BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig13170

Length=682
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|KDO84745.1|  hypothetical protein CISIN_1g0038682mg                  202   1e-60   Citrus sinensis [apfelsine]
ref|XP_006473595.1|  PREDICTED: pentatricopeptide repeat-containi...    213   3e-60   Citrus sinensis [apfelsine]
ref|XP_009608057.1|  PREDICTED: pentatricopeptide repeat-containi...    210   2e-59   Nicotiana tomentosiformis
ref|XP_012065865.1|  PREDICTED: pentatricopeptide repeat-containi...    210   3e-59   Jatropha curcas
ref|XP_006342194.1|  PREDICTED: pentatricopeptide repeat-containi...    210   4e-59   Solanum tuberosum [potatoes]
ref|XP_004238467.1|  PREDICTED: pentatricopeptide repeat-containi...    208   2e-58   
ref|XP_009777873.1|  PREDICTED: pentatricopeptide repeat-containi...    208   2e-58   Nicotiana sylvestris
ref|XP_006435103.1|  hypothetical protein CICLE_v10000322mg             204   3e-57   Citrus clementina [clementine]
emb|CDP19381.1|  unnamed protein product                                202   2e-56   Coffea canephora [robusta coffee]
ref|XP_002302000.2|  pentatricopeptide repeat-containing family p...    200   8e-56   
ref|XP_010061020.1|  PREDICTED: pentatricopeptide repeat-containi...    199   1e-55   
ref|XP_011028950.1|  PREDICTED: pentatricopeptide repeat-containi...    199   2e-55   Populus euphratica
ref|XP_010271478.1|  PREDICTED: pentatricopeptide repeat-containi...    197   1e-54   Nelumbo nucifera [Indian lotus]
ref|XP_002280360.1|  PREDICTED: pentatricopeptide repeat-containi...    196   2e-54   Vitis vinifera
ref|XP_008343247.1|  PREDICTED: pentatricopeptide repeat-containi...    196   2e-54   
ref|XP_011099914.1|  PREDICTED: pentatricopeptide repeat-containi...    196   2e-54   Sesamum indicum [beniseed]
emb|CBI19832.3|  unnamed protein product                                191   2e-53   Vitis vinifera
ref|XP_008444805.1|  PREDICTED: pentatricopeptide repeat-containi...    193   3e-53   
ref|XP_008228974.1|  PREDICTED: pentatricopeptide repeat-containi...    191   3e-52   
ref|XP_004152765.1|  PREDICTED: pentatricopeptide repeat-containi...    190   4e-52   Cucumis sativus [cucumbers]
gb|KGN62652.1|  hypothetical protein Csa_2G365100                       190   4e-52   Cucumis sativus [cucumbers]
ref|XP_009109879.1|  PREDICTED: pentatricopeptide repeat-containi...    188   2e-51   
ref|XP_002521664.1|  pentatricopeptide repeat-containing protein,...    186   2e-51   
ref|XP_008444772.1|  PREDICTED: pentatricopeptide repeat-containi...    187   2e-51   Cucumis melo [Oriental melon]
ref|XP_010093155.1|  hypothetical protein L484_005164                   187   2e-51   
ref|XP_004152758.1|  PREDICTED: pentatricopeptide repeat-containi...    187   3e-51   Cucumis sativus [cucumbers]
ref|XP_007034693.1|  Pentatricopeptide repeat (PPR) superfamily p...    187   4e-51   Theobroma cacao [chocolate]
emb|CDY24406.1|  BnaCnng04730D                                          185   1e-50   Brassica napus [oilseed rape]
ref|XP_006415862.1|  hypothetical protein EUTSA_v10006846mg             183   8e-50   Eutrema salsugineum [saltwater cress]
ref|XP_006306802.1|  hypothetical protein CARUB_v10008344mg             183   1e-49   Capsella rubella
ref|XP_010477942.1|  PREDICTED: pentatricopeptide repeat-containi...    181   5e-49   Camelina sativa [gold-of-pleasure]
ref|XP_002893429.1|  pentatricopeptide repeat-containing protein        181   6e-49   Arabidopsis lyrata subsp. lyrata
gb|KFK44540.1|  hypothetical protein AALP_AA1G270100                    181   8e-49   Arabis alpina [alpine rockcress]
ref|NP_173907.1|  pentatricopeptide repeat-containing protein           180   1e-48   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010499119.1|  PREDICTED: pentatricopeptide repeat-containi...    178   6e-48   Camelina sativa [gold-of-pleasure]
emb|CDY36110.1|  BnaA08g19380D                                          175   1e-47   Brassica napus [oilseed rape]
ref|XP_008228975.1|  PREDICTED: pentatricopeptide repeat-containi...    177   3e-47   
gb|KCW67919.1|  hypothetical protein EUGRSUZ_F01621                     176   3e-47   Eucalyptus grandis [rose gum]
ref|XP_010549219.1|  PREDICTED: pentatricopeptide repeat-containi...    175   1e-46   Tarenaya hassleriana [spider flower]
gb|EPS72239.1|  hypothetical protein M569_02517                         174   2e-46   Genlisea aurea
ref|XP_009378934.1|  PREDICTED: pentatricopeptide repeat-containi...    170   4e-45   
ref|XP_003590744.1|  Pentatricopeptide repeat-containing protein        170   6e-45   Medicago truncatula
ref|XP_004495263.1|  PREDICTED: pentatricopeptide repeat-containi...    169   7e-45   Cicer arietinum [garbanzo]
ref|XP_010672235.1|  PREDICTED: pentatricopeptide repeat-containi...    167   9e-44   
ref|XP_004301492.2|  PREDICTED: pentatricopeptide repeat-containi...    164   4e-43   Fragaria vesca subsp. vesca
gb|KJB26847.1|  hypothetical protein B456_004G262700                    163   1e-42   Gossypium raimondii
ref|XP_003535453.2|  PREDICTED: pentatricopeptide repeat-containi...    161   6e-42   Glycine max [soybeans]
ref|XP_007144135.1|  hypothetical protein PHAVU_007G131600g             160   3e-41   Phaseolus vulgaris [French bean]
ref|XP_010942837.1|  PREDICTED: pentatricopeptide repeat-containi...    134   4e-32   Elaeis guineensis
ref|XP_008787226.1|  PREDICTED: pentatricopeptide repeat-containi...    129   3e-30   Phoenix dactylifera
ref|XP_009394346.1|  PREDICTED: pentatricopeptide repeat-containi...    127   9e-30   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008805705.1|  PREDICTED: pentatricopeptide repeat-containi...    122   7e-28   Phoenix dactylifera
ref|XP_010938946.1|  PREDICTED: pentatricopeptide repeat-containi...    120   3e-27   Elaeis guineensis
gb|KFK44541.1|  hypothetical protein AALP_AA1G270100                    119   7e-27   Arabis alpina [alpine rockcress]
ref|XP_006841418.1|  PREDICTED: pentatricopeptide repeat-containi...    108   2e-23   Amborella trichopoda
gb|ERN03238.1|  hypothetical protein AMTR_s00003p00182540             96.7    3e-19   Amborella trichopoda
ref|XP_011622368.1|  PREDICTED: LOW QUALITY PROTEIN: pentatricope...  97.1    3e-19   
ref|XP_008783105.1|  PREDICTED: pentatricopeptide repeat-containi...  95.5    1e-18   Phoenix dactylifera
ref|XP_010929076.1|  PREDICTED: pentatricopeptide repeat-containi...  95.1    2e-18   Elaeis guineensis
ref|XP_011622555.1|  PREDICTED: putative pentatricopeptide repeat...  92.0    8e-18   
ref|XP_006878551.1|  PREDICTED: pentatricopeptide repeat-containi...  88.6    1e-16   Amborella trichopoda
ref|XP_009113933.1|  PREDICTED: pentatricopeptide repeat-containi...  87.4    4e-16   
ref|XP_007139372.1|  hypothetical protein PHAVU_008G023900g           86.3    1e-15   Phaseolus vulgaris [French bean]
gb|EYU37931.1|  hypothetical protein MIMGU_mgv1a003299mg              85.9    1e-15   Erythranthe guttata [common monkey flower]
ref|XP_012080484.1|  PREDICTED: putative pentatricopeptide repeat...  85.9    2e-15   Jatropha curcas
gb|KDO57645.1|  hypothetical protein CISIN_1g042265mg                 84.7    2e-15   Citrus sinensis [apfelsine]
emb|CDY13116.1|  BnaA09g17010D                                        85.1    2e-15   Brassica napus [oilseed rape]
ref|XP_006485061.1|  PREDICTED: pentatricopeptide repeat-containi...  84.3    3e-15   Citrus sinensis [apfelsine]
ref|XP_010100885.1|  hypothetical protein L484_009655                 85.1    3e-15   Morus notabilis
ref|XP_002533488.1|  pentatricopeptide repeat-containing protein,...  85.1    4e-15   
emb|CDP01970.1|  unnamed protein product                              84.3    4e-15   Coffea canephora [robusta coffee]
ref|XP_011009234.1|  PREDICTED: putative pentatricopeptide repeat...  84.3    5e-15   Populus euphratica
ref|XP_010651252.1|  PREDICTED: pentatricopeptide repeat-containi...  84.0    5e-15   
ref|XP_010245110.1|  PREDICTED: pentatricopeptide repeat-containi...  83.6    5e-15   
gb|EYU39396.1|  hypothetical protein MIMGU_mgv1a026743mg              84.0    5e-15   Erythranthe guttata [common monkey flower]
ref|XP_008244547.1|  PREDICTED: pentatricopeptide repeat-containi...  84.3    6e-15   
emb|CBI16904.3|  unnamed protein product                              84.0    8e-15   Vitis vinifera
ref|XP_002278668.2|  PREDICTED: pentatricopeptide repeat-containi...  84.0    8e-15   Vitis vinifera
ref|XP_002878586.1|  pentatricopeptide repeat-containing protein      83.6    1e-14   
ref|XP_006847449.2|  PREDICTED: pentatricopeptide repeat-containi...  79.7    1e-14   Amborella trichopoda
ref|XP_002528283.1|  pentatricopeptide repeat-containing protein,...  82.8    1e-14   
ref|XP_011624784.1|  PREDICTED: pentatricopeptide repeat-containi...  82.8    1e-14   
ref|XP_006451257.1|  hypothetical protein CICLE_v10010361mg           82.8    1e-14   Citrus clementina [clementine]
ref|NP_179798.1|  pentatricopeptide repeat-containing protein         82.8    2e-14   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002522543.1|  pentatricopeptide repeat-containing protein,...  82.0    2e-14   
ref|XP_010943703.1|  PREDICTED: pentatricopeptide repeat-containi...  82.0    2e-14   
ref|XP_004242544.1|  PREDICTED: pentatricopeptide repeat-containi...  82.4    2e-14   Solanum lycopersicum
ref|XP_006406355.1|  hypothetical protein EUTSA_v10020511mg           81.6    2e-14   Eutrema salsugineum [saltwater cress]
ref|XP_010257871.1|  PREDICTED: LOW QUALITY PROTEIN: pentatricope...  82.4    2e-14   
ref|XP_011629250.1|  PREDICTED: pentatricopeptide repeat-containi...  81.3    3e-14   
ref|XP_003551787.1|  PREDICTED: pentatricopeptide repeat-containi...  82.0    3e-14   Glycine max [soybeans]
gb|KDP20411.1|  hypothetical protein JCGZ_06370                       80.9    3e-14   Jatropha curcas
ref|XP_010519672.1|  PREDICTED: putative pentatricopeptide repeat...  81.6    3e-14   Tarenaya hassleriana [spider flower]
ref|XP_010463633.1|  PREDICTED: pentatricopeptide repeat-containi...  82.0    3e-14   Camelina sativa [gold-of-pleasure]
ref|XP_007013068.1|  Tetratricopeptide repeat-like superfamily pr...  81.6    3e-14   
emb|CDY34720.1|  BnaA01g33050D                                        82.0    3e-14   Brassica napus [oilseed rape]
gb|KDO66510.1|  hypothetical protein CISIN_1g005454mg                 81.6    3e-14   Citrus sinensis [apfelsine]
ref|XP_009117919.1|  PREDICTED: pentatricopeptide repeat-containi...  82.0    3e-14   Brassica rapa
ref|XP_002314911.1|  pentatricopeptide repeat-containing family p...  81.6    4e-14   Populus trichocarpa [western balsam poplar]
ref|XP_006299596.1|  hypothetical protein CARUB_v10015774mg           82.0    4e-14   
ref|XP_003530462.1|  PREDICTED: pentatricopeptide repeat-containi...  81.6    4e-14   Glycine max [soybeans]
ref|XP_010091655.1|  hypothetical protein L484_026509                 81.6    4e-14   Morus notabilis
ref|XP_007217021.1|  hypothetical protein PRUPE_ppa001933mg           81.3    5e-14   
emb|CDY36989.1|  BnaC09g18050D                                        81.3    5e-14   Brassica napus [oilseed rape]
ref|XP_006430993.1|  hypothetical protein CICLE_v10011041mg           81.3    5e-14   Citrus clementina [clementine]
ref|XP_011628220.1|  PREDICTED: pentatricopeptide repeat-containi...  80.9    5e-14   Amborella trichopoda
emb|CDP13155.1|  unnamed protein product                              80.9    5e-14   Coffea canephora [robusta coffee]
ref|XP_007131688.1|  hypothetical protein PHAVU_011G033500g           80.5    6e-14   Phaseolus vulgaris [French bean]
ref|XP_002530515.1|  pentatricopeptide repeat-containing protein,...  79.3    6e-14   
ref|XP_009625829.1|  PREDICTED: pentatricopeptide repeat-containi...  81.3    6e-14   Nicotiana tomentosiformis
ref|XP_004289114.1|  PREDICTED: pentatricopeptide repeat-containi...  80.9    6e-14   Fragaria vesca subsp. vesca
ref|XP_010252400.1|  PREDICTED: pentatricopeptide repeat-containi...  80.9    7e-14   Nelumbo nucifera [Indian lotus]
ref|XP_010109916.1|  hypothetical protein L484_013254                 80.5    7e-14   
ref|XP_012092576.1|  PREDICTED: pentatricopeptide repeat-containi...  80.5    7e-14   Jatropha curcas
gb|AAG12601.1|AC068900_7  hypothetical protein; 7123-4412             80.9    7e-14   Arabidopsis thaliana [mouse-ear cress]
ref|NP_186882.2|  pentatricopeptide repeat-containing protein         80.9    7e-14   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010255496.1|  PREDICTED: pentatricopeptide repeat-containi...  80.9    7e-14   Nelumbo nucifera [Indian lotus]
ref|XP_010690409.1|  PREDICTED: pentatricopeptide repeat-containi...  80.5    7e-14   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007046822.1|  Pentatricopeptide repeat (PPR) superfamily p...  80.5    8e-14   
ref|XP_002267303.1|  PREDICTED: pentatricopeptide repeat-containi...  80.1    8e-14   Vitis vinifera
ref|XP_004309485.2|  PREDICTED: pentatricopeptide repeat-containi...  80.1    9e-14   Fragaria vesca subsp. vesca
ref|XP_008221533.1|  PREDICTED: pentatricopeptide repeat-containi...  80.1    9e-14   Prunus mume [ume]
ref|XP_011028231.1|  PREDICTED: pentatricopeptide repeat-containi...  80.1    9e-14   Populus euphratica
ref|XP_011623321.1|  PREDICTED: pentatricopeptide repeat-containi...  80.5    9e-14   Amborella trichopoda
ref|XP_010940859.1|  PREDICTED: pentatricopeptide repeat-containi...  79.7    9e-14   Elaeis guineensis
ref|XP_010472662.1|  PREDICTED: LOW QUALITY PROTEIN: pentatricope...  80.5    9e-14   
ref|XP_008777202.1|  PREDICTED: pentatricopeptide repeat-containi...  79.7    9e-14   Phoenix dactylifera
gb|KHN05415.1|  Pentatricopeptide repeat-containing protein           80.1    1e-13   Glycine soja [wild soybean]
emb|CDY36792.1|  BnaA03g10940D                                        79.7    1e-13   Brassica napus [oilseed rape]
ref|XP_004303223.1|  PREDICTED: pentatricopeptide repeat-containi...  80.5    1e-13   Fragaria vesca subsp. vesca
ref|XP_010905347.1|  PREDICTED: pentatricopeptide repeat-containi...  77.4    1e-13   
ref|XP_006591553.1|  PREDICTED: pentatricopeptide repeat-containi...  79.7    1e-13   
ref|XP_002523296.1|  pentatricopeptide repeat-containing protein,...  78.2    1e-13   
ref|XP_004233728.1|  PREDICTED: pentatricopeptide repeat-containi...  79.7    1e-13   Solanum lycopersicum
gb|KHN06390.1|  Pentatricopeptide repeat-containing protein           79.7    1e-13   Glycine soja [wild soybean]
gb|AEP33771.1|  organelle transcript processing 82                    79.7    1e-13   Thlaspi arvense
ref|XP_006451021.1|  hypothetical protein CICLE_v10007671mg           79.7    1e-13   Citrus clementina [clementine]
emb|CBI30660.3|  unnamed protein product                              79.7    1e-13   Vitis vinifera
gb|KDO80373.1|  hypothetical protein CISIN_1g007077mg                 79.7    1e-13   Citrus sinensis [apfelsine]
ref|XP_006475772.1|  PREDICTED: pentatricopeptide repeat-containi...  79.7    1e-13   Citrus sinensis [apfelsine]
ref|XP_009132312.1|  PREDICTED: pentatricopeptide repeat-containi...  79.3    1e-13   Brassica rapa
ref|XP_002520145.1|  pentatricopeptide repeat-containing protein,...  77.8    1e-13   
ref|XP_011028230.1|  PREDICTED: pentatricopeptide repeat-containi...  79.7    1e-13   Populus euphratica
ref|XP_003524199.1|  PREDICTED: pentatricopeptide repeat-containi...  79.7    1e-13   Glycine max [soybeans]
ref|XP_007222375.1|  hypothetical protein PRUPE_ppa004015mg           79.3    1e-13   Prunus persica
emb|CAN75464.1|  hypothetical protein VITISV_006518                   79.0    2e-13   Vitis vinifera
gb|ERN12377.1|  hypothetical protein AMTR_s00025p00107100             75.9    2e-13   Amborella trichopoda
ref|XP_009352955.1|  PREDICTED: pentatricopeptide repeat-containi...  79.0    2e-13   Pyrus x bretschneideri [bai li]
gb|KDO72337.1|  hypothetical protein CISIN_1g002718mg                 79.7    2e-13   Citrus sinensis [apfelsine]
ref|XP_006482464.1|  PREDICTED: pentatricopeptide repeat-containi...  79.7    2e-13   Citrus sinensis [apfelsine]
gb|KJB80450.1|  hypothetical protein B456_013G098500                  79.3    2e-13   Gossypium raimondii
ref|XP_011088576.1|  PREDICTED: pentatricopeptide repeat-containi...  79.0    2e-13   Sesamum indicum [beniseed]
ref|XP_010524431.1|  PREDICTED: pentatricopeptide repeat-containi...  79.0    2e-13   Tarenaya hassleriana [spider flower]
ref|XP_009395862.1|  PREDICTED: pentatricopeptide repeat-containi...  79.3    2e-13   
ref|XP_006366808.1|  PREDICTED: pentatricopeptide repeat-containi...  79.3    2e-13   Solanum tuberosum [potatoes]
ref|XP_009624583.1|  PREDICTED: pentatricopeptide repeat-containi...  79.0    2e-13   Nicotiana tomentosiformis
ref|XP_010689314.1|  PREDICTED: pentatricopeptide repeat-containi...  79.0    2e-13   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008804906.1|  PREDICTED: pentatricopeptide repeat-containi...  78.6    2e-13   
ref|XP_010257435.1|  PREDICTED: pentatricopeptide repeat-containi...  79.0    2e-13   
ref|XP_004137053.1|  PREDICTED: pentatricopeptide repeat-containi...  79.0    2e-13   Cucumis sativus [cucumbers]
gb|KJB21916.1|  hypothetical protein B456_004G021000                  78.6    3e-13   Gossypium raimondii
gb|ABR16520.1|  unknown                                               79.0    3e-13   Picea sitchensis
ref|XP_006436989.1|  hypothetical protein CICLE_v10033340mg           78.6    3e-13   
ref|XP_007041899.1|  Pentatricopeptide repeat (PPR-like) superfam...  78.6    3e-13   
gb|EYU33153.1|  hypothetical protein MIMGU_mgv1a026552mg              78.2    3e-13   Erythranthe guttata [common monkey flower]
gb|ERN16355.1|  hypothetical protein AMTR_s00439p00011190             75.5    3e-13   Amborella trichopoda
gb|KHN33415.1|  Pentatricopeptide repeat-containing protein           79.0    3e-13   Glycine soja [wild soybean]
ref|XP_003635554.1|  PREDICTED: pentatricopeptide repeat-containi...  78.2    4e-13   Vitis vinifera
gb|ERN05800.1|  hypothetical protein AMTR_s00006p00257350             78.6    4e-13   Amborella trichopoda
ref|XP_008389431.1|  PREDICTED: pentatricopeptide repeat-containi...  78.2    4e-13   
emb|CBI16398.3|  unnamed protein product                              78.2    4e-13   Vitis vinifera
ref|XP_007201591.1|  hypothetical protein PRUPE_ppa020837mg           78.2    4e-13   Prunus persica
ref|XP_009767912.1|  PREDICTED: pentatricopeptide repeat-containi...  78.6    4e-13   Nicotiana sylvestris
ref|XP_006385618.1|  hypothetical protein POPTR_0003s08690g           78.2    4e-13   
ref|XP_007045928.1|  Pentatricopeptide repeat-containing protein      77.8    4e-13   
ref|XP_007043264.1|  Pentatricopeptide repeat superfamily protein     77.8    5e-13   
ref|XP_002277549.1|  PREDICTED: pentatricopeptide repeat-containi...  78.2    5e-13   Vitis vinifera
ref|XP_009148065.1|  PREDICTED: pentatricopeptide repeat-containi...  78.2    5e-13   Brassica rapa
emb|CBI37903.3|  unnamed protein product                              77.8    5e-13   Vitis vinifera
gb|EMS53979.1|  hypothetical protein TRIUR3_11705                     77.4    5e-13   Triticum urartu
ref|XP_011627243.1|  PREDICTED: pentatricopeptide repeat-containi...  76.3    5e-13   
ref|XP_008452110.1|  PREDICTED: pentatricopeptide repeat-containi...  78.2    5e-13   Cucumis melo [Oriental melon]
ref|XP_006383156.1|  hypothetical protein POPTR_0005s12100g           77.8    5e-13   Populus trichocarpa [western balsam poplar]
ref|XP_004146494.1|  PREDICTED: pentatricopeptide repeat-containi...  77.8    5e-13   Cucumis sativus [cucumbers]
ref|XP_010558533.1|  PREDICTED: pentatricopeptide repeat-containi...  78.2    5e-13   Tarenaya hassleriana [spider flower]
ref|XP_008358707.1|  PREDICTED: pentatricopeptide repeat-containi...  77.4    6e-13   
ref|XP_011629106.1|  PREDICTED: pentatricopeptide repeat-containi...  77.8    6e-13   Amborella trichopoda
ref|XP_008362270.1|  PREDICTED: pentatricopeptide repeat-containi...  76.6    6e-13   
ref|XP_006340666.1|  PREDICTED: pentatricopeptide repeat-containi...  77.8    6e-13   Solanum tuberosum [potatoes]
ref|XP_010429126.1|  PREDICTED: pentatricopeptide repeat-containi...  77.8    6e-13   
ref|XP_006296049.1|  hypothetical protein CARUB_v10025197mg           77.8    6e-13   
ref|XP_004242310.1|  PREDICTED: pentatricopeptide repeat-containi...  77.8    6e-13   Solanum lycopersicum
ref|XP_006398078.1|  hypothetical protein EUTSA_v10001098mg           77.8    6e-13   
ref|XP_003572610.1|  PREDICTED: pentatricopeptide repeat-containi...  77.0    6e-13   
ref|XP_008803058.1|  PREDICTED: LOW QUALITY PROTEIN: pentatricope...  77.4    6e-13   Phoenix dactylifera
ref|XP_003632466.2|  PREDICTED: pentatricopeptide repeat-containi...  77.8    7e-13   Vitis vinifera
ref|XP_008649224.1|  PREDICTED: pentatricopeptide repeat-containi...  77.4    7e-13   Zea mays [maize]
ref|XP_009773656.1|  PREDICTED: pentatricopeptide repeat-containi...  77.4    7e-13   Nicotiana sylvestris
ref|XP_008225203.1|  PREDICTED: pentatricopeptide repeat-containi...  77.0    7e-13   Prunus mume [ume]
ref|XP_004485929.1|  PREDICTED: pentatricopeptide repeat-containi...  77.4    7e-13   Cicer arietinum [garbanzo]
gb|ERN14924.1|  hypothetical protein AMTR_s00032p00190360             77.4    7e-13   Amborella trichopoda
ref|XP_009353223.1|  PREDICTED: pentatricopeptide repeat-containi...  77.0    7e-13   Pyrus x bretschneideri [bai li]
ref|XP_008349239.1|  PREDICTED: pentatricopeptide repeat-containi...  77.0    7e-13   
ref|XP_012091736.1|  PREDICTED: pentatricopeptide repeat-containi...  77.0    8e-13   Jatropha curcas
ref|XP_010091291.1|  hypothetical protein L484_001646                 77.4    8e-13   Morus notabilis
ref|XP_010694524.1|  PREDICTED: pentatricopeptide repeat-containi...  77.8    8e-13   
ref|XP_011627771.1|  PREDICTED: pentatricopeptide repeat-containi...  77.4    8e-13   
emb|CBI17453.3|  unnamed protein product                              76.6    8e-13   Vitis vinifera
gb|KJB23426.1|  hypothetical protein B456_004G097600                  77.0    8e-13   Gossypium raimondii
ref|XP_007208178.1|  hypothetical protein PRUPE_ppa017277mg           77.4    8e-13   
ref|XP_011624979.1|  PREDICTED: pentatricopeptide repeat-containi...  77.0    8e-13   Amborella trichopoda
ref|XP_009340246.1|  PREDICTED: pentatricopeptide repeat-containi...  77.0    8e-13   Pyrus x bretschneideri [bai li]
ref|XP_011623320.1|  PREDICTED: LOW QUALITY PROTEIN: putative pen...  77.8    9e-13   
ref|XP_004505771.1|  PREDICTED: pentatricopeptide repeat-containi...  77.0    9e-13   Cicer arietinum [garbanzo]
ref|XP_009788407.1|  PREDICTED: pentatricopeptide repeat-containi...  77.0    9e-13   Nicotiana sylvestris
gb|AFW62747.1|  hypothetical protein ZEAMMB73_141955                  75.1    9e-13   
ref|XP_002441797.1|  hypothetical protein SORBIDRAFT_08g002505        77.4    9e-13   
ref|XP_012080313.1|  PREDICTED: pentatricopeptide repeat-containi...  77.0    9e-13   Jatropha curcas
ref|XP_008237416.1|  PREDICTED: pentatricopeptide repeat-containi...  77.4    1e-12   Prunus mume [ume]
ref|XP_002268784.1|  PREDICTED: pentatricopeptide repeat-containi...  77.0    1e-12   Vitis vinifera
ref|XP_011658917.1|  PREDICTED: pentatricopeptide repeat-containi...  77.4    1e-12   Cucumis sativus [cucumbers]
ref|XP_006483247.1|  PREDICTED: putative pentatricopeptide repeat...  77.0    1e-12   Citrus sinensis [apfelsine]
ref|XP_006425612.1|  hypothetical protein CICLE_v10025108mg           77.0    1e-12   Citrus clementina [clementine]
gb|KGN43953.1|  hypothetical protein Csa_7G074860                     77.4    1e-12   Cucumis sativus [cucumbers]
ref|XP_004137118.2|  PREDICTED: pentatricopeptide repeat-containi...  77.4    1e-12   Cucumis sativus [cucumbers]
ref|XP_010416963.1|  PREDICTED: pentatricopeptide repeat-containi...  77.0    1e-12   
ref|XP_008464984.1|  PREDICTED: pentatricopeptide repeat-containi...  77.0    1e-12   Cucumis melo [Oriental melon]
ref|XP_004301518.1|  PREDICTED: pentatricopeptide repeat-containi...  76.6    1e-12   Fragaria vesca subsp. vesca
ref|XP_004288346.1|  PREDICTED: pentatricopeptide repeat-containi...  77.0    1e-12   Fragaria vesca subsp. vesca
gb|KJB38678.1|  hypothetical protein B456_006G266600                  77.0    1e-12   Gossypium raimondii
ref|XP_002452047.1|  hypothetical protein SORBIDRAFT_04g017510        76.6    1e-12   
ref|XP_011624828.1|  PREDICTED: pentatricopeptide repeat-containi...  76.6    1e-12   
ref|XP_008455202.1|  PREDICTED: pentatricopeptide repeat-containi...  76.6    1e-12   Cucumis melo [Oriental melon]
ref|XP_008789842.1|  PREDICTED: pentatricopeptide repeat-containi...  74.7    1e-12   
ref|XP_009377683.1|  PREDICTED: pentatricopeptide repeat-containi...  76.6    1e-12   Pyrus x bretschneideri [bai li]
gb|KDO71020.1|  hypothetical protein CISIN_1g038673mg                 76.6    1e-12   Citrus sinensis [apfelsine]
ref|XP_010258291.1|  PREDICTED: pentatricopeptide repeat-containi...  76.3    1e-12   Nelumbo nucifera [Indian lotus]
ref|XP_009373813.1|  PREDICTED: pentatricopeptide repeat-containi...  77.0    1e-12   Pyrus x bretschneideri [bai li]
ref|XP_008375044.1|  PREDICTED: pentatricopeptide repeat-containi...  76.6    1e-12   Malus domestica [apple tree]
ref|XP_004979558.1|  PREDICTED: pentatricopeptide repeat-containi...  76.3    1e-12   
ref|XP_006438573.1|  hypothetical protein CICLE_v10030908mg           76.6    2e-12   
ref|XP_006466854.1|  PREDICTED: pentatricopeptide repeat-containi...  76.6    2e-12   
ref|XP_003621610.1|  Pentatricopeptide repeat-containing protein      76.6    2e-12   Medicago truncatula
ref|XP_007212512.1|  hypothetical protein PRUPE_ppa017842mg           76.3    2e-12   Prunus persica
gb|ACP39950.1|  pentatricopeptide repeat protein                      76.3    2e-12   Gossypium hirsutum [American cotton]
gb|ERN18511.1|  hypothetical protein AMTR_s00065p00033910             75.9    2e-12   Amborella trichopoda
gb|ERN05798.1|  hypothetical protein AMTR_s00006p00257020             76.6    2e-12   Amborella trichopoda
ref|XP_010250474.1|  PREDICTED: pentatricopeptide repeat-containi...  76.3    2e-12   Nelumbo nucifera [Indian lotus]
ref|XP_009404762.1|  PREDICTED: pentatricopeptide repeat-containi...  76.3    2e-12   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010098972.1|  hypothetical protein L484_025631                 76.3    2e-12   
gb|KCW59311.1|  hypothetical protein EUGRSUZ_H01992                   76.3    2e-12   Eucalyptus grandis [rose gum]
ref|XP_010915122.1|  PREDICTED: pentatricopeptide repeat-containi...  76.6    2e-12   
ref|XP_011091407.1|  PREDICTED: pentatricopeptide repeat-containi...  75.5    2e-12   Sesamum indicum [beniseed]
emb|CDP02363.1|  unnamed protein product                              76.6    2e-12   Coffea canephora [robusta coffee]
ref|XP_011625801.1|  PREDICTED: pentatricopeptide repeat-containi...  75.9    2e-12   
ref|XP_010070499.1|  PREDICTED: pentatricopeptide repeat-containi...  76.3    2e-12   Eucalyptus grandis [rose gum]
ref|XP_011028546.1|  PREDICTED: pentatricopeptide repeat-containi...  76.3    2e-12   Populus euphratica
ref|XP_006351154.1|  PREDICTED: pentatricopeptide repeat-containi...  76.3    2e-12   
ref|XP_002971568.1|  hypothetical protein SELMODRAFT_96189            75.9    2e-12   
ref|XP_006352817.1|  PREDICTED: pentatricopeptide repeat-containi...  76.3    2e-12   
gb|KCW47309.1|  hypothetical protein EUGRSUZ_K01097                   75.9    2e-12   Eucalyptus grandis [rose gum]
ref|XP_008679372.1|  PREDICTED: pentatricopeptide repeat-containi...  75.9    2e-12   Zea mays [maize]
ref|XP_003610927.1|  Pentatricopeptide repeat-containing protein      76.3    2e-12   
gb|KHN30207.1|  Pentatricopeptide repeat-containing protein           76.3    2e-12   Glycine soja [wild soybean]
ref|XP_002446813.1|  hypothetical protein SORBIDRAFT_06g023080        75.9    2e-12   Sorghum bicolor [broomcorn]
gb|KDO70550.1|  hypothetical protein CISIN_1g046956mg                 75.9    2e-12   Citrus sinensis [apfelsine]
ref|XP_008370702.1|  PREDICTED: pentatricopeptide repeat-containi...  76.3    2e-12   
ref|XP_008241553.1|  PREDICTED: LOW QUALITY PROTEIN: pentatricope...  76.3    2e-12   
ref|XP_006361889.1|  PREDICTED: pentatricopeptide repeat-containi...  75.9    2e-12   Solanum tuberosum [potatoes]
ref|XP_002324099.1|  hypothetical protein POPTR_0017s12720g           76.3    2e-12   
gb|AEP33772.1|  organelle transcript processing 82                    75.9    2e-12   Draba nemorosa
ref|XP_007032935.1|  Pentatricopeptide repeat (PPR) superfamily p...  76.3    2e-12   
ref|XP_006430120.1|  hypothetical protein CICLE_v10011370mg           75.9    2e-12   Citrus clementina [clementine]
ref|XP_002270938.2|  PREDICTED: pentatricopeptide repeat-containi...  75.9    2e-12   Vitis vinifera
ref|XP_010108113.1|  hypothetical protein L484_023201                 75.9    2e-12   Morus notabilis
ref|XP_003581157.2|  PREDICTED: pentatricopeptide repeat-containi...  74.7    2e-12   
ref|XP_011074861.1|  PREDICTED: pentatricopeptide repeat-containi...  75.9    2e-12   Sesamum indicum [beniseed]
gb|KCW64110.1|  hypothetical protein EUGRSUZ_G01766                   75.5    2e-12   Eucalyptus grandis [rose gum]
gb|AES93885.2|  pentatricopeptide (PPR) repeat protein                76.3    2e-12   Medicago truncatula
ref|XP_002263755.1|  PREDICTED: pentatricopeptide repeat-containi...  75.9    2e-12   
ref|XP_002514718.1|  pentatricopeptide repeat-containing protein,...  75.1    2e-12   
ref|XP_011628061.1|  PREDICTED: pentatricopeptide repeat-containi...  75.9    3e-12   
gb|EPS74289.1|  hypothetical protein M569_00469                       75.1    3e-12   
ref|XP_008454910.1|  PREDICTED: pentatricopeptide repeat-containi...  76.3    3e-12   
gb|AFW64678.1|  hypothetical protein ZEAMMB73_926861                  75.9    3e-12   
ref|XP_012088086.1|  PREDICTED: pentatricopeptide repeat-containi...  76.3    3e-12   
ref|XP_010508236.1|  PREDICTED: pentatricopeptide repeat-containi...  75.5    3e-12   
ref|XP_002511599.1|  pentatricopeptide repeat-containing protein,...  75.1    3e-12   
gb|KDP32344.1|  hypothetical protein JCGZ_13269                       75.5    3e-12   
ref|XP_002463110.1|  hypothetical protein SORBIDRAFT_02g037960        75.9    3e-12   
gb|AEN99834.1|  chlororespiratory reduction 4                         75.5    3e-12   
ref|XP_010525143.1|  PREDICTED: pentatricopeptide repeat-containi...  75.5    3e-12   
gb|AEP33764.1|  organelle transcript processing 82                    75.5    3e-12   
ref|XP_010506424.1|  PREDICTED: pentatricopeptide repeat-containi...  75.5    3e-12   
ref|XP_010262425.1|  PREDICTED: putative pentatricopeptide repeat...  75.5    3e-12   
ref|XP_009356368.1|  PREDICTED: pentatricopeptide repeat-containi...  75.1    3e-12   
gb|AEP33770.1|  organelle transcript processing 82                    75.5    3e-12   
ref|XP_010087362.1|  hypothetical protein L484_018388                 75.1    3e-12   
gb|KDO79338.1|  hypothetical protein CISIN_1g038936mg                 75.1    3e-12   
ref|XP_008338226.1|  PREDICTED: pentatricopeptide repeat-containi...  75.5    3e-12   
ref|XP_010035839.1|  PREDICTED: pentatricopeptide repeat-containi...  75.5    3e-12   
ref|XP_009620093.1|  PREDICTED: pentatricopeptide repeat-containi...  75.5    4e-12   
ref|XP_010245883.1|  PREDICTED: pentatricopeptide repeat-containi...  75.1    4e-12   
gb|EMT08213.1|  hypothetical protein F775_15992                       75.1    4e-12   
ref|XP_004231259.1|  PREDICTED: pentatricopeptide repeat-containi...  75.1    4e-12   
ref|XP_011463034.1|  PREDICTED: pentatricopeptide repeat-containi...  75.1    4e-12   
ref|XP_008789962.1|  PREDICTED: LOW QUALITY PROTEIN: pentatricope...  75.1    4e-12   
ref|XP_002971500.1|  hypothetical protein SELMODRAFT_63315            73.6    4e-12   
ref|XP_008342059.1|  PREDICTED: pentatricopeptide repeat-containi...  75.5    4e-12   
ref|XP_008351182.1|  PREDICTED: pentatricopeptide repeat-containi...  75.1    4e-12   
gb|KHM99218.1|  Putative pentatricopeptide repeat-containing protein  75.5    4e-12   
ref|XP_010066261.1|  PREDICTED: pentatricopeptide repeat-containi...  75.1    4e-12   
ref|XP_010277322.1|  PREDICTED: pentatricopeptide repeat-containi...  75.1    4e-12   
ref|XP_012090553.1|  PREDICTED: pentatricopeptide repeat-containi...  75.1    4e-12   
ref|XP_009377672.1|  PREDICTED: pentatricopeptide repeat-containi...  75.1    4e-12   
ref|XP_010557968.1|  PREDICTED: pentatricopeptide repeat-containi...  75.1    4e-12   
ref|XP_003542017.1|  PREDICTED: pentatricopeptide repeat-containi...  75.1    4e-12   
ref|XP_006393847.1|  hypothetical protein EUTSA_v10005524mg           75.1    4e-12   
ref|XP_002884315.1|  pentatricopeptide repeat-containing protein      75.5    4e-12   
ref|XP_006466653.1|  PREDICTED: pentatricopeptide repeat-containi...  75.1    5e-12   
ref|XP_006857535.1|  PREDICTED: pentatricopeptide repeat-containi...  75.1    5e-12   
ref|XP_006425825.1|  hypothetical protein CICLE_v10024955mg           75.1    5e-12   
emb|CDY30771.1|  BnaC07g16710D                                        74.7    5e-12   
ref|XP_007159438.1|  hypothetical protein PHAVU_002G237800g           74.7    5e-12   
ref|XP_009360403.1|  PREDICTED: putative pentatricopeptide repeat...  74.7    5e-12   
ref|XP_010249212.1|  PREDICTED: putative pentatricopeptide repeat...  75.1    5e-12   
ref|XP_004289369.1|  PREDICTED: pentatricopeptide repeat-containi...  75.1    5e-12   
ref|XP_008778338.1|  PREDICTED: pentatricopeptide repeat-containi...  74.7    5e-12   
ref|XP_003629742.1|  Pentatricopeptide repeat-containing protein      74.7    5e-12   
ref|XP_008788464.1|  PREDICTED: pentatricopeptide repeat-containi...  74.7    5e-12   
ref|XP_008390483.1|  PREDICTED: pentatricopeptide repeat-containi...  74.7    5e-12   
ref|XP_008218268.1|  PREDICTED: pentatricopeptide repeat-containi...  74.7    5e-12   
ref|XP_007203614.1|  hypothetical protein PRUPE_ppa002292mg           74.7    6e-12   
ref|XP_002448927.1|  hypothetical protein SORBIDRAFT_05g001710        74.7    6e-12   
ref|XP_002892433.1|  pentatricopeptide repeat-containing protein      74.7    6e-12   
ref|XP_010938918.1|  PREDICTED: pentatricopeptide repeat-containi...  74.7    6e-12   
ref|NP_199236.1|  pentatricopeptide repeat-containing protein         74.7    6e-12   
ref|XP_012078740.1|  PREDICTED: pentatricopeptide repeat-containi...  74.7    6e-12   
ref|XP_002281719.2|  PREDICTED: pentatricopeptide repeat-containi...  74.7    7e-12   
ref|XP_008667875.1|  PREDICTED: hypothetical protein isoform X1       74.3    7e-12   
ref|XP_006293876.1|  hypothetical protein CARUB_v10022861mg           74.3    7e-12   
ref|XP_010267716.1|  PREDICTED: pentatricopeptide repeat-containi...  74.7    7e-12   
emb|CDP11977.1|  unnamed protein product                              72.4    7e-12   
ref|XP_007048080.1|  Pentatricopeptide (PPR) repeat-containing pr...  74.7    7e-12   
ref|XP_010518097.1|  PREDICTED: pentatricopeptide repeat-containi...  74.3    7e-12   
ref|XP_006280148.1|  hypothetical protein CARUB_v10026047mg           74.3    7e-12   
ref|XP_009103519.1|  PREDICTED: pentatricopeptide repeat-containi...  74.3    7e-12   
emb|CDX93594.1|  BnaA06g04540D                                        74.3    7e-12   
ref|XP_010673557.1|  PREDICTED: pentatricopeptide repeat-containi...  74.3    7e-12   
ref|XP_012067416.1|  PREDICTED: pentatricopeptide repeat-containi...  73.9    7e-12   
ref|XP_002880144.1|  pentatricopeptide repeat-containing protein      73.9    8e-12   
gb|AEP33759.1|  organelle transcript processing 82                    74.3    8e-12   
ref|XP_010920669.1|  PREDICTED: pentatricopeptide repeat-containi...  74.3    8e-12   
ref|XP_010541412.1|  PREDICTED: LOW QUALITY PROTEIN: putative pen...  73.9    9e-12   
ref|XP_009598233.1|  PREDICTED: pentatricopeptide repeat-containi...  74.3    9e-12   
gb|KHN35174.1|  Pentatricopeptide repeat-containing protein           73.9    9e-12   
ref|XP_010942337.1|  PREDICTED: pentatricopeptide repeat-containi...  73.9    9e-12   
gb|KJB32641.1|  hypothetical protein B456_005G252900                  73.9    9e-12   
ref|XP_009376232.1|  PREDICTED: pentatricopeptide repeat-containi...  73.9    9e-12   
ref|XP_009359788.1|  PREDICTED: pentatricopeptide repeat-containi...  73.9    9e-12   
ref|XP_010278235.1|  PREDICTED: pentatricopeptide repeat-containi...  74.3    9e-12   
ref|XP_010278229.1|  PREDICTED: pentatricopeptide repeat-containi...  74.3    9e-12   
ref|XP_009369706.1|  PREDICTED: pentatricopeptide repeat-containi...  73.9    9e-12   
ref|XP_011093233.1|  PREDICTED: pentatricopeptide repeat-containi...  73.9    9e-12   
ref|XP_008241735.1|  PREDICTED: pentatricopeptide repeat-containi...  73.9    9e-12   
ref|XP_008242522.1|  PREDICTED: pentatricopeptide repeat-containi...  73.9    1e-11   
ref|XP_007204248.1|  hypothetical protein PRUPE_ppa002250mg           73.9    1e-11   
ref|XP_004306131.1|  PREDICTED: pentatricopeptide repeat-containi...  73.9    1e-11   
ref|XP_010501370.1|  PREDICTED: pentatricopeptide repeat-containi...  73.9    1e-11   
ref|XP_007203772.1|  hypothetical protein PRUPE_ppa002597mg           73.9    1e-11   
ref|XP_007135284.1|  hypothetical protein PHAVU_010G116300g           73.6    1e-11   
gb|AFW76727.1|  hypothetical protein ZEAMMB73_427029                  74.3    1e-11   
ref|XP_008792153.1|  PREDICTED: pentatricopeptide repeat-containi...  73.9    1e-11   
ref|XP_009416039.1|  PREDICTED: putative pentatricopeptide repeat...  73.9    1e-11   
ref|XP_010272332.1|  PREDICTED: pentatricopeptide repeat-containi...  73.9    1e-11   
gb|KCW90501.1|  hypothetical protein EUGRSUZ_A02621                   73.6    1e-11   
ref|XP_010938497.1|  PREDICTED: LOW QUALITY PROTEIN: pentatricope...  73.6    1e-11   
ref|XP_002529360.1|  pentatricopeptide repeat-containing protein,...  73.9    1e-11   
ref|XP_010460972.1|  PREDICTED: pentatricopeptide repeat-containi...  73.9    1e-11   
ref|XP_006446638.1|  hypothetical protein CICLE_v10017631mg           71.2    1e-11   
ref|XP_006403127.1|  hypothetical protein EUTSA_v10003396mg           73.9    1e-11   
gb|EMT19719.1|  hypothetical protein F775_03918                       73.6    1e-11   
gb|EYU31178.1|  hypothetical protein MIMGU_mgv1a027138mg              73.9    1e-11   
ref|XP_006354595.1|  PREDICTED: pentatricopeptide repeat-containi...  73.9    1e-11   
gb|ERN03236.1|  hypothetical protein AMTR_s00003p00181560             72.8    1e-11   
gb|AEP33773.1|  organelle transcript processing 82                    73.9    1e-11   
ref|XP_004306000.1|  PREDICTED: putative pentatricopeptide repeat...  73.2    1e-11   
ref|XP_010685827.1|  PREDICTED: pentatricopeptide repeat-containi...  73.6    1e-11   
gb|KJB22911.1|  hypothetical protein B456_004G073100                  73.6    1e-11   
emb|CDY45235.1|  BnaA07g12550D                                        73.6    1e-11   
ref|XP_006339636.1|  PREDICTED: pentatricopeptide repeat-containi...  73.9    1e-11   
ref|XP_010278295.1|  PREDICTED: pentatricopeptide repeat-containi...  73.9    1e-11   
ref|XP_008465707.1|  PREDICTED: pentatricopeptide repeat-containi...  73.2    1e-11   
ref|XP_010255189.1|  PREDICTED: pentatricopeptide repeat-containi...  73.6    1e-11   
ref|XP_004963495.1|  PREDICTED: pentatricopeptide repeat-containi...  73.6    1e-11   
ref|XP_010322701.1|  PREDICTED: pentatricopeptide repeat-containi...  73.2    1e-11   
ref|NP_200442.1|  pentatricopeptide repeat-containing protein         73.6    1e-11   
ref|XP_009385828.1|  PREDICTED: pentatricopeptide repeat-containi...  73.6    1e-11   
ref|XP_010106892.1|  hypothetical protein L484_012985                 73.6    1e-11   
gb|KEH27289.1|  PPR containing protein                                73.6    1e-11   
ref|XP_006361254.1|  PREDICTED: pentatricopeptide repeat-containi...  73.6    1e-11   
ref|XP_008371711.1|  PREDICTED: LOW QUALITY PROTEIN: pentatricope...  73.2    1e-11   
gb|AEP33761.1|  organelle transcript processing 82                    73.6    1e-11   
ref|XP_010096333.1|  hypothetical protein L484_021080                 73.6    1e-11   
ref|XP_009392649.1|  PREDICTED: pentatricopeptide repeat-containi...  73.6    1e-11   
gb|KJB48770.1|  hypothetical protein B456_008G086200                  73.6    1e-11   
gb|KFK43278.1|  hypothetical protein AALP_AA1G103400                  73.6    1e-11   
ref|XP_004961943.1|  PREDICTED: pentatricopeptide repeat-containi...  73.2    1e-11   
gb|ERM98112.1|  hypothetical protein AMTR_s00095p00031150             73.6    1e-11   
ref|XP_009384885.1|  PREDICTED: pentatricopeptide repeat-containi...  73.6    2e-11   
ref|XP_009608343.1|  PREDICTED: pentatricopeptide repeat-containi...  73.6    2e-11   
emb|CAN64316.1|  hypothetical protein VITISV_027915                   73.6    2e-11   
ref|XP_010481764.1|  PREDICTED: pentatricopeptide repeat-containi...  73.6    2e-11   
ref|XP_010065411.1|  PREDICTED: putative pentatricopeptide repeat...  73.2    2e-11   
ref|XP_006391071.1|  hypothetical protein EUTSA_v10019713mg           73.6    2e-11   
ref|XP_006481702.1|  PREDICTED: putative pentatricopeptide repeat...  73.2    2e-11   
ref|XP_008389535.1|  PREDICTED: putative pentatricopeptide repeat...  73.2    2e-11   
ref|XP_009610860.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  73.6    2e-11   
gb|EYU44257.1|  hypothetical protein MIMGU_mgv1a021838mg              73.6    2e-11   
emb|CDP03394.1|  unnamed protein product                              73.2    2e-11   
ref|XP_010059384.1|  PREDICTED: putative pentatricopeptide repeat...  73.2    2e-11   
emb|CDP00406.1|  unnamed protein product                              73.2    2e-11   
ref|XP_002512787.1|  pentatricopeptide repeat-containing protein,...  72.8    2e-11   
ref|XP_011035853.1|  PREDICTED: pentatricopeptide repeat-containi...  73.2    2e-11   
gb|KGN51874.1|  hypothetical protein Csa_5G604190                     73.2    2e-11   
gb|KHN30482.1|  Pentatricopeptide repeat-containing protein           73.2    2e-11   
gb|KJB54118.1|  hypothetical protein B456_009G021500                  73.2    2e-11   
ref|XP_010035219.1|  PREDICTED: pentatricopeptide repeat-containi...  73.2    2e-11   
ref|XP_007217579.1|  hypothetical protein PRUPE_ppa019357mg           72.8    2e-11   
ref|XP_011628652.1|  PREDICTED: pentatricopeptide repeat-containi...  73.2    2e-11   
ref|XP_006404655.1|  hypothetical protein EUTSA_v10000053mg           73.6    2e-11   
ref|XP_010318680.1|  PREDICTED: pentatricopeptide repeat-containi...  73.2    2e-11   
ref|XP_003573875.1|  PREDICTED: pentatricopeptide repeat-containi...  73.2    2e-11   
ref|XP_006353201.1|  PREDICTED: pentatricopeptide repeat-containi...  72.8    2e-11   
ref|XP_009117354.1|  PREDICTED: pentatricopeptide repeat-containi...  73.6    2e-11   
ref|XP_008235876.1|  PREDICTED: putative pentatricopeptide repeat...  73.2    2e-11   
ref|XP_008235986.1|  PREDICTED: pentatricopeptide repeat-containi...  73.2    2e-11   
ref|XP_011620383.1|  PREDICTED: pentatricopeptide repeat-containi...  73.6    2e-11   
ref|XP_010275418.1|  PREDICTED: pentatricopeptide repeat-containi...  73.2    2e-11   
ref|XP_010255696.1|  PREDICTED: putative pentatricopeptide repeat...  73.2    2e-11   
gb|KJB37273.1|  hypothetical protein B456_006G196400                  72.8    2e-11   
ref|XP_011622619.1|  PREDICTED: pentatricopeptide repeat-containi...  73.2    2e-11   
gb|AEP33762.1|  organelle transcript processing 82                    73.2    2e-11   
ref|XP_010920183.1|  PREDICTED: pentatricopeptide repeat-containi...  73.2    2e-11   
ref|XP_009356472.1|  PREDICTED: putative pentatricopeptide repeat...  73.2    2e-11   
gb|KCW46505.1|  hypothetical protein EUGRSUZ_K00330                   72.8    2e-11   
ref|XP_002267613.1|  PREDICTED: putative pentatricopeptide repeat...  73.2    2e-11   
ref|XP_011469941.1|  PREDICTED: LOW QUALITY PROTEIN: pentatricope...  72.4    2e-11   
ref|XP_002275535.1|  PREDICTED: pentatricopeptide repeat-containi...  72.8    2e-11   
ref|XP_012079670.1|  PREDICTED: pentatricopeptide repeat-containi...  72.8    2e-11   
emb|CDX95096.1|  BnaC05g05750D                                        73.2    2e-11   
gb|KFK31656.1|  hypothetical protein AALP_AA6G141600                  73.2    2e-11   
ref|XP_008662428.1|  PREDICTED: pentatricopeptide repeat-containi...  73.2    2e-11   
ref|XP_004135465.1|  PREDICTED: putative pentatricopeptide repeat...  72.8    2e-11   
gb|KCW82782.1|  hypothetical protein EUGRSUZ_C04158                   72.8    2e-11   
gb|EMT01519.1|  hypothetical protein F775_01753                       72.4    2e-11   
ref|XP_012078934.1|  PREDICTED: pentatricopeptide repeat-containi...  73.2    2e-11   
ref|XP_009362610.1|  PREDICTED: pentatricopeptide repeat-containi...  73.2    2e-11   
gb|KDP31652.1|  hypothetical protein JCGZ_14968                       72.8    2e-11   
gb|EYU30350.1|  hypothetical protein MIMGU_mgv1a017701mg              72.4    2e-11   
ref|XP_002309408.2|  hypothetical protein POPTR_0006s22400g           72.8    2e-11   
ref|XP_008465705.1|  PREDICTED: pentatricopeptide repeat-containi...  72.8    2e-11   
ref|XP_010067950.1|  PREDICTED: pentatricopeptide repeat-containi...  72.8    2e-11   
ref|XP_012075191.1|  PREDICTED: pentatricopeptide repeat-containi...  73.2    2e-11   
ref|XP_010051700.1|  PREDICTED: pentatricopeptide repeat-containi...  72.8    2e-11   
ref|XP_006651422.1|  PREDICTED: pentatricopeptide repeat-containi...  72.8    2e-11   
gb|KHN22581.1|  Pentatricopeptide repeat-containing protein           70.5    2e-11   
ref|XP_004491978.1|  PREDICTED: pentatricopeptide repeat-containi...  73.2    2e-11   
gb|EPS71377.1|  hypothetical protein M569_03380                       72.8    2e-11   
gb|KJB77362.1|  hypothetical protein B456_012G134100                  72.4    2e-11   
ref|XP_004250591.1|  PREDICTED: pentatricopeptide repeat-containi...  72.8    2e-11   
emb|CDY27150.1|  BnaA08g07880D                                        72.4    3e-11   
ref|XP_006437829.1|  hypothetical protein CICLE_v10033304mg           72.8    3e-11   
ref|XP_004509764.1|  PREDICTED: putative pentatricopeptide repeat...  72.8    3e-11   
ref|XP_010914194.1|  PREDICTED: pentatricopeptide repeat-containi...  72.8    3e-11   
emb|CAH66401.1|  OSIGBa0155K12.4                                      72.4    3e-11   
ref|XP_010551347.1|  PREDICTED: putative pentatricopeptide repeat...  72.8    3e-11   
ref|XP_009348084.1|  PREDICTED: pentatricopeptide repeat-containi...  72.8    3e-11   
dbj|BAJ53111.1|  JHL07K02.1                                           70.5    3e-11   
ref|XP_002275884.1|  PREDICTED: putative pentatricopeptide repeat...  72.4    3e-11   
ref|XP_009793694.1|  PREDICTED: pentatricopeptide repeat-containi...  72.4    3e-11   
ref|XP_006411944.1|  hypothetical protein EUTSA_v10026762mg           72.8    3e-11   
ref|XP_004244671.2|  PREDICTED: pentatricopeptide repeat-containi...  72.8    3e-11   
ref|XP_006844721.1|  PREDICTED: pentatricopeptide repeat-containi...  72.0    3e-11   
gb|AEP33757.1|  organelle transcript processing 82                    72.8    3e-11   
gb|AEP33763.1|  organelle transcript processing 82                    72.8    3e-11   
ref|XP_010927406.1|  PREDICTED: pentatricopeptide repeat-containi...  72.4    3e-11   
ref|XP_010029354.1|  PREDICTED: pentatricopeptide repeat-containi...  72.4    3e-11   
ref|XP_010911263.1|  PREDICTED: pentatricopeptide repeat-containi...  72.0    3e-11   
gb|EYU42170.1|  hypothetical protein MIMGU_mgv1a003558mg              72.4    3e-11   
ref|XP_007013319.1|  Pentatricopeptide repeat-containing protein,...  72.4    3e-11   
ref|XP_008776306.1|  PREDICTED: pentatricopeptide repeat-containi...  72.4    3e-11   
ref|XP_008338038.1|  PREDICTED: pentatricopeptide repeat-containi...  72.4    3e-11   
gb|KCW62595.1|  hypothetical protein EUGRSUZ_G00084                   72.4    3e-11   
ref|XP_003624492.1|  Pentatricopeptide repeat-containing protein      72.8    3e-11   
ref|XP_010039610.1|  PREDICTED: pentatricopeptide repeat-containi...  72.4    3e-11   
ref|XP_006282116.1|  hypothetical protein CARUB_v10028364mg           72.4    3e-11   
ref|XP_011096416.1|  PREDICTED: pentatricopeptide repeat-containi...  72.0    3e-11   
ref|XP_008804951.1|  PREDICTED: pentatricopeptide repeat-containi...  72.4    3e-11   
ref|XP_004971569.1|  PREDICTED: pentatricopeptide repeat-containi...  72.0    3e-11   



>gb|KDO84745.1| hypothetical protein CISIN_1g0038682mg, partial [Citrus sinensis]
Length=270

 Score =   202 bits (515),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 96/141 (68%), Positives = 115/141 (82%), Gaps = 2/141 (1%)
 Frame = +3

Query  255  RQLATRYAAHLQLCSSNIHTPATSSLATTIHANMITSGFKPRAHILNRLIDIYCKSSNLP  434
            R LA RYA+ LQLC      P TSSLA ++HA+MI+SGFKPR HI+NRLIDIYCKS  L 
Sbjct  10   RTLANRYASQLQLCDP--RNPITSSLARSVHAHMISSGFKPREHIINRLIDIYCKSLKLV  67

Query  435  YARHLFDEIPQPDIVARTTMIAAYSASGDPNLAAEIFDRTPLSMRDTVFYNARITGYSHQ  614
            YAR LFDEIPQPDIVARTT+IAAYSAS +  LA E+F++TPL MRDTVFYNA IT YSH 
Sbjct  68   YARTLFDEIPQPDIVARTTLIAAYSASDNVKLAREMFNKTPLKMRDTVFYNAMITAYSHN  127

Query  615  NDGHAAIQVFNDMKRNNFQPD  677
            ++GHAAI++F DM+R++ +PD
Sbjct  128  SNGHAAIELFRDMRRDDVKPD  148


 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 32/101 (32%), Positives = 51/101 (50%), Gaps = 11/101 (11%)
 Frame = +3

Query  342  IHANMITSGFKPRAHILNRLIDIYCKSSNLPY---------ARHLFDEIPQPDIVARTTM  494
            +H  ++ SG      +LN LI +Y K  + P+         AR +FDE+P+ D ++ TTM
Sbjct  172  MHCTVVKSGTGLFTSVLNALISVYVKCVSSPFVSSRSLMGAARRVFDEMPERDELSWTTM  231

Query  495  IAAYSASGDPNLAAEIFDRTPLSMRDTVFYNARITGYSHQN  617
            +  Y  +   + A E  D   +S    V +NA I+GY H+ 
Sbjct  232  MTGYVKNDYLDAAREFLD--GMSENVGVAWNALISGYVHRE  270



>ref|XP_006473595.1| PREDICTED: pentatricopeptide repeat-containing protein At1g25360-like 
isoform X1 [Citrus sinensis]
 ref|XP_006473596.1| PREDICTED: pentatricopeptide repeat-containing protein At1g25360-like 
isoform X2 [Citrus sinensis]
Length=799

 Score =   213 bits (541),  Expect = 3e-60, Method: Composition-based stats.
 Identities = 99/141 (70%), Positives = 116/141 (82%), Gaps = 2/141 (1%)
 Frame = +3

Query  255  RQLATRYAAHLQLCSSNIHTPATSSLATTIHANMITSGFKPRAHILNRLIDIYCKSSNLP  434
            R LA RYA+ LQLC      P TSSLA ++HA+MI+SGFKPR HI+NRLIDIYCKS  L 
Sbjct  10   RTLANRYASQLQLCDP--RNPITSSLARSVHAHMISSGFKPREHIINRLIDIYCKSLKLV  67

Query  435  YARHLFDEIPQPDIVARTTMIAAYSASGDPNLAAEIFDRTPLSMRDTVFYNARITGYSHQ  614
            YAR LFDEIPQPDIVARTT+IAAYSASG+  LA E+F++TPL MRDTVFYNA IT YSH 
Sbjct  68   YARTLFDEIPQPDIVARTTLIAAYSASGNVKLAREMFNKTPLKMRDTVFYNAMITAYSHN  127

