BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig13126

Length=877
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009587296.1|  PREDICTED: probable cyclic nucleotide-gated ...    148   2e-36   Nicotiana tomentosiformis
emb|CDO98618.1|  unnamed protein product                                148   2e-36   Coffea canephora [robusta coffee]
ref|XP_006364384.1|  PREDICTED: probable cyclic nucleotide-gated ...    147   4e-36   Solanum tuberosum [potatoes]
ref|XP_010247505.1|  PREDICTED: probable cyclic nucleotide-gated ...    147   6e-36   
ref|XP_011086974.1|  PREDICTED: probable cyclic nucleotide-gated ...    146   1e-35   Sesamum indicum [beniseed]
gb|KJB39198.1|  hypothetical protein B456_007G002000                    145   1e-35   Gossypium raimondii
ref|XP_004235383.1|  PREDICTED: probable cyclic nucleotide-gated ...    145   2e-35   
gb|KJB39199.1|  hypothetical protein B456_007G002000                    145   2e-35   Gossypium raimondii
ref|XP_009761448.1|  PREDICTED: probable cyclic nucleotide-gated ...    143   4e-35   Nicotiana sylvestris
ref|XP_009761447.1|  PREDICTED: probable cyclic nucleotide-gated ...    143   6e-35   Nicotiana sylvestris
ref|XP_009761446.1|  PREDICTED: probable cyclic nucleotide-gated ...    143   9e-35   Nicotiana sylvestris
ref|XP_007010889.1|  Cyclic nucleotide-binding transporter 1 isof...    140   2e-34   
ref|XP_007010884.1|  Cyclic nucleotide-binding transporter 1 isof...    141   5e-34   
ref|XP_007010887.1|  Cyclic nucleotide-binding transporter 1 isof...    140   6e-34   
ref|XP_007010881.1|  Cyclic nucleotide-binding transporter 1 isof...    140   1e-33   
ref|XP_007010880.1|  Cyclic nucleotide-binding transporter 1 isof...    140   1e-33   
gb|AJC00855.1|  cyclic nucleotide gated channel CNGC15                  139   4e-33   Solanum lycopersicum
ref|XP_009761450.1|  PREDICTED: probable cyclic nucleotide-gated ...    138   6e-33   Nicotiana sylvestris
ref|XP_009761449.1|  PREDICTED: probable cyclic nucleotide-gated ...    138   7e-33   Nicotiana sylvestris
ref|XP_009617226.1|  PREDICTED: probable cyclic nucleotide-gated ...    134   2e-32   Nicotiana tomentosiformis
gb|KDO46408.1|  hypothetical protein CISIN_1g0040641mg                  131   5e-32   Citrus sinensis [apfelsine]
ref|XP_006478110.1|  PREDICTED: probable cyclic nucleotide-gated ...    131   2e-30   Citrus sinensis [apfelsine]
ref|XP_006478111.1|  PREDICTED: probable cyclic nucleotide-gated ...    131   2e-30   Citrus sinensis [apfelsine]
ref|XP_006441354.1|  hypothetical protein CICLE_v10018948mg             131   2e-30   
ref|XP_006478108.1|  PREDICTED: probable cyclic nucleotide-gated ...    130   3e-30   Citrus sinensis [apfelsine]
ref|XP_010276306.1|  PREDICTED: probable cyclic nucleotide-gated ...    125   4e-30   
ref|XP_010069491.1|  PREDICTED: probable cyclic nucleotide-gated ...    129   1e-29   Eucalyptus grandis [rose gum]
ref|XP_002524633.1|  Cyclic nucleotide-gated ion channel, putative      128   2e-29   Ricinus communis
ref|XP_008240379.1|  PREDICTED: probable cyclic nucleotide-gated ...    127   6e-29   Prunus mume [ume]
emb|CDO98619.1|  unnamed protein product                                126   8e-29   Coffea canephora [robusta coffee]
ref|XP_011072038.1|  PREDICTED: probable cyclic nucleotide-gated ...    126   9e-29   Sesamum indicum [beniseed]
ref|XP_011072036.1|  PREDICTED: probable cyclic nucleotide-gated ...    126   1e-28   
ref|XP_003529780.1|  PREDICTED: probable cyclic nucleotide-gated ...    117   1e-27   Glycine max [soybeans]
ref|XP_010069489.1|  PREDICTED: probable cyclic nucleotide-gated ...    120   7e-27   Eucalyptus grandis [rose gum]
ref|XP_006583097.1|  PREDICTED: probable cyclic nucleotide-gated ...    116   1e-26   Glycine max [soybeans]
ref|XP_006587442.1|  PREDICTED: probable cyclic nucleotide-gated ...    119   3e-26   
ref|XP_006587443.1|  PREDICTED: probable cyclic nucleotide-gated ...    119   3e-26   
ref|XP_007210351.1|  hypothetical protein PRUPE_ppa001680mg             119   3e-26   Prunus persica
ref|XP_006587441.1|  PREDICTED: probable cyclic nucleotide-gated ...    119   3e-26   
ref|XP_012079190.1|  PREDICTED: probable cyclic nucleotide-gated ...    118   4e-26   Jatropha curcas
ref|XP_003534111.1|  PREDICTED: probable cyclic nucleotide-gated ...    118   5e-26   
gb|KHN43679.1|  Putative cyclic nucleotide-gated ion channel 20, ...    118   5e-26   Glycine soja [wild soybean]
ref|XP_006599725.1|  PREDICTED: probable cyclic nucleotide-gated ...    118   6e-26   
ref|XP_004299484.1|  PREDICTED: probable cyclic nucleotide-gated ...    118   6e-26   Fragaria vesca subsp. vesca
ref|XP_006599724.1|  PREDICTED: probable cyclic nucleotide-gated ...    117   9e-26   
ref|XP_003548315.1|  PREDICTED: probable cyclic nucleotide-gated ...    117   9e-26   
ref|XP_011035549.1|  PREDICTED: probable cyclic nucleotide-gated ...    117   1e-25   Populus euphratica
ref|XP_011035548.1|  PREDICTED: probable cyclic nucleotide-gated ...    117   1e-25   Populus euphratica
gb|KHN24538.1|  Putative cyclic nucleotide-gated ion channel 20, ...    116   3e-25   Glycine soja [wild soybean]
emb|CAN68349.1|  hypothetical protein VITISV_032026                     111   5e-25   Vitis vinifera
ref|XP_007152601.1|  hypothetical protein PHAVU_004G143800g             115   5e-25   Phaseolus vulgaris [French bean]
ref|XP_011035551.1|  PREDICTED: probable cyclic nucleotide-gated ...    115   5e-25   Populus euphratica
ref|XP_006374214.1|  cyclic nucleotide-gated ion channel 20 famil...    115   9e-25   
ref|XP_006587446.1|  PREDICTED: probable cyclic nucleotide-gated ...    114   1e-24   
ref|XP_006587445.1|  PREDICTED: probable cyclic nucleotide-gated ...    114   1e-24   
ref|XP_003534113.1|  PREDICTED: probable cyclic nucleotide-gated ...    114   1e-24   Glycine max [soybeans]
ref|XP_007152603.1|  hypothetical protein PHAVU_004G144000g             114   1e-24   Phaseolus vulgaris [French bean]
gb|KHN43677.1|  Putative cyclic nucleotide-gated ion channel 20, ...    114   1e-24   Glycine soja [wild soybean]
ref|XP_006374215.1|  hypothetical protein POPTR_0015s05090g             113   2e-24   
emb|CAN66851.1|  hypothetical protein VITISV_001070                     110   2e-24   Vitis vinifera
ref|XP_002317721.1|  cyclic nucleotide-gated ion channel 20 famil...    112   9e-24   Populus trichocarpa [western balsam poplar]
gb|KGN63955.1|  hypothetical protein Csa_1G031768                       104   2e-23   Cucumis sativus [cucumbers]
ref|XP_010663941.1|  PREDICTED: probable cyclic nucleotide-gated ...    110   3e-23   Vitis vinifera
ref|XP_010099680.1|  putative cyclic nucleotide-gated ion channel 20    108   1e-22   
ref|XP_003548318.1|  PREDICTED: probable cyclic nucleotide-gated ...    107   3e-22   Glycine max [soybeans]
gb|KHN24541.1|  Putative cyclic nucleotide-gated ion channel 20, ...    107   3e-22   Glycine soja [wild soybean]
ref|XP_010663940.1|  PREDICTED: probable cyclic nucleotide-gated ...    107   4e-22   Vitis vinifera
ref|XP_010663937.1|  PREDICTED: probable cyclic nucleotide-gated ...    107   4e-22   Vitis vinifera
gb|EYU17788.1|  hypothetical protein MIMGU_mgv1a001774mg                106   5e-22   Erythranthe guttata [common monkey flower]
gb|KHN24540.1|  Putative cyclic nucleotide-gated ion channel 20, ...    106   7e-22   Glycine soja [wild soybean]
ref|XP_004515246.1|  PREDICTED: probable cyclic nucleotide-gated ...    106   7e-22   Cicer arietinum [garbanzo]
ref|XP_003548317.1|  PREDICTED: probable cyclic nucleotide-gated ...    106   7e-22   Glycine max [soybeans]
gb|KCW57855.1|  hypothetical protein EUGRSUZ_H00608                     105   8e-22   Eucalyptus grandis [rose gum]
ref|XP_008364700.1|  PREDICTED: probable cyclic nucleotide-gated ...    102   1e-21   
gb|KEH26818.1|  cyclic nucleotide-gated cation channel protein          105   1e-21   Medicago truncatula
gb|KEH26817.1|  cyclic nucleotide-gated cation channel protein          105   1e-21   Medicago truncatula
ref|XP_010069488.1|  PREDICTED: probable cyclic nucleotide-gated ...    105   2e-21   Eucalyptus grandis [rose gum]
ref|XP_010069486.1|  PREDICTED: probable cyclic nucleotide-gated ...    104   2e-21   
gb|KCW57853.1|  hypothetical protein EUGRSUZ_H00606                     104   2e-21   Eucalyptus grandis [rose gum]
gb|EYU22267.1|  hypothetical protein MIMGU_mgv1a001823mg                103   6e-21   Erythranthe guttata [common monkey flower]
ref|XP_011649574.1|  PREDICTED: probable cyclic nucleotide-gated ...    102   1e-20   Cucumis sativus [cucumbers]
ref|XP_010687225.1|  PREDICTED: probable cyclic nucleotide-gated ...    102   2e-20   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_003534112.2|  PREDICTED: probable cyclic nucleotide-gated ...    101   3e-20   Glycine max [soybeans]
ref|XP_006587444.1|  PREDICTED: probable cyclic nucleotide-gated ...    101   3e-20   Glycine max [soybeans]
ref|XP_004515287.1|  PREDICTED: probable cyclic nucleotide-gated ...    101   3e-20   Cicer arietinum [garbanzo]
ref|XP_009356084.1|  PREDICTED: putative cyclic nucleotide-gated ...    101   3e-20   
ref|XP_008437120.1|  PREDICTED: probable cyclic nucleotide-gated ...    100   4e-20   
ref|XP_008467252.1|  PREDICTED: probable cyclic nucleotide-gated ...    100   4e-20   Cucumis melo [Oriental melon]
ref|XP_008436960.1|  PREDICTED: probable cyclic nucleotide-gated ...  99.4    1e-19   Cucumis melo [Oriental melon]
ref|XP_007152605.1|  hypothetical protein PHAVU_004G144100g           99.4    2e-19   Phaseolus vulgaris [French bean]
ref|XP_008375103.1|  PREDICTED: probable cyclic nucleotide-gated ...  97.8    4e-19   
ref|XP_010069485.1|  PREDICTED: probable cyclic nucleotide-gated ...  95.5    3e-18   Eucalyptus grandis [rose gum]
ref|XP_009356083.1|  PREDICTED: probable cyclic nucleotide-gated ...  94.7    4e-18   
ref|XP_010069490.1|  PREDICTED: probable cyclic nucleotide-gated ...  92.0    3e-17   Eucalyptus grandis [rose gum]
ref|XP_007152606.1|  hypothetical protein PHAVU_004G144200g           91.7    4e-17   Phaseolus vulgaris [French bean]
gb|KFK39083.1|  hypothetical protein AALP_AA3G198800                  91.7    4e-17   Arabis alpina [alpine rockcress]
gb|KHN43680.1|  Putative cyclic nucleotide-gated ion channel 19       91.3    5e-17   Glycine soja [wild soybean]
ref|XP_006297016.1|  hypothetical protein CARUB_v10013007mg           91.3    6e-17   
ref|XP_006587439.1|  PREDICTED: probable cyclic nucleotide-gated ...  87.8    6e-16   
ref|XP_006587438.1|  PREDICTED: probable cyclic nucleotide-gated ...  88.2    6e-16   
emb|CDX95833.1|  BnaC05g35840D                                        87.8    7e-16   
ref|XP_006587437.1|  PREDICTED: probable cyclic nucleotide-gated ...  87.8    8e-16   
ref|XP_002883080.1|  cyclic nucleotide-binding transporter 1          87.4    1e-15   Arabidopsis lyrata subsp. lyrata
ref|XP_009146131.1|  PREDICTED: probable cyclic nucleotide-gated ...  87.4    1e-15   
emb|CDX92152.1|  BnaA05g22550D                                        85.9    3e-15   
ref|XP_010549021.1|  PREDICTED: probable cyclic nucleotide-gated ...  85.1    5e-15   Tarenaya hassleriana [spider flower]
ref|NP_566585.1|  cyclic nucleotide-binding transporter 1             85.1    6e-15   Arabidopsis thaliana [mouse-ear cress]
emb|CDY46885.1|  BnaA01g27850D                                        84.7    7e-15   Brassica napus [oilseed rape]
ref|XP_009381391.1|  PREDICTED: probable cyclic nucleotide-gated ...  84.3    9e-15   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009113813.1|  PREDICTED: probable cyclic nucleotide-gated ...  83.6    2e-14   
ref|XP_007152600.1|  hypothetical protein PHAVU_004G143700g           82.8    3e-14   Phaseolus vulgaris [French bean]
ref|XP_003610842.1|  Cyclic nucleotide gated channel                  82.8    3e-14   
emb|CDY65691.1|  BnaCnng48280D                                        82.0    6e-14   Brassica napus [oilseed rape]
ref|XP_006406700.1|  hypothetical protein EUTSA_v10020123mg           81.3    9e-14   Eutrema salsugineum [saltwater cress]
ref|XP_003549190.1|  PREDICTED: probable cyclic nucleotide-gated ...  80.1    2e-13   
gb|KHN24539.1|  Putative cyclic nucleotide-gated ion channel 20, ...  80.1    2e-13   Glycine soja [wild soybean]
ref|XP_006299424.1|  hypothetical protein CARUB_v10015585mg           80.1    2e-13   Capsella rubella
gb|KFK39100.1|  hypothetical protein AALP_AA3G201000                  78.2    6e-13   Arabis alpina [alpine rockcress]
ref|XP_003619945.1|  Cyclic nucleotide-gated ion channel              77.0    7e-13   
ref|XP_008789209.1|  PREDICTED: probable cyclic nucleotide-gated ...  77.0    2e-12   Phoenix dactylifera
ref|XP_010932484.1|  PREDICTED: probable cyclic nucleotide-gated ...  76.6    3e-12   Elaeis guineensis
ref|XP_008789206.1|  PREDICTED: probable cyclic nucleotide-gated ...  76.6    3e-12   Phoenix dactylifera
ref|XP_008789204.1|  PREDICTED: probable cyclic nucleotide-gated ...  75.9    5e-12   
ref|XP_008789205.1|  PREDICTED: probable cyclic nucleotide-gated ...  75.9    6e-12   
ref|XP_008789202.1|  PREDICTED: probable cyclic nucleotide-gated ...  75.9    6e-12   Phoenix dactylifera
ref|XP_010505803.1|  PREDICTED: probable cyclic nucleotide-gated ...  75.1    1e-11   Camelina sativa [gold-of-pleasure]
ref|XP_010487667.1|  PREDICTED: probable cyclic nucleotide-gated ...  74.3    2e-11   Camelina sativa [gold-of-pleasure]
emb|CDX92150.1|  BnaA05g22570D                                        74.3    2e-11   
ref|XP_006849531.2|  PREDICTED: probable cyclic nucleotide-gated ...  73.6    4e-11   Amborella trichopoda
ref|XP_009145988.1|  PREDICTED: putative cyclic nucleotide-gated ...  72.8    6e-11   Brassica rapa
ref|XP_010505715.1|  PREDICTED: putative cyclic nucleotide-gated ...  72.4    7e-11   Camelina sativa [gold-of-pleasure]
ref|XP_010505696.1|  PREDICTED: putative cyclic nucleotide-gated ...  72.4    7e-11   Camelina sativa [gold-of-pleasure]
gb|KEH26827.1|  cyclic nucleotide gated channel protein               72.0    1e-10   Medicago truncatula
gb|KEH26828.1|  cyclic nucleotide gated channel protein               72.0    1e-10   Medicago truncatula
gb|KHN44945.1|  Putative cyclic nucleotide-gated ion channel 20, ...  67.8    1e-10   Glycine soja [wild soybean]
ref|NP_188396.2|  cyclic nucleotide gated channel 19                  71.2    2e-10   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002883079.1|  ATCNGC19                                         71.2    2e-10   Arabidopsis lyrata subsp. lyrata
ref|XP_006297066.1|  hypothetical protein CARUB_v10013067mg           70.9    2e-10   Capsella rubella
ref|XP_007152602.1|  hypothetical protein PHAVU_004G143900g           70.9    3e-10   Phaseolus vulgaris [French bean]
gb|EPS69237.1|  hypothetical protein M569_05530                       69.7    6e-10   Genlisea aurea
ref|XP_010487666.1|  PREDICTED: putative cyclic nucleotide-gated ...  69.7    6e-10   Camelina sativa [gold-of-pleasure]
ref|XP_010465830.1|  PREDICTED: probable cyclic nucleotide-gated ...  69.3    8e-10   
ref|XP_010465825.1|  PREDICTED: putative cyclic nucleotide-gated ...  68.2    2e-09   Camelina sativa [gold-of-pleasure]
ref|XP_010435405.1|  PREDICTED: probable cyclic nucleotide-gated ...  68.2    2e-09   Camelina sativa [gold-of-pleasure]
emb|CDX95835.1|  BnaC05g35860D                                        67.4    3e-09   
ref|XP_012076151.1|  PREDICTED: probable cyclic nucleotide-gated ...  67.0    5e-09   
ref|XP_012076152.1|  PREDICTED: probable cyclic nucleotide-gated ...  66.6    6e-09   
ref|XP_012076149.1|  PREDICTED: probable cyclic nucleotide-gated ...  66.6    6e-09   Jatropha curcas
ref|XP_002883082.1|  cyclic nucleotide-binding transporter 1          66.6    7e-09   
ref|XP_010937008.1|  PREDICTED: probable cyclic nucleotide-gated ...  64.7    3e-08   Elaeis guineensis
emb|CDY24513.1|  BnaA01g22170D                                        64.3    4e-08   Brassica napus [oilseed rape]
gb|ERN11112.1|  hypothetical protein AMTR_s00024p00155680             64.3    4e-08   Amborella trichopoda
emb|CDX95834.1|  BnaC05g35850D                                        62.8    1e-07   
gb|KFK39097.1|  hypothetical protein AALP_AA3G200700                  62.8    1e-07   Arabis alpina [alpine rockcress]
gb|KFK34623.1|  hypothetical protein AALP_AA5G169900                  61.2    4e-07   Arabis alpina [alpine rockcress]
gb|KFK34622.1|  hypothetical protein AALP_AA5G169900                  61.2    4e-07   Arabis alpina [alpine rockcress]
ref|XP_010435423.1|  PREDICTED: probable cyclic nucleotide-gated ...  58.5    3e-06   Camelina sativa [gold-of-pleasure]
ref|XP_010435431.1|  PREDICTED: probable cyclic nucleotide-gated ...  58.5    3e-06   Camelina sativa [gold-of-pleasure]
emb|CDY55604.1|  BnaC01g42610D                                        57.8    5e-06   Brassica napus [oilseed rape]
ref|XP_006406701.1|  hypothetical protein EUTSA_v10020120mg           57.8    6e-06   
ref|XP_009145990.1|  PREDICTED: putative cyclic nucleotide-gated ...  57.4    7e-06   Brassica rapa
ref|XP_009102285.1|  PREDICTED: probable cyclic nucleotide-gated ...  57.0    1e-05   
emb|CDY46049.1|  BnaC01g34960D                                        55.8    2e-05   Brassica napus [oilseed rape]
emb|CDX92151.1|  BnaA05g22560D                                        53.5    1e-04   
ref|XP_010227874.1|  PREDICTED: probable cyclic nucleotide-gated ...  53.1    2e-04   
ref|XP_004515288.1|  PREDICTED: probable cyclic nucleotide-gated ...  52.8    2e-04   
ref|XP_003564124.1|  PREDICTED: probable cyclic nucleotide-gated ...  52.8    2e-04   
ref|XP_010227870.1|  PREDICTED: probable cyclic nucleotide-gated ...  52.8    3e-04   
gb|AFW73689.1|  hypothetical protein ZEAMMB73_901576                  50.8    4e-04   



>ref|XP_009587296.1| PREDICTED: probable cyclic nucleotide-gated ion channel 20, chloroplastic 
[Nicotiana tomentosiformis]
 ref|XP_009587297.1| PREDICTED: probable cyclic nucleotide-gated ion channel 20, chloroplastic 
[Nicotiana tomentosiformis]
Length=771

 Score =   148 bits (374),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 78/148 (53%), Positives = 104/148 (70%), Gaps = 6/148 (4%)
 Frame = +3

Query  438  MAAYERDVVPMLSATDSQADES-GY--RRFSYRARR-SLSIPANSYDT-ENNNHF-GFTG  599
            M  +E+D +PMLS +  Q+DE+ G+  RRF+YR R  SLS+P +S D+ EN++ F G+TG
Sbjct  1    MGTFEKDEMPMLSPSFPQSDENDGFQNRRFTYRTRSASLSMPTSSMDSFENDSSFVGYTG  60

Query  600  PLRNERRTSYIQMSGPLYVGQTPTNNLRTSQVALGRKSTRQTLEIYPSTAIRESNDWEDY  779
            PLR+ERRTS + MSGPLY+ + P N+   +  A+  K T  T E YPS    E N W + 
Sbjct  61   PLRSERRTSLVHMSGPLYISRKPENSFWPTPAAVVHKPTLPTTEKYPSIGSAERNGWPNN  120

Query  780  DYAQKNEHLLRSGRLGVCNDPYCTTCPT  863
            DY  KNEHLL+SG+LG+C+DPYCTTCPT
Sbjct  121  DYTGKNEHLLKSGQLGMCSDPYCTTCPT  148



>emb|CDO98618.1| unnamed protein product [Coffea canephora]
Length=783

 Score =   148 bits (374),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 82/149 (55%), Positives = 102/149 (68%), Gaps = 8/149 (5%)
 Frame = +3

Query  438  MAAYERDVVPMLSATDSQADE---SGYRRFSYRARR-SLSIPANS---YDTENNNHFGFT  596
            MAA ERDV PMLS+ DS  DE   S  RRF+   R  S+SIP NS   YD+EN+   G+T
Sbjct  1    MAASERDVTPMLSSMDSPVDEQYDSQLRRFTSGTRSASISIPMNSVDYYDSENS-FVGYT  59

Query  597  GPLRNERRTSYIQMSGPLYVGQTPTNNLRTSQVALGRKSTRQTLEIYPSTAIRESNDWED  776
            GPLRNE++T Y QMSGPLYVG   +N  R +Q  LG K+T   +E YPS    + N   D
Sbjct  60   GPLRNEKQTPYGQMSGPLYVGHKNSNVFRRTQGLLGNKTTETAVERYPSLNGVDQNVRSD  119

Query  777  YDYAQKNEHLLRSGRLGVCNDPYCTTCPT  863
             D+A KN+HLL+SG+LG+C+DPYCTTCP+
Sbjct  120  KDHAGKNDHLLKSGQLGMCHDPYCTTCPS  148



>ref|XP_006364384.1| PREDICTED: probable cyclic nucleotide-gated ion channel 20, chloroplastic-like 
isoform X1 [Solanum tuberosum]
 ref|XP_006364385.1| PREDICTED: probable cyclic nucleotide-gated ion channel 20, chloroplastic-like 
isoform X2 [Solanum tuberosum]
 ref|XP_006364386.1| PREDICTED: probable cyclic nucleotide-gated ion channel 20, chloroplastic-like 
isoform X3 [Solanum tuberosum]
Length=771

 Score =   147 bits (371),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 77/148 (52%), Positives = 102/148 (69%), Gaps = 6/148 (4%)
 Frame = +3

Query  438  MAAYERDVVPMLSATDSQADESGY---RRFSYRARR-SLSIPANSYDTENNN--HFGFTG  599
            M  +E+D +PMLS +  Q+D +     RR +YR R  SLS+P +S D+  N+  + G+TG
Sbjct  1    MDTFEKDEMPMLSPSYPQSDGNDAFQNRRSTYRTRSASLSMPMSSMDSFENDSSYVGYTG  60

Query  600  PLRNERRTSYIQMSGPLYVGQTPTNNLRTSQVALGRKSTRQTLEIYPSTAIRESNDWEDY  779
            PLR+ERRTS +QMSGPLY+G+ P N+ R +  A+  K T  T E YPS +  E NDW + 
Sbjct  61   PLRSERRTSLVQMSGPLYIGRDPENSSRPTPAAVVHKPTLPTTEKYPSISSAERNDWRNN  120

Query  780  DYAQKNEHLLRSGRLGVCNDPYCTTCPT  863
            DY  KNEHL +SG+LG+CNDPYCTTCPT
Sbjct  121  DYTGKNEHLFKSGQLGMCNDPYCTTCPT  148



>ref|XP_010247505.1| PREDICTED: probable cyclic nucleotide-gated ion channel 20, chloroplastic, 
partial [Nelumbo nucifera]
Length=724

 Score =   147 bits (370),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 83/149 (56%), Positives = 100/149 (67%), Gaps = 7/149 (5%)
 Frame = +3

Query  438  MAAYERDVVPMLSATDSQA-DES---GYRRFSYRARR-SLSIPANS--YDTENNNHFGFT  596
            MA+ E+D VPMLS TDSQ+ DES    + RFS R R  S+SI  NS   +   NN  G+T
Sbjct  1    MASDEKDEVPMLSNTDSQSLDESLDVEFPRFSSRNRSASMSITMNSVHLNEGENNFVGYT  60

Query  597  GPLRNERRTSYIQMSGPLYVGQTPTNNLRTSQVALGRKSTRQTLEIYPSTAIRESNDWED  776
            GPLRNERRT ++QMSGPLY+ + P N  R    ++  K +  T E YPS   R+  +W D
Sbjct  61   GPLRNERRTPFVQMSGPLYISRKPENFNRPMHGSIDDKISILTAEHYPSFNGRDKKEWMD  120

Query  777  YDYAQKNEHLLRSGRLGVCNDPYCTTCPT  863
              YA+KNEHLLRSG LGVCNDPYCTTCPT
Sbjct  121  ESYARKNEHLLRSGPLGVCNDPYCTTCPT  149



>ref|XP_011086974.1| PREDICTED: probable cyclic nucleotide-gated ion channel 20, chloroplastic 
[Sesamum indicum]
Length=773

 Score =   146 bits (369),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 82/149 (55%), Positives = 98/149 (66%), Gaps = 7/149 (5%)
 Frame = +3

Query  438  MAAYERDVVPMLSATDSQADE---SGYRRFSYRARR-SLSIPANSYDTENNNH--FGFTG  599
            M A ERD +PMLSAT  QAD+   S  R FS R R  S+SIP  S D+    H   GFTG
Sbjct  1    MDASERDEIPMLSATYFQADDPNDSTSRSFSTRTRSASMSIPMTSLDSSGTEHNLVGFTG  60

Query  600  PLRNERR-TSYIQMSGPLYVGQTPTNNLRTSQVALGRKSTRQTLEIYPSTAIRESNDWED  776
            PLRNERR T+++QMSGPLYV        +  + AL +K+    +E YPS    E+NDW  
Sbjct  61   PLRNERRSTTFVQMSGPLYVKHNHEFIFQRPEDALQKKTPEPKIERYPSIDRAENNDWPL  120

Query  777  YDYAQKNEHLLRSGRLGVCNDPYCTTCPT  863
             DYA KNEHLL+SG+LG+CNDPYCTTCPT
Sbjct  121  SDYAGKNEHLLKSGQLGMCNDPYCTTCPT  149



>gb|KJB39198.1| hypothetical protein B456_007G002000 [Gossypium raimondii]
Length=693

 Score =   145 bits (367),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 77/149 (52%), Positives = 101/149 (68%), Gaps = 7/149 (5%)
 Frame = +3

Query  438  MAAYERDVVPMLSATDSQADE----SGYRRFSYRARR-SLSIPANSYDTENNNHF-GFTG  599
            MA+Y++D VPMLS T  Q+ E    S  + F  R R  S+SIP NS ++  N H  G TG
Sbjct  1    MASYDKDEVPMLSDTYPQSSENNRDSQSQTFISRTRSASISIPLNSMESYQNTHLVGHTG  60

Query  600  PLRNERRTSYIQMSGPLYVGQTPTNNLRTSQ-VALGRKSTRQTLEIYPSTAIRESNDWED  776
            PLRNER+T +IQMSGPLY+ + P N+ + +Q  A G+K      E +PS   ++ NDW D
Sbjct  61   PLRNERKTPFIQMSGPLYISRKPENSFQLNQSTAAGQKMMEPKAEKFPSFNGKDENDWPD  120

Query  777  YDYAQKNEHLLRSGRLGVCNDPYCTTCPT  863
             +Y+ KNEHLLRSG+LG+C+DPYCTTCPT
Sbjct  121  NNYSGKNEHLLRSGQLGMCSDPYCTTCPT  149



>ref|XP_004235383.1| PREDICTED: probable cyclic nucleotide-gated ion channel 20, chloroplastic 
[Solanum lycopersicum]
Length=771

 Score =   145 bits (367),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 76/148 (51%), Positives = 101/148 (68%), Gaps = 6/148 (4%)
 Frame = +3

Query  438  MAAYERDVVPMLSATDSQADESGY---RRFSYRARR-SLSIPANSYDTENNN--HFGFTG  599
            M  +E+D +PMLS +  Q+D +     RR +YR R  SLS+P +S D+  N+  + G+TG
Sbjct  1    MDTFEKDEMPMLSPSYPQSDGNDAFQNRRSTYRTRSASLSMPMSSIDSFENDSSYVGYTG  60

Query  600  PLRNERRTSYIQMSGPLYVGQTPTNNLRTSQVALGRKSTRQTLEIYPSTAIRESNDWEDY  779
            PLR+ERRTS +QMSGPLY+G+ P N+ R +  A+  KST    E YPS +  E N W + 
Sbjct  61   PLRSERRTSLVQMSGPLYIGREPENSFRPTPAAVVHKSTLPPTERYPSISSAERNGWRNN  120

Query  780  DYAQKNEHLLRSGRLGVCNDPYCTTCPT  863
            DY  KNEHL +SG+LG+CNDPYCTTCPT
Sbjct  121  DYTGKNEHLFKSGQLGMCNDPYCTTCPT  148



>gb|KJB39199.1| hypothetical protein B456_007G002000 [Gossypium raimondii]
Length=770

 Score =   145 bits (367),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 77/149 (52%), Positives = 101/149 (68%), Gaps = 7/149 (5%)
 Frame = +3

Query  438  MAAYERDVVPMLSATDSQADE----SGYRRFSYRARR-SLSIPANSYDTENNNHF-GFTG  599
            MA+Y++D VPMLS T  Q+ E    S  + F  R R  S+SIP NS ++  N H  G TG
Sbjct  1    MASYDKDEVPMLSDTYPQSSENNRDSQSQTFISRTRSASISIPLNSMESYQNTHLVGHTG  60

