +1

Query  319  ASTSQEDASGISLV-------ARSEKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVI  477
            AS +    SG +++        ++  SG E LPKEMHEMK++DDK D+ ++ K++E  V+
Sbjct  2    ASATAAAVSGTNMIGGGRAAPTKAGSSGVELLPKEMHEMKLRDDKVDHGDD-KEIEATVV  60

Query  478  TGNGTETGQIIVTTVGGRNGEQKQVLSYMAERVVGTGSFGVVFQAKCLESGEAVAIKKVL  657
             GNGTETG II TT+GGRNG+ KQ +SY AERVVGTGSFG+VFQAKC+ESGE VAIKKVL
Sbjct  61   DGNGTETGHIIATTIGGRNGQPKQTISYSAERVVGTGSFGIVFQAKCIESGETVAIKKVL  120

Query  658  XDRRYXNRELQIMRMLEHPNVV  723
             D+RY NRELQIMR+L+HPN+V
Sbjct  121  QDKRYKNRELQIMRLLDHPNIV  142



>gb|AAQ23109.1| shaggy-related protein kinase 4 [Physcomitrella patens]
Length=424

 Score =   179 bits (453),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 87/142 (61%), Positives = 111/142 (78%), Gaps = 8/142 (6%)
 Frame = +1

Query  319  ASTSQEDASGISLV-------ARSEKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVI  477
            AS++    SG +++        ++  SG E LPKEMHEMK++DDK D+ ++ K++E  V+
Sbjct  2    ASSTAGAVSGTNMIGGGRAAPTKAGSSGVELLPKEMHEMKLRDDKVDHGDD-KEIEATVV  60

Query  478  TGNGTETGQIIVTTVGGRNGEQKQVLSYMAERVVGTGSFGVVFQAKCLESGEAVAIKKVL  657
             GNGTETG II TT+GGRNG+ KQ +SY AERVVGTGSFG+VFQAKC+ESGE VAIKKVL
Sbjct  61   DGNGTETGHIIATTIGGRNGQPKQTISYSAERVVGTGSFGIVFQAKCIESGETVAIKKVL  120

Query  658  XDRRYXNRELQIMRMLEHPNVV  723
             D+RY NRELQIMR+L+HPN+V
Sbjct  121  QDKRYKNRELQIMRLLDHPNIV  142



>gb|KJB24671.1| hypothetical protein B456_004G156700 [Gossypium raimondii]
Length=471

 Score =   179 bits (455),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 112/198 (57%), Positives = 135/198 (68%), Gaps = 7/198 (4%)
 Frame = +1

Query  145  MNVMRRLKSVASGRSSVSDPQGGDSSIKRVKVAQDFDQRIAGKPESEEICTTAPMHEAAS  324
            MNVMRRLKS+AS RSS+SD  G   + KR KV Q+ + +  G+    +  T  P H  AS
Sbjct  1    MNVMRRLKSIASSRSSISDSGGDSFT-KRAKVDQESEFKATGESNISDRSTPGPEHHMAS  59

Query  325  TSQEDASGISLVAR-----SEKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNG  489
            TS E  +  S  A      +EK   ++LP EMHEM+I+D+K+    + KD+   VI GNG
Sbjct  60   TSSETVASTSNAASSSSNITEKLDLDQLPNEMHEMRIRDEKTTGHYD-KDVGSNVINGNG  118

Query  490  TETGQIIVTTVGGRNGEQKQVLSYMAERVVGTGSFGVVFQAKCLESGEAVAIKKVLXDRR  669
            TE GQII T VGGR G  KQ +SYMAERVVGTGSFGVVFQAKC+E GE VAIKKVL D+R
Sbjct  119  TEAGQIITTVVGGRGGHPKQTISYMAERVVGTGSFGVVFQAKCMERGEHVAIKKVLQDKR  178

Query  670  YXNRELQIMRMLEHPNVV  723
            Y NRELQIM +L+HPN V
Sbjct  179  YKNRELQIMHLLDHPNTV  196



>ref|XP_001765207.1| predicted protein [Physcomitrella patens]
 gb|EDQ69935.1| predicted protein [Physcomitrella patens]
Length=424

 Score =   177 bits (450),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 84/126 (67%), Positives = 103/126 (82%), Gaps = 1/126 (1%)
 Frame = +1

Query  346  GISLVARSEKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTETGQIIVTTVG  525
            G ++  ++  SG E LPKEMH MK++DDK D+ ++ K+ E  V+ GNGTETG II TT+G
Sbjct  18   GGAVPTKAGSSGVESLPKEMHGMKLRDDKVDHSDD-KEFEATVVDGNGTETGHIIATTIG  76

Query  526  GRNGEQKQVLSYMAERVVGTGSFGVVFQAKCLESGEAVAIKKVLXDRRYXNRELQIMRML  705
            GRNG+ KQ +SY AERVVGTGSFG+VFQAKC+ESGE VAIKKVL D+RY NRELQIMR+L
Sbjct  77   GRNGQPKQTISYSAERVVGTGSFGIVFQAKCIESGETVAIKKVLQDKRYKNRELQIMRLL  136

Query  706  EHPNVV  723
            EHPN+V
Sbjct  137  EHPNIV  142



>gb|KJB41235.1| hypothetical protein B456_007G096100 [Gossypium raimondii]
 gb|KJB41236.1| hypothetical protein B456_007G096100 [Gossypium raimondii]
Length=413

 Score =   177 bits (448),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 89/138 (64%), Positives = 108/138 (78%), Gaps = 4/138 (3%)
 Frame = +1

Query  319  ASTSQEDASGISLV---ARSEKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNG  489
            AS+S E  +  S V   AR+EK   + LP EMHEM+I+D+K+ + +  KDME  VI GNG
Sbjct  2    ASSSLETVASTSYVTSVARTEKPDVDLLPNEMHEMRIRDEKTADPDE-KDMEAPVINGNG  60

Query  490  TETGQIIVTTVGGRNGEQKQVLSYMAERVVGTGSFGVVFQAKCLESGEAVAIKKVLXDRR  669
            TETGQII  T+GGR+G+ KQ +SYMAERV+G GSFGVVFQAKCLE GE+VAIKKV  D+R
Sbjct  61   TETGQIISATIGGRDGKPKQTISYMAERVIGRGSFGVVFQAKCLERGESVAIKKVPQDKR  120

Query  670  YXNRELQIMRMLEHPNVV  723
            Y NRELQIMR+L+HPNVV
Sbjct  121  YKNRELQIMRILDHPNVV  138



>emb|CDY19757.1| BnaA09g04100D [Brassica napus]
Length=406

 Score =   176 bits (446),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 83/121 (69%), Positives = 99/121 (82%), Gaps = 8/121 (7%)
 Frame = +1

Query  361  ARSEKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTETGQIIVTTVGGRNGE  540
            AR   +G ++LP+EM++MK++DDK        +MEPVV+ GNGTETG IIVTT+GGRNG+
Sbjct  12   ARDSTTGLDKLPEEMNDMKLRDDK--------EMEPVVVDGNGTETGHIIVTTIGGRNGQ  63

Query  541  QKQVLSYMAERVVGTGSFGVVFQAKCLESGEAVAIKKVLXDRRYXNRELQIMRMLEHPNV  720
             KQ +SYMAERVVG GSFGVVFQAKCLE+GE VAIKKVL DRRY NRELQ MR+ +HPNV
Sbjct  64   PKQTISYMAERVVGQGSFGVVFQAKCLETGETVAIKKVLQDRRYKNRELQTMRLFDHPNV  123

Query  721  V  723
            V
Sbjct  124  V  124



>emb|CDX87033.1| BnaC09g03480D [Brassica napus]
Length=406

 Score =   176 bits (446),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 82/121 (68%), Positives = 99/121 (82%), Gaps = 8/121 (7%)
 Frame = +1

Query  361  ARSEKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTETGQIIVTTVGGRNGE  540
            AR   +G ++LP+EM++MK++DDK        +MEP+V+ GNGTETG IIVTT+GGRNG+
Sbjct  12   ARDSTTGLDKLPEEMNDMKLRDDK--------EMEPIVVDGNGTETGHIIVTTIGGRNGQ  63

Query  541  QKQVLSYMAERVVGTGSFGVVFQAKCLESGEAVAIKKVLXDRRYXNRELQIMRMLEHPNV  720
             KQ +SYMAERVVG GSFGVVFQAKCLE+GE VAIKKVL DRRY NRELQ MR+ +HPNV
Sbjct  64   PKQTISYMAERVVGQGSFGVVFQAKCLETGETVAIKKVLQDRRYKNRELQTMRLFDHPNV  123

Query  721  V  723
            V
Sbjct  124  V  124



>ref|XP_001781582.1| predicted protein [Physcomitrella patens]
 gb|EDQ53633.1| predicted protein [Physcomitrella patens]
Length=424

 Score =   175 bits (444),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 80/116 (69%), Positives = 100/116 (86%), Gaps = 1/116 (1%)
 Frame = +1

Query  376  SGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTETGQIIVTTVGGRNGEQKQVL  555
            SG E LPKEMH+MK++DDK D+ ++ K++E  ++ GNGTETG II TT+GGRNG+ KQ +
Sbjct  27   SGVELLPKEMHDMKLRDDKVDHSDD-KEIEASIVDGNGTETGHIIATTIGGRNGQPKQTI  85

Query  556  SYMAERVVGTGSFGVVFQAKCLESGEAVAIKKVLXDRRYXNRELQIMRMLEHPNVV  723
            SY AERVVGTGSFG+VFQAKC+E+GE VAIKKVL D+RY NRELQIMR+L+HPN+V
Sbjct  86   SYSAERVVGTGSFGIVFQAKCIETGETVAIKKVLQDKRYKNRELQIMRLLDHPNIV  141



>gb|AAQ23108.1| shaggy-related protein kinase 3 [Physcomitrella patens]
 gb|AAQ23113.1| shaggy-related protein kinase 3 [Physcomitrella patens]
Length=423

 Score =   175 bits (444),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 80/116 (69%), Positives = 100/116 (86%), Gaps = 1/116 (1%)
 Frame = +1

Query  376  SGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTETGQIIVTTVGGRNGEQKQVL  555
            SG E LPKEMH+MK++DDK D+ ++ K++E  ++ GNGTETG II TT+GGRNG+ KQ +
Sbjct  27   SGVELLPKEMHDMKLRDDKVDHSDD-KEIEASIVDGNGTETGHIIATTIGGRNGQPKQTI  85

Query  556  SYMAERVVGTGSFGVVFQAKCLESGEAVAIKKVLXDRRYXNRELQIMRMLEHPNVV  723
            SY AERVVGTGSFG+VFQAKC+E+GE VAIKKVL D+RY NRELQIMR+L+HPN+V
Sbjct  86   SYSAERVVGTGSFGIVFQAKCIETGETVAIKKVLQDKRYKNRELQIMRLLDHPNIV  141



>gb|AAQ23107.1| shaggy-related protein kinase 2 [Physcomitrella patens]
 gb|AAQ23112.1| shaggy-related protein kinase 2 [Physcomitrella patens]
Length=423

 Score =   175 bits (444),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 80/116 (69%), Positives = 100/116 (86%), Gaps = 1/116 (1%)
 Frame = +1

Query  376  SGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTETGQIIVTTVGGRNGEQKQVL  555
            SG E LPKEMH+MK++DDK D+ ++ K++E  V+ GNGTETG II TT+GG+NG+ KQ +
Sbjct  27   SGVESLPKEMHDMKLRDDKVDHSDD-KEIEASVVDGNGTETGHIIATTIGGKNGQPKQTI  85

Query  556  SYMAERVVGTGSFGVVFQAKCLESGEAVAIKKVLXDRRYXNRELQIMRMLEHPNVV  723
            SY AERVVGTGSFG+VFQAKC+E+GE VAIKKVL D+RY NRELQIMR+L+HPN+V
Sbjct  86   SYSAERVVGTGSFGIVFQAKCIETGETVAIKKVLQDKRYKNRELQIMRLLDHPNIV  141



>ref|XP_001763265.1| predicted protein [Physcomitrella patens]
 gb|EDQ71795.1| predicted protein [Physcomitrella patens]
Length=423

 Score =   175 bits (444),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 80/116 (69%), Positives = 100/116 (86%), Gaps = 1/116 (1%)
 Frame = +1

Query  376  SGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTETGQIIVTTVGGRNGEQKQVL  555
            SG E LPKEMH+MK++DDK D+ ++ K++E  V+ GNGTETG II TT+GG+NG+ KQ +
Sbjct  27   SGVESLPKEMHDMKLRDDKVDHSDD-KEIEASVVDGNGTETGHIIATTIGGKNGQPKQTI  85

Query  556  SYMAERVVGTGSFGVVFQAKCLESGEAVAIKKVLXDRRYXNRELQIMRMLEHPNVV  723
            SY AERVVGTGSFG+VFQAKC+E+GE VAIKKVL D+RY NRELQIMR+L+HPN+V
Sbjct  86   SYSAERVVGTGSFGIVFQAKCIETGETVAIKKVLQDKRYKNRELQIMRLLDHPNIV  141



>gb|KJB22347.1| hypothetical protein B456_004G042400 [Gossypium raimondii]
Length=442

 Score =   175 bits (444),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 89/136 (65%), Positives = 108/136 (79%), Gaps = 6/136 (4%)
 Frame = +1

Query  316  AASTSQEDASGISLVARSEKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTE  495
             ASTS+     +  VAR +    ++LP EM EM+I+D+K+ + ++ KD E  VI GNGTE
Sbjct  38   VASTSR-----VPSVARQQNLVVDQLPNEMREMRIRDEKTVSHDD-KDPEATVINGNGTE  91

Query  496  TGQIIVTTVGGRNGEQKQVLSYMAERVVGTGSFGVVFQAKCLESGEAVAIKKVLXDRRYX  675
            TGQII TTVGG+NG+ KQ +SYMAERVVGTGSFGVVFQAKCLE+GE VAIKKVL D+RY 
Sbjct  92   TGQIISTTVGGQNGQPKQTMSYMAERVVGTGSFGVVFQAKCLETGEPVAIKKVLQDKRYK  151

Query  676  NRELQIMRMLEHPNVV  723
            NRELQIMR+L+HPNVV
Sbjct  152  NRELQIMRVLDHPNVV  167



>ref|XP_011079505.1| PREDICTED: shaggy-related protein kinase alpha-like [Sesamum 
indicum]
Length=413

 Score =   174 bits (441),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 86/128 (67%), Positives = 102/128 (80%), Gaps = 9/128 (7%)
 Frame = +1

Query  340  ASGISLVARSEKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTETGQIIVTT  519
            ASG+   +R +  G ++LP EM+EMK++DDK        DMEP VI GNGTETG IIVTT
Sbjct  9    ASGVRDPSR-KAGGLDKLPDEMNEMKLRDDK--------DMEPAVIDGNGTETGHIIVTT  59

Query  520  VGGRNGEQKQVLSYMAERVVGTGSFGVVFQAKCLESGEAVAIKKVLXDRRYXNRELQIMR  699
            +GGRNG+ KQ +SYMAER+VG GSFGVVFQAKCLE+GE VAIKKVL D+RY NRELQ MR
Sbjct  60   IGGRNGQPKQTISYMAERIVGQGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMR  119

Query  700  MLEHPNVV  723
            +L+HPNVV
Sbjct  120  LLDHPNVV  127



>gb|KJB45482.1| hypothetical protein B456_007G308500 [Gossypium raimondii]
Length=275

 Score =   170 bits (431),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 86/135 (64%), Positives = 102/135 (76%), Gaps = 11/135 (8%)
 Frame = +1

Query  319  ASTSQEDASGISLVARSEKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTET  498
            AS      SG+     S  +G E+LP+EM++MKI+DDK        +ME  V+ GNGTET
Sbjct  2    ASVGMVPTSGLR---ESSTAGVEKLPEEMNDMKIRDDK--------EMEATVVDGNGTET  50

Query  499  GQIIVTTVGGRNGEQKQVLSYMAERVVGTGSFGVVFQAKCLESGEAVAIKKVLXDRRYXN  678
            G IIVTT+GGRNG+ KQ +SYMAERVVG GSFGVVFQAKCLE+GE VAIKKVL D+RY N
Sbjct  51   GHIIVTTIGGRNGQPKQTISYMAERVVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKN  110

Query  679  RELQIMRMLEHPNVV  723
            RELQ MR+L+HPNVV
Sbjct  111  RELQTMRLLDHPNVV  125



>gb|ABR68632.1| RIM11-like protein [Oryza sativa Japonica Group]
Length=419

 Score =   174 bits (441),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 88/135 (65%), Positives = 107/135 (79%), Gaps = 6/135 (4%)
 Frame = +1

Query  319  ASTSQEDASGISLVARSEKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTET  498
            ASTS     G     R+E++G + LPKEM+EM I DDK D  N+ K+ E V++  NGTET
Sbjct  16   ASTSTSKNPG-----RTEEAGADILPKEMNEMTISDDKVDGHND-KESEGVIVNANGTET  69

Query  499  GQIIVTTVGGRNGEQKQVLSYMAERVVGTGSFGVVFQAKCLESGEAVAIKKVLXDRRYXN  678
            GQIIVT++GG+NG+ KQ +SYMAERVVGTGSFGVVFQAKCLE+GE VAIKKVL D+RY N
Sbjct  70   GQIIVTSIGGQNGKPKQKVSYMAERVVGTGSFGVVFQAKCLETGETVAIKKVLQDKRYKN  129

Query  679  RELQIMRMLEHPNVV  723
            RELQ M++L+HPNVV
Sbjct  130  RELQTMQLLDHPNVV  144



>ref|XP_009111716.1| PREDICTED: shaggy-related protein kinase alpha-like [Brassica 
rapa]
Length=406

 Score =   173 bits (439),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 81/121 (67%), Positives = 98/121 (81%), Gaps = 8/121 (7%)
 Frame = +1

Query  361  ARSEKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTETGQIIVTTVGGRNGE  540
            AR   +  ++LP+EM++MK++DDK        +MEP+V+ GNGTETG IIVTT+GGRNG+
Sbjct  12   ARDSTTSLDKLPEEMNDMKLRDDK--------EMEPIVVDGNGTETGHIIVTTIGGRNGQ  63

Query  541  QKQVLSYMAERVVGTGSFGVVFQAKCLESGEAVAIKKVLXDRRYXNRELQIMRMLEHPNV  720
             KQ +SYMAERVVG GSFGVVFQAKCLE+GE VAIKKVL DRRY NRELQ MR+ +HPNV
Sbjct  64   PKQTISYMAERVVGQGSFGVVFQAKCLETGETVAIKKVLQDRRYKNRELQTMRLFDHPNV  123

Query  721  V  723
            V
Sbjct  124  V  124



>ref|XP_001763270.1| predicted protein [Physcomitrella patens]
 gb|AAQ23106.1| shaggy-related protein kinase 1 [Physcomitrella patens]
 gb|EDQ71800.1| predicted protein [Physcomitrella patens]
Length=422