Query  615  NDGHAAIQVFNDMKRNNFQPD  677
            +DGHAAI++F DM+R+N +PD
Sbjct  128  SDGHAAIELFRDMRRDNVKPD  148


 Score = 56.2 bits (134),  Expect = 8e-06, Method: Composition-based stats.
 Identities = 38/122 (31%), Positives = 61/122 (50%), Gaps = 11/122 (9%)
 Frame = +3

Query  342  IHANMITSGFKPRAHILNRLIDIYCK---------SSNLPYARHLFDEIPQPDIVARTTM  494
            +H  ++ SG      +LN LI +Y K          S++  AR +FDE+P+ D ++ TTM
Sbjct  172  MHCTVVKSGTGLFTSVLNALISVYVKCVSSPFVSSRSSMGAARRVFDEMPERDELSWTTM  231

Query  495  IAAYSASGDPNLAAEIFDRTPLSMRDTVFYNARITGYSHQNDGHAAIQVFNDMKRNNFQP  674
            +  Y  + D + A E  D   +S    V +NA I+GY H+     A+++F  M     Q 
Sbjct  232  MTGYVKNDDLDAAREFLD--GMSENVGVAWNALISGYVHRELYQEALEMFRKMLMLRIQL  289

Query  675  DQ  680
            D+
Sbjct  290  DE  291


 Score = 52.8 bits (125),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 28/119 (24%), Positives = 62/119 (52%), Gaps = 6/119 (5%)
 Frame = +3

Query  330  LATTIHANMITSGFKPRAH----ILNRLIDIYCKSSNLPYARHLFDEIPQPDIVARTTMI  497
            L   +HA ++ +  KP       + N L+ +Y K   +  AR +F+++P+ D+V+   ++
Sbjct  309  LGKQVHAYLLRTEAKPTPEFSLPVNNALVTLYWKCGKVNEARDIFNQMPERDLVSWNAIL  368

Query  498  AAYSASGDPNLAAEIFDRTPLSMRDTVFYNARITGYSHQNDGHAAIQVFNDMKRNNFQP  674
            +AY ++G  + A  +F    +  R+ + +   I+G +    G   +++F+ M+   F+P
Sbjct  369  SAYVSAGLIDEAKSLFG--TMRERNLLTWTVMISGLAQNGYGEEGLKLFSQMRLEGFEP  425



>ref|XP_009608057.1| PREDICTED: pentatricopeptide repeat-containing protein At1g25360 
[Nicotiana tomentosiformis]
 ref|XP_009608058.1| PREDICTED: pentatricopeptide repeat-containing protein At1g25360 
[Nicotiana tomentosiformis]
 ref|XP_009608059.1| PREDICTED: pentatricopeptide repeat-containing protein At1g25360 
[Nicotiana tomentosiformis]
 ref|XP_009608061.1| PREDICTED: pentatricopeptide repeat-containing protein At1g25360 
[Nicotiana tomentosiformis]
Length=807

 Score =   210 bits (535),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 104/164 (63%), Positives = 123/164 (75%), Gaps = 4/164 (2%)
 Frame = +3

Query  192  MKNGAAAAKSFESWAQGIYICRQLATRYAAHLQ-LCSSNIHTPATSSLATTIHANMITSG  368
            MKN A A K+     Q     R +A  YAA LQ LC    H  +  +L  +IH NMITSG
Sbjct  1    MKNAATAVKTS---LQNQSDTRTIANFYAAQLQPLCREKKHASSAFALVRSIHGNMITSG  57

Query  369  FKPRAHILNRLIDIYCKSSNLPYARHLFDEIPQPDIVARTTMIAAYSASGDPNLAAEIFD  548
            F+PR+HILNRLIDIYCK+S L YA+ LFD IPQPD+VARTT+IAAYSASGDP LA E+FD
Sbjct  58   FRPRSHILNRLIDIYCKNSGLVYAKRLFDRIPQPDVVARTTVIAAYSASGDPKLAREVFD  117

Query  549  RTPLSMRDTVFYNARITGYSHQNDGHAAIQVFNDMKRNNFQPDQ  680
            +TPLS+RDTV YNA ITGYSH NDGHAAI++F DM+  +FQPD+
Sbjct  118  KTPLSIRDTVCYNAMITGYSHNNDGHAAIKLFLDMRWKSFQPDE  161


 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 34/122 (28%), Positives = 60/122 (49%), Gaps = 11/122 (9%)
 Frame = +3

Query  342  IHANMITSGFKPRAHILNRLIDIYCKSSNLPY---------ARHLFDEIPQPDIVARTTM  494
            +H  ++ SG      ++N LI +Y K ++ P          A  LF E+P+ D ++ TT+
Sbjct  184  LHCAVVKSGMAWVKCVVNALISVYVKCASSPIVSSVLLMDAASKLFYEMPERDDLSWTTI  243

Query  495  IAAYSASGDPNLAAEIFDRTPLSMRDTVFYNARITGYSHQNDGHAAIQVFNDMKRNNFQP  674
            I  Y  + D + A ++FD   +  +  V +NA I+GY H+     A+ +   M     +P
Sbjct  244  ITGYVKNDDLDAARKVFD--GMDEKLLVAWNAMISGYVHKGFIFEALDMLRKMHSAGLKP  301

Query  675  DQ  680
            D+
Sbjct  302  DE  303


 Score = 57.4 bits (137),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 29/114 (25%), Positives = 57/114 (50%), Gaps = 2/114 (2%)
 Frame = +3

Query  330  LATTIHANMITSGFKPRAHILNRLIDIYCKSSNLPYARHLFDEIPQPDIVARTTMIAAYS  509
            L   +HA +  +  +    + N LI +Y K   +  AR +FD +   D+V+   +++AY 
Sbjct  321  LGKQVHAYVRRTEEEIHVSVHNALITLYWKCGRVDEARKVFDNLAFKDLVSWNAVLSAYV  380

Query  510  ASGDPNLAAEIFDRTPLSMRDTVFYNARITGYSHQNDGHAAIQVFNDMKRNNFQ  671
              G  N A   FD  P   ++++ +   I+G++    G  A+++FN M+ +  +
Sbjct  381  GEGRINEAKLFFDEIP--EKNSLAWTVMISGFAQNGKGEEALKLFNQMRLHGIE  432



>ref|XP_012065865.1| PREDICTED: pentatricopeptide repeat-containing protein At1g25360 
[Jatropha curcas]
Length=797

 Score =   210 bits (534),  Expect = 3e-59, Method: Composition-based stats.
 Identities = 98/141 (70%), Positives = 113/141 (80%), Gaps = 2/141 (1%)
 Frame = +3

Query  255  RQLATRYAAHLQLCSSNIHTPATSSLATTIHANMITSGFKPRAHILNRLIDIYCKSSNLP  434
            R +A RYA+HLQLC     +  + S A TIHA+MI SGFKPR HILNRLIDIYCKS+ L 
Sbjct  8    RTVANRYASHLQLCCP--QSSNSGSFARTIHAHMIASGFKPRGHILNRLIDIYCKSAGLA  65

Query  435  YARHLFDEIPQPDIVARTTMIAAYSASGDPNLAAEIFDRTPLSMRDTVFYNARITGYSHQ  614
            YARH+FDEIPQPDIVARTT+I+AYSA+G   LA EIF  TP  MRDTVFYNA IT YSH 
Sbjct  66   YARHMFDEIPQPDIVARTTLISAYSATGSLELAREIFFGTPSIMRDTVFYNAMITAYSHN  125

Query  615  NDGHAAIQVFNDMKRNNFQPD  677
            NDGHAAI++F DM+RN+F+PD
Sbjct  126  NDGHAAIELFCDMRRNDFKPD  146


 Score = 58.5 bits (140),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 38/122 (31%), Positives = 63/122 (52%), Gaps = 11/122 (9%)
 Frame = +3

Query  342  IHANMITSGFKPRAHILNRLIDIYCKSSN---------LPYARHLFDEIPQPDIVARTTM  494
            +H  ++ SG      +LN LI  Y K ++         +  AR LFDE+P+ D ++ TT+
Sbjct  170  LHCEVVKSGTVFVTSVLNALISAYVKCASSPSVLSSSLMGAARRLFDEMPERDELSWTTI  229

Query  495  IAAYSASGDPNLAAEIFDRTPLSMRDTVFYNARITGYSHQNDGHAAIQVFNDMKRNNFQP  674
            I  Y  + D + A E FD   +S +  V +NA I+GY H+     A+++F  M  +  + 
Sbjct  230  ITGYLKTDDLDGAREFFD--GMSEKLAVAWNAMISGYMHRGLYQEALEMFRKMYLSGMRL  287

Query  675  DQ  680
            D+
Sbjct  288  DE  289


 Score = 52.8 bits (125),  Expect = 9e-05, Method: Composition-based stats.
 Identities = 29/119 (24%), Positives = 59/119 (50%), Gaps = 6/119 (5%)
 Frame = +3

Query  330  LATTIHANMITSGFKPRAH----ILNRLIDIYCKSSNLPYARHLFDEIPQPDIVARTTMI  497
            L   +HA ++ +  KP  +    + N L+ +Y +   +  AR +F+++P  D+V+   ++
Sbjct  307  LGKQVHAYILKTEAKPSVNFSLPVNNALVTLYWRCGTVDRARVVFNKMPVRDLVSWNAIL  366

Query  498  AAYSASGDPNLAAEIFDRTPLSMRDTVFYNARITGYSHQNDGHAAIQVFNDMKRNNFQP  674
            + Y  +G  N A   F+  P   +  + +   I+G +    G   +++FN MK   F+P
Sbjct  367  SGYVNTGRLNEAKSFFEEMP--EKTVLTWTVMISGLAQNGFGEEGLKLFNQMKLMGFKP  423



>ref|XP_006342194.1| PREDICTED: pentatricopeptide repeat-containing protein At1g25360-like 
[Solanum tuberosum]
Length=804

 Score =   210 bits (534),  Expect = 4e-59, Method: Composition-based stats.
 Identities = 97/141 (69%), Positives = 115/141 (82%), Gaps = 1/141 (1%)
 Frame = +3

Query  261  LATRYAAHLQL-CSSNIHTPATSSLATTIHANMITSGFKPRAHILNRLIDIYCKSSNLPY  437
            +A  YA  LQL C  + H  + S+L  +IHANMITSGF PR+HILN LI+IYCK+S L Y
Sbjct  18   IANFYAVQLQLLCREHKHATSASALLRSIHANMITSGFSPRSHILNNLINIYCKNSGLVY  77

Query  438  ARHLFDEIPQPDIVARTTMIAAYSASGDPNLAAEIFDRTPLSMRDTVFYNARITGYSHQN  617
            A+HLFD IPQPD+VARTTMIAAYSASG+P LA E+FD+TPLS+RDTV YNA ITGYSH N
Sbjct  78   AKHLFDRIPQPDVVARTTMIAAYSASGEPKLAREVFDKTPLSIRDTVCYNAMITGYSHNN  137

Query  618  DGHAAIQVFNDMKRNNFQPDQ  680
            DGHAAI++F DM+  NFQPD+
Sbjct  138  DGHAAIKLFLDMRWKNFQPDE  158


 Score = 50.8 bits (120),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 29/109 (27%), Positives = 55/109 (50%), Gaps = 2/109 (2%)
 Frame = +3

Query  330  LATTIHANMITSGFKPRAHILNRLIDIYCKSSNLPYARHLFDEIPQPDIVARTTMIAAYS  509
            L   +HA +  +  K    + N LI +Y K   +  AR +FD +   D+V+   +++AY 
Sbjct  318  LGKQVHAYVRRTEEKIHVSVYNALITLYWKCGRVDDARKVFDNLVFKDLVSWNAVLSAYV  377

Query  510  ASGDPNLAAEIFDRTPLSMRDTVFYNARITGYSHQNDGHAAIQVFNDMK  656
            ++G  N A   FD  P   ++++ +   I+G +    G   +++FN M+
Sbjct  378  SAGRINEAKLFFDEMP--EKNSLAWTVMISGLAQNGLGEDGLKLFNQMR  424



>ref|XP_004238467.1| PREDICTED: pentatricopeptide repeat-containing protein At1g25360 
[Solanum lycopersicum]
 ref|XP_010320488.1| PREDICTED: pentatricopeptide repeat-containing protein At1g25360 
[Solanum lycopersicum]
Length=804

 Score =   208 bits (529),  Expect = 2e-58, Method: Composition-based stats.
 Identities = 97/141 (69%), Positives = 114/141 (81%), Gaps = 1/141 (1%)
 Frame = +3

Query  261  LATRYAAHLQL-CSSNIHTPATSSLATTIHANMITSGFKPRAHILNRLIDIYCKSSNLPY  437
            +A  YA  LQL C  + H  + S+L  +IHANMITSGF+PR+HILN LI+IYCK+S L Y
Sbjct  18   IANFYAVQLQLLCREHKHATSASALLRSIHANMITSGFRPRSHILNSLINIYCKNSGLVY  77

Query  438  ARHLFDEIPQPDIVARTTMIAAYSASGDPNLAAEIFDRTPLSMRDTVFYNARITGYSHQN  617
            A+HLFD IPQPD+VARTTMIAAYSASG+P LA EIFD+TPLS RDTV YNA ITGYSH N
Sbjct  78   AKHLFDRIPQPDVVARTTMIAAYSASGEPKLAREIFDKTPLSFRDTVCYNAMITGYSHNN  137

Query  618  DGHAAIQVFNDMKRNNFQPDQ  680
             GHAAI++F DM+  NFQPD+
Sbjct  138  HGHAAIKLFLDMRWKNFQPDE  158



>ref|XP_009777873.1| PREDICTED: pentatricopeptide repeat-containing protein At1g25360 
[Nicotiana sylvestris]
 ref|XP_009777874.1| PREDICTED: pentatricopeptide repeat-containing protein At1g25360 
[Nicotiana sylvestris]
 ref|XP_009777875.1| PREDICTED: pentatricopeptide repeat-containing protein At1g25360 
[Nicotiana sylvestris]
Length=807

 Score =   208 bits (529),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 103/165 (62%), Positives = 125/165 (76%), Gaps = 6/165 (4%)
 Frame = +3

Query  192  MKNGAAAAK-SFESWAQGIYICRQLATRYAAHLQL-CSSNIHTPATSSLATTIHANMITS  365
            MKN AAA K S  + +      R +A  YA  LQL C    +  +  +L  +IH NMITS
Sbjct  1    MKNAAAAVKTSLLNQSD----TRTIANFYAVQLQLLCREKKYASSAFALVRSIHGNMITS  56

Query  366  GFKPRAHILNRLIDIYCKSSNLPYARHLFDEIPQPDIVARTTMIAAYSASGDPNLAAEIF  545
            GF+PR+HILNRLIDIYCK+S L YA+HLFD IPQPD+VARTT+IAAYSASGDP LA E+F
Sbjct  57   GFRPRSHILNRLIDIYCKNSGLAYAKHLFDRIPQPDVVARTTIIAAYSASGDPKLAREVF  116

Query  546  DRTPLSMRDTVFYNARITGYSHQNDGHAAIQVFNDMKRNNFQPDQ  680
            ++TPLS+RDTV YNA ITGYSH NDGHAAI++F DM+  +FQPD+
Sbjct  117  NKTPLSIRDTVCYNAMITGYSHNNDGHAAIKLFLDMRWKSFQPDE  161


 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 29/114 (25%), Positives = 58/114 (51%), Gaps = 2/114 (2%)
 Frame = +3

Query  330  LATTIHANMITSGFKPRAHILNRLIDIYCKSSNLPYARHLFDEIPQPDIVARTTMIAAYS  509
            L   +HA +  +  +    + N LI +Y K   +  AR +FD +   D+V+   +++AY 
Sbjct  321  LGKQVHAYVRRTEEEIHVSVHNALITLYWKCGRVDEARKVFDNLAFKDLVSWNAVLSAYV  380

Query  510  ASGDPNLAAEIFDRTPLSMRDTVFYNARITGYSHQNDGHAAIQVFNDMKRNNFQ  671
             +G  N A   FD  P   ++++ +   I+G++    G  A+++FN M+ +  +
Sbjct  381  GAGRINEAKLFFDEMP--EKNSLAWTVMISGFAQNGKGEEALKLFNQMRLHGIE  432


 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 33/122 (27%), Positives = 59/122 (48%), Gaps = 11/122 (9%)
 Frame = +3

Query  342  IHANMITSGFKPRAHILNRLIDIYCKSSNLPYAR---------HLFDEIPQPDIVARTTM  494
            +H  ++ SG      ++N LI +Y K ++ P A           LF E+ + D ++ TT+
Sbjct  184  LHCAVVKSGMASVKCVVNALISVYVKCASSPIASSVVLMDSASKLFYEMSERDDLSWTTI  243

Query  495  IAAYSASGDPNLAAEIFDRTPLSMRDTVFYNARITGYSHQNDGHAAIQVFNDMKRNNFQP  674
            I  Y  + D + A ++FD   +  +  V +NA I+GY H+     A+ +   M     +P
Sbjct  244  ITGYVKNDDLDAARKVFD--GMDEKLLVAWNAMISGYVHKGFIFEALDMLRKMHSAGLKP  301

Query  675  DQ  680
            D+
Sbjct  302  DE  303



>ref|XP_006435103.1| hypothetical protein CICLE_v10000322mg [Citrus clementina]
 gb|ESR48343.1| hypothetical protein CICLE_v10000322mg [Citrus clementina]
Length=799

 Score =   204 bits (520),  Expect = 3e-57, Method: Composition-based stats.
 Identities = 95/139 (68%), Positives = 114/139 (82%), Gaps = 2/139 (1%)
 Frame = +3

Query  261  LATRYAAHLQLCSSNIHTPATSSLATTIHANMITSGFKPRAHILNRLIDIYCKSSNLPYA  440
            LA RYA+ LQLC      P TSSLA ++HA+MI+SGFKPR HI+NRLIDIYCKS NL YA
Sbjct  12   LANRYASQLQLCDP--RNPITSSLARSVHAHMISSGFKPRGHIINRLIDIYCKSLNLVYA  69

Query  441  RHLFDEIPQPDIVARTTMIAAYSASGDPNLAAEIFDRTPLSMRDTVFYNARITGYSHQND  620
            R LFDEIPQPDIVARTT+IAAYSAS +  LA E+F++TPL  RDTVFYNA IT YSH ++
Sbjct  70   RKLFDEIPQPDIVARTTLIAAYSASDNVKLAREMFNKTPLKKRDTVFYNAMITAYSHNSN  129

Query  621  GHAAIQVFNDMKRNNFQPD  677
            GHAAI++F DM+R++ +PD
Sbjct  130  GHAAIELFRDMRRDDVKPD  148


 Score = 56.6 bits (135),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 37/122 (30%), Positives = 60/122 (49%), Gaps = 11/122 (9%)
 Frame = +3

Query  342  IHANMITSGFKPRAHILNRLIDIYCKSSNLPY---------ARHLFDEIPQPDIVARTTM  494
            +H  ++ SG      +LN LI +Y K  + P+         AR +FDE+P+ D ++ TTM
Sbjct  172  MHCTVVKSGTGLFTSVLNALISVYVKCVSSPFVSSRSLMGAARRVFDEMPERDELSWTTM  231

Query  495  IAAYSASGDPNLAAEIFDRTPLSMRDTVFYNARITGYSHQNDGHAAIQVFNDMKRNNFQP  674
            +  Y  +   + A E  D   +S    V +NA I+GY H+     A+++F  M     Q 
Sbjct  232  MTGYVKNDYLDAAREFLD--GMSENVGVAWNALISGYVHRELYQEALEMFRKMLMLGIQL  289

Query  675  DQ  680
            D+
Sbjct  290  DE  291


 Score = 50.1 bits (118),  Expect = 0.001, Method: Composition-based stats.
 Identities = 23/94 (24%), Positives = 53/94 (56%), Gaps = 2/94 (2%)
 Frame = +3

Query  393  NRLIDIYCKSSNLPYARHLFDEIPQPDIVARTTMIAAYSASGDPNLAAEIFDRTPLSMRD  572
            N L+ +Y K   +  AR +F+++P+ D+V+   +++AY ++G  + A  +F+   +  R+
Sbjct  334  NALVTLYWKCGKVNEARDIFNQMPERDLVSWNAILSAYVSAGLIDEAKSLFE--AMRERN  391

Query  573  TVFYNARITGYSHQNDGHAAIQVFNDMKRNNFQP  674
             + +   I+G +    G   +++F+ M+   F+P
Sbjct  392  LLSWTVMISGLAQNGYGEEGLKLFSQMRLEGFKP  425



>emb|CDP19381.1| unnamed protein product [Coffea canephora]
Length=811

 Score =   202 bits (514),  Expect = 2e-56, Method: Composition-based stats.
 Identities = 96/141 (68%), Positives = 111/141 (79%), Gaps = 2/141 (1%)
 Frame = +3

Query  255  RQLATRYAAHLQLCSSNIHTPATSSLATTIHANMITSGFKPRAHILNRLIDIYCKSSNLP  434
            R +A R AA LQLC  N  +P + + A TIH +MITSGFKPR HILNRLID+YCKSSNL 
Sbjct  22   RAVANRCAAQLQLCCPN--SPTSYTRARTIHGHMITSGFKPRGHILNRLIDVYCKSSNLG  79

Query  435  YARHLFDEIPQPDIVARTTMIAAYSASGDPNLAAEIFDRTPLSMRDTVFYNARITGYSHQ  614
            YA+ LFD IPQPD+VARTT+IAAYSASG P LA  IFD TPL +RDTV YNA IT YSH 
Sbjct  80   YAKKLFDRIPQPDVVARTTLIAAYSASGSPKLARAIFDGTPLRVRDTVIYNAMITCYSHN  139

Query  615  NDGHAAIQVFNDMKRNNFQPD  677
            +DG+AAI++FNDM +N F PD
Sbjct  140  DDGNAAIRLFNDMSKNGFWPD  160


 Score = 58.2 bits (139),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 37/113 (33%), Positives = 59/113 (52%), Gaps = 11/113 (10%)
 Frame = +3

Query  342  IHANMITSGFKPRAHILNRLIDIYCK---------SSNLPYARHLFDEIPQPDIVARTTM  494
            +H  ++ SG      ++N LI +Y K         SS L  AR LFDE+P  D ++ TT+
Sbjct  184  LHCAVVKSGTGMVISVMNALISVYVKCAASPLVSASSLLGSARKLFDEMPVRDELSWTTI  243

Query  495  IAAYSASGDPNLAAEIFDRTPLSMRDTVFYNARITGYSHQNDGHAAIQVFNDM  653
            I  Y  + +   A E+FD   +  +  V +NA I+GY+H+     A+++F  M
Sbjct  244  ITGYVKNNELAAAREVFD--GMEEKLVVAWNAMISGYAHKGYSSEALEMFRRM  294



>ref|XP_002302000.2| pentatricopeptide repeat-containing family protein [Populus trichocarpa]
 gb|EEE81273.2| pentatricopeptide repeat-containing family protein [Populus trichocarpa]
Length=797

 Score =   200 bits (509),  Expect = 8e-56, Method: Composition-based stats.
 Identities = 93/141 (66%), Positives = 113/141 (80%), Gaps = 2/141 (1%)
 Frame = +3

Query  255  RQLATRYAAHLQLCSSNIHTPATSSLATTIHANMITSGFKPRAHILNRLIDIYCKSSNLP  434
            R  A RY + LQ+C   + +P + SLA  +HA+MI SGF+PR HILNRLIDIY KSS L 
Sbjct  8    RTAANRYGSLLQICC--LQSPISYSLARPVHAHMIASGFQPRGHILNRLIDIYSKSSKLN  65

Query  435  YARHLFDEIPQPDIVARTTMIAAYSASGDPNLAAEIFDRTPLSMRDTVFYNARITGYSHQ  614
            YAR+LFDEIPQPDIVARTT+IAAYSA+GD  L+ +IF  TPL MRD+VFYNA IT YSH 
Sbjct  66   YARYLFDEIPQPDIVARTTLIAAYSAAGDLKLSRKIFSDTPLGMRDSVFYNAMITAYSHN  125

Query  615  NDGHAAIQVFNDMKRNNFQPD  677
            +DGHAAI++F DM+R+NF+PD
Sbjct  126  HDGHAAIELFCDMQRDNFRPD  146


 Score = 55.5 bits (132),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 38/122 (31%), Positives = 60/122 (49%), Gaps = 11/122 (9%)
 Frame = +3

Query  342  IHANMITSGFKPRAHILNRLIDIYCKSSN---------LPYARHLFDEIPQPDIVARTTM  494
            +H  ++ SG      +LN LI  Y K +          +  AR LFDE+P  D ++ TT+
Sbjct  170  LHCAVVKSGTGFVTSVLNALISSYVKCAASPSAQSSSLMAEARKLFDEMPNRDELSWTTI  229

Query  495  IAAYSASGDPNLAAEIFDRTPLSMRDTVFYNARITGYSHQNDGHAAIQVFNDMKRNNFQP  674
            I  Y  + D + A E  + T  S +  V +NA I+GY+H+     A ++F  M  +  Q 
Sbjct  230  ITGYVKNNDLDAAKEFLNGT--SKKLGVAWNAMISGYAHRGLYLEAFEMFRKMIMSKIQL  287

Query  675  DQ  680
            D+
Sbjct  288  DE  289



>ref|XP_010061020.1| PREDICTED: pentatricopeptide repeat-containing protein At1g25360 
[Eucalyptus grandis]
Length=799

 Score =   199 bits (507),  Expect = 1e-55, Method: Composition-based stats.
 Identities = 92/141 (65%), Positives = 111/141 (79%), Gaps = 2/141 (1%)
 Frame = +3

Query  255  RQLATRYAAHLQLCSSNIHTPATSSLATTIHANMITSGFKPRAHILNRLIDIYCKSSNLP  434
            R +ATR+AA L+ C      PA+ S A  +HA+MI SG KPR HI+NRLID+YCKSSN+ 
Sbjct  10   RAIATRFAAQLRRCGPG--APASHSAARAVHAHMIASGLKPRGHIVNRLIDVYCKSSNIG  67

Query  435  YARHLFDEIPQPDIVARTTMIAAYSASGDPNLAAEIFDRTPLSMRDTVFYNARITGYSHQ  614
            YARHLFD IPQPD+VARTT+IAAY+ +G   LA EIFD TPL MRDTV YNA ITGYSH 
Sbjct  68   YARHLFDGIPQPDVVARTTLIAAYAGAGGLKLAREIFDGTPLGMRDTVCYNAMITGYSHN  127

Query  615  NDGHAAIQVFNDMKRNNFQPD  677
            NDGHAA+++F DM+R+ F+PD
Sbjct  128  NDGHAAVRLFLDMRRHGFKPD  148



>ref|XP_011028950.1| PREDICTED: pentatricopeptide repeat-containing protein At1g25360 
[Populus euphratica]
 ref|XP_011028951.1| PREDICTED: pentatricopeptide repeat-containing protein At1g25360 
[Populus euphratica]
 ref|XP_011028952.1| PREDICTED: pentatricopeptide repeat-containing protein At1g25360 
[Populus euphratica]
Length=797

 Score =   199 bits (505),  Expect = 2e-55, Method: Composition-based stats.
 Identities = 93/141 (66%), Positives = 113/141 (80%), Gaps = 2/141 (1%)
 Frame = +3

Query  255  RQLATRYAAHLQLCSSNIHTPATSSLATTIHANMITSGFKPRAHILNRLIDIYCKSSNLP  434
            R  A RY + LQ+C   + +P + SLA  +HA+MI SGF+PR HILNRLIDIY KSS L 
Sbjct  8    RTAANRYGSLLQICC--LQSPISYSLACPVHAHMIASGFQPRGHILNRLIDIYRKSSKLN  65

Query  435  YARHLFDEIPQPDIVARTTMIAAYSASGDPNLAAEIFDRTPLSMRDTVFYNARITGYSHQ  614
            YAR+LFDEIPQPDIVARTT+IAAYSA+GD  L+ +IF  TPL MRD+VFYNA IT YSH 
Sbjct  66   YARYLFDEIPQPDIVARTTLIAAYSAAGDLKLSRKIFSDTPLRMRDSVFYNAMITAYSHN  125

Query  615  NDGHAAIQVFNDMKRNNFQPD  677
            +DGHAAI++F DM+R+NF+PD
Sbjct  126  HDGHAAIELFCDMQRHNFRPD  146


 Score = 55.5 bits (132),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 38/122 (31%), Positives = 60/122 (49%), Gaps = 11/122 (9%)
 Frame = +3

Query  342  IHANMITSGFKPRAHILNRLIDIYCKSSN---------LPYARHLFDEIPQPDIVARTTM  494
            +H  ++ SG      +LN LI  Y K +          +  AR LFDE+P  D ++ TT+
Sbjct  170  LHCAVVKSGTGFVTSVLNALISSYVKCAASPSAQSASLMAEARRLFDEMPNRDELSWTTI  229

Query  495  IAAYSASGDPNLAAEIFDRTPLSMRDTVFYNARITGYSHQNDGHAAIQVFNDMKRNNFQP  674
            I  Y  + D + A E  + T  S +  V +NA I+GY+H+     A ++F  M  +  Q 
Sbjct  230  ITGYVKNNDLDAAKEFLNGT--SEKLGVAWNAMISGYAHRGLYLEAFEMFRKMIMSKIQL  287

Query  675  DQ  680
            D+
Sbjct  288  DE  289



>ref|XP_010271478.1| PREDICTED: pentatricopeptide repeat-containing protein At1g25360 
[Nelumbo nucifera]
Length=801

 Score =   197 bits (500),  Expect = 1e-54, Method: Composition-based stats.
 Identities = 96/162 (59%), Positives = 118/162 (73%), Gaps = 8/162 (5%)
 Frame = +3

Query  192  MKNGAAAAKSFESWAQGIYICRQLATRYAAHLQLCSSNIHTPATSSLATTIHANMITSGF  371
            MKN A A+ S  +        R  A RYAA LQLC      P + SLA ++HA+MITSGF
Sbjct  1    MKNAALASSSLFT------DVRATANRYAALLQLCCP--QGPKSYSLARSVHAHMITSGF  52

Query  372  KPRAHILNRLIDIYCKSSNLPYARHLFDEIPQPDIVARTTMIAAYSASGDPNLAAEIFDR  551
            +PR HILNRLIDIYCKS N+ YARHLFD IP+PDIVARTT+I+AYS  G   LA E+FD 
Sbjct  53   RPRGHILNRLIDIYCKSRNIAYARHLFDAIPKPDIVARTTLISAYSVEGSLKLARELFDG  112

Query  552  TPLSMRDTVFYNARITGYSHQNDGHAAIQVFNDMKRNNFQPD  677
            TP+S+RDTV YNA ITGYSH  DGH+A+++F+DM+ +  +PD
Sbjct  113  TPVSVRDTVSYNAMITGYSHNGDGHSAVKLFSDMRCDCLRPD  154


 Score = 68.9 bits (167),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 40/117 (34%), Positives = 63/117 (54%), Gaps = 7/117 (6%)
 Frame = +3

Query  345  HANMITSGFKPRAHILNRLIDIYCK-----SSNLPYARHLFDEIPQPDIVARTTMIAAYS  509
            H  ++ SG +    +LN LI +Y K     SS +  AR LFD +P+ D ++ TTMI  Y 
Sbjct  179  HCTVVKSGLESVVSVLNALISLYVKCAGFSSSLMNSARRLFDAMPEKDELSWTTMITGYV  238

Query  510  ASGDPNLAAEIFDRTPLSMRDTVFYNARITGYSHQNDGHAAIQVFNDMKRNNFQPDQ  680
              GD + A ++FD   ++ +  V +NA I+GY H      A+++F  M+    Q D+
Sbjct  239  KRGDLDAARKLFD--GMTEKLEVAWNAMISGYVHHGFTLEALEMFKRMRSEGIQFDE  293


 Score = 50.4 bits (119),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 28/115 (24%), Positives = 59/115 (51%), Gaps = 6/115 (5%)
 Frame = +3

Query  342  IHANMITSGFKPRAH----ILNRLIDIYCKSSNLPYARHLFDEIPQPDIVARTTMIAAYS  509
            +HA ++ +  KP       + N L+ +Y K+  +  AR +FD + + D+V+   +++ Y 
Sbjct  315  VHAYILRTEAKPAPDFSLPVNNALVTLYWKNGKVDQARRVFDRMLERDLVSWNAILSGYV  374

Query  510  ASGDPNLAAEIFDRTPLSMRDTVFYNARITGYSHQNDGHAAIQVFNDMKRNNFQP  674
             SG  + A  +F+  P   R+ + +   I+G++    G   +++FN M+    +P
Sbjct  375  NSGRIDEAKILFEEMP--GRNLLTWTVMISGFAQNGLGEEGLRLFNRMRIEGIEP  427



>ref|XP_002280360.1| PREDICTED: pentatricopeptide repeat-containing protein At1g25360 
[Vitis vinifera]
Length=799

 Score =   196 bits (498),  Expect = 2e-54, Method: Composition-based stats.
 Identities = 92/141 (65%), Positives = 111/141 (79%), Gaps = 2/141 (1%)
 Frame = +3

Query  255  RQLATRYAAHLQLCSSNIHTPATSSLATTIHANMITSGFKPRAHILNRLIDIYCKSSNLP  434
            R+LA +YAA LQ C    H P + S+A T+HA+MI SGFKPR +ILNRLID+YCKSS+L 
Sbjct  10   RRLANQYAAQLQQCCP--HNPMSYSIARTVHAHMIASGFKPRGYILNRLIDVYCKSSDLV  67

Query  435  YARHLFDEIPQPDIVARTTMIAAYSASGDPNLAAEIFDRTPLSMRDTVFYNARITGYSHQ  614
             A HLFDEI QPDIVARTT+IAA+S++G+ NLA EIF  TPL +RDTV YNA ITGYSH 
Sbjct  68   SAHHLFDEIRQPDIVARTTLIAAHSSAGNSNLAREIFFATPLGIRDTVCYNAMITGYSHN  127

Query  615  NDGHAAIQVFNDMKRNNFQPD  677
            NDG  AI++F D+ RN F+PD
Sbjct  128  NDGFGAIELFRDLLRNGFRPD  148


 Score = 54.3 bits (129),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 36/122 (30%), Positives = 62/122 (51%), Gaps = 11/122 (9%)
 Frame = +3

Query  342  IHANMITSGFKPRAHILNRLIDIYCKSSN---------LPYARHLFDEIPQPDIVARTTM  494
            IH  ++ SG      +LN L+ ++ K ++         +  AR LFDE+ + D ++ TTM
Sbjct  172  IHCAVVKSGSGFVTSVLNALLSVFVKCASSPLVSSSSLMAAARKLFDEMTERDELSWTTM  231

Query  495  IAAYSASGDPNLAAEIFDRTPLSMRDTVFYNARITGYSHQNDGHAAIQVFNDMKRNNFQP  674
            IA Y  +G+ + A +  D   ++ +  V +NA I+GY H      A+++F  M     Q 
Sbjct  232  IAGYVRNGELDAARQFLD--GMTEKLVVAWNAMISGYVHHGFFLEALEMFRKMYLLGIQW  289

Query  675  DQ  680
            D+
Sbjct  290  DE  291


 Score = 52.8 bits (125),  Expect = 9e-05, Method: Composition-based stats.
 Identities = 33/133 (25%), Positives = 61/133 (46%), Gaps = 17/133 (13%)
 Frame = +3

Query  321  TSSLATTIHANMITSGFKPRAHIL---------------NRLIDIYCKSSNLPYARHLFD  455
            TS L+   +A     G +  A+IL               N L  +Y K   +  AR +F+
Sbjct  295  TSVLSACANAGFFLHGKQVHAYILRTEPRPSLDFSLSVNNALATLYWKCGKVDEARQVFN  354

Query  456  EIPQPDIVARTTMIAAYSASGDPNLAAEIFDRTPLSMRDTVFYNARITGYSHQNDGHAAI  635
            ++P  D+V+   +++ Y  +G  + A   F+  P   R+ + +   I+G +    G  ++
Sbjct  355  QMPVKDLVSWNAILSGYVNAGRIDEAKSFFEEMP--ERNLLTWTVMISGLAQNGFGEESL  412

Query  636  QVFNDMKRNNFQP  674
            ++FN MK   F+P
Sbjct  413  KLFNRMKSEGFEP  425



>ref|XP_008343247.1| PREDICTED: pentatricopeptide repeat-containing protein At1g25360 
[Malus domestica]
Length=807

 Score =   196 bits (499),  Expect = 2e-54, Method: Composition-based stats.
 Identities = 92/139 (66%), Positives = 110/139 (79%), Gaps = 2/139 (1%)
 Frame = +3

Query  261  LATRYAAHLQLCSSNIHTPATSSLATTIHANMITSGFKPRAHILNRLIDIYCKSSNLPYA  440
            +A RYAA LQLC     +P + SLA TIHA+MI SGF PR HILNRLIDIYCKSSN+ YA
Sbjct  20   VANRYAAQLQLCCP--QSPTSHSLARTIHAHMIASGFSPRGHILNRLIDIYCKSSNIXYA  77

Query  441  RHLFDEIPQPDIVARTTMIAAYSASGDPNLAAEIFDRTPLSMRDTVFYNARITGYSHQND  620
            R LFD+IP+ DIVARTT++ AYS  G+  LA +IFD TPLSMRDTV YNA ITGYSH ND
Sbjct  78   RQLFDKIPKXDIVARTTLVKAYSVIGNLTLARKIFDETPLSMRDTVSYNAMITGYSHNND  137

Query  621  GHAAIQVFNDMKRNNFQPD  677
            G+AA+++F DM+R + +PD
Sbjct  138  GYAAVRLFCDMRRGDVRPD  156


 Score = 52.8 bits (125),  Expect = 9e-05, Method: Composition-based stats.
 Identities = 34/122 (28%), Positives = 60/122 (49%), Gaps = 11/122 (9%)
 Frame = +3

Query  342  IHANMITSGFKPRAHILNRLIDIYCKSSN---------LPYARHLFDEIPQPDIVARTTM  494
            +H  ++ SG      + N L+ +Y K ++         +  AR LFDE+P+ D ++ TTM
Sbjct  180  LHCGIVKSGTAFAXSVWNALLSVYVKCASSPLVSSSSLMREARKLFDEMPKRDELSWTTM  239

Query  495  IAAYSASGDPNLAAEIFDRTPLSMRDTVFYNARITGYSHQNDGHAAIQVFNDMKRNNFQP  674
            I  Y  + D + A E+ D   +  +  V +NA I+GY   +    A+ +F  M+    + 
Sbjct  240  ITGYVRNEDLDAARELLD--GMDEKLEVAWNAMISGYVRHDSFQEALLLFRKMRLLGIRQ  297

Query  675  DQ  680
            D+
Sbjct  298  DE  299



>ref|XP_011099914.1| PREDICTED: pentatricopeptide repeat-containing protein At1g25360 
[Sesamum indicum]
Length=811

 Score =   196 bits (498),  Expect = 2e-54, Method: Composition-based stats.
 Identities = 95/162 (59%), Positives = 115/162 (71%), Gaps = 2/162 (1%)
 Frame = +3

Query  192  MKNGAAAAKSFESWAQGIYICRQLATRYAAHLQLCSSNIHTPATSSLATTIHANMITSGF  371
            MKN A  +     + +        A +YAA LQLC      P   +LA  +HA+MI SGF
Sbjct  1    MKNAAPNSFYSHQYFRRTADISATANQYAAKLQLCFQ--RGPPVYALAPAVHAHMIASGF  58

Query  372  KPRAHILNRLIDIYCKSSNLPYARHLFDEIPQPDIVARTTMIAAYSASGDPNLAAEIFDR  551
             PR HILNRLID YCKSSN  YA+ LFDEIPQPD+VARTT+IAAYSASG P +A EIFD+
Sbjct  59   IPRGHILNRLIDFYCKSSNFNYAKRLFDEIPQPDVVARTTLIAAYSASGKPKMAREIFDK  118

Query  552  TPLSMRDTVFYNARITGYSHQNDGHAAIQVFNDMKRNNFQPD  677
            TPL +RDTV YN+ IT YSH NDGHAAI++FN+M++  F+PD
Sbjct  119  TPLRIRDTVCYNSMITCYSHNNDGHAAIRLFNEMRQKGFRPD  160


 Score = 57.8 bits (138),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 32/115 (28%), Positives = 61/115 (53%), Gaps = 6/115 (5%)
 Frame = +3

Query  342  IHANMITSGFKPRAHIL----NRLIDIYCKSSNLPYARHLFDEIPQPDIVARTTMIAAYS  509
            +HA ++ +  KP    +    N LI +Y K   +  AR +FD I   D+++   +++AY 
Sbjct  325  VHAYILRTEAKPARDFMISVNNALITLYWKCGKIDQARSIFDSICTKDLISWNAILSAYV  384

Query  510  ASGDPNLAAEIFDRTPLSMRDTVFYNARITGYSHQNDGHAAIQVFNDMKRNNFQP  674
            ++G  + A  IFD+  +S ++ + +   I+G +    G  A++ FN MK +  +P
Sbjct  385  SAGRIHEARSIFDQ--MSEKNMLSWTVMISGLAQHGLGEEALKFFNKMKSSGLEP  437


 Score = 53.5 bits (127),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 34/113 (30%), Positives = 57/113 (50%), Gaps = 11/113 (10%)
 Frame = +3

Query  342  IHANMITSGFKPRAHILNRLIDIYCKSSNLPY---------ARHLFDEIPQPDIVARTTM  494
            +H  ++ SG      ++N LI +Y K +  P+         AR LFDE+ + D ++ TT+
Sbjct  184  LHCAVVKSGAASITSVVNALISLYVKCALSPFSSSSSLMASARELFDEMLEKDELSWTTI  243

Query  495  IAAYSASGDPNLAAEIFDRTPLSMRDTVFYNARITGYSHQNDGHAAIQVFNDM  653
            I  Y  + D + A E+FD   +  +  V +NA I+GY  +    A  ++F  M
Sbjct  244  ITGYVKNEDLDAAREVFD--GMDEKLVVAWNAMISGYVQKGMVFAVFEMFRKM  294



>emb|CBI19832.3| unnamed protein product [Vitis vinifera]
Length=544

 Score =   191 bits (484),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 92/141 (65%), Positives = 111/141 (79%), Gaps = 2/141 (1%)
 Frame = +3

Query  255  RQLATRYAAHLQLCSSNIHTPATSSLATTIHANMITSGFKPRAHILNRLIDIYCKSSNLP  434
            R+LA +YAA LQ C    H P + S+A T+HA+MI SGFKPR +ILNRLID+YCKSS+L 
Sbjct  8    RRLANQYAAQLQQCCP--HNPMSYSIARTVHAHMIASGFKPRGYILNRLIDVYCKSSDLV  65

Query  435  YARHLFDEIPQPDIVARTTMIAAYSASGDPNLAAEIFDRTPLSMRDTVFYNARITGYSHQ  614
             A HLFDEI QPDIVARTT+IAA+S++G+ NLA EIF  TPL +RDTV YNA ITGYSH 
Sbjct  66   SAHHLFDEIRQPDIVARTTLIAAHSSAGNSNLAREIFFATPLGIRDTVCYNAMITGYSHN  125

Query  615  NDGHAAIQVFNDMKRNNFQPD  677
            NDG  AI++F D+ RN F+PD
Sbjct  126  NDGFGAIELFRDLLRNGFRPD  146


 Score = 59.3 bits (142),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 36/122 (30%), Positives = 62/122 (51%), Gaps = 11/122 (9%)
 Frame = +3

Query  342  IHANMITSGFKPRAHILNRLIDIYCKSSN---------LPYARHLFDEIPQPDIVARTTM  494
            IH  ++ SG      +LN L+ ++ K ++         +  AR LFDE+ + D ++ TTM
Sbjct  170  IHCAVVKSGSGFVTSVLNALLSVFVKCASSPLVSSSSLMAAARKLFDEMTERDELSWTTM  229

Query  495  IAAYSASGDPNLAAEIFDRTPLSMRDTVFYNARITGYSHQNDGHAAIQVFNDMKRNNFQP  674
            IA Y  +G+ + A +  D   ++ +  V +NA I+GY H      A+++F  M     Q 
Sbjct  230  IAGYVRNGELDAARQFLD--GMTEKLVVAWNAMISGYVHHGFFLEALEMFRKMYLLGIQW  287

Query  675  DQ  680
            D+
Sbjct  288  DE  289



>ref|XP_008444805.1| PREDICTED: pentatricopeptide repeat-containing protein At1g25360-like 
[Cucumis melo]
Length=797

 Score =   193 bits (490),  Expect = 3e-53, Method: Composition-based stats.
 Identities = 90/141 (64%), Positives = 108/141 (77%), Gaps = 2/141 (1%)
 Frame = +3

Query  255  RQLATRYAAHLQLCSSNIHTPATSSLATTIHANMITSGFKPRAHILNRLIDIYCKSSNLP  434
            R LA RY A L LC      P++ SLA T+HA++I SGFK R HI+NRLID+Y KSS+  
Sbjct  8    RVLANRYVAQLNLCCP--QNPSSYSLARTVHAHVIASGFKLRGHIVNRLIDVYWKSSDFV  65

Query  435  YARHLFDEIPQPDIVARTTMIAAYSASGDPNLAAEIFDRTPLSMRDTVFYNARITGYSHQ  614
            YAR LFDEIPQPD++ARTT+I AYSA G+  +A EIF+ TPL MRDTVFYNA ITGYSH 
Sbjct  66   YARQLFDEIPQPDVIARTTLITAYSALGNLKMAREIFNETPLDMRDTVFYNAMITGYSHM  125

Query  615  NDGHAAIQVFNDMKRNNFQPD  677
            NDGH+AI++F  M+  NFQPD
Sbjct  126  NDGHSAIELFRAMRWANFQPD  146


 Score = 56.2 bits (134),  Expect = 8e-06, Method: Composition-based stats.
 Identities = 30/120 (25%), Positives = 61/120 (51%), Gaps = 6/120 (5%)
 Frame = +3

Query  330  LATTIHANMITSGFKPRAHIL----NRLIDIYCKSSNLPYARHLFDEIPQPDIVARTTMI  497
            L   +HA ++ +   P  + L    N LI +Y K   +  AR +F E+P  D+++  T++
Sbjct  307  LGKQVHAYILKNELNPDRNFLLSVGNTLITLYWKYGKVDGARKIFYEMPVKDVISWNTLL  366

Query  498  AAYSASGDPNLAAEIFDRTPLSMRDTVFYNARITGYSHQNDGHAAIQVFNDMKRNNFQPD  677
            + Y  +G    A   F + P   ++ + +   I+G +    G  A+++FN M+ + ++P+
Sbjct  367  SGYVNAGRMEEAKSFFAQMP--EKNLLTWTVMISGLAQNGFGEQALKLFNQMRLDGYEPN  424


 Score = 53.1 bits (126),  Expect = 7e-05, Method: Composition-based stats.
 Identities = 35/122 (29%), Positives = 59/122 (48%), Gaps = 11/122 (9%)
 Frame = +3

Query  342  IHANMITSGFKPRAHILNRLIDIYCKSSN---------LPYARHLFDEIPQPDIVARTTM  494
            +H  ++ SG      +LN L+ +Y K ++         +  AR LFDE+P+ +    TT+
Sbjct  170  MHGAVVKSGIGLFPAVLNSLLSVYVKCASSPLVSSSSLMASARKLFDEMPKRNEFIWTTL  229

Query  495  IAAYSASGDPNLAAEIFDRTPLSMRDTVFYNARITGYSHQNDGHAAIQVFNDMKRNNFQP  674
            I  Y  + D   A EI D   ++ +  + +NA I+GY H      A+ +F  M+    Q 
Sbjct  230  ITGYVRNDDLAAAREILD--TMTEQPGIAWNAMISGYLHHGLFEDALTLFRKMRLLGVQL  287

Query  675  DQ  680
            D+
Sbjct  288  DE  289



>ref|XP_008228974.1| PREDICTED: pentatricopeptide repeat-containing protein At1g25360-like 
[Prunus mume]
Length=822

 Score =   191 bits (484),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 91/144 (63%), Positives = 111/144 (77%), Gaps = 2/144 (1%)
 Frame = +3

Query  246  YICRQLATRYAAHLQLCSSNIHTPATSSLATTIHANMITSGFKPRAHILNRLIDIYCKSS  425
            +I   +A RYAA LQLC     +P + S+A T HA+MI SGFKPR HILNRLID+YCKSS
Sbjct  30   FIFLTVANRYAAQLQLCCP--QSPVSYSIARTTHAHMIASGFKPRGHILNRLIDVYCKSS  87

Query  426  NLPYARHLFDEIPQPDIVARTTMIAAYSASGDPNLAAEIFDRTPLSMRDTVFYNARITGY  605
            N  YA  LFD+IP+PDIVARTT+I AYSA G+  LA +IF+ TPLSMRDTV YNA ITGY
Sbjct  88   NFSYAHQLFDQIPKPDIVARTTLITAYSAIGNLTLARKIFNETPLSMRDTVCYNAMITGY  147

Query  606  SHQNDGHAAIQVFNDMKRNNFQPD  677
            S  NDG+A+I++F +M+R  F+PD
Sbjct  148  SRNNDGYASIRLFCEMRRGGFRPD  171


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 36/144 (25%), Positives = 68/144 (47%), Gaps = 10/144 (7%)
 Frame = +3

Query  255  RQLATRYAAHLQLCSSNIHTPATSSLATTIHANMITSGFKPRA----HILNRLIDIYCKS  422
            RQ    Y + +  C++N        L   +HA ++ +  KP       + N L+ +Y K 
Sbjct  311  RQDEFTYTSVISTCANN----GLFQLGKQVHAYILRTEAKPTVDFSLSVNNTLLTLYYKC  366

Query  423  SNLPYARHLFDEIPQPDIVARTTMIAAYSASGDPNLAAEIFDRTPLSMRDTVFYNARITG  602
              L  AR++F+ +P  D+V+   +++ Y ++G    A   F   P+  R  + +   I+G
Sbjct  367  GKLDEARYIFNNMPVKDLVSWNAILSGYVSAGRIQEAKSFFKEMPV--RSILTWTVMISG  424

Query  603  YSHQNDGHAAIQVFNDMKRNNFQP  674
             +    G  A+++FN M+   F+P
Sbjct  425  LAQNGFGEEAMKLFNQMRLEGFEP  448


 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 35/122 (29%), Positives = 63/122 (52%), Gaps = 11/122 (9%)
 Frame = +3

Query  342  IHANMITSGFKPRAHILNRLIDIYCKSSN---------LPYARHLFDEIPQPDIVARTTM  494
            +H  ++ SG      + N L+ +Y + ++         +  AR+LF+E+P+ D ++ TTM
Sbjct  195  LHCAVVKSGTGFATSVWNALLSVYVRCASSPLVSSSSLMGEARNLFNEMPERDELSWTTM  254

Query  495  IAAYSASGDPNLAAEIFDRTPLSMRDTVFYNARITGYSHQNDGHAAIQVFNDMKRNNFQP  674
            I  Y  + D + A E+ D   +  R  V +NA I+GY+H N    A+ +F  M+    + 
Sbjct  255  ITGYIRNEDLHAARELLD--GMDERMEVVWNAMISGYAHHNSFQEALLLFRKMRLLGIRQ  312

Query  675  DQ  680
            D+
Sbjct  313  DE  314



>ref|XP_004152765.1| PREDICTED: pentatricopeptide repeat-containing protein At1g25360-like 
[Cucumis sativus]
Length=797

 Score =   190 bits (482),  Expect = 4e-52, Method: Composition-based stats.
 Identities = 86/141 (61%), Positives = 108/141 (77%), Gaps = 2/141 (1%)
 Frame = +3

Query  255  RQLATRYAAHLQLCSSNIHTPATSSLATTIHANMITSGFKPRAHILNRLIDIYCKSSNLP  434
            R LA RYA  LQLCS     PA+ SLA  +HA+MI SGFKPR H LNRL+++YCKSSN+ 
Sbjct  8    RLLANRYAEKLQLCSP--QDPASFSLARAVHAHMIASGFKPRGHFLNRLLEMYCKSSNVV  65

Query  435  YARHLFDEIPQPDIVARTTMIAAYSASGDPNLAAEIFDRTPLSMRDTVFYNARITGYSHQ  614
            YAR LF+EIP PD +ARTT+I AY A G+  L  EIF+ TPL MRD+VFYNA ITGY+H 
Sbjct  66   YARQLFEEIPNPDAIARTTLITAYCALGNLELGREIFNGTPLYMRDSVFYNAMITGYAHN  125

Query  615  NDGHAAIQVFNDMKRNNFQPD  677
             DGH+A+++F  M+R++F+PD
Sbjct  126  GDGHSALELFRAMRRDDFRPD  146



>gb|KGN62652.1| hypothetical protein Csa_2G365100 [Cucumis sativus]
Length=816

 Score =   190 bits (482),  Expect = 4e-52, Method: Composition-based stats.
 Identities = 86/141 (61%), Positives = 108/141 (77%), Gaps = 2/141 (1%)
 Frame = +3

Query  255  RQLATRYAAHLQLCSSNIHTPATSSLATTIHANMITSGFKPRAHILNRLIDIYCKSSNLP  434
            R LA RYA  LQLCS     PA+ SLA  +HA+MI SGFKPR H LNRL+++YCKSSN+ 
Sbjct  27   RLLANRYAEKLQLCSP--QDPASFSLARAVHAHMIASGFKPRGHFLNRLLEMYCKSSNVV  84

Query  435  YARHLFDEIPQPDIVARTTMIAAYSASGDPNLAAEIFDRTPLSMRDTVFYNARITGYSHQ  614
            YAR LF+EIP PD +ARTT+I AY A G+  L  EIF+ TPL MRD+VFYNA ITGY+H 
Sbjct  85   YARQLFEEIPNPDAIARTTLITAYCALGNLELGREIFNGTPLYMRDSVFYNAMITGYAHN  144

Query  615  NDGHAAIQVFNDMKRNNFQPD  677
             DGH+A+++F  M+R++F+PD
Sbjct  145  GDGHSALELFRAMRRDDFRPD  165



>ref|XP_009109879.1| PREDICTED: pentatricopeptide repeat-containing protein At1g25360 
[Brassica rapa]
Length=790

 Score =   188 bits (477),  Expect = 2e-51, Method: Composition-based stats.
 Identities = 88/143 (62%), Positives = 108/143 (76%), Gaps = 2/143 (1%)
 Frame = +3

Query  249  ICRQLATRYAAHLQLCSSNIHTPATSSLATTIHANMITSGFKPRAHILNRLIDIYCKSSN  428
            + R +A RYAA+L LC     T  +  LA  IHAN IT GF+PRAHILNRLID+Y KSS 
Sbjct  7    LIRTIANRYAANLTLCFPLRRT--SLQLARAIHANFITFGFQPRAHILNRLIDVYSKSSE  64

Query  429  LPYARHLFDEIPQPDIVARTTMIAAYSASGDPNLAAEIFDRTPLSMRDTVFYNARITGYS  608
            L YARHLFDEIP+PD +ARTTM++ YSASGD  LA  IF+ TPLSMRDT+ YNA ITG++
Sbjct  65   LRYARHLFDEIPEPDKIARTTMVSGYSASGDIALAQNIFEETPLSMRDTIMYNAMITGFT  124

Query  609  HQNDGHAAIQVFNDMKRNNFQPD  677
            H +DG +A+ +F +MKR  F+PD
Sbjct  125  HSHDGCSAVSMFREMKREGFRPD  147



>ref|XP_002521664.1| pentatricopeptide repeat-containing protein, putative [Ricinus 
communis]
 gb|EEF40651.1| pentatricopeptide repeat-containing protein, putative [Ricinus 
communis]
Length=574

 Score =   186 bits (473),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 93/141 (66%), Positives = 104/141 (74%), Gaps = 2/141 (1%)
 Frame = +3

Query  255  RQLATRYAAHLQLCSSNIHTPATSSLATTIHANMITSGFKPRAHILNRLIDIYCKSSNLP  434
            R  A  YA+ LQLC     +P +   A TIHA+MI SGFKP  H LNRLI IYCKSS L 
Sbjct  12   RTAANHYASLLQLCCP--QSPISYPFARTIHAHMIASGFKPHGHTLNRLIYIYCKSSKLS  69

Query  435  YARHLFDEIPQPDIVARTTMIAAYSASGDPNLAAEIFDRTPLSMRDTVFYNARITGYSHQ  614
            YAR LFDEIPQPDIVARTT+I AYSA+G   LA E+F  TPL MRD V YNA IT YSH 
Sbjct  70   YARSLFDEIPQPDIVARTTLINAYSATGHLKLAKEMFYETPLIMRDAVIYNAMITAYSHN  129

Query  615  NDGHAAIQVFNDMKRNNFQPD  677
            NDGHAAI++F DMKRN+F+PD
Sbjct  130  NDGHAAIELFCDMKRNDFRPD  150


 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 39/124 (31%), Positives = 63/124 (51%), Gaps = 15/124 (12%)
 Frame = +3

Query  342  IHANMITSGFKPRAHILNRLIDIYCKSSN---------LPYARHLFDEIPQPDIVARTTM  494
            +H  ++ SG      +LN LI +Y K ++         +  AR LFDE+P  D ++ TT+
Sbjct  174  LHCTVVKSGTWFVTSVLNALISVYVKCASSPSVISSSLMGAARRLFDEMPVRDELSWTTI  233

Query  495  IAAYSASGDPNLAAEIFDRTPLSMRD--TVFYNARITGYSHQNDGHAAIQVFNDMKRNNF  668
            I  Y  + D + A E+FD     MR+   V +NA I+GY H+     A+++F  M     
Sbjct  234  ITGYVKNDDLDAAREVFD----GMREKLVVVWNAMISGYMHRGLYQEALEMFRKMYLAGL  289

Query  669  QPDQ  680
            + D+
Sbjct  290  KLDE  293


 Score = 53.1 bits (126),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 24/94 (26%), Positives = 49/94 (52%), Gaps = 2/94 (2%)
 Frame = +3

Query  393  NRLIDIYCKSSNLPYARHLFDEIPQPDIVARTTMIAAYSASGDPNLAAEIFDRTPLSMRD  572
            N L+ +Y K   +  A+ +F+ +P  D+V+  T+++ Y  +G  + A   F+  P   ++
Sbjct  336  NALVTLYWKCGKVDEAQEVFNNMPVRDLVSWNTILSGYLNAGRMDEAKTFFEEMP--EKN  393

Query  573  TVFYNARITGYSHQNDGHAAIQVFNDMKRNNFQP  674
             + +   I+G +    G   +++FN MK   F+P
Sbjct  394  ILSWVVMISGLAQNGFGEEGLKLFNQMKLRGFEP  427



>ref|XP_008444772.1| PREDICTED: pentatricopeptide repeat-containing protein At1g25360-like 
[Cucumis melo]
Length=797

 Score =   187 bits (476),  Expect = 2e-51, Method: Composition-based stats.
 Identities = 85/141 (60%), Positives = 106/141 (75%), Gaps = 2/141 (1%)
 Frame = +3

Query  255  RQLATRYAAHLQLCSSNIHTPATSSLATTIHANMITSGFKPRAHILNRLIDIYCKSSNLP  434
            R +A RYA  LQLCS     PA+ SLA  +HA+MI SGFKPR H LNRL+++YCKSSNL 
Sbjct  8    RLVANRYAEKLQLCSP--QDPASFSLARAVHAHMIASGFKPRGHFLNRLLEMYCKSSNLV  65

Query  435  YARHLFDEIPQPDIVARTTMIAAYSASGDPNLAAEIFDRTPLSMRDTVFYNARITGYSHQ  614
            YAR LFDEIP P  + RTT+I AY A G+  L  E+F+ TPL MRD+VFYNA ITGYSH 
Sbjct  66   YARQLFDEIPNPGAITRTTLITAYCALGNLELGREVFNGTPLYMRDSVFYNAMITGYSHN  125

Query  615  NDGHAAIQVFNDMKRNNFQPD  677
             DGH+A+++F  M+R++F+PD
Sbjct  126  GDGHSALELFRAMRRDDFRPD  146



>ref|XP_010093155.1| hypothetical protein L484_005164 [Morus notabilis]
 gb|EXB53614.1| hypothetical protein L484_005164 [Morus notabilis]
Length=800

 Score =   187 bits (476),  Expect = 2e-51, Method: Composition-based stats.
 Identities = 87/141 (62%), Positives = 104/141 (74%), Gaps = 2/141 (1%)
 Frame = +3

Query  255  RQLATRYAAHLQLCSSNIHTPATSSLATTIHANMITSGFKPRAHILNRLIDIYCKSSNLP  434
            R +A R+AA L  C      P + SLA TIHA+M  SGF+PR HI+NRLID+YCK SNL 
Sbjct  9    RSVANRFAAQLHFCRR--QNPISYSLARTIHAHMTASGFRPRGHIVNRLIDVYCKCSNLS  66