Query  600  PLRNERRTSYIQMSGPLYVGQTPTNNLRTSQ-VALGRKSTRQTLEIYPSTAIRESNDWED  776
            PLRNER+T +IQMSGPLY+ + P N+ + +Q  A G+K      E +PS   ++ NDW D
Sbjct  61   PLRNERKTPFIQMSGPLYISRKPENSFQLNQSTAAGQKMMEPKAEKFPSFNGKDENDWPD  120

Query  777  YDYAQKNEHLLRSGRLGVCNDPYCTTCPT  863
             +Y+ KNEHLLRSG+LG+C+DPYCTTCPT
Sbjct  121  NNYSGKNEHLLRSGQLGMCSDPYCTTCPT  149



>ref|XP_009761448.1| PREDICTED: probable cyclic nucleotide-gated ion channel 20, chloroplastic 
isoform X3 [Nicotiana sylvestris]
Length=562

 Score =   143 bits (360),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 74/148 (50%), Positives = 100/148 (68%), Gaps = 6/148 (4%)
 Frame = +3

Query  438  MAAYERDVVPMLSATDSQADES-GY--RRFSYRARR-SLSIPANSYDTENNN--HFGFTG  599
            M  +E+D +PMLS +  Q+DE+ G+  RRF+YR R  SLS+P +S D+  N+    G+TG
Sbjct  1    METFEKDDMPMLSPSFPQSDENDGFQNRRFTYRTRSASLSMPTSSMDSFGNDSSFVGYTG  60

Query  600  PLRNERRTSYIQMSGPLYVGQTPTNNLRTSQVALGRKSTRQTLEIYPSTAIRESNDWEDY  779
            PLR+E RTS + MSGPLY+ + P N+ R +  A+  K +    E YPS    E N W + 
Sbjct  61   PLRSEGRTSLVHMSGPLYISRKPENSFRPTPAAVVHKPSLPATEKYPSIGSAERNGWPNN  120

Query  780  DYAQKNEHLLRSGRLGVCNDPYCTTCPT  863
            DY  KNEHLL+SG+LG+C+DPYCTTCPT
Sbjct  121  DYTGKNEHLLKSGQLGMCSDPYCTTCPT  148



>ref|XP_009761447.1| PREDICTED: probable cyclic nucleotide-gated ion channel 20, chloroplastic 
isoform X2 [Nicotiana sylvestris]
Length=645

 Score =   143 bits (360),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 74/148 (50%), Positives = 100/148 (68%), Gaps = 6/148 (4%)
 Frame = +3

Query  438  MAAYERDVVPMLSATDSQADES-GY--RRFSYRARR-SLSIPANSYDTENNN--HFGFTG  599
            M  +E+D +PMLS +  Q+DE+ G+  RRF+YR R  SLS+P +S D+  N+    G+TG
Sbjct  1    METFEKDDMPMLSPSFPQSDENDGFQNRRFTYRTRSASLSMPTSSMDSFGNDSSFVGYTG  60

Query  600  PLRNERRTSYIQMSGPLYVGQTPTNNLRTSQVALGRKSTRQTLEIYPSTAIRESNDWEDY  779
            PLR+E RTS + MSGPLY+ + P N+ R +  A+  K +    E YPS    E N W + 
Sbjct  61   PLRSEGRTSLVHMSGPLYISRKPENSFRPTPAAVVHKPSLPATEKYPSIGSAERNGWPNN  120

Query  780  DYAQKNEHLLRSGRLGVCNDPYCTTCPT  863
            DY  KNEHLL+SG+LG+C+DPYCTTCPT
Sbjct  121  DYTGKNEHLLKSGQLGMCSDPYCTTCPT  148



>ref|XP_009761446.1| PREDICTED: probable cyclic nucleotide-gated ion channel 20, chloroplastic 
isoform X1 [Nicotiana sylvestris]
Length=691

 Score =   143 bits (360),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 74/148 (50%), Positives = 100/148 (68%), Gaps = 6/148 (4%)
 Frame = +3

Query  438  MAAYERDVVPMLSATDSQADES-GY--RRFSYRARR-SLSIPANSYDTENNN--HFGFTG  599
            M  +E+D +PMLS +  Q+DE+ G+  RRF+YR R  SLS+P +S D+  N+    G+TG
Sbjct  1    METFEKDDMPMLSPSFPQSDENDGFQNRRFTYRTRSASLSMPTSSMDSFGNDSSFVGYTG  60

Query  600  PLRNERRTSYIQMSGPLYVGQTPTNNLRTSQVALGRKSTRQTLEIYPSTAIRESNDWEDY  779
            PLR+E RTS + MSGPLY+ + P N+ R +  A+  K +    E YPS    E N W + 
Sbjct  61   PLRSEGRTSLVHMSGPLYISRKPENSFRPTPAAVVHKPSLPATEKYPSIGSAERNGWPNN  120

Query  780  DYAQKNEHLLRSGRLGVCNDPYCTTCPT  863
            DY  KNEHLL+SG+LG+C+DPYCTTCPT
Sbjct  121  DYTGKNEHLLKSGQLGMCSDPYCTTCPT  148



>ref|XP_007010889.1| Cyclic nucleotide-binding transporter 1 isoform 10 [Theobroma 
cacao]
 gb|EOY19699.1| Cyclic nucleotide-binding transporter 1 isoform 10 [Theobroma 
cacao]
Length=569

 Score =   140 bits (354),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 72/148 (49%), Positives = 90/148 (61%), Gaps = 6/148 (4%)
 Frame = +3

Query  438  MAAYERDVVPMLSATDSQADESGY-----RRFSYRARRSLSIPANSYDT-ENNNHFGFTG  599
            MA Y++D VPMLS    Q  E+         FS     S+SIP NS ++ E+ N  G TG
Sbjct  1    MACYDKDEVPMLSDIHPQPSENNQDSQFQALFSRTQSASISIPMNSIESYESTNLVGHTG  60

Query  600  PLRNERRTSYIQMSGPLYVGQTPTNNLRTSQVALGRKSTRQTLEIYPSTAIRESNDWEDY  779
            PLRNER+  +IQMSGPLY+ + P N+   +Q   G K      E +PS    +  DW D 
Sbjct  61   PLRNERKIPFIQMSGPLYISRKPENSFHPNQSVAGHKMVESKAEKFPSFNGVDEKDWSDN  120

Query  780  DYAQKNEHLLRSGRLGVCNDPYCTTCPT  863
            +Y  KNEHLLRSG+LG+CNDPYCTTCPT
Sbjct  121  NYVGKNEHLLRSGQLGMCNDPYCTTCPT  148



>ref|XP_007010884.1| Cyclic nucleotide-binding transporter 1 isoform 5 [Theobroma 
cacao]
 ref|XP_007010886.1| Cyclic nucleotide-binding transporter 1 isoform 5 [Theobroma 
cacao]
 gb|EOY19694.1| Cyclic nucleotide-binding transporter 1 isoform 5 [Theobroma 
cacao]
 gb|EOY19696.1| Cyclic nucleotide-binding transporter 1 isoform 5 [Theobroma 
cacao]
Length=694

 Score =   141 bits (355),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 72/148 (49%), Positives = 90/148 (61%), Gaps = 6/148 (4%)
 Frame = +3

Query  438  MAAYERDVVPMLSATDSQADESGY-----RRFSYRARRSLSIPANSYDT-ENNNHFGFTG  599
            MA Y++D VPMLS    Q  E+         FS     S+SIP NS ++ E+ N  G TG
Sbjct  1    MACYDKDEVPMLSDIHPQPSENNQDSQFQALFSRTQSASISIPMNSIESYESTNLVGHTG  60

Query  600  PLRNERRTSYIQMSGPLYVGQTPTNNLRTSQVALGRKSTRQTLEIYPSTAIRESNDWEDY  779
            PLRNER+  +IQMSGPLY+ + P N+   +Q   G K      E +PS    +  DW D 
Sbjct  61   PLRNERKIPFIQMSGPLYISRKPENSFHPNQSVAGHKMVESKAEKFPSFNGVDEKDWSDN  120

Query  780  DYAQKNEHLLRSGRLGVCNDPYCTTCPT  863
            +Y  KNEHLLRSG+LG+CNDPYCTTCPT
Sbjct  121  NYVGKNEHLLRSGQLGMCNDPYCTTCPT  148



>ref|XP_007010887.1| Cyclic nucleotide-binding transporter 1 isoform 8 [Theobroma 
cacao]
 ref|XP_007010888.1| Cyclic nucleotide-binding transporter 1 isoform 8 [Theobroma 
cacao]
 gb|EOY19697.1| Cyclic nucleotide-binding transporter 1 isoform 8 [Theobroma 
cacao]
 gb|EOY19698.1| Cyclic nucleotide-binding transporter 1 isoform 8 [Theobroma 
cacao]
Length=688

 Score =   140 bits (354),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 72/148 (49%), Positives = 90/148 (61%), Gaps = 6/148 (4%)
 Frame = +3

Query  438  MAAYERDVVPMLSATDSQADESGY-----RRFSYRARRSLSIPANSYDT-ENNNHFGFTG  599
            MA Y++D VPMLS    Q  E+         FS     S+SIP NS ++ E+ N  G TG
Sbjct  1    MACYDKDEVPMLSDIHPQPSENNQDSQFQALFSRTQSASISIPMNSIESYESTNLVGHTG  60

Query  600  PLRNERRTSYIQMSGPLYVGQTPTNNLRTSQVALGRKSTRQTLEIYPSTAIRESNDWEDY  779
            PLRNER+  +IQMSGPLY+ + P N+   +Q   G K      E +PS    +  DW D 
Sbjct  61   PLRNERKIPFIQMSGPLYISRKPENSFHPNQSVAGHKMVESKAEKFPSFNGVDEKDWSDN  120

Query  780  DYAQKNEHLLRSGRLGVCNDPYCTTCPT  863
            +Y  KNEHLLRSG+LG+CNDPYCTTCPT
Sbjct  121  NYVGKNEHLLRSGQLGMCNDPYCTTCPT  148



>ref|XP_007010881.1| Cyclic nucleotide-binding transporter 1 isoform 2 [Theobroma 
cacao]
 ref|XP_007010882.1| Cyclic nucleotide-binding transporter 1 isoform 2 [Theobroma 
cacao]
 gb|EOY19691.1| Cyclic nucleotide-binding transporter 1 isoform 2 [Theobroma 
cacao]
 gb|EOY19692.1| Cyclic nucleotide-binding transporter 1 isoform 2 [Theobroma 
cacao]
Length=775

 Score =   140 bits (354),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 72/148 (49%), Positives = 90/148 (61%), Gaps = 6/148 (4%)
 Frame = +3

Query  438  MAAYERDVVPMLSATDSQADESGY-----RRFSYRARRSLSIPANSYDT-ENNNHFGFTG  599
            MA Y++D VPMLS    Q  E+         FS     S+SIP NS ++ E+ N  G TG
Sbjct  1    MACYDKDEVPMLSDIHPQPSENNQDSQFQALFSRTQSASISIPMNSIESYESTNLVGHTG  60

Query  600  PLRNERRTSYIQMSGPLYVGQTPTNNLRTSQVALGRKSTRQTLEIYPSTAIRESNDWEDY  779
            PLRNER+  +IQMSGPLY+ + P N+   +Q   G K      E +PS    +  DW D 
Sbjct  61   PLRNERKIPFIQMSGPLYISRKPENSFHPNQSVAGHKMVESKAEKFPSFNGVDEKDWSDN  120

Query  780  DYAQKNEHLLRSGRLGVCNDPYCTTCPT  863
            +Y  KNEHLLRSG+LG+CNDPYCTTCPT
Sbjct  121  NYVGKNEHLLRSGQLGMCNDPYCTTCPT  148



>ref|XP_007010880.1| Cyclic nucleotide-binding transporter 1 isoform 1 [Theobroma 
cacao]
 ref|XP_007010883.1| Cyclic nucleotide-binding transporter 1 isoform 1 [Theobroma 
cacao]
 ref|XP_007010885.1| Cyclic nucleotide-binding transporter 1 isoform 1 [Theobroma 
cacao]
 gb|EOY19690.1| Cyclic nucleotide-binding transporter 1 isoform 1 [Theobroma 
cacao]
 gb|EOY19693.1| Cyclic nucleotide-binding transporter 1 isoform 1 [Theobroma 
cacao]
 gb|EOY19695.1| Cyclic nucleotide-binding transporter 1 isoform 1 [Theobroma 
cacao]
Length=771

 Score =   140 bits (354),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 72/148 (49%), Positives = 90/148 (61%), Gaps = 6/148 (4%)
 Frame = +3

Query  438  MAAYERDVVPMLSATDSQADESGY-----RRFSYRARRSLSIPANSYDT-ENNNHFGFTG  599
            MA Y++D VPMLS    Q  E+         FS     S+SIP NS ++ E+ N  G TG
Sbjct  1    MACYDKDEVPMLSDIHPQPSENNQDSQFQALFSRTQSASISIPMNSIESYESTNLVGHTG  60

Query  600  PLRNERRTSYIQMSGPLYVGQTPTNNLRTSQVALGRKSTRQTLEIYPSTAIRESNDWEDY  779
            PLRNER+  +IQMSGPLY+ + P N+   +Q   G K      E +PS    +  DW D 
Sbjct  61   PLRNERKIPFIQMSGPLYISRKPENSFHPNQSVAGHKMVESKAEKFPSFNGVDEKDWSDN  120

Query  780  DYAQKNEHLLRSGRLGVCNDPYCTTCPT  863
            +Y  KNEHLLRSG+LG+CNDPYCTTCPT
Sbjct  121  NYVGKNEHLLRSGQLGMCNDPYCTTCPT  148



>gb|AJC00855.1| cyclic nucleotide gated channel CNGC15 [Solanum lycopersicum]
Length=763

 Score =   139 bits (349),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 73/140 (52%), Positives = 96/140 (69%), Gaps = 6/140 (4%)
 Frame = +3

Query  462  VPMLSATDSQADESGY---RRFSYRARR-SLSIPANSYDTENNN--HFGFTGPLRNERRT  623
            +PMLS +  Q+D +     RR +YR R  SLS+P +S D+  N+  + G+TGPLR+ERRT
Sbjct  1    MPMLSPSYPQSDGNDAFQNRRSTYRTRSASLSMPMSSIDSFENDSSYVGYTGPLRSERRT  60

Query  624  SYIQMSGPLYVGQTPTNNLRTSQVALGRKSTRQTLEIYPSTAIRESNDWEDYDYAQKNEH  803
            S +QMSGPLY+G+ P N+ R +  A+  KST    E YPS +  E N W + DY  KNEH
Sbjct  61   SLVQMSGPLYIGREPENSFRPTPAAVVHKSTLPPTERYPSISSAERNGWRNNDYTGKNEH  120

Query  804  LLRSGRLGVCNDPYCTTCPT  863
            L +SG+LG+CNDPYCTTCPT
Sbjct  121  LFKSGQLGMCNDPYCTTCPT  140



>ref|XP_009761450.1| PREDICTED: probable cyclic nucleotide-gated ion channel 20, chloroplastic 
isoform X2 [Nicotiana sylvestris]
Length=749

 Score =   138 bits (348),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 74/148 (50%), Positives = 98/148 (66%), Gaps = 6/148 (4%)
 Frame = +3

Query  438  MAAYERDVVPMLSATDSQADE-SGYR--RFSYRARR-SLSIPANSYDTENNN--HFGFTG  599
            M   E D +PMLS++  Q++E  G++  RF+YR R  SLS+P +S D+  N+    G+TG
Sbjct  1    MGTSEIDEMPMLSSSYPQSNEIDGFQDQRFTYRTRSASLSMPMSSMDSFGNDSSFVGYTG  60

Query  600  PLRNERRTSYIQMSGPLYVGQTPTNNLRTSQVALGRKSTRQTLEIYPSTAIRESNDWEDY  779
            PLR+E RTS + MSGPLY+   P N+ R +  A+  K T  T E YPS    E N W + 
Sbjct  61   PLRSEGRTSLVHMSGPLYISHKPENSSRPTPTAVVHKPTLPTTEKYPSIGSGEQNGWTNN  120

Query  780  DYAQKNEHLLRSGRLGVCNDPYCTTCPT  863
            DY  KNEHLL+SG+LG+C+DPYCTTCPT
Sbjct  121  DYTGKNEHLLKSGQLGMCSDPYCTTCPT  148



>ref|XP_009761449.1| PREDICTED: probable cyclic nucleotide-gated ion channel 20, chloroplastic 
isoform X1 [Nicotiana sylvestris]
Length=767

 Score =   138 bits (348),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 74/148 (50%), Positives = 98/148 (66%), Gaps = 6/148 (4%)
 Frame = +3

Query  438  MAAYERDVVPMLSATDSQADE-SGYR--RFSYRARR-SLSIPANSYDTENNN--HFGFTG  599
            M   E D +PMLS++  Q++E  G++  RF+YR R  SLS+P +S D+  N+    G+TG
Sbjct  1    MGTSEIDEMPMLSSSYPQSNEIDGFQDQRFTYRTRSASLSMPMSSMDSFGNDSSFVGYTG  60

Query  600  PLRNERRTSYIQMSGPLYVGQTPTNNLRTSQVALGRKSTRQTLEIYPSTAIRESNDWEDY  779
            PLR+E RTS + MSGPLY+   P N+ R +  A+  K T  T E YPS    E N W + 
Sbjct  61   PLRSEGRTSLVHMSGPLYISHKPENSSRPTPTAVVHKPTLPTTEKYPSIGSGEQNGWTNN  120

Query  780  DYAQKNEHLLRSGRLGVCNDPYCTTCPT  863
            DY  KNEHLL+SG+LG+C+DPYCTTCPT
Sbjct  121  DYTGKNEHLLKSGQLGMCSDPYCTTCPT  148



>ref|XP_009617226.1| PREDICTED: probable cyclic nucleotide-gated ion channel 20, chloroplastic 
[Nicotiana tomentosiformis]
Length=490

 Score =   134 bits (338),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 72/148 (49%), Positives = 97/148 (66%), Gaps = 6/148 (4%)
 Frame = +3

Query  438  MAAYERDVVPMLSATDSQADE-SGYR--RFSYRARR-SLSIPANSYDT--ENNNHFGFTG  599
            M   E D +PMLS +  Q++E  G++  RF YR R  SLS+P +S D+  ++++  G+ G
Sbjct  1    MGTSEIDEMPMLSPSYPQSNEIDGFQNQRFVYRTRSASLSMPMSSMDSFGDDSSFVGYNG  60

Query  600  PLRNERRTSYIQMSGPLYVGQTPTNNLRTSQVALGRKSTRQTLEIYPSTAIRESNDWEDY  779
            PLR+E RTS + MSGPLY+   P N+ R +  A+  K T  T E YPS    E N W + 
Sbjct  61   PLRSEGRTSLVHMSGPLYISHKPENSSRPTPAAVVHKPTLPTTEKYPSIGSGEQNGWPNN  120

Query  780  DYAQKNEHLLRSGRLGVCNDPYCTTCPT  863
            DY  KNEHLL+SG+LG+C+DPYCTTCPT
Sbjct  121  DYTGKNEHLLKSGQLGMCSDPYCTTCPT  148



>gb|KDO46408.1| hypothetical protein CISIN_1g0040641mg, partial [Citrus sinensis]
 gb|KDO46409.1| hypothetical protein CISIN_1g0040641mg, partial [Citrus sinensis]
 gb|KDO46410.1| hypothetical protein CISIN_1g0040641mg, partial [Citrus sinensis]
Length=310

 Score =   131 bits (329),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 71/149 (48%), Positives = 92/149 (62%), Gaps = 7/149 (5%)
 Frame = +3

Query  438  MAAYERDVVPMLSATDSQADESGY----RRFSYRARR-SLSIPANSYDT--ENNNHFGFT  596
            MA  E+D +PMLS + S++ +  +    + F+ R R  S+SI  NS D+     N  G T
Sbjct  1    MAGDEKDEMPMLSDSQSKSSDRNFDFRLQTFASRTRSASMSITMNSTDSFEPEANLVGLT  60

Query  597  GPLRNERRTSYIQMSGPLYVGQTPTNNLRTSQVALGRKSTRQTLEIYPSTAIRESNDWED  776
            GPLRNERRT ++QMSGPLY  + P +  R +Q   G        E +PS +  + NDW D
Sbjct  61   GPLRNERRTQFLQMSGPLYSNRKPDHIFRRNQGVTGVNLVETKAEKFPSFSGMDQNDWPD  120

Query  777  YDYAQKNEHLLRSGRLGVCNDPYCTTCPT  863
              Y  KNEHLLRSG+LG+CNDPYCTTCPT
Sbjct  121  DRYEAKNEHLLRSGQLGMCNDPYCTTCPT  149



>ref|XP_006478110.1| PREDICTED: probable cyclic nucleotide-gated ion channel 20, chloroplastic-like 
isoform X3 [Citrus sinensis]
Length=691

 Score =   131 bits (329),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 71/149 (48%), Positives = 92/149 (62%), Gaps = 7/149 (5%)
 Frame = +3

Query  438  MAAYERDVVPMLSATDSQADESGY----RRFSYRARR-SLSIPANSYDT--ENNNHFGFT  596
            MA  E+D +PMLS + S++ +  +    + F+ R R  S+SI  NS D+     N  G T
Sbjct  1    MAGDEKDEMPMLSDSQSKSSDRNFDFRLQTFASRTRSASMSITMNSTDSFEPEANLVGLT  60

Query  597  GPLRNERRTSYIQMSGPLYVGQTPTNNLRTSQVALGRKSTRQTLEIYPSTAIRESNDWED  776
            GPLRNERRT ++QMSGPLY  + P +  R +Q   G        E +PS +  + NDW D
Sbjct  61   GPLRNERRTQFLQMSGPLYSNRKPDHIFRRNQGVTGVNLVETKAEKFPSFSGMDQNDWPD  120

Query  777  YDYAQKNEHLLRSGRLGVCNDPYCTTCPT  863
              Y  KNEHLLRSG+LG+CNDPYCTTCPT
Sbjct  121  DRYEAKNEHLLRSGQLGMCNDPYCTTCPT  149



>ref|XP_006478111.1| PREDICTED: probable cyclic nucleotide-gated ion channel 20, chloroplastic-like 
isoform X4 [Citrus sinensis]
Length=689

 Score =   131 bits (329),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 71/149 (48%), Positives = 92/149 (62%), Gaps = 7/149 (5%)
 Frame = +3

Query  438  MAAYERDVVPMLSATDSQADESGY----RRFSYRARR-SLSIPANSYDT--ENNNHFGFT  596
            MA  E+D +PMLS + S++ +  +    + F+ R R  S+SI  NS D+     N  G T
Sbjct  1    MAGDEKDEMPMLSDSQSKSSDRNFDFRLQTFASRTRSASMSITMNSTDSFEPEANLVGLT  60

Query  597  GPLRNERRTSYIQMSGPLYVGQTPTNNLRTSQVALGRKSTRQTLEIYPSTAIRESNDWED  776
            GPLRNERRT ++QMSGPLY  + P +  R +Q   G        E +PS +  + NDW D
Sbjct  61   GPLRNERRTQFLQMSGPLYSNRKPDHIFRRNQGVTGVNLVETKAEKFPSFSGMDQNDWPD  120

Query  777  YDYAQKNEHLLRSGRLGVCNDPYCTTCPT  863
              Y  KNEHLLRSG+LG+CNDPYCTTCPT
Sbjct  121  DRYEAKNEHLLRSGQLGMCNDPYCTTCPT  149



>ref|XP_006441354.1| hypothetical protein CICLE_v10018948mg [Citrus clementina]
 ref|XP_006441355.1| hypothetical protein CICLE_v10018948mg [Citrus clementina]
 gb|ESR54594.1| hypothetical protein CICLE_v10018948mg [Citrus clementina]
 gb|ESR54595.1| hypothetical protein CICLE_v10018948mg [Citrus clementina]
Length=776

 Score =   131 bits (329),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 71/149 (48%), Positives = 92/149 (62%), Gaps = 7/149 (5%)
 Frame = +3

Query  438  MAAYERDVVPMLSATDSQADESGY----RRFSYRARR-SLSIPANSYDT--ENNNHFGFT  596
            MA  E+D +PMLS + S++ +  +    + F+ R R  S+SI  NS D+     N  G T
Sbjct  1    MAGDEKDEMPMLSDSQSKSSDRNFDFRLQTFASRTRSASMSITMNSTDSFEPEANLVGLT  60

Query  597  GPLRNERRTSYIQMSGPLYVGQTPTNNLRTSQVALGRKSTRQTLEIYPSTAIRESNDWED  776
            GPLRNERRT ++QMSGPLY  + P +  R +Q   G        E +PS +  + NDW D
Sbjct  61   GPLRNERRTQFLQMSGPLYSNRKPDHIFRRNQGVTGVNLVETKAEKFPSFSGMDQNDWLD  120

Query  777  YDYAQKNEHLLRSGRLGVCNDPYCTTCPT  863
              Y  KNEHLLRSG+LG+CNDPYCTTCPT
Sbjct  121  NRYEAKNEHLLRSGQLGMCNDPYCTTCPT  149



>ref|XP_006478108.1| PREDICTED: probable cyclic nucleotide-gated ion channel 20, chloroplastic-like 
isoform X1 [Citrus sinensis]
 ref|XP_006478109.1| PREDICTED: probable cyclic nucleotide-gated ion channel 20, chloroplastic-like 
isoform X2 [Citrus sinensis]
Length=774

 Score =   130 bits (328),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 71/149 (48%), Positives = 92/149 (62%), Gaps = 7/149 (5%)
 Frame = +3

Query  438  MAAYERDVVPMLSATDSQADESGY----RRFSYRARR-SLSIPANSYDT--ENNNHFGFT  596
            MA  E+D +PMLS + S++ +  +    + F+ R R  S+SI  NS D+     N  G T
Sbjct  1    MAGDEKDEMPMLSDSQSKSSDRNFDFRLQTFASRTRSASMSITMNSTDSFEPEANLVGLT  60

Query  597  GPLRNERRTSYIQMSGPLYVGQTPTNNLRTSQVALGRKSTRQTLEIYPSTAIRESNDWED  776
            GPLRNERRT ++QMSGPLY  + P +  R +Q   G        E +PS +  + NDW D
Sbjct  61   GPLRNERRTQFLQMSGPLYSNRKPDHIFRRNQGVTGVNLVETKAEKFPSFSGMDQNDWPD  120

Query  777  YDYAQKNEHLLRSGRLGVCNDPYCTTCPT  863
              Y  KNEHLLRSG+LG+CNDPYCTTCPT
Sbjct  121  DRYEAKNEHLLRSGQLGMCNDPYCTTCPT  149



>ref|XP_010276306.1| PREDICTED: probable cyclic nucleotide-gated ion channel 20, chloroplastic 
[Nelumbo nucifera]
Length=281

 Score =   125 bits (314),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 70/149 (47%), Positives = 88/149 (59%), Gaps = 7/149 (5%)
 Frame = +3

Query  438  MAAYERDVVPMLSATDSQA-DESG---YRRFSYRAR---RSLSIPANSYDTENNNHFGFT  596
            M + E+D VPMLS T SQ+ DE     + RFS R R    S+++     D   +   G+T
Sbjct  1    MTSDEKDEVPMLSNTHSQSLDECQDVEFPRFSSRNRSVSMSIAMKPMELDESESKFVGYT  60

Query  597  GPLRNERRTSYIQMSGPLYVGQTPTNNLRTSQVALGRKSTRQTLEIYPSTAIRESNDWED  776
            GPLR ER T ++QMSGPLY+ + P N  +     + RK +    E YPS    +  +W  
Sbjct  61   GPLRTERSTPFVQMSGPLYITRKPENLNKPMHGLIDRKKSVLMEEHYPSQNGMDQKEWIV  120

Query  777  YDYAQKNEHLLRSGRLGVCNDPYCTTCPT  863
              YA KNEHLLRSG LGVCNDPYCTTCPT
Sbjct  121  ESYADKNEHLLRSGPLGVCNDPYCTTCPT  149



>ref|XP_010069491.1| PREDICTED: probable cyclic nucleotide-gated ion channel 20, chloroplastic 
[Eucalyptus grandis]
 gb|KCW57848.1| hypothetical protein EUGRSUZ_H00600 [Eucalyptus grandis]
Length=771

 Score =   129 bits (323),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 71/151 (47%), Positives = 95/151 (63%), Gaps = 9/151 (6%)
 Frame = +3

Query  438  MAAYERDVVPMLSATDSQA--DESGYRRFSYRAR---RSLSIPANSYDTENN--NHFGFT  596
            MA +ERD VPML     Q   D +  RR ++ +R    S+SIP +S ++  N  N  G+T
Sbjct  1    MADHERDEVPMLLEMQHQLSDDSNSSRRQAFVSRTRSASMSIPTSSMESHENIPNLVGYT  60

Query  597  GPLRNERRTSYIQMSGPLYVGQTPTNNLRTSQVALGRK--STRQTLEIYPSTAIRESNDW  770
            GPLR+E+R  + QMSGPLY+G  P   +R + V  GRK   ++   E +PS  I++  D 
Sbjct  61   GPLRSEKRMPFSQMSGPLYIGHGPEKAVRRNHVVPGRKLVESQYMREKFPSFGIKDRIDS  120

Query  771  EDYDYAQKNEHLLRSGRLGVCNDPYCTTCPT  863
             D  YA KNEHL RSG+LG+CNDPYCTTCP+
Sbjct  121  TDDHYAAKNEHLQRSGQLGLCNDPYCTTCPS  151



>ref|XP_002524633.1| Cyclic nucleotide-gated ion channel, putative [Ricinus communis]
 gb|EEF37758.1| Cyclic nucleotide-gated ion channel, putative [Ricinus communis]
Length=778

 Score =   128 bits (321),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 71/149 (48%), Positives = 88/149 (59%), Gaps = 7/149 (5%)
 Frame = +3

Query  438  MAAYERDVVPMLSATDSQA-DESGYRRFSYRARR----SLSIPANSYDTENN--NHFGFT  596
            MA+Y++D VPMLS    Q  DE+   RF     R    S+SIP N+ ++  N  N  G+T
Sbjct  1    MASYDKDEVPMLSDVHPQLLDENPDSRFQAFVSRTQSASISIPMNTMESYGNEANLVGYT  60

Query  597  GPLRNERRTSYIQMSGPLYVGQTPTNNLRTSQVALGRKSTRQTLEIYPSTAIRESNDWED  776
            GPLR+ERR    QMSGP+Y  +    N R +     RK      E  PS +  + +DW D
Sbjct  61   GPLRSERRAQMNQMSGPIYSNRKADKNFRLNHGVPNRKVAESKAEKIPSFSKMDQHDWAD  120

Query  777  YDYAQKNEHLLRSGRLGVCNDPYCTTCPT  863
              Y  KNEHLLRSG+LGVCNDPYCTTCPT
Sbjct  121  DKYTGKNEHLLRSGQLGVCNDPYCTTCPT  149



>ref|XP_008240379.1| PREDICTED: probable cyclic nucleotide-gated ion channel 20, chloroplastic 
[Prunus mume]
Length=783

 Score =   127 bits (318),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 74/154 (48%), Positives = 99/154 (64%), Gaps = 10/154 (6%)
 Frame = +3

Query  438  MAAYERDVVPMLSATDSQ-ADES---GYRRFSYRARR-SLSIPANSYDTE---NNNHFGF  593
            MA YER+ VPMLS T  Q +DE+    + RF+ R R  S+SIP +S D       +    
Sbjct  1    MAGYEREEVPMLSGTHPQLSDENVHLQFERFTSRTRSASVSIPMDSVDLSYEREASLVSH  60

Query  594  TGPLRNERRTSYIQMSGPLYVGQTPTNNLRTSQVALGRK-STRQTLEIYPSTAIRESNDW  770
            TGPLR++ +T ++ MSGPLY  + P N LR +Q   G++ S     E +PST +   N+W
Sbjct  61   TGPLRSQTKTPFLPMSGPLY-RRRPDNILRPTQAVPGQEESVEPAGEKFPSTNVTNQNEW  119

