BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig13111

Length=629
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006340840.1|  PREDICTED: uncharacterized protein LOC102595...    291   3e-88   Solanum tuberosum [potatoes]
ref|XP_006340839.1|  PREDICTED: uncharacterized protein LOC102595...    291   3e-88   Solanum tuberosum [potatoes]
ref|XP_010316466.1|  PREDICTED: uncharacterized protein LOC101257...    291   4e-88   Solanum lycopersicum
ref|XP_004232566.1|  PREDICTED: uncharacterized protein LOC101257...    291   4e-88   Solanum lycopersicum
ref|XP_008241938.1|  PREDICTED: uncharacterized protein LOC103340321    291   5e-88   Prunus mume [ume]
ref|XP_009359594.1|  PREDICTED: uncharacterized protein LOC103950160    291   7e-88   Pyrus x bretschneideri [bai li]
ref|XP_008361332.1|  PREDICTED: uncharacterized protein LOC103425029    290   8e-88   
ref|XP_009803527.1|  PREDICTED: uncharacterized protein LOC104248...    287   2e-86   Nicotiana sylvestris
ref|XP_009803526.1|  PREDICTED: uncharacterized protein LOC104248...    287   2e-86   Nicotiana sylvestris
ref|XP_007204792.1|  hypothetical protein PRUPE_ppa017381mg             286   3e-86   
ref|XP_006340841.1|  PREDICTED: uncharacterized protein LOC102595...    285   9e-86   Solanum tuberosum [potatoes]
ref|XP_010649445.1|  PREDICTED: uncharacterized protein LOC100262...    283   3e-85   Vitis vinifera
ref|XP_002280019.1|  PREDICTED: uncharacterized protein LOC100262...    283   4e-85   Vitis vinifera
ref|XP_002521721.1|  conserved hypothetical protein                     281   9e-85   
ref|XP_011461610.1|  PREDICTED: uncharacterized protein LOC101298...    281   2e-84   Fragaria vesca subsp. vesca
ref|XP_004287725.1|  PREDICTED: uncharacterized protein LOC101298...    280   3e-84   Fragaria vesca subsp. vesca
ref|XP_010266195.1|  PREDICTED: uncharacterized protein LOC104603...    280   4e-84   Nelumbo nucifera [Indian lotus]
ref|XP_010266194.1|  PREDICTED: uncharacterized protein LOC104603...    280   5e-84   Nelumbo nucifera [Indian lotus]
ref|XP_010266193.1|  PREDICTED: uncharacterized protein LOC104603...    280   7e-84   Nelumbo nucifera [Indian lotus]
ref|XP_007046505.1|  Transducin/WD40 repeat-like superfamily prot...    279   1e-83   
ref|XP_007046503.1|  Transducin/WD40 repeat-like superfamily prot...    279   1e-83   
ref|XP_009590622.1|  PREDICTED: uncharacterized protein LOC104087...    279   2e-83   Nicotiana tomentosiformis
ref|XP_009590624.1|  PREDICTED: uncharacterized protein LOC104087...    279   2e-83   Nicotiana tomentosiformis
ref|XP_007046506.1|  Transducin/WD40 repeat-like superfamily prot...    278   2e-83   
ref|XP_007046504.1|  Transducin/WD40 repeat-like superfamily prot...    278   2e-83   
ref|XP_011022177.1|  PREDICTED: uncharacterized protein LOC105124...    275   2e-82   Populus euphratica
ref|XP_011022179.1|  PREDICTED: uncharacterized protein LOC105124...    276   2e-82   Populus euphratica
ref|XP_011022176.1|  PREDICTED: uncharacterized protein LOC105124...    276   2e-82   Populus euphratica
gb|EYU30835.1|  hypothetical protein MIMGU_mgv1a000647mg                275   4e-82   Erythranthe guttata [common monkey flower]
ref|XP_012065395.1|  PREDICTED: uncharacterized protein LOC105628567    275   5e-82   Jatropha curcas
gb|KJB17500.1|  hypothetical protein B456_003G002400                    274   8e-82   Gossypium raimondii
gb|KEH20352.1|  transducin/WD40 repeat protein                          272   3e-81   Medicago truncatula
emb|CBI37643.3|  unnamed protein product                                272   4e-81   Vitis vinifera
ref|XP_008448470.1|  PREDICTED: uncharacterized protein LOC103490...    270   2e-80   Cucumis melo [Oriental melon]
ref|XP_011650254.1|  PREDICTED: uncharacterized protein LOC101213...    269   6e-80   Cucumis sativus [cucumbers]
ref|XP_002307215.2|  hypothetical protein POPTR_0005s10460g             266   4e-79   
ref|XP_011099901.1|  PREDICTED: uncharacterized protein LOC105178...    265   9e-79   
ref|XP_011099900.1|  PREDICTED: uncharacterized protein LOC105178...    265   9e-79   Sesamum indicum [beniseed]
ref|XP_007158006.1|  hypothetical protein PHAVU_002G116600g             249   6e-78   Phaseolus vulgaris [French bean]
ref|XP_006425282.1|  hypothetical protein CICLE_v10024783mg             261   4e-77   Citrus clementina [clementine]
ref|XP_006467080.1|  PREDICTED: uncharacterized protein LOC102630995    258   4e-76   Citrus sinensis [apfelsine]
gb|KDO71481.1|  hypothetical protein CISIN_1g001628mg                   257   6e-76   Citrus sinensis [apfelsine]
ref|XP_010033584.1|  PREDICTED: uncharacterized protein LOC104422...    256   1e-75   
ref|XP_003548801.1|  PREDICTED: uncharacterized protein LOC100811...    256   1e-75   Glycine max [soybeans]
emb|CDP01788.1|  unnamed protein product                                256   2e-75   Coffea canephora [robusta coffee]
ref|XP_010683214.1|  PREDICTED: uncharacterized protein LOC104897...    256   2e-75   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010683216.1|  PREDICTED: uncharacterized protein LOC104897...    256   2e-75   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006599278.1|  PREDICTED: uncharacterized protein LOC100811...    256   3e-75   Glycine max [soybeans]
ref|XP_007156241.1|  hypothetical protein PHAVU_003G2701001g            254   8e-75   Phaseolus vulgaris [French bean]
ref|XP_007156240.1|  hypothetical protein PHAVU_003G2701001g            254   8e-75   Phaseolus vulgaris [French bean]
ref|XP_006587564.1|  PREDICTED: uncharacterized protein LOC100793...    252   3e-74   Glycine max [soybeans]
ref|XP_006587562.1|  PREDICTED: uncharacterized protein LOC100793...    252   4e-74   Glycine max [soybeans]
ref|XP_006590749.1|  PREDICTED: uncharacterized protein LOC100782...    250   2e-73   Glycine max [soybeans]
ref|XP_006590750.1|  PREDICTED: uncharacterized protein LOC100782...    250   2e-73   Glycine max [soybeans]
ref|XP_004509443.1|  PREDICTED: uncharacterized protein LOC101491...    250   2e-73   
ref|XP_004509444.1|  PREDICTED: uncharacterized protein LOC101491...    250   2e-73   
gb|KHN38837.1|  Syntaxin-binding protein 5                              248   2e-72   Glycine soja [wild soybean]
ref|XP_006587563.1|  PREDICTED: uncharacterized protein LOC100793...    246   6e-72   
ref|XP_010103254.1|  Syntaxin-binding protein 5                         245   1e-71   
ref|XP_004512431.1|  PREDICTED: uncharacterized protein LOC101494027    245   1e-71   
ref|XP_006599277.1|  PREDICTED: uncharacterized protein LOC100811...    245   1e-71   
ref|XP_010432265.1|  PREDICTED: uncharacterized protein LOC104716...    243   1e-70   Camelina sativa [gold-of-pleasure]
ref|XP_010432264.1|  PREDICTED: uncharacterized protein LOC104716...    243   1e-70   Camelina sativa [gold-of-pleasure]
ref|XP_010918268.1|  PREDICTED: uncharacterized protein LOC105042667    241   5e-70   Elaeis guineensis
gb|AES95324.2|  transducin/WD40 repeat protein                          241   7e-70   Medicago truncatula
ref|XP_003612366.1|  Syntaxin-binding protein                           241   7e-70   
ref|XP_002869080.1|  hypothetical protein ARALYDRAFT_491090             240   9e-70   
ref|XP_010446909.1|  PREDICTED: uncharacterized protein LOC104729648    239   1e-69   Camelina sativa [gold-of-pleasure]
ref|XP_009138375.1|  PREDICTED: uncharacterized protein LOC103862...    239   2e-69   Brassica rapa
ref|XP_009138377.1|  PREDICTED: uncharacterized protein LOC103862...    239   2e-69   Brassica rapa
emb|CDY40621.1|  BnaA03g53420D                                          239   2e-69   Brassica napus [oilseed rape]
ref|XP_008809117.1|  PREDICTED: uncharacterized protein LOC103720924    239   3e-69   
ref|XP_006285838.1|  hypothetical protein CARUB_v10007318mg             238   5e-69   Capsella rubella
gb|KFK30193.1|  hypothetical protein AALP_AA7G230100                    236   2e-68   Arabis alpina [alpine rockcress]
ref|XP_006412089.1|  hypothetical protein EUTSA_v10024291mg             234   2e-67   Eutrema salsugineum [saltwater cress]
ref|XP_006412090.1|  hypothetical protein EUTSA_v10024291mg             233   2e-67   
ref|XP_010526846.1|  PREDICTED: uncharacterized protein LOC104804294    232   7e-67   Tarenaya hassleriana [spider flower]
emb|CDX72547.1|  BnaC07g45690D                                          232   7e-67   
ref|NP_001190926.1|  DUO1-activated WD40 1                              229   1e-65   Arabidopsis thaliana [mouse-ear cress]
ref|NP_195281.2|  DUO1-activated WD40 1                                 229   1e-65   Arabidopsis thaliana [mouse-ear cress]
gb|ERN17199.1|  hypothetical protein AMTR_s00044p00158440               228   2e-65   Amborella trichopoda
ref|XP_011627590.1|  PREDICTED: uncharacterized protein LOC18445533     228   5e-65   
ref|XP_009400998.1|  PREDICTED: uncharacterized protein LOC103985...    226   6e-65   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009400997.1|  PREDICTED: uncharacterized protein LOC103985...    226   7e-65   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009400999.1|  PREDICTED: uncharacterized protein LOC103985...    226   7e-65   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010548217.1|  PREDICTED: uncharacterized protein LOC104819...    226   8e-65   Tarenaya hassleriana [spider flower]
ref|XP_010548216.1|  PREDICTED: uncharacterized protein LOC104819...    226   1e-64   Tarenaya hassleriana [spider flower]
ref|XP_010548212.1|  PREDICTED: uncharacterized protein LOC104819...    226   2e-64   Tarenaya hassleriana [spider flower]
ref|XP_010548221.1|  PREDICTED: uncharacterized protein LOC104819...    221   5e-63   Tarenaya hassleriana [spider flower]
ref|XP_010548218.1|  PREDICTED: uncharacterized protein LOC104819...    221   5e-63   Tarenaya hassleriana [spider flower]
ref|XP_010548214.1|  PREDICTED: uncharacterized protein LOC104819...    221   7e-63   Tarenaya hassleriana [spider flower]
ref|XP_010548213.1|  PREDICTED: uncharacterized protein LOC104819...    221   7e-63   Tarenaya hassleriana [spider flower]
ref|XP_010548211.1|  PREDICTED: uncharacterized protein LOC104819...    221   8e-63   Tarenaya hassleriana [spider flower]
gb|KHN38868.1|  Syntaxin-binding protein 5                              218   5e-62   Glycine soja [wild soybean]
gb|KHN41818.1|  Syntaxin-binding protein 5-like                         216   2e-61   Glycine soja [wild soybean]
gb|EEC77809.1|  hypothetical protein OsI_16999                          216   5e-61   Oryza sativa Indica Group [Indian rice]
ref|NP_001174047.1|  Os04g0564700                                       208   1e-59   
dbj|BAJ98402.1|  predicted protein                                      212   1e-59   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009401000.1|  PREDICTED: uncharacterized protein LOC103985...    209   8e-59   
ref|XP_008669023.1|  PREDICTED: LOW QUALITY PROTEIN: protein leth...    205   2e-58   
ref|XP_010240265.1|  PREDICTED: uncharacterized protein LOC100825373    207   4e-58   Brachypodium distachyon [annual false brome]
tpg|DAA36430.1|  TPA: hypothetical protein ZEAMMB73_590297              205   3e-57   
emb|CAH66754.1|  OSIGBa0158F05.3                                        203   4e-57   Oryza sativa [red rice]
emb|CAE03092.2|  OSJNBa0017B10.7                                        197   1e-54   Oryza sativa Japonica Group [Japonica rice]
ref|XP_011650255.1|  PREDICTED: uncharacterized protein LOC101213...    193   4e-53   Cucumis sativus [cucumbers]
ref|XP_008448471.1|  PREDICTED: uncharacterized protein LOC103490...    193   6e-53   Cucumis melo [Oriental melon]
ref|XP_002448340.1|  hypothetical protein SORBIDRAFT_06g025450          189   9e-52   
gb|EMT27203.1|  hypothetical protein F775_06534                         177   3e-47   
gb|EEE61509.1|  hypothetical protein OsJ_15799                          176   1e-46   Oryza sativa Japonica Group [Japonica rice]
ref|XP_011004756.1|  PREDICTED: uncharacterized protein LOC105111...    174   5e-46   Populus euphratica
ref|XP_007026671.1|  Transducin family protein / WD-40 repeat fam...    174   6e-46   
ref|XP_007026669.1|  Transducin family protein / WD-40 repeat fam...    173   8e-46   
ref|XP_011048260.1|  PREDICTED: uncharacterized protein LOC105142...    172   2e-45   Populus euphratica
ref|XP_002993402.1|  hypothetical protein SELMODRAFT_449132             172   3e-45   Selaginella moellendorffii
ref|XP_011035925.1|  PREDICTED: syntaxin-binding protein 5-like i...    171   3e-45   Populus euphratica
ref|XP_011035924.1|  PREDICTED: uncharacterized protein LOC105133...    171   4e-45   Populus euphratica
ref|XP_011035923.1|  PREDICTED: uncharacterized protein LOC105133...    171   4e-45   Populus euphratica
ref|XP_011035922.1|  PREDICTED: uncharacterized protein LOC105133...    171   4e-45   Populus euphratica
ref|XP_012087836.1|  PREDICTED: uncharacterized protein LOC105646578    169   2e-44   Jatropha curcas
ref|XP_011048186.1|  PREDICTED: uncharacterized protein LOC105142...    169   2e-44   Populus euphratica
ref|XP_008243549.1|  PREDICTED: uncharacterized protein LOC103341775    169   4e-44   Prunus mume [ume]
ref|XP_007207154.1|  hypothetical protein PRUPE_ppa000427mg             168   4e-44   
ref|XP_007207155.1|  hypothetical protein PRUPE_ppa000427mg             168   7e-44   
gb|KHG05321.1|  Syntaxin-binding protein 5-like protein                 166   3e-43   Gossypium arboreum [tree cotton]
gb|KJB76967.1|  hypothetical protein B456_012G115100                    166   3e-43   Gossypium raimondii
ref|XP_002323587.2|  hypothetical protein POPTR_0016s12520g             166   3e-43   
ref|XP_011084900.1|  PREDICTED: syntaxin-binding protein 5 isofor...    164   9e-43   
ref|XP_009377747.1|  PREDICTED: uncharacterized protein LOC103966...    164   1e-42   Pyrus x bretschneideri [bai li]
ref|XP_009377746.1|  PREDICTED: uncharacterized protein LOC103966...    164   1e-42   Pyrus x bretschneideri [bai li]
emb|CDP14008.1|  unnamed protein product                                164   1e-42   Coffea canephora [robusta coffee]
ref|XP_011084899.1|  PREDICTED: uncharacterized protein LOC105167...    164   2e-42   Sesamum indicum [beniseed]
ref|XP_008363911.1|  PREDICTED: uncharacterized protein LOC103427...    164   2e-42   
ref|XP_008363912.1|  PREDICTED: uncharacterized protein LOC103427...    164   2e-42   
ref|XP_011095022.1|  PREDICTED: uncharacterized protein LOC105174...    163   2e-42   Sesamum indicum [beniseed]
ref|XP_011095023.1|  PREDICTED: uncharacterized protein LOC105174...    163   2e-42   
ref|XP_009338156.1|  PREDICTED: uncharacterized protein LOC103930534    163   3e-42   Pyrus x bretschneideri [bai li]
ref|XP_010253763.1|  PREDICTED: uncharacterized protein LOC104594...    161   2e-41   Nelumbo nucifera [Indian lotus]
ref|XP_010065698.1|  PREDICTED: uncharacterized protein LOC104452894    161   2e-41   
ref|XP_010253764.1|  PREDICTED: uncharacterized protein LOC104594...    161   2e-41   Nelumbo nucifera [Indian lotus]
ref|XP_010253765.1|  PREDICTED: uncharacterized protein LOC104594...    161   2e-41   Nelumbo nucifera [Indian lotus]
gb|KCW88134.1|  hypothetical protein EUGRSUZ_A00527                     160   2e-41   Eucalyptus grandis [rose gum]
gb|KCW88135.1|  hypothetical protein EUGRSUZ_A00527                     160   2e-41   Eucalyptus grandis [rose gum]
ref|XP_002532114.1|  nucleotide binding protein, putative               160   3e-41   
ref|XP_008367163.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    161   3e-41   
ref|XP_010653303.1|  PREDICTED: uncharacterized protein LOC100257563    159   9e-41   Vitis vinifera
ref|XP_006435755.1|  hypothetical protein CICLE_v10030572mg             158   2e-40   
ref|XP_006486530.1|  PREDICTED: uncharacterized protein LOC102617119    158   2e-40   
gb|EPS63539.1|  hypothetical protein M569_11243                         154   2e-40   Genlisea aurea
ref|XP_009600570.1|  PREDICTED: syntaxin-binding protein 5-like         155   3e-40   Nicotiana tomentosiformis
ref|XP_006481054.1|  PREDICTED: uncharacterized protein LOC102612...    157   3e-40   Citrus sinensis [apfelsine]
ref|XP_006429414.1|  hypothetical protein CICLE_v10010948mg             157   3e-40   Citrus clementina [clementine]
ref|XP_009769451.1|  PREDICTED: uncharacterized protein LOC104220...    157   3e-40   Nicotiana sylvestris
ref|XP_006481055.1|  PREDICTED: uncharacterized protein LOC102612...    157   3e-40   Citrus sinensis [apfelsine]
gb|KDO56671.1|  hypothetical protein CISIN_1g001279mg                   157   3e-40   Citrus sinensis [apfelsine]
gb|KDO56672.1|  hypothetical protein CISIN_1g001279mg                   157   4e-40   Citrus sinensis [apfelsine]
gb|KDO56674.1|  hypothetical protein CISIN_1g001279mg                   157   4e-40   Citrus sinensis [apfelsine]
ref|XP_007008944.1|  Transducin family protein / WD-40 repeat fam...    156   4e-40   
gb|KDO56673.1|  hypothetical protein CISIN_1g001279mg                   157   4e-40   Citrus sinensis [apfelsine]
ref|XP_007008943.1|  Transducin family protein / WD-40 repeat fam...    156   4e-40   
ref|XP_009402380.1|  PREDICTED: uncharacterized protein LOC103986182    157   5e-40   Musa acuminata subsp. malaccensis [pisang utan]
gb|EEC82738.1|  hypothetical protein OsI_27444                          156   6e-40   Oryza sativa Indica Group [Indian rice]
ref|NP_001060732.1|  Os07g0693700                                       156   7e-40   
dbj|BAC75571.1|  hypothetical protein                                   156   7e-40   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007008941.1|  Transducin family protein / WD-40 repeat fam...    156   7e-40   
ref|XP_007008942.1|  Transducin family protein / WD-40 repeat fam...    156   9e-40   
ref|XP_003530287.1|  PREDICTED: uncharacterized protein LOC100779801    155   1e-39   Glycine max [soybeans]
gb|KJB76197.1|  hypothetical protein B456_012G077100                    154   3e-39   Gossypium raimondii
ref|XP_003552256.1|  PREDICTED: uncharacterized protein LOC100776...    154   4e-39   Glycine max [soybeans]
gb|KJB76195.1|  hypothetical protein B456_012G077100                    154   4e-39   Gossypium raimondii
gb|EYU41912.1|  hypothetical protein MIMGU_mgv1a024167mg                154   5e-39   Erythranthe guttata [common monkey flower]
gb|KFK24974.1|  hypothetical protein AALP_AA8G050200                    153   7e-39   Arabis alpina [alpine rockcress]
ref|XP_009122161.1|  PREDICTED: uncharacterized protein LOC103846904    153   8e-39   Brassica rapa
emb|CDX70143.1|  BnaA10g24920D                                          153   9e-39   
emb|CDX98850.1|  BnaC09g49850D                                          153   9e-39   
ref|XP_009612132.1|  PREDICTED: uncharacterized protein LOC104105...    153   1e-38   Nicotiana tomentosiformis
ref|XP_010558072.1|  PREDICTED: uncharacterized protein LOC104826...    153   1e-38   Tarenaya hassleriana [spider flower]
ref|XP_009612131.1|  PREDICTED: uncharacterized protein LOC104105...    153   1e-38   Nicotiana tomentosiformis
ref|XP_010558071.1|  PREDICTED: uncharacterized protein LOC104826...    153   1e-38   Tarenaya hassleriana [spider flower]
ref|XP_008793107.1|  PREDICTED: uncharacterized protein LOC103709502    152   1e-38   
gb|KJB76196.1|  hypothetical protein B456_012G077100                    152   2e-38   Gossypium raimondii
ref|XP_006286944.1|  hypothetical protein CARUB_v10000088mg             152   2e-38   
ref|XP_011623149.1|  PREDICTED: uncharacterized protein LOC18433437     152   2e-38   
ref|XP_010326061.1|  PREDICTED: uncharacterized protein LOC101248608    152   2e-38   Solanum lycopersicum
ref|XP_007140270.1|  hypothetical protein PHAVU_008G098000g             152   3e-38   Phaseolus vulgaris [French bean]
ref|XP_010552925.1|  PREDICTED: uncharacterized protein LOC104823185    152   3e-38   Tarenaya hassleriana [spider flower]
ref|XP_006399016.1|  hypothetical protein EUTSA_v10012508mg             151   3e-38   Eutrema salsugineum [saltwater cress]
ref|XP_006366943.1|  PREDICTED: uncharacterized protein LOC102587909    151   4e-38   Solanum tuberosum [potatoes]
ref|XP_002312164.2|  transducin family protein                          151   4e-38   
ref|XP_006659002.1|  PREDICTED: uncharacterized protein LOC102719885    151   4e-38   
gb|KHN44705.1|  Syntaxin-binding protein 5                              151   4e-38   Glycine soja [wild soybean]
ref|XP_009763492.1|  PREDICTED: uncharacterized protein LOC104215...    151   5e-38   Nicotiana sylvestris
gb|KHN20308.1|  Syntaxin-binding protein 5                              150   1e-37   Glycine soja [wild soybean]
ref|XP_010491088.1|  PREDICTED: uncharacterized protein LOC104768753    150   1e-37   Camelina sativa [gold-of-pleasure]
gb|KEH23187.1|  nucleotide-binding protein                              149   3e-37   Medicago truncatula
gb|ERN05265.1|  hypothetical protein AMTR_s00007p00123180               149   3e-37   Amborella trichopoda
ref|NP_196176.1|  transducin family protein / WD-40 repeat family...    148   4e-37   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001190229.1|  transducin family protein / WD-40 repeat fam...    148   4e-37   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006378656.1|  hypothetical protein POPTR_0010s19500g             147   1e-36   
ref|XP_010452462.1|  PREDICTED: uncharacterized protein LOC104734561    147   1e-36   
ref|XP_002315153.2|  transducin family protein                          147   1e-36   
gb|EYU26793.1|  hypothetical protein MIMGU_mgv1a0006321mg               146   1e-36   Erythranthe guttata [common monkey flower]
ref|XP_002972980.1|  hypothetical protein SELMODRAFT_413341             147   1e-36   
gb|EYU26792.1|  hypothetical protein MIMGU_mgv1a0006321mg               146   2e-36   Erythranthe guttata [common monkey flower]
ref|XP_010689562.1|  PREDICTED: uncharacterized protein LOC104903...    146   2e-36   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010689554.1|  PREDICTED: uncharacterized protein LOC104903...    146   2e-36   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004514217.1|  PREDICTED: uncharacterized protein LOC101513...    146   2e-36   Cicer arietinum [garbanzo]
ref|XP_010920833.1|  PREDICTED: uncharacterized protein LOC105044...    146   2e-36   Elaeis guineensis
ref|XP_010423454.1|  PREDICTED: uncharacterized protein LOC104708556    146   2e-36   
ref|XP_004514218.1|  PREDICTED: uncharacterized protein LOC101513...    146   3e-36   Cicer arietinum [garbanzo]
ref|XP_010233571.1|  PREDICTED: uncharacterized protein LOC100837...    146   3e-36   Brachypodium distachyon [annual false brome]
ref|XP_003559744.1|  PREDICTED: uncharacterized protein LOC100837...    145   4e-36   Brachypodium distachyon [annual false brome]
emb|CDY14108.1|  BnaC02g02250D                                          145   5e-36   Brassica napus [oilseed rape]
ref|XP_002871170.1|  transducin family protein                          145   5e-36   
emb|CDY04957.1|  BnaAnng01390D                                          145   7e-36   
ref|XP_010658263.1|  PREDICTED: uncharacterized protein LOC100250...    144   7e-36   Vitis vinifera
ref|XP_009125606.1|  PREDICTED: uncharacterized protein LOC103850...    144   9e-36   Brassica rapa
ref|XP_006338829.1|  PREDICTED: uncharacterized protein LOC102596...    144   1e-35   Solanum tuberosum [potatoes]
ref|XP_002272182.1|  PREDICTED: uncharacterized protein LOC100250...    144   1e-35   Vitis vinifera
emb|CBI25466.3|  unnamed protein product                                144   1e-35   Vitis vinifera
ref|XP_009125607.1|  PREDICTED: uncharacterized protein LOC103850...    144   1e-35   Brassica rapa
ref|XP_008465213.1|  PREDICTED: lethal(2) giant larvae protein ho...    144   1e-35   Cucumis melo [Oriental melon]
ref|XP_006338828.1|  PREDICTED: uncharacterized protein LOC102596...    144   1e-35   Solanum tuberosum [potatoes]
ref|XP_004491029.1|  PREDICTED: lethal(2) giant larvae protein ho...    144   1e-35   Cicer arietinum [garbanzo]
ref|XP_004958799.1|  PREDICTED: uncharacterized protein LOC101753058    144   1e-35   Setaria italica
ref|XP_008465214.1|  PREDICTED: lethal(2) giant larvae protein ho...    144   1e-35   Cucumis melo [Oriental melon]
ref|XP_010920834.1|  PREDICTED: uncharacterized protein LOC105044...    144   1e-35   Elaeis guineensis
ref|XP_007220439.1|  hypothetical protein PRUPE_ppa000521mg             144   2e-35   
emb|CDP06470.1|  unnamed protein product                                142   2e-35   Coffea canephora [robusta coffee]
gb|EMT18415.1|  hypothetical protein F775_52555                         143   2e-35   
ref|XP_010676760.1|  PREDICTED: uncharacterized protein LOC104892...    143   3e-35   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010676759.1|  PREDICTED: uncharacterized protein LOC104892...    143   3e-35   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010676758.1|  PREDICTED: uncharacterized protein LOC104892...    143   3e-35   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006575540.1|  PREDICTED: uncharacterized protein LOC100777...    143   3e-35   Glycine max [soybeans]
gb|KDP43769.1|  hypothetical protein JCGZ_22396                         142   5e-35   Jatropha curcas
ref|XP_008653533.1|  PREDICTED: uncharacterized protein LOC103633...    142   5e-35   Zea mays [maize]
ref|XP_008653535.1|  PREDICTED: uncharacterized protein LOC103633...    142   6e-35   Zea mays [maize]
tpg|DAA64252.1|  TPA: hypothetical protein ZEAMMB73_724610              142   8e-35   
ref|XP_008653536.1|  PREDICTED: uncharacterized protein LOC103633...    142   9e-35   Zea mays [maize]
ref|XP_011654993.1|  PREDICTED: uncharacterized protein LOC101208...    141   2e-34   Cucumis sativus [cucumbers]
ref|XP_011654994.1|  PREDICTED: uncharacterized protein LOC101208...    141   2e-34   Cucumis sativus [cucumbers]
ref|XP_008233769.1|  PREDICTED: lethal(2) giant larvae protein ho...    140   4e-34   Prunus mume [ume]
ref|XP_008234069.1|  PREDICTED: LOW QUALITY PROTEIN: lethal(2) gi...    139   4e-34   
ref|XP_002461277.1|  hypothetical protein SORBIDRAFT_02g043970          139   5e-34   
ref|XP_010322180.1|  PREDICTED: uncharacterized protein LOC101264...    139   6e-34   Solanum lycopersicum
gb|KCW50465.1|  hypothetical protein EUGRSUZ_J00199                     139   8e-34   Eucalyptus grandis [rose gum]
ref|XP_007141757.1|  hypothetical protein PHAVU_008G223200g             139   1e-33   Phaseolus vulgaris [French bean]
ref|XP_003616655.1|  Syntaxin-binding protein 5-like protein            139   1e-33   
ref|XP_010253766.1|  PREDICTED: uncharacterized protein LOC104594...    139   1e-33   Nelumbo nucifera [Indian lotus]
gb|AES99613.2|  nucleotide-binding protein, putative                    139   1e-33   Medicago truncatula
ref|XP_010031200.1|  PREDICTED: uncharacterized protein LOC104421...    138   1e-33   Eucalyptus grandis [rose gum]
ref|XP_010031201.1|  PREDICTED: uncharacterized protein LOC104421...    138   1e-33   Eucalyptus grandis [rose gum]
ref|XP_009345056.1|  PREDICTED: uncharacterized protein LOC103936...    137   3e-33   Pyrus x bretschneideri [bai li]
ref|XP_009345026.1|  PREDICTED: uncharacterized protein LOC103936...    137   5e-33   Pyrus x bretschneideri [bai li]
ref|XP_008354175.1|  PREDICTED: lethal(2) giant larvae protein ho...    137   6e-33   
ref|XP_009345034.1|  PREDICTED: uncharacterized protein LOC103936...    136   6e-33   Pyrus x bretschneideri [bai li]
gb|EMS53343.1|  Syntaxin-binding protein 5-like protein                 136   7e-33   Triticum urartu
ref|XP_011469924.1|  PREDICTED: uncharacterized protein LOC101299...    135   1e-32   Fragaria vesca subsp. vesca
ref|XP_011469925.1|  PREDICTED: uncharacterized protein LOC101299...    135   1e-32   Fragaria vesca subsp. vesca
ref|XP_011466469.1|  PREDICTED: uncharacterized protein LOC101312...    135   1e-32   Fragaria vesca subsp. vesca
ref|XP_004305125.1|  PREDICTED: uncharacterized protein LOC101312...    135   1e-32   Fragaria vesca subsp. vesca
ref|XP_006587565.1|  PREDICTED: uncharacterized protein LOC100793...    135   2e-32   Glycine max [soybeans]
gb|KDO56675.1|  hypothetical protein CISIN_1g001279mg                   133   8e-32   Citrus sinensis [apfelsine]
ref|XP_010920837.1|  PREDICTED: uncharacterized protein LOC105044...    130   1e-30   
ref|XP_010920839.1|  PREDICTED: uncharacterized protein LOC105044...    130   1e-30   
ref|XP_010920838.1|  PREDICTED: uncharacterized protein LOC105044...    130   1e-30   
ref|XP_010920835.1|  PREDICTED: uncharacterized protein LOC105044...    130   1e-30   
ref|XP_010920836.1|  PREDICTED: uncharacterized protein LOC105044...    130   1e-30   
ref|XP_010920831.1|  PREDICTED: uncharacterized protein LOC105044...    130   1e-30   
ref|XP_001756186.1|  tomosyn-like protein                               128   5e-30   
gb|KDO68939.1|  hypothetical protein CISIN_1g001109mg                   128   6e-30   Citrus sinensis [apfelsine]
ref|XP_009348569.1|  PREDICTED: syntaxin-binding protein 5-like         117   8e-29   Pyrus x bretschneideri [bai li]
ref|XP_008442406.1|  PREDICTED: uncharacterized protein LOC103486283    124   2e-28   Cucumis melo [Oriental melon]
ref|XP_011651858.1|  PREDICTED: uncharacterized protein LOC101217...    123   2e-28   Cucumis sativus [cucumbers]
tpg|DAA64253.1|  TPA: hypothetical protein ZEAMMB73_724610              114   5e-28   
ref|XP_010513768.1|  PREDICTED: uncharacterized protein LOC104789824    115   2e-27   
gb|KGN58748.1|  hypothetical protein Csa_3G731100                       117   3e-26   Cucumis sativus [cucumbers]
ref|XP_006338830.1|  PREDICTED: uncharacterized protein LOC102596...    116   7e-26   Solanum tuberosum [potatoes]
ref|XP_012090712.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    115   1e-25   
gb|ADN33787.1|  nucleotide binding protein                              113   6e-25   Cucumis melo subsp. melo
ref|XP_010033585.1|  PREDICTED: uncharacterized protein LOC104422...    110   7e-24   
ref|XP_010548220.1|  PREDICTED: uncharacterized protein LOC104819...    109   2e-23   
ref|XP_010548219.1|  PREDICTED: uncharacterized protein LOC104819...    109   2e-23   
ref|XP_010266197.1|  PREDICTED: uncharacterized protein LOC104603...    104   7e-22   
gb|EMS65077.1|  Serine/threonine-protein phosphatase 7 long form-...  99.0    6e-20   
ref|XP_002528300.1|  nucleotide binding protein, putative             97.1    3e-19   
ref|XP_006595864.1|  PREDICTED: syntaxin-binding protein 5-like       88.2    4e-18   
ref|XP_008370150.1|  PREDICTED: uncharacterized protein LOC103433663  93.2    4e-18   
ref|XP_010101429.1|  Syntaxin-binding protein 5-like protein          93.2    4e-18   
gb|KHN48571.1|  Syntaxin-binding protein 5                            93.2    5e-18   
ref|XP_006590751.1|  PREDICTED: uncharacterized protein LOC100782...  92.8    7e-18   
ref|XP_011651859.1|  PREDICTED: uncharacterized protein LOC101217...  92.8    7e-18   
ref|XP_010104257.1|  Lethal(2) giant larvae protein-1-like protein    89.4    1e-16   
ref|XP_011049193.1|  PREDICTED: syntaxin-binding protein 5 isofor...  85.5    2e-15   
ref|XP_011049196.1|  PREDICTED: syntaxin-binding protein 5 isofor...  85.5    2e-15   
ref|XP_011049195.1|  PREDICTED: syntaxin-binding protein 5 isofor...  85.5    2e-15   
ref|XP_011049197.1|  PREDICTED: syntaxin-binding protein 5 isofor...  85.5    2e-15   
ref|XP_011049198.1|  PREDICTED: syntaxin-binding protein 5 isofor...  85.5    2e-15   
ref|XP_011049191.1|  PREDICTED: syntaxin-binding protein 5 isofor...  85.5    2e-15   
ref|XP_011049192.1|  PREDICTED: syntaxin-binding protein 5 isofor...  85.1    3e-15   
ref|XP_012059369.1|  PREDICTED: syntaxin-binding protein 5            84.7    3e-15   
ref|XP_002127809.3|  PREDICTED: LOW QUALITY PROTEIN: syntaxin-bin...  84.0    6e-15   
ref|XP_011860240.1|  PREDICTED: syntaxin-binding protein 5 isofor...  83.6    8e-15   
ref|XP_011860242.1|  PREDICTED: syntaxin-binding protein 5 isofor...  83.6    8e-15   
ref|XP_011860243.1|  PREDICTED: syntaxin-binding protein 5 isofor...  83.6    9e-15   
ref|XP_011860238.1|  PREDICTED: syntaxin-binding protein 5 isofor...  83.6    1e-14   
ref|XP_011860239.1|  PREDICTED: syntaxin-binding protein 5 isofor...  83.2    1e-14   
ref|XP_011860237.1|  PREDICTED: syntaxin-binding protein 5 isofor...  83.2    1e-14   
ref|XP_011860236.1|  PREDICTED: syntaxin-binding protein 5 isofor...  83.2    1e-14   
ref|XP_003429120.2|  PREDICTED: syntaxin-binding protein 5-like       80.5    1e-14   
emb|CDS25279.1|  syntaxin binding protein 5                           82.4    2e-14   
ref|XP_009704679.1|  PREDICTED: syntaxin-binding protein 5-like       79.7    2e-14   
ref|XP_010122818.1|  PREDICTED: syntaxin-binding protein 5-like       78.6    3e-14   
gb|AAM61882.1|AF516608_1  b-tomosyn                                   78.6    7e-14   
ref|XP_006111358.1|  PREDICTED: syntaxin-binding protein 5 isofor...  80.5    8e-14   
ref|XP_011159585.1|  PREDICTED: syntaxin-binding protein 5 isofor...  80.5    8e-14   
ref|XP_009513590.1|  PREDICTED: syntaxin-binding protein 5-like       77.4    8e-14   
ref|XP_006111357.1|  PREDICTED: syntaxin-binding protein 5 isofor...  80.5    8e-14   
ref|XP_011698609.1|  PREDICTED: syntaxin-binding protein 5 isofor...  80.5    9e-14   
ref|XP_009488354.1|  PREDICTED: syntaxin-binding protein 5-like       76.6    9e-14   
ref|XP_006111356.1|  PREDICTED: syntaxin-binding protein 5 isofor...  80.5    1e-13   
ref|XP_006111355.1|  PREDICTED: syntaxin-binding protein 5 isofor...  80.5    1e-13   
ref|XP_011159587.1|  PREDICTED: syntaxin-binding protein 5 isofor...  80.5    1e-13   
ref|XP_011698607.1|  PREDICTED: syntaxin-binding protein 5 isofor...  80.5    1e-13   
ref|XP_011698608.1|  PREDICTED: syntaxin-binding protein 5 isofor...  80.1    1e-13   
ref|XP_011159581.1|  PREDICTED: syntaxin-binding protein 5 isofor...  80.1    1e-13   
gb|AAI07738.1|  STXBP5 protein                                        77.4    1e-13   
ref|XP_007424234.1|  PREDICTED: syntaxin-binding protein 5-like       80.1    1e-13   
ref|XP_011159583.1|  PREDICTED: syntaxin-binding protein 5 isofor...  80.1    1e-13   
ref|XP_011159582.1|  PREDICTED: syntaxin-binding protein 5 isofor...  80.1    1e-13   
ref|XP_007056324.1|  PREDICTED: syntaxin-binding protein 5 isofor...  80.1    1e-13   
ref|XP_007056323.1|  PREDICTED: syntaxin-binding protein 5 isofor...  79.7    1e-13   
ref|XP_011159584.1|  PREDICTED: syntaxin-binding protein 5 isofor...  79.7    2e-13   
ref|XP_007056322.1|  PREDICTED: syntaxin-binding protein 5 isofor...  79.7    2e-13   
gb|KFP75590.1|  Syntaxin-binding protein 5                            79.0    2e-13   
ref|XP_007892685.1|  PREDICTED: syntaxin-binding protein 5            79.3    2e-13   
ref|XP_008933832.1|  PREDICTED: syntaxin-binding protein 5            79.3    2e-13   
gb|KFQ25397.1|  Syntaxin-binding protein 5                            79.3    2e-13   
ref|XP_004320000.1|  PREDICTED: syntaxin-binding protein 5-like       75.9    2e-13   
ref|XP_002936417.1|  PREDICTED: syntaxin-binding protein 5 isoformX2  79.3    2e-13   
ref|XP_011259557.1|  PREDICTED: syntaxin-binding protein 5 isofor...  79.3    2e-13   
ref|XP_011259558.1|  PREDICTED: syntaxin-binding protein 5 isofor...  79.3    2e-13   
ref|XP_004914714.1|  PREDICTED: syntaxin-binding protein 5 isofor...  79.3    2e-13   
ref|XP_010157952.1|  PREDICTED: syntaxin-binding protein 5            78.6    2e-13   
ref|XP_007547621.1|  PREDICTED: syntaxin-binding protein 5 isofor...  79.3    2e-13   
ref|XP_009667063.1|  PREDICTED: syntaxin-binding protein 5            78.6    2e-13   
ref|XP_011259561.1|  PREDICTED: syntaxin-binding protein 5 isofor...  79.0    2e-13   
ref|XP_010205711.1|  PREDICTED: syntaxin-binding protein 5            78.2    2e-13   
ref|XP_002936416.1|  PREDICTED: syntaxin-binding protein 5 isoformX1  79.0    3e-13   
ref|XP_006057648.1|  PREDICTED: syntaxin-binding protein 5-like       76.3    3e-13   
ref|XP_011814830.1|  PREDICTED: syntaxin-binding protein 5 isofor...  79.0    3e-13   
ref|XP_011639557.1|  PREDICTED: syntaxin-binding protein 5 isofor...  79.0    3e-13   
ref|XP_011639555.1|  PREDICTED: syntaxin-binding protein 5 isofor...  79.0    3e-13   
ref|XP_007547605.1|  PREDICTED: syntaxin-binding protein 5 isofor...  79.0    3e-13   
ref|XP_011259560.1|  PREDICTED: syntaxin-binding protein 5 isofor...  79.0    3e-13   
ref|XP_011814829.1|  PREDICTED: syntaxin-binding protein 5 isofor...  79.0    3e-13   
ref|XP_011639560.1|  PREDICTED: syntaxin-binding protein 5 isofor...  79.0    3e-13   
ref|XP_007547613.1|  PREDICTED: syntaxin-binding protein 5 isofor...  79.0    3e-13   
ref|XP_011639558.1|  PREDICTED: syntaxin-binding protein 5 isofor...  79.0    3e-13   
ref|XP_010385232.1|  PREDICTED: syntaxin-binding protein 5 isofor...  79.0    3e-13   
ref|XP_006884308.1|  PREDICTED: syntaxin-binding protein 5-like i...  79.0    3e-13   
ref|XP_011259554.1|  PREDICTED: syntaxin-binding protein 5 isofor...  79.0    3e-13   
ref|XP_005150218.1|  PREDICTED: syntaxin-binding protein 5            79.0    3e-13   
gb|KFW84686.1|  Syntaxin-binding protein 5                            79.0    3e-13   
ref|XP_004935651.1|  PREDICTED: syntaxin-binding protein 5 isofor...  79.0    3e-13   
ref|XP_011639559.1|  PREDICTED: syntaxin-binding protein 5 isofor...  79.0    3e-13   
ref|XP_010385230.1|  PREDICTED: syntaxin-binding protein 5 isofor...  79.0    3e-13   
ref|XP_011639553.1|  PREDICTED: syntaxin-binding protein 5 isofor...  79.0    3e-13   
ref|XP_010582822.1|  PREDICTED: syntaxin-binding protein 5 isofor...  79.0    3e-13   
ref|XP_011814828.1|  PREDICTED: syntaxin-binding protein 5 isofor...  79.0    3e-13   
ref|XP_005507760.1|  PREDICTED: syntaxin-binding protein 5            79.0    3e-13   
gb|EFN66225.1|  Syntaxin-binding protein 5                            79.0    3e-13   
ref|XP_011639552.1|  PREDICTED: syntaxin-binding protein 5 isofor...  79.0    3e-13   
ref|XP_011259556.1|  PREDICTED: syntaxin-binding protein 5 isofor...  79.0    3e-13   
ref|XP_004935652.1|  PREDICTED: syntaxin-binding protein 5 isofor...  78.6    3e-13   
ref|XP_005802643.1|  PREDICTED: syntaxin-binding protein 5-like i...  78.6    3e-13   
ref|XP_011259552.1|  PREDICTED: syntaxin-binding protein 5 isofor...  79.0    3e-13   
ref|XP_011259555.1|  PREDICTED: syntaxin-binding protein 5 isofor...  79.0    3e-13   
ref|XP_010582819.1|  PREDICTED: syntaxin-binding protein 5 isofor...  78.6    3e-13   
ref|XP_010582823.1|  PREDICTED: syntaxin-binding protein 5 isofor...  78.6    3e-13   
ref|XP_010385223.1|  PREDICTED: syntaxin-binding protein 5 isofor...  78.6    3e-13   
ref|XP_011590281.1|  PREDICTED: syntaxin-binding protein 5 isofor...  78.6    3e-13   
ref|XP_011590280.1|  PREDICTED: syntaxin-binding protein 5 isofor...  78.6    3e-13   
ref|XP_008926638.1|  PREDICTED: syntaxin-binding protein 5            78.6    3e-13   
gb|KFV08355.1|  Syntaxin-binding protein 5                            78.2    3e-13   
ref|XP_009279821.1|  PREDICTED: syntaxin-binding protein 5            78.6    3e-13   
ref|XP_011639551.1|  PREDICTED: syntaxin-binding protein 5 isofor...  78.6    3e-13   
ref|XP_011590286.1|  PREDICTED: syntaxin-binding protein 5 isofor...  78.6    3e-13   
ref|XP_005802644.1|  PREDICTED: syntaxin-binding protein 5-like i...  78.6    3e-13   
ref|XP_011639554.1|  PREDICTED: syntaxin-binding protein 5 isofor...  78.6    3e-13   
ref|XP_009612133.1|  PREDICTED: uncharacterized protein LOC104105...  78.6    3e-13   
gb|KFP08160.1|  Syntaxin-binding protein 5                            78.6    3e-13   
gb|KGL88396.1|  Syntaxin-binding protein 5                            78.6    3e-13   
ref|XP_003770502.1|  PREDICTED: syntaxin-binding protein 5-like       77.4    3e-13   
ref|XP_011590284.1|  PREDICTED: syntaxin-binding protein 5 isofor...  78.6    4e-13   
ref|XP_010582817.1|  PREDICTED: syntaxin-binding protein 5 isofor...  78.6    4e-13   
ref|XP_011590285.1|  PREDICTED: syntaxin-binding protein 5 isofor...  78.6    4e-13   
ref|XP_008501559.1|  PREDICTED: syntaxin-binding protein 5            78.6    4e-13   
ref|XP_006884307.1|  PREDICTED: syntaxin-binding protein 5-like i...  78.6    4e-13   
ref|XP_010582821.1|  PREDICTED: syntaxin-binding protein 5 isofor...  78.6    4e-13   
ref|XP_007255723.1|  PREDICTED: syntaxin-binding protein 5-like i...  78.6    4e-13   
ref|XP_010705461.1|  PREDICTED: syntaxin-binding protein 5 isofor...  78.6    4e-13   
ref|XP_010705460.1|  PREDICTED: syntaxin-binding protein 5 isofor...  78.6    4e-13   
ref|XP_007547630.1|  PREDICTED: syntaxin-binding protein 5 isofor...  78.6    4e-13   
ref|XP_010705459.1|  PREDICTED: syntaxin-binding protein 5 isofor...  78.6    4e-13   
gb|KFO69719.1|  Syntaxin-binding protein 5                            78.6    4e-13   
ref|XP_011590283.1|  PREDICTED: syntaxin-binding protein 5 isofor...  78.6    4e-13   
ref|XP_010705457.1|  PREDICTED: syntaxin-binding protein 5 isofor...  78.6    4e-13   
gb|KFM08936.1|  Syntaxin-binding protein 5                            78.6    4e-13   
ref|XP_011590277.1|  PREDICTED: syntaxin-binding protein 5 isofor...  78.6    4e-13   
gb|KFW61338.1|  Syntaxin-binding protein 5                            78.6    4e-13   
ref|XP_010582818.1|  PREDICTED: syntaxin-binding protein 5 isofor...  78.6    4e-13   
ref|XP_005230324.1|  PREDICTED: syntaxin-binding protein 5            78.6    4e-13   
ref|XP_005280487.1|  PREDICTED: syntaxin-binding protein 5 isofor...  78.6    4e-13   
ref|XP_007255722.1|  PREDICTED: syntaxin-binding protein 5-like i...  78.6    4e-13   
ref|XP_010582816.1|  PREDICTED: syntaxin-binding protein 5 isofor...  78.6    4e-13   
ref|XP_004935649.1|  PREDICTED: syntaxin-binding protein 5 isofor...  78.6    4e-13   
ref|XP_004935650.1|  PREDICTED: syntaxin-binding protein 5 isofor...  78.6    4e-13   
ref|XP_010582820.1|  PREDICTED: syntaxin-binding protein 5 isofor...  78.6    4e-13   
gb|KFQ98017.1|  Syntaxin-binding protein 5                            78.6    4e-13   
ref|XP_009293004.1|  PREDICTED: syntaxin-binding protein 5 isofor...  78.6    4e-13   
ref|XP_011590279.1|  PREDICTED: syntaxin-binding protein 5 isofor...  78.6    4e-13   
ref|XP_004935648.1|  PREDICTED: syntaxin-binding protein 5 isofor...  78.6    4e-13   
ref|XP_003641042.1|  PREDICTED: syntaxin-binding protein 5 isoformX1  78.6    4e-13   
ref|XP_010582815.1|  PREDICTED: syntaxin-binding protein 5 isofor...  78.6    4e-13   
ref|XP_009293005.1|  PREDICTED: syntaxin-binding protein 5 isofor...  78.6    4e-13   
ref|XP_419658.3|  PREDICTED: syntaxin-binding protein 5 isoformX2     78.6    4e-13   
ref|XP_011590278.1|  PREDICTED: syntaxin-binding protein 5 isofor...  78.6    4e-13   
ref|XP_009293002.1|  PREDICTED: syntaxin-binding protein 5 isofor...  78.6    4e-13   
gb|KFP22717.1|  Syntaxin-binding protein 5                            78.2    4e-13   
ref|XP_010705455.1|  PREDICTED: syntaxin-binding protein 5 isofor...  78.6    4e-13   
gb|KFQ89570.1|  Syntaxin-binding protein 5                            78.6    4e-13   
ref|XP_005280486.1|  PREDICTED: syntaxin-binding protein 5 isofor...  78.2    4e-13   
ref|XP_005446634.1|  PREDICTED: syntaxin-binding protein 5 isofor...  78.2    4e-13   
gb|EOA99833.1|  Syntaxin-binding protein 5                            78.2    4e-13   
ref|XP_005446635.1|  PREDICTED: syntaxin-binding protein 5 isofor...  78.2    4e-13   
ref|XP_010705456.1|  PREDICTED: syntaxin-binding protein 5 isofor...  78.2    4e-13   
ref|XP_005280484.1|  PREDICTED: syntaxin-binding protein 5 isofor...  78.2    4e-13   
ref|XP_005280485.1|  PREDICTED: syntaxin-binding protein 5 isofor...  78.2    4e-13   
ref|XP_009293003.1|  PREDICTED: syntaxin-binding protein 5 isofor...  78.2    5e-13   
ref|XP_009899499.1|  PREDICTED: LOW QUALITY PROTEIN: syntaxin-bin...  78.2    5e-13   
ref|XP_011349984.1|  PREDICTED: syntaxin-binding protein 5 isofor...  78.2    5e-13   
ref|XP_007536130.1|  PREDICTED: syntaxin-binding protein 5-like       78.2    5e-13   
ref|XP_007252030.1|  PREDICTED: syntaxin-binding protein 5-like i...  78.2    5e-13   
ref|XP_005043839.1|  PREDICTED: syntaxin-binding protein 5 isofor...  78.2    5e-13   
ref|NP_001093451.1|  syntaxin-binding protein 5                       78.2    5e-13   
ref|XP_003795176.1|  PREDICTED: LOW QUALITY PROTEIN: syntaxin-bin...  78.2    5e-13   
ref|XP_005043838.1|  PREDICTED: syntaxin-binding protein 5 isofor...  78.2    5e-13   
ref|XP_010843698.1|  PREDICTED: syntaxin-binding protein 5-like i...  78.2    5e-13   
gb|KFV72009.1|  Syntaxin-binding protein 5-like                       78.2    5e-13   
ref|XP_007252032.1|  PREDICTED: syntaxin-binding protein 5-like i...  78.2    5e-13   
ref|XP_010843699.1|  PREDICTED: syntaxin-binding protein 5-like i...  78.2    5e-13   
ref|XP_010843696.1|  PREDICTED: syntaxin-binding protein 5-like i...  78.2    5e-13   
ref|XP_010843700.1|  PREDICTED: syntaxin-binding protein 5-like i...  78.2    5e-13   
ref|XP_010143314.1|  PREDICTED: syntaxin-binding protein 5 isofor...  78.2    5e-13   
ref|XP_005489299.1|  PREDICTED: syntaxin-binding protein 5            78.2    5e-13   
ref|XP_007252031.1|  PREDICTED: syntaxin-binding protein 5-like i...  78.2    5e-13   
ref|XP_010843701.1|  PREDICTED: syntaxin-binding protein 5-like i...  78.2    5e-13   
ref|XP_010143307.1|  PREDICTED: syntaxin-binding protein 5 isofor...  78.2    5e-13   
ref|XP_008834914.1|  PREDICTED: syntaxin-binding protein 5 isofor...  78.2    5e-13   
ref|XP_005021611.1|  PREDICTED: syntaxin-binding protein 5            78.2    5e-13   
ref|XP_009878191.1|  PREDICTED: syntaxin-binding protein 5-like       78.2    5e-13   
ref|XP_008834921.1|  PREDICTED: syntaxin-binding protein 5 isofor...  78.2    5e-13   
ref|XP_009637391.1|  PREDICTED: syntaxin-binding protein 5-like       78.2    5e-13   
ref|XP_005043837.1|  PREDICTED: syntaxin-binding protein 5 isofor...  78.2    5e-13   
ref|XP_009904832.1|  PREDICTED: syntaxin-binding protein 5-like       78.2    5e-13   
ref|XP_011349985.1|  PREDICTED: syntaxin-binding protein 5 isofor...  78.2    6e-13   
gb|KFO60334.1|  Syntaxin-binding protein 5                            78.2    6e-13   
ref|XP_005015030.1|  PREDICTED: syntaxin-binding protein 5-like       78.2    6e-13   
ref|XP_011349983.1|  PREDICTED: syntaxin-binding protein 5 isofor...  78.2    6e-13   
ref|XP_005231145.1|  PREDICTED: syntaxin-binding protein 5-like       78.2    6e-13   
ref|XP_002196809.1|  PREDICTED: syntaxin-binding protein 5 isoform 1  77.8    6e-13   
ref|XP_009458796.1|  PREDICTED: syntaxin-binding protein 5-like       78.2    6e-13   
ref|XP_005043836.1|  PREDICTED: syntaxin-binding protein 5 isofor...  77.8    6e-13   
ref|XP_011349982.1|  PREDICTED: syntaxin-binding protein 5 isofor...  78.2    6e-13   
ref|XP_005043835.1|  PREDICTED: syntaxin-binding protein 5 isofor...  77.8    6e-13   
ref|XP_009939865.1|  PREDICTED: LOW QUALITY PROTEIN: syntaxin-bin...  77.8    6e-13   
ref|XP_005518557.1|  PREDICTED: syntaxin-binding protein 5 isofor...  77.8    6e-13   
gb|KGL89074.1|  Syntaxin-binding protein 5-like                       77.8    6e-13   
ref|XP_003225851.2|  PREDICTED: syntaxin-binding protein 5-like       77.8    6e-13   
ref|XP_005518556.1|  PREDICTED: syntaxin-binding protein 5 isofor...  77.8    6e-13   
ref|XP_006032547.1|  PREDICTED: syntaxin-binding protein 5-like       77.8    6e-13   
ref|XP_010143299.1|  PREDICTED: syntaxin-binding protein 5 isofor...  77.8    6e-13   
ref|XP_005502684.1|  PREDICTED: LOW QUALITY PROTEIN: syntaxin-bin...  77.8    6e-13   
ref|XP_002196819.1|  PREDICTED: syntaxin-binding protein 5 isoform 2  77.8    6e-13   
emb|CDS18633.1|  syntaxin binding protein 5                           77.8    6e-13   
gb|KFR00840.1|  Syntaxin-binding protein 5-like                       77.8    6e-13   
ref|XP_010979898.1|  PREDICTED: syntaxin-binding protein 5-like       77.8    6e-13   
ref|XP_007942075.1|  PREDICTED: syntaxin-binding protein 5-like i...  77.8    6e-13   
gb|KFP16225.1|  Syntaxin-binding protein 5-like                       77.8    6e-13   
ref|XP_005518554.1|  PREDICTED: syntaxin-binding protein 5 isofor...  77.8    7e-13   
ref|XP_006263570.1|  PREDICTED: syntaxin-binding protein 5-like       77.8    7e-13   
ref|XP_010591229.1|  PREDICTED: syntaxin-binding protein 5-like i...  77.8    7e-13   
ref|XP_006797305.1|  PREDICTED: syntaxin-binding protein 5-like       77.8    7e-13   
ref|XP_006132970.1|  PREDICTED: syntaxin-binding protein 5-like i...  77.8    7e-13   
ref|XP_005518555.1|  PREDICTED: syntaxin-binding protein 5 isofor...  77.8    7e-13   
ref|XP_008284385.1|  PREDICTED: syntaxin-binding protein 5-like i...  77.8    7e-13   
ref|XP_008284384.1|  PREDICTED: syntaxin-binding protein 5-like i...  77.8    7e-13   
ref|XP_008473242.1|  PREDICTED: syntaxin-binding protein 5-like       76.6    7e-13   
ref|XP_011349980.1|  PREDICTED: syntaxin-binding protein 5 isofor...  77.8    7e-13   
ref|XP_007196966.1|  PREDICTED: syntaxin-binding protein 5 isofor...  77.8    7e-13   