Query  435  YARHLFDEIPQPDIVARTTMIAAYSASGDPNLAAEIFDRTPLSMRDTVFYNARITGYSHQ  614
            YAR+LFDEIPQPD+VARTT++AAYSA+G+  LA EIF   PL MRDT+ YNA ITGYS  
Sbjct  67   YARNLFDEIPQPDVVARTTLVAAYSAAGNLKLAREIFCGIPLDMRDTICYNAMITGYSRN  126

Query  615  NDGHAAIQVFNDMKRNNFQPD  677
            NDG AA Q+F DM+ +   PD
Sbjct  127  NDGFAAFQLFRDMRWDGVTPD  147


 Score = 50.1 bits (118),  Expect = 8e-04, Method: Composition-based stats.
 Identities = 28/119 (24%), Positives = 58/119 (49%), Gaps = 6/119 (5%)
 Frame = +3

Query  330  LATTIHANMITSGFKPRA----HILNRLIDIYCKSSNLPYARHLFDEIPQPDIVARTTMI  497
            L   +HA+++ +  +P       + N L+ +Y +   +  AR +FD++P  DIV+   ++
Sbjct  309  LGKELHAHILRTEAEPTKDFSLSVNNALVTLYYRCGKVDLARKIFDKMPVRDIVSWNAIL  368

Query  498  AAYSASGDPNLAAEIFDRTPLSMRDTVFYNARITGYSHQNDGHAAIQVFNDMKRNNFQP  674
            + Y  +     A   F   P   R+ + +   ++G +    G  A+++FN M+   F+P
Sbjct  369  SGYIEAKRIEEAKSFFVEIP--ERNGLTWTVIVSGLAQNGYGEEAMKLFNQMRLEGFEP  425



>ref|XP_004152758.1| PREDICTED: pentatricopeptide repeat-containing protein At1g25360-like 
[Cucumis sativus]
 gb|KGN62675.1| hypothetical protein Csa_2G368270 [Cucumis sativus]
Length=797

 Score =   187 bits (475),  Expect = 3e-51, Method: Composition-based stats.
 Identities = 89/141 (63%), Positives = 106/141 (75%), Gaps = 2/141 (1%)
 Frame = +3

Query  255  RQLATRYAAHLQLCSSNIHTPATSSLATTIHANMITSGFKPRAHILNRLIDIYCKSSNLP  434
            R LA RY A L LC       ++ SLA T+H ++I SGFK R HI+NRLIDIY KSS+  
Sbjct  8    RVLANRYFAQLNLCCP--QNLSSYSLARTVHGHVIASGFKLRGHIVNRLIDIYWKSSDFV  65

Query  435  YARHLFDEIPQPDIVARTTMIAAYSASGDPNLAAEIFDRTPLSMRDTVFYNARITGYSHQ  614
            YAR LFDEIPQPD++ARTT+I AYSA G+  +A EIF+ TPL MRDTVFYNA ITGYSH 
Sbjct  66   YARKLFDEIPQPDVIARTTLITAYSALGNLKMAREIFNETPLDMRDTVFYNAMITGYSHM  125

Query  615  NDGHAAIQVFNDMKRNNFQPD  677
            NDGH+AI++F  M+  NFQPD
Sbjct  126  NDGHSAIELFRAMRWANFQPD  146


 Score = 56.6 bits (135),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 32/120 (27%), Positives = 59/120 (49%), Gaps = 6/120 (5%)
 Frame = +3

Query  330  LATTIHANMITSGFKPRAHIL----NRLIDIYCKSSNLPYARHLFDEIPQPDIVARTTMI  497
            L   +HA ++ +   P    L    N LI +Y K   +  AR +F E+P  DI+   T++
Sbjct  307  LGKQVHAYILKNELNPDRDFLLSVGNTLITLYWKYGKVDGARKIFYEMPVKDIITWNTLL  366

Query  498  AAYSASGDPNLAAEIFDRTPLSMRDTVFYNARITGYSHQNDGHAAIQVFNDMKRNNFQPD  677
            + Y  +G    A   F + P   ++ + +   I+G +    G  A+++FN MK + ++P+
Sbjct  367  SGYVNAGRMEEAKSFFAQMP--EKNLLTWTVMISGLAQNGFGEQALKLFNQMKLDGYEPN  424


 Score = 55.1 bits (131),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 35/122 (29%), Positives = 60/122 (49%), Gaps = 11/122 (9%)
 Frame = +3

Query  342  IHANMITSGFKPRAHILNRLIDIYCKSSN---------LPYARHLFDEIPQPDIVARTTM  494
            +H  ++  G +    +LN L+ +Y K ++         +  AR LFDE+P+ +    TT+
Sbjct  170  MHGTVVKFGIEIFPAVLNALLSVYVKCASSPLVSSSSLMASARKLFDEMPKRNEFIWTTL  229

Query  495  IAAYSASGDPNLAAEIFDRTPLSMRDTVFYNARITGYSHQNDGHAAIQVFNDMKRNNFQP  674
            I  Y  +GD   A EI D   ++ +  + +NA I+GY H      A+ +F  M+    Q 
Sbjct  230  ITGYVRNGDLTGAREILD--TMTEQPGIAWNAMISGYLHHGLFEDALTLFRKMRLLGVQV  287

Query  675  DQ  680
            D+
Sbjct  288  DE  289



>ref|XP_007034693.1| Pentatricopeptide repeat (PPR) superfamily protein [Theobroma 
cacao]
 gb|EOY05619.1| Pentatricopeptide repeat (PPR) superfamily protein [Theobroma 
cacao]
Length=788

 Score =   187 bits (475),  Expect = 4e-51, Method: Composition-based stats.
 Identities = 85/143 (59%), Positives = 108/143 (76%), Gaps = 2/143 (1%)
 Frame = +3

Query  249  ICRQLATRYAAHLQLCSSNIHTPATSSLATTIHANMITSGFKPRAHILNRLIDIYCKSSN  428
            + R +A RYA+ LQLC     TPA+ SLA  IH+ MI SGF PR HILNRLID+YCKSS 
Sbjct  6    LIRAVANRYASQLQLCYP--QTPASFSLAKAIHSRMIASGFHPRGHILNRLIDVYCKSSR  63

Query  429  LPYARHLFDEIPQPDIVARTTMIAAYSASGDPNLAAEIFDRTPLSMRDTVFYNARITGYS  608
            + YAR+LFD+IP PDIV+RT+++ AYS SG+   A E+F+ TPLS+RD+VFYNA ITG+S
Sbjct  64   IDYARNLFDKIPAPDIVSRTSLVLAYSTSGNIKKAREMFEETPLSIRDSVFYNAMITGFS  123

Query  609  HQNDGHAAIQVFNDMKRNNFQPD  677
               DGHA I++F  M R+ F+PD
Sbjct  124  RNEDGHACIKLFRQMLRDEFRPD  146


 Score = 55.1 bits (131),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 31/104 (30%), Positives = 54/104 (52%), Gaps = 2/104 (2%)
 Frame = +3

Query  342  IHANMITSGFKPRAHILNRLIDIYCKSSNLPYARHLFDEIPQPDIVARTTMIAAYSASGD  521
            +H  +  SG      +LN L+ +Y   + +  AR LFDE+ + D ++ TTM+  Y  + +
Sbjct  170  MHCTVFKSGTVFVTSVLNALVSVYVNCTLMFEARKLFDEMSEKDELSWTTMVTGYVKNDE  229

Query  522  PNLAAEIFDRTPLSMRDTVFYNARITGYSHQNDGHAAIQVFNDM  653
             + A E+ D   ++ +  V +NA I+GY H      A+ +F  M
Sbjct  230  LDAARELVD--GMNEKLAVAWNAMISGYVHHGRYEEALDMFRKM  271


 Score = 52.0 bits (123),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 29/119 (24%), Positives = 57/119 (48%), Gaps = 6/119 (5%)
 Frame = +3

Query  330  LATTIHANMITSGFKPRAH----ILNRLIDIYCKSSNLPYARHLFDEIPQPDIVARTTMI  497
            L   +HA ++ +  KP       + N L+ +Y K   + +AR +F+ +P  D+V+   ++
Sbjct  298  LGQQVHAYVLRTEGKPTPDFSLPVNNALVTLYWKCDKVDWAREVFNNMPVRDLVSWNAIL  357

Query  498  AAYSASGDPNLAAEIFDRTPLSMRDTVFYNARITGYSHQNDGHAAIQVFNDMKRNNFQP  674
            + Y  +G  +     F   P   R+ + +   I+G +    G   +++FN MK   F+P
Sbjct  358  SGYVNAGRIDEGMSFFREMP--ERNLLTWIVMISGLAQNGFGEEGLKLFNQMKSEGFEP  414



>emb|CDY24406.1| BnaCnng04730D [Brassica napus]
Length=703

 Score =   185 bits (470),  Expect = 1e-50, Method: Composition-based stats.
 Identities = 85/143 (59%), Positives = 109/143 (76%), Gaps = 2/143 (1%)
 Frame = +3

Query  249  ICRQLATRYAAHLQLCSSNIHTPATSSLATTIHANMITSGFKPRAHILNRLIDIYCKSSN  428
            + R +A RYAA+L LC     T  +  LA  IHAN IT GF+PRAHILNRLID+YCKSS 
Sbjct  7    LIRTIANRYAANLTLCFPLRRT--SLQLARAIHANFITFGFQPRAHILNRLIDVYCKSSE  64

Query  429  LPYARHLFDEIPQPDIVARTTMIAAYSASGDPNLAAEIFDRTPLSMRDTVFYNARITGYS  608
            L YAR+LFDEIP+PD +ARTTM++ Y ASGD +LA  +F+ TPLSMRDT+ YNA ITG++
Sbjct  65   LRYARNLFDEIPEPDKIARTTMVSGYCASGDISLARSVFEETPLSMRDTIMYNAMITGFA  124

Query  609  HQNDGHAAIQVFNDMKRNNFQPD  677
            H +DG +A+ +F +M+R  F+PD
Sbjct  125  HSHDGCSAVNMFREMRREGFRPD  147



>ref|XP_006415862.1| hypothetical protein EUTSA_v10006846mg [Eutrema salsugineum]
 gb|ESQ34215.1| hypothetical protein EUTSA_v10006846mg [Eutrema salsugineum]
Length=787

 Score =   183 bits (465),  Expect = 8e-50, Method: Composition-based stats.
 Identities = 85/143 (59%), Positives = 108/143 (76%), Gaps = 2/143 (1%)
 Frame = +3

Query  249  ICRQLATRYAAHLQLCSSNIHTPATSSLATTIHANMITSGFKPRAHILNRLIDIYCKSSN  428
            + R +A RYAA+L+LC     T  +  LA  +H N+IT GF+PRAHILNRLID+YCKSS 
Sbjct  7    LVRAIANRYAANLRLCLPLRRT--SLQLARAVHGNIITFGFQPRAHILNRLIDVYCKSSE  64

Query  429  LPYARHLFDEIPQPDIVARTTMIAAYSASGDPNLAAEIFDRTPLSMRDTVFYNARITGYS  608
            L YAR LFDEI +PD +ARTTM++ Y ASGD  LA  +F+ TPLSMRDTV YNA ITG++
Sbjct  65   LHYARQLFDEISEPDKIARTTMVSGYCASGDVTLARCVFEETPLSMRDTVMYNAMITGFT  124

Query  609  HQNDGHAAIQVFNDMKRNNFQPD  677
            H +DG++AI +F +MKR  F+PD
Sbjct  125  HNHDGYSAINMFCEMKRQGFKPD  147


 Score = 60.1 bits (144),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 38/113 (34%), Positives = 60/113 (53%), Gaps = 2/113 (2%)
 Frame = +3

Query  345  HANMITSGFKPRAHILNRLIDIYCK-SSNLPYARHLFDEIPQPDIVARTTMIAAYSASGD  521
            HA  + SG      +LN L+ +Y K +S L  AR +FDEIP+ D  + TTMI  Y  +G 
Sbjct  172  HAAAMKSGAGYITSVLNALVSVYSKCASMLSSARKVFDEIPEKDERSWTTMITGYVKNGF  231

Query  522  PNLAAEIFDRTPLSMRDTVFYNARITGYSHQNDGHAAIQVFNDMKRNNFQPDQ  680
             +   ++ +    +MR  V YNA I+GY H+     A+++   M  +  + D+
Sbjct  232  FDSGQDLLEGMDENMR-LVAYNAMISGYVHRGLYQEALEMVRRMVSSGIELDE  283



>ref|XP_006306802.1| hypothetical protein CARUB_v10008344mg [Capsella rubella]
 gb|EOA39700.1| hypothetical protein CARUB_v10008344mg [Capsella rubella]
Length=790

 Score =   183 bits (464),  Expect = 1e-49, Method: Composition-based stats.
 Identities = 86/143 (60%), Positives = 107/143 (75%), Gaps = 2/143 (1%)
 Frame = +3

Query  249  ICRQLATRYAAHLQLCSSNIHTPATSSLATTIHANMITSGFKPRAHILNRLIDIYCKSSN  428
            + R +A RYAA+L+LC     T  +  LA  +HAN+IT GF+PRAHILNRLID+YCKSS 
Sbjct  7    LVRAIANRYAANLRLCLPIRRT--SLQLARAVHANIITFGFQPRAHILNRLIDVYCKSSE  64

Query  429  LPYARHLFDEIPQPDIVARTTMIAAYSASGDPNLAAEIFDRTPLSMRDTVFYNARITGYS  608
            L YAR LFDEI +PD +ARTTM++ Y ASGD  LA  +F+ T +SMRDTV YNA ITG+S
Sbjct  65   LRYARELFDEISEPDKIARTTMVSGYCASGDITLARGVFEETSVSMRDTVMYNAMITGFS  124

Query  609  HQNDGHAAIQVFNDMKRNNFQPD  677
            H NDG++AI++F  MK   FQPD
Sbjct  125  HNNDGYSAIKLFCKMKHEGFQPD  147


 Score = 56.2 bits (134),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 35/116 (30%), Positives = 60/116 (52%), Gaps = 5/116 (4%)
 Frame = +3

Query  345  HANMITSGFKPRAHILNRLIDIYCKSSNLPY----ARHLFDEIPQPDIVARTTMIAAYSA  512
            HA  + SG      + N L+ +Y K ++ P     AR +FDE+P+ D  + TTMI  Y  
Sbjct  172  HAAALKSGAGSITSVSNALVSVYSKCASSPSLLHSARKVFDEMPEKDERSWTTMITGYVK  231

Query  513  SGDPNLAAEIFDRTPLSMRDTVFYNARITGYSHQNDGHAAIQVFNDMKRNNFQPDQ  680
            +G  +L  E+ +    +M+  V YNA I+GY ++     A+++   M  +  + D+
Sbjct  232  NGCFDLGKELLEVMDENMK-VVAYNAMISGYVNRGLYQEALEMVRRMVSSGIELDE  286


 Score = 50.1 bits (118),  Expect = 8e-04, Method: Composition-based stats.
 Identities = 25/97 (26%), Positives = 50/97 (52%), Gaps = 2/97 (2%)
 Frame = +3

Query  384  HILNRLIDIYCKSSNLPYARHLFDEIPQPDIVARTTMIAAYSASGDPNLAAEIFDRTPLS  563
            H  N L+ +Y K      AR +F+++P  D+V+   +++ Y +SG    A  IF    + 
Sbjct  321  HFDNSLVSLYYKCGKFDEARAIFEKMPAKDLVSWNALLSGYVSSGHIGEAKLIFKE--MK  378

Query  564  MRDTVFYNARITGYSHQNDGHAAIQVFNDMKRNNFQP  674
             ++ + +   I+G +    G   +++F+ MK+  F+P
Sbjct  379  EKNILTWMIMISGLAENGFGEEGLKLFSCMKKEGFEP  415



>ref|XP_010477942.1| PREDICTED: pentatricopeptide repeat-containing protein At1g25360 
[Camelina sativa]
Length=790

 Score =   181 bits (459),  Expect = 5e-49, Method: Composition-based stats.
 Identities = 84/143 (59%), Positives = 105/143 (73%), Gaps = 2/143 (1%)
 Frame = +3

Query  249  ICRQLATRYAAHLQLCSSNIHTPATSSLATTIHANMITSGFKPRAHILNRLIDIYCKSSN  428
            + R +A  YAA L+LC     T  +  LA  +HAN+IT GF+PRAHILNRLID+YCKSS 
Sbjct  7    LVRAIANSYAASLRLCLPIRRT--SLQLARAVHANIITFGFQPRAHILNRLIDVYCKSSE  64

Query  429  LPYARHLFDEIPQPDIVARTTMIAAYSASGDPNLAAEIFDRTPLSMRDTVFYNARITGYS  608
            L YARHLFDEI +PD +A TTM++ Y ASGD  LA  +F+ TP+SMRDTV YNA ITG+S
Sbjct  65   LRYARHLFDEISEPDKIASTTMVSGYCASGDITLARGVFEETPVSMRDTVMYNAMITGFS  124

Query  609  HQNDGHAAIQVFNDMKRNNFQPD  677
            H NDG++A+ +F  MK   F+PD
Sbjct  125  HNNDGYSAVNLFCKMKHEGFKPD  147


 Score = 56.2 bits (134),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 36/116 (31%), Positives = 60/116 (52%), Gaps = 5/116 (4%)
 Frame = +3

Query  345  HANMITSGFKPRAHILNRLIDIYCKSSNLPY----ARHLFDEIPQPDIVARTTMIAAYSA  512
            HA  + SG      + N L+ +Y K ++ P     AR +FDEI + D  + TTMI  Y  
Sbjct  172  HAAALKSGAGSITSVSNALVSVYSKCASSPSLLHSARKVFDEILEKDERSWTTMITGYVK  231

Query  513  SGDPNLAAEIFDRTPLSMRDTVFYNARITGYSHQNDGHAAIQVFNDMKRNNFQPDQ  680
            +G  +L  E+ +    +M+  V YNA I+GY ++   H A+++   M  +  + D+
Sbjct  232  NGCFDLGKELVEVMDENMK-VVAYNAMISGYVNRGLYHEALEMVRSMVSSGIELDE  286


 Score = 50.8 bits (120),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 25/97 (26%), Positives = 49/97 (51%), Gaps = 2/97 (2%)
 Frame = +3

Query  384  HILNRLIDIYCKSSNLPYARHLFDEIPQPDIVARTTMIAAYSASGDPNLAAEIFDRTPLS  563
            H  N L+ +Y K      AR +F+++P  D+V+   +++ Y +SG    A  +F    + 
Sbjct  321  HFDNSLVSLYYKCGKFDEARAIFEKMPAKDLVSWNALLSGYVSSGHIGEAKLVFKE--MK  378

Query  564  MRDTVFYNARITGYSHQNDGHAAIQVFNDMKRNNFQP  674
             ++ + +   I+G +    G   +++F  MKR  F+P
Sbjct  379  EKNILTWMIMISGLAENGFGEEGLKLFTCMKREGFEP  415



>ref|XP_002893429.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH69688.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata 
subsp. lyrata]
Length=790

 Score =   181 bits (458),  Expect = 6e-49, Method: Composition-based stats.
 Identities = 84/143 (59%), Positives = 105/143 (73%), Gaps = 2/143 (1%)
 Frame = +3

Query  249  ICRQLATRYAAHLQLCSSNIHTPATSSLATTIHANMITSGFKPRAHILNRLIDIYCKSSN  428
            + R +A RYAA+L+LC     T  +  LA  +H N+IT GF+P AHILNRLID+YCKSS 
Sbjct  7    LVRAIANRYAANLRLCLPLRRT--SLQLARAVHGNIITFGFQPHAHILNRLIDVYCKSSE  64

Query  429  LPYARHLFDEIPQPDIVARTTMIAAYSASGDPNLAAEIFDRTPLSMRDTVFYNARITGYS  608
            L YAR LFDEI +PD +ARTTM++ Y ASGD  LA  +F+ TP+SMRDTV YNA ITG+S
Sbjct  65   LDYARQLFDEISEPDKIARTTMVSGYCASGDIALARSVFEETPVSMRDTVMYNAMITGFS  124

Query  609  HQNDGHAAIQVFNDMKRNNFQPD  677
            H NDG++AI +F  MK   F+PD
Sbjct  125  HNNDGYSAINLFCKMKHEGFKPD  147


 Score = 50.8 bits (120),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 26/97 (27%), Positives = 50/97 (52%), Gaps = 2/97 (2%)
 Frame = +3

Query  384  HILNRLIDIYCKSSNLPYARHLFDEIPQPDIVARTTMIAAYSASGDPNLAAEIFDRTPLS  563
            H  N L+ +Y K      AR +F+++P  D+V+   +++ Y +SG    A  IF    + 
Sbjct  321  HFDNSLVTLYYKCGKFNEARAIFEKMPAKDLVSWNALLSGYVSSGHIGEAKLIFKE--MK  378

Query  564  MRDTVFYNARITGYSHQNDGHAAIQVFNDMKRNNFQP  674
             ++ + +   I+G +    G   +++F+ MKR  F+P
Sbjct  379  EKNILSWMIMISGLAENGFGEEGLKLFSCMKREGFEP  415


 Score = 50.1 bits (118),  Expect = 7e-04, Method: Composition-based stats.
 Identities = 33/116 (28%), Positives = 58/116 (50%), Gaps = 5/116 (4%)
 Frame = +3

Query  345  HANMITSGFKPRAHILNRLIDIYCKSSNLPY----ARHLFDEIPQPDIVARTTMIAAYSA  512
            HA  + SG      + N L+ +Y + ++ P     AR +FD+IP+ D  + TTM+  Y  
Sbjct  172  HAAALKSGAGYVTSVSNALVSVYSRCASSPSLLHSARKVFDDIPEKDERSWTTMMTGYVK  231

Query  513  SGDPNLAAEIFDRTPLSMRDTVFYNARITGYSHQNDGHAAIQVFNDMKRNNFQPDQ  680
            +G  +L  E+      +M+  V YNA I+GY +      A+++   M  +  + D+
Sbjct  232  NGCFDLGKELLKGMDENMK-LVAYNAMISGYVNCGLYQEALEMVRRMVSSGIELDE  286



>gb|KFK44540.1| hypothetical protein AALP_AA1G270100 [Arabis alpina]
Length=795

 Score =   181 bits (458),  Expect = 8e-49, Method: Composition-based stats.
 Identities = 85/143 (59%), Positives = 106/143 (74%), Gaps = 2/143 (1%)
 Frame = +3

Query  249  ICRQLATRYAAHLQLCSSNIHTPATSSLATTIHANMITSGFKPRAHILNRLIDIYCKSSN  428
            + R +A RYAA+L+LC     T  +  LA  +H N+IT GF+PRAHILNRLID+YCKSS 
Sbjct  7    LVRAIAHRYAANLRLCLPIRRT--SLQLARAVHGNIITYGFQPRAHILNRLIDVYCKSSE  64

Query  429  LPYARHLFDEIPQPDIVARTTMIAAYSASGDPNLAAEIFDRTPLSMRDTVFYNARITGYS  608
            L YAR LFDEI +PD VARTTM++ Y AS D  LA  +F+ TPLSMRDTV YNA ITG+S
Sbjct  65   LSYARQLFDEISEPDKVARTTMVSGYCASRDIALARLVFEETPLSMRDTVMYNAMITGFS  124

Query  609  HQNDGHAAIQVFNDMKRNNFQPD  677
            H NDG++A+ +F  MK+  F+PD
Sbjct  125  HNNDGYSAVNLFCKMKQEGFKPD  147


 Score = 53.5 bits (127),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 39/121 (32%), Positives = 59/121 (49%), Gaps = 10/121 (8%)
 Frame = +3

Query  345  HANMITSGFKPRAHILNRLIDIYCK---------SSNLPYARHLFDEIPQPDIVARTTMI  497
            HA  +  G      +LN L+ +Y K         SS L  AR +FDEIP+ D  + TTMI
Sbjct  172  HAAALKCGAGYVTSVLNALVSVYSKCGSSSLSTSSSLLRSARKVFDEIPEKDERSWTTMI  231

Query  498  AAYSASGDPNLAAEIFDRTPLSMRDTVFYNARITGYSHQNDGHAAIQVFNDMKRNNFQPD  677
              Y  +G  +L  E+ +    +M+  V YNA I+GY H      A+++   M  +  + D
Sbjct  232  TGYVKNGCFDLGKELLEGMDENMK-LVAYNAMISGYVHHGLYQEALEMVRRMVSSGIELD  290

Query  678  Q  680
            +
Sbjct  291  E  291



>ref|NP_173907.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana]
 sp|Q9FRI5.1|PPR57_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At1g25360 
[Arabidopsis thaliana]
 gb|AAG28801.1|AC079374_4 hypothetical protein [Arabidopsis thaliana]
 gb|AEE30612.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana]
Length=790

 Score =   180 bits (456),  Expect = 1e-48, Method: Composition-based stats.
 Identities = 83/143 (58%), Positives = 105/143 (73%), Gaps = 2/143 (1%)
 Frame = +3

Query  249  ICRQLATRYAAHLQLCSSNIHTPATSSLATTIHANMITSGFKPRAHILNRLIDIYCKSSN  428
            + R +A RYAA+L+LC     T  +  LA  +H N+IT GF+PRAHILNRLID+YCKSS 
Sbjct  7    LVRAIANRYAANLRLCLPLRRT--SLQLARAVHGNIITFGFQPRAHILNRLIDVYCKSSE  64

Query  429  LPYARHLFDEIPQPDIVARTTMIAAYSASGDPNLAAEIFDRTPLSMRDTVFYNARITGYS  608
            L YAR LFDEI +PD +ARTTM++ Y ASGD  LA  +F++ P+ MRDTV YNA ITG+S
Sbjct  65   LNYARQLFDEISEPDKIARTTMVSGYCASGDITLARGVFEKAPVCMRDTVMYNAMITGFS  124

Query  609  HQNDGHAAIQVFNDMKRNNFQPD  677
            H NDG++AI +F  MK   F+PD
Sbjct  125  HNNDGYSAINLFCKMKHEGFKPD  147


 Score = 51.6 bits (122),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 26/97 (27%), Positives = 50/97 (52%), Gaps = 2/97 (2%)
 Frame = +3

Query  384  HILNRLIDIYCKSSNLPYARHLFDEIPQPDIVARTTMIAAYSASGDPNLAAEIFDRTPLS  563
            H  N L+ +Y K      AR +F+++P  D+V+   +++ Y +SG    A  IF    + 
Sbjct  321  HFDNSLVSLYYKCGKFDEARAIFEKMPAKDLVSWNALLSGYVSSGHIGEAKLIFKE--MK  378

Query  564  MRDTVFYNARITGYSHQNDGHAAIQVFNDMKRNNFQP  674
             ++ + +   I+G +    G   +++F+ MKR  F+P
Sbjct  379  EKNILSWMIMISGLAENGFGEEGLKLFSCMKREGFEP  415


 Score = 50.4 bits (119),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 34/116 (29%), Positives = 59/116 (51%), Gaps = 5/116 (4%)
 Frame = +3

Query  345  HANMITSGFKPRAHILNRLIDIYCKSSNLPY----ARHLFDEIPQPDIVARTTMIAAYSA  512
            HA  + SG      + N L+ +Y K ++ P     AR +FDEI + D  + TTM+  Y  
Sbjct  172  HAAALKSGAGYITSVSNALVSVYSKCASSPSLLHSARKVFDEILEKDERSWTTMMTGYVK  231

Query  513  SGDPNLAAEIFDRTPLSMRDTVFYNARITGYSHQNDGHAAIQVFNDMKRNNFQPDQ  680
            +G  +L  E+ +    +M+  V YNA I+GY ++     A+++   M  +  + D+
Sbjct  232  NGYFDLGEELLEGMDDNMK-LVAYNAMISGYVNRGFYQEALEMVRRMVSSGIELDE  286



>ref|XP_010499119.1| PREDICTED: pentatricopeptide repeat-containing protein At1g25360-like 
[Camelina sativa]
Length=790

 Score =   178 bits (451),  Expect = 6e-48, Method: Composition-based stats.
 Identities = 83/143 (58%), Positives = 104/143 (73%), Gaps = 2/143 (1%)
 Frame = +3

Query  249  ICRQLATRYAAHLQLCSSNIHTPATSSLATTIHANMITSGFKPRAHILNRLIDIYCKSSN  428
            + R +A  YAA L+LC     T  +  LA  +HAN+IT GF+PRAHILNRLID+YCKSS 
Sbjct  7    LVRAIANSYAASLRLCLPIRRT--SLQLARAVHANIITFGFQPRAHILNRLIDVYCKSSE  64

Query  429  LPYARHLFDEIPQPDIVARTTMIAAYSASGDPNLAAEIFDRTPLSMRDTVFYNARITGYS  608
            L YAR LFDEI +PD +A TTM++ Y ASGD  LA  +F+ TP+SMRDTV YNA ITG+S
Sbjct  65   LRYARQLFDEISEPDKIASTTMVSGYCASGDITLARGVFEETPVSMRDTVIYNAMITGFS  124

Query  609  HQNDGHAAIQVFNDMKRNNFQPD  677
            H NDG++A+ +F  MK   F+PD
Sbjct  125  HNNDGYSAVNLFCKMKHEGFKPD  147


 Score = 58.2 bits (139),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 36/116 (31%), Positives = 60/116 (52%), Gaps = 5/116 (4%)
 Frame = +3

Query  345  HANMITSGFKPRAHILNRLIDIYCKSSNLPY----ARHLFDEIPQPDIVARTTMIAAYSA  512
            HA  + SG      + N L+ +Y K ++ P     AR +FDEIP+ D  + TTMI  Y  
Sbjct  172  HAAALKSGAGSITSVSNALVSVYSKCASSPSLLHSARKVFDEIPEKDERSWTTMITGYVK  231

Query  513  SGDPNLAAEIFDRTPLSMRDTVFYNARITGYSHQNDGHAAIQVFNDMKRNNFQPDQ  680
            +G  +L  E+ +    +M+  V YNA I+GY ++     A+++   M  +  + D+
Sbjct  232  NGCFDLGKELLEVMDENMK-VVAYNAMISGYVNRGLYQEALEMVRSMVSSGIELDE  286



>emb|CDY36110.1| BnaA08g19380D [Brassica napus]
Length=517

 Score =   175 bits (444),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 85/139 (61%), Positives = 104/139 (75%), Gaps = 2/139 (1%)
 Frame = +3

Query  249  ICRQLATRYAAHLQLCSSNIHTPATSSLATTIHANMITSGFKPRAHILNRLIDIYCKSSN  428
            + R +A RYAA+L LC     T  +  LA  IHAN IT GF+PRAHILNRLID+Y KSS 
Sbjct  7    LIRTIANRYAANLTLCFPLRRT--SLQLARAIHANFITFGFQPRAHILNRLIDVYSKSSE  64

Query  429  LPYARHLFDEIPQPDIVARTTMIAAYSASGDPNLAAEIFDRTPLSMRDTVFYNARITGYS  608
            L YARHLFDEIP+PD +ARTTM++ YSASGD  LA  IF+ TPLSMRDT+ YNA ITG++
Sbjct  65   LRYARHLFDEIPEPDKIARTTMVSGYSASGDIALAQNIFEETPLSMRDTIMYNAMITGFT  124

Query  609  HQNDGHAAIQVFNDMKRNN  665
            H +DG +A+ +F +MKR  
Sbjct  125  HSHDGCSAVSMFREMKREG  143



>ref|XP_008228975.1| PREDICTED: pentatricopeptide repeat-containing protein At1g25360-like 
[Prunus mume]
Length=849

 Score =   177 bits (448),  Expect = 3e-47, Method: Composition-based stats.
 Identities = 85/144 (59%), Positives = 108/144 (75%), Gaps = 2/144 (1%)
 Frame = +3

Query  246  YICRQLATRYAAHLQLCSSNIHTPATSSLATTIHANMITSGFKPRAHILNRLIDIYCKSS  425
            +I   +A RY A LQLC     +P + S+A T HA+MI SGFKP  HILNRLID+Y KS 
Sbjct  57   FIFFTVAHRYLAQLQLCCP--QSPVSYSIARTTHAHMIVSGFKPCGHILNRLIDVYYKSL  114

Query  426  NLPYARHLFDEIPQPDIVARTTMIAAYSASGDPNLAAEIFDRTPLSMRDTVFYNARITGY  605
            N  YA  LFD+IP+PDIVARTT+I AYSA G+  LA +IF+ TPLSMRDTV YNA ITGY
Sbjct  115  NFSYAHQLFDQIPKPDIVARTTLITAYSAIGNLTLARKIFNETPLSMRDTVCYNAMITGY  174

Query  606  SHQNDGHAAIQVFNDMKRNNFQPD  677
            S  NDG+A+I++F +M++ +F+P+
Sbjct  175  SRNNDGYASIRLFCEMRQGSFRPN  198


 Score = 57.8 bits (138),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 35/122 (29%), Positives = 62/122 (51%), Gaps = 11/122 (9%)
 Frame = +3

Query  342  IHANMITSGFKPRAHILNRLIDIYCKSSN---------LPYARHLFDEIPQPDIVARTTM  494
            +H  ++ SG      + N L+ +Y + ++         +  AR+LF+E+P+ D ++ TTM
Sbjct  222  LHCAVVKSGTGFATSVWNALLSVYVRCASSPLVSSSSLMGEARNLFNEMPERDELSWTTM  281

Query  495  IAAYSASGDPNLAAEIFDRTPLSMRDTVFYNARITGYSHQNDGHAAIQVFNDMKRNNFQP  674
            I  Y  + D + A E+ D   +  R  V +NA I+GY+H N    A+ +F  M+      
Sbjct  282  ITGYIRNEDLHAARELLD--GMDERMEVVWNAMISGYAHHNSFQEALLLFRKMRLVGIHQ  339

Query  675  DQ  680
            D+
Sbjct  340  DE  341


 Score = 55.8 bits (133),  Expect = 9e-06, Method: Composition-based stats.
 Identities = 34/138 (25%), Positives = 64/138 (46%), Gaps = 10/138 (7%)
 Frame = +3

Query  273  YAAHLQLCSSNIHTPATSSLATTIHANMITSGFKPRA----HILNRLIDIYCKSSNLPYA  440
            Y + +  C++N        L   +HA ++ +  KP       + N L+ +Y K   L  A
Sbjct  344  YTSVISSCANN----GLFQLGKQVHAYILRTEAKPTVDFSLSVNNTLLTLYYKCGKLDEA  399

Query  441  RHLFDEIPQPDIVARTTMIAAYSASGDPNLAAEIFDRTPLSMRDTVFYNARITGYSHQND  620
            R++F+ +P  D+V+   +++ Y  +G    A   F   P   R  + +   I+G +    
Sbjct  400  RYIFNNMPVKDLVSWNAILSGYVRAGRIQEAKSFFKEMP--ERSILTWTVMISGLARNGL  457

Query  621  GHAAIQVFNDMKRNNFQP  674
            G  A+++FN M+   F+P
Sbjct  458  GEEAMKLFNQMRLEGFEP  475



>gb|KCW67919.1| hypothetical protein EUGRSUZ_F01621 [Eucalyptus grandis]
Length=759

 Score =   176 bits (446),  Expect = 3e-47, Method: Composition-based stats.
 Identities = 78/108 (72%), Positives = 91/108 (84%), Gaps = 0/108 (0%)
 Frame = +3

Query  354  MITSGFKPRAHILNRLIDIYCKSSNLPYARHLFDEIPQPDIVARTTMIAAYSASGDPNLA  533
            MI SG KPR HI+NRLID+YCKSSN+ YARHLFD IPQPD+VARTT+IAAY+ +G   LA
Sbjct  1    MIASGLKPRGHIVNRLIDVYCKSSNIGYARHLFDGIPQPDVVARTTLIAAYAGAGGLKLA  60

Query  534  AEIFDRTPLSMRDTVFYNARITGYSHQNDGHAAIQVFNDMKRNNFQPD  677
             EIFD TPL MRDTV YNA ITGYSH NDGHAA+++F DM+R+ F+PD
Sbjct  61   REIFDGTPLGMRDTVCYNAMITGYSHNNDGHAAVRLFLDMRRHGFKPD  108


 Score = 50.1 bits (118),  Expect = 8e-04, Method: Composition-based stats.
 Identities = 30/115 (26%), Positives = 53/115 (46%), Gaps = 6/115 (5%)
 Frame = +3

Query  342  IHANMITSGFKPRAH----ILNRLIDIYCKSSNLPYARHLFDEIPQPDIVARTTMIAAYS  509
            IHA ++ +   P  H    + N LI +Y K      AR +F+ +P  DIV+   +++ Y 
Sbjct  273  IHAYILKTESSPTQHFALSVNNSLITLYMKFGKFDEARKVFNAMPVRDIVSWNAVLSGYV  332

Query  510  ASGDPNLAAEIFDRTPLSMRDTVFYNARITGYSHQNDGHAAIQVFNDMKRNNFQP  674
                   A  +F   P   R+ + +   I+G +    G   +++FN M+   F+P
Sbjct  333  NERRLEEARTLFSEMP--ERNLLTWTVMISGLAQNGFGEEGLKMFNQMRLEGFEP  385



>ref|XP_010549219.1| PREDICTED: pentatricopeptide repeat-containing protein At1g25360 
[Tarenaya hassleriana]
Length=789

 Score =   175 bits (443),  Expect = 1e-46, Method: Composition-based stats.
 Identities = 81/141 (57%), Positives = 107/141 (76%), Gaps = 2/141 (1%)
 Frame = +3

Query  255  RQLATRYAAHLQLCSSNIHTPATSSLATTIHANMITSGFKPRAHILNRLIDIYCKSSNLP  434
            R +A RYAA+L+LC     T A+  LA +IHAN+  SGF+PRAHI+NRLID YCKSS L 
Sbjct  9    RIIANRYAAYLRLCFPP--TGASLPLALSIHANITASGFRPRAHIVNRLIDFYCKSSKLD  66

Query  435  YARHLFDEIPQPDIVARTTMIAAYSASGDPNLAAEIFDRTPLSMRDTVFYNARITGYSHQ  614
            YAR LFDEIP+ D +ART+MI+ YS SG+  L+  +F  TPLS+RDT+ YNA IT +SH 
Sbjct  67   YARTLFDEIPKQDGIARTSMISGYSNSGNIKLSCRVFLETPLSLRDTIMYNAMITAFSHN  126

Query  615  NDGHAAIQVFNDMKRNNFQPD  677
            NDG++A+ +F++MK + F+PD
Sbjct  127  NDGYSALNLFSEMKCDGFRPD  147


 Score = 56.6 bits (135),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 36/121 (30%), Positives = 58/121 (48%), Gaps = 11/121 (9%)
 Frame = +3

Query  345  HANMITSGFKPRAHILNRLIDIYCKSSNLPYA---------RHLFDEIPQPDIVARTTMI  497
            H  ++ SG      +LN LI +Y K ++ PYA         R +FDEIP  D ++ T+MI
Sbjct  172  HGAVVKSGVGYATSVLNALISVYVKCASSPYAAPSSLLGAARKVFDEIPTKDELSWTSMI  231

Query  498  AAYSASGDPNLAAEIFDRTPLSMRDTVFYNARITGYSHQNDGHAAIQVFNDMKRNNFQPD  677
              Y  +G  +   E+       M+  V +NA I+GY H+     A+ +   M  +  + D
Sbjct  232  TGYVKNGLLDAGKELLAGMDEKMQ--VAWNAMISGYVHRGLYREALDMVRRMLSSGIELD  289

Query  678  Q  680
            +
Sbjct  290  E  290



>gb|EPS72239.1| hypothetical protein M569_02517, partial [Genlisea aurea]
Length=786

 Score =   174 bits (440),  Expect = 2e-46, Method: Composition-based stats.
 Identities = 81/140 (58%), Positives = 101/140 (72%), Gaps = 2/140 (1%)
 Frame = +3

Query  258  QLATRYAAHLQLCSSNIHTPATSSLATTIHANMITSGFKPRAHILNRLIDIYCKSSNLPY  437
            + A  YA  L+LC      PA  SLA  +H +MI SGF PR HILNRLID+YCKSS   Y
Sbjct  4    EAANLYAGKLRLCWEK--GPAGYSLAGGVHGHMIVSGFIPRRHILNRLIDMYCKSSCFDY  61

Query  438  ARHLFDEIPQPDIVARTTMIAAYSASGDPNLAAEIFDRTPLSMRDTVFYNARITGYSHQN  617
            AR +FDEIPQPD+V RTT+IAAYS+ G+P +A  +FD TP+ +RD + YNA IT YSH +
Sbjct  62   ARKMFDEIPQPDVVTRTTLIAAYSSYGNPKMARVLFDATPVGIRDNICYNAMITCYSHND  121

Query  618  DGHAAIQVFNDMKRNNFQPD  677
            DG AA+++F DMKR+ F PD
Sbjct  122  DGCAALKLFVDMKRDGFTPD  141


 Score = 55.5 bits (132),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 31/91 (34%), Positives = 49/91 (54%), Gaps = 2/91 (2%)
 Frame = +3

Query  342  IHANMITSGFKPRAHILNRLIDIYCKSSNLPYARHLFDEIPQPDIVARTTMIAAYSASGD  521
            +H  +I SG      +LN L+ +Y K  ++  AR LFDE+   D ++ TT+IA Y  + D
Sbjct  166  LHCAVIKSGCGQVTSVLNALVSVYVKCESMASARLLFDEMVHKDELSWTTIIAGYVKNDD  225

Query  522  PNLAAEIFDRTPLSMRDTVFYNARITGYSHQ  614
               A E+FD     +   V +NA ++GY  +
Sbjct  226  LAAAREVFDGMDEEL--VVAWNAMMSGYVQK  254


 Score = 50.8 bits (120),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 34/131 (26%), Positives = 59/131 (45%), Gaps = 7/131 (5%)
 Frame = +3

Query  273  YAAHLQLCSSN---IHTPATSSLATTIHANMITSGFKPRAHILNRLIDIYCKSSNLPYAR  443
            Y + L  C+ +   +H            A  +TS      H  N LI +Y +   +  A+
Sbjct  279  YTSVLSACADSELFLHGRELHGYIIKTEAKRLTSDLVVSIH--NALITLYWRCGKILQAK  336

Query  444  HLFDEIPQPDIVARTTMIAAYSASGDPNLAAEIFDRTPLSMRDTVFYNARITGYSHQNDG  623
             +FD  P  D+V+   M++A+   G    A  IFD  P   ++ + +   I+G + Q  G
Sbjct  337  QVFDGAPIKDLVSCNAMLSAFVGCGKLREAKRIFDGMP--EKNHLSWTVMISGLAQQGSG  394

Query  624  HAAIQVFNDMK  656
              A+++FN M+
Sbjct  395  EEALKLFNLMR  405



>ref|XP_009378934.1| PREDICTED: pentatricopeptide repeat-containing protein At1g25360 
[Pyrus x bretschneideri]
Length=759

 Score =   170 bits (430),  Expect = 4e-45, Method: Composition-based stats.
 Identities = 76/108 (70%), Positives = 89/108 (82%), Gaps = 0/108 (0%)
 Frame = +3

Query  354  MITSGFKPRAHILNRLIDIYCKSSNLPYARHLFDEIPQPDIVARTTMIAAYSASGDPNLA  533
            MI SGF PR HILNRLIDIYCKSSN+ YAR LFD+IP+PDIVARTT++ AYS  G+  LA
Sbjct  1    MIASGFSPRGHILNRLIDIYCKSSNIRYARQLFDKIPKPDIVARTTLVKAYSVIGNLTLA  60

Query  534  AEIFDRTPLSMRDTVFYNARITGYSHQNDGHAAIQVFNDMKRNNFQPD  677
             +IFD TPLSMRDTV YNA ITG+SH NDG+AA+ +F DM+R N +PD
Sbjct  61   RKIFDETPLSMRDTVSYNAMITGHSHNNDGYAAVSLFCDMRRGNIRPD  108


 Score = 53.5 bits (127),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 34/122 (28%), Positives = 60/122 (49%), Gaps = 11/122 (9%)
 Frame = +3

Query  342  IHANMITSGFKPRAHILNRLIDIYCKSSN---------LPYARHLFDEIPQPDIVARTTM  494
            +H  ++ SG      + N L+ +Y K ++         +  AR LFDE+P+ D ++ TTM
Sbjct  132  LHCGIVKSGTAFATSVWNALLSVYVKCASSPLVSSSSLMREARKLFDEMPKRDELSWTTM  191

Query  495  IAAYSASGDPNLAAEIFDRTPLSMRDTVFYNARITGYSHQNDGHAAIQVFNDMKRNNFQP  674
            I  Y  + D + A E+ D   +  +  V +NA I+GY   +    A+ +F  M+    + 
Sbjct  192  ITGYVRNEDLDAARELLD--GMDEKLEVAWNAMISGYVRHDSFQEALLLFRKMRLLGIRQ  249

Query  675  DQ  680
            D+
Sbjct  250  DE  251



>ref|XP_003590744.1| Pentatricopeptide repeat-containing protein [Medicago truncatula]
 gb|AES60995.1| pentatricopeptide (PPR) repeat protein [Medicago truncatula]
Length=795

 Score =   170 bits (430),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 82/141 (58%), Positives = 103/141 (73%), Gaps = 6/141 (4%)
 Frame = +3

Query  255  RQLATRYAAHLQLCSSNIHTPATSSLATTIHANMITSGFKPRAHILNRLIDIYCKSSNLP  434
            R LA RY   L       H   T  +A  +HA+++TSGFKP   ILNRLI+IYCKSSN+ 
Sbjct  4    RDLAYRYLTQLN------HVSTTQIIARAVHAHILTSGFKPNTFILNRLINIYCKSSNIT  57

Query  435  YARHLFDEIPQPDIVARTTMIAAYSASGDPNLAAEIFDRTPLSMRDTVFYNARITGYSHQ  614
            YAR LFD+IP+PDIVARTT+++AYS+SG+  LA ++F+ TPL++RDTV YNA IT YSH 
Sbjct  58   YARKLFDKIPKPDIVARTTLLSAYSSSGNVKLAQQLFNATPLTIRDTVSYNAMITAYSHG  117

Query  615  NDGHAAIQVFNDMKRNNFQPD  677
            NDGHAA+ +F  MKR  F PD
Sbjct  118  NDGHAALNLFVQMKRYGFLPD  138


 Score = 56.2 bits (134),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 32/138 (23%), Positives = 60/138 (43%), Gaps = 6/138 (4%)
 Frame = +3

Query  273  YAAHLQLCSSNIHTPATSSLATTIHANMITSGFKPRAHIL----NRLIDIYCKSSNLPYA  440
            Y + +  C S        +    +H  ++ +  +P  H +    N LI  Y K   +  A
Sbjct  286  YTSLISACGSCNEKMGMFNCGRQVHGYILRTVVEPSHHFVLSVNNALITFYTKYDRMIEA  345

Query  441  RHLFDEIPQPDIVARTTMIAAYSASGDPNLAAEIFDRTPLSMRDTVFYNARITGYSHQND  620
            R +FD++P  DI++   +++ Y  +     A  IF   P   R+ + +   I+G +    
Sbjct  346  RRVFDKMPVRDIISWNAVLSGYVNAQRIEEANSIFSEMP--ERNVLTWTVMISGLAQNGF  403

Query  621  GHAAIQVFNDMKRNNFQP  674
            G   +++FN MK    +P
Sbjct  404  GEEGLKLFNQMKSEGLEP  421



>ref|XP_004495263.1| PREDICTED: pentatricopeptide repeat-containing protein At1g25360-like 
[Cicer arietinum]
Length=795

 Score =   169 bits (429),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 84/141 (60%), Positives = 105/141 (74%), Gaps = 6/141 (4%)
 Frame = +3

Query  255  RQLATRYAAHLQLCSSNIHTPATSSLATTIHANMITSGFKPRAHILNRLIDIYCKSSNLP  434
            R +A RY   L       HT AT +LA  IHA++ITSGF P   ILNRLI+IYCKSSN+ 
Sbjct  4    RDMAYRYLTQLT------HTSATKTLARAIHAHIITSGFTPNTFILNRLINIYCKSSNIT  57

Query  435  YARHLFDEIPQPDIVARTTMIAAYSASGDPNLAAEIFDRTPLSMRDTVFYNARITGYSHQ  614
            YAR LFD+IP+PDIVARTT+++AYS+SG+  LA E+F+ TPL++ DTV YNA IT YS  
Sbjct  58   YARKLFDKIPKPDIVARTTLLSAYSSSGNIKLAQELFNTTPLTIHDTVSYNAMITAYSRG  117

Query  615  NDGHAAIQVFNDMKRNNFQPD  677
            NDGHAA+++F  MKR +F PD
Sbjct  118  NDGHAALKLFLQMKRLSFLPD  138



>ref|XP_010672235.1| PREDICTED: pentatricopeptide repeat-containing protein At1g25360 
[Beta vulgaris subsp. vulgaris]
Length=813

 Score =   167 bits (422),  Expect = 9e-44, Method: Composition-based stats.
 Identities = 86/165 (52%), Positives = 110/165 (67%), Gaps = 5/165 (3%)
 Frame = +3

Query  192  MKNGAAAAKSF--ESWAQGIYICRQLATRYAAHLQLCSSNIHTPATSSLATTIHANMITS  365
            M+N A  A +F   ++ Q I   R+LA RYAA LQLC     +P + S A  IHA+M TS
Sbjct  1    MRNAAQYAINFTRNNFPQQIDF-RELANRYAAQLQLCCPP--SPTSHSRARAIHAHMTTS  57

Query  366  GFKPRAHILNRLIDIYCKSSNLPYARHLFDEIPQPDIVARTTMIAAYSASGDPNLAAEIF  545
            GF PR H+++RLIDIYCKS NL YA  LFD++P+PDIVARTTM++AY    D   A  IF
Sbjct  58   GFNPRGHLIDRLIDIYCKSKNLVYAHRLFDKMPEPDIVARTTMVSAYCNLRDMKEARRIF  117

Query  546  DRTPLSMRDTVFYNARITGYSHQNDGHAAIQVFNDMKRNNFQPDQ  680
            D  PL +RD V YNA ITGY+H +DG +A+ +F  M R+  +PD 
Sbjct  118  DEIPLRIRDVVSYNAMITGYNHNDDGVSAVLLFGKMMRDGCRPDH  162


 Score = 60.1 bits (144),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 38/122 (31%), Positives = 59/122 (48%), Gaps = 11/122 (9%)
 Frame = +3

Query  342  IHANMITSGFKPRAHILNRLIDIYCKSSNLPY---------ARHLFDEIPQPDIVARTTM  494
            +H  ++ SG      +LN LI +Y K ++ P+         AR +FDE+   D +  TTM
Sbjct  185  MHCAVVKSGTWCSTSVLNALISLYVKCASSPFVVASSLLGVAREIFDEMGDKDELTWTTM  244

Query  495  IAAYSASGDPNLAAEIFDRTPLSMRDTVFYNARITGYSHQNDGHAAIQVFNDMKRNNFQP  674
            I  Y+ + D   A ++FD T  S +    +NA I+GY H      A+ +F  M     Q 
Sbjct  245  ITGYTRNDDLESARKVFDST--SEKVVAVWNAMISGYVHHGLYSEALGLFRRMNVEGIQH  302

Query  675  DQ  680
            D+
Sbjct  303  DE  304


 Score = 55.1 bits (131),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 29/99 (29%), Positives = 53/99 (54%), Gaps = 2/99 (2%)
 Frame = +3

Query  378  RAHILNRLIDIYCKSSNLPYARHLFDEIPQPDIVARTTMIAAYSASGDPNLAAEIFDRTP  557
            R+ I N L+ +Y K   +  ARH+FDE+P  DIV+   +++ Y+ +G    A + F++ P
Sbjct  344  RSSISNALVTLYSKCGRIHEARHIFDEMPIRDIVSWNAVLSGYTTAGLILEAKDFFNKMP  403

Query  558  LSMRDTVFYNARITGYSHQNDGHAAIQVFNDMKRNNFQP  674
               ++ + +   I   +    G  +I++ N M+   FQP
Sbjct  404  --EKNHLSWAVMIAANAQSGFGEESIKLLNKMRIELFQP  440



>ref|XP_004301492.2| PREDICTED: pentatricopeptide repeat-containing protein At1g25360 
[Fragaria vesca subsp. vesca]
Length=754

 Score =   164 bits (415),  Expect = 4e-43, Method: Composition-based stats.
 Identities = 72/109 (66%), Positives = 86/109 (79%), Gaps = 0/109 (0%)
 Frame = +3

Query  354  MITSGFKPRAHILNRLIDIYCKSSNLPYARHLFDEIPQPDIVARTTMIAAYSASGDPNLA  533
            MI SGF PR HILNRLID+YCKS+NL YA HLFDEIP PDIVARTT+++AYS  GD  LA
Sbjct  1    MIASGFSPRGHILNRLIDVYCKSNNLRYALHLFDEIPNPDIVARTTLVSAYSGVGDVTLA  60

Query  534  AEIFDRTPLSMRDTVFYNARITGYSHQNDGHAAIQVFNDMKRNNFQPDQ  680
              +F  TP+SMRDTV YNA ITGYS   DG+AA+++F +M+R  F+PD 
Sbjct  61   RRVFRETPVSMRDTVSYNAMITGYSQNRDGNAAVELFREMRRGGFRPDH  109


 Score = 56.6 bits (135),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 36/119 (30%), Positives = 61/119 (51%), Gaps = 10/119 (8%)
 Frame = +3

Query  342  IHANMITSGFKPRAHILNRLIDIYCKSSN----LPYARHLFDEIPQPDIVARTTMIAAYS  509
            +H  ++ SG      + N L+ +Y K ++    +  AR +FDE+ + D ++ TTMI  Y 
Sbjct  132  LHCAIVKSGVLLATSVSNALVSVYVKCASSLVVVAAARKVFDEMDKRDELSWTTMITGYV  191

Query  510  ASGDPNLAAEIFDRTPLSMRDT--VFYNARITGYSHQNDGHAAIQVFNDMKRNNFQPDQ  680
             + D + A ++ D     M D   V +NA I+GY H    H A+Q+F +M     + D+
Sbjct  192  RNEDLDGARQLLD----GMDDKLEVAWNAMISGYVHHGFCHEALQLFREMHLMGIRQDE  246


 Score = 53.1 bits (126),  Expect = 7e-05, Method: Composition-based stats.
 Identities = 34/144 (24%), Positives = 66/144 (46%), Gaps = 10/144 (7%)
 Frame = +3

Query  255  RQLATRYAAHLQLCSSNIHTPATSSLATTIHANMITSGFKPRA----HILNRLIDIYCKS  422
            RQ    Y + +  C++N            +HA ++ S  KP       + N L+ +Y + 
Sbjct  243  RQDEYTYTSVISACANN----GLFKHGKQLHAYILRSEAKPTVDFSLSVNNALVTLYFRC  298

Query  423  SNLPYARHLFDEIPQPDIVARTTMIAAYSASGDPNLAAEIFDRTPLSMRDTVFYNARITG  602
              +  ARH+F+ +   D+V+   +++ Y  +G    A   F+  P   R  + +   I+G
Sbjct  299  GKIDEARHIFNNMSVRDLVSWNAILSGYVNAGRIQEAKSFFEEMP--ERSGLSWTVIISG  356

Query  603  YSHQNDGHAAIQVFNDMKRNNFQP  674
             +    G  A+++FN M+ + F+P
Sbjct  357  LAQNGYGEDAMKLFNQMRLDGFKP  380



>gb|KJB26847.1| hypothetical protein B456_004G262700 [Gossypium raimondii]
Length=761

 Score =   163 bits (413),  Expect = 1e-42, Method: Composition-based stats.
 Identities = 80/137 (58%), Positives = 101/137 (74%), Gaps = 3/137 (2%)
 Frame = +3

Query  237  QGIYICRQLATRYAAHLQLCSSNIHTPATSSLATTIHANMITSGFKPRAHILNRLIDIYC  416
            +G    R +A RYA+ LQLC     T A+ SLA TIH++MIT GF PR H+LNRLID+Y 
Sbjct  2    KGSDFIRTVANRYASQLQLCYP--QTLASFSLAKTIHSHMITFGFHPRGHLLNRLIDVYS  59

Query  417  KSSNLPYARHLFDEIPQPDIVARTTMIAAYSASGDPNLAAEIFDRTPLSMRDTVFYNARI  596
            KSS + YARHLFD+IP+PDI +RT+++ AYS SGD   A ++F+ TPLS+RD+VFYNA I
Sbjct  60   KSSKIIYARHLFDQIPEPDIASRTSLLLAYSLSGDVKTAQKMFEETPLSIRDSVFYNAMI  119

Query  597  TGYSHQNDGHAAIQVFN  647
            TGYS   DG  A +VFN
Sbjct  120  TGYSRNEDGGLA-RVFN  135


 Score = 63.5 bits (153),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 34/119 (29%), Positives = 59/119 (50%), Gaps = 6/119 (5%)
 Frame = +3

Query  330  LATTIHANMITSGFKPRAH----ILNRLIDIYCKSSNLPYARHLFDEIPQPDIVARTTMI  497
            L   +H  ++ +  KP       + N LI +YCK   + +AR +FD +P  DIV+   ++
Sbjct  271  LGKQVHCYVLRTEAKPTLDFSLPVNNALITLYCKCDKVDWARRIFDNMPVRDIVSWNAIL  330

Query  498  AAYSASGDPNLAAEIFDRTPLSMRDTVFYNARITGYSHQNDGHAAIQVFNDMKRNNFQP  674
            + Y  +G  +     F + P   R+ + +N  I+G +    G   +++FN MK   FQP
Sbjct  331  SGYVNAGRIDEGRLFFSKMP--ERNHLTWNVMISGLAQNGFGEEGLKLFNQMKSEGFQP  387


 Score = 53.1 bits (126),  Expect = 7e-05, Method: Composition-based stats.
 Identities = 32/104 (31%), Positives = 54/104 (52%), Gaps = 2/104 (2%)
 Frame = +3

Query  342  IHANMITSGFKPRAHILNRLIDIYCKSSNLPYARHLFDEIPQPDIVARTTMIAAYSASGD  521
            +H  ++ +G      +LN L+ +Y     +  AR LFDEI   D ++ TT++  Y  + +
Sbjct  143  LHGLVLKTGTGFFTSVLNALVSVYVNCGLMFEARKLFDEIDTKDELSWTTIVTGYVRNDE  202

Query  522  PNLAAEIFDRTPLSMRDTVFYNARITGYSHQNDGHAAIQVFNDM  653
             + A E+ D   +S +  V +NA I+GY H N    A+ +F  M
Sbjct  203  LDAARELVD--GMSEKLAVAWNAMISGYVHCNRYDEAVDMFRKM  244



>ref|XP_003535453.2| PREDICTED: pentatricopeptide repeat-containing protein At1g25360-like 
[Glycine max]
Length=787

 Score =   161 bits (408),  Expect = 6e-42, Method: Composition-based stats.
 Identities = 79/139 (57%), Positives = 102/139 (73%), Gaps = 10/139 (7%)
 Frame = +3

Query  261  LATRYAAHLQLCSSNIHTPATSSLATTIHANMITSGFKPRAHILNRLIDIYCKSSNLPYA  440
            +  RY A L       HT    S A  +HA+++TSGFKP   I+NRLID YCKS N+PYA
Sbjct  6    MGNRYLAQLS------HT----SFARAVHAHILTSGFKPFPLIINRLIDHYCKSFNIPYA  55

Query  441  RHLFDEIPQPDIVARTTMIAAYSASGDPNLAAEIFDRTPLSMRDTVFYNARITGYSHQND  620
            R+LFD+IP+PDIVA TTM++AYSA+G+  LA ++F+ TP+S+RDTV YNA IT +SH +D
Sbjct  56   RYLFDKIPKPDIVAATTMLSAYSAAGNIKLAHQLFNATPMSIRDTVSYNAMITAFSHSHD  115

Query  621  GHAAIQVFNDMKRNNFQPD  677
            GHAA+Q+F  MKR  F PD
Sbjct  116  GHAALQLFVQMKRLGFVPD  134


 Score = 50.4 bits (119),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 29/120 (24%), Positives = 57/120 (48%), Gaps = 6/120 (5%)
 Frame = +3

Query  327  SLATTIHANMITSGFKPRAHIL----NRLIDIYCKSSNLPYARHLFDEIPQPDIVARTTM  494
            ++   +HA ++ +  +P  H +    N LI +Y +   L  AR +FD++P  D+V+   +
Sbjct  296  NIGRQVHAYVLRTVVQPSGHFVLSVNNALITLYTRCGKLVEARRVFDKMPVKDLVSWNAI  355

Query  495  IAAYSASGDPNLAAEIFDRTPLSMRDTVFYNARITGYSHQNDGHAAIQVFNDMKRNNFQP  674
            ++    +     A  IF   P+  R  + +   I+G +    G   +++FN MK    +P
Sbjct  356  LSGCVNARRIEEANSIFREMPV--RSLLTWTVMISGLAQNGFGEEGLKLFNQMKLEGLEP  413



>ref|XP_007144135.1| hypothetical protein PHAVU_007G131600g [Phaseolus vulgaris]
 gb|ESW16129.1| hypothetical protein PHAVU_007G131600g [Phaseolus vulgaris]
Length=787