Query  771  EDYDYAQKNEHLLRSGRLGVCNDPYCTTCPTIDI  872
             D +YA KNEHLLRSG+LG+CNDPYCTTCPT ++
Sbjct  120  TDDNYAGKNEHLLRSGQLGMCNDPYCTTCPTYNL  153



>emb|CDO98619.1| unnamed protein product [Coffea canephora]
Length=781

 Score =   126 bits (317),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 70/147 (48%), Positives = 94/147 (64%), Gaps = 6/147 (4%)
 Frame = +3

Query  438  MAAYERDVVPMLSATDSQADE---SGYRRFSYRARRSLSIPANS--YDTENNNHFGFTGP  602
            MAA ERDV  +LSATDSQ DE   S + R +YR+  SLSIP +S  ++   N+  G +  
Sbjct  1    MAASERDVTHLLSATDSQVDEQDGSQFCRLTYRSA-SLSIPMDSTEFNDSENSLVGRSVY  59

Query  603  LRNERRTSYIQMSGPLYVGQTPTNNLRTSQVALGRKSTRQTLEIYPSTAIRESNDWEDYD  782
            L NER++SY+QMSGPLY+       L   Q A+ ++ T   +  YP    RE   W D  
Sbjct  60   LENERKSSYLQMSGPLYISSGDGIVLGPMQSAVAQQPTEAPVVRYPPLNGRERKVWPDKS  119

Query  783  YAQKNEHLLRSGRLGVCNDPYCTTCPT  863
            YA KN+HL++SG+LG+C+DPYCTTCP+
Sbjct  120  YASKNDHLIKSGQLGMCDDPYCTTCPS  146



>ref|XP_011072038.1| PREDICTED: probable cyclic nucleotide-gated ion channel 20, chloroplastic 
isoform X2 [Sesamum indicum]
Length=733

 Score =   126 bits (316),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 69/150 (46%), Positives = 94/150 (63%), Gaps = 8/150 (5%)
 Frame = +3

Query  438  MAAYERDVVPMLSATDSQADE-----SGYRRFSYRARR-SLSIPANSYDT--ENNNHFGF  593
            M A E+D  PMLSA   ++D+     S  R FS R R  S+SIPAN  D+  + NN  GF
Sbjct  1    MDASEKDKTPMLSAMHFKSDDQDDSRSRSRIFSTRMRSASMSIPANVLDSSEQENNLVGF  60

Query  594  TGPLRNERRTSYIQMSGPLYVGQTPTNNLRTSQVALGRKSTRQTLEIYPSTAIRESNDWE  773
            TGPL+N R+ S +QMSGPLY+ +      +  Q+ L + +    ++ YPS    ++NDW 
Sbjct  61   TGPLKNGRQVSSVQMSGPLYISRNHEVIFQPPQIPLEQNANEPKIDRYPSIDGMDNNDWP  120

Query  774  DYDYAQKNEHLLRSGRLGVCNDPYCTTCPT  863
              +Y  KN+ LL+SG+LG+CNDPYCTTCPT
Sbjct  121  LDNYEAKNDRLLKSGQLGMCNDPYCTTCPT  150



>ref|XP_011072036.1| PREDICTED: probable cyclic nucleotide-gated ion channel 20, chloroplastic 
isoform X1 [Sesamum indicum]
 ref|XP_011072037.1| PREDICTED: probable cyclic nucleotide-gated ion channel 20, chloroplastic 
isoform X1 [Sesamum indicum]
Length=779

 Score =   126 bits (316),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 69/150 (46%), Positives = 94/150 (63%), Gaps = 8/150 (5%)
 Frame = +3

Query  438  MAAYERDVVPMLSATDSQADE-----SGYRRFSYRARR-SLSIPANSYDT--ENNNHFGF  593
            M A E+D  PMLSA   ++D+     S  R FS R R  S+SIPAN  D+  + NN  GF
Sbjct  1    MDASEKDKTPMLSAMHFKSDDQDDSRSRSRIFSTRMRSASMSIPANVLDSSEQENNLVGF  60

Query  594  TGPLRNERRTSYIQMSGPLYVGQTPTNNLRTSQVALGRKSTRQTLEIYPSTAIRESNDWE  773
            TGPL+N R+ S +QMSGPLY+ +      +  Q+ L + +    ++ YPS    ++NDW 
Sbjct  61   TGPLKNGRQVSSVQMSGPLYISRNHEVIFQPPQIPLEQNANEPKIDRYPSIDGMDNNDWP  120

Query  774  DYDYAQKNEHLLRSGRLGVCNDPYCTTCPT  863
              +Y  KN+ LL+SG+LG+CNDPYCTTCPT
Sbjct  121  LDNYEAKNDRLLKSGQLGMCNDPYCTTCPT  150



>ref|XP_003529780.1| PREDICTED: probable cyclic nucleotide-gated ion channel 20, chloroplastic-like 
isoform X1 [Glycine max]
 ref|XP_006583105.1| PREDICTED: probable cyclic nucleotide-gated ion channel 20, chloroplastic-like 
isoform X10 [Glycine max]
Length=217

 Score =   117 bits (292),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 69/149 (46%), Positives = 91/149 (61%), Gaps = 8/149 (5%)
 Frame = +3

Query  438  MAAYERDVVPMLSATDSQ-ADE---SGYRRFSYRARR-SLSIPANSYDT--ENNNHFGFT  596
            MA +E+D VPMLS T +Q +DE   S +RR   R R  S+SIP  S ++  +  +  G T
Sbjct  1    MAHFEKDEVPMLSETHAQLSDEVVDSSFRRLVSRTRSASISIPMASLESYEKETSLVGHT  60

Query  597  GPLRNERRTSYIQMSGPLYVGQTPTNNLRTSQVALGRKSTRQTLEIYPSTAIRESNDWED  776
            GPL + R+T ++QMSGPLY      N  R + VA   K      E + +    + N W D
Sbjct  61   GPLCSVRKTPFVQMSGPLYATNGTGNLSRQNIVATRTKVVESKTEKFSTFNGTDENRW-D  119

Query  777  YDYAQKNEHLLRSGRLGVCNDPYCTTCPT  863
             DY +KNEHL+RSG+LG+CNDPYCTTCPT
Sbjct  120  NDYNRKNEHLMRSGQLGMCNDPYCTTCPT  148



>ref|XP_010069489.1| PREDICTED: probable cyclic nucleotide-gated ion channel 20, chloroplastic 
[Eucalyptus grandis]
 gb|KCW57852.1| hypothetical protein EUGRSUZ_H00605 [Eucalyptus grandis]
Length=771

 Score =   120 bits (302),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 69/151 (46%), Positives = 91/151 (60%), Gaps = 9/151 (6%)
 Frame = +3

Query  438  MAAYERDVVPMLSATDSQADE----SGYRRFSYRARR-SLSIPANSYDTENN--NHFGFT  596
            MA +ERD VPML     Q  +    S +R F  R R  S SIP +S ++  N  N  G+T
Sbjct  1    MADHERDEVPMLLEMQHQLSDDYNSSRHRAFVSRTRSASTSIPMSSMESHENIPNLVGYT  60

Query  597  GPLRNERRTSYIQMSGPLYVGQTPTNNLRTSQVALGRK--STRQTLEIYPSTAIRESNDW  770
            GPLR+E+R  + Q+SGPLY+   P   +R + V   RK   ++   E +PS  I++  D 
Sbjct  61   GPLRSEKRMPFSQLSGPLYISHGPEKAVRRNHVVPVRKLVESQYMREKFPSFGIKDRIDS  120

Query  771  EDYDYAQKNEHLLRSGRLGVCNDPYCTTCPT  863
             D  YA KNEHL RSG+LG+CNDPYCTTCP+
Sbjct  121  TDDHYAAKNEHLQRSGQLGLCNDPYCTTCPS  151



>ref|XP_006583097.1| PREDICTED: probable cyclic nucleotide-gated ion channel 20, chloroplastic-like 
isoform X2 [Glycine max]
 ref|XP_006583098.1| PREDICTED: probable cyclic nucleotide-gated ion channel 20, chloroplastic-like 
isoform X3 [Glycine max]
 ref|XP_006583099.1| PREDICTED: probable cyclic nucleotide-gated ion channel 20, chloroplastic-like 
isoform X4 [Glycine max]
 ref|XP_006583100.1| PREDICTED: probable cyclic nucleotide-gated ion channel 20, chloroplastic-like 
isoform X5 [Glycine max]
 ref|XP_006583101.1| PREDICTED: probable cyclic nucleotide-gated ion channel 20, chloroplastic-like 
isoform X6 [Glycine max]
 ref|XP_006583102.1| PREDICTED: probable cyclic nucleotide-gated ion channel 20, chloroplastic-like 
isoform X7 [Glycine max]
 ref|XP_006583103.1| PREDICTED: probable cyclic nucleotide-gated ion channel 20, chloroplastic-like 
isoform X8 [Glycine max]
 ref|XP_006583104.1| PREDICTED: probable cyclic nucleotide-gated ion channel 20, chloroplastic-like 
isoform X9 [Glycine max]
Length=307

 Score =   116 bits (291),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 69/149 (46%), Positives = 91/149 (61%), Gaps = 8/149 (5%)
 Frame = +3

Query  438  MAAYERDVVPMLSATDSQ-ADE---SGYRRFSYRARR-SLSIPANSYDT--ENNNHFGFT  596
            MA +E+D VPMLS T +Q +DE   S +RR   R R  S+SIP  S ++  +  +  G T
Sbjct  1    MAHFEKDEVPMLSETHAQLSDEVVDSSFRRLVSRTRSASISIPMASLESYEKETSLVGHT  60

Query  597  GPLRNERRTSYIQMSGPLYVGQTPTNNLRTSQVALGRKSTRQTLEIYPSTAIRESNDWED  776
            GPL + R+T ++QMSGPLY      N  R + VA   K      E + +    + N W D
Sbjct  61   GPLCSVRKTPFVQMSGPLYATNGTGNLSRQNIVATRTKVVESKTEKFSTFNGTDENRW-D  119

Query  777  YDYAQKNEHLLRSGRLGVCNDPYCTTCPT  863
             DY +KNEHL+RSG+LG+CNDPYCTTCPT
Sbjct  120  NDYNRKNEHLMRSGQLGMCNDPYCTTCPT  148



>ref|XP_006587442.1| PREDICTED: probable cyclic nucleotide-gated ion channel 20, chloroplastic-like 
isoform X4 [Glycine max]
Length=706

 Score =   119 bits (297),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 69/149 (46%), Positives = 92/149 (62%), Gaps = 8/149 (5%)
 Frame = +3

Query  438  MAAYERDVVPMLSATDSQ-ADE---SGYRRFSYRARR-SLSIPANSYDT--ENNNHFGFT  596
            MA +E+D VPMLS T +Q +DE   S +RR   R +  S+SIP  S ++  +  +  G T
Sbjct  1    MAHFEKDEVPMLSETHAQLSDEVVDSNFRRLVSRTQSASISIPMASLESYEKETSLVGHT  60

Query  597  GPLRNERRTSYIQMSGPLYVGQTPTNNLRTSQVALGRKSTRQTLEIYPSTAIRESNDWED  776
            GPLR+ R+T ++QMSGPLY      N  R + VA   K      E + +    + N W D
Sbjct  61   GPLRSVRKTPFVQMSGPLYATNGTGNLSRQNIVATRTKVVESKTEKFSTFNGTDENHW-D  119

Query  777  YDYAQKNEHLLRSGRLGVCNDPYCTTCPT  863
             DY +KNEHL+RSG+LG+CNDPYCTTCPT
Sbjct  120  NDYNRKNEHLMRSGQLGMCNDPYCTTCPT  148



>ref|XP_006587443.1| PREDICTED: probable cyclic nucleotide-gated ion channel 20, chloroplastic-like 
isoform X5 [Glycine max]
Length=673

 Score =   119 bits (297),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 69/149 (46%), Positives = 92/149 (62%), Gaps = 8/149 (5%)
 Frame = +3

Query  438  MAAYERDVVPMLSATDSQ-ADE---SGYRRFSYRARR-SLSIPANSYDT--ENNNHFGFT  596
            MA +E+D VPMLS T +Q +DE   S +RR   R +  S+SIP  S ++  +  +  G T
Sbjct  1    MAHFEKDEVPMLSETHAQLSDEVVDSNFRRLVSRTQSASISIPMASLESYEKETSLVGHT  60

Query  597  GPLRNERRTSYIQMSGPLYVGQTPTNNLRTSQVALGRKSTRQTLEIYPSTAIRESNDWED  776
            GPLR+ R+T ++QMSGPLY      N  R + VA   K      E + +    + N W D
Sbjct  61   GPLRSVRKTPFVQMSGPLYATNGTGNLSRQNIVATRTKVVESKTEKFSTFNGTDENHW-D  119

Query  777  YDYAQKNEHLLRSGRLGVCNDPYCTTCPT  863
             DY +KNEHL+RSG+LG+CNDPYCTTCPT
Sbjct  120  NDYNRKNEHLMRSGQLGMCNDPYCTTCPT  148



>ref|XP_007210351.1| hypothetical protein PRUPE_ppa001680mg [Prunus persica]
 gb|EMJ11550.1| hypothetical protein PRUPE_ppa001680mg [Prunus persica]
Length=781

 Score =   119 bits (298),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 70/154 (45%), Positives = 95/154 (62%), Gaps = 10/154 (6%)
 Frame = +3

Query  438  MAAYERDVVPMLSATDSQ-ADESGYRRFSYRARR----SLSIPANSYDTENNNHFGF---  593
            MA YERD VPMLS T  Q +DE+ + +F     R    S+SIP +S D+           
Sbjct  1    MAGYERDEVPMLSDTHPQLSDENVHLQFETFMSRTRSASVSIPMDSMDSSFEREASLVSH  60

Query  594  TGPLRNERRTSYIQMSGPLYVGQTPTNNLRTSQVALGRK-STRQTLEIYPSTAIRESNDW  770
            TGPLR+  +T ++ MSGPLY  + P N  R +Q   G++ + +   E +PST +   N+ 
Sbjct  61   TGPLRSRTKTPFLPMSGPLY-NRRPDNIFRLTQAVPGQEEAVKPAGEKFPSTNVTNQNEG  119

Query  771  EDYDYAQKNEHLLRSGRLGVCNDPYCTTCPTIDI  872
             D +YA KNEHLLRSG+LG+CNDPYCTTCPT ++
Sbjct  120  TDDNYAGKNEHLLRSGQLGMCNDPYCTTCPTYNL  153



>ref|XP_006587441.1| PREDICTED: probable cyclic nucleotide-gated ion channel 20, chloroplastic-like 
isoform X3 [Glycine max]
Length=724

 Score =   119 bits (297),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 69/149 (46%), Positives = 92/149 (62%), Gaps = 8/149 (5%)
 Frame = +3

Query  438  MAAYERDVVPMLSATDSQ-ADE---SGYRRFSYRARR-SLSIPANSYDT--ENNNHFGFT  596
            MA +E+D VPMLS T +Q +DE   S +RR   R +  S+SIP  S ++  +  +  G T
Sbjct  1    MAHFEKDEVPMLSETHAQLSDEVVDSNFRRLVSRTQSASISIPMASLESYEKETSLVGHT  60

Query  597  GPLRNERRTSYIQMSGPLYVGQTPTNNLRTSQVALGRKSTRQTLEIYPSTAIRESNDWED  776
            GPLR+ R+T ++QMSGPLY      N  R + VA   K      E + +    + N W D
Sbjct  61   GPLRSVRKTPFVQMSGPLYATNGTGNLSRQNIVATRTKVVESKTEKFSTFNGTDENHW-D  119

Query  777  YDYAQKNEHLLRSGRLGVCNDPYCTTCPT  863
             DY +KNEHL+RSG+LG+CNDPYCTTCPT
Sbjct  120  NDYNRKNEHLMRSGQLGMCNDPYCTTCPT  148



>ref|XP_012079190.1| PREDICTED: probable cyclic nucleotide-gated ion channel 20, chloroplastic 
[Jatropha curcas]
 gb|KDP45796.1| hypothetical protein JCGZ_17403 [Jatropha curcas]
Length=769

 Score =   118 bits (296),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 69/150 (46%), Positives = 87/150 (58%), Gaps = 18/150 (12%)
 Frame = +3

Query  438  MAAYERDVVPMLSAT-----DSQADESGYRRFSYRARR-SLSIPANSYDTENN--NHFGF  593
            MA+Y++D VPMLS       D   D S ++ F  R R  S+SIP +S D+  N  N  G+
Sbjct  1    MASYDKDEVPMLSDVQPRLFDENVD-SRFQAFISRTRSASISIPMDSMDSYENEVNLVGY  59

Query  594  TGPLRNERRTSYIQMSGPLYVGQTPTNNLRTSQVALGRKSTRQTLEIYPSTAIRESNDWE  773
            TGPLR+ERR   IQMSGP+Y  +    +          K      E +PS    +  DW 
Sbjct  60   TGPLRSERRVPMIQMSGPIYSNRKADKS---------HKIVEPKAEKFPSFNGMDQQDWT  110

Query  774  DYDYAQKNEHLLRSGRLGVCNDPYCTTCPT  863
            +  YA KNEHLLRSG+LG+CNDPYCTTCPT
Sbjct  111  NDKYAGKNEHLLRSGQLGICNDPYCTTCPT  140



>ref|XP_003534111.1| PREDICTED: probable cyclic nucleotide-gated ion channel 20, chloroplastic-like 
isoform X1 [Glycine max]
 ref|XP_006587440.1| PREDICTED: probable cyclic nucleotide-gated ion channel 20, chloroplastic-like 
isoform X2 [Glycine max]
Length=770

 Score =   118 bits (296),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 69/149 (46%), Positives = 92/149 (62%), Gaps = 8/149 (5%)
 Frame = +3

Query  438  MAAYERDVVPMLSATDSQ-ADE---SGYRRFSYRARR-SLSIPANSYDT--ENNNHFGFT  596
            MA +E+D VPMLS T +Q +DE   S +RR   R +  S+SIP  S ++  +  +  G T
Sbjct  1    MAHFEKDEVPMLSETHAQLSDEVVDSNFRRLVSRTQSASISIPMASLESYEKETSLVGHT  60

Query  597  GPLRNERRTSYIQMSGPLYVGQTPTNNLRTSQVALGRKSTRQTLEIYPSTAIRESNDWED  776
            GPLR+ R+T ++QMSGPLY      N  R + VA   K      E + +    + N W D
Sbjct  61   GPLRSVRKTPFVQMSGPLYATNGTGNLSRQNIVATRTKVVESKTEKFSTFNGTDENHW-D  119

Query  777  YDYAQKNEHLLRSGRLGVCNDPYCTTCPT  863
             DY +KNEHL+RSG+LG+CNDPYCTTCPT
Sbjct  120  NDYNRKNEHLMRSGQLGMCNDPYCTTCPT  148



>gb|KHN43679.1| Putative cyclic nucleotide-gated ion channel 20, chloroplastic 
[Glycine soja]
Length=721

 Score =   118 bits (296),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 69/149 (46%), Positives = 92/149 (62%), Gaps = 8/149 (5%)
 Frame = +3

Query  438  MAAYERDVVPMLSATDSQ-ADE---SGYRRFSYRARR-SLSIPANSYDT--ENNNHFGFT  596
            MA +E+D VPMLS T +Q +DE   S +RR   R +  S+SIP  S ++  +  +  G T
Sbjct  1    MAHFEKDEVPMLSETHAQLSDEVVDSNFRRLVSRTQSASISIPMASLESYEKETSLVGHT  60

Query  597  GPLRNERRTSYIQMSGPLYVGQTPTNNLRTSQVALGRKSTRQTLEIYPSTAIRESNDWED  776
            GPLR+ R+T ++QMSGPLY      N  R + VA   K      E + +    + N W D
Sbjct  61   GPLRSVRKTPFVQMSGPLYATNGTGNLSRQNIVATRTKVVESKTEKFSTFNGTDENRW-D  119

Query  777  YDYAQKNEHLLRSGRLGVCNDPYCTTCPT  863
             DY +KNEHL+RSG+LG+CNDPYCTTCPT
Sbjct  120  NDYNRKNEHLMRSGQLGMCNDPYCTTCPT  148



>ref|XP_006599725.1| PREDICTED: probable cyclic nucleotide-gated ion channel 20, chloroplastic 
isoform X4 [Glycine max]
Length=675

 Score =   118 bits (295),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 69/149 (46%), Positives = 91/149 (61%), Gaps = 8/149 (5%)
 Frame = +3

Query  438  MAAYERDVVPMLSATDSQ-ADE---SGYRRFSYRARR-SLSIPANSYDT--ENNNHFGFT  596
            MA +E+D VPMLS T ++ +DE   S +RR   R R  S+SIP  S ++  +  N  G T
Sbjct  1    MAHFEKDEVPMLSETHARLSDEVVDSNFRRLVSRTRSASISIPMASLESYEKETNLVGHT  60

Query  597  GPLRNERRTSYIQMSGPLYVGQTPTNNLRTSQVALGRKSTRQTLEIYPSTAIRESNDWED  776
            GPLR+ R+T ++QMSGPLY      N  R + VA G K      E + +      N W D
Sbjct  61   GPLRSVRKTPFVQMSGPLYATNGTGNLSRQNIVATGTKVVESKTEKFSTFDGTNENRW-D  119

Query  777  YDYAQKNEHLLRSGRLGVCNDPYCTTCPT  863
             DY +KNEHL+RSG+LG+CNDP CTTCP+
Sbjct  120  NDYDRKNEHLMRSGQLGMCNDPCCTTCPS  148



>ref|XP_004299484.1| PREDICTED: probable cyclic nucleotide-gated ion channel 20, chloroplastic 
[Fragaria vesca subsp. vesca]
Length=777

 Score =   118 bits (296),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 73/154 (47%), Positives = 91/154 (59%), Gaps = 12/154 (8%)
 Frame = +3

Query  438  MAAYERDVVPMLSATDSQADESGY----RRFSYRARR-SLSIPANS---YDTENNNHFGF  593
            MA  ERD VPMLS T  Q+          RF  R R  S+SIP NS   Y+ +  N  G 
Sbjct  1    MADDERDEVPMLSDTHPQSSNEHLALQIERFISRTRSASISIPMNSMDSYERDEVNLVGH  60

Query  594  TGPLRNERRTSYIQMSGPLYVGQT-PTNNLRTSQVALGRKS--TRQTLEIYPSTAIRESN  764
            TGPLR   +T ++ MSGPLY  Q  P N LR  Q    +++  T+ T E +P T     +
Sbjct  61   TGPLRTHTKTPFLAMSGPLYANQGRPDNVLRLPQGVTDQEAAETQTTAEKFPYTNTTNES  120

Query  765  DWEDYDYAQKNEHLLRSGRLGVCNDPYCTTCPTI  866
            +W D +YA KN HLLRSG+LG+CNDPYCTTCPT+
Sbjct  121  EWND-EYAAKNGHLLRSGQLGMCNDPYCTTCPTV  153



>ref|XP_006599724.1| PREDICTED: probable cyclic nucleotide-gated ion channel 20, chloroplastic 
isoform X3 [Glycine max]
Length=742

 Score =   117 bits (294),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 69/149 (46%), Positives = 91/149 (61%), Gaps = 8/149 (5%)
 Frame = +3

Query  438  MAAYERDVVPMLSATDSQ-ADE---SGYRRFSYRARR-SLSIPANSYDT--ENNNHFGFT  596
            MA +E+D VPMLS T ++ +DE   S +RR   R R  S+SIP  S ++  +  N  G T
Sbjct  1    MAHFEKDEVPMLSETHARLSDEVVDSNFRRLVSRTRSASISIPMASLESYEKETNLVGHT  60

Query  597  GPLRNERRTSYIQMSGPLYVGQTPTNNLRTSQVALGRKSTRQTLEIYPSTAIRESNDWED  776
            GPLR+ R+T ++QMSGPLY      N  R + VA G K      E + +      N W D
Sbjct  61   GPLRSVRKTPFVQMSGPLYATNGTGNLSRQNIVATGTKVVESKTEKFSTFDGTNENRW-D  119

Query  777  YDYAQKNEHLLRSGRLGVCNDPYCTTCPT  863
             DY +KNEHL+RSG+LG+CNDP CTTCP+
Sbjct  120  NDYDRKNEHLMRSGQLGMCNDPCCTTCPS  148



>ref|XP_003548315.1| PREDICTED: probable cyclic nucleotide-gated ion channel 20, chloroplastic 
isoform X1 [Glycine max]
 ref|XP_006599723.1| PREDICTED: probable cyclic nucleotide-gated ion channel 20, chloroplastic 
isoform X2 [Glycine max]
Length=772

 Score =   117 bits (294),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 69/149 (46%), Positives = 91/149 (61%), Gaps = 8/149 (5%)
 Frame = +3

Query  438  MAAYERDVVPMLSATDSQ-ADE---SGYRRFSYRARR-SLSIPANSYDT--ENNNHFGFT  596
            MA +E+D VPMLS T ++ +DE   S +RR   R R  S+SIP  S ++  +  N  G T
Sbjct  1    MAHFEKDEVPMLSETHARLSDEVVDSNFRRLVSRTRSASISIPMASLESYEKETNLVGHT  60

Query  597  GPLRNERRTSYIQMSGPLYVGQTPTNNLRTSQVALGRKSTRQTLEIYPSTAIRESNDWED  776
            GPLR+ R+T ++QMSGPLY      N  R + VA G K      E + +      N W D
Sbjct  61   GPLRSVRKTPFVQMSGPLYATNGTGNLSRQNIVATGTKVVESKTEKFSTFDGTNENRW-D  119

Query  777  YDYAQKNEHLLRSGRLGVCNDPYCTTCPT  863
             DY +KNEHL+RSG+LG+CNDP CTTCP+
Sbjct  120  NDYDRKNEHLMRSGQLGMCNDPCCTTCPS  148



>ref|XP_011035549.1| PREDICTED: probable cyclic nucleotide-gated ion channel 20, chloroplastic 
isoform X2 [Populus euphratica]
Length=785

 Score =   117 bits (293),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 66/149 (44%), Positives = 88/149 (59%), Gaps = 8/149 (5%)
 Frame = +3

Query  438  MAAYERDVVPMLSATDSQA-DE---SGYRRFSYRARR-SLSIPANSYDT--ENNNHFGFT  596
            MA +++D +PMLS T  ++ DE   S +R F  R R  S SIP +S ++     N  GFT
Sbjct  1    MANHDKDDIPMLSDTHPKSVDENVDSRFRPFLSRTRSASTSIPLDSMESYGSETNIVGFT  60

Query  597  GPLRNERRTSYIQMSGPLYVGQTPTNNLRTSQVALGRKSTRQTLEIYPSTAIRESNDWED  776
            GPLR+ R+   +QMSGPLY+ +   N           K      E YPS   R+ NDW+D
Sbjct  61   GPLRSARKAPLVQMSGPLYINRNTENLFLAKHGVTAHKKVEPKPEKYPSLNGRDKNDWDD  120

Query  777  YDYAQKNEHLLRSGRLGVCNDPYCTTCPT  863
             +Y   N HL+RSG+LG+CNDPYCTTCP+
Sbjct  121  -NYTATNAHLMRSGQLGMCNDPYCTTCPS  148



>ref|XP_011035548.1| PREDICTED: probable cyclic nucleotide-gated ion channel 20, chloroplastic 
isoform X1 [Populus euphratica]
Length=799

 Score =   117 bits (293),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 66/149 (44%), Positives = 88/149 (59%), Gaps = 8/149 (5%)
 Frame = +3

Query  438  MAAYERDVVPMLSATDSQA-DE---SGYRRFSYRARR-SLSIPANSYDT--ENNNHFGFT  596
            MA +++D +PMLS T  ++ DE   S +R F  R R  S SIP +S ++     N  GFT
Sbjct  1    MANHDKDDIPMLSDTHPKSVDENVDSRFRPFLSRTRSASTSIPLDSMESYGSETNIVGFT  60

Query  597  GPLRNERRTSYIQMSGPLYVGQTPTNNLRTSQVALGRKSTRQTLEIYPSTAIRESNDWED  776
            GPLR+ R+   +QMSGPLY+ +   N           K      E YPS   R+ NDW+D
Sbjct  61   GPLRSARKAPLVQMSGPLYINRNTENLFLAKHGVTAHKKVEPKPEKYPSLNGRDKNDWDD  120

Query  777  YDYAQKNEHLLRSGRLGVCNDPYCTTCPT  863
             +Y   N HL+RSG+LG+CNDPYCTTCP+
Sbjct  121  -NYTATNAHLMRSGQLGMCNDPYCTTCPS  148



>gb|KHN24538.1| Putative cyclic nucleotide-gated ion channel 20, chloroplastic 
[Glycine soja]
Length=772

 Score =   116 bits (290),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 68/149 (46%), Positives = 90/149 (60%), Gaps = 8/149 (5%)
 Frame = +3

Query  438  MAAYERDVVPMLSATDSQ-ADE---SGYRRFSYRARR-SLSIPANSYDT--ENNNHFGFT  596
            MA +E+D VPMLS T ++ +DE   S +RR   R R  S+SIP  S ++  +  N  G T
Sbjct  1    MAHFEKDEVPMLSETHARLSDEVVDSNFRRLVSRTRSASISIPMASLESYEKETNLVGHT  60

Query  597  GPLRNERRTSYIQMSGPLYVGQTPTNNLRTSQVALGRKSTRQTLEIYPSTAIRESNDWED  776
            GPLR+ R+T ++QMSGPLY      N  R + V  G K      E + +      N W D
Sbjct  61   GPLRSVRKTPFVQMSGPLYATNGTGNLSRQNIVVTGTKVVESKTEKFSTFDGTNENRW-D  119

Query  777  YDYAQKNEHLLRSGRLGVCNDPYCTTCPT  863
             DY +KNEHL+RSG+LG+CNDP CTTCP+
Sbjct  120  NDYDRKNEHLMRSGQLGMCNDPCCTTCPS  148



>emb|CAN68349.1| hypothetical protein VITISV_032026 [Vitis vinifera]
Length=261

 Score =   111 bits (277),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 74/157 (47%), Positives = 90/157 (57%), Gaps = 22/157 (14%)
 Frame = +3

Query  432  LKMAAYERDVVPMLSATDSQADE----SGYRRFSYRARR-SLSIPANS---YDTENN--N  581
            L+M+  E+D  PMLS   SQ  +    S   R + R R  S SIP NS   Y TE+N  N
Sbjct  58   LEMSDLEKDETPMLSDAYSQYLDKPRVSHSDRLTSRNRSASSSIPMNSMESYQTESNLVN  117

Query  582  HFGFTGPLRNERRTSYIQMSGPLYVGQ---TPTNNLRTSQVALGRKSTRQTLEIYPSTAI  752
            H   TGPLRNE++T +I MSGPL   +    PT  +R      G +      E +PS   
Sbjct  118  H---TGPLRNEKKTPFIPMSGPLLKSEGFFPPTPGVR------GHRKAEPRAEKFPSFNG  168

Query  753  RESNDWEDYDYAQKNEHLLRSGRLGVCNDPYCTTCPT  863
             E N+W   +YA KNEHLLRSG+LGVCNDPYCT CPT
Sbjct  169  MEWNNWPHNNYAGKNEHLLRSGQLGVCNDPYCTICPT  205



>ref|XP_007152601.1| hypothetical protein PHAVU_004G143800g [Phaseolus vulgaris]
 gb|ESW24595.1| hypothetical protein PHAVU_004G143800g [Phaseolus vulgaris]
Length=767

 Score =   115 bits (288),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 65/149 (44%), Positives = 88/149 (59%), Gaps = 8/149 (5%)
 Frame = +3