>ref|XP_006340840.1| PREDICTED: uncharacterized protein LOC102595164 isoform X2 [Solanum 
tuberosum]
Length=1053

 Score =   291 bits (746),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 133/210 (63%), Positives = 167/210 (80%), Gaps = 1/210 (0%)
 Frame = +2

Query  2    GVPPGALLLAYDSIQKILAISTKDGRIKVFGKDGAQALLESPNIVPSKFMQFMENQGFLI  181
            G+P G++L A+DSIQKI+A++TKDGRIK+FGKD  QALL S   V SKF+QFMENQG LI
Sbjct  38   GIPSGSVLSAHDSIQKIVALATKDGRIKLFGKDSTQALLVSSETVSSKFLQFMENQGLLI  97

Query  182  KINVDNHIEVWNVDQKSLSNIHEFKRDITSFKIIQHTPYMYIGDSLGYVWVLKLEKEPCN  361
             IN +N IEVW+V+Q+ L N+H+F RDITSF +IQHTPY+Y+GD  G+V V+K+ KEPCN
Sbjct  98   NINSNNQIEVWDVEQRYLCNVHDFDRDITSFTLIQHTPYLYLGDLSGHVSVMKVVKEPCN  157

Query  362  VVKMKYHIPFSESHGNSNK-DGDNAIVEILPQPTAESKRVLIIYRDGLIILWAVQESKTI  538
            + KMKY IP S SHG SN+  GD A+  ILPQP AE+KRV I+Y+DG+I LW+++ESK I
Sbjct  158  IEKMKYCIPLSASHGLSNEVSGDAAVAHILPQPAAETKRVAIVYKDGVITLWSIRESKAI  217

Query  539  FTTGGNALQSVNHEAXKATAACWACPNGTK  628
            F TGG+ LQS+ HE  KAT ACW CP G+K
Sbjct  218  FITGGSPLQSMGHETKKATTACWCCPYGSK  247



>ref|XP_006340839.1| PREDICTED: uncharacterized protein LOC102595164 isoform X1 [Solanum 
tuberosum]
Length=1054

 Score =   291 bits (746),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 133/210 (63%), Positives = 167/210 (80%), Gaps = 1/210 (0%)
 Frame = +2

Query  2    GVPPGALLLAYDSIQKILAISTKDGRIKVFGKDGAQALLESPNIVPSKFMQFMENQGFLI  181
            G+P G++L A+DSIQKI+A++TKDGRIK+FGKD  QALL S   V SKF+QFMENQG LI
Sbjct  38   GIPSGSVLSAHDSIQKIVALATKDGRIKLFGKDSTQALLVSSETVSSKFLQFMENQGLLI  97

Query  182  KINVDNHIEVWNVDQKSLSNIHEFKRDITSFKIIQHTPYMYIGDSLGYVWVLKLEKEPCN  361
             IN +N IEVW+V+Q+ L N+H+F RDITSF +IQHTPY+Y+GD  G+V V+K+ KEPCN
Sbjct  98   NINSNNQIEVWDVEQRYLCNVHDFDRDITSFTLIQHTPYLYLGDLSGHVSVMKVVKEPCN  157

Query  362  VVKMKYHIPFSESHGNSNK-DGDNAIVEILPQPTAESKRVLIIYRDGLIILWAVQESKTI  538
            + KMKY IP S SHG SN+  GD A+  ILPQP AE+KRV I+Y+DG+I LW+++ESK I
Sbjct  158  IEKMKYCIPLSASHGLSNEVSGDAAVAHILPQPAAETKRVAIVYKDGVITLWSIRESKAI  217

Query  539  FTTGGNALQSVNHEAXKATAACWACPNGTK  628
            F TGG+ LQS+ HE  KAT ACW CP G+K
Sbjct  218  FITGGSPLQSMGHETKKATTACWCCPYGSK  247



>ref|XP_010316466.1| PREDICTED: uncharacterized protein LOC101257625 isoform X1 [Solanum 
lycopersicum]
Length=1055

 Score =   291 bits (746),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 133/210 (63%), Positives = 166/210 (79%), Gaps = 1/210 (0%)
 Frame = +2

Query  2    GVPPGALLLAYDSIQKILAISTKDGRIKVFGKDGAQALLESPNIVPSKFMQFMENQGFLI  181
            G+P G++L AYDSIQ I+A++TKDGRIK+FGKD  QALL S  +V SKF+QFMENQG LI
Sbjct  38   GIPSGSVLSAYDSIQNIIALATKDGRIKLFGKDSTQALLVSSEMVSSKFLQFMENQGLLI  97

Query  182  KINVDNHIEVWNVDQKSLSNIHEFKRDITSFKIIQHTPYMYIGDSLGYVWVLKLEKEPCN  361
             IN +N IEVW+V+Q+ L N+H+F RDITSF +IQHT Y+Y+GDS G+V V+K+ KEPCN
Sbjct  98   NINSNNRIEVWDVEQRYLCNVHDFDRDITSFTVIQHTIYLYLGDSSGHVSVMKVVKEPCN  157

Query  362  VVKMKYHIPFSESHGNSNK-DGDNAIVEILPQPTAESKRVLIIYRDGLIILWAVQESKTI  538
            + KMKY IP S SHG SN+  GD A+  ILPQP AE+KRV I+Y+DG+I LW++ ESK I
Sbjct  158  IEKMKYCIPLSASHGLSNEVSGDAAVAHILPQPAAETKRVAIVYKDGVITLWSIHESKAI  217

Query  539  FTTGGNALQSVNHEAXKATAACWACPNGTK  628
            F TGG+ LQS+ HE  KAT ACW CP G+K
Sbjct  218  FITGGSPLQSMGHETKKATTACWCCPYGSK  247



>ref|XP_004232566.1| PREDICTED: uncharacterized protein LOC101257625 isoform X2 [Solanum 
lycopersicum]
Length=1054

 Score =   291 bits (745),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 133/210 (63%), Positives = 166/210 (79%), Gaps = 1/210 (0%)
 Frame = +2

Query  2    GVPPGALLLAYDSIQKILAISTKDGRIKVFGKDGAQALLESPNIVPSKFMQFMENQGFLI  181
            G+P G++L AYDSIQ I+A++TKDGRIK+FGKD  QALL S  +V SKF+QFMENQG LI
Sbjct  38   GIPSGSVLSAYDSIQNIIALATKDGRIKLFGKDSTQALLVSSEMVSSKFLQFMENQGLLI  97

Query  182  KINVDNHIEVWNVDQKSLSNIHEFKRDITSFKIIQHTPYMYIGDSLGYVWVLKLEKEPCN  361
             IN +N IEVW+V+Q+ L N+H+F RDITSF +IQHT Y+Y+GDS G+V V+K+ KEPCN
Sbjct  98   NINSNNRIEVWDVEQRYLCNVHDFDRDITSFTVIQHTIYLYLGDSSGHVSVMKVVKEPCN  157

Query  362  VVKMKYHIPFSESHGNSNK-DGDNAIVEILPQPTAESKRVLIIYRDGLIILWAVQESKTI  538
            + KMKY IP S SHG SN+  GD A+  ILPQP AE+KRV I+Y+DG+I LW++ ESK I
Sbjct  158  IEKMKYCIPLSASHGLSNEVSGDAAVAHILPQPAAETKRVAIVYKDGVITLWSIHESKAI  217

Query  539  FTTGGNALQSVNHEAXKATAACWACPNGTK  628
            F TGG+ LQS+ HE  KAT ACW CP G+K
Sbjct  218  FITGGSPLQSMGHETKKATTACWCCPYGSK  247



>ref|XP_008241938.1| PREDICTED: uncharacterized protein LOC103340321 [Prunus mume]
Length=1048

 Score =   291 bits (745),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 131/210 (62%), Positives = 172/210 (82%), Gaps = 3/210 (1%)
 Frame = +2

Query  2    GVPPGALLLAYDSIQKILAISTKDGRIKVFGKDGAQALLESPNIVPSKFMQFMENQGFLI  181
            G+P G  +LAYD IQKILA+S+KDGRIK+FGKD  QALLES N VPSKF+QF+ENQG L+
Sbjct  35   GIPSGCNMLAYDPIQKILAVSSKDGRIKLFGKDNTQALLESVNAVPSKFLQFVENQGILV  94

Query  182  KINVDNHIEVWNVDQKSLSNIHEFKRDITSFKIIQHTPYMYIGDSLGYVWVLKLEKEPCN  361
             +N  NHIE+W++++  L+++H F+ DITSF ++QH+ YMY+GDS G V VLKLE+E  +
Sbjct  95   NVNSKNHIEIWDIEKNLLADVHAFEEDITSFTVMQHSLYMYVGDSAGNVRVLKLEQE--H  152

Query  362  VVKMKYHIPFSESHGNSNKD-GDNAIVEILPQPTAESKRVLIIYRDGLIILWAVQESKTI  538
            +V+MKY IP+S SHGN  ++ GD ++V +LPQP AESKRVLII+RDG+I LW ++ESKT+
Sbjct  153  IVQMKYTIPYSASHGNPTEETGDTSVVHVLPQPAAESKRVLIIFRDGIISLWDIRESKTV  212

Query  539  FTTGGNALQSVNHEAXKATAACWACPNGTK  628
            FT GGNALQS++HE  K T+ACWACP G+K
Sbjct  213  FTAGGNALQSLHHEGKKVTSACWACPFGSK  242



>ref|XP_009359594.1| PREDICTED: uncharacterized protein LOC103950160 [Pyrus x bretschneideri]
Length=1054

 Score =   291 bits (744),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 133/211 (63%), Positives = 172/211 (82%), Gaps = 4/211 (2%)
 Frame = +2

Query  2    GVPPGALLLAYDSIQKILAISTKDGRIKVFGKDGAQALLESPNIVPSKFMQFMENQGFLI  181
            G+P G  LLAYDSIQK+LA STKDGRIK+FGKD  QALLES N VPSKF+QF+ENQG LI
Sbjct  35   GIPSGCNLLAYDSIQKLLATSTKDGRIKLFGKDNTQALLESVNAVPSKFLQFIENQGILI  94

Query  182  KINVDNHIEVWNVDQKSLSNIHEFKRDITSFKIIQHTPYMYIGDSLGYVWVLKLEKEPCN  361
             +N+ NHIEVW++++   +++H F+ DITSF ++QH+PYMY+GDS G V VLKLE+E  +
Sbjct  95   NVNIRNHIEVWDIEKNLFADVHPFQEDITSFTVMQHSPYMYVGDSAGNVTVLKLEQE--H  152

Query  362  VVKMKYHIPFSESHGNSNKD--GDNAIVEILPQPTAESKRVLIIYRDGLIILWAVQESKT  535
            +V+MKY IP+S SHGN+  +  GD A++ ILPQPTAESKRVLII+RDG+I LW ++ESK+
Sbjct  153  IVQMKYTIPYSVSHGNNPTEVAGDTAVMHILPQPTAESKRVLIIFRDGIISLWDIRESKS  212

Query  536  IFTTGGNALQSVNHEAXKATAACWACPNGTK  628
            ++T GGN LQS++ E  K T+ACWACP G+K
Sbjct  213  VYTVGGNPLQSLHQEGKKVTSACWACPFGSK  243



>ref|XP_008361332.1| PREDICTED: uncharacterized protein LOC103425029 [Malus domestica]
Length=1054

 Score =   290 bits (743),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 133/211 (63%), Positives = 171/211 (81%), Gaps = 4/211 (2%)
 Frame = +2

Query  2    GVPPGALLLAYDSIQKILAISTKDGRIKVFGKDGAQALLESPNIVPSKFMQFMENQGFLI  181
            G+P G  LL YDSIQK+LA STKDGRIK+FGKD  QALLES N VPSKF+QFMENQG LI
Sbjct  35   GIPSGCNLLXYDSIQKLLATSTKDGRIKLFGKDNTQALLESVNAVPSKFLQFMENQGILI  94

Query  182  KINVDNHIEVWNVDQKSLSNIHEFKRDITSFKIIQHTPYMYIGDSLGYVWVLKLEKEPCN  361
             +N+ NHIEVW++++   +++H F+ DITSF ++QH+PYMY+GDS G V VLKLE+E  +
Sbjct  95   NVNIRNHIEVWDIEKNLFADVHPFQEDITSFTVMQHSPYMYVGDSAGNVTVLKLEQE--H  152

Query  362  VVKMKYHIPFSESHGNSNKD--GDNAIVEILPQPTAESKRVLIIYRDGLIILWAVQESKT  535
            +V+MKY IP+S SHGN+  +  GD A++ ILPQPTAESKRVLII+RDG+I LW ++ESK+
Sbjct  153  IVQMKYTIPYSVSHGNNPTEVAGDTAVMHILPQPTAESKRVLIIFRDGIISLWDIRESKS  212

Query  536  IFTTGGNALQSVNHEAXKATAACWACPNGTK  628
            ++T GGN LQS++ E  K T+ACWACP G+K
Sbjct  213  VYTVGGNPLQSLHQEGKKVTSACWACPFGSK  243



>ref|XP_009803527.1| PREDICTED: uncharacterized protein LOC104248871 isoform X2 [Nicotiana 
sylvestris]
Length=1053

 Score =   287 bits (734),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 132/210 (63%), Positives = 168/210 (80%), Gaps = 1/210 (0%)
 Frame = +2

Query  2    GVPPGALLLAYDSIQKILAISTKDGRIKVFGKDGAQALLESPNIVPSKFMQFMENQGFLI  181
            G+P G++L AYDSIQKI+A++T+DGRIK+FGKD  QALL S + V SKF+QFMENQG L+
Sbjct  38   GIPSGSVLSAYDSIQKIVALATEDGRIKLFGKDSTQALLVSSDTVSSKFLQFMENQGLLV  97

Query  182  KINVDNHIEVWNVDQKSLSNIHEFKRDITSFKIIQHTPYMYIGDSLGYVWVLKLEKEPCN  361
             IN +N IEVW+V+Q  L N+H+F R+ITSF IIQ T Y+Y+GDS G+V ++K+ K  CN
Sbjct  98   NINSNNRIEVWDVEQSYLCNVHDFDREITSFTIIQQTSYLYLGDSSGHVSIMKVVKASCN  157

Query  362  VVKMKYHIPFSESHGNSNK-DGDNAIVEILPQPTAESKRVLIIYRDGLIILWAVQESKTI  538
            + KM+Y IPFS SHG SN+  GDNA+  ILPQP AESKRV I+Y+DG+IILWA++ESK I
Sbjct  158  IEKMEYCIPFSASHGLSNEVAGDNAVAHILPQPAAESKRVAIVYKDGVIILWAIRESKAI  217

Query  539  FTTGGNALQSVNHEAXKATAACWACPNGTK  628
            F TGG+ LQS+ +E  KATAACW CP G+K
Sbjct  218  FMTGGSPLQSMGNETKKATAACWCCPYGSK  247



>ref|XP_009803526.1| PREDICTED: uncharacterized protein LOC104248871 isoform X1 [Nicotiana 
sylvestris]
Length=1054

 Score =   287 bits (734),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 132/210 (63%), Positives = 168/210 (80%), Gaps = 1/210 (0%)
 Frame = +2

Query  2    GVPPGALLLAYDSIQKILAISTKDGRIKVFGKDGAQALLESPNIVPSKFMQFMENQGFLI  181
            G+P G++L AYDSIQKI+A++T+DGRIK+FGKD  QALL S + V SKF+QFMENQG L+
Sbjct  38   GIPSGSVLSAYDSIQKIVALATEDGRIKLFGKDSTQALLVSSDTVSSKFLQFMENQGLLV  97

Query  182  KINVDNHIEVWNVDQKSLSNIHEFKRDITSFKIIQHTPYMYIGDSLGYVWVLKLEKEPCN  361
             IN +N IEVW+V+Q  L N+H+F R+ITSF IIQ T Y+Y+GDS G+V ++K+ K  CN
Sbjct  98   NINSNNRIEVWDVEQSYLCNVHDFDREITSFTIIQQTSYLYLGDSSGHVSIMKVVKASCN  157

Query  362  VVKMKYHIPFSESHGNSNK-DGDNAIVEILPQPTAESKRVLIIYRDGLIILWAVQESKTI  538
            + KM+Y IPFS SHG SN+  GDNA+  ILPQP AESKRV I+Y+DG+IILWA++ESK I
Sbjct  158  IEKMEYCIPFSASHGLSNEVAGDNAVAHILPQPAAESKRVAIVYKDGVIILWAIRESKAI  217

Query  539  FTTGGNALQSVNHEAXKATAACWACPNGTK  628
            F TGG+ LQS+ +E  KATAACW CP G+K
Sbjct  218  FMTGGSPLQSMGNETKKATAACWCCPYGSK  247



>ref|XP_007204792.1| hypothetical protein PRUPE_ppa017381mg, partial [Prunus persica]
 gb|EMJ05991.1| hypothetical protein PRUPE_ppa017381mg, partial [Prunus persica]
Length=1035

 Score =   286 bits (732),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 128/210 (61%), Positives = 171/210 (81%), Gaps = 3/210 (1%)
 Frame = +2

Query  2    GVPPGALLLAYDSIQKILAISTKDGRIKVFGKDGAQALLESPNIVPSKFMQFMENQGFLI  181
            G+P G  +LAYD +QKILA+S+KDGRIK+FGK   QALLES N VPSKF+QF+ENQG L+
Sbjct  22   GIPSGCNMLAYDPVQKILAVSSKDGRIKLFGKGNTQALLESVNAVPSKFLQFVENQGILV  81

Query  182  KINVDNHIEVWNVDQKSLSNIHEFKRDITSFKIIQHTPYMYIGDSLGYVWVLKLEKEPCN  361
             +N  NHIE+W++++  L+++H F+ DITSF ++QH+ YMY+GDS G V VLKLE+E  +
Sbjct  82   NVNSKNHIEIWDIEKNLLADVHAFEEDITSFTVMQHSLYMYVGDSAGNVRVLKLEQE--H  139

Query  362  VVKMKYHIPFSESHGNSNKD-GDNAIVEILPQPTAESKRVLIIYRDGLIILWAVQESKTI  538
            +V+MKY IP+S SHGN  ++ GD +++ +LPQP AESKRVLII+RDG+I LW ++ESKT+
Sbjct  140  IVQMKYTIPYSASHGNPTEETGDTSVLHVLPQPAAESKRVLIIFRDGIISLWDIRESKTV  199

Query  539  FTTGGNALQSVNHEAXKATAACWACPNGTK  628
            FT GGNALQS++HE  K T+ACWACP G+K
Sbjct  200  FTAGGNALQSLHHEGKKVTSACWACPFGSK  229



>ref|XP_006340841.1| PREDICTED: uncharacterized protein LOC102595164 isoform X3 [Solanum 
tuberosum]
Length=1049

 Score =   285 bits (729),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 130/209 (62%), Positives = 164/209 (78%), Gaps = 4/209 (2%)
 Frame = +2

Query  2    GVPPGALLLAYDSIQKILAISTKDGRIKVFGKDGAQALLESPNIVPSKFMQFMENQGFLI  181
            G+P G++L A+DSIQKI+A++TKDGRIK+FGKD  QALL S   V SKF+QFMENQG LI
Sbjct  38   GIPSGSVLSAHDSIQKIVALATKDGRIKLFGKDSTQALLVSSETVSSKFLQFMENQGLLI  97

Query  182  KINVDNHIEVWNVDQKSLSNIHEFKRDITSFKIIQHTPYMYIGDSLGYVWVLKLEKEPCN  361
             IN +N IEVW+V+Q+ L N+H+F RDITSF +IQHTPY+Y+GD  G+V V+K+ KEPCN
Sbjct  98   NINSNNQIEVWDVEQRYLCNVHDFDRDITSFTLIQHTPYLYLGDLSGHVSVMKVVKEPCN  157

Query  362  VVKMKYHIPFSESHGNSNKDGDNAIVEILPQPTAESKRVLIIYRDGLIILWAVQESKTIF  541
            + KMKY IP S SH +    GD A+  ILPQP AE+KRV I+Y+DG+I LW+++ESK IF
Sbjct  158  IEKMKYCIPLSASHVS----GDAAVAHILPQPAAETKRVAIVYKDGVITLWSIRESKAIF  213

Query  542  TTGGNALQSVNHEAXKATAACWACPNGTK  628
             TGG+ LQS+ HE  KAT ACW CP G+K
Sbjct  214  ITGGSPLQSMGHETKKATTACWCCPYGSK  242



>ref|XP_010649445.1| PREDICTED: uncharacterized protein LOC100262676 isoform X2 [Vitis 
vinifera]
Length=1051

 Score =   283 bits (725),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 129/210 (61%), Positives = 168/210 (80%), Gaps = 1/210 (0%)
 Frame = +2

Query  2    GVPPGALLLAYDSIQKILAISTKDGRIKVFGKDGAQALLESPNIVPSKFMQFMENQGFLI  181
            G+P G++L AYDSIQKILAI+T+DGRIK+FGKD  QALLES   VPSKF+QF+ENQG L+
Sbjct  33   GIPGGSILFAYDSIQKILAIATRDGRIKLFGKDNTQALLESNETVPSKFLQFIENQGILL  92

Query  182  KINVDNHIEVWNVDQKSLSNIHEFKRDITSFKIIQHTPYMYIGDSLGYVWVLKLEKEPCN  361
             +  +NHIEVW++D+K LS++H FK +ITSF ++Q + +MY+GDS G + VLKLE+EPC+
Sbjct  93   NVTAENHIEVWDIDKKLLSHVHVFKEEITSFMVMQRSFFMYLGDSSGNISVLKLEQEPCH  152

Query  362  VVKMKYHIPFSESHGNSNK-DGDNAIVEILPQPTAESKRVLIIYRDGLIILWAVQESKTI  538
            +V+MKY IP + SHGN  +  G  A++ ILPQPTAESKRVLII+RDGLI+LW ++ESK I
Sbjct  153  MVQMKYTIPSTASHGNPTEVAGGTAVMHILPQPTAESKRVLIIFRDGLIVLWDIRESKVI  212

Query  539  FTTGGNALQSVNHEAXKATAACWACPNGTK  628
            F TG N LQ ++H+    T+ACWACP G K
Sbjct  213  FKTGVNMLQPLSHDTKTVTSACWACPFGGK  242



>ref|XP_002280019.1| PREDICTED: uncharacterized protein LOC100262676 isoform X1 [Vitis 
vinifera]
Length=1053

 Score =   283 bits (724),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 129/210 (61%), Positives = 168/210 (80%), Gaps = 1/210 (0%)
 Frame = +2

Query  2    GVPPGALLLAYDSIQKILAISTKDGRIKVFGKDGAQALLESPNIVPSKFMQFMENQGFLI  181
            G+P G++L AYDSIQKILAI+T+DGRIK+FGKD  QALLES   VPSKF+QF+ENQG L+
Sbjct  35   GIPGGSILFAYDSIQKILAIATRDGRIKLFGKDNTQALLESNETVPSKFLQFIENQGILL  94

Query  182  KINVDNHIEVWNVDQKSLSNIHEFKRDITSFKIIQHTPYMYIGDSLGYVWVLKLEKEPCN  361
             +  +NHIEVW++D+K LS++H FK +ITSF ++Q + +MY+GDS G + VLKLE+EPC+
Sbjct  95   NVTAENHIEVWDIDKKLLSHVHVFKEEITSFMVMQRSFFMYLGDSSGNISVLKLEQEPCH  154

Query  362  VVKMKYHIPFSESHGNSNK-DGDNAIVEILPQPTAESKRVLIIYRDGLIILWAVQESKTI  538
            +V+MKY IP + SHGN  +  G  A++ ILPQPTAESKRVLII+RDGLI+LW ++ESK I
Sbjct  155  MVQMKYTIPSTASHGNPTEVAGGTAVMHILPQPTAESKRVLIIFRDGLIVLWDIRESKVI  214

Query  539  FTTGGNALQSVNHEAXKATAACWACPNGTK  628
            F TG N LQ ++H+    T+ACWACP G K
Sbjct  215  FKTGVNMLQPLSHDTKTVTSACWACPFGGK  244



>ref|XP_002521721.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF40708.1| conserved hypothetical protein [Ricinus communis]
Length=995

 Score =   281 bits (720),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 130/210 (62%), Positives = 165/210 (79%), Gaps = 1/210 (0%)
 Frame = +2

Query  2    GVPPGALLLAYDSIQKILAISTKDGRIKVFGKDGAQALLESPNIVPSKFMQFMENQGFLI  181
            G+P GA + AYDSIQKILAIST+DGRIK+FGKD  Q LLE P  VPSKF+QF++N+G LI
Sbjct  45   GIPSGANMFAYDSIQKILAISTRDGRIKLFGKDNTQLLLECPEAVPSKFLQFIQNKGILI  104

Query  182  KINVDNHIEVWNVDQKSLSNIHEFKRDITSFKIIQHTPYMYIGDSLGYVWVLKLEKEPCN  361
             +   NHIEVW+VD+K LS++H FK +ITSF I+QH  +MY+GDS+G V VLKL++E  +
Sbjct  105  NVTSKNHIEVWDVDKKLLSHVHVFKEEITSFTIMQHCFHMYVGDSVGDVSVLKLDQETSS  164

Query  362  VVKMKYHIPFSESHGNSNK-DGDNAIVEILPQPTAESKRVLIIYRDGLIILWAVQESKTI  538
            + +MKY IPFS SHGN  +   D  ++ ILPQPTAESKRV+I++RDGLI LW ++ESK I
Sbjct  165  LEQMKYTIPFSASHGNQTEVSADTTVLHILPQPTAESKRVVIVFRDGLITLWEIRESKCI  224

Query  539  FTTGGNALQSVNHEAXKATAACWACPNGTK  628
            FTTGG+ L S N+E  K T+ACWACP G+K
Sbjct  225  FTTGGSLLHSQNNETKKVTSACWACPVGSK  254



>ref|XP_011461610.1| PREDICTED: uncharacterized protein LOC101298930 isoform X2 [Fragaria 
vesca subsp. vesca]
Length=1032

 Score =   281 bits (718),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 125/210 (60%), Positives = 166/210 (79%), Gaps = 1/210 (0%)
 Frame = +2

Query  2    GVPPGALLLAYDSIQKILAISTKDGRIKVFGKDGAQALLESPNIVPSKFMQFMENQGFLI  181
            GVP G+  LAYDSIQKILA+STKDGRIK+ G+D  QALLES N +PSKF+QF+ENQG L+
Sbjct  35   GVPSGSNTLAYDSIQKILAVSTKDGRIKLLGRDNTQALLESVNALPSKFLQFVENQGILL  94

Query  182  KINVDNHIEVWNVDQKSLSNIHEFKRDITSFKIIQHTPYMYIGDSLGYVWVLKLEKEPCN  361
             +N  NHIEVW+++   L+++H F  +ITSF ++Q +  MY+GDS+G V VLKLE+E C+
Sbjct  95   NVNAKNHIEVWDLENNQLAHVHAFHENITSFALMQQSLCMYVGDSVGNVSVLKLEQESCH  154

Query  362  VVKMKYHIPFSESHGNSNK-DGDNAIVEILPQPTAESKRVLIIYRDGLIILWAVQESKTI  538
            +++MKY IP+S SHGN  +  GD A++ I+PQPT ES+RVL+++ DGLI LW ++ESK+I
Sbjct  155  ILQMKYTIPYSASHGNPTEVTGDTAVMCIMPQPTCESRRVLVVFLDGLIALWDIRESKSI  214

Query  539  FTTGGNALQSVNHEAXKATAACWACPNGTK  628
            FT G N LQS+ HE  K T+ACWACP+GTK
Sbjct  215  FTAGVNTLQSLQHETRKVTSACWACPSGTK  244



>ref|XP_004287725.1| PREDICTED: uncharacterized protein LOC101298930 isoform X1 [Fragaria 
vesca subsp. vesca]
Length=1034

 Score =   280 bits (717),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 125/210 (60%), Positives = 166/210 (79%), Gaps = 1/210 (0%)
 Frame = +2

Query  2    GVPPGALLLAYDSIQKILAISTKDGRIKVFGKDGAQALLESPNIVPSKFMQFMENQGFLI  181
            GVP G+  LAYDSIQKILA+STKDGRIK+ G+D  QALLES N +PSKF+QF+ENQG L+
Sbjct  35   GVPSGSNTLAYDSIQKILAVSTKDGRIKLLGRDNTQALLESVNALPSKFLQFVENQGILL  94

Query  182  KINVDNHIEVWNVDQKSLSNIHEFKRDITSFKIIQHTPYMYIGDSLGYVWVLKLEKEPCN  361
             +N  NHIEVW+++   L+++H F  +ITSF ++Q +  MY+GDS+G V VLKLE+E C+
Sbjct  95   NVNAKNHIEVWDLENNQLAHVHAFHENITSFALMQQSLCMYVGDSVGNVSVLKLEQESCH  154

Query  362  VVKMKYHIPFSESHGNSNK-DGDNAIVEILPQPTAESKRVLIIYRDGLIILWAVQESKTI  538
            +++MKY IP+S SHGN  +  GD A++ I+PQPT ES+RVL+++ DGLI LW ++ESK+I
Sbjct  155  ILQMKYTIPYSASHGNPTEVTGDTAVMCIMPQPTCESRRVLVVFLDGLIALWDIRESKSI  214

Query  539  FTTGGNALQSVNHEAXKATAACWACPNGTK  628
            FT G N LQS+ HE  K T+ACWACP+GTK
Sbjct  215  FTAGVNTLQSLQHETRKVTSACWACPSGTK  244



>ref|XP_010266195.1| PREDICTED: uncharacterized protein LOC104603774 isoform X3 [Nelumbo 
nucifera]
Length=1026

 Score =   280 bits (717),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 128/210 (61%), Positives = 163/210 (78%), Gaps = 1/210 (0%)
 Frame = +2

Query  2    GVPPGALLLAYDSIQKILAISTKDGRIKVFGKDGAQALLESPNIVPSKFMQFMENQGFLI  181
            G+P G++ LAYDSIQKILAISTKDGRIK+FGK   QALLES   VPSKF++F+ENQG L+
Sbjct  36   GIPAGSISLAYDSIQKILAISTKDGRIKLFGKSNTQALLESNEAVPSKFLKFIENQGILL  95

Query  182  KINVDNHIEVWNVDQKSLSNIHEFKRDITSFKIIQHTPYMYIGDSLGYVWVLKLEKEPCN  361
             + + N IEVW++ +K LS++H FK +ITS  +IQ T YMY+GDS G + VLKL++E C 
Sbjct  96   NVTIQNRIEVWDIRRKQLSHVHSFKEEITSLTVIQQTLYMYVGDSGGNISVLKLDQESCQ  155

Query  362  VVKMKYHIPFSESHGNSNK-DGDNAIVEILPQPTAESKRVLIIYRDGLIILWAVQESKTI  538
            +V+MKY+IPFS +HGN+ +   + A+V ILPQP AESKRVLII+RDGLI LW +QE K  
Sbjct  156  LVQMKYYIPFSATHGNNTEVASETAVVHILPQPMAESKRVLIIFRDGLITLWEIQECKVN  215

Query  539  FTTGGNALQSVNHEAXKATAACWACPNGTK  628
            F TGGN L S+ HE  + T+ACWACP G+K
Sbjct  216  FVTGGNILHSLRHETKQVTSACWACPFGSK  245



>ref|XP_010266194.1| PREDICTED: uncharacterized protein LOC104603774 isoform X2 [Nelumbo 
nucifera]
Length=1054

 Score =   280 bits (716),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 128/210 (61%), Positives = 163/210 (78%), Gaps = 1/210 (0%)
 Frame = +2

Query  2    GVPPGALLLAYDSIQKILAISTKDGRIKVFGKDGAQALLESPNIVPSKFMQFMENQGFLI  181
            G+P G++ LAYDSIQKILAISTKDGRIK+FGK   QALLES   VPSKF++F+ENQG L+
Sbjct  36   GIPAGSISLAYDSIQKILAISTKDGRIKLFGKSNTQALLESNEAVPSKFLKFIENQGILL  95

Query  182  KINVDNHIEVWNVDQKSLSNIHEFKRDITSFKIIQHTPYMYIGDSLGYVWVLKLEKEPCN  361
             + + N IEVW++ +K LS++H FK +ITS  +IQ T YMY+GDS G + VLKL++E C 
Sbjct  96   NVTIQNRIEVWDIRRKQLSHVHSFKEEITSLTVIQQTLYMYVGDSGGNISVLKLDQESCQ  155

Query  362  VVKMKYHIPFSESHGNSNK-DGDNAIVEILPQPTAESKRVLIIYRDGLIILWAVQESKTI  538
            +V+MKY+IPFS +HGN+ +   + A+V ILPQP AESKRVLII+RDGLI LW +QE K  
Sbjct  156  LVQMKYYIPFSATHGNNTEVASETAVVHILPQPMAESKRVLIIFRDGLITLWEIQECKVN  215

Query  539  FTTGGNALQSVNHEAXKATAACWACPNGTK  628
            F TGGN L S+ HE  + T+ACWACP G+K
Sbjct  216  FVTGGNILHSLRHETKQVTSACWACPFGSK  245



>ref|XP_010266193.1| PREDICTED: uncharacterized protein LOC104603774 isoform X1 [Nelumbo 
nucifera]
Length=1088

 Score =   280 bits (716),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 128/210 (61%), Positives = 163/210 (78%), Gaps = 1/210 (0%)
 Frame = +2

Query  2    GVPPGALLLAYDSIQKILAISTKDGRIKVFGKDGAQALLESPNIVPSKFMQFMENQGFLI  181
            G+P G++ LAYDSIQKILAISTKDGRIK+FGK   QALLES   VPSKF++F+ENQG L+
Sbjct  36   GIPAGSISLAYDSIQKILAISTKDGRIKLFGKSNTQALLESNEAVPSKFLKFIENQGILL  95

Query  182  KINVDNHIEVWNVDQKSLSNIHEFKRDITSFKIIQHTPYMYIGDSLGYVWVLKLEKEPCN  361
             + + N IEVW++ +K LS++H FK +ITS  +IQ T YMY+GDS G + VLKL++E C 
Sbjct  96   NVTIQNRIEVWDIRRKQLSHVHSFKEEITSLTVIQQTLYMYVGDSGGNISVLKLDQESCQ  155

Query  362  VVKMKYHIPFSESHGNSNK-DGDNAIVEILPQPTAESKRVLIIYRDGLIILWAVQESKTI  538
            +V+MKY+IPFS +HGN+ +   + A+V ILPQP AESKRVLII+RDGLI LW +QE K  
Sbjct  156  LVQMKYYIPFSATHGNNTEVASETAVVHILPQPMAESKRVLIIFRDGLITLWEIQECKVN  215

Query  539  FTTGGNALQSVNHEAXKATAACWACPNGTK  628
            F TGGN L S+ HE  + T+ACWACP G+K
Sbjct  216  FVTGGNILHSLRHETKQVTSACWACPFGSK  245