 Score =   174 bits (440),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 82/136 (60%), Positives = 105/136 (77%), Gaps = 1/136 (1%)
 Frame = +1

Query  316  AASTSQEDASGISLVARSEKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTE  495
            A  TS  +  G     ++  SG E LPKEMH+MK++D+K D+ ++ K++E  V+ GNGTE
Sbjct  6    AGVTSSTNMIGGGAPIKAGSSGVESLPKEMHDMKLRDEKVDHSDD-KEIEASVVAGNGTE  64

Query  496  TGQIIVTTVGGRNGEQKQVLSYMAERVVGTGSFGVVFQAKCLESGEAVAIKKVLXDRRYX  675
            TG II TT+GGRNG+ KQ +SY AERVVGTGSFG+VFQAKC+E+ E VAIKKVL D+RY 
Sbjct  65   TGHIIATTIGGRNGQPKQTISYCAERVVGTGSFGIVFQAKCIETAETVAIKKVLQDKRYK  124

Query  676  NRELQIMRMLEHPNVV  723
            NRELQIMR+ +HPN+V
Sbjct  125  NRELQIMRLFDHPNIV  140



>ref|XP_001781586.1| predicted protein [Physcomitrella patens]
 gb|EDQ53637.1| predicted protein [Physcomitrella patens]
Length=424

 Score =   173 bits (439),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 80/116 (69%), Positives = 99/116 (85%), Gaps = 1/116 (1%)
 Frame = +1

Query  376  SGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTETGQIIVTTVGGRNGEQKQVL  555
            SG E LPKEMH MK++DDK D+ ++ K++E  V+ GNGTETG II TT+GG+NG+ KQ +
Sbjct  27   SGVESLPKEMHGMKLRDDKVDHSDD-KEIEASVVDGNGTETGHIIATTIGGKNGQPKQTI  85

Query  556  SYMAERVVGTGSFGVVFQAKCLESGEAVAIKKVLXDRRYXNRELQIMRMLEHPNVV  723
            SY AERVVGTGSFG+VFQAKC+E+GE VAIKKVL D+RY NRELQIMR+L+HPN+V
Sbjct  86   SYSAERVVGTGSFGIVFQAKCIETGETVAIKKVLQDKRYKNRELQIMRLLDHPNIV  141



>gb|ACU14009.1| unknown [Glycine max]
Length=156

 Score =   165 bits (417),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 86/157 (55%), Positives = 114/157 (73%), Gaps = 4/157 (3%)
 Frame = +1

Query  145  MNVMRRLKSVASGRSSVSDPQGGDSSIKRVKVAQDFDQRIAGKPESEEICTTAP---MHE  315
            MN+MRRLKS+ASGR+S+S   GGD++ KR K   + + +   K  + E   T     +  
Sbjct  1    MNMMRRLKSIASGRTSISSDPGGDNNSKRAKFEPETEVKADEKTNTTETIYTDQEQLIDT  60

Query  316  AASTSQEDASGISLVARSEKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTE  495
            +  TS    S +S VAR+EKSG+EELPKE++EMKI+D+KS N N+ KD+E  V++GNGTE
Sbjct  61   SKETSNVGTSDVSTVARTEKSGFEELPKELNEMKIRDEKSKN-NSEKDIEATVVSGNGTE  119

Query  496  TGQIIVTTVGGRNGEQKQVLSYMAERVVGTGSFGVVF  606
            TGQII T +GGR+G+ KQ +SYMAERVVGTGSFG+VF
Sbjct  120  TGQIITTAIGGRDGQPKQTISYMAERVVGTGSFGIVF  156



>gb|AAQ23111.1| shaggy-related protein kinase 1 [Physcomitrella patens]
Length=410

 Score =   172 bits (436),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 78/116 (67%), Positives = 98/116 (84%), Gaps = 1/116 (1%)
 Frame = +1

Query  376  SGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTETGQIIVTTVGGRNGEQKQVL  555
            SG E LPKEMH+MK++D+K D+ ++ K++E  V+ GNGTETG II TT+GGRNG+ KQ +
Sbjct  14   SGVESLPKEMHDMKLRDEKVDHSDD-KEIEASVVAGNGTETGHIIATTIGGRNGQPKQTI  72

Query  556  SYMAERVVGTGSFGVVFQAKCLESGEAVAIKKVLXDRRYXNRELQIMRMLEHPNVV  723
            SY AERVVGTGSFG+VFQAKC+E+ E VAIKKVL D+RY NRELQIMR+ +HPN+V
Sbjct  73   SYCAERVVGTGSFGIVFQAKCIETAETVAIKKVLQDKRYKNRELQIMRLFDHPNIV  128



>gb|KJB45480.1| hypothetical protein B456_007G308500 [Gossypium raimondii]
Length=332

 Score =   170 bits (430),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 86/135 (64%), Positives = 102/135 (76%), Gaps = 11/135 (8%)
 Frame = +1

Query  319  ASTSQEDASGISLVARSEKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTET  498
            AS      SG+     S  +G E+LP+EM++MKI+DDK        +ME  V+ GNGTET
Sbjct  2    ASVGMVPTSGLR---ESSTAGVEKLPEEMNDMKIRDDK--------EMEATVVDGNGTET  50

Query  499  GQIIVTTVGGRNGEQKQVLSYMAERVVGTGSFGVVFQAKCLESGEAVAIKKVLXDRRYXN  678
            G IIVTT+GGRNG+ KQ +SYMAERVVG GSFGVVFQAKCLE+GE VAIKKVL D+RY N
Sbjct  51   GHIIVTTIGGRNGQPKQTISYMAERVVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKN  110

Query  679  RELQIMRMLEHPNVV  723
            RELQ MR+L+HPNVV
Sbjct  111  RELQTMRLLDHPNVV  125



>gb|AEQ94156.1| shaggy-related protein kinase [Elaeis guineensis]
Length=216

 Score =   166 bits (421),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 86/135 (64%), Positives = 102/135 (76%), Gaps = 9/135 (7%)
 Frame = +1

Query  319  ASTSQEDASGISLVARSEKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTET  498
            AS S   +SG+   + +   G + LP EM+EMKI+DDK        ++E  VI GNGTET
Sbjct  2    ASVSVVPSSGMKNTSGTH-VGVDRLPDEMNEMKIRDDK--------EVEATVIDGNGTET  52

Query  499  GQIIVTTVGGRNGEQKQVLSYMAERVVGTGSFGVVFQAKCLESGEAVAIKKVLXDRRYXN  678
            G IIVTT+GGRNG+ KQ +SYMAERVVG GSFGVVFQAKCLE+GE VAIKKVL D+RY N
Sbjct  53   GHIIVTTIGGRNGQPKQTISYMAERVVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKN  112

Query  679  RELQIMRMLEHPNVV  723
            RELQ MR+L+HPNVV
Sbjct  113  RELQTMRLLDHPNVV  127



>gb|AEQ94143.1| putative Glycogen synthase kinase 3 [Elaeis guineensis]
Length=231

 Score =   167 bits (422),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 86/135 (64%), Positives = 102/135 (76%), Gaps = 9/135 (7%)
 Frame = +1

Query  319  ASTSQEDASGISLVARSEKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTET  498
            AS S   +SG+   + +   G + LP EM+EMKI+DDK        ++E  VI GNGTET
Sbjct  2    ASVSVVPSSGMKNTSGTH-VGVDRLPDEMNEMKIRDDK--------EVEATVIDGNGTET  52

Query  499  GQIIVTTVGGRNGEQKQVLSYMAERVVGTGSFGVVFQAKCLESGEAVAIKKVLXDRRYXN  678
            G IIVTT+GGRNG+ KQ +SYMAERVVG GSFGVVFQAKCLE+GE VAIKKVL D+RY N
Sbjct  53   GHIIVTTIGGRNGQPKQTISYMAERVVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKN  112

Query  679  RELQIMRMLEHPNVV  723
            RELQ MR+L+HPNVV
Sbjct  113  RELQTMRLLDHPNVV  127



>ref|XP_010455024.1| PREDICTED: shaggy-related protein kinase alpha-like [Camelina 
sativa]
 ref|XP_010455025.1| PREDICTED: shaggy-related protein kinase alpha-like [Camelina 
sativa]
Length=412

 Score =   171 bits (433),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 82/116 (71%), Positives = 96/116 (83%), Gaps = 8/116 (7%)
 Frame = +1

Query  376  SGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTETGQIIVTTVGGRNGEQKQVL  555
            +G E+LP+EM++MKI+DDK        +ME  V+ GNGTETG IIVTT+GGRNG+ KQ +
Sbjct  23   TGVEKLPEEMNDMKIRDDK--------EMEATVVDGNGTETGHIIVTTIGGRNGQPKQTI  74

Query  556  SYMAERVVGTGSFGVVFQAKCLESGEAVAIKKVLXDRRYXNRELQIMRMLEHPNVV  723
            SYMAERVVG GSFGVVFQAKCLE+GE VAIKKVL DRRY NRELQ MR+L+HPNVV
Sbjct  75   SYMAERVVGHGSFGVVFQAKCLETGETVAIKKVLQDRRYKNRELQTMRLLDHPNVV  130



>ref|XP_012088843.1| PREDICTED: shaggy-related protein kinase alpha [Jatropha curcas]
 gb|KDP23349.1| hypothetical protein JCGZ_23182 [Jatropha curcas]
Length=408

 Score =   171 bits (432),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 86/136 (63%), Positives = 102/136 (75%), Gaps = 15/136 (11%)
 Frame = +1

Query  316  AASTSQEDASGISLVARSEKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTE  495
             A T   +ASG         +G ++LP+EM+EMKI+DDK        +ME  V+ GNGTE
Sbjct  6    VAPTGLREASG-------HNAGVDKLPEEMNEMKIRDDK--------EMEATVVDGNGTE  50

Query  496  TGQIIVTTVGGRNGEQKQVLSYMAERVVGTGSFGVVFQAKCLESGEAVAIKKVLXDRRYX  675
            TG IIVTT+GGRNG+ KQ +SYMAERVVG GSFGVVFQAKCLE+GE VAIKKVL D+RY 
Sbjct  51   TGHIIVTTIGGRNGQPKQTISYMAERVVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYK  110

Query  676  NRELQIMRMLEHPNVV  723
            NRELQ MR+L+HPNVV
Sbjct  111  NRELQTMRLLDHPNVV  126



>gb|EPS63877.1| hypothetical protein M569_10905 [Genlisea aurea]
Length=409

 Score =   171 bits (432),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 80/115 (70%), Positives = 94/115 (82%), Gaps = 8/115 (7%)
 Frame = +1

Query  379  GYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTETGQIIVTTVGGRNGEQKQVLS  558
            G + LP EM+EMK++DDK        D+EP V+ GNGTETG IIVTT+GGRNG+ KQ +S
Sbjct  21   GLDRLPDEMNEMKLRDDK--------DIEPAVVDGNGTETGHIIVTTIGGRNGQPKQTIS  72

Query  559  YMAERVVGTGSFGVVFQAKCLESGEAVAIKKVLXDRRYXNRELQIMRMLEHPNVV  723
            YMAER+VG GSFGVVFQAKCLE+GE VAIKKVL D+RY NRELQ MR+L+HPNVV
Sbjct  73   YMAERIVGQGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRLLDHPNVV  127



>ref|XP_006289925.1| hypothetical protein CARUB_v10003541mg [Capsella rubella]
 gb|EOA22823.1| hypothetical protein CARUB_v10003541mg [Capsella rubella]
Length=409

 Score =   170 bits (431),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 82/119 (69%), Positives = 97/119 (82%), Gaps = 8/119 (7%)
 Frame = +1

Query  367  SEKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTETGQIIVTTVGGRNGEQK  546
            +  SG ++LP+EM++MKI+DDK        +ME  V+ GNGTETG IIVTT+GGRNG+ K
Sbjct  17   AHASGVDKLPEEMNDMKIRDDK--------EMEATVVDGNGTETGHIIVTTIGGRNGQPK  68

Query  547  QVLSYMAERVVGTGSFGVVFQAKCLESGEAVAIKKVLXDRRYXNRELQIMRMLEHPNVV  723
            Q +SYMAERVVG GSFGVVFQAKCLE+GE VAIKKVL DRRY NRELQ MR+L+HPNVV
Sbjct  69   QTISYMAERVVGHGSFGVVFQAKCLETGETVAIKKVLQDRRYKNRELQTMRLLDHPNVV  127



>gb|KJB45479.1| hypothetical protein B456_007G308500 [Gossypium raimondii]
 gb|KJB45481.1| hypothetical protein B456_007G308500 [Gossypium raimondii]
Length=407

 Score =   170 bits (431),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 86/135 (64%), Positives = 102/135 (76%), Gaps = 11/135 (8%)
 Frame = +1

Query  319  ASTSQEDASGISLVARSEKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTET  498
            AS      SG+     S  +G E+LP+EM++MKI+DDK        +ME  V+ GNGTET
Sbjct  2    ASVGMVPTSGLR---ESSTAGVEKLPEEMNDMKIRDDK--------EMEATVVDGNGTET  50

Query  499  GQIIVTTVGGRNGEQKQVLSYMAERVVGTGSFGVVFQAKCLESGEAVAIKKVLXDRRYXN  678
            G IIVTT+GGRNG+ KQ +SYMAERVVG GSFGVVFQAKCLE+GE VAIKKVL D+RY N
Sbjct  51   GHIIVTTIGGRNGQPKQTISYMAERVVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKN  110

Query  679  RELQIMRMLEHPNVV  723
            RELQ MR+L+HPNVV
Sbjct  111  RELQTMRLLDHPNVV  125



>gb|ACJ83284.1| unknown [Medicago truncatula]
Length=172

 Score =   163 bits (413),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 78/111 (70%), Positives = 91/111 (82%), Gaps = 8/111 (7%)
 Frame = +1

Query  391  LPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTETGQIIVTTVGGRNGEQKQVLSYMAE  570
            LP+EM +MKI+DD+        +ME  V+ GNGTETG IIVTT+GGRNG+ KQ +SYMAE
Sbjct  27   LPEEMSDMKIRDDR--------EMEATVVDGNGTETGHIIVTTIGGRNGQPKQTISYMAE  78

Query  571  RVVGTGSFGVVFQAKCLESGEAVAIKKVLXDRRYXNRELQIMRMLEHPNVV  723
            RVVG GSFGVVFQAKCLE+GE VAIKKVL D+RY NRELQ MR+L+HPNVV
Sbjct  79   RVVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRLLDHPNVV  129



>ref|XP_007031229.1| Shaggy-related kinase 11, 11 isoform 1 [Theobroma cacao]
 gb|EOY11731.1| Shaggy-related kinase 11, 11 isoform 1 [Theobroma cacao]
Length=407

 Score =   170 bits (430),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 82/124 (66%), Positives = 100/124 (81%), Gaps = 8/124 (6%)
 Frame = +1

Query  352  SLVARSEKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTETGQIIVTTVGGR  531
            S++  S  +G ++LP+EM++MKI+DDK        +ME  V+ GNGTETG IIVTT+GGR
Sbjct  10   SVLRESNAAGVDKLPEEMNDMKIRDDK--------EMEATVVDGNGTETGHIIVTTIGGR  61

Query  532  NGEQKQVLSYMAERVVGTGSFGVVFQAKCLESGEAVAIKKVLXDRRYXNRELQIMRMLEH  711
            NG+ KQ +SYMAERVVG GSFGVVFQAKCLE+GE VAIKKVL D+RY NRELQ MR+L+H
Sbjct  62   NGQPKQTISYMAERVVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRLLDH  121

Query  712  PNVV  723
            PNVV
Sbjct  122  PNVV  125



>ref|XP_006394905.1| hypothetical protein EUTSA_v10004319mg [Eutrema salsugineum]
 gb|ESQ32191.1| hypothetical protein EUTSA_v10004319mg [Eutrema salsugineum]
Length=409

 Score =   170 bits (430),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 81/119 (68%), Positives = 98/119 (82%), Gaps = 8/119 (7%)
 Frame = +1

Query  367  SEKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTETGQIIVTTVGGRNGEQK  546
            ++ +G ++LP+EM++MKI+DDK        +ME  V+ GNGTETG IIVTT+GGRNG+ K
Sbjct  17   AQATGVDKLPEEMNDMKIRDDK--------EMEATVVDGNGTETGHIIVTTIGGRNGQPK  68

Query  547  QVLSYMAERVVGTGSFGVVFQAKCLESGEAVAIKKVLXDRRYXNRELQIMRMLEHPNVV  723
            Q +SYMAERVVG GSFGVVFQAKCLE+GE VAIKKVL DRRY NRELQ MR+L+HPNVV
Sbjct  69   QTISYMAERVVGHGSFGVVFQAKCLETGETVAIKKVLQDRRYKNRELQTMRLLDHPNVV  127



>gb|EPS68300.1| hypothetical protein M569_06467 [Genlisea aurea]
Length=411

 Score =   170 bits (430),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 81/113 (72%), Positives = 94/113 (83%), Gaps = 8/113 (7%)
 Frame = +1

Query  385  EELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTETGQIIVTTVGGRNGEQKQVLSYM  564
            + LP EM+EMKI+DDK        D+EP V+ GNGTETG IIVTT+GGRNG+ KQ +SYM
Sbjct  24   DRLPDEMNEMKIRDDK--------DIEPAVVDGNGTETGHIIVTTIGGRNGQPKQKISYM  75

Query  565  AERVVGTGSFGVVFQAKCLESGEAVAIKKVLXDRRYXNRELQIMRMLEHPNVV  723
            AER+VG GSFGVVFQAKCLE+GEAVAIKKVL D+RY NRELQ MR+L+HPNVV
Sbjct  76   AERIVGQGSFGVVFQAKCLETGEAVAIKKVLQDKRYKNRELQTMRLLDHPNVV  128



>ref|NP_568486.1| Shaggy-related protein kinase alpha [Arabidopsis thaliana]
 sp|P43288.3|KSG1_ARATH RecName: Full=Shaggy-related protein kinase alpha; AltName: Full=ASK-alpha 
[Arabidopsis thaliana]
 gb|AAL16257.1|AF428327_1 AT5g26750/F2P16_10 [Arabidopsis thaliana]
 gb|AAK76698.1| putative shaggy kinase alpha [Arabidopsis thaliana]
 gb|AAN13164.1| putative shaggy kinase alpha [Arabidopsis thaliana]
 gb|AED93596.1| Shaggy-related protein kinase alpha [Arabidopsis thaliana]
Length=405

 Score =   169 bits (429),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 81/118 (69%), Positives = 97/118 (82%), Gaps = 8/118 (7%)
 Frame = +1

Query  370  EKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTETGQIIVTTVGGRNGEQKQ  549
            + +G ++LP+EM++MKI+DDK        +ME  V+ GNGTETG IIVTT+GGRNG+ KQ
Sbjct  14   DSTGVDKLPEEMNDMKIRDDK--------EMEATVVDGNGTETGHIIVTTIGGRNGQPKQ  65