 Score =   160 bits (404),  Expect = 3e-41, Method: Composition-based stats.
 Identities = 79/141 (56%), Positives = 103/141 (73%), Gaps = 10/141 (7%)
 Frame = +3

Query  255  RQLATRYAAHLQLCSSNIHTPATSSLATTIHANMITSGFKPRAHILNRLIDIYCKSSNLP  434
            R +  RY A L       HT    SLA  +HA+++TSGF P   I+NRLID YCKSSN+P
Sbjct  4    RTMGNRYLAQLT------HT----SLARAVHAHILTSGFNPFPLIINRLIDHYCKSSNIP  53

Query  435  YARHLFDEIPQPDIVARTTMIAAYSASGDPNLAAEIFDRTPLSMRDTVFYNARITGYSHQ  614
            YARHLFD+I +PDIVA TT+++AYSA+G+  LA ++F+ TPL++RDTV YNA IT +SH 
Sbjct  54   YARHLFDKISKPDIVATTTLLSAYSAAGNIKLAHQLFNATPLTIRDTVSYNAMITAFSHS  113

Query  615  NDGHAAIQVFNDMKRNNFQPD  677
            +DG+AA+Q+F  MKR  F PD
Sbjct  114  HDGYAALQLFVQMKRLGFVPD  134



>ref|XP_010942837.1| PREDICTED: pentatricopeptide repeat-containing protein At1g25360-like 
[Elaeis guineensis]
Length=818

 Score =   134 bits (337),  Expect = 4e-32, Method: Composition-based stats.
 Identities = 75/153 (49%), Positives = 98/153 (64%), Gaps = 13/153 (8%)
 Frame = +3

Query  258  QLATRYAAHLQLCSSNIHTPATSSLATT-----------IHANMITSGFKPRAHILNRLI  404
            +LA R+AAHLQL S+ +   + S  ATT           +HA+++ SGFKPRAHILNRLI
Sbjct  20   KLANRFAAHLQLLSAVLPKTSASPPATTSPTPLLRRLRALHAHVLASGFKPRAHILNRLI  79

Query  405  DIYCKSSNLPYARHLFDEIPQPDIVAR--TTMIAAYSASGDPNLAAEIFDRTPLSMRDTV  578
            D+Y KS +LP AR LFD        A   T+++ AY+ASG   LA  +FDRTPL  RDTV
Sbjct  80   DLYAKSGDLPSARCLFDAASPAPADAVAATSLVNAYAASGHLPLARRLFDRTPLPARDTV  139

Query  579  FYNARITGYSHQNDGHAAIQVFNDMKRNNFQPD  677
            FYNA I+ Y+   DG  A+ VF +M ++ F+PD
Sbjct  140  FYNAMISSYARAGDGLPALVVFREMLQDGFRPD  172


 Score = 50.4 bits (119),  Expect = 7e-04, Method: Composition-based stats.
 Identities = 34/107 (32%), Positives = 54/107 (50%), Gaps = 5/107 (5%)
 Frame = +3

Query  342  IHANMITSGFKPRAHILNRLIDIY--CKSSNLP-YARHLFDEIPQPDIVARTTMIAAYSA  512
            +H +++ SG +    + N LI +Y  C S      AR +FD + + D +  TTM+  Y  
Sbjct  197  LHCSVVKSGTEHAISVSNALISLYFKCDSPETAVLAREVFDRMVERDELTWTTMVVGYVR  256

Query  513  SGDPNLAAEIFDRTPLSMRDTVFYNARITGYSHQNDGHAAIQVFNDM  653
             GD   A ++FD   +  R  V +NA I+GY H      A+++F  M
Sbjct  257  RGDIGEARQVFD--DVEGRFNVIWNAMISGYVHCGLFLEALEMFRRM  301



>ref|XP_008787226.1| PREDICTED: pentatricopeptide repeat-containing protein At1g25360-like 
[Phoenix dactylifera]
Length=817

 Score =   129 bits (323),  Expect = 3e-30, Method: Composition-based stats.
 Identities = 63/114 (55%), Positives = 84/114 (74%), Gaps = 2/114 (2%)
 Frame = +3

Query  342  IHANMITSGFKPRAHILNRLIDIYCKSSNLPYARHLFDEI-PQP-DIVARTTMIAAYSAS  515
            +HA+++ SGFKPRAHILNRLID+Y K+ +LP AR LFD   P P D VA T+++ AY+A+
Sbjct  58   LHAHILASGFKPRAHILNRLIDLYAKAGDLPSARRLFDAASPAPTDAVAATSLVNAYAAA  117

Query  516  GDPNLAAEIFDRTPLSMRDTVFYNARITGYSHQNDGHAAIQVFNDMKRNNFQPD  677
            G   LA  +FDRTPL  RDTVFYNA I+GY+   +G  A+ VF +M ++ F+PD
Sbjct  118  GHLPLARCLFDRTPLPARDTVFYNAMISGYARAGNGLPALLVFCEMLQDGFRPD  171


 Score = 53.1 bits (126),  Expect = 7e-05, Method: Composition-based stats.
 Identities = 35/108 (32%), Positives = 56/108 (52%), Gaps = 5/108 (5%)
 Frame = +3

Query  342  IHANMITSGFKPRAHILNRLIDIY--CKSSNLPY-ARHLFDEIPQPDIVARTTMIAAYSA  512
            +H +++ SG +    + N LI +Y  C S +    AR +FD + + D +  TTM+  Y  
Sbjct  196  LHCSVVKSGTEHAISVSNALIALYFKCDSPDTAVIAREVFDRMVERDELTWTTMVVGYVR  255

Query  513  SGDPNLAAEIFDRTPLSMRDTVFYNARITGYSHQNDGHAAIQVFNDMK  656
             GD   A ++FD   +  R  V +NA I+GY H      A+++F  MK
Sbjct  256  RGDITEARQVFD--DMEGRFNVVWNAMISGYVHCGLFLEALEMFRKMK  301



>ref|XP_009394346.1| PREDICTED: pentatricopeptide repeat-containing protein At1g25360 
[Musa acuminata subsp. malaccensis]
Length=799

 Score =   127 bits (319),  Expect = 9e-30, Method: Composition-based stats.
 Identities = 62/106 (58%), Positives = 78/106 (74%), Gaps = 2/106 (2%)
 Frame = +3

Query  342  IHANMITSGFKPRAHILNRLIDIYCKSSNLPYARHLFDEIP--QPDIVARTTMIAAYSAS  515
            +HA+++ SGFKPRAHILNRLID+Y KS +LP AR LFD     + D +A T++I AYSA 
Sbjct  40   VHAHILASGFKPRAHILNRLIDLYSKSGDLPSARRLFDATTARRHDSIAATSLITAYSAG  99

Query  516  GDPNLAAEIFDRTPLSMRDTVFYNARITGYSHQNDGHAAIQVFNDM  653
            G  + A +IFD TPL+ RDTVFYNA I+ YS  +DG AA+ VF DM
Sbjct  100  GHLDAARQIFDHTPLASRDTVFYNAMISSYSRASDGPAAVAVFRDM  145


 Score = 57.4 bits (137),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 33/115 (29%), Positives = 59/115 (51%), Gaps = 6/115 (5%)
 Frame = +3

Query  342  IHANMI--TSGFKPRAH--ILNRLIDIYCKSSNLPYARHLFDEIPQPDIVARTTMIAAYS  509
            +HA++I     F P     + N L+ +Y K  N+  AR +F++I + D+V+   M+  Y 
Sbjct  313  VHAHIIRVAPDFDPETALPVENVLVTLYSKDGNVDVARRIFNDIRRKDVVSWNAMLTGYL  372

Query  510  ASGDPNLAAEIFDRTPLSMRDTVFYNARITGYSHQNDGHAAIQVFNDMKRNNFQP  674
             SG  + A +IF  TP   ++ + +   I+G+ H       +++FN MK    +P
Sbjct  373  NSGKIHDAIDIFRDTP--QKNQLTWMVMISGFLHNGLAEEGLKLFNQMKEEGVKP  425


 Score = 54.3 bits (129),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 34/116 (29%), Positives = 56/116 (48%), Gaps = 5/116 (4%)
 Frame = +3

Query  315  PATSSLATTIHANMITSGFKPRAHILNRLIDIYCK---SSNLPYARHLFDEIPQPDIVAR  485
            P   +    +H +++ SG +    + N LI +Y K        +AR +FD +P+ D +  
Sbjct  169  PLELTQCQQLHCSVVKSGTENSVSVSNALIALYAKCEAQEAAVHAREVFDLMPERDELTW  228

Query  486  TTMIAAYSASGDPNLAAEIFDRTPLSMRDTVFYNARITGYSHQNDGHAAIQVFNDM  653
            TT++  Y   GD   A  +FD   +  R  V +NA I+GY H      A+++F  M
Sbjct  229  TTVVVGYVRRGDIGEARRVFDE--MEGRFDVVWNAMISGYVHHGLISEALEMFRQM  282



>ref|XP_008805705.1| PREDICTED: pentatricopeptide repeat-containing protein At1g25360-like 
[Phoenix dactylifera]
Length=812

 Score =   122 bits (305),  Expect = 7e-28, Method: Composition-based stats.
 Identities = 58/112 (52%), Positives = 80/112 (71%), Gaps = 0/112 (0%)
 Frame = +3

Query  342  IHANMITSGFKPRAHILNRLIDIYCKSSNLPYARHLFDEIPQPDIVARTTMIAAYSASGD  521
            +HA+++ SGFKPRAHILNRL+D+Y K+ +LP AR LFD     D  A T+++ AY+A+G 
Sbjct  55   LHAHILASGFKPRAHILNRLVDLYAKAGDLPSARLLFDAAAPADAAAATSLVNAYAATGR  114

Query  522  PNLAAEIFDRTPLSMRDTVFYNARITGYSHQNDGHAAIQVFNDMKRNNFQPD  677
              LA  +FD  PL  RDTVFYN+ I+GY+   DG  A+ +F DM R++F+PD
Sbjct  115  LPLARRLFDCIPLPSRDTVFYNSMISGYARAGDGPLALAIFRDMLRDDFRPD  166


 Score = 54.3 bits (129),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 35/107 (33%), Positives = 55/107 (51%), Gaps = 5/107 (5%)
 Frame = +3

Query  342  IHANMITSGFKPRAHILNRLIDIY--CKSSNLPY-ARHLFDEIPQPDIVARTTMIAAYSA  512
            +H  ++ SG +    + N LI +Y  C S      AR +FD + + D +  TTM+  Y  
Sbjct  191  LHCAVVKSGTEQVISVSNALIALYFRCDSPETAVIAREVFDRMVERDELTWTTMVVGYVR  250

Query  513  SGDPNLAAEIFDRTPLSMRDTVFYNARITGYSHQNDGHAAIQVFNDM  653
             GD N A ++FD+  +  R  V +NA I+GY H      A+++F  M
Sbjct  251  KGDINEARQVFDK--MEGRFDVVWNAMISGYVHCGLFSEALEMFRRM  295



>ref|XP_010938946.1| PREDICTED: pentatricopeptide repeat-containing protein At1g25360-like 
[Elaeis guineensis]
Length=811

 Score =   120 bits (301),  Expect = 3e-27, Method: Composition-based stats.
 Identities = 59/111 (53%), Positives = 79/111 (71%), Gaps = 1/111 (1%)
 Frame = +3

Query  345  HANMITSGFKPRAHILNRLIDIYCKSSNLPYARHLFDEIPQPDIVARTTMIAAYSASGDP  524
            HA+++  GFKPRAHILNRL+DIY K+ +LP ARHLFD  P  +  A T+++ AY+A+G  
Sbjct  56   HAHILAFGFKPRAHILNRLVDIYAKAGDLPSARHLFDAAPA-EAAAATSLVNAYAAAGCL  114

Query  525  NLAAEIFDRTPLSMRDTVFYNARITGYSHQNDGHAAIQVFNDMKRNNFQPD  677
             LA  +FD  PL  RDTVFYNA I+ Y+   DG  A+ +F DM R++F+PD
Sbjct  115  PLARRLFDCIPLPARDTVFYNAMISSYARAGDGLPALAIFRDMLRDDFRPD  165



>gb|KFK44541.1| hypothetical protein AALP_AA1G270100 [Arabis alpina]
Length=769

 Score =   119 bits (298),  Expect = 7e-27, Method: Composition-based stats.
 Identities = 64/143 (45%), Positives = 82/143 (57%), Gaps = 28/143 (20%)
 Frame = +3

Query  249  ICRQLATRYAAHLQLCSSNIHTPATSSLATTIHANMITSGFKPRAHILNRLIDIYCKSSN  428
            + R +A RYAA+L+LC     T  +  LA  +H                           
Sbjct  7    LVRAIAHRYAANLRLCLPIRRT--SLQLARAVH--------------------------E  38

Query  429  LPYARHLFDEIPQPDIVARTTMIAAYSASGDPNLAAEIFDRTPLSMRDTVFYNARITGYS  608
            L YAR LFDEI +PD VARTTM++ Y AS D  LA  +F+ TPLSMRDTV YNA ITG+S
Sbjct  39   LSYARQLFDEISEPDKVARTTMVSGYCASRDIALARLVFEETPLSMRDTVMYNAMITGFS  98

Query  609  HQNDGHAAIQVFNDMKRNNFQPD  677
            H NDG++A+ +F  MK+  F+PD
Sbjct  99   HNNDGYSAVNLFCKMKQEGFKPD  121


 Score = 53.5 bits (127),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 39/121 (32%), Positives = 59/121 (49%), Gaps = 10/121 (8%)
 Frame = +3

Query  345  HANMITSGFKPRAHILNRLIDIYCK---------SSNLPYARHLFDEIPQPDIVARTTMI  497
            HA  +  G      +LN L+ +Y K         SS L  AR +FDEIP+ D  + TTMI
Sbjct  146  HAAALKCGAGYVTSVLNALVSVYSKCGSSSLSTSSSLLRSARKVFDEIPEKDERSWTTMI  205

Query  498  AAYSASGDPNLAAEIFDRTPLSMRDTVFYNARITGYSHQNDGHAAIQVFNDMKRNNFQPD  677
              Y  +G  +L  E+ +    +M+  V YNA I+GY H      A+++   M  +  + D
Sbjct  206  TGYVKNGCFDLGKELLEGMDENMK-LVAYNAMISGYVHHGLYQEALEMVRRMVSSGIELD  264

Query  678  Q  680
            +
Sbjct  265  E  265



>ref|XP_006841418.1| PREDICTED: pentatricopeptide repeat-containing protein At1g25360 
[Amborella trichopoda]
 gb|ERN03093.1| hypothetical protein AMTR_s00003p00032470 [Amborella trichopoda]
Length=791

 Score =   108 bits (271),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 59/137 (43%), Positives = 81/137 (59%), Gaps = 7/137 (5%)
 Frame = +3

Query  270  RYAAHLQLCSSNIHTPATSSLATTIHANMITSGFKPRAHILNRLIDIYCKSSNLPYARHL  449
            R A+ LQ  +     P        IHA +ITSG KPRAH+LN LI  YC + +L  A H+
Sbjct  24   RLASLLQASTRTQSRPR----GRAIHAVIITSGLKPRAHLLNLLIAFYCSTEDLKCAHHV  79

Query  450  FDEIPQPDIVARTTMIAAYSASGDPNLAAEIFDRTPLSMRDTVFYNARITGYSHQNDGHA  629
            FD +PQ D+VARTT++AA++ SG   +A +IFD  P   RD V YNA I+ Y H  +   
Sbjct  80   FDRMPQRDVVARTTLLAAHARSGALAVAHQIFDEMP--TRDAVAYNAMISAYGHHGEFRE  137

Query  630  AIQVFNDM-KRNNFQPD  677
            A+ +F  M ++   +PD
Sbjct  138  ALSLFRAMLEQGKPRPD  154


 Score = 55.5 bits (132),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 35/111 (32%), Positives = 54/111 (49%), Gaps = 6/111 (5%)
 Frame = +3

Query  327  SLATTIHANMITSGFKPRAHILNRLIDIYCKSSNLPYARHLFDEIPQPDIVARTTMIAAY  506
            +L++ +H   + +G      + N LI +Y KS  L  A  +F E+ + D +  TTMI  +
Sbjct  172  NLSSQVHCLALKAGLAHVTSVSNALISVYVKSGELGLASKMFTELLKRDEITWTTMITGF  231

Query  507  SASGDPNLAAEIFDRTPLSMRD--TVFYNARITGYSHQNDGHAAIQVFNDM  653
               GD   A  +F+     MRD   V +NA I GY+       A+ +F DM
Sbjct  232  VRIGDLEGARRVFE----VMRDRFDVAWNAMIAGYAQHGLCMEALDLFRDM  278


 Score = 52.0 bits (123),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 29/129 (22%), Positives = 64/129 (50%), Gaps = 13/129 (10%)
 Frame = +3

Query  321  TSSLATTIHANMITSGFKPRAHILNR-----------LIDIYCKSSNLPYARHLFDEIPQ  467
            TS L+   +  ++ +G +  A+I++R           +I +Y K   +  A  +FD + +
Sbjct  291  TSLLSACANIGLVRTGMEAHAYIVHREAEISLPVWNAIISLYAKCGRMEVAMRVFDAMRE  350

Query  468  PDIVARTTMIAAYSASGDPNLAAEIFDRTPLSMRDTVFYNARITGYSHQNDGHAAIQVFN  647
             D+V+   +++ Y+  G    A EIF++  +  R+ + +   I+G +    G   +++FN
Sbjct  351  KDLVSWNAVVSGYATLGMITEAREIFEK--MIERNELTWTVMISGSAQHGQGEEGLRLFN  408

Query  648  DMKRNNFQP  674
             M+  + +P
Sbjct  409  RMRHEDSRP  417



>gb|ERN03238.1| hypothetical protein AMTR_s00003p00182540 [Amborella trichopoda]
Length=689

 Score = 96.7 bits (239),  Expect = 3e-19, Method: Composition-based stats.
 Identities = 50/123 (41%), Positives = 72/123 (59%), Gaps = 13/123 (11%)
 Frame = +3

Query  321  TSSLATTIHANMITSGFKPRAHILNRLIDIYCKSSNLPYARHLFDEIPQPDIVARTTMIA  500
            + S    IHA +ITSG KPRAH+LN LI  YC + +L  A H+FD +PQ D+VARTT++A
Sbjct  22   SRSQGRAIHALIITSGLKPRAHLLNPLIAFYCSTEDLTCAHHVFDRMPQRDVVARTTLLA  81

Query  501  AYSASGDPNLAAEIFDRTPLSMRDTVFYN-----------ARITGYSHQNDGHAAIQVFN  647
             ++ +G   +  ++FDR P   RDT+ +N             ITG+    D  +A +VF 
Sbjct  82   THACAGALAVVRQLFDRMP--TRDTMVFNELLKRDEFTWTTMITGFVRVGDLESARKVFE  139

Query  648  DMK  656
             M+
Sbjct  140  VMR  142


 Score = 53.1 bits (126),  Expect = 8e-05, Method: Composition-based stats.
 Identities = 30/129 (23%), Positives = 62/129 (48%), Gaps = 13/129 (10%)
 Frame = +3

Query  321  TSSLATTIHANMITSGFKPRAHILNR-----------LIDIYCKSSNLPYARHLFDEIPQ  467
            TS L+   +  ++ +G +  A+I++R           ++ +Y K   +  A  +FD + +
Sbjct  185  TSLLSACANIGLVRTGMEAHAYIVHREAEISLPVWNAIVSLYAKCGRMEVATRVFDAMRE  244

Query  468  PDIVARTTMIAAYSASGDPNLAAEIFDRTPLSMRDTVFYNARITGYSHQNDGHAAIQVFN  647
             D+V+   M+  Y+  G    A EIF++  +  R+   +   ITG +    G   +++FN
Sbjct  245  KDLVSWNAMVFGYATLGMITEAREIFEK--MVERNERTWTVMITGSAQHGQGEEGLRLFN  302

Query  648  DMKRNNFQP  674
             M+  + +P
Sbjct  303  RMRHEDSKP  311



>ref|XP_011622368.1| PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing 
protein At1g25360 [Amborella trichopoda]
Length=850

 Score = 97.1 bits (240),  Expect = 3e-19, Method: Composition-based stats.
 Identities = 45/93 (48%), Positives = 63/93 (68%), Gaps = 2/93 (2%)
 Frame = +3

Query  321  TSSLATTIHANMITSGFKPRAHILNRLIDIYCKSSNLPYARHLFDEIPQPDIVARTTMIA  500
            + S    IHA +ITSG KPRAH+LN LI  YC + +L  A H+FD +PQ D+VARTT++A
Sbjct  142  SRSQGRAIHALIITSGLKPRAHLLNPLIAFYCSTEDLTCAHHVFDRMPQRDVVARTTLLA  201

Query  501  AYSASGDPNLAAEIFDRTPLSMRDTVFYNARIT  599
             ++ +G   +  ++FDR P   RDT+ YNA I+
Sbjct  202  THACAGALAVVRQLFDRMP--TRDTMXYNAMIS  232


 Score = 53.1 bits (126),  Expect = 8e-05, Method: Composition-based stats.
 Identities = 30/129 (23%), Positives = 62/129 (48%), Gaps = 13/129 (10%)
 Frame = +3

Query  321  TSSLATTIHANMITSGFKPRAHILNR-----------LIDIYCKSSNLPYARHLFDEIPQ  467
            TS L+   +  ++ +G +  A+I++R           ++ +Y K   +  A  +FD + +
Sbjct  346  TSLLSACANIGLVRTGMEAHAYIVHREAEISLPVWNAIVSLYAKCGRMEVATRVFDAMRE  405

Query  468  PDIVARTTMIAAYSASGDPNLAAEIFDRTPLSMRDTVFYNARITGYSHQNDGHAAIQVFN  647
             D+V+   M+  Y+  G    A EIF++  +  R+   +   ITG +    G   +++FN
Sbjct  406  KDLVSWNAMVFGYATLGMITEAREIFEK--MVERNERTWTVMITGSAQHGQGEEGLRLFN  463

Query  648  DMKRNNFQP  674
             M+  + +P
Sbjct  464  RMRHEDSKP  472


 Score = 50.1 bits (118),  Expect = 9e-04, Method: Composition-based stats.
 Identities = 31/96 (32%), Positives = 46/96 (48%), Gaps = 2/96 (2%)
 Frame = +3

Query  366  GFKPRAHILNRLIDIYCKSSNLPYARHLFDEIPQPDIVARTTMIAAYSASGDPNLAAEIF  545
            G + R  + N LI +Y K   L     +F+E+ + D    TTMI  +   GD   A ++F
Sbjct  240  GLRTRIWVSNALISLYVKCGELGLTSKVFNELLKRDEFTWTTMITGFVRVGDLESARKVF  299

Query  546  DRTPLSMRDTVFYNARITGYSHQNDGHAAIQVFNDM  653
            +   +  R  V +NA I GYS       A+ +F DM
Sbjct  300  E--VMRERFDVAWNAMIAGYSQHGLYMEALDLFRDM  333



>ref|XP_008783105.1| PREDICTED: pentatricopeptide repeat-containing protein At3g02330 
[Phoenix dactylifera]
Length=889

 Score = 95.5 bits (236),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 43/112 (38%), Positives = 68/112 (61%), Gaps = 2/112 (2%)
 Frame = +3

Query  345  HANMITSGFKPRAHILNRLIDIYCKSSNLPYARHLFDEIPQPDIVARTTMIAAYSASGDP  524
            HA MIT+GF P   + N L+ +Y + SNL YAR +FD +P+ D ++   MI+ YS SG  
Sbjct  68   HAQMITTGFVPTTFVANCLMHMYVRCSNLDYARKVFDRMPEKDTISWNAMISGYSESGAM  127

Query  525  NLAAEIFDRTPLSMRDTVFYNARITGYSHQNDGHAAIQVFNDMKRNNFQPDQ  680
             +A  +FD  P   RD + +N+ I+GY      +++I++F  M R+  +PD+
Sbjct  128  GIAESLFDAIP--ERDVISWNSLISGYLQNGSSYSSIELFLQMGRSGIEPDR  177



>ref|XP_010929076.1| PREDICTED: pentatricopeptide repeat-containing protein At3g02330 
[Elaeis guineensis]
Length=889

 Score = 95.1 bits (235),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 43/112 (38%), Positives = 67/112 (60%), Gaps = 2/112 (2%)
 Frame = +3

Query  345  HANMITSGFKPRAHILNRLIDIYCKSSNLPYARHLFDEIPQPDIVARTTMIAAYSASGDP  524
            HA MI SGF P   + N L+ +Y + SNL YAR +FD +P+ D ++   MI+ YS SG  
Sbjct  68   HARMIASGFVPTIFVANCLMHMYTRCSNLDYARKVFDRMPEKDTISWNAMISGYSQSGAM  127

Query  525  NLAAEIFDRTPLSMRDTVFYNARITGYSHQNDGHAAIQVFNDMKRNNFQPDQ  680
             +A  +FD  P   RD + +N+ I+GY      + +I++F  M+R+  +PD+
Sbjct  128  GIAESLFDAMP--ERDVISWNSLISGYLQNGSSYGSIELFLQMRRSGIEPDR  177



>ref|XP_011622555.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At5g40405 [Amborella trichopoda]
Length=534

 Score = 92.0 bits (227),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 44/116 (38%), Positives = 67/116 (58%), Gaps = 2/116 (2%)
 Frame = +3

Query  333  ATTIHANMITSGFKPRAHILNRLIDIYCKSSNLPYARHLFDEIPQPDIVARTTMIAAYSA  512
               +H + I  GF+   H+ + LI +Y    ++  AR LF + P PDIVA T MI A++ 
Sbjct  49   GKVVHGSAIKLGFELDGHVESALIHMYANFGHVESARQLFGKSPDPDIVAWTAMIGAWAK  108

Query  513  SGDPNLAAEIFDRTPLSMRDTVFYNARITGYSHQNDGHAAIQVFNDMKRNNFQPDQ  680
              D + A E FDR P   RD++ +NA ITGY H      A+ +F+DM+R+  +P++
Sbjct  109  CNDLDRARECFDRMP--RRDSIAWNAMITGYVHAGYSREALSLFDDMQRDGVRPNE  162



>ref|XP_006878551.1| PREDICTED: pentatricopeptide repeat-containing protein At4g37170 
[Amborella trichopoda]
 gb|ERM94696.1| hypothetical protein AMTR_s00011p00233950 [Amborella trichopoda]
Length=607

 Score = 88.6 bits (218),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 49/137 (36%), Positives = 77/137 (56%), Gaps = 7/137 (5%)
 Frame = +3

Query  258  QLATRYAAHLQLCSSNIHTPATSSLATTIHANMITS-GFKPRAHILNRLIDIYCKSSNLP  434
            Q A  YA+ LQ C+             T+H++M++S  F+P   + NRL+D+Y K ++L 
Sbjct  115  QFAPIYASLLQACAQQ----RALDEGKTVHSHMLSSPSFEPGLFLFNRLLDVYIKCNSLN  170

Query  435  YARHLFDEIPQPDIVARTTMIAAYSASGDPNLAAEIFDRTPLSMRDTVFYNARITGYSHQ  614
             AR LFDE+ Q DI +  T+IA Y   GD   A ++FD   +  RD   +++ I+GY   
Sbjct  171  QARQLFDEMTQKDICSYNTLIAGYCKVGDLCNAKKLFDE--MDQRDNFSWSSIISGYVRH  228

Query  615  NDGHAAIQVFNDMKRNN  665
               + A+ +F +MK+NN
Sbjct  229  GSPNEALSIFREMKQNN  245


 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 31/116 (27%), Positives = 58/116 (50%), Gaps = 4/116 (3%)
 Frame = +3

Query  318  ATSSLATTIHANMITSGFKPRAHILNRLIDIYCKSSNLPYARHLFDEIPQPDIVARTTMI  497
            A   L   +H  M+ +GF P    ++ L+D+Y K  N+  A ++F  IP PD++  T +I
Sbjct  367  AAEKLGREVHGYMVRAGFDPSGSSVSALVDMYAKCGNIKSAENIFQSIPNPDLITWTAII  426

Query  498  AAYSASGDPNLAAEIFDRTPLSMR---DTVFYNARITGYSHQNDGHAAIQVFNDMK  656
            +  + +G    A + F+ T L++    D V +   +T  +H       +++F  +K
Sbjct  427  SGSAKNGRDLEALQYFE-TLLNLGKKPDHVTFVGVLTACTHAGLVEKGLEIFVSIK  481


 Score = 50.1 bits (118),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 41/68 (60%), Gaps = 0/68 (0%)
 Frame = +3

Query  342  IHANMITSGFKPRAHILNRLIDIYCKSSNLPYARHLFDEIPQPDIVARTTMIAAYSASGD  521
            +HA++  +G +  A + + L D+Y K  ++  AR++FD I + D VA TTMI  Y  +G 
Sbjct  273  LHAHITRTGLESDAIVWSALSDMYAKCGSITEARYVFDRILERDTVAWTTMIGRYVQAGQ  332

Query  522  PNLAAEIF  545
             + A ++F
Sbjct  333  ASEALQLF  340



>ref|XP_009113933.1| PREDICTED: pentatricopeptide repeat-containing protein At5g44230 
[Brassica rapa]
Length=667

 Score = 87.4 bits (215),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 47/137 (34%), Positives = 78/137 (57%), Gaps = 8/137 (6%)
 Frame = +3

Query  273  YAAHLQLCSSNIHTPATSSLATTIHANMI-TSGFKPRAHILNRLIDIYCKSSNLPYARHL  449
            ++A L+ C S        SL    HA     SGF    ++ N +ID+Y K  ++  AR +
Sbjct  162  FSALLKACGS----VGDLSLGRQFHAQTFRLSGF-CSVYVGNTMIDVYVKCGSMECARKV  216

Query  450  FDEIPQPDIVARTTMIAAYSASGDPNLAAEIFDRTPLSMRDTVFYNARITGYSHQNDGHA  629
            FDE+P+ D+++ T +IAAY+ +GD + AAE+F+R P   +D V + A +TG+        
Sbjct  217  FDEMPERDVISWTELIAAYAKAGDMDSAAELFERLP--KKDMVAWTAIVTGFVQNAKPQE  274

Query  630  AIQVFNDMKRNNFQPDQ  680
            A++ FN M+++   PD+
Sbjct  275  ALEYFNRMEKSGVLPDE  291



>ref|XP_007139372.1| hypothetical protein PHAVU_008G023900g [Phaseolus vulgaris]
 gb|ESW11366.1| hypothetical protein PHAVU_008G023900g [Phaseolus vulgaris]
Length=891

 Score = 86.3 bits (212),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 39/104 (38%), Positives = 61/104 (59%), Gaps = 2/104 (2%)
 Frame = +3

Query  345  HANMITSGFKPRAHILNRLIDIYCKSSNLPYARHLFDEIPQPDIVARTTMIAAYSASGDP  524
            HA MI +GF P  ++ N LI  YCK SN+ YA ++FD +P+ D+++  TMI  Y+  G+ 
Sbjct  68   HAQMIVTGFVPNIYVANCLIQFYCKGSNMGYAFNVFDRMPERDVISWNTMIFGYAGVGNM  127

Query  525  NLAAEIFDRTPLSMRDTVFYNARITGYSHQNDGHAAIQVFNDMK  656
              A  +FD  P   RD V +N+ ++ Y H      +I++F  M+
Sbjct  128  GFAQSLFDTMP--ERDVVSWNSLLSCYLHNGANRKSIEIFVKMR  169


 Score = 51.2 bits (121),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 29/96 (30%), Positives = 49/96 (51%), Gaps = 4/96 (4%)
 Frame = +3

Query  273  YAAHLQLCSSNIHTPATSSLATTIHANMITSGFKPRAHILNRLIDIYCKSSNLPYARHLF  452
            YA  L +C++     AT  L   IHA ++        +I + L+D+Y K  N+  +R +F
Sbjct  584  YATVLDICANM----ATVELGKQIHAQILKLQLHSDVYIASTLVDMYSKCGNMQDSRLMF  639

Query  453  DEIPQPDIVARTTMIAAYSASGDPNLAAEIFDRTPL  560
            ++ P+ D V  + MI AY+  G    A ++F+   L
Sbjct  640  EKAPKRDYVTWSAMICAYAYHGLGEEAIKLFEEMQL  675



>gb|EYU37931.1| hypothetical protein MIMGU_mgv1a003299mg [Erythranthe guttata]
Length=594

 Score = 85.9 bits (211),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 40/117 (34%), Positives = 67/117 (57%), Gaps = 2/117 (2%)
 Frame = +3

Query  330  LATTIHANMITSGFKPRAHILNRLIDIYCKSSNLPYARHLFDEIPQPDIVARTTMIAAYS  509
            LA  +H  +   GF     + + +ID+Y K   L  AR LFD++ + D++A TT+++ Y+
Sbjct  195  LAKQLHCQVFLLGFLSNVVLSSSIIDVYAKCGELVDARRLFDQMSERDVLAWTTLVSGYA  254

Query  510  ASGDPNLAAEIFDRTPLSMRDTVFYNARITGYSHQNDGHAAIQVFNDMKRNNFQPDQ  680
              GD   A E+FD  P   +++V + A I GY+    GH ++++F+ M   N +PDQ
Sbjct  255  KGGDMKSAQEMFDTMP--EKNSVSWTALIAGYAQNGMGHHSLKLFSKMVMLNIEPDQ  309


 Score = 54.3 bits (129),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 34/130 (26%), Positives = 65/130 (50%), Gaps = 6/130 (5%)
 Frame = +3

Query  291  LCSSNIHTPATSS---LATTIHANMITSGFK-PRAHILNRLIDIYCKSSNLPYARHLFDE  458
            L +S IH  A +       ++H ++  +G K P A + N LI++Y K  +   AR +FD+
Sbjct  46   LIASLIHQCAGAKSIRFGKSVHLHLKLTGSKRPNAFLSNHLINMYAKCGDHVKARDVFDK  105

Query  459  IPQPDIVARTTMIAAYSASGDPNLAAEIFDRTPLSMRDTVFYNARITGYSHQNDGHAAIQ  638
            +   ++ +   M++ Y+  G    A  +FD+ P   RD V +N  +  Y        A++
Sbjct  106  MTARNLYSWNNMLSGYAKLGMVKAAKRLFDKMP--ERDFVSWNTMVMAYVQSGWFDEALR  163

Query  639  VFNDMKRNNF  668
            +  +++R+N 
Sbjct  164  LHMELRRSNI  173



>ref|XP_012080484.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At1g68930 [Jatropha curcas]
Length=743

 Score = 85.9 bits (211),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 45/136 (33%), Positives = 74/136 (54%), Gaps = 6/136 (4%)
 Frame = +3

Query  261  LATRYAAHLQLCSSNIHTPATSSLATTIHANMITSGFKPRAHILNRLIDIYCKSSNLPYA  440
            ++ +Y++ L+ C            A  +H ++I +   P   + N LI+ Y K  NL YA
Sbjct  4    VSNQYSSLLKFCCET----RNQKQAKKLHCHIIKTLMNPEPFLYNNLINTYSKLGNLKYA  59

Query  441  RHLFDEIPQPDIVARTTMIAAYSASGDPNLAAEIFDRTPLSMRDTVFYNARITGYSHQND  620
            RHLF+E+ QP++ +  T+++AYS SG  +   EIF+  P   RD V +N+ I GY+    
Sbjct  60   RHLFEEMSQPNLFSWNTILSAYSKSGHLSKMKEIFNLMP--SRDGVSWNSLIAGYACYGS  117

Query  621  GHAAIQVFNDMKRNNF  668
               A++ +N M R+ F
Sbjct  118  VAEAVKAYNSMLRDGF  133



>gb|KDO57645.1| hypothetical protein CISIN_1g042265mg, partial [Citrus sinensis]
Length=490

 Score = 84.7 bits (208),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 48/130 (37%), Positives = 69/130 (53%), Gaps = 10/130 (8%)
 Frame = +3

Query  288  QLCSSNIHTPATSSLATTIHANMITSGFKPRAHILNRLIDIYCKSSNLPYARHLFDEIPQ  467
            QLCS         SLA TIH+ ++  GF     +LN L+ +YC    L  A+ LFDEI  
Sbjct  123  QLCSH--------SLAQTIHSQVLKLGFICDVFVLNSLMHVYCVFHRLRDAQELFDEILY  174

Query  468  PDIVARTTMIAAYSASGDPNLAAEIFDRTPLSMRDTVFYNARITGYSHQNDGHAAIQVFN  647
             D+V+  T+I  Y  +GD   A ++FDR P   RD V +   + GY+  +    AIQ+F 
Sbjct  175  RDVVSCNTLIDGYVKAGDLAHARQLFDRMPF--RDAVSWGTLVAGYAQSDQCEEAIQLFC  232

Query  648  DMKRNNFQPD  677
            +M   + +PD
Sbjct  233  NMMDLDIKPD  242



>emb|CDY13116.1| BnaA09g17010D [Brassica napus]
Length=656

 Score = 85.1 bits (209),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 47/137 (34%), Positives = 77/137 (56%), Gaps = 8/137 (6%)
 Frame = +3

Query  273  YAAHLQLCSSNIHTPATSSLATTIHANMI-TSGFKPRAHILNRLIDIYCKSSNLPYARHL  449
            ++A L+ C S        SL    HA     SGF    ++ N +ID+Y K  ++  AR +
Sbjct  151  FSALLKACGS----VGDLSLGRQFHAQTFRLSGF-CSVYVGNTMIDLYVKCGSMECARKV  205

Query  450  FDEIPQPDIVARTTMIAAYSASGDPNLAAEIFDRTPLSMRDTVFYNARITGYSHQNDGHA  629
            FDE+P+ D+++ T +IAAY+ +GD + AAE+F+R P   +D V + A +TG+        
Sbjct  206  FDEMPERDVISWTELIAAYAKAGDMDSAAELFERLP--KKDIVAWTAMVTGFVQNAKPLE  263

Query  630  AIQVFNDMKRNNFQPDQ  680
            A++ FN M+ +   PD+
Sbjct  264  ALEYFNRMEMSGVLPDE  280



>ref|XP_006485061.1| PREDICTED: pentatricopeptide repeat-containing protein At5g61800-like 
[Citrus sinensis]
Length=523

 Score = 84.3 bits (207),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 48/130 (37%), Positives = 69/130 (53%), Gaps = 10/130 (8%)
 Frame = +3

Query  288  QLCSSNIHTPATSSLATTIHANMITSGFKPRAHILNRLIDIYCKSSNLPYARHLFDEIPQ  467
            QLCS         SLA TIH+ ++  GF     +LN L+ +YC    L  A+ LFDEI  
Sbjct  123  QLCSH--------SLAQTIHSQVLKLGFICDVFVLNSLMHVYCVFHRLRDAQELFDEILY  174

Query  468  PDIVARTTMIAAYSASGDPNLAAEIFDRTPLSMRDTVFYNARITGYSHQNDGHAAIQVFN  647
             D+V+  T+I  Y  +GD   A ++FDR P   RD V +   + GY+  +    AIQ+F 
Sbjct  175  RDVVSCNTLIDGYVKAGDLAHARQLFDRMPF--RDAVSWGTLVAGYAQSDQCEEAIQLFC  232

Query  648  DMKRNNFQPD  677
            +M   + +PD
Sbjct  233  NMMDLDIKPD  242



>ref|XP_010100885.1| hypothetical protein L484_009655 [Morus notabilis]
 gb|EXB85809.1| hypothetical protein L484_009655 [Morus notabilis]
Length=879

 Score = 85.1 bits (209),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 43/99 (43%), Positives = 57/99 (58%), Gaps = 2/99 (2%)
 Frame = +3

Query  345  HANMITSGFKPRAHILNRLIDIYCKSSNLPYARHLFDEIPQPDIVARTTMIAAYSASGDP  524
            H  MI SGF+P   ++N LI +Y K SNL YA   FDE+P+ D V+  TMI+ YS  G  
Sbjct  64   HCRMIVSGFEPTVFVMNCLIQMYVKCSNLEYASKTFDEMPERDSVSWNTMISGYSVRGKM  123

Query  525  NLAAEIFDRTPLSMRDTVFYNARITGYSHQNDGHAAIQV  641
             +A  +FD  P   RD V +N+ I+GY    D   +I V
Sbjct  124  EIAQSLFDAMP--RRDVVSWNSLISGYLQNGDYQNSIGV  160


 Score = 53.9 bits (128),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 37/136 (27%), Positives = 58/136 (43%), Gaps = 37/136 (27%)
 Frame = +3

Query  273  YAAHLQLCSSNIHTPATSSLATTIHANMITSGFKPRAHILNRLIDIYCKSSNLPYARHLF  452
            YAA L  C++     AT  L   IH+ +I       A+I + L+D+Y K  N+  +R +F
Sbjct  580  YAAVLDTCAN----LATVGLGMQIHSQIIKQELLSDAYISSTLVDMYSKCGNMQDSRLMF  635

Query  453  DEIPQPDIVARTTMIAAYSASGDPNLAAEIFDRTPLSMRDTVFYNARITGYSHQNDGHAA  632
            ++  +                                 RD+V +N  I GY+H   G  A
Sbjct  636  EKSRK---------------------------------RDSVTWNTMICGYAHHGLGEDA  662

Query  633  IQVFNDMKRNNFQPDQ  680
            I+VF DM+  N +P+ 
Sbjct  663  IKVFEDMQLENVKPNH  678



>ref|XP_002533488.1| pentatricopeptide repeat-containing protein, putative [Ricinus 
communis]
 gb|EEF28892.1| pentatricopeptide repeat-containing protein, putative [Ricinus 
communis]
Length=939

 Score = 85.1 bits (209),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 42/106 (40%), Positives = 66/106 (62%), Gaps = 2/106 (2%)
 Frame = +3

Query  345  HANMITSGFKPRAHILNRLIDIYCKSSNLPYARHLFDEIPQPDIVARTTMIAAYSASGDP  524
            HA MI SGF P  +I N L+ +Y + S+L YA  +F+++ Q D+++  TMI+ Y+ +G+ 
Sbjct  66   HARMIVSGFIPDVYISNCLMKMYLRCSHLNYAYKVFEKMSQRDVISYNTMISGYADAGEM  125

Query  525  NLAAEIFDRTPLSMRDTVFYNARITGYSHQNDGHAAIQVFNDMKRN  662
            NLA E F  TP   RD V +N+ ++G+    +   +I VF DM R+
Sbjct  126  NLANEFFYDTP--KRDVVSWNSMLSGFLQNGECRKSIDVFLDMGRS  169



>emb|CDP01970.1| unnamed protein product [Coffea canephora]
Length=657

 Score = 84.3 bits (207),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 44/137 (32%), Positives = 73/137 (53%), Gaps = 7/137 (5%)
 Frame = +3

Query  273  YAAHLQLCSSNIHTPATSSLATTIHA-NMITSGFKPRAHILNRLIDIYCKSSNLPYARHL  449
            + A L+ C+  +H      L   IH  ++   GF     + N LID+Y K   L +AR +
Sbjct  152  FTALLKACTGVLHV----DLGRQIHGQSLKIGGFVQDLFVGNTLIDMYVKCGCLDFARRV  207

Query  450  FDEIPQPDIVARTTMIAAYSASGDPNLAAEIFDRTPLSMRDTVFYNARITGYSHQNDGHA  629
            FDE+P  D+++ T +I AY+ SGD   A+++FDR P   +D V + A +TG++       
Sbjct  208  FDELPTRDVISFTALIVAYAKSGDMVAASDLFDRLP--AKDMVAWTAMVTGFAQNAQPKE  265

Query  630  AIQVFNDMKRNNFQPDQ  680
            A++ F  M+ +    D+
Sbjct  266  ALEYFEKMQNSGVNTDE  282



>ref|XP_011009234.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At1g68930 [Populus euphratica]
 ref|XP_011009241.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At1g68930 [Populus euphratica]
 ref|XP_011009249.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At1g68930 [Populus euphratica]
Length=743

 Score = 84.3 bits (207),  Expect = 5e-15, Method: Composition-based stats.
 Identities = 43/110 (39%), Positives = 64/110 (58%), Gaps = 2/110 (2%)
 Frame = +3

Query  333  ATTIHANMITSGFKPRAHILNRLIDIYCKSSNLPYARHLFDEIPQPDIVARTTMIAAYSA  512
            A  +H  +I S   P   + N LI+ Y K  N+ YARHLFD++PQP+  +  TM++AYS 
Sbjct  24   AKKLHCLIIKSLTNPETFLYNNLINAYSKLGNITYARHLFDKMPQPNSFSWNTMLSAYSK  83

Query  513  SGDPNLAAEIFDRTPLSMRDTVFYNARITGYSHQNDGHAAIQVFNDMKRN  662
            SGD +   EIF   P   RD V +N+ I+GY+       A++ +N M ++
Sbjct  84   SGDLSTMQEIFSIMP--SRDGVSWNSLISGYACYGSVVEAVKTYNSMMKD  131


 Score = 50.8 bits (120),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 30/117 (26%), Positives = 52/117 (44%), Gaps = 2/117 (2%)
 Frame = +3

Query  330  LATTIHANMITSGFKPRAHILNRLIDIYCKSSNLPYARHLFDEIPQPDIVARTTMIAAYS  509
            L   IH  ++  GF     + + L+D+Y K   +  A  +FDE+ + ++V   TMI    
Sbjct  156  LGRQIHGQIVKFGFGAYVFVGSSLVDMYAKMGLVSVASQVFDEVQERNVVMYNTMITGLL  215

Query  510  ASGDPNLAAEIFDRTPLSMRDTVFYNARITGYSHQNDGHAAIQVFNDMKRNNFQPDQ  680
              G    +  +F    +  RD++ +   ITG         A+ +F DM++     DQ
Sbjct  216  RCGMVKDSKRLFH--GMKERDSISWTTMITGLIQNGLEAEAMDLFRDMRQEGMAMDQ  270



>ref|XP_010651252.1| PREDICTED: pentatricopeptide repeat-containing protein At2g22410, 
mitochondrial [Vitis vinifera]
 ref|XP_010651254.1| PREDICTED: pentatricopeptide repeat-containing protein At2g22410, 
mitochondrial [Vitis vinifera]
 ref|XP_010651255.1| PREDICTED: pentatricopeptide repeat-containing protein At2g22410, 
mitochondrial [Vitis vinifera]
Length=686

 Score = 84.0 bits (206),  Expect = 5e-15, Method: Composition-based stats.
 Identities = 43/112 (38%), Positives = 64/112 (57%), Gaps = 2/112 (2%)
 Frame = +3

Query  345  HANMITSGFKPRAHILNRLIDIYCKSSNLPYARHLFDEIPQPDIVARTTMIAAYSASGDP  524
            H  +  +G K    + N L+D+Y K  NL  AR LFD +    +V+ TTM+  Y+ SG  
Sbjct  275  HCYIEENGLKLTVPLANALMDMYMKCGNLESARKLFDSMTNKTMVSWTTMVVGYAQSGLL  334

Query  525  NLAAEIFDRTPLSMRDTVFYNARITGYSHQNDGHAAIQVFNDMKRNNFQPDQ  680
            ++A ++FD  P   +D V +NA I GY H N G  A+ +FN+M+  N  PD+
Sbjct  335  DMAWKLFDEMP--DKDVVPWNAMIGGYVHANRGKEALALFNEMQAMNINPDE  384



>ref|XP_010245110.1| PREDICTED: pentatricopeptide repeat-containing protein At2g13600-like 
isoform X1 [Nelumbo nucifera]
 ref|XP_010245111.1| PREDICTED: pentatricopeptide repeat-containing protein At2g13600-like 
isoform X1 [Nelumbo nucifera]
Length=570

 Score = 83.6 bits (205),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 38/96 (40%), Positives = 62/96 (65%), Gaps = 2/96 (2%)
 Frame = +3

Query  393  NRLIDIYCKSSNLPYARHLFDEIPQPDIVARTTMIAAYSASGDPNLAAEIFDRTPLSMRD  572
            N +I  Y K+ N+  AR +FD++ Q D ++ T+MI++Y+  G+   A E+FD+  + +RD
Sbjct  190  NAMIMCYGKAGNVEAAREIFDKMTQRDSISWTSMISSYTNHGNMQAAQELFDQ--MCLRD  247

Query  573  TVFYNARITGYSHQNDGHAAIQVFNDMKRNNFQPDQ  680
               +NA I GY+H  DG  A+ +FN+MK  N +P+Q
Sbjct  248  VSCWNALIRGYAHSGDGERALLLFNEMKLENVEPNQ  283



>gb|EYU39396.1| hypothetical protein MIMGU_mgv1a026743mg, partial [Erythranthe 
guttata]
Length=670

 Score = 84.0 bits (206),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 47/137 (34%), Positives = 75/137 (55%), Gaps = 6/137 (4%)
 Frame = +3

Query  255  RQLATRYAAHLQLCSSNIHTPATSSLATTIHANMITSGFKPRAHILNRLIDIYCKSSNLP  434
            R  A+ YAA LQLC   I   A       +H+++  SGF P   I N+++D+YCK  ++ 
Sbjct  61   RPSASLYAAVLQLC---IEKRALDE-GKRVHSHIKGSGFAPGVFISNKILDLYCKCESIS  116

Query  435  YARHLFDEIPQPDIVARTTMIAAYSASGDPNLAAEIFDRTPLSMRDTVFYNARITGYSHQ  614
             AR LFDE+   D+ +  T+I+ Y+  G  + A ++FD  P   RD   + A I+GY   
Sbjct  117  DARKLFDEMGDRDVCSWNTLISGYAKMGRVSEARKLFDEMP--KRDNFSWTAMISGYVKH  174

Query  615  NDGHAAIQVFNDMKRNN  665
                 A++++  M+RN+
Sbjct  175  KSPADALELYRLMQRNS  191


 Score = 55.8 bits (133),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 28/92 (30%), Positives = 51/92 (55%), Gaps = 4/92 (4%)
 Frame = +3

Query  273  YAAHLQLCSSNIHTPATSSLATTIHANMITSGFKPRAHILNRLIDIYCKSSNLPYARHLF  452
            +A  L  C+   H  A   L   +H  M+  GF P +   + L+ +Y K  ++  A  +F
Sbjct  301  FAGVLNACA---HQTA-EELGRQVHGLMMRIGFDPSSFAASALVHMYTKCGSVERANRVF  356

Query  453  DEIPQPDIVARTTMIAAYSASGDPNLAAEIFD  548
            + +P+PD+V+ T++I  Y+ +G P+ A ++FD
Sbjct  357  NWLPKPDLVSYTSLINGYAQNGQPHEALKLFD  388



>ref|XP_008244547.1| PREDICTED: pentatricopeptide repeat-containing protein At3g02330 
[Prunus mume]
Length=904

 Score = 84.3 bits (207),  Expect = 6e-15, Method: Composition-based stats.
 Identities = 44/103 (43%), Positives = 58/103 (56%), Gaps = 2/103 (2%)
 Frame = +3

Query  345  HANMITSGFKPRAHILNRLIDIYCKSSNLPYARHLFDEIPQPDIVARTTMIAAYSASGDP  524
            HA MI SGF+P   + N LI +Y K   L YA  +FD +PQ D V+  TMI  Y+ SG  
Sbjct  82   HARMIVSGFEPTVFVKNCLIQMYVKCGFLEYASKVFDGMPQRDTVSWNTMIFGYAESGKM  141

Query  525  NLAAEIFDRTPLSMRDTVFYNARITGYSHQNDGHAAIQVFNDM  653
              A   FD  P   RD V +N+ I+GY    D H +I+V+ +M
Sbjct  142  GFAQSCFDVMP--ERDVVSWNSLISGYLQSGDYHKSIEVYVNM  182



>emb|CBI16904.3| unnamed protein product [Vitis vinifera]
Length=843

 Score = 84.0 bits (206),  Expect = 8e-15, Method: Composition-based stats.
 Identities = 43/105 (41%), Positives = 59/105 (56%), Gaps = 2/105 (2%)
 Frame = +3

Query  345  HANMITSGFKPRAHILNRLIDIYCKSSNLPYARHLFDEIPQPDIVARTTMIAAYSASGDP  524
            HA MI + FKP   + N LI +Y K S+L +A  +FD +PQ D V+   M+  Y+  GD 
Sbjct  65   HARMILTEFKPTVFVTNCLIQMYIKCSDLEFAFKVFDGMPQRDTVSWNAMLFGYAGRGDI  124

Query  525  NLAAEIFDRTPLSMRDTVFYNARITGYSHQNDGHAAIQVFNDMKR  659
             +A ++FD  P   RD V +N+ I+GY H  D    I VF  M R
Sbjct  125  GVAQKLFDAMP--ERDVVSWNSLISGYLHNGDHRKVIDVFLQMGR  167



>ref|XP_002278668.2| PREDICTED: pentatricopeptide repeat-containing protein At3g02330 
isoform X1 [Vitis vinifera]
Length=877

 Score = 84.0 bits (206),  Expect = 8e-15, Method: Composition-based stats.
 Identities = 43/105 (41%), Positives = 59/105 (56%), Gaps = 2/105 (2%)
 Frame = +3

Query  345  HANMITSGFKPRAHILNRLIDIYCKSSNLPYARHLFDEIPQPDIVARTTMIAAYSASGDP  524
            HA MI + FKP   + N LI +Y K S+L +A  +FD +PQ D V+   M+  Y+  GD 
Sbjct  65   HARMILTEFKPTVFVTNCLIQMYIKCSDLEFAFKVFDGMPQRDTVSWNAMLFGYAGRGDI  124

Query  525  NLAAEIFDRTPLSMRDTVFYNARITGYSHQNDGHAAIQVFNDMKR  659
             +A ++FD  P   RD V +N+ I+GY H  D    I VF  M R
Sbjct  125  GVAQKLFDAMP--ERDVVSWNSLISGYLHNGDHRKVIDVFLQMGR  167



>ref|XP_002878586.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH54845.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata 
subsp. lyrata]
Length=786

 Score = 83.6 bits (205),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 43/136 (32%), Positives = 72/136 (53%), Gaps = 6/136 (4%)
 Frame = +3

Query  285  LQLCSSNIHTPATSS----LATTIHANMITSGFKPRAHILNRLIDIYCKSSNLPYARHLF  452
            L+LC++ +      S     A  +H  +I SG     +++N L+++Y K+    +AR LF
Sbjct  13   LELCTNLLQKSVNKSNGRFTAQLVHCRVIKSGLVFSVYLMNNLMNVYSKTGYALHARKLF  72

Query  453  DEIPQPDIVARTTMIAAYSASGDPNLAAEIFDRTPLSMRDTVFYNARITGYSHQNDGHAA  632
            DE+P     +  T+++AY+  GD + + E FDR P   RD+V +   I GY +    H A
Sbjct  73   DEMPLRTAFSWNTVLSAYAKRGDMDSSCEFFDRLP--QRDSVSWTTMIVGYKNIGQYHKA  130

Query  633  IQVFNDMKRNNFQPDQ  680
            I++  +M R   +P Q
Sbjct  131  IRIMGEMMREGIEPSQ  146


 Score = 56.6 bits (135),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 37/118 (31%), Positives = 55/118 (47%), Gaps = 4/118 (3%)
 Frame = +3

Query  330  LATTIHANMITSGFKPRAHILNRLIDIYCKSSNLPYARHLFDEIPQPD--IVARTTMIAA  503
            +   IH++++T+GF     +LN LI +Y +   +  AR L ++    D  I   T ++  
Sbjct  297  IGEQIHSHIVTTGFDISGIVLNALISMYSRCGGVETARRLIEQRGTKDLKIEGFTALLDG  356

Query  504  YSASGDPNLAAEIFDRTPLSMRDTVFYNARITGYSHQNDGHAAIQVFNDMKRNNFQPD  677
            Y   GD N A  IFD   L  RD V + A I GY        AI +F  M     +P+
Sbjct  357  YIKLGDMNEAKNIFDS--LKDRDVVAWTAMIVGYEQHGLYGEAINLFRSMVGEEQRPN  412


 Score = 55.1 bits (131),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 35/124 (28%), Positives = 66/124 (53%), Gaps = 5/124 (4%)
 Frame = +3

Query  318  ATSSLAT--TIHANMITSGFKPRAHILNRLIDIYCKSSNLPYARHLFDEIPQPDIVARTT  491
            AT  L T   +H+ ++  G +    + N L+++Y K  +   A+ +FD +   DI +   
Sbjct  158  ATRCLETGKKVHSFIVKLGLRGNVSVSNSLLNMYAKCGDPMMAKVVFDRMVVKDISSWNA  217

Query  492  MIAAYSASGDPNLAAEIFDRTPLSMRDTVFYNARITGYSHQNDGHAAIQVFNDMKRNN-F  668
            MIA +   G  +LA   F++  ++ RD V +N+ I+GY+ +     A+ +F+ M R++  
Sbjct  218  MIALHMQVGQMDLAMAQFEQ--MAERDIVTWNSMISGYNQRGYDLRALDMFSKMLRDSML  275

Query  669  QPDQ  680
             PD+
Sbjct  276  SPDR  279



>ref|XP_006847449.2| PREDICTED: pentatricopeptide repeat-containing protein At5g19020, 
mitochondrial, partial [Amborella trichopoda]
Length=217

 Score = 79.7 bits (195),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 44/135 (33%), Positives = 71/135 (53%), Gaps = 6/135 (4%)
 Frame = +3

Query  273  YAAHLQLCSSNIHTPATSSLATTIHANMITSGFKPRAHILNRLIDIYCKSSNLPYARHLF  452
            Y+  LQ CS ++     +SLA  +  +M+ + F     + NRLIDIYCKS  +  AR +F
Sbjct  78   YSCLLQACSESM----AASLAQKVETHMVKTSFPHCLFLNNRLIDIYCKSGYIREARKVF  133

Query  453  DEIPQPDIVARTTMIAAYSASGDPNLAAEIFDRTPLSMRDTVFYNARITGYSHQNDGHAA  632
            DE+ + D+ +  TMI  Y   G  + A ++F    +  ++ V +   I GY        A
Sbjct  134  DEMSEKDLFSYNTMIHGYCCFGLLDDARQVF--VQMHEKNQVSWGIMIGGYVRHEYAFEA  191

Query  633  IQVFNDMKRNNFQPD  677
            +++F DM R+  +PD
Sbjct  192  LEMFVDMNRSGLKPD  206



>ref|XP_002528283.1| pentatricopeptide repeat-containing protein, putative [Ricinus 
communis]
 gb|EEF34121.1| pentatricopeptide repeat-containing protein, putative [Ricinus 
communis]
Length=602

 Score = 82.8 bits (203),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 41/118 (35%), Positives = 66/118 (56%), Gaps = 2/118 (2%)
 Frame = +3

Query  327  SLATTIHANMITSGFKPRAHILNRLIDIYCKSSNLPYARHLFDEIPQPDIVARTTMIAAY  506
             L+   H  ++ +GF     I + ++D Y K S +  AR LFDE+   D++A TTM++ Y
Sbjct  200  ELSKQAHGQVLVAGFLSNLVISSSVLDAYAKCSEMGDARRLFDEMIIRDVLAWTTMVSGY  259

Query  507  SASGDPNLAAEIFDRTPLSMRDTVFYNARITGYSHQNDGHAAIQVFNDMKRNNFQPDQ  680
            +  GD   A E+FD  P   ++ V + + I GY+  + GH A+++F  M   N +PDQ
Sbjct  260  AQWGDVEAARELFDLMP--EKNPVAWTSLIAGYARHDLGHKALELFTKMMALNIRPDQ  315


 Score = 57.4 bits (137),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 31/126 (25%), Positives = 64/126 (51%), Gaps = 7/126 (6%)
 Frame = +3

Query  285  LQLCSSNIHTPATSSLATTIHANMITSGFK-PRAHILNRLIDIYCKSSNLPYARHLFDEI  461
            LQ C++      +  L   +H ++  +G K P   + N LI++Y K  + P A  +FDE+
Sbjct  57   LQQCANT----KSLKLGKWVHLHLKVTGLKRPNTFLANHLINMYSKCGDYPSAYKVFDEM  112

Query  462  PQPDIVARTTMIAAYSASGDPNLAAEIFDRTPLSMRDTVFYNARITGYSHQNDGHAAIQV  641
               ++ +   M++ Y+  G    A ++FD+ P   +D V +N  +  Y+     + A++ 
Sbjct  113  STRNLYSWNGMLSGYAKLGKIKPARKLFDKMP--EKDVVSWNTMVIAYAKSGFCNDALRF  170

Query  642  FNDMKR  659
            + +++R
Sbjct  171  YRELRR  176



>ref|XP_011624784.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like 
[Amborella trichopoda]
Length=649

 Score = 82.8 bits (203),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 44/114 (39%), Positives = 64/114 (56%), Gaps = 2/114 (2%)
 Frame = +3

Query  330  LATTIHANMITSGFKPRAHILNRLIDIYCKSSNLPYARHLFDEIPQPDIVARTTMIAAYS  509
            L   +HA+++ +G      + N LI++YC       AR +FDEI   D+V+ TTMI  Y 
Sbjct  132  LGFELHAHIVKTGLDSDIFVQNNLINMYCCCDRTDVARRVFDEITTLDVVSWTTMITGYG  191