>ref|XP_007046505.1| Transducin/WD40 repeat-like superfamily protein isoform 3 [Theobroma 
cacao]
 gb|EOX90662.1| Transducin/WD40 repeat-like superfamily protein isoform 3 [Theobroma 
cacao]
Length=1016

 Score =   279 bits (713),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 125/210 (60%), Positives = 166/210 (79%), Gaps = 1/210 (0%)
 Frame = +2

Query  2    GVPPGALLLAYDSIQKILAISTKDGRIKVFGKDGAQALLESPNIVPSKFMQFMENQGFLI  181
            G+P G  +LAYDSIQKILAIST DGRIK+FG+D +QALLES ++VPSKFM+ M+NQG L+
Sbjct  35   GIPLGCCMLAYDSIQKILAISTMDGRIKLFGRDNSQALLESDDMVPSKFMEVMQNQGILV  94

Query  182  KINVDNHIEVWNVDQKSLSNIHEFKRDITSFKIIQHTPYMYIGDSLGYVWVLKLEKEPCN  361
             +N  N IEVW++D+K LS++H FK +ITSF ++Q  PYMY+GDS+G + VLK+++E C+
Sbjct  95   NVNYKNDIEVWDLDKKLLSHVHVFKEEITSFTVMQSGPYMYVGDSVGNIKVLKIDQELCH  154

Query  362  VVKMKYHIPFSESHGNSNK-DGDNAIVEILPQPTAESKRVLIIYRDGLIILWAVQESKTI  538
            VV+MKY IPFS SHGN  +   D A++ I+PQPTAESKR+LII++DG I LW ++ESK I
Sbjct  155  VVQMKYAIPFSASHGNPTEVASDRAVISIMPQPTAESKRILIIFKDGFITLWEIRESKAI  214

Query  539  FTTGGNALQSVNHEAXKATAACWACPNGTK  628
               GG+  QSV++EA   T+ACW CP G+K
Sbjct  215  LVAGGSMFQSVHNEAKHVTSACWVCPFGSK  244



>ref|XP_007046503.1| Transducin/WD40 repeat-like superfamily protein isoform 1 [Theobroma 
cacao]
 gb|EOX90660.1| Transducin/WD40 repeat-like superfamily protein isoform 1 [Theobroma 
cacao]
Length=1052

 Score =   279 bits (713),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 125/210 (60%), Positives = 166/210 (79%), Gaps = 1/210 (0%)
 Frame = +2

Query  2    GVPPGALLLAYDSIQKILAISTKDGRIKVFGKDGAQALLESPNIVPSKFMQFMENQGFLI  181
            G+P G  +LAYDSIQKILAIST DGRIK+FG+D +QALLES ++VPSKFM+ M+NQG L+
Sbjct  35   GIPLGCCMLAYDSIQKILAISTMDGRIKLFGRDNSQALLESDDMVPSKFMEVMQNQGILV  94

Query  182  KINVDNHIEVWNVDQKSLSNIHEFKRDITSFKIIQHTPYMYIGDSLGYVWVLKLEKEPCN  361
             +N  N IEVW++D+K LS++H FK +ITSF ++Q  PYMY+GDS+G + VLK+++E C+
Sbjct  95   NVNYKNDIEVWDLDKKLLSHVHVFKEEITSFTVMQSGPYMYVGDSVGNIKVLKIDQELCH  154

Query  362  VVKMKYHIPFSESHGNSNK-DGDNAIVEILPQPTAESKRVLIIYRDGLIILWAVQESKTI  538
            VV+MKY IPFS SHGN  +   D A++ I+PQPTAESKR+LII++DG I LW ++ESK I
Sbjct  155  VVQMKYAIPFSASHGNPTEVASDRAVISIMPQPTAESKRILIIFKDGFITLWEIRESKAI  214

Query  539  FTTGGNALQSVNHEAXKATAACWACPNGTK  628
               GG+  QSV++EA   T+ACW CP G+K
Sbjct  215  LVAGGSMFQSVHNEAKHVTSACWVCPFGSK  244



>ref|XP_009590622.1| PREDICTED: uncharacterized protein LOC104087766 isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009590623.1| PREDICTED: uncharacterized protein LOC104087766 isoform X1 [Nicotiana 
tomentosiformis]
Length=1054

 Score =   279 bits (713),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 129/210 (61%), Positives = 165/210 (79%), Gaps = 1/210 (0%)
 Frame = +2

Query  2    GVPPGALLLAYDSIQKILAISTKDGRIKVFGKDGAQALLESPNIVPSKFMQFMENQGFLI  181
            G+P G++L AYDSIQKI+A++TKDGRIK+FGKD  QALL S + V SK +QFMENQG LI
Sbjct  38   GIPSGSVLSAYDSIQKIVALATKDGRIKLFGKDSTQALLVSSDTVSSKLLQFMENQGLLI  97

Query  182  KINVDNHIEVWNVDQKSLSNIHEFKRDITSFKIIQHTPYMYIGDSLGYVWVLKLEKEPCN  361
             IN +N IEVW+V+Q+ L N+ +F R+ITSF I+Q T Y+++GDS G+V ++K+ K  CN
Sbjct  98   NINSNNRIEVWDVEQRYLCNVQDFDREITSFTILQQTSYLFLGDSSGHVSIMKVVKASCN  157

Query  362  VVKMKYHIPFSESHGNSNK-DGDNAIVEILPQPTAESKRVLIIYRDGLIILWAVQESKTI  538
            + KM+Y IPFS SHG SN+  GDNA+V ILPQP AESKRV I+Y+DG+IILWA++ESK I
Sbjct  158  IEKMEYCIPFSASHGLSNEVAGDNAVVHILPQPAAESKRVAIVYKDGVIILWAIRESKAI  217

Query  539  FTTGGNALQSVNHEAXKATAACWACPNGTK  628
            F TGG  L S+ +E  KAT ACW CP G+K
Sbjct  218  FITGGCPLHSMGNETKKATTACWCCPYGSK  247



>ref|XP_009590624.1| PREDICTED: uncharacterized protein LOC104087766 isoform X2 [Nicotiana 
tomentosiformis]
Length=1053

 Score =   279 bits (713),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 129/210 (61%), Positives = 165/210 (79%), Gaps = 1/210 (0%)
 Frame = +2

Query  2    GVPPGALLLAYDSIQKILAISTKDGRIKVFGKDGAQALLESPNIVPSKFMQFMENQGFLI  181
            G+P G++L AYDSIQKI+A++TKDGRIK+FGKD  QALL S + V SK +QFMENQG LI
Sbjct  38   GIPSGSVLSAYDSIQKIVALATKDGRIKLFGKDSTQALLVSSDTVSSKLLQFMENQGLLI  97

Query  182  KINVDNHIEVWNVDQKSLSNIHEFKRDITSFKIIQHTPYMYIGDSLGYVWVLKLEKEPCN  361
             IN +N IEVW+V+Q+ L N+ +F R+ITSF I+Q T Y+++GDS G+V ++K+ K  CN
Sbjct  98   NINSNNRIEVWDVEQRYLCNVQDFDREITSFTILQQTSYLFLGDSSGHVSIMKVVKASCN  157

Query  362  VVKMKYHIPFSESHGNSNK-DGDNAIVEILPQPTAESKRVLIIYRDGLIILWAVQESKTI  538
            + KM+Y IPFS SHG SN+  GDNA+V ILPQP AESKRV I+Y+DG+IILWA++ESK I
Sbjct  158  IEKMEYCIPFSASHGLSNEVAGDNAVVHILPQPAAESKRVAIVYKDGVIILWAIRESKAI  217

Query  539  FTTGGNALQSVNHEAXKATAACWACPNGTK  628
            F TGG  L S+ +E  KAT ACW CP G+K
Sbjct  218  FITGGCPLHSMGNETKKATTACWCCPYGSK  247



>ref|XP_007046506.1| Transducin/WD40 repeat-like superfamily protein isoform 4 [Theobroma 
cacao]
 gb|EOX90663.1| Transducin/WD40 repeat-like superfamily protein isoform 4 [Theobroma 
cacao]
Length=1011

 Score =   278 bits (711),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 125/210 (60%), Positives = 166/210 (79%), Gaps = 1/210 (0%)
 Frame = +2

Query  2    GVPPGALLLAYDSIQKILAISTKDGRIKVFGKDGAQALLESPNIVPSKFMQFMENQGFLI  181
            G+P G  +LAYDSIQKILAIST DGRIK+FG+D +QALLES ++VPSKFM+ M+NQG L+
Sbjct  35   GIPLGCCMLAYDSIQKILAISTMDGRIKLFGRDNSQALLESDDMVPSKFMEVMQNQGILV  94

Query  182  KINVDNHIEVWNVDQKSLSNIHEFKRDITSFKIIQHTPYMYIGDSLGYVWVLKLEKEPCN  361
             +N  N IEVW++D+K LS++H FK +ITSF ++Q  PYMY+GDS+G + VLK+++E C+
Sbjct  95   NVNYKNDIEVWDLDKKLLSHVHVFKEEITSFTVMQSGPYMYVGDSVGNIKVLKIDQELCH  154

Query  362  VVKMKYHIPFSESHGNSNK-DGDNAIVEILPQPTAESKRVLIIYRDGLIILWAVQESKTI  538
            VV+MKY IPFS SHGN  +   D A++ I+PQPTAESKR+LII++DG I LW ++ESK I
Sbjct  155  VVQMKYAIPFSASHGNPTEVASDRAVISIMPQPTAESKRILIIFKDGFITLWEIRESKAI  214

Query  539  FTTGGNALQSVNHEAXKATAACWACPNGTK  628
               GG+  QSV++EA   T+ACW CP G+K
Sbjct  215  LVAGGSMFQSVHNEAKHVTSACWVCPFGSK  244



>ref|XP_007046504.1| Transducin/WD40 repeat-like superfamily protein isoform 2 [Theobroma 
cacao]
 gb|EOX90661.1| Transducin/WD40 repeat-like superfamily protein isoform 2 [Theobroma 
cacao]
Length=1026

 Score =   278 bits (711),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 125/210 (60%), Positives = 166/210 (79%), Gaps = 1/210 (0%)
 Frame = +2

Query  2    GVPPGALLLAYDSIQKILAISTKDGRIKVFGKDGAQALLESPNIVPSKFMQFMENQGFLI  181
            G+P G  +LAYDSIQKILAIST DGRIK+FG+D +QALLES ++VPSKFM+ M+NQG L+
Sbjct  35   GIPLGCCMLAYDSIQKILAISTMDGRIKLFGRDNSQALLESDDMVPSKFMEVMQNQGILV  94

Query  182  KINVDNHIEVWNVDQKSLSNIHEFKRDITSFKIIQHTPYMYIGDSLGYVWVLKLEKEPCN  361
             +N  N IEVW++D+K LS++H FK +ITSF ++Q  PYMY+GDS+G + VLK+++E C+
Sbjct  95   NVNYKNDIEVWDLDKKLLSHVHVFKEEITSFTVMQSGPYMYVGDSVGNIKVLKIDQELCH  154

Query  362  VVKMKYHIPFSESHGNSNK-DGDNAIVEILPQPTAESKRVLIIYRDGLIILWAVQESKTI  538
            VV+MKY IPFS SHGN  +   D A++ I+PQPTAESKR+LII++DG I LW ++ESK I
Sbjct  155  VVQMKYAIPFSASHGNPTEVASDRAVISIMPQPTAESKRILIIFKDGFITLWEIRESKAI  214

Query  539  FTTGGNALQSVNHEAXKATAACWACPNGTK  628
               GG+  QSV++EA   T+ACW CP G+K
Sbjct  215  LVAGGSMFQSVHNEAKHVTSACWVCPFGSK  244



>ref|XP_011022177.1| PREDICTED: uncharacterized protein LOC105124039 isoform X2 [Populus 
euphratica]
Length=972

 Score =   275 bits (703),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 127/210 (60%), Positives = 161/210 (77%), Gaps = 1/210 (0%)
 Frame = +2

Query  2    GVPPGALLLAYDSIQKILAISTKDGRIKVFGKDGAQALLESPNIVPSKFMQFMENQGFLI  181
            G+P GA   AYD+IQKILAIST+DGRIK+FG+D  QALLESP  VPSKF+QF++N+G L+
Sbjct  36   GIPHGATKFAYDTIQKILAISTQDGRIKLFGRDNTQALLESPEAVPSKFLQFIQNKGILV  95

Query  182  KINVDNHIEVWNVDQKSLSNIHEFKRDITSFKIIQHTPYMYIGDSLGYVWVLKLEKEPCN  361
             +   N IEVW++D K LSN+H FK DITSF ++Q   Y+Y+GD LG V VLKL++E C+
Sbjct  96   NVTSKNQIEVWDLDSKVLSNVHVFKEDITSFTVMQSNLYIYVGDYLGNVVVLKLDQESCH  155

Query  362  VVKMKYHIPFSESHGN-SNKDGDNAIVEILPQPTAESKRVLIIYRDGLIILWAVQESKTI  538
               MKY IP S SHG+ +   GD A++  LPQP AESKRVLI++RDGL+ LW ++ESK+I
Sbjct  156  FELMKYTIPLSASHGSPAEVSGDTAVLHTLPQPAAESKRVLIVFRDGLLALWDIRESKSI  215

Query  539  FTTGGNALQSVNHEAXKATAACWACPNGTK  628
            FTTGG  LQS +HE  K T+ACWACP G+K
Sbjct  216  FTTGGGLLQSQHHEMKKVTSACWACPFGSK  245



>ref|XP_011022179.1| PREDICTED: uncharacterized protein LOC105124039 isoform X3 [Populus 
euphratica]
Length=1049

 Score =   276 bits (705),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 127/210 (60%), Positives = 161/210 (77%), Gaps = 1/210 (0%)
 Frame = +2

Query  2    GVPPGALLLAYDSIQKILAISTKDGRIKVFGKDGAQALLESPNIVPSKFMQFMENQGFLI  181
            G+P GA   AYD+IQKILAIST+DGRIK+FG+D  QALLESP  VPSKF+QF++N+G L+
Sbjct  36   GIPHGATKFAYDTIQKILAISTQDGRIKLFGRDNTQALLESPEAVPSKFLQFIQNKGILV  95

Query  182  KINVDNHIEVWNVDQKSLSNIHEFKRDITSFKIIQHTPYMYIGDSLGYVWVLKLEKEPCN  361
             +   N IEVW++D K LSN+H FK DITSF ++Q   Y+Y+GD LG V VLKL++E C+
Sbjct  96   NVTSKNQIEVWDLDSKVLSNVHVFKEDITSFTVMQSNLYIYVGDYLGNVVVLKLDQESCH  155

Query  362  VVKMKYHIPFSESHGN-SNKDGDNAIVEILPQPTAESKRVLIIYRDGLIILWAVQESKTI  538
               MKY IP S SHG+ +   GD A++  LPQP AESKRVLI++RDGL+ LW ++ESK+I
Sbjct  156  FELMKYTIPLSASHGSPAEVSGDTAVLHTLPQPAAESKRVLIVFRDGLLALWDIRESKSI  215

Query  539  FTTGGNALQSVNHEAXKATAACWACPNGTK  628
            FTTGG  LQS +HE  K T+ACWACP G+K
Sbjct  216  FTTGGGLLQSQHHEMKKVTSACWACPFGSK  245



>ref|XP_011022176.1| PREDICTED: uncharacterized protein LOC105124039 isoform X1 [Populus 
euphratica]
Length=1049

 Score =   276 bits (705),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 127/210 (60%), Positives = 161/210 (77%), Gaps = 1/210 (0%)
 Frame = +2

Query  2    GVPPGALLLAYDSIQKILAISTKDGRIKVFGKDGAQALLESPNIVPSKFMQFMENQGFLI  181
            G+P GA   AYD+IQKILAIST+DGRIK+FG+D  QALLESP  VPSKF+QF++N+G L+
Sbjct  36   GIPHGATKFAYDTIQKILAISTQDGRIKLFGRDNTQALLESPEAVPSKFLQFIQNKGILV  95

Query  182  KINVDNHIEVWNVDQKSLSNIHEFKRDITSFKIIQHTPYMYIGDSLGYVWVLKLEKEPCN  361
             +   N IEVW++D K LSN+H FK DITSF ++Q   Y+Y+GD LG V VLKL++E C+
Sbjct  96   NVTSKNQIEVWDLDSKVLSNVHVFKEDITSFTVMQSNLYIYVGDYLGNVVVLKLDQESCH  155

Query  362  VVKMKYHIPFSESHGN-SNKDGDNAIVEILPQPTAESKRVLIIYRDGLIILWAVQESKTI  538
               MKY IP S SHG+ +   GD A++  LPQP AESKRVLI++RDGL+ LW ++ESK+I
Sbjct  156  FELMKYTIPLSASHGSPAEVSGDTAVLHTLPQPAAESKRVLIVFRDGLLALWDIRESKSI  215

Query  539  FTTGGNALQSVNHEAXKATAACWACPNGTK  628
            FTTGG  LQS +HE  K T+ACWACP G+K
Sbjct  216  FTTGGGLLQSQHHEMKKVTSACWACPFGSK  245



>gb|EYU30835.1| hypothetical protein MIMGU_mgv1a000647mg [Erythranthe guttata]
Length=1032

 Score =   275 bits (702),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 132/211 (63%), Positives = 165/211 (78%), Gaps = 2/211 (1%)
 Frame = +2

Query  2    GVPPGALLLAYDSIQKILAISTKDGRIKVFGKDGAQALLESPNIVPSKFMQFMENQGFLI  181
            G+P G++LLAYDSIQ+ILAISTKDG+IK+FGKDG+QALLES   +PSKF+ F+ENQG L+
Sbjct  37   GIPSGSILLAYDSIQQILAISTKDGQIKLFGKDGSQALLESSETIPSKFLLFIENQGILL  96

Query  182  KINVDNHIEVWNVDQKSLSNIHEFKRDITSFKIIQHTPYMYIGDSLGYVWVLKLEKEPCN  361
             +NV NHIEVW++D+K LS IH F+R+I SF  I+  PYMYIGDS G V VL+L ++ C 
Sbjct  97   NVNVKNHIEVWDLDRKFLSAIHHFEREIISFAAIRTGPYMYIGDSGGDVSVLRLHQDQCR  156

Query  362  VVKMKYHIPFSESHGNSNKDG-DNAIVEILPQPTAESKRVLIIYRDGLIILWAVQESKTI  538
            +  MKY IPFS SHG  N+ G D A   ILPQPTAE+KRVLI+Y DG+I LW+++ESK I
Sbjct  157  IELMKYRIPFSASHGKINEVGSDIAAKVILPQPTAETKRVLIMYSDGVITLWSIEESKVI  216

Query  539  FT-TGGNALQSVNHEAXKATAACWACPNGTK  628
             T + G  LQS+  EA K T+ACWACP+GTK
Sbjct  217  CTNSSGTTLQSMYQEAKKVTSACWACPDGTK  247



>ref|XP_012065395.1| PREDICTED: uncharacterized protein LOC105628567 [Jatropha curcas]
Length=1059

 Score =   275 bits (702),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 124/210 (59%), Positives = 164/210 (78%), Gaps = 1/210 (0%)
 Frame = +2

Query  2    GVPPGALLLAYDSIQKILAISTKDGRIKVFGKDGAQALLESPNIVPSKFMQFMENQGFLI  181
            G+P GA +LAYDSIQKILAIST+DGRIK+FGKD  Q LLE P   PSKF+QF++N+G L+
Sbjct  37   GIPSGANMLAYDSIQKILAISTRDGRIKLFGKDNTQVLLECPEAEPSKFLQFIQNKGILL  96

Query  182  KINVDNHIEVWNVDQKSLSNIHEFKRDITSFKIIQHTPYMYIGDSLGYVWVLKLEKEPCN  361
             I   NHIEVW+V++K LS++H FK DITSF ++Q   YMY+GD +G + +LKL++E C 
Sbjct  97   NITSKNHIEVWDVEKKLLSHVHVFKGDITSFTVMQRCLYMYVGDHVGNISILKLDEETCR  156

Query  362  VVKMKYHIPFSESHGNS-NKDGDNAIVEILPQPTAESKRVLIIYRDGLIILWAVQESKTI  538
            +++MKY IP S SHGNS     D A++ I+PQP AESKRVLI++RDGLI LW ++ES++I
Sbjct  157  ILQMKYTIPLSASHGNSIEASADAAVLHIIPQPMAESKRVLIVFRDGLITLWDIRESRSI  216

Query  539  FTTGGNALQSVNHEAXKATAACWACPNGTK  628
            FTTGG+ L S +++  K T+ACWACP G+K
Sbjct  217  FTTGGSLLHSQHNDTKKVTSACWACPFGSK  246



>gb|KJB17500.1| hypothetical protein B456_003G002400 [Gossypium raimondii]
Length=1040

 Score =   274 bits (700),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 121/210 (58%), Positives = 165/210 (79%), Gaps = 1/210 (0%)
 Frame = +2

Query  2    GVPPGALLLAYDSIQKILAISTKDGRIKVFGKDGAQALLESPNIVPSKFMQFMENQGFLI  181
            G+P G  + AYDSIQKILAIST DGRIK+FGKD +QALLES + VPSKF++F++NQG L+
Sbjct  40   GIPLGCCMFAYDSIQKILAISTTDGRIKLFGKDNSQALLESDDTVPSKFLEFVQNQGILL  99

Query  182  KINVDNHIEVWNVDQKSLSNIHEFKRDITSFKIIQHTPYMYIGDSLGYVWVLKLEKEPCN  361
             +N+ NHIEVW+++++ LS++H FK +ITSF ++Q  PYMY+GDS G + V K+E+E C+
Sbjct  100  NVNLKNHIEVWDLERRLLSHVHVFKEEITSFTVMQAGPYMYVGDSEGNIKVFKIEQEVCH  159

Query  362  VVKMKYHIPFSESHGNSNKD-GDNAIVEILPQPTAESKRVLIIYRDGLIILWAVQESKTI  538
            V++MKY IPFS SHGN  +   D A++ ILPQPT ESKR+LII++DG + LW ++E K+I
Sbjct  160  VMQMKYTIPFSASHGNPTEVLADRAVISILPQPTGESKRILIIFKDGFMTLWEIRECKSI  219

Query  539  FTTGGNALQSVNHEAXKATAACWACPNGTK  628
              TGG+  QSV++EA   T+ACW CP G+K
Sbjct  220  LVTGGSMFQSVHNEAKHVTSACWVCPFGSK  249



>gb|KEH20352.1| transducin/WD40 repeat protein [Medicago truncatula]
Length=1054

 Score =   272 bits (696),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 123/209 (59%), Positives = 165/209 (79%), Gaps = 0/209 (0%)
 Frame = +2

Query  2    GVPPGALLLAYDSIQKILAISTKDGRIKVFGKDGAQALLESPNIVPSKFMQFMENQGFLI  181
            G+P G    AYDSIQKILA+STKDGRIK++GKD AQALL+S   +PSKF+QF++NQG L+
Sbjct  37   GIPSGGAKFAYDSIQKILALSTKDGRIKLYGKDNAQALLDSSEPLPSKFLQFIQNQGILL  96

Query  182  KINVDNHIEVWNVDQKSLSNIHEFKRDITSFKIIQHTPYMYIGDSLGYVWVLKLEKEPCN  361
             +  +NHIEVW++++K LS+++  K +IT F +IQH+ YMYIG S G + VLKLE++P +
Sbjct  97   NVTSNNHIEVWDIEKKILSDVYVAKEEITCFAVIQHSLYMYIGHSNGNISVLKLEQDPWH  156

Query  362  VVKMKYHIPFSESHGNSNKDGDNAIVEILPQPTAESKRVLIIYRDGLIILWAVQESKTIF  541
            +V+MKY IPFS S+GNS    D  ++ ILPQP AESKRVL+I+R+G IILW +QES+T+F
Sbjct  157  IVRMKYTIPFSASYGNSEVSDDTTVMHILPQPAAESKRVLVIFRNGQIILWDIQESRTVF  216

Query  542  TTGGNALQSVNHEAXKATAACWACPNGTK  628
             TGGN  QS+++E  K T+ACWACP G+K
Sbjct  217  RTGGNMSQSLHNETKKVTSACWACPFGSK  245



>emb|CBI37643.3| unnamed protein product [Vitis vinifera]
Length=1054

 Score =   272 bits (695),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 129/229 (56%), Positives = 168/229 (73%), Gaps = 20/229 (9%)
 Frame = +2

Query  2    GVPPGALLLAYDSIQKILAISTKDGRIKVFGKDGAQALLESPNIVPSKFMQFMENQGFLI  181
            G+P G++L AYDSIQKILAI+T+DGRIK+FGKD  QALLES   VPSKF+QF+ENQG L+
Sbjct  35   GIPGGSILFAYDSIQKILAIATRDGRIKLFGKDNTQALLESNETVPSKFLQFIENQGILL  94

Query  182  KINVDNHIE-------------------VWNVDQKSLSNIHEFKRDITSFKIIQHTPYMY  304
             +  +NHIE                   VW++D+K LS++H FK +ITSF ++Q + +MY
Sbjct  95   NVTAENHIEANYMSRVLIGNYQDTDNGNVWDIDKKLLSHVHVFKEEITSFMVMQRSFFMY  154

Query  305  IGDSLGYVWVLKLEKEPCNVVKMKYHIPFSESHGNSNK-DGDNAIVEILPQPTAESKRVL  481
            +GDS G + VLKLE+EPC++V+MKY IP + SHGN  +  G  A++ ILPQPTAESKRVL
Sbjct  155  LGDSSGNISVLKLEQEPCHMVQMKYTIPSTASHGNPTEVAGGTAVMHILPQPTAESKRVL  214

Query  482  IIYRDGLIILWAVQESKTIFTTGGNALQSVNHEAXKATAACWACPNGTK  628
            II+RDGLI+LW ++ESK IF TG N LQ ++H+    T+ACWACP G K
Sbjct  215  IIFRDGLIVLWDIRESKVIFKTGVNMLQPLSHDTKTVTSACWACPFGGK  263



>ref|XP_008448470.1| PREDICTED: uncharacterized protein LOC103490647 isoform X1 [Cucumis 
melo]
Length=1053

 Score =   270 bits (691),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 122/210 (58%), Positives = 165/210 (79%), Gaps = 1/210 (0%)
 Frame = +2

Query  2    GVPPGALLLAYDSIQKILAISTKDGRIKVFGKDGAQALLESPNIVPSKFMQFMENQGFLI  181
            G+P G+ + AYDSIQKILA+ST+DGRIK+FGKD +QALLES   +PSKF+QFMENQGFL+
Sbjct  35   GIPSGSTISAYDSIQKILALSTRDGRIKLFGKDNSQALLESKEAIPSKFLQFMENQGFLL  94

Query  182  KINVDNHIEVWNVDQKSLSNIHEFKRDITSFKIIQHTPYMYIGDSLGYVWVLKLEKEPCN  361
             +   N IE+W++D+K ++++H F+++ITSF I+Q TPY+Y+GD LG V VLKL++  CN
Sbjct  95   NVTSKNEIEIWDIDRKLVAHVHVFEQEITSFTILQQTPYIYVGDYLGNVSVLKLDQSVCN  154

Query  362  VVKMKYHIPFSESHGN-SNKDGDNAIVEILPQPTAESKRVLIIYRDGLIILWAVQESKTI  538
            +++MKY IP S S GN +    D ++  ILPQPT+E KRVL+I+ DGLI LW ++ESK+I
Sbjct  155  IIQMKYIIPVSASRGNPAEATSDISLTHILPQPTSEFKRVLLIFSDGLIALWDIKESKSI  214

Query  539  FTTGGNALQSVNHEAXKATAACWACPNGTK  628
            F TGGN++ S   EA K T+ACWACP G+K
Sbjct  215  FITGGNSMLSPYQEAKKVTSACWACPLGSK  244



>ref|XP_011650254.1| PREDICTED: uncharacterized protein LOC101213055 isoform X1 [Cucumis 
sativus]
 gb|KGN55610.1| hypothetical protein Csa_3G002310 [Cucumis sativus]
Length=1053

 Score =   269 bits (687),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 122/210 (58%), Positives = 162/210 (77%), Gaps = 1/210 (0%)
 Frame = +2

Query  2    GVPPGALLLAYDSIQKILAISTKDGRIKVFGKDGAQALLESPNIVPSKFMQFMENQGFLI  181
            G+P G++  AYD IQKILA+ST+DGRIK+FGKD +QALLES   +PSKF+QFMENQGFL+
Sbjct  35   GIPSGSITSAYDPIQKILALSTRDGRIKLFGKDNSQALLESKEAIPSKFLQFMENQGFLL  94

Query  182  KINVDNHIEVWNVDQKSLSNIHEFKRDITSFKIIQHTPYMYIGDSLGYVWVLKLEKEPCN  361
             +   N IEVW++D+K L+++H F+++ITSF I+Q TPY+Y+GD LG V VLKL++  CN
Sbjct  95   NVTSKNEIEVWDIDRKLLAHVHVFEQEITSFTILQQTPYIYVGDYLGNVSVLKLDQSVCN  154

Query  362  VVKMKYHIPFSESHGN-SNKDGDNAIVEILPQPTAESKRVLIIYRDGLIILWAVQESKTI  538
            +++MKY IP S S GN +    D ++  ILPQPT E KRVL+I+ DG I LW ++ESK+I
Sbjct  155  IIQMKYIIPVSASRGNPAEATSDISLTHILPQPTTEFKRVLLIFSDGFITLWEIKESKSI  214

Query  539  FTTGGNALQSVNHEAXKATAACWACPNGTK  628
            F TGGN++ S   EA K T+ACWACP G+K
Sbjct  215  FITGGNSMLSPYQEAKKVTSACWACPLGSK  244



>ref|XP_002307215.2| hypothetical protein POPTR_0005s10460g, partial [Populus trichocarpa]
 gb|EEE94211.2| hypothetical protein POPTR_0005s10460g, partial [Populus trichocarpa]
Length=1041

 Score =   266 bits (681),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 126/216 (58%), Positives = 160/216 (74%), Gaps = 7/216 (3%)
 Frame = +2

Query  2    GVPPGALLLAYDSIQKILAISTKDGRIKVFGKDGAQALLESPNIVPSKFMQFMENQGFLI  181
            G+P GA   AYD+IQKILAIST+DGRIK+FG+D  QALLESP  VPSKF+QF++N+G L+
Sbjct  22   GIPHGATKFAYDTIQKILAISTQDGRIKLFGRDNTQALLESPEAVPSKFLQFIQNKGILV  81

Query  182  KINVDNHIE------VWNVDQKSLSNIHEFKRDITSFKIIQHTPYMYIGDSLGYVWVLKL  343
             +   N IE      VW++D K LSN+H FK DITSF ++Q   Y+Y+GD LG V VLKL
Sbjct  82   NVTSKNQIEASNPIRVWDLDSKVLSNVHVFKEDITSFTVMQSNLYIYVGDYLGNVKVLKL  141

Query  344  EKEPCNVVKMKYHIPFSESHGN-SNKDGDNAIVEILPQPTAESKRVLIIYRDGLIILWAV  520
            ++E C+   MKY IP S SHG+ +   GD A++  LPQP AESKRVLI++RDGL+ LW +
Sbjct  142  DQESCHFELMKYTIPLSASHGSPAEVSGDTAVLHTLPQPAAESKRVLIVFRDGLLALWDI  201

Query  521  QESKTIFTTGGNALQSVNHEAXKATAACWACPNGTK  628
            +ESK+IFTTGG  LQS +HE  K T+ACWACP  +K
Sbjct  202  RESKSIFTTGGGLLQSQHHEMKKVTSACWACPFASK  237



>ref|XP_011099901.1| PREDICTED: uncharacterized protein LOC105178189 isoform X2 [Sesamum 
indicum]
Length=1040

 Score =   265 bits (678),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 124/211 (59%), Positives = 167/211 (79%), Gaps = 2/211 (1%)
 Frame = +2

Query  2    GVPPGALLLAYDSIQKILAISTKDGRIKVFGKDGAQALLESPNIVPSKFMQFMENQGFLI  181
            G+P G+ LLAYDSIQ+ILAIST DG+IK+FGKDG+QALLES   V SKF+ F+ENQG L+
Sbjct  25   GIPSGSKLLAYDSIQQILAISTMDGQIKLFGKDGSQALLESVETVASKFLLFIENQGVLL  84

Query  182  KINVDNHIEVWNVDQKSLSNIHEFKRDITSFKIIQHTPYMYIGDSLGYVWVLKLEKEPCN  361
             +NV+NHIE+W++D+K LS +H F++DITSF  +++  Y+Y+GDS G + +L+L ++  +
Sbjct  85   NVNVNNHIEIWDIDRKCLSAVHHFEKDITSFAAMRNGSYLYVGDSAGDILILRLHQDQRH  144

Query  362  VVKMKYHIPFSESHGNSNKDG-DNAIVEILPQPTAESKRVLIIYRDGLIILWAVQESKTI  538
            +  M Y IP S S+G +++ G D A+  ILPQPTAE+KRVLIIY +G+I LWA++ESKTI
Sbjct  145  IELMNYSIPLSASYGKTDEVGSDTAVQYILPQPTAETKRVLIIYSNGVITLWAIRESKTI  204

Query  539  F-TTGGNALQSVNHEAXKATAACWACPNGTK  628
            F +TGG  LQS++ EA K TAACWACP GTK
Sbjct  205  FASTGGTTLQSMHQEAKKVTAACWACPAGTK  235



>ref|XP_011099900.1| PREDICTED: uncharacterized protein LOC105178189 isoform X1 [Sesamum 
indicum]
Length=1053

 Score =   265 bits (678),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 124/211 (59%), Positives = 167/211 (79%), Gaps = 2/211 (1%)
 Frame = +2

Query  2    GVPPGALLLAYDSIQKILAISTKDGRIKVFGKDGAQALLESPNIVPSKFMQFMENQGFLI  181
            G+P G+ LLAYDSIQ+ILAIST DG+IK+FGKDG+QALLES   V SKF+ F+ENQG L+
Sbjct  38   GIPSGSKLLAYDSIQQILAISTMDGQIKLFGKDGSQALLESVETVASKFLLFIENQGVLL  97

Query  182  KINVDNHIEVWNVDQKSLSNIHEFKRDITSFKIIQHTPYMYIGDSLGYVWVLKLEKEPCN  361
             +NV+NHIE+W++D+K LS +H F++DITSF  +++  Y+Y+GDS G + +L+L ++  +
Sbjct  98   NVNVNNHIEIWDIDRKCLSAVHHFEKDITSFAAMRNGSYLYVGDSAGDILILRLHQDQRH  157

Query  362  VVKMKYHIPFSESHGNSNKDG-DNAIVEILPQPTAESKRVLIIYRDGLIILWAVQESKTI  538
            +  M Y IP S S+G +++ G D A+  ILPQPTAE+KRVLIIY +G+I LWA++ESKTI
Sbjct  158  IELMNYSIPLSASYGKTDEVGSDTAVQYILPQPTAETKRVLIIYSNGVITLWAIRESKTI  217

Query  539  F-TTGGNALQSVNHEAXKATAACWACPNGTK  628
            F +TGG  LQS++ EA K TAACWACP GTK
Sbjct  218  FASTGGTTLQSMHQEAKKVTAACWACPAGTK  248



>ref|XP_007158006.1| hypothetical protein PHAVU_002G116600g [Phaseolus vulgaris]
 gb|ESW30000.1| hypothetical protein PHAVU_002G116600g [Phaseolus vulgaris]
Length=332

 Score =   249 bits (635),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 116/210 (55%), Positives = 158/210 (75%), Gaps = 1/210 (0%)
 Frame = +2

Query  2    GVPPGALLLAYDSIQKILAISTKDGRIKVFGKDGAQALLESPNIVPSKFMQFMENQGFLI  181
            GVP G    AYD+IQKILA+STKDGRIK+FGKD AQ LLES   VPSKF+QF++NQG LI
Sbjct  37   GVPSGGTKFAYDNIQKILALSTKDGRIKLFGKDNAQVLLESREAVPSKFLQFIQNQGILI  96

Query  182  KINVDNHIEVWNVDQKSLSNIHEFKRDITSFKIIQHTPYMYIGDSLGYVWVLKLEKEPCN  361
             ++ +NHIEVW++D+K L ++   K +IT F ++QH+ +MYIG S G + VL L++EP +
Sbjct  97   NVSFNNHIEVWDIDKKLLIDVFIVKEEITCFSVLQHSLFMYIGFSNGNIAVLSLDQEPWH  156

Query  362  VVKMKYHIPFSESHGNSNKDGDNAIV-EILPQPTAESKRVLIIYRDGLIILWAVQESKTI  538
            +V+MKY IP   S+GNS ++ D+ +V  +LPQP AES+RVLII+++G IILW +QES++I
Sbjct  157  LVRMKYSIPLLASYGNSTEESDDTVVTHVLPQPAAESQRVLIIFKNGQIILWDIQESRSI  216

Query  539  FTTGGNALQSVNHEAXKATAACWACPNGTK  628
            F TGG  L    +E  K ++ACW CP G+K
Sbjct  217  FRTGGRMLHVQYNETKKVSSACWVCPFGSK  246



>ref|XP_006425282.1| hypothetical protein CICLE_v10024783mg [Citrus clementina]
 gb|ESR38522.1| hypothetical protein CICLE_v10024783mg [Citrus clementina]
Length=1041

 Score =   261 bits (666),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 122/209 (58%), Positives = 157/209 (75%), Gaps = 1/209 (0%)
 Frame = +2

Query  2    GVPPGALLLAYDSIQKILAISTKDGRIKVFGKDGAQALLESPNIVPSKFMQFMENQGFLI  181
            G P G    AYD +QKILA +TKDGRIK++G+   QALLES   V +KF+QF+ENQG L+
Sbjct  36   GFPSGCNKFAYDPLQKILAAATKDGRIKLYGRHNTQALLESSEAVSTKFLQFLENQGILL  95

Query  182  KINVDNHIEVWNVDQKSLSNIHEFKRDITSFKIIQHTPYMYIGDSLGYVWVLKLEKEPCN  361
             +   N IEVW++D+K LS++H  K +ITSF I+QH+ YM +GD+ G + VLKL++E   
Sbjct  96   NVTSMNLIEVWDIDKKRLSHVHVCKEEITSFTIMQHSNYMLLGDTAGKISVLKLDQESSQ  155

Query  362  VVKMKYHIPFSESHGNSNKDGDNAIVEILPQPTAESKRVLIIYRDGLIILWAVQESKTIF  541
            +VKMKY IP S SHGN    GD A++ ILPQPTAESKR+LII+RDGLI LW ++ESK+IF
Sbjct  156  IVKMKYIIPLSASHGN-EVSGDPAVINILPQPTAESKRILIIFRDGLISLWDIRESKSIF  214

Query  542  TTGGNALQSVNHEAXKATAACWACPNGTK  628
            + GGN LQSV HE  + T+ACWACP G+K
Sbjct  215  SMGGNVLQSVYHETKQVTSACWACPVGSK  243



>ref|XP_006467080.1| PREDICTED: uncharacterized protein LOC102630995 [Citrus sinensis]
Length=1042

 Score =   258 bits (658),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 122/210 (58%), Positives = 158/210 (75%), Gaps = 2/210 (1%)
 Frame = +2

Query  2    GVPPGALLLAYDSIQKILAISTKDGRIKVFGK-DGAQALLESPNIVPSKFMQFMENQGFL  178
            G P G    AYD +QKILA +TKDGRIK++G+ +  QALLES   V +KF+QF+ENQG L
Sbjct  36   GFPSGCNKFAYDPLQKILAAATKDGRIKLYGRHNNTQALLESSEAVSTKFLQFLENQGIL  95

Query  179  IKINVDNHIEVWNVDQKSLSNIHEFKRDITSFKIIQHTPYMYIGDSLGYVWVLKLEKEPC  358
            + +   N IEVW++D+K LS++H  K +ITSF I+QH+ YM +GD+ G + VLKL++E  
Sbjct  96   LNVTSTNLIEVWDIDKKRLSHVHVCKEEITSFTIMQHSNYMLLGDTAGKISVLKLDQESS  155

Query  359  NVVKMKYHIPFSESHGNSNKDGDNAIVEILPQPTAESKRVLIIYRDGLIILWAVQESKTI  538
             +VKMKY IP S SHGN    GD A++ ILPQPTAESKR+LII+RDGLI LW ++ESK+I
Sbjct  156  QIVKMKYIIPLSASHGN-EVSGDPAVINILPQPTAESKRILIIFRDGLISLWDIRESKSI  214

Query  539  FTTGGNALQSVNHEAXKATAACWACPNGTK  628
            F+ GGN LQSV HE  + T+ACWACP G+K
Sbjct  215  FSMGGNVLQSVYHETKQVTSACWACPVGSK  244



>gb|KDO71481.1| hypothetical protein CISIN_1g001628mg [Citrus sinensis]
Length=1042

 Score =   257 bits (657),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 122/210 (58%), Positives = 158/210 (75%), Gaps = 2/210 (1%)
 Frame = +2

Query  2    GVPPGALLLAYDSIQKILAISTKDGRIKVFGK-DGAQALLESPNIVPSKFMQFMENQGFL  178
            G P G    AYD +QKILA +TKDGRIK++G+ +  QALLES   V +KF+QF+ENQG L
Sbjct  36   GFPSGCNKFAYDPLQKILAAATKDGRIKLYGRHNNTQALLESSEAVSTKFLQFLENQGIL  95

Query  179  IKINVDNHIEVWNVDQKSLSNIHEFKRDITSFKIIQHTPYMYIGDSLGYVWVLKLEKEPC  358
            + +   N IEVW++D+K LS++H  K +ITSF I+QH+ YM +GD+ G + VLKL++E  
Sbjct  96   LNVTSTNLIEVWDIDKKRLSHVHVCKEEITSFTIMQHSNYMLLGDTAGKISVLKLDQESS  155

Query  359  NVVKMKYHIPFSESHGNSNKDGDNAIVEILPQPTAESKRVLIIYRDGLIILWAVQESKTI  538
             +VKMKY IP S SHGN    GD A++ ILPQPTAESKR+LII+RDGLI LW ++ESK+I
Sbjct  156  QIVKMKYIIPLSASHGN-EVSGDPAVINILPQPTAESKRILIIFRDGLISLWDIRESKSI  214

Query  539  FTTGGNALQSVNHEAXKATAACWACPNGTK  628
            F+ GGN LQSV HE  + T+ACWACP G+K
Sbjct  215  FSMGGNVLQSVYHETKQVTSACWACPIGSK  244



>ref|XP_010033584.1| PREDICTED: uncharacterized protein LOC104422838 isoform X1 [Eucalyptus 
grandis]
 gb|KCW53280.1| hypothetical protein EUGRSUZ_J02536 [Eucalyptus grandis]
Length=1041

 Score =   256 bits (655),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 123/210 (59%), Positives = 156/210 (74%), Gaps = 2/210 (1%)
 Frame = +2

Query  2    GVPPGALLLAYDSIQKILAISTKDGRIKVFGKDGAQALLESPNIVPSKFMQFMENQGFLI  181
            G+P G    AYDSIQ ILA+STK+G+IK++GKD  Q +LES    PSKFMQF+ENQG L+
Sbjct  36   GIPSGCTKFAYDSIQSILAVSTKNGQIKLYGKDNTQVILESEQTGPSKFMQFIENQGILL  95

Query  182  KINVDNHIEVWNVDQKSLSNIHEFKRDITSFKIIQHTPYMYIGDSLGYVWVLKLEKEPCN  361
             +  +N IEVW++D+K LS+I+ FK  ITS  ++QH+ YMY GD LG V VLKL +EP N
Sbjct  96   NVTFNNQIEVWDIDKKLLSHIYNFKDAITSLSVLQHSLYMYAGDPLGNVSVLKLNQEPYN  155

Query  362  VVKMKYHIPFSESHGNSNK-DGDNAIVEILPQPTAESKRVLIIYRDGLIILWAVQESKTI  538
            +V+MKY IPF  SHG  N+  G  A++  LPQP AESKRVLIIY DGL +LW ++ESK+I
Sbjct  156  LVQMKYTIPFEVSHGIQNELSGHVAVMHALPQPLAESKRVLIIYEDGLFVLWEIRESKSI  215

Query  539  FTTGGNALQSVNHEAXKATAACWACPNGTK  628
            F  GGN LQS ++E  K T+ACWACP G+K
Sbjct  216  F-KGGNMLQSAHNEGKKVTSACWACPLGSK  244



>ref|XP_003548801.1| PREDICTED: uncharacterized protein LOC100811900 isoform X1 [Glycine 
max]
Length=1055

 Score =   256 bits (655),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 119/210 (57%), Positives = 160/210 (76%), Gaps = 1/210 (0%)
 Frame = +2

Query  2    GVPPGALLLAYDSIQKILAISTKDGRIKVFGKDGAQALLESPNIVPSKFMQFMENQGFLI  181
            GVP G    AYD+IQ+ILA+STKDG+IK++GKD AQA+LES   +PSKF+QF++NQG LI
Sbjct  37   GVPSGGAKFAYDTIQRILALSTKDGQIKLYGKDNAQAMLESSEPLPSKFLQFIQNQGVLI  96

Query  182  KINVDNHIEVWNVDQKSLSNIHEFKRDITSFKIIQHTPYMYIGDSLGYVWVLKLEKEPC-  358
             +  +NHIEVW++D+K LS+++  K +ITSF +I H+ YMYIG S G + VLKL++EP  
Sbjct  97   NVTSNNHIEVWDIDKKLLSDVYMAKEEITSFAVIHHSLYMYIGHSNGNISVLKLDQEPSW  156

Query  359  NVVKMKYHIPFSESHGNSNKDGDNAIVEILPQPTAESKRVLIIYRDGLIILWAVQESKTI  538
            ++V+MKY IP S S+GNS    D  +  ILPQP AESKRVLII+R+G +ILW ++ES++I
Sbjct  157  HLVQMKYTIPLSASYGNSEVSDDTVVTHILPQPAAESKRVLIIFRNGQMILWNIRESRSI  216

Query  539  FTTGGNALQSVNHEAXKATAACWACPNGTK  628
            F TG N LQ ++ E  K T+ACW CP G+K
Sbjct  217  FKTGENMLQPLHTETKKVTSACWVCPFGSK  246