Query  550  VLSYMAERVVGTGSFGVVFQAKCLESGEAVAIKKVLXDRRYXNRELQIMRMLEHPNVV  723
             +SYMAERVVG GSFGVVFQAKCLE+GE VAIKKVL DRRY NRELQ MR+L+HPNVV
Sbjct  66   TISYMAERVVGHGSFGVVFQAKCLETGETVAIKKVLQDRRYKNRELQTMRLLDHPNVV  123



>emb|CAA04265.1| shaggy-like kinase alpha [Arabidopsis thaliana]
Length=405

 Score =   169 bits (429),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 81/118 (69%), Positives = 97/118 (82%), Gaps = 8/118 (7%)
 Frame = +1

Query  370  EKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTETGQIIVTTVGGRNGEQKQ  549
            + +G ++LP+EM++MKI+DDK        +ME  V+ GNGTETG IIVTT+GGRNG+ KQ
Sbjct  14   DSTGVDKLPEEMNDMKIRDDK--------EMEATVVDGNGTETGHIIVTTIGGRNGQPKQ  65

Query  550  VLSYMAERVVGTGSFGVVFQAKCLESGEAVAIKKVLXDRRYXNRELQIMRMLEHPNVV  723
             +SYMAERVVG GSFGVVFQAKCLE+GE VAIKKVL DRRY NRELQ MR+L+HPNVV
Sbjct  66   TISYMAERVVGHGSFGVVFQAKCLETGETVAIKKVLQDRRYKNRELQTMRLLDHPNVV  123



>ref|XP_010674528.1| PREDICTED: shaggy-related protein kinase alpha [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010674529.1| PREDICTED: shaggy-related protein kinase alpha [Beta vulgaris 
subsp. vulgaris]
Length=407

 Score =   169 bits (429),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 81/115 (70%), Positives = 94/115 (82%), Gaps = 8/115 (7%)
 Frame = +1

Query  379  GYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTETGQIIVTTVGGRNGEQKQVLS  558
            G + LP+EM++MKI+DDK        DMEP V+ GNGTETG IIVTT+GG+NG+ KQ +S
Sbjct  19   GVDRLPEEMNDMKIRDDK--------DMEPTVVDGNGTETGHIIVTTIGGKNGQPKQTIS  70

Query  559  YMAERVVGTGSFGVVFQAKCLESGEAVAIKKVLXDRRYXNRELQIMRMLEHPNVV  723
            YMAERVVG GSFGVVFQAKCLE+GE VAIKKVL D+RY NRELQ MR L+HPNVV
Sbjct  71   YMAERVVGQGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRPLDHPNVV  125



>emb|CAA53181.1| shaggy related kinase [Arabidopsis thaliana]
 emb|CAA48538.1| serine /threonine protein kinase [Arabidopsis thaliana]
Length=405

 Score =   169 bits (429),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 81/118 (69%), Positives = 97/118 (82%), Gaps = 8/118 (7%)
 Frame = +1

Query  370  EKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTETGQIIVTTVGGRNGEQKQ  549
            + +G ++LP+EM++MKI+DDK        +ME  V+ GNGTETG IIVTT+GGRNG+ KQ
Sbjct  14   DSTGVDKLPEEMNDMKIRDDK--------EMEATVVDGNGTETGHIIVTTIGGRNGQPKQ  65

Query  550  VLSYMAERVVGTGSFGVVFQAKCLESGEAVAIKKVLXDRRYXNRELQIMRMLEHPNVV  723
             +SYMAERVVG GSFGVVFQAKCLE+GE VAIKKVL DRRY NRELQ MR+L+HPNVV
Sbjct  66   TISYMAERVVGHGSFGVVFQAKCLETGETVAIKKVLQDRRYKNRELQTMRLLDHPNVV  123



>gb|KCW78018.1| hypothetical protein EUGRSUZ_D02249 [Eucalyptus grandis]
Length=409

 Score =   169 bits (429),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 87/135 (64%), Positives = 105/135 (78%), Gaps = 2/135 (1%)
 Frame = +1

Query  319  ASTSQEDASGISLVARSEKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTET  498
            ASTS E  +G S  +   K   +++ +  HE +IKDDK+ + +  KD EP VI G+GTET
Sbjct  2    ASTSLEAVAGTSSKSSVSKHSDDQVHRGGHETRIKDDKAFHDD--KDCEPAVINGHGTET  59

Query  499  GQIIVTTVGGRNGEQKQVLSYMAERVVGTGSFGVVFQAKCLESGEAVAIKKVLXDRRYXN  678
            G II TTVGGR+G+ KQ +SYMAERVVGTGSFGVVFQAKCLE+GE VAIKKVL D+RY N
Sbjct  60   GHIITTTVGGRDGQPKQTISYMAERVVGTGSFGVVFQAKCLETGETVAIKKVLQDKRYKN  119

Query  679  RELQIMRMLEHPNVV  723
            RELQIMR+L+HPNVV
Sbjct  120  RELQIMRILDHPNVV  134



>gb|KCW84977.1| hypothetical protein EUGRSUZ_B01797 [Eucalyptus grandis]
Length=293

 Score =   166 bits (421),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 88/145 (61%), Positives = 104/145 (72%), Gaps = 20/145 (14%)
 Frame = +1

Query  304  PMHEAAST-----SQEDASGISLVARSEKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEP  468
            P+H  AS      S  + SG S+       G + LP+EM+EMKI+DDK        +ME 
Sbjct  2    PVHLMASVGIAPNSVREPSGQSV-------GVDRLPEEMNEMKIRDDK--------EMET  46

Query  469  VVITGNGTETGQIIVTTVGGRNGEQKQVLSYMAERVVGTGSFGVVFQAKCLESGEAVAIK  648
             V+ GNGTE G IIVTT+GGRNG+ KQ +SYMAERVVG GSFGVVFQAKCLE+GE VAIK
Sbjct  47   TVVDGNGTEAGHIIVTTIGGRNGQPKQTISYMAERVVGQGSFGVVFQAKCLETGETVAIK  106

Query  649  KVLXDRRYXNRELQIMRMLEHPNVV  723
            KVL D+RY NRELQ MR+L+HPNVV
Sbjct  107  KVLQDKRYKNRELQTMRLLDHPNVV  131



>ref|XP_010546768.1| PREDICTED: shaggy-related protein kinase alpha [Tarenaya hassleriana]
Length=399

 Score =   169 bits (428),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 82/122 (67%), Positives = 98/122 (80%), Gaps = 8/122 (7%)
 Frame = +1

Query  358  VARSEKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTETGQIIVTTVGGRNG  537
            V  +  SG ++LP+EM++MKI+DDK        +ME  V+ GNGTETG IIVTT+GG+NG
Sbjct  4    VGVAPASGVDKLPEEMNDMKIRDDK--------EMEATVVDGNGTETGHIIVTTIGGKNG  55

Query  538  EQKQVLSYMAERVVGTGSFGVVFQAKCLESGEAVAIKKVLXDRRYXNRELQIMRMLEHPN  717
            + KQ +SYMAERVVG GSFGVVFQAKCLE+GE VAIKKVL DRRY NRELQ MR+L+HPN
Sbjct  56   QPKQTISYMAERVVGHGSFGVVFQAKCLETGETVAIKKVLQDRRYKNRELQTMRLLDHPN  115

Query  718  VV  723
            VV
Sbjct  116  VV  117



>ref|XP_010493927.1| PREDICTED: shaggy-related protein kinase alpha isoform X1 [Camelina 
sativa]
 ref|XP_010493928.1| PREDICTED: shaggy-related protein kinase alpha isoform X1 [Camelina 
sativa]
Length=412

 Score =   169 bits (429),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 81/116 (70%), Positives = 96/116 (83%), Gaps = 8/116 (7%)
 Frame = +1

Query  376  SGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTETGQIIVTTVGGRNGEQKQVL  555
            +G ++LP+EM++MKI+DDK        +ME  V+ GNGTETG IIVTT+GGRNG+ KQ +
Sbjct  23   TGVDKLPEEMNDMKIRDDK--------EMEATVVDGNGTETGHIIVTTIGGRNGQPKQTI  74

Query  556  SYMAERVVGTGSFGVVFQAKCLESGEAVAIKKVLXDRRYXNRELQIMRMLEHPNVV  723
            SYMAERVVG GSFGVVFQAKCLE+GE VAIKKVL DRRY NRELQ MR+L+HPNVV
Sbjct  75   SYMAERVVGHGSFGVVFQAKCLETGETVAIKKVLQDRRYKNRELQTMRLLDHPNVV  130



>ref|XP_006382290.1| hypothetical protein POPTR_0005s00710g [Populus trichocarpa]
 ref|XP_006382291.1| hypothetical protein POPTR_0005s00710g [Populus trichocarpa]
 ref|XP_006382292.1| Glycogen synthase kinase-3 MsK-1 family protein [Populus trichocarpa]
 gb|ERP60087.1| hypothetical protein POPTR_0005s00710g [Populus trichocarpa]
 gb|ERP60088.1| hypothetical protein POPTR_0005s00710g [Populus trichocarpa]
 gb|ERP60089.1| Glycogen synthase kinase-3 MsK-1 family protein [Populus trichocarpa]
Length=409

 Score =   169 bits (429),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 81/121 (67%), Positives = 98/121 (81%), Gaps = 8/121 (7%)
 Frame = +1

Query  361  ARSEKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTETGQIIVTTVGGRNGE  540
            A +  +G ++LP+EM++MKI+DDK        +ME  V+ GNGTETG IIVTT+GGRNG+
Sbjct  15   ASAHNAGVDKLPEEMNDMKIRDDK--------EMEATVVDGNGTETGHIIVTTIGGRNGQ  66

Query  541  QKQVLSYMAERVVGTGSFGVVFQAKCLESGEAVAIKKVLXDRRYXNRELQIMRMLEHPNV  720
             KQ +SYMAERVVG GSFGVVFQAKCLE+GE VAIKKVL D+RY NRELQ MR+L+HPNV
Sbjct  67   PKQTISYMAERVVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRLLDHPNV  126

Query  721  V  723
            V
Sbjct  127  V  127



>emb|CDX80585.1| BnaC07g28590D [Brassica napus]
Length=402

 Score =   169 bits (428),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 81/127 (64%), Positives = 100/127 (79%), Gaps = 8/127 (6%)
 Frame = +1

Query  343  SGISLVARSEKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTETGQIIVTTV  522
            + +S+    + +G ++LP+EM++MKI+DDK        +ME  V+ GN TETG IIVTT+
Sbjct  2    ASVSIPPPRDSTGVDKLPEEMNDMKIRDDK--------EMEATVVDGNSTETGHIIVTTI  53

Query  523  GGRNGEQKQVLSYMAERVVGTGSFGVVFQAKCLESGEAVAIKKVLXDRRYXNRELQIMRM  702
            GGRNG+ KQ +SYMAERVVG GSFGVVFQAKCLE+GE VAIKKVL DRRY NRELQ MR+
Sbjct  54   GGRNGQPKQTISYMAERVVGHGSFGVVFQAKCLETGETVAIKKVLQDRRYKNRELQTMRL  113

Query  703  LEHPNVV  723
            L+HPNVV
Sbjct  114  LDHPNVV  120



>ref|XP_010421531.1| PREDICTED: shaggy-related protein kinase alpha-like [Camelina 
sativa]
 ref|XP_010421533.1| PREDICTED: shaggy-related protein kinase alpha-like [Camelina 
sativa]
Length=412

 Score =   169 bits (429),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 81/116 (70%), Positives = 96/116 (83%), Gaps = 8/116 (7%)
 Frame = +1

Query  376  SGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTETGQIIVTTVGGRNGEQKQVL  555
            +G ++LP+EM++MKI+DDK        +ME  V+ GNGTETG IIVTT+GGRNG+ KQ +
Sbjct  23   TGVDKLPEEMNDMKIRDDK--------EMEATVVDGNGTETGHIIVTTIGGRNGQPKQTI  74

Query  556  SYMAERVVGTGSFGVVFQAKCLESGEAVAIKKVLXDRRYXNRELQIMRMLEHPNVV  723
            SYMAERVVG GSFGVVFQAKCLE+GE VAIKKVL DRRY NRELQ MR+L+HPNVV
Sbjct  75   SYMAERVVGHGSFGVVFQAKCLETGETVAIKKVLQDRRYKNRELQTMRLLDHPNVV  130



>ref|XP_010524830.1| PREDICTED: shaggy-related protein kinase alpha-like [Tarenaya 
hassleriana]
Length=409

 Score =   169 bits (428),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 84/136 (62%), Positives = 101/136 (74%), Gaps = 15/136 (11%)
 Frame = +1

Query  316  AASTSQEDASGISLVARSEKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTE  495
            A ++   D++G         SG + LP+EM++MKI+DDK        +ME  V+ GNGTE
Sbjct  7    APTSGARDSTG-------HASGVDRLPEEMNDMKIRDDK--------EMEATVVDGNGTE  51

Query  496  TGQIIVTTVGGRNGEQKQVLSYMAERVVGTGSFGVVFQAKCLESGEAVAIKKVLXDRRYX  675
            TG IIVTT+GGRNG+ KQ +SYMAERVVG GSFGVVFQAKCLE+GE VAIKKVL DRRY 
Sbjct  52   TGHIIVTTIGGRNGQPKQTISYMAERVVGHGSFGVVFQAKCLETGETVAIKKVLQDRRYK  111

Query  676  NRELQIMRMLEHPNVV  723
            NRELQ MR+ +HPNVV
Sbjct  112  NRELQTMRLFDHPNVV  127



>ref|XP_007031504.1| Shaggy-like kinase 13 isoform 1 [Theobroma cacao]
 ref|XP_007031505.1| Shaggy-like kinase 13 isoform 1 [Theobroma cacao]
 gb|EOY02430.1| Shaggy-like kinase 13 isoform 1 [Theobroma cacao]
 gb|EOY02431.1| Shaggy-like kinase 13 isoform 1 [Theobroma cacao]
Length=412

 Score =   169 bits (428),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 81/113 (72%), Positives = 96/113 (85%), Gaps = 5/113 (4%)
 Frame = +1

Query  385  EELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTETGQIIVTTVGGRNGEQKQVLSYM  564
            ++LP+E++EMKIKD+K +     K+ME  V+ GNGTETG IIVTT+GGRNGE KQ +SYM
Sbjct  23   DKLPEEINEMKIKDEKVE-----KEMEATVVDGNGTETGHIIVTTIGGRNGEPKQTISYM  77

Query  565  AERVVGTGSFGVVFQAKCLESGEAVAIKKVLXDRRYXNRELQIMRMLEHPNVV  723
            AERVVG GSFG+VFQAKCLESGE VAIKKVL D+RY NRELQ MR+L+HPNVV
Sbjct  78   AERVVGQGSFGIVFQAKCLESGETVAIKKVLQDKRYKNRELQTMRLLDHPNVV  130



>ref|XP_002512564.1| Glycogen synthase kinase-3 beta, putative [Ricinus communis]
 gb|EEF50016.1| Glycogen synthase kinase-3 beta, putative [Ricinus communis]
Length=383

 Score =   168 bits (426),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 85/136 (63%), Positives = 101/136 (74%), Gaps = 15/136 (11%)
 Frame = +1

Query  316  AASTSQEDASGISLVARSEKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTE  495
             A T   +ASG          G ++LP+EM++MKI+DDK        +ME  V+ GNGTE
Sbjct  6    VAPTGLREASG-------HNVGVDKLPEEMNDMKIRDDK--------EMEATVVDGNGTE  50

Query  496  TGQIIVTTVGGRNGEQKQVLSYMAERVVGTGSFGVVFQAKCLESGEAVAIKKVLXDRRYX  675
            TG IIVTT+GGRNG+ KQ +SYMAERVVG GSFGVVFQAKCLE+GE VAIKKVL D+RY 
Sbjct  51   TGHIIVTTIGGRNGQPKQTISYMAERVVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYK  110

Query  676  NRELQIMRMLEHPNVV  723
            NRELQ MR+L+HPNVV
Sbjct  111  NRELQTMRLLDHPNVV  126



>gb|KDO86865.1| hypothetical protein CISIN_1g015632mg [Citrus sinensis]
Length=296

 Score =   166 bits (420),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 85/135 (63%), Positives = 102/135 (76%), Gaps = 15/135 (11%)
 Frame = +1

Query  319  ASTSQEDASGISLVARSEKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTET  498
            AS S   ASG ++       G + LP+EM++MKI+DDK        +ME  V+ GNGTE 
Sbjct  2    ASVSVVPASGNTV-------GVDRLPEEMNDMKIRDDK--------EMEATVVDGNGTEA  46

Query  499  GQIIVTTVGGRNGEQKQVLSYMAERVVGTGSFGVVFQAKCLESGEAVAIKKVLXDRRYXN  678
            G IIVTT+GG+NG+ KQ +SYMAERVVG GSFGVVFQAKCLE+GEAVAIKKVL D+RY N
Sbjct  47   GHIIVTTIGGKNGQPKQTISYMAERVVGHGSFGVVFQAKCLETGEAVAIKKVLQDKRYKN  106

Query  679  RELQIMRMLEHPNVV  723
            RELQ MR+L+HPNVV
Sbjct  107  RELQTMRLLDHPNVV  121



>ref|XP_007031506.1| Shaggy-like kinase 13 isoform 3 [Theobroma cacao]
 gb|EOY02432.1| Shaggy-like kinase 13 isoform 3 [Theobroma cacao]
Length=413

 Score =   169 bits (428),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 81/113 (72%), Positives = 96/113 (85%), Gaps = 5/113 (4%)
 Frame = +1

Query  385  EELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTETGQIIVTTVGGRNGEQKQVLSYM  564
            ++LP+E++EMKIKD+K +     K+ME  V+ GNGTETG IIVTT+GGRNGE KQ +SYM
Sbjct  23   DKLPEEINEMKIKDEKVE-----KEMEATVVDGNGTETGHIIVTTIGGRNGEPKQTISYM  77

Query  565  AERVVGTGSFGVVFQAKCLESGEAVAIKKVLXDRRYXNRELQIMRMLEHPNVV  723
            AERVVG GSFG+VFQAKCLESGE VAIKKVL D+RY NRELQ MR+L+HPNVV
Sbjct  78   AERVVGQGSFGIVFQAKCLESGETVAIKKVLQDKRYKNRELQTMRLLDHPNVV  130



>gb|EYU46859.1| hypothetical protein MIMGU_mgv1a007395mg [Erythranthe guttata]
 gb|EYU46860.1| hypothetical protein MIMGU_mgv1a007395mg [Erythranthe guttata]
Length=409

 Score =   169 bits (427),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 85/135 (63%), Positives = 101/135 (75%), Gaps = 9/135 (7%)
 Frame = +1

Query  319  ASTSQEDASGISLVARSEKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTET  498
            AS S   + G+    R   S  + LP EM+EMK++D+K        DMEP V+ GNGTET
Sbjct  2    ASVSVAPSLGVRDPGRKTGS-LDRLPDEMNEMKLRDEK--------DMEPAVVDGNGTET  52