Query  438  MAAYERDVVPMLSATDSQADE----SGYRRFSYRARR-SLSIPANSYDT--ENNNHFGFT  596
            MA +E+D VPMLS T +Q  +    S +RR   R R  S+SIP  S ++  +  +  G T
Sbjct  1    MADFEKDEVPMLSETRAQLSDDVVDSNFRRLVSRTRSASMSIPMASLESYEKETSLVGHT  60

Query  597  GPLRNERRTSYIQMSGPLYVGQTPTNNLRTSQVALGRKSTRQTLEIYPSTAIRESNDWED  776
            GPLR+  +T ++ MSGPLY     +N    +  A+G +      E + S      N W D
Sbjct  61   GPLRSVSKTPFVHMSGPLYATHGTSNLSGQNSAAIGNRVVESKTEKFSSFNGANENRW-D  119

Query  777  YDYAQKNEHLLRSGRLGVCNDPYCTTCPT  863
             DY +KNEHL+RSG+LG+CNDPYCTTCPT
Sbjct  120  NDYDRKNEHLMRSGQLGMCNDPYCTTCPT  148



>ref|XP_011035551.1| PREDICTED: probable cyclic nucleotide-gated ion channel 20, chloroplastic 
[Populus euphratica]
Length=763

 Score =   115 bits (288),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 66/148 (45%), Positives = 87/148 (59%), Gaps = 8/148 (5%)
 Frame = +3

Query  438  MAAYERDVVPMLSATDSQA-DE---SGYRRFSYRARR-SLSIPANSYDT--ENNNHFGFT  596
            MA + +D +PMLS T  ++ DE   S ++ F  R R  S SIP +S ++     N  GFT
Sbjct  1    MANHNKDDIPMLSDTHPKSVDENVDSRFQPFLSRTRSASTSIPLDSMESYGSETNIVGFT  60

Query  597  GPLRNERRTSYIQMSGPLYVGQTPTNNLRTSQVALGRKSTRQTLEIYPSTAIRESNDWED  776
            GPLR+ R+   +QMSGPLY+ +   N          RK      E YPS   R+ NDW+D
Sbjct  61   GPLRSARKAPLVQMSGPLYINRNTENLFLAKHGVTTRKKVDSKPEKYPSLNGRDKNDWDD  120

Query  777  YDYAQKNEHLLRSGRLGVCNDPYCTTCP  860
             +Y   N HL+RSG+LG+CNDPYCTTCP
Sbjct  121  -NYTATNAHLMRSGQLGMCNDPYCTTCP  147



>ref|XP_006374214.1| cyclic nucleotide-gated ion channel 20 family protein [Populus 
trichocarpa]
 gb|ERP52011.1| cyclic nucleotide-gated ion channel 20 family protein [Populus 
trichocarpa]
Length=785

 Score =   115 bits (287),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 65/149 (44%), Positives = 88/149 (59%), Gaps = 8/149 (5%)
 Frame = +3

Query  438  MAAYERDVVPMLSATDSQA-DE---SGYRRFSYRARR-SLSIPANSYDT--ENNNHFGFT  596
            MA +++D +PMLS T  ++ DE   S +R F  R +  S SIP +S ++     N  GFT
Sbjct  1    MANHDKDDIPMLSYTHPKSVDENVDSRFRPFLSRTQSASTSIPLDSMESYGSETNLVGFT  60

Query  597  GPLRNERRTSYIQMSGPLYVGQTPTNNLRTSQVALGRKSTRQTLEIYPSTAIRESNDWED  776
            GPLR+ R+   +QMSGPLY+ +   N    +     RK      E YPS    + NDW+D
Sbjct  61   GPLRSARKAPLVQMSGPLYINRNTENLFLANHGVTARKKVEPKPEKYPSLNGMDKNDWDD  120

Query  777  YDYAQKNEHLLRSGRLGVCNDPYCTTCPT  863
              Y   N HL+RSG+LG+CNDPYCTTCP+
Sbjct  121  -KYTATNAHLMRSGQLGMCNDPYCTTCPS  148



>ref|XP_006587446.1| PREDICTED: probable cyclic nucleotide-gated ion channel 20, chloroplastic-like 
isoform X3 [Glycine max]
Length=717

 Score =   114 bits (285),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 65/149 (44%), Positives = 88/149 (59%), Gaps = 8/149 (5%)
 Frame = +3

Query  438  MAAYERDVVPMLS-----ATDSQADESGYRRFSYRARRSLSIPANSYD--TENNNHFGFT  596
            MA +E+D VP+ S      ++   D    RR       S+SIPA   +    + N  G+T
Sbjct  1    MANFEKDEVPIFSDIHPKLSNELVDSKFPRRVPRTRSVSISIPATLTEPYERDTNLVGYT  60

Query  597  GPLRNERRTSYIQMSGPLYVGQTPTNNLRTSQVALGRKSTRQTLEIYPSTAIRESNDWED  776
            GPLR++R+T + QMSGPLYV   P N  R ++VA   ++     E +PS      ND ++
Sbjct  61   GPLRSQRKTPFDQMSGPLYVTNKPGNLFRQNRVAPEYQTAESKTENFPSCCGMGENDLQN  120

Query  777  YDYAQKNEHLLRSGRLGVCNDPYCTTCPT  863
             +YA KNEHL+RSG LG+CNDPYCTTCPT
Sbjct  121  -NYAGKNEHLIRSGPLGMCNDPYCTTCPT  148



>ref|XP_006587445.1| PREDICTED: probable cyclic nucleotide-gated ion channel 20, chloroplastic-like 
isoform X2 [Glycine max]
Length=750

 Score =   114 bits (285),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 65/149 (44%), Positives = 88/149 (59%), Gaps = 8/149 (5%)
 Frame = +3

Query  438  MAAYERDVVPMLS-----ATDSQADESGYRRFSYRARRSLSIPANSYD--TENNNHFGFT  596
            MA +E+D VP+ S      ++   D    RR       S+SIPA   +    + N  G+T
Sbjct  1    MANFEKDEVPIFSDIHPKLSNELVDSKFPRRVPRTRSVSISIPATLTEPYERDTNLVGYT  60

Query  597  GPLRNERRTSYIQMSGPLYVGQTPTNNLRTSQVALGRKSTRQTLEIYPSTAIRESNDWED  776
            GPLR++R+T + QMSGPLYV   P N  R ++VA   ++     E +PS      ND ++
Sbjct  61   GPLRSQRKTPFDQMSGPLYVTNKPGNLFRQNRVAPEYQTAESKTENFPSCCGMGENDLQN  120

Query  777  YDYAQKNEHLLRSGRLGVCNDPYCTTCPT  863
             +YA KNEHL+RSG LG+CNDPYCTTCPT
Sbjct  121  -NYAGKNEHLIRSGPLGMCNDPYCTTCPT  148



>ref|XP_003534113.1| PREDICTED: probable cyclic nucleotide-gated ion channel 20, chloroplastic-like 
isoform X1 [Glycine max]
Length=781

 Score =   114 bits (285),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 65/149 (44%), Positives = 88/149 (59%), Gaps = 8/149 (5%)
 Frame = +3

Query  438  MAAYERDVVPMLS-----ATDSQADESGYRRFSYRARRSLSIPANSYD--TENNNHFGFT  596
            MA +E+D VP+ S      ++   D    RR       S+SIPA   +    + N  G+T
Sbjct  1    MANFEKDEVPIFSDIHPKLSNELVDSKFPRRVPRTRSVSISIPATLTEPYERDTNLVGYT  60

Query  597  GPLRNERRTSYIQMSGPLYVGQTPTNNLRTSQVALGRKSTRQTLEIYPSTAIRESNDWED  776
            GPLR++R+T + QMSGPLYV   P N  R ++VA   ++     E +PS      ND ++
Sbjct  61   GPLRSQRKTPFDQMSGPLYVTNKPGNLFRQNRVAPEYQTAESKTENFPSCCGMGENDLQN  120

Query  777  YDYAQKNEHLLRSGRLGVCNDPYCTTCPT  863
             +YA KNEHL+RSG LG+CNDPYCTTCPT
Sbjct  121  -NYAGKNEHLIRSGPLGMCNDPYCTTCPT  148



>ref|XP_007152603.1| hypothetical protein PHAVU_004G144000g [Phaseolus vulgaris]
 ref|XP_007152604.1| hypothetical protein PHAVU_004G144000g [Phaseolus vulgaris]
 gb|ESW24597.1| hypothetical protein PHAVU_004G144000g [Phaseolus vulgaris]
 gb|ESW24598.1| hypothetical protein PHAVU_004G144000g [Phaseolus vulgaris]
Length=762

 Score =   114 bits (285),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 66/149 (44%), Positives = 96/149 (64%), Gaps = 9/149 (6%)
 Frame = +3

Query  438  MAAYERDVVPMLSATDSQA----DESGYRRFSYRARR-SLSIPANSYDT--ENNNHFGFT  596
            MA +E D  PMLS TD+Q      +S +RR   R +  S+SIP +S ++  +  +  G T
Sbjct  1    MANFENDKQPMLSDTDAQPYDDPLDSKFRRTVTRTQSASISIPMSSLESYEKETSLVGHT  60

Query  597  GPLRNERRTSYIQMSGPLYVGQTPTNNLRTSQVALGRKSTRQTLEIYPSTAIRESNDWED  776
            GPL+++R+T ++ MSGPLY   T T NL    +  G K+  +  + + +T    S+D+++
Sbjct  61   GPLQSKRKTPFMHMSGPLY-ATTGTGNLLQKHIVSGNKADERKTDSF-ATLHGSSSDYQN  118

Query  777  YDYAQKNEHLLRSGRLGVCNDPYCTTCPT  863
             DY +KNEHLLRSG+LG+CNDPYCTTCPT
Sbjct  119  SDYDRKNEHLLRSGQLGMCNDPYCTTCPT  147



>gb|KHN43677.1| Putative cyclic nucleotide-gated ion channel 20, chloroplastic 
[Glycine soja]
Length=717

 Score =   114 bits (284),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 65/149 (44%), Positives = 88/149 (59%), Gaps = 8/149 (5%)
 Frame = +3

Query  438  MAAYERDVVPMLS-----ATDSQADESGYRRFSYRARRSLSIPANSYD--TENNNHFGFT  596
            MA +E+D VP+ S      ++   D    RR       S+SIPA   +    + N  G+T
Sbjct  1    MANFEKDEVPIFSDIHPKLSNELVDSKFPRRVPRTRSVSISIPATLTEPYERDTNLVGYT  60

Query  597  GPLRNERRTSYIQMSGPLYVGQTPTNNLRTSQVALGRKSTRQTLEIYPSTAIRESNDWED  776
            GPLR++R+T + QMSGPLYV   P N  R ++VA   ++     E +PS      ND ++
Sbjct  61   GPLRSQRKTPFDQMSGPLYVTNKPGNLFRQNRVAPEYQTAESKTENFPSCCGVGENDLQN  120

Query  777  YDYAQKNEHLLRSGRLGVCNDPYCTTCPT  863
             +YA KNEHL+RSG LG+CNDPYCTTCPT
Sbjct  121  -NYAGKNEHLIRSGPLGMCNDPYCTTCPT  148



>ref|XP_006374215.1| hypothetical protein POPTR_0015s05090g [Populus trichocarpa]
 gb|ERP52012.1| hypothetical protein POPTR_0015s05090g [Populus trichocarpa]
Length=781

 Score =   113 bits (283),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 65/148 (44%), Positives = 87/148 (59%), Gaps = 8/148 (5%)
 Frame = +3

Query  438  MAAYERDVVPMLSATDSQA-DE---SGYRRFSYRARR-SLSIPANSYDT--ENNNHFGFT  596
            MA +++D +P LS T  ++ DE   S +R F  R +  S SIP +S ++     N  GFT
Sbjct  1    MANHDKDNIPTLSDTHPKSVDENVDSRFRPFLSRTQSASTSIPLDSMESYGSETNIVGFT  60

Query  597  GPLRNERRTSYIQMSGPLYVGQTPTNNLRTSQVALGRKSTRQTLEIYPSTAIRESNDWED  776
            GPLR+ R+   +QMSGPLY+ +   N          RK      E YPS   R+ NDW+D
Sbjct  61   GPLRSARKAPLVQMSGPLYINRNTENLFLAKHGVTTRKKVDSKPEKYPSLNGRDKNDWDD  120

Query  777  YDYAQKNEHLLRSGRLGVCNDPYCTTCP  860
             +Y   N HL+RSG+LG+CNDPYCTTCP
Sbjct  121  -NYTATNAHLMRSGQLGMCNDPYCTTCP  147



>emb|CAN66851.1| hypothetical protein VITISV_001070 [Vitis vinifera]
Length=302

 Score =   110 bits (274),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 71/155 (46%), Positives = 88/155 (57%), Gaps = 18/155 (12%)
 Frame = +3

Query  432  LKMAAYERDVVPMLSATDSQ-ADE----SGYRRFSYRARRSLSIPANS---YDTENNNHF  587
            L+M+  E+D  PMLS   SQ  DE      +RR S     S+SIP NS   Y TE++   
Sbjct  132  LEMSDLEKDETPMLSEAHSQYLDEPRVSHSHRRTSRNRSASISIPMNSMESYQTESSL-V  190

Query  588  GFTGPLRNERRTSYIQMSGPLYVGQ---TPTNNLRTSQVALGRKSTRQTLEIYPSTAIRE  758
              TGPLRNE++T +I MSGPL   +    PT  +R      G +      E +PS    E
Sbjct  191  SHTGPLRNEKKTPFIPMSGPLLKSEGLFPPTPGVR------GHRKAEPRAEXFPSXNGME  244

Query  759  SNDWEDYDYAQKNEHLLRSGRLGVCNDPYCTTCPT  863
             N+    +YA KNEHLLRSG+LGVCNDPYCT CPT
Sbjct  245  WNNRPHNNYAGKNEHLLRSGQLGVCNDPYCTICPT  279



>ref|XP_002317721.1| cyclic nucleotide-gated ion channel 20 family protein [Populus 
trichocarpa]
 gb|EEE95941.1| cyclic nucleotide-gated ion channel 20 family protein [Populus 
trichocarpa]
Length=769

 Score =   112 bits (279),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 65/150 (43%), Positives = 85/150 (57%), Gaps = 8/150 (5%)
 Frame = +3

Query  438  MAAYERDVVPMLSATDSQ-ADESGYRRFSYRARR----SLSIPANSYDTEN--NNHFGFT  596
            MA +E+D V MLS T  +  DE    RFS    R    S+SIP NS ++     N  G+T
Sbjct  1    MADHEKDDVAMLSDTHPKLVDEEVDSRFSPFLSRTQSASISIPVNSMESYGFETNLVGYT  60

Query  597  GPLRNERRTSYIQMSGPLYVGQTPTNNLRTSQVALGRKSTRQTLEIYPSTAIRESNDWED  776
            GPLR+ER+   +QMSGPLY+ +   N    +      K      E Y S    + NDW+D
Sbjct  61   GPLRSERKAPLVQMSGPLYINRNTENLFLANHGVTAHKKVEPKPERYLSFKGMDPNDWDD  120

Query  777  YDYAQKNEHLLRSGRLGVCNDPYCTTCPTI  866
              Y   N HL+RSG+LG+CNDPYCTTCP++
Sbjct  121  M-YTTTNAHLMRSGQLGMCNDPYCTTCPSL  149



>gb|KGN63955.1| hypothetical protein Csa_1G031768 [Cucumis sativus]
Length=184

 Score =   104 bits (260),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 66/151 (44%), Positives = 85/151 (56%), Gaps = 13/151 (9%)
 Frame = +3

Query  438  MAAYERDVVPMLSATD-----SQADESGYRRFSYRARRSLSIPANS---YDTENNNHFGF  593
            MAA+E+D +PMLS TD      Q D       S     SLSIP NS   Y +E N   G 
Sbjct  1    MAAFEKDDIPMLSNTDPPMFDEQVDSYFPSYASLGRSSSLSIPENSSGMYGSEAN-LVGH  59

Query  594  TGPLRNERRTSYIQMSGPLYVGQTPTNNLRTSQVALGRKSTRQTL-EIYPSTAIRESNDW  770
            TGPLR ER  S   +SG    G  P   L  S+  +    T + L E +PS  I + +DW
Sbjct  60   TGPLRIER--SSFMVSGSKKTGSKP-KKLSQSKPGVTESKTAEPLAEKFPSFKIVDESDW  116

Query  771  EDYDYAQKNEHLLRSGRLGVCNDPYCTTCPT  863
              ++YA +NEHL++SG+LG+CNDP+C TCPT
Sbjct  117  SIHNYAGRNEHLIKSGQLGLCNDPFCITCPT  147



>ref|XP_010663941.1| PREDICTED: probable cyclic nucleotide-gated ion channel 20, chloroplastic 
[Vitis vinifera]
 ref|XP_010663942.1| PREDICTED: probable cyclic nucleotide-gated ion channel 20, chloroplastic 
[Vitis vinifera]
 emb|CBI35308.3| unnamed protein product [Vitis vinifera]
Length=775

 Score =   110 bits (275),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 75/162 (46%), Positives = 91/162 (56%), Gaps = 22/162 (14%)
 Frame = +3

Query  417  NSINCLKMAAYERDVVPMLSATDSQADE----SGYRRFSYRARR-SLSIPANS---YDTE  572
            N    L+M+  E+D  PMLS   SQ  +    S   R + R R  S SIP NS   Y TE
Sbjct  3    NRSKVLEMSDLEKDETPMLSDAYSQYLDKPRVSHSDRLTSRNRSASSSIPMNSMESYQTE  62

Query  573  NN--NHFGFTGPLRNERRTSYIQMSGPLYVGQT---PTNNLRTSQVALGRKSTRQTLEIY  737
            +N  NH   TGPLRNE++T +I MSGPL   +    PT  +R      G +      E +
Sbjct  63   SNLVNH---TGPLRNEKKTPFIPMSGPLLKSEGFFPPTPGVR------GHRKAEPRAEKF  113

Query  738  PSTAIRESNDWEDYDYAQKNEHLLRSGRLGVCNDPYCTTCPT  863
            PS    E N+W   +YA KNEHLLRSG+LGVCNDPYCT CPT
Sbjct  114  PSFNGMEWNNWPHNNYAGKNEHLLRSGQLGVCNDPYCTICPT  155



>ref|XP_010099680.1| putative cyclic nucleotide-gated ion channel 20 [Morus notabilis]
 gb|EXB80257.1| putative cyclic nucleotide-gated ion channel 20 [Morus notabilis]
Length=693

 Score =   108 bits (269),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 64/148 (43%), Positives = 83/148 (56%), Gaps = 9/148 (6%)
 Frame = +3

Query  444  AYERDVVPMLS-----ATDSQADESGYRRFSYRARRSLSI--PANSYDTENNNHFGFTGP  602
            A ERD  PMLS     + D   D    R   +    SLSI  P+        N  G TGP
Sbjct  2    AGERDETPMLSDCHPRSLDEHVDSQFRRSVPWTRSASLSIDMPSMESHERETNLVGHTGP  61

Query  603  LRNERRTSYIQMSGPLYVGQTPTN-NLRTSQVALGRKSTRQTLEIYPSTAIRESNDWEDY  779
            LR++R T ++ MSGPL   +   N   R SQVA  +K     +E +PS +    NDW D 
Sbjct  62   LRSQR-TPFVAMSGPLSSNRRADNLVFRPSQVAKPQKEATPRIEKFPSISGMNQNDWADD  120

Query  780  DYAQKNEHLLRSGRLGVCNDPYCTTCPT  863
            ++ +KN+HLLRSG+LG+CNDPYCTTCP+
Sbjct  121  NFGKKNDHLLRSGQLGMCNDPYCTTCPS  148



>ref|XP_003548318.1| PREDICTED: probable cyclic nucleotide-gated ion channel 20, chloroplastic-like 
[Glycine max]
Length=778

 Score =   107 bits (267),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 63/149 (42%), Positives = 89/149 (60%), Gaps = 8/149 (5%)
 Frame = +3

Query  438  MAAYERDVVPMLSAT----DSQADESGYRRFSYRARR-SLSIPANSYD--TENNNHFGFT  596
            MA +E+D VP+ S       ++  ++ + R   R R  S+SIP+   +     NN  G+T
Sbjct  1    MANFEKDEVPIFSEVHPKPSNEPVDTKFPRGVPRTRSVSISIPSTLTEPYERGNNLVGYT  60

Query  597  GPLRNERRTSYIQMSGPLYVGQTPTNNLRTSQVALGRKSTRQTLEIYPSTAIRESNDWED  776
            GPLR++R+T +  MSGPLYV     N  R ++VA   ++     E +PS      ND ++
Sbjct  61   GPLRSQRKTPFDHMSGPLYVTNKHGNLFRHNRVASEYQTAESKAENFPSCCGMGENDLQN  120

Query  777  YDYAQKNEHLLRSGRLGVCNDPYCTTCPT  863
             +YA KNEHL+RSG LG+CNDPYCTTCPT
Sbjct  121  -NYAGKNEHLVRSGPLGMCNDPYCTTCPT  148



>gb|KHN24541.1| Putative cyclic nucleotide-gated ion channel 20, chloroplastic 
[Glycine soja]
Length=778

 Score =   107 bits (267),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 63/149 (42%), Positives = 89/149 (60%), Gaps = 8/149 (5%)
 Frame = +3

Query  438  MAAYERDVVPMLSAT----DSQADESGYRRFSYRARR-SLSIPANSYD--TENNNHFGFT  596
            MA +E+D VP+ S       ++  ++ + R   R R  S+SIP+   +     NN  G+T
Sbjct  1    MANFEKDEVPIFSEVHPKPSNEPVDTKFPRGVPRTRSVSISIPSTLTEPYERGNNLVGYT  60

Query  597  GPLRNERRTSYIQMSGPLYVGQTPTNNLRTSQVALGRKSTRQTLEIYPSTAIRESNDWED  776
            GPLR++R+T +  MSGPLYV     N  R ++VA   ++     E +PS      ND ++
Sbjct  61   GPLRSQRKTPFDHMSGPLYVTNKHGNLFRHNRVASEYQTAESKTENFPSCCGMGENDLQN  120

Query  777  YDYAQKNEHLLRSGRLGVCNDPYCTTCPT  863
             +YA KNEHL+RSG LG+CNDPYCTTCPT
Sbjct  121  -NYAGKNEHLVRSGPLGMCNDPYCTTCPT  148



>ref|XP_010663940.1| PREDICTED: probable cyclic nucleotide-gated ion channel 20, chloroplastic 
isoform X2 [Vitis vinifera]
Length=685

 Score =   107 bits (266),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 72/160 (45%), Positives = 89/160 (56%), Gaps = 18/160 (11%)
 Frame = +3

Query  417  NSINCLKMAAYERDVVPMLSATDSQ-ADE----SGYRRFSYRARRSLSIPANS---YDTE  572
            N    L+M+  E+D  PMLS   SQ  DE      +RR S     S+SIP NS   Y TE
Sbjct  3    NRSEVLEMSDLEKDETPMLSEAHSQYLDEPRVSHSHRRTSRNRSASISIPMNSMESYQTE  62

Query  573  NNNHFGFTGPLRNERRTSYIQMSGPLYVGQT---PTNNLRTSQVALGRKSTRQTLEIYPS  743
            ++     TGPLRNE++T +I MSGPL   +    PT  +R      G +      E +PS
Sbjct  63   SS-LVSHTGPLRNEKKTPFIPMSGPLLKSEGLFPPTPGVR------GHRKAEPRAENFPS  115

Query  744  TAIRESNDWEDYDYAQKNEHLLRSGRLGVCNDPYCTTCPT  863
                E N+    +YA KNEHLLRSG+LGVCNDPYCT CPT
Sbjct  116  FNGMEWNNRPHNNYAGKNEHLLRSGQLGVCNDPYCTICPT  155



>ref|XP_010663937.1| PREDICTED: probable cyclic nucleotide-gated ion channel 20, chloroplastic 
isoform X1 [Vitis vinifera]
 ref|XP_010663938.1| PREDICTED: probable cyclic nucleotide-gated ion channel 20, chloroplastic 
isoform X1 [Vitis vinifera]
 ref|XP_010663939.1| PREDICTED: probable cyclic nucleotide-gated ion channel 20, chloroplastic 
isoform X1 [Vitis vinifera]
 emb|CBI35306.3| unnamed protein product [Vitis vinifera]
Length=777

 Score =   107 bits (266),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 72/160 (45%), Positives = 89/160 (56%), Gaps = 18/160 (11%)
 Frame = +3

Query  417  NSINCLKMAAYERDVVPMLSATDSQ-ADE----SGYRRFSYRARRSLSIPANS---YDTE  572
            N    L+M+  E+D  PMLS   SQ  DE      +RR S     S+SIP NS   Y TE
Sbjct  3    NRSEVLEMSDLEKDETPMLSEAHSQYLDEPRVSHSHRRTSRNRSASISIPMNSMESYQTE  62

Query  573  NNNHFGFTGPLRNERRTSYIQMSGPLYVGQT---PTNNLRTSQVALGRKSTRQTLEIYPS  743
            ++     TGPLRNE++T +I MSGPL   +    PT  +R      G +      E +PS
Sbjct  63   SS-LVSHTGPLRNEKKTPFIPMSGPLLKSEGLFPPTPGVR------GHRKAEPRAENFPS  115

Query  744  TAIRESNDWEDYDYAQKNEHLLRSGRLGVCNDPYCTTCPT  863
                E N+    +YA KNEHLLRSG+LGVCNDPYCT CPT
Sbjct  116  FNGMEWNNRPHNNYAGKNEHLLRSGQLGVCNDPYCTICPT  155



>gb|EYU17788.1| hypothetical protein MIMGU_mgv1a001774mg [Erythranthe guttata]
Length=761

 Score =   106 bits (265),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 66/144 (46%), Positives = 86/144 (60%), Gaps = 13/144 (9%)
 Frame = +3

Query  450  ERDVVPMLSATDSQAD---ESGYRRFSYRARR-SLSIPANSYDTENN--NHFGFTGPLRN  611
            ERD +PML  T  Q+D   ESG R F+ R R  S+SIP NS +T +   +  GFTGPLR 
Sbjct  5    ERDEIPMLPTTYVQSDDIVESGNRAFATRTRSASMSIPRNSLETSDYEPSLVGFTGPLRA  64

Query  612  ERRTSYIQMSGPLYVGQTPTNNLRTSQVALGR-KSTRQTLEIYPSTAIRESNDWEDYDYA  788
            ++ T+       LY  Q      +  Q A  + K+T   +E +PS    ES+DW   DY 
Sbjct  65   QKPTA------SLYANQNREFIFQPPQGASSQQKNTETKMERFPSMVQSESSDWPMDDYT  118

Query  789  QKNEHLLRSGRLGVCNDPYCTTCP  860
             KN+HLL+SG+LG+CNDPYCTTCP
Sbjct  119  SKNDHLLKSGQLGMCNDPYCTTCP  142



>gb|KHN24540.1| Putative cyclic nucleotide-gated ion channel 20, chloroplastic 
[Glycine soja]
Length=766

 Score =   106 bits (264),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 64/150 (43%), Positives = 87/150 (58%), Gaps = 11/150 (7%)
 Frame = +3

Query  438  MAAYERDVVPMLSATDSQA-DESGYRRFSYRARRS-------LSIPANSYDTENNNHFGF  593
            MA  E D +PMLS  D+Q  DE    +F     R+             SY+ E +   G 
Sbjct  1    MANLENDKLPMLSDIDAQPYDEPLDSKFKRTVTRTQSASVSISMSSLESYEKETS-LVGH  59

Query  594  TGPLRNERRTSYIQMSGPLYVGQTPTNNLRTSQVALGRKSTRQTLEIYPSTAIRESNDWE  773
            TGPL+++R+T ++QMSGPLY   T T NL    +  G K+  +T + + +     SN W 
Sbjct  60   TGPLQSKRKTPFMQMSGPLY-ATTGTGNLLQKHIVSGNKAKERTTDNFATHHDTGSNYWN  118

Query  774  DYDYAQKNEHLLRSGRLGVCNDPYCTTCPT  863
            + DY +KNEHLL+SG+LG+CNDPYCTTCPT
Sbjct  119  N-DYDRKNEHLLKSGQLGMCNDPYCTTCPT  147



>ref|XP_004515246.1| PREDICTED: probable cyclic nucleotide-gated ion channel 20, chloroplastic-like 
isoform X1 [Cicer arietinum]
Length=770

 Score =   106 bits (264),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 64/148 (43%), Positives = 82/148 (55%), Gaps = 7/148 (5%)
 Frame = +3

Query  438  MAAYERDVVPMLSATDSQ-ADE---SGYRRFSYRARRSLSIPANSYDTENN--NHFGFTG  599
            M  +++D VPMLS   +Q +DE   S +RR S     S+SIP  S D  +   N  G TG
Sbjct  1    MNHFDKDEVPMLSEMRAQPSDEPANSNFRRISRTQSASISIPMASLDPNDRQPNLVGHTG  60

Query  600  PLRNERRTSYIQMSGPLYVGQTPTNNLRTSQVALGRKSTRQTLEIYPSTAIRESNDWEDY  779
            PLR  R+T + QMSGPL       N  +   V  G K      E + +      + W + 
Sbjct  61   PLRTARKTPFAQMSGPLNATPGMGNPFQNGIVVAGNKVGENKTEKFSTFDDTNEHHW-NI  119

Query  780  DYAQKNEHLLRSGRLGVCNDPYCTTCPT  863
            D  +KNEHLLRSG+LG+CNDPYCTTCPT
Sbjct  120  DNDRKNEHLLRSGQLGMCNDPYCTTCPT  147



>ref|XP_003548317.1| PREDICTED: probable cyclic nucleotide-gated ion channel 20, chloroplastic-like 
[Glycine max]
Length=766

 Score =   106 bits (264),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 64/150 (43%), Positives = 87/150 (58%), Gaps = 11/150 (7%)
 Frame = +3

Query  438  MAAYERDVVPMLSATDSQA-DESGYRRFSYRARRS-------LSIPANSYDTENNNHFGF  593
            MA  E D +PMLS  D+Q  DE    +F     R+             SY+ E +   G 
Sbjct  1    MANLENDKLPMLSDIDAQPYDEPLDSKFKRTVTRTHSASVSISMSSLESYEKETS-LVGH  59

Query  594  TGPLRNERRTSYIQMSGPLYVGQTPTNNLRTSQVALGRKSTRQTLEIYPSTAIRESNDWE  773
            TGPL+++R+T ++QMSGPLY   T T NL    +  G K+  +T + + +     SN W 
Sbjct  60   TGPLQSKRKTPFMQMSGPLY-ATTGTGNLLQKHIVSGNKAKERTTDNFATHHDTGSNYWN  118

Query  774  DYDYAQKNEHLLRSGRLGVCNDPYCTTCPT  863
            + DY +KNEHLL+SG+LG+CNDPYCTTCPT
Sbjct  119  N-DYDRKNEHLLKSGQLGMCNDPYCTTCPT  147



>gb|KCW57855.1| hypothetical protein EUGRSUZ_H00608 [Eucalyptus grandis]
Length=680

 Score =   105 bits (263),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 66/153 (43%), Positives = 89/153 (58%), Gaps = 12/153 (8%)
 Frame = +3

Query  438  MAAYERDVVPMLSATDSQADE-----SGYRRFSYRARRSLSIPANSYDTENN--NHFGFT  596
            MA  ERD VP+LS T  Q  +         R S     S+SIP +S ++  +  +  G+T
Sbjct  1    MAHNERDEVPILSETQQQLSDDYNSSQPRSRISRTRSVSISIPTSSMESYESIPSRVGYT  60

Query  597  GPLRNERRTSYIQMSGPLYVGQTPTNNLRTSQVALGRKST----RQTLEIYPSTAIRESN  764
            GPLR+ERRT +   SGPL+    P +  R ++ A G  ST    +   E +PS ++++  
Sbjct  61   GPLRSERRTPFSLRSGPLH-NHGPESTFRHNRGAPGTGSTGVESQHMKEKFPSFSVKDRI  119