>emb|CDP01788.1| unnamed protein product [Coffea canephora]
Length=1065

 Score =   256 bits (654),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 122/225 (54%), Positives = 160/225 (71%), Gaps = 16/225 (7%)
 Frame = +2

Query  2    GVPPGALLLAYDSIQKILAISTKDGRIKVFGKDGAQALLESPNIVPSKFMQFMENQGFLI  181
            G+P GA L AY++ +KILAIS +DG+IK+FGK+G+Q LLESP ++PSKF+QF+ENQ  L+
Sbjct  36   GIPSGANLFAYNNPKKILAISVRDGQIKLFGKNGSQTLLESPEVLPSKFLQFIENQQILV  95

Query  182  KINVDNHIE---------------VWNVDQKSLSNIHEFKRDITSFKIIQHTPYMYIGDS  316
             IN +NHIE               VW+++++ LS +H+ K++ITS   + H PYMY GDS
Sbjct  96   NINPNNHIEAIVLLLSGKALRDYQVWDLEKRCLSYVHDIKKEITSCTSMLHAPYMYFGDS  155

Query  317  LGYVWVLKLEKEPCNVVKMKYHIPFSESHGNSNK-DGDNAIVEILPQPTAESKRVLIIYR  493
             G V V K+ +EP  + +MKYHIP S SHGNS +   D A++ ILPQPTAESKRVLIIY 
Sbjct  156  AGNVSVFKVNQEPTIIEQMKYHIPLSASHGNSGQVPADIAVIRILPQPTAESKRVLIIYT  215

Query  494  DGLIILWAVQESKTIFTTGGNALQSVNHEAXKATAACWACPNGTK  628
            DG + LW +Q+SK IFT GG  LQ+ +HE  K TAA WACP G+K
Sbjct  216  DGFMTLWDIQDSKAIFTAGGTTLQATSHETKKVTAATWACPFGSK  260



>ref|XP_010683214.1| PREDICTED: uncharacterized protein LOC104897939 isoform X1 [Beta 
vulgaris subsp. vulgaris]
 ref|XP_010683215.1| PREDICTED: uncharacterized protein LOC104897939 isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=1047

 Score =   256 bits (653),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 116/210 (55%), Positives = 159/210 (76%), Gaps = 1/210 (0%)
 Frame = +2

Query  2    GVPPGALLLAYDSIQKILAISTKDGRIKVFGKDGAQALLESPNIVPSKFMQFMENQGFLI  181
            GVP  A +LAYD +QKILAISTK+G+IK+ GKD  QALLES ++ PSKF+QF++NQG L+
Sbjct  35   GVPSSAAMLAYDPVQKILAISTKNGQIKLLGKDNTQALLESNDVQPSKFLQFIQNQGILL  94

Query  182  KINVDNHIEVWNVDQKSLSNIHEFKRDITSFKIIQHTPYMYIGDSLGYVWVLKLEKEPCN  361
             + + + IEVW+VD+K +S++H+   +ITSF ++Q   ++YIGD  G V V KLEKE C 
Sbjct  95   NVTLKDQIEVWDVDKKIMSHVHDVNEEITSFSVVQQCFFIYIGDRAGNVTVWKLEKESCQ  154

Query  362  VVKMKYHIPFSESHGNSNKDG-DNAIVEILPQPTAESKRVLIIYRDGLIILWAVQESKTI  538
            + KM+Y IPFS SHG++N+D  D++++ +LPQPTA+SKR+LII+ DGLI LWA+QESK +
Sbjct  155  IEKMRYWIPFSASHGHTNRDPVDHSVMYVLPQPTAQSKRILIIFADGLITLWAIQESKAV  214

Query  539  FTTGGNALQSVNHEAXKATAACWACPNGTK  628
            FT GG+   +   E    TAACW CP G+K
Sbjct  215  FTIGGSGTATHLQETKTVTAACWVCPFGSK  244



>ref|XP_010683216.1| PREDICTED: uncharacterized protein LOC104897939 isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=1043

 Score =   256 bits (653),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 116/210 (55%), Positives = 159/210 (76%), Gaps = 1/210 (0%)
 Frame = +2

Query  2    GVPPGALLLAYDSIQKILAISTKDGRIKVFGKDGAQALLESPNIVPSKFMQFMENQGFLI  181
            GVP  A +LAYD +QKILAISTK+G+IK+ GKD  QALLES ++ PSKF+QF++NQG L+
Sbjct  35   GVPSSAAMLAYDPVQKILAISTKNGQIKLLGKDNTQALLESNDVQPSKFLQFIQNQGILL  94

Query  182  KINVDNHIEVWNVDQKSLSNIHEFKRDITSFKIIQHTPYMYIGDSLGYVWVLKLEKEPCN  361
             + + + IEVW+VD+K +S++H+   +ITSF ++Q   ++YIGD  G V V KLEKE C 
Sbjct  95   NVTLKDQIEVWDVDKKIMSHVHDVNEEITSFSVVQQCFFIYIGDRAGNVTVWKLEKESCQ  154

Query  362  VVKMKYHIPFSESHGNSNKDG-DNAIVEILPQPTAESKRVLIIYRDGLIILWAVQESKTI  538
            + KM+Y IPFS SHG++N+D  D++++ +LPQPTA+SKR+LII+ DGLI LWA+QESK +
Sbjct  155  IEKMRYWIPFSASHGHTNRDPVDHSVMYVLPQPTAQSKRILIIFADGLITLWAIQESKAV  214

Query  539  FTTGGNALQSVNHEAXKATAACWACPNGTK  628
            FT GG+   +   E    TAACW CP G+K
Sbjct  215  FTIGGSGTATHLQETKTVTAACWVCPFGSK  244



>ref|XP_006599278.1| PREDICTED: uncharacterized protein LOC100811900 isoform X3 [Glycine 
max]
Length=1036

 Score =   256 bits (653),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 119/210 (57%), Positives = 160/210 (76%), Gaps = 1/210 (0%)
 Frame = +2

Query  2    GVPPGALLLAYDSIQKILAISTKDGRIKVFGKDGAQALLESPNIVPSKFMQFMENQGFLI  181
            GVP G    AYD+IQ+ILA+STKDG+IK++GKD AQA+LES   +PSKF+QF++NQG LI
Sbjct  37   GVPSGGAKFAYDTIQRILALSTKDGQIKLYGKDNAQAMLESSEPLPSKFLQFIQNQGVLI  96

Query  182  KINVDNHIEVWNVDQKSLSNIHEFKRDITSFKIIQHTPYMYIGDSLGYVWVLKLEKEPC-  358
             +  +NHIEVW++D+K LS+++  K +ITSF +I H+ YMYIG S G + VLKL++EP  
Sbjct  97   NVTSNNHIEVWDIDKKLLSDVYMAKEEITSFAVIHHSLYMYIGHSNGNISVLKLDQEPSW  156

Query  359  NVVKMKYHIPFSESHGNSNKDGDNAIVEILPQPTAESKRVLIIYRDGLIILWAVQESKTI  538
            ++V+MKY IP S S+GNS    D  +  ILPQP AESKRVLII+R+G +ILW ++ES++I
Sbjct  157  HLVQMKYTIPLSASYGNSEVSDDTVVTHILPQPAAESKRVLIIFRNGQMILWNIRESRSI  216

Query  539  FTTGGNALQSVNHEAXKATAACWACPNGTK  628
            F TG N LQ ++ E  K T+ACW CP G+K
Sbjct  217  FKTGENMLQPLHTETKKVTSACWVCPFGSK  246



>ref|XP_007156241.1| hypothetical protein PHAVU_003G2701001g, partial [Phaseolus vulgaris]
 gb|ESW28235.1| hypothetical protein PHAVU_003G2701001g, partial [Phaseolus vulgaris]
Length=1044

 Score =   254 bits (649),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 119/210 (57%), Positives = 159/210 (76%), Gaps = 1/210 (0%)
 Frame = +2

Query  2    GVPPGALLLAYDSIQKILAISTKDGRIKVFGKDGAQALLESPNIVPSKFMQFMENQGFLI  181
            GVP G    AYD+IQ+ILA+STKDG+IK++GKD AQA+LES    PSKF+QF++NQG LI
Sbjct  23   GVPSGGTNFAYDTIQRILALSTKDGQIKLYGKDNAQAMLESSEAQPSKFLQFIQNQGVLI  82

Query  182  KINVDNHIEVWNVDQKSLSNIHEFKRDITSFKIIQHTPYMYIGDSLGYVWVLKLEKEPC-  358
             +  ++HIEVW++D+KSLS+++  K +IT F +IQH+ YMYIG S G + VL L++EP  
Sbjct  83   NVTSNDHIEVWDIDKKSLSDVYIAKEEITCFVVIQHSLYMYIGHSNGDISVLMLDQEPSW  142

Query  359  NVVKMKYHIPFSESHGNSNKDGDNAIVEILPQPTAESKRVLIIYRDGLIILWAVQESKTI  538
             +VKMKY IP S S+GNS    D  +  +LPQP AESKRVLII+R+G +ILW VQES++I
Sbjct  143  RLVKMKYVIPLSASYGNSEVSDDTVVTHVLPQPAAESKRVLIIFRNGQMILWDVQESRSI  202

Query  539  FTTGGNALQSVNHEAXKATAACWACPNGTK  628
              TGG+ LQ +++E  K T+ACW CP G+K
Sbjct  203  LRTGGSKLQPLHNETKKVTSACWVCPFGSK  232



>ref|XP_007156240.1| hypothetical protein PHAVU_003G2701001g, partial [Phaseolus vulgaris]
 gb|ESW28234.1| hypothetical protein PHAVU_003G2701001g, partial [Phaseolus vulgaris]
Length=1045

 Score =   254 bits (649),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 119/210 (57%), Positives = 159/210 (76%), Gaps = 1/210 (0%)
 Frame = +2

Query  2    GVPPGALLLAYDSIQKILAISTKDGRIKVFGKDGAQALLESPNIVPSKFMQFMENQGFLI  181
            GVP G    AYD+IQ+ILA+STKDG+IK++GKD AQA+LES    PSKF+QF++NQG LI
Sbjct  23   GVPSGGTNFAYDTIQRILALSTKDGQIKLYGKDNAQAMLESSEAQPSKFLQFIQNQGVLI  82

Query  182  KINVDNHIEVWNVDQKSLSNIHEFKRDITSFKIIQHTPYMYIGDSLGYVWVLKLEKEPC-  358
             +  ++HIEVW++D+KSLS+++  K +IT F +IQH+ YMYIG S G + VL L++EP  
Sbjct  83   NVTSNDHIEVWDIDKKSLSDVYIAKEEITCFVVIQHSLYMYIGHSNGDISVLMLDQEPSW  142

Query  359  NVVKMKYHIPFSESHGNSNKDGDNAIVEILPQPTAESKRVLIIYRDGLIILWAVQESKTI  538
             +VKMKY IP S S+GNS    D  +  +LPQP AESKRVLII+R+G +ILW VQES++I
Sbjct  143  RLVKMKYVIPLSASYGNSEVSDDTVVTHVLPQPAAESKRVLIIFRNGQMILWDVQESRSI  202

Query  539  FTTGGNALQSVNHEAXKATAACWACPNGTK  628
              TGG+ LQ +++E  K T+ACW CP G+K
Sbjct  203  LRTGGSKLQPLHNETKKVTSACWVCPFGSK  232



>ref|XP_006587564.1| PREDICTED: uncharacterized protein LOC100793138 isoform X3 [Glycine 
max]
Length=967

 Score =   252 bits (644),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 115/210 (55%), Positives = 159/210 (76%), Gaps = 1/210 (0%)
 Frame = +2

Query  2    GVPPGALLLAYDSIQKILAISTKDGRIKVFGKDGAQALLESPNIVPSKFMQFMENQGFLI  181
            GVP G    AYD+  +ILA++TKDG+IK++GKD AQA+LES   +PSKF+QF++NQG LI
Sbjct  37   GVPSGGAKFAYDTTLRILALATKDGQIKLYGKDNAQAMLESSEPLPSKFLQFIQNQGVLI  96

Query  182  KINVDNHIEVWNVDQKSLSNIHEFKRDITSFKIIQHTPYMYIGDSLGYVWVLKLEKEPC-  358
             +  +NHIEVW++++K LS+++  K +ITSF +IQH+ YMYIG S G + V KL++EP  
Sbjct  97   NVTSNNHIEVWDIEKKLLSDVYIAKDEITSFTVIQHSLYMYIGHSNGNISVFKLDQEPSW  156

Query  359  NVVKMKYHIPFSESHGNSNKDGDNAIVEILPQPTAESKRVLIIYRDGLIILWAVQESKTI  538
            ++ +MKY IP S SHGNS    D A+  ILPQP A+SKRVLI++R+G +ILW ++ES++I
Sbjct  157  HLAQMKYTIPLSASHGNSEASDDTAVTHILPQPAADSKRVLIVFRNGQMILWDIRESRSI  216

Query  539  FTTGGNALQSVNHEAXKATAACWACPNGTK  628
            F TGGN LQ ++ E  K T+ACW CP G+K
Sbjct  217  FRTGGNMLQPLHTETKKVTSACWVCPFGSK  246



>ref|XP_006587562.1| PREDICTED: uncharacterized protein LOC100793138 isoform X1 [Glycine 
max]
Length=1055

 Score =   252 bits (644),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 115/210 (55%), Positives = 159/210 (76%), Gaps = 1/210 (0%)
 Frame = +2

Query  2    GVPPGALLLAYDSIQKILAISTKDGRIKVFGKDGAQALLESPNIVPSKFMQFMENQGFLI  181
            GVP G    AYD+  +ILA++TKDG+IK++GKD AQA+LES   +PSKF+QF++NQG LI
Sbjct  37   GVPSGGAKFAYDTTLRILALATKDGQIKLYGKDNAQAMLESSEPLPSKFLQFIQNQGVLI  96

Query  182  KINVDNHIEVWNVDQKSLSNIHEFKRDITSFKIIQHTPYMYIGDSLGYVWVLKLEKEPC-  358
             +  +NHIEVW++++K LS+++  K +ITSF +IQH+ YMYIG S G + V KL++EP  
Sbjct  97   NVTSNNHIEVWDIEKKLLSDVYIAKDEITSFTVIQHSLYMYIGHSNGNISVFKLDQEPSW  156

Query  359  NVVKMKYHIPFSESHGNSNKDGDNAIVEILPQPTAESKRVLIIYRDGLIILWAVQESKTI  538
            ++ +MKY IP S SHGNS    D A+  ILPQP A+SKRVLI++R+G +ILW ++ES++I
Sbjct  157  HLAQMKYTIPLSASHGNSEASDDTAVTHILPQPAADSKRVLIVFRNGQMILWDIRESRSI  216

Query  539  FTTGGNALQSVNHEAXKATAACWACPNGTK  628
            F TGGN LQ ++ E  K T+ACW CP G+K
Sbjct  217  FRTGGNMLQPLHTETKKVTSACWVCPFGSK  246



>ref|XP_006590749.1| PREDICTED: uncharacterized protein LOC100782049 isoform X1 [Glycine 
max]
Length=1053

 Score =   250 bits (639),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 117/210 (56%), Positives = 160/210 (76%), Gaps = 1/210 (0%)
 Frame = +2

Query  2    GVPPGALLLAYDSIQKILAISTKDGRIKVFGKDGAQALLESPNIVPSKFMQFMENQGFLI  181
            GVP G    AYD+IQKILA+STKDGRIK+FG+D AQ LLES   VPSKF+ F++NQG LI
Sbjct  37   GVPSGGAKFAYDNIQKILALSTKDGRIKLFGEDNAQVLLESKEPVPSKFLLFIQNQGILI  96

Query  182  KINVDNHIEVWNVDQKSLSNIHEFKRDITSFKIIQHTPYMYIGDSLGYVWVLKLEKEPCN  361
             +  +NHIEVW++D+K LS+++  K +IT F +I+H+ +MYIG S G + VL L++EP +
Sbjct  97   NVTFNNHIEVWDIDKKLLSDVYIVKEEITCFSVIKHSLFMYIGFSNGNISVLMLDQEPWH  156

Query  362  VVKMKYHIPFSESHGNSNKDGDNAIV-EILPQPTAESKRVLIIYRDGLIILWAVQESKTI  538
            VV+MKY IP S S+GNS ++ D+ +V  +LPQP AES+RVLII+R+G IILW ++E ++I
Sbjct  157  VVRMKYTIPLSASYGNSTEESDDTVVTHVLPQPAAESQRVLIIFRNGQIILWDIREIRSI  216

Query  539  FTTGGNALQSVNHEAXKATAACWACPNGTK  628
            F TGG  LQ+  +E  K ++ACW CP G+K
Sbjct  217  FRTGGKILQTRYNETRKVSSACWVCPFGSK  246



>ref|XP_006590750.1| PREDICTED: uncharacterized protein LOC100782049 isoform X2 [Glycine 
max]
Length=1052

 Score =   250 bits (639),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 117/210 (56%), Positives = 160/210 (76%), Gaps = 1/210 (0%)
 Frame = +2

Query  2    GVPPGALLLAYDSIQKILAISTKDGRIKVFGKDGAQALLESPNIVPSKFMQFMENQGFLI  181
            GVP G    AYD+IQKILA+STKDGRIK+FG+D AQ LLES   VPSKF+ F++NQG LI
Sbjct  37   GVPSGGAKFAYDNIQKILALSTKDGRIKLFGEDNAQVLLESKEPVPSKFLLFIQNQGILI  96

Query  182  KINVDNHIEVWNVDQKSLSNIHEFKRDITSFKIIQHTPYMYIGDSLGYVWVLKLEKEPCN  361
             +  +NHIEVW++D+K LS+++  K +IT F +I+H+ +MYIG S G + VL L++EP +
Sbjct  97   NVTFNNHIEVWDIDKKLLSDVYIVKEEITCFSVIKHSLFMYIGFSNGNISVLMLDQEPWH  156

Query  362  VVKMKYHIPFSESHGNSNKDGDNAIV-EILPQPTAESKRVLIIYRDGLIILWAVQESKTI  538
            VV+MKY IP S S+GNS ++ D+ +V  +LPQP AES+RVLII+R+G IILW ++E ++I
Sbjct  157  VVRMKYTIPLSASYGNSTEESDDTVVTHVLPQPAAESQRVLIIFRNGQIILWDIREIRSI  216

Query  539  FTTGGNALQSVNHEAXKATAACWACPNGTK  628
            F TGG  LQ+  +E  K ++ACW CP G+K
Sbjct  217  FRTGGKILQTRYNETRKVSSACWVCPFGSK  246



>ref|XP_004509443.1| PREDICTED: uncharacterized protein LOC101491617 isoform X1 [Cicer 
arietinum]
Length=1060

 Score =   250 bits (639),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 117/210 (56%), Positives = 158/210 (75%), Gaps = 1/210 (0%)
 Frame = +2

Query  2    GVPPGALLLAYDSIQKILAISTKDGRIKVFGKDGAQALLESPNIVPSKFMQFMENQGFLI  181
            G+P G    AYD+IQKILA+STKDGRIK++GKD +QA+LES   + SKF+QF++NQG L+
Sbjct  38   GIPSGGAKFAYDTIQKILALSTKDGRIKLYGKDNSQAMLESSEPLSSKFLQFIQNQGILL  97

Query  182  KINVDNHIEVWNVDQKSLSNIHEFKRDITSFKIIQHTPYMYIGDSLGYVWVLKLEKEPCN  361
             +  +N +EVW++++K LS+++  K +ITSF +IQH+ Y+YIG S G + VLKL++ P +
Sbjct  98   NVTSNNLVEVWDIEKKLLSDLYISKEEITSFAVIQHSLYVYIGHSNGNISVLKLDQNPWH  157

Query  362  VVKMKYHIPFSESHGNSNKDGDNAIVEILPQPTAESKRVLIIYRDGLIILWAVQESKTIF  541
            +V+MKY IP S S+GNS    D  ++ ILPQP AESKRVLII+R+G IILW + ES+T F
Sbjct  158  MVQMKYTIPLSASYGNSEVSDDTTVMHILPQPAAESKRVLIIFRNGQIILWDIHESRTTF  217

Query  542  TTGGNALQSVNH-EAXKATAACWACPNGTK  628
             TGGN LQS  H E  K T+ACW CP G+K
Sbjct  218  RTGGNMLQSSLHNETKKVTSACWTCPFGSK  247



>ref|XP_004509444.1| PREDICTED: uncharacterized protein LOC101491617 isoform X2 [Cicer 
arietinum]
Length=1051

 Score =   250 bits (639),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 117/210 (56%), Positives = 158/210 (75%), Gaps = 1/210 (0%)
 Frame = +2

Query  2    GVPPGALLLAYDSIQKILAISTKDGRIKVFGKDGAQALLESPNIVPSKFMQFMENQGFLI  181
            G+P G    AYD+IQKILA+STKDGRIK++GKD +QA+LES   + SKF+QF++NQG L+
Sbjct  38   GIPSGGAKFAYDTIQKILALSTKDGRIKLYGKDNSQAMLESSEPLSSKFLQFIQNQGILL  97

Query  182  KINVDNHIEVWNVDQKSLSNIHEFKRDITSFKIIQHTPYMYIGDSLGYVWVLKLEKEPCN  361
             +  +N +EVW++++K LS+++  K +ITSF +IQH+ Y+YIG S G + VLKL++ P +
Sbjct  98   NVTSNNLVEVWDIEKKLLSDLYISKEEITSFAVIQHSLYVYIGHSNGNISVLKLDQNPWH  157

Query  362  VVKMKYHIPFSESHGNSNKDGDNAIVEILPQPTAESKRVLIIYRDGLIILWAVQESKTIF  541
            +V+MKY IP S S+GNS    D  ++ ILPQP AESKRVLII+R+G IILW + ES+T F
Sbjct  158  MVQMKYTIPLSASYGNSEVSDDTTVMHILPQPAAESKRVLIIFRNGQIILWDIHESRTTF  217

Query  542  TTGGNALQSVNH-EAXKATAACWACPNGTK  628
             TGGN LQS  H E  K T+ACW CP G+K
Sbjct  218  RTGGNMLQSSLHNETKKVTSACWTCPFGSK  247



>gb|KHN38837.1| Syntaxin-binding protein 5 [Glycine soja]
Length=1054

 Score =   248 bits (633),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 119/221 (54%), Positives = 160/221 (72%), Gaps = 12/221 (5%)
 Frame = +2

Query  2    GVPPGALLLAYDSIQKILAISTKDGRIKVFGKDGAQALLESPNIVPSKFMQFMENQGFLI  181
            GVP G    AYD+IQ+ILA+STKDG+IK++GKD AQA+LES   +PSKF+QF++NQG LI
Sbjct  25   GVPSGGAKFAYDTIQRILALSTKDGQIKLYGKDNAQAMLESSEPLPSKFLQFIQNQGVLI  84

Query  182  KINVDNHIE-----------VWNVDQKSLSNIHEFKRDITSFKIIQHTPYMYIGDSLGYV  328
             +  +NHIE           VW++D+K LS+++  K +ITSF +I H+ YMYIG S G +
Sbjct  85   NVTSNNHIEASISMDLLTFIVWDIDKKLLSDVYMAKEEITSFAVIHHSLYMYIGHSNGNI  144

Query  329  WVLKLEKEPC-NVVKMKYHIPFSESHGNSNKDGDNAIVEILPQPTAESKRVLIIYRDGLI  505
             VLKL++EP  ++V+MKY IP S S+GNS    D  +  ILPQP AESKRVLII+R+G +
Sbjct  145  SVLKLDQEPSWHLVQMKYTIPLSASYGNSEVSDDTVVTHILPQPAAESKRVLIIFRNGQM  204

Query  506  ILWAVQESKTIFTTGGNALQSVNHEAXKATAACWACPNGTK  628
            ILW ++ES++IF TG N LQ ++ E  K T+ACW CP G+K
Sbjct  205  ILWNIRESRSIFKTGENMLQPLHTETKKVTSACWVCPFGSK  245



>ref|XP_006587563.1| PREDICTED: uncharacterized protein LOC100793138 isoform X2 [Glycine 
max]
Length=1054

 Score =   246 bits (628),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 114/210 (54%), Positives = 158/210 (75%), Gaps = 2/210 (1%)
 Frame = +2

Query  2    GVPPGALLLAYDSIQKILAISTKDGRIKVFGKDGAQALLESPNIVPSKFMQFMENQGFLI  181
            GVP G    AYD+  +ILA++TKDG+IK++GKD AQA+LES   +PSKF+QF++NQG LI
Sbjct  37   GVPSGGAKFAYDTTLRILALATKDGQIKLYGKDNAQAMLESSEPLPSKFLQFIQNQGVLI  96

Query  182  KINVDNHIEVWNVDQKSLSNIHEFKRDITSFKIIQHTPYMYIGDSLGYVWVLKLEKEPC-  358
             +  +NHIEVW++++K LS+++  K +ITSF +IQH+ YMYIG S G + V KL++EP  
Sbjct  97   NVTSNNHIEVWDIEKKLLSDVYIAKDEITSFTVIQHSLYMYIGHSNGNISVFKLDQEPSW  156

Query  359  NVVKMKYHIPFSESHGNSNKDGDNAIVEILPQPTAESKRVLIIYRDGLIILWAVQESKTI  538
            ++ +MKY IP S SHGNS    D A+  ILPQP A+SKR LI++R+G +ILW ++ES++I
Sbjct  157  HLAQMKYTIPLSASHGNSEASDDTAVTHILPQPAADSKR-LIVFRNGQMILWDIRESRSI  215

Query  539  FTTGGNALQSVNHEAXKATAACWACPNGTK  628
            F TGGN LQ ++ E  K T+ACW CP G+K
Sbjct  216  FRTGGNMLQPLHTETKKVTSACWVCPFGSK  245



>ref|XP_010103254.1| Syntaxin-binding protein 5 [Morus notabilis]
 gb|EXB95125.1| Syntaxin-binding protein 5 [Morus notabilis]
Length=1021

 Score =   245 bits (626),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 119/212 (56%), Positives = 154/212 (73%), Gaps = 21/212 (10%)
 Frame = +2

Query  2    GVPPGALLLAYDSIQKILAISTKDGRIKVFGKDGAQALLESPNIVPSKFMQFMENQGFLI  181
            G+P G+ + AYD +QKILAIST+DGR+K+FG+D  QALL+S    P+KF+Q         
Sbjct  30   GIPSGSNIFAYDPLQKILAISTQDGRLKLFGRDNTQALLQSKEAEPTKFLQ---------  80

Query  182  KINVDNHIEVWNVDQKSLSNIHEFKRDITSFKIIQHTPYMYIGDSLGYVWVLKLEKEPCN  361
                     VW+++ K  S++H F+ +ITSF I+Q +PYMYIG+SLG V VLKLEKEP  
Sbjct  81   ---------VWDIENKVWSHVHAFQHEITSFAIMQQSPYMYIGNSLGNVSVLKLEKEPFR  131

Query  362  VV--KMKYHIPFSESHGNSNK-DGDNAIVEILPQPTAESKRVLIIYRDGLIILWAVQESK  532
            +V  +  Y IPFS SHGNS +   +NA+  ILPQP AESKRVLII+RDGLI+LW ++ESK
Sbjct  132  IVLVQTNYTIPFSISHGNSTEVSAENAVAHILPQPMAESKRVLIIFRDGLIVLWDIRESK  191

Query  533  TIFTTGGNALQSVNHEAXKATAACWACPNGTK  628
             +F TGGN LQS++HEA KAT+ACWACP GT+
Sbjct  192  PVFITGGNVLQSLHHEATKATSACWACPFGTR  223



>ref|XP_004512431.1| PREDICTED: uncharacterized protein LOC101494027, partial [Cicer 
arietinum]
Length=1045

 Score =   245 bits (626),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 122/211 (58%), Positives = 157/211 (74%), Gaps = 3/211 (1%)
 Frame = +2

Query  2    GVPPGALLLAYDSIQKILAISTKDGRIKVFGKDGAQALLESPNIVPSKFMQFMENQGFLI  181
            GVP   +  A D+IQKILA+ST DGRIK+FGKD AQ LLES   VPSKF+QF++NQG LI
Sbjct  28   GVPSCGIKFASDNIQKILALSTNDGRIKLFGKDNAQVLLESKKAVPSKFLQFIQNQGILI  87

Query  182  KINVDNHIEVWNVDQKSLSNIHEFKRDITSFKIIQHTPYMYIGDSLGYVWVLKLEKEPCN  361
             +  +NHIEVW++D+K LS+++  K +ITSF I+QH+ YMYIG S G + VLKL+++  +
Sbjct  88   NVTSNNHIEVWDIDKKKLSDLYIVKEEITSFAILQHSLYMYIGVSSGNISVLKLDQD-WH  146

Query  362  VVKMKYHIPFSESHGNSNKDGDNAIV-EILPQPTAESKRVLIIYRDGLIILWAVQESKTI  538
            VV+M Y IP S S GNS +  D+ +V  ILPQP AESKRVLII+R+G IILW +QES+ I
Sbjct  147  VVRMNYTIPLSASFGNSTEAFDDTVVTHILPQPAAESKRVLIIFRNGQIILWDIQESRCI  206

Query  539  FTTGGNALQSV-NHEAXKATAACWACPNGTK  628
            F TGGN  Q + N+E  K + ACW CP G+K
Sbjct  207  FRTGGNVSQPLHNNETKKVSCACWVCPFGSK  237



>ref|XP_006599277.1| PREDICTED: uncharacterized protein LOC100811900 isoform X2 [Glycine 
max]
Length=1051

 Score =   245 bits (625),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 116/210 (55%), Positives = 158/210 (75%), Gaps = 5/210 (2%)
 Frame = +2

Query  2    GVPPGALLLAYDSIQKILAISTKDGRIKVFGKDGAQALLESPNIVPSKFMQFMENQGFLI  181
            GVP G    AYD+IQ+ILA+STKDG+IK++GKD AQA+LES   +PSKF+QF++NQG LI
Sbjct  37   GVPSGGAKFAYDTIQRILALSTKDGQIKLYGKDNAQAMLESSEPLPSKFLQFIQNQGVLI  96

Query  182  KINVDNHIEVWNVDQKSLSNIHEFKRDITSFKIIQHTPYMYIGDSLGYVWVLKLEKEPC-  358
             +  +NHIEVW++D+K LS+++  K +ITSF +I H+ YMYIG S G + VLKL++EP  
Sbjct  97   NVTSNNHIEVWDIDKKLLSDVYMAKEEITSFAVIHHSLYMYIGHSNGNISVLKLDQEPSW  156

Query  359  NVVKMKYHIPFSESHGNSNKDGDNAIVEILPQPTAESKRVLIIYRDGLIILWAVQESKTI  538
            ++V+MKY IP S S+ +     D  +  ILPQP AESKRVLII+R+G +ILW ++ES++I
Sbjct  157  HLVQMKYTIPLSASYVSD----DTVVTHILPQPAAESKRVLIIFRNGQMILWNIRESRSI  212

Query  539  FTTGGNALQSVNHEAXKATAACWACPNGTK  628
            F TG N LQ ++ E  K T+ACW CP G+K
Sbjct  213  FKTGENMLQPLHTETKKVTSACWVCPFGSK  242



>ref|XP_010432265.1| PREDICTED: uncharacterized protein LOC104716576 isoform X2 [Camelina 
sativa]
Length=1049

 Score =   243 bits (619),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 110/210 (52%), Positives = 156/210 (74%), Gaps = 3/210 (1%)
 Frame = +2

Query  2    GVPPGALLLAYDSIQKILAISTKDGRIKVFGKDGAQALLESPNIVPSKFMQFMENQGFLI  181
            G+P G+ L AYD IQK LA+STKDGRIK+FGKD  QALL S     S+F++F++NQG L+
Sbjct  36   GLPSGSHLFAYDPIQKTLAVSTKDGRIKLFGKDQTQALLVSEEASASRFLEFVQNQGILL  95

Query  182  KINVDNHIEVWNVDQKSLSNIHEFKRDITSFKIIQHTPYMYIGDSLGYVWVLKLEKEPCN  361
             +N  N IEVW++D+K LS++H F  +ITSF+++QHTPY Y+GDS G V VLK+E++   
Sbjct  96   NVNAKNQIEVWDLDKKLLSHVHVFNGEITSFRVMQHTPYFYVGDSSGNVSVLKIEQDSNQ  155

Query  362  VVKMKYHIPFSESHGNSNKDG-DNAIVEILPQPTAESKRVLIIYRDGLIILWAVQESKTI  538
            V++M+Y IP+  S+G+  +D  D ++V ILPQPTAESKR+L+++  G I LW ++ESK +
Sbjct  156  VIQMEYTIPYLASNGSPVEDSEDTSVVSILPQPTAESKRILLVFSSGFIALWDIKESKPV  215

Query  539  FTTGGNALQSVNHEAXKATAACWACPNGTK  628
              TGG+ +  V  +A KAT ACW CP+G++
Sbjct  216  LKTGGHGM--VKQDAKKATCACWVCPSGSR  243



>ref|XP_010432264.1| PREDICTED: uncharacterized protein LOC104716576 isoform X1 [Camelina 
sativa]
Length=1050

 Score =   243 bits (619),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 110/210 (52%), Positives = 156/210 (74%), Gaps = 3/210 (1%)
 Frame = +2

Query  2    GVPPGALLLAYDSIQKILAISTKDGRIKVFGKDGAQALLESPNIVPSKFMQFMENQGFLI  181
            G+P G+ L AYD IQK LA+STKDGRIK+FGKD  QALL S     S+F++F++NQG L+
Sbjct  36   GLPSGSHLFAYDPIQKTLAVSTKDGRIKLFGKDQTQALLVSEEASASRFLEFVQNQGILL  95

Query  182  KINVDNHIEVWNVDQKSLSNIHEFKRDITSFKIIQHTPYMYIGDSLGYVWVLKLEKEPCN  361
             +N  N IEVW++D+K LS++H F  +ITSF+++QHTPY Y+GDS G V VLK+E++   
Sbjct  96   NVNAKNQIEVWDLDKKLLSHVHVFNGEITSFRVMQHTPYFYVGDSSGNVSVLKIEQDSNQ  155

Query  362  VVKMKYHIPFSESHGNSNKDG-DNAIVEILPQPTAESKRVLIIYRDGLIILWAVQESKTI  538
            V++M+Y IP+  S+G+  +D  D ++V ILPQPTAESKR+L+++  G I LW ++ESK +
Sbjct  156  VIQMEYTIPYLASNGSPVEDSEDTSVVSILPQPTAESKRILLVFSSGFIALWDIKESKPV  215

Query  539  FTTGGNALQSVNHEAXKATAACWACPNGTK  628
              TGG+ +  V  +A KAT ACW CP+G++
Sbjct  216  LKTGGHGM--VKQDAKKATCACWVCPSGSR  243



>ref|XP_010918268.1| PREDICTED: uncharacterized protein LOC105042667 [Elaeis guineensis]
Length=1042

 Score =   241 bits (614),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 112/209 (54%), Positives = 151/209 (72%), Gaps = 2/209 (1%)
 Frame = +2

Query  2    GVPPGALLLAYDSIQKILAISTKDGRIKVFGKDGAQALLESPNIVPSKFMQFMENQGFLI  181
            G+P  A  +AYD IQ ILAIST++G+IK+FGKD  QALL S   VPSKF+QFMENQG L+
Sbjct  36   GIPTEASSMAYDPIQHILAISTRNGQIKLFGKDNTQALLHSEEAVPSKFLQFMENQGILL  95

Query  182  KINVDNHIEVWNVDQKSLSNIHEFKRDITSFKIIQHTPYMYIGDSLGYVWVLKLEKEPCN  361
             + V N IEVW++D+K L N+H F  +IT+F ++Q T ++Y+GD LG + VLKL+    +
Sbjct  96   NVTVQNRIEVWDIDKKQLCNVHVFNEEITAFSVVQQTFFIYVGDCLGNISVLKLDHVLNH  155

Query  362  VVKMKYHIPFSESHGNSNKDGDNAIVEILPQPTAESKRVLIIYRDGLIILWAVQESKTIF  541
            +V M+Y IPFS+SH  ++K  + A+  ILPQP AESKR LII+RDG++ LW +QESK +F
Sbjct  156  LVYMQYRIPFSKSHAEADK--ETAVTCILPQPMAESKRALIIFRDGVMSLWGMQESKVLF  213

Query  542  TTGGNALQSVNHEAXKATAACWACPNGTK  628
            T GGN L +  +E     +ACWAC  G+K
Sbjct  214  TAGGNVLHTSLNEPKNVVSACWACAIGSK  242



>gb|AES95324.2| transducin/WD40 repeat protein [Medicago truncatula]
Length=1108

 Score =   241 bits (614),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 120/211 (57%), Positives = 157/211 (74%), Gaps = 3/211 (1%)
 Frame = +2

Query  2    GVPPGALLLAYDSIQKILAISTKDGRIKVFGKDGAQALLESPNIVPSKFMQFMENQGFLI  181
            GVP GA     D+I  ILA+ST DGRIK+FGKD AQ LLES  +VPSKF+QF++NQG LI
Sbjct  101  GVPSGATKFTCDNIHNILALSTNDGRIKLFGKDNAQVLLESNKLVPSKFLQFIQNQGILI  160

Query  182  KINVDNHIEVWNVDQKSLSNIHEFKRDITSFKIIQHTPYMYIGDSLGYVWVLKLEKEPCN  361
             +  +NHIEVW++D+K LS+++  K +ITSF +IQH+ YMYIG S G + VLKL++   +
Sbjct  161  NVTSNNHIEVWDIDKKLLSDLYIVKEEITSFAVIQHSLYMYIGVSTGNISVLKLDQN-LH  219

Query  362  VVKMKYHIPFSESHGNSNKDGDNAIV-EILPQPTAESKRVLIIYRDGLIILWAVQESKTI  538
            VV+M Y IP S S GNS +  D+ +V  ILPQP AESKRV+II+R+G IILW ++ESK I
Sbjct  220  VVRMSYTIPLSASIGNSTEMFDDTVVTHILPQPAAESKRVVIIFRNGQIILWDIRESKCI  279

Query  539  FTTGGN-ALQSVNHEAXKATAACWACPNGTK  628
            F TGGN + Q +++EA K + ACW CP G+K
Sbjct  280  FRTGGNVSQQPLHNEAKKVSCACWVCPFGSK  310



>ref|XP_003612366.1| Syntaxin-binding protein [Medicago truncatula]
Length=1124

 Score =   241 bits (614),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 120/211 (57%), Positives = 157/211 (74%), Gaps = 3/211 (1%)
 Frame = +2

Query  2    GVPPGALLLAYDSIQKILAISTKDGRIKVFGKDGAQALLESPNIVPSKFMQFMENQGFLI  181
            GVP GA     D+I  ILA+ST DGRIK+FGKD AQ LLES  +VPSKF+QF++NQG LI
Sbjct  101  GVPSGATKFTCDNIHNILALSTNDGRIKLFGKDNAQVLLESNKLVPSKFLQFIQNQGILI  160

Query  182  KINVDNHIEVWNVDQKSLSNIHEFKRDITSFKIIQHTPYMYIGDSLGYVWVLKLEKEPCN  361
             +  +NHIEVW++D+K LS+++  K +ITSF +IQH+ YMYIG S G + VLKL++   +
Sbjct  161  NVTSNNHIEVWDIDKKLLSDLYIVKEEITSFAVIQHSLYMYIGVSTGNISVLKLDQN-LH  219

Query  362  VVKMKYHIPFSESHGNSNKDGDNAIV-EILPQPTAESKRVLIIYRDGLIILWAVQESKTI  538
            VV+M Y IP S S GNS +  D+ +V  ILPQP AESKRV+II+R+G IILW ++ESK I
Sbjct  220  VVRMSYTIPLSASIGNSTEMFDDTVVTHILPQPAAESKRVVIIFRNGQIILWDIRESKCI  279

Query  539  FTTGGN-ALQSVNHEAXKATAACWACPNGTK  628
            F TGGN + Q +++EA K + ACW CP G+K
Sbjct  280  FRTGGNVSQQPLHNEAKKVSCACWVCPFGSK  310



>ref|XP_002869080.1| hypothetical protein ARALYDRAFT_491090 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH45339.1| hypothetical protein ARALYDRAFT_491090 [Arabidopsis lyrata subsp. 
lyrata]
Length=1048

 Score =   240 bits (612),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 109/210 (52%), Positives = 154/210 (73%), Gaps = 3/210 (1%)
 Frame = +2

Query  2    GVPPGALLLAYDSIQKILAISTKDGRIKVFGKDGAQALLESPNIVPSKFMQFMENQGFLI  181
            G+P G+ + AYD IQKILA+STKDGRIK+FGKD  QALL S     S+F++F++NQG L+
Sbjct  36   GIPSGSHVFAYDPIQKILAVSTKDGRIKLFGKDQTQALLVSEETSTSRFLEFVQNQGILL  95

Query  182  KINVDNHIEVWNVDQKSLSNIHEFKRDITSFKIIQHTPYMYIGDSLGYVWVLKLEKEPCN  361
             +N  N IEVW++D+K LS++H FK +ITSF+++QHTPY Y+GDS G V V K+E++   
Sbjct  96   NVNAKNQIEVWDLDKKLLSHVHHFKGEITSFRVMQHTPYFYVGDSSGNVSVFKIEQDSNQ  155

Query  362  VVKMKYHIPFSESHGNS-NKDGDNAIVEILPQPTAESKRVLIIYRDGLIILWAVQESKTI  538
            V++M+Y IP+  S+G+      D ++V ILPQPTAESKR+L+++  G I LW ++ESK I
Sbjct  156  VIQMEYTIPYLASNGSPVEASEDTSVVSILPQPTAESKRILLVFSSGFIALWDIKESKPI  215

Query  539  FTTGGNALQSVNHEAXKATAACWACPNGTK  628
              TG + +  V  +A KAT ACW CP+G++
Sbjct  216  LKTGVHGM--VKQDAKKATCACWVCPSGSR  243



>ref|XP_010446909.1| PREDICTED: uncharacterized protein LOC104729648 [Camelina sativa]
Length=1048

 Score =   239 bits (611),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 109/210 (52%), Positives = 154/210 (73%), Gaps = 3/210 (1%)
 Frame = +2

Query  2    GVPPGALLLAYDSIQKILAISTKDGRIKVFGKDGAQALLESPNIVPSKFMQFMENQGFLI  181
            G+P G+ L AYD IQK LA+STKDGRIK+FGKD  QALL S     S+F++F++NQG L+
Sbjct  36   GLPSGSHLFAYDPIQKTLAVSTKDGRIKLFGKDQTQALLVSEEASTSRFLEFVQNQGILL  95

Query  182  KINVDNHIEVWNVDQKSLSNIHEFKRDITSFKIIQHTPYMYIGDSLGYVWVLKLEKEPCN  361
             +N  N IEVW++D+K LS++H F  +ITSF+++QHTPY Y+GDS G V VLK+E +   
Sbjct  96   NVNAKNQIEVWDLDKKLLSHVHVFNGEITSFRVMQHTPYFYVGDSSGNVSVLKIELDSNQ  155

Query  362  VVKMKYHIPFSESHGNSNKDG-DNAIVEILPQPTAESKRVLIIYRDGLIILWAVQESKTI  538
            V++M+Y IP+  S+G+  +D  D ++V ILPQPTAESKR+L+++  G I LW ++ESK +
Sbjct  156  VIQMEYTIPYLASNGSPVEDSEDTSVVSILPQPTAESKRILLVFSSGFIALWDIRESKPV  215

Query  539  FTTGGNALQSVNHEAXKATAACWACPNGTK  628
              TGG+ +  V  +  KAT ACW CP+G++
Sbjct  216  LKTGGHGM--VKQDTKKATCACWVCPSGSR  243



>ref|XP_009138375.1| PREDICTED: uncharacterized protein LOC103862418 isoform X1 [Brassica 
rapa]
Length=1037

 Score =   239 bits (609),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 108/210 (51%), Positives = 153/210 (73%), Gaps = 3/210 (1%)
 Frame = +2

Query  2    GVPPGALLLAYDSIQKILAISTKDGRIKVFGKDGAQALLESPNIVPSKFMQFMENQGFLI  181
            G+P GA L AYD +QKILA+STKDGRIK+FGK+  QALL S     SKF++F++NQG L+
Sbjct  36   GIPSGAHLFAYDPVQKILAVSTKDGRIKLFGKNQTQALLVSEEASTSKFIEFVQNQGLLL  95

Query  182  KINVDNHIEVWNVDQKSLSNIHEFKRDITSFKIIQHTPYMYIGDSLGYVWVLKLEKEPCN  361
             +N  N IEVW++++K +S++H F  +ITS +++QHTPY Y+GDS G V VLK++++   
Sbjct  96   NVNSKNQIEVWDLEKKLMSHVHVFNGEITSLRVMQHTPYFYVGDSSGNVSVLKIDQDSNQ  155

Query  362  VVKMKYHIPFSESHGNS-NKDGDNAIVEILPQPTAESKRVLIIYRDGLIILWAVQESKTI  538
            V++M Y IP+  S+G+      D ++V ILPQPTAE+KR+L+++  G I LW ++ESK +
Sbjct  156  VIQMDYTIPYLASNGSPVEASDDTSVVSILPQPTAETKRILLVFSSGFITLWDIKESKPV  215

Query  539  FTTGGNALQSVNHEAXKATAACWACPNGTK  628
              TGGN +  V  EA KAT ACW CP+G+K
Sbjct  216  LKTGGNGM--VKQEAKKATCACWVCPSGSK  243



>ref|XP_009138377.1| PREDICTED: uncharacterized protein LOC103862418 isoform X2 [Brassica 
rapa]
Length=1036

 Score =   239 bits (609),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 108/210 (51%), Positives = 153/210 (73%), Gaps = 3/210 (1%)
 Frame = +2

Query  2    GVPPGALLLAYDSIQKILAISTKDGRIKVFGKDGAQALLESPNIVPSKFMQFMENQGFLI  181
            G+P GA L AYD +QKILA+STKDGRIK+FGK+  QALL S     SKF++F++NQG L+
Sbjct  36   GIPSGAHLFAYDPVQKILAVSTKDGRIKLFGKNQTQALLVSEEASTSKFIEFVQNQGLLL  95