Query  499  GQIIVTTVGGRNGEQKQVLSYMAERVVGTGSFGVVFQAKCLESGEAVAIKKVLXDRRYXN  678
            G IIVTT+GGRNG+ KQ +SYMAER+VG GSFGVVFQAKCLE+GE VAIKKVL D+RY N
Sbjct  53   GHIIVTTIGGRNGQPKQTISYMAERIVGQGSFGVVFQAKCLETGETVAIKKVLQDKRYKN  112

Query  679  RELQIMRMLEHPNVV  723
            RELQ MR+L+HPNVV
Sbjct  113  RELQTMRLLDHPNVV  127



>ref|XP_002874323.1| hypothetical protein ARALYDRAFT_489503 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH50582.1| hypothetical protein ARALYDRAFT_489503 [Arabidopsis lyrata subsp. 
lyrata]
Length=409

 Score =   168 bits (426),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 81/115 (70%), Positives = 95/115 (83%), Gaps = 8/115 (7%)
 Frame = +1

Query  379  GYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTETGQIIVTTVGGRNGEQKQVLS  558
            G ++LP+EM++MKI+DDK        +ME  V+ GNGTETG IIVTT+GGRNG+ KQ +S
Sbjct  21   GVDKLPEEMNDMKIRDDK--------EMEATVVDGNGTETGHIIVTTIGGRNGQPKQTIS  72

Query  559  YMAERVVGTGSFGVVFQAKCLESGEAVAIKKVLXDRRYXNRELQIMRMLEHPNVV  723
            YMAERVVG GSFGVVFQAKCLE+GE VAIKKVL DRRY NRELQ MR+L+HPNVV
Sbjct  73   YMAERVVGHGSFGVVFQAKCLETGETVAIKKVLQDRRYKNRELQTMRLLDHPNVV  127



>gb|EPS73818.1| hypothetical protein M569_00937, partial [Genlisea aurea]
Length=408

 Score =   168 bits (426),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 83/135 (61%), Positives = 103/135 (76%), Gaps = 9/135 (7%)
 Frame = +1

Query  319  ASTSQEDASGISLVARSEKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTET  498
            A+TS + +SG+    + +  G + LP EM+EMK++DDK        D+EP V+ GN TET
Sbjct  2    AATSVDSSSGVRDPTK-KPGGMDRLPDEMNEMKLRDDK--------DIEPAVVDGNVTET  52

Query  499  GQIIVTTVGGRNGEQKQVLSYMAERVVGTGSFGVVFQAKCLESGEAVAIKKVLXDRRYXN  678
            G IIVTT+GGRNG+ KQ + YMAER+VG GSFGVVFQAKCLE+GE VAIKKVL D+RY N
Sbjct  53   GHIIVTTIGGRNGQPKQTIGYMAERIVGQGSFGVVFQAKCLETGETVAIKKVLQDKRYKN  112

Query  679  RELQIMRMLEHPNVV  723
            RELQ MR+L+HPNVV
Sbjct  113  RELQTMRLLDHPNVV  127



>ref|XP_008803035.1| PREDICTED: shaggy-related protein kinase epsilon-like isoform 
X2 [Phoenix dactylifera]
Length=443

 Score =   169 bits (428),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 90/175 (51%), Positives = 123/175 (70%), Gaps = 14/175 (8%)
 Frame = +1

Query  223  IKRVKVAQDFDQRIAGKPES--------EEICTTAPMHEAASTSQEDASGISLVARSEKS  378
            +K+VKV QD + +   +           E++ T+A +   ASTS +  +      R + +
Sbjct  1    MKKVKVEQDVEGKECTEHSVVENKAMGLEQLTTSAHLDSDASTSSKGPT-----TRLKNA  55

Query  379  GYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTETGQIIVTTVGGRNGEQKQVLS  558
            G ++L KEMHEM I++DK+D  N+ K+++  VI G  TETG +I TT+GG+NG+ KQ +S
Sbjct  56   GIDQLSKEMHEMTIRNDKADGHND-KNVKATVIKGKSTETGHLITTTIGGQNGQPKQTIS  114

Query  559  YMAERVVGTGSFGVVFQAKCLESGEAVAIKKVLXDRRYXNRELQIMRMLEHPNVV  723
            YMA+RVVGTGSFGVV QAKCL +GEAVAIKKVL D+RY NRELQIM++L+HPNVV
Sbjct  115  YMADRVVGTGSFGVVLQAKCLGTGEAVAIKKVLQDKRYKNRELQIMQLLDHPNVV  169



>ref|XP_004495628.1| PREDICTED: glycogen synthase kinase-3 homolog MsK-1-like isoform 
X4 [Cicer arietinum]
Length=410

 Score =   168 bits (426),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 83/135 (61%), Positives = 101/135 (75%), Gaps = 8/135 (6%)
 Frame = +1

Query  319  ASTSQEDASGISLVARSEKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTET  498
            AS      SG+   +    +G + LP+EM++MKI+DD+        +ME  V+ GNGTET
Sbjct  2    ASVGVAPTSGLRETSGHAAAGVDRLPEEMNDMKIRDDR--------EMEATVVDGNGTET  53

Query  499  GQIIVTTVGGRNGEQKQVLSYMAERVVGTGSFGVVFQAKCLESGEAVAIKKVLXDRRYXN  678
            G IIVTT+GGRNG+ KQ +SYMAERVVG GSFGVVFQAKCLE+GE VAIKKVL D+RY N
Sbjct  54   GHIIVTTIGGRNGQPKQTISYMAERVVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKN  113

Query  679  RELQIMRMLEHPNVV  723
            RELQ MR+L+HPNVV
Sbjct  114  RELQTMRLLDHPNVV  128



>ref|NP_001242406.1| uncharacterized protein LOC100788612 [Glycine max]
 gb|ACU21024.1| unknown [Glycine max]
Length=406

 Score =   168 bits (426),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 80/118 (68%), Positives = 96/118 (81%), Gaps = 8/118 (7%)
 Frame = +1

Query  370  EKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTETGQIIVTTVGGRNGEQKQ  549
            E SG + LP+EM++M+I+DDK        +ME  V+ GNGTETG IIVTT+GGRNG+ KQ
Sbjct  15   ESSGVDRLPEEMNDMRIRDDK--------EMEATVVDGNGTETGHIIVTTIGGRNGQPKQ  66

Query  550  VLSYMAERVVGTGSFGVVFQAKCLESGEAVAIKKVLXDRRYXNRELQIMRMLEHPNVV  723
             +SYMAER+VG GSFGVVFQAKCLE+GE VAIKKVL D+RY NRELQ MR+L+HPNVV
Sbjct  67   TISYMAERIVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRLLDHPNVV  124



>ref|XP_011039006.1| PREDICTED: shaggy-related protein kinase alpha [Populus euphratica]
 ref|XP_011039008.1| PREDICTED: shaggy-related protein kinase alpha [Populus euphratica]
 ref|XP_011039009.1| PREDICTED: shaggy-related protein kinase alpha [Populus euphratica]
 ref|XP_011039010.1| PREDICTED: shaggy-related protein kinase alpha [Populus euphratica]
 ref|XP_011039011.1| PREDICTED: shaggy-related protein kinase alpha [Populus euphratica]
Length=409

 Score =   168 bits (426),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 81/121 (67%), Positives = 97/121 (80%), Gaps = 8/121 (7%)
 Frame = +1

Query  361  ARSEKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTETGQIIVTTVGGRNGE  540
            A    +G ++LP+EM++MKI+DDK        +ME  V+ GNGTETG IIVTT+GGRNG+
Sbjct  15   ASVHNAGVDKLPEEMNDMKIRDDK--------EMEATVVDGNGTETGHIIVTTIGGRNGQ  66

Query  541  QKQVLSYMAERVVGTGSFGVVFQAKCLESGEAVAIKKVLXDRRYXNRELQIMRMLEHPNV  720
             KQ +SYMAERVVG GSFGVVFQAKCLE+GE VAIKKVL D+RY NRELQ MR+L+HPNV
Sbjct  67   PKQTISYMAERVVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRLLDHPNV  126

Query  721  V  723
            V
Sbjct  127  V  127



>ref|XP_006576226.1| PREDICTED: uncharacterized protein LOC100788612 isoform X1 [Glycine 
max]
 gb|KHN14222.1| Shaggy-related protein kinase alpha [Glycine soja]
Length=406

 Score =   168 bits (426),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 80/118 (68%), Positives = 96/118 (81%), Gaps = 8/118 (7%)
 Frame = +1

Query  370  EKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTETGQIIVTTVGGRNGEQKQ  549
            E SG + LP+EM++M+I+DDK        +ME  V+ GNGTETG IIVTT+GGRNG+ KQ
Sbjct  15   ESSGVDRLPEEMNDMRIRDDK--------EMEATVVDGNGTETGHIIVTTIGGRNGQPKQ  66

Query  550  VLSYMAERVVGTGSFGVVFQAKCLESGEAVAIKKVLXDRRYXNRELQIMRMLEHPNVV  723
             +SYMAER+VG GSFGVVFQAKCLE+GE VAIKKVL D+RY NRELQ MR+L+HPNVV
Sbjct  67   TISYMAERIVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRLLDHPNVV  124



>gb|KDO45354.1| hypothetical protein CISIN_1g015298mg [Citrus sinensis]
Length=353

 Score =   167 bits (422),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 79/115 (69%), Positives = 95/115 (83%), Gaps = 8/115 (7%)
 Frame = +1

Query  379  GYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTETGQIIVTTVGGRNGEQKQVLS  558
            G ++LP+EM++MKI+DDK        +ME  V+ GNGTETG IIVTT+GGRNG+ KQ +S
Sbjct  21   GVDKLPEEMNDMKIRDDK--------EMEATVVDGNGTETGHIIVTTIGGRNGQPKQTIS  72

Query  559  YMAERVVGTGSFGVVFQAKCLESGEAVAIKKVLXDRRYXNRELQIMRMLEHPNVV  723
            YMAER+VG GSFGVVFQAKCLE+GE VAIKKVL D+RY NRELQ MR+L+HPNVV
Sbjct  73   YMAERIVGQGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRLLDHPNVV  127



>ref|XP_003554602.1| PREDICTED: shaggy-related protein kinase alpha-like isoform 1 
[Glycine max]
Length=406

 Score =   168 bits (425),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 80/118 (68%), Positives = 96/118 (81%), Gaps = 8/118 (7%)
 Frame = +1

Query  370  EKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTETGQIIVTTVGGRNGEQKQ  549
            E SG + LP+EM++M+I+DDK        +ME  V+ GNGTETG IIVTT+GGRNG+ KQ
Sbjct  15   ESSGVDRLPEEMNDMRIRDDK--------EMEATVVDGNGTETGHIIVTTIGGRNGQPKQ  66

Query  550  VLSYMAERVVGTGSFGVVFQAKCLESGEAVAIKKVLXDRRYXNRELQIMRMLEHPNVV  723
             +SYMAER+VG GSFGVVFQAKCLE+GE VAIKKVL D+RY NRELQ MR+L+HPNVV
Sbjct  67   TISYMAERIVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRLLDHPNVV  124



>gb|KHG02936.1| Shaggy-related protein kinase alpha [Gossypium arboreum]
 gb|KHG22311.1| Shaggy-related protein kinase alpha [Gossypium arboreum]
Length=407

 Score =   168 bits (425),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 85/135 (63%), Positives = 101/135 (75%), Gaps = 11/135 (8%)
 Frame = +1

Query  319  ASTSQEDASGISLVARSEKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTET  498
            AS      SG+     S  +  E+LP+EM++MKI+DDK        +ME  V+ GNGTET
Sbjct  2    ASVGMVPTSGLR---ESSTASVEKLPEEMNDMKIRDDK--------EMEATVVDGNGTET  50

Query  499  GQIIVTTVGGRNGEQKQVLSYMAERVVGTGSFGVVFQAKCLESGEAVAIKKVLXDRRYXN  678
            G IIVTT+GGRNG+ KQ +SYMAERVVG GSFGVVFQAKCLE+GE VAIKKVL D+RY N
Sbjct  51   GHIIVTTIGGRNGQPKQTISYMAERVVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKN  110

Query  679  RELQIMRMLEHPNVV  723
            RELQ MR+L+HPNVV
Sbjct  111  RELQTMRLLDHPNVV  125



>gb|ABK93098.1| unknown [Populus trichocarpa]
Length=409

 Score =   168 bits (425),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 80/116 (69%), Positives = 95/116 (82%), Gaps = 8/116 (7%)
 Frame = +1

Query  376  SGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTETGQIIVTTVGGRNGEQKQVL  555
            +G ++LP+EM++MKI+DDK        DME  V+ GNGTETG IIVTT+GGRNG+ KQ +
Sbjct  20   AGVDKLPEEMNDMKIRDDK--------DMEATVVDGNGTETGHIIVTTIGGRNGQPKQTI  71

Query  556  SYMAERVVGTGSFGVVFQAKCLESGEAVAIKKVLXDRRYXNRELQIMRMLEHPNVV  723
            SYMAERVVG GSFGVVFQAKCLE+ E VAIKKVL D+RY NRELQ MR+L+HPNVV
Sbjct  72   SYMAERVVGNGSFGVVFQAKCLETSETVAIKKVLQDKRYKNRELQTMRLLDHPNVV  127



>gb|KDO45355.1| hypothetical protein CISIN_1g015298mg [Citrus sinensis]
Length=371

 Score =   167 bits (423),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 79/115 (69%), Positives = 95/115 (83%), Gaps = 8/115 (7%)
 Frame = +1

Query  379  GYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTETGQIIVTTVGGRNGEQKQVLS  558
            G ++LP+EM++MKI+DDK        +ME  V+ GNGTETG IIVTT+GGRNG+ KQ +S
Sbjct  21   GVDKLPEEMNDMKIRDDK--------EMEATVVDGNGTETGHIIVTTIGGRNGQPKQTIS  72

Query  559  YMAERVVGTGSFGVVFQAKCLESGEAVAIKKVLXDRRYXNRELQIMRMLEHPNVV  723
            YMAER+VG GSFGVVFQAKCLE+GE VAIKKVL D+RY NRELQ MR+L+HPNVV
Sbjct  73   YMAERIVGQGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRLLDHPNVV  127



>ref|XP_002319468.1| Glycogen synthase kinase-3 MsK-1 family protein [Populus trichocarpa]
 gb|EEE95391.1| Glycogen synthase kinase-3 MsK-1 family protein [Populus trichocarpa]
Length=409

 Score =   168 bits (425),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 80/116 (69%), Positives = 95/116 (82%), Gaps = 8/116 (7%)
 Frame = +1

Query  376  SGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTETGQIIVTTVGGRNGEQKQVL  555
            +G ++LP+EM++MKI+DDK        DME  V+ GNGTETG IIVTT+GGRNG+ KQ +
Sbjct  20   AGVDKLPEEMNDMKIRDDK--------DMEATVVDGNGTETGHIIVTTIGGRNGQPKQTI  71

Query  556  SYMAERVVGTGSFGVVFQAKCLESGEAVAIKKVLXDRRYXNRELQIMRMLEHPNVV  723
            SYMAERVVG GSFGVVFQAKCLE+ E VAIKKVL D+RY NRELQ MR+L+HPNVV
Sbjct  72   SYMAERVVGNGSFGVVFQAKCLETSETVAIKKVLQDKRYKNRELQTMRLLDHPNVV  127



>ref|XP_004495625.1| PREDICTED: glycogen synthase kinase-3 homolog MsK-1-like isoform 
X1 [Cicer arietinum]
 ref|XP_004495626.1| PREDICTED: glycogen synthase kinase-3 homolog MsK-1-like isoform 
X2 [Cicer arietinum]
 ref|XP_004495627.1| PREDICTED: glycogen synthase kinase-3 homolog MsK-1-like isoform 
X3 [Cicer arietinum]
Length=434

 Score =   168 bits (426),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 83/135 (61%), Positives = 101/135 (75%), Gaps = 8/135 (6%)
 Frame = +1

Query  319  ASTSQEDASGISLVARSEKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTET  498
            AS      SG+   +    +G + LP+EM++MKI+DD+        +ME  V+ GNGTET
Sbjct  2    ASVGVAPTSGLRETSGHAAAGVDRLPEEMNDMKIRDDR--------EMEATVVDGNGTET  53

Query  499  GQIIVTTVGGRNGEQKQVLSYMAERVVGTGSFGVVFQAKCLESGEAVAIKKVLXDRRYXN  678
            G IIVTT+GGRNG+ KQ +SYMAERVVG GSFGVVFQAKCLE+GE VAIKKVL D+RY N
Sbjct  54   GHIIVTTIGGRNGQPKQTISYMAERVVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKN  113

Query  679  RELQIMRMLEHPNVV  723
            RELQ MR+L+HPNVV
Sbjct  114  RELQTMRLLDHPNVV  128



>ref|XP_010660897.1| PREDICTED: shaggy-related protein kinase epsilon isoform X2 [Vitis 
vinifera]
Length=393

 Score =   167 bits (423),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 78/113 (69%), Positives = 96/113 (85%), Gaps = 5/113 (4%)
 Frame = +1

Query  385  EELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTETGQIIVTTVGGRNGEQKQVLSYM  564
            ++LP+E++EMKI+DDK +     K+ME  V+ GNGTETG IIVTT+GGRNG+ KQ +SYM
Sbjct  4    DKLPEEINEMKIRDDKVE-----KEMEATVVDGNGTETGHIIVTTIGGRNGQPKQTISYM  58

Query  565  AERVVGTGSFGVVFQAKCLESGEAVAIKKVLXDRRYXNRELQIMRMLEHPNVV  723
            AERVVG GSFG+VFQAKCLE+GE VAIKKVL D+RY NRELQ MR+L+HPN+V
Sbjct  59   AERVVGQGSFGIVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRLLDHPNIV  111



>gb|EMT29598.1| Shaggy-related protein kinase theta [Aegilops tauschii]
Length=513

 Score =   169 bits (429),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 98/180 (54%), Positives = 123/180 (68%), Gaps = 13/180 (7%)
 Frame = +1

Query  208  GGDSSIKRVKVAQDFDQRIAGKPESEEICTTAPMH-------EAASTSQEDASGISL-VA  363
            GGDS  KR K  QD    I  +P   +     PMH        ++    E ++  S+  A
Sbjct  64   GGDSGSKRPKFDQDGLGDIVIQPHLSD---DKPMHLDQESSSSSSHRDAEASTSTSMNPA  120

Query  364  RSEKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTETGQIIVTTVGGRNGEQ  543
            ++E++G  +LPK M++M I DDK    NN K+ E V + GNGTE GQIIVTT+GG+NG+ 
Sbjct  121  KAEETG-ADLPKGMNDMTISDDKV-GHNNDKEAEGVTVDGNGTEAGQIIVTTIGGQNGKP  178