Query  510  ASGDPNLAAEIFDRTPLSMRDTVFYNARITGYSHQNDGHAAIQVFNDMKRNNFQ  671
             SG+ + A  + D+ PL  R+TV YNA ITGYS       A +VF++M   N +
Sbjct  192  NSGEIDAAKFLLDQMPL--RNTVTYNAMITGYSRSGHFDEARKVFDEMPNRNVE  243



>ref|XP_006451257.1| hypothetical protein CICLE_v10010361mg [Citrus clementina]
 ref|XP_006494315.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At5g09950-like [Citrus sinensis]
 gb|ESR64497.1| hypothetical protein CICLE_v10010361mg [Citrus clementina]
Length=696

 Score = 82.8 bits (203),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 41/116 (35%), Positives = 71/116 (61%), Gaps = 3/116 (3%)
 Frame = +3

Query  330  LATTIHANMITSGFKPRAHIL-NRLIDIYCKSSNLPYARHLFDEIPQPDIVARTTMIAAY  506
            LA  + ++M  + ++P    L NRL+  Y KS  L YAR LFD++P  DI++   +++A+
Sbjct  41   LAKRLQSHMDLNFYEPNTTFLHNRLLHFYAKSGKLSYARDLFDKMPLRDIISWNALLSAH  100

Query  507  SASGDPNLAAEIFDRTPLSMRDTVFYNARITGYSHQNDGHAAIQVFNDMKRNNFQP  674
            + SG       +FD+ P+  RD+V YN  I G++++     A+QVF+ M+++ F+P
Sbjct  101  ARSGSVQDLRALFDKMPI--RDSVSYNTAIAGFANKGFSREALQVFSRMQKDRFEP  154



>ref|NP_179798.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana]
 sp|Q9SHZ8.1|PP168_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At2g22070 
[Arabidopsis thaliana]
 gb|AAD25817.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEC07259.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana]
Length=786

 Score = 82.8 bits (203),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 44/136 (32%), Positives = 71/136 (52%), Gaps = 6/136 (4%)
 Frame = +3

Query  285  LQLCSSNIHTPATSS----LATTIHANMITSGFKPRAHILNRLIDIYCKSSNLPYARHLF  452
            L+LC++ +      S     A  +H  +I SG     +++N L+++Y K+    +AR LF
Sbjct  13   LELCTNLLQKSVNKSNGRFTAQLVHCRVIKSGLMFSVYLMNNLMNVYSKTGYALHARKLF  72

Query  453  DEIPQPDIVARTTMIAAYSASGDPNLAAEIFDRTPLSMRDTVFYNARITGYSHQNDGHAA  632
            DE+P     +  T+++AYS  GD +   E FD+ P   RD+V +   I GY +    H A
Sbjct  73   DEMPLRTAFSWNTVLSAYSKRGDMDSTCEFFDQLP--QRDSVSWTTMIVGYKNIGQYHKA  130

Query  633  IQVFNDMKRNNFQPDQ  680
            I+V  DM +   +P Q
Sbjct  131  IRVMGDMVKEGIEPTQ  146


 Score = 55.8 bits (133),  Expect = 9e-06, Method: Composition-based stats.
 Identities = 36/118 (31%), Positives = 54/118 (46%), Gaps = 4/118 (3%)
 Frame = +3

Query  330  LATTIHANMITSGFKPRAHILNRLIDIYCKSSNLPYARHLFDEIPQPD--IVARTTMIAA  503
            +   IH++++T+GF     +LN LI +Y +   +  AR L ++    D  I   T ++  
Sbjct  297  IGKQIHSHIVTTGFDISGIVLNALISMYSRCGGVETARRLIEQRGTKDLKIEGFTALLDG  356

Query  504  YSASGDPNLAAEIFDRTPLSMRDTVFYNARITGYSHQNDGHAAIQVFNDMKRNNFQPD  677
            Y   GD N A  IF    L  RD V + A I GY        AI +F  M     +P+
Sbjct  357  YIKLGDMNQAKNIF--VSLKDRDVVAWTAMIVGYEQHGSYGEAINLFRSMVGGGQRPN  412


 Score = 53.9 bits (128),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 30/114 (26%), Positives = 62/114 (54%), Gaps = 3/114 (3%)
 Frame = +3

Query  342  IHANMITSGFKPRAHILNRLIDIYCKSSNLPYARHLFDEIPQPDIVARTTMIAAYSASGD  521
            +H+ ++  G +    + N L+++Y K  +   A+ +FD +   DI +   MIA +   G 
Sbjct  168  VHSFIVKLGLRGNVSVSNSLLNMYAKCGDPMMAKFVFDRMVVRDISSWNAMIALHMQVGQ  227

Query  522  PNLAAEIFDRTPLSMRDTVFYNARITGYSHQNDGHAAIQVFNDMKRNN-FQPDQ  680
             +LA   F++  ++ RD V +N+ I+G++ +     A+ +F+ M R++   PD+
Sbjct  228  MDLAMAQFEQ--MAERDIVTWNSMISGFNQRGYDLRALDIFSKMLRDSLLSPDR  279



>ref|XP_002522543.1| pentatricopeptide repeat-containing protein, putative [Ricinus 
communis]
 gb|EEF39843.1| pentatricopeptide repeat-containing protein, putative [Ricinus 
communis]
Length=530

 Score = 82.0 bits (201),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 42/136 (31%), Positives = 74/136 (54%), Gaps = 3/136 (2%)
 Frame = +3

Query  273  YAAHLQLCSSNIHTPATSSLATTIHANMITSGFKPRAHILNRLIDIYCKSSNLPYARHLF  452
            Y+  L+  +S  +   + +L + +H  ++ S  +P   +   L+D Y KS  + YAR +F
Sbjct  146  YSMILKASTSGDNVTLSCNLGSVVHGQILKSEVEPDDVLYTALVDSYVKSGRVGYARKVF  205

Query  453  DEIPQPDIVARTTMIAAYSASGDPNLAAEIFDRTPLSMRDTVFYNARITGYSHQ-NDGHA  629
            D + + +++  T+MI+ Y   G    A EIF+RT    +D V +NA I GYS        
Sbjct  206  DMMMEKNVICSTSMISGYMNRGSVEDAEEIFERTV--EKDVVVFNAMIEGYSKSVQTAEK  263

Query  630  AIQVFNDMKRNNFQPD  677
            A++V+ +M+R  F+P+
Sbjct  264  ALEVYVEMQRYGFRPN  279


 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 35/59 (59%), Gaps = 0/59 (0%)
 Frame = +3

Query  342  IHANMITSGFKPRAHILNRLIDIYCKSSNLPYARHLFDEIPQPDIVARTTMIAAYSASG  518
            IHA+++ +GF P  ++  +L+ +Y K   L YAR +FDE+PQ  + A   +I  Y   G
Sbjct  64   IHAHIVKTGFIPNTNVSIKLLILYLKCGCLKYARQMFDELPQRTLSAYNYLIGGYLKLG  122



>ref|XP_010943703.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like 
[Elaeis guineensis]
Length=523

 Score = 82.0 bits (201),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 49/165 (30%), Positives = 81/165 (49%), Gaps = 10/165 (6%)
 Frame = +3

Query  204  AAAAKSFESWAQGIYICRQLATR-------YAAHLQLCSSNIHTPATSSLATTIHANMIT  362
            A A + F   A   Y C + ATR       +A  ++ C     T     L   +H  ++ 
Sbjct  116  AHADQGFPDSAVAFYFCMR-ATRAPPNTYTFALLVKACIHGGDTGKLIGLGKEVHGQILK  174

Query  363  SGFKPRAHILNRLIDIYCKSSNLPYARHLFDEIPQPDIVARTTMIAAYSASGDPNLAAEI  542
             G +    + N L+++YC   +L  AR LFD+    D+++  T+I+AY  +GD   A E+
Sbjct  175  CGVEDVIVVKNSLLNMYCGMDHLAEARLLFDKSWHLDLISWNTLISAYGKNGDVVTAGEL  234

Query  543  FDRTPLSMRDTVFYNARITGYSHQNDGHAAIQVFNDMKRNNFQPD  677
            F+R P   R  V ++A I GY    D   A+++F++M+    +PD
Sbjct  235  FERMP--ERSLVSWSAMIDGYVRNGDFSMALRLFDEMQDEGMEPD  277



>ref|XP_004242544.1| PREDICTED: pentatricopeptide repeat-containing protein At3g02330 
[Solanum lycopersicum]
Length=858

 Score = 82.4 bits (202),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 44/112 (39%), Positives = 63/112 (56%), Gaps = 2/112 (2%)
 Frame = +3

Query  345  HANMITSGFKPRAHILNRLIDIYCKSSNLPYARHLFDEIPQPDIVARTTMIAAYSASGDP  524
            HA MI SGF+P   + N LI +Y K SNL YA  +FD++P  D V+   MI  YS   + 
Sbjct  47   HARMIISGFQPTVFVTNCLIQMYVKCSNLGYADKVFDKMPLRDTVSWNAMIFGYSMVSEL  106

Query  525  NLAAEIFDRTPLSMRDTVFYNARITGYSHQNDGHAAIQVFNDMKRNNFQPDQ  680
            + A  +FD TP   RD + +N+ I+GY    +   +IQ F +M R+    D+
Sbjct  107  DKAQLMFDLTP--ERDAISWNSLISGYMQNRNYGKSIQTFLEMGRDGIAFDR  156


 Score = 51.2 bits (121),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 31/117 (26%), Positives = 53/117 (45%), Gaps = 2/117 (2%)
 Frame = +3

Query  318  ATSSLATTIHANMITSGFKPRAHILNRLIDIYCKSSNLPYARHLFDEIPQPDIVARTTMI  497
            AT  L   IHA +I    +    I + L+D+Y K  N+  +R +F++ P+ D V    ++
Sbjct  574  ATVGLGKQIHAQIIKQELQSDVFITSTLVDMYSKCGNMQDSRLMFEKAPKKDFVTWNALV  633

Query  498  AAYSASGDPNLAAEIFDRTPLS--MRDTVFYNARITGYSHQNDGHAAIQVFNDMKRN  662
              Y+  G    A +IF++  L     +   + A +   +H       +Q FN M  N
Sbjct  634  CGYAQHGLGEEALQIFEKMQLEDVRPNHATFLAVLRACAHIGLVEKGLQHFNSMSNN  690



>ref|XP_006406355.1| hypothetical protein EUTSA_v10020511mg [Eutrema salsugineum]
 gb|ESQ47808.1| hypothetical protein EUTSA_v10020511mg [Eutrema salsugineum]
Length=522

 Score = 81.6 bits (200),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 44/135 (33%), Positives = 65/135 (48%), Gaps = 4/135 (3%)
 Frame = +3

Query  273  YAAHLQLCSSNIHTPATSSLATTIHANMITSGFKPRAHILNRLIDIYCKSSNLPYARHLF  452
            Y   L+LCS              IH N +TSG        NRL+D+Y K  ++ +AR LF
Sbjct  44   YIKALKLCS----CQNVGKQVLLIHGNSLTSGLGSNLKFNNRLMDLYAKQGDMKHARKLF  99

Query  453  DEIPQPDIVARTTMIAAYSASGDPNLAAEIFDRTPLSMRDTVFYNARITGYSHQNDGHAA  632
            D IP+ D+V+ T MI+ +S  G    A  +F +     RD V +N  I GY+  +    +
Sbjct  100  DRIPKRDVVSWTVMISGFSECGRHEDALLLFKQIRPEERDVVSWNVMINGYTAASTADTS  159

Query  633  IQVFNDMKRNNFQPD  677
             ++F  M     +PD
Sbjct  160  FRLFQLMLAEGKKPD  174



>ref|XP_010257871.1| PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing 
protein At3g02330 [Nelumbo nucifera]
Length=875

 Score = 82.4 bits (202),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 41/103 (40%), Positives = 58/103 (56%), Gaps = 2/103 (2%)
 Frame = +3

Query  345  HANMITSGFKPRAHILNRLIDIYCKSSNLPYARHLFDEIPQPDIVARTTMIAAYSASGDP  524
            HA MITSGF P   + N LI++Y + SN+ YA  +F+ +PQ D V+   MI+ Y+  G  
Sbjct  60   HAQMITSGFSPTVFVTNCLINMYIRCSNIDYASKVFERMPQRDTVSWNAMISGYAGCGSM  119

Query  525  NLAAEIFDRTPLSMRDTVFYNARITGYSHQNDGHAAIQVFNDM  653
            +LA  IFD  P   RD + +N+ I+GY    +    I  F  M
Sbjct  120  DLAQSIFDSMP--ERDVISWNSLISGYLRNGNYREPIIFFLQM  160


 Score = 53.1 bits (126),  Expect = 8e-05, Method: Composition-based stats.
 Identities = 32/109 (29%), Positives = 53/109 (49%), Gaps = 11/109 (10%)
 Frame = +3

Query  246  YICRQLAT-------RYAAHLQLCSSNIHTPATSSLATTIHANMITSGFKPRAHILNRLI  404
            + C+ L T        YA  L  C++     AT  L   +HA +I    +    I + L+
Sbjct  561  FFCQMLDTGLRPDNFTYATVLDTCAN----LATIGLGRQVHAQVIKQEMQSDVFISSTLV  616

Query  405  DIYCKSSNLPYARHLFDEIPQPDIVARTTMIAAYSASGDPNLAAEIFDR  551
            D+Y K  N+  +R +F+++P+ D V+   MI  Y+  G    A +IF+R
Sbjct  617  DMYSKCGNMQDSRLMFEKMPKKDFVSWNAMITGYAQHGLGEEALKIFER  665



>ref|XP_011629250.1| PREDICTED: pentatricopeptide repeat-containing protein At5g56310 
[Amborella trichopoda]
Length=491

 Score = 81.3 bits (199),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 42/113 (37%), Positives = 65/113 (58%), Gaps = 2/113 (2%)
 Frame = +3

Query  342  IHANMITSGFKPRAHILNRLIDIYCKSSNLPYARHLFDEIPQPDIVARTTMIAAYSASGD  521
            IHA +I  GF    H+   LI +Y   S L  AR LFDE+   D+++   MIA Y+  GD
Sbjct  98   IHAQVIRVGFGSDVHVQTGLIHMYSNCSVLLDARRLFDEMSHRDLISWNAMIAGYAKLGD  157

Query  522  PNLAAEIFDRTPLSMRDTVFYNARITGYSHQNDGHAAIQVFNDMKRNNFQPDQ  680
             + A EIF++  +  R+ + + A I+GY+  N  + AI +F  M+ +N +PD+
Sbjct  158  IDTAHEIFEQ--MDERNVISWTAVISGYAQMNRSNEAISLFRRMQLSNVKPDE  208



>ref|XP_003551787.1| PREDICTED: pentatricopeptide repeat-containing protein At3g02330-like 
[Glycine max]
Length=852

 Score = 82.0 bits (201),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 37/105 (35%), Positives = 60/105 (57%), Gaps = 2/105 (2%)
 Frame = +3

Query  342  IHANMITSGFKPRAHILNRLIDIYCKSSNLPYARHLFDEIPQPDIVARTTMIAAYSASGD  521
            +H  MI +GF P  ++ N L+  YCKSS + YA  +FD +PQ D+++  T+I  Y+  G+
Sbjct  28   VHTQMIVTGFVPTIYVANCLLQFYCKSSKMNYAFKVFDRMPQRDVISWNTLIFGYAGIGN  87

Query  522  PNLAAEIFDRTPLSMRDTVFYNARITGYSHQNDGHAAIQVFNDMK  656
               A  +FD  P   RD V +N+ ++ Y H      +I++F  M+
Sbjct  88   MGFAQSLFDSMP--ERDVVSWNSLLSCYLHNGVNRKSIEIFVRMR  130


 Score = 50.4 bits (119),  Expect = 7e-04, Method: Composition-based stats.
 Identities = 29/96 (30%), Positives = 48/96 (50%), Gaps = 4/96 (4%)
 Frame = +3

Query  273  YAAHLQLCSSNIHTPATSSLATTIHANMITSGFKPRAHILNRLIDIYCKSSNLPYARHLF  452
            YA  L +C++     AT  L   IHA ++        +I + L+D+Y K  N+  +R +F
Sbjct  545  YATVLDVCANM----ATIELGKQIHAQILKLQLHSDVYIASTLVDMYSKCGNMQDSRLMF  600

Query  453  DEIPQPDIVARTTMIAAYSASGDPNLAAEIFDRTPL  560
            ++ P+ D V  + MI AY+  G    A  +F+   L
Sbjct  601  EKAPKRDYVTWSAMICAYAYHGLGEKAINLFEEMQL  636



>gb|KDP20411.1| hypothetical protein JCGZ_06370 [Jatropha curcas]
Length=450

 Score = 80.9 bits (198),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 44/136 (32%), Positives = 71/136 (52%), Gaps = 6/136 (4%)
 Frame = +3

Query  273  YAAHLQLCSSNIHTPATSSLATTIHANMITSGFKPRAHILNRLIDIYCKSSNLPYARHLF  452
            +A  L++C  +     T       H  ++ +GF     I + ++D Y K S +  AR LF
Sbjct  33   FAGLLKICVKSKELELTRQ----GHGQVLVAGFLSNLVICSSILDAYVKCSEMVDARQLF  88

Query  453  DEIPQPDIVARTTMIAAYSASGDPNLAAEIFDRTPLSMRDTVFYNARITGYSHQNDGHAA  632
            D +   DI+A TTM++ Y+  GD   A E+FD  P   ++ V + A I+GY+    GH A
Sbjct  89   DGMNVKDILAWTTMVSGYAQWGDMEAANELFDLMP--EKNPVSWTALISGYARHGLGHKA  146

Query  633  IQVFNDMKRNNFQPDQ  680
            +++F  M   + +PDQ
Sbjct  147  LELFTKMLMLHIRPDQ  162



>ref|XP_010519672.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At1g68930 [Tarenaya hassleriana]
Length=700

 Score = 81.6 bits (200),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 41/115 (36%), Positives = 71/115 (62%), Gaps = 3/115 (3%)
 Frame = +3

Query  333  ATTIHANMITSGFKPRAHIL-NRLIDIYCKSSNLPYARHLFDEIPQPDIVARTTMIAAYS  509
            A  + +++ ++ F+P    L NRL+ IY KS  + YAR LFD++P  D+++   ++AAY+
Sbjct  44   AKRLQSHIESTSFEPSGTFLFNRLLHIYAKSGLVSYARDLFDKMPVRDVISWNALLAAYA  103

Query  510  ASGDPNLAAEIFDRTPLSMRDTVFYNARITGYSHQNDGHAAIQVFNDMKRNNFQP  674
             +G  +   E+FD  P+  RD+V YN  ++G+S       A++VF  M+R+ F+P
Sbjct  104  RAGSVDKLKEVFDAMPV--RDSVSYNTVVSGFSGNGFYIEALEVFLRMQRDGFEP  156



>ref|XP_010463633.1| PREDICTED: pentatricopeptide repeat-containing protein At3g02330-like 
[Camelina sativa]
Length=899

 Score = 82.0 bits (201),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 41/116 (35%), Positives = 64/116 (55%), Gaps = 2/116 (2%)
 Frame = +3

Query  330  LATTIHANMITSGFKPRAHILNRLIDIYCKSSNLPYARHLFDEIPQPDIVARTTMIAAYS  509
            L    HA+MI SGF+P   +LN L+ +Y  S +   A  +FD++P  D+V+   MI  Y+
Sbjct  66   LGKQAHAHMILSGFRPTTFVLNCLLQVYTNSRDFVSASMVFDKMPLRDVVSWNKMINGYA  125

Query  510  ASGDPNLAAEIFDRTPLSMRDTVFYNARITGYSHQNDGHAAIQVFNDMKRNNFQPD  677
             S D   A+  FD  P+  RD V +N+ ++GY    +   +I++F DM R   + D
Sbjct  126  KSNDMAKASSFFDMMPV--RDVVSWNSMLSGYLQNGESLKSIEIFLDMGRAGIEFD  179



>ref|XP_007013068.1| Tetratricopeptide repeat-like superfamily protein [Theobroma 
cacao]
 gb|EOY30687.1| Tetratricopeptide repeat-like superfamily protein [Theobroma 
cacao]
Length=697

 Score = 81.6 bits (200),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 40/117 (34%), Positives = 66/117 (56%), Gaps = 1/117 (1%)
 Frame = +3

Query  333  ATTIHANMITSGFKPRAHIL-NRLIDIYCKSSNLPYARHLFDEIPQPDIVARTTMIAAYS  509
            A  + ++M    F P    L NRL+ +Y KS  +  AR+LFD++PQ D+++   M++AY+
Sbjct  41   AKRLQSHMDLHYFTPSDTFLHNRLLHLYAKSGKILDARNLFDKMPQRDVISWNAMLSAYA  100

Query  510  ASGDPNLAAEIFDRTPLSMRDTVFYNARITGYSHQNDGHAAIQVFNDMKRNNFQPDQ  680
             SG       +FD+ P  +RD+V YN  I G +     + A++VF  M +  F+P +
Sbjct  101  KSGSIENLIAVFDQMPFRLRDSVSYNTVIAGLAGSGFSNKALEVFARMNKEEFEPTE  157



>emb|CDY34720.1| BnaA01g33050D [Brassica napus]
Length=881

 Score = 82.0 bits (201),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 41/110 (37%), Positives = 63/110 (57%), Gaps = 2/110 (2%)
 Frame = +3

Query  330  LATTIHANMITSGFKPRAHILNRLIDIYCKSSNLPYARHLFDEIPQPDIVARTTMIAAYS  509
            L    HA+MI SGF+P   +LN L+ +Y  S +L  A  LFD++P  D+V+  TMI  Y+
Sbjct  67   LGKQAHAHMILSGFRPTTFVLNCLLQVYTNSRDLLSASKLFDKMPVRDVVSWNTMINCYA  126

Query  510  ASGDPNLAAEIFDRTPLSMRDTVFYNARITGYSHQNDGHAAIQVFNDMKR  659
             S D   A+  F+  P   RD V +N+ ++GY    +   ++++F DM R
Sbjct  127  KSKDMVKASSFFNTMP--GRDVVSWNSMLSGYLQNGESFKSVEIFVDMGR  174



>gb|KDO66510.1| hypothetical protein CISIN_1g005454mg [Citrus sinensis]
Length=696

 Score = 81.6 bits (200),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 41/116 (35%), Positives = 71/116 (61%), Gaps = 3/116 (3%)
 Frame = +3

Query  330  LATTIHANMITSGFKPRAHIL-NRLIDIYCKSSNLPYARHLFDEIPQPDIVARTTMIAAY  506
            LA  + ++M  + ++P    L NRL+  Y KS  L YAR LFD++P  DI++   +++A+
Sbjct  41   LAKRLQSHMDLNFYEPNTTFLHNRLLHFYAKSGKLFYARDLFDKMPLRDIISWNALLSAH  100

Query  507  SASGDPNLAAEIFDRTPLSMRDTVFYNARITGYSHQNDGHAAIQVFNDMKRNNFQP  674
            + SG       +FD+ P+  RD+V YN  I G++++     A+QVF+ M+++ F+P
Sbjct  101  ARSGSVQDLRALFDKMPI--RDSVSYNTAIAGFANKGFSREALQVFSRMQKDRFEP  154



>ref|XP_009117919.1| PREDICTED: pentatricopeptide repeat-containing protein At3g02330 
[Brassica rapa]
Length=898

 Score = 82.0 bits (201),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 41/110 (37%), Positives = 63/110 (57%), Gaps = 2/110 (2%)
 Frame = +3

Query  330  LATTIHANMITSGFKPRAHILNRLIDIYCKSSNLPYARHLFDEIPQPDIVARTTMIAAYS  509
            L    HA+MI SGF+P   +LN L+ +Y  S +L  A  LFD++P  D+V+  TMI  Y+
Sbjct  67   LGKQAHAHMILSGFRPTTFVLNCLLQVYTNSRDLLSASKLFDKMPVRDVVSWNTMINCYA  126

Query  510  ASGDPNLAAEIFDRTPLSMRDTVFYNARITGYSHQNDGHAAIQVFNDMKR  659
             S D   A+  F+  P   RD V +N+ ++GY    +   ++++F DM R
Sbjct  127  KSKDMVKASSFFNTMP--GRDVVSWNSMLSGYLQNGESFKSVEIFVDMGR  174



>ref|XP_002314911.1| pentatricopeptide repeat-containing family protein [Populus trichocarpa]
 gb|EEF01082.1| pentatricopeptide repeat-containing family protein [Populus trichocarpa]
Length=743

 Score = 81.6 bits (200),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 42/110 (38%), Positives = 63/110 (57%), Gaps = 2/110 (2%)
 Frame = +3

Query  333  ATTIHANMITSGFKPRAHILNRLIDIYCKSSNLPYARHLFDEIPQPDIVARTTMIAAYSA  512
            A  +H  +I S   P   + N LI+ Y K  N+ YARH+FD++PQP+  +  TM++AYS 
Sbjct  24   AKKLHCLIIKSLTNPETFLYNNLINAYSKLGNITYARHVFDKMPQPNSFSWNTMLSAYSK  83

Query  513  SGDPNLAAEIFDRTPLSMRDTVFYNARITGYSHQNDGHAAIQVFNDMKRN  662
            SGD +   EIF   P   RD V +N+ I+GY        A++ +N M ++
Sbjct  84   SGDLSTMQEIFSIMP--NRDGVSWNSLISGYVCYGSVVEAVKTYNSMMKD  131


 Score = 52.8 bits (125),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 31/117 (26%), Positives = 53/117 (45%), Gaps = 2/117 (2%)
 Frame = +3

Query  330  LATTIHANMITSGFKPRAHILNRLIDIYCKSSNLPYARHLFDEIPQPDIVARTTMIAAYS  509
            L   IH  ++  GF     + + L+D+Y K   +  A  +FDE+ + ++V   TMI    
Sbjct  156  LGRQIHGQIVKFGFGAYVFVGSSLVDMYAKMGLVSVASQVFDEVQERNVVMYNTMITGLL  215

Query  510  ASGDPNLAAEIFDRTPLSMRDTVFYNARITGYSHQNDGHAAIQVFNDMKRNNFQPDQ  680
             SG    +  +F    +  RD++ +   ITG         A+ +F DM++     DQ
Sbjct  216  RSGMVKDSKRLFH--GMKERDSISWTTMITGLIQNGLEAEAMDLFRDMRQEGMAMDQ  270



>ref|XP_006299596.1| hypothetical protein CARUB_v10015774mg [Capsella rubella]
 gb|EOA32494.1| hypothetical protein CARUB_v10015774mg [Capsella rubella]
Length=1030

 Score = 82.0 bits (201),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 42/116 (36%), Positives = 63/116 (54%), Gaps = 2/116 (2%)
 Frame = +3

Query  330  LATTIHANMITSGFKPRAHILNRLIDIYCKSSNLPYARHLFDEIPQPDIVARTTMIAAYS  509
            L    HA+MI SGF+P   +LN LI +Y  S +   A  +FD +P  D+V+   MI  Y+
Sbjct  66   LGKQTHAHMILSGFRPTTFVLNCLIQVYTNSRDFMSASMVFDRMPLRDVVSWNKMINGYA  125

Query  510  ASGDPNLAAEIFDRTPLSMRDTVFYNARITGYSHQNDGHAAIQVFNDMKRNNFQPD  677
             S D   A+  FD+ P+  RD V +N+ ++GY    +   +I +F DM R   + D
Sbjct  126  KSNDMAKASSFFDKMPV--RDVVSWNSMLSGYLLNGESLKSIDIFLDMGRAGMEFD  179



>ref|XP_003530462.1| PREDICTED: pentatricopeptide repeat-containing protein At3g02330-like 
[Glycine max]
Length=852

 Score = 81.6 bits (200),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 38/104 (37%), Positives = 59/104 (57%), Gaps = 2/104 (2%)
 Frame = +3

Query  345  HANMITSGFKPRAHILNRLIDIYCKSSNLPYARHLFDEIPQPDIVARTTMIAAYSASGDP  524
            HA MI + F P  ++ N L+  YCKSSN+ YA  +FD +P  D+++  TMI  Y+  G+ 
Sbjct  29   HAQMIVTSFVPTIYVANCLVQFYCKSSNMNYAFKVFDRMPHRDVISWNTMIFGYAEIGNM  88

Query  525  NLAAEIFDRTPLSMRDTVFYNARITGYSHQNDGHAAIQVFNDMK  656
              A  +FD  P   RD V +N+ ++ Y H      +I++F  M+
Sbjct  89   GFAQSLFDTMP--ERDVVSWNSLLSCYLHNGVNRKSIEIFVRMR  130


 Score = 52.8 bits (125),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 29/96 (30%), Positives = 49/96 (51%), Gaps = 4/96 (4%)
 Frame = +3

Query  273  YAAHLQLCSSNIHTPATSSLATTIHANMITSGFKPRAHILNRLIDIYCKSSNLPYARHLF  452
            YA  L +C++     AT  L   IHA ++        +I + L+D+Y K  N+  +R +F
Sbjct  545  YATVLDVCANM----ATIELGKQIHAQILKLNLHSDVYIASTLVDMYSKCGNMQDSRLMF  600

Query  453  DEIPQPDIVARTTMIAAYSASGDPNLAAEIFDRTPL  560
            ++ P+ D V  + MI AY+  G    A ++F+   L
Sbjct  601  EKTPKRDYVTWSAMICAYAYHGHGEQAIKLFEEMQL  636



>ref|XP_010091655.1| hypothetical protein L484_026509 [Morus notabilis]
 gb|EXB44921.1| hypothetical protein L484_026509 [Morus notabilis]
Length=743

 Score = 81.6 bits (200),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 44/123 (36%), Positives = 69/123 (56%), Gaps = 6/123 (5%)
 Frame = +3

Query  285  LQLCSSNIHTPATSSLATTIHANMITSGFKPRAHILNRLIDIYCKSSNLPYARHLFDEIP  464
            L+LC          +LA  +H +++ +   P   + N+LID Y K   + YARHLFD++P
Sbjct  12   LKLCCET----QNQALAKKLHGHIVRNLTNPEIFLSNKLIDAYGKLGKVRYARHLFDQMP  67

Query  465  QPDIVARTTMIAAYSASGDPNLAAEIFDRTPLSMRDTVFYNARITGYSHQNDGHAAIQVF  644
            Q ++ +  T+++AYS SG  +   EIFDR P   RD V +NA I+GY+        ++V+
Sbjct  68   QRNLFSWNTILSAYSKSGYLSEMQEIFDRMP--SRDGVTWNALISGYASSGSVAQTVKVY  125

Query  645  NDM  653
              M
Sbjct  126  TLM  128



>ref|XP_007217021.1| hypothetical protein PRUPE_ppa001933mg [Prunus persica]
 gb|EMJ18220.1| hypothetical protein PRUPE_ppa001933mg [Prunus persica]
Length=739

 Score = 81.3 bits (199),  Expect = 5e-14, Method: Composition-based stats.
 Identities = 42/100 (42%), Positives = 57/100 (57%), Gaps = 2/100 (2%)
 Frame = +3

Query  354  MITSGFKPRAHILNRLIDIYCKSSNLPYARHLFDEIPQPDIVARTTMIAAYSASGDPNLA  533
            MI SGF+P   + N LI +Y K   L YA  +FD +PQ D V+  TMI  Y+ SG+   A
Sbjct  1    MIVSGFEPTVFVTNCLIQMYVKCGVLEYASKVFDGMPQRDTVSWNTMIFGYAESGNMGFA  60

Query  534  AEIFDRTPLSMRDTVFYNARITGYSHQNDGHAAIQVFNDM  653
               FD  P   RD V +N+ I+GY    D H +I+V+ +M
Sbjct  61   QSCFDVMP--ERDVVSWNSLISGYLQNGDYHKSIEVYVNM  98



>emb|CDY36989.1| BnaC09g18050D [Brassica napus]
Length=664

 Score = 81.3 bits (199),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 45/137 (33%), Positives = 76/137 (55%), Gaps = 8/137 (6%)
 Frame = +3

Query  273  YAAHLQLCSSNIHTPATSSLATTIHANMI-TSGFKPRAHILNRLIDIYCKSSNLPYARHL  449
            ++A L+ C S        SL    HA     SGF    ++ N +ID+Y K  ++  AR +
Sbjct  159  FSALLKACGS----VGDLSLGRQFHAQTFRLSGF-CSVYVGNTMIDLYVKCGSMECARKV  213

Query  450  FDEIPQPDIVARTTMIAAYSASGDPNLAAEIFDRTPLSMRDTVFYNARITGYSHQNDGHA  629
            FDE+P+ D+++ T +IAAY+ +GD + AAE+F+  P   +D V + A +TG+        
Sbjct  214  FDEMPERDVISWTELIAAYAKAGDMDSAAELFENLP--KKDIVAWTAMVTGFVQNAKPQE  271

Query  630  AIQVFNDMKRNNFQPDQ  680
            A++ F+ M+ +   PD+
Sbjct  272  ALEYFHRMEMSGVLPDE  288



>ref|XP_006430993.1| hypothetical protein CICLE_v10011041mg [Citrus clementina]
 gb|ESR44233.1| hypothetical protein CICLE_v10011041mg [Citrus clementina]
Length=888

 Score = 81.3 bits (199),  Expect = 5e-14, Method: Composition-based stats.
 Identities = 42/105 (40%), Positives = 62/105 (59%), Gaps = 2/105 (2%)
 Frame = +3

Query  345  HANMITSGFKPRAHILNRLIDIYCKSSNLPYARHLFDEIPQPDIVARTTMIAAYSASGDP  524
            HA +I SGFKP   + N LI +Y K SNL  A  +FD++PQ D+V+   +I  Y+A G+ 
Sbjct  69   HARLIVSGFKPTIFVSNCLIQLYIKCSNLKSALKVFDKMPQRDVVSWNALIFGYAARGEM  128

Query  525  NLAAEIFDRTPLSMRDTVFYNARITGYSHQNDGHAAIQVFNDMKR  659
             +A  +F+  P   RD + +N+ ++GY    D   AI VF +M R
Sbjct  129  GIARTLFEAMP--ERDVISWNSLLSGYLLVGDCAKAIDVFVEMGR  171


 Score = 53.5 bits (127),  Expect = 6e-05, Method: Composition-based stats.
 Identities = 34/123 (28%), Positives = 58/123 (47%), Gaps = 6/123 (5%)
 Frame = +3

Query  324  SSLATTIHANMITSGFKPRAHILNRLIDIYCKSSNLPYARHLFDEI----PQPDIVARTT  491
            S  A    + M+  G KP       L+D     + +     L  +I     Q D+   +T
Sbjct  563  SEDAQKFFSYMLKMGVKPDDFTYATLLDTCGNLATVGLGMQLHAQIIKQEMQSDVYISST  622

Query  492  MIAAYSASGDPNLAAEIFDRTPLSMRDTVFYNARITGYSHQNDGHAAIQVFNDMKRNNFQ  671
            ++  YS  G+   +  +F+++P   RD V +NA I GY+H   G  A++VF +M+  N +
Sbjct  623  LVDMYSKCGNVQDSRIMFEKSP--KRDFVTWNAMICGYAHHGLGEEALKVFENMELENVK  680

Query  672  PDQ  680
            P+ 
Sbjct  681  PNH  683



>ref|XP_011628220.1| PREDICTED: pentatricopeptide repeat-containing protein At2g13600 
[Amborella trichopoda]
Length=689

 Score = 80.9 bits (198),  Expect = 5e-14, Method: Composition-based stats.
 Identities = 48/138 (35%), Positives = 75/138 (54%), Gaps = 6/138 (4%)
 Frame = +3

Query  264  ATRYAAHLQLCSSNIHTPATSSLATTIHANMITSGFKPRAHILNRLIDIYCKSSNLPYAR  443
            +T +A  L++C   I+  + S    T H+ ++ + F     I+NRLID Y K  ++  AR
Sbjct  28   STIFADLLRIC---INQKSISGTRAT-HSRLLKTQFSTEVFIVNRLIDAYAKCHSIDSAR  83

Query  444  HLFDEIPQPDIVARTTMIAAYSASGDPNLAAEIFDRTPLSMRDTVFYNARITGYSHQNDG  623
             LFD++ Q +  +  TMI  Y+ S D   A  +FD  P    D V +NA I+G S QN  
Sbjct  84   SLFDQMLQRNTFSWNTMITGYAKSNDLTNAFSLFDSMP--QPDEVSWNAIISGLSKQNFC  141

Query  624  HAAIQVFNDMKRNNFQPD  677
            + A++ F  M++  F+PD
Sbjct  142  NKALEFFTRMRKEGFKPD  159


 Score = 63.9 bits (154),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 34/118 (29%), Positives = 61/118 (52%), Gaps = 2/118 (2%)
 Frame = +3

Query  321  TSSLATTIHANMITSGFKPRAHILNRLIDIYCKSSNLPYARHLFDEIPQPDIVARTTMIA  500
            ++   T +H + I  G+     + N L+D+Y K   +  AR +FD +P  D+V+ T++++
Sbjct  274  SAKCGTQVHGHSIVCGYGDDLVLGNALVDMYAKCGMVEEARRVFDWMPVRDVVSGTSIVS  333

Query  501  AYSASGDPNLAAEIFDRTPLSMRDTVFYNARITGYSHQNDGHAAIQVFNDMKRNNFQP  674
             Y+       A  +F++ P   R+ + +NA I GYS       A+ +F  MKR   +P
Sbjct  334  GYAKLSSVRDAYLMFEKMP--ERNVISWNALIAGYSQSRREEDALGLFKLMKREAIEP  389



>emb|CDP13155.1| unnamed protein product [Coffea canephora]
Length=602

 Score = 80.9 bits (198),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 40/117 (34%), Positives = 65/117 (56%), Gaps = 2/117 (2%)
 Frame = +3

Query  330  LATTIHANMITSGFKPRAHILNRLIDIYCKSSNLPYARHLFDEIPQPDIVARTTMIAAYS  509
            L   +H+ ++ +GF     + + ++D Y K   L  AR LFD++ + D++A TT+I+ Y+
Sbjct  208  LTKQVHSQVLVAGFSLNVVLSSSIVDAYAKCGELGDARKLFDQMGRRDVLAWTTLISGYA  267

Query  510  ASGDPNLAAEIFDRTPLSMRDTVFYNARITGYSHQNDGHAAIQVFNDMKRNNFQPDQ  680
              GD   A  +FD  P   R+ V + A I+GY+  N GH A+ +F  M     +PDQ
Sbjct  268  KWGDMESARVLFDVMP--ERNPVSWTAMISGYARNNKGHEALDLFMKMMMLCIRPDQ  322


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 40/134 (30%), Positives = 69/134 (51%), Gaps = 6/134 (4%)
 Frame = +3

Query  291  LCSSNIHTPATSSLATTIHANMITSGFKPRAHILNRLIDIYCKSSNLPYARHLFDEIP-Q  467
            LC+S   + A+      IHA++I   F+P + +L+ LID+Y K   L  A+ +FD +  +
Sbjct  329  LCASA--SIASLKHGKQIHAHLIRIKFRPNSIVLSSLIDMYSKCGCLELAKQVFDVVGDK  386

Query  468  PDIVARTTMIAAYSASGDPNLAAEIF-DRTPLSMR-DTVFYNARITGYSHQNDGHAAIQV  641
             D+V   TM++A +  G    A  +F +     +R D + +   ++  SH    H  +++
Sbjct  387  QDVVLWNTMLSALAQHGSGEKAINLFAEMVTAGVRPDKITFLVLLSACSHSGLVHEGLRL  446

Query  642  FNDMKRN-NFQPDQ  680
            F  M R+ N  PDQ
Sbjct  447  FESMNRDHNIVPDQ  460


 Score = 53.5 bits (127),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 39/154 (25%), Positives = 75/154 (49%), Gaps = 13/154 (8%)
 Frame = +3

Query  210  AAKSFESWAQ-GIYI-CRQLATRYAAHLQLCSSNIHTPATSSLATTIHANMITSGFK-PR  380
            A KS +  AQ GI + C++LA      +Q C+ +        L   +H ++  +G K P 
Sbjct  41   AVKSLDLLAQKGIRLDCKKLAFL----IQKCAES----KNLKLGRWVHLHLKVTGLKHPN  92

Query  381  AHILNRLIDIYCKSSNLPYARHLFDEIPQPDIVARTTMIAAYSASGDPNLAAEIFDRTPL  560
              + N LI++Y K  +   AR +FD++   ++ +   M++ Y+       A  +FD+ P 
Sbjct  93   TFLANHLINMYGKCGDHIEARRVFDKMSLRNLYSWNNMLSGYAKQLMVKPARRLFDKMP-  151

Query  561  SMRDTVFYNARITGYSHQNDGHAAIQVFNDMKRN  662
              RD V +N  +  Y+       A++ + +++R+
Sbjct  152  -ERDVVSWNTMVIAYAQSGICDEALRFYKELRRS  184



>ref|XP_007131688.1| hypothetical protein PHAVU_011G033500g [Phaseolus vulgaris]
 gb|ESW03682.1| hypothetical protein PHAVU_011G033500g [Phaseolus vulgaris]
Length=549

 Score = 80.5 bits (197),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 42/117 (36%), Positives = 63/117 (54%), Gaps = 2/117 (2%)
 Frame = +3

Query  330  LATTIHANMITSGFKPRAHILNRLIDIYCKSSNLPYARHLFDEIPQPDIVARTTMIAAYS  509
            L   IH  ++  GF     I + +ID Y K   +  AR LFD +   D+ A TT+++AY+
Sbjct  199  LCRQIHGQVLAVGFLSNVVISSLIIDAYAKCGKMEDARRLFDYMAVRDVRAWTTLVSAYA  258

Query  510  ASGDPNLAAEIFDRTPLSMRDTVFYNARITGYSHQNDGHAAIQVFNDMKRNNFQPDQ  680
            A GD    AE+F + P S   +  + + I GYS    GH A+ VF +M ++  +PDQ
Sbjct  259  ACGDMESGAELFSQMPKS--QSCSWTSLIRGYSRNGMGHEALGVFREMIKHQVRPDQ  313



>ref|XP_002530515.1| pentatricopeptide repeat-containing protein, putative [Ricinus 
communis]
 gb|EEF31847.1| pentatricopeptide repeat-containing protein, putative [Ricinus 
communis]
Length=359

 Score = 79.3 bits (194),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 34/96 (35%), Positives = 62/96 (65%), Gaps = 2/96 (2%)
 Frame = +3

Query  393  NRLIDIYCKSSNLPYARHLFDEIPQPDIVARTTMIAAYSASGDPNLAAEIFDRTPLSMRD  572
            N +ID + K+ +L  AR +FDE+P+ ++V+ T MI  Y+ +GD   A ++F+R P   RD
Sbjct  113  NAMIDGWVKAGDLLLARKVFDEMPERNVVSFTVMIDGYAKAGDMTTARDLFERAP--KRD  170

Query  573  TVFYNARITGYSHQNDGHAAIQVFNDMKRNNFQPDQ  680
             + ++A I+GY+     + A+++F +M+  N +PD+
Sbjct  171  VIAWSALISGYAQNGQPNEAVRIFLEMESKNVKPDE  206


 Score = 66.2 bits (160),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 34/108 (31%), Positives = 55/108 (51%), Gaps = 2/108 (2%)
 Frame = +3

Query  342  IHANMITSGFKPRAHILNRLIDIYCKSSNLPYARHLFDEIPQPDIVARTTMIAAYSASGD  521
            +H + I  G     ++ + L+D Y K   +  AR +FDE+ Q ++V+ T M+  Y   GD
Sbjct  34   VHGSAIRCGVSDDVYVGSSLVDFYGKCKEILSARKMFDEMTQKNVVSWTAMVVGYLNVGD  93

Query  522  PNLAAEIFDRTPLSMRDTVFYNARITGYSHQNDGHAAIQVFNDMKRNN  665
               A  +FD+ P   R+   +NA I G+    D   A +VF++M   N
Sbjct  94   LGNAERLFDQMP--ERNLKSWNAMIDGWVKAGDLLLARKVFDEMPERN  139



>ref|XP_009625829.1| PREDICTED: pentatricopeptide repeat-containing protein At3g02330 
[Nicotiana tomentosiformis]
Length=873

 Score = 81.3 bits (199),  Expect = 6e-14, Method: Composition-based stats.
 Identities = 43/112 (38%), Positives = 61/112 (54%), Gaps = 2/112 (2%)
 Frame = +3

Query  345  HANMITSGFKPRAHILNRLIDIYCKSSNLPYARHLFDEIPQPDIVARTTMIAAYSASGDP  524
            HA MI SGF+P   + N LI +Y K SNL YA  +FD++P  D V+   MI  YS   D 
Sbjct  47   HARMIISGFQPTIFVTNCLIQLYIKCSNLGYADRVFDKMPLRDTVSWNAMIFGYSMVSDM  106

Query  525  NLAAEIFDRTPLSMRDTVFYNARITGYSHQNDGHAAIQVFNDMKRNNFQPDQ  680
              A  +FD  P   RD + +N+ I+GY    +   +I+ F +M R+    D+
Sbjct  107  EKAKLMFDLMP--ERDVISWNSMISGYLQHGNYQKSIRAFMEMGRDGIAFDR  156


 Score = 52.4 bits (124),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 34/132 (26%), Positives = 60/132 (45%), Gaps = 6/132 (5%)
 Frame = +3

Query  273  YAAHLQLCSSNIHTPATSSLATTIHANMITSGFKPRAHILNRLIDIYCKSSNLPYARHLF  452
            YA  L  C++     AT  +   IHA +I    +    I + L+D+Y K  N+  +R +F
Sbjct  563  YATVLDTCAN----LATVGIGKQIHAQIIKQELQSDVFITSTLVDMYSKCGNMQDSRLMF  618

Query  453  DEIPQPDIVARTTMIAAYSASGDPNLAAEIFDRTPLS--MRDTVFYNARITGYSHQNDGH  626
            ++ P+ D V    ++  Y+  G  + A +IF++  L     +   + A +   +H     
Sbjct  619  EKAPKKDFVTWNALVCGYAQHGLGDEALQIFEKMQLEDVRPNHATFLAVLRACAHIGLVE  678

Query  627  AAIQVFNDMKRN  662
              +Q FN M  N
Sbjct  679  KGLQHFNSMSNN  690



>ref|XP_004289114.1| PREDICTED: pentatricopeptide repeat-containing protein At5g44230 
[Fragaria vesca subsp. vesca]
Length=650

 Score = 80.9 bits (198),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 41/119 (34%), Positives = 65/119 (55%), Gaps = 3/119 (3%)
 Frame = +3

Query  327  SLATTIHAN-MITSGFKPRAHILNRLIDIYCKSSNLPYARHLFDEIPQPDIVARTTMIAA  503
            SL   +HA  ++  GF    ++ N +ID+Y K   L   R +FDE+P+ D+V+ T +IA 
Sbjct  158  SLGRQVHAQTVVIGGFAADLYVGNTMIDMYLKCGELGCGRKVFDEMPERDVVSWTELIAV  217

Query  504  YSASGDPNLAAEIFDRTPLSMRDTVFYNARITGYSHQNDGHAAIQVFNDMKRNNFQPDQ  680
            Y+ SGD   A E+F+   LS++D V + A +TGY+       A+  F  M+      D+
Sbjct  218  YAKSGDMGSARELFEE--LSLKDMVAWTAMVTGYAQNLMPREALDCFERMRGAGVGIDE  274



>ref|XP_010252400.1| PREDICTED: pentatricopeptide repeat-containing protein At1g31430 
[Nelumbo nucifera]
 ref|XP_010252401.1| PREDICTED: pentatricopeptide repeat-containing protein At1g31430 
[Nelumbo nucifera]
 ref|XP_010252402.1| PREDICTED: pentatricopeptide repeat-containing protein At1g31430 
[Nelumbo nucifera]
Length=661

 Score = 80.9 bits (198),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 36/98 (37%), Positives = 58/98 (59%), Gaps = 2/98 (2%)
 Frame = +3

Query  387  ILNRLIDIYCKSSNLPYARHLFDEIPQPDIVARTTMIAAYSASGDPNLAAEIFDRTPLSM  566
            I N L+D+Y K   L  AR +FDE+P  ++++ T+M++ Y   G  + A E+FDRTP+  
Sbjct  269  IRNALLDMYSKCGYLSLARQIFDEMPDKNVISWTSMVSGYVNCGQLDEARELFDRTPV--  326

Query  567  RDTVFYNARITGYSHQNDGHAAIQVFNDMKRNNFQPDQ  680
            RD + + A I GY   N    A+ +F +M+    +PD+
Sbjct  327  RDVILWTAMINGYVQYNQFDKALTLFREMQMKRVKPDK  364



>ref|XP_010109916.1| hypothetical protein L484_013254 [Morus notabilis]
 gb|EXC24885.1| hypothetical protein L484_013254 [Morus notabilis]
Length=615

 Score = 80.5 bits (197),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 44/143 (31%), Positives = 73/143 (51%), Gaps = 7/143 (5%)
 Frame = +3

Query  255  RQLATRYAAHLQLCSSNIHTPATSSLATTIHAN-MITSGFKPRAHILNRLIDIYCKSSNL  431
            R L+  ++A  + C +         L   IHA  ++  GF    ++ N L+D+Y K   L
Sbjct  103  RPLSFTFSALFKTCGA----VKEMGLGRQIHAQTILVGGFVSDLYVGNTLMDMYVKCGVL  158

Query  432  PYARHLFDEIPQPDIVARTTMIAAYSASGDPNLAAEIFDRTPLSMRDTVFYNARITGYSH  611
              AR +FDE+P+ D+V+ T +I A++  GD  LA ++F   P+  +D V + A +TGY+ 
Sbjct  159  GCARRVFDEMPERDVVSWTELIVAHAKGGDMELAEDLFGELPV--KDKVAWTAMVTGYAQ  216

Query  612  QNDGHAAIQVFNDMKRNNFQPDQ  680
                  A+ +F  MK      D+
Sbjct  217  NARPREALYIFERMKNAGVLTDE  239



>ref|XP_012092576.1| PREDICTED: pentatricopeptide repeat-containing protein At2g21090 
[Jatropha curcas]
Length=617

 Score = 80.5 bits (197),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 44/136 (32%), Positives = 71/136 (52%), Gaps = 6/136 (4%)
 Frame = +3

Query  273  YAAHLQLCSSNIHTPATSSLATTIHANMITSGFKPRAHILNRLIDIYCKSSNLPYARHLF  452
            +A  L++C  +        L    H  ++ +GF     I + ++D Y K S +  AR LF
Sbjct  200  FAGLLKICVKS----KELELTRQGHGQVLVAGFLSNLVICSSILDAYVKCSEMVDARQLF  255

Query  453  DEIPQPDIVARTTMIAAYSASGDPNLAAEIFDRTPLSMRDTVFYNARITGYSHQNDGHAA  632
            D +   DI+A TTM++ Y+  GD   A E+FD  P   ++ V + A I+GY+    GH A
Sbjct  256  DGMNVKDILAWTTMVSGYAQWGDMEAANELFDLMP--EKNPVSWTALISGYARHGLGHKA  313

Query  633  IQVFNDMKRNNFQPDQ  680
            +++F  M   + +PDQ
Sbjct  314  LELFTKMLMLHIRPDQ  329


 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 32/136 (24%), Positives = 69/136 (51%), Gaps = 8/136 (6%)
 Frame = +3

Query  258  QLATRYAAHL-QLCSSNIHTPATSSLATTIHANMITSGFK-PRAHILNRLIDIYCKSSNL  431
            +L ++  AHL Q C++      +  L   +H ++  +G K P A + N LI +Y K  + 
Sbjct  61   RLPSQTLAHLIQQCANT----KSFKLGKRVHLHLKLTGLKRPNAFLANNLIAMYSKCGDY  116

Query  432  PYARHLFDEIPQPDIVARTTMIAAYSASGDPNLAAEIFDRTPLSMRDTVFYNARITGYSH  611
              A  +FDE+   ++ +   M++ Y+  G    A ++FD+ P   +D V +N  +  Y+ 
Sbjct  117  KSAHKVFDEMSMRNLYSWNNMLSVYAKLGKIKAARKLFDKMP--EKDVVSWNTMVIAYAQ  174

Query  612  QNDGHAAIQVFNDMKR  659
                + +++ + ++++
Sbjct  175  SGFCNESLRFYRELRK  190



>gb|AAG12601.1|AC068900_7 hypothetical protein; 7123-4412 [Arabidopsis thaliana]
Length=861

 Score = 80.9 bits (198),  Expect = 7e-14, Method: Composition-based stats.
 Identities = 42/116 (36%), Positives = 63/116 (54%), Gaps = 2/116 (2%)
 Frame = +3

Query  330  LATTIHANMITSGFKPRAHILNRLIDIYCKSSNLPYARHLFDEIPQPDIVARTTMIAAYS  509
            L    HA+MI SGF+P   +LN L+ +Y  S +   A  +FD++P  D+V+   MI  YS
Sbjct  24   LGKQAHAHMIISGFRPTTFVLNCLLQVYTNSRDFVSASMVFDKMPLRDVVSWNKMINGYS  83

Query  510  ASGDPNLAAEIFDRTPLSMRDTVFYNARITGYSHQNDGHAAIQVFNDMKRNNFQPD  677
             S D   A   F+  P+  RD V +N+ ++GY    +   +I+VF DM R   + D
Sbjct  84   KSNDMFKANSFFNMMPV--RDVVSWNSMLSGYLQNGESLKSIEVFVDMGREGIEFD  137



>ref|NP_186882.2| pentatricopeptide repeat-containing protein [Arabidopsis thaliana]
 sp|Q9FWA6.2|PP207_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At3g02330 
[Arabidopsis thaliana]
 gb|AEE73793.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana]
Length=903

 Score = 80.9 bits (198),  Expect = 7e-14, Method: Composition-based stats.
 Identities = 42/116 (36%), Positives = 63/116 (54%), Gaps = 2/116 (2%)
 Frame = +3

Query  330  LATTIHANMITSGFKPRAHILNRLIDIYCKSSNLPYARHLFDEIPQPDIVARTTMIAAYS  509
            L    HA+MI SGF+P   +LN L+ +Y  S +   A  +FD++P  D+V+   MI  YS
Sbjct  66   LGKQAHAHMIISGFRPTTFVLNCLLQVYTNSRDFVSASMVFDKMPLRDVVSWNKMINGYS  125

Query  510  ASGDPNLAAEIFDRTPLSMRDTVFYNARITGYSHQNDGHAAIQVFNDMKRNNFQPD  677
             S D   A   F+  P+  RD V +N+ ++GY    +   +I+VF DM R   + D
Sbjct  126  KSNDMFKANSFFNMMPV--RDVVSWNSMLSGYLQNGESLKSIEVFVDMGREGIEFD  179



>ref|XP_010255496.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21065 
[Nelumbo nucifera]
Length=842

 Score = 80.9 bits (198),  Expect = 7e-14, Method: Composition-based stats.
 Identities = 52/172 (30%), Positives = 88/172 (51%), Gaps = 12/172 (7%)
 Frame = +3

Query  174  LQIAMTMKNGAAAAKSFESWAQGIY---ICRQLATRYAAHLQLCSSNIHTPATSSLATTI  344
            L +A+   N   +A   E   +G+     CR L +     L+ C   IH  +       +
Sbjct  4    LSLAVGSWNSTPSALGTEKAGKGVMNRLRCRPLCSP----LKSCLQRIHLDSVQQTQFPL  59

Query  345  HANMITSGFKPRAHILNRLIDIYCKSSNLPYARHLFDEIPQPDIVARTTMIAAYSASGDP  524
            H+   T+   P   + NRL+D   KS  +  AR LFD++P  D  +  TMI+AY+  G  
Sbjct  60   HS---TAASFPSIFVSNRLLDDLSKSGRVDEARQLFDQMPCRDDFSWNTMISAYARLGRL  116

Query  525  NLAAEIFDRTPLSMRDTVFYNARITGYSHQNDGHAAIQVFNDMKRNNFQPDQ  680
              A ++FD+TP   + ++ ++A I+G++ Q DG  A+++F  M+ +  QP+Q
Sbjct  117  TEARQLFDQTP--TQTSITWSALISGHARQGDGLGALELFCQMRSDGLQPNQ  166


 Score = 52.4 bits (124),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 24/71 (34%), Positives = 41/71 (58%), Gaps = 0/71 (0%)
 Frame = +3

Query  333  ATTIHANMITSGFKPRAHILNRLIDIYCKSSNLPYARHLFDEIPQPDIVARTTMIAAYSA  512
            A  +H  ++ +GF+   H+ N LID+Y K  NL  A  +F  +P+ D+V+ T++I  Y+ 
Sbjct  388  AKCVHCLIVKTGFEAYKHVSNALIDVYAKQGNLNCAFSVFHRMPEQDVVSWTSLITGYAH  447

Query  513  SGDPNLAAEIF  545
             G    A ++F
Sbjct  448  HGFYENALKLF  458



>ref|XP_010690409.1| PREDICTED: pentatricopeptide repeat-containing protein At2g21090 
[Beta vulgaris subsp. vulgaris]
Length=572

 Score = 80.5 bits (197),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 41/118 (35%), Positives = 65/118 (55%), Gaps = 2/118 (2%)
 Frame = +3

Query  327  SLATTIHANMITSGFKPRAHILNRLIDIYCKSSNLPYARHLFDEIPQPDIVARTTMIAAY  506
            +L    H  ++ +GF P   + + ++D Y K   +  AR LFD +   DI A TT+I+ Y
Sbjct  210  ALTRQAHCQVLVAGFLPNLILSSSIVDAYAKCGEMSDARKLFDVMQFRDIPAWTTLISGY  269

Query  507  SASGDPNLAAEIFDRTPLSMRDTVFYNARITGYSHQNDGHAAIQVFNDMKRNNFQPDQ  680
               GD   A E+FD  P   +  V + A ++GY+  N GHAA+++F +M   + +PDQ
Sbjct  270  CKWGDMRSAQELFDVMP--AKSPVSWTAMVSGYARNNVGHAALELFREMMMFHIRPDQ  325



>ref|XP_007046822.1| Pentatricopeptide repeat (PPR) superfamily protein [Theobroma 
cacao]
 gb|EOX90979.1| Pentatricopeptide repeat (PPR) superfamily protein [Theobroma 
cacao]
Length=658

 Score = 80.5 bits (197),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 40/119 (34%), Positives = 64/119 (54%), Gaps = 3/119 (3%)
 Frame = +3

Query  327  SLATTIHANMI-TSGFKPRAHILNRLIDIYCKSSNLPYARHLFDEIPQPDIVARTTMIAA  503
            +L   IHA  I   GF    ++ N LI++Y K   L  AR +FDE+P+ D+++ T +I A
Sbjct  167  NLGRQIHAQTILIGGFGSDLYVNNSLIEMYVKLGFLGCARKVFDELPERDLISWTELIVA  226

Query  504  YSASGDPNLAAEIFDRTPLSMRDTVFYNARITGYSHQNDGHAAIQVFNDMKRNNFQPDQ  680
            Y+  GD   A E+FD  P+  +D V +   +TGY+       A++ F  M+    + D+
Sbjct  227  YAKLGDMESAGELFDELPI--KDMVAWTTMVTGYAQNAKPREALEFFERMQNEGVETDE  283



>ref|XP_002267303.1| PREDICTED: pentatricopeptide repeat-containing protein At1g28690, 
mitochondrial [Vitis vinifera]
Length=533

 Score = 80.1 bits (196),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 43/128 (34%), Positives = 70/128 (55%), Gaps = 3/128 (2%)
 Frame = +3

Query  294  CSSNIHTPATSSLATTIHANMITSGFKPRAHILNRLIDIYCKSSNLPYARHLFDEIPQPD  473
            C+S    P T SL   +HA ++ S  +    +   L+D Y K+  + YAR +FD +   +
Sbjct  155  CASGGIFPLTYSLGKVVHAQILRSNVESDDVLYTALVDSYVKNGKVGYARRVFDMMLDKN  214

Query  474  IVARTTMIAAYSASGDPNLAAEIFDRTPLSMRDTVFYNARITGYSHQND-GHAAIQVFND  650
            ++  T+MI+ Y + G    A +IF RT    +D V +NA I GYS   +    +++V+ D
Sbjct  215  VLCSTSMISGYMSQGSVEDAEDIFKRT--VEKDVVVFNAMIEGYSKSVETARRSLEVYID  272

Query  651  MKRNNFQP  674
            M+R NF+P
Sbjct  273  MQRLNFRP  280



>ref|XP_004309485.2| PREDICTED: pentatricopeptide repeat-containing protein At5g61800 
[Fragaria vesca subsp. vesca]
Length=527

 Score = 80.1 bits (196),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 38/121 (31%), Positives = 66/121 (55%), Gaps = 2/121 (2%)
 Frame = +3