Query  182  KINVDNHIEVWNVDQKSLSNIHEFKRDITSFKIIQHTPYMYIGDSLGYVWVLKLEKEPCN  361
             +N  N IEVW++++K +S++H F  +ITS +++QHTPY Y+GDS G V VLK++++   
Sbjct  96   NVNSKNQIEVWDLEKKLMSHVHVFNGEITSLRVMQHTPYFYVGDSSGNVSVLKIDQDSNQ  155

Query  362  VVKMKYHIPFSESHGNS-NKDGDNAIVEILPQPTAESKRVLIIYRDGLIILWAVQESKTI  538
            V++M Y IP+  S+G+      D ++V ILPQPTAE+KR+L+++  G I LW ++ESK +
Sbjct  156  VIQMDYTIPYLASNGSPVEASDDTSVVSILPQPTAETKRILLVFSSGFITLWDIKESKPV  215

Query  539  FTTGGNALQSVNHEAXKATAACWACPNGTK  628
              TGGN +  V  EA KAT ACW CP+G+K
Sbjct  216  LKTGGNGM--VKQEAKKATCACWVCPSGSK  243



>emb|CDY40621.1| BnaA03g53420D [Brassica napus]
Length=1034

 Score =   239 bits (609),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 108/210 (51%), Positives = 153/210 (73%), Gaps = 3/210 (1%)
 Frame = +2

Query  2    GVPPGALLLAYDSIQKILAISTKDGRIKVFGKDGAQALLESPNIVPSKFMQFMENQGFLI  181
            G+P GA L AYD +QKILA+STKDGRIK+FGK+  QALL S     SKF++F++NQG L+
Sbjct  36   GIPSGAHLFAYDPVQKILAVSTKDGRIKLFGKNQTQALLVSEEASTSKFIEFVQNQGLLL  95

Query  182  KINVDNHIEVWNVDQKSLSNIHEFKRDITSFKIIQHTPYMYIGDSLGYVWVLKLEKEPCN  361
             +N  N IEVW++++K +S++H F  +ITS +++QHTPY Y+GDS G V VLK++++   
Sbjct  96   NVNSKNQIEVWDLEKKLMSHVHVFNGEITSLRVMQHTPYFYVGDSSGNVSVLKIDQDSNQ  155

Query  362  VVKMKYHIPFSESHGNS-NKDGDNAIVEILPQPTAESKRVLIIYRDGLIILWAVQESKTI  538
            V++M Y IP+  S+G+      D ++V ILPQPTAE+KR+L+++  G I LW ++ESK +
Sbjct  156  VIQMDYTIPYLASNGSPVEASDDTSVVSILPQPTAETKRILLVFSSGFITLWDIKESKPV  215

Query  539  FTTGGNALQSVNHEAXKATAACWACPNGTK  628
              TGGN +  V  EA KAT ACW CP+G+K
Sbjct  216  LKTGGNGM--VKQEAKKATCACWVCPSGSK  243



>ref|XP_008809117.1| PREDICTED: uncharacterized protein LOC103720924 [Phoenix dactylifera]
Length=1179

 Score =   239 bits (611),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 111/209 (53%), Positives = 150/209 (72%), Gaps = 2/209 (1%)
 Frame = +2

Query  2    GVPPGALLLAYDSIQKILAISTKDGRIKVFGKDGAQALLESPNIVPSKFMQFMENQGFLI  181
            GVP GA  +AYD IQ ILA+ST++G+IK+FGKD  QALL+S   VPSKF+QFMENQG L+
Sbjct  173  GVPAGASSMAYDPIQHILAVSTRNGQIKLFGKDNTQALLQSQEAVPSKFLQFMENQGILL  232

Query  182  KINVDNHIEVWNVDQKSLSNIHEFKRDITSFKIIQHTPYMYIGDSLGYVWVLKLEKEPCN  361
             + V NHIEVW++D+K L N+H F  +IT+F ++Q + ++Y+GD LG + VLKL+    +
Sbjct  233  NVTVQNHIEVWDIDKKQLCNMHIFNEEITAFSVVQQSFFIYVGDRLGNISVLKLDHTLNH  292

Query  362  VVKMKYHIPFSESHGNSNKDGDNAIVEILPQPTAESKRVLIIYRDGLIILWAVQESKTIF  541
            +V M+Y IPFS+SH  + K  + A+   L QP AESKRVLII+RDG++ LW +QESK +F
Sbjct  293  LVYMQYRIPFSKSHAEAAK--ETAVTCTLQQPMAESKRVLIIFRDGVMSLWGIQESKVVF  350

Query  542  TTGGNALQSVNHEAXKATAACWACPNGTK  628
            T GGN      +E     +ACWAC  G+K
Sbjct  351  TAGGNVQHKSLYEPKSVVSACWACAIGSK  379



>ref|XP_006285838.1| hypothetical protein CARUB_v10007318mg [Capsella rubella]
 gb|EOA18736.1| hypothetical protein CARUB_v10007318mg [Capsella rubella]
Length=1046

 Score =   238 bits (607),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 108/210 (51%), Positives = 153/210 (73%), Gaps = 3/210 (1%)
 Frame = +2

Query  2    GVPPGALLLAYDSIQKILAISTKDGRIKVFGKDGAQALLESPNIVPSKFMQFMENQGFLI  181
            G+P G+ L AYD IQK+LA+STKDGRIK+FGK   QALL S     S+F++F+ NQG L+
Sbjct  36   GIPSGSHLFAYDPIQKMLAVSTKDGRIKLFGKHQTQALLVSEEASTSRFLEFVHNQGILL  95

Query  182  KINVDNHIEVWNVDQKSLSNIHEFKRDITSFKIIQHTPYMYIGDSLGYVWVLKLEKEPCN  361
             +N  N IEVW++D+K LS++H F  +ITSF+++QHTPY Y+GDS G V VLK+E++   
Sbjct  96   NVNAKNQIEVWDLDKKLLSHVHVFNGEITSFRVMQHTPYFYVGDSSGNVSVLKIEQDSNQ  155

Query  362  VVKMKYHIPFSESHGNS-NKDGDNAIVEILPQPTAESKRVLIIYRDGLIILWAVQESKTI  538
            V++M+Y IP+  S+G+      D ++V ILPQPTAESKR+L+++  G I LW ++ESK +
Sbjct  156  VIQMEYTIPYLASNGSPVEASEDTSVVSILPQPTAESKRILLVFSSGFIALWDIKESKPV  215

Query  539  FTTGGNALQSVNHEAXKATAACWACPNGTK  628
              TGG+ +  V  +A KAT ACW CP+G++
Sbjct  216  LKTGGHGM--VKQDAKKATCACWVCPSGSR  243



>gb|KFK30193.1| hypothetical protein AALP_AA7G230100 [Arabis alpina]
Length=1057

 Score =   236 bits (603),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 108/210 (51%), Positives = 152/210 (72%), Gaps = 3/210 (1%)
 Frame = +2

Query  2    GVPPGALLLAYDSIQKILAISTKDGRIKVFGKDGAQALLESPNIVPSKFMQFMENQGFLI  181
            GVP G+ L AYD   KILA+STKDGRIK+FGKD  Q LL S     SKF++F++NQG L+
Sbjct  36   GVPSGSHLFAYDPFHKILAVSTKDGRIKLFGKDQTQCLLVSVEASTSKFLEFVQNQGLLL  95

Query  182  KINVDNHIEVWNVDQKSLSNIHEFKRDITSFKIIQHTPYMYIGDSLGYVWVLKLEKEPCN  361
             +N  N IEVW++++K LS++H F  +ITSF+++QHTPY Y+GDS G V VLK+E +  +
Sbjct  96   NVNTKNQIEVWDLEKKCLSHVHVFNGEITSFRVMQHTPYFYVGDSSGNVSVLKIEHDSNH  155

Query  362  VVKMKYHIPFSESHGNSNKDGDN-AIVEILPQPTAESKRVLIIYRDGLIILWAVQESKTI  538
            V++M Y IP+  S+G+  +  D+ ++V ILPQPTAESKR+L+++  G I LW ++ESK +
Sbjct  156  VIQMDYTIPYLASNGSPVESSDDTSVVSILPQPTAESKRILLVFSSGFITLWDIKESKPV  215

Query  539  FTTGGNALQSVNHEAXKATAACWACPNGTK  628
              TGG  +  V  +A KAT ACW CP+G++
Sbjct  216  LKTGGYGM--VRQDAKKATCACWVCPSGSR  243



>ref|XP_006412089.1| hypothetical protein EUTSA_v10024291mg [Eutrema salsugineum]
 gb|ESQ53542.1| hypothetical protein EUTSA_v10024291mg [Eutrema salsugineum]
Length=1054

 Score =   234 bits (596),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 107/210 (51%), Positives = 149/210 (71%), Gaps = 3/210 (1%)
 Frame = +2

Query  2    GVPPGALLLAYDSIQKILAISTKDGRIKVFGKDGAQALLESPNIVPSKFMQFMENQGFLI  181
            G+P G+ L  YD IQKIL +STKDGRIK+FGKD  QALL S     S+F++F++NQG L+
Sbjct  36   GIPSGSHLFTYDPIQKILGVSTKDGRIKLFGKDHTQALLVSEEASTSRFLEFVQNQGILL  95

Query  182  KINVDNHIEVWNVDQKSLSNIHEFKRDITSFKIIQHTPYMYIGDSLGYVWVLKLEKEPCN  361
             +N  N IEVW+VD+K LS++H F  +ITSF+++QHTPY Y+GDS G V VLK++++   
Sbjct  96   NVNSKNQIEVWDVDKKLLSHVHVFNGEITSFRVMQHTPYFYVGDSSGNVTVLKIDQDSNQ  155

Query  362  VVKMKYHIPFSESHGNS-NKDGDNAIVEILPQPTAESKRVLIIYRDGLIILWAVQESKTI  538
            V++M Y IP+  S+G+      D ++V ILPQPTAES+R+L+++  G I LW ++ESK I
Sbjct  156  VIQMDYTIPYLASNGSPVEASEDTSVVSILPQPTAESQRILLVFSSGFIALWDIKESKPI  215

Query  539  FTTGGNALQSVNHEAXKATAACWACPNGTK  628
              TG + +  V  EA K T ACW CP G++
Sbjct  216  LKTGAHGM--VKQEAKKVTCACWVCPYGSR  243



>ref|XP_006412090.1| hypothetical protein EUTSA_v10024291mg [Eutrema salsugineum]
 gb|ESQ53543.1| hypothetical protein EUTSA_v10024291mg [Eutrema salsugineum]
Length=1008

 Score =   233 bits (594),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 107/210 (51%), Positives = 149/210 (71%), Gaps = 3/210 (1%)
 Frame = +2

Query  2    GVPPGALLLAYDSIQKILAISTKDGRIKVFGKDGAQALLESPNIVPSKFMQFMENQGFLI  181
            G+P G+ L  YD IQKIL +STKDGRIK+FGKD  QALL S     S+F++F++NQG L+
Sbjct  36   GIPSGSHLFTYDPIQKILGVSTKDGRIKLFGKDHTQALLVSEEASTSRFLEFVQNQGILL  95

Query  182  KINVDNHIEVWNVDQKSLSNIHEFKRDITSFKIIQHTPYMYIGDSLGYVWVLKLEKEPCN  361
             +N  N IEVW+VD+K LS++H F  +ITSF+++QHTPY Y+GDS G V VLK++++   
Sbjct  96   NVNSKNQIEVWDVDKKLLSHVHVFNGEITSFRVMQHTPYFYVGDSSGNVTVLKIDQDSNQ  155

Query  362  VVKMKYHIPFSESHGNS-NKDGDNAIVEILPQPTAESKRVLIIYRDGLIILWAVQESKTI  538
            V++M Y IP+  S+G+      D ++V ILPQPTAES+R+L+++  G I LW ++ESK I
Sbjct  156  VIQMDYTIPYLASNGSPVEASEDTSVVSILPQPTAESQRILLVFSSGFIALWDIKESKPI  215

Query  539  FTTGGNALQSVNHEAXKATAACWACPNGTK  628
              TG + +  V  EA K T ACW CP G++
Sbjct  216  LKTGAHGM--VKQEAKKVTCACWVCPYGSR  243



>ref|XP_010526846.1| PREDICTED: uncharacterized protein LOC104804294 [Tarenaya hassleriana]
Length=1036

 Score =   232 bits (591),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 107/211 (51%), Positives = 154/211 (73%), Gaps = 2/211 (1%)
 Frame = +2

Query  2    GVPPGALLLAYDSIQKILAISTKDGRIKVFGKDGAQALLESPNIVPSKFMQFMENQGFLI  181
            G+P G+ L AYD +QKILA+ST+DGRIK+FGKD +QALL S     SKF++F+ NQG L+
Sbjct  36   GIPTGSHLFAYDPVQKILAVSTRDGRIKLFGKDHSQALLVSEEASSSKFLEFVHNQGILL  95

Query  182  KINVDNHIEVWNVDQKSLSNIHEFKRDITSFKIIQHTPYMYIGDSLGYVWVLKLEKEPCN  361
             +NV N IEVW++++K +S++H F  +ITSF+++Q TPY Y+GD+ G V VL+LE++   
Sbjct  96   NVNVKNQIEVWDIERKIVSHVHVFNGEITSFRVMQRTPYFYVGDASGNVTVLRLEQDSGQ  155

Query  362  VVKMKYHIPFSESHGNS-NKDGDNAIVEILPQPTAESKRVLIIYRDGLIILWAVQESKTI  538
            VV+M Y IP+  S+G+     GD A+V IL QP AE KR+L+++ +G+I LW + ESK I
Sbjct  156  VVQMDYTIPYLASNGSPVEAHGDTAVVNILLQPMAEGKRILLVFGNGVIALWDISESKPI  215

Query  539  FTTGGNALQSVNHE-AXKATAACWACPNGTK  628
               GG+ +QSV H+   KAT+ACW CP+ ++
Sbjct  216  LKMGGHGIQSVQHQDVKKATSACWVCPHESR  246



>emb|CDX72547.1| BnaC07g45690D [Brassica napus]
Length=1030

 Score =   232 bits (591),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 105/210 (50%), Positives = 148/210 (70%), Gaps = 7/210 (3%)
 Frame = +2

Query  2    GVPPGALLLAYDSIQKILAISTKDGRIKVFGKDGAQALLESPNIVPSKFMQFMENQGFLI  181
            G+P GA L AYD +QKILA+STKDGRIK FGKD  QALL S     SK ++F++NQG L+
Sbjct  36   GIPSGAHLFAYDPVQKILAVSTKDGRIKFFGKDQTQALLVSEEASTSKLIEFVQNQGLLL  95

Query  182  KINVDNHIEVWNVDQKSLSNIHEFKRDITSFKIIQHTPYMYIGDSLGYVWVLKLEKEPCN  361
             +N  N IEVW++++K +S++H F  +ITS +++QHTPY Y+GDS G V VLK++++   
Sbjct  96   NVNSKNQIEVWDLEKKLMSHVHVFNGEITSLRVMQHTPYFYVGDSSGNVSVLKIDQDSSQ  155

Query  362  VVKMKYHIPFSESHGNS-NKDGDNAIVEILPQPTAESKRVLIIYRDGLIILWAVQESKTI  538
            V++M Y IP+  S+G+      D ++V ILPQPTAE+KR+L+++  G I LW ++ESK +
Sbjct  156  VIQMDYTIPYLASNGSPVEASDDTSVVSILPQPTAETKRILLVFSSGFITLWDIKESKPV  215

Query  539  FTTGGNALQSVNHEAXKATAACWACPNGTK  628
              TGG        EA KAT ACW CP+G++
Sbjct  216  LKTGG------KQEAKKATCACWVCPSGSR  239



>ref|NP_001190926.1| DUO1-activated WD40 1 [Arabidopsis thaliana]
 gb|AEE86531.1| DUO1-activated WD40 1 [Arabidopsis thaliana]
Length=1050

 Score =   229 bits (583),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 105/210 (50%), Positives = 150/210 (71%), Gaps = 3/210 (1%)
 Frame = +2

Query  2    GVPPGALLLAYDSIQKILAISTKDGRIKVFGKDGAQALLESPNIVPSKFMQFMENQGFLI  181
            G+P G+ L AYD  QKILA+STKDGRIK+FGKD  QALL S     S+F++F++NQG L+
Sbjct  36   GIPSGSHLFAYDPFQKILAVSTKDGRIKLFGKDQTQALLVSEETSTSRFLEFVQNQGILL  95

Query  182  KINVDNHIEVWNVDQKSLSNIHEFKRDITSFKIIQHTPYMYIGDSLGYVWVLKLEKEPCN  361
             +N  N IEVW++D+K LS++H F  +ITSF+++QHTPY Y+GDS G V V K+E++   
Sbjct  96   NVNSKNQIEVWDLDKKLLSHVHVFNGEITSFRVMQHTPYFYVGDSSGNVSVFKIEQDSNQ  155

Query  362  VVKMKYHIPFSESHGNS-NKDGDNAIVEILPQPTAESKRVLIIYRDGLIILWAVQESKTI  538
            V++++Y IP+  S+G+      D ++V ILPQ TAESKR+L+++  G I LW ++ESK I
Sbjct  156  VIQLEYTIPYLASNGSPIEASEDTSVVSILPQLTAESKRILLVFSSGFIALWDIKESKPI  215

Query  539  FTTGGNALQSVNHEAXKATAACWACPNGTK  628
              TG + +  V  +  KAT ACW CP+G++
Sbjct  216  LKTGVHGM--VKQDTKKATCACWVCPSGSR  243



>ref|NP_195281.2| DUO1-activated WD40 1 [Arabidopsis thaliana]
 dbj|BAF00759.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE86530.1| DUO1-activated WD40 1 [Arabidopsis thaliana]
Length=1049

 Score =   229 bits (583),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 105/210 (50%), Positives = 150/210 (71%), Gaps = 3/210 (1%)
 Frame = +2

Query  2    GVPPGALLLAYDSIQKILAISTKDGRIKVFGKDGAQALLESPNIVPSKFMQFMENQGFLI  181
            G+P G+ L AYD  QKILA+STKDGRIK+FGKD  QALL S     S+F++F++NQG L+
Sbjct  36   GIPSGSHLFAYDPFQKILAVSTKDGRIKLFGKDQTQALLVSEETSTSRFLEFVQNQGILL  95

Query  182  KINVDNHIEVWNVDQKSLSNIHEFKRDITSFKIIQHTPYMYIGDSLGYVWVLKLEKEPCN  361
             +N  N IEVW++D+K LS++H F  +ITSF+++QHTPY Y+GDS G V V K+E++   
Sbjct  96   NVNSKNQIEVWDLDKKLLSHVHVFNGEITSFRVMQHTPYFYVGDSSGNVSVFKIEQDSNQ  155

Query  362  VVKMKYHIPFSESHGNS-NKDGDNAIVEILPQPTAESKRVLIIYRDGLIILWAVQESKTI  538
            V++++Y IP+  S+G+      D ++V ILPQ TAESKR+L+++  G I LW ++ESK I
Sbjct  156  VIQLEYTIPYLASNGSPIEASEDTSVVSILPQLTAESKRILLVFSSGFIALWDIKESKPI  215

Query  539  FTTGGNALQSVNHEAXKATAACWACPNGTK  628
              TG + +  V  +  KAT ACW CP+G++
Sbjct  216  LKTGVHGM--VKQDTKKATCACWVCPSGSR  243



>gb|ERN17199.1| hypothetical protein AMTR_s00044p00158440 [Amborella trichopoda]
Length=1025

 Score =   228 bits (581),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 107/210 (51%), Positives = 145/210 (69%), Gaps = 1/210 (0%)
 Frame = +2

Query  2    GVPPGALLLAYDSIQKILAISTKDGRIKVFGKDGAQALLESPNIVPSKFMQFMENQGFLI  181
            G+P G+  LA DSIQ ILAISTKDGRIK+ G D AQ LLES    PSKF+QF+ENQG L+
Sbjct  32   GIPEGSETLALDSIQNILAISTKDGRIKLVGVDQAQVLLESTEGAPSKFLQFLENQGILL  91

Query  182  KINVDNHIEVWNVDQKSLSNIHEFKRDITSFKIIQHTPYMYIGDSLGYVWVLKLEKEPCN  361
             +   N IEVW++D+K LS ++ F+ +ITSF +IQ + +MYIG+SLG + V+K ++E C 
Sbjct  92   NVTTKNQIEVWDIDKKELSFMYTFEEEITSFTVIQGSHFMYIGNSLGNISVMKFDRESCQ  151

Query  362  VVKMKYHIPFSESHGN-SNKDGDNAIVEILPQPTAESKRVLIIYRDGLIILWAVQESKTI  538
            ++ M+Y IP S S G+ S    D ++  ILPQP AE++R L+I+    II+W   ESK I
Sbjct  152  LIHMQYTIPLSASRGSMSETSEDTSVAYILPQPLAETRRTLVIFGSSRIIVWDTMESKVI  211

Query  539  FTTGGNALQSVNHEAXKATAACWACPNGTK  628
               G ++LQS +    + T+ACWACP GTK
Sbjct  212  AVNGSSSLQSCHESNKRVTSACWACPVGTK  241



>ref|XP_011627590.1| PREDICTED: uncharacterized protein LOC18445533 [Amborella trichopoda]
Length=1159

 Score =   228 bits (580),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 107/210 (51%), Positives = 145/210 (69%), Gaps = 1/210 (0%)
 Frame = +2

Query  2    GVPPGALLLAYDSIQKILAISTKDGRIKVFGKDGAQALLESPNIVPSKFMQFMENQGFLI  181
            G+P G+  LA DSIQ ILAISTKDGRIK+ G D AQ LLES    PSKF+QF+ENQG L+
Sbjct  133  GIPEGSETLALDSIQNILAISTKDGRIKLVGVDQAQVLLESTEGAPSKFLQFLENQGILL  192

Query  182  KINVDNHIEVWNVDQKSLSNIHEFKRDITSFKIIQHTPYMYIGDSLGYVWVLKLEKEPCN  361
             +   N IEVW++D+K LS ++ F+ +ITSF +IQ + +MYIG+SLG + V+K ++E C 
Sbjct  193  NVTTKNQIEVWDIDKKELSFMYTFEEEITSFTVIQGSHFMYIGNSLGNISVMKFDRESCQ  252

Query  362  VVKMKYHIPFSESHGN-SNKDGDNAIVEILPQPTAESKRVLIIYRDGLIILWAVQESKTI  538
            ++ M+Y IP S S G+ S    D ++  ILPQP AE++R L+I+    II+W   ESK I
Sbjct  253  LIHMQYTIPLSASRGSMSETSEDTSVAYILPQPLAETRRTLVIFGSSRIIVWDTMESKVI  312

Query  539  FTTGGNALQSVNHEAXKATAACWACPNGTK  628
               G ++LQS +    + T+ACWACP GTK
Sbjct  313  AVNGSSSLQSCHESNKRVTSACWACPVGTK  342



>ref|XP_009400998.1| PREDICTED: uncharacterized protein LOC103985112 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=1051

 Score =   226 bits (577),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 114/210 (54%), Positives = 146/210 (70%), Gaps = 2/210 (1%)
 Frame = +2

Query  2    GVPPGALLLAYDSIQKILAISTKDGRIKVFGKDGAQALLESPNIVPSKFMQFMENQGFLI  181
            GVPP +  LAYD IQ ILAIST++G IK+ GKD +QALL+S    PSKFMQFMENQG L+
Sbjct  37   GVPPESSSLAYDPIQHILAISTRNGVIKLLGKDNSQALLQSEAASPSKFMQFMENQGILL  96

Query  182  KINVDNHIEVWNVDQKSLSNIHEFKRDITSFKIIQHTPYMYIGDSLGYVWVLKLEKEPCN  361
             +   NHIEVWN+D+K ++++H F  +ITSF ++Q + Y+Y+GD LG V VLKL+     
Sbjct  97   NVTSHNHIEVWNIDKKQVTHVHIFNEEITSFVVVQQSFYIYVGDCLGNVTVLKLDNTLQC  156

Query  362  VVKMKYHIPFSESHGNSNK-DGDNAIVEILPQPTAESKRVLIIYRDGLIILWAVQESKTI  538
            +VKM Y IP SES G   + D D A++   PQP AESKRVLII+R+GLI LW +QESK +
Sbjct  157  LVKMPYKIPPSESCGTQTEADSDTAVIFSSPQPLAESKRVLIIFRNGLISLWGIQESKVL  216

Query  539  FTTGGNALQSVNHEAXKATAACWACPNGTK  628
               GGNA Q  + E     +A WAC  G+K
Sbjct  217  LVAGGNA-QHSSQEPKLVVSASWACVFGSK  245



>ref|XP_009400997.1| PREDICTED: uncharacterized protein LOC103985112 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=1054

 Score =   226 bits (577),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 114/210 (54%), Positives = 146/210 (70%), Gaps = 2/210 (1%)
 Frame = +2

Query  2    GVPPGALLLAYDSIQKILAISTKDGRIKVFGKDGAQALLESPNIVPSKFMQFMENQGFLI  181
            GVPP +  LAYD IQ ILAIST++G IK+ GKD +QALL+S    PSKFMQFMENQG L+
Sbjct  37   GVPPESSSLAYDPIQHILAISTRNGVIKLLGKDNSQALLQSEAASPSKFMQFMENQGILL  96

Query  182  KINVDNHIEVWNVDQKSLSNIHEFKRDITSFKIIQHTPYMYIGDSLGYVWVLKLEKEPCN  361
             +   NHIEVWN+D+K ++++H F  +ITSF ++Q + Y+Y+GD LG V VLKL+     
Sbjct  97   NVTSHNHIEVWNIDKKQVTHVHIFNEEITSFVVVQQSFYIYVGDCLGNVTVLKLDNTLQC  156

Query  362  VVKMKYHIPFSESHGNSNK-DGDNAIVEILPQPTAESKRVLIIYRDGLIILWAVQESKTI  538
            +VKM Y IP SES G   + D D A++   PQP AESKRVLII+R+GLI LW +QESK +
Sbjct  157  LVKMPYKIPPSESCGTQTEADSDTAVIFSSPQPLAESKRVLIIFRNGLISLWGIQESKVL  216

Query  539  FTTGGNALQSVNHEAXKATAACWACPNGTK  628
               GGNA Q  + E     +A WAC  G+K
Sbjct  217  LVAGGNA-QHSSQEPKLVVSASWACVFGSK  245



>ref|XP_009400999.1| PREDICTED: uncharacterized protein LOC103985112 isoform X3 [Musa 
acuminata subsp. malaccensis]
Length=1049

 Score =   226 bits (577),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 114/210 (54%), Positives = 146/210 (70%), Gaps = 2/210 (1%)
 Frame = +2

Query  2    GVPPGALLLAYDSIQKILAISTKDGRIKVFGKDGAQALLESPNIVPSKFMQFMENQGFLI  181
            GVPP +  LAYD IQ ILAIST++G IK+ GKD +QALL+S    PSKFMQFMENQG L+
Sbjct  37   GVPPESSSLAYDPIQHILAISTRNGVIKLLGKDNSQALLQSEAASPSKFMQFMENQGILL  96

Query  182  KINVDNHIEVWNVDQKSLSNIHEFKRDITSFKIIQHTPYMYIGDSLGYVWVLKLEKEPCN  361
             +   NHIEVWN+D+K ++++H F  +ITSF ++Q + Y+Y+GD LG V VLKL+     
Sbjct  97   NVTSHNHIEVWNIDKKQVTHVHIFNEEITSFVVVQQSFYIYVGDCLGNVTVLKLDNTLQC  156

Query  362  VVKMKYHIPFSESHGNSNK-DGDNAIVEILPQPTAESKRVLIIYRDGLIILWAVQESKTI  538
            +VKM Y IP SES G   + D D A++   PQP AESKRVLII+R+GLI LW +QESK +
Sbjct  157  LVKMPYKIPPSESCGTQTEADSDTAVIFSSPQPLAESKRVLIIFRNGLISLWGIQESKVL  216

Query  539  FTTGGNALQSVNHEAXKATAACWACPNGTK  628
               GGNA Q  + E     +A WAC  G+K
Sbjct  217  LVAGGNA-QHSSQEPKLVVSASWACVFGSK  245



>ref|XP_010548217.1| PREDICTED: uncharacterized protein LOC104819720 isoform X6 [Tarenaya 
hassleriana]
Length=1043

 Score =   226 bits (576),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 106/210 (50%), Positives = 146/210 (70%), Gaps = 4/210 (2%)
 Frame = +2

Query  2    GVPPGALLLAYDSIQKILAISTKDGRIKVFGKDGAQALLESPNIVPSKFMQFMENQGFLI  181
            G+P G+ +  YD IQKILA+ST+DGRIK+FGKD  QALL S     +KF+ F+ NQG L+
Sbjct  36   GIPSGSCMFGYDPIQKILAVSTRDGRIKLFGKDHTQALLVSEEASTTKFLDFVHNQGILL  95

Query  182  KINVDNHIEVWNVDQKSLSNIHEFKRDITSFKIIQHTPYMYIGDSLGYVWVLKLEKEPCN  361
             +NV N IEVW++D+K LS++H F   ITSF+++Q  PY Y+GDS G V VL+L  +   
Sbjct  96   VVNVKNRIEVWDIDKKLLSHVHVFNGKITSFRVMQVIPYFYVGDSSGNVTVLRLVPDSGK  155

Query  362  VVKMKYHIPFSESHGNSNKDGDNAIVEILPQPTAESKRVLIIYRDGLIILWAVQESKTIF  541
            VV+M Y IPF  S+G+    GD A++ ILPQP  E +R+L+I+ +G+I LW + ES+ I 
Sbjct  156  VVQMDYTIPFVASNGSP---GDTAVINILPQPMTERERILLIFGNGVIALWDITESRPIL  212

Query  542  TTGGNALQSVNHE-AXKATAACWACPNGTK  628
              GG+ +QS  H+   KAT+ACW CP G+K
Sbjct  213  KMGGHGIQSAQHQDMKKATSACWVCPLGSK  242



>ref|XP_010548216.1| PREDICTED: uncharacterized protein LOC104819720 isoform X5 [Tarenaya 
hassleriana]
Length=1069

 Score =   226 bits (575),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 106/210 (50%), Positives = 146/210 (70%), Gaps = 4/210 (2%)
 Frame = +2

Query  2    GVPPGALLLAYDSIQKILAISTKDGRIKVFGKDGAQALLESPNIVPSKFMQFMENQGFLI  181
            G+P G+ +  YD IQKILA+ST+DGRIK+FGKD  QALL S     +KF+ F+ NQG L+
Sbjct  36   GIPSGSCMFGYDPIQKILAVSTRDGRIKLFGKDHTQALLVSEEASTTKFLDFVHNQGILL  95

Query  182  KINVDNHIEVWNVDQKSLSNIHEFKRDITSFKIIQHTPYMYIGDSLGYVWVLKLEKEPCN  361
             +NV N IEVW++D+K LS++H F   ITSF+++Q  PY Y+GDS G V VL+L  +   
Sbjct  96   VVNVKNRIEVWDIDKKLLSHVHVFNGKITSFRVMQVIPYFYVGDSSGNVTVLRLVPDSGK  155

Query  362  VVKMKYHIPFSESHGNSNKDGDNAIVEILPQPTAESKRVLIIYRDGLIILWAVQESKTIF  541
            VV+M Y IPF  S+G+    GD A++ ILPQP  E +R+L+I+ +G+I LW + ES+ I 
Sbjct  156  VVQMDYTIPFVASNGSP---GDTAVINILPQPMTERERILLIFGNGVIALWDITESRPIL  212

Query  542  TTGGNALQSVNHE-AXKATAACWACPNGTK  628
              GG+ +QS  H+   KAT+ACW CP G+K
Sbjct  213  KMGGHGIQSAQHQDMKKATSACWVCPLGSK  242



>ref|XP_010548212.1| PREDICTED: uncharacterized protein LOC104819720 isoform X2 [Tarenaya 
hassleriana]
Length=1104

 Score =   226 bits (575),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 106/210 (50%), Positives = 146/210 (70%), Gaps = 4/210 (2%)
 Frame = +2

Query  2    GVPPGALLLAYDSIQKILAISTKDGRIKVFGKDGAQALLESPNIVPSKFMQFMENQGFLI  181
            G+P G+ +  YD IQKILA+ST+DGRIK+FGKD  QALL S     +KF+ F+ NQG L+
Sbjct  36   GIPSGSCMFGYDPIQKILAVSTRDGRIKLFGKDHTQALLVSEEASTTKFLDFVHNQGILL  95

Query  182  KINVDNHIEVWNVDQKSLSNIHEFKRDITSFKIIQHTPYMYIGDSLGYVWVLKLEKEPCN  361
             +NV N IEVW++D+K LS++H F   ITSF+++Q  PY Y+GDS G V VL+L  +   
Sbjct  96   VVNVKNRIEVWDIDKKLLSHVHVFNGKITSFRVMQVIPYFYVGDSSGNVTVLRLVPDSGK  155

Query  362  VVKMKYHIPFSESHGNSNKDGDNAIVEILPQPTAESKRVLIIYRDGLIILWAVQESKTIF  541
            VV+M Y IPF  S+G+    GD A++ ILPQP  E +R+L+I+ +G+I LW + ES+ I 
Sbjct  156  VVQMDYTIPFVASNGSP---GDTAVINILPQPMTERERILLIFGNGVIALWDITESRPIL  212

Query  542  TTGGNALQSVNHE-AXKATAACWACPNGTK  628
              GG+ +QS  H+   KAT+ACW CP G+K
Sbjct  213  KMGGHGIQSAQHQDMKKATSACWVCPLGSK  242



>ref|XP_010548221.1| PREDICTED: uncharacterized protein LOC104819720 isoform X10 [Tarenaya 
hassleriana]
Length=975

 Score =   221 bits (562),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 106/211 (50%), Positives = 146/211 (69%), Gaps = 5/211 (2%)
 Frame = +2

Query  2    GVPPGALLLAYDSIQKILAISTKDGRIKVFGKDGAQALLESPNIVPSKFMQFMENQGFLI  181
            G+P G+ +  YD IQKILA+ST+DGRIK+FGKD  QALL S     +KF+ F+ NQG L+
Sbjct  36   GIPSGSCMFGYDPIQKILAVSTRDGRIKLFGKDHTQALLVSEEASTTKFLDFVHNQGILL  95

Query  182  KINVDNHIEVWNVDQKSLSNIHEFKRDITSFKIIQHTPYM-YIGDSLGYVWVLKLEKEPC  358
             +NV N IEVW++D+K LS++H F   ITSF+++Q  PY  Y+GDS G V VL+L  +  
Sbjct  96   VVNVKNRIEVWDIDKKLLSHVHVFNGKITSFRVMQVIPYFSYVGDSSGNVTVLRLVPDSG  155

Query  359  NVVKMKYHIPFSESHGNSNKDGDNAIVEILPQPTAESKRVLIIYRDGLIILWAVQESKTI  538
             VV+M Y IPF  S+G+    GD A++ ILPQP  E +R+L+I+ +G+I LW + ES+ I
Sbjct  156  KVVQMDYTIPFVASNGSP---GDTAVINILPQPMTERERILLIFGNGVIALWDITESRPI  212

Query  539  FTTGGNALQSVNHE-AXKATAACWACPNGTK  628
               GG+ +QS  H+   KAT+ACW CP G+K
Sbjct  213  LKMGGHGIQSAQHQDMKKATSACWVCPLGSK  243



>ref|XP_010548218.1| PREDICTED: uncharacterized protein LOC104819720 isoform X7 [Tarenaya 
hassleriana]
Length=1000

 Score =   221 bits (562),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 106/211 (50%), Positives = 146/211 (69%), Gaps = 5/211 (2%)
 Frame = +2

Query  2    GVPPGALLLAYDSIQKILAISTKDGRIKVFGKDGAQALLESPNIVPSKFMQFMENQGFLI  181
            G+P G+ +  YD IQKILA+ST+DGRIK+FGKD  QALL S     +KF+ F+ NQG L+
Sbjct  36   GIPSGSCMFGYDPIQKILAVSTRDGRIKLFGKDHTQALLVSEEASTTKFLDFVHNQGILL  95

Query  182  KINVDNHIEVWNVDQKSLSNIHEFKRDITSFKIIQHTPYM-YIGDSLGYVWVLKLEKEPC  358
             +NV N IEVW++D+K LS++H F   ITSF+++Q  PY  Y+GDS G V VL+L  +  
Sbjct  96   VVNVKNRIEVWDIDKKLLSHVHVFNGKITSFRVMQVIPYFSYVGDSSGNVTVLRLVPDSG  155

Query  359  NVVKMKYHIPFSESHGNSNKDGDNAIVEILPQPTAESKRVLIIYRDGLIILWAVQESKTI  538
             VV+M Y IPF  S+G+    GD A++ ILPQP  E +R+L+I+ +G+I LW + ES+ I
Sbjct  156  KVVQMDYTIPFVASNGS---PGDTAVINILPQPMTERERILLIFGNGVIALWDITESRPI  212

Query  539  FTTGGNALQSVNHE-AXKATAACWACPNGTK  628
               GG+ +QS  H+   KAT+ACW CP G+K
Sbjct  213  LKMGGHGIQSAQHQDMKKATSACWVCPLGSK  243



>ref|XP_010548214.1| PREDICTED: uncharacterized protein LOC104819720 isoform X4 [Tarenaya 
hassleriana]
Length=1070

 Score =   221 bits (563),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 106/211 (50%), Positives = 146/211 (69%), Gaps = 5/211 (2%)
 Frame = +2

Query  2    GVPPGALLLAYDSIQKILAISTKDGRIKVFGKDGAQALLESPNIVPSKFMQFMENQGFLI  181
            G+P G+ +  YD IQKILA+ST+DGRIK+FGKD  QALL S     +KF+ F+ NQG L+
Sbjct  36   GIPSGSCMFGYDPIQKILAVSTRDGRIKLFGKDHTQALLVSEEASTTKFLDFVHNQGILL  95

Query  182  KINVDNHIEVWNVDQKSLSNIHEFKRDITSFKIIQHTPYM-YIGDSLGYVWVLKLEKEPC  358
             +NV N IEVW++D+K LS++H F   ITSF+++Q  PY  Y+GDS G V VL+L  +  
Sbjct  96   VVNVKNRIEVWDIDKKLLSHVHVFNGKITSFRVMQVIPYFSYVGDSSGNVTVLRLVPDSG  155

Query  359  NVVKMKYHIPFSESHGNSNKDGDNAIVEILPQPTAESKRVLIIYRDGLIILWAVQESKTI  538
             VV+M Y IPF  S+G+    GD A++ ILPQP  E +R+L+I+ +G+I LW + ES+ I
Sbjct  156  KVVQMDYTIPFVASNGSP---GDTAVINILPQPMTERERILLIFGNGVIALWDITESRPI  212

Query  539  FTTGGNALQSVNHE-AXKATAACWACPNGTK  628
               GG+ +QS  H+   KAT+ACW CP G+K
Sbjct  213  LKMGGHGIQSAQHQDMKKATSACWVCPLGSK  243



>ref|XP_010548213.1| PREDICTED: uncharacterized protein LOC104819720 isoform X3 [Tarenaya 
hassleriana]
Length=1079

 Score =   221 bits (563),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 106/211 (50%), Positives = 146/211 (69%), Gaps = 5/211 (2%)
 Frame = +2

Query  2    GVPPGALLLAYDSIQKILAISTKDGRIKVFGKDGAQALLESPNIVPSKFMQFMENQGFLI  181
            G+P G+ +  YD IQKILA+ST+DGRIK+FGKD  QALL S     +KF+ F+ NQG L+
Sbjct  36   GIPSGSCMFGYDPIQKILAVSTRDGRIKLFGKDHTQALLVSEEASTTKFLDFVHNQGILL  95

Query  182  KINVDNHIEVWNVDQKSLSNIHEFKRDITSFKIIQHTPYM-YIGDSLGYVWVLKLEKEPC  358
             +NV N IEVW++D+K LS++H F   ITSF+++Q  PY  Y+GDS G V VL+L  +  
Sbjct  96   VVNVKNRIEVWDIDKKLLSHVHVFNGKITSFRVMQVIPYFSYVGDSSGNVTVLRLVPDSG  155

Query  359  NVVKMKYHIPFSESHGNSNKDGDNAIVEILPQPTAESKRVLIIYRDGLIILWAVQESKTI  538
             VV+M Y IPF  S+G+    GD A++ ILPQP  E +R+L+I+ +G+I LW + ES+ I
Sbjct  156  KVVQMDYTIPFVASNGSP---GDTAVINILPQPMTERERILLIFGNGVIALWDITESRPI  212

Query  539  FTTGGNALQSVNHE-AXKATAACWACPNGTK  628
               GG+ +QS  H+   KAT+ACW CP G+K
Sbjct  213  LKMGGHGIQSAQHQDMKKATSACWVCPLGSK  243



>ref|XP_010548211.1| PREDICTED: uncharacterized protein LOC104819720 isoform X1 [Tarenaya 
hassleriana]
Length=1105

 Score =   221 bits (563),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 106/211 (50%), Positives = 146/211 (69%), Gaps = 5/211 (2%)
 Frame = +2

Query  2    GVPPGALLLAYDSIQKILAISTKDGRIKVFGKDGAQALLESPNIVPSKFMQFMENQGFLI  181
            G+P G+ +  YD IQKILA+ST+DGRIK+FGKD  QALL S     +KF+ F+ NQG L+
Sbjct  36   GIPSGSCMFGYDPIQKILAVSTRDGRIKLFGKDHTQALLVSEEASTTKFLDFVHNQGILL  95

Query  182  KINVDNHIEVWNVDQKSLSNIHEFKRDITSFKIIQHTPYM-YIGDSLGYVWVLKLEKEPC  358
             +NV N IEVW++D+K LS++H F   ITSF+++Q  PY  Y+GDS G V VL+L  +  
Sbjct  96   VVNVKNRIEVWDIDKKLLSHVHVFNGKITSFRVMQVIPYFSYVGDSSGNVTVLRLVPDSG  155

Query  359  NVVKMKYHIPFSESHGNSNKDGDNAIVEILPQPTAESKRVLIIYRDGLIILWAVQESKTI  538
             VV+M Y IPF  S+G+    GD A++ ILPQP  E +R+L+I+ +G+I LW + ES+ I
Sbjct  156  KVVQMDYTIPFVASNGSP---GDTAVINILPQPMTERERILLIFGNGVIALWDITESRPI  212

Query  539  FTTGGNALQSVNHE-AXKATAACWACPNGTK  628
               GG+ +QS  H+   KAT+ACW CP G+K
Sbjct  213  LKMGGHGIQSAQHQDMKKATSACWVCPLGSK  243



>gb|KHN38868.1| Syntaxin-binding protein 5 [Glycine soja]
Length=1025

 Score =   218 bits (556),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 105/210 (50%), Positives = 145/210 (69%), Gaps = 19/210 (9%)
 Frame = +2

Query  2    GVPPGALLLAYDSIQKILAISTKDGRIKVFGKDGAQALLESPNIVPSKFMQFMENQGFLI  181
            GVP G    AYD+  +ILA++TKDG+IK++GKD AQA+LES   +PSKF+Q         
Sbjct  25   GVPSGGAKFAYDTTLRILALATKDGQIKLYGKDNAQAMLESSEPLPSKFLQ---------  75

Query  182  KINVDNHIEVWNVDQKSLSNIHEFKRDITSFKIIQHTPYMYIGDSLGYVWVLKLEKEPC-  358
                     VW++++K LS+++  K +ITSF +IQH+ YMYIG S G + V KL++EP  
Sbjct  76   ---------VWDIEKKLLSDVYIAKDEITSFTVIQHSLYMYIGHSNGNISVFKLDQEPSW  126

Query  359  NVVKMKYHIPFSESHGNSNKDGDNAIVEILPQPTAESKRVLIIYRDGLIILWAVQESKTI  538
            ++ +MKY IP S SHGNS    D A+  ILPQP A+SKRVLI++R+G +ILW ++ES++I
Sbjct  127  HLAQMKYTIPLSASHGNSEASDDTAVTHILPQPAADSKRVLIVFRNGQMILWDIRESRSI  186

Query  539  FTTGGNALQSVNHEAXKATAACWACPNGTK  628
            F TGGN LQ ++ E  K T+ACW CP G+K
Sbjct  187  FRTGGNMLQPLHTETKKVTSACWVCPFGSK  216



>gb|KHN41818.1| Syntaxin-binding protein 5-like [Glycine soja]
Length=927

 Score =   216 bits (550),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 107/210 (51%), Positives = 146/210 (70%), Gaps = 19/210 (9%)
 Frame = +2

Query  2    GVPPGALLLAYDSIQKILAISTKDGRIKVFGKDGAQALLESPNIVPSKFMQFMENQGFLI  181
            GVP G    AYD+IQKILA+STKDGRIK+FG+D AQ LLES   VPSKF+          
Sbjct  14   GVPSGGAKFAYDNIQKILALSTKDGRIKLFGEDNAQVLLESKEPVPSKFLL---------  64

Query  182  KINVDNHIEVWNVDQKSLSNIHEFKRDITSFKIIQHTPYMYIGDSLGYVWVLKLEKEPCN  361
                     VW++D+K LS+++  K +IT F +I+H+ +MYIG S G + VL L++EP +
Sbjct  65   ---------VWDIDKKLLSDVYIVKEEITCFSVIKHSLFMYIGFSNGNISVLMLDQEPWH  115

Query  362  VVKMKYHIPFSESHGNSNKDGDNAIV-EILPQPTAESKRVLIIYRDGLIILWAVQESKTI  538
            VV+MKY IP S S+GNS ++ D+ +V  +LPQP AES+RVLII+R+G IILW ++E ++I
Sbjct  116  VVRMKYTIPLSASYGNSTEESDDTVVTHVLPQPAAESQRVLIIFRNGQIILWDIREIRSI  175

Query  539  FTTGGNALQSVNHEAXKATAACWACPNGTK  628
            F TGG  LQ+  +E  K ++ACW CP G+K
Sbjct  176  FRTGGKILQTRYNETRKVSSACWVCPFGSK  205



>gb|EEC77809.1| hypothetical protein OsI_16999 [Oryza sativa Indica Group]
Length=1025

 Score =   216 bits (549),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 100/210 (48%), Positives = 147/210 (70%), Gaps = 1/210 (0%)
 Frame = +2