Query  544  KQVLSYMAERVVGTGSFGVVFQAKCLESGEAVAIKKVLXDRRYXNRELQIMRMLEHPNVV  723
            KQ +SYMAERVVGTGSFGVV+QAKCLE+GE VAIKKVL D+RY NRELQ M++LEHPNVV
Sbjct  179  KQKVSYMAERVVGTGSFGVVYQAKCLETGETVAIKKVLQDKRYKNRELQTMQLLEHPNVV  238



>ref|XP_011092192.1| PREDICTED: shaggy-related protein kinase alpha [Sesamum indicum]
Length=409

 Score =   167 bits (424),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 81/121 (67%), Positives = 96/121 (79%), Gaps = 8/121 (7%)
 Frame = +1

Query  361  ARSEKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTETGQIIVTTVGGRNGE  540
            A S   G + LP+EM++MKI+DDK        +ME  V+ GNGTETG IIVTT+GGRNG+
Sbjct  15   AGSHAVGVDRLPEEMNDMKIRDDK--------EMEATVVDGNGTETGHIIVTTIGGRNGQ  66

Query  541  QKQVLSYMAERVVGTGSFGVVFQAKCLESGEAVAIKKVLXDRRYXNRELQIMRMLEHPNV  720
             KQ +SYMAER+VG GSFGVVFQAKCLE+GE VAIKKVL D+RY NRELQ MR+L+HPNV
Sbjct  67   PKQTISYMAERIVGQGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRLLDHPNV  126

Query  721  V  723
            V
Sbjct  127  V  127



>ref|XP_002280673.1| PREDICTED: shaggy-related protein kinase alpha [Vitis vinifera]
Length=409

 Score =   167 bits (424),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 80/116 (69%), Positives = 95/116 (82%), Gaps = 8/116 (7%)
 Frame = +1

Query  376  SGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTETGQIIVTTVGGRNGEQKQVL  555
            +G + LP+EM++MKI+DDK        +ME  V+ GNGTETG IIVTT+GGRNG+ KQ +
Sbjct  20   AGVDRLPEEMNDMKIRDDK--------EMEATVVDGNGTETGHIIVTTIGGRNGQPKQTI  71

Query  556  SYMAERVVGTGSFGVVFQAKCLESGEAVAIKKVLXDRRYXNRELQIMRMLEHPNVV  723
            SYMAERVVG GSFGVVFQAKCLE+GE VAIKKVL D+RY NRELQ MR+L+HPNVV
Sbjct  72   SYMAERVVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRLLDHPNVV  127



>ref|XP_010660896.1| PREDICTED: shaggy-related protein kinase epsilon isoform X1 [Vitis 
vinifera]
 emb|CBI34900.3| unnamed protein product [Vitis vinifera]
Length=412

 Score =   167 bits (424),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 78/113 (69%), Positives = 96/113 (85%), Gaps = 5/113 (4%)
 Frame = +1

Query  385  EELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTETGQIIVTTVGGRNGEQKQVLSYM  564
            ++LP+E++EMKI+DDK +     K+ME  V+ GNGTETG IIVTT+GGRNG+ KQ +SYM
Sbjct  23   DKLPEEINEMKIRDDKVE-----KEMEATVVDGNGTETGHIIVTTIGGRNGQPKQTISYM  77

Query  565  AERVVGTGSFGVVFQAKCLESGEAVAIKKVLXDRRYXNRELQIMRMLEHPNVV  723
            AERVVG GSFG+VFQAKCLE+GE VAIKKVL D+RY NRELQ MR+L+HPN+V
Sbjct  78   AERVVGQGSFGIVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRLLDHPNIV  130



>ref|XP_006444574.1| hypothetical protein CICLE_v10020852mg [Citrus clementina]
 gb|ESR57814.1| hypothetical protein CICLE_v10020852mg [Citrus clementina]
Length=354

 Score =   166 bits (420),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 85/135 (63%), Positives = 102/135 (76%), Gaps = 15/135 (11%)
 Frame = +1

Query  319  ASTSQEDASGISLVARSEKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTET  498
            AS S   ASG ++       G + LP+EM++MKI+DDK        +ME  V+ GNGTE 
Sbjct  2    ASVSVVPASGNTV-------GVDRLPEEMNDMKIRDDK--------EMEATVVDGNGTEA  46

Query  499  GQIIVTTVGGRNGEQKQVLSYMAERVVGTGSFGVVFQAKCLESGEAVAIKKVLXDRRYXN  678
            G IIVTT+GG+NG+ KQ +SYMAERVVG GSFGVVFQAKCLE+GEAVAIKKVL D+RY N
Sbjct  47   GHIIVTTIGGKNGQPKQTISYMAERVVGHGSFGVVFQAKCLETGEAVAIKKVLQDKRYKN  106

Query  679  RELQIMRMLEHPNVV  723
            RELQ MR+L+HPNVV
Sbjct  107  RELQTMRLLDHPNVV  121



>gb|KDO86864.1| hypothetical protein CISIN_1g015632mg [Citrus sinensis]
Length=354

 Score =   166 bits (420),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 85/135 (63%), Positives = 102/135 (76%), Gaps = 15/135 (11%)
 Frame = +1

Query  319  ASTSQEDASGISLVARSEKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTET  498
            AS S   ASG ++       G + LP+EM++MKI+DDK        +ME  V+ GNGTE 
Sbjct  2    ASVSVVPASGNTV-------GVDRLPEEMNDMKIRDDK--------EMEATVVDGNGTEA  46

Query  499  GQIIVTTVGGRNGEQKQVLSYMAERVVGTGSFGVVFQAKCLESGEAVAIKKVLXDRRYXN  678
            G IIVTT+GG+NG+ KQ +SYMAERVVG GSFGVVFQAKCLE+GEAVAIKKVL D+RY N
Sbjct  47   GHIIVTTIGGKNGQPKQTISYMAERVVGHGSFGVVFQAKCLETGEAVAIKKVLQDKRYKN  106

Query  679  RELQIMRMLEHPNVV  723
            RELQ MR+L+HPNVV
Sbjct  107  RELQTMRLLDHPNVV  121



>ref|XP_002515218.1| Glycogen synthase kinase-3 beta, putative [Ricinus communis]
 gb|EEF47202.1| Glycogen synthase kinase-3 beta, putative [Ricinus communis]
Length=409

 Score =   167 bits (424),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 86/135 (64%), Positives = 101/135 (75%), Gaps = 9/135 (7%)
 Frame = +1

Query  319  ASTSQEDASGISLVARSEKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTET  498
            AS S    SGI        +G + LP EM++MKI+DDK        +ME  V+ GNGTET
Sbjct  2    ASVSVAPTSGIR-DPGGNAAGVDRLPDEMNDMKIRDDK--------EMEATVVDGNGTET  52

Query  499  GQIIVTTVGGRNGEQKQVLSYMAERVVGTGSFGVVFQAKCLESGEAVAIKKVLXDRRYXN  678
            G IIVTT+GG+NG+ KQ +SYMAERVVG GSFGVVFQAKCLE+GEAVAIKKVL D+RY N
Sbjct  53   GHIIVTTIGGKNGQPKQTISYMAERVVGHGSFGVVFQAKCLETGEAVAIKKVLQDKRYKN  112

Query  679  RELQIMRMLEHPNVV  723
            RELQ MR+L+HPNVV
Sbjct  113  RELQTMRLLDHPNVV  127



>gb|ERN02393.1| hypothetical protein AMTR_s00096p00102520 [Amborella trichopoda]
Length=356

 Score =   166 bits (420),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 80/115 (70%), Positives = 96/115 (83%), Gaps = 8/115 (7%)
 Frame = +1

Query  379  GYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTETGQIIVTTVGGRNGEQKQVLS  558
            G ++LP+E++EMKIKDDK        +ME  V+ GNGTETGQIIVTT+GGRNG+ KQ +S
Sbjct  21   GVDKLPEEINEMKIKDDK--------EMEANVVDGNGTETGQIIVTTIGGRNGQPKQNIS  72

Query  559  YMAERVVGTGSFGVVFQAKCLESGEAVAIKKVLXDRRYXNRELQIMRMLEHPNVV  723
            YMAERVVG GSFG+VFQAKCLE+GE VAIKKVL D+RY NRELQ MR+L+HPN+V
Sbjct  73   YMAERVVGHGSFGIVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRLLDHPNIV  127



>gb|KDO66112.1| hypothetical protein CISIN_1g0141741mg, partial [Citrus sinensis]
 gb|KDO66113.1| hypothetical protein CISIN_1g0141741mg, partial [Citrus sinensis]
 gb|KDO66114.1| hypothetical protein CISIN_1g0141741mg, partial [Citrus sinensis]
Length=244

 Score =   163 bits (412),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 77/113 (68%), Positives = 95/113 (84%), Gaps = 5/113 (4%)
 Frame = +1

Query  385  EELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTETGQIIVTTVGGRNGEQKQVLSYM  564
            ++LP+E++EMKIK ++ +     K+ME  V+ GNGTETG IIVTT+GGRNG+ KQ +SYM
Sbjct  40   DKLPEEINEMKIKGERVE-----KEMEATVVDGNGTETGHIIVTTIGGRNGQPKQTISYM  94

Query  565  AERVVGTGSFGVVFQAKCLESGEAVAIKKVLXDRRYXNRELQIMRMLEHPNVV  723
            AERVVG GSFG+VFQAKCLE+GE VAIKKVL D+RY NRELQ MR+L+HPNVV
Sbjct  95   AERVVGQGSFGIVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRLLDHPNVV  147



>ref|XP_006841582.1| PREDICTED: glycogen synthase kinase-3 homolog MsK-1 [Amborella 
trichopoda]
 gb|ERN03257.1| hypothetical protein AMTR_s00003p00196730 [Amborella trichopoda]
Length=409

 Score =   167 bits (423),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 85/135 (63%), Positives = 104/135 (77%), Gaps = 9/135 (7%)
 Frame = +1

Query  319  ASTSQEDASGISLVARSEKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTET  498
            AS S   A+G   ++ S   G ++LP+EM++MKI+DDK        ++E  V+ GNGTET
Sbjct  2    ASVSVVPATGFRELSGS-TMGVDKLPEEMNDMKIRDDK--------EVEATVVDGNGTET  52

Query  499  GQIIVTTVGGRNGEQKQVLSYMAERVVGTGSFGVVFQAKCLESGEAVAIKKVLXDRRYXN  678
            G IIVTT+GGRNG+ KQ +SYMAERVVG GSFG+VFQAKCLESGE VAIKKVL D+RY N
Sbjct  53   GHIIVTTIGGRNGQPKQTISYMAERVVGHGSFGIVFQAKCLESGETVAIKKVLQDKRYKN  112

Query  679  RELQIMRMLEHPNVV  723
            RELQ MR+L+HPNVV
Sbjct  113  RELQTMRLLDHPNVV  127



>gb|KDO66115.1| hypothetical protein CISIN_1g0141741mg, partial [Citrus sinensis]
Length=243

 Score =   163 bits (412),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 77/113 (68%), Positives = 95/113 (84%), Gaps = 5/113 (4%)
 Frame = +1

Query  385  EELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTETGQIIVTTVGGRNGEQKQVLSYM  564
            ++LP+E++EMKIK ++ +     K+ME  V+ GNGTETG IIVTT+GGRNG+ KQ +SYM
Sbjct  40   DKLPEEINEMKIKGERVE-----KEMEATVVDGNGTETGHIIVTTIGGRNGQPKQTISYM  94

Query  565  AERVVGTGSFGVVFQAKCLESGEAVAIKKVLXDRRYXNRELQIMRMLEHPNVV  723
            AERVVG GSFG+VFQAKCLE+GE VAIKKVL D+RY NRELQ MR+L+HPNVV
Sbjct  95   AERVVGQGSFGIVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRLLDHPNVV  147



>gb|KDO45353.1| hypothetical protein CISIN_1g015298mg [Citrus sinensis]
Length=409

 Score =   167 bits (423),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 79/115 (69%), Positives = 95/115 (83%), Gaps = 8/115 (7%)
 Frame = +1

Query  379  GYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTETGQIIVTTVGGRNGEQKQVLS  558
            G ++LP+EM++MKI+DDK        +ME  V+ GNGTETG IIVTT+GGRNG+ KQ +S
Sbjct  21   GVDKLPEEMNDMKIRDDK--------EMEATVVDGNGTETGHIIVTTIGGRNGQPKQTIS  72

Query  559  YMAERVVGTGSFGVVFQAKCLESGEAVAIKKVLXDRRYXNRELQIMRMLEHPNVV  723
            YMAER+VG GSFGVVFQAKCLE+GE VAIKKVL D+RY NRELQ MR+L+HPNVV
Sbjct  73   YMAERIVGQGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRLLDHPNVV  127



>ref|XP_007205270.1| hypothetical protein PRUPE_ppa006473mg [Prunus persica]
 ref|XP_007205271.1| hypothetical protein PRUPE_ppa006473mg [Prunus persica]
 ref|XP_007205272.1| hypothetical protein PRUPE_ppa006473mg [Prunus persica]
 gb|EMJ06469.1| hypothetical protein PRUPE_ppa006473mg [Prunus persica]
 gb|EMJ06470.1| hypothetical protein PRUPE_ppa006473mg [Prunus persica]
 gb|EMJ06471.1| hypothetical protein PRUPE_ppa006473mg [Prunus persica]
Length=410

 Score =   167 bits (423),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 80/115 (70%), Positives = 95/115 (83%), Gaps = 8/115 (7%)
 Frame = +1

Query  379  GYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTETGQIIVTTVGGRNGEQKQVLS  558
            G ++LP+EM++MKI+DDK        +ME  V+ GNGTETG IIVTT+GGRNG+ KQ +S
Sbjct  21   GVDKLPEEMNDMKIRDDK--------EMEATVVDGNGTETGHIIVTTIGGRNGQPKQTIS  72

Query  559  YMAERVVGTGSFGVVFQAKCLESGEAVAIKKVLXDRRYXNRELQIMRMLEHPNVV  723
            YMAERVVG GSFGVVFQAKCLE+GE VAIKKVL D+RY NRELQ MR+L+HPNVV
Sbjct  73   YMAERVVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRLLDHPNVV  127



>ref|XP_006480288.1| PREDICTED: shaggy-related protein kinase alpha-like [Citrus sinensis]
Length=409

 Score =   167 bits (422),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 79/115 (69%), Positives = 95/115 (83%), Gaps = 8/115 (7%)
 Frame = +1

Query  379  GYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTETGQIIVTTVGGRNGEQKQVLS  558
            G ++LP+EM++MKI+DDK        +ME  V+ GNGTETG IIVTT+GGRNG+ KQ +S
Sbjct  21   GVDKLPEEMNDMKIRDDK--------EMEATVVDGNGTETGHIIVTTIGGRNGQPKQTIS  72

Query  559  YMAERVVGTGSFGVVFQAKCLESGEAVAIKKVLXDRRYXNRELQIMRMLEHPNVV  723
            YMAER+VG GSFGVVFQAKCLE+GE VAIKKVL D+RY NRELQ MR+L+HPNVV
Sbjct  73   YMAERIVGQGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRLLDHPNVV  127



>ref|XP_010042192.1| PREDICTED: shaggy-related protein kinase alpha [Eucalyptus grandis]
 ref|XP_010042197.1| PREDICTED: shaggy-related protein kinase alpha [Eucalyptus grandis]
 ref|XP_010042204.1| PREDICTED: shaggy-related protein kinase alpha [Eucalyptus grandis]
 gb|KCW84972.1| hypothetical protein EUGRSUZ_B01797 [Eucalyptus grandis]
 gb|KCW84973.1| hypothetical protein EUGRSUZ_B01797 [Eucalyptus grandis]
 gb|KCW84974.1| hypothetical protein EUGRSUZ_B01797 [Eucalyptus grandis]
 gb|KCW84975.1| hypothetical protein EUGRSUZ_B01797 [Eucalyptus grandis]
Length=413

 Score =   167 bits (422),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 88/145 (61%), Positives = 104/145 (72%), Gaps = 20/145 (14%)
 Frame = +1

Query  304  PMHEAAST-----SQEDASGISLVARSEKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEP  468
            P+H  AS      S  + SG S+       G + LP+EM+EMKI+DDK        +ME 
Sbjct  2    PVHLMASVGIAPNSVREPSGQSV-------GVDRLPEEMNEMKIRDDK--------EMET  46

Query  469  VVITGNGTETGQIIVTTVGGRNGEQKQVLSYMAERVVGTGSFGVVFQAKCLESGEAVAIK  648
             V+ GNGTE G IIVTT+GGRNG+ KQ +SYMAERVVG GSFGVVFQAKCLE+GE VAIK
Sbjct  47   TVVDGNGTEAGHIIVTTIGGRNGQPKQTISYMAERVVGQGSFGVVFQAKCLETGETVAIK  106

Query  649  KVLXDRRYXNRELQIMRMLEHPNVV  723
            KVL D+RY NRELQ MR+L+HPNVV
Sbjct  107  KVLQDKRYKNRELQTMRLLDHPNVV  131



>gb|ABY60447.1| serine/threonine protein kinase [Adonis aestivalis var. palaestina]
Length=409

 Score =   167 bits (422),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 84/135 (62%), Positives = 100/135 (74%), Gaps = 9/135 (7%)
 Frame = +1

Query  319  ASTSQEDASGISLVARSEKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTET  498
            AS S    SG+         G + LP+EM++MKI+DDK        +ME  V+ GNGTET
Sbjct  2    ASVSMAPPSGLR-DPTGNAGGADRLPEEMNDMKIRDDK--------EMEATVVDGNGTET  52

Query  499  GQIIVTTVGGRNGEQKQVLSYMAERVVGTGSFGVVFQAKCLESGEAVAIKKVLXDRRYXN  678
            G IIVTT+GGRNG+ KQ +SYMAERVVG GSFG+VFQAKCLE+GE VAIKKVL D+RY N
Sbjct  53   GHIIVTTIGGRNGQPKQTISYMAERVVGHGSFGIVFQAKCLETGETVAIKKVLQDKRYKN  112

Query  679  RELQIMRMLEHPNVV  723
            RELQ MR+L+HPNVV
Sbjct  113  RELQTMRLLDHPNVV  127



>ref|XP_009151155.1| PREDICTED: shaggy-related protein kinase alpha [Brassica rapa]
 emb|CDX88238.1| BnaA06g28290D [Brassica napus]
Length=403

 Score =   166 bits (421),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 80/115 (70%), Positives = 94/115 (82%), Gaps = 8/115 (7%)
 Frame = +1

Query  379  GYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTETGQIIVTTVGGRNGEQKQVLS  558
            G ++LP+EM++MKI+DDK        +ME  V+ GN TETG IIVTT+GGRNG+ KQ +S
Sbjct  15   GVDKLPEEMNDMKIRDDK--------EMEATVVDGNSTETGHIIVTTIGGRNGQPKQTIS  66

Query  559  YMAERVVGTGSFGVVFQAKCLESGEAVAIKKVLXDRRYXNRELQIMRMLEHPNVV  723
            YMAERVVG GSFGVVFQAKCLE+GE VAIKKVL DRRY NRELQ MR+L+HPNVV
Sbjct  67   YMAERVVGQGSFGVVFQAKCLETGETVAIKKVLQDRRYKNRELQTMRLLDHPNVV  121