Query  765  DWEDYDYAQKNEHLLRSGRLGVCNDPYCTTCPT  863
            D  D DY  KNEHLLRSGRLG+CND YCTTCP+
Sbjct  120  DSADDDYGAKNEHLLRSGRLGMCNDRYCTTCPS  152



>ref|XP_008364700.1| PREDICTED: probable cyclic nucleotide-gated ion channel 20, chloroplastic 
[Malus domestica]
Length=321

 Score =   102 bits (254),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 60/152 (39%), Positives = 87/152 (57%), Gaps = 11/152 (7%)
 Frame = +3

Query  441  AAYERDVVPMLSATDSQ-ADESGYRRF----SYRARRSLSIPANSYDTENNNHF-----G  590
            A Y    VP+L  T  Q ++++G   F    S   + S+SIP +S D++ +        G
Sbjct  3    AGYNGTEVPILPNTLPQYSEDNGQLLFDTFVSQNRKASVSIPMSSMDSDTSYEGEHRLEG  62

Query  591  FTGPLRNERRTSYIQMSGPLYVGQTPTNNLRTSQ-VALGRKSTRQTLEIYPSTAIRESND  767
             TGPL ++ +  +  +SGPLY    P +  R +Q +  G+++     E +P T     N+
Sbjct  63   HTGPLGSQSKPLFGPVSGPLYTNDRPDSIFRAAQALTAGQEAVEPAGETFPCTNATNQNE  122

Query  768  WEDYDYAQKNEHLLRSGRLGVCNDPYCTTCPT  863
            W D +YA KNEHLLRSG+LG+CNDPYCTTCPT
Sbjct  123  WTDENYAGKNEHLLRSGQLGLCNDPYCTTCPT  154



>gb|KEH26818.1| cyclic nucleotide-gated cation channel protein [Medicago truncatula]
Length=727

 Score =   105 bits (262),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 63/149 (42%), Positives = 84/149 (56%), Gaps = 9/149 (6%)
 Frame = +3

Query  438  MAAYERDVVPMLSATD----SQADESGYRRFSYRARR-SLSIPANSYD--TENNNHFGFT  596
            MA ++ D +P+LS  +    ++ D S +R    R R  S+SIP    +    + N  G T
Sbjct  1    MAEFDNDELPILSDANPKQSNEPDSSKFRNLVPRTRSVSISIPMIPMEPYERDTNFKGHT  60

Query  597  GPLRNERRTSYIQMSGPLYVGQTPTNNLRTSQVALGRKSTRQTLEIYPSTAIRESNDWED  776
            GPLR++R+ S+  MSGPLYV  TP N    S V    K+     E +P   + E      
Sbjct  61   GPLRSQRKASFNPMSGPLYVTHTPGNLFGQSLVVPTSKAVESKTEKFPLCGMNEHG--LQ  118

Query  777  YDYAQKNEHLLRSGRLGVCNDPYCTTCPT  863
             + A KNEHLLRSG+LG+CNDPYCTTCPT
Sbjct  119  NNNAGKNEHLLRSGQLGMCNDPYCTTCPT  147



>gb|KEH26817.1| cyclic nucleotide-gated cation channel protein [Medicago truncatula]
Length=768

 Score =   105 bits (262),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 63/149 (42%), Positives = 84/149 (56%), Gaps = 9/149 (6%)
 Frame = +3

Query  438  MAAYERDVVPMLSATD----SQADESGYRRFSYRARR-SLSIPANSYD--TENNNHFGFT  596
            MA ++ D +P+LS  +    ++ D S +R    R R  S+SIP    +    + N  G T
Sbjct  1    MAEFDNDELPILSDANPKQSNEPDSSKFRNLVPRTRSVSISIPMIPMEPYERDTNFKGHT  60

Query  597  GPLRNERRTSYIQMSGPLYVGQTPTNNLRTSQVALGRKSTRQTLEIYPSTAIRESNDWED  776
            GPLR++R+ S+  MSGPLYV  TP N    S V    K+     E +P   + E      
Sbjct  61   GPLRSQRKASFNPMSGPLYVTHTPGNLFGQSLVVPTSKAVESKTEKFPLCGMNEHG--LQ  118

Query  777  YDYAQKNEHLLRSGRLGVCNDPYCTTCPT  863
             + A KNEHLLRSG+LG+CNDPYCTTCPT
Sbjct  119  NNNAGKNEHLLRSGQLGMCNDPYCTTCPT  147



>ref|XP_010069488.1| PREDICTED: probable cyclic nucleotide-gated ion channel 20, chloroplastic 
isoform X2 [Eucalyptus grandis]
Length=759

 Score =   105 bits (261),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 68/153 (44%), Positives = 88/153 (58%), Gaps = 12/153 (8%)
 Frame = +3

Query  438  MAAYERDVVPMLSATDSQADE-----SGYRRFSYRARRSLSIPANSYDTENN--NHFGFT  596
            MA  ERD VPMLS T  Q  +         R S     S+SIP +S ++  +  +  G+T
Sbjct  1    MAHSERDEVPMLSETQQQLSDDYNSSQPRSRISRTRSVSISIPTSSMESYESITSRAGYT  60

Query  597  GPLRNERRTSYIQMSGPLYVGQTPTNNLRTSQVALGRKST----RQTLEIYPSTAIRESN  764
            GPLR+ERRT +  MSGPL   + P +    +  A G  ST    +   E +PS +I++  
Sbjct  61   GPLRSERRTPFSLMSGPLR-NRGPESTFGHNPGAPGTGSTGVESQHMKEKFPSFSIKDRI  119

Query  765  DWEDYDYAQKNEHLLRSGRLGVCNDPYCTTCPT  863
            D  D DY  KNEHLLRSGRLG+CND YCTTCP+
Sbjct  120  DSADDDYGAKNEHLLRSGRLGMCNDRYCTTCPS  152



>ref|XP_010069486.1| PREDICTED: probable cyclic nucleotide-gated ion channel 20, chloroplastic 
isoform X1 [Eucalyptus grandis]
Length=776

 Score =   104 bits (260),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 68/153 (44%), Positives = 88/153 (58%), Gaps = 12/153 (8%)
 Frame = +3

Query  438  MAAYERDVVPMLSATDSQADE-----SGYRRFSYRARRSLSIPANSYDTENN--NHFGFT  596
            MA  ERD VPMLS T  Q  +         R S     S+SIP +S ++  +  +  G+T
Sbjct  1    MAHSERDEVPMLSETQQQLSDDYNSSQPRSRISRTRSVSISIPTSSMESYESITSRAGYT  60

Query  597  GPLRNERRTSYIQMSGPLYVGQTPTNNLRTSQVALGRKST----RQTLEIYPSTAIRESN  764
            GPLR+ERRT +  MSGPL   + P +    +  A G  ST    +   E +PS +I++  
Sbjct  61   GPLRSERRTPFSLMSGPLR-NRGPESTFGHNPGAPGTGSTGVESQHMKEKFPSFSIKDRI  119

Query  765  DWEDYDYAQKNEHLLRSGRLGVCNDPYCTTCPT  863
            D  D DY  KNEHLLRSGRLG+CND YCTTCP+
Sbjct  120  DSADDDYGAKNEHLLRSGRLGMCNDRYCTTCPS  152



>gb|KCW57853.1| hypothetical protein EUGRSUZ_H00606 [Eucalyptus grandis]
Length=807

 Score =   104 bits (260),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 68/153 (44%), Positives = 88/153 (58%), Gaps = 12/153 (8%)
 Frame = +3

Query  438  MAAYERDVVPMLSATDSQADE-----SGYRRFSYRARRSLSIPANSYDTENN--NHFGFT  596
            MA  ERD VPMLS T  Q  +         R S     S+SIP +S ++  +  +  G+T
Sbjct  1    MAHSERDEVPMLSETQQQLSDDYNSSQPRSRISRTRSVSISIPTSSMESYESITSRAGYT  60

Query  597  GPLRNERRTSYIQMSGPLYVGQTPTNNLRTSQVALGRKST----RQTLEIYPSTAIRESN  764
            GPLR+ERRT +  MSGPL   + P +    +  A G  ST    +   E +PS +I++  
Sbjct  61   GPLRSERRTPFSLMSGPLR-NRGPESTFGHNPGAPGTGSTGVESQHMKEKFPSFSIKDRI  119

Query  765  DWEDYDYAQKNEHLLRSGRLGVCNDPYCTTCPT  863
            D  D DY  KNEHLLRSGRLG+CND YCTTCP+
Sbjct  120  DSADDDYGAKNEHLLRSGRLGMCNDRYCTTCPS  152



>gb|EYU22267.1| hypothetical protein MIMGU_mgv1a001823mg [Erythranthe guttata]
Length=754

 Score =   103 bits (257),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 63/145 (43%), Positives = 82/145 (57%), Gaps = 22/145 (15%)
 Frame = +3

Query  438  MAAYERDVVPMLSATDSQADESGYRR---FSYRARRSLSIPANSYDTENNNHFGFTGPLR  608
            M A E D +PMLS T+ ++DE    R   F+ +  RS S+      + ++N  G TGPLR
Sbjct  1    MVASENDNIPMLSPTNIKSDEHDATRISGFTTKMMRSASM------SNDSNLVGSTGPLR  54

Query  609  NERRTSYIQMSGPLYVGQTPTNNLRTSQVALGRKSTRQTLEIYPSTAIRESNDWEDYDYA  788
            NERRTS + MS PLY+ +         Q+A  +K T Q LEIYPS   +  N        
Sbjct  55   NERRTSIVPMSSPLYLTRNHEVIFEPPQLASEQKITDQELEIYPSIEGKHGN--------  106

Query  789  QKNEHLLRSGRLGVCNDPYCTTCPT  863
                 LL+SG+LG+CNDPYCTTCPT
Sbjct  107  -----LLKSGQLGMCNDPYCTTCPT  126



>ref|XP_011649574.1| PREDICTED: probable cyclic nucleotide-gated ion channel 20, chloroplastic 
[Cucumis sativus]
Length=774

 Score =   102 bits (255),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 66/151 (44%), Positives = 85/151 (56%), Gaps = 13/151 (9%)
 Frame = +3

Query  438  MAAYERDVVPMLSATD-----SQADESGYRRFSYRARRSLSIPANS---YDTENNNHFGF  593
            MAA+E+D +PMLS TD      Q D       S     SLSIP NS   Y +E N   G 
Sbjct  1    MAAFEKDDIPMLSNTDPPMFDEQVDSYFPSYASLGRSSSLSIPENSSGMYGSEAN-LVGH  59

Query  594  TGPLRNERRTSYIQMSGPLYVGQTPTNNLRTSQVALGRKSTRQTL-EIYPSTAIRESNDW  770
            TGPLR ER  S   +SG    G  P   L  S+  +    T + L E +PS  I + +DW
Sbjct  60   TGPLRIER--SSFMVSGSKKTGSKP-KKLSQSKPGVTESKTAEPLAEKFPSFKIVDESDW  116

Query  771  EDYDYAQKNEHLLRSGRLGVCNDPYCTTCPT  863
              ++YA +NEHL++SG+LG+CNDP+C TCPT
Sbjct  117  SIHNYAGRNEHLIKSGQLGLCNDPFCITCPT  147



>ref|XP_010687225.1| PREDICTED: probable cyclic nucleotide-gated ion channel 20, chloroplastic 
[Beta vulgaris subsp. vulgaris]
 ref|XP_010687226.1| PREDICTED: probable cyclic nucleotide-gated ion channel 20, chloroplastic 
[Beta vulgaris subsp. vulgaris]
Length=770

 Score =   102 bits (254),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 66/153 (43%), Positives = 80/153 (52%), Gaps = 18/153 (12%)
 Frame = +3

Query  438  MAAYERDVVPMLSAT-DSQADES----------GYRRFSYRARRSLSIPANSYDTENNNH  584
            M  YERD  PMLS   D  +DE+            R  S  AR S   PA S++  N   
Sbjct  1    MNTYERDETPMLSVNPDPLSDENENPTYNKSPLWMRSVSVSARMS---PAESWEESN---  54

Query  585  FGFTGPLRNERRTSYIQMSGPLYVGQTPTNNLRTSQVALGRKSTRQTLEIYPSTAIRESN  764
            F   GPLR++  TS++QMSGPLYV   P  +      A G +   Q  E Y        N
Sbjct  55   FAGHGPLRSDI-TSFVQMSGPLYVKSKPDYSYDAKSQAPGLQDKLQLTEKYSKNDGMTMN  113

Query  765  DWEDYDYAQKNEHLLRSGRLGVCNDPYCTTCPT  863
             WE   Y +KN HLLRSG+LG+CNDPYCTTCP+
Sbjct  114  GWEHTGYNEKNTHLLRSGQLGMCNDPYCTTCPS  146



>ref|XP_003534112.2| PREDICTED: probable cyclic nucleotide-gated ion channel 20, chloroplastic-like 
isoform X1 [Glycine max]
 gb|KHN43678.1| Putative cyclic nucleotide-gated ion channel 20, chloroplastic 
[Glycine soja]
Length=812

 Score =   101 bits (252),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 65/150 (43%), Positives = 90/150 (60%), Gaps = 11/150 (7%)
 Frame = +3

Query  438  MAAYERDVVPMLSATDSQA-DE---SGYRRFSYRARRSLSIPANS----YDTENNNHFGF  593
            MA +E D + MLS TD+Q  DE   + +RR   R + +    + S    YD E +   G 
Sbjct  47   MANFENDKLLMLSDTDAQPYDEPLDAKFRRTVTRTQSASISISMSSLESYDKETS-LVGH  105

Query  594  TGPLRNERRTSYIQMSGPLYVGQTPTNNLRTSQVALGRKSTRQTLEIYPSTAIRESNDWE  773
            TGPL+++R+T ++QMSGPLY   T T N     +  G K+  +  + + +     SN W 
Sbjct  106  TGPLQSKRKTPFMQMSGPLY-ATTGTGNPLQKHIVSGNKAEERKTDNFATLRDTGSNYWN  164

Query  774  DYDYAQKNEHLLRSGRLGVCNDPYCTTCPT  863
            + DY +KNEHLLRSG+LG+CNDPYCTTCPT
Sbjct  165  N-DYDRKNEHLLRSGQLGMCNDPYCTTCPT  193



>ref|XP_006587444.1| PREDICTED: probable cyclic nucleotide-gated ion channel 20, chloroplastic-like 
isoform X2 [Glycine max]
Length=766

 Score =   101 bits (252),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 65/150 (43%), Positives = 90/150 (60%), Gaps = 11/150 (7%)
 Frame = +3

Query  438  MAAYERDVVPMLSATDSQA-DE---SGYRRFSYRARRSLSIPANS----YDTENNNHFGF  593
            MA +E D + MLS TD+Q  DE   + +RR   R + +    + S    YD E +   G 
Sbjct  1    MANFENDKLLMLSDTDAQPYDEPLDAKFRRTVTRTQSASISISMSSLESYDKETS-LVGH  59

Query  594  TGPLRNERRTSYIQMSGPLYVGQTPTNNLRTSQVALGRKSTRQTLEIYPSTAIRESNDWE  773
            TGPL+++R+T ++QMSGPLY   T T N     +  G K+  +  + + +     SN W 
Sbjct  60   TGPLQSKRKTPFMQMSGPLY-ATTGTGNPLQKHIVSGNKAEERKTDNFATLRDTGSNYWN  118

Query  774  DYDYAQKNEHLLRSGRLGVCNDPYCTTCPT  863
            + DY +KNEHLLRSG+LG+CNDPYCTTCPT
Sbjct  119  N-DYDRKNEHLLRSGQLGMCNDPYCTTCPT  147



>ref|XP_004515287.1| PREDICTED: probable cyclic nucleotide-gated ion channel 20, chloroplastic-like 
[Cicer arietinum]
Length=772

 Score =   101 bits (251),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 62/149 (42%), Positives = 89/149 (60%), Gaps = 9/149 (6%)
 Frame = +3

Query  438  MAAYERDVVPMLSATD----SQADESGYRRFSYRARR-SLSIPANSYD--TENNNHFGFT  596
            MA +E++ + M+S T+    ++ D+S  + F  R R  S+SIP    D    + N  G T
Sbjct  1    MAEFEKEEMQMISDTNPKPSNEPDDSKSKNFLPRMRSVSISIPMIPIDPYERDTNLKGHT  60

Query  597  GPLRNERRTSYIQMSGPLYVGQTPTNNLRTSQVALGRKSTRQTLEIYPSTAIRESNDWED  776
            GPLR++R+T +I MSGPLYV     N    + +A    +     E +P   + E +D ++
Sbjct  61   GPLRSQRKTPFIPMSGPLYVTNRGENLFGQNIMAPRSGTIENKTEKFPLCGMNE-DDLQN  119

Query  777  YDYAQKNEHLLRSGRLGVCNDPYCTTCPT  863
              YA KNEHL+RSG+LG+CNDPYCTTCPT
Sbjct  120  -KYAAKNEHLVRSGQLGMCNDPYCTTCPT  147



>ref|XP_009356084.1| PREDICTED: putative cyclic nucleotide-gated ion channel 19, partial 
[Pyrus x bretschneideri]
Length=770

 Score =   101 bits (251),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 49/114 (43%), Positives = 72/114 (63%), Gaps = 6/114 (5%)
 Frame = +3

Query  540  LSIPANSYDTENNNHF-----GFTGPLRNERRTSYIQMSGPLYVGQTPTNNLRTSQ-VAL  701
            LSIP +  D+++++       G  GPL ++ +  ++ MSGPLY    P +  R +Q +  
Sbjct  21   LSIPMSYIDSDSSDEGEPRLEGHIGPLGSQSKPLFVPMSGPLYANHRPGSIFRAAQALTA  80

Query  702  GRKSTRQTLEIYPSTAIRESNDWEDYDYAQKNEHLLRSGRLGVCNDPYCTTCPT  863
            G+++     E +PST     N+W D +YA KN+HLLRSGRLG+C+DPYCTTCPT
Sbjct  81   GQEAVEPAGEYFPSTNATNQNEWTDENYAGKNDHLLRSGRLGLCDDPYCTTCPT  134



>ref|XP_008437120.1| PREDICTED: probable cyclic nucleotide-gated ion channel 20, chloroplastic 
isoform X3 [Cucumis melo]
Length=698

 Score =   100 bits (250),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 67/153 (44%), Positives = 85/153 (56%), Gaps = 13/153 (8%)
 Frame = +3

Query  432  LKMAAYERDVVPMLSATD-----SQADESGYRRFSYRARRSLSIPANS---YDTENNNHF  587
            L MAA+E+D +PMLS TD      Q D       S     SLSIPANS   Y +E N   
Sbjct  23   LGMAAFEKDDIPMLSNTDPPIFDEQMDSYFPSYASLGRSSSLSIPANSSGMYSSEAN-LV  81

Query  588  GFTGPLRNERRTSYIQMSGPLYVGQTPTNNLRTSQVALGRKSTRQTL-EIYPSTAIRESN  764
            G TGPLR ER  S   +SG       P   L  S+  +    T + L E +PS  I +  
Sbjct  82   GHTGPLRIER--SSFAVSGSKNTDSKP-KKLSQSKPGVTESKTAEPLAEKFPSFKIVDDP  138

Query  765  DWEDYDYAQKNEHLLRSGRLGVCNDPYCTTCPT  863
            DW  ++YA +NEHL++SG+LG+CNDP+C TCPT
Sbjct  139  DWSIHNYAGRNEHLIKSGQLGLCNDPFCITCPT  171



>ref|XP_008467252.1| PREDICTED: probable cyclic nucleotide-gated ion channel 20, chloroplastic 
isoform X1 [Cucumis melo]
Length=798

 Score =   100 bits (250),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 67/153 (44%), Positives = 85/153 (56%), Gaps = 13/153 (8%)
 Frame = +3

Query  432  LKMAAYERDVVPMLSATD-----SQADESGYRRFSYRARRSLSIPANS---YDTENNNHF  587
            L MAA+E+D +PMLS TD      Q D       S     SLSIPANS   Y +E N   
Sbjct  23   LGMAAFEKDDIPMLSNTDPPIFDEQMDSYFPSYASLGRSSSLSIPANSSGMYSSEAN-LV  81

Query  588  GFTGPLRNERRTSYIQMSGPLYVGQTPTNNLRTSQVALGRKSTRQTL-EIYPSTAIRESN  764
            G TGPLR ER  S   +SG       P   L  S+  +    T + L E +PS  I +  
Sbjct  82   GHTGPLRIER--SSFAVSGSKNTDSKP-KKLSQSKPGVTESKTAEPLAEKFPSFKIVDDP  138

Query  765  DWEDYDYAQKNEHLLRSGRLGVCNDPYCTTCPT  863
            DW  ++YA +NEHL++SG+LG+CNDP+C TCPT
Sbjct  139  DWSIHNYAGRNEHLIKSGQLGLCNDPFCITCPT  171



>ref|XP_008436960.1| PREDICTED: probable cyclic nucleotide-gated ion channel 20, chloroplastic 
isoform X2 [Cucumis melo]
 ref|XP_008437038.1| PREDICTED: probable cyclic nucleotide-gated ion channel 20, chloroplastic 
isoform X2 [Cucumis melo]
Length=774

 Score = 99.4 bits (246),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 66/151 (44%), Positives = 84/151 (56%), Gaps = 13/151 (9%)
 Frame = +3

Query  438  MAAYERDVVPMLSATD-----SQADESGYRRFSYRARRSLSIPANS---YDTENNNHFGF  593
            MAA+E+D +PMLS TD      Q D       S     SLSIPANS   Y +E N   G 
Sbjct  1    MAAFEKDDIPMLSNTDPPIFDEQMDSYFPSYASLGRSSSLSIPANSSGMYSSEAN-LVGH  59

Query  594  TGPLRNERRTSYIQMSGPLYVGQTPTNNLRTSQVALGRKSTRQTL-EIYPSTAIRESNDW  770
            TGPLR ER  S   +SG       P   L  S+  +    T + L E +PS  I +  DW
Sbjct  60   TGPLRIER--SSFAVSGSKNTDSKP-KKLSQSKPGVTESKTAEPLAEKFPSFKIVDDPDW  116

Query  771  EDYDYAQKNEHLLRSGRLGVCNDPYCTTCPT  863
              ++YA +NEHL++SG+LG+CNDP+C TCPT
Sbjct  117  SIHNYAGRNEHLIKSGQLGLCNDPFCITCPT  147



>ref|XP_007152605.1| hypothetical protein PHAVU_004G144100g [Phaseolus vulgaris]
 gb|ESW24599.1| hypothetical protein PHAVU_004G144100g [Phaseolus vulgaris]
Length=765

 Score = 99.4 bits (246),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 64/150 (43%), Positives = 82/150 (55%), Gaps = 9/150 (6%)
 Frame = +3

Query  438  MAAYERDVVPMLSATDSQA-----DESGYRRFSYRARRSLSIPANSYD--TENNNHFGFT  596
            MA +E+D VP LS +  Q      D    R  S     S+SIP    +    + N  G+T
Sbjct  1    MANFEKDEVPFLSDSHPQVSTEVVDSILPRHISRTQSVSISIPTTLTEPYERDTNSVGYT  60

Query  597  GPLRNERRTSYIQMSGPLYVGQTPTNNLRTSQVALGRKSTRQTLEIYPST-AIRESNDWE  773
            GPLR +R T + QMSGPL+    P N  R ++VA   +      EI+ S   I   ND +
Sbjct  61   GPLRIQRITPFNQMSGPLHDTNRPENLSRQNKVAPKPQPEESKTEIFSSCCGIMGENDLQ  120

Query  774  DYDYAQKNEHLLRSGRLGVCNDPYCTTCPT  863
             Y YA KNEHL+RSG  G+C+DPYCTTCPT
Sbjct  121  TY-YASKNEHLVRSGPQGMCSDPYCTTCPT  149



>ref|XP_008375103.1| PREDICTED: probable cyclic nucleotide-gated ion channel 20, chloroplastic 
[Malus domestica]
Length=767

 Score = 97.8 bits (242),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 59/153 (39%), Positives = 84/153 (55%), Gaps = 13/153 (8%)
 Frame = +3

Query  441  AAYERDVVPMLSATDSQADESG----YRRFSYRARRS-LSIPANSYDTENNNHFG-----  590
            A Y    VP+L  T  Q  E      +  F  + R++ LSIP  SY   +++  G     
Sbjct  3    AGYNGTEVPILPNTLPQYSEDNAQLLFDIFVTQTRKAPLSIPM-SYIDSDSSDDGEPRLE  61

Query  591  -FTGPLRNERRTSYIQMSGPLYVGQTPTNNLRTSQ-VALGRKSTRQTLEIYPSTAIRESN  764
               GPL ++ +  ++ MSGPLY    P +  R +Q +  G+++     EI+P T     N
Sbjct  62   GHIGPLGSQSKPLFVPMSGPLYANHRPDSIFRAAQALTAGQEAVEPAGEIFPFTNATNQN  121

Query  765  DWEDYDYAQKNEHLLRSGRLGVCNDPYCTTCPT  863
            +W D +Y  KN+HLLRSGRLG+C+DPYCTTCPT
Sbjct  122  EWTDENYVGKNDHLLRSGRLGLCDDPYCTTCPT  154



>ref|XP_010069485.1| PREDICTED: probable cyclic nucleotide-gated ion channel 20, chloroplastic 
[Eucalyptus grandis]
 gb|KCW57854.1| hypothetical protein EUGRSUZ_H00607 [Eucalyptus grandis]
Length=752

 Score = 95.5 bits (236),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 64/151 (42%), Positives = 84/151 (56%), Gaps = 10/151 (7%)
 Frame = +3

Query  438  MAAYERDVVPMLSATDSQADE-----SGYRRFSYRARRSLSIPANSYDTENN--NHFGFT  596
            MA  E D VPMLS T  Q  +         R S     S+SIP +S ++  +  +  G+T
Sbjct  1    MARNESDEVPMLSETHQQLSDDYNSSQPRSRISRTRSVSISIPTSSMESYESITSRAGYT  60

Query  597  GPLRNERRTSYIQMSGPLYVGQTPTNNLRTSQVALGRKS--TRQTLEIYPSTAIRESNDW  770
            GPLR+ERR      SGPL   + P +    +  A G     ++Q  E +PS +I++  D 
Sbjct  61   GPLRSERRPPLSLTSGPLR-NRLPESTFWHNPGAPGSTGVESQQMKEKFPSFSIKDRIDS  119

Query  771  EDYDYAQKNEHLLRSGRLGVCNDPYCTTCPT  863
             D DY  KNEHLLRSGRLG+CND YCTTCP+
Sbjct  120  ADDDYGAKNEHLLRSGRLGMCNDRYCTTCPS  150



>ref|XP_009356083.1| PREDICTED: probable cyclic nucleotide-gated ion channel 20, chloroplastic 
[Pyrus x bretschneideri]
Length=754

 Score = 94.7 bits (234),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 48/105 (46%), Positives = 65/105 (62%), Gaps = 2/105 (2%)
 Frame = +3

Query  552  ANSYDTENNNHFGFTGPLRNERRTSYIQMSGPLYVGQTPTNNLRTSQ-VALGRKSTRQTL  728
              SY+ E+    G TGPL ++ +  +  +SGPLY    P +  R ++ +  G++      
Sbjct  7    GTSYEGEHRLE-GHTGPLGSQSKPLFGPVSGPLYANGRPDSIFRAAEALTAGQEVVEPAG  65

Query  729  EIYPSTAIRESNDWEDYDYAQKNEHLLRSGRLGVCNDPYCTTCPT  863
            E +PST     N+W D +YA KNEHLLRSGRLG+CNDPYCTTCPT
Sbjct  66   ENFPSTNATNQNEWTDENYAGKNEHLLRSGRLGLCNDPYCTTCPT  110



>ref|XP_010069490.1| PREDICTED: probable cyclic nucleotide-gated ion channel 20, chloroplastic 
[Eucalyptus grandis]
 gb|KCW57851.1| hypothetical protein EUGRSUZ_H00603 [Eucalyptus grandis]
Length=731

 Score = 92.0 bits (227),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 60/149 (40%), Positives = 81/149 (54%), Gaps = 19/149 (13%)
 Frame = +3

Query  438  MAAYERDVVPMLSATDSQADESG-----YRRFSYRARRSLSIPANSYDTENN--NHFGFT  596
            MA  ERD  P+LS T  Q  +         R S     S+SIP +S ++  +  +  G+T
Sbjct  1    MAHNERDEEPILSETQQQLSDDHNSSQPRSRISRTRSVSISIPTSSMESYESITSRVGYT  60

Query  597  GPLRNERRTSYIQMSGPLYVGQTPTNNLRTSQVALGRKSTRQTLEIYPSTAIRESNDWED  776
            GPLR+  RT +  MSGPL+     +  +   Q+           E +PS +I++  D  D
Sbjct  61   GPLRS--RTPFSLMSGPLHNHGPESTGVEPQQMK----------EKFPSFSIKDRIDSAD  108

Query  777  YDYAQKNEHLLRSGRLGVCNDPYCTTCPT  863
             DY  KNEHLLRSGRLG+CND YCTTCP+
Sbjct  109  DDYGAKNEHLLRSGRLGMCNDRYCTTCPS  137



>ref|XP_007152606.1| hypothetical protein PHAVU_004G144200g [Phaseolus vulgaris]
 gb|ESW24600.1| hypothetical protein PHAVU_004G144200g [Phaseolus vulgaris]
Length=748

 Score = 91.7 bits (226),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 57/149 (38%), Positives = 83/149 (56%), Gaps = 7/149 (5%)
 Frame = +3

Query  438  MAAYERDVVPMLSATDSQA----DESGYRRFSYRARR-SLSIPANSYD--TENNNHFGFT  596
            MA +++  +P LS +  Q     ++S + R   R R  S+SIP    +    + N  G+T
Sbjct  1    MAIFDKAELPFLSDSHPQVSIELNDSRFPRHVSRTRSVSISIPTTLTEPYERDTNRLGYT  60

Query  597  GPLRNERRTSYIQMSGPLYVGQTPTNNLRTSQVALGRKSTRQTLEIYPSTAIRESNDWED  776
            GPLR +R T + +MSGPL+    P N  R ++VA   ++     E + S       +   
Sbjct  61   GPLRIQRITPFNEMSGPLHATNRPENLSRQNKVAPESQAEESKTENFSSCCGPMGENDLQ  120

Query  777  YDYAQKNEHLLRSGRLGVCNDPYCTTCPT  863
             +YA KNEHL+RSG LG+C+DPYCTTCPT
Sbjct  121  TNYACKNEHLVRSGPLGMCSDPYCTTCPT  149



>gb|KFK39083.1| hypothetical protein AALP_AA3G198800, partial [Arabis alpina]
Length=725

 Score = 91.7 bits (226),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 57/141 (40%), Positives = 79/141 (56%), Gaps = 5/141 (4%)
 Frame = +3

Query  450  ERDVVPMLSATDSQADESGYRRFSYRARR-SLSIPANSYDTENNNH--FGFTGPLRNERR  620
            E D +PML  T+  +  +  R F+ R+R  SLS P +S D  +N+    G+TGPLR ++R
Sbjct  6    ENDDIPMLPITNP-SSRTRTRPFTSRSRSVSLSNPTSSIDGFDNSTVVLGYTGPLRTQKR  64

Query  621  TSYIQMSGPLYVGQTPTNNLRTSQVALGRKSTRQTLEIYPSTAIRESNDWEDYDYAQKNE  800
               +QMSGPL   Q                     LE YPS A  E  + +D ++  K+ 
Sbjct  65   PPLVQMSGPLTSTQRTETLFLPPPPPPPPTGVSSQLENYPSFAALEHKNSDD-EFVLKHA  123

Query  801  HLLRSGRLGVCNDPYCTTCPT  863
            +LLRSG+LG+CNDPYCTTCP+
Sbjct  124  NLLRSGQLGMCNDPYCTTCPS  144



>gb|KHN43680.1| Putative cyclic nucleotide-gated ion channel 19, partial [Glycine 
soja]
Length=717