Query  2    GVPPGALLLAYDSIQKILAISTKDGRIKVFGKDGAQALLESPNIVPSKFMQFMENQGFLI  181
            GVP  A LLAYD    +LA++T++G+IK+FG+D  QALL+SP+ VPSKF++F E QG L+
Sbjct  36   GVPADAALLAYDPALHVLAVATRNGQIKLFGRDNTQALLQSPSPVPSKFLRFAEGQGVLL  95

Query  182  KINVDNHIEVWNVDQKSLSNIHEFKRDITSFKIIQHTPYMYIGDSLGYVWVLKLEKEPCN  361
             +NV N IE+W++D K L  +H F+++IT+F ++Q++ Y+Y+GDS G V +LKL+     
Sbjct  96   NVNVKNQIEIWDIDTKKLCYVHPFEKEITAFSVLQNSFYIYVGDSFGNVSLLKLDLGQTC  155

Query  362  VVKMKYHIPFSESHGNSNKDGDNAIVEIL-PQPTAESKRVLIIYRDGLIILWAVQESKTI  538
            +V M Y IPFSES+G+    G+   V  + PQP AE+ RVLII+RDG++ LW ++ SK +
Sbjct  156  LVDMPYWIPFSESYGSGANVGNEVEVAFVSPQPLAENNRVLIIFRDGIMSLWDIKTSKVV  215

Query  539  FTTGGNALQSVNHEAXKATAACWACPNGTK  628
              +G +  Q  + EA   T+ACWAC  G+K
Sbjct  216  SLSGKSMQQQSHQEAKAVTSACWACAKGSK  245



>ref|NP_001174047.1| Os04g0564700 [Oryza sativa Japonica Group]
 dbj|BAH92775.1| Os04g0564700 [Oryza sativa Japonica Group]
Length=624

 Score =   208 bits (530),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 97/210 (46%), Positives = 144/210 (69%), Gaps = 1/210 (0%)
 Frame = +2

Query  2    GVPPGALLLAYDSIQKILAISTKDGRIKVFGKDGAQALLESPNIVPSKFMQFMENQGFLI  181
            GVP  A LLAYD    +LA++ ++G+IK+FG+D  QALL+SP+ VPSKF++F E Q  L+
Sbjct  36   GVPADAALLAYDPALHVLAVAIRNGQIKLFGRDNTQALLQSPSPVPSKFLRFAEGQRVLL  95

Query  182  KINVDNHIEVWNVDQKSLSNIHEFKRDITSFKIIQHTPYMYIGDSLGYVWVLKLEKEPCN  361
             +N  N IE+W++D K L  +H F+++IT+F ++Q++ Y+Y+GDS G V +LKL+     
Sbjct  96   NVNAKNQIEIWDIDTKKLCYVHPFEKEITAFSVLQNSFYIYVGDSFGNVSLLKLDLGQTC  155

Query  362  VVKMKYHIPFSESHGNSNKDGDNAIVEIL-PQPTAESKRVLIIYRDGLIILWAVQESKTI  538
            +V M Y IPFSES+G+    G+   V  + PQP AE+ RVLII+RDG++ LW ++ SK +
Sbjct  156  LVDMPYWIPFSESYGSGANVGNEVEVAFVSPQPLAENNRVLIIFRDGIMSLWDIKTSKVV  215

Query  539  FTTGGNALQSVNHEAXKATAACWACPNGTK  628
              +G +  Q  + EA   T+ACWAC  G+K
Sbjct  216  SLSGKSMQQQSHQEAKAVTSACWACAKGSK  245



>dbj|BAJ98402.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=1023

 Score =   212 bits (539),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 95/210 (45%), Positives = 144/210 (69%), Gaps = 1/210 (0%)
 Frame = +2

Query  2    GVPPGALLLAYDSIQKILAISTKDGRIKVFGKDGAQALLESPNIVPSKFMQFMENQGFLI  181
            GVP  A LLAYD +  +LA+ T++G+IK+FG+D  QALL+SP+ +PSKF+QF + QG L+
Sbjct  36   GVPADAALLAYDPLLHVLAVGTRNGQIKLFGRDNTQALLQSPSPIPSKFLQFADGQGLLL  95

Query  182  KINVDNHIEVWNVDQKSLSNIHEFKRDITSFKIIQHTPYMYIGDSLGYVWVLKLEKEPCN  361
             ++  N IEVW++D K L  +H F++ IT+F ++Q + Y+Y GDS G V +LKL+     
Sbjct  96   SVSTQNQIEVWDIDTKRLCYLHPFEKQITAFTVLQKSFYIYAGDSFGNVSLLKLDSGQRC  155

Query  362  VVKMKYHIPFSESHGNSNKDGDNAIVEIL-PQPTAESKRVLIIYRDGLIILWAVQESKTI  538
            +V + Y IPF+ES+G++   G+   V  + PQP AES R+LII+RDG++ LW ++ SK +
Sbjct  156  LVDLPYCIPFAESYGSTPNGGNGVEVAFVSPQPLAESNRLLIIFRDGVMTLWDIKASKVV  215

Query  539  FTTGGNALQSVNHEAXKATAACWACPNGTK  628
            F +G    Q ++ E    T++CWAC  G+K
Sbjct  216  FVSGRTTQQQLHQEDKNVTSSCWACTKGSK  245



>ref|XP_009401000.1| PREDICTED: uncharacterized protein LOC103985112 isoform X4 [Musa 
acuminata subsp. malaccensis]
Length=1048

 Score =   209 bits (533),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 109/210 (52%), Positives = 140/210 (67%), Gaps = 8/210 (4%)
 Frame = +2

Query  2    GVPPGALLLAYDSIQKILAISTKDGRIKVFGKDGAQALLESPNIVPSKFMQFMENQGFLI  181
            GVPP +  LAYD IQ ILAIST++G IK+ GKD +QALL+S    PSKFMQFMENQG L+
Sbjct  37   GVPPESSSLAYDPIQHILAISTRNGVIKLLGKDNSQALLQSEAASPSKFMQFMENQGILL  96

Query  182  KINVDNHIEVWNVDQKSLSNIHEFKRDITSFKIIQHTPYMYIGDSLGYVWVLKLEKEPCN  361
             +   NHIEVWN+D+K ++++H F  +ITSF ++Q + Y+Y+GD LG V VLKL+     
Sbjct  97   NVTSHNHIEVWNIDKKQVTHVHIFNEEITSFVVVQQSFYIYVGDCLGNVTVLKLDNTLQC  156

Query  362  VVKMKYHIPFSESHGNSNK-DGDNAIVEILPQPTAESKRVLIIYRDGLIILWAVQESKTI  538
            +VKM Y IP SES G   + D D A++   PQP AESK      R+GLI LW +QESK +
Sbjct  157  LVKMPYKIPPSESCGTQTEADSDTAVIFSSPQPLAESK------RNGLISLWGIQESKVL  210

Query  539  FTTGGNALQSVNHEAXKATAACWACPNGTK  628
               GGNA Q  + E     +A WAC  G+K
Sbjct  211  LVAGGNA-QHSSQEPKLVVSASWACVFGSK  239



>ref|XP_008669023.1| PREDICTED: LOW QUALITY PROTEIN: protein lethal(2) giant larvae 
[Zea mays]
Length=622

 Score =   205 bits (522),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 94/210 (45%), Positives = 142/210 (68%), Gaps = 1/210 (0%)
 Frame = +2

Query  2    GVPPGALLLAYDSIQKILAISTKDGRIKVFGKDGAQALLESPNIVPSKFMQFMENQGFLI  181
            GVP  A LLAYD +  +LA++T++G+IK+FG+D  QALL+SP+ +PS+F+QF E QG L+
Sbjct  36   GVPADAALLAYDPVLHVLAVATRNGQIKLFGRDNTQALLQSPSPLPSRFLQFAEGQGVLL  95

Query  182  KINVDNHIEVWNVDQKSLSNIHEFKRDITSFKIIQHTPYMYIGDSLGYVWVLKLEKEPCN  361
             +N  N IEVW++D K L  +H  ++ IT+F ++Q + Y+Y+GDS G V  LKL+     
Sbjct  96   NVNTQNQIEVWDIDAKKLCYLHPAEKAITAFSVLQKSFYIYVGDSSGSVSPLKLDLAQRC  155

Query  362  VVKMKYHIPFSESHGNSNKDGDNA-IVEILPQPTAESKRVLIIYRDGLIILWAVQESKTI  538
            +  + Y IPF+ES+G++   G++  +V + PQP +ES RVLII+RDG++ LW ++ SK +
Sbjct  156  LADLPYWIPFTESYGSTTSAGNDVEVVFVSPQPLSESNRVLIIFRDGVMSLWDIKASKAV  215

Query  539  FTTGGNALQSVNHEAXKATAACWACPNGTK  628
              +G    Q    EA   T+ACW C  G+K
Sbjct  216  SISGKTTQQQSQKEAKNVTSACWVCAKGSK  245



>ref|XP_010240265.1| PREDICTED: uncharacterized protein LOC100825373 [Brachypodium 
distachyon]
Length=1023

 Score =   207 bits (528),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 97/210 (46%), Positives = 143/210 (68%), Gaps = 1/210 (0%)
 Frame = +2

Query  2    GVPPGALLLAYDSIQKILAISTKDGRIKVFGKDGAQALLESPNIVPSKFMQFMENQGFLI  181
            GVP  A LLAYD I  +LA++T++G+IK+FG+D  QALL+SP+ VPSKF+QF + QG L+
Sbjct  35   GVPADAALLAYDPILHVLAVATRNGQIKLFGRDNTQALLQSPSPVPSKFLQFADGQGVLL  94

Query  182  KINVDNHIEVWNVDQKSLSNIHEFKRDITSFKIIQHTPYMYIGDSLGYVWVLKLEKEPCN  361
             +N  N IEVW++D K L  +H  ++ IT+F ++Q + Y+Y+GDS+G V +LKL+ +   
Sbjct  95   NVNTQNQIEVWDIDTKKLCFLHPLEKQITAFAVLQKSFYIYVGDSVGNVSLLKLDLDQRC  154

Query  362  VVKMKYHIPFSESHGNSNKDGDNAIVEIL-PQPTAESKRVLIIYRDGLIILWAVQESKTI  538
            +  M Y IPF+ES+G++    +   V  L PQP AE  R+LII++DG+I LW ++ SK I
Sbjct  155  LSDMPYCIPFAESYGSTANVRNEVEVSFLSPQPLAEYNRLLIIFKDGVITLWDIKTSKGI  214

Query  539  FTTGGNALQSVNHEAXKATAACWACPNGTK  628
            F +G    Q  + E    T++CWAC  G+K
Sbjct  215  FVSGRTMQQQSHQEEKNVTSSCWACTKGSK  244



>tpg|DAA36430.1| TPA: hypothetical protein ZEAMMB73_590297 [Zea mays]
Length=1053

 Score =   205 bits (522),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 94/210 (45%), Positives = 142/210 (68%), Gaps = 1/210 (0%)
 Frame = +2

Query  2    GVPPGALLLAYDSIQKILAISTKDGRIKVFGKDGAQALLESPNIVPSKFMQFMENQGFLI  181
            GVP  A LLAYD +  +LA++T++G+IK+FG+D  QALL+SP+ +PS+F+QF E QG L+
Sbjct  36   GVPADAALLAYDPVLHVLAVATRNGQIKLFGRDNTQALLQSPSPLPSRFLQFAEGQGVLL  95

Query  182  KINVDNHIEVWNVDQKSLSNIHEFKRDITSFKIIQHTPYMYIGDSLGYVWVLKLEKEPCN  361
             +N  N IEVW++D K L  +H  ++ IT+F ++Q + Y+Y+GDS G V  LKL+     
Sbjct  96   NVNTQNQIEVWDIDAKKLCYLHPAEKAITAFSVLQKSFYIYVGDSSGSVSPLKLDLAQRC  155

Query  362  VVKMKYHIPFSESHGNSNKDGDNA-IVEILPQPTAESKRVLIIYRDGLIILWAVQESKTI  538
            +  + Y IPF+ES+G++   G++  +V + PQP +ES RVLII+RDG++ LW ++ SK +
Sbjct  156  LADLPYWIPFTESYGSTTSAGNDVEVVFVSPQPLSESNRVLIIFRDGVMSLWDIKASKAV  215

Query  539  FTTGGNALQSVNHEAXKATAACWACPNGTK  628
              +G    Q    EA   T+ACW C  G+K
Sbjct  216  SISGKTTQQQSQKEAKNVTSACWVCAKGSK  245



>emb|CAH66754.1| OSIGBa0158F05.3 [Oryza sativa Indica Group]
Length=852

 Score =   203 bits (517),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 100/229 (44%), Positives = 147/229 (64%), Gaps = 20/229 (9%)
 Frame = +2

Query  2    GVPPGALLLAYDSIQKILAISTKDGRIKVFGKDGAQALLESPNIVPSKFMQFMENQGFLI  181
            GVP  A LLAYD    +LA++T++G+IK+FG+D  QALL+SP+ VPSKF++F E QG L+
Sbjct  36   GVPADAALLAYDPALHVLAVATRNGQIKLFGRDNTQALLQSPSPVPSKFLRFAEGQGVLL  95

Query  182  KINVDNHIE-------------------VWNVDQKSLSNIHEFKRDITSFKIIQHTPYMY  304
             +NV N IE                   +W++D K L  +H F+++IT+F ++Q++ Y+Y
Sbjct  96   NVNVKNQIEASLFSDLSVLVWLNVVSFLIWDIDTKKLCYVHPFEKEITAFSVLQNSFYIY  155

Query  305  IGDSLGYVWVLKLEKEPCNVVKMKYHIPFSESHGNSNKDGDNAIVEIL-PQPTAESKRVL  481
            +GDS G V +LKL+     +V M Y IPFSES+G+    G+   V  + PQP AE+ RVL
Sbjct  156  VGDSFGNVSLLKLDLGQTCLVDMPYWIPFSESYGSGANVGNEVEVAFVSPQPLAENNRVL  215

Query  482  IIYRDGLIILWAVQESKTIFTTGGNALQSVNHEAXKATAACWACPNGTK  628
            II+RDG++ LW ++ SK +  +G +  Q  + EA   T+ACWAC  G+K
Sbjct  216  IIFRDGIMSLWDIKTSKVVSLSGKSMQQQSHQEAKAVTSACWACAKGSK  264



>emb|CAE03092.2| OSJNBa0017B10.7 [Oryza sativa Japonica Group]
Length=852

 Score =   197 bits (500),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 97/229 (42%), Positives = 144/229 (63%), Gaps = 20/229 (9%)
 Frame = +2

Query  2    GVPPGALLLAYDSIQKILAISTKDGRIKVFGKDGAQALLESPNIVPSKFMQFMENQGFLI  181
            GVP  A LLAYD    +LA++ ++G+IK+FG+D  QALL+SP+ VPSKF++F E Q  L+
Sbjct  36   GVPADAALLAYDPALHVLAVAIRNGQIKLFGRDNTQALLQSPSPVPSKFLRFAEGQRVLL  95

Query  182  KINVDNHIE-------------------VWNVDQKSLSNIHEFKRDITSFKIIQHTPYMY  304
             +N  N IE                   +W++D K L  +H F+++IT+F ++Q++ Y+Y
Sbjct  96   NVNAKNQIEASLFSDLSVLVWLNVVSFLIWDIDTKKLCYVHPFEKEITAFSVLQNSFYIY  155

Query  305  IGDSLGYVWVLKLEKEPCNVVKMKYHIPFSESHGNSNKDGDNAIVEIL-PQPTAESKRVL  481
            +GDS G V +LKL+     +V M Y IPFSES+G+    G+   V  + PQP AE+ RVL
Sbjct  156  VGDSFGNVSLLKLDLGQTCLVDMPYWIPFSESYGSGANVGNEVEVAFVSPQPLAENNRVL  215

Query  482  IIYRDGLIILWAVQESKTIFTTGGNALQSVNHEAXKATAACWACPNGTK  628
            II+RDG++ LW ++ SK +  +G +  Q  + EA   T+ACWAC  G+K
Sbjct  216  IIFRDGIMSLWDIKTSKVVSLSGKSMQQQSHQEAKAVTSACWACAKGSK  264



>ref|XP_011650255.1| PREDICTED: uncharacterized protein LOC101213055 isoform X2 [Cucumis 
sativus]
Length=967

 Score =   193 bits (491),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 87/158 (55%), Positives = 118/158 (75%), Gaps = 1/158 (1%)
 Frame = +2

Query  158  MENQGFLIKINVDNHIEVWNVDQKSLSNIHEFKRDITSFKIIQHTPYMYIGDSLGYVWVL  337
            MENQGFL+ +   N IEVW++D+K L+++H F+++ITSF I+Q TPY+Y+GD LG V VL
Sbjct  1    MENQGFLLNVTSKNEIEVWDIDRKLLAHVHVFEQEITSFTILQQTPYIYVGDYLGNVSVL  60

Query  338  KLEKEPCNVVKMKYHIPFSESHGN-SNKDGDNAIVEILPQPTAESKRVLIIYRDGLIILW  514
            KL++  CN+++MKY IP S S GN +    D ++  ILPQPT E KRVL+I+ DG I LW
Sbjct  61   KLDQSVCNIIQMKYIIPVSASRGNPAEATSDISLTHILPQPTTEFKRVLLIFSDGFITLW  120

Query  515  AVQESKTIFTTGGNALQSVNHEAXKATAACWACPNGTK  628
             ++ESK+IF TGGN++ S   EA K T+ACWACP G+K
Sbjct  121  EIKESKSIFITGGNSMLSPYQEAKKVTSACWACPLGSK  158



>ref|XP_008448471.1| PREDICTED: uncharacterized protein LOC103490647 isoform X2 [Cucumis 
melo]
Length=967

 Score =   193 bits (490),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 86/158 (54%), Positives = 120/158 (76%), Gaps = 1/158 (1%)
 Frame = +2

Query  158  MENQGFLIKINVDNHIEVWNVDQKSLSNIHEFKRDITSFKIIQHTPYMYIGDSLGYVWVL  337
            MENQGFL+ +   N IE+W++D+K ++++H F+++ITSF I+Q TPY+Y+GD LG V VL
Sbjct  1    MENQGFLLNVTSKNEIEIWDIDRKLVAHVHVFEQEITSFTILQQTPYIYVGDYLGNVSVL  60

Query  338  KLEKEPCNVVKMKYHIPFSESHGN-SNKDGDNAIVEILPQPTAESKRVLIIYRDGLIILW  514
            KL++  CN+++MKY IP S S GN +    D ++  ILPQPT+E KRVL+I+ DGLI LW
Sbjct  61   KLDQSVCNIIQMKYIIPVSASRGNPAEATSDISLTHILPQPTSEFKRVLLIFSDGLIALW  120

Query  515  AVQESKTIFTTGGNALQSVNHEAXKATAACWACPNGTK  628
             ++ESK+IF TGGN++ S   EA K T+ACWACP G+K
Sbjct  121  DIKESKSIFITGGNSMLSPYQEAKKVTSACWACPLGSK  158



>ref|XP_002448340.1| hypothetical protein SORBIDRAFT_06g025450 [Sorghum bicolor]
 gb|EES12668.1| hypothetical protein SORBIDRAFT_06g025450 [Sorghum bicolor]
Length=934

 Score =   189 bits (480),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 88/210 (42%), Positives = 137/210 (65%), Gaps = 7/210 (3%)
 Frame = +2

Query  2    GVPPGALLLAYDSIQKILAISTKDGRIKVFGKDGAQALLESPNIVPSKFMQFMENQGFLI  181
            GVP  A LLAYD +  +LA++T++G+IK+FG+D  QALL+SP+ +PS+F+QF E QG L+
Sbjct  87   GVPADATLLAYDPVLHVLAVATRNGQIKLFGRDNTQALLQSPSPLPSRFLQFAEGQGVLL  146

Query  182  KINVDNHIEVWNVDQKSLSNIHEFKRDITSFKIIQHTPYMYIGDSLGYVWVLKLEKEPCN  361
             +N  N IEVW++D K L  +H  ++ +T+F ++Q + Y+Y+GDS G V +LKL+     
Sbjct  147  NVNTQNQIEVWDIDAKKLCYLHPTEKAVTAFSVLQKSFYIYVGDSSGNVSLLKLDLAQRC  206

Query  362  VVKMKYHIPFSESHGNSNKDGDNA-IVEILPQPTAESKRVLIIYRDGLIILWAVQESKTI  538
            +  M Y IPF+ES+G++   G++  ++ + PQP AE      + RDG++ LW ++ SK +
Sbjct  207  LADMPYWIPFTESYGSTASAGNDVEVIFVSPQPLAE------LNRDGVMSLWDIKASKAV  260

Query  539  FTTGGNALQSVNHEAXKATAACWACPNGTK  628
              +G    Q    EA   T+ACW C  G+K
Sbjct  261  SISGKTMQQQSQKEAKNVTSACWVCAKGSK  290



>gb|EMT27203.1| hypothetical protein F775_06534 [Aegilops tauschii]
Length=984

 Score =   177 bits (449),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 85/210 (40%), Positives = 130/210 (62%), Gaps = 19/210 (9%)
 Frame = +2

Query  2    GVPPGALLLAYDSIQKILAISTKDGRIKVFGKDGAQALLESPNIVPSKFMQFMENQGFLI  181
            GVP  A LLAYD +  + A++T++G+IK+ G+D  QALL+SP+ +PSKFMQ         
Sbjct  36   GVPADAALLAYDPLPHVPAVATRNGQIKLLGRDNTQALLQSPSPIPSKFMQ---------  86

Query  182  KINVDNHIEVWNVDQKSLSNIHEFKRDITSFKIIQHTPYMYIGDSLGYVWVLKLEKEPCN  361
                     VW++D K L  +H F++ IT+F ++Q + Y+Y GDS G V + KL+     
Sbjct  87   ---------VWDIDTKRLCYLHPFEKQITAFTVLQKSFYIYAGDSFGNVSLFKLDLGQRC  137

Query  362  VVKMKYHIPFSESHGNSNKDGDNAIVEIL-PQPTAESKRVLIIYRDGLIILWAVQESKTI  538
            +V + Y IPF+ES+G++   G+   V  + PQP AES R+LII+RDG++ LW ++ S+ +
Sbjct  138  LVDLPYCIPFAESYGSTANGGNGVDVAFVSPQPLAESNRLLIIFRDGVMTLWDIKASRVV  197

Query  539  FTTGGNALQSVNHEAXKATAACWACPNGTK  628
            F +G    Q  + E    T++CWAC  G+K
Sbjct  198  FVSGRTTQQQSHQEEKNVTSSCWACSKGSK  227



>gb|EEE61509.1| hypothetical protein OsJ_15799 [Oryza sativa Japonica Group]
Length=1028

 Score =   176 bits (445),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 88/225 (39%), Positives = 139/225 (62%), Gaps = 23/225 (10%)
 Frame = +2

Query  23   LLAYDSIQKILAISTK---DGRIKVFGKDGAQALLESPNIVPSKFMQFMENQGFLIKINV  193
            + +  S +++L++  +   +G+IK+FG+D  QALL+SP+ VPSKF++F E Q  L+ +N 
Sbjct  15   IFSCRSKKRMLSLRRRAVWNGQIKLFGRDNTQALLQSPSPVPSKFLRFAEGQRVLLNVNA  74

Query  194  DNHIE-------------------VWNVDQKSLSNIHEFKRDITSFKIIQHTPYMYIGDS  316
             N IE                   +W++D K L  +H F+++IT+F ++Q++ Y+Y+GDS
Sbjct  75   KNQIEASLFSDLSVLVWLNVVSFLIWDIDTKKLCYVHPFEKEITAFSVLQNSFYIYVGDS  134

Query  317  LGYVWVLKLEKEPCNVVKMKYHIPFSESHGNSNKDGDNAIVEIL-PQPTAESKRVLIIYR  493
             G V +LKL+     +V M Y IPFSES+G+    G+   V  + PQP AE+ RVLII+R
Sbjct  135  FGNVSLLKLDLGQTCLVDMPYWIPFSESYGSGANVGNEVEVAFVSPQPLAENNRVLIIFR  194

Query  494  DGLIILWAVQESKTIFTTGGNALQSVNHEAXKATAACWACPNGTK  628
            DG++ LW ++ SK +  +G +  Q  + EA   T+ACWAC  G+K
Sbjct  195  DGIMSLWDIKTSKVVSLSGKSMQQQSHQEAKAVTSACWACAKGSK  239



>ref|XP_011004756.1| PREDICTED: uncharacterized protein LOC105111170 isoform X1 [Populus 
euphratica]
Length=1116

 Score =   174 bits (441),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 96/229 (42%), Positives = 139/229 (61%), Gaps = 22/229 (10%)
 Frame = +2

Query  2    GVPPGALLLAYDSIQKILAISTKDGRIKVFGKDGAQALLESPNIVPSKFMQFMENQGFLI  181
            G+P  A LLA+D IQ++LAI+T DGRIKV G DG +AL  SP  +P K ++F++NQGFLI
Sbjct  40   GIPSTASLLAFDPIQRLLAIATLDGRIKVIGGDGIEALFTSPKQLPYKNIEFLQNQGFLI  99

Query  182  KINVDNHIEVWNVDQKSLSNIHEFKRDITSFKIIQHTPYMYIGDSLGYVWVLKLEKEPCN  361
             I++DN I+VWN++ + L+   +++ +IT+F +I  + +MYIGD  G + VLK + E   
Sbjct  100  SISIDNDIQVWNLESRCLACSLQWELNITAFSVISRSCFMYIGDEHGSMSVLKYDSEDAK  159

Query  362  VVKMKYHIPFS---ESHGNSNKDGDNAIVEILPQPTAESKRVLIIYRDGLIILWAVQESK  532
            ++ + YHI  S   E+ G  + D    IV +LPQP +   RVLI Y++GLI+LW V E +
Sbjct  160  LLWLPYHITASSLKEAAGFPSPD-HQPIVGVLPQPHSSGNRVLIAYQNGLIVLWDVSEGR  218

Query  533  TIFTTGGNALQ-----------------SVNH-EAXKATAACWACPNGT  625
             +F  GG  LQ                 S +H E  + TA  WA  NG+
Sbjct  219  ILFVGGGKDLQLKDDSQNEVDPNIPKDTSHHHLEEKEITALSWASSNGS  267



>ref|XP_007026671.1| Transducin family protein / WD-40 repeat family protein, putative 
isoform 3 [Theobroma cacao]
 gb|EOY07173.1| Transducin family protein / WD-40 repeat family protein, putative 
isoform 3 [Theobroma cacao]
Length=1059

 Score =   174 bits (440),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 92/225 (41%), Positives = 138/225 (61%), Gaps = 18/225 (8%)
 Frame = +2

Query  2    GVPPGALLLAYDSIQKILAISTKDGRIKVFGKDGAQALLESPNIVPSKFMQFMENQGFLI  181
            G+P  A LL +D IQ++LAI T DGRIKV G DG +AL  SP  +P K+++F++NQGFLI
Sbjct  33   GIPSTASLLTFDPIQRLLAIGTLDGRIKVIGGDGIEALFISPKQLPFKYLEFIQNQGFLI  92

Query  182  KINVDNHIEVWNVDQKSLSNIHEFKRDITSFKIIQHTPYMYIGDSLGYVWVLKLEKEPCN  361
             I+ DN I+VWN++ + L+   +++ ++T+F  I  + +MYIGD  G + V+K + E   
Sbjct  93   SISNDNDIQVWNLESRCLACCLQWESNVTAFSFISGSQFMYIGDEYGLMSVIKYDAENGK  152

Query  362  VVKMKYHI---PFSESHGNSNKDGDNAIVEILPQPTAESKRVLIIYRDGLIILWAVQESK  532
            ++++ Y+I     SE+ G S  D D  +V ILPQP +   RV+I Y +GLIILW V E++
Sbjct  153  LLQLPYYISANSLSEAAGFSFPD-DQPVVGILPQPHSSGNRVIIAYANGLIILWDVSEAQ  211

Query  533  TIFTTGGNALQ------------SVNH--EAXKATAACWACPNGT  625
             +F  GG  LQ            +  H  +  + +A CWA  +GT
Sbjct  212  ILFIGGGKDLQLKDAVESDVQDDTFEHHLQEKEISAICWASSDGT  256



>ref|XP_007026669.1| Transducin family protein / WD-40 repeat family protein, putative 
isoform 1 [Theobroma cacao]
 gb|EOY07171.1| Transducin family protein / WD-40 repeat family protein, putative 
isoform 1 [Theobroma cacao]
Length=1095

 Score =   173 bits (439),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 92/225 (41%), Positives = 138/225 (61%), Gaps = 18/225 (8%)
 Frame = +2

Query  2    GVPPGALLLAYDSIQKILAISTKDGRIKVFGKDGAQALLESPNIVPSKFMQFMENQGFLI  181
            G+P  A LL +D IQ++LAI T DGRIKV G DG +AL  SP  +P K+++F++NQGFLI
Sbjct  33   GIPSTASLLTFDPIQRLLAIGTLDGRIKVIGGDGIEALFISPKQLPFKYLEFIQNQGFLI  92

Query  182  KINVDNHIEVWNVDQKSLSNIHEFKRDITSFKIIQHTPYMYIGDSLGYVWVLKLEKEPCN  361
             I+ DN I+VWN++ + L+   +++ ++T+F  I  + +MYIGD  G + V+K + E   
Sbjct  93   SISNDNDIQVWNLESRCLACCLQWESNVTAFSFISGSQFMYIGDEYGLMSVIKYDAENGK  152

Query  362  VVKMKYHI---PFSESHGNSNKDGDNAIVEILPQPTAESKRVLIIYRDGLIILWAVQESK  532
            ++++ Y+I     SE+ G S  D D  +V ILPQP +   RV+I Y +GLIILW V E++
Sbjct  153  LLQLPYYISANSLSEAAGFSFPD-DQPVVGILPQPHSSGNRVIIAYANGLIILWDVSEAQ  211

Query  533  TIFTTGGNALQ------------SVNH--EAXKATAACWACPNGT  625
             +F  GG  LQ            +  H  +  + +A CWA  +GT
Sbjct  212  ILFIGGGKDLQLKDAVESDVQDDTFEHHLQEKEISAICWASSDGT  256



>ref|XP_011048260.1| PREDICTED: uncharacterized protein LOC105142284 isoform X2 [Populus 
euphratica]
Length=1124

 Score =   172 bits (436),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 78/190 (41%), Positives = 125/190 (66%), Gaps = 2/190 (1%)
 Frame = +2

Query  2    GVPPGALLLAYDSIQKILAISTKDGRIKVFGKDGAQALLESPNIVPSKFMQFMENQGFLI  181
            G+P  A +LA+D IQ +LAI T DGRIKV G D  + LL SP  +P K+++F++NQG L+
Sbjct  54   GIPSTASVLAFDHIQSLLAIGTLDGRIKVIGGDNIEGLLVSPKTLPFKYLEFLQNQGILV  113

Query  182  KINVDNHIEVWNVDQKSLSNIHEFKRDITSFKIIQHTPYMYIGDSLGYVWVLKLEKEPCN  361
             ++ DN I+VW+++Q+ +++  ++  +IT+F +I  + YMYIGD  G V+VLK + E   
Sbjct  114  SVSSDNEIQVWDLEQRQIASTLQWDSNITAFSVIFASSYMYIGDEYGMVYVLKYDVEEVK  173

Query  362  VVKMKYHIP--FSESHGNSNKDGDNAIVEILPQPTAESKRVLIIYRDGLIILWAVQESKT  535
            +V M YH+P   +E     +   ++++V +LPQP+++  +VLI Y DGL+ILW V E K 
Sbjct  174  LVPMPYHVPADVAEDASGMSSPKNHSVVGVLPQPSSQGNKVLIAYEDGLMILWDVSEDKV  233

Query  536  IFTTGGNALQ  565
            +   G   ++
Sbjct  234  VLVKGNKDIE  243



>ref|XP_002993402.1| hypothetical protein SELMODRAFT_449132 [Selaginella moellendorffii]
 gb|EFJ05587.1| hypothetical protein SELMODRAFT_449132 [Selaginella moellendorffii]
Length=1134

 Score =   172 bits (436),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 85/221 (38%), Positives = 133/221 (60%), Gaps = 13/221 (6%)
 Frame = +2

Query  2    GVPPGALLLAYDSIQKILAISTKDGRIKVFGKDGAQALLESPNIVPSKFMQFMENQGFLI  181
            G+P  A +LAY+  Q++LAI+++DGRIK+FG++G + L +SP   P K+++F+ N+G LI
Sbjct  39   GIPASASVLAYEPGQRLLAIASRDGRIKIFGREGVEVLFKSPANAPCKYLEFVNNEGRLI  98

Query  182  KINVDNHIEVWNVDQKSLSNIHEFKRDITSFKIIQHTPYMYIGDSLGYVWVLKLEKEPCN  361
             +   N IEVW++  K L +   ++ DI++F +IQ T +MY+GD  G V VL    E   
Sbjct  99   HVTTRNEIEVWDLSTKELVSSKTWEADISAFAVIQATAFMYVGDETGQVSVLHFNNEDRC  158

Query  362  VVKMKYHIPFSES-HGNSNKDGDNA--IVEILPQPTAESKRVLIIYRDGLIILWAVQESK  532
             V+M+Y +P   +  G  + D  +A  +V ILPQP A   RV+I+Y +G+I+LW + E++
Sbjct  159  FVQMQYTVPAHLTLSGLIDTDDSSAPSVVSILPQPDAVHSRVVIVYGNGVIVLWGLHEAQ  218

Query  533  TIFTTGGNALQ----------SVNHEAXKATAACWACPNGT  625
             +   GG   Q            + E  +   ACWACP+GT
Sbjct  219  VLAIRGGTEDQQRKLSGGKSSGSDEEEKEPCCACWACPSGT  259



>ref|XP_011035925.1| PREDICTED: syntaxin-binding protein 5-like isoform X4 [Populus 
euphratica]
Length=964

 Score =   171 bits (434),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 85/233 (36%), Positives = 141/233 (61%), Gaps = 26/233 (11%)
 Frame = +2

Query  2    GVPPGALLLAYDSIQKILAISTKDGRIKVFGKDGAQALLESPNIVPSKFMQFMENQGFLI  181
            G+P  A +LA+D IQ +LAI T DGRIKV G +  + LL SP  +P K+++F++NQGFL+
Sbjct  60   GIPSTASILAFDHIQSLLAIGTLDGRIKVIGGNNIEGLLVSPKQLPFKYLEFLQNQGFLV  119

Query  182  KINVDNHIEVWNVDQKSLSNIHEFKRDITSFKIIQHTPYMYIGDSLGYVWVLKLEKEPCN  361
             ++ +N I+VW+++Q+ +++  + + +IT+F +I  + YMY+GD  G V+VLK + E   
Sbjct  120  SVSNENEIQVWDLEQRQIASSLQLESNITAFSVISCSSYMYVGDEYGMVYVLKYDAEEVK  179

Query  362  VVKMKYHIP---FSESHGNSNKDGDNAIVEILPQPTAESKRVLIIYRDGLIILWAVQESK  532
            +V M YH+P    +++ G S+   + ++V +LPQP+++  +VLI Y DGLII+W+V E K
Sbjct  180  LVPMPYHVPADVAADASGMSSPK-NRSVVGVLPQPSSQGNKVLIAYEDGLIIIWSVSEDK  238

Query  533  TIFTTGGNALQ---SVNHEAXKAT-------------------AACWACPNGT  625
             +   G   L+    +  ++ K T                   A CWA  +G+
Sbjct  239  VVLVKGNKDLELKCKITTDSHKDTRPELSDDISDYQPLEKEIAALCWASTDGS  291



>ref|XP_011035924.1| PREDICTED: uncharacterized protein LOC105133574 isoform X3 [Populus 
euphratica]
Length=1135

 Score =   171 bits (434),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 85/233 (36%), Positives = 141/233 (61%), Gaps = 26/233 (11%)
 Frame = +2

Query  2    GVPPGALLLAYDSIQKILAISTKDGRIKVFGKDGAQALLESPNIVPSKFMQFMENQGFLI  181
            G+P  A +LA+D IQ +LAI T DGRIKV G +  + LL SP  +P K+++F++NQGFL+
Sbjct  60   GIPSTASILAFDHIQSLLAIGTLDGRIKVIGGNNIEGLLVSPKQLPFKYLEFLQNQGFLV  119

Query  182  KINVDNHIEVWNVDQKSLSNIHEFKRDITSFKIIQHTPYMYIGDSLGYVWVLKLEKEPCN  361
             ++ +N I+VW+++Q+ +++  + + +IT+F +I  + YMY+GD  G V+VLK + E   
Sbjct  120  SVSNENEIQVWDLEQRQIASSLQLESNITAFSVISCSSYMYVGDEYGMVYVLKYDAEEVK  179

Query  362  VVKMKYHIP---FSESHGNSNKDGDNAIVEILPQPTAESKRVLIIYRDGLIILWAVQESK  532
            +V M YH+P    +++ G S+   + ++V +LPQP+++  +VLI Y DGLII+W+V E K
Sbjct  180  LVPMPYHVPADVAADASGMSSPK-NRSVVGVLPQPSSQGNKVLIAYEDGLIIIWSVSEDK  238

Query  533  TIFTTGGNALQ---SVNHEAXKAT-------------------AACWACPNGT  625
             +   G   L+    +  ++ K T                   A CWA  +G+
Sbjct  239  VVLVKGNKDLELKCKITTDSHKDTRPELSDDISDYQPLEKEIAALCWASTDGS  291



>ref|XP_011035923.1| PREDICTED: uncharacterized protein LOC105133574 isoform X2 [Populus 
euphratica]
Length=1138

 Score =   171 bits (434),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 85/233 (36%), Positives = 141/233 (61%), Gaps = 26/233 (11%)
 Frame = +2

Query  2    GVPPGALLLAYDSIQKILAISTKDGRIKVFGKDGAQALLESPNIVPSKFMQFMENQGFLI  181
            G+P  A +LA+D IQ +LAI T DGRIKV G +  + LL SP  +P K+++F++NQGFL+
Sbjct  60   GIPSTASILAFDHIQSLLAIGTLDGRIKVIGGNNIEGLLVSPKQLPFKYLEFLQNQGFLV  119

Query  182  KINVDNHIEVWNVDQKSLSNIHEFKRDITSFKIIQHTPYMYIGDSLGYVWVLKLEKEPCN  361
             ++ +N I+VW+++Q+ +++  + + +IT+F +I  + YMY+GD  G V+VLK + E   
Sbjct  120  SVSNENEIQVWDLEQRQIASSLQLESNITAFSVISCSSYMYVGDEYGMVYVLKYDAEEVK  179

Query  362  VVKMKYHIP---FSESHGNSNKDGDNAIVEILPQPTAESKRVLIIYRDGLIILWAVQESK  532
            +V M YH+P    +++ G S+   + ++V +LPQP+++  +VLI Y DGLII+W+V E K
Sbjct  180  LVPMPYHVPADVAADASGMSSPK-NRSVVGVLPQPSSQGNKVLIAYEDGLIIIWSVSEDK  238

Query  533  TIFTTGGNALQ---SVNHEAXKAT-------------------AACWACPNGT  625
             +   G   L+    +  ++ K T                   A CWA  +G+
Sbjct  239  VVLVKGNKDLELKCKITTDSHKDTRPELSDDISDYQPLEKEIAALCWASTDGS  291



>ref|XP_011035922.1| PREDICTED: uncharacterized protein LOC105133574 isoform X1 [Populus 
euphratica]
Length=1139

 Score =   171 bits (434),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 85/233 (36%), Positives = 141/233 (61%), Gaps = 26/233 (11%)
 Frame = +2

Query  2    GVPPGALLLAYDSIQKILAISTKDGRIKVFGKDGAQALLESPNIVPSKFMQFMENQGFLI  181
            G+P  A +LA+D IQ +LAI T DGRIKV G +  + LL SP  +P K+++F++NQGFL+
Sbjct  60   GIPSTASILAFDHIQSLLAIGTLDGRIKVIGGNNIEGLLVSPKQLPFKYLEFLQNQGFLV  119

Query  182  KINVDNHIEVWNVDQKSLSNIHEFKRDITSFKIIQHTPYMYIGDSLGYVWVLKLEKEPCN  361
             ++ +N I+VW+++Q+ +++  + + +IT+F +I  + YMY+GD  G V+VLK + E   
Sbjct  120  SVSNENEIQVWDLEQRQIASSLQLESNITAFSVISCSSYMYVGDEYGMVYVLKYDAEEVK  179

Query  362  VVKMKYHIP---FSESHGNSNKDGDNAIVEILPQPTAESKRVLIIYRDGLIILWAVQESK  532
            +V M YH+P    +++ G S+   + ++V +LPQP+++  +VLI Y DGLII+W+V E K
Sbjct  180  LVPMPYHVPADVAADASGMSSPK-NRSVVGVLPQPSSQGNKVLIAYEDGLIIIWSVSEDK  238

Query  533  TIFTTGGNALQ---SVNHEAXKAT-------------------AACWACPNGT  625
             +   G   L+    +  ++ K T                   A CWA  +G+
Sbjct  239  VVLVKGNKDLELKCKITTDSHKDTRPELSDDISDYQPLEKEIAALCWASTDGS  291



>ref|XP_012087836.1| PREDICTED: uncharacterized protein LOC105646578 [Jatropha curcas]
Length=1122

 Score =   169 bits (429),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 95/232 (41%), Positives = 136/232 (59%), Gaps = 25/232 (11%)
 Frame = +2

Query  2    GVPPGALLLAYDSIQKILAISTKDGRIKVFGKDGAQALLESPNIVPSKFMQFMENQGFLI  181
            G+P  A LLA+DSIQ++LAI T DGRIKV G D  +ALL SP  +P K ++F++N+GFL+
Sbjct  42   GIPSTASLLAFDSIQRLLAIGTLDGRIKVIGGDRIEALLISPKQLPFKSIEFLQNKGFLV  101

Query  182  KINVDNHIEVWNVDQKSLSNIHEFKRDITSFKIIQHTPYMYIGDSLGYVWVLKLEKEPCN  361
             I+ +N IEVWN++ + L+   +++ +IT+F II  T  MYIGD  G + VLK + E   
Sbjct  102  TISNENDIEVWNLENRCLACCLQWESNITAFSIISSTYLMYIGDEYGLMSVLKYDVEDGK  161

Query  362  VVKMKYHIP---FSESHGNSNKDGDNAIVEILPQPTAESKRVLIIYRDGLIILWAVQESK  532
            ++++ Y I     +E+ G  + D    +V +LPQP +   RVLI Y +GLIILW V E +
Sbjct  162  LLRLPYSISSNHLNEAAGFPSPD-HQPVVGVLPQPCSSGNRVLIAYENGLIILWDVSEGR  220

Query  533  TIFTTGGNALQS--------------------VNH-EAXKATAACWACPNGT  625
             +F  GG  LQ                      NH +  + TA CWA  NG+
Sbjct  221  VLFVGGGKDLQLKDGNADSQNGLDADPQDNMFYNHLQEKEITALCWASSNGS  272



>ref|XP_011048186.1| PREDICTED: uncharacterized protein LOC105142284 isoform X1 [Populus 
euphratica]
Length=1126

 Score =   169 bits (429),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 79/193 (41%), Positives = 127/193 (66%), Gaps = 6/193 (3%)
 Frame = +2

Query  2    GVPPGALLLAYDSIQKILAISTKDGRIKVFGKDGAQALLESPNIVPSKFMQFMENQGFLI  181
            G+P  A +LA+D IQ +LAI T DGRIKV G D  + LL SP  +P K+++F++NQG L+
Sbjct  54   GIPSTASVLAFDHIQSLLAIGTLDGRIKVIGGDNIEGLLVSPKTLPFKYLEFLQNQGILV  113

Query  182  KINVDNHIEVWNVDQKSLSNIHEFKRDITSFKIIQHTPYMYIGDSLGYVWVLKLEKEPCN  361
             ++ DN I+VW+++Q+ +++  ++  +IT+F +I  + YMYIGD  G V+VLK + E   
Sbjct  114  SVSSDNEIQVWDLEQRQIASTLQWDSNITAFSVIFASSYMYIGDEYGMVYVLKYDVEEVK  173

Query  362  VVKMKYHIP-----FSESHGNSNKDGDNAIVEILPQPTAESKRVLIIYRDGLIILWAVQE  526
            +V M YH+P       ++ G S+   ++++V +LPQP+++  +VLI Y DGL+ILW V E
Sbjct  174  LVPMPYHVPADVAEVPDASGMSSPK-NHSVVGVLPQPSSQGNKVLIAYEDGLMILWDVSE  232

Query  527  SKTIFTTGGNALQ  565
             K +   G   ++
Sbjct  233  DKVVLVKGNKDIE  245



>ref|XP_008243549.1| PREDICTED: uncharacterized protein LOC103341775 [Prunus mume]
Length=1113

 Score =   169 bits (427),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 91/232 (39%), Positives = 135/232 (58%), Gaps = 25/232 (11%)
 Frame = +2

Query  2    GVPPGALLLAYDSIQKILAISTKDGRIKVFGKDGAQALLESPNIVPSKFMQFMENQGFLI  181
            G+P  A +LA+D IQ++LAI T DGRIKV G DG + LL SP  +P K+++F++NQG+L+
Sbjct  37   GIPSTASILAFDPIQRLLAIGTLDGRIKVIGGDGIEGLLISPKQLPYKYIEFLKNQGYLV  96

Query  182  KINVDNHIEVWNVDQKSLSNIHEFKRDITSFKIIQHTPYMYIGDSLGYVWVLKLEKEPCN  361
             I  DN I+VWN++ + L    E++ +IT+F +I  +  MY+GD    V V+K + E   
Sbjct  97   SILTDNDIQVWNLESRCLVYCLEWESNITAFSVINGSNLMYVGDDYALVAVMKYDAEEGK  156

Query  362  VVKMKYHI---PFSESHGNSNKDGDNAIVEILPQPTAESKRVLIIYRDGLIILWAVQESK  532
            ++++ YHI     SE+ G      D  +V +LPQP +   RVLI Y++GL+ILW V E +
Sbjct  157  LLQLPYHISANSLSETAGFPFPT-DQPVVGVLPQPCSSGNRVLIAYQNGLVILWDVSEDQ  215