Query  315  PATSSLATTIHANMITSGFKPRAHILNRLIDIYCKSSNLPYARHLFDEIPQPDIVARTTM  494
            P++  ++  +H+  +  GF   + + N LI +Y    NL +AR LFDE P  D+V+   M
Sbjct  127  PSSFPISQALHSQALKFGFASHSFVANTLIHVYSVCHNLNHARQLFDESPHKDMVSYNAM  186

Query  495  IAAYSASGDPNLAAEIFDRTPLSMRDTVFYNARITGYSHQNDGHAAIQVFNDMKRNNFQP  674
            + A+   G+ + A E+FD  P   RD+V +   + GY+  +    AI++F +M  +  +P
Sbjct  187  LDAFVKGGEMDNAREVFDEMP--ERDSVSWGTVLAGYAQTSRCEEAIELFGEMMESEIRP  244

Query  675  D  677
            D
Sbjct  245  D  245



>ref|XP_008221533.1| PREDICTED: pentatricopeptide repeat-containing protein At2g20540-like 
[Prunus mume]
Length=526

 Score = 80.1 bits (196),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 40/120 (33%), Positives = 62/120 (52%), Gaps = 2/120 (2%)
 Frame = +3

Query  321  TSSLATTIHANMITSGFKPRAHILNRLIDIYCKSSNLPYARHLFDEIPQPDIVARTTMIA  500
            +S L   +H   +  GF     + N LI +YC   ++  ARH+FDEIP  + V+ T MI+
Sbjct  125  SSCLGELVHGCSLKLGFVSDIFVGNSLIVMYCAFDDMKAARHIFDEIPSLNAVSWTVMIS  184

Query  501  AYSASGDPNLAAEIFDRTPLSMRDTVFYNARITGYSHQNDGHAAIQVFNDMKRNNFQPDQ  680
             +S +GD + A   FD  P+  RD   + A I+GY   N     + +F  M+    +PD+
Sbjct  185  GHSKAGDLDTARLFFDEAPV--RDRGIWGAMISGYVQNNCFKEGLYMFRLMQLTEIEPDE  242



>ref|XP_011028231.1| PREDICTED: pentatricopeptide repeat-containing protein At1g31430 
isoform X2 [Populus euphratica]
Length=540

 Score = 80.1 bits (196),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 34/94 (36%), Positives = 57/94 (61%), Gaps = 2/94 (2%)
 Frame = +3

Query  399  LIDIYCKSSNLPYARHLFDEIPQPDIVARTTMIAAYSASGDPNLAAEIFDRTPLSMRDTV  578
            L+D+YCK   L  AR +FDE+P  +++  T+M++ Y   G+ + A E+F+R+P+  RD V
Sbjct  151  LLDMYCKCGCLSVARKIFDEMPHKNVICWTSMVSGYVNYGELDKARELFERSPV--RDVV  208

Query  579  FYNARITGYSHQNDGHAAIQVFNDMKRNNFQPDQ  680
             + A I GY   N    A+ +F +M+    +PD+
Sbjct  209  LWTAMINGYVQFNHFDEAVALFQEMQIQRVKPDK  242



>ref|XP_011623321.1| PREDICTED: pentatricopeptide repeat-containing protein At3g02330 
[Amborella trichopoda]
Length=844

 Score = 80.5 bits (197),  Expect = 9e-14, Method: Composition-based stats.
 Identities = 46/140 (33%), Positives = 71/140 (51%), Gaps = 7/140 (5%)
 Frame = +3

Query  261  LATRYAAHLQLCSSNIHTPATSSLATTIHANMITSGFKPRAHILNRLIDIYCKSSNLPYA  440
            L   Y+  LQ C+        S      HA+MITSGFKP   + N LI++Y KSSN   A
Sbjct  15   LRKTYSHILQECAIR-----RSEAGREAHAHMITSGFKPSIFVFNCLINMYLKSSNTHDA  69

Query  441  RHLFDEIPQPDIVARTTMIAAYSASGDPNLAAEIFDRTPLSMRDTVFYNARITGYSHQND  620
             ++F ++P  D+V+  +MI  YS +     A  +F+  P+  +D + +N+ + GYS   D
Sbjct  70   LNVFKQMPHKDLVSYNSMIYQYSFTNSMPSALSLFNSMPI--KDAISWNSLMAGYSQNGD  127

Query  621  GHAAIQVFNDMKRNNFQPDQ  680
                + +F  M   +  PD 
Sbjct  128  HFKPLFLFKQMLETDVGPDH  147


 Score = 57.4 bits (137),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 38/136 (28%), Positives = 59/136 (43%), Gaps = 37/136 (27%)
 Frame = +3

Query  273  YAAHLQLCSSNIHTPATSSLATTIHANMITSGFKPRAHILNRLIDIYCKSSNLPYARHLF  452
            YA  L  C++     AT  L   IHA +I        +I + LID+YCK           
Sbjct  553  YATVLDTCAN----LATVGLGKQIHAQIIKEDLHKDVYIGSTLIDMYCKC----------  598

Query  453  DEIPQPDIVARTTMIAAYSASGDPNLAAEIFDRTPLSMRDTVFYNARITGYSHQNDGHAA  632
                                 GD + + ++F++  +  RD + +NA ITGY+H   G  A
Sbjct  599  ---------------------GDMDDSLKMFEK--MEKRDFISWNAVITGYAHHGRGKEA  635

Query  633  IQVFNDMKRNNFQPDQ  680
            +++F  MKR N +P+ 
Sbjct  636  LEIFERMKRENVKPNH  651



>ref|XP_010940859.1| PREDICTED: pentatricopeptide repeat-containing protein At5g08510 
[Elaeis guineensis]
Length=510

 Score = 79.7 bits (195),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 40/115 (35%), Positives = 63/115 (55%), Gaps = 3/115 (3%)
 Frame = +3

Query  339  TIHANMITSGFKPRAHILNRLIDIYCKSSNLPYARHLFDEIPQPDIVARTTMIAAYSASG  518
             +HA+ + SGF   A +   L+D+Y K+  L  AR LFDE+P  D+    +MI  Y+  G
Sbjct  106  ALHADFVKSGFTFDAFVATSLLDMYAKAGLLASARRLFDEMPHRDVALWNSMIGGYAKCG  165

Query  519  DPNLAAEIFDRTPLSMRDTVFYNARITGYSHQNDGHAAIQVFNDM-KRNNFQPDQ  680
            +   A E+FD  PL  R+ + + + I+GYS       AI+VF  M +    +P++
Sbjct  166  ELAKAKELFDMMPL--RNVISWTSMISGYSQNGKYEEAIEVFVRMWEEGEVRPNE  218



>ref|XP_010472662.1| PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing 
protein At3g02330-like [Camelina sativa]
Length=899

 Score = 80.5 bits (197),  Expect = 9e-14, Method: Composition-based stats.
 Identities = 41/116 (35%), Positives = 62/116 (53%), Gaps = 2/116 (2%)
 Frame = +3

Query  330  LATTIHANMITSGFKPRAHILNRLIDIYCKSSNLPYARHLFDEIPQPDIVARTTMIAAYS  509
            L    HA+MI SGF+P   +LN L+ +Y  S +   A  +FD +P  D+V+   MI  Y+
Sbjct  66   LGKQAHAHMILSGFRPTTFVLNCLLQVYTNSRDFVSASMVFDRMPLRDVVSWNKMINGYA  125

Query  510  ASGDPNLAAEIFDRTPLSMRDTVFYNARITGYSHQNDGHAAIQVFNDMKRNNFQPD  677
             S D   A   FD  P+  RD V +N+ ++GY    +   +I++F DM R   + D
Sbjct  126  KSNDMAKANSFFDMMPV--RDVVSWNSMLSGYLQNGESLKSIEIFIDMGRAGIEFD  179



>ref|XP_008777202.1| PREDICTED: pentatricopeptide repeat-containing protein At5g61800 
[Phoenix dactylifera]
Length=513

 Score = 79.7 bits (195),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 42/116 (36%), Positives = 61/116 (53%), Gaps = 2/116 (2%)
 Frame = +3

Query  330  LATTIHANMITSGFKPRAHILNRLIDIYCKSSNLPYARHLFDEIPQPDIVARTTMIAAYS  509
            L  T+H+    SGF     + N LI +Y  S ++  AR LFD+I  P++VA  T+I  Y 
Sbjct  129  LGRTLHSQAFKSGFAADLFVRNTLISVYASSHSMLDARRLFDQISSPEVVAYNTLIDGYV  188

Query  510  ASGDPNLAAEIFDRTPLSMRDTVFYNARITGYSHQNDGHAAIQVFNDMKRNNFQPD  677
             +GD  LA ++FD  P   RD V +   + GYS       A+Q+F+ M     +PD
Sbjct  189  KAGDMTLARKLFDEMP--ARDAVSWGTLLAGYSRMRQFKDALQLFDRMLAAGSRPD  242



>gb|KHN05415.1| Pentatricopeptide repeat-containing protein [Glycine soja]
Length=605

 Score = 80.1 bits (196),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 39/118 (33%), Positives = 63/118 (53%), Gaps = 2/118 (2%)
 Frame = +3

Query  327  SLATTIHANMITSGFKPRAHILNRLIDIYCKSSNLPYARHLFDEIPQPDIVARTTMIAAY  506
             L   IH  ++  GF     I + ++D Y K   +  AR LFD++P  D+ A TT+++ Y
Sbjct  259  ELCRQIHGQVLVVGFLSNVVISSLIVDAYAKCGKMENARRLFDDMPVRDVRAWTTLVSGY  318

Query  507  SASGDPNLAAEIFDRTPLSMRDTVFYNARITGYSHQNDGHAAIQVFNDMKRNNFQPDQ  680
            +  GD    AE+F + P S  D+  + + I GY+    G+ A+ VF  M ++  +PDQ
Sbjct  319  AVWGDMESGAELFSQMPKS--DSCSWTSLIRGYARNGMGYEALGVFKQMIKHQVRPDQ  374



>emb|CDY36792.1| BnaA03g10940D [Brassica napus]
Length=543

 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 34/113 (30%), Positives = 58/113 (51%), Gaps = 0/113 (0%)
 Frame = +3

Query  342  IHANMITSGFKPRAHILNRLIDIYCKSSNLPYARHLFDEIPQPDIVARTTMIAAYSASGD  521
            +H+  + SGF    H++  LI +YC S  L  AR +FDE+P  D+     ++A     G+
Sbjct  150  VHSQTVVSGFDSSVHVVTSLIQMYCSSGGLRDARKVFDEMPVRDVTVWNALLAGCGKVGE  209

Query  522  PNLAAEIFDRTPLSMRDTVFYNARITGYSHQNDGHAAIQVFNDMKRNNFQPDQ  680
             + A  + +  P  +R+ V +   I+ Y+ +     AI+VF  M   N +PD+
Sbjct  210  VDEARRLLEMMPCWVRNVVSWTCVISAYAKKGRATEAIEVFQRMVMENVEPDE  262



>ref|XP_004303223.1| PREDICTED: pentatricopeptide repeat-containing protein At3g02330 
[Fragaria vesca subsp. vesca]
Length=857

 Score = 80.5 bits (197),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 43/103 (42%), Positives = 56/103 (54%), Gaps = 2/103 (2%)
 Frame = +3

Query  345  HANMITSGFKPRAHILNRLIDIYCKSSNLPYARHLFDEIPQPDIVARTTMIAAYSASGDP  524
            HA M+ SGF P   + N LI +Y K   L YA  +FDE+PQ D V+  TMI  Y+ SGD 
Sbjct  50   HARMLISGFDPTVFVSNCLIQMYLKCRVLRYAAKVFDEMPQRDTVSWNTMIFGYAESGDM  109

Query  525  NLAAEIFDRTPLSMRDTVFYNARITGYSHQNDGHAAIQVFNDM  653
             LA   FD  P   RD V +N+ ++GY    +    I V+  M
Sbjct  110  GLAQACFDAMP--ARDVVSWNSLVSGYLRNGECFETIDVYVKM  150



>ref|XP_010905347.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like 
[Elaeis guineensis]
Length=272

 Score = 77.4 bits (189),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 44/151 (29%), Positives = 75/151 (50%), Gaps = 10/151 (7%)
 Frame = +3

Query  246  YICRQLATR-------YAAHLQLCSSNIHTPATSSLATTIHANMITSGFKPRAHILNRLI  404
            Y C + ATR       +A  ++ C     T     L   +H  ++  G +    + N L+
Sbjct  18   YFCMR-ATRAPPNTYNFALLVKACIHGGDTRKLIGLGKEVHGQILKCGVEDVIVVKNSLL  76

Query  405  DIYCKSSNLPYARHLFDEIPQPDIVARTTMIAAYSASGDPNLAAEIFDRTPLSMRDTVFY  584
            ++YC    L  AR LFD+    D+++  T+I+AY  +GD   A ++F+R P   R  V +
Sbjct  77   NMYCAMGRLAEARLLFDKSWHLDLISWNTLISAYGKNGDVVTAGDLFERMP--ERSLVSW  134

Query  585  NARITGYSHQNDGHAAIQVFNDMKRNNFQPD  677
            +A I GY    D   A+++F++M+    +PD
Sbjct  135  SAMIDGYVRNEDFSMALRLFHEMQDERMKPD  165



>ref|XP_006591553.1| PREDICTED: pentatricopeptide repeat-containing protein At2g21090-like 
[Glycine max]
Length=548

 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 41/118 (35%), Positives = 62/118 (53%), Gaps = 2/118 (2%)
 Frame = +3

Query  327  SLATTIHANMITSGFKPRAHILNRLIDIYCKSSNLPYARHLFDEIPQPDIVARTTMIAAY  506
             L   IH  ++  GF     I + ++D Y K   L  AR LFD +P  D+ A TT+++ Y
Sbjct  192  ELCRQIHGQVLVIGFSSNVVISSLIVDAYAKCGKLEDARRLFDGMPVRDVRAWTTLVSGY  251

Query  507  SASGDPNLAAEIFDRTPLSMRDTVFYNARITGYSHQNDGHAAIQVFNDMKRNNFQPDQ  680
            +  GD    AE+F + P S  ++  + + I GY+    G+ AI VF  M R+  +PDQ
Sbjct  252  ATWGDMKSGAELFSQMPKS--NSCSWTSLIRGYARNGMGYEAIGVFRQMIRHQVRPDQ  307



>ref|XP_002523296.1| pentatricopeptide repeat-containing protein, putative [Ricinus 
communis]
 gb|EEF39012.1| pentatricopeptide repeat-containing protein, putative [Ricinus 
communis]
Length=353

 Score = 78.2 bits (191),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 49/140 (35%), Positives = 71/140 (51%), Gaps = 13/140 (9%)
 Frame = +3

Query  294  CSSNIHT-----PATSSLATTIHANMI-----TSGFKPRAHILNRLIDIYCKSSNLPYAR  443
            C+ N HT      A +S  + +HA M+      SGF+     L  L+D+YCK   + +A 
Sbjct  78   CTGNQHTFTFLFAACASFFSPLHAQMLHTHFKKSGFESDVIALTALVDMYCKLGMVAFAH  137

Query  444  HLFDEIPQPDIVARTTMIAAYSASGDPNLAAEIFDRTPLSMRDTVFYNARITGYSHQNDG  623
             +FDEIP  DI     +IA YS  GD   A +IF   P   R+ V + A I+GYS     
Sbjct  138  RVFDEIPVRDIPTWNALIAGYSRCGDMEGALKIFKLMP--DRNVVSWTAMISGYSQNGRY  195

Query  624  HAAIQVFNDM-KRNNFQPDQ  680
              A+++F  M K N  +P++
Sbjct  196  AKALELFLKMEKENGLRPNE  215



>ref|XP_004233728.1| PREDICTED: pentatricopeptide repeat-containing protein At5g44230 
[Solanum lycopersicum]
Length=651

 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 40/119 (34%), Positives = 67/119 (56%), Gaps = 3/119 (3%)
 Frame = +3

Query  327  SLATTIHANMIT-SGFKPRAHILNRLIDIYCKSSNLPYARHLFDEIPQPDIVARTTMIAA  503
            +L   IH   I   GF     + N LID+Y K   L Y R +FDE+ + D+++ T++I A
Sbjct  159  NLGRQIHCQSIKLGGFCEDLFVHNILIDMYVKCGWLDYGRKVFDEMSERDVISWTSLIVA  218

Query  504  YSASGDPNLAAEIFDRTPLSMRDTVFYNARITGYSHQNDGHAAIQVFNDMKRNNFQPDQ  680
            YS +GD   AAE+F+R P+  +D V + A ++G++       A++ F+ M+    + D+
Sbjct  219  YSKAGDMAAAAEMFERLPV--KDLVAWTAMVSGFAQNAKPREALEFFHRMQSEGVETDE  275



>gb|KHN06390.1| Pentatricopeptide repeat-containing protein [Glycine soja]
Length=599

 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 42/137 (31%), Positives = 76/137 (55%), Gaps = 7/137 (5%)
 Frame = +3

Query  273  YAAHLQLCSSNIHTPATSSLATTIHAN-MITSGFKPRAHILNRLIDIYCKSSNLPYARHL  449
            ++A    C++  H    S+L   +HA  ++  GF    ++ N +ID+Y K  +L  AR +
Sbjct  112  FSALFSACAAVRH----SALGAQLHAQTLLLGGFSSDLYVNNAVIDMYVKCGSLRCARMV  167

Query  450  FDEIPQPDIVARTTMIAAYSASGDPNLAAEIFDRTPLSMRDTVFYNARITGYSHQNDGHA  629
            FDE+P+ D+++ T +I AY+  GD   A ++FD  P+  +D V + A +TGY+       
Sbjct  168  FDEMPERDVISWTGLIVAYTRIGDMRAARDLFDGLPV--KDMVTWTAMVTGYAQNAMPMD  225

Query  630  AIQVFNDMKRNNFQPDQ  680
            A++VF  ++    + D+
Sbjct  226  ALEVFRRLRDEGVEIDE  242



>gb|AEP33771.1| organelle transcript processing 82, partial [Thlaspi arvense]
Length=673

 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 36/113 (32%), Positives = 66/113 (58%), Gaps = 2/113 (2%)
 Frame = +3

Query  342  IHANMITSGFKPRAHILNRLIDIYCKSSNLPYARHLFDEIPQPDIVARTTMIAAYSASGD  521
            IH +++  G++P  ++   LI +Y ++  L  A  +FD     D+V+ T +I  Y++SG+
Sbjct  88   IHGHVLKLGYEPDLYVHTSLISMYAQNGRLEDAHKVFDRSSHRDVVSYTALITGYASSGN  147

Query  522  PNLAAEIFDRTPLSMRDTVFYNARITGYSHQNDGHAAIQVFNDMKRNNFQPDQ  680
               A E+FD  P+  +D V +NA I+GY+       A+++F +M + N +PD+
Sbjct  148  IRSAQEMFDEIPV--KDVVSWNAMISGYAETGSYKEALELFKEMMKTNVRPDE  198



>ref|XP_006451021.1| hypothetical protein CICLE_v10007671mg [Citrus clementina]
 gb|ESR64261.1| hypothetical protein CICLE_v10007671mg [Citrus clementina]
Length=663

 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 36/96 (38%), Positives = 56/96 (58%), Gaps = 2/96 (2%)
 Frame = +3

Query  393  NRLIDIYCKSSNLPYARHLFDEIPQPDIVARTTMIAAYSASGDPNLAAEIFDRTPLSMRD  572
            N L+D+YCK   L  AR LFDE+P  +++  T+M++ Y   G    A ++FDR+P+  RD
Sbjct  272  NALLDMYCKCGCLSEARELFDEMPNKNVICWTSMVSGYVNCGQLEKARDLFDRSPV--RD  329

Query  573  TVFYNARITGYSHQNDGHAAIQVFNDMKRNNFQPDQ  680
             V + A I GY   N    A+ +F +M+    +PD+
Sbjct  330  IVLWTAMINGYVQFNRFDEAVALFREMQIIRLKPDK  365



>emb|CBI30660.3| unnamed protein product [Vitis vinifera]
Length=598

 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 43/128 (34%), Positives = 70/128 (55%), Gaps = 3/128 (2%)
 Frame = +3

Query  294  CSSNIHTPATSSLATTIHANMITSGFKPRAHILNRLIDIYCKSSNLPYARHLFDEIPQPD  473
            C+S    P T SL   +HA ++ S  +    +   L+D Y K+  + YAR +FD +   +
Sbjct  155  CASGGIFPLTYSLGKVVHAQILRSNVESDDVLYTALVDSYVKNGKVGYARRVFDMMLDKN  214

Query  474  IVARTTMIAAYSASGDPNLAAEIFDRTPLSMRDTVFYNARITGYSHQND-GHAAIQVFND  650
            ++  T+MI+ Y + G    A +IF RT    +D V +NA I GYS   +    +++V+ D
Sbjct  215  VLCSTSMISGYMSQGSVEDAEDIFKRT--VEKDVVVFNAMIEGYSKSVETARRSLEVYID  272

Query  651  MKRNNFQP  674
            M+R NF+P
Sbjct  273  MQRLNFRP  280



>gb|KDO80373.1| hypothetical protein CISIN_1g007077mg [Citrus sinensis]
Length=619

 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 36/96 (38%), Positives = 56/96 (58%), Gaps = 2/96 (2%)
 Frame = +3

Query  393  NRLIDIYCKSSNLPYARHLFDEIPQPDIVARTTMIAAYSASGDPNLAAEIFDRTPLSMRD  572
            N L+D+YCK   L  AR LFDE+P  +++  T+M++ Y   G    A ++FDR+P+  RD
Sbjct  228  NALLDMYCKCGCLSEARELFDEMPNKNVICWTSMVSGYVNCGQLEKARDLFDRSPV--RD  285

Query  573  TVFYNARITGYSHQNDGHAAIQVFNDMKRNNFQPDQ  680
             V + A I GY   N    A+ +F +M+    +PD+
Sbjct  286  IVLWTAMINGYVQFNRFDEAVALFREMQIIRLKPDK  321



>ref|XP_006475772.1| PREDICTED: pentatricopeptide repeat-containing protein At1g31430-like 
[Citrus sinensis]
Length=663

 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 36/96 (38%), Positives = 56/96 (58%), Gaps = 2/96 (2%)
 Frame = +3

Query  393  NRLIDIYCKSSNLPYARHLFDEIPQPDIVARTTMIAAYSASGDPNLAAEIFDRTPLSMRD  572
            N L+D+YCK   L  AR LFDE+P  +++  T+M++ Y   G    A ++FDR+P+  RD
Sbjct  272  NALLDMYCKCGCLSEARELFDEMPNKNVICWTSMVSGYVNCGQLEKARDLFDRSPV--RD  329

Query  573  TVFYNARITGYSHQNDGHAAIQVFNDMKRNNFQPDQ  680
             V + A I GY   N    A+ +F +M+    +PD+
Sbjct  330  IVLWTAMINGYVQFNRFDEAVALFREMQIIRLKPDK  365



>ref|XP_009132312.1| PREDICTED: pentatricopeptide repeat-containing protein At5g56310 
[Brassica rapa]
Length=543

 Score = 79.3 bits (194),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 33/113 (29%), Positives = 58/113 (51%), Gaps = 0/113 (0%)
 Frame = +3

Query  342  IHANMITSGFKPRAHILNRLIDIYCKSSNLPYARHLFDEIPQPDIVARTTMIAAYSASGD  521
            +H+  + SGF    H++  LI +YC    L  AR +FDE+P  D+     ++A Y   G+
Sbjct  150  VHSQTVVSGFDSSVHVVTSLIQMYCSCEVLGDARKVFDEMPVRDVTVWNALLAGYGKVGE  209

Query  522  PNLAAEIFDRTPLSMRDTVFYNARITGYSHQNDGHAAIQVFNDMKRNNFQPDQ  680
             + A  + +  P  +R+ V +   I+ Y+ +     AI+VF  M   + +PD+
Sbjct  210  VDEARRLLEMMPCWVRNVVSWTCVISAYAKKGRASEAIEVFQRMVMEDVEPDE  262



>ref|XP_002520145.1| pentatricopeptide repeat-containing protein, putative [Ricinus 
communis]
 gb|EEF42200.1| pentatricopeptide repeat-containing protein, putative [Ricinus 
communis]
Length=327

 Score = 77.8 bits (190),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 38/118 (32%), Positives = 63/118 (53%), Gaps = 2/118 (2%)
 Frame = +3

Query  327  SLATTIHANMITSGFKPRAHILNRLIDIYCKSSNLPYARHLFDEIPQPDIVARTTMIAAY  506
             +   +H  +I  GF    H+ + LI +Y +   L + R +FD IPQPD+V +T M++A 
Sbjct  101  EIGLAVHGCVIKYGFGLDPHVQSGLIFMYAELGCLGFCRQVFDLIPQPDLVCQTAMVSAC  160

Query  507  SASGDPNLAAEIFDRTPLSMRDTVFYNARITGYSHQNDGHAAIQVFNDMKRNNFQPDQ  680
            S  GD   A E+FD  P   RD + ++A I GY+       A+ +F+ M+  + +  +
Sbjct  161  SKCGDVGFARELFDSMP--HRDHIAWSAMIAGYAQCGQSREALALFHLMQLEDVKVSE  216



>ref|XP_011028230.1| PREDICTED: pentatricopeptide repeat-containing protein At1g31430 
isoform X1 [Populus euphratica]
Length=668

 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 34/94 (36%), Positives = 57/94 (61%), Gaps = 2/94 (2%)
 Frame = +3

Query  399  LIDIYCKSSNLPYARHLFDEIPQPDIVARTTMIAAYSASGDPNLAAEIFDRTPLSMRDTV  578
            L+D+YCK   L  AR +FDE+P  +++  T+M++ Y   G+ + A E+F+R+P+  RD V
Sbjct  281  LLDMYCKCGCLSVARKIFDEMPHKNVICWTSMVSGYVNYGELDKARELFERSPV--RDVV  338

Query  579  FYNARITGYSHQNDGHAAIQVFNDMKRNNFQPDQ  680
             + A I GY   N    A+ +F +M+    +PD+
Sbjct  339  LWTAMINGYVQFNHFDEAVALFQEMQIQRVKPDK  372



>ref|XP_003524199.1| PREDICTED: pentatricopeptide repeat-containing protein At5g44230-like 
[Glycine max]
Length=617

 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 42/137 (31%), Positives = 76/137 (55%), Gaps = 7/137 (5%)
 Frame = +3

Query  273  YAAHLQLCSSNIHTPATSSLATTIHAN-MITSGFKPRAHILNRLIDIYCKSSNLPYARHL  449
            ++A    C++  H    S+L   +HA  ++  GF    ++ N +ID+Y K  +L  AR +
Sbjct  112  FSALFSACAAVRH----SALGAQLHAQTLLLGGFSSDLYVNNAVIDMYVKCGSLRCARMV  167

Query  450  FDEIPQPDIVARTTMIAAYSASGDPNLAAEIFDRTPLSMRDTVFYNARITGYSHQNDGHA  629
            FDE+P+ D+++ T +I AY+  GD   A ++FD  P+  +D V + A +TGY+       
Sbjct  168  FDEMPERDVISWTGLIVAYTRIGDMRAARDLFDGLPV--KDMVTWTAMVTGYAQNAMPMD  225

Query  630  AIQVFNDMKRNNFQPDQ  680
            A++VF  ++    + D+
Sbjct  226  ALEVFRRLRDEGVEIDE  242



>ref|XP_007222375.1| hypothetical protein PRUPE_ppa004015mg [Prunus persica]
 gb|EMJ23574.1| hypothetical protein PRUPE_ppa004015mg [Prunus persica]
Length=535

 Score = 79.3 bits (194),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 40/120 (33%), Positives = 61/120 (51%), Gaps = 2/120 (2%)
 Frame = +3

Query  321  TSSLATTIHANMITSGFKPRAHILNRLIDIYCKSSNLPYARHLFDEIPQPDIVARTTMIA  500
            +S L   +H   +  GF     + N LI +YC   ++  ARH+FDEIP    V+ T MI+
Sbjct  124  SSCLGELVHGCSLKLGFVSDIFVGNSLIVMYCAFDDMKAARHIFDEIPSLSAVSWTVMIS  183

Query  501  AYSASGDPNLAAEIFDRTPLSMRDTVFYNARITGYSHQNDGHAAIQVFNDMKRNNFQPDQ  680
             +S +GD + A   FD  P+  RD   + A I+GY   N     + +F  M+    +PD+
Sbjct  184  GHSKAGDLDTARLFFDEAPV--RDRGIWGAMISGYVQNNCFKEGLYMFRLMQLTEIEPDE  241



>emb|CAN75464.1| hypothetical protein VITISV_006518 [Vitis vinifera]
Length=504

 Score = 79.0 bits (193),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 43/128 (34%), Positives = 70/128 (55%), Gaps = 3/128 (2%)
 Frame = +3

Query  294  CSSNIHTPATSSLATTIHANMITSGFKPRAHILNRLIDIYCKSSNLPYARHLFDEIPQPD  473
            C+S    P T SL   +HA ++ S  +    +   L+D Y K+  + YAR +FD +   +
Sbjct  155  CASGGIFPLTYSLGKVVHAQILRSNVEXDDVLYTALVDSYVKNGKVGYARRVFDMMLDKN  214

Query  474  IVARTTMIAAYSASGDPNLAAEIFDRTPLSMRDTVFYNARITGYSHQND-GHAAIQVFND  650
            ++  T+MI+ Y + G    A +IF RT    +D V +NA I GYS   +    +++V+ D
Sbjct  215  VLCSTSMISGYMSQGSVEDAEDIFKRT--VEKDVVVFNAMIEGYSKSVETARRSLEVYID  272

Query  651  MKRNNFQP  674
            M+R NF+P
Sbjct  273  MQRLNFRP  280



>gb|ERN12377.1| hypothetical protein AMTR_s00025p00107100 [Amborella trichopoda]
Length=184

 Score = 75.9 bits (185),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/113 (35%), Positives = 62/113 (55%), Gaps = 2/113 (2%)
 Frame = +3

Query  342  IHANMITSGFKPRAHILNRLIDIYCKSSNLPYARHLFDEIPQPDIVARTTMIAAYSASGD  521
            IHA  + SGF+ R  I   L+ +Y  S +L  A  LF+EI +P+IV    ++  ++  G 
Sbjct  32   IHALSLKSGFEGRVLISTNLVHMYALSEHLEEACRLFEEILEPNIVTWNVILNGFAKLGF  91

Query  522  PNLAAEIFDRTPLSMRDTVFYNARITGYSHQNDGHAAIQVFNDMKRNNFQPDQ  680
             N A ++FDR P   RD V +   I GY      + A++VF++M R   +P++
Sbjct  92   LNEAKQVFDRIP--ERDVVSWGVMIDGYLLSGQFNEALEVFHEMGRAGMRPNE  142



>ref|XP_009352955.1| PREDICTED: pentatricopeptide repeat-containing protein At1g28690, 
mitochondrial-like [Pyrus x bretschneideri]
Length=509

 Score = 79.0 bits (193),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 42/129 (33%), Positives = 69/129 (53%), Gaps = 5/129 (4%)
 Frame = +3

Query  294  CSSNIHTPATSSLATTIHANMITSGFKPRAHILNRLIDIYCKSSNLPYARHLFDEIPQPD  473
            C+ ++  P   SL   +H  MI +   P   +   L+D Y K+  + YAR +FD + + +
Sbjct  134  CAGDVALP--RSLGRVVHGQMIRTDVAPDEVLYTALVDSYVKNGKVRYARTVFDMMLEKN  191

Query  474  IVARTTMIAAYSASGDPNLAAEIFDRTPLSMRDTVFYNARITGYSHQND-GHAAIQVFND  650
            ++  T+MI+ Y   G    A +IF +T    +D V +NA I GYS   +    ++ V+ D
Sbjct  192  VICSTSMISGYMNQGSVEDAEDIFRKTV--EKDVVVFNAMIEGYSKSVEYARRSLDVYID  249

Query  651  MKRNNFQPD  677
            M+R NFQP+
Sbjct  250  MQRLNFQPN  258


 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/133 (25%), Positives = 63/133 (47%), Gaps = 7/133 (5%)
 Frame = +3

Query  273  YAAHLQLCSSNIHTPATSSLATTIHANMITSGFKPRAHILNRLIDIYCKSSNLPYARHLF  452
            +A+ +  CS      A+  +   I ++++ +G      + + LID+Y K   +  AR +F
Sbjct  262  FASVIGACS----VLASFEVGQQIQSHLMKTGLFLDIKMGSALIDMYSKCGRVEDARRIF  317

Query  453  DEIPQPDIVARTTMIAAYSASGDPNLAAEIFD---RTPLSMRDTVFYNARITGYSHQNDG  623
            D +PQ ++ + T+MI  Y  +G PN A E F    R      + V + + ++   H    
Sbjct  318  DHMPQKNVFSWTSMIDGYGKNGYPNEALEFFSIMQRKHQIEPNFVTFLSALSACGHAGLV  377

Query  624  HAAIQVFNDMKRN  662
               +++F  M R+
Sbjct  378  DKGLEIFESMDRD  390



>gb|KDO72337.1| hypothetical protein CISIN_1g002718mg [Citrus sinensis]
Length=888

 Score = 79.7 bits (195),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 41/105 (39%), Positives = 61/105 (58%), Gaps = 2/105 (2%)
 Frame = +3

Query  345  HANMITSGFKPRAHILNRLIDIYCKSSNLPYARHLFDEIPQPDIVARTTMIAAYSASGDP  524
            HA +I SGFKP   + N LI +Y K SNL  A  +FD++PQ D+V+   +I  Y+  G+ 
Sbjct  69   HARLIVSGFKPTIFVSNCLIQLYIKCSNLKSALKVFDKMPQRDVVSWNALIFGYAVRGEM  128

Query  525  NLAAEIFDRTPLSMRDTVFYNARITGYSHQNDGHAAIQVFNDMKR  659
             +A  +F+  P   RD + +N+ ++GY    D   AI VF +M R
Sbjct  129  GIARTLFEAMP--ERDVISWNSLLSGYLLVGDFSKAIDVFVEMGR  171


 Score = 53.5 bits (127),  Expect = 7e-05, Method: Composition-based stats.
 Identities = 32/113 (28%), Positives = 55/113 (49%), Gaps = 6/113 (5%)
 Frame = +3

Query  354  MITSGFKPRAHILNRLIDIYCKSSNLPYARHLFDEI----PQPDIVARTTMIAAYSASGD  521
            M+  G KP       L+D     + +     L  +I     Q D+   +T++  YS  G+
Sbjct  573  MLKMGVKPDDFTYATLLDTCGNLATVGLGMQLHAQIIKQEMQSDVYISSTLVDMYSKCGN  632

Query  522  PNLAAEIFDRTPLSMRDTVFYNARITGYSHQNDGHAAIQVFNDMKRNNFQPDQ  680
               +  +F+++P   RD V +NA I GY+H   G  A++VF +M+  N +P+ 
Sbjct  633  VQDSRIMFEKSP--KRDFVTWNAMICGYAHHGLGEEALKVFENMELENVKPNH  683



>ref|XP_006482464.1| PREDICTED: pentatricopeptide repeat-containing protein At3g02330-like 
[Citrus sinensis]
Length=892

 Score = 79.7 bits (195),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 41/105 (39%), Positives = 61/105 (58%), Gaps = 2/105 (2%)
 Frame = +3

Query  345  HANMITSGFKPRAHILNRLIDIYCKSSNLPYARHLFDEIPQPDIVARTTMIAAYSASGDP  524
            HA +I SGFKP   + N LI +Y K SNL  A  +FD++PQ D+V+   +I  Y+  G+ 
Sbjct  69   HARLIVSGFKPTIFVSNCLIQLYIKCSNLKSALKVFDKMPQRDVVSWNALIFGYAVRGEM  128

Query  525  NLAAEIFDRTPLSMRDTVFYNARITGYSHQNDGHAAIQVFNDMKR  659
             +A  +F+  P   RD + +N+ ++GY    D   AI VF +M R
Sbjct  129  GIARTLFEAMP--ERDVISWNSLLSGYLLVGDFSKAIDVFVEMGR  171


 Score = 53.5 bits (127),  Expect = 7e-05, Method: Composition-based stats.
 Identities = 32/113 (28%), Positives = 55/113 (49%), Gaps = 6/113 (5%)
 Frame = +3

Query  354  MITSGFKPRAHILNRLIDIYCKSSNLPYARHLFDEI----PQPDIVARTTMIAAYSASGD  521
            M+  G KP       L+D     + +     L  +I     Q D+   +T++  YS  G+
Sbjct  573  MLKMGVKPDDFTYATLLDTCGNLATVGLGMQLHAQIIKQEMQSDVYISSTLVDMYSKCGN  632

Query  522  PNLAAEIFDRTPLSMRDTVFYNARITGYSHQNDGHAAIQVFNDMKRNNFQPDQ  680
               +  +F+++P   RD V +NA I GY+H   G  A++VF +M+  N +P+ 
Sbjct  633  VQDSRIMFEKSP--KRDFVTWNAMICGYAHHGLGEEALKVFENMELENVKPNH  683



>gb|KJB80450.1| hypothetical protein B456_013G098500 [Gossypium raimondii]
Length=743

 Score = 79.3 bits (194),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 43/127 (34%), Positives = 74/127 (58%), Gaps = 6/127 (5%)
 Frame = +3

Query  273  YAAHLQLCSSNIHTPATSSLATTIHANMITSGFKPRAHILNRLIDIYCKSSNLPYARHLF  452
            Y + L++C+         S A  IH +++ +   P   +LN L++ Y K  +L YAR+LF
Sbjct  8    YCSLLKICTET----RNRSQAKKIHCHILRTIKDPETFLLNNLVNAYGKLGDLTYARNLF  63

Query  453  DEIPQPDIVARTTMIAAYSASGDPNLAAEIFDRTPLSMRDTVFYNARITGYSHQNDGHAA  632
            D+IPQP++ +  T++  YS SG+ +   +IF+R P   RD V +N+ I+GY+ +     A
Sbjct  64   DKIPQPNLFSWNTILFTYSKSGNLSDMNDIFNRMP--KRDGVSWNSLISGYASRALVTDA  121

Query  633  IQVFNDM  653
            ++ +N M
Sbjct  122  VKGYNSM  128


 Score = 50.4 bits (119),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 33/119 (28%), Positives = 54/119 (45%), Gaps = 6/119 (5%)
 Frame = +3

Query  330  LATTIHANMITSGFKPRAHILNRLIDIYCKSSNLPYARHLFDEIPQPDIVARTTMIAAYS  509
            L   IH  ++  GF     +   L+D+Y K+  +  A+ +FDE P+ ++V   TMI  + 
Sbjct  156  LGRQIHGQIVKFGFGSYVFVSCPLMDMYSKAGFVYDAKQVFDETPERNVVMYNTMITGFL  215

Query  510  ASGDPNLAAEIFDRTPLSMR--DTVFYNARITGYSHQNDGHAAIQVFNDMKRNNFQPDQ  680
              G    +  +F     SMR  D + +   ITG +       AI +F +M+      DQ
Sbjct  216  RCGMVEDSWSLFH----SMREKDAISWTTMITGLTQNGLYKEAIDLFREMRTEGLVMDQ  270



>ref|XP_011088576.1| PREDICTED: pentatricopeptide repeat-containing protein At2g21090 
[Sesamum indicum]
Length=593

 Score = 79.0 bits (193),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 38/117 (32%), Positives = 65/117 (56%), Gaps = 2/117 (2%)
 Frame = +3

Query  330  LATTIHANMITSGFKPRAHILNRLIDIYCKSSNLPYARHLFDEIPQPDIVARTTMIAAYS  509
             A  +H  +   G+     + + ++D Y K   +  A  LFDE+ + D++A TT+++AY+
Sbjct  195  FAKQLHCQVFLIGYLSNVVLSSSILDAYAKCGEMGDASRLFDEMRKKDVLAWTTLVSAYA  254

Query  510  ASGDPNLAAEIFDRTPLSMRDTVFYNARITGYSHQNDGHAAIQVFNDMKRNNFQPDQ  680
              GD   A +IFD  P   +++V + A I GY+H   G  A+++F +M   N +PDQ
Sbjct  255  QWGDMKAARQIFDSMP--EKNSVSWTALIAGYAHNGMGRHALKLFAEMVMLNVEPDQ  309


 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 37/117 (32%), Positives = 61/117 (52%), Gaps = 4/117 (3%)
 Frame = +3

Query  342  IHANMITSGFKPRAHILNRLIDIYCKSSNLPYARHLFDEIPQPDIVA-RTTMIAAYSASG  518
            +H++MIT+G +P   +++ LID+Y K  +L  A+ +FD I     VA   T+I+A    G
Sbjct  331  LHSHMITAGIRPNVVVVSSLIDMYSKCGSLEVAKRVFDTIENKQHVALWNTIISALGHQG  390

Query  519  DPNLAAEIF-DRTPLSMR-DTVFYNARITGYSHQNDGHAAIQVFND-MKRNNFQPDQ  680
                A ++F D   L ++ D V ++A ++  SH       + +F   M   N  PDQ
Sbjct  391  CGKQAIKLFADMVRLGVKPDGVTFHALLSACSHSGLVQEGLCLFESIMPDYNIIPDQ  447



>ref|XP_010524431.1| PREDICTED: pentatricopeptide repeat-containing protein At2g44880 
[Tarenaya hassleriana]
Length=594

 Score = 79.0 bits (193),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 37/104 (36%), Positives = 62/104 (60%), Gaps = 1/104 (1%)
 Frame = +3

Query  342  IHANMITSGFKPRAHILNRLIDIYCKSSNLPYARHLFDEIPQPDIVARTTMIAAYSASGD  521
            +H +++ SGF    ++   +ID+Y K   + +AR++F+E+PQ   V+ T +I  Y+  GD
Sbjct  137  LHGHIMKSGFCLDMYVSTGMIDMYAKFGMVNWARNVFEEMPQRSAVSWTALICGYAKCGD  196

Query  522  PNLAAEIFDRTPLSMRDTVFYNARITGYSHQNDGHAAIQVFNDM  653
              +A+++F   P  M+D V YNA I GY    D  +A  +FN+M
Sbjct  197  MRVASKLFAEMP-EMKDVVIYNALIDGYVKSGDMVSARSLFNEM  239


 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 38/99 (38%), Positives = 55/99 (56%), Gaps = 3/99 (3%)
 Frame = +3

Query  387  ILNRLIDIYCKSSNLPYARHLFDEIPQPDIVARTTMIAAYSASGDPNLAAEIFDRTPLSM  566
            I N LID Y KS ++  AR LF+E+P   +V  TTMI+ Y  +GD   A  +FD  P   
Sbjct  215  IYNALIDGYVKSGDMVSARSLFNEMPDRSVVTWTTMISGYCTNGDIVSARLLFDAMP--E  272

Query  567  RDTVFYNARITGYSHQNDGHAAIQVFNDMK-RNNFQPDQ  680
            R+ V +NA I G S       A+ +F +M+   + +PD+
Sbjct  273  RNLVSWNAMIGGCSKNKQPQEALSLFQEMQTTTSLEPDE  311



>ref|XP_009395862.1| PREDICTED: pentatricopeptide repeat-containing protein At3g02330 
[Musa acuminata subsp. malaccensis]
Length=841

 Score = 79.3 bits (194),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 47/132 (36%), Positives = 67/132 (51%), Gaps = 6/132 (5%)
 Frame = +3

Query  285  LQLCSSNIHTPATSSLATTIHANMITSGFKPRAHILNRLIDIYCKSSNLPYARHLFDEIP  464
             Q CS + H   T   A   HA M+ SGF P   + N LI +Y   SNL YA  +F  +P
Sbjct  7    FQQCSKH-HDGDTGGQA---HARMLVSGFVPTTFVANCLIHMYITCSNLDYAHQVFVRMP  62

Query  465  QPDIVARTTMIAAYSASGDPNLAAEIFDRTPLSMRDTVFYNARITGYSHQNDGHAAIQVF  644
            Q D V+   MIA Y+ +G  ++A  +FDR P   RD + +N+ ++G       +  I +F
Sbjct  63   QRDTVSWNAMIAGYARNGSVDVAKSLFDRMP--ERDVISWNSLMSGCLQNGGLYEPINLF  120

Query  645  NDMKRNNFQPDQ  680
              M  N   PD+
Sbjct  121  IQMLWNGIVPDR  132



>ref|XP_006366808.1| PREDICTED: pentatricopeptide repeat-containing protein At3g02330-like 
[Solanum tuberosum]
Length=894

 Score = 79.3 bits (194),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 43/112 (38%), Positives = 61/112 (54%), Gaps = 2/112 (2%)
 Frame = +3

Query  345  HANMITSGFKPRAHILNRLIDIYCKSSNLPYARHLFDEIPQPDIVARTTMIAAYSASGDP  524
            HA MI SGF+P   + N LI +Y K SNL YA  +FD++P  D V+   MI  YS   + 
Sbjct  71   HARMIISGFQPTVFVTNCLIQMYIKCSNLGYADKVFDKMPLRDTVSWNAMIFGYSMVSEL  130

Query  525  NLAAEIFDRTPLSMRDTVFYNARITGYSHQNDGHAAIQVFNDMKRNNFQPDQ  680
              A  +FD  P   RD + +N+ I+GY    +   +IQ F +M R+    D+
Sbjct  131  EKAQLMFDLMP--ERDAISWNSLISGYMQNGNYGKSIQTFLEMGRDGIAFDR  180


 Score = 50.8 bits (120),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 31/117 (26%), Positives = 53/117 (45%), Gaps = 2/117 (2%)
 Frame = +3

Query  318  ATSSLATTIHANMITSGFKPRAHILNRLIDIYCKSSNLPYARHLFDEIPQPDIVARTTMI  497
            AT  L   IHA +I    +    I + L+D+Y K  N+  +R +F++ P+ D V    ++
Sbjct  598  ATVGLGKQIHAQIIKQELQSDVFITSTLVDMYSKCGNMQDSRLMFEKAPKKDFVTWNALV  657

Query  498  AAYSASGDPNLAAEIFDRTPLS--MRDTVFYNARITGYSHQNDGHAAIQVFNDMKRN  662
              Y+  G    A +IF++  L     +   + A +   +H       +Q FN M  N
Sbjct  658  CGYAQHGLGEEALQIFEKMQLEDVRPNHAAFLAVLRACAHIGLVEIGLQHFNSMSNN  714



>ref|XP_009624583.1| PREDICTED: pentatricopeptide repeat-containing protein At5g44230 
[Nicotiana tomentosiformis]
Length=653

 Score = 79.0 bits (193),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 44/135 (33%), Positives = 72/135 (53%), Gaps = 7/135 (5%)
 Frame = +3

Query  279  AHLQLCSSNIHTPATSSLATTIHANMIT-SGFKPRAHILNRLIDIYCKSSNLPYARHLFD  455
            A L+ CS  +      +L   IH   I   GF     + N LID+Y K   L   R +FD
Sbjct  150  ALLKGCSDELGL----NLGKQIHCQGIKLGGFCKDLFVHNILIDMYVKCGWLDCGRKVFD  205

Query  456  EIPQPDIVARTTMIAAYSASGDPNLAAEIFDRTPLSMRDTVFYNARITGYSHQNDGHAAI  635
            E+ + D+++ T++I AYS +GD   AAE+F+R P+  +D V + A ++G++       A+
Sbjct  206  EMSERDVISWTSLIVAYSKTGDMVAAAELFERLPV--KDLVAWTAMVSGFAQNAKPREAL  263

Query  636  QVFNDMKRNNFQPDQ  680
            + FN M+    + D+
Sbjct  264  EFFNRMQCGGVETDE  278



>ref|XP_010689314.1| PREDICTED: pentatricopeptide repeat-containing protein At5g44230 
[Beta vulgaris subsp. vulgaris]
Length=658

 Score = 79.0 bits (193),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 42/121 (35%), Positives = 64/121 (53%), Gaps = 5/121 (4%)
 Frame = +3

Query  327  SLATTIHANMIT-SGFKPRA--HILNRLIDIYCKSSNLPYARHLFDEIPQPDIVARTTMI  497
             L   +H  M    GF      H  N LID+Y KS  L  AR +FDE+P  D+++ T++I
Sbjct  165  GLGCQLHGQMFKFGGFGSELFLHAGNSLIDLYVKSGVLESARKVFDEMPMRDVISGTSLI  224

Query  498  AAYSASGDPNLAAEIFDRTPLSMRDTVFYNARITGYSHQNDGHAAIQVFNDMKRNNFQPD  677
             AY+  GD   A E+F    L ++D V + A IT Y+       A+++F+ M+R   + D
Sbjct  225  VAYAKGGDMEAATELF--VELDVKDAVVWTAMITSYAQNARPKEALEMFDRMQRCGIKAD  282

Query  678  Q  680
            +
Sbjct  283  E  283



>ref|XP_008804906.1| PREDICTED: pentatricopeptide repeat-containing protein At5g44230 
[Phoenix dactylifera]
Length=519

 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 42/137 (31%), Positives = 74/137 (54%), Gaps = 7/137 (5%)
 Frame = +3

Query  273  YAAHLQLCSSNIHTPATSSLATTIHAN-MITSGFKPRAHILNRLIDIYCKSSNLPYARHL  449
            ++A L+ C +    P    + T +HA  + T GF     + N LI  Y + S+L  AR L
Sbjct  15   FSALLKACGAARCLP----MGTQVHAQALATGGFDSDLFVQNTLISFYVECSDLSSARKL  70

Query  450  FDEIPQPDIVARTTMIAAYSASGDPNLAAEIFDRTPLSMRDTVFYNARITGYSHQNDGHA  629
            FD +   D ++ T++I AY+ +GD   A  +F++TP+  +D V + A +TGY+  +    
Sbjct  71   FDRMSVRDAISWTSLIVAYTKTGDMGSAEGLFEKTPV--KDMVAWTAMVTGYAQNSMPKE  128

Query  630  AIQVFNDMKRNNFQPDQ  680
            A++ F+ M+    + D+
Sbjct  129  ALETFDRMREAGVKIDE  145



>ref|XP_010257435.1| PREDICTED: pentatricopeptide repeat-containing protein At5g59600-like 
[Nelumbo nucifera]
Length=555

 Score = 79.0 bits (193),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 45/152 (30%), Positives = 72/152 (47%), Gaps = 14/152 (9%)
 Frame = +3

Query  264  ATRYAAHLQ--------LCSSNIHTPATS----SLATTIHANMITSGFKPRAHILNRLID  407
            A RY +H+Q          SS++          ++   +H  +   GF+    + N LID
Sbjct  109  AVRYFSHMQEAGILPNKFTSSSVLKACVGLMDINMGKELHCIINRMGFESDVQVANALID  168

Query  408  IYCKSSNLPYARHLFDEIPQPDIVARTTMIAAYSASGDPNLAAEIFDRTPLSMRD--TVF  581
            +YCK   L  AR LFD +P+ DI + T+MI  YS  G    +  +F++  L   +     
Sbjct  169  MYCKCGKLDSARQLFDRMPKRDIASWTSMICGYSRGGKLKQSLILFEQMKLEDLEPNDFT  228

Query  582  YNARITGYSHQNDGHAAIQVFNDMKRNNFQPD  677
            +NA I GY+   D   A ++F+ M++    PD
Sbjct  229  WNAIIAGYAQNGDCDRAFELFSKMRKERSVPD  260



>ref|XP_004137053.1| PREDICTED: pentatricopeptide repeat-containing protein At2g21090 
[Cucumis sativus]
 gb|KGN43720.1| hypothetical protein Csa_7G062860 [Cucumis sativus]
Length=611

 Score = 79.0 bits (193),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/117 (33%), Positives = 66/117 (56%), Gaps = 2/117 (2%)
 Frame = +3

Query  330  LATTIHANMITSGFKPRAHILNRLIDIYCKSSNLPYARHLFDEIPQPDIVARTTMIAAYS  509
            LA  +H  ++ +GF     + + ++D Y K   +  AR LFDE+   DI A TT+++ Y+
Sbjct  213  LAKQVHGQVLVAGFLSNLVLSSSIVDAYAKCGEMRCARTLFDEMLVKDIHAWTTIVSGYA  272

Query  510  ASGDPNLAAEIFDRTPLSMRDTVFYNARITGYSHQNDGHAAIQVFNDMKRNNFQPDQ  680
              GD N A+E+F + P   ++ V ++A I+GY+  + GH A+  F  M +    P+Q
Sbjct  273  KWGDMNSASELFHQMP--EKNPVSWSALISGYARNSLGHEALDYFTKMMKFGINPEQ  327


 Score = 57.4 bits (137),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 35/126 (28%), Positives = 64/126 (51%), Gaps = 7/126 (6%)
 Frame = +3

Query  285  LQLCSSNIHTPATSSLATTIHANMITSGFK-PRAHILNRLIDIYCKSSNLPYARHLFDEI  461
            L+LC+   +          +H ++  +GFK P   + N LI +Y +      AR +FD++
Sbjct  69   LRLCAKAKYFKG----GKCVHLHLKHTGFKRPTTIVANHLIGMYFECGRDVEARKVFDKM  124

Query  462  PQPDIVARTTMIAAYSASGDPNLAAEIFDRTPLSMRDTVFYNARITGYSHQNDGHAAIQV  641
               ++ +   M+A Y+  GD N A ++FDR  +  +D V +N  +  Y+ Q   + AI +
Sbjct  125  SVRNLYSWNHMLAGYAKLGDVNNARKLFDR--MMEKDVVSWNTIVLAYAKQGCFNEAIGL  182

Query  642  FNDMKR  659
            + D +R
Sbjct  183  YRDFRR  188



>gb|KJB21916.1| hypothetical protein B456_004G021000 [Gossypium raimondii]
Length=494

 Score = 78.6 bits (192),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 41/126 (33%), Positives = 64/126 (51%), Gaps = 8/126 (6%)
 Frame = +3

Query  327  SLATTIHANMITSGFKPRAHILNRLIDIYCKSSNLPYARHLFDEIP-----QPDIVARTT  491
            SL T IH+  I +G +   H+++ LI +Y   + +  AR +FDE+P       D+V    
Sbjct  119  SLGTQIHSQAICAGLESNVHVVSALIQMYSSCARISDARKVFDEMPLASVCSDDVVVWMA  178

Query  492  MIAAYSASGDPNLAAEIFDRTPLSMRD---TVFYNARITGYSHQNDGHAAIQVFNDMKRN  662
            MIA Y   GDP+ A ++  R P +  D    + + + I GY+  +    AI VF  M+  
Sbjct  179  MIAGYVKVGDPDTAMDLLSRMPRTQTDGAVLITWTSVIAGYAQMDRPDEAIAVFRKMQLE  238

Query  663  NFQPDQ  680
            N  PD+
Sbjct  239  NVVPDE  244



>gb|ABR16520.1| unknown [Picea sitchensis]
Length=644

 Score = 79.0 bits (193),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 38/120 (32%), Positives = 61/120 (51%), Gaps = 4/120 (3%)
 Frame = +3

Query  315  PATSSLAT--TIHANMITSGFKPRAHILNRLIDIYCKSSNLPYARHLFDEIPQPDIVART  488
            PA + L      H  ++  GF+    + N L+D+Y K   + +AR LFD++PQ D+V+  
Sbjct  174  PACTDLEVLGEFHDEIVKGGFESNVFVGNGLVDMYAKRGCIEFARELFDKMPQRDVVSWN  233

Query  489  TMIAAYSASGDPNLAAEIFDRTPLSMRDTVFYNARITGYSHQNDGHAAIQVFNDMKRNNF  668
             MIA Y  +G    A ++F   P   RD + +N  + GY+   D   A+++F  M   N 
Sbjct  234  AMIAGYVQNGLIEDALKLFQEIP--KRDVITWNTMMAGYAQCGDVENAVELFEKMPEQNL  291



>ref|XP_006436989.1| hypothetical protein CICLE_v10033340mg, partial [Citrus clementina]
 gb|ESR50229.1| hypothetical protein CICLE_v10033340mg, partial [Citrus clementina]
Length=527

 Score = 78.6 bits (192),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 46/130 (35%), Positives = 67/130 (52%), Gaps = 10/130 (8%)
 Frame = +3

Query  288  QLCSSNIHTPATSSLATTIHANMITSGFKPRAHILNRLIDIYCKSSNLPYARHLFDEIPQ  467
            QLCS         SLA TIH+ ++  GF     +LN L+ +YC    L  A+ LFDE   
Sbjct  127  QLCSH--------SLAQTIHSQVLKLGFICDVFVLNSLMRVYCIFHRLRDAQELFDESLY  178

Query  468  PDIVARTTMIAAYSASGDPNLAAEIFDRTPLSMRDTVFYNARITGYSHQNDGHAAIQVFN  647
             D+V+  T+I  Y  +GD   A ++FD  P   RD V +   + GY+  +    AIQ+F 
Sbjct  179  RDVVSCNTLIDGYVKAGDLAHARQLFDTLPF--RDAVSWGTLVAGYAQSDQCQEAIQLFC  236

Query  648  DMKRNNFQPD  677
            +M   + +PD
Sbjct  237  NMMDLDIKPD  246



>ref|XP_007041899.1| Pentatricopeptide repeat (PPR-like) superfamily protein [Theobroma 
cacao]
 gb|EOX97730.1| Pentatricopeptide repeat (PPR-like) superfamily protein [Theobroma 
cacao]
Length=610

 Score = 78.6 bits (192),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 38/117 (32%), Positives = 65/117 (56%), Gaps = 2/117 (2%)
 Frame = +3

Query  330  LATTIHANMITSGFKPRAHILNRLIDIYCKSSNLPYARHLFDEIPQPDIVARTTMIAAYS  509
            L   +H  ++ SGF     I + ++D Y K   +  +R LFDE+   D++A TT+++ YS
Sbjct  206  LTRQVHGQVLVSGFLSNLVISSSVVDGYVKCGMMGESRRLFDEMKVKDVLAWTTLVSGYS  265

Query  510  ASGDPNLAAEIFDRTPLSMRDTVFYNARITGYSHQNDGHAAIQVFNDMKRNNFQPDQ  680
              GD   A ++FD+ P   ++ V + A I+GY+    G+ A+++F  M     +PDQ
Sbjct  266  QWGDMESANDLFDKMP--QKNPVSWTALISGYARNGMGNKALELFTRMMVCRVRPDQ  320



>gb|EYU33153.1| hypothetical protein MIMGU_mgv1a026552mg [Erythranthe guttata]
Length=534

 Score = 78.2 bits (191),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 37/117 (32%), Positives = 61/117 (52%), Gaps = 2/117 (2%)
 Frame = +3

Query  327  SLATTIHANMITSGFKPRAHILNRLIDIYCKSSNLPYARHLFDEIPQPDIVARTTMIAAY  506
             L   +H+ ++  G      +   L+  Y K  NL  AR +FD+IP+ ++V+ T M++ Y
Sbjct  47   GLGAKVHSLVVKVGSDSDVFVKTGLLGFYAKVENLVDARKMFDDIPEKNVVSWTAMMSGY  106

Query  507  SASGDPNLAAEIFDRTPLSMRDTVFYNARITGYSHQNDGHAAIQVFNDMKRNNFQPD  677
               GD   A  IFD  P   +D V + A I GY+       A+++F+ M++ N +PD
Sbjct  107  IGCGDMEKALSIFDEMP--EKDIVTWGAIIQGYAANGLPKEALEIFSQMQKQNLKPD  161



>gb|ERN16355.1| hypothetical protein AMTR_s00439p00011190 [Amborella trichopoda]
Length=231

 Score = 75.5 bits (184),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 43/135 (32%), Positives = 70/135 (52%), Gaps = 6/135 (4%)
 Frame = +3

Query  273  YAAHLQLCSSNIHTPATSSLATTIHANMITSGFKPRAHILNRLIDIYCKSSNLPYARHLF  452
            Y+  LQ CS ++     +SLA  +  +M  + F     + NR IDIYCKS  +  AR +F
Sbjct  78   YSCLLQACSESM----AASLAQKVETHMAKTSFPHCLFLNNRRIDIYCKSGYIIEARKVF  133

Query  453  DEIPQPDIVARTTMIAAYSASGDPNLAAEIFDRTPLSMRDTVFYNARITGYSHQNDGHAA  632
            DE+ + D+V+  TMI  Y   G  + A ++F    +  ++ V +   I GY        A
Sbjct  134  DEMSEKDLVSYNTMIHGYCCFGLLDDARQVF--VQMHEKNQVSWGIMIGGYVRHEYAFEA  191

Query  633  IQVFNDMKRNNFQPD  677
            +++F DM R+  +P+
Sbjct  192  LEMFVDMNRSGLKPE  206



>gb|KHN33415.1| Pentatricopeptide repeat-containing protein [Glycine soja]
Length=988

 Score = 79.0 bits (193),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 42/111 (38%), Positives = 61/111 (55%), Gaps = 2/111 (2%)
 Frame = +3

Query  330  LATTIHANMITSGFKPRAHILNRLIDIYCKSSNLPYARHLFDEIPQPDIVARTTMIAAYS  509
            L   +H +   S F PR  I NRL+D+Y K  +L  A+ LFDE+   D+ +  TMIA Y+
Sbjct  428  LGRRVHTHTKASSFVPRIFISNRLLDMYSKCGSLVDAQMLFDEMGHRDLCSWNTMIAGYA  487