 Score = 91.3 bits (225),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 57/149 (38%), Positives = 77/149 (52%), Gaps = 7/149 (5%)
 Frame = +3

Query  435  KMAAYERDVVPMLSATDSQADESGYRRFSYRARR----SLSIPANSYD--TENNNHFGFT  596
            K+A +E+   P  S T +Q DE    RF     R    S+SIP  S +      +  G T
Sbjct  5    KVANFEKHGEPAPSETHAQHDELENSRFGKVISRTKSASISIPMVSMEPYERETSLVGHT  64

Query  597  GPLRNERRTSYIQMSGPLYVGQTPTNNLRTSQVALGRKSTRQTLEIYPSTAIRESNDWED  776
            GPL + R++  + ++G LY      N L  S    G K      E   +   ++ N W +
Sbjct  65   GPLPSVRKSPIMHVNGSLYATNGTENLLHQSIFVKGNKVVESKTEKISTLDRKDENHWNN  124

Query  777  YDYAQKNEHLLRSGRLGVCNDPYCTTCPT  863
             +Y +KNEHLLRSG LG+CNDPYCTTCPT
Sbjct  125  -NYDRKNEHLLRSGLLGMCNDPYCTTCPT  152



>ref|XP_006297016.1| hypothetical protein CARUB_v10013007mg [Capsella rubella]
 gb|EOA29914.1| hypothetical protein CARUB_v10013007mg [Capsella rubella]
Length=798

 Score = 91.3 bits (225),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 62/146 (42%), Positives = 85/146 (58%), Gaps = 10/146 (7%)
 Frame = +3

Query  438  MAAY-ERDVVPMLSATDSQADESGYRRFSYRARR-SLSIPANSYDTENNNH--FGFTGPL  605
            MA++ E D +PML  +DS +     R F+ R R  SLS P +S D  +N++   G+TGPL
Sbjct  1    MASHNENDDIPMLPISDSSSRS---RAFTSRTRSASLSNPTSSIDGFDNSNVVLGYTGPL  57

Query  606  RNERRTSYIQMSGPLYVGQTPTNNLRTSQVALGRKSTRQTLEIYPSTAIRESNDWEDYDY  785
            R  RR   +QMSGPL   + P   L     +         LE YPS A+   N  +D D+
Sbjct  58   RAPRRPPLVQMSGPLTSTRKP-EPLFLPHPSTSSSGVSSQLERYPS-ALEHKNSSDD-DF  114

Query  786  AQKNEHLLRSGRLGVCNDPYCTTCPT  863
              K+ +LL+SG+LG+CNDPYCTTCP+
Sbjct  115  VLKHANLLKSGQLGMCNDPYCTTCPS  140



>ref|XP_006587439.1| PREDICTED: probable cyclic nucleotide-gated ion channel 20, chloroplastic-like 
isoform X3 [Glycine max]
Length=615

 Score = 87.8 bits (216),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 58/150 (39%), Positives = 78/150 (52%), Gaps = 9/150 (6%)
 Frame = +3

Query  435  KMAAYERDVVPMLSATDSQADESGYRRFSYRARR----SLSIPANS---YDTENNNHFGF  593
            K+A +E+   P  S T +Q DE    RF     R    S+SIP  S   Y+ E +   G 
Sbjct  8    KVANFEKHGEPAPSETHAQHDELENSRFGKVISRTKSASISIPMVSMEPYERETS-LVGH  66

Query  594  TGPLRNERRTSYIQMSGPLYVGQTPTNNLRTSQVALGRKSTRQTLEIYPSTAIRESNDWE  773
            TGPL + R++  + ++G L       N L  S    G K      E   +   ++ N W 
Sbjct  67   TGPLPSVRKSPIMHVNGSLSATNGTENLLHQSIFVKGNKVVESKTEKISTLDRKDENHWN  126

Query  774  DYDYAQKNEHLLRSGRLGVCNDPYCTTCPT  863
            + +Y +KNEHLLRSG LG+CNDPYCTTCPT
Sbjct  127  N-NYDRKNEHLLRSGLLGMCNDPYCTTCPT  155



>ref|XP_006587438.1| PREDICTED: probable cyclic nucleotide-gated ion channel 20, chloroplastic-like 
isoform X2 [Glycine max]
Length=719

 Score = 88.2 bits (217),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 56/149 (38%), Positives = 76/149 (51%), Gaps = 7/149 (5%)
 Frame = +3

Query  435  KMAAYERDVVPMLSATDSQADESGYRRFSYRARR----SLSIPANSYD--TENNNHFGFT  596
            K+A +E+   P  S T +Q DE    RF     R    S+SIP  S +      +  G T
Sbjct  8    KVANFEKHGEPAPSETHAQHDELENSRFGKVISRTKSASISIPMVSMEPYERETSLVGHT  67

Query  597  GPLRNERRTSYIQMSGPLYVGQTPTNNLRTSQVALGRKSTRQTLEIYPSTAIRESNDWED  776
            GPL + R++  + ++G L       N L  S    G K      E   +   ++ N W +
Sbjct  68   GPLPSVRKSPIMHVNGSLSATNGTENLLHQSIFVKGNKVVESKTEKISTLDRKDENHWNN  127

Query  777  YDYAQKNEHLLRSGRLGVCNDPYCTTCPT  863
             +Y +KNEHLLRSG LG+CNDPYCTTCPT
Sbjct  128  -NYDRKNEHLLRSGLLGMCNDPYCTTCPT  155



>emb|CDX95833.1| BnaC05g35840D [Brassica napus]
Length=750

 Score = 87.8 bits (216),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 57/141 (40%), Positives = 82/141 (58%), Gaps = 5/141 (4%)
 Frame = +3

Query  450  ERDVVPMLSATDSQADESGYRRFSYRARR-SLSIPANSYDTENNNH--FGFTGPLRNERR  620
            E+D VPML  +DS +  S  R F+ R+R  SL+  +++ D  +++    G+TGPLR  RR
Sbjct  2    EKDDVPMLPVSDS-SSLSRTRPFTSRSRSVSLANTSSTIDGFDSSTVVLGYTGPLRTRRR  60

Query  621  TSYIQMSGPLYVGQTPTNNLRTSQVALGRKSTRQTLEIYPSTAIRESNDWEDYDYAQKNE  800
               +QMSGPL   ++             R  +    E YPS A  E  + E+ ++  K+ 
Sbjct  61   PPLVQMSGPLSSTRSSEPLFLPPPPTSTRDVSSSQPERYPSFAALEHKNSEE-EFVLKHA  119

Query  801  HLLRSGRLGVCNDPYCTTCPT  863
            HLLRSG+LG+CNDPYCTTCP+
Sbjct  120  HLLRSGQLGMCNDPYCTTCPS  140



>ref|XP_006587437.1| PREDICTED: probable cyclic nucleotide-gated ion channel 20, chloroplastic-like 
isoform X1 [Glycine max]
Length=785

 Score = 87.8 bits (216),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 56/149 (38%), Positives = 76/149 (51%), Gaps = 7/149 (5%)
 Frame = +3

Query  435  KMAAYERDVVPMLSATDSQADESGYRRFSYRARR----SLSIPANSYD--TENNNHFGFT  596
            K+A +E+   P  S T +Q DE    RF     R    S+SIP  S +      +  G T
Sbjct  8    KVANFEKHGEPAPSETHAQHDELENSRFGKVISRTKSASISIPMVSMEPYERETSLVGHT  67

Query  597  GPLRNERRTSYIQMSGPLYVGQTPTNNLRTSQVALGRKSTRQTLEIYPSTAIRESNDWED  776
            GPL + R++  + ++G L       N L  S    G K      E   +   ++ N W +
Sbjct  68   GPLPSVRKSPIMHVNGSLSATNGTENLLHQSIFVKGNKVVESKTEKISTLDRKDENHWNN  127

Query  777  YDYAQKNEHLLRSGRLGVCNDPYCTTCPT  863
             +Y +KNEHLLRSG LG+CNDPYCTTCPT
Sbjct  128  -NYDRKNEHLLRSGLLGMCNDPYCTTCPT  155



>ref|XP_002883080.1| cyclic nucleotide-binding transporter 1 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH59339.1| cyclic nucleotide-binding transporter 1 [Arabidopsis lyrata subsp. 
lyrata]
Length=767

 Score = 87.4 bits (215),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 59/148 (40%), Positives = 83/148 (56%), Gaps = 7/148 (5%)
 Frame = +3

Query  438  MAAY-ERDVVPMLSATDSQADESGYRRFSYRARR-SLSIPANSYDTENNNH--FGFTGPL  605
            MA++ E D +PML  +D  +     R F+ R+R  SLS P +S +  +N+    G+TGPL
Sbjct  1    MASHNENDDIPMLPISDPSSRTRA-RAFTSRSRSVSLSNPTSSIEGFDNSTVVLGYTGPL  59

Query  606  RNERRTSYIQMSGPLYVGQTPTNNLRTSQVALGRKSTRQTL--EIYPSTAIRESNDWEDY  779
            R +RR   +QMSGPL   + P         +    S   +   E YPS A  E     D 
Sbjct  60   RTQRRPPLVQMSGPLTSTRKPEPLFLPHPSSGSSDSVGVSSQPERYPSFAALEHKKSSDD  119

Query  780  DYAQKNEHLLRSGRLGVCNDPYCTTCPT  863
            ++  K+ +LLRSG+LG+CNDPYCTTCP+
Sbjct  120  EFVLKHANLLRSGQLGMCNDPYCTTCPS  147



>ref|XP_009146131.1| PREDICTED: probable cyclic nucleotide-gated ion channel 20, chloroplastic 
[Brassica rapa]
Length=680

 Score = 87.4 bits (215),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 57/141 (40%), Positives = 81/141 (57%), Gaps = 5/141 (4%)
 Frame = +3

Query  450  ERDVVPMLSATDSQADESGYRRFSYRARR-SLSIPANSYDTENNNH--FGFTGPLRNERR  620
            E+D VPML  +DS +  S  R F+ R+R  SL+  ++  D  +++    G+TGPLR  RR
Sbjct  2    EKDDVPMLPVSDS-SSLSRTRPFTSRSRSVSLANTSSILDGFDSSTVVLGYTGPLRTHRR  60

Query  621  TSYIQMSGPLYVGQTPTNNLRTSQVALGRKSTRQTLEIYPSTAIRESNDWEDYDYAQKNE  800
               +QMSGPL   ++             R  +    E YPS A  E  + E+ ++  K+ 
Sbjct  61   PPLVQMSGPLSSTRSSEPLFLPPPPTSTRDVSSSQPERYPSFAALEHKNSEE-EFVLKHA  119

Query  801  HLLRSGRLGVCNDPYCTTCPT  863
            HLLRSG+LG+CNDPYCTTCP+
Sbjct  120  HLLRSGQLGMCNDPYCTTCPS  140



>emb|CDX92152.1| BnaA05g22550D [Brassica napus]
Length=753

 Score = 85.9 bits (211),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 56/142 (39%), Positives = 79/142 (56%), Gaps = 7/142 (5%)
 Frame = +3

Query  450  ERDVVPMLSATDSQADESGYRRFSYRARRSLSIPANSYDTENNNH----FGFTGPLRNER  617
            E+D VPML  +DS +  S  R F+ R+R S+S+   S   +  +      G+TGPLR  R
Sbjct  2    EKDDVPMLPVSDS-SSLSRTRPFTSRSR-SVSLANTSSIIDGFDSSTVVLGYTGPLRTHR  59

Query  618  RTSYIQMSGPLYVGQTPTNNLRTSQVALGRKSTRQTLEIYPSTAIRESNDWEDYDYAQKN  797
            R   +QMSGPL   ++             R  +    E +PS A  E  + E+ ++  K+
Sbjct  60   RPPLVQMSGPLSSTRSSEPLFLPPPPTSTRDVSSSQPERHPSFAALEHKNSEE-EFVLKH  118

Query  798  EHLLRSGRLGVCNDPYCTTCPT  863
             HLLRSG+LG+CNDPYCTTCP+
Sbjct  119  AHLLRSGQLGMCNDPYCTTCPS  140



>ref|XP_010549021.1| PREDICTED: probable cyclic nucleotide-gated ion channel 20, chloroplastic 
[Tarenaya hassleriana]
Length=739

 Score = 85.1 bits (209),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 56/139 (40%), Positives = 71/139 (51%), Gaps = 32/139 (23%)
 Frame = +3

Query  453  RDVVPMLSATDSQADESGYRRFSYRARRSLSIPANSYDTENNNHFGFTGPLRNERRTSYI  632
            +D +PMLSA   +AD    R F++R +RS S+       E N   GFTGPLR +RRT+ I
Sbjct  9    KDEIPMLSA---EAD----RAFTWR-QRSASLSNPPVAVEANVRLGFTGPLRTQRRTTII  60

Query  633  QMS--GPLYVGQTPTNNLRTSQVALGRKSTRQTLEIYPSTAIRESNDWEDYDYAQKNEHL  806
            QMS  GPL     P                       PS ++   N       + KN HL
Sbjct  61   QMSQSGPLSSDPQPQ----------------------PSPSLTHLNHSSSSVSSYKNSHL  98

Query  807  LRSGRLGVCNDPYCTTCPT  863
            LRSG+LG+CNDPYCT CP+
Sbjct  99   LRSGQLGLCNDPYCTVCPS  117



>ref|NP_566585.1| cyclic nucleotide-binding transporter 1 [Arabidopsis thaliana]
 sp|Q9LD37.1|CNG20_ARATH RecName: Full=Probable cyclic nucleotide-gated ion channel 20, 
chloroplastic; AltName: Full=Cyclic nucleotide-binding transporter 
1; Flags: Precursor [Arabidopsis thaliana]
 gb|AAF73128.1|AF148541_1 cyclic nucleotide-binding transporter 1 [Arabidopsis thaliana]
 gb|AAF73130.1|AF148542_2 cyclic nucleotide-binding transporter 1 [Arabidopsis thaliana]
 dbj|BAB02062.1| unnamed protein product [Arabidopsis thaliana]
 gb|AEE75994.1| cyclic nucleotide-binding transporter 1 [Arabidopsis thaliana]
Length=764

 Score = 85.1 bits (209),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 61/149 (41%), Positives = 85/149 (57%), Gaps = 12/149 (8%)
 Frame = +3

Query  438  MAAY-ERDVVPMLSATDSQADESGYRRFSYRARR-SLSIPANS---YDTENNNHFGFTGP  602
            MA++ E D +PML  +D  +     R F+ R+R  SLS P +S   +DT +    G+TGP
Sbjct  1    MASHNENDDIPMLPISDPSSRTRA-RAFTSRSRSVSLSNPTSSIEGFDT-STVVLGYTGP  58

Query  603  LRNERRTSYIQMSGPLYV--GQTPTNNLRTSQVALGRKSTRQTLEIYPSTAIRESNDWED  776
            LR +RR   +QMSGPL       P      S  ++G  S     E YPS A  E  +  +
Sbjct  59   LRTQRRPPLVQMSGPLTSTRKHEPLFLPHPSSDSVGVSSQP---ERYPSFAALEHKNSSE  115

Query  777  YDYAQKNEHLLRSGRLGVCNDPYCTTCPT  863
             ++  K+ +LLRSG+LG+CNDPYCTTCP+
Sbjct  116  DEFVLKHANLLRSGQLGMCNDPYCTTCPS  144



>emb|CDY46885.1| BnaA01g27850D [Brassica napus]
Length=760

 Score = 84.7 bits (208),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 57/141 (40%), Positives = 81/141 (57%), Gaps = 8/141 (6%)
 Frame = +3

Query  450  ERDVVPMLSATDSQADESGYRRFSYRARR-SLSIPANSYDTENNNH--FGFTGPLRNERR  620
            E+D VPML  +D+    S  R F+ R+R  SLS   ++ D  +++    G+TGPLR +RR
Sbjct  6    EKDDVPMLPISDT----SRTRPFTSRSRSVSLSNTCSTIDGFDSSTVVLGYTGPLRAQRR  61

Query  621  TSYIQMSGPLYVGQTPTNNLRTSQVALGRKSTRQTLEIYPSTAIRESNDWEDYDYAQKNE  800
               +QMSGPL   +TP         +     +    E YPS A  E    +D ++  K+ 
Sbjct  62   PPLVQMSGPLSSTRTPEPLFLLPPPSDSVGISSSQPERYPSFATLEHKKSDD-EFVLKHA  120

Query  801  HLLRSGRLGVCNDPYCTTCPT  863
            +LLRSG+LG+CNDPYCTTCP+
Sbjct  121  NLLRSGQLGMCNDPYCTTCPS  141



>ref|XP_009381391.1| PREDICTED: probable cyclic nucleotide-gated ion channel 20, chloroplastic 
[Musa acuminata subsp. malaccensis]
Length=748

 Score = 84.3 bits (207),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 58/144 (40%), Positives = 77/144 (53%), Gaps = 16/144 (11%)
 Frame = +3

Query  438  MAAYERDVVPMLSATDSQADESGYRRFSYRARRSLSIPAN-SYDTENNNHFGFTGPLRNE  614
            MA +E+D VPMLS           RRF+ R+  S+S+P N SYD E++  F  TGPLR +
Sbjct  1    MAEHEKDYVPMLSGNIEM------RRFTARSA-SMSVPPNASYDGEDSLVFH-TGPLRTQ  52

Query  615  RRTSYIQMSGPLYVGQTPTNNLRTSQVALGRKSTRQTLEIYPSTAIRESNDWEDYDYAQK  794
            R T Y    GPL   + P N+  T    L  +S     E+    A  ++N      Y  +
Sbjct  53   RTTEYGVAVGPLSRNRKPENHW-TGHGKLHNRSQAVMPEVLGGGAFPDTN------YVTR  105

Query  795  NEHLLRSGRLGVCNDPYCTTCPTI  866
            NEHLL SG LG+CN+P CT CP +
Sbjct  106  NEHLLMSGPLGLCNNPDCTECPAV  129



>ref|XP_009113813.1| PREDICTED: probable cyclic nucleotide-gated ion channel 20, chloroplastic 
[Brassica rapa]
 ref|XP_009113822.1| PREDICTED: probable cyclic nucleotide-gated ion channel 20, chloroplastic 
[Brassica rapa]
Length=760

 Score = 83.6 bits (205),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 57/141 (40%), Positives = 80/141 (57%), Gaps = 8/141 (6%)
 Frame = +3

Query  450  ERDVVPMLSATDSQADESGYRRFSYRARR-SLSIPANSYDTENNNH--FGFTGPLRNERR  620
            E D VPML  +D+    S  R F+ R+R  SLS   ++ D  +++    G+TGPLR +RR
Sbjct  6    ENDDVPMLPISDT----SRTRPFTSRSRSVSLSNTCSTIDGFDSSTVVLGYTGPLRAQRR  61

Query  621  TSYIQMSGPLYVGQTPTNNLRTSQVALGRKSTRQTLEIYPSTAIRESNDWEDYDYAQKNE  800
               +QMSGPL   +TP         +     +    E YPS A  E    +D ++  K+ 
Sbjct  62   PPLVQMSGPLSSTRTPEPLFLLPPPSDSVGISSSQPERYPSFATLEHKKSDD-EFVLKHA  120

Query  801  HLLRSGRLGVCNDPYCTTCPT  863
            +LLRSG+LG+CNDPYCTTCP+
Sbjct  121  NLLRSGQLGMCNDPYCTTCPS  141



>ref|XP_007152600.1| hypothetical protein PHAVU_004G143700g [Phaseolus vulgaris]
 gb|ESW24594.1| hypothetical protein PHAVU_004G143700g [Phaseolus vulgaris]
Length=776

 Score = 82.8 bits (203),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 57/149 (38%), Positives = 79/149 (53%), Gaps = 11/149 (7%)
 Frame = +3

Query  438  MAAYERDVVPMLSATDSQADESGYRRFSYRARR----SLSIPANS---YDTENNNHFGFT  596
            MA +E+D     S T +Q +E  + RF     R    S+S+P  S   YD E +   G +
Sbjct  1    MANFEKDGEHRPSETHAQQNE--HFRFGKVVSRTRSASISVPVVSMEPYDRETS-LVGHS  57

Query  597  GPLRNERRTSYIQMSGPLYVGQTPTNNLRTSQVALGRKSTRQTLEIYPSTAIRESNDWED  776
            GPL + R+ S + MSGPLY      N L  ++V  G K      E     ++++ N   +
Sbjct  58   GPLPSVRKPSLMHMSGPLYATNGTENPLHHTKVVKGNKVVDSKTEKICILSLKDENHCSN  117

Query  777  YDYAQKNEHLLRSGRLGVCNDPYCTTCPT  863
             +Y +KNEHL+RS  LG CNDP CTTCPT
Sbjct  118  -NYDRKNEHLVRSRLLGTCNDPCCTTCPT  145



>ref|XP_003610842.1| Cyclic nucleotide gated channel [Medicago truncatula]
 gb|AES93800.1| cyclic nucleotide-gated cation channel protein [Medicago truncatula]
Length=742

 Score = 82.8 bits (203),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 51/142 (36%), Positives = 71/142 (50%), Gaps = 16/142 (11%)
 Frame = +3

Query  438  MAAYERDVVPMLSATDSQADESGYRRFSYRARRSLSIPANSYDTENNNHFGFTGPLRNER  617
            M  +++  +P+LS +      +  +  ++R R   S P+ S     +N  G TGPL   R
Sbjct  1    MNHFDKGEIPILSESTCAQRSNEPQDSTFR-RNISSTPSASI----SNLVGHTGPLHTAR  55

Query  618  RTSYIQMSGPLYVGQTPTNNLRTSQVALGRKSTRQTLEIYPSTAIRESNDWEDYDYAQKN  797
            +T   +MSGPLY      N  + S +  G K     +E               +D   KN
Sbjct  56   KTPVYRMSGPLYATPATGNPFQNSIIVAGNKVGENNIE-----------KLSTFDGTDKN  104

Query  798  EHLLRSGRLGVCNDPYCTTCPT  863
            EHLLRSG+LG+CNDPYCTTCPT
Sbjct  105  EHLLRSGQLGMCNDPYCTTCPT  126



>emb|CDY65691.1| BnaCnng48280D [Brassica napus]
Length=759

 Score = 82.0 bits (201),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 59/146 (40%), Positives = 86/146 (59%), Gaps = 19/146 (13%)
 Frame = +3

Query  450  ERDVVPMLSATDSQADESGYRRFSYRARR-SLSIPANSYDTENNNH--FGFTGPLRNERR  620
            E D VPML  +D+    S  R F+ R+R  SLS   ++ D  +++    G+TGPLR +RR
Sbjct  6    ENDDVPMLPISDT----SRTRPFTSRSRSVSLSNTCSTIDGFDSSTVVLGYTGPLRAQRR  61

Query  621  TSYIQMSGPLYVGQTPTNNLRTSQV-----ALGRKSTRQTLEIYPSTAIRESNDWEDYDY  785
               +QMSGPL    + T N     +     ++G  S++   E YPS A  E  + +D ++
Sbjct  62   PPLVQMSGPL----SSTRNPEPLFLLPPPDSVGISSSQP--ERYPSFATLEHKNSDD-EF  114

Query  786  AQKNEHLLRSGRLGVCNDPYCTTCPT  863
              K+ +LLRSG+LG+CNDPYCTTCP+
Sbjct  115  VLKHANLLRSGQLGMCNDPYCTTCPS  140



>ref|XP_006406700.1| hypothetical protein EUTSA_v10020123mg [Eutrema salsugineum]
 gb|ESQ48153.1| hypothetical protein EUTSA_v10020123mg [Eutrema salsugineum]
Length=766

 Score = 81.3 bits (199),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 62/147 (42%), Positives = 88/147 (60%), Gaps = 14/147 (10%)
 Frame = +3

Query  450  ERDVVPMLSATDSQADESGYRRFSYRARR-SLSIPANSYDTENNNH--FGFTGPLRNERR  620
            E D VPML   DS    S  R F+ R+R  SLS  +++ D  +++    G+TGPLR +RR
Sbjct  6    ENDDVPMLPIPDS--SRSRARTFTSRSRSVSLSNTSSTIDGFDSSSVVLGYTGPLRTQRR  63

Query  621  TS-YIQMSGPLYVGQT--PTNNL---RTSQVALGRKSTRQTLEIYPSTAIRESNDWEDYD  782
                +QMSGPLY  ++  P + L     S  ++G  S++   E YPS A  E    +D +
Sbjct  64   PPPLVQMSGPLYPTRSSEPVSLLPLPTGSCDSVGGVSSQP--ERYPSFAALEHKKSDD-E  120

Query  783  YAQKNEHLLRSGRLGVCNDPYCTTCPT  863
            +  K+ +LLRSG+LG+CNDPYCTTCP+
Sbjct  121  FVLKHANLLRSGQLGMCNDPYCTTCPS  147



>ref|XP_003549190.1| PREDICTED: probable cyclic nucleotide-gated ion channel 20, chloroplastic-like 
[Glycine max]
Length=747

 Score = 80.1 bits (196),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 56/149 (38%), Positives = 75/149 (50%), Gaps = 30/149 (20%)
 Frame = +3

Query  438  MAAYERDVVPMLSATDSQA-DESGYRRFSYRARR----SLSIPANSYDTENNNHFGFTGP  602
            MA +E   + M+S TD+Q+ DE+ + +F     R    S+SIP  SY             
Sbjct  1    MANFEDRELLMMSETDAQSYDETLHSKFQRLLSRTQSASVSIPMESY-------------  47

Query  603  LRNERRTSYIQMSGPLYVGQTPT--NNLRTSQVALGRKSTRQTLEIYPSTAIRESNDWED  776
               ER+TS +  SG LY   TP   N L+ S V  G K+     + + +    +  D   
Sbjct  48   ---ERKTSIVGHSGSLYANATPGTDNLLQHSIVVTGNKTEESKTDKFATFISTDKFD---  101

Query  777  YDYAQKNEHLLRSGRLGVCNDPYCTTCPT  863
                 KNEHLL SG+LG+CNDPYCTTCPT
Sbjct  102  ----SKNEHLLISGQLGICNDPYCTTCPT  126



>gb|KHN24539.1| Putative cyclic nucleotide-gated ion channel 20, chloroplastic 
[Glycine soja]
Length=747

 Score = 80.1 bits (196),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 56/149 (38%), Positives = 75/149 (50%), Gaps = 30/149 (20%)
 Frame = +3

Query  438  MAAYERDVVPMLSATDSQA-DESGYRRFSYRARR----SLSIPANSYDTENNNHFGFTGP  602
            MA +E   + M+S TD+Q+ DE+ + +F     R    S+SIP  SY             
Sbjct  1    MANFEDRELLMMSETDAQSYDETLHSKFQRLLSRTQSASVSIPMESY-------------  47

Query  603  LRNERRTSYIQMSGPLYVGQTPT--NNLRTSQVALGRKSTRQTLEIYPSTAIRESNDWED  776
               ER+TS +  SG LY   TP   N L+ S V  G K+     + + +    +  D   
Sbjct  48   ---ERKTSIVGHSGSLYANATPGTDNLLQHSIVVTGNKTEESKTDKFATFISTDKFD---  101

Query  777  YDYAQKNEHLLRSGRLGVCNDPYCTTCPT  863
                 KNEHLL SG+LG+CNDPYCTTCPT
Sbjct  102  ----SKNEHLLISGQLGICNDPYCTTCPT  126



>ref|XP_006299424.1| hypothetical protein CARUB_v10015585mg [Capsella rubella]
 gb|EOA32322.1| hypothetical protein CARUB_v10015585mg [Capsella rubella]
Length=753

 Score = 80.1 bits (196),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 56/143 (39%), Positives = 78/143 (55%), Gaps = 18/143 (13%)
 Frame = +3

Query  450  ERDVVPMLSATDSQADESGYRRFSYRARRSLSIPANSYDTENNNH----FGFTGPLRNER  617
            E +  P+L    + A  +  R F+ R  RSLS+   ++ TE  +H     G+TGPLR +R
Sbjct  6    ENEEFPILQ-FQATAPRAHSRTFTSR-NRSLSLSNPTFSTEGVDHSSVVLGYTGPLRTQR  63

Query  618  -RTSYIQMSGPLYVGQTPTNNLRTSQVALGRKSTRQTLEIYPSTAIRESNDWEDYDYAQK  794
             R   +QMSGPLY  + P      S     R S+  T+ + P          ED D+  +
Sbjct  64   VRPRLVQMSGPLYSTRRPEPLSPLSPQEPLRSSSSSTVNVPP----------ED-DFVFQ  112

Query  795  NEHLLRSGRLGVCNDPYCTTCPT  863
            N +LLRSG+LG+CNDPYCTTCP+
Sbjct  113  NANLLRSGQLGMCNDPYCTTCPS  135



>gb|KFK39100.1| hypothetical protein AALP_AA3G201000 [Arabis alpina]
Length=436

 Score = 78.2 bits (191),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 55/139 (40%), Positives = 78/139 (56%), Gaps = 20/139 (14%)
 Frame = +3

Query  459  VVPMLSATDSQADESGYRRFSYRARR-SLSIPANSYDTENNN--HFGFTGPLRNERRTS-  626
            ++P+  AT S A     R F+   R  SLS P  S D  +N+  +FG+TGPLR +RR   
Sbjct  13   LLPISEATSSHAHS---RSFTSTNRSVSLSNPTFSIDGFDNSSVNFGYTGPLRTQRRLPP  69

Query  627  YIQMSGPLYVGQTPTNNLRTSQVALGRKSTRQTLEIYPSTAIRESNDWEDYDYAQKNEHL  806
             +QMS PLY  + P ++   S       ++  T+++ P          ED D+  KN  L
Sbjct  70   LVQMSRPLYSTRIPESHF--SPTPNQPPASSSTVDVPP----------ED-DFVLKNADL  116

Query  807  LRSGRLGVCNDPYCTTCPT  863
            L+SG+LG+CNDPYCTTCP+
Sbjct  117  LKSGQLGMCNDPYCTTCPS  135



>ref|XP_003619945.1| Cyclic nucleotide-gated ion channel [Medicago truncatula]
Length=301

 Score = 77.0 bits (188),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 54/150 (36%), Positives = 75/150 (50%), Gaps = 35/150 (23%)
 Frame = +3

Query  438  MAAYERDVVPMLSATDSQ-ADE---SGYRRFSYRARR-SLSIPANS---YDTENNNHFGF  593
            M  +++D +P+LS T  Q +DE   S +RR   R R  S+SIP  S   Y+ + N     
Sbjct  1    MNHFDKDEIPILSETHGQRSDEPQDSTFRRNISRTRSASISIPMASLEPYERQPNL----  56

Query  594  TGPLRNERRTSYIQMSGPLYVGQTPTNNLRTSQVALGRKSTRQTLEIYPSTAIRESNDWE  773
               +R  R+T   QMSGPLY      N  + + +                     + ++ 
Sbjct  57   ---VRTTRKTPISQMSGPLYATAATGNPFQNTMIV--------------------TENFS  93

Query  774  DYDYAQKNEHLLRSGRLGVCNDPYCTTCPT  863
             +D   KNEHLLRSG+LG+CNDPY TTCPT
Sbjct  94   TFDGMDKNEHLLRSGQLGMCNDPYFTTCPT  123



>ref|XP_008789209.1| PREDICTED: probable cyclic nucleotide-gated ion channel 20, chloroplastic 
isoform X2 [Phoenix dactylifera]
Length=684

 Score = 77.0 bits (188),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 52/144 (36%), Positives = 78/144 (54%), Gaps = 17/144 (12%)
 Frame = +3

Query  438  MAAYERDVVPMLSATDSQADESGYRRFSYRARRSLSIPAN-SYDTENNNHFGFTGPLRNE  614
            MA  ++D +PMLS       +   ++ + R+  S+S+P N SY++E+      TGPLR +
Sbjct  1    MADQDKDHIPMLS------KDIELQKITARSA-SMSMPPNVSYESEDT-FISHTGPLRIQ  52