>ref|XP_010091400.1| Glycogen synthase kinase-3-MsK-3-like protein [Morus notabilis]
 gb|EXB44437.1| Glycogen synthase kinase-3-MsK-3-like protein [Morus notabilis]
Length=412

 Score =   167 bits (422),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 82/135 (61%), Positives = 102/135 (76%), Gaps = 8/135 (6%)
 Frame = +1

Query  319  ASTSQEDASGISLVARSEKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTET  498
            AS S   ASG+   +    +G + LP EM++MKI+D+K        ++E  ++ GNGTET
Sbjct  2    ASVSVVPASGVVRESSGNAAGVDRLPDEMNDMKIRDEK--------EVEATIVDGNGTET  53

Query  499  GQIIVTTVGGRNGEQKQVLSYMAERVVGTGSFGVVFQAKCLESGEAVAIKKVLXDRRYXN  678
            G IIVTT+GG+NG+ KQ +SYMAERVVG GSFGVVFQAKCLE+GE VAIKKVL D+RY N
Sbjct  54   GHIIVTTIGGKNGQPKQTISYMAERVVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKN  113

Query  679  RELQIMRMLEHPNVV  723
            RELQ MR+L+HPNVV
Sbjct  114  RELQTMRLLDHPNVV  128



>ref|XP_010910596.1| PREDICTED: shaggy-related protein kinase alpha-like [Elaeis guineensis]
Length=409

 Score =   166 bits (421),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 86/135 (64%), Positives = 102/135 (76%), Gaps = 9/135 (7%)
 Frame = +1

Query  319  ASTSQEDASGISLVARSEKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTET  498
            AS S   +SG+   + +   G + LP EM+EMKI+DDK        ++E  VI GNGTET
Sbjct  2    ASVSVVPSSGMKNTSGTH-VGVDRLPDEMNEMKIRDDK--------EVEATVIDGNGTET  52

Query  499  GQIIVTTVGGRNGEQKQVLSYMAERVVGTGSFGVVFQAKCLESGEAVAIKKVLXDRRYXN  678
            G IIVTT+GGRNG+ KQ +SYMAERVVG GSFGVVFQAKCLE+GE VAIKKVL D+RY N
Sbjct  53   GHIIVTTIGGRNGQPKQTISYMAERVVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKN  112

Query  679  RELQIMRMLEHPNVV  723
            RELQ MR+L+HPNVV
Sbjct  113  RELQTMRLLDHPNVV  127



>gb|KDO66111.1| hypothetical protein CISIN_1g0141741mg, partial [Citrus sinensis]
Length=210

 Score =   161 bits (407),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 76/112 (68%), Positives = 94/112 (84%), Gaps = 5/112 (4%)
 Frame = +1

Query  385  EELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTETGQIIVTTVGGRNGEQKQVLSYM  564
            ++LP+E++EMKIK ++ +     K+ME  V+ GNGTETG IIVTT+GGRNG+ KQ +SYM
Sbjct  40   DKLPEEINEMKIKGERVE-----KEMEATVVDGNGTETGHIIVTTIGGRNGQPKQTISYM  94

Query  565  AERVVGTGSFGVVFQAKCLESGEAVAIKKVLXDRRYXNRELQIMRMLEHPNV  720
            AERVVG GSFG+VFQAKCLE+GE VAIKKVL D+RY NRELQ MR+L+HPNV
Sbjct  95   AERVVGQGSFGIVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRLLDHPNV  146



>ref|XP_010921357.1| PREDICTED: shaggy-related protein kinase alpha [Elaeis guineensis]
Length=409

 Score =   166 bits (421),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 86/135 (64%), Positives = 102/135 (76%), Gaps = 9/135 (7%)
 Frame = +1

Query  319  ASTSQEDASGISLVARSEKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTET  498
            AS S   +SG+   + +   G + LP EM+EMKI+DDK        ++E  VI GNGTET
Sbjct  2    ASVSVVPSSGMKNTSGTH-VGVDRLPDEMNEMKIRDDK--------EVEATVIDGNGTET  52

Query  499  GQIIVTTVGGRNGEQKQVLSYMAERVVGTGSFGVVFQAKCLESGEAVAIKKVLXDRRYXN  678
            G IIVTT+GGRNG+ KQ +SYMAERVVG GSFGVVFQAKCLE+GE VAIKKVL D+RY N
Sbjct  53   GHIIVTTIGGRNGQPKQTISYMAERVVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKN  112

Query  679  RELQIMRMLEHPNVV  723
            RELQ MR+L+HPNVV
Sbjct  113  RELQTMRLLDHPNVV  127



>ref|XP_011003165.1| PREDICTED: shaggy-related protein kinase alpha-like [Populus 
euphratica]
 ref|XP_011003166.1| PREDICTED: shaggy-related protein kinase alpha-like [Populus 
euphratica]
Length=409

 Score =   166 bits (421),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 85/135 (63%), Positives = 101/135 (75%), Gaps = 9/135 (7%)
 Frame = +1

Query  319  ASTSQEDASGISLVARSEKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTET  498
            AS S   ASG+    R   +G ++LP EM+ MKI DDK        +ME  V+ GNGTET
Sbjct  2    ASVSVVPASGLR-DTRGNTTGIDKLPDEMNGMKISDDK--------EMEAAVVDGNGTET  52

Query  499  GQIIVTTVGGRNGEQKQVLSYMAERVVGTGSFGVVFQAKCLESGEAVAIKKVLXDRRYXN  678
            G IIVTT+GG+NG+ KQ +SYMAERVVG GSFG+VFQAKCLE+GE VAIKKVL D+RY N
Sbjct  53   GHIIVTTIGGKNGQPKQTISYMAERVVGHGSFGLVFQAKCLETGETVAIKKVLQDKRYKN  112

Query  679  RELQIMRMLEHPNVV  723
            RELQ MR+L+HPNVV
Sbjct  113  RELQTMRLLDHPNVV  127



>ref|XP_011097427.1| PREDICTED: shaggy-related protein kinase epsilon-like [Sesamum 
indicum]
Length=407

 Score =   166 bits (421),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 78/113 (69%), Positives = 96/113 (85%), Gaps = 5/113 (4%)
 Frame = +1

Query  385  EELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTETGQIIVTTVGGRNGEQKQVLSYM  564
            ++LP+E++EMKIKD+K +     K+ME  V+ GNGTETG IIVTT+GG+NG+ KQ +SYM
Sbjct  19   DKLPEEINEMKIKDEKVE-----KEMEAAVVDGNGTETGHIIVTTIGGKNGQPKQTISYM  73

Query  565  AERVVGTGSFGVVFQAKCLESGEAVAIKKVLXDRRYXNRELQIMRMLEHPNVV  723
            AER+VG GSFG+VFQAKCLESGE VAIKKVL D+RY NRELQ MR+L+HPNVV
Sbjct  74   AERIVGQGSFGIVFQAKCLESGETVAIKKVLQDKRYKNRELQTMRLLDHPNVV  126



>ref|XP_011622016.1| PREDICTED: shaggy-related protein kinase epsilon [Amborella trichopoda]
Length=409

 Score =   166 bits (421),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 80/115 (70%), Positives = 96/115 (83%), Gaps = 8/115 (7%)
 Frame = +1

Query  379  GYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTETGQIIVTTVGGRNGEQKQVLS  558
            G ++LP+E++EMKIKDDK        +ME  V+ GNGTETGQIIVTT+GGRNG+ KQ +S
Sbjct  21   GVDKLPEEINEMKIKDDK--------EMEANVVDGNGTETGQIIVTTIGGRNGQPKQNIS  72

Query  559  YMAERVVGTGSFGVVFQAKCLESGEAVAIKKVLXDRRYXNRELQIMRMLEHPNVV  723
            YMAERVVG GSFG+VFQAKCLE+GE VAIKKVL D+RY NRELQ MR+L+HPN+V
Sbjct  73   YMAERVVGHGSFGIVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRLLDHPNIV  127



>ref|XP_008781189.1| PREDICTED: shaggy-related protein kinase alpha-like [Phoenix 
dactylifera]
 ref|XP_008781190.1| PREDICTED: shaggy-related protein kinase alpha-like [Phoenix 
dactylifera]
Length=409

 Score =   166 bits (421),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 84/136 (62%), Positives = 101/136 (74%), Gaps = 15/136 (11%)
 Frame = +1

Query  316  AASTSQEDASGISLVARSEKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTE  495
              S+  ++ SG S+       G + LP EM+EMKI+DDK        ++E  VI GNGTE
Sbjct  7    VPSSRMKNTSGTSV-------GVDRLPDEMNEMKIRDDK--------EVEATVIDGNGTE  51

Query  496  TGQIIVTTVGGRNGEQKQVLSYMAERVVGTGSFGVVFQAKCLESGEAVAIKKVLXDRRYX  675
            TG IIVTT+GGRNG+ KQ +SYMAERVVG GSFG+VFQAKCLE+GE VAIKKVL D+RY 
Sbjct  52   TGHIIVTTIGGRNGQPKQTISYMAERVVGHGSFGIVFQAKCLETGETVAIKKVLQDKRYK  111

Query  676  NRELQIMRMLEHPNVV  723
            NRELQ MR+L+HPNVV
Sbjct  112  NRELQTMRLLDHPNVV  127



>ref|XP_009775930.1| PREDICTED: shaggy-related protein kinase NtK-1-like [Nicotiana 
sylvestris]
 ref|XP_009775931.1| PREDICTED: shaggy-related protein kinase NtK-1-like [Nicotiana 
sylvestris]
Length=409

 Score =   166 bits (421),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 78/116 (67%), Positives = 95/116 (82%), Gaps = 8/116 (7%)
 Frame = +1

Query  376  SGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTETGQIIVTTVGGRNGEQKQVL  555
            +G + LP+EM++M+I+DDK        +ME  ++ GNGTETG IIVTT+GGRNG+ KQ +
Sbjct  20   AGVDRLPEEMNDMRIRDDK--------EMEAAIVDGNGTETGHIIVTTIGGRNGQAKQTI  71

Query  556  SYMAERVVGTGSFGVVFQAKCLESGEAVAIKKVLXDRRYXNRELQIMRMLEHPNVV  723
            SYMAERVVG GSFGVVFQAKCLE+GE VAIKKVL D+RY NRELQ MR+L+HPNVV
Sbjct  72   SYMAERVVGQGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRLLDHPNVV  127



>ref|XP_010276519.1| PREDICTED: shaggy-related protein kinase alpha [Nelumbo nucifera]
 ref|XP_010276520.1| PREDICTED: shaggy-related protein kinase alpha [Nelumbo nucifera]
Length=409

 Score =   166 bits (421),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 80/115 (70%), Positives = 94/115 (82%), Gaps = 8/115 (7%)
 Frame = +1

Query  379  GYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTETGQIIVTTVGGRNGEQKQVLS  558
            G + LP+EM++MKI+DDK        +ME  V+ GNGTETG IIVTT+GGRNG+ KQ +S
Sbjct  21   GVDRLPEEMNDMKIRDDK--------EMEATVVDGNGTETGHIIVTTIGGRNGQPKQTIS  72

Query  559  YMAERVVGTGSFGVVFQAKCLESGEAVAIKKVLXDRRYXNRELQIMRMLEHPNVV  723
            YMAERVVG GSFGVVFQAKCLE+GE VAIKKVL D+RY NRELQ MR+L+HPNVV
Sbjct  73   YMAERVVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRLLDHPNVV  127



>ref|XP_010270906.1| PREDICTED: shaggy-related protein kinase alpha-like isoform X2 
[Nelumbo nucifera]
 ref|XP_010270907.1| PREDICTED: shaggy-related protein kinase alpha-like isoform X2 
[Nelumbo nucifera]
Length=409

 Score =   166 bits (421),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 85/135 (63%), Positives = 101/135 (75%), Gaps = 9/135 (7%)
 Frame = +1

Query  319  ASTSQEDASGISLVARSEKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTET  498
            AS S   ASG+         G ++LP+EM+ MKI+DDK        +ME  V+ GNGTET
Sbjct  2    ASVSIVPASGVK-EPSGNCVGVDKLPEEMNGMKIRDDK--------EMEATVVDGNGTET  52

Query  499  GQIIVTTVGGRNGEQKQVLSYMAERVVGTGSFGVVFQAKCLESGEAVAIKKVLXDRRYXN  678
            G IIVTT+GGRNG+ KQ +SYMAERVVG GSFG+VFQAKCLE+GE VAIKKVL D+RY N
Sbjct  53   GHIIVTTIGGRNGQPKQTISYMAERVVGNGSFGIVFQAKCLETGETVAIKKVLQDKRYKN  112

Query  679  RELQIMRMLEHPNVV  723
            RELQ MR+L+HPNVV
Sbjct  113  RELQTMRLLDHPNVV  127



>gb|KHN16033.1| Glycogen synthase kinase-3 like MsK-1 [Glycine soja]
Length=411

 Score =   166 bits (421),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 79/116 (68%), Positives = 95/116 (82%), Gaps = 8/116 (7%)
 Frame = +1

Query  376  SGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTETGQIIVTTVGGRNGEQKQVL  555
            +G + LP+EM++MKI+DD+        +ME  V+ GNGTETG IIVTT+GGRNG+ KQ +
Sbjct  21   AGVDRLPEEMNDMKIRDDR--------EMEATVVDGNGTETGHIIVTTIGGRNGQPKQTI  72

Query  556  SYMAERVVGTGSFGVVFQAKCLESGEAVAIKKVLXDRRYXNRELQIMRMLEHPNVV  723
            SYMAERVVG GSFGVVFQAKCLE+GE VAIKKVL D+RY NRELQ MR+L+HPNVV
Sbjct  73   SYMAERVVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRLLDHPNVV  128



>ref|XP_009629200.1| PREDICTED: shaggy-related protein kinase NtK-1-like [Nicotiana 
tomentosiformis]
 ref|XP_009629201.1| PREDICTED: shaggy-related protein kinase NtK-1-like [Nicotiana 
tomentosiformis]
Length=409

 Score =   166 bits (421),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 78/116 (67%), Positives = 95/116 (82%), Gaps = 8/116 (7%)
 Frame = +1

Query  376  SGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTETGQIIVTTVGGRNGEQKQVL  555
            +G + LP+EM++M+I+DDK        +ME  ++ GNGTETG IIVTT+GGRNG+ KQ +
Sbjct  20   AGVDRLPEEMNDMRIRDDK--------EMEAAIVDGNGTETGHIIVTTIGGRNGQPKQTI  71

Query  556  SYMAERVVGTGSFGVVFQAKCLESGEAVAIKKVLXDRRYXNRELQIMRMLEHPNVV  723
            SYMAERVVG GSFGVVFQAKCLE+GE VAIKKVL D+RY NRELQ MR+L+HPNVV
Sbjct  72   SYMAERVVGQGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRLLDHPNVV  127



>ref|XP_004230343.1| PREDICTED: shaggy-related protein kinase NtK-1 [Solanum lycopersicum]
Length=409

 Score =   166 bits (420),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 78/116 (67%), Positives = 95/116 (82%), Gaps = 8/116 (7%)
 Frame = +1

Query  376  SGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTETGQIIVTTVGGRNGEQKQVL  555
            +G + LP+EM++M+I+DDK        +ME  ++ GNGTETG IIVTT+GGRNG+ KQ +
Sbjct  20   AGVDRLPEEMNDMRIRDDK--------EMEAAIVDGNGTETGHIIVTTIGGRNGQPKQTI  71

Query  556  SYMAERVVGTGSFGVVFQAKCLESGEAVAIKKVLXDRRYXNRELQIMRMLEHPNVV  723
            SYMAERVVG GSFGVVFQAKCLE+GE VAIKKVL D+RY NRELQ MR+L+HPNVV
Sbjct  72   SYMAERVVGQGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRLLDHPNVV  127



>ref|XP_010251221.1| PREDICTED: shaggy-related protein kinase epsilon-like isoform 
X4 [Nelumbo nucifera]
Length=350

 Score =   165 bits (417),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 78/113 (69%), Positives = 94/113 (83%), Gaps = 8/113 (7%)
 Frame = +1

Query  385  EELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTETGQIIVTTVGGRNGEQKQVLSYM  564
            ++LP+E++EMKI+DDK        +ME  V+ GNGTETG IIVTT+GGRNG+ KQ +SYM
Sbjct  23   DKLPEEINEMKIRDDK--------EMEATVVDGNGTETGHIIVTTIGGRNGQPKQTISYM  74

Query  565  AERVVGTGSFGVVFQAKCLESGEAVAIKKVLXDRRYXNRELQIMRMLEHPNVV  723
            AERVVG GSFG+VFQAKCLE+GE VAIKKVL D+RY NRELQ MR+L+HPNVV
Sbjct  75   AERVVGHGSFGIVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRLLDHPNVV  127



>ref|XP_007145031.1| hypothetical protein PHAVU_007G204000g [Phaseolus vulgaris]
 ref|XP_007145032.1| hypothetical protein PHAVU_007G204000g [Phaseolus vulgaris]
 gb|ESW17025.1| hypothetical protein PHAVU_007G204000g [Phaseolus vulgaris]
 gb|ESW17026.1| hypothetical protein PHAVU_007G204000g [Phaseolus vulgaris]
Length=410

 Score =   166 bits (420),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 79/116 (68%), Positives = 95/116 (82%), Gaps = 8/116 (7%)
 Frame = +1

Query  376  SGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTETGQIIVTTVGGRNGEQKQVL  555
            +G + LP+EM++MKI+DD+        +ME  V+ GNGTETG IIVTT+GGRNG+ KQ +
Sbjct  21   AGVDRLPEEMNDMKIRDDR--------EMEATVVDGNGTETGHIIVTTIGGRNGQPKQTI  72

Query  556  SYMAERVVGTGSFGVVFQAKCLESGEAVAIKKVLXDRRYXNRELQIMRMLEHPNVV  723
            SYMAERVVG GSFGVVFQAKCLE+GE VAIKKVL D+RY NRELQ MR+L+HPNVV
Sbjct  73   SYMAERVVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRLLDHPNVV  128



>ref|XP_006588432.1| PREDICTED: glycogen synthase kinase-3 isoform X1 [Glycine max]
Length=410

 Score =   166 bits (420),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 79/116 (68%), Positives = 95/116 (82%), Gaps = 8/116 (7%)
 Frame = +1

Query  376  SGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTETGQIIVTTVGGRNGEQKQVL  555
            +G + LP+EM++MKI+DD+        +ME  V+ GNGTETG IIVTT+GGRNG+ KQ +
Sbjct  21   AGVDRLPEEMNDMKIRDDR--------EMEATVVDGNGTETGHIIVTTIGGRNGQPKQTI  72

Query  556  SYMAERVVGTGSFGVVFQAKCLESGEAVAIKKVLXDRRYXNRELQIMRMLEHPNVV  723
            SYMAERVVG GSFGVVFQAKCLE+GE VAIKKVL D+RY NRELQ MR+L+HPNVV
Sbjct  73   SYMAERVVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRLLDHPNVV  128