Query  510  ASGDPNLAAEIFDRTPLSMRDTVFYNARITGYSHQNDGHAAIQVFNDMKRN  662
              G    A ++FD  P   RD   +NA I+GY   N    A+++F  M+R+
Sbjct  488  KLGRLEQARKLFDEMP--QRDNFSWNAAISGYVSHNQPRGALELFRVMQRH  536


 Score = 57.4 bits (137),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 25/76 (33%), Positives = 43/76 (57%), Gaps = 0/76 (0%)
 Frame = +3

Query  318  ATSSLATTIHANMITSGFKPRAHILNRLIDIYCKSSNLPYARHLFDEIPQPDIVARTTMI  497
            A   L   +H  M+ +G+ P +  ++ L+ +Y K  N   AR +F+E+ QPD+V+ T++I
Sbjct  618  AAEHLGKEVHRYMMRTGYGPFSFAISALVHMYSKCGNTRVARKVFNEMHQPDLVSWTSLI  677

Query  498  AAYSASGDPNLAAEIF  545
              Y+ +G P  A   F
Sbjct  678  VGYAQNGQPEEALHFF  693



>ref|XP_003635554.1| PREDICTED: pentatricopeptide repeat-containing protein At4g22760 
[Vitis vinifera]
 emb|CBI23551.3| unnamed protein product [Vitis vinifera]
Length=580

 Score = 78.2 bits (191),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 36/115 (31%), Positives = 61/115 (53%), Gaps = 5/115 (4%)
 Frame = +3

Query  333  ATTIHANMITSGFKPRA---HILNRLIDIYCKSSNLPYARHLFDEIPQPDIVARTTMIAA  503
              +IH  +   GF       ++   L+D YCK  ++  AR +FDE+ + ++V+  +M+A 
Sbjct  124  GLSIHGQVQKFGFSGGGDGIYVETALVDFYCKLGDMEIARKMFDEMAERNVVSWNSMLAG  183

Query  504  YSASGDPNLAAEIFDRTPLSMRDTVFYNARITGYSHQNDGHAAIQVFNDMKRNNF  668
            Y  SGD  +A  +FD  P   +D + +N+ I+GY+   D   A+ +F  M   NF
Sbjct  184  YLKSGDLVVAQRVFDEIP--QKDVISWNSMISGYARAGDMEKALSLFQQMPERNF  236


 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 34/92 (37%), Positives = 54/92 (59%), Gaps = 3/92 (3%)
 Frame = +3

Query  393  NRLIDIYCKSSNLPYARHLFDEIPQPDIVARTTMIAAYSASGDPNLAAEIFDRTPLSMRD  572
            N ++  Y KS +L  A+ +FDEIPQ D+++  +MI+ Y+ +GD   A  +F + P   R+
Sbjct  178  NSMLAGYLKSGDLVVAQRVFDEIPQKDVISWNSMISGYARAGDMEKALSLFQQMP--ERN  235

Query  573  TVFYNARITGYSHQNDGHAAIQVFNDM-KRNN  665
               +NA I+GY    D  +A   F+ M +RNN
Sbjct  236  FASWNAMISGYVEFGDIDSARSFFDAMPQRNN  267


 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 34/98 (35%), Positives = 56/98 (57%), Gaps = 4/98 (4%)
 Frame = +3

Query  393  NRLIDIYCKSSNLPYARHLFDEIPQPDIVARTTMIAAYSASGDPNLAAEIFDRTPLSMRD  572
            N +I  Y +  ++  AR  FD +PQ + V+  TMI+ YS  GD + A E+FD+  +  +D
Sbjct  240  NAMISGYVEFGDIDSARSFFDAMPQRNNVSWMTMISGYSKCGDVDSACELFDQ--VGGKD  297

Query  573  TVFYNARITGYSHQNDGHAAIQVFNDMKR--NNFQPDQ  680
             + +NA I  Y+  +    A+++FN+M     N QPD+
Sbjct  298  LLLFNAMIACYAQNSRPKEALKLFNNMLNPDVNVQPDE  335



>gb|ERN05800.1| hypothetical protein AMTR_s00006p00257350 [Amborella trichopoda]
Length=668

 Score = 78.6 bits (192),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 40/111 (36%), Positives = 63/111 (57%), Gaps = 2/111 (2%)
 Frame = +3

Query  345  HANMITSGFKPRAHILNRLIDIYCKSSNLPYARHLFDEIPQPDIVARTTMIAAYSASGDP  524
            HA+MITSGFKP   + N LI++Y KSSN   A ++F ++P  D+V+  +MI  YS +   
Sbjct  38   HAHMITSGFKPSIFVFNCLINMYLKSSNTHDALNVFKQMPHKDLVSYNSMIYQYSFTNSM  97

Query  525  NLAAEIFDRTPLSMRDTVFYNARITGYSHQNDGHAAIQVFNDMKRNNFQPD  677
              A  +F+  P+  +D + +N+ + GYS   D    + +F  M   +  PD
Sbjct  98   PSALSLFNSMPI--KDAISWNSLMAGYSQNGDHFKPLFLFKQMLETDVGPD  146



>ref|XP_008389431.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like 
[Malus domestica]
 ref|XP_008350909.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like 
[Malus domestica]
Length=536

 Score = 78.2 bits (191),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 37/119 (31%), Positives = 62/119 (52%), Gaps = 2/119 (2%)
 Frame = +3

Query  324  SSLATTIHANMITSGFKPRAHILNRLIDIYCKSSNLPYARHLFDEIPQPDIVARTTMIAA  503
            S L   +H   +  GF     + N L+  YC S ++  AR++FDE+P   +V+ T MI+ 
Sbjct  126  SCLGELVHGLCLKLGFVSDIFVGNSLVVXYCASDDMKGARYVFDEMPSLSVVSWTVMISG  185

Query  504  YSASGDPNLAAEIFDRTPLSMRDTVFYNARITGYSHQNDGHAAIQVFNDMKRNNFQPDQ  680
            ++  GD N+A   FD  P+  RD   + A I+GY   +     + +F  M+  + +PD+
Sbjct  186  FAKVGDLNMARLFFDEAPV--RDRGIWGAMISGYVQNSCFKEGLYLFRLMQFTDIEPDE  242



>emb|CBI16398.3| unnamed protein product [Vitis vinifera]
Length=608

 Score = 78.2 bits (191),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 39/96 (41%), Positives = 57/96 (59%), Gaps = 4/96 (4%)
 Frame = +3

Query  393  NRLIDIYCKSSNLPYARHLFDEIPQPDIVARTTMIAAYSASGDPNLAAEIFDRTPLSMRD  572
            N +I+ YC   NL  AR LFD +    +V+ TTM+  Y+ SG  ++A ++FD  P   +D
Sbjct  221  NSMINGYC--GNLESARKLFDSMTNKTMVSWTTMVVGYAQSGLLDMAWKLFDEMP--DKD  276

Query  573  TVFYNARITGYSHQNDGHAAIQVFNDMKRNNFQPDQ  680
             V +NA I GY H N G  A+ +FN+M+  N  PD+
Sbjct  277  VVPWNAMIGGYVHANRGKEALALFNEMQAMNINPDE  312



>ref|XP_007201591.1| hypothetical protein PRUPE_ppa020837mg [Prunus persica]
 gb|EMJ02790.1| hypothetical protein PRUPE_ppa020837mg [Prunus persica]
Length=610

 Score = 78.2 bits (191),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 36/118 (31%), Positives = 64/118 (54%), Gaps = 2/118 (2%)
 Frame = +3

Query  327  SLATTIHANMITSGFKPRAHILNRLIDIYCKSSNLPYARHLFDEIPQPDIVARTTMIAAY  506
             L   +H  ++ +GF     + + L+D Y K   +  AR LFD +P  D++A TT+++ Y
Sbjct  207  ELTRQVHGQVLVAGFLSNVVLSSSLVDAYTKCGEMGDARRLFDNMPVRDVLAWTTLVSGY  266

Query  507  SASGDPNLAAEIFDRTPLSMRDTVFYNARITGYSHQNDGHAAIQVFNDMKRNNFQPDQ  680
            +  GD    +E+F + P   ++ V + A I+GY+    G+ A+ +F +M     +PDQ
Sbjct  267  AKWGDMESGSELFSQMP--EKNPVSWTALISGYARNGLGYEALALFTEMMLYQVRPDQ  322


 Score = 53.5 bits (127),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 31/117 (26%), Positives = 62/117 (53%), Gaps = 5/117 (4%)
 Frame = +3

Query  318  ATSSL--ATTIHANMITSGFK-PRAHILNRLIDIYCKSSNLPYARHLFDEIPQPDIVART  488
            AT SL     +H ++  +GFK P   + N LI++Y K ++   AR +FD++   ++ +  
Sbjct  69   ATGSLREGKWVHIHLRLTGFKHPPPFLANHLINMYFKCADDVEARRVFDKMSVRNLYSWN  128

Query  489  TMIAAYSASGDPNLAAEIFDRTPLSMRDTVFYNARITGYSHQNDGHAAIQVFNDMKR  659
             M++ Y+   +   A  +FD+ P   +D V +N  + GY+       A++ + +++R
Sbjct  129  NMLSGYAKMRNLKEARSLFDKMP--EKDVVSWNTMVIGYAQSGVCDEALRYYRELRR  183



>ref|XP_009767912.1| PREDICTED: pentatricopeptide repeat-containing protein At3g02330 
[Nicotiana sylvestris]
Length=842

 Score = 78.6 bits (192),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 42/112 (38%), Positives = 61/112 (54%), Gaps = 2/112 (2%)
 Frame = +3

Query  345  HANMITSGFKPRAHILNRLIDIYCKSSNLPYARHLFDEIPQPDIVARTTMIAAYSASGDP  524
            HA MI SGF+P   + N LI +Y K SNL YA  +FD++P  D V+   MI  YS   D 
Sbjct  47   HARMIISGFQPTIFVTNCLIQMYIKCSNLGYADKVFDKMPLRDTVSWNAMIFGYSMVNDM  106

Query  525  NLAAEIFDRTPLSMRDTVFYNARITGYSHQNDGHAAIQVFNDMKRNNFQPDQ  680
              A  +FD  P   RD + +N+ I+G+    +   +I+ F +M R+    D+
Sbjct  107  EKAKLMFDLMP--ERDVISWNSMISGHLQNGNYQKSIRAFMEMGRDGIAFDR  156


 Score = 52.8 bits (125),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 29/96 (30%), Positives = 48/96 (50%), Gaps = 4/96 (4%)
 Frame = +3

Query  273  YAAHLQLCSSNIHTPATSSLATTIHANMITSGFKPRAHILNRLIDIYCKSSNLPYARHLF  452
            YA  L  C++     AT  L   IHA +I    +    I + L+D+Y K  N+  +R +F
Sbjct  563  YATVLDACAN----LATVGLGKQIHAQIIKQELQSDVFITSTLVDMYSKCGNMQDSRLMF  618

Query  453  DEIPQPDIVARTTMIAAYSASGDPNLAAEIFDRTPL  560
            ++ P+ D V    M+  Y+  G  + A +IF++  L
Sbjct  619  EKAPKKDFVTWNAMVCGYAQHGLGDEALQIFEKMQL  654



>ref|XP_006385618.1| hypothetical protein POPTR_0003s08690g [Populus trichocarpa]
 gb|ERP63415.1| hypothetical protein POPTR_0003s08690g [Populus trichocarpa]
Length=609

 Score = 78.2 bits (191),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 33/94 (35%), Positives = 57/94 (61%), Gaps = 2/94 (2%)
 Frame = +3

Query  399  LIDIYCKSSNLPYARHLFDEIPQPDIVARTTMIAAYSASGDPNLAAEIFDRTPLSMRDTV  578
            L+D+YCK   L  AR +FDE+P  +++  T+M++ Y   G+ + A E+F+R+P+  +D V
Sbjct  230  LLDMYCKCGCLSVARKIFDEMPHKNVICWTSMVSGYVNYGELDKARELFERSPV--KDVV  287

Query  579  FYNARITGYSHQNDGHAAIQVFNDMKRNNFQPDQ  680
             + A I GY   N    A+ +F +M+    +PD+
Sbjct  288  LWTAMINGYVQFNHFDEAVALFQEMQIQRVKPDK  321



>ref|XP_007045928.1| Pentatricopeptide repeat-containing protein [Theobroma cacao]
 gb|EOY01760.1| Pentatricopeptide repeat-containing protein [Theobroma cacao]
Length=523

 Score = 77.8 bits (190),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 37/117 (32%), Positives = 62/117 (53%), Gaps = 2/117 (2%)
 Frame = +3

Query  330  LATTIHANMITSGFKPRAHILNRLIDIYCKSSNLPYARHLFDEIPQPDIVARTTMIAAYS  509
                ++ + +  GF     + N LI ++C   N+  AR++FDEIP PD V+ T MI+ Y 
Sbjct  123  FGELVYGHCLKLGFVFDIFVGNALIAMFCAFDNVKVARYIFDEIPWPDFVSWTVMISGYG  182

Query  510  ASGDPNLAAEIFDRTPLSMRDTVFYNARITGYSHQNDGHAAIQVFNDMKRNNFQPDQ  680
              GD + A  +FD    S++D   + A I+GY   N     + +F  M+ ++ +PD+
Sbjct  183  KIGDIDTARLLFDEA--SVKDAGIWGAMISGYVKNNCFKEGLYMFRLMQMSDIEPDE  237



>ref|XP_007043264.1| Pentatricopeptide repeat superfamily protein [Theobroma cacao]
 gb|EOX99095.1| Pentatricopeptide repeat superfamily protein [Theobroma cacao]
Length=530

 Score = 77.8 bits (190),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 39/110 (35%), Positives = 59/110 (54%), Gaps = 2/110 (2%)
 Frame = +3

Query  327  SLATTIHANMITSGFKPRAHILNRLIDIYCKSSNLPYARHLFDEIPQPDIVARTTMIAAY  506
             L   IH + + +GF+    I N LI +Y    ++ YAR +FDE+P  +IV+   M+  Y
Sbjct  119  ELGGAIHCHALKNGFELDKFINNSLIHMYASCHDIVYARRVFDELPMKNIVSWNAMLDGY  178

Query  507  SASGDPNLAAEIFDRTPLSMRDTVFYNARITGYSHQNDGHAAIQVFNDMK  656
            +  GD  LA ++FD  P   RD V ++  I GY+   D   A+ VF  M+
Sbjct  179  AKCGDMALARQVFDWMP--QRDVVSWSCLIDGYAKSGDYKEALAVFEGMR  226



>ref|XP_002277549.1| PREDICTED: pentatricopeptide repeat-containing protein At2g21090 
[Vitis vinifera]
Length=612

 Score = 78.2 bits (191),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 38/118 (32%), Positives = 64/118 (54%), Gaps = 2/118 (2%)
 Frame = +3

Query  327  SLATTIHANMITSGFKPRAHILNRLIDIYCKSSNLPYARHLFDEIPQPDIVARTTMIAAY  506
             L   +H  ++ +GF     + + ++D Y K   +  AR LFDE+   D++A TTM++ Y
Sbjct  209  GLTRQVHGQILVAGFLSNVVLSSSVLDAYVKCGLMGDARKLFDEMSARDVLAWTTMVSGY  268

Query  507  SASGDPNLAAEIFDRTPLSMRDTVFYNARITGYSHQNDGHAAIQVFNDMKRNNFQPDQ  680
            +  GD   A E+F   P   ++ V + A I+GY+    GH A+++F  M   + +PDQ
Sbjct  269  AKWGDMKSANELFVEMP--EKNPVSWTALISGYARNGMGHKALELFTKMMLFHVRPDQ  324



>ref|XP_009148065.1| PREDICTED: pentatricopeptide repeat-containing protein At1g08070 
[Brassica rapa]
Length=741

 Score = 78.2 bits (191),  Expect = 5e-13, Method: Composition-based stats.
 Identities = 40/113 (35%), Positives = 62/113 (55%), Gaps = 2/113 (2%)
 Frame = +3

Query  342  IHANMITSGFKPRAHILNRLIDIYCKSSNLPYARHLFDEIPQPDIVARTTMIAAYSASGD  521
            IHA ++  G     ++   LI +Y ++  L  AR +FD   Q D+V+ T +I  Y++ GD
Sbjct  155  IHAQVLKLGCDRDRYVHTSLISMYARNGRLEDARKVFDTSSQRDVVSCTALITGYASRGD  214

Query  522  PNLAAEIFDRTPLSMRDTVFYNARITGYSHQNDGHAAIQVFNDMKRNNFQPDQ  680
               A ++FD  P   RD V +NA ITGY        A+++F +M R N +PD+
Sbjct  215  VRSARKVFDEMP--ERDVVSWNAMITGYVENGGYEEALELFKEMMRTNVRPDE  265



>emb|CBI37903.3| unnamed protein product [Vitis vinifera]
Length=516

 Score = 77.8 bits (190),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 38/118 (32%), Positives = 64/118 (54%), Gaps = 2/118 (2%)
 Frame = +3

Query  327  SLATTIHANMITSGFKPRAHILNRLIDIYCKSSNLPYARHLFDEIPQPDIVARTTMIAAY  506
             L   +H  ++ +GF     + + ++D Y K   +  AR LFDE+   D++A TTM++ Y
Sbjct  209  GLTRQVHGQILVAGFLSNVVLSSSVLDAYVKCGLMGDARKLFDEMSARDVLAWTTMVSGY  268

Query  507  SASGDPNLAAEIFDRTPLSMRDTVFYNARITGYSHQNDGHAAIQVFNDMKRNNFQPDQ  680
            +  GD   A E+F   P   ++ V + A I+GY+    GH A+++F  M   + +PDQ
Sbjct  269  AKWGDMKSANELFVEMP--EKNPVSWTALISGYARNGMGHKALELFTKMMLFHVRPDQ  324



>gb|EMS53979.1| hypothetical protein TRIUR3_11705 [Triticum urartu]
Length=411

 Score = 77.4 bits (189),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 37/117 (32%), Positives = 63/117 (54%), Gaps = 2/117 (2%)
 Frame = +3

Query  330  LATTIHANMITSGFKPRAHILNRLIDIYCKSSNLPYARHLFDEIPQPDIVARTTMIAAYS  509
            LA  +HA++   GF    +I + L+D+Y K   + YA  LFDE+P  D+   T+++  Y+
Sbjct  92   LARQLHAHLSHLGFLSDINIASSLVDVYRKCGCIAYAHRLFDEMPVKDLRVWTSIVCGYA  151

Query  510  ASGDPNLAAEIFDRTPLSMRDTVFYNARITGYSHQNDGHAAIQVFNDMKRNNFQPDQ  680
                 ++A +IFDR  +  R  + +NA + GY        A+ +F  + ++ F PDQ
Sbjct  152  EDSQMSIARQIFDR--MQKRSIISWNALMEGYVRNGQAAEALSIFKHLIKDGFHPDQ  206



>ref|XP_011627243.1| PREDICTED: pentatricopeptide repeat-containing protein At4g37170 
[Amborella trichopoda]
Length=331

 Score = 76.3 bits (186),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 43/135 (32%), Positives = 70/135 (52%), Gaps = 6/135 (4%)
 Frame = +3

Query  273  YAAHLQLCSSNIHTPATSSLATTIHANMITSGFKPRAHILNRLIDIYCKSSNLPYARHLF  452
            Y+  LQ CS ++     +SLA  +  +M  + F     + NR IDIYCKS  +  AR +F
Sbjct  78   YSCLLQACSESM----AASLAQKVETHMAKTSFPHCLFLNNRRIDIYCKSGYIIEARKVF  133

Query  453  DEIPQPDIVARTTMIAAYSASGDPNLAAEIFDRTPLSMRDTVFYNARITGYSHQNDGHAA  632
            DE+ + D+V+  TMI  Y   G  + A ++F    +  ++ V +   I GY        A
Sbjct  134  DEMSEKDLVSYNTMIHGYCCFGLLDDARQVF--VQMHEKNQVSWGIMIGGYVRHEYAFEA  191

Query  633  IQVFNDMKRNNFQPD  677
            +++F DM R+  +P+
Sbjct  192  LEMFVDMNRSGLKPE  206



>ref|XP_008452110.1| PREDICTED: pentatricopeptide repeat-containing protein At5g44230 
[Cucumis melo]
Length=663

 Score = 78.2 bits (191),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 41/137 (30%), Positives = 73/137 (53%), Gaps = 7/137 (5%)
 Frame = +3

Query  273  YAAHLQLCSSNIHTPATSSLATTIHAN-MITSGFKPRAHILNRLIDIYCKSSNLPYARHL  449
            ++A  + C ++++      L   +HA  ++  GF    ++ N +ID+Y K   L  AR +
Sbjct  158  FSALFKACGASLNM----DLGKQVHAQTILIGGFASDLYVGNSMIDLYVKCGFLGCARKV  213

Query  450  FDEIPQPDIVARTTMIAAYSASGDPNLAAEIFDRTPLSMRDTVFYNARITGYSHQNDGHA  629
            FDE+ + D+V+ T +I AY+  GD   A+ +FD  PL  +D V + A +TGY+       
Sbjct  214  FDEMSERDVVSWTELIVAYAKYGDMESASGLFDDLPL--KDMVAWTAMVTGYAQNARPKE  271

Query  630  AIQVFNDMKRNNFQPDQ  680
            A++ F  M+    + D+
Sbjct  272  ALEYFQKMQDVGMETDE  288



>ref|XP_006383156.1| hypothetical protein POPTR_0005s12100g [Populus trichocarpa]
 gb|ERP60953.1| hypothetical protein POPTR_0005s12100g [Populus trichocarpa]
Length=654

 Score = 77.8 bits (190),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 40/137 (29%), Positives = 66/137 (48%), Gaps = 7/137 (5%)
 Frame = +3

Query  273  YAAHLQLCSSNIHTPATSSLATTIHANMI-TSGFKPRAHILNRLIDIYCKSSNLPYARHL  449
            + A  + C + +       L   IH   I   GF    H+ N +ID+Y K   L   R +
Sbjct  149  FTALFKACGAKMDV----GLGRQIHGQTILVGGFGEDLHVGNSMIDMYIKCGFLECGRKV  204

Query  450  FDEIPQPDIVARTTMIAAYSASGDPNLAAEIFDRTPLSMRDTVFYNARITGYSHQNDGHA  629
            FDE+P  D+++ T +I+AY  SG+   A E+FD  P+  +D V +   ++G++       
Sbjct  205  FDEMPNRDVISWTELISAYVKSGNMESAGELFDGLPV--KDMVAWTVMVSGFAQNAKPRE  262

Query  630  AIQVFNDMKRNNFQPDQ  680
            AI  F  M+    + D+
Sbjct  263  AIMFFEKMQEFGVETDE  279



>ref|XP_004146494.1| PREDICTED: pentatricopeptide repeat-containing protein At5g44230 
[Cucumis sativus]
 gb|KGN53288.1| hypothetical protein Csa_4G045030 [Cucumis sativus]
Length=650

 Score = 77.8 bits (190),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 42/137 (31%), Positives = 71/137 (52%), Gaps = 7/137 (5%)
 Frame = +3

Query  273  YAAHLQLCSSNIHTPATSSLATTIHANMI-TSGFKPRAHILNRLIDIYCKSSNLPYARHL  449
            ++A  + C + ++      L   +HA  I   GF    ++ N +ID+Y K   L  AR +
Sbjct  145  FSALFKACGAALNM----DLGKQVHAQTILIGGFASDLYVGNSMIDLYVKCGFLGCARKV  200

Query  450  FDEIPQPDIVARTTMIAAYSASGDPNLAAEIFDRTPLSMRDTVFYNARITGYSHQNDGHA  629
            FDE+ + D+V+ T +I AY+  GD   A+ +FD  PL  +D V + A +TGY+       
Sbjct  201  FDEMSERDVVSWTELIVAYAKYGDMESASGLFDDLPL--KDMVAWTAMVTGYAQNGRPKE  258

Query  630  AIQVFNDMKRNNFQPDQ  680
            A++ F  M+    + D+
Sbjct  259  ALEYFQKMQDVGMETDE  275



>ref|XP_010558533.1| PREDICTED: pentatricopeptide repeat-containing protein At3g02330 
[Tarenaya hassleriana]
 gb|ABD96900.1| hypothetical protein [Cleome spinosa]
Length=924

 Score = 78.2 bits (191),  Expect = 5e-13, Method: Composition-based stats.
 Identities = 41/116 (35%), Positives = 64/116 (55%), Gaps = 2/116 (2%)
 Frame = +3

Query  330  LATTIHANMITSGFKPRAHILNRLIDIYCKSSNLPYARHLFDEIPQPDIVARTTMIAAYS  509
            L    HA+MI SGF+P   + N L+ +Y    NL YA  LFD +P  D+V+   MI  Y+
Sbjct  67   LGKQAHAHMIISGFRPTVFVSNCLLQLYINCGNLGYATKLFDGMPLRDVVSWNAMIFGYA  126

Query  510  ASGDPNLAAEIFDRTPLSMRDTVFYNARITGYSHQNDGHAAIQVFNDMKRNNFQPD  677
            AS D   A+  F+  P   RD V +N+ ++G+    +   +++VF +M R+  + D
Sbjct  127  ASNDMVRASLCFEMMP--TRDVVSWNSMLSGFLQTGENLESVKVFIEMGRSGVEFD  180



>ref|XP_008358707.1| PREDICTED: pentatricopeptide repeat-containing protein At1g28690, 
mitochondrial-like [Malus domestica]
Length=506

 Score = 77.4 bits (189),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 41/129 (32%), Positives = 69/129 (53%), Gaps = 5/129 (4%)
 Frame = +3

Query  294  CSSNIHTPATSSLATTIHANMITSGFKPRAHILNRLIDIYCKSSNLPYARHLFDEIPQPD  473
            C+ ++  P   +L   +H  MI +   P   +   L+D Y K+  + YAR +FD + + +
Sbjct  134  CAGDVALP--RNLGRVVHGQMIRTDVAPDEVLYTALVDSYVKNGKVRYARTVFDMMLEKN  191

Query  474  IVARTTMIAAYSASGDPNLAAEIFDRTPLSMRDTVFYNARITGYSHQND-GHAAIQVFND  650
            ++  T+MI+ Y   G    A +IF +T    +D V +NA I GYS   +    ++ V+ D
Sbjct  192  VICSTSMISGYMNQGSVEDAEDIFRKTV--EKDVVVFNAMIEGYSKSVEYARRSLDVYID  249

Query  651  MKRNNFQPD  677
            M+R NFQP+
Sbjct  250  MQRLNFQPN  258



>ref|XP_011629106.1| PREDICTED: pentatricopeptide repeat-containing protein ELI1, 
chloroplastic-like [Amborella trichopoda]
Length=645

 Score = 77.8 bits (190),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 41/131 (31%), Positives = 69/131 (53%), Gaps = 6/131 (5%)
 Frame = +3

Query  285  LQLCSSNIHTPATSSLATTIHANMITSGFKPRAHILNRLIDIYCKSSNLPYARHLFDEIP  464
            L+ C+S    PA       +HA+++  G +    + N ++D+Y K  ++ YAR +FDEIP
Sbjct  148  LRACAS---VPAVLE-GHQVHAHVVKFGLESDGFVKNGMVDMYSKFGDMGYARKVFDEIP  203

Query  465  QPDIVARTTMIAAYSASGDPNLAAEIFDRTPLSMRDTVFYNARITGYSHQNDGHAAIQVF  644
              D+V+   +IA +   GD   A  +F    ++ RD V +NA ITGY+       A+ +F
Sbjct  204  NKDLVSWNALIAGFIRLGDMGSAEALF--RDMAERDIVTWNAMITGYARSEHASEALALF  261

Query  645  NDMKRNNFQPD  677
              M+    +P+
Sbjct  262  RQMQAEGIRPN  272



>ref|XP_008362270.1| PREDICTED: pentatricopeptide repeat-containing protein At3g02330-like 
[Malus domestica]
Length=377

 Score = 76.6 bits (187),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 38/108 (35%), Positives = 56/108 (52%), Gaps = 2/108 (2%)
 Frame = +3

Query  354  MITSGFKPRAHILNRLIDIYCKSSNLPYARHLFDEIPQPDIVARTTMIAAYSASGDPNLA  533
            MI SGF P   + N LI +Y K   L YA  +FD +PQ D+V+  TM+  Y+ SG    A
Sbjct  1    MIVSGFDPTVFVTNCLIQMYVKCGVLQYAGKVFDGMPQRDMVSWNTMVFGYARSGKMGFA  60

Query  534  AEIFDRTPLSMRDTVFYNARITGYSHQNDGHAAIQVFNDMKRNNFQPD  677
               FD  P   +D V +N+ I+GY    +   + +V+ +M     + D
Sbjct  61   QSCFDAMP--EKDVVSWNSLISGYLQSGEYWKSTEVYVEMVSGGMEFD  106



>ref|XP_006340666.1| PREDICTED: pentatricopeptide repeat-containing protein At5g44230-like 
[Solanum tuberosum]
Length=654

 Score = 77.8 bits (190),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 40/119 (34%), Positives = 66/119 (55%), Gaps = 3/119 (3%)
 Frame = +3

Query  327  SLATTIHANMIT-SGFKPRAHILNRLIDIYCKSSNLPYARHLFDEIPQPDIVARTTMIAA  503
            +L   IH   I   GF     + N LID+Y K   L   R +FDE+ + D+++ T++I A
Sbjct  162  NLGRQIHCQSIKLGGFCKDLFVHNILIDMYVKCGWLDCGRKVFDEMSERDVISWTSLIVA  221

Query  504  YSASGDPNLAAEIFDRTPLSMRDTVFYNARITGYSHQNDGHAAIQVFNDMKRNNFQPDQ  680
            YS SGD   AAE+F+R P+  +D V + A ++G++       A++ F+ M+    + D+
Sbjct  222  YSKSGDMAAAAELFERLPV--KDLVAWTAMVSGFAQNAKPREALEFFHRMQSEGVETDE  278



>ref|XP_010429126.1| PREDICTED: pentatricopeptide repeat-containing protein At2g22070 
[Camelina sativa]
Length=786

 Score = 77.8 bits (190),  Expect = 6e-13, Method: Composition-based stats.
 Identities = 41/136 (30%), Positives = 70/136 (51%), Gaps = 6/136 (4%)
 Frame = +3

Query  285  LQLCSSNIHTPATSS----LATTIHANMITSGFKPRAHILNRLIDIYCKSSNLPYARHLF  452
            L+LC++ +      S     A  +H  +I SG     +++N L+++Y K+    +AR LF
Sbjct  13   LELCTNLLQKSVNKSNGRFTAQLVHCRVIKSGLFFSVYLINNLMNVYSKTGYALHARKLF  72

Query  453  DEIPQPDIVARTTMIAAYSASGDPNLAAEIFDRTPLSMRDTVFYNARITGYSHQNDGHAA  632
            DE+PQ    +  T+++AY+  GD +   E FDR P   +D+V +   I GY +      A
Sbjct  73   DEMPQRTAFSWNTVLSAYAKRGDMDSTCEFFDRLP--QKDSVSWTTMIVGYKNIGQYRKA  130

Query  633  IQVFNDMKRNNFQPDQ  680
            I+   +M +   +P Q
Sbjct  131  IRTMGEMMKEGIEPTQ  146


 Score = 56.2 bits (134),  Expect = 7e-06, Method: Composition-based stats.
 Identities = 36/124 (29%), Positives = 65/124 (52%), Gaps = 5/124 (4%)
 Frame = +3

Query  318  ATSSLAT--TIHANMITSGFKPRAHILNRLIDIYCKSSNLPYARHLFDEIPQPDIVARTT  491
            AT  L T   +H+ ++  G +    + N L+++Y K  +   A+ +FD +   DI +   
Sbjct  158  ATRCLETGKKVHSFIVKLGLRGNVSVSNSLVNMYAKCGDPMMAKVVFDRMVVRDISSWNA  217

Query  492  MIAAYSASGDPNLAAEIFDRTPLSMRDTVFYNARITGYSHQNDGHAAIQVFNDMKRNN-F  668
            MIA +   G   LA E F++  ++ RD V +N+ I GY+ +     A+ +F+ M R++  
Sbjct  218  MIALHMQVGQMELAMEQFEQ--MAERDIVTWNSMIAGYNQRGYDLRALDMFSKMLRDSML  275

Query  669  QPDQ  680
             PD+
Sbjct  276  SPDR  279


 Score = 55.8 bits (133),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 37/118 (31%), Positives = 54/118 (46%), Gaps = 4/118 (3%)
 Frame = +3

Query  330  LATTIHANMITSGFKPRAHILNRLIDIYCKSSNLPYARHLFDEIPQPD--IVARTTMIAA  503
            +   IH++++T+GF     +LN LI +Y +   +  AR L ++    D  I   T ++  
Sbjct  297  IGKQIHSHIVTTGFDISGIVLNALISMYSRCGGVETARRLIEQRGTGDLKIEGFTALLDG  356

Query  504  YSASGDPNLAAEIFDRTPLSMRDTVFYNARITGYSHQNDGHAAIQVFNDMKRNNFQPD  677
            Y   GD N A  IFD   L  RD V + A I GY        AI  F  M     +P+
Sbjct  357  YIKLGDMNQAKMIFDS--LKDRDVVVWTAMIVGYEQHGLYGEAINFFKSMVGGGQRPN  412



>ref|XP_006296049.1| hypothetical protein CARUB_v10025197mg [Capsella rubella]
 gb|EOA28947.1| hypothetical protein CARUB_v10025197mg [Capsella rubella]
Length=795

 Score = 77.8 bits (190),  Expect = 6e-13, Method: Composition-based stats.
 Identities = 40/136 (29%), Positives = 70/136 (51%), Gaps = 6/136 (4%)
 Frame = +3

Query  285  LQLCSSNIHTPATSS----LATTIHANMITSGFKPRAHILNRLIDIYCKSSNLPYARHLF  452
            L+LC++ +      S     A  +H  +I SG     +++N L+++Y K+    +AR LF
Sbjct  22   LELCTNLLQKSVNKSNGRFTAQLVHCRVIKSGLFFSVYLMNNLMNVYSKTGYALHARKLF  81

Query  453  DEIPQPDIVARTTMIAAYSASGDPNLAAEIFDRTPLSMRDTVFYNARITGYSHQNDGHAA  632
            DE+P     +   +++AY+  GD +   E FDR P   RD+V +   + GY +    H A
Sbjct  82   DEMPLRTAFSWNIVLSAYAKRGDMDSTCEFFDRLP--QRDSVSWTTMVVGYKNVGQYHKA  139

Query  633  IQVFNDMKRNNFQPDQ  680
            I++  +M +   +P Q
Sbjct  140  IRIMGEMMKEGVEPTQ  155


 Score = 54.7 bits (130),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 35/124 (28%), Positives = 66/124 (53%), Gaps = 5/124 (4%)
 Frame = +3

Query  318  ATSSLAT--TIHANMITSGFKPRAHILNRLIDIYCKSSNLPYARHLFDEIPQPDIVARTT  491
            AT  L T   +H+ ++  G +    + N L+++Y K  +   A+ +FD +   DI +   
Sbjct  167  ATRCLETGKKVHSFIVKLGLRGNVSVSNSLLNMYAKCGDPVMAKVVFDRMVVRDISSWNA  226

Query  492  MIAAYSASGDPNLAAEIFDRTPLSMRDTVFYNARITGYSHQNDGHAAIQVFNDMKRNN-F  668
            MIA +   G  +LA   F++  ++ RD V +N+ I+GY+ +     A+ +F+ M R++  
Sbjct  227  MIALHMQVGQMDLAMAQFEQ--MAERDIVTWNSMISGYNQRGYDLRALDMFSKMLRDSML  284

Query  669  QPDQ  680
             PD+
Sbjct  285  SPDR  288


 Score = 50.1 bits (118),  Expect = 8e-04, Method: Composition-based stats.
 Identities = 35/118 (30%), Positives = 54/118 (46%), Gaps = 4/118 (3%)
 Frame = +3

Query  330  LATTIHANMITSGFKPRAHILNRLIDIYCKSSNLPYARHLFDEIPQPD--IVARTTMIAA  503
            +   I+++++T+GF     +LN LI +Y +   +  AR L ++    D  I   T ++  
Sbjct  306  IGKQIYSHIVTTGFDISGIVLNALISMYSRCGGVETARRLIEQRGTADLKIEGFTALLDG  365

Query  504  YSASGDPNLAAEIFDRTPLSMRDTVFYNARITGYSHQNDGHAAIQVFNDMKRNNFQPD  677
            Y   GD   A  IFD   L  RD V + A I GY        AI +F  M     +P+
Sbjct  366  YIKLGDMIQAKMIFDS--LRDRDVVVWTAMIVGYEQHGLYCEAINLFRSMVGGEQRPN  421



>ref|XP_004242310.1| PREDICTED: pentatricopeptide repeat-containing protein At4g20770 
[Solanum lycopersicum]
Length=765

 Score = 77.8 bits (190),  Expect = 6e-13, Method: Composition-based stats.
 Identities = 40/130 (31%), Positives = 75/130 (58%), Gaps = 3/130 (2%)
 Frame = +3

Query  285  LQLCSSNIHTPATSSLATTIHANMITSGFKPRAHILNRLIDIYCKSSNLPYARHLFDEIP  464
            + L  ++I T A S+    +HA+++  G      +LNRLI++Y KS ++  ARHLFD++ 
Sbjct  11   VNLLQTSIDTKAYSA-GKLLHAHILRIGLSADTFLLNRLIELYSKSGHIHTARHLFDQML  69

Query  465  QPDIVARTTMIAAYSASGDPNLAAEIFDRTPLSMRDTVFYNARITGYSHQNDGHAAIQVF  644
            +P++ +  +++ AY   G  + A E+F   P   R+TV +N  I+ ++  +    A++V+
Sbjct  70   EPNVYSWHSLLTAYCKQGQLDNAHELFSNMP--ERNTVSWNTLISAFARNHHETKALKVY  127

Query  645  NDMKRNNFQP  674
            + M  + F P
Sbjct  128  SQMNAHGFSP  137



>ref|XP_006398078.1| hypothetical protein EUTSA_v10001098mg [Eutrema salsugineum]
 gb|ESQ39531.1| hypothetical protein EUTSA_v10001098mg [Eutrema salsugineum]
Length=889

 Score = 77.8 bits (190),  Expect = 6e-13, Method: Composition-based stats.
 Identities = 42/116 (36%), Positives = 63/116 (54%), Gaps = 2/116 (2%)
 Frame = +3

Query  330  LATTIHANMITSGFKPRAHILNRLIDIYCKSSNLPYARHLFDEIPQPDIVARTTMIAAYS  509
            L    +A+MI SGF+P  ++LN L+ +Y  S +L  A  LFD +P  D+V+  TMI  Y+
Sbjct  60   LGKQAYAHMILSGFRPTTYVLNCLLQMYTNSRDLVSACMLFDRMPLRDVVSWNTMINGYA  119

Query  510  ASGDPNLAAEIFDRTPLSMRDTVFYNARITGYSHQNDGHAAIQVFNDMKRNNFQPD  677
             S D   A+  FD  P   RD V +N+ ++ Y        +++VF DM R   + D
Sbjct  120  KSKDMVKASSFFDMMP--ERDVVSWNSMLSAYLQNGQSLKSVEVFLDMGRAGVEFD  173



>ref|XP_003572610.1| PREDICTED: pentatricopeptide repeat-containing protein At5g06540-like 
[Brachypodium distachyon]
 ref|XP_010235532.1| PREDICTED: pentatricopeptide repeat-containing protein At5g06540-like 
[Brachypodium distachyon]
Length=454

 Score = 77.0 bits (188),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 39/115 (34%), Positives = 58/115 (50%), Gaps = 2/115 (2%)
 Frame = +3

Query  333  ATTIHANMITSGFKPRAHILNRLIDIYCKSSNLPYARHLFDEIPQPDIVARTTMIAAYSA  512
            A   HA  +  G    + + N L+ +YC    LP+AR +FD     D+ +  TM++ Y  
Sbjct  95   APVAHAQALKCGALAHSVVTNSLLKLYCTLGLLPHARRVFDSGAALDVASWNTMVSGYGK  154

Query  513  SGDPNLAAEIFDRTPLSMRDTVFYNARITGYSHQNDGHAAIQVFNDMKRNNFQPD  677
            SGD   A E+F R P   R+ V ++A I    H  +   A+ VF+ M R  F+PD
Sbjct  155  SGDLAAAREVFGRMP--GRNLVSWSAMIDALVHAEEFGEALSVFDQMMREGFKPD  207



>ref|XP_008803058.1| PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing 
protein At5g08510-like [Phoenix dactylifera]
Length=510

 Score = 77.4 bits (189),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 40/115 (35%), Positives = 63/115 (55%), Gaps = 3/115 (3%)
 Frame = +3

Query  339  TIHANMITSGFKPRAHILNRLIDIYCKSSNLPYARHLFDEIPQPDIVARTTMIAAYSASG  518
             +HA+   SGF   A +   L+D+Y K+  L  AR LFDE+P  D+    +MI  Y+  G
Sbjct  106  ALHAHFHKSGFPFDAFVATSLLDMYAKAGLLASARRLFDEMPHRDLALWNSMIGGYAKCG  165

Query  519  DPNLAAEIFDRTPLSMRDTVFYNARITGYSHQNDGHAAIQVFNDM-KRNNFQPDQ  680
            +   A E+FD  PL  R+ + + + I+GYS       AIQ+F+ M +    +P++
Sbjct  166  ELAEAKELFDMMPL--RNVISWTSMISGYSQNGRYEEAIQMFSSMWEEGELRPNE  218



>ref|XP_003632466.2| PREDICTED: pentatricopeptide repeat-containing protein At4g37170 
[Vitis vinifera]
Length=695

 Score = 77.8 bits (190),  Expect = 7e-13, Method: Composition-based stats.
 Identities = 46/143 (32%), Positives = 79/143 (55%), Gaps = 7/143 (5%)
 Frame = +3

Query  246  YICRQLATRYAAHLQLCSSNIHTPATSSLATTIHANMITSGFKPRAHILNRLIDIYCKSS  425
            ++ R  A  Y+  LQLC   +   A       +HA+  TSGF P   I NR++D+Y K +
Sbjct  83   HVDRPSAATYSTLLQLC---LQLRALDE-GMKVHAHTKTSGFVPGVVISNRILDMYIKCN  138

Query  426  NLPYARHLFDEIPQPDIVARTTMIAAYSASGDPNLAAEIFDRTPLSMRDTVFYNARITGY  605
            +L  A+ LFDE+ + D+ +   MI+ Y+ +G    A ++FD+  ++ RD   + A  +GY
Sbjct  139  SLVNAKRLFDEMAERDLCSWNIMISGYAKAGRLQEARKLFDQ--MTERDNFSWTAMTSGY  196

Query  606  SHQNDGHAAIQVFNDMKRN-NFQ  671
               +    A+++F  M+R+ NF+
Sbjct  197  VRHDQHEEALELFRAMQRHENFK  219


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 25/77 (32%), Positives = 45/77 (58%), Gaps = 0/77 (0%)
 Frame = +3

Query  318  ATSSLATTIHANMITSGFKPRAHILNRLIDIYCKSSNLPYARHLFDEIPQPDIVARTTMI  497
            A   L   +H  M   GF P +   + L+ +Y K  N+  AR +F+ +P+PD+V+ T++I
Sbjct  337  AAEELGKQVHGYMTRIGFDPSSFAASTLVHMYTKCGNIKNARRVFNGMPRPDLVSWTSLI  396

Query  498  AAYSASGDPNLAAEIFD  548
            + Y+ +G P+ A + F+
Sbjct  397  SGYAQNGQPDEALQFFE  413



>ref|XP_008649224.1| PREDICTED: pentatricopeptide repeat-containing protein At2g22410, 
mitochondrial-like isoform X1 [Zea mays]
 ref|XP_008649225.1| PREDICTED: pentatricopeptide repeat-containing protein At2g22410, 
mitochondrial-like isoform X1 [Zea mays]
 ref|XP_008649226.1| PREDICTED: pentatricopeptide repeat-containing protein At2g22410, 
mitochondrial-like isoform X1 [Zea mays]
 gb|AFW76726.1| hypothetical protein ZEAMMB73_427029 [Zea mays]
Length=646

 Score = 77.4 bits (189),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 37/116 (32%), Positives = 65/116 (56%), Gaps = 2/116 (2%)
 Frame = +3

Query  327  SLATTIHANMITSGFKPRAHILNRLIDIYCKSSNLPYARHLFDEIPQPDIVARTTMIAAY  506
             L  T+H  ++ SG +   ++ N L+D++ K   +  A+ +FD +P  D+ + T+M++AY
Sbjct  250  GLGRTVHQCIVESGGRMSVNLENALVDMFGKCGCVAAAKEVFDGMPIKDVYSWTSMVSAY  309

Query  507  SASGDPNLAAEIFDRTPLSMRDTVFYNARITGYSHQNDGHAAIQVFNDMKRNNFQP  674
            +  GD   AA++F   P   R+ V ++  +  YSH N    AI++FNDM     +P
Sbjct  310  AKCGDLENAAKLFKEIP--NRNVVSWSCMVAAYSHANMPDEAIRIFNDMIAAGVEP  363


 Score = 50.4 bits (119),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 36/101 (36%), Positives = 50/101 (50%), Gaps = 2/101 (2%)
 Frame = +3

Query  255  RQLATRYAAHLQLCSSNIHTPATSSLAT-TIHANMITSGFKPRAHIL-NRLIDIYCKSSN  428
            R L  R A   +     +   ATSS  T  IH      GF  ++ +  N L+ +Y  S  
Sbjct  122  RVLRDRLAVDARTIVFAVKAAATSSSPTEAIHCVAFKRGFIGQSVLAGNALVHMYTSSML  181

Query  429  LPYARHLFDEIPQPDIVARTTMIAAYSASGDPNLAAEIFDR  551
            LP AR LFDE+   D+V+ TT+I  Y+  G P+ A  +F R
Sbjct  182  LPDARKLFDEMADRDVVSWTTLIDGYARGGLPDEAWRVFCR  222



>ref|XP_009773656.1| PREDICTED: pentatricopeptide repeat-containing protein At5g44230 
[Nicotiana sylvestris]
Length=653

 Score = 77.4 bits (189),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 43/135 (32%), Positives = 71/135 (53%), Gaps = 7/135 (5%)
 Frame = +3

Query  279  AHLQLCSSNIHTPATSSLATTIHANMIT-SGFKPRAHILNRLIDIYCKSSNLPYARHLFD  455
            A L+ CS  +      +L   IH       GF     + N LID+Y +   L   R +FD
Sbjct  150  ALLKGCSDELEL----NLGRQIHCQGTKLGGFCKDLFVHNTLIDMYVECGWLDSGRKVFD  205

Query  456  EIPQPDIVARTTMIAAYSASGDPNLAAEIFDRTPLSMRDTVFYNARITGYSHQNDGHAAI  635
            E+P  D+++ T++I AYS +GD   AAE+F+R P+  +D V + A ++G++       A+
Sbjct  206  EMPDRDVISWTSLIVAYSKAGDMMAAAELFERLPV--KDLVAWTAMVSGFAQNAKPREAL  263

Query  636  QVFNDMKRNNFQPDQ  680
            + F+ M+    Q D+
Sbjct  264  EFFHRMQCGGVQTDE  278



>ref|XP_008225203.1| PREDICTED: pentatricopeptide repeat-containing protein At1g28690, 
mitochondrial [Prunus mume]
Length=527

 Score = 77.0 bits (188),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 43/129 (33%), Positives = 71/129 (55%), Gaps = 6/129 (5%)
 Frame = +3

Query  294  CSSNIHTPATSSLATTIHANMITSGFKPRAHILNRLIDIYCKSSNLPYARHLFDEIPQPD  473
            C+ N   P +  +   +HA +I S  +P   +   L+D Y K+  + YAR +FD + + +
Sbjct  153  CAGNAAFPWSLGV---VHAQIIKSDVEPDDVLYTVLVDSYIKNGKVGYARTVFDTMLEKN  209

Query  474  IVARTTMIAAYSASGDPNLAAEIFDRTPLSMRDTVFYNARITGYSHQND-GHAAIQVFND  650
            +V  T+MI+ Y   G    A +IF RT    +D V +NA I GYS   +    +++V+ D
Sbjct  210  VVCSTSMISGYMNQGSVEDAEDIFRRT--VEKDVVVFNAMIEGYSKSTEYAWRSLEVYVD  267

Query  651  MKRNNFQPD  677
            M+R NF+P+
Sbjct  268  MQRLNFRPN  276



>ref|XP_004485929.1| PREDICTED: pentatricopeptide repeat-containing protein At5g59600-like 
[Cicer arietinum]
Length=548

 Score = 77.4 bits (189),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 38/114 (33%), Positives = 58/114 (51%), Gaps = 2/114 (2%)
 Frame = +3

Query  342  IHANMITSGFKPRAHILNRLIDIYCKSSNLPYARHLFDEIPQPDIVARTTMIAAYSASGD  521
            +HA +   GF+    I N LID+YCK  ++ YA  +F+E+P+ D+ + T+MI  +   GD
Sbjct  135  VHAMIYEMGFQNDVSIGNGLIDMYCKCGSISYACRVFEEMPERDVASWTSMICGFCNVGD  194

Query  522  PNLAAEIFDRTPLSMRD--TVFYNARITGYSHQNDGHAAIQVFNDMKRNNFQPD  677
               A  +F+R  L   +     +NA I  Y+   D   A      MK+  F PD
Sbjct  195  IEQALVLFERMKLEGLEPNDFTWNAIIAMYARLGDSKKAFSFMEKMKKEGFLPD  248


 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 34/136 (25%), Positives = 61/136 (45%), Gaps = 11/136 (8%)
 Frame = +3

Query  285  LQLCSSNIHT----PATSSLATT-----IHANMITSGFKPRAHILNRLIDIYCKSSNLPY  437
            L++CS+ +      PA  S+ +      IH  +   GF     I + LID+Y K  +L  
Sbjct  278  LRICSNQVTIAALLPACGSVGSVKWGREIHGFICRKGFDANVFIASALIDMYSKCGSLNN  337

Query  438  ARHLFDEIPQPDIVARTTMIAAYSASGDPNLAAEIFDRTPLSMR--DTVFYNARITGYSH  611
            AR++FD+I   ++ +   MI  Y   G  + + E+F +        + V +   ++  SH
Sbjct  338  ARNVFDKISCKNVASWNAMIDCYGKCGMVDSSMELFTKMQEEGLQPNEVTFTCILSACSH  397

Query  612  QNDGHAAIQVFNDMKR  659
                   +++F  MK 
Sbjct  398  SGSVEKGLEIFTSMKE  413



>gb|ERN14924.1| hypothetical protein AMTR_s00032p00190360 [Amborella trichopoda]
Length=677

 Score = 77.4 bits (189),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 39/113 (35%), Positives = 62/113 (55%), Gaps = 2/113 (2%)
 Frame = +3

Query  342  IHANMITSGFKPRAHILNRLIDIYCKSSNLPYARHLFDEIPQPDIVARTTMIAAYSASGD  521
            IH  ++  GF   A + N LI +Y    +L  AR +FDEIP+P +V+  +MI++Y  SG 
Sbjct  59   IHGEILKLGFDHDAFLTNALISMYGNCRDLDSARKVFDEIPEPGVVSWNSMISSYFHSGH  118

Query  522  PNLAAEIFDRTPLSMRDTVFYNARITGYSHQNDGHAAIQVFNDMKRNNFQPDQ  680
             N A E+F    +   + + ++  I GYS     H A+Q+F  ++R   Q D+
Sbjct  119  CNTANELFKL--MKHPNLITWSVMIVGYSQNGHAHEAMQLFKQIRREAAQEDE  169



>ref|XP_009353223.1| PREDICTED: pentatricopeptide repeat-containing protein At1g28690, 
mitochondrial-like [Pyrus x bretschneideri]
Length=509

 Score = 77.0 bits (188),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 42/129 (33%), Positives = 67/129 (52%), Gaps = 5/129 (4%)
 Frame = +3

Query  294  CSSNIHTPATSSLATTIHANMITSGFKPRAHILNRLIDIYCKSSNLPYARHLFDEIPQPD  473
            C+  +  P   SL   IH  MI    +P   +   L+D Y K+  + YAR +FD   + +
Sbjct  134  CAGIVALPC--SLGRVIHGQMIRKDVEPDDVLYTALVDSYVKNGKVQYARTMFDMTLEKN  191

Query  474  IVARTTMIAAYSASGDPNLAAEIFDRTPLSMRDTVFYNARITGYSHQND-GHAAIQVFND  650
            ++  T+MI+ Y   G    A +IF +T    +D V +NA I GYS   +    +++V+ D
Sbjct  192  VICSTSMISGYMNRGSVEDAEDIFRKT--VKKDVVLFNAMIEGYSKSVEYARGSLEVYID  249

Query  651  MKRNNFQPD  677
            M+R NF P+
Sbjct  250  MQRLNFLPN  258



>ref|XP_008349239.1| PREDICTED: pentatricopeptide repeat-containing protein At1g28690, 
mitochondrial-like [Malus domestica]
Length=526

 Score = 77.0 bits (188),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 41/129 (32%), Positives = 69/129 (53%), Gaps = 5/129 (4%)
 Frame = +3

Query  294  CSSNIHTPATSSLATTIHANMITSGFKPRAHILNRLIDIYCKSSNLPYARHLFDEIPQPD  473
            C+ ++  P   +L   +H  MI +   P   +   L+D Y K+  + YAR +FD + + +
Sbjct  150  CAGDVALP--RNLGRVVHGQMIRTDVAPDEVLYXALVDSYVKNGKVRYARTVFDMMLEKN  207

Query  474  IVARTTMIAAYSASGDPNLAAEIFDRTPLSMRDTVFYNARITGYSHQND-GHAAIQVFND  650
            ++  T+MI+ Y   G    A +IF +T    +D V +NA I GYS   +    ++ V+ D
Sbjct  208  VICSTSMISGYMNQGSVEDAEDIFRKTV--EKDVVVFNAMIEGYSKSVEYARRSLDVYID  265

Query  651  MKRNNFQPD  677
            M+R NFQP+
Sbjct  266  MQRLNFQPN  274



>ref|XP_012091736.1| PREDICTED: pentatricopeptide repeat-containing protein At1g28690, 
mitochondrial [Jatropha curcas]
 gb|KDP21066.1| hypothetical protein JCGZ_21537 [Jatropha curcas]
Length=528

 Score = 77.0 bits (188),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 40/136 (29%), Positives = 74/136 (54%), Gaps = 3/136 (2%)
 Frame = +3

Query  273  YAAHLQLCSSNIHTPATSSLATTIHANMITSGFKPRAHILNRLIDIYCKSSNLPYARHLF  452
            Y+  L++ +S  +     +L   +HA ++ S  +P   +   L+D Y KS  + +AR +F
Sbjct  144  YSMILKVSTSGCNLALPRNLVGMVHAQIVKSDVQPDDVLCTALVDAYVKSGRIDFARRVF  203

Query  453  DEIPQPDIVARTTMIAAYSASGDPNLAAEIFDRTPLSMRDTVFYNARITGYSHQND-GHA  629
            D + + +++  T+MI+ Y   G    A EIF +T    +D V +NA I GYS   +    
Sbjct  204  DMMIEKNVICSTSMISGYMNRGFVEDAEEIFKKTI--EKDVVVFNAMIEGYSKSVETATK  261

Query  630  AIQVFNDMKRNNFQPD  677
            A++++ +M+R  F+P+
Sbjct  262  ALEIYVEMQRFGFRPN  277



>ref|XP_010091291.1| hypothetical protein L484_001646 [Morus notabilis]
 gb|EXB44248.1| hypothetical protein L484_001646 [Morus notabilis]
Length=633

 Score = 77.4 bits (189),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 39/113 (35%), Positives = 58/113 (51%), Gaps = 0/113 (0%)
 Frame = +3

Query  342  IHANMITSGFKPRAHILNRLIDIYCKSSNLPYARHLFDEIPQPDIVARTTMIAAYSASGD  521
            +HA+++  GF       N LI +Y     L  AR +FD +P PD+V+ TT+IA YS  G 
Sbjct  147  VHAHVLKFGFGEDGFCQNSLIHMYVGCGALDDARKVFDGMPAPDVVSWTTLIAGYSRCGS  206

Query  522  PNLAAEIFDRTPLSMRDTVFYNARITGYSHQNDGHAAIQVFNDMKRNNFQPDQ  680
             + A  +F+  P   R +V +NA I  Y   N  H A  +F  M+    + D+
Sbjct  207  VDEAFRLFESMPEGERSSVSWNAMIASYVQSNRFHEAFALFQRMRDEKVELDK  259



>ref|XP_010694524.1| PREDICTED: pentatricopeptide repeat-containing protein At3g02330 
[Beta vulgaris subsp. vulgaris]
Length=872

 Score = 77.8 bits (190),  Expect = 8e-13, Method: Composition-based stats.
 Identities = 39/100 (39%), Positives = 55/100 (55%), Gaps = 2/100 (2%)
 Frame = +3

Query  345  HANMITSGFKPRAHILNRLIDIYCKSSNLPYARHLFDEIPQPDIVARTTMIAAYSASGDP  524
            HA MI SGF+P   + N L+ +Y K S L YA  +FD++PQ D V+  +MI  YS  G  
Sbjct  66   HAQMIVSGFEPTIFVTNCLLQMYIKCSRLGYAHKVFDQMPQRDTVSWNSMIFGYSGEGKM  125

Query  525  NLAAEIFDRTPLSMRDTVFYNARITGYSHQNDGHAAIQVF  644
             +A  +FD  P   RD V +N  I+ Y    +    +Q+F
Sbjct  126  KVAQILFDLMP--KRDVVSWNTLISSYLQCGNHQKCVQIF  163



>ref|XP_011627771.1| PREDICTED: pentatricopeptide repeat-containing protein At2g22410, 
mitochondrial [Amborella trichopoda]
Length=607

 Score = 77.4 bits (189),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 38/135 (28%), Positives = 71/135 (53%), Gaps = 6/135 (4%)
 Frame = +3

Query  276  AAHLQLCSSNIHTPATSSLATTIHANMITSGFKPRAHILNRLIDIYCKSSNLPYARHLFD  455
             + L +CS             ++H  +   G +   ++ N L+D+Y K   +  AR +FD
Sbjct  193  VSMLSVCSQT----GDLEFGRSLHFCIAKKGIRADVYVHNALVDMYAKCGQIREARLIFD  248

Query  456  EIPQPDIVARTTMIAAYSASGDPNLAAEIFDRTPLSMRDTVFYNARITGYSHQNDGHAAI  635
            ++P+ ++V+ TTM+ AY   G  +LA   F++ P   ++ V +NA I G++ Q+ G  A+
Sbjct  249  QMPERNVVSWTTMVTAYVKQGMLDLAYRFFEQMP--EKNVVSWNALIAGFAQQDRGREAL  306

Query  636  QVFNDMKRNNFQPDQ  680
             +   M+ +N  PD+
Sbjct  307  DLLTCMENSNVMPDE  321



>emb|CBI17453.3| unnamed protein product [Vitis vinifera]
Length=451

 Score = 76.6 bits (187),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 41/137 (30%), Positives = 72/137 (53%), Gaps = 7/137 (5%)
 Frame = +3

Query  273  YAAHLQLCSSNIHTPATSSLATTIHAN-MITSGFKPRAHILNRLIDIYCKSSNLPYARHL  449
            + A L+ CS+ +      +L   +H   ++  GF    ++ N LID+Y K   L     +
Sbjct  142  FTALLKACSAALDV----NLGRQVHTQTILIGGFGSDLYVGNTLIDMYVKCGCLGCGHRV  197

Query  450  FDEIPQPDIVARTTMIAAYSASGDPNLAAEIFDRTPLSMRDTVFYNARITGYSHQNDGHA  629
            FDE+   D+++ T++I AY+  G+   A+E+FD  P  M+D V + A +TGY+       
Sbjct  198  FDEMLDRDVISWTSLIVAYAKVGNMEAASELFDGLP--MKDMVAWTAMVTGYAQNARPRE  255

Query  630  AIQVFNDMKRNNFQPDQ  680
            A++VF  M+    + D+
Sbjct  256  ALEVFERMQAAGVKTDE  272



>gb|KJB23426.1| hypothetical protein B456_004G097600 [Gossypium raimondii]
Length=477

 Score = 77.0 bits (188),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 44/131 (34%), Positives = 68/131 (52%), Gaps = 8/131 (6%)
 Frame = +3

Query  285  LQLCSSNIHTPATSSLATTIHANMITSGFKPRAHILNRLIDIYCKSSNLPYARHLFDEIP  464
            L+ C+ N      S +    HA +I  G++    +LN LI +Y   S++  AR LFD   
Sbjct  61   LRACTDN------SPVGLASHAQVIKLGWESYDFVLNGLIHLYANWSSVEAARKLFDVST  114