Query  615  RRTSYIQMSGPLYVGQTPTNNLRTSQVALGRKSTRQTLEIYPST-AIRESNDWEDYDYAQ  791
            R T +   SGPL  G+   + +         K  +Q  +I+    A+   N W D ++  
Sbjct  53   RTTQFAPTSGPL-CGKQKVDEVP------WLKHGKQHAKIHAVMPAVMGQNGWSDNNHHT  105

Query  792  KNEHLLRSGRLGVCNDPYCTTCPT  863
            KNEHLL+SG LG+CNDP CT CP 
Sbjct  106  KNEHLLKSGPLGLCNDPDCTDCPA  129



>ref|XP_010932484.1| PREDICTED: probable cyclic nucleotide-gated ion channel 20, chloroplastic 
[Elaeis guineensis]
Length=766

 Score = 76.6 bits (187),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 50/144 (35%), Positives = 76/144 (53%), Gaps = 18/144 (13%)
 Frame = +3

Query  438  MAAYERDVVPMLSATDSQADESGYRRFSYRARRSLSIPANSYDTENNNHFGFTGPLRNER  617
            MA  ++D +PMLS       +   ++F+ R+  S+S+P N      +     TGPLR  R
Sbjct  1    MANQDKDHIPMLS------KDIKLQKFTARSA-SMSMPPNVSSESEDIFVSHTGPLRIPR  53

Query  618  RTSYIQMSGPLYVGQTPTNNLRTSQVALGR--KSTRQTLEIYPSTAIRESNDWEDYDYAQ  791
             T +   SGPLY      +N +  +V   +  K   +   + P  A+   NDW D ++ +
Sbjct  54   -TQFAHTSGPLY------SNQKVDEVPWLKHDKLHAKVHSVMP--AVMGQNDWSDNNHVE  104

Query  792  KNEHLLRSGRLGVCNDPYCTTCPT  863
            KNE+LL+SG LG+CN+P CT CP 
Sbjct  105  KNEYLLKSGPLGLCNNPDCTDCPA  128



>ref|XP_008789206.1| PREDICTED: probable cyclic nucleotide-gated ion channel 20, chloroplastic 
isoform X1 [Phoenix dactylifera]
 ref|XP_008789207.1| PREDICTED: probable cyclic nucleotide-gated ion channel 20, chloroplastic 
isoform X1 [Phoenix dactylifera]
 ref|XP_008789208.1| PREDICTED: probable cyclic nucleotide-gated ion channel 20, chloroplastic 
isoform X1 [Phoenix dactylifera]
Length=772

 Score = 76.6 bits (187),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 52/144 (36%), Positives = 78/144 (54%), Gaps = 17/144 (12%)
 Frame = +3

Query  438  MAAYERDVVPMLSATDSQADESGYRRFSYRARRSLSIPAN-SYDTENNNHFGFTGPLRNE  614
            MA  ++D +PMLS       +   ++ + R+  S+S+P N SY++E+      TGPLR +
Sbjct  1    MADQDKDHIPMLS------KDIELQKITARSA-SMSMPPNVSYESEDT-FISHTGPLRIQ  52

Query  615  RRTSYIQMSGPLYVGQTPTNNLRTSQVALGRKSTRQTLEIYPST-AIRESNDWEDYDYAQ  791
            R T +   SGPL  G+   + +         K  +Q  +I+    A+   N W D ++  
Sbjct  53   RTTQFAPTSGPL-CGKQKVDEVP------WLKHGKQHAKIHAVMPAVMGQNGWSDNNHHT  105

Query  792  KNEHLLRSGRLGVCNDPYCTTCPT  863
            KNEHLL+SG LG+CNDP CT CP 
Sbjct  106  KNEHLLKSGPLGLCNDPDCTDCPA  129



>ref|XP_008789204.1| PREDICTED: probable cyclic nucleotide-gated ion channel 20, chloroplastic 
isoform X2 [Phoenix dactylifera]
Length=711

 Score = 75.9 bits (185),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 50/143 (35%), Positives = 72/143 (50%), Gaps = 15/143 (10%)
 Frame = +3

Query  438  MAAYERDVVPMLSATDSQADESGYRRFSYRARRSLSIPANSYDTENNNHFGFTGPLRNER  617
            MA  ++D +PMLS       +   ++ + R+      P  SY++E+      TGPLR +R
Sbjct  1    MADQDKDHIPMLS------KDIKLQKITARSASMSMAPNVSYESEDT-FISHTGPLRIQR  53

Query  618  RTSYIQMSGPLYVGQTPTNNLRTSQVALGRKSTRQTLEIYPST-AIRESNDWEDYDYAQK  794
             T +   SGPL        N +  +V    K   Q  +I+    A+   N W D ++  K
Sbjct  54   TTQFAPTSGPL------CGNQKVDEVPW-LKHGNQHAKIHAGMPAVMGQNGWSDNNHHTK  106

Query  795  NEHLLRSGRLGVCNDPYCTTCPT  863
            NEHLL+SG LG+CNDP CT CP 
Sbjct  107  NEHLLKSGPLGLCNDPDCTDCPA  129



>ref|XP_008789205.1| PREDICTED: probable cyclic nucleotide-gated ion channel 20, chloroplastic 
isoform X3 [Phoenix dactylifera]
Length=671

 Score = 75.9 bits (185),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 50/143 (35%), Positives = 72/143 (50%), Gaps = 15/143 (10%)
 Frame = +3

Query  438  MAAYERDVVPMLSATDSQADESGYRRFSYRARRSLSIPANSYDTENNNHFGFTGPLRNER  617
            MA  ++D +PMLS       +   ++ + R+      P  SY++E+      TGPLR +R
Sbjct  1    MADQDKDHIPMLS------KDIKLQKITARSASMSMAPNVSYESEDT-FISHTGPLRIQR  53

Query  618  RTSYIQMSGPLYVGQTPTNNLRTSQVALGRKSTRQTLEIYPST-AIRESNDWEDYDYAQK  794
             T +   SGPL        N +  +V    K   Q  +I+    A+   N W D ++  K
Sbjct  54   TTQFAPTSGPL------CGNQKVDEVP-WLKHGNQHAKIHAGMPAVMGQNGWSDNNHHTK  106

Query  795  NEHLLRSGRLGVCNDPYCTTCPT  863
            NEHLL+SG LG+CNDP CT CP 
Sbjct  107  NEHLLKSGPLGLCNDPDCTDCPA  129



>ref|XP_008789202.1| PREDICTED: probable cyclic nucleotide-gated ion channel 20, chloroplastic 
isoform X1 [Phoenix dactylifera]
 ref|XP_008789203.1| PREDICTED: probable cyclic nucleotide-gated ion channel 20, chloroplastic 
isoform X1 [Phoenix dactylifera]
Length=759

 Score = 75.9 bits (185),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 50/143 (35%), Positives = 72/143 (50%), Gaps = 15/143 (10%)
 Frame = +3

Query  438  MAAYERDVVPMLSATDSQADESGYRRFSYRARRSLSIPANSYDTENNNHFGFTGPLRNER  617
            MA  ++D +PMLS       +   ++ + R+      P  SY++E+      TGPLR +R
Sbjct  1    MADQDKDHIPMLS------KDIKLQKITARSASMSMAPNVSYESEDT-FISHTGPLRIQR  53

Query  618  RTSYIQMSGPLYVGQTPTNNLRTSQVALGRKSTRQTLEIYPST-AIRESNDWEDYDYAQK  794
             T +   SGPL        N +  +V    K   Q  +I+    A+   N W D ++  K
Sbjct  54   TTQFAPTSGPL------CGNQKVDEVPW-LKHGNQHAKIHAGMPAVMGQNGWSDNNHHTK  106

Query  795  NEHLLRSGRLGVCNDPYCTTCPT  863
            NEHLL+SG LG+CNDP CT CP 
Sbjct  107  NEHLLKSGPLGLCNDPDCTDCPA  129



>ref|XP_010505803.1| PREDICTED: probable cyclic nucleotide-gated ion channel 20, chloroplastic 
[Camelina sativa]
Length=752

 Score = 75.1 bits (183),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 55/141 (39%), Positives = 76/141 (54%), Gaps = 18/141 (13%)
 Frame = +3

Query  450  ERDVVPMLSATDSQADESGYRRFSYRARR-SLSIPANSYDTENNNH--FGFTGPLRNERR  620
            E D +PML  +DS    S  R F+ R+R  SLS P +S D  +N+    G+TGPLR +RR
Sbjct  6    ENDDLPMLPISDS---SSRTRDFTSRSRSVSLSNPTSSIDGFDNSAVVLGYTGPLRTQRR  62

Query  621  TSYIQMSGPLYVGQTPTNNLRTSQVALGRKSTRQTLEIYPSTAIRESNDWEDYDYAQKNE  800
               +QMSGPL   + P          L       T     S A  + +D    ++   + 
Sbjct  63   PPLVQMSGPLTSTRKPE--------PLFLPHPSTTTTATSSGASSQLDD----EFVLNHA  110

Query  801  HLLRSGRLGVCNDPYCTTCPT  863
            +LL+SG+LG+CNDPYCTTCP+
Sbjct  111  NLLKSGQLGMCNDPYCTTCPS  131



>ref|XP_010487667.1| PREDICTED: probable cyclic nucleotide-gated ion channel 20, chloroplastic 
[Camelina sativa]
Length=752

 Score = 74.3 bits (181),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 54/141 (38%), Positives = 75/141 (53%), Gaps = 18/141 (13%)
 Frame = +3

Query  450  ERDVVPMLSATDSQADESGYRRFSYRARR-SLSIPANSYDTENNNHF--GFTGPLRNERR  620
            E D +PML  +DS    S  R F+ R+   SLS P +S D  +N+    G+TGPLR +RR
Sbjct  6    ENDDIPMLPISDS---SSRTRAFTSRSHSVSLSNPTSSIDGFDNSTVVSGYTGPLRTQRR  62

Query  621  TSYIQMSGPLYVGQTPTNNLRTSQVALGRKSTRQTLEIYPSTAIRESNDWEDYDYAQKNE  800
               +QMSGPL   + P          L       T     S A  + +D    ++  K+ 
Sbjct  63   PPLVQMSGPLTSTRIPE--------PLFLPHPSTTTTTTSSGASSQLDD----EFVLKHA  110

Query  801  HLLRSGRLGVCNDPYCTTCPT  863
            +L +SG+LG+CNDPYCTTCP+
Sbjct  111  NLFKSGQLGMCNDPYCTTCPS  131



>emb|CDX92150.1| BnaA05g22570D [Brassica napus]
Length=790

 Score = 74.3 bits (181),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 52/146 (36%), Positives = 78/146 (53%), Gaps = 19/146 (13%)
 Frame = +3

Query  450  ERDVVPMLSATDSQADESGYRRFSYRARRSLSIPANSYDTENNNH----FGFTGPLRNER  617
            E+D  P+L         +  R F+ R  RS+S   ++Y T   ++     G+TGPLR +R
Sbjct  6    EKDEFPILLPVPEARSRANTRAFNSR-NRSVSFSNSTYSTNRVDNSSVVLGYTGPLRTQR  64

Query  618  RTS-YIQMSGPLYVGQTPTNNL---RTSQVALGRKSTRQTLEIYPSTAIRESNDWEDYDY  785
            R    +QMSGPLY  + P  +     + Q      S+  T+++ PS         E+ + 
Sbjct  65   RPPPSVQMSGPLYSTRRPDQSFFSPSSVQPPDSSLSSSTTVDV-PS---------EEDEV  114

Query  786  AQKNEHLLRSGRLGVCNDPYCTTCPT  863
              KN +LL+SG+LG+CNDPYCTTCP+
Sbjct  115  VLKNANLLKSGQLGMCNDPYCTTCPS  140



>ref|XP_006849531.2| PREDICTED: probable cyclic nucleotide-gated ion channel 20, chloroplastic 
[Amborella trichopoda]
 ref|XP_011625272.1| PREDICTED: probable cyclic nucleotide-gated ion channel 20, chloroplastic 
[Amborella trichopoda]
Length=772

 Score = 73.6 bits (179),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 52/153 (34%), Positives = 79/153 (52%), Gaps = 20/153 (13%)
 Frame = +3

Query  438  MAAYERDVVPMLSATDSQADESGY----RRFSYRARRSLSIPANSYDTENNNHF---GFT  596
            MA + +D +PML       ++ G+    +RFS    R +S   ++  T N+N +     T
Sbjct  1    MAFHNKDELPMLDTRIEVLNDGGFDRERKRFS--LSRCVSFSVDATPTPNSNEYVPMFHT  58

Query  597  GPLRNERRTSYIQMSGPLYVGQTPTNNLRTSQVALG--RKSTRQTLEIYPSTAIRESNDW  770
            GPLR+ R+  Y++        +   + LR ++ + G  R +  Q +E        + +D 
Sbjct  59   GPLRSSRKNPYLR-------SRDLIHTLRDNEGSQGTSRSNAVQAIEFPNDNGKTQESDK  111

Query  771  EDYD--YAQKNEHLLRSGRLGVCNDPYCTTCPT  863
            E  D  Y  KNEHLLRSG LG CNDP+CTTCP+
Sbjct  112  EKLDNSYDGKNEHLLRSGPLGRCNDPFCTTCPS  144



>ref|XP_009145988.1| PREDICTED: putative cyclic nucleotide-gated ion channel 19 [Brassica 
rapa]
 ref|XP_009145989.1| PREDICTED: putative cyclic nucleotide-gated ion channel 19 [Brassica 
rapa]
Length=786

 Score = 72.8 bits (177),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 51/143 (36%), Positives = 76/143 (53%), Gaps = 17/143 (12%)
 Frame = +3

Query  450  ERDVVPMLSATDSQADESGYRRFSYRARRSLSIPANSYDTENNNH----FGFTGPLRNER  617
            E+D  P+L         +  R F+ R  RS+S   ++Y T   ++     G+TGPLR +R
Sbjct  6    EKDEFPILLPVPEARSRANTRAFNSR-NRSVSFSNSTYSTNRVDNSSVVLGYTGPLRTQR  64

Query  618  RTS-YIQMSGPLYVGQTPTNNLRTSQVALGRKSTRQTLEIYPSTAIRESNDWEDYDYAQK  794
            R    +QMSGPLY  + P  +           S+  T+++ PS         E+ +   K
Sbjct  65   RLPPSVQMSGPLYSTRRPDQSFFPPSPVQPPDSS-STVDV-PS---------EEDEVVLK  113

Query  795  NEHLLRSGRLGVCNDPYCTTCPT  863
            N +LL+SG+LG+CNDPYCTTCP+
Sbjct  114  NANLLKSGQLGMCNDPYCTTCPS  136



>ref|XP_010505715.1| PREDICTED: putative cyclic nucleotide-gated ion channel 19 isoform 
X2 [Camelina sativa]
Length=714

 Score = 72.4 bits (176),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 54/145 (37%), Positives = 74/145 (51%), Gaps = 28/145 (19%)
 Frame = +3

Query  450  ERDVVPMLSATDSQADESGYRRFSYRARR-SLSIPANSYDTENNNHF--GFTGPLRNER-  617
            E D  P+L         S  R F++R R  SLS P  S +  +N+ F  G+TGPL+ +R 
Sbjct  6    ENDEFPILPEVTPPRARS--RTFTFRNRSLSLSNPTFSTEGVDNSSFVLGYTGPLQTQRI  63

Query  618  RTSYIQMSGPLYVGQTPTNNLRTSQVALGRKSTRQTLEIYPSTAI---RESNDWEDYDYA  788
            R   +QMSGPLY                   STR+T  + P +        N   + D+ 
Sbjct  64   RPRLVQMSGPLY-------------------STRRTEPLSPPSPQEPPHSINVQPEEDFV  104

Query  789  QKNEHLLRSGRLGVCNDPYCTTCPT  863
             +N +L RSG+LG+CNDPYCTTCP+
Sbjct  105  FQNANLWRSGQLGMCNDPYCTTCPS  129



>ref|XP_010505696.1| PREDICTED: putative cyclic nucleotide-gated ion channel 19 isoform 
X1 [Camelina sativa]
 ref|XP_010505703.1| PREDICTED: putative cyclic nucleotide-gated ion channel 19 isoform 
X1 [Camelina sativa]
 ref|XP_010505708.1| PREDICTED: putative cyclic nucleotide-gated ion channel 19 isoform 
X1 [Camelina sativa]
Length=747

 Score = 72.4 bits (176),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 54/145 (37%), Positives = 74/145 (51%), Gaps = 28/145 (19%)
 Frame = +3

Query  450  ERDVVPMLSATDSQADESGYRRFSYRARR-SLSIPANSYDTENNNHF--GFTGPLRNER-  617
            E D  P+L         S  R F++R R  SLS P  S +  +N+ F  G+TGPL+ +R 
Sbjct  6    ENDEFPILPEVTPPRARS--RTFTFRNRSLSLSNPTFSTEGVDNSSFVLGYTGPLQTQRI  63

Query  618  RTSYIQMSGPLYVGQTPTNNLRTSQVALGRKSTRQTLEIYPSTAI---RESNDWEDYDYA  788
            R   +QMSGPLY                   STR+T  + P +        N   + D+ 
Sbjct  64   RPRLVQMSGPLY-------------------STRRTEPLSPPSPQEPPHSINVQPEEDFV  104

Query  789  QKNEHLLRSGRLGVCNDPYCTTCPT  863
             +N +L RSG+LG+CNDPYCTTCP+
Sbjct  105  FQNANLWRSGQLGMCNDPYCTTCPS  129



>gb|KEH26827.1| cyclic nucleotide gated channel protein [Medicago truncatula]
Length=778

 Score = 72.0 bits (175),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 51/150 (34%), Positives = 72/150 (48%), Gaps = 35/150 (23%)
 Frame = +3

Query  438  MAAYERDVVPMLSATDSQ----ADESGYRRFSYRARR-SLSIPANS---YDTENNNHFGF  593
            M  +++D + +LS T  Q      +S +RR   R R  S+SIP  S   Y+ + N     
Sbjct  1    MNHFDKDEILILSETHVQRSHEPQDSTFRRNISRTRSASISIPMASLEPYERQPN-----  55

Query  594  TGPLRNERRTSYIQMSGPLYVGQTPTNNLRTSQVALGRKSTRQTLEIYPSTAIRESNDWE  773
               +R  R+T   QMSGPLY      N  + + +                     + ++ 
Sbjct  56   --LVRTTRKTPISQMSGPLYATAATGNPFQNTMIV--------------------TENFS  93

Query  774  DYDYAQKNEHLLRSGRLGVCNDPYCTTCPT  863
             +D   KNEHLLRSG+LG+CNDPY TTCPT
Sbjct  94   TFDGMDKNEHLLRSGQLGMCNDPYFTTCPT  123



>gb|KEH26828.1| cyclic nucleotide gated channel protein [Medicago truncatula]
Length=765

 Score = 72.0 bits (175),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 51/150 (34%), Positives = 72/150 (48%), Gaps = 35/150 (23%)
 Frame = +3

Query  438  MAAYERDVVPMLSATDSQ----ADESGYRRFSYRARR-SLSIPANS---YDTENNNHFGF  593
            M  +++D + +LS T  Q      +S +RR   R R  S+SIP  S   Y+ + N     
Sbjct  1    MNHFDKDEILILSETHVQRSHEPQDSTFRRNISRTRSASISIPMASLEPYERQPN-----  55

Query  594  TGPLRNERRTSYIQMSGPLYVGQTPTNNLRTSQVALGRKSTRQTLEIYPSTAIRESNDWE  773
               +R  R+T   QMSGPLY      N  + + +                     + ++ 
Sbjct  56   --LVRTTRKTPISQMSGPLYATAATGNPFQNTMIV--------------------TENFS  93

Query  774  DYDYAQKNEHLLRSGRLGVCNDPYCTTCPT  863
             +D   KNEHLLRSG+LG+CNDPY TTCPT
Sbjct  94   TFDGMDKNEHLLRSGQLGMCNDPYFTTCPT  123



>gb|KHN44945.1| Putative cyclic nucleotide-gated ion channel 20, chloroplastic 
[Glycine soja]
Length=126

 Score = 67.8 bits (164),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 49/127 (39%), Positives = 68/127 (54%), Gaps = 8/127 (6%)
 Frame = +3

Query  438  MAAYERDVVPMLSATDSQ-ADE---SGYRRFSYRARR-SLSIPANSYDT--ENNNHFGFT  596
            MA +E+D VPM+S T +Q +DE   S +RR   R R  S+SIP  S ++  +  +  G T
Sbjct  1    MAHFEKDEVPMMSETHAQLSDEVVDSNFRRLVSRTRSASISIPMASLESYEKETSLVGHT  60

Query  597  GPLRNERRTSYIQMSGPLYVGQTPTNNLRTSQVALGRKSTRQTLEIYPSTAIRESNDWED  776
            GPL + R+T  +QMSGPLY      N  R + VA   K      E + +    + N W D
Sbjct  61   GPLHSVRKTPSVQMSGPLYATNGTGNLSRQNIVATRTKVMESKTEKFSTFNGTDENRW-D  119

Query  777  YDYAQKN  797
             DY +KN
Sbjct  120  NDYNRKN  126



>ref|NP_188396.2| cyclic nucleotide gated channel 19 [Arabidopsis thaliana]
 sp|Q9LDR2.1|CNG19_ARATH RecName: Full=Putative cyclic nucleotide-gated ion channel 19; 
AltName: Full=Cyclic nucleotide-binding transporter 2 [Arabidopsis 
thaliana]
 gb|AAF73129.1|AF148542_1 cyclic nucleotide-binding transporter 2 [Arabidopsis thaliana]
 dbj|BAB02061.1| cyclic nucleotide and calmodulin-regulated ion channel protein-like 
[Arabidopsis thaliana]
 gb|AEE75993.1| cyclic nucleotide gated channel 19 [Arabidopsis thaliana]
Length=729

 Score = 71.2 bits (173),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 54/130 (42%), Positives = 73/130 (56%), Gaps = 33/130 (25%)
 Frame = +3

Query  510  RRFSYRARR-SLSIPANSYDTENNNH--FGFTGPLRNER-RTSYIQMSGPLYVGQTPTNN  677
            R F+ R R  SLS P+ S D  +N+    G+TGPLR +R R   +QMSGP++        
Sbjct  5    RTFTSRNRSVSLSNPSFSIDGFDNSTVTLGYTGPLRTQRIRPPLVQMSGPIH--------  56

Query  678  LRTSQVALGRKSTRQTLEIYPSTAIRESNDW--------EDYDYAQKNEHLLRSGRLGVC  833
                       STR+T  ++ S + +ES D         ED D+  KN +LLRSG+LG+C
Sbjct  57   -----------STRRTEPLF-SPSPQESPDSSSTVDVPPED-DFVFKNANLLRSGQLGMC  103

Query  834  NDPYCTTCPT  863
            NDPYCTTCP+
Sbjct  104  NDPYCTTCPS  113



>ref|XP_002883079.1| ATCNGC19 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH59338.1| ATCNGC19 [Arabidopsis lyrata subsp. lyrata]
Length=753

 Score = 71.2 bits (173),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 53/142 (37%), Positives = 75/142 (53%), Gaps = 16/142 (11%)
 Frame = +3

Query  450  ERDVVPMLSATDSQADESGYRRFSYRARR-SLSIPANSYDTENNNH--FGFTGPLRNER-  617
            E D  P+L    +    +  R F+ R R  SLS P  S+D  +++    G+TGPLR +R 
Sbjct  6    ENDEFPILPIPKA-TPRAHTRAFTSRNRSVSLSNPTFSFDGFDSSSVVLGYTGPLRTQRI  64

Query  618  RTSYIQMSGPLYVGQTPTNNLRTSQVALGRKSTRQTLEIYPSTAIRESNDWEDYDYAQKN  797
            R   +QMSGPL+  +        S       S+  T+ + P          ED D+  +N
Sbjct  65   RPPLVQMSGPLHSTRRTEPLFSPSPQEPPDSSSSSTVNVPP----------ED-DFVFQN  113

Query  798  EHLLRSGRLGVCNDPYCTTCPT  863
             +LLRSG+LG+CNDPYCTTCP+
Sbjct  114  ANLLRSGQLGMCNDPYCTTCPS  135



>ref|XP_006297066.1| hypothetical protein CARUB_v10013067mg [Capsella rubella]
 gb|EOA29964.1| hypothetical protein CARUB_v10013067mg [Capsella rubella]
Length=724

 Score = 70.9 bits (172),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 55/146 (38%), Positives = 77/146 (53%), Gaps = 19/146 (13%)
 Frame = +3

Query  450  ERDVVPMLSATDSQADESGYRRFSYRARR-SLSIPANSYDTENNNH--FGFTGPLRNERR  620
            E+D + ML  +DS    S  R F+ R R  S S P +  D  +N+    G+TGPLR + R
Sbjct  7    EKDDMHMLPISDS---SSSTRAFNSRTRNVSHSNPTSYADGSDNSTVVLGYTGPLRTQGR  63

Query  621  TSYIQMSGPLYVGQTPTNNLR-----TSQVALGRKSTRQTLEIYPSTAIRESNDWEDYDY  785
               +QM  PL   + P          TS  ++G  +    LE++PS A+   N  +D  +
Sbjct  64   PPLVQMRAPLTSSRQPEPIFLPHPSTTSSDSVGVSTQ---LEMHPS-ALEHKNTSDDLKH  119

Query  786  AQKNEHLLRSGRLGVCNDPYCTTCPT  863
            A+     LRSG LGVC+DPYCTTCP+
Sbjct  120  AKP----LRSGTLGVCSDPYCTTCPS  141



>ref|XP_007152602.1| hypothetical protein PHAVU_004G143900g [Phaseolus vulgaris]
 gb|ESW24596.1| hypothetical protein PHAVU_004G143900g [Phaseolus vulgaris]
Length=753

 Score = 70.9 bits (172),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 44/109 (40%), Positives = 54/109 (50%), Gaps = 17/109 (16%)
 Frame = +3

Query  537  SLSIPANSYDTENNNHFGFTGPLRNERRTSYIQMSGPLYVGQTPTNNLRTSQVALGRKST  716
            S+SIP  SY                ER TS +  SG LY      N ++ S V  G K+ 
Sbjct  40   SVSIPMESY----------------ERETSLVGDSGSLYSTPEIDNLMQHSIVVTGNKTE  83

Query  717  RQTLEIYPSTAIRESNDWEDYDYAQKNEHLLRSGRLGVCNDPYCTTCPT  863
               ++ + +     S  W    Y   NEHLLRSG+LGVCNDPYCTTCPT
Sbjct  84   EIKIDEFSTFDSTVSKYWNK-SYDSINEHLLRSGKLGVCNDPYCTTCPT  131



>gb|EPS69237.1| hypothetical protein M569_05530, partial [Genlisea aurea]
Length=722

 Score = 69.7 bits (169),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 49/120 (41%), Positives = 61/120 (51%), Gaps = 15/120 (13%)
 Frame = +3

Query  510  RRFSYRARR-SLSIPAN-SYDTENNNHFGFTGPLRNERRTSYIQMSGPLYVGQTPTNNLR  683
            RRF+ R R  S+SI +N S   E  N   FTGPL  + RTS     GP Y          
Sbjct  2    RRFTSRMRSASMSILSNQSEPMEQKNAVNFTGPLIAQGRTS-----GPQYTNLNHEVIFE  56

Query  684  TSQVALGRKSTRQTLEIYPSTAIRESNDWEDYDYAQKNEHLLRSGRLGVCNDPYCTTCPT  863
               +ALG     Q +EI        + D    +Y  +NEHLL+SG LG+CNDPYCT CP+
Sbjct  57   PPTMALG-----QEMEILDGM---NNGDLPPENYEVRNEHLLKSGPLGMCNDPYCTLCPS  108



>ref|XP_010487666.1| PREDICTED: putative cyclic nucleotide-gated ion channel 19 [Camelina 
sativa]
Length=750

 Score = 69.7 bits (169),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 53/146 (36%), Positives = 75/146 (51%), Gaps = 30/146 (21%)
 Frame = +3

Query  450  ERDVVPMLSATDSQADESGYRRFSYRARRSLSIPANSYDTENNNH----FGFTGPLRNER  617
            E  ++P+  AT  +A  +  R F+    RSLS+   ++ TE  ++     G+TGPLR +R
Sbjct  9    EFPILPIPEATPPRARTT--RTFT-STNRSLSLSNPTFSTEGFDNSSVVLGYTGPLRTQR  65

Query  618  -RTSYIQMSGPLYVGQTPTNNLRTSQVALGRKSTRQT---LEIYPSTAIRESNDWEDYDY  785
             R   +QMSGPLY                   STR+T       P       N   + D+
Sbjct  66   IRPRLVQMSGPLY-------------------STRRTEPLSPPSPQQPPHSINVPPEDDF  106

Query  786  AQKNEHLLRSGRLGVCNDPYCTTCPT  863
              +N +LLRSG+LG+CNDPYCTTCP+
Sbjct  107  VYQNANLLRSGQLGMCNDPYCTTCPS  132



>ref|XP_010465830.1| PREDICTED: probable cyclic nucleotide-gated ion channel 20, chloroplastic 
[Camelina sativa]
Length=765

 Score = 69.3 bits (168),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 55/146 (38%), Positives = 78/146 (53%), Gaps = 15/146 (10%)
 Frame = +3

Query  450  ERDVVPMLSATDSQADESGYRRFSYRARRSLSIPANSYDTENNNH---FGFTGPLRNERR  620
            E D +PML  +DS    S  R F+ R+R       +S     +N     G+TGPLR + R
Sbjct  6    ENDDIPMLPISDS---SSRTRAFTSRSRSVSLSNPSSSIDGFDNSAVVLGYTGPLRTQGR  62

Query  621  TSYIQMSGPLYVGQTPTNNLRTSQVALGRKSTR--QTLEI-YPSTAIRESNDWEDYD--Y  785
               +QMSGPL   + P       Q++    STR  + L + +PST    S+     D  +
Sbjct  63   PPLVQMSGPLRTQRRPP----LVQMSGPLTSTRNPEPLSLPHPSTTTTSSDVSSQLDDEF  118

Query  786  AQKNEHLLRSGRLGVCNDPYCTTCPT  863
              K+ +LL+SG+LG+CNDPYCTTCP+
Sbjct  119  VSKHANLLKSGQLGMCNDPYCTTCPS  144



>ref|XP_010465825.1| PREDICTED: putative cyclic nucleotide-gated ion channel 19 [Camelina 
sativa]
Length=751

 Score = 68.2 bits (165),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 56/146 (38%), Positives = 76/146 (52%), Gaps = 29/146 (20%)
 Frame = +3

Query  450  ERDVVPMLSATDSQADESGYRRFSYRARR-SLSIP-ANSYDTENNNH--FGFTGPLRNER  617
            E  ++P+  AT  +A  +  R F+ R R  SLS P  +S D  +N+    G+TGPLR +R
Sbjct  9    EFPILPIPEATPPRAHTT--RTFTSRNRSLSLSNPTVSSTDGVDNSSVLLGYTGPLRTQR  66

Query  618  -RTSYIQMSGPLYVGQTPTNNLRTSQVALGRKSTRQT---LEIYPSTAIRESNDWEDYDY  785
             R   +QMSGPLY                   STR+T       P       N   + D+
Sbjct  67   IRPRLVQMSGPLY-------------------STRRTEPLSPPSPQQPPHSINVPPEDDF  107

Query  786  AQKNEHLLRSGRLGVCNDPYCTTCPT  863
              +N +LLRSG+LG+CNDPYCTTCP+
Sbjct  108  VFQNANLLRSGQLGMCNDPYCTTCPS  133



>ref|XP_010435405.1| PREDICTED: probable cyclic nucleotide-gated ion channel 20, chloroplastic 
isoform X1 [Camelina sativa]
 ref|XP_010435415.1| PREDICTED: probable cyclic nucleotide-gated ion channel 20, chloroplastic 
isoform X1 [Camelina sativa]
Length=736