Query  533  TIFTTGGNALQ----------SVNHEAXKAT-----------AACWACPNGT  625
             +F  GG  LQ           VN ++ + T           A CWA  NG+
Sbjct  216  IVFVGGGKDLQLKDGVVKSTNEVNIDSPEETLEHQLGDKEISALCWASSNGS  267



>ref|XP_007207154.1| hypothetical protein PRUPE_ppa000427mg [Prunus persica]
 gb|EMJ08353.1| hypothetical protein PRUPE_ppa000427mg [Prunus persica]
Length=1096

 Score =   168 bits (426),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 92/232 (40%), Positives = 135/232 (58%), Gaps = 25/232 (11%)
 Frame = +2

Query  2    GVPPGALLLAYDSIQKILAISTKDGRIKVFGKDGAQALLESPNIVPSKFMQFMENQGFLI  181
            G+P  A +LA+D IQ++LAI T DGRIKV G DG + LL SP  +P K+++F++NQG+L+
Sbjct  20   GIPSTASILAFDPIQRLLAIGTLDGRIKVIGGDGIEGLLISPKQLPYKYIEFLQNQGYLV  79

Query  182  KINVDNHIEVWNVDQKSLSNIHEFKRDITSFKIIQHTPYMYIGDSLGYVWVLKLEKEPCN  361
             I  DN I+VWN++ + L    E++ +IT+F +I  +  MY+GD    V V+K + E   
Sbjct  80   SILNDNDIQVWNLESRCLVYCLEWESNITAFSVINGSNLMYVGDDYALVAVMKYDAEEGK  139

Query  362  VVKMKYHI---PFSESHGNSNKDGDNAIVEILPQPTAESKRVLIIYRDGLIILWAVQESK  532
            ++++ YHI     SE+ G      D  IV +LPQP +   RVLI Y++GL+ILW V E +
Sbjct  140  LLQLPYHISANSLSETAGFPFPT-DQPIVGVLPQPCSSGNRVLIAYQNGLVILWDVSEDQ  198

Query  533  TIFTTGGNALQ----------SVNHEAXKAT-----------AACWACPNGT  625
             +F  GG  LQ           VN ++ + T           A CWA  NG+
Sbjct  199  IVFVGGGKDLQLKDGVVKSTNEVNIDSPEETLEHQLGDKEISALCWASSNGS  250



>ref|XP_007207155.1| hypothetical protein PRUPE_ppa000427mg [Prunus persica]
 gb|EMJ08354.1| hypothetical protein PRUPE_ppa000427mg [Prunus persica]
Length=1191

 Score =   168 bits (425),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 92/232 (40%), Positives = 135/232 (58%), Gaps = 25/232 (11%)
 Frame = +2

Query  2    GVPPGALLLAYDSIQKILAISTKDGRIKVFGKDGAQALLESPNIVPSKFMQFMENQGFLI  181
            G+P  A +LA+D IQ++LAI T DGRIKV G DG + LL SP  +P K+++F++NQG+L+
Sbjct  20   GIPSTASILAFDPIQRLLAIGTLDGRIKVIGGDGIEGLLISPKQLPYKYIEFLQNQGYLV  79

Query  182  KINVDNHIEVWNVDQKSLSNIHEFKRDITSFKIIQHTPYMYIGDSLGYVWVLKLEKEPCN  361
             I  DN I+VWN++ + L    E++ +IT+F +I  +  MY+GD    V V+K + E   
Sbjct  80   SILNDNDIQVWNLESRCLVYCLEWESNITAFSVINGSNLMYVGDDYALVAVMKYDAEEGK  139

Query  362  VVKMKYHI---PFSESHGNSNKDGDNAIVEILPQPTAESKRVLIIYRDGLIILWAVQESK  532
            ++++ YHI     SE+ G      D  IV +LPQP +   RVLI Y++GL+ILW V E +
Sbjct  140  LLQLPYHISANSLSETAGFPFPT-DQPIVGVLPQPCSSGNRVLIAYQNGLVILWDVSEDQ  198

Query  533  TIFTTGGNALQ----------SVNHEAXKAT-----------AACWACPNGT  625
             +F  GG  LQ           VN ++ + T           A CWA  NG+
Sbjct  199  IVFVGGGKDLQLKDGVVKSTNEVNIDSPEETLEHQLGDKEISALCWASSNGS  250



>gb|KHG05321.1| Syntaxin-binding protein 5-like protein [Gossypium arboreum]
Length=1088

 Score =   166 bits (420),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 93/225 (41%), Positives = 137/225 (61%), Gaps = 18/225 (8%)
 Frame = +2

Query  2    GVPPGALLLAYDSIQKILAISTKDGRIKVFGKDGAQALLESPNIVPSKFMQFMENQGFLI  181
            G+P  A +LA+D IQ++LAI T DGRIKV G DG + LL SP  +P K+++F++NQGFLI
Sbjct  37   GIPSTASILAFDPIQRLLAIGTLDGRIKVIGGDGIEGLLISPKQLPYKYLEFIQNQGFLI  96

Query  182  KINVDNHIEVWNVDQKSLSNIHEFKRDITSFKIIQHTPYMYIGDSLGYVWVLKLEKEPCN  361
             I+ DN I+VWN++ + L+   +++ +IT+F +I  + +MYIGD  G + V+K + E   
Sbjct  97   GISNDNDIQVWNLETRHLACCLQWESNITAFCLIGGSHFMYIGDEYGILSVVKYDGEDGK  156

Query  362  VVKMKYHI---PFSESHGNSNKDGDNAIVEILPQPTAESKRVLIIYRDGLIILWAVQESK  532
            +  + Y+I     SE+ G S  D D  IV ILPQP +   RV+I Y +GLIILW V +S+
Sbjct  157  LSHLPYNISANSLSEAAGFSFPD-DQPIVGILPQPHSSGDRVIIAYANGLIILWDVSKSQ  215

Query  533  TIFTTGGNALQ------------SVNH--EAXKATAACWACPNGT  625
              F  GG  LQ            +  H  +  + +A CWA  +G+
Sbjct  216  IPFIGGGKDLQLKDAVDSDVQDDTFEHHLQEKEISAICWASSDGS  260



>gb|KJB76967.1| hypothetical protein B456_012G115100 [Gossypium raimondii]
Length=1096

 Score =   166 bits (420),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 93/225 (41%), Positives = 137/225 (61%), Gaps = 18/225 (8%)
 Frame = +2

Query  2    GVPPGALLLAYDSIQKILAISTKDGRIKVFGKDGAQALLESPNIVPSKFMQFMENQGFLI  181
            G+P  A +LA+D IQ++LAI T DGRIKV G DG + LL SP  +P K+++F++NQGFLI
Sbjct  37   GIPSTASILAFDPIQRLLAIGTLDGRIKVIGGDGIEGLLISPKQLPYKYLEFIQNQGFLI  96

Query  182  KINVDNHIEVWNVDQKSLSNIHEFKRDITSFKIIQHTPYMYIGDSLGYVWVLKLEKEPCN  361
             I+ DN I+VWN++ + L+   +++ +IT+F +I  + +MYIGD  G + V+K + E   
Sbjct  97   GISNDNDIQVWNLETRHLACCLQWESNITAFCLIGGSHFMYIGDDYGILSVVKYDGEDGK  156

Query  362  VVKMKYHI---PFSESHGNSNKDGDNAIVEILPQPTAESKRVLIIYRDGLIILWAVQESK  532
            +  + Y+I     SE+ G S  D D  IV ILPQP +   RV+I Y +GLIILW V +S+
Sbjct  157  LSHLPYNITANSLSEAAGFSFPD-DQPIVGILPQPHSSGDRVIIAYANGLIILWDVSKSQ  215

Query  533  TIFTTGGNALQ------------SVNH--EAXKATAACWACPNGT  625
              F  GG  LQ            +  H  +  + +A CWA  +G+
Sbjct  216  IPFIGGGKDLQLKDAVDSDVQDDTFEHHLQEKEISAICWASSDGS  260



>ref|XP_002323587.2| hypothetical protein POPTR_0016s12520g [Populus trichocarpa]
 gb|EEF05348.2| hypothetical protein POPTR_0016s12520g [Populus trichocarpa]
Length=1115

 Score =   166 bits (420),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 84/191 (44%), Positives = 125/191 (65%), Gaps = 4/191 (2%)
 Frame = +2

Query  2    GVPPGALLLAYDSIQKILAISTKDGRIKVFGKDGAQALLESPNIVPSKFMQFMENQGFLI  181
            G+P  A LLA+D IQ++LAI+T DGRIKV G DG +AL  SP  +P K ++F++NQGFLI
Sbjct  40   GIPSTASLLAFDPIQRLLAIATLDGRIKVIGGDGIEALFTSPKQLPYKNIEFLQNQGFLI  99

Query  182  KINVDNHIEVWNVDQKSLSNIHEFKRDITSFKIIQHTPYMYIGDSLGYVWVLKLEKEPCN  361
             I+++N I+VWN++ + L+   +++ +IT+F +I  + +MYIGD  G + VLK + E   
Sbjct  100  SISIENDIQVWNLESRCLACSLQWELNITAFSVISRSCFMYIGDEHGSMSVLKYDSEDAK  159

Query  362  VVKMKYHI---PFSESHGNSNKDGDNAIVEILPQPTAESKRVLIIYRDGLIILWAVQESK  532
            ++ + Y I      E+ G  + D    IV +LPQP +   RVLI Y++GLI+LW V E +
Sbjct  160  LLWLPYRITADSLKEAAGFPSPD-HQPIVGVLPQPHSSGNRVLIAYQNGLIVLWDVSEGQ  218

Query  533  TIFTTGGNALQ  565
             +F  GG  LQ
Sbjct  219  ILFVGGGKDLQ  229



>ref|XP_011084900.1| PREDICTED: syntaxin-binding protein 5 isoform X2 [Sesamum indicum]
Length=897

 Score =   164 bits (415),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 87/233 (37%), Positives = 137/233 (59%), Gaps = 26/233 (11%)
 Frame = +2

Query  2    GVPPGALLLAYDSIQKILAISTKDGRIKVFGKDGAQALLESPNIVPSKFMQFMENQGFLI  181
            G+P  A +LA+D IQ++LAI T DGRIKV G D  + LL SP  +P K ++F++NQGFL+
Sbjct  42   GIPSTASILAFDPIQRLLAIGTLDGRIKVVGGDNIEGLLISPKALPFKNLEFLQNQGFLV  101

Query  182  KINVDNHIEVWNVDQKSLSNIHEFKRDITSFKIIQHTPYMYIGDSLGYVWVLKLEKEPCN  361
             ++ +N I+VW+++++ LS+  +++ +IT+F +I  T ++Y+GD  G+V VLK + E  N
Sbjct  102  SVSNENEIQVWDLEKRRLSSNMQWESNITAFAVISGTNFIYVGDEYGFVSVLKYDAEEAN  161

Query  362  VVKMKYHIP---FSESHGNSNKDGDNAIVEILPQPTAESKRVLIIYRDGLIILWAVQESK  532
            ++++ YH+P    +E  G S  D   ++V +L QP +   RVLI + +GLIILW V E +
Sbjct  162  ILQLPYHVPPNLIAEGAGVSLPD-HQSVVGVLSQPCSCGNRVLIAFENGLIILWDVTEDR  220

Query  533  TIFTTGGNALQSV---------------------NHEAXKATAA-CWACPNGT  625
             I   G   LQ                       N E  K  ++ CW  P+G+
Sbjct  221  AIHVRGYKDLQLKERMVVKFSNNESHTYLNDALDNEETEKEISSLCWVSPDGS  273



>ref|XP_009377747.1| PREDICTED: uncharacterized protein LOC103966318 isoform X2 [Pyrus 
x bretschneideri]
Length=1117

 Score =   164 bits (416),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 92/236 (39%), Positives = 133/236 (56%), Gaps = 33/236 (14%)
 Frame = +2

Query  2    GVPPGALLLAYDSIQKILAISTKDGRIKVFGKDGAQALLESPNIVPSKFMQFMENQGFLI  181
            G+P  A +LA+D IQ +LAI T DGRIKV G DG + L  SP  +P K+++F++N G+L+
Sbjct  37   GIPSTASILAFDPIQHLLAIGTLDGRIKVIGDDGIEGLFISPKQLPYKYIEFLQNHGYLV  96

Query  182  KINVDNHIEVWNVDQKSLSNIHEFKRDITSFKIIQHTPYMYIGDSLGYVWVLKLEKEPCN  361
             I  DN I+VWN++ +SL    E++ +IT+F +I  +  MY+GD    V V+K + E   
Sbjct  97   SILNDNDIQVWNLESRSLVYCLEWETNITAFSVIHGSNLMYVGDEYALVAVVKYDAEEGK  156

Query  362  VVKMKYHIPFSESHGNSNKDG-------DNAIVEILPQPTAESKRVLIIYRDGLIILWAV  520
            ++++ YHI       NS  +        D  IV ILPQP +   RVLI Y++GL+ILW V
Sbjct  157  LLRLPYHI-----SANSLYEAAAFPFPIDQPIVGILPQPCSSGNRVLIAYQNGLVILWDV  211

Query  521  QESKTIFTTGGNALQ----------SVNHEAXKAT-----------AACWACPNGT  625
             E+K +F  GG  LQ           VN ++ + T           A CWA  NG+
Sbjct  212  SEAKIVFIGGGKDLQLRDGVVKSTHEVNVDSPEDTLEQQLGDKEISALCWASANGS  267



>ref|XP_009377746.1| PREDICTED: uncharacterized protein LOC103966318 isoform X1 [Pyrus 
x bretschneideri]
Length=1118

 Score =   164 bits (416),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 92/236 (39%), Positives = 133/236 (56%), Gaps = 33/236 (14%)
 Frame = +2

Query  2    GVPPGALLLAYDSIQKILAISTKDGRIKVFGKDGAQALLESPNIVPSKFMQFMENQGFLI  181
            G+P  A +LA+D IQ +LAI T DGRIKV G DG + L  SP  +P K+++F++N G+L+
Sbjct  37   GIPSTASILAFDPIQHLLAIGTLDGRIKVIGDDGIEGLFISPKQLPYKYIEFLQNHGYLV  96

Query  182  KINVDNHIEVWNVDQKSLSNIHEFKRDITSFKIIQHTPYMYIGDSLGYVWVLKLEKEPCN  361
             I  DN I+VWN++ +SL    E++ +IT+F +I  +  MY+GD    V V+K + E   
Sbjct  97   SILNDNDIQVWNLESRSLVYCLEWETNITAFSVIHGSNLMYVGDEYALVAVVKYDAEEGK  156

Query  362  VVKMKYHIPFSESHGNSNKDG-------DNAIVEILPQPTAESKRVLIIYRDGLIILWAV  520
            ++++ YHI       NS  +        D  IV ILPQP +   RVLI Y++GL+ILW V
Sbjct  157  LLRLPYHI-----SANSLYEAAAFPFPIDQPIVGILPQPCSSGNRVLIAYQNGLVILWDV  211

Query  521  QESKTIFTTGGNALQ----------SVNHEAXKAT-----------AACWACPNGT  625
             E+K +F  GG  LQ           VN ++ + T           A CWA  NG+
Sbjct  212  SEAKIVFIGGGKDLQLRDGVVKSTHEVNVDSPEDTLEQQLGDKEISALCWASANGS  267



>emb|CDP14008.1| unnamed protein product [Coffea canephora]
Length=1096

 Score =   164 bits (415),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 76/190 (40%), Positives = 124/190 (65%), Gaps = 2/190 (1%)
 Frame = +2

Query  2    GVPPGALLLAYDSIQKILAISTKDGRIKVFGKDGAQALLESPNIVPSKFMQFMENQGFLI  181
            G+P  A +LA+DS+Q++LA+ T DGRIKV G D  + LL SP  +P K ++F++NQG+L+
Sbjct  43   GIPSTASVLAFDSVQQLLAVGTLDGRIKVVGGDSIEGLLMSPKPIPFKNLEFLQNQGYLV  102

Query  182  KINVDNHIEVWNVDQKSLSNIHEFKRDITSFKIIQHTPYMYIGDSLGYVWVLKLEKEPCN  361
             I+ +N I+VW+++ +S+S   +++ +IT+F +I  T +MYIGD  G++ VLK + E   
Sbjct  103  SISNENEIQVWDLESRSISTSLQWESNITAFSVIYGTQFMYIGDEYGFLSVLKYDAEEQT  162

Query  362  VVKMKYHIP--FSESHGNSNKDGDNAIVEILPQPTAESKRVLIIYRDGLIILWAVQESKT  535
            ++++ YHIP          +   + +IV +LPQP++   R+L+ Y DGLI+LW V E + 
Sbjct  163  ILQLPYHIPANLVAEAAEISLPFNQSIVGVLPQPSSFGNRLLLAYEDGLIVLWDVTEDRA  222

Query  536  IFTTGGNALQ  565
            +   G   LQ
Sbjct  223  VLVRGNKDLQ  232



>ref|XP_011084899.1| PREDICTED: uncharacterized protein LOC105167041 isoform X1 [Sesamum 
indicum]
Length=1107

 Score =   164 bits (415),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 87/233 (37%), Positives = 137/233 (59%), Gaps = 26/233 (11%)
 Frame = +2

Query  2    GVPPGALLLAYDSIQKILAISTKDGRIKVFGKDGAQALLESPNIVPSKFMQFMENQGFLI  181
            G+P  A +LA+D IQ++LAI T DGRIKV G D  + LL SP  +P K ++F++NQGFL+
Sbjct  42   GIPSTASILAFDPIQRLLAIGTLDGRIKVVGGDNIEGLLISPKALPFKNLEFLQNQGFLV  101

Query  182  KINVDNHIEVWNVDQKSLSNIHEFKRDITSFKIIQHTPYMYIGDSLGYVWVLKLEKEPCN  361
             ++ +N I+VW+++++ LS+  +++ +IT+F +I  T ++Y+GD  G+V VLK + E  N
Sbjct  102  SVSNENEIQVWDLEKRRLSSNMQWESNITAFAVISGTNFIYVGDEYGFVSVLKYDAEEAN  161

Query  362  VVKMKYHIP---FSESHGNSNKDGDNAIVEILPQPTAESKRVLIIYRDGLIILWAVQESK  532
            ++++ YH+P    +E  G S  D   ++V +L QP +   RVLI + +GLIILW V E +
Sbjct  162  ILQLPYHVPPNLIAEGAGVSLPD-HQSVVGVLSQPCSCGNRVLIAFENGLIILWDVTEDR  220

Query  533  TIFTTGGNALQSV---------------------NHEAXKATAA-CWACPNGT  625
             I   G   LQ                       N E  K  ++ CW  P+G+
Sbjct  221  AIHVRGYKDLQLKERMVVKFSNNESHTYLNDALDNEETEKEISSLCWVSPDGS  273



>ref|XP_008363911.1| PREDICTED: uncharacterized protein LOC103427620 isoform X1 [Malus 
domestica]
Length=1118

 Score =   164 bits (414),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 92/236 (39%), Positives = 134/236 (57%), Gaps = 33/236 (14%)
 Frame = +2

Query  2    GVPPGALLLAYDSIQKILAISTKDGRIKVFGKDGAQALLESPNIVPSKFMQFMENQGFLI  181
            G+P  A +LA+D IQ++LAI T DGRIKV G DG + L  SP  +P K+++F++NQG+L+
Sbjct  37   GIPSTASILAFDPIQRLLAIGTLDGRIKVIGDDGIEGLFISPKQLPYKYIEFLQNQGYLV  96

Query  182  KINVDNHIEVWNVDQKSLSNIHEFKRDITSFKIIQHTPYMYIGDSLGYVWVLKLEKEPCN  361
             I  DN I+VWN++ +SL    E++ +IT+F +I  +  MY+GD    V V+K + E   
Sbjct  97   SILNDNDIQVWNLESRSLVYCLEWETNITAFSVIHGSNLMYVGDEYALVAVVKYDAEEGK  156

Query  362  VVKMKYHIPFSESHGNSNKDG-------DNAIVEILPQPTAESKRVLIIYRDGLIILWAV  520
            ++++ YHI       NS  +        D  IV ILPQ  +   RVLI Y++GL+ILW V
Sbjct  157  LLRLPYHI-----SANSLYEAAAFPFPIDQPIVGILPQLCSSGNRVLIAYQNGLVILWDV  211

Query  521  QESKTIFTTGGNALQ----------SVNHEAXKAT-----------AACWACPNGT  625
             E+K +F  GG  LQ           VN ++ + T           A CWA  NG+
Sbjct  212  SEAKIVFIGGGKDLQLKDGVVKSTNEVNVDSPEDTLEHQLGDKEISALCWASSNGS  267



>ref|XP_008363912.1| PREDICTED: uncharacterized protein LOC103427620 isoform X2 [Malus 
domestica]
Length=1117

 Score =   164 bits (414),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 92/236 (39%), Positives = 134/236 (57%), Gaps = 33/236 (14%)
 Frame = +2

Query  2    GVPPGALLLAYDSIQKILAISTKDGRIKVFGKDGAQALLESPNIVPSKFMQFMENQGFLI  181
            G+P  A +LA+D IQ++LAI T DGRIKV G DG + L  SP  +P K+++F++NQG+L+
Sbjct  37   GIPSTASILAFDPIQRLLAIGTLDGRIKVIGDDGIEGLFISPKQLPYKYIEFLQNQGYLV  96

Query  182  KINVDNHIEVWNVDQKSLSNIHEFKRDITSFKIIQHTPYMYIGDSLGYVWVLKLEKEPCN  361
             I  DN I+VWN++ +SL    E++ +IT+F +I  +  MY+GD    V V+K + E   
Sbjct  97   SILNDNDIQVWNLESRSLVYCLEWETNITAFSVIHGSNLMYVGDEYALVAVVKYDAEEGK  156

Query  362  VVKMKYHIPFSESHGNSNKDG-------DNAIVEILPQPTAESKRVLIIYRDGLIILWAV  520
            ++++ YHI       NS  +        D  IV ILPQ  +   RVLI Y++GL+ILW V
Sbjct  157  LLRLPYHI-----SANSLYEAAAFPFPIDQPIVGILPQLCSSGNRVLIAYQNGLVILWDV  211

Query  521  QESKTIFTTGGNALQ----------SVNHEAXKAT-----------AACWACPNGT  625
             E+K +F  GG  LQ           VN ++ + T           A CWA  NG+
Sbjct  212  SEAKIVFIGGGKDLQLKDGVVKSTNEVNVDSPEDTLEHQLGDKEISALCWASSNGS  267



>ref|XP_011095022.1| PREDICTED: uncharacterized protein LOC105174577 isoform X1 [Sesamum 
indicum]
Length=1094

 Score =   163 bits (413),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 86/230 (37%), Positives = 134/230 (58%), Gaps = 23/230 (10%)
 Frame = +2

Query  2    GVPPGALLLAYDSIQKILAISTKDGRIKVFGKDGAQALLESPNIVPSKFMQFMENQGFLI  181
            GVP  A +LA+DSIQ++LAI T DGRIK+ G D  + LL SP +VP K+++F++NQGFL+
Sbjct  36   GVPSTASILAFDSIQRLLAIGTLDGRIKLIGGDNIEGLLISPKLVPYKYLEFLQNQGFLV  95

Query  182  KINVDNHIEVWNVDQKSLSNIHEFKRDITSFKIIQHTPYMYIGDSLGYVWVLKLEKEPCN  361
             I  DN I+VWN+  +S++   +++ ++T+F +I  + +MY+GD  G + VLK + +   
Sbjct  96   SITNDNDIQVWNLQMRSIACSFQWESNVTAFSVISGSSFMYVGDEYGLMSVLKYDSDGGE  155

Query  362  VVKMKYHI---PFSESHGNSNKDGDNAIVEILPQPTAESKRVLIIYRDGLIILWAVQESK  532
            ++K+ Y +     +E+ G S  +    IV +LPQP +   R+LI Y  GLIILW V E+ 
Sbjct  156  LLKLHYQLSSDSLAEATGFSISN-RQPIVGLLPQPCSSGNRLLIAYESGLIILWDVVEAH  214

Query  533  TIFTTGGNALQ------------------SVNHEAXKATAA-CWACPNGT  625
             +   G   LQ                   ++H   K  +A CWA  +G+
Sbjct  215  VVIVRGDKVLQLKNKVVPPIDIDTNIVGDELSHNLDKEISALCWASTDGS  264



>ref|XP_011095023.1| PREDICTED: uncharacterized protein LOC105174577 isoform X2 [Sesamum 
indicum]
Length=1063

 Score =   163 bits (413),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 86/230 (37%), Positives = 134/230 (58%), Gaps = 23/230 (10%)
 Frame = +2

Query  2    GVPPGALLLAYDSIQKILAISTKDGRIKVFGKDGAQALLESPNIVPSKFMQFMENQGFLI  181
            GVP  A +LA+DSIQ++LAI T DGRIK+ G D  + LL SP +VP K+++F++NQGFL+
Sbjct  36   GVPSTASILAFDSIQRLLAIGTLDGRIKLIGGDNIEGLLISPKLVPYKYLEFLQNQGFLV  95

Query  182  KINVDNHIEVWNVDQKSLSNIHEFKRDITSFKIIQHTPYMYIGDSLGYVWVLKLEKEPCN  361
             I  DN I+VWN+  +S++   +++ ++T+F +I  + +MY+GD  G + VLK + +   
Sbjct  96   SITNDNDIQVWNLQMRSIACSFQWESNVTAFSVISGSSFMYVGDEYGLMSVLKYDSDGGE  155

Query  362  VVKMKYHI---PFSESHGNSNKDGDNAIVEILPQPTAESKRVLIIYRDGLIILWAVQESK  532
            ++K+ Y +     +E+ G S  +    IV +LPQP +   R+LI Y  GLIILW V E+ 
Sbjct  156  LLKLHYQLSSDSLAEATGFSISN-RQPIVGLLPQPCSSGNRLLIAYESGLIILWDVVEAH  214

Query  533  TIFTTGGNALQ------------------SVNHEAXKATAA-CWACPNGT  625
             +   G   LQ                   ++H   K  +A CWA  +G+
Sbjct  215  VVIVRGDKVLQLKNKVVPPIDIDTNIVGDELSHNLDKEISALCWASTDGS  264



>ref|XP_009338156.1| PREDICTED: uncharacterized protein LOC103930534 [Pyrus x bretschneideri]
Length=1117

 Score =   163 bits (413),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 88/236 (37%), Positives = 135/236 (57%), Gaps = 33/236 (14%)
 Frame = +2

Query  2    GVPPGALLLAYDSIQKILAISTKDGRIKVFGKDGAQALLESPNIVPSKFMQFMENQGFLI  181
            G+P  A +LA+D IQ++LAI T DGRIKV G DG + L  SP  +P K+++F++NQG+L+
Sbjct  37   GIPSTASILAFDPIQRLLAIGTLDGRIKVIGGDGIEGLFISPKQLPYKYIEFLQNQGYLV  96

Query  182  KINVDNHIEVWNVDQKSLSNIHEFKRDITSFKIIQHTPYMYIGDSLGYVWVLKLEKEPCN  361
             I  DN I+VWN++ +SL    E++ +IT+F +I  +  MY+GD    V V+K + E   
Sbjct  97   SILNDNDIQVWNLESRSLVYCLEWETNITAFSVIHGSSLMYVGDEYSLVAVVKYDAEEGK  156

Query  362  VVKMKYHIPFSESHGNSNKDG-------DNAIVEILPQPTAESKRVLIIYRDGLIILWAV  520
            ++++ YHI       NS  +        D  IV ILPQP +   RVLI Y++G+++LW V
Sbjct  157  LLQLPYHI-----SANSLSEAAEFPFPTDQPIVGILPQPYSSGNRVLIAYQNGVVVLWDV  211

Query  521  QESKTIFTTGGNALQ-------------------SVNHEA--XKATAACWACPNGT  625
             E+K ++  GG  LQ                   ++ H+    + +A CWA  NG+
Sbjct  212  SEAKIVYIGGGKDLQLKEGIVKSTNEIDVDCPEDTLEHQLGDKEISALCWASLNGS  267



>ref|XP_010253763.1| PREDICTED: uncharacterized protein LOC104594912 isoform X1 [Nelumbo 
nucifera]
Length=1116

 Score =   161 bits (407),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 87/233 (37%), Positives = 132/233 (57%), Gaps = 26/233 (11%)
 Frame = +2

Query  2    GVPPGALLLAYDSIQKILAISTKDGRIKVFGKDGAQALLESPNIVPSKFMQFMENQGFLI  181
            G+P  A +LA+D IQ++LAI T DGRIKV G D  + LL SP  +P K ++F+ NQGF++
Sbjct  37   GIPSSASVLAFDPIQRLLAIGTLDGRIKVIGGDNIEGLLISPKQLPFKNLEFLHNQGFIV  96

Query  182  KINVDNHIEVWNVDQKSLSNIHEFKRDITSFKIIQHTPYMYIGDSLGYVWVLKLEKEPCN  361
             +  +N I+VW+++ + ++    ++ +IT+F +I  TP+MY+GD  G + VLK +     
Sbjct  97   SVTNENDIQVWDLENRHMACSLVWETNITAFSVISGTPFMYVGDEYGLMSVLKYDANEGK  156

Query  362  VVKMKYHIP---FSESHGNSNKDGDNAIVEILPQPTAESKRVLIIYRDGLIILWAVQESK  532
            ++K+ YHIP    +E+ G S  D    IV +LPQP     RVLI Y  GL+ILW V E++
Sbjct  157  LLKLPYHIPADLLAEAAGISLPD-HQTIVGLLPQPCTSGNRVLIAYEHGLLILWDVCENR  215

Query  533  TIFTTGGNALQ--------------------SVNHEAXKA--TAACWACPNGT  625
             +   G   LQ                    + NHE  +   ++ CWA  NG+
Sbjct  216  VVLVRGYEDLQLKDEGVVNFPTGADNEFTDDTSNHEQEEKEISSHCWASTNGS  268



>ref|XP_010065698.1| PREDICTED: uncharacterized protein LOC104452894 [Eucalyptus grandis]
Length=1075

 Score =   161 bits (407),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 88/231 (38%), Positives = 130/231 (56%), Gaps = 23/231 (10%)
 Frame = +2

Query  2    GVPPGALLLAYDSIQKILAISTKDGRIKVFGKDGAQALLESPNIVPSKFMQFMENQGFLI  181
            GVP  A +LA+D IQ +LAI T DGRIKV G DG + L  SP  +P K ++F+ NQG L+
Sbjct  38   GVPSTASILAFDPIQSLLAIGTLDGRIKVIGGDGIEGLFMSPRQLPIKHLEFLRNQGILV  97

Query  182  KINVDNHIEVWNVDQKSLSNIHEFKRDITSFKIIQHTPYMYIGDSLGYVWVLKLEKEPCN  361
             I+ DN+I+VWN++++SL++  +++ +IT+F +I  + ++YIGD  G + VLK   +   
Sbjct  98   SISNDNYIQVWNLERRSLASCLQWQSNITAFSVITGSNFIYIGDDHGLLSVLKCNADSGE  157

Query  362  VVKMKYHIP---FSESHGNSNKDGDNAIVEILPQPTAESKRVLIIYRDGLIILWAVQESK  532
            + ++ YHIP    S+  G S  D  + IV +L QP     RVLI Y  GL+ LW V E +
Sbjct  158  LCQLPYHIPATSISKVSGISFPDDHHMIVGVLHQPCPSGDRVLIAYECGLLTLWDVTEGQ  217

Query  533  TIFTTGGNALQSVNHEAXKA--------------------TAACWACPNGT  625
             +F  GG  L   +  A  A                    +A CWA  +G+
Sbjct  218  ILFIGGGKDLHLKDGFANSAIKEDNLSDDTSGCYLGEKEISALCWASGDGS  268



>ref|XP_010253764.1| PREDICTED: uncharacterized protein LOC104594912 isoform X2 [Nelumbo 
nucifera]
Length=1115

 Score =   161 bits (407),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 87/233 (37%), Positives = 132/233 (57%), Gaps = 26/233 (11%)
 Frame = +2

Query  2    GVPPGALLLAYDSIQKILAISTKDGRIKVFGKDGAQALLESPNIVPSKFMQFMENQGFLI  181
            G+P  A +LA+D IQ++LAI T DGRIKV G D  + LL SP  +P K ++F+ NQGF++
Sbjct  37   GIPSSASVLAFDPIQRLLAIGTLDGRIKVIGGDNIEGLLISPKQLPFKNLEFLHNQGFIV  96

Query  182  KINVDNHIEVWNVDQKSLSNIHEFKRDITSFKIIQHTPYMYIGDSLGYVWVLKLEKEPCN  361
             +  +N I+VW+++ + ++    ++ +IT+F +I  TP+MY+GD  G + VLK +     
Sbjct  97   SVTNENDIQVWDLENRHMACSLVWETNITAFSVISGTPFMYVGDEYGLMSVLKYDANEGK  156

Query  362  VVKMKYHIP---FSESHGNSNKDGDNAIVEILPQPTAESKRVLIIYRDGLIILWAVQESK  532
            ++K+ YHIP    +E+ G S  D    IV +LPQP     RVLI Y  GL+ILW V E++
Sbjct  157  LLKLPYHIPADLLAEAAGISLPD-HQTIVGLLPQPCTSGNRVLIAYEHGLLILWDVCENR  215

Query  533  TIFTTGGNALQ--------------------SVNHEAXKA--TAACWACPNGT  625
             +   G   LQ                    + NHE  +   ++ CWA  NG+
Sbjct  216  VVLVRGYEDLQLKDEGVVNFPTGADNEFTDDTSNHEQEEKEISSHCWASTNGS  268



>ref|XP_010253765.1| PREDICTED: uncharacterized protein LOC104594912 isoform X3 [Nelumbo 
nucifera]
Length=1113

 Score =   161 bits (407),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 87/233 (37%), Positives = 132/233 (57%), Gaps = 26/233 (11%)
 Frame = +2

Query  2    GVPPGALLLAYDSIQKILAISTKDGRIKVFGKDGAQALLESPNIVPSKFMQFMENQGFLI  181
            G+P  A +LA+D IQ++LAI T DGRIKV G D  + LL SP  +P K ++F+ NQGF++
Sbjct  37   GIPSSASVLAFDPIQRLLAIGTLDGRIKVIGGDNIEGLLISPKQLPFKNLEFLHNQGFIV  96

Query  182  KINVDNHIEVWNVDQKSLSNIHEFKRDITSFKIIQHTPYMYIGDSLGYVWVLKLEKEPCN  361
             +  +N I+VW+++ + ++    ++ +IT+F +I  TP+MY+GD  G + VLK +     
Sbjct  97   SVTNENDIQVWDLENRHMACSLVWETNITAFSVISGTPFMYVGDEYGLMSVLKYDANEGK  156

Query  362  VVKMKYHIP---FSESHGNSNKDGDNAIVEILPQPTAESKRVLIIYRDGLIILWAVQESK  532
            ++K+ YHIP    +E+ G S  D    IV +LPQP     RVLI Y  GL+ILW V E++
Sbjct  157  LLKLPYHIPADLLAEAAGISLPD-HQTIVGLLPQPCTSGNRVLIAYEHGLLILWDVCENR  215

Query  533  TIFTTGGNALQ--------------------SVNHEAXKA--TAACWACPNGT  625
             +   G   LQ                    + NHE  +   ++ CWA  NG+
Sbjct  216  VVLVRGYEDLQLKDEGVVNFPTGADNEFTDDTSNHEQEEKEISSHCWASTNGS  268



>gb|KCW88134.1| hypothetical protein EUGRSUZ_A00527 [Eucalyptus grandis]
Length=1117

 Score =   160 bits (406),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 88/231 (38%), Positives = 130/231 (56%), Gaps = 23/231 (10%)
 Frame = +2

Query  2    GVPPGALLLAYDSIQKILAISTKDGRIKVFGKDGAQALLESPNIVPSKFMQFMENQGFLI  181
            GVP  A +LA+D IQ +LAI T DGRIKV G DG + L  SP  +P K ++F+ NQG L+
Sbjct  38   GVPSTASILAFDPIQSLLAIGTLDGRIKVIGGDGIEGLFMSPRQLPIKHLEFLRNQGILV  97

Query  182  KINVDNHIEVWNVDQKSLSNIHEFKRDITSFKIIQHTPYMYIGDSLGYVWVLKLEKEPCN  361
             I+ DN+I+VWN++++SL++  +++ +IT+F +I  + ++YIGD  G + VLK   +   
Sbjct  98   SISNDNYIQVWNLERRSLASCLQWQSNITAFSVITGSNFIYIGDDHGLLSVLKCNADSGE  157

Query  362  VVKMKYHIP---FSESHGNSNKDGDNAIVEILPQPTAESKRVLIIYRDGLIILWAVQESK  532
            + ++ YHIP    S+  G S  D  + IV +L QP     RVLI Y  GL+ LW V E +
Sbjct  158  LCQLPYHIPATSISKVSGISFPDDHHMIVGVLHQPCPSGDRVLIAYECGLLTLWDVTEGQ  217

Query  533  TIFTTGGNALQSVNHEAXKA--------------------TAACWACPNGT  625
             +F  GG  L   +  A  A                    +A CWA  +G+
Sbjct  218  ILFIGGGKDLHLKDGFANSAIKEDNLSDDTSGCYLGEKEISALCWASGDGS  268



>gb|KCW88135.1| hypothetical protein EUGRSUZ_A00527 [Eucalyptus grandis]
Length=1121

 Score =   160 bits (406),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 88/231 (38%), Positives = 130/231 (56%), Gaps = 23/231 (10%)
 Frame = +2

Query  2    GVPPGALLLAYDSIQKILAISTKDGRIKVFGKDGAQALLESPNIVPSKFMQFMENQGFLI  181
            GVP  A +LA+D IQ +LAI T DGRIKV G DG + L  SP  +P K ++F+ NQG L+
Sbjct  38   GVPSTASILAFDPIQSLLAIGTLDGRIKVIGGDGIEGLFMSPRQLPIKHLEFLRNQGILV  97

Query  182  KINVDNHIEVWNVDQKSLSNIHEFKRDITSFKIIQHTPYMYIGDSLGYVWVLKLEKEPCN  361
             I+ DN+I+VWN++++SL++  +++ +IT+F +I  + ++YIGD  G + VLK   +   
Sbjct  98   SISNDNYIQVWNLERRSLASCLQWQSNITAFSVITGSNFIYIGDDHGLLSVLKCNADSGE  157

Query  362  VVKMKYHIP---FSESHGNSNKDGDNAIVEILPQPTAESKRVLIIYRDGLIILWAVQESK  532
            + ++ YHIP    S+  G S  D  + IV +L QP     RVLI Y  GL+ LW V E +
Sbjct  158  LCQLPYHIPATSISKVSGISFPDDHHMIVGVLHQPCPSGDRVLIAYECGLLTLWDVTEGQ  217

Query  533  TIFTTGGNALQSVNHEAXKA--------------------TAACWACPNGT  625
             +F  GG  L   +  A  A                    +A CWA  +G+
Sbjct  218  ILFIGGGKDLHLKDGFANSAIKEDNLSDDTSGCYLGEKEISALCWASGDGS  268



>ref|XP_002532114.1| nucleotide binding protein, putative [Ricinus communis]
 gb|EEF30276.1| nucleotide binding protein, putative [Ricinus communis]
Length=1096

 Score =   160 bits (406),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 87/232 (38%), Positives = 136/232 (59%), Gaps = 25/232 (11%)
 Frame = +2

Query  2    GVPPGALLLAYDSIQKILAISTKDGRIKVFGKDGAQALLESPNIVPSKFMQFMENQGFLI  181
            GVP  A LLA+DSIQ++LAI+T DGRIKV G DG + +  SP  +P K ++F++N+GFL+
Sbjct  41   GVPSTASLLAFDSIQRLLAIATLDGRIKVIGGDGIEGIFISPKQLPYKNLEFLQNRGFLV  100

Query  182  KINVDNHIEVWNVDQKSLSNIHEFKRDITSFKIIQHTPYMYIGDSLGYVWVLKLEKEPCN  361
             I+ +N IEVWN+  + L    +++++IT+F +I  +  MYIGD  G + V+K + +   
Sbjct  101  SISNENDIEVWNLKSRCLKCCLQWEKNITAFSVISGSYLMYIGDEYGLMSVVKYDADNAK  160

Query  362  VVKMKYHIP---FSESHGNSNKDGDNAIVEILPQPTAESKRVLIIYRDGLIILWAVQESK  532
            ++++ Y+IP    +E  G  + D    IV +LP P +   RVLI Y +GL++LW V E++
Sbjct  161  LLRLPYNIPSNQLNEVAGFPSSD-HQPIVGLLPHPCSSGNRVLIAYENGLMVLWDVSEAR  219

Query  533  TIFTTGGNALQ----SVNHEAXKAT-----------------AACWACPNGT  625
             +F  G   LQ    +V+ ++   T                 A CWA  NG+
Sbjct  220  ILFVGGSKDLQLKDGNVDSQSGPHTNLQDNASNDQLQDKEISALCWASSNGS  271



>ref|XP_008367163.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103430801 
[Malus domestica]
Length=1575

 Score =   161 bits (407),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 87/236 (37%), Positives = 133/236 (56%), Gaps = 33/236 (14%)
 Frame = +2

Query  2    GVPPGALLLAYDSIQKILAISTKDGRIKVFGKDGAQALLESPNIVPSKFMQFMENQGFLI  181
            G+P  A +LA+D IQ++LAI T DGRIKV G DG + L   P  +P K+++F++NQG+L+
Sbjct  495  GIPSTASILAFDPIQRLLAIGTLDGRIKVIGGDGIEGLFIXPKQLPYKYIEFLQNQGYLV  554

Query  182  KINVDNHIEVWNVDQKSLSNIHEFKRDITSFKIIQHTPYMYIGDSLGYVWVLKLEKEPCN  361
             I  DN I+VWN++ +SL    E++ +IT+F +I  +  MY+GD    V V+K + E   
Sbjct  555  SILNDNDIQVWNLESRSLVYCLEWETNITAFSVIHGSSLMYVGDEYALVAVMKYDAEEGK  614

Query  362  VVKMKYHIPFSESHGNSNKDG-------DNAIVEILPQPTAESKRVLIIYRDGLIILWAV  520
            ++++ YHI       NS  +        D  IV ILPQP     RVLI Y++G+++LW V
Sbjct  615  LLQLPYHI-----SANSLSEAAEFPFPTDQPIVGILPQPXFSXGRVLIAYQNGVVVLWDV  669

Query  521  QESKTIFTTGGNALQ-------------------SVNHEA--XKATAACWACPNGT  625
             E+K ++  GG  LQ                   ++ H+    + +A CWA  NG+
Sbjct  670  SEAKIVYIGGGKDLQLKDGIVKSTNEIDXDCPEDTLEHQLGDKEISALCWASXNGS  725



>ref|XP_010653303.1| PREDICTED: uncharacterized protein LOC100257563 [Vitis vinifera]
 emb|CBI22805.3| unnamed protein product [Vitis vinifera]
Length=1127

 Score =   159 bits (402),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 87/232 (38%), Positives = 135/232 (58%), Gaps = 25/232 (11%)
 Frame = +2

Query  2    GVPPGALLLAYDSIQKILAISTKDGRIKVFGKDGAQALLESPNIVPSKFMQFMENQGFLI  181
            G+P  A +LA+D IQ++LAI T DGRIKV G D  + L  SP  +P K+++F++NQGFL+
Sbjct  50   GIPSTASILAFDPIQRLLAIGTLDGRIKVIGGDNIEGLFISPKQLPYKYLEFLQNQGFLV  109

Query  182  KINVDNHIEVWNVDQKSLSNIHEFKRDITSFKIIQHTPYMYIGDSLGYVWVLKLEKEPCN  361
             I+ D+ I+VWN++++ +S    ++ +IT+F +I  + +MYIGD  G + VLK E +   
Sbjct  110  SISNDDEIQVWNLERQCISCCLHWESNITAFSVISGSNFMYIGDEYGSISVLKCEADDGK  169

Query  362  VVKMKYHI---PFSESHGNSNKDGDNAIVEILPQPTAESKRVLIIYRDGLIILWAVQESK  532
            ++++ Y+I     SE+ G S  +    ++ +LPQP +   RVLI Y +GLIILW V E++
Sbjct  170  LLQLPYNIFAKSISEAGGFSFFN-HQPVIGVLPQPCSSGNRVLIAYENGLIILWDVSEAQ  228

Query  533  TIFTTGGNALQ--------------------SVNH-EAXKATAACWACPNGT  625
             I   G   LQ                    S  H E  + +A CWA  +G+
Sbjct  229  IIVAKGDKNLQLNDRAVDSPSEADSNLPDDASEQHLEEKEISALCWASSDGS  280



>ref|XP_006435755.1| hypothetical protein CICLE_v10030572mg [Citrus clementina]
 gb|ESR48995.1| hypothetical protein CICLE_v10030572mg [Citrus clementina]
Length=1091

 Score =   158 bits (399),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 76/188 (40%), Positives = 121/188 (64%), Gaps = 2/188 (1%)
 Frame = +2

Query  2    GVPPGALLLAYDSIQKILAISTKDGRIKVFGKDGAQALLESPNIVPSKFMQFMENQGFLI  181
            G+P  A +LA+D +Q +LAI T+DGRIKV G D  + LL SP  +  K ++F++NQGFL+
Sbjct  29   GIPSTASILAFDHVQSLLAIGTQDGRIKVIGGDNIEGLLVSPKQLAFKHLEFLQNQGFLV  88

Query  182  KINVDNHIEVWNVDQKSLSNIHEFKRDITSFKIIQHTPYMYIGDSLGYVWVLKLEKEPCN  361
             I+  N I++W+++ + +++   ++ +IT+F +I  T YMYIGD  G V+VLK + E   
Sbjct  89   SISSGNEIQLWDLEARRITSTLPWESNITAFSVIFGTSYMYIGDEYGMVYVLKYDTEEGK  148

Query  362  VVKMKYHIPFSESHGNSNKDGDNAIVEILPQPTAESKRVLIIYRDGLIILWAVQESKTIF  541
            ++   Y++P       ++    ++IV +LPQP +E KR+L++Y +GLIILW V E K + 
Sbjct  149  LIHSPYYVPKDVIEEAASI--QSSIVGVLPQPYSEGKRLLLVYANGLIILWDVSEDKVVL  206