>gb|AFH00876.1| glycogen synthase kinase-3 [Glycine soja]
Length=410

 Score =   166 bits (420),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 79/116 (68%), Positives = 95/116 (82%), Gaps = 8/116 (7%)
 Frame = +1

Query  376  SGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTETGQIIVTTVGGRNGEQKQVL  555
            +G + LP+EM++MKI+DD+        +ME  V+ GNGTETG IIVTT+GGRNG+ KQ +
Sbjct  21   AGVDRLPEEMNDMKIRDDR--------EMEATVVDGNGTETGHIIVTTIGGRNGQPKQTI  72

Query  556  SYMAERVVGTGSFGVVFQAKCLESGEAVAIKKVLXDRRYXNRELQIMRMLEHPNVV  723
            SYMAERVVG GSFGVVFQAKCLE+GE VAIKKVL D+RY NRELQ MR+L+HPNVV
Sbjct  73   SYMAERVVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRLLDHPNVV  128



>ref|XP_006444573.1| hypothetical protein CICLE_v10020852mg [Citrus clementina]
 ref|XP_006444575.1| hypothetical protein CICLE_v10020852mg [Citrus clementina]
 ref|XP_006492384.1| PREDICTED: glycogen synthase kinase-3 homolog MsK-3-like isoform 
X1 [Citrus sinensis]
 gb|ESR57813.1| hypothetical protein CICLE_v10020852mg [Citrus clementina]
 gb|ESR57815.1| hypothetical protein CICLE_v10020852mg [Citrus clementina]
 gb|KDO86860.1| hypothetical protein CISIN_1g015632mg [Citrus sinensis]
 gb|KDO86861.1| hypothetical protein CISIN_1g015632mg [Citrus sinensis]
 gb|KDO86862.1| hypothetical protein CISIN_1g015632mg [Citrus sinensis]
 gb|KDO86863.1| hypothetical protein CISIN_1g015632mg [Citrus sinensis]
Length=403

 Score =   166 bits (420),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 85/135 (63%), Positives = 102/135 (76%), Gaps = 15/135 (11%)
 Frame = +1

Query  319  ASTSQEDASGISLVARSEKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTET  498
            AS S   ASG ++       G + LP+EM++MKI+DDK        +ME  V+ GNGTE 
Sbjct  2    ASVSVVPASGNTV-------GVDRLPEEMNDMKIRDDK--------EMEATVVDGNGTEA  46

Query  499  GQIIVTTVGGRNGEQKQVLSYMAERVVGTGSFGVVFQAKCLESGEAVAIKKVLXDRRYXN  678
            G IIVTT+GG+NG+ KQ +SYMAERVVG GSFGVVFQAKCLE+GEAVAIKKVL D+RY N
Sbjct  47   GHIIVTTIGGKNGQPKQTISYMAERVVGHGSFGVVFQAKCLETGEAVAIKKVLQDKRYKN  106

Query  679  RELQIMRMLEHPNVV  723
            RELQ MR+L+HPNVV
Sbjct  107  RELQTMRLLDHPNVV  121



>ref|XP_006428242.1| hypothetical protein CICLE_v10013624mg [Citrus clementina]
 gb|ESR41482.1| hypothetical protein CICLE_v10013624mg [Citrus clementina]
Length=453

 Score =   167 bits (422),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 79/115 (69%), Positives = 95/115 (83%), Gaps = 8/115 (7%)
 Frame = +1

Query  379  GYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTETGQIIVTTVGGRNGEQKQVLS  558
            G ++LP+EM++MKI+DDK        +ME  V+ GNGTETG IIVTT+GGRNG+ KQ +S
Sbjct  21   GVDKLPEEMNDMKIRDDK--------EMEATVVDGNGTETGHIIVTTIGGRNGQPKQTIS  72

Query  559  YMAERVVGTGSFGVVFQAKCLESGEAVAIKKVLXDRRYXNRELQIMRMLEHPNVV  723
            YMAER+VG GSFGVVFQAKCLE+GE VAIKKVL D+RY NRELQ MR+L+HPNVV
Sbjct  73   YMAERIVGQGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRLLDHPNVV  127



>ref|NP_001274855.1| Shaggy-like protein kinase NtK-1 [Solanum tuberosum]
 ref|XP_006344811.1| PREDICTED: shaggy-related protein kinase NtK-1 [Solanum tuberosum]
 gb|ABB87119.1| NtK-1-like [Solanum tuberosum]
Length=409

 Score =   166 bits (420),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 78/116 (67%), Positives = 95/116 (82%), Gaps = 8/116 (7%)
 Frame = +1

Query  376  SGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTETGQIIVTTVGGRNGEQKQVL  555
            +G + LP+EM++M+I+DDK        +ME  ++ GNGTETG IIVTT+GGRNG+ KQ +
Sbjct  20   AGVDRLPEEMNDMRIRDDK--------EMEATIVDGNGTETGHIIVTTIGGRNGQPKQTI  71

Query  556  SYMAERVVGTGSFGVVFQAKCLESGEAVAIKKVLXDRRYXNRELQIMRMLEHPNVV  723
            SYMAERVVG GSFGVVFQAKCLE+GE VAIKKVL D+RY NRELQ MR+L+HPNVV
Sbjct  72   SYMAERVVGQGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRLLDHPNVV  127



>gb|ACQ91102.1| glycogen synthase kinase [Glycine max]
Length=410

 Score =   166 bits (420),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 79/116 (68%), Positives = 95/116 (82%), Gaps = 8/116 (7%)
 Frame = +1

Query  376  SGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTETGQIIVTTVGGRNGEQKQVL  555
            +G + LP+EM++MKI+DD+        +ME  V+ GNGTETG IIVTT+GGRNG+ KQ +
Sbjct  21   AGVDRLPEEMNDMKIRDDR--------EMEATVVDGNGTETGHIIVTTIGGRNGQPKQTI  72

Query  556  SYMAERVVGTGSFGVVFQAKCLESGEAVAIKKVLXDRRYXNRELQIMRMLEHPNVV  723
            SYMAERVVG GSFGVVFQAKCLE+GE VAIKKVL D+RY NRELQ MR+L+HPNVV
Sbjct  73   SYMAERVVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRLLDHPNVV  128



>emb|CAA58594.1| Petunia Shaggy kinase 4 [Petunia x hybrida]
Length=409

 Score =   166 bits (420),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 83/132 (63%), Positives = 104/132 (79%), Gaps = 9/132 (7%)
 Frame = +1

Query  340  ASGISLVA----RSEKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTETGQI  507
            ASGI   A    R++    ++LP+E++EMKI+DDK++     K+ME  V+ GNGTE G I
Sbjct  2    ASGIMPSAGGKHRTDAMLVDKLPEEINEMKIRDDKAE-----KEMEAAVVDGNGTEKGHI  56

Query  508  IVTTVGGRNGEQKQVLSYMAERVVGTGSFGVVFQAKCLESGEAVAIKKVLXDRRYXNREL  687
            IVTT+GG+NGE KQ +SYMAERVVG GSFG+VFQAKCLE+GE VAIKKVL D+RY NREL
Sbjct  57   IVTTIGGKNGEPKQTISYMAERVVGQGSFGIVFQAKCLETGETVAIKKVLQDKRYKNREL  116

Query  688  QIMRMLEHPNVV  723
            Q +R+L+HPNVV
Sbjct  117  QTIRLLDHPNVV  128



>ref|XP_008793304.1| PREDICTED: shaggy-related protein kinase alpha-like [Phoenix 
dactylifera]
Length=409

 Score =   166 bits (420),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 82/136 (60%), Positives = 102/136 (75%), Gaps = 15/136 (11%)
 Frame = +1

Query  316  AASTSQEDASGISLVARSEKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTE  495
              S+  ++ASG S+       G + LP EM++MKI+DDK        ++E  V+ GNGTE
Sbjct  7    VTSSGMKNASGTSV-------GMDRLPDEMNDMKIRDDK--------EVEATVVDGNGTE  51

Query  496  TGQIIVTTVGGRNGEQKQVLSYMAERVVGTGSFGVVFQAKCLESGEAVAIKKVLXDRRYX  675
            TG IIVTT+GGRNG+ KQ +SYMAERVVG GSFG+VFQAKCLE+GE VAIKKVL D+RY 
Sbjct  52   TGHIIVTTIGGRNGQPKQTISYMAERVVGHGSFGIVFQAKCLETGETVAIKKVLQDKRYK  111

Query  676  NRELQIMRMLEHPNVV  723
            NRELQ MR+L+HPN+V
Sbjct  112  NRELQTMRLLDHPNIV  127



>ref|XP_002279596.1| PREDICTED: shaggy-related protein kinase alpha isoform X1 [Vitis 
vinifera]
 emb|CAN75652.1| hypothetical protein VITISV_017659 [Vitis vinifera]
Length=409

 Score =   166 bits (420),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 85/135 (63%), Positives = 100/135 (74%), Gaps = 9/135 (7%)
 Frame = +1

Query  319  ASTSQEDASGISLVARSEKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTET  498
            AS S   ASG+         G + LP EM++MKI+DDK        +ME  V+ GNGTET
Sbjct  2    ASVSIAPASGLR-EPNGNTVGVDRLPDEMNDMKIRDDK--------EMEDTVVDGNGTET  52

Query  499  GQIIVTTVGGRNGEQKQVLSYMAERVVGTGSFGVVFQAKCLESGEAVAIKKVLXDRRYXN  678
            G IIVTT+GG+NG+ KQ +SYMAERVVG GSFGVVFQAKCLE+GE VAIKKVL D+RY N
Sbjct  53   GHIIVTTIGGKNGQPKQTISYMAERVVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKN  112

Query  679  RELQIMRMLEHPNVV  723
            RELQ MR+L+HPNVV
Sbjct  113  RELQTMRLLDHPNVV  127



>ref|XP_008246288.1| PREDICTED: shaggy-related protein kinase alpha [Prunus mume]
 ref|XP_008246289.1| PREDICTED: shaggy-related protein kinase alpha [Prunus mume]
 ref|XP_008246290.1| PREDICTED: shaggy-related protein kinase alpha [Prunus mume]
Length=410

 Score =   166 bits (420),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 79/115 (69%), Positives = 95/115 (83%), Gaps = 8/115 (7%)
 Frame = +1

Query  379  GYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTETGQIIVTTVGGRNGEQKQVLS  558
            G ++LP+E+++MKI+DDK        +ME  V+ GNGTETG IIVTT+GGRNG+ KQ +S
Sbjct  21   GVDKLPEELNDMKIRDDK--------EMEATVVDGNGTETGHIIVTTIGGRNGQPKQTIS  72

Query  559  YMAERVVGTGSFGVVFQAKCLESGEAVAIKKVLXDRRYXNRELQIMRMLEHPNVV  723
            YMAERVVG GSFGVVFQAKCLE+GE VAIKKVL D+RY NRELQ MR+L+HPNVV
Sbjct  73   YMAERVVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRLLDHPNVV  127



>ref|XP_011023844.1| PREDICTED: shaggy-related protein kinase alpha [Populus euphratica]
 ref|XP_011023845.1| PREDICTED: shaggy-related protein kinase alpha [Populus euphratica]
Length=409

 Score =   166 bits (420),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 79/116 (68%), Positives = 95/116 (82%), Gaps = 8/116 (7%)
 Frame = +1

Query  376  SGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTETGQIIVTTVGGRNGEQKQVL  555
            +G ++LP+EM++MKI+D+K        DME  V+ GNGTETG IIVTT+GGRNG+ KQ +
Sbjct  20   AGVDKLPEEMNDMKIRDEK--------DMEATVVDGNGTETGHIIVTTIGGRNGQPKQTI  71

Query  556  SYMAERVVGTGSFGVVFQAKCLESGEAVAIKKVLXDRRYXNRELQIMRMLEHPNVV  723
            SYMAERVVG GSFGVVFQAKCLE+ E VAIKKVL D+RY NRELQ MR+L+HPNVV
Sbjct  72   SYMAERVVGNGSFGVVFQAKCLETSETVAIKKVLQDKRYKNRELQTMRLLDHPNVV  127



>ref|XP_011040636.1| PREDICTED: shaggy-related protein kinase alpha-like [Populus 
euphratica]
Length=409

 Score =   166 bits (420),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 84/135 (62%), Positives = 103/135 (76%), Gaps = 9/135 (7%)
 Frame = +1

Query  319  ASTSQEDASGISLVARSEKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTET  498
            AS S   A G+    R+  +G ++LP EM++M+I+DDK        +ME  V+ GNGTET
Sbjct  2    ASVSVVPAPGLRDRNRNS-TGVDKLPDEMNDMRIRDDK--------EMEATVVDGNGTET  52

Query  499  GQIIVTTVGGRNGEQKQVLSYMAERVVGTGSFGVVFQAKCLESGEAVAIKKVLXDRRYXN  678
            G IIVTT+GG+NG+ KQ +SYMAERVVG GSFGVVFQAKCLE+GE VAIKKVL D+RY N
Sbjct  53   GHIIVTTIGGKNGQPKQTISYMAERVVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKN  112

Query  679  RELQIMRMLEHPNVV  723
            RELQ MR+L+HPNVV
Sbjct  113  RELQTMRLLDHPNVV  127



>ref|XP_010270905.1| PREDICTED: shaggy-related protein kinase alpha-like isoform X1 
[Nelumbo nucifera]
Length=434

 Score =   166 bits (421),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 85/137 (62%), Positives = 102/137 (74%), Gaps = 9/137 (7%)
 Frame = +1

Query  313  EAASTSQEDASGISLVARSEKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGT  492
            + AS S   ASG+         G ++LP+EM+ MKI+DDK        +ME  V+ GNGT
Sbjct  25   QMASVSIVPASGVK-EPSGNCVGVDKLPEEMNGMKIRDDK--------EMEATVVDGNGT  75

Query  493  ETGQIIVTTVGGRNGEQKQVLSYMAERVVGTGSFGVVFQAKCLESGEAVAIKKVLXDRRY  672
            ETG IIVTT+GGRNG+ KQ +SYMAERVVG GSFG+VFQAKCLE+GE VAIKKVL D+RY
Sbjct  76   ETGHIIVTTIGGRNGQPKQTISYMAERVVGNGSFGIVFQAKCLETGETVAIKKVLQDKRY  135

Query  673  XNRELQIMRMLEHPNVV  723
             NRELQ MR+L+HPNVV
Sbjct  136  KNRELQTMRLLDHPNVV  152



>ref|XP_002302794.1| Glycogen synthase kinase-3 MsK-3 family protein [Populus trichocarpa]
 gb|EEE82067.1| Glycogen synthase kinase-3 MsK-3 family protein [Populus trichocarpa]
Length=409

 Score =   166 bits (419),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 84/135 (62%), Positives = 102/135 (76%), Gaps = 9/135 (7%)
 Frame = +1

Query  319  ASTSQEDASGISLVARSEKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTET  498
            AS S   ASG+        +G ++LP+EM++MKI DDK        +ME  V+ GNGTET
Sbjct  2    ASVSVVPASGLR-DTLGNTTGVDKLPEEMNDMKISDDK--------EMEAAVVDGNGTET  52

Query  499  GQIIVTTVGGRNGEQKQVLSYMAERVVGTGSFGVVFQAKCLESGEAVAIKKVLXDRRYXN  678
            G IIVTT+GG+NG+ KQ +SYMAERVVG GSFG+VFQAKCLE+GE VAIKKVL D+RY N
Sbjct  53   GHIIVTTIGGKNGQPKQTISYMAERVVGHGSFGLVFQAKCLETGETVAIKKVLQDKRYKN  112

Query  679  RELQIMRMLEHPNVV  723
            RELQ MR+L+HPNVV
Sbjct  113  RELQTMRLLDHPNVV  127



>ref|XP_010251218.1| PREDICTED: shaggy-related protein kinase epsilon-like isoform 
X2 [Nelumbo nucifera]
Length=392

 Score =   165 bits (418),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 78/113 (69%), Positives = 94/113 (83%), Gaps = 8/113 (7%)
 Frame = +1

Query  385  EELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTETGQIIVTTVGGRNGEQKQVLSYM  564
            ++LP+E++EMKI+DDK        +ME  V+ GNGTETG IIVTT+GGRNG+ KQ +SYM
Sbjct  23   DKLPEEINEMKIRDDK--------EMEATVVDGNGTETGHIIVTTIGGRNGQPKQTISYM  74

Query  565  AERVVGTGSFGVVFQAKCLESGEAVAIKKVLXDRRYXNRELQIMRMLEHPNVV  723
            AERVVG GSFG+VFQAKCLE+GE VAIKKVL D+RY NRELQ MR+L+HPNVV
Sbjct  75   AERVVGHGSFGIVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRLLDHPNVV  127



>ref|XP_006446534.1| hypothetical protein CICLE_v10015323mg [Citrus clementina]
 ref|XP_006446536.1| hypothetical protein CICLE_v10015323mg [Citrus clementina]
 gb|ESR59774.1| hypothetical protein CICLE_v10015323mg [Citrus clementina]
 gb|ESR59776.1| hypothetical protein CICLE_v10015323mg [Citrus clementina]
Length=429

 Score =   166 bits (420),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 78/113 (69%), Positives = 96/113 (85%), Gaps = 5/113 (4%)
 Frame = +1

Query  385  EELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTETGQIIVTTVGGRNGEQKQVLSYM  564
            ++LP+E++EMKIKD++ +     K+ME  V+ GNGTETG IIVTT+GGRNG+ KQ +SYM
Sbjct  40   DKLPEEINEMKIKDERVE-----KEMEATVVDGNGTETGHIIVTTIGGRNGQPKQTISYM  94

Query  565  AERVVGTGSFGVVFQAKCLESGEAVAIKKVLXDRRYXNRELQIMRMLEHPNVV  723
            AERVVG GSFG+VFQAKCLE+GE VAIKKVL D+RY NRELQ MR+L+HPNVV
Sbjct  95   AERVVGQGSFGIVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRLLDHPNVV  147



>ref|XP_010097328.1| Shaggy-related protein kinase alpha [Morus notabilis]
 gb|EXB67560.1| Shaggy-related protein kinase alpha [Morus notabilis]
Length=522

 Score =   167 bits (424),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 80/116 (69%), Positives = 96/116 (83%), Gaps = 8/116 (7%)
 Frame = +1

Query  376  SGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTETGQIIVTTVGGRNGEQKQVL  555
            +G ++LP+EM++MKI+DDK        +ME  V+ GNGTETG IIVTT+GGRNG+ KQ +
Sbjct  19   AGVDKLPEEMNDMKIRDDK--------EMEATVVDGNGTETGHIIVTTIGGRNGQPKQTI  70

Query  556  SYMAERVVGTGSFGVVFQAKCLESGEAVAIKKVLXDRRYXNRELQIMRMLEHPNVV  723
            SYMAERVVG GSFGVVFQAKCLE+GE VAIKKVL D+RY NRELQ MR+L+HPNVV
Sbjct  71   SYMAERVVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRLLDHPNVV  126