 Score = 68.2 bits (165),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 48/144 (33%), Positives = 70/144 (49%), Gaps = 20/144 (14%)
 Frame = +3

Query  441  AAYERDVVPMLSATDSQADESGYRRFSYRARR-SLSIPANSYDTENNNHFGFTGPLR-NE  614
            +A E+D +PML  +DS +          RAR  S+S P +S+D  +    G+TGPLR ++
Sbjct  3    SANEKDDIPMLPISDSSSRT--------RARSVSISTPTSSFD-NSTVVLGYTGPLRTHQ  53

Query  615  RRTSYIQMSGPL--YVGQTPTNNLRTSQVALGRKSTRQTLEIYPSTAIRESNDWEDYDYA  788
            R    +Q+SGP   Y        L     +         +E YPS  +   N       +
Sbjct  54   RHLPLVQVSGPRIRYTSSRNPEPLFLPHPSTTSSGVYTQVERYPSDVLEHKN-------S  106

Query  789  QKNEHLLRSGRLGVCNDPYCTTCP  860
              NE +L+  +LG+CNDPYCT CP
Sbjct  107  SDNEKVLKHAKLGMCNDPYCTICP  130



>emb|CDX95835.1| BnaC05g35860D [Brassica napus]
Length=762

 Score = 67.4 bits (163),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 48/143 (34%), Positives = 67/143 (47%), Gaps = 14/143 (10%)
 Frame = +3

Query  450  ERDVVPMLSATDSQADESGYRRFSYRARRSLSIPANSYDTENNNH---FGFTGPLRNERR  620
            E+D  P+L         +  R  + R R      +       +N     G+TGPLR +RR
Sbjct  6    EKDEFPILLPVSEARPRANTRALNSRNRSVSFSSSTYSTNRVDNSSVVLGYTGPLRTQRR  65

Query  621  TSY-IQMSGPLYVGQTPTNNLR-TSQVALGRKSTRQTLEIYPSTAIRESNDWEDYDYAQK  794
                +QMSGPLY  + P  +    S V     S   +    PS         E+ +   K
Sbjct  66   PPLSVQMSGPLYSTRRPDQSFFPASPVQPPDSSLSSSTVDVPS---------EEDEVVLK  116

Query  795  NEHLLRSGRLGVCNDPYCTTCPT  863
            N +LL+SG+LG+CNDPYCTTCP+
Sbjct  117  NANLLKSGQLGMCNDPYCTTCPS  139



>ref|XP_012076151.1| PREDICTED: probable cyclic nucleotide-gated ion channel 20, chloroplastic 
isoform X2 [Jatropha curcas]
Length=724

 Score = 67.0 bits (162),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 46/112 (41%), Positives = 61/112 (54%), Gaps = 14/112 (13%)
 Frame = +3

Query  537  SLSIPAN---SYDTENNNHFGFTGPLRNERRTSYIQMSGPLYVGQTPTNNLRTSQVALGR  707
            S+SIP N     +TE  N  G+T  L +E        S  LYV + P    + +     R
Sbjct  17   SISIPMNYTEFSETEVRNG-GYTDRLHSE--------SSSLYVSRIPEILSQPNHGVSRR  67

Query  708  KSTRQTLEIYPSTAIRESNDWEDYDYAQKNEHLLRSGRLGVCNDPYCTTCPT  863
            K++R   E + S    + N W +  Y+ +NEHLLRSG LG+CNDPYCTTCPT
Sbjct  68   KASRA--ETFLSFDGTDQNYWINDKYSGENEHLLRSGLLGMCNDPYCTTCPT  117



>ref|XP_012076152.1| PREDICTED: probable cyclic nucleotide-gated ion channel 20, chloroplastic 
isoform X3 [Jatropha curcas]
Length=670

 Score = 66.6 bits (161),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 46/112 (41%), Positives = 61/112 (54%), Gaps = 14/112 (13%)
 Frame = +3

Query  537  SLSIPAN---SYDTENNNHFGFTGPLRNERRTSYIQMSGPLYVGQTPTNNLRTSQVALGR  707
            S+SIP N     +TE  N  G+T  L +E        S  LYV + P    + +     R
Sbjct  17   SISIPMNYTEFSETEVRNG-GYTDRLHSE--------SSSLYVSRIPEILSQPNHGVSRR  67

Query  708  KSTRQTLEIYPSTAIRESNDWEDYDYAQKNEHLLRSGRLGVCNDPYCTTCPT  863
            K++R   E + S    + N W +  Y+ +NEHLLRSG LG+CNDPYCTTCPT
Sbjct  68   KASRA--ETFLSFDGTDQNYWINDKYSGENEHLLRSGLLGMCNDPYCTTCPT  117



>ref|XP_012076149.1| PREDICTED: probable cyclic nucleotide-gated ion channel 20, chloroplastic 
isoform X1 [Jatropha curcas]
 ref|XP_012076150.1| PREDICTED: probable cyclic nucleotide-gated ion channel 20, chloroplastic 
isoform X1 [Jatropha curcas]
 gb|KDP34391.1| hypothetical protein JCGZ_12785 [Jatropha curcas]
Length=734

 Score = 66.6 bits (161),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 46/112 (41%), Positives = 61/112 (54%), Gaps = 14/112 (13%)
 Frame = +3

Query  537  SLSIPAN---SYDTENNNHFGFTGPLRNERRTSYIQMSGPLYVGQTPTNNLRTSQVALGR  707
            S+SIP N     +TE  N  G+T  L +E        S  LYV + P    + +     R
Sbjct  17   SISIPMNYTEFSETEVRNG-GYTDRLHSE--------SSSLYVSRIPEILSQPNHGVSRR  67

Query  708  KSTRQTLEIYPSTAIRESNDWEDYDYAQKNEHLLRSGRLGVCNDPYCTTCPT  863
            K++R   E + S    + N W +  Y+ +NEHLLRSG LG+CNDPYCTTCPT
Sbjct  68   KASRA--ETFLSFDGTDQNYWINDKYSGENEHLLRSGLLGMCNDPYCTTCPT  117



>ref|XP_002883082.1| cyclic nucleotide-binding transporter 1 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH59341.1| cyclic nucleotide-binding transporter 1 [Arabidopsis lyrata subsp. 
lyrata]
Length=739

 Score = 66.6 bits (161),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 38/97 (39%), Positives = 51/97 (53%), Gaps = 9/97 (9%)
 Frame = +3

Query  585  FGFTGPLRNERRTSYIQMSGPLYVGQTPTNNL----RTSQVALGRKSTRQTLEIYPSTAI  752
            FG+TGPLR  R    +Q+SGPLY    P         +  V +  +  R      PS + 
Sbjct  51   FGYTGPLRTRRHPPLLQLSGPLYSTCKPEPLFLPLPSSDSVGVSSQPERD-----PSFSA  105

Query  753  RESNDWEDYDYAQKNEHLLRSGRLGVCNDPYCTTCPT  863
             E  +  D +   K  +LL SG+LG+CNDPYCTTCP+
Sbjct  106  LEHKNSSDDESLLKYANLLGSGQLGMCNDPYCTTCPS  142



>ref|XP_010937008.1| PREDICTED: probable cyclic nucleotide-gated ion channel 20, chloroplastic 
[Elaeis guineensis]
Length=758

 Score = 64.7 bits (156),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 41/121 (34%), Positives = 62/121 (51%), Gaps = 10/121 (8%)
 Frame = +3

Query  498  ESGYRRFSYRARRSLSIPANSYDTENNNHF-GFTGPLRNERRTSYIQMSGPLYVGQTPTN  674
            E  YR     +      P +SY  EN +HF   TG LR++R T ++ +S PLY  Q P  
Sbjct  6    EGEYRSSMAGSASMSKPPRSSY--ENEDHFVSPTGHLRSKRTTQFVPLSSPLYSKQKPD-  62

Query  675  NLRTSQVALGRKSTRQTLEIYPSTAIRESNDWEDYDYAQKNEHLLRSGRLGVCNDPYCTT  854
              + S    G++     L + P    ++  +W D D+  +NEHLL+SG L +C++P C  
Sbjct  63   --KISGSKFGKQ--HNLLAVMPEEMAQK--NWSDGDHEGRNEHLLKSGSLALCSNPDCIN  116

Query  855  C  857
            C
Sbjct  117  C  117



>emb|CDY24513.1| BnaA01g22170D [Brassica napus]
Length=801

 Score = 64.3 bits (155),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 49/143 (34%), Positives = 74/143 (52%), Gaps = 16/143 (11%)
 Frame = +3

Query  462  VPMLSATDSQADESGYRRFSYRARRSLSIPANSYDTENNNH----FGFTGPLRNERRTSY  629
            +P+L  + S    S  R F++R+R ++S+P  S  +E  +       +T P R +R    
Sbjct  13   LPVLDTSSS----SRTRPFTFRSR-NVSLPNTSSTSEGLDSSTVVLRYTDPHRTQRPPPS  67

Query  630  IQMSGPLYVGQTPTNNLRTSQVALGRKS-----TRQTLEIYPSTAIRESNDWEDYDYAQK  794
            +QM+GPL+   +P   +     + G  S     +    E YPS A  E ++ +D      
Sbjct  68   VQMNGPLFSTSSPEPLILLPPPSTGGSSDPVGVSSSQPERYPSFAALEHDNSDDNSVL--  125

Query  795  NEHLLRSGRLGVCNDPYCTTCPT  863
            N HLLRS + GVCNDPYCTTCP+
Sbjct  126  NPHLLRSEKFGVCNDPYCTTCPS  148



>gb|ERN11112.1| hypothetical protein AMTR_s00024p00155680 [Amborella trichopoda]
Length=762

 Score = 64.3 bits (155),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 48/143 (34%), Positives = 72/143 (50%), Gaps = 20/143 (14%)
 Frame = +3

Query  468  MLSATDSQADESGY----RRFSYRARRSLSIPANSYDTENNNHF---GFTGPLRNERRTS  626
            ML       ++ G+    +RFS    R +S   ++  T N+N +     TGPLR+ R+  
Sbjct  1    MLDTRIEVLNDGGFDRERKRFS--LSRCVSFSVDATPTPNSNEYVPMFHTGPLRSSRKNP  58

Query  627  YIQMSGPLYVGQTPTNNLRTSQVALG--RKSTRQTLEIYPSTAIRESNDWEDYD--YAQK  794
            Y++        +   + LR ++ + G  R +  Q +E        + +D E  D  Y  K
Sbjct  59   YLR-------SRDLIHTLRDNEGSQGTSRSNAVQAIEFPNDNGKTQESDKEKLDNSYDGK  111

Query  795  NEHLLRSGRLGVCNDPYCTTCPT  863
            NEHLLRSG LG CNDP+CTTCP+
Sbjct  112  NEHLLRSGPLGRCNDPFCTTCPS  134



>emb|CDX95834.1| BnaC05g35850D [Brassica napus]
Length=750

 Score = 62.8 bits (151),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 51/143 (36%), Positives = 69/143 (48%), Gaps = 19/143 (13%)
 Frame = +3

Query  450  ERDVVPMLSATDSQADESGYRRFSYRARRSLSIPANSYDT---ENNNHFGFTGPLRNERR  620
            E D  PML         +  R    R  RS+S   ++Y T   EN+     +GP R + R
Sbjct  6    ESDEFPMLRQVPEARSRAQTRALHSR-NRSVSFSDSTYSTNRVENS-----SGPRRTQSR  59

Query  621  TS-YIQMSGPLYVGQTPTNNLRT-SQVALGRKSTRQTLEIYPSTAIRESNDWEDYDYAQK  794
             S  +QMSGPLY  + P  +    S V     S   +    PS  + E+          K
Sbjct  60   PSPLVQMSGPLYDTRRPDQSFFPPSPVQPPESSISSSTVDIPSEEVVEA--------LLK  111

Query  795  NEHLLRSGRLGVCNDPYCTTCPT  863
            N +LL+SG+LG+CNDPYCTTCP+
Sbjct  112  NANLLKSGQLGMCNDPYCTTCPS  134



>gb|KFK39097.1| hypothetical protein AALP_AA3G200700 [Arabis alpina]
Length=684

 Score = 62.8 bits (151),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 47/139 (34%), Positives = 71/139 (51%), Gaps = 37/139 (27%)
 Frame = +3

Query  450  ERDVVPMLSATDSQADESGYRRFSYRARRSLSIPANSYDTENN-NHFGFTGPLRNERRTS  626
            E+D  P+L   +S    +  R F+  + RS+S+   ++  E +  + G+TGPLR +RR  
Sbjct  6    EKDDFPILLIPESPPSRA--RAFT-SSNRSVSLLNPTFGFEESIVNLGYTGPLRTQRR--  60

Query  627  YIQMSGPLYVGQTPTNNLRTSQVALGRKSTRQTLEIYPSTAIRESNDWEDYDYAQKNEHL  806
                  PLY  + P ++               T+++ P          ED D   KN +L
Sbjct  61   ------PLYSARRPDSS--------------STVDVPP----------ED-DLVMKNTNL  89

Query  807  LRSGRLGVCNDPYCTTCPT  863
            LRSG+LG+CNDPYCTTCP+
Sbjct  90   LRSGQLGMCNDPYCTTCPS  108



>gb|KFK34623.1| hypothetical protein AALP_AA5G169900 [Arabis alpina]
Length=713

 Score = 61.2 bits (147),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 47/141 (33%), Positives = 69/141 (49%), Gaps = 24/141 (17%)
 Frame = +3

Query  450  ERDVVPMLSATDSQADESGYRRFSYRARRSLSIPANSYDTENNNHFGFTGPLRNERRTSY  629
            E D +PML              FS      LS P++  + ++N   G+ G LR++RR   
Sbjct  6    ENDKIPMLP-------------FSRTRSVPLSNPSDEIN-DSNVVLGYAGSLRSQRRPPL  51

Query  630  IQMS-GPLYVGQTPTNNLRTSQVALGRKSTRQTLEIYPSTAIRESNDWED--YDYAQKNE  800
            + M+ GP    + P          L R+S+        S A  E N+  D   ++  K+ 
Sbjct  52   VPMAAGPSSSTRRPEPLFFPPAAPLTRRSS-------DSFATLEENNSSDNNEEFVLKHA  104

Query  801  HLLRSGRLGVCNDPYCTTCPT  863
            +LLRSG+LG+CNDPYCTTCP+
Sbjct  105  NLLRSGKLGMCNDPYCTTCPS  125



>gb|KFK34622.1| hypothetical protein AALP_AA5G169900 [Arabis alpina]
Length=730

 Score = 61.2 bits (147),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 47/141 (33%), Positives = 69/141 (49%), Gaps = 24/141 (17%)
 Frame = +3

Query  450  ERDVVPMLSATDSQADESGYRRFSYRARRSLSIPANSYDTENNNHFGFTGPLRNERRTSY  629
            E D +PML              FS      LS P++  + ++N   G+ G LR++RR   
Sbjct  6    ENDKIPMLP-------------FSRTRSVPLSNPSDEIN-DSNVVLGYAGSLRSQRRPPL  51

Query  630  IQMS-GPLYVGQTPTNNLRTSQVALGRKSTRQTLEIYPSTAIRESNDWED--YDYAQKNE  800
            + M+ GP    + P          L R+S+        S A  E N+  D   ++  K+ 
Sbjct  52   VPMAAGPSSSTRRPEPLFFPPAAPLTRRSS-------DSFATLEENNSSDNNEEFVLKHA  104

Query  801  HLLRSGRLGVCNDPYCTTCPT  863
            +LLRSG+LG+CNDPYCTTCP+
Sbjct  105  NLLRSGKLGMCNDPYCTTCPS  125



>ref|XP_010435423.1| PREDICTED: probable cyclic nucleotide-gated ion channel 20, chloroplastic 
isoform X2 [Camelina sativa]
Length=704

 Score = 58.5 bits (140),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 45/141 (32%), Positives = 63/141 (45%), Gaps = 46/141 (33%)
 Frame = +3

Query  441  AAYERDVVPMLSATDSQADESGYRRFSYRARR-SLSIPANSYDTENNNHFGFTGPLRNER  617
            +A E+D +PML  +DS +          RAR  S+S P +S+D  +    G+TGPLR  +
Sbjct  3    SANEKDDIPMLPISDSSSRT--------RARSVSISTPTSSFDN-STVVLGYTGPLRTHQ  53

Query  618  RTSYIQMSGPLYVGQTPTNNLRTSQVALGRKSTRQTLEIYPSTAIRESNDWEDYDYAQKN  797
            R                  +L   QV           E YPS  +   N       +  N
Sbjct  54   R------------------HLPLVQV-----------ERYPSDVLEHKN-------SSDN  77

Query  798  EHLLRSGRLGVCNDPYCTTCP  860
            E +L+  +LG+CNDPYCT CP
Sbjct  78   EKVLKHAKLGMCNDPYCTICP  98



>ref|XP_010435431.1| PREDICTED: probable cyclic nucleotide-gated ion channel 20, chloroplastic 
isoform X3 [Camelina sativa]
Length=671

 Score = 58.5 bits (140),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 45/141 (32%), Positives = 63/141 (45%), Gaps = 46/141 (33%)
 Frame = +3

Query  441  AAYERDVVPMLSATDSQADESGYRRFSYRARR-SLSIPANSYDTENNNHFGFTGPLRNER  617
            +A E+D +PML  +DS +          RAR  S+S P +S+D  +    G+TGPLR  +
Sbjct  3    SANEKDDIPMLPISDSSSRT--------RARSVSISTPTSSFDN-STVVLGYTGPLRTHQ  53

Query  618  RTSYIQMSGPLYVGQTPTNNLRTSQVALGRKSTRQTLEIYPSTAIRESNDWEDYDYAQKN  797
            R                  +L   QV           E YPS  +   N       +  N
Sbjct  54   R------------------HLPLVQV-----------ERYPSDVLEHKN-------SSDN  77

Query  798  EHLLRSGRLGVCNDPYCTTCP  860
            E +L+  +LG+CNDPYCT CP
Sbjct  78   EKVLKHAKLGMCNDPYCTICP  98



>emb|CDY55604.1| BnaC01g42610D [Brassica napus]
Length=741

 Score = 57.8 bits (138),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 44/137 (32%), Positives = 63/137 (46%), Gaps = 7/137 (5%)
 Frame = +3

Query  456  DVVPMLSATDSQADESGYRRFSYRARRS-LSIPANSYDTENNNHFGFTGPLRNERRTSYI  632
            D + ML  +D+ +  S  R F+ R R   LS P +     N    G+ G L ++R    +
Sbjct  8    DKIHMLPISDASSSSSQTRVFTSRTRSVPLSNPTDETGNSNAVTLGYAGSLPSQR-PPLV  66

Query  633  QMSGPLYVGQTPTNNLRTSQVALGRKSTRQTLEIYPSTAIRESNDWEDYDYAQKNEHLLR  812
             M+GPL      ++  R   +                  + E N   D D   K+ H LR
Sbjct  67   PMTGPL-----SSSTRRPEPLFPRPAPPPTRRSSGYFGDLEEVNYSSDNDELLKHAHRLR  121

Query  813  SGRLGVCNDPYCTTCPT  863
            SG+LG+CNDPYCTTCP+
Sbjct  122  SGKLGMCNDPYCTTCPS  138



>ref|XP_006406701.1| hypothetical protein EUTSA_v10020120mg [Eutrema salsugineum]
 gb|ESQ48154.1| hypothetical protein EUTSA_v10020120mg [Eutrema salsugineum]
Length=768

 Score = 57.8 bits (138),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 44/141 (31%), Positives = 60/141 (43%), Gaps = 32/141 (23%)
 Frame = +3

Query  450  ERDVVPMLSATDSQADESGYRRFSYRARRSLSIPANSYDTENNNHFGFTGPLRNERRTS-  626
            E D VPML         +  R F                T  N     + PLR +R    
Sbjct  6    ENDEVPMLLPIPEATTRAHTRDF----------------TCTNRSVSLSNPLRTQRSRQP  49

Query  627  --YIQMSGPLYVGQTPTNNLRTSQVALGRKSTRQTLEIYPSTAIRESNDWEDYDYAQKNE  800
                QMSGPLY  + P +   TS +        +  +I  +  I   N+     +  KN 
Sbjct  50   PLVQQMSGPLYSTRRPESLFPTSPI--------EPPDISSTVDIPSQNE-----FVLKNT  96

Query  801  HLLRSGRLGVCNDPYCTTCPT  863
            +L +SG+LG+CNDPYCTTCP+
Sbjct  97   NLFKSGQLGMCNDPYCTTCPS  117



>ref|XP_009145990.1| PREDICTED: putative cyclic nucleotide-gated ion channel 19 [Brassica 
rapa]
Length=748

 Score = 57.4 bits (137),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 51/143 (36%), Positives = 70/143 (49%), Gaps = 23/143 (16%)
 Frame = +3

Query  450  ERDVVPMLSATDSQADESGYRRFSYRARRSLSIPANSYDT---ENNNHFGFTGPLRNERR  620
            E D  PML     Q  E+  R    R  RS+S   ++Y +   EN+     +GP R + R
Sbjct  8    ESDEFPMLR----QFPEARSRALHSR-NRSISFSDSTYSSNRVENS-----SGPRRTQSR  57

Query  621  TS-YIQMSGPLYVGQTPTNNLRT-SQVALGRKSTRQTLEIYPSTAIRESNDWEDYDYAQK  794
             S  + MSGPLY  + P  +    S V     S   +    PS  + E+          K
Sbjct  58   PSPSVHMSGPLYDTRRPDQSFFPPSPVQPPASSLSSSTVDIPSEEVVEA--------LLK  109

Query  795  NEHLLRSGRLGVCNDPYCTTCPT  863
            N +LL+SG+LG+CNDPYCTTCP+
Sbjct  110  NANLLKSGQLGMCNDPYCTTCPS  132



>ref|XP_009102285.1| PREDICTED: probable cyclic nucleotide-gated ion channel 20, chloroplastic 
[Brassica rapa]
Length=721

 Score = 57.0 bits (136),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 46/140 (33%), Positives = 67/140 (48%), Gaps = 29/140 (21%)
 Frame = +3

Query  456  DVVPMLSATDSQADESGYRRFSYRARRSLSIPANSYDTENNNH----FGFTGPLRNERRT  623
            D + ML  +D+ +  S  R F+ R R   S+P ++   E  N      G+ G L ++R  
Sbjct  8    DKIHMLPISDASSSSSQTRVFTSRTR---SVPLSNPTEETGNSKAATLGYAGSLPSQRPP  64

Query  624  SYIQMSGPLYVGQTPTNNLRTSQVALGRKSTRQTLEIYPSTAIRESNDWEDYDYAQKNEH  803
             +  M+GPL                    STR++   +    + E N   D D   K+ H
Sbjct  65   LF-PMTGPL------------------SSSTRRSSGYFGD--LEEVNS-SDNDELLKHAH  102

Query  804  LLRSGRLGVCNDPYCTTCPT  863
             LRSG+LG+CNDPYCTTCP+
Sbjct  103  RLRSGKLGMCNDPYCTTCPS  122



>emb|CDY46049.1| BnaC01g34960D [Brassica napus]
Length=734

 Score = 55.8 bits (133),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 47/149 (32%), Positives = 68/149 (46%), Gaps = 24/149 (16%)
 Frame = +3

Query  450  ERDVVPMLSATDSQADESGYRRFSYRARRSLSIPANSYDT--ENNNHFGFTGPLRNERRT  623
            E+D VPML  + S +        S     SL+  +++ D    +N   G+TGPL+   R 
Sbjct  6    EKDDVPMLPISSSSSSSRTRSFTSRFRSTSLANTSSAIDGFDSSNVVLGYTGPLQTYGRP  65

Query  624  SYIQMSG---------PLYVGQTPTNNLRTSQVALGRKSTRQTLEIYPSTAIRESNDWED  776
            +++QMS          PL++  TPT     S      +      E  P  A+ + N    
Sbjct  66   AFVQMSASLPSTLIPEPLFLHPTPTGGSSHSIGVSSSQP-----ESCPFAALEQKNS---  117

Query  777  YDYAQKNEHLLRSGRLGVCNDPYCTTCPT  863
                  +E  L SG+L VCNDPYCTTCP+
Sbjct  118  -----DDELGLGSGQLEVCNDPYCTTCPS  141



>emb|CDX92151.1| BnaA05g22560D [Brassica napus]
Length=751

 Score = 53.5 bits (127),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 50/143 (35%), Positives = 69/143 (48%), Gaps = 23/143 (16%)
 Frame = +3

Query  450  ERDVVPMLSATDSQADESGYRRFSYRARRSLSIPANSYDT---ENNNHFGFTGPLRNERR  620
            E D  PML     Q  E+  R    R  RS+S   ++Y +   EN+     +GP R + R
Sbjct  8    ESDEFPMLR----QFPEARSRALHSR-NRSISFSDSTYSSNRVENS-----SGPRRTQSR  57

Query  621  TS-YIQMSGPLYVGQTPTNNLRT-SQVALGRKSTRQTLEIYPSTAIRESNDWEDYDYAQK  794
             S  + MSGPLY  + P  +    S V     S   +    PS  + E+          K
Sbjct  58   PSPSVHMSGPLYDTRRPDQSFFPPSPVQPPASSLSSSTVDIPSEEVVEA--------LLK  109

Query  795  NEHLLRSGRLGVCNDPYCTTCPT  863
            N +LL+SG+LG+CN PYCTTCP+
Sbjct  110  NANLLKSGQLGMCNYPYCTTCPS  132



>ref|XP_010227874.1| PREDICTED: probable cyclic nucleotide-gated ion channel 20, chloroplastic 
isoform X3 [Brachypodium distachyon]
Length=721

 Score = 53.1 bits (126),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 46/142 (32%), Positives = 64/142 (45%), Gaps = 16/142 (11%)
 Frame = +3

Query  438  MAAYERDVVPMLS-ATDSQADESGYRRFSYRARRSLSIPANSYDTENNNHFGFTGPLRNE  614
            M+  E+D VPML  A + Q       R   R+  S+ IP     T  ++    TGPL   
Sbjct  1    MSGEEKDDVPMLQRALELQ-------RLPARSS-SMCIPVRD-GTYEDSFISHTGPLFVR  51

Query  615  RRTSYIQMSGPLYVGQTPTNNLRTSQVALGRKSTRQTLEIYPSTAIRESNDWEDYDYAQK  794
            R T +  M  P      P       Q   G+K+      + P+     ++D+ D  +A K
Sbjct  52   RPTQFASMGIPSGSRDVPDKISWPFQGKQGKKTN----AVMPADI--GTSDYCDGRHAPK  105

Query  795  NEHLLRSGRLGVCNDPYCTTCP  860
            NEHL+ SG LG C+DP C  CP
Sbjct  106  NEHLMMSGPLGQCDDPDCVHCP  127



>ref|XP_004515288.1| PREDICTED: probable cyclic nucleotide-gated ion channel 20, chloroplastic-like 
[Cicer arietinum]
Length=786

 Score = 52.8 bits (125),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 26/64 (41%), Positives = 39/64 (61%), Gaps = 6/64 (9%)
 Frame = +3

Query  672  NNLRTSQVALGRKSTRQTLEIYPSTAIRESNDWEDYDYAQKNEHLLRSGRLGVCNDPYCT  851
            N ++ + V +G K  +   EI+        N W +  + ++NEHL +SG LG+C+DPYCT
Sbjct  27   NLVQQTVVVIGNKVEKCKKEIFSPL-----NHWNN-THDRENEHLGKSGLLGMCDDPYCT  80

Query  852  TCPT  863
            TCPT
Sbjct  81   TCPT  84



>ref|XP_003564124.1| PREDICTED: probable cyclic nucleotide-gated ion channel 20, chloroplastic 
isoform X2 [Brachypodium distachyon]
Length=760

 Score = 52.8 bits (125),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 46/142 (32%), Positives = 64/142 (45%), Gaps = 16/142 (11%)
 Frame = +3

Query  438  MAAYERDVVPMLS-ATDSQADESGYRRFSYRARRSLSIPANSYDTENNNHFGFTGPLRNE  614
            M+  E+D VPML  A + Q       R   R+  S+ IP     T  ++    TGPL   
Sbjct  1    MSGEEKDDVPMLQRALELQ-------RLPARSS-SMCIPVRD-GTYEDSFISHTGPLFVR  51

Query  615  RRTSYIQMSGPLYVGQTPTNNLRTSQVALGRKSTRQTLEIYPSTAIRESNDWEDYDYAQK  794
            R T +  M  P      P       Q   G+K+      + P+     ++D+ D  +A K
Sbjct  52   RPTQFASMGIPSGSRDVPDKISWPFQGKQGKKTN----AVMPADI--GTSDYCDGRHAPK  105

Query  795  NEHLLRSGRLGVCNDPYCTTCP  860
            NEHL+ SG LG C+DP C  CP
Sbjct  106  NEHLMMSGPLGQCDDPDCVHCP  127



>ref|XP_010227870.1| PREDICTED: probable cyclic nucleotide-gated ion channel 20, chloroplastic 
isoform X1 [Brachypodium distachyon]
 ref|XP_010227871.1| PREDICTED: probable cyclic nucleotide-gated ion channel 20, chloroplastic 
isoform X1 [Brachypodium distachyon]
 ref|XP_010227872.1| PREDICTED: probable cyclic nucleotide-gated ion channel 20, chloroplastic 
isoform X1 [Brachypodium distachyon]
 ref|XP_010227873.1| PREDICTED: probable cyclic nucleotide-gated ion channel 20, chloroplastic 
isoform X1 [Brachypodium distachyon]
Length=782

 Score = 52.8 bits (125),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 46/142 (32%), Positives = 64/142 (45%), Gaps = 16/142 (11%)
 Frame = +3

Query  438  MAAYERDVVPMLS-ATDSQADESGYRRFSYRARRSLSIPANSYDTENNNHFGFTGPLRNE  614
            M+  E+D VPML  A + Q       R   R+  S+ IP     T  ++    TGPL   
Sbjct  1    MSGEEKDDVPMLQRALELQ-------RLPARSS-SMCIPVRD-GTYEDSFISHTGPLFVR  51

Query  615  RRTSYIQMSGPLYVGQTPTNNLRTSQVALGRKSTRQTLEIYPSTAIRESNDWEDYDYAQK  794
            R T +  M  P      P       Q   G+K+      + P+     ++D+ D  +A K
Sbjct  52   RPTQFASMGIPSGSRDVPDKISWPFQGKQGKKTN----AVMPADI--GTSDYCDGRHAPK  105

Query  795  NEHLLRSGRLGVCNDPYCTTCP  860
            NEHL+ SG LG C+DP C  CP
Sbjct  106  NEHLMMSGPLGQCDDPDCVHCP  127



>gb|AFW73689.1| hypothetical protein ZEAMMB73_901576, partial [Zea mays]
Length=241

 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 46/142 (32%), Positives = 57/142 (40%), Gaps = 16/142 (11%)
 Frame = +3

Query  438  MAAYERDVVPMLSATDSQADESGYRRFSYRARRSLSIPANSYDTENNNHFGFTGPLRNER  617
            M   ERD VPML             RF  R+  S+ IP    D E +     TGPL  + 
Sbjct  1    MTDQERDDVPML------LRNVELPRFPLRST-SMCIPVRDDDYEEDTFVPHTGPLFVQP  53

Query  618  RTSYIQMSGPLYVGQ-TPTNNLRTSQVALGRKSTRQTLEIYPSTAIRESNDWEDYDYAQK  794
             T      G  + G+ TP    + SQ     K   +   I P       N W       K
Sbjct  54   STQ--TAPGISFTGRDTPDRLPKPSQ----GKQVSKPHAIMPEEI--RGNKWSYSGQVPK  105

Query  795  NEHLLRSGRLGVCNDPYCTTCP  860
            NEHL+ SG LG C++P C  CP
Sbjct  106  NEHLMMSGPLGQCDNPDCVNCP  127



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1977341620752