Query  465  QPDIVARTTMIAAYSASGDPNLAAEIFDRTPLSMRDTVFYNARITGYSHQNDGHAAIQVF  644
              D++  T +I  Y  SG    A E+FD+ P   R+ V ++A ITGY H      A+++F
Sbjct  115  CRDVITWTALINGYVKSGHLEFARELFDQMP--ERNEVSWSAMITGYVHMGMFREALELF  172

Query  645  NDMKRNNFQPD  677
            NDM+    +P+
Sbjct  173  NDMQLTGLRPN  183



>ref|XP_007208178.1| hypothetical protein PRUPE_ppa017277mg, partial [Prunus persica]
 gb|EMJ09377.1| hypothetical protein PRUPE_ppa017277mg, partial [Prunus persica]
Length=634

 Score = 77.4 bits (189),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 38/116 (33%), Positives = 62/116 (53%), Gaps = 1/116 (1%)
 Frame = +3

Query  330  LATTIHANMITSGFKPRAHILNRLIDIYCKSSNLPYARHLFDEIPQPDIVARTTMIAAYS  509
              T +HA+ I +G K   H+ N L+ +Y K+ +L   + +FDEI  PD+ + TT+++A +
Sbjct  75   FGTQLHAHAIRTGLKAYPHVANTLLSLYAKAEDLNSVKWVFDEIENPDVYSWTTLLSACT  134

Query  510  ASGDPNLAAEIFDRTPLSMRDTVFYNARITGYSHQNDGHAAIQVFNDMKRNNFQPD  677
              G  + A ++FD  P   R+   +NA ITG +       AI +F +M R     D
Sbjct  135  KLGHVDYAYKLFDTMP-EKRNVTIWNAMITGCAENGCEEVAIGLFGEMHRMGVMHD  189


 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 31/115 (27%), Positives = 55/115 (48%), Gaps = 4/115 (3%)
 Frame = +3

Query  342  IHANMITSGFKPRAHILNRLIDIYCKSSNLPYARHLFDEIPQPDIVARTTMIAAYSASGD  521
            +H  ++  GF P+  + N LI +Y K   + ++  +F+ +PQ D V+  ++I+AY+  G 
Sbjct  412  VHGYILKFGFSPQMCLHNALITMYAKCGVIDWSVRVFNAMPQKDTVSWNSLISAYAQHGQ  471

Query  522  PNLAAEIFDRTPLSMR---DTVFYNARITGYSHQNDGHAAIQVFNDMKRN-NFQP  674
             N A   F+    S     D   + A ++  SH        ++FN M  +  F P
Sbjct  472  GNEAVRCFEAMQDSAAVKPDQATFTAVLSACSHAGLVVDGTRIFNSMINDYGFMP  526



>ref|XP_011624979.1| PREDICTED: pentatricopeptide repeat-containing protein At1g08070-like 
[Amborella trichopoda]
Length=544

 Score = 77.0 bits (188),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 41/118 (35%), Positives = 62/118 (53%), Gaps = 2/118 (2%)
 Frame = +3

Query  324  SSLATTIHANMITSGFKPRAHILNRLIDIYCKSSNLPYARHLFDEIPQPDIVARTTMIAA  503
              L   +HA+   SGF   +++   L+D+Y K      AR +FD IP  DIVA T M++A
Sbjct  46   EKLGKMVHAHTEKSGFWCDSYVQKSLLDLYAKLGLFEQARQVFDTIPARDIVAHTCMVSA  105

Query  504  YSASGDPNLAAEIFDRTPLSMRDTVFYNARITGYSHQNDGHAAIQVFNDMKRNNFQPD  677
            Y+   D + A  +FD   +S +D V + A I GYS       A+ +F  MK  + +P+
Sbjct  106  YNKVSDISSARLVFD--SVSEKDIVLWTAMIVGYSQNGAPDEALALFRSMKSTSVKPN  161



>ref|XP_009340246.1| PREDICTED: pentatricopeptide repeat-containing protein At2g21090-like 
[Pyrus x bretschneideri]
 ref|XP_009340251.1| PREDICTED: pentatricopeptide repeat-containing protein At2g21090-like 
[Pyrus x bretschneideri]
Length=611

 Score = 77.0 bits (188),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 37/118 (31%), Positives = 65/118 (55%), Gaps = 2/118 (2%)
 Frame = +3

Query  327  SLATTIHANMITSGFKPRAHILNRLIDIYCKSSNLPYARHLFDEIPQPDIVARTTMIAAY  506
             L   +HA ++ +GF     + + ++D Y K   +  AR +FD +P  D++  TT+++ Y
Sbjct  208  GLTRQVHAQVLVAGFLSNVVLSSSVVDAYAKCGEMRDARKVFDSMPVKDVLVWTTLVSGY  267

Query  507  SASGDPNLAAEIFDRTPLSMRDTVFYNARITGYSHQNDGHAAIQVFNDMKRNNFQPDQ  680
            +  GD   A+E+F+R P   ++ V + A I+GY+    GH A+  F +M     +PDQ
Sbjct  268  AKFGDMESASELFNRMP--EKNPVSWTAVISGYARNGLGHEALAFFTEMMFYQVRPDQ  323


 Score = 57.0 bits (136),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 29/107 (27%), Positives = 59/107 (55%), Gaps = 3/107 (3%)
 Frame = +3

Query  342  IHANMITSGFK-PRAHILNRLIDIYCKSSNLPYARHLFDEIPQPDIVARTTMIAAYSASG  518
            +H +M  +GFK P   + N LI++Y K ++   AR +FD++   ++ +   M++ Y+   
Sbjct  80   VHIHMKLTGFKHPSTFLANHLINMYFKCADDVEARRVFDKMAVRNLYSWNNMLSGYAKMR  139

Query  519  DPNLAAEIFDRTPLSMRDTVFYNARITGYSHQNDGHAAIQVFNDMKR  659
              + A  +FD+ P   +D V +N  + GY+       A++V+ +++R
Sbjct  140  KLSEARSLFDKMP--EKDVVSWNTMVIGYAQSGVCDEALRVYRELRR  184



>ref|XP_011623320.1| PREDICTED: LOW QUALITY PROTEIN: putative pentatricopeptide repeat-containing 
protein At1g68930 [Amborella trichopoda]
Length=1138

 Score = 77.8 bits (190),  Expect = 9e-13, Method: Composition-based stats.
 Identities = 42/117 (36%), Positives = 60/117 (51%), Gaps = 0/117 (0%)
 Frame = +3

Query  330  LATTIHANMITSGFKPRAHILNRLIDIYCKSSNLPYARHLFDEIPQPDIVARTTMIAAYS  509
            L   IH  +I  GF+    + + LID+Y K SNL  AR +FDE+ + + V+  TMI  Y 
Sbjct  549  LGRQIHGQIIRIGFESNPFVTSPLIDMYVKCSNLEGARRVFDELSERNSVSYNTMITGYC  608

Query  510  ASGDPNLAAEIFDRTPLSMRDTVFYNARITGYSHQNDGHAAIQVFNDMKRNNFQPDQ  680
              G    A  IF++ P   RD+V +   ITGY        A+++F  MK  +   DQ
Sbjct  609  KCGMVEEAKRIFNKMPERERDSVSWTTMITGYMQNGHSREALELFRGMKFADSASDQ  665


 Score = 76.3 bits (186),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 40/133 (30%), Positives = 71/133 (53%), Gaps = 2/133 (2%)
 Frame = +3

Query  282  HLQLCSSNIHTPATSSLATTIHANMITSGFKPRAHILNRLIDIYCKSSNLPYARHLFDEI  461
             +++ S +   P+       +H  ++ +       + N LI++Y KS NL YAR +FD +
Sbjct  401  QVEVLSRSFRYPSKPHHGKKLHCLILKTVENTDTFVTNNLINLYAKSWNLSYARRVFDRM  460

Query  462  PQPDIVARTTMIAAYSASGDPNLAAEIFDRTPLSMRDTVFYNARITGYSHQNDGHAAIQV  641
            P  ++++  +MI  YS  G       +F   PL  RD V +NA ++GY++  DG  AI+V
Sbjct  461  PHKNLISWNSMITGYSKWGFLREMENLFKLMPL--RDGVSWNAVLSGYANWGDGKTAIKV  518

Query  642  FNDMKRNNFQPDQ  680
            + +M  N+  P++
Sbjct  519  YQEMLHNSQTPNR  531



>ref|XP_004505771.1| PREDICTED: pentatricopeptide repeat-containing protein At2g21090-like 
[Cicer arietinum]
Length=604

 Score = 77.0 bits (188),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 39/117 (33%), Positives = 63/117 (54%), Gaps = 2/117 (2%)
 Frame = +3

Query  330  LATTIHANMITSGFKPRAHILNRLIDIYCKSSNLPYARHLFDEIPQPDIVARTTMIAAYS  509
            L   +H  ++  GF     + + ++D Y K   +  AR LFDE+P  DI A TT+++ Y+
Sbjct  203  LCRQMHGQVLVVGFLSNVVVSSSIVDAYAKCGKMEDARRLFDEMPVKDIPAWTTLVSGYA  262

Query  510  ASGDPNLAAEIFDRTPLSMRDTVFYNARITGYSHQNDGHAAIQVFNDMKRNNFQPDQ  680
              GD   AAE+F + P   +++  +   I GY   + GH A+ VF  M ++  +PDQ
Sbjct  263  LCGDMESAAELFSQMP--KKNSYSWTCLIGGYERNSLGHKALGVFRKMIKHQVRPDQ  317



>ref|XP_009788407.1| PREDICTED: pentatricopeptide repeat-containing protein At2g21090-like 
[Nicotiana sylvestris]
Length=627

 Score = 77.0 bits (188),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 38/118 (32%), Positives = 64/118 (54%), Gaps = 2/118 (2%)
 Frame = +3

Query  327  SLATTIHANMITSGFKPRAHILNRLIDIYCKSSNLPYARHLFDEIPQPDIVARTTMIAAY  506
            SL   +H+ ++ +GF     + + ++D Y K   +  AR LFD +   D++A TT+++ Y
Sbjct  211  SLTGQVHSQVLVAGFLSNVVLSSSIVDAYAKCGKMSDARRLFDAMRVKDVLAWTTLVSGY  270

Query  507  SASGDPNLAAEIFDRTPLSMRDTVFYNARITGYSHQNDGHAAIQVFNDMKRNNFQPDQ  680
            S  GD   A E+F+  P   ++ V +   I GYSH      A+++F+ M +   QPDQ
Sbjct  271  SRCGDMVSARELFEAMP--EKNPVSWTTLIAGYSHSGMSLQALELFSKMMKLQVQPDQ  326


 Score = 55.8 bits (133),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 29/107 (27%), Positives = 58/107 (54%), Gaps = 3/107 (3%)
 Frame = +3

Query  342  IHANMITSGFK-PRAHILNRLIDIYCKSSNLPYARHLFDEIPQPDIVARTTMIAAYSASG  518
            IH ++ T+G+K P   + N LI++Y K      AR++FD++   ++ +   M++ Y+ SG
Sbjct  83   IHFHLKTTGWKHPTTFLANHLINMYGKCGRHIEARNVFDKMTTRNLYSWNNMLSGYAKSG  142

Query  519  DPNLAAEIFDRTPLSMRDTVFYNARITGYSHQNDGHAAIQVFNDMKR  659
                A  +FD+ P   +D V +N  +  Y+     + A++ + + +R
Sbjct  143  MVKAAKRLFDKMP--EKDVVSWNTMVIAYAQVGYFNEALKFYREFRR  187



>gb|AFW62747.1| hypothetical protein ZEAMMB73_141955 [Zea mays]
Length=301

 Score = 75.1 bits (183),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 37/117 (32%), Positives = 65/117 (56%), Gaps = 2/117 (2%)
 Frame = +3

Query  330  LATTIHANMITSGFKPRAHILNRLIDIYCKSSNLPYARHLFDEIPQPDIVARTTMIAAYS  509
            +   IH+ M+ S     AHI + LI +Y   +N+  A  L++E+P+ D+V+ T M++ Y+
Sbjct  28   IGKAIHSYMLVSDMIIGAHISSALISLYASCANMEMAEKLYNEMPRKDLVSSTAMVSRYA  87

Query  510  ASGDPNLAAEIFDRTPLSMRDTVFYNARITGYSHQNDGHAAIQVFNDMKRNNFQPDQ  680
             +    +A  IFD  P   +D V ++A I+GY   N  + A+ +FN M+    + D+
Sbjct  88   RNRKVEIARSIFDGMP--EKDVVSWSAMISGYVDSNQPNEALSLFNGMQECGIRSDE  142


 Score = 52.4 bits (124),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 23/73 (32%), Positives = 43/73 (59%), Gaps = 0/73 (0%)
 Frame = +3

Query  333  ATTIHANMITSGFKPRAHILNRLIDIYCKSSNLPYARHLFDEIPQPDIVARTTMIAAYSA  512
            A  IHA +  +G     HI N LID++ K   +  A ++F+E+P  +++  T+MI+A++ 
Sbjct  161  AKWIHAFIKNNGLNKVLHICNALIDMFAKCGGINLALNVFNEMPLKNVITWTSMISAFAM  220

Query  513  SGDPNLAAEIFDR  551
             GD   +  +F++
Sbjct  221  HGDGKSSLRLFEQ  233



>ref|XP_002441797.1| hypothetical protein SORBIDRAFT_08g002505 [Sorghum bicolor]
 gb|EES15635.1| hypothetical protein SORBIDRAFT_08g002505, partial [Sorghum bicolor]
Length=839

 Score = 77.4 bits (189),  Expect = 9e-13, Method: Composition-based stats.
 Identities = 48/142 (34%), Positives = 73/142 (51%), Gaps = 9/142 (6%)
 Frame = +3

Query  264  ATRYAAHL-QLCSSNIHTPATSSLAT--TIHANMITSGFKPRAHILNRLIDIYCKSSNLP  434
            AT   +HL QLC+        S+LAT    HA M+ SGF P   + N L+ +Y +     
Sbjct  1    ATATFSHLYQLCAG----AGRSALATGQAAHARMLVSGFMPTTFVSNCLLQMYARCGGAA  56

Query  435  YARHLFDEIPQPDIVARTTMIAAYSASGDPNLAAEIFDRTPLSMRDTVFYNARITGYSHQ  614
            +AR +FD +P  D V+  TM+ AY+ +GD   AA +F   P    D V +NA ++GY  +
Sbjct  57   HARGVFDVMPHRDTVSWNTMLTAYAHAGDTGAAASLFGAMPDP--DVVSWNALLSGYCQR  114

Query  615  NDGHAAIQVFNDMKRNNFQPDQ  680
                 ++ +  +M R    PD+
Sbjct  115  GMFRDSVGLSVEMARRGVAPDR  136



>ref|XP_012080313.1| PREDICTED: pentatricopeptide repeat-containing protein At5g44230 
[Jatropha curcas]
 gb|KDP31290.1| hypothetical protein JCGZ_11666 [Jatropha curcas]
Length=654

 Score = 77.0 bits (188),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 42/137 (31%), Positives = 71/137 (52%), Gaps = 7/137 (5%)
 Frame = +3

Query  273  YAAHLQLCSSNIHTPATSSLATTIHA-NMITSGFKPRAHILNRLIDIYCKSSNLPYARHL  449
            ++A L+ C S +       L   +HA +++  GF+    + N LID+Y K   +   R +
Sbjct  149  FSAILKACGSVLDV----GLGRQMHAQSILIGGFRSDLFVNNTLIDMYVKCGFIECGRKV  204

Query  450  FDEIPQPDIVARTTMIAAYSASGDPNLAAEIFDRTPLSMRDTVFYNARITGYSHQNDGHA  629
            FDE+P+ D+++ T +I AY+  GD   A E+FD  P+  +D V + A +TG++       
Sbjct  205  FDEMPERDLISWTGLIVAYAKLGDMESARELFDGLPV--KDMVAWTAMVTGFAQNAKPRE  262

Query  630  AIQVFNDMKRNNFQPDQ  680
            AI+ F  M       D+
Sbjct  263  AIEFFERMLDTGVGTDE  279



>ref|XP_008237416.1| PREDICTED: pentatricopeptide repeat-containing protein At3g49740 
[Prunus mume]
Length=734

 Score = 77.4 bits (189),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 38/110 (35%), Positives = 63/110 (57%), Gaps = 1/110 (1%)
 Frame = +3

Query  330  LATTIHANMITSGFKPRAHILNRLIDIYCKSSNLPYARHLFDEIPQPDIVARTTMIAAYS  509
              T +HA+ I +G K   H+ N L+ +Y K+ NL   + +FDEI  PD+ + TT+++A +
Sbjct  75   FGTQLHAHAIRTGLKAYPHVANTLLSLYAKAENLNSVKWVFDEIENPDVYSWTTLLSACT  134

Query  510  ASGDPNLAAEIFDRTPLSMRDTVFYNARITGYSHQNDGHAAIQVFNDMKR  659
              G  + A+++FD  P   R+   +NA ITG +       AI +F +M+R
Sbjct  135  KLGHVDYASKLFDTMP-EKRNVAIWNAMITGCAENGCEEVAIGLFGEMRR  183



>ref|XP_002268784.1| PREDICTED: pentatricopeptide repeat-containing protein At5g44230 
[Vitis vinifera]
Length=647

 Score = 77.0 bits (188),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 41/137 (30%), Positives = 72/137 (53%), Gaps = 7/137 (5%)
 Frame = +3

Query  273  YAAHLQLCSSNIHTPATSSLATTIHAN-MITSGFKPRAHILNRLIDIYCKSSNLPYARHL  449
            + A L+ CS+ +      +L   +H   ++  GF    ++ N LID+Y K   L     +
Sbjct  142  FTALLKACSAALDV----NLGRQVHTQTILIGGFGSDLYVGNTLIDMYVKCGCLGCGHRV  197

Query  450  FDEIPQPDIVARTTMIAAYSASGDPNLAAEIFDRTPLSMRDTVFYNARITGYSHQNDGHA  629
            FDE+   D+++ T++I AY+  G+   A+E+FD  P  M+D V + A +TGY+       
Sbjct  198  FDEMLDRDVISWTSLIVAYAKVGNMEAASELFDGLP--MKDMVAWTAMVTGYAQNARPRE  255

Query  630  AIQVFNDMKRNNFQPDQ  680
            A++VF  M+    + D+
Sbjct  256  ALEVFERMQAAGVKTDE  272



>ref|XP_011658917.1| PREDICTED: pentatricopeptide repeat-containing protein At3g02330 
isoform X2 [Cucumis sativus]
Length=847

 Score = 77.4 bits (189),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 41/104 (39%), Positives = 58/104 (56%), Gaps = 1/104 (1%)
 Frame = +3

Query  345  HANMITSGFKPRAHILNRLIDIYCKSSNLPYARHLFDEIPQPDIVARTTMIAAYSASGDP  524
            HA+MI SGF P   + N LI +Y K   L YA  +F+E+PQ DIV+  TM+   + +G  
Sbjct  65   HAHMILSGFTPTVFVTNCLIQMYVKCCALEYAYKVFEEMPQRDIVSWNTMVFGCAGAGRM  124

Query  525  NLAAEIFDRTPLSMRDTVFYNARITGYSHQNDGHAAIQVFNDMK  656
             LA  +F+  P    D V +N+ I+GY    D   +I VF  M+
Sbjct  125  ELAQAVFNSMP-HHGDVVSWNSLISGYLQNGDIQKSIAVFLKMR  167



>ref|XP_006483247.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At5g40405-like [Citrus sinensis]
Length=619

 Score = 77.0 bits (188),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 40/127 (31%), Positives = 74/127 (58%), Gaps = 5/127 (4%)
 Frame = +3

Query  300  SNIHTPATSSLATTIHANMITSGFKPRAHILNRLIDIYCKSSNLPYARHLFDEIPQPDIV  479
            + I +P T+ L   +HA+++  GF    H+ + LI +Y +   L Y + +FD I +PD+V
Sbjct  126  AQILSPGTALL---VHASVLRRGFHNDPHVQSGLIFMYAELGCLGYCQKVFDGIHEPDVV  182

Query  480  ARTTMIAAYSASGDPNLAAEIFDRTPLSMRDTVFYNARITGYSHQNDGHAAIQVFNDMKR  659
             +T MI+A +  GD +LA ++FD  P   RD + +NA + GY+       A+ +F+ M+ 
Sbjct  183  CQTAMISACAKCGDVDLARKMFDEMP--ERDPIAWNAMLAGYAQCGKSREALHLFHLMQI  240

Query  660  NNFQPDQ  680
            ++ + ++
Sbjct  241  HDVKLNE  247



>ref|XP_006425612.1| hypothetical protein CICLE_v10025108mg [Citrus clementina]
 gb|ESR38852.1| hypothetical protein CICLE_v10025108mg [Citrus clementina]
Length=653

 Score = 77.0 bits (188),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 41/118 (35%), Positives = 62/118 (53%), Gaps = 3/118 (3%)
 Frame = +3

Query  327  SLATTIHANMIT-SGFKPRAHILNRLIDIYCKSSNLPYARHLFDEIPQPDIVARTTMIAA  503
            SL   IHA  I   GF    ++ N +I +Y K   L  +R +FDE+P+ D+V+ T +I A
Sbjct  162  SLGQQIHAQTILLGGFTSDLYVANTMIGMYVKCGFLGCSRKVFDEMPERDVVSWTELIVA  221

Query  504  YSASGDPNLAAEIFDRTPLSMRDTVFYNARITGYSHQNDGHAAIQVFNDMKRNNFQPD  677
            Y+ +GD   A  +F+  PL  +D V + A +TGY        AI+ F  M+    + D
Sbjct  222  YANNGDMESAGGLFNELPL--KDKVAWTAMVTGYVQNAKPREAIEYFERMQYAGVETD  277



>gb|KGN43953.1| hypothetical protein Csa_7G074860 [Cucumis sativus]
Length=868

 Score = 77.4 bits (189),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 41/104 (39%), Positives = 58/104 (56%), Gaps = 1/104 (1%)
 Frame = +3

Query  345  HANMITSGFKPRAHILNRLIDIYCKSSNLPYARHLFDEIPQPDIVARTTMIAAYSASGDP  524
            HA+MI SGF P   + N LI +Y K   L YA  +F+E+PQ DIV+  TM+   + +G  
Sbjct  47   HAHMILSGFTPTVFVTNCLIQMYVKCCALEYAYKVFEEMPQRDIVSWNTMVFGCAGAGRM  106

Query  525  NLAAEIFDRTPLSMRDTVFYNARITGYSHQNDGHAAIQVFNDMK  656
             LA  +F+  P    D V +N+ I+GY    D   +I VF  M+
Sbjct  107  ELAQAVFNSMP-HHGDVVSWNSLISGYLQNGDIQKSIAVFLKMR  149



>ref|XP_004137118.2| PREDICTED: pentatricopeptide repeat-containing protein At3g02330 
isoform X1 [Cucumis sativus]
Length=886

 Score = 77.4 bits (189),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 41/104 (39%), Positives = 58/104 (56%), Gaps = 1/104 (1%)
 Frame = +3

Query  345  HANMITSGFKPRAHILNRLIDIYCKSSNLPYARHLFDEIPQPDIVARTTMIAAYSASGDP  524
            HA+MI SGF P   + N LI +Y K   L YA  +F+E+PQ DIV+  TM+   + +G  
Sbjct  65   HAHMILSGFTPTVFVTNCLIQMYVKCCALEYAYKVFEEMPQRDIVSWNTMVFGCAGAGRM  124

Query  525  NLAAEIFDRTPLSMRDTVFYNARITGYSHQNDGHAAIQVFNDMK  656
             LA  +F+  P    D V +N+ I+GY    D   +I VF  M+
Sbjct  125  ELAQAVFNSMP-HHGDVVSWNSLISGYLQNGDIQKSIAVFLKMR  167



>ref|XP_010416963.1| PREDICTED: pentatricopeptide repeat-containing protein At2g22070-like 
[Camelina sativa]
Length=786

 Score = 77.0 bits (188),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 40/136 (29%), Positives = 70/136 (51%), Gaps = 6/136 (4%)
 Frame = +3

Query  285  LQLCSSNIHTPATSS----LATTIHANMITSGFKPRAHILNRLIDIYCKSSNLPYARHLF  452
            L+LC++ +      S     A  +H  +I SG     +++N L+++Y K+    +AR +F
Sbjct  13   LELCTNLLQKSVNKSNGRFTAQLVHCRVIKSGLFFSVYLINNLMNVYSKTGYALHARKMF  72

Query  453  DEIPQPDIVARTTMIAAYSASGDPNLAAEIFDRTPLSMRDTVFYNARITGYSHQNDGHAA  632
            DE+P     +  T+++AY+  GD +   E FDR P   +D+V +   I GY +    H A
Sbjct  73   DEMPLRTAFSWNTVLSAYAKRGDMDSTCEFFDRLP--QKDSVSWTTMIVGYKNIGQYHKA  130

Query  633  IQVFNDMKRNNFQPDQ  680
            I+   +M +   +P Q
Sbjct  131  IRTMGEMMKEGIEPTQ  146


 Score = 54.7 bits (130),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 36/124 (29%), Positives = 65/124 (52%), Gaps = 5/124 (4%)
 Frame = +3

Query  318  ATSSLAT--TIHANMITSGFKPRAHILNRLIDIYCKSSNLPYARHLFDEIPQPDIVARTT  491
            AT  L T   +H+ ++  G +    + N L+++Y K  +   A+ +FD +   DI +   
Sbjct  158  ATRCLETGKKVHSFIVKLGLRCNVSVSNSLLNMYAKCGDPMMAKVVFDRMVVRDISSWNA  217

Query  492  MIAAYSASGDPNLAAEIFDRTPLSMRDTVFYNARITGYSHQNDGHAAIQVFNDMKRNN-F  668
            MIA +   G  +LA E F+   ++ RD V +N+ I GY+ +     A+ +F+ M R++  
Sbjct  218  MIALHMQVGQMDLAMEQFEL--MAERDIVTWNSMIAGYNQRGYDLRALDMFSKMLRDSML  275

Query  669  QPDQ  680
             PD+
Sbjct  276  SPDR  279


 Score = 54.3 bits (129),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 36/118 (31%), Positives = 55/118 (47%), Gaps = 4/118 (3%)
 Frame = +3

Query  330  LATTIHANMITSGFKPRAHILNRLIDIYCKSSNLPYARHLFDEIPQPD--IVARTTMIAA  503
            +   I+++++T+GF     +LN LI +Y +   +  AR L +     D  I   T ++  
Sbjct  297  IGKQIYSHIVTTGFDNSGIVLNALISMYSRCGGVETARRLIEHRGTADLKIEGFTALLDG  356

Query  504  YSASGDPNLAAEIFDRTPLSMRDTVFYNARITGYSHQNDGHAAIQVFNDMKRNNFQPD  677
            Y   GD N A  IFD   L  RD V + A I GY        AI +F  M  +  +P+
Sbjct  357  YIKLGDMNQAKMIFDS--LKDRDVVVWTAMIVGYEQHGLYGEAINLFRSMVGSGQRPN  412



>ref|XP_008464984.1| PREDICTED: pentatricopeptide repeat-containing protein At1g31430 
[Cucumis melo]
 ref|XP_008464985.1| PREDICTED: pentatricopeptide repeat-containing protein At1g31430 
[Cucumis melo]
 ref|XP_008464986.1| PREDICTED: pentatricopeptide repeat-containing protein At1g31430 
[Cucumis melo]
 ref|XP_008464987.1| PREDICTED: pentatricopeptide repeat-containing protein At1g31430 
[Cucumis melo]
 ref|XP_008464988.1| PREDICTED: pentatricopeptide repeat-containing protein At1g31430 
[Cucumis melo]
 ref|XP_008464989.1| PREDICTED: pentatricopeptide repeat-containing protein At1g31430 
[Cucumis melo]
 ref|XP_008464990.1| PREDICTED: pentatricopeptide repeat-containing protein At1g31430 
[Cucumis melo]
 ref|XP_008464991.1| PREDICTED: pentatricopeptide repeat-containing protein At1g31430 
[Cucumis melo]
 ref|XP_008464992.1| PREDICTED: pentatricopeptide repeat-containing protein At1g31430 
[Cucumis melo]
 ref|XP_008464993.1| PREDICTED: pentatricopeptide repeat-containing protein At1g31430 
[Cucumis melo]
 ref|XP_008464994.1| PREDICTED: pentatricopeptide repeat-containing protein At1g31430 
[Cucumis melo]
Length=670

 Score = 77.0 bits (188),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 38/105 (36%), Positives = 62/105 (59%), Gaps = 4/105 (4%)
 Frame = +3

Query  366  GFKPRAHILNRLIDIYCKSSNLPYARHLFDEIPQPDIVARTTMIAAYSASGDPNLAAEIF  545
            GF PR  I N L+D+Y K   L  +R++FDE+P  +++  T+MI+ Y   GD   A ++F
Sbjct  268  GFTPR--IDNALLDMYAKCGCLNISRNIFDEMPMKNVICWTSMISGYINCGDLREARDLF  325

Query  546  DRTPLSMRDTVFYNARITGYSHQNDGHAAIQVFNDMKRNNFQPDQ  680
            D++P+  RD V + A I GY   +    A+ +F +M+    +PD+
Sbjct  326  DKSPV--RDVVLWTAMINGYVQFHHFDDAVALFREMQIQKVKPDK  368



>ref|XP_004301518.1| PREDICTED: pentatricopeptide repeat-containing protein At1g28690, 
mitochondrial [Fragaria vesca subsp. vesca]
Length=525

 Score = 76.6 bits (187),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 45/128 (35%), Positives = 68/128 (53%), Gaps = 5/128 (4%)
 Frame = +3

Query  294  CSSNIHTPATSSLATTIHANMITSGFKPRAHILNRLIDIYCKSSNLPYARHLFDEIPQPD  473
            C+ N+  P   SL   +HA +I S  +    +   L+  Y K+  + YAR +FD +   +
Sbjct  150  CNGNVALPP--SLGRMVHAQIIKSDVEGDDVLYTALVASYIKNGRVGYARCVFDMMLDKN  207

Query  474  IVARTTMIAAYSASGDPNLAAEIFDRTPLSMRDTVFYNARITGYSHQ-NDGHAAIQVFND  650
            IV  T+MI+ Y + G    A +IF +T    +D V +NA I GYS        +I+V+ D
Sbjct  208  IVCSTSMISGYMSQGSGEDAEDIFRKT--VEKDVVVFNAMIEGYSKSVGSAKKSIEVYID  265

Query  651  MKRNNFQP  674
            M+R NFQP
Sbjct  266  MQRLNFQP  273



>ref|XP_004288346.1| PREDICTED: pentatricopeptide repeat-containing protein At2g21090 
[Fragaria vesca subsp. vesca]
 ref|XP_011466963.1| PREDICTED: pentatricopeptide repeat-containing protein At2g21090 
[Fragaria vesca subsp. vesca]
 ref|XP_011466972.1| PREDICTED: pentatricopeptide repeat-containing protein At2g21090 
[Fragaria vesca subsp. vesca]
 ref|XP_011466978.1| PREDICTED: pentatricopeptide repeat-containing protein At2g21090 
[Fragaria vesca subsp. vesca]
 ref|XP_011466982.1| PREDICTED: pentatricopeptide repeat-containing protein At2g21090 
[Fragaria vesca subsp. vesca]
Length=614

 Score = 77.0 bits (188),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 36/112 (32%), Positives = 60/112 (54%), Gaps = 2/112 (2%)
 Frame = +3

Query  345  HANMITSGFKPRAHILNRLIDIYCKSSNLPYARHLFDEIPQPDIVARTTMIAAYSASGDP  524
            H  ++ +GF     + + L+D Y K   +   R LFDE+   D++A TT+++ Y+  GD 
Sbjct  217  HGQVLVAGFLSNVVLSSSLVDAYAKCGEMGDGRRLFDEMGVRDVLAWTTLVSGYAKWGDM  276

Query  525  NLAAEIFDRTPLSMRDTVFYNARITGYSHQNDGHAAIQVFNDMKRNNFQPDQ  680
              A E+FD  P   ++ V + + I+GY+    GH A+ +F  M     +PDQ
Sbjct  277  RSAGELFDMMP--EKNPVSWTSMISGYARNGLGHEALALFAKMMMFQVRPDQ  326



>gb|KJB38678.1| hypothetical protein B456_006G266600 [Gossypium raimondii]
Length=630

 Score = 77.0 bits (188),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 41/116 (35%), Positives = 63/116 (54%), Gaps = 2/116 (2%)
 Frame = +3

Query  333  ATTIHANMITSGFKPRAHILNRLIDIYCKSSNLPYARHLFDEIPQPDIVARTTMIAAYSA  512
               IHA++   GF      LN LI +Y     L  AR +F+++P+ D+V+ TT+I+ Y+ 
Sbjct  143  GAQIHAHVFKFGFANDGFCLNNLIHMYVDFKALENARKVFNKMPRRDVVSWTTLISGYAQ  202

Query  513  SGDPNLAAEIFDRTPLSMRDTVFYNARITGYSHQNDGHAAIQVFNDMKRNNFQPDQ  680
             G  + A E+F+R P   R++V +NA I  Y   N  H A  +FN M+  N   D+
Sbjct  203  LGLVDAAFEVFERMP--ERNSVSWNAMIAAYVQSNRFHEAFALFNRMRAENLALDK  256



>ref|XP_002452047.1| hypothetical protein SORBIDRAFT_04g017510 [Sorghum bicolor]
 gb|EES05023.1| hypothetical protein SORBIDRAFT_04g017510 [Sorghum bicolor]
Length=530

 Score = 76.6 bits (187),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 36/116 (31%), Positives = 63/116 (54%), Gaps = 4/116 (3%)
 Frame = +3

Query  330  LATTIHANMITSGFKPRAHILNRLIDIYCKSSNLPYARHLFDEIPQPDIVARTTMIAAYS  509
            +A  +HA +I +GF  +  +   L+++Y K  NL  AR +FD +   +++  T+M+  Y 
Sbjct  272  VAKGVHALVIKAGFDCQEDLAASLVNLYSKCGNLLAAREVFDSLHWKNVIMWTSMLNGYV  331

Query  510  ASGDPNLAAEIFDRTPLSMRDTVFYNARITGYSHQNDGHAAIQVFNDMKRNNFQPD  677
              G P+ A   FD    +M D   ++A I GY+   +G  A+ +FN+M+    +PD
Sbjct  332  ECGCPDEALATFD----AMLDLAIWSAMINGYACNGEGSEAVVLFNEMQSKGVRPD  383


 Score = 50.4 bits (119),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 23/68 (34%), Positives = 36/68 (53%), Gaps = 0/68 (0%)
 Frame = +3

Query  471  DIVARTTMIAAYSASGDPNLAAEIFDRTPLSMRDTVFYNARITGYSHQNDGHAAIQVFND  650
            D   RT+++  Y+  G    A  +FD TP S R  V +N  I+ Y   +    A++VFN 
Sbjct  83   DAFVRTSLVDMYAKCGSLPDAQRLFDETPCSSRTLVAWNCMISAYGRSSQVEEAVEVFNA  142

Query  651  MKRNNFQP  674
            M+R + +P
Sbjct  143  MRRADVRP  150



>ref|XP_011624828.1| PREDICTED: pentatricopeptide repeat-containing protein At1g28690, 
mitochondrial [Amborella trichopoda]
Length=504

 Score = 76.6 bits (187),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 41/117 (35%), Positives = 65/117 (56%), Gaps = 3/117 (3%)
 Frame = +3

Query  327  SLATTIHANMITSGFKPRAHILNRLIDIYCKSSNLPYARHLFDEIPQPDIVARTTMIAAY  506
             L   +H  +  +GF+    +   LID+Y KS ++  AR +F E+P+ ++V+ T MI  Y
Sbjct  141  GLGKQVHTQITKNGFQSDEVLYTALIDMYSKSDSISCARKVFSEMPERNVVSCTAMIHGY  200

Query  507  SASGDPNLAAEIFDRTPLSMRDTVFYNARITGY-SHQNDGHAAIQVFNDMKRNNFQP  674
                 PN A EIFD   +  +D V +NA I GY SH N    ++  + +M+R+ F+P
Sbjct  201  MRCACPNEAHEIFD--GIHEKDVVAWNALIEGYSSHPNYALKSLTAYVEMQRSGFRP  255


 Score = 62.4 bits (150),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 38/120 (32%), Positives = 61/120 (51%), Gaps = 6/120 (5%)
 Frame = +3

Query  333  ATTIHANMITSGFKPRAHILNRLIDIYCKSSNLPYARHLFDEIPQPDIVARTTMIAAYSA  512
              T+HA ++ +GFKP  ++  +L+ +Y KS+NL YAR +FD+I +P I +   MI+ YS 
Sbjct  42   GQTLHAFIVKAGFKPDIYLSTKLLILYVKSNNLKYARQMFDKIHEPTIESWNAMISCYSR  101

Query  513  SGDPNLAAEIFDRTPLS--MRDTVFYNA--RITGYSHQNDGHAAIQVFNDMKRNNFQPDQ  680
            +G          +   S    D   Y +  R++   H  D     QV   + +N FQ D+
Sbjct  102  NGPAEKTLNFISQMANSGLKFDGFTYASILRVSALIH--DLGLGKQVHTQITKNGFQSDE  159



>ref|XP_008455202.1| PREDICTED: pentatricopeptide repeat-containing protein At2g21090 
[Cucumis melo]
Length=611

 Score = 76.6 bits (187),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 38/117 (32%), Positives = 62/117 (53%), Gaps = 2/117 (2%)
 Frame = +3

Query  330  LATTIHANMITSGFKPRAHILNRLIDIYCKSSNLPYARHLFDEIPQPDIVARTTMIAAYS  509
            L   +H  ++ +GF     +   ++D Y K   +  AR LFDE+   DI   TTM++ Y+
Sbjct  213  LTKQVHGQVLVAGFLSNLVLSCSIVDAYAKCGKMGCARRLFDEMLVKDIHIWTTMVSGYA  272

Query  510  ASGDPNLAAEIFDRTPLSMRDTVFYNARITGYSHQNDGHAAIQVFNDMKRNNFQPDQ  680
              GD N A+E+F + P   ++ V + A I+GY+  + GH A+  F  M +    P+Q
Sbjct  273  KWGDMNSASELFHQMP--EKNPVSWTALISGYARNSLGHEALDYFTKMMKLGINPEQ  327


 Score = 52.8 bits (125),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 32/126 (25%), Positives = 64/126 (51%), Gaps = 7/126 (6%)
 Frame = +3

Query  285  LQLCSSNIHTPATSSLATTIHANMITSGFK-PRAHILNRLIDIYCKSSNLPYARHLFDEI  461
            L+LC+   +          +H ++  +GFK P   + N LI +Y +      AR +FD++
Sbjct  69   LRLCAKAKYFKG----GKCVHLHLKHTGFKRPTTIVANHLIGMYFECGRDVEARKVFDKM  124

Query  462  PQPDIVARTTMIAAYSASGDPNLAAEIFDRTPLSMRDTVFYNARITGYSHQNDGHAAIQV  641
               ++ +   M+A Y+  G+ + A ++FDR  +  +D V +N  +  Y+ +   + AI +
Sbjct  125  SVRNLYSWNHMLAGYAKLGEVHHARKLFDR--MMEKDVVSWNTMVLAYAKKGCFNEAIGL  182

Query  642  FNDMKR  659
            + D +R
Sbjct  183  YRDFRR  188



>ref|XP_008789842.1| PREDICTED: pentatricopeptide repeat-containing protein At3g51320-like 
[Phoenix dactylifera]
Length=287

 Score = 74.7 bits (182),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 36/111 (32%), Positives = 57/111 (51%), Gaps = 2/111 (2%)
 Frame = +3

Query  345  HANMITSGFKPRAHILNRLIDIYCKSSNLPYARHLFDEIPQPDIVARTTMIAAYSASGDP  524
            HA  I  G     H+ N LI +Y     L YAR LFDE+P  D+++  +M+  Y+ +GD 
Sbjct  162  HAQAIKRGVDAVLHVRNSLIHVYSVCGLLEYARVLFDEMPHRDVISWNSMVDGYAEAGDL  221

Query  525  NLAAEIFDRTPLSMRDTVFYNARITGYSHQNDGHAAIQVFNDMKRNNFQPD  677
            + A E+FD  P   R+ V +N  I+GY         +++F +M     + +
Sbjct  222  DAARELFDMMP--ERNVVSWNVMISGYLKGKSPECGLEIFREMGETGAEGE  270



>ref|XP_009377683.1| PREDICTED: pentatricopeptide repeat-containing protein At2g21090-like 
[Pyrus x bretschneideri]
Length=612

 Score = 76.6 bits (187),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 35/118 (30%), Positives = 64/118 (54%), Gaps = 2/118 (2%)
 Frame = +3

Query  327  SLATTIHANMITSGFKPRAHILNRLIDIYCKSSNLPYARHLFDEIPQPDIVARTTMIAAY  506
             L   +H  ++ +GF     + + ++D Y K   +  AR +FD +P  D++  TT+++ Y
Sbjct  209  GLTRQVHGQVLVAGFLSNVVLSSSVVDAYAKCGEMGDARKVFDSMPVKDVLVWTTLVSGY  268

Query  507  SASGDPNLAAEIFDRTPLSMRDTVFYNARITGYSHQNDGHAAIQVFNDMKRNNFQPDQ  680
            +  GD   A+E F+R P   ++ + + A I+GY+    GH A+ +F +M     +PDQ
Sbjct  269  AKFGDMESASEFFNRMP--EKNPISWTAVISGYARNGLGHEALALFTEMMMYQVRPDQ  324



>gb|KDO71020.1| hypothetical protein CISIN_1g038673mg [Citrus sinensis]
Length=548

 Score = 76.6 bits (187),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 41/118 (35%), Positives = 62/118 (53%), Gaps = 3/118 (3%)
 Frame = +3

Query  327  SLATTIHANMIT-SGFKPRAHILNRLIDIYCKSSNLPYARHLFDEIPQPDIVARTTMIAA  503
            SL   IHA  I   GF    ++ N +I +Y K   L  +R +FDE+P+ D+V+ T +I A
Sbjct  69   SLGQQIHAQTILLGGFTSDLYVGNTMIGMYVKCGFLGCSRKVFDEMPERDVVSWTELIVA  128

Query  504  YSASGDPNLAAEIFDRTPLSMRDTVFYNARITGYSHQNDGHAAIQVFNDMKRNNFQPD  677
            Y+ +GD   A  +F+  PL  +D V + A +TGY        AI+ F  M+    + D
Sbjct  129  YANNGDMESAGGLFNELPL--KDKVAWTAMVTGYVQNAKPREAIEYFERMQYAGVETD  184



>ref|XP_010258291.1| PREDICTED: pentatricopeptide repeat-containing protein At5g15300 
[Nelumbo nucifera]
Length=543

 Score = 76.3 bits (186),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 39/114 (34%), Positives = 61/114 (54%), Gaps = 3/114 (3%)
 Frame = +3

Query  342  IHANMITSGFKPRAHI-LNRLIDIYCKSSNLPYARHLFDEIPQPDIVARTTMIAAYSASG  518
            + A M+  G   R  +  + L   Y +  NL  AR +FDE+P  D+V+   MI  Y+  G
Sbjct  164  VVATMLFDGLAKRDVVAWSALTAGYARRGNLEMARQIFDEMPVKDLVSWNVMITGYAKRG  223

Query  519  DPNLAAEIFDRTPLSMRDTVFYNARITGYSHQNDGHAAIQVFNDMKRNNFQPDQ  680
            + + A ++FD+ P   RD V +NA I GY        A+++F +M+R   QPD+
Sbjct  224  EMDCARKLFDQVP--ERDVVTWNAMIAGYVLSGSNDQALEMFEEMRRAGEQPDE  275



>ref|XP_009373813.1| PREDICTED: pentatricopeptide repeat-containing protein At3g02330 
[Pyrus x bretschneideri]
Length=892

 Score = 77.0 bits (188),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 40/103 (39%), Positives = 56/103 (54%), Gaps = 2/103 (2%)
 Frame = +3

Query  345  HANMITSGFKPRAHILNRLIDIYCKSSNLPYARHLFDEIPQPDIVARTTMIAAYSASGDP  524
            HA MI SGF P   + N LI +Y K   L YA  +FD +PQ D+V+  TM+  Y+ SG  
Sbjct  72   HARMIVSGFDPTVFVTNCLIQMYVKCGVLQYAGKVFDGMPQRDMVSWNTMVFGYAGSGKM  131

Query  525  NLAAEIFDRTPLSMRDTVFYNARITGYSHQNDGHAAIQVFNDM  653
              A   FD  P   RD V +N+ I+GY    +   + +V+ +M
Sbjct  132  GFAQSCFDAMP--ERDVVSWNSLISGYLQNGEYWKSTEVYVEM  172



>ref|XP_008375044.1| PREDICTED: pentatricopeptide repeat-containing protein At2g21090 
[Malus domestica]
Length=626

 Score = 76.6 bits (187),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 35/118 (30%), Positives = 64/118 (54%), Gaps = 2/118 (2%)
 Frame = +3

Query  327  SLATTIHANMITSGFKPRAHILNRLIDIYCKSSNLPYARHLFDEIPQPDIVARTTMIAAY  506
             L   +H  ++ +GF     + + ++D Y K   +  AR +FD +P  D++  TT+++ Y
Sbjct  209  GLTRQVHGQVLVAGFLSNVVLSSSVVDAYAKCGEMGDARKVFDSMPVKDVLVWTTLVSGY  268

Query  507  SASGDPNLAAEIFDRTPLSMRDTVFYNARITGYSHQNDGHAAIQVFNDMKRNNFQPDQ  680
            +  GD   A+E F+R P   ++ + + A I+GY+    GH A+ +F +M     +PDQ
Sbjct  269  AKFGDMESASEFFNRMP--EKNPISWTAVISGYARNGLGHEALALFTEMMMYQVRPDQ  324



>ref|XP_004979558.1| PREDICTED: pentatricopeptide repeat-containing protein At4g14820-like 
[Setaria italica]
Length=447

 Score = 76.3 bits (186),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 35/117 (30%), Positives = 67/117 (57%), Gaps = 2/117 (2%)
 Frame = +3

Query  330  LATTIHANMITSGFKPRAHILNRLIDIYCKSSNLPYARHLFDEIPQPDIVARTTMIAAYS  509
            +   IH+ M+ S     AH+ + LI++Y   + +  A  L++ +P+ D+V+ T M+  Y+
Sbjct  59   IGKAIHSYMLVSDILINAHLSSALINLYASCAKMDIAEKLYNGMPRKDLVSSTAMVFGYA  118

Query  510  ASGDPNLAAEIFDRTPLSMRDTVFYNARITGYSHQNDGHAAIQVFNDMKRNNFQPDQ  680
             +    +A  IFD  P   +D V ++A I+GY+  N  + A+ +F+DM+ +  +PD+
Sbjct  119  KNRKVEIARSIFDGMP--EKDVVSWSAMISGYAESNQPNEALNLFSDMQEHGIRPDE  173



>ref|XP_006438573.1| hypothetical protein CICLE_v10030908mg [Citrus clementina]
 gb|ESR51813.1| hypothetical protein CICLE_v10030908mg [Citrus clementina]
Length=661

 Score = 76.6 bits (187),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 40/127 (31%), Positives = 73/127 (57%), Gaps = 5/127 (4%)
 Frame = +3

Query  300  SNIHTPATSSLATTIHANMITSGFKPRAHILNRLIDIYCKSSNLPYARHLFDEIPQPDIV  479
            + I +P T+ L   +HA+++  GF    H+ + LI +Y +   L Y   +FD I +PD+V
Sbjct  168  AQILSPGTALL---VHASVLRRGFHNDPHVQSGLIFMYAELGCLGYCHKVFDGIHEPDVV  224

Query  480  ARTTMIAAYSASGDPNLAAEIFDRTPLSMRDTVFYNARITGYSHQNDGHAAIQVFNDMKR  659
             +T MI+A +  GD +LA ++FD  P   RD + +NA + GY+       A+ +F+ M+ 
Sbjct  225  CQTAMISACAKCGDVDLARKMFDEMP--ERDPIAWNAMLAGYAQCGKSREALHLFHLMQI  282

Query  660  NNFQPDQ  680
            ++ + ++
Sbjct  283  HDVKLNE  289



>ref|XP_006466854.1| PREDICTED: pentatricopeptide repeat-containing protein At5g44230-like 
isoform X1 [Citrus sinensis]
 ref|XP_006466855.1| PREDICTED: pentatricopeptide repeat-containing protein At5g44230-like 
isoform X2 [Citrus sinensis]
 ref|XP_006466856.1| PREDICTED: pentatricopeptide repeat-containing protein At5g44230-like 
isoform X3 [Citrus sinensis]
 ref|XP_006466857.1| PREDICTED: pentatricopeptide repeat-containing protein At5g44230-like 
isoform X4 [Citrus sinensis]
Length=653

 Score = 76.6 bits (187),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 40/118 (34%), Positives = 63/118 (53%), Gaps = 3/118 (3%)
 Frame = +3

Query  327  SLATTIHAN-MITSGFKPRAHILNRLIDIYCKSSNLPYARHLFDEIPQPDIVARTTMIAA  503
            SL   IHA  ++  GF    ++ N +I +Y K   L  +R +FDE+P+ D+V+ T +I A
Sbjct  162  SLGQQIHAQTILLGGFTSDLYVGNTMIGMYVKCGFLGCSRKVFDEMPERDVVSWTELIVA  221

Query  504  YSASGDPNLAAEIFDRTPLSMRDTVFYNARITGYSHQNDGHAAIQVFNDMKRNNFQPD  677
            Y+ +GD   A  +F+  PL  +D V + A +TGY        AI+ F  M+    + D
Sbjct  222  YANNGDMESAGGLFNELPL--KDKVAWTAMVTGYVQNAKPREAIEYFERMQYAGVETD  277



>ref|XP_003621610.1| Pentatricopeptide repeat-containing protein [Medicago truncatula]
 gb|AES77828.1| PPR containing plant-like protein [Medicago truncatula]
 gb|KEH21778.1| PPR containing plant-like protein [Medicago truncatula]
Length=881

 Score = 76.6 bits (187),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 38/111 (34%), Positives = 60/111 (54%), Gaps = 2/111 (2%)
 Frame = +3

Query  345  HANMITSGFKPRAHILNRLIDIYCKSSNLPYARHLFDEIPQPDIVARTTMIAAYSASGDP  524
            HA +  +GF P   + N L+  YCK  NL YA ++FD++PQ D+++  TMI  Y+  G+ 
Sbjct  61   HAQITVTGFVPTVFVSNCLLQFYCKCLNLNYAFNVFDKMPQRDVISWNTMIFGYAGVGNM  120

Query  525  NLAAEIFDRTPLSMRDTVFYNARITGYSHQNDGHAAIQVFNDMKRNNFQPD  677
              A  +FD  P   RD V +N+ ++ Y        +I++F  M+    Q D
Sbjct  121  EFAQFLFDSMP--ERDVVSWNSMLSCYLQNGFHRKSIEIFTKMRLLEIQHD  169



>ref|XP_007212512.1| hypothetical protein PRUPE_ppa017842mg [Prunus persica]
 gb|EMJ13711.1| hypothetical protein PRUPE_ppa017842mg [Prunus persica]
Length=527

 Score = 76.3 bits (186),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 43/129 (33%), Positives = 70/129 (54%), Gaps = 6/129 (5%)
 Frame = +3

Query  294  CSSNIHTPATSSLATTIHANMITSGFKPRAHILNRLIDIYCKSSNLPYARHLFDEIPQPD  473
            C+ N   P +  +   +HA +I S  +P   +   L+D Y K+  + YAR +FD + + +
Sbjct  153  CAGNAAFPWSLGV---VHAQIIKSDVEPDDVLYTVLVDSYIKNGKVGYARTVFDTMLEKN  209

Query  474  IVARTTMIAAYSASGDPNLAAEIFDRTPLSMRDTVFYNARITGYSHQND-GHAAIQVFND  650
            +V  T+MI+ Y   G    A +IF RT    +D V +NA I GYS   +    + +V+ D
Sbjct  210  VVCSTSMISGYMNQGSVEDAEDIFRRT--VEKDVVVFNAMIEGYSKSTEYAWRSFEVYVD  267

Query  651  MKRNNFQPD  677
            M+R NF+P+
Sbjct  268  MQRLNFRPN  276


 Score = 50.4 bits (119),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 34/123 (28%), Positives = 59/123 (48%), Gaps = 15/123 (12%)
 Frame = +3

Query  246  YICRQLATRYAAHLQ--LCSSNIHTPATSSLATTIHANMITSGFKPRAHILNRLIDIYCK  419
            Y+   +AT  A+ LQ  + S N       S    IH +++ +GF+P  ++  +L+ ++ K
Sbjct  34   YVASPIATTLASSLQHYINSEN------PSHGQKIHTHILKTGFRPNINVSIKLLILHLK  87

Query  420  SSNLPYARHLFDEIPQPDIVARTTMIAAYSASGDPNLAAEIFDRTPLSMRDTVFYNARIT  599
              +L YAR +FDE+P   + A   +I AY   G    +  +       +R  VF   +  
Sbjct  88   CGSLKYARQVFDELPAQTLSAYNYLIGAYLKRGKVEESLNL-------VRRLVFSGEKPD  140

Query  600  GYS  608
            GY+
Sbjct  141  GYT  143



>gb|ACP39950.1| pentatricopeptide repeat protein [Gossypium hirsutum]
 gb|ACP39951.1| pentatricopeptide repeat protein [Gossypium hirsutum]
Length=532

 Score = 76.3 bits (186),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 43/132 (33%), Positives = 68/132 (52%), Gaps = 8/132 (6%)
 Frame = +3

Query  285  LQLCSSNIHTPATSSLATTIHANMITSGFKPRAHILNRLIDIYCKSSNLPYARHLFDEIP  464
            L+ C+ N      S +    HA +I  G++    +LN LI +Y   S++  AR LFD   
Sbjct  117  LRACTDN------SPVGLASHAQVIKLGWESYDFVLNGLIHLYANWSSVEAARKLFDVST  170

Query  465  QPDIVARTTMIAAYSASGDPNLAAEIFDRTPLSMRDTVFYNARITGYSHQNDGHAAIQVF  644
              D++  T +I  Y  SG    A E+FD+ P   R+ V ++A ITGY H      A+++F
Sbjct  171  CRDVITWTALINGYVKSGHVEFARELFDQMP--ERNEVSWSAMITGYVHMGMFREALELF  228

Query  645  NDMKRNNFQPDQ  680
            ND++    +P+ 
Sbjct  229  NDLQLTGLRPNH  240



>gb|ERN18511.1| hypothetical protein AMTR_s00065p00033910 [Amborella trichopoda]
Length=484

 Score = 75.9 bits (185),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 35/113 (31%), Positives = 65/113 (58%), Gaps = 2/113 (2%)
 Frame = +3

Query  342  IHANMITSGFKPRAHILNRLIDIYCKSSNLPYARHLFDEIPQPDIVARTTMIAAYSASGD  521
            +HA+   +GF+P  ++ N L+  Y K  +   +  +FDEI +PD+ + TT++++Y+  G 
Sbjct  66   LHAHATVAGFRPNLNLCNSLLAFYAKCCDPNSSHQVFDEITKPDVYSWTTLLSSYTKCGM  125

Query  522  PNLAAEIFDRTPLSMRDTVFYNARITGYSHQNDGHAAIQVFNDMKRNNFQPDQ  680
             + A +IFDR P +  + V +NA I G +       ++Q F +M+ +   PD+
Sbjct  126  VHEACKIFDRMPET--NVVSWNAIINGCAEHGHADTSLQFFREMRSSGISPDR  176



>gb|ERN05798.1| hypothetical protein AMTR_s00006p00257020 [Amborella trichopoda]
Length=965

 Score = 76.6 bits (187),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 42/117 (36%), Positives = 60/117 (51%), Gaps = 0/117 (0%)
 Frame = +3

Query  330  LATTIHANMITSGFKPRAHILNRLIDIYCKSSNLPYARHLFDEIPQPDIVARTTMIAAYS  509
            L   IH  +I  GF+    + + LID+Y K SNL  AR +FDE+ + + V+  TMI  Y 
Sbjct  573  LGRQIHGQIIRIGFESNPFVTSPLIDMYVKCSNLEGARRVFDELSERNSVSYNTMITGYC  632

Query  510  ASGDPNLAAEIFDRTPLSMRDTVFYNARITGYSHQNDGHAAIQVFNDMKRNNFQPDQ  680
              G    A  IF++ P   RD+V +   ITGY        A+++F  MK  +   DQ
Sbjct  633  KCGMVEEAKRIFNKMPERERDSVSWTTMITGYMQNGHSREALELFRGMKFADSASDQ  689


 Score = 73.6 bits (179),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 39/122 (32%), Positives = 66/122 (54%), Gaps = 2/122 (2%)
 Frame = +3

Query  315  PATSSLATTIHANMITSGFKPRAHILNRLIDIYCKSSNLPYARHLFDEIPQPDIVARTTM  494
            P+       +H  ++ +       + N LI++Y KS NL YAR +FD +P  ++++  +M
Sbjct  436  PSKPHHGKKLHCLILKTVENTDTFVTNNLINLYAKSWNLSYARRVFDRMPHKNLISWNSM  495

Query  495  IAAYSASGDPNLAAEIFDRTPLSMRDTVFYNARITGYSHQNDGHAAIQVFNDMKRNNFQP  674
            I  YS  G       +F   PL  RD V +NA ++GY++  DG  AI+V+ +M  N+  P
Sbjct  496  ITGYSKWGFLREMENLFKLMPL--RDGVSWNAVLSGYANWGDGKTAIKVYQEMLHNSQTP  553

Query  675  DQ  680
            ++
Sbjct  554  NR  555



>ref|XP_010250474.1| PREDICTED: pentatricopeptide repeat-containing protein At5g61800 
[Nelumbo nucifera]
Length=522

 Score = 76.3 bits (186),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 38/117 (32%), Positives = 65/117 (56%), Gaps = 2/117 (2%)
 Frame = +3

Query  327  SLATTIHANMITSGFKPRAHILNRLIDIYCKSSNLPYARHLFDEIPQPDIVARTTMIAAY  506
            +LA T+H+ ++  GF     +LN LI +Y    ++  A  LFD  PQ D+V+  ++I  +
Sbjct  127  ALAKTLHSQVVKFGFGSDLFVLNSLIHVYSDLGSMTDACQLFDVTPQRDVVSYNSIIHGF  186

Query  507  SASGDPNLAAEIFDRTPLSMRDTVFYNARITGYSHQNDGHAAIQVFNDMKRNNFQPD  677
              +G+ + A +IFD   + +RD V +   + GY+  N    AIQ+FN M  +  +P+
Sbjct  187  VKAGNTSRARDIFDE--MLVRDDVTWGTLLAGYAQMNQCKEAIQLFNQMLASGLKPN  241



>ref|XP_009404762.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like 
[Musa acuminata subsp. malaccensis]
Length=648

 Score = 76.3 bits (186),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 41/132 (31%), Positives = 65/132 (49%), Gaps = 5/132 (4%)
 Frame = +3

Query  285  LQLCSSNIHTPATSSLATTIHANMITSGFKPRAHILNRLIDIYCKSSNLPYARHLFDEIP  464
            L+ CS    TP+   L   +HA +   GF+    +LN L+ +Y    ++  AR LFD IP
Sbjct  148  LKACS---RTPSALPLGRAVHALVEKLGFRSDVFLLNTLVHMYASRGDISAARLLFDVIP  204

Query  465  QPDIVARTTMIAAYSASGDPNLAAEIFDRTPLSMRDTVFYNARITGYSHQNDGHAAIQVF  644
              D+V    MI  Y+ +G+  +A  +FD  P   R    + A I GY        A+++F
Sbjct  205  AKDVVTWNIMITHYTKTGEMEIARHLFDLMP--ERSVRSWTAMIAGYGQWKKPREAVRLF  262

Query  645  NDMKRNNFQPDQ  680
             +M+    QP++
Sbjct  263  REMESAGVQPNE  274



>ref|XP_010098972.1| hypothetical protein L484_025631 [Morus notabilis]
 gb|EXB76274.1| hypothetical protein L484_025631 [Morus notabilis]
Length=564

 Score = 76.3 bits (186),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 38/105 (36%), Positives = 59/105 (56%), Gaps = 4/105 (4%)
 Frame = +3

Query  366  GFKPRAHILNRLIDIYCKSSNLPYARHLFDEIPQPDIVARTTMIAAYSASGDPNLAAEIF  545
            GF  R  I N L+D+Y K   L  AR +FDE+P  +++  T+M++ Y   G  + A E+F
Sbjct  195  GFTDR--INNVLLDMYAKCGWLSVAREIFDEMPTKNVICWTSMVSGYVKFGKLDEAIELF  252

Query  546  DRTPLSMRDTVFYNARITGYSHQNDGHAAIQVFNDMKRNNFQPDQ  680
            DR+P+  RD V + A I GY   N    A+ +F +M+    + D+
Sbjct  253  DRSPV--RDVVLWTAMINGYVQYNRFDDAMDLFQEMQSKRVKADK  295



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1161397529311