>ref|XP_007031230.1| Shaggy-related kinase 11, 11 isoform 2 [Theobroma cacao]
 gb|EOY11732.1| Shaggy-related kinase 11, 11 isoform 2 [Theobroma cacao]
Length=409

 Score =   165 bits (418),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 82/125 (66%), Positives = 100/125 (80%), Gaps = 9/125 (7%)
 Frame = +1

Query  352  SLVARSEKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTETGQIIVTTVGGR  531
            S++  S  +G ++LP+EM++MKI+DDK        +ME  V+ GNGTETG IIVTT+GGR
Sbjct  10   SVLRESNAAGVDKLPEEMNDMKIRDDK--------EMEATVVDGNGTETGHIIVTTIGGR  61

Query  532  NGEQKQ-VLSYMAERVVGTGSFGVVFQAKCLESGEAVAIKKVLXDRRYXNRELQIMRMLE  708
            NG+ KQ  +SYMAERVVG GSFGVVFQAKCLE+GE VAIKKVL D+RY NRELQ MR+L+
Sbjct  62   NGQPKQQTISYMAERVVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRLLD  121

Query  709  HPNVV  723
            HPNVV
Sbjct  122  HPNVV  126



>ref|XP_010251217.1| PREDICTED: shaggy-related protein kinase epsilon-like isoform 
X1 [Nelumbo nucifera]
Length=409

 Score =   165 bits (418),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 78/113 (69%), Positives = 94/113 (83%), Gaps = 8/113 (7%)
 Frame = +1

Query  385  EELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTETGQIIVTTVGGRNGEQKQVLSYM  564
            ++LP+E++EMKI+DDK        +ME  V+ GNGTETG IIVTT+GGRNG+ KQ +SYM
Sbjct  23   DKLPEEINEMKIRDDK--------EMEATVVDGNGTETGHIIVTTIGGRNGQPKQTISYM  74

Query  565  AERVVGTGSFGVVFQAKCLESGEAVAIKKVLXDRRYXNRELQIMRMLEHPNVV  723
            AERVVG GSFG+VFQAKCLE+GE VAIKKVL D+RY NRELQ MR+L+HPNVV
Sbjct  75   AERVVGHGSFGIVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRLLDHPNVV  127



>gb|EYU38392.1| hypothetical protein MIMGU_mgv1a007572mg [Erythranthe guttata]
Length=403

 Score =   165 bits (417),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 79/118 (67%), Positives = 95/118 (81%), Gaps = 8/118 (7%)
 Frame = +1

Query  370  EKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTETGQIIVTTVGGRNGEQKQ  549
            E  G + LP+EM++MKI+DDK        +ME  V+ GNGTETG IIVTT+GGR+G+ KQ
Sbjct  12   EAVGVDRLPEEMNDMKIRDDK--------EMEATVVDGNGTETGHIIVTTIGGRSGQPKQ  63

Query  550  VLSYMAERVVGTGSFGVVFQAKCLESGEAVAIKKVLXDRRYXNRELQIMRMLEHPNVV  723
             +SYMAER+VG GSFGVVFQAKCLE+GE VAIKKVL D+RY NRELQ MR+L+HPNVV
Sbjct  64   TISYMAERIVGQGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRLLDHPNVV  121



>ref|XP_004252662.1| PREDICTED: shaggy-related protein kinase epsilon isoform X2 [Solanum 
lycopersicum]
 ref|XP_010314527.1| PREDICTED: shaggy-related protein kinase epsilon isoform X2 [Solanum 
lycopersicum]
Length=392

 Score =   165 bits (417),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 77/113 (68%), Positives = 96/113 (85%), Gaps = 5/113 (4%)
 Frame = +1

Query  385  EELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTETGQIIVTTVGGRNGEQKQVLSYM  564
            ++LP+E++EMKI+DDK++     K+ME  V+ GNGTE G IIVTT+GG+NGE KQ +SYM
Sbjct  4    DKLPEEINEMKIRDDKAE-----KEMEAAVVDGNGTEKGHIIVTTIGGKNGEPKQTISYM  58

Query  565  AERVVGTGSFGVVFQAKCLESGEAVAIKKVLXDRRYXNRELQIMRMLEHPNVV  723
            AERVVG GSFG+VFQAKCLE+GE VAIKKVL D+RY NRELQ +R+L+HPNVV
Sbjct  59   AERVVGQGSFGIVFQAKCLETGETVAIKKVLQDKRYKNRELQTIRLLDHPNVV  111



>ref|XP_006364003.1| PREDICTED: shaggy-related protein kinase epsilon-like isoform 
X1 [Solanum tuberosum]
 ref|XP_006364004.1| PREDICTED: shaggy-related protein kinase epsilon-like isoform 
X2 [Solanum tuberosum]
Length=410

 Score =   165 bits (417),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 77/113 (68%), Positives = 96/113 (85%), Gaps = 5/113 (4%)
 Frame = +1

Query  385  EELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTETGQIIVTTVGGRNGEQKQVLSYM  564
            ++LP+E++EMKI+DDK++     K+ME  V+ GNGTE G IIVTT+GG+NGE KQ +SYM
Sbjct  22   DKLPEEINEMKIRDDKAE-----KEMEAAVVDGNGTEKGHIIVTTIGGKNGEPKQTISYM  76

Query  565  AERVVGTGSFGVVFQAKCLESGEAVAIKKVLXDRRYXNRELQIMRMLEHPNVV  723
            AERVVG GSFG+VFQAKCLE+GE VAIKKVL D+RY NRELQ +R+L+HPNVV
Sbjct  77   AERVVGQGSFGIVFQAKCLETGETVAIKKVLQDKRYKNRELQTIRLLDHPNVV  129



>gb|EYU34726.1| hypothetical protein MIMGU_mgv1a007335mg [Erythranthe guttata]
Length=407

 Score =   165 bits (417),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 77/112 (69%), Positives = 95/112 (85%), Gaps = 5/112 (4%)
 Frame = +1

Query  388  ELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTETGQIIVTTVGGRNGEQKQVLSYMA  567
            +LP+E++EMKIKD+K +     K+ME  V+ GNGTETG IIVTT+GG+NG+ KQ +SYMA
Sbjct  20   KLPEEINEMKIKDEKVE-----KEMEAAVVDGNGTETGHIIVTTIGGKNGQPKQTISYMA  74

Query  568  ERVVGTGSFGVVFQAKCLESGEAVAIKKVLXDRRYXNRELQIMRMLEHPNVV  723
            ER+VG GSFG+VFQAKCLE+GE VAIKKVL D+RY NRELQ MR+L+HPNVV
Sbjct  75   ERIVGQGSFGIVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRLLDHPNVV  126



>ref|XP_004252661.1| PREDICTED: shaggy-related protein kinase epsilon isoform X1 [Solanum 
lycopersicum]
Length=410

 Score =   165 bits (417),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 77/113 (68%), Positives = 96/113 (85%), Gaps = 5/113 (4%)
 Frame = +1

Query  385  EELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTETGQIIVTTVGGRNGEQKQVLSYM  564
            ++LP+E++EMKI+DDK++     K+ME  V+ GNGTE G IIVTT+GG+NGE KQ +SYM
Sbjct  22   DKLPEEINEMKIRDDKAE-----KEMEAAVVDGNGTEKGHIIVTTIGGKNGEPKQTISYM  76

Query  565  AERVVGTGSFGVVFQAKCLESGEAVAIKKVLXDRRYXNRELQIMRMLEHPNVV  723
            AERVVG GSFG+VFQAKCLE+GE VAIKKVL D+RY NRELQ +R+L+HPNVV
Sbjct  77   AERVVGQGSFGIVFQAKCLETGETVAIKKVLQDKRYKNRELQTIRLLDHPNVV  129



>ref|XP_008381452.1| PREDICTED: glycogen synthase kinase-3 homolog MsK-3 [Malus domestica]
Length=409

 Score =   165 bits (417),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 82/135 (61%), Positives = 100/135 (74%), Gaps = 9/135 (7%)
 Frame = +1

Query  319  ASTSQEDASGISLVARSEKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTET  498
            AS S   ASG+        +G + LP EM++MKI+DDK        +ME  V+ GNGTE 
Sbjct  2    ASVSVVPASGLR-EPXGNAAGVDNLPNEMNDMKIRDDK--------EMEATVVNGNGTEA  52

Query  499  GQIIVTTVGGRNGEQKQVLSYMAERVVGTGSFGVVFQAKCLESGEAVAIKKVLXDRRYXN  678
            G IIVTT+GG+NG+ KQ +SYMAERVVG GSFG+VFQAKCLE+GE VAIKKVL D+RY N
Sbjct  53   GHIIVTTIGGKNGQPKQTISYMAERVVGHGSFGLVFQAKCLETGETVAIKKVLQDKRYKN  112

Query  679  RELQIMRMLEHPNVV  723
            RELQ MR+L+HPN+V
Sbjct  113  RELQTMRLLDHPNIV  127



>emb|CDP15204.1| unnamed protein product [Coffea canephora]
Length=409

 Score =   165 bits (417),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 78/115 (68%), Positives = 94/115 (82%), Gaps = 8/115 (7%)
 Frame = +1

Query  379  GYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTETGQIIVTTVGGRNGEQKQVLS  558
            G + LP+EM++MKI+DDK        ++E  ++ GNGTETG IIVTT+GGRNG+ KQ +S
Sbjct  21   GVDRLPEEMNDMKIRDDK--------EVEATIVDGNGTETGHIIVTTIGGRNGQPKQTIS  72

Query  559  YMAERVVGTGSFGVVFQAKCLESGEAVAIKKVLXDRRYXNRELQIMRMLEHPNVV  723
            YMAERVVG GSFGVVFQAKCLE+GE VAIKKVL D+RY NRELQ MR+L+HPNVV
Sbjct  73   YMAERVVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRLLDHPNVV  127



>ref|XP_008230580.1| PREDICTED: shaggy-related protein kinase epsilon [Prunus mume]
Length=409

 Score =   164 bits (416),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 78/113 (69%), Positives = 94/113 (83%), Gaps = 8/113 (7%)
 Frame = +1

Query  385  EELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTETGQIIVTTVGGRNGEQKQVLSYM  564
            ++LP+E++EMKIKD+K        +ME  V+ GNGTETG IIVTT+GGRNG+ KQ +SYM
Sbjct  23   DKLPEEINEMKIKDEK--------EMETAVVNGNGTETGHIIVTTIGGRNGQPKQTISYM  74

Query  565  AERVVGTGSFGVVFQAKCLESGEAVAIKKVLXDRRYXNRELQIMRMLEHPNVV  723
            AERVVG GSFG+VFQAKCLE+GE VAIKKVL D+RY NRELQ MR+L+HPNVV
Sbjct  75   AERVVGQGSFGIVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRLLDHPNVV  127



>ref|XP_007215466.1| hypothetical protein PRUPE_ppa006497mg [Prunus persica]
 gb|EMJ16665.1| hypothetical protein PRUPE_ppa006497mg [Prunus persica]
Length=409

 Score =   164 bits (416),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 78/113 (69%), Positives = 94/113 (83%), Gaps = 8/113 (7%)
 Frame = +1

Query  385  EELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTETGQIIVTTVGGRNGEQKQVLSYM  564
            ++LP+E++EMKIKD+K        +ME  V+ GNGTETG IIVTT+GGRNG+ KQ +SYM
Sbjct  23   DKLPEEINEMKIKDEK--------EMETAVVNGNGTETGHIIVTTIGGRNGQPKQTISYM  74

Query  565  AERVVGTGSFGVVFQAKCLESGEAVAIKKVLXDRRYXNRELQIMRMLEHPNVV  723
            AERVVG GSFG+VFQAKCLE+GE VAIKKVL D+RY NRELQ MR+L+HPNVV
Sbjct  75   AERVVGQGSFGIVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRLLDHPNVV  127



>ref|XP_008795404.1| PREDICTED: shaggy-related protein kinase theta-like isoform X1 
[Phoenix dactylifera]
Length=381

 Score =   164 bits (414),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 77/107 (72%), Positives = 91/107 (85%), Gaps = 1/107 (1%)
 Frame = +1

Query  403  MHEMKIKDDKSDNQNNLKDMEPVVITGNGTETGQIIVTTVGGRNGEQKQVLSYMAERVVG  582
            MHEM I+DDK + +N  KD E  ++ GNGTETGQII TT+GGR+G+ KQ +SYMAERVVG
Sbjct  1    MHEMTIRDDKVEGRNE-KDTEGTMVNGNGTETGQIIATTIGGRHGQPKQTISYMAERVVG  59

Query  583  TGSFGVVFQAKCLESGEAVAIKKVLXDRRYXNRELQIMRMLEHPNVV  723
            TGSFGVVFQAKC+E+GE VAIKKVL D+RY NRELQIM +L+HPNVV
Sbjct  60   TGSFGVVFQAKCVETGETVAIKKVLQDKRYKNRELQIMHLLDHPNVV  106



>emb|CAN64359.1| hypothetical protein VITISV_041427 [Vitis vinifera]
Length=442

 Score =   165 bits (417),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 77/113 (68%), Positives = 94/113 (83%), Gaps = 8/113 (7%)
 Frame = +1

Query  385  EELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTETGQIIVTTVGGRNGEQKQVLSYM  564
            ++LP+E++EMKI+DDK        +ME  V+ GNGTETG IIVTT+GGRNG+ KQ +SYM
Sbjct  23   DKLPEEINEMKIRDDK--------EMEATVVDGNGTETGHIIVTTIGGRNGQPKQTISYM  74

Query  565  AERVVGTGSFGVVFQAKCLESGEAVAIKKVLXDRRYXNRELQIMRMLEHPNVV  723
            AERVVG GSFG+VFQAKCLE+GE VAIKKVL D+RY NRELQ MR+L+HPN+V
Sbjct  75   AERVVGQGSFGIVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRLLDHPNIV  127



>ref|XP_003555781.1| PREDICTED: glycogen synthase kinase-3 homolog MsK-1-like isoform 
X1 [Glycine max]
 ref|XP_006605787.1| PREDICTED: glycogen synthase kinase-3 homolog MsK-1-like isoform 
X2 [Glycine max]
 ref|XP_006605788.1| PREDICTED: glycogen synthase kinase-3 homolog MsK-1-like isoform 
X3 [Glycine max]
 ref|XP_006605789.1| PREDICTED: glycogen synthase kinase-3 homolog MsK-1-like isoform 
X4 [Glycine max]
Length=426

 Score =   164 bits (416),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 78/113 (69%), Positives = 93/113 (82%), Gaps = 8/113 (7%)
 Frame = +1

Query  385  EELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTETGQIIVTTVGGRNGEQKQVLSYM  564
            + LP+EM++MKI+DD+        +ME  V+ GNGTETG IIVTT+GGRNG+ KQ +SYM
Sbjct  40   DRLPEEMNDMKIRDDR--------EMEATVVDGNGTETGHIIVTTIGGRNGQPKQTISYM  91

Query  565  AERVVGTGSFGVVFQAKCLESGEAVAIKKVLXDRRYXNRELQIMRMLEHPNVV  723
            AERVVG GSFGVVFQAKCLE+GE VAIKKVL D+RY NRELQ MR+L+HPNVV
Sbjct  92   AERVVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRLLDHPNVV  144



>emb|CDY27737.1| BnaA05g31460D [Brassica napus]
Length=514

 Score =   166 bits (419),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 84/146 (58%), Positives = 105/146 (72%), Gaps = 9/146 (6%)
 Frame = +1

Query  289  IC-TTAPMHEAASTSQEDASGISLVARSEKSGYEELPKEMHEMKIKDDKSDNQNNLKDME  465
            IC T + + E A+   E ++ +     +  +  + LP+EM+ MKI+DDK        +ME
Sbjct  94   ICFTNSSVPEMATMGVEPSAAVRDSTANAATDVDRLPEEMNHMKIQDDK--------EME  145

Query  466  PVVITGNGTETGQIIVTTVGGRNGEQKQVLSYMAERVVGTGSFGVVFQAKCLESGEAVAI  645
              ++ GN TETG IIVTT+GGRNG+ KQ +SYMAERVVG GSFGVVFQAKCLE+GE VAI
Sbjct  146  ATIVNGNVTETGHIIVTTIGGRNGQPKQTISYMAERVVGHGSFGVVFQAKCLETGETVAI  205

Query  646  KKVLXDRRYXNRELQIMRMLEHPNVV  723
            KKVL DRRY NRELQ MR+L+HPNVV
Sbjct  206  KKVLQDRRYKNRELQTMRLLDHPNVV  231



>ref|XP_009759533.1| PREDICTED: shaggy-related protein kinase epsilon [Nicotiana sylvestris]
Length=410

 Score =   164 bits (414),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 77/113 (68%), Positives = 95/113 (84%), Gaps = 5/113 (4%)
 Frame = +1

Query  385  EELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTETGQIIVTTVGGRNGEQKQVLSYM  564
            ++LP+E++EMKI+DDK +     K+ME  V+ GNGTE G IIVTT+GG+NGE KQ +SYM
Sbjct  22   DKLPEEINEMKIRDDKVE-----KEMEAAVVDGNGTEKGHIIVTTIGGKNGEPKQTISYM  76

Query  565  AERVVGTGSFGVVFQAKCLESGEAVAIKKVLXDRRYXNRELQIMRMLEHPNVV  723
            AERVVG GSFG+VFQAKCLE+GE VAIKKVL D+RY NRELQ +R+L+HPNVV
Sbjct  77   AERVVGQGSFGIVFQAKCLETGETVAIKKVLQDKRYKNRELQTIRLLDHPNVV  129



>ref|XP_002873682.1| kinase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH49941.1| kinase family protein [Arabidopsis lyrata subsp. lyrata]
Length=410

 Score =   164 bits (414),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 81/135 (60%), Positives = 100/135 (74%), Gaps = 8/135 (6%)
 Frame = +1

Query  319  ASTSQEDASGISLVARSEKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTET  498
            AS     AS ++    +     E+LP+ ++EMKIKDDK        +ME  V+ GNGTET
Sbjct  2    ASVGTLPASSVATKQSNASICAEKLPEGINEMKIKDDK--------EMEAAVVDGNGTET  53

Query  499  GQIIVTTVGGRNGEQKQVLSYMAERVVGTGSFGVVFQAKCLESGEAVAIKKVLXDRRYXN  678
            G IIVTT+GG+NG+ KQ +SYMAER+VG GSFG+VFQAKCLE+GE VAIKKVL D+RY N
Sbjct  54   GHIIVTTIGGKNGQPKQTISYMAERIVGQGSFGIVFQAKCLETGETVAIKKVLQDKRYKN  113

Query  679  RELQIMRMLEHPNVV  723
            RELQ MR+L+HPNVV
Sbjct  114  RELQTMRLLDHPNVV  128



Lambda      K        H        a         alpha
   0.311    0.128    0.351    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1337034311616