Query  542  TTGGNALQ  565
              G   LQ
Sbjct  207  VRGSKDLQ  214



>ref|XP_006486530.1| PREDICTED: uncharacterized protein LOC102617119 [Citrus sinensis]
Length=1125

 Score =   158 bits (399),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 76/188 (40%), Positives = 121/188 (64%), Gaps = 2/188 (1%)
 Frame = +2

Query  2    GVPPGALLLAYDSIQKILAISTKDGRIKVFGKDGAQALLESPNIVPSKFMQFMENQGFLI  181
            G+P  A +LA+D +Q +LAI T+DGRIKV G D  + LL SP  +  K ++F++NQGFL+
Sbjct  40   GIPSTASILAFDHVQSLLAIGTQDGRIKVIGGDNIEGLLVSPKQLAFKHLEFLQNQGFLV  99

Query  182  KINVDNHIEVWNVDQKSLSNIHEFKRDITSFKIIQHTPYMYIGDSLGYVWVLKLEKEPCN  361
             I+  N I++W+++ + +++   ++ +IT+F +I  T YMYIGD  G V+VLK + E   
Sbjct  100  SISSGNEIQLWDLEARRITSTLPWESNITAFSVIFGTSYMYIGDEYGMVYVLKYDTEEGK  159

Query  362  VVKMKYHIPFSESHGNSNKDGDNAIVEILPQPTAESKRVLIIYRDGLIILWAVQESKTIF  541
            ++   Y++P       ++    ++IV +LPQP +E KR+L++Y +GLIILW V E K + 
Sbjct  160  LIHSPYYVPKDVIEEAASI--QSSIVGVLPQPYSEGKRLLLVYANGLIILWDVSEDKVVL  217

Query  542  TTGGNALQ  565
              G   LQ
Sbjct  218  VRGSKDLQ  225



>gb|EPS63539.1| hypothetical protein M569_11243, partial [Genlisea aurea]
Length=451

 Score =   154 bits (388),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 87/232 (38%), Positives = 136/232 (59%), Gaps = 24/232 (10%)
 Frame = +2

Query  2    GVPPGALLLAYDSIQKILAISTKDGRIKVFGKDGAQALLESPNIVPSKFMQFMENQGFLI  181
            G+P  A +LA+DSIQ++LAI T DGRIKV G +  + LL SP   P K ++F +NQG L+
Sbjct  22   GIPATASILAFDSIQRLLAIGTLDGRIKVVGGENIEWLLISPTSSPFKNLEFFQNQGLLV  81

Query  182  KINVDNHIEVWNVDQKSLSNIHEFKRDITSFKIIQHTPYMYIGDSLGYVWVLKLEKEPCN  361
             ++ +N I+VW++D++ ++   +++ +IT+F +I  T YMY GD  G++ VLK + +  N
Sbjct  82   SVSNENEIQVWDIDKRCIACNVQWESNITAFSVILGTSYMYAGDEYGFLSVLKYDADERN  141

Query  362  VVKMKYHIPFSE-SHGNSNKDGDN-AIVEILPQPTAESKRVLIIYRDGLIILWAVQESKT  535
            +V++ YH+P +  + G      +N +IV +L QP++  KRVLI Y +GLIILW V + K 
Sbjct  142  IVQLPYHMPPNLIAEGAKIPVSENQSIVGVLSQPSSGGKRVLIAYGNGLIILWDVTQDKA  201

Query  536  IFTTGGNALQ---------------------SVNHEAXKATAA-CWACPNGT  625
            I   G   L+                     S + EA K   + CWA  +G+
Sbjct  202  IHVKGNKNLELKGSTVVSFSNSQSNASLNNLSDDDEAEKEIGSLCWASLDGS  253



>ref|XP_009600570.1| PREDICTED: syntaxin-binding protein 5-like [Nicotiana tomentosiformis]
Length=604

 Score =   155 bits (391),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 87/232 (38%), Positives = 129/232 (56%), Gaps = 25/232 (11%)
 Frame = +2

Query  2    GVPPGALLLAYDSIQKILAISTKDGRIKVFGKDGAQALLESPNIVPSKFMQFMENQGFLI  181
            G+P  A +LA D IQ++LAI T DGR+KV G D  + LL SP  +P K+++F++NQGFL+
Sbjct  40   GIPSTASILAVDPIQRLLAIGTLDGRVKVIGGDNIEGLLISPKQLPYKYLEFLQNQGFLV  99

Query  182  KINVDNHIEVWNVDQKSLSNIHEFKRDITSFKIIQHTPYMYIGDSLGYVWVLKLEKEPCN  361
             I  +N I+VWN+  +S++   ++K +IT+F +I  + ++Y+GD  G + VLK   E   
Sbjct  100  SITNENDIQVWNLKSRSVACDLQWKSNITAFSVINGSSFLYVGDEYGTISVLKFCVENRE  159

Query  362  VVKMKYHI---PFSESHGNSNKDGDNAIVEILPQPTAESKRVLIIYRDGLIILWAVQESK  532
            ++++ Y I     SE+ G +N D    +V ILPQP     R+LI Y  GLIILW V E+ 
Sbjct  160  LLQLPYQILWSSLSEAAGFANAD-HQPVVGILPQPFTSGNRLLIAYESGLIILWDVVEAH  218

Query  533  TIFTTGGNALQ----SVN-----------------HEAXKATAACWACPNGT  625
             I   G   L     +VN                  E  + T  CWA  +G+
Sbjct  219  VIIVKGDKDLHLKDGAVNFKKNADSSSPDDLLQHEFEEKEITTLCWASTDGS  270



>ref|XP_006481054.1| PREDICTED: uncharacterized protein LOC102612279 isoform X1 [Citrus 
sinensis]
Length=1108

 Score =   157 bits (398),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 87/234 (37%), Positives = 135/234 (58%), Gaps = 29/234 (12%)
 Frame = +2

Query  2    GVPPGALLLAYDSIQKILAISTKDGRIKVFGKDGAQALLESPNIVPSKFMQFMENQGFLI  181
            G+P  A +LA+D IQ++LAI+T DGRIKV G DG + LL SP+ +P K ++F++NQGFLI
Sbjct  33   GIPATASILAFDHIQRLLAIATLDGRIKVIGGDGIEGLLISPSQLPYKNLEFLQNQGFLI  92

Query  182  KINVDNHIEVWNVDQKSLSNIHEFKRDITSFKIIQHTPYMYIGDSLGYVWVLKLEKEPCN  361
             I  DN I+VW+++ +SL+   +++ +IT+F +I  + +MYIGD  G + V+K + +   
Sbjct  93   SITNDNEIQVWSLESRSLACCLKWESNITAFSVISGSHFMYIGDENGLMSVIKYDADEGK  152

Query  362  VVKMKYHIPFSESHGNSNKDG-----DNAIVEILPQPTAESKRVLIIYRDGLIILWAVQE  526
            + ++ Y+I    +   S K G        +V +LP P +   RVLI Y + L+ILW V E
Sbjct  153  LFQLPYNI---SADALSEKAGFPLLSHQPVVGVLPHPNSSGNRVLIAYENALVILWDVSE  209

Query  527  SKTIFTTGGNALQS-------------------VNH--EAXKATAACWACPNGT  625
            ++ IF  GG  LQ                    + H  E  + +A CWA  +G+
Sbjct  210  AQIIFVGGGKDLQLKDGVVDSPSEGDSTFLEGILEHQPEEKEISALCWASSSGS  263



>ref|XP_006429414.1| hypothetical protein CICLE_v10010948mg [Citrus clementina]
 gb|ESR42654.1| hypothetical protein CICLE_v10010948mg [Citrus clementina]
Length=1107

 Score =   157 bits (398),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 87/234 (37%), Positives = 135/234 (58%), Gaps = 29/234 (12%)
 Frame = +2

Query  2    GVPPGALLLAYDSIQKILAISTKDGRIKVFGKDGAQALLESPNIVPSKFMQFMENQGFLI  181
            G+P  A +LA+D IQ++LAI+T DGRIKV G DG + LL SP+ +P K ++F++NQGFLI
Sbjct  33   GIPATASILAFDHIQRLLAIATLDGRIKVIGGDGIEGLLISPSQLPYKNLEFLQNQGFLI  92

Query  182  KINVDNHIEVWNVDQKSLSNIHEFKRDITSFKIIQHTPYMYIGDSLGYVWVLKLEKEPCN  361
             I  DN I+VW+++ +SL+   +++ +IT+F +I  + +MYIGD  G + V+K + +   
Sbjct  93   SITNDNEIQVWSLESRSLACCLKWESNITAFSVISGSHFMYIGDENGLMSVIKYDADEGK  152

Query  362  VVKMKYHIPFSESHGNSNKDG-----DNAIVEILPQPTAESKRVLIIYRDGLIILWAVQE  526
            + ++ Y+I    +   S K G        +V +LP P +   RVLI Y + L+ILW V E
Sbjct  153  LFQLPYNI---SADALSEKAGFPLLSHQPVVGVLPHPNSSGNRVLIAYENALVILWDVSE  209

Query  527  SKTIFTTGGNALQS-------------------VNH--EAXKATAACWACPNGT  625
            ++ IF  GG  LQ                    + H  E  + +A CWA  +G+
Sbjct  210  AQIIFVGGGKDLQLKDGVVDSPSEGDSTFLEGILEHQPEEKEISALCWASSSGS  263



>ref|XP_009769451.1| PREDICTED: uncharacterized protein LOC104220306 isoform X1 [Nicotiana 
sylvestris]
Length=1111

 Score =   157 bits (398),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 89/232 (38%), Positives = 129/232 (56%), Gaps = 25/232 (11%)
 Frame = +2

Query  2    GVPPGALLLAYDSIQKILAISTKDGRIKVFGKDGAQALLESPNIVPSKFMQFMENQGFLI  181
            G+P  A +LA D IQ++LAI T DGR+KV G D  + LL SP  +P KF++F++NQGFL+
Sbjct  40   GIPSTASILAVDPIQRLLAIGTLDGRVKVIGGDNIEGLLISPKQLPYKFLEFLQNQGFLV  99

Query  182  KINVDNHIEVWNVDQKSLSNIHEFKRDITSFKIIQHTPYMYIGDSLGYVWVLKLEKEPCN  361
             I  +N I+VWN+  +S++   ++K +IT+F +I  + +MY+GD  G + VLK   E   
Sbjct  100  SITNENDIQVWNLKSRSVACDLQWKSNITAFSVINGSSFMYVGDEYGTISVLKFCVENRE  159

Query  362  VVKMKYHI---PFSESHGNSNKDGDNAIVEILPQPTAESKRVLIIYRDGLIILWAVQESK  532
            ++++ Y I     SE+ G +N D    +V ILPQP     R+LI Y  GLIILW V E+ 
Sbjct  160  LLQLPYQILWSSLSEAAGFANSD-HQPVVGILPQPFTSGNRLLIAYESGLIILWDVVEAH  218

Query  533  TIFTTGGNALQ----SVN-----------------HEAXKATAACWACPNGT  625
             I   G   L     +VN                  E  + T  CWA  +G+
Sbjct  219  VIIVKGDKDLHLKDGAVNFRKNADSSSPDDLLKHEFEEKEITTLCWASTDGS  270



>ref|XP_006481055.1| PREDICTED: uncharacterized protein LOC102612279 isoform X2 [Citrus 
sinensis]
Length=1107

 Score =   157 bits (398),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 87/234 (37%), Positives = 135/234 (58%), Gaps = 29/234 (12%)
 Frame = +2

Query  2    GVPPGALLLAYDSIQKILAISTKDGRIKVFGKDGAQALLESPNIVPSKFMQFMENQGFLI  181
            G+P  A +LA+D IQ++LAI+T DGRIKV G DG + LL SP+ +P K ++F++NQGFLI
Sbjct  33   GIPATASILAFDHIQRLLAIATLDGRIKVIGGDGIEGLLISPSQLPYKNLEFLQNQGFLI  92

Query  182  KINVDNHIEVWNVDQKSLSNIHEFKRDITSFKIIQHTPYMYIGDSLGYVWVLKLEKEPCN  361
             I  DN I+VW+++ +SL+   +++ +IT+F +I  + +MYIGD  G + V+K + +   
Sbjct  93   SITNDNEIQVWSLESRSLACCLKWESNITAFSVISGSHFMYIGDENGLMSVIKYDADEGK  152

Query  362  VVKMKYHIPFSESHGNSNKDG-----DNAIVEILPQPTAESKRVLIIYRDGLIILWAVQE  526
            + ++ Y+I    +   S K G        +V +LP P +   RVLI Y + L+ILW V E
Sbjct  153  LFQLPYNI---SADALSEKAGFPLLSHQPVVGVLPHPNSSGNRVLIAYENALVILWDVSE  209

Query  527  SKTIFTTGGNALQS-------------------VNH--EAXKATAACWACPNGT  625
            ++ IF  GG  LQ                    + H  E  + +A CWA  +G+
Sbjct  210  AQIIFVGGGKDLQLKDGVVDSPSEGDSTFLEGILEHQPEEKEISALCWASSSGS  263



>gb|KDO56671.1| hypothetical protein CISIN_1g001279mg [Citrus sinensis]
Length=1043

 Score =   157 bits (397),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 86/234 (37%), Positives = 134/234 (57%), Gaps = 29/234 (12%)
 Frame = +2

Query  2    GVPPGALLLAYDSIQKILAISTKDGRIKVFGKDGAQALLESPNIVPSKFMQFMENQGFLI  181
            G+P  A +LA+D IQ++LAI+T DGRIKV G DG + LL SP+ +P K ++F++NQGFLI
Sbjct  33   GIPATASILAFDHIQRLLAIATLDGRIKVIGGDGIEGLLISPSQLPYKNLEFLQNQGFLI  92

Query  182  KINVDNHIEVWNVDQKSLSNIHEFKRDITSFKIIQHTPYMYIGDSLGYVWVLKLEKEPCN  361
             I  DN I+VW+++ +SL+   +++ +IT+F +I  + +MYIGD  G + V+K + +   
Sbjct  93   SITNDNEIQVWSLESRSLACCLKWESNITAFSVISGSHFMYIGDENGLMSVIKYDADEGK  152

Query  362  VVKMKYHIPFSESHGNSNKDG-----DNAIVEILPQPTAESKRVLIIYRDGLIILWAVQE  526
            + ++ Y+I    +   S K G        +V +LP P +   RVLI Y + L+ILW V E
Sbjct  153  LFQLPYNI---SADALSEKAGFPLLSHQPVVGVLPHPNSSGNRVLIAYENALVILWDVSE  209

Query  527  SKTIFTTGGNALQSVNH---------------------EAXKATAACWACPNGT  625
            ++ IF  GG  LQ  +                      E  + +A CWA  +G+
Sbjct  210  AQIIFVGGGKDLQLKDGVVDSPSEGDSTFLEGISEHQPEEKEISALCWASSSGS  263



>gb|KDO56672.1| hypothetical protein CISIN_1g001279mg [Citrus sinensis]
Length=1100

 Score =   157 bits (397),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 86/234 (37%), Positives = 134/234 (57%), Gaps = 29/234 (12%)
 Frame = +2

Query  2    GVPPGALLLAYDSIQKILAISTKDGRIKVFGKDGAQALLESPNIVPSKFMQFMENQGFLI  181
            G+P  A +LA+D IQ++LAI+T DGRIKV G DG + LL SP+ +P K ++F++NQGFLI
Sbjct  33   GIPATASILAFDHIQRLLAIATLDGRIKVIGGDGIEGLLISPSQLPYKNLEFLQNQGFLI  92

Query  182  KINVDNHIEVWNVDQKSLSNIHEFKRDITSFKIIQHTPYMYIGDSLGYVWVLKLEKEPCN  361
             I  DN I+VW+++ +SL+   +++ +IT+F +I  + +MYIGD  G + V+K + +   
Sbjct  93   SITNDNEIQVWSLESRSLACCLKWESNITAFSVISGSHFMYIGDENGLMSVIKYDADEGK  152

Query  362  VVKMKYHIPFSESHGNSNKDG-----DNAIVEILPQPTAESKRVLIIYRDGLIILWAVQE  526
            + ++ Y+I    +   S K G        +V +LP P +   RVLI Y + L+ILW V E
Sbjct  153  LFQLPYNI---SADALSEKAGFPLLSHQPVVGVLPHPNSSGNRVLIAYENALVILWDVSE  209

Query  527  SKTIFTTGGNALQSVNH---------------------EAXKATAACWACPNGT  625
            ++ IF  GG  LQ  +                      E  + +A CWA  +G+
Sbjct  210  AQIIFVGGGKDLQLKDGVVDSPSEGDSTFLEGISEHQPEEKEISALCWASSSGS  263



>gb|KDO56674.1| hypothetical protein CISIN_1g001279mg [Citrus sinensis]
Length=1108

 Score =   157 bits (397),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 80/193 (41%), Positives = 123/193 (64%), Gaps = 8/193 (4%)
 Frame = +2

Query  2    GVPPGALLLAYDSIQKILAISTKDGRIKVFGKDGAQALLESPNIVPSKFMQFMENQGFLI  181
            G+P  A +LA+D IQ++LAI+T DGRIKV G DG + LL SP+ +P K ++F++NQGFLI
Sbjct  33   GIPATASILAFDHIQRLLAIATLDGRIKVIGGDGIEGLLISPSQLPYKNLEFLQNQGFLI  92

Query  182  KINVDNHIEVWNVDQKSLSNIHEFKRDITSFKIIQHTPYMYIGDSLGYVWVLKLEKEPCN  361
             I  DN I+VW+++ +SL+   +++ +IT+F +I  + +MYIGD  G + V+K + +   
Sbjct  93   SITNDNEIQVWSLESRSLACCLKWESNITAFSVISGSHFMYIGDENGLMSVIKYDADEGK  152

Query  362  VVKMKYHIPFSESHGNSNKDG-----DNAIVEILPQPTAESKRVLIIYRDGLIILWAVQE  526
            + ++ Y+I    +   S K G        +V +LP P +   RVLI Y + L+ILW V E
Sbjct  153  LFQLPYNI---SADALSEKAGFPLLSHQPVVGVLPHPNSSGNRVLIAYENALVILWDVSE  209

Query  527  SKTIFTTGGNALQ  565
            ++ IF  GG  LQ
Sbjct  210  AQIIFVGGGKDLQ  222



>ref|XP_007008944.1| Transducin family protein / WD-40 repeat family protein, putative 
isoform 4 [Theobroma cacao]
 gb|EOY17754.1| Transducin family protein / WD-40 repeat family protein, putative 
isoform 4 [Theobroma cacao]
Length=820

 Score =   156 bits (394),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 79/232 (34%), Positives = 137/232 (59%), Gaps = 25/232 (11%)
 Frame = +2

Query  2    GVPPGALLLAYDSIQKILAISTKDGRIKVFGKDGAQALLESPNIVPSKFMQFMENQGFLI  181
            G+P  A +LA D IQ+++A+ T DGRIKV G +  +ALL SP  +P K ++F++NQGFL+
Sbjct  39   GIPATASVLACDLIQRLVAVGTLDGRIKVIGGENIEALLVSPKQLPIKNLEFLQNQGFLV  98

Query  182  KINVDNHIEVWNVDQKSLSNIHEFKRDITSFKIIQHTPYMYIGDSLGYVWVLKLEKEPCN  361
             ++ +N I+VW+++Q+ +++  +++ +IT+FK+I  T YMY+GD  G V+V+K + E   
Sbjct  99   SVSNENEIQVWDLEQRQIASHIQWESNITAFKVIHGTSYMYLGDEHGMVYVIKYDAEEHK  158

Query  362  VVKMKYHIP---FSESHGNSNKDGDNAIVEILPQPTAESKRVLIIYRDGLIILWAVQESK  532
            +  + Y++P    +E  G S+ +   ++V +LPQP ++  RVLI Y +GL+ +W + E +
Sbjct  159  LAHLPYYVPTNVIAEEAGISSPN-HPSVVGVLPQPCSQGNRVLIAYENGLLAIWDISEDR  217

Query  533  TIFTTGGNALQ---------------------SVNHEAXKATAACWACPNGT  625
             +   G   LQ                     S   E  + ++ CWA  +G+
Sbjct  218  VVLVRGNKDLQLKGRTTSDSPEEKKLEVSDCTSDGDEVKEISSLCWASNDGS  269



>gb|KDO56673.1| hypothetical protein CISIN_1g001279mg [Citrus sinensis]
Length=1107

 Score =   157 bits (397),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 86/234 (37%), Positives = 134/234 (57%), Gaps = 29/234 (12%)
 Frame = +2

Query  2    GVPPGALLLAYDSIQKILAISTKDGRIKVFGKDGAQALLESPNIVPSKFMQFMENQGFLI  181
            G+P  A +LA+D IQ++LAI+T DGRIKV G DG + LL SP+ +P K ++F++NQGFLI
Sbjct  33   GIPATASILAFDHIQRLLAIATLDGRIKVIGGDGIEGLLISPSQLPYKNLEFLQNQGFLI  92

Query  182  KINVDNHIEVWNVDQKSLSNIHEFKRDITSFKIIQHTPYMYIGDSLGYVWVLKLEKEPCN  361
             I  DN I+VW+++ +SL+   +++ +IT+F +I  + +MYIGD  G + V+K + +   
Sbjct  93   SITNDNEIQVWSLESRSLACCLKWESNITAFSVISGSHFMYIGDENGLMSVIKYDADEGK  152

Query  362  VVKMKYHIPFSESHGNSNKDG-----DNAIVEILPQPTAESKRVLIIYRDGLIILWAVQE  526
            + ++ Y+I    +   S K G        +V +LP P +   RVLI Y + L+ILW V E
Sbjct  153  LFQLPYNI---SADALSEKAGFPLLSHQPVVGVLPHPNSSGNRVLIAYENALVILWDVSE  209

Query  527  SKTIFTTGGNALQSVNH---------------------EAXKATAACWACPNGT  625
            ++ IF  GG  LQ  +                      E  + +A CWA  +G+
Sbjct  210  AQIIFVGGGKDLQLKDGVVDSPSEGDSTFLEGISEHQPEEKEISALCWASSSGS  263



>ref|XP_007008943.1| Transducin family protein / WD-40 repeat family protein, putative 
isoform 3 [Theobroma cacao]
 gb|EOY17753.1| Transducin family protein / WD-40 repeat family protein, putative 
isoform 3 [Theobroma cacao]
Length=892

 Score =   156 bits (395),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 79/232 (34%), Positives = 137/232 (59%), Gaps = 25/232 (11%)
 Frame = +2

Query  2    GVPPGALLLAYDSIQKILAISTKDGRIKVFGKDGAQALLESPNIVPSKFMQFMENQGFLI  181
            G+P  A +LA D IQ+++A+ T DGRIKV G +  +ALL SP  +P K ++F++NQGFL+
Sbjct  39   GIPATASVLACDLIQRLVAVGTLDGRIKVIGGENIEALLVSPKQLPIKNLEFLQNQGFLV  98

Query  182  KINVDNHIEVWNVDQKSLSNIHEFKRDITSFKIIQHTPYMYIGDSLGYVWVLKLEKEPCN  361
             ++ +N I+VW+++Q+ +++  +++ +IT+FK+I  T YMY+GD  G V+V+K + E   
Sbjct  99   SVSNENEIQVWDLEQRQIASHIQWESNITAFKVIHGTSYMYLGDEHGMVYVIKYDAEEHK  158

Query  362  VVKMKYHIP---FSESHGNSNKDGDNAIVEILPQPTAESKRVLIIYRDGLIILWAVQESK  532
            +  + Y++P    +E  G S+ +   ++V +LPQP ++  RVLI Y +GL+ +W + E +
Sbjct  159  LAHLPYYVPTNVIAEEAGISSPN-HPSVVGVLPQPCSQGNRVLIAYENGLLAIWDISEDR  217

Query  533  TIFTTGGNALQ---------------------SVNHEAXKATAACWACPNGT  625
             +   G   LQ                     S   E  + ++ CWA  +G+
Sbjct  218  VVLVRGNKDLQLKGRTTSDSPEEKKLEVSDCTSDGDEVKEISSLCWASNDGS  269



>ref|XP_009402380.1| PREDICTED: uncharacterized protein LOC103986182 [Musa acuminata 
subsp. malaccensis]
Length=1111

 Score =   157 bits (396),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 86/232 (37%), Positives = 130/232 (56%), Gaps = 25/232 (11%)
 Frame = +2

Query  2    GVPPGALLLAYDSIQKILAISTKDGRIKVFGKDGAQALLESPNIVPSKFMQFMENQGFLI  181
            G+P  A +LA+D IQ++LAI T DGRIKV G D  + LL  P  VP K+++F+ NQGFL+
Sbjct  34   GIPYTASILAFDPIQRLLAIGTLDGRIKVIGGDNIEGLLICPKKVPYKYLEFLHNQGFLV  93

Query  182  KINVDNHIEVWNVDQKSLSNIHEFKRDITSFKIIQHTPYMYIGDSLGYVWVLKLEKEPCN  361
             I  +N ++VWN++ + L +  +++ ++T+F +I  T  MYIGD  G + VLK ++E   
Sbjct  94   TITNENEVQVWNLELRQLVHCFQWEANVTAFSVIYGTYLMYIGDENGLLSVLKYDEENGE  153

Query  362  VVKMKYHIP---FSESHGNSNKDGDNAIVEILPQPTAESKRVLIIYRDGLIILWAVQESK  532
            ++K+ Y +P    +E+ G S  D   +IV ILPQP   S RVL+ Y  GL+ILW + + +
Sbjct  154  LLKLPYQLPANAVAEAAGISIPD-IQSIVGILPQPGTSSTRVLVAYEKGLLILWDIHKGQ  212

Query  533  TIFTTGGNALQ--------------------SVNHEAXKATAA-CWACPNGT  625
             + T G   LQ                    + NH+        CW   NG+
Sbjct  213  AVTTRGHTNLQLKGAEGPDSLSETSDQLQSNAANHDGDNEICCLCWVSTNGS  264



>gb|EEC82738.1| hypothetical protein OsI_27444 [Oryza sativa Indica Group]
Length=1101

 Score =   156 bits (395),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 88/230 (38%), Positives = 131/230 (57%), Gaps = 23/230 (10%)
 Frame = +2

Query  2    GVPPGALLLAYDSIQKILAISTKDGRIKVFGKDGAQALLESPNIVPSKFMQFMENQGFLI  181
            G+P  A LLA+D +Q++LA++T DGRIK+FG D  + LL SPN +P KF+QF++NQGFLI
Sbjct  32   GIPYTASLLAFDPVQRLLALATLDGRIKIFGGDNIEGLLISPNSLPYKFLQFIQNQGFLI  91

Query  182  KINVDNHIEVWNVDQKSLSNIHEFKRDITSFKIIQHTPYMYIGDSLGYVWVLKLEKEPCN  361
             I+ +N I+VWN++ + L    ++  +IT+F +++ T  MY+GD  G + VLK + +   
Sbjct  92   AISNENEIQVWNLEFRQLFYSSKWDINITAFAVVEGTFLMYLGDENGLLSVLKYDVDDGK  151

Query  362  VVKMKYHIP---FSESHGNSNKDGDNAIVEILPQPTAESKRVLIIYRDGLIILWAVQESK  532
            + KM Y++P    +E+   S +D   +IV ILPQP     RVLI Y  GL++LW V E +
Sbjct  152  LQKMPYNVPIHSLAEAACVSLED-PQSIVGILPQPDTFGTRVLIAYEKGLLVLWDVSEDR  210

Query  533  TIFTTGGNALQSVNH-------------------EAXKATAACWACPNGT  625
             I   G   L   N                    E  +  + CWA   G+
Sbjct  211  AISVRGYGDLHMKNQITGAQRDAGEDEDNNISAEEEREICSLCWASQGGS  260



>ref|NP_001060732.1| Os07g0693700 [Oryza sativa Japonica Group]
 dbj|BAF22646.1| Os07g0693700 [Oryza sativa Japonica Group]
 gb|EEE67875.1| hypothetical protein OsJ_25695 [Oryza sativa Japonica Group]
Length=1101

 Score =   156 bits (395),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 88/230 (38%), Positives = 131/230 (57%), Gaps = 23/230 (10%)
 Frame = +2

Query  2    GVPPGALLLAYDSIQKILAISTKDGRIKVFGKDGAQALLESPNIVPSKFMQFMENQGFLI  181
            G+P  A LLA+D +Q++LA++T DGRIK+FG D  + LL SPN +P KF+QF++NQGFLI
Sbjct  32   GIPYTASLLAFDPVQRLLALATLDGRIKIFGGDNIEGLLISPNSLPYKFLQFIQNQGFLI  91

Query  182  KINVDNHIEVWNVDQKSLSNIHEFKRDITSFKIIQHTPYMYIGDSLGYVWVLKLEKEPCN  361
             I+ +N I+VWN++ + L    ++  +IT+F +++ T  MY+GD  G + VLK + +   
Sbjct  92   AISNENEIQVWNLEFRQLFYSSKWDINITAFAVVEGTFLMYLGDENGLLSVLKYDVDDGK  151

Query  362  VVKMKYHIP---FSESHGNSNKDGDNAIVEILPQPTAESKRVLIIYRDGLIILWAVQESK  532
            + KM Y++P    +E+   S +D   +IV ILPQP     RVLI Y  GL++LW V E +
Sbjct  152  LQKMPYNVPIHSLAEAACVSLED-PQSIVGILPQPDTFGTRVLIAYEKGLLVLWDVSEDR  210

Query  533  TIFTTGGNALQSVNH-------------------EAXKATAACWACPNGT  625
             I   G   L   N                    E  +  + CWA   G+
Sbjct  211  AISVRGYGDLHMKNQITGAQRDAGEDEDNNISAEEEREICSLCWASQGGS  260



>dbj|BAC75571.1| hypothetical protein [Oryza sativa Japonica Group]
Length=1074

 Score =   156 bits (395),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 88/230 (38%), Positives = 131/230 (57%), Gaps = 23/230 (10%)
 Frame = +2

Query  2    GVPPGALLLAYDSIQKILAISTKDGRIKVFGKDGAQALLESPNIVPSKFMQFMENQGFLI  181
            G+P  A LLA+D +Q++LA++T DGRIK+FG D  + LL SPN +P KF+QF++NQGFLI
Sbjct  32   GIPYTASLLAFDPVQRLLALATLDGRIKIFGGDNIEGLLISPNSLPYKFLQFIQNQGFLI  91

Query  182  KINVDNHIEVWNVDQKSLSNIHEFKRDITSFKIIQHTPYMYIGDSLGYVWVLKLEKEPCN  361
             I+ +N I+VWN++ + L    ++  +IT+F +++ T  MY+GD  G + VLK + +   
Sbjct  92   AISNENEIQVWNLEFRQLFYSSKWDINITAFAVVEGTFLMYLGDENGLLSVLKYDVDDGK  151

Query  362  VVKMKYHIP---FSESHGNSNKDGDNAIVEILPQPTAESKRVLIIYRDGLIILWAVQESK  532
            + KM Y++P    +E+   S +D   +IV ILPQP     RVLI Y  GL++LW V E +
Sbjct  152  LQKMPYNVPIHSLAEAACVSLED-PQSIVGILPQPDTFGTRVLIAYEKGLLVLWDVSEDR  210

Query  533  TIFTTGGNALQSVNH-------------------EAXKATAACWACPNGT  625
             I   G   L   N                    E  +  + CWA   G+
Sbjct  211  AISVRGYGDLHMKNQITGAQRDAGEDEDNNISAEEEREICSLCWASQGGS  260



>ref|XP_007008941.1| Transducin family protein / WD-40 repeat family protein, putative 
isoform 1 [Theobroma cacao]
 gb|EOY17751.1| Transducin family protein / WD-40 repeat family protein, putative 
isoform 1 [Theobroma cacao]
Length=1110

 Score =   156 bits (395),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 79/232 (34%), Positives = 137/232 (59%), Gaps = 25/232 (11%)
 Frame = +2

Query  2    GVPPGALLLAYDSIQKILAISTKDGRIKVFGKDGAQALLESPNIVPSKFMQFMENQGFLI  181
            G+P  A +LA D IQ+++A+ T DGRIKV G +  +ALL SP  +P K ++F++NQGFL+
Sbjct  39   GIPATASVLACDLIQRLVAVGTLDGRIKVIGGENIEALLVSPKQLPIKNLEFLQNQGFLV  98

Query  182  KINVDNHIEVWNVDQKSLSNIHEFKRDITSFKIIQHTPYMYIGDSLGYVWVLKLEKEPCN  361
             ++ +N I+VW+++Q+ +++  +++ +IT+FK+I  T YMY+GD  G V+V+K + E   
Sbjct  99   SVSNENEIQVWDLEQRQIASHIQWESNITAFKVIHGTSYMYLGDEHGMVYVIKYDAEEHK  158

Query  362  VVKMKYHIP---FSESHGNSNKDGDNAIVEILPQPTAESKRVLIIYRDGLIILWAVQESK  532
            +  + Y++P    +E  G S+ +   ++V +LPQP ++  RVLI Y +GL+ +W + E +
Sbjct  159  LAHLPYYVPTNVIAEEAGISSPN-HPSVVGVLPQPCSQGNRVLIAYENGLLAIWDISEDR  217

Query  533  TIFTTGGNALQ---------------------SVNHEAXKATAACWACPNGT  625
             +   G   LQ                     S   E  + ++ CWA  +G+
Sbjct  218  VVLVRGNKDLQLKGRTTSDSPEEKKLEVSDCTSDGDEVKEISSLCWASNDGS  269



>ref|XP_007008942.1| Transducin family protein / WD-40 repeat family protein, putative 
isoform 2 [Theobroma cacao]
 gb|EOY17752.1| Transducin family protein / WD-40 repeat family protein, putative 
isoform 2 [Theobroma cacao]
Length=1016

 Score =   156 bits (394),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 79/232 (34%), Positives = 137/232 (59%), Gaps = 25/232 (11%)
 Frame = +2

Query  2    GVPPGALLLAYDSIQKILAISTKDGRIKVFGKDGAQALLESPNIVPSKFMQFMENQGFLI  181
            G+P  A +LA D IQ+++A+ T DGRIKV G +  +ALL SP  +P K ++F++NQGFL+
Sbjct  39   GIPATASVLACDLIQRLVAVGTLDGRIKVIGGENIEALLVSPKQLPIKNLEFLQNQGFLV  98

Query  182  KINVDNHIEVWNVDQKSLSNIHEFKRDITSFKIIQHTPYMYIGDSLGYVWVLKLEKEPCN  361
             ++ +N I+VW+++Q+ +++  +++ +IT+FK+I  T YMY+GD  G V+V+K + E   
Sbjct  99   SVSNENEIQVWDLEQRQIASHIQWESNITAFKVIHGTSYMYLGDEHGMVYVIKYDAEEHK  158

Query  362  VVKMKYHIP---FSESHGNSNKDGDNAIVEILPQPTAESKRVLIIYRDGLIILWAVQESK  532
            +  + Y++P    +E  G S+ +   ++V +LPQP ++  RVLI Y +GL+ +W + E +
Sbjct  159  LAHLPYYVPTNVIAEEAGISSPN-HPSVVGVLPQPCSQGNRVLIAYENGLLAIWDISEDR  217

Query  533  TIFTTGGNALQ---------------------SVNHEAXKATAACWACPNGT  625
             +   G   LQ                     S   E  + ++ CWA  +G+
Sbjct  218  VVLVRGNKDLQLKGRTTSDSPEEKKLEVSDCTSDGDEVKEISSLCWASNDGS  269



>ref|XP_003530287.1| PREDICTED: uncharacterized protein LOC100779801 [Glycine max]
Length=1118

 Score =   155 bits (393),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 82/231 (35%), Positives = 129/231 (56%), Gaps = 23/231 (10%)
 Frame = +2

Query  2    GVPPGALLLAYDSIQKILAISTKDGRIKVFGKDGAQALLESPNIVPSKFMQFMENQGFLI  181
            G+P  A +LA+D IQ++LAI T DGR+KV G D  + LL SP  +P K+++F++NQG L+
Sbjct  38   GIPSTASVLAFDPIQRLLAIGTLDGRLKVIGGDNIEGLLVSPKQLPYKYLEFLQNQGHLV  97

Query  182  KINVDNHIEVWNVDQKSLSNIHEFKRDITSFKIIQHTPYMYIGDSLGYVWVLKLEKEPCN  361
             +  DN I+VWN++ +SL    +++ DIT+F +I  + ++Y+GD  G   V+K E E   
Sbjct  98   GVLNDNDIQVWNLESRSLVCSLQWEFDITAFSVISGSHFIYVGDQHGLFSVIKFEAEEGQ  157

Query  362  VVKMKYHIP--FSESHGNSNKDGDNAIVEILPQPTAESKRVLIIYRDGLIILWAVQESKT  535
            ++K  Y++   F        +  +  IV +L QP++   R+LI + DGL+ILW V ES+ 
Sbjct  158  LLKSSYYLSAKFLREAAGFPEPSEQPIVGVLLQPSSFGNRLLIAFEDGLLILWDVSESRI  217

Query  536  IFTTGGNALQSVNHEAXKA---------------------TAACWACPNGT  625
            +F  GG  LQ  + +   +                     TA CWA   G+
Sbjct  218  VFLGGGKDLQLKDEDGNSSSETGTNPPADIVEQNLGDKEITALCWASSTGS  268



>gb|KJB76197.1| hypothetical protein B456_012G077100 [Gossypium raimondii]
Length=1104

 Score =   154 bits (390),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 75/191 (39%), Positives = 125/191 (65%), Gaps = 4/191 (2%)
 Frame = +2

Query  2    GVPPGALLLAYDSIQKILAISTKDGRIKVFGKDGAQALLESPNIVPSKFMQFMENQGFLI  181
            G+P  A +LA D IQ+++A+ T DGRIKV G +  +ALL SP  +P K ++F++NQGFL+
Sbjct  41   GIPATASILACDLIQRLVAVGTLDGRIKVIGGEYVEALLVSPKHIPFKNLEFLQNQGFLV  100

Query  182  KINVDNHIEVWNVDQKSLSNIHEFKRDITSFKIIQHTPYMYIGDSLGYVWVLKLEKEPCN  361
             ++ +N I+VW++ Q+ +++  +++ +IT+FK I  T YMY+GD  G V+VLK + +   
Sbjct  101  SVSNENEIQVWDLGQRQIASSIKWESNITAFKAIHGTSYMYLGDEHGMVYVLKYDADQRK  160

Query  362  VVKMKYHIP---FSESHGNSNKDGDNAIVEILPQPTAESKRVLIIYRDGLIILWAVQESK  532
            +  + Y++P    +E  G S+ +   ++V +LPQP ++  RVLI Y +GLI++W V + K
Sbjct  161  LTNLPYYVPTNVIAEEAGISSPN-HPSVVGVLPQPCSQGNRVLIAYVNGLIVIWDVSDDK  219

Query  533  TIFTTGGNALQ  565
             +   G   LQ
Sbjct  220  VVLVRGNKDLQ  230



>ref|XP_003552256.1| PREDICTED: uncharacterized protein LOC100776508 isoform X1 [Glycine 
max]
Length=1115

 Score =   154 bits (390),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 80/231 (35%), Positives = 130/231 (56%), Gaps = 23/231 (10%)
 Frame = +2

Query  2    GVPPGALLLAYDSIQKILAISTKDGRIKVFGKDGAQALLESPNIVPSKFMQFMENQGFLI  181
            G+P  A +LA+D IQ++LAI T DGR+KV G D  + LL SP  +P K+++F++NQG L+
Sbjct  38   GIPSTASVLAFDPIQRLLAIGTLDGRLKVIGGDNIEGLLVSPKQLPYKYLEFLQNQGHLV  97

Query  182  KINVDNHIEVWNVDQKSLSNIHEFKRDITSFKIIQHTPYMYIGDSLGYVWVLKLEKEPCN  361
             +  DN I+VWN++ +SL    +++ DIT+F +I  + ++Y+GD  G   V+K E E   
Sbjct  98   GVLNDNDIQVWNLESRSLVCSLQWEFDITAFSVISGSHFIYVGDQHGLFSVIKFEAEEGQ  157

Query  362  VVKMKYHIP--FSESHGNSNKDGDNAIVEILPQPTAESKRVLIIYRDGLIILWAVQESKT  535
            ++K  Y++   F       ++  +  I+ +L QP++   R+LI + DGL+ILW V E++ 
Sbjct  158  LLKSSYNLSAKFLREAAGFSEPSEQPIIGVLLQPSSFGNRLLIAFEDGLLILWDVSEARI  217

Query  536  IFTTGGNALQSVNHEAXKA---------------------TAACWACPNGT  625
            +F  GG  LQ  + +   +                     TA CWA   G+
Sbjct  218  VFLGGGKDLQLKDEDGNSSSESGANPPADIVEQNLGDKEITALCWASSTGS  268



>gb|KJB76195.1| hypothetical protein B456_012G077100 [Gossypium raimondii]
Length=1103

 Score =   154 bits (390),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 75/191 (39%), Positives = 125/191 (65%), Gaps = 4/191 (2%)
 Frame = +2

Query  2    GVPPGALLLAYDSIQKILAISTKDGRIKVFGKDGAQALLESPNIVPSKFMQFMENQGFLI  181
            G+P  A +LA D IQ+++A+ T DGRIKV G +  +ALL SP  +P K ++F++NQGFL+
Sbjct  40   GIPATASILACDLIQRLVAVGTLDGRIKVIGGEYVEALLVSPKHIPFKNLEFLQNQGFLV  99

Query  182  KINVDNHIEVWNVDQKSLSNIHEFKRDITSFKIIQHTPYMYIGDSLGYVWVLKLEKEPCN  361
             ++ +N I+VW++ Q+ +++  +++ +IT+FK I  T YMY+GD  G V+VLK + +   
Sbjct  100  SVSNENEIQVWDLGQRQIASSIKWESNITAFKAIHGTSYMYLGDEHGMVYVLKYDADQRK  159

Query  362  VVKMKYHIP---FSESHGNSNKDGDNAIVEILPQPTAESKRVLIIYRDGLIILWAVQESK  532
            +  + Y++P    +E  G S+ +   ++V +LPQP ++  RVLI Y +GLI++W V + K
Sbjct  160  LTNLPYYVPTNVIAEEAGISSPN-HPSVVGVLPQPCSQGNRVLIAYVNGLIVIWDVSDDK  218

Query  533  TIFTTGGNALQ  565
             +   G   LQ
Sbjct  219  VVLVRGNKDLQ  229



>gb|EYU41912.1| hypothetical protein MIMGU_mgv1a024167mg, partial [Erythranthe 
guttata]
Length=1067

 Score =   154 bits (388),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 87/251 (35%), Positives = 130/251 (52%), Gaps = 43/251 (17%)
 Frame = +2

Query  2    GVPPGALLLAYDSIQKILAISTKDGRIKVFGKDGAQALLESPNIVPSKFMQFMENQGFLI  181
            G+P  A LLA+D IQ++LAI+T DGRIKV G D  + LL SP + P K+++F++NQGFL+
Sbjct  11   GIPSTASLLAFDPIQRLLAIATLDGRIKVIGGDNIEGLLISPKMSPYKYLEFLQNQGFLV  70

Query  182  KINVDNHIEVWNVDQKSLSNIHEFKRDITSFKIIQHTPYMYIGDSLGYVWVLKLEKEPCN  361
             I  DN I+VWN++ +S++   +++ ++T+F +I  + +MYIGD  G + VLK +     
Sbjct  71   SITNDNEIQVWNLETRSIACCLQWQSNVTAFSVISGSSFMYIGDEYGLMSVLKYDPNSEQ  130

Query  362  VVKMKYHIPFSESHGNSNK----------------DGDNAIVEILPQPTAESKR------  475
            +++  YH+      G  +K                     IV +LPQP +   R      
Sbjct  131  LLQFHYHLSSDSLAGEYSKVTEIFLKSAEATGFSISSRQPIVGLLPQPFSSGNRQNSAGN  190

Query  476  -VLIIYRDGLIILWAVQESKTIFTTGGNALQ--------------------SVNHEAXKA  592
             +LI Y  GLIILW V E+  I   G   LQ                    S + E  + 
Sbjct  191  LLLIAYASGLIILWDVVEAHAIVVRGDKVLQLKNKVVPPNDVDTSTFDDTPSCDLEEKEI  250

Query  593  TAACWACPNGT  625
            TA CWA  +G+
Sbjct  251  TALCWASTDGS  261



>gb|KFK24974.1| hypothetical protein AALP_AA8G050200 [Arabis alpina]
Length=1095

 Score =   153 bits (387),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 82/229 (36%), Positives = 135/229 (59%), Gaps = 22/229 (10%)
 Frame = +2

Query  2    GVPPGALLLAYDSIQKILAISTKDGRIKVFGKDGAQALLESPNIVPSKFMQFMENQGFLI  181
            G+P  A LLA+D IQ +LA+ T DGRIKV G D  +A+L SP  +P K ++F+ENQGFL+
Sbjct  38   GIPSTASLLAFDPIQCLLAVGTLDGRIKVIGGDNIEAILASPKQLPFKNLEFIENQGFLV  97

Query  182  KINVDNHIEVWNVDQKSLSNIHEFKRDITSFKIIQHTPYMYIGDSLGYVWVLKLEKEPCN  361
             I+ +N I+VW++D + +++   ++ +IT+F I+  T YMY+GD  G V VLK   +   
Sbjct  98   SISNENEIQVWDLDLRQIASSLHWESNITAFSILHGTGYMYVGDEYGMVSVLKYNVDEGK  157

Query  362  VVKMKYHIP---FSESHGNSNKDGDNAIVEILPQPTAESKRVLIIYRDGLIILWAVQESK  532
            +V++ Y++P    +E+ G S+   D  IV +L QP++   R+LI + +GL+ LW   E +
Sbjct  158  LVQLPYYVPADALAEAAGLSSPI-DYPIVGLLSQPSSRGTRLLIAFSNGLLFLWDASEDR  216

Query  533  TIFTTG-----------GNALQSVNHE-------AXKATAACWACPNGT  625
             +   G           G +L++ + E         + ++ CWA  +G+
Sbjct  217  VVVVRGNKDLPVEGKTVGESLEASHDELSDLELDGKEISSLCWASADGS  265



>ref|XP_009122161.1| PREDICTED: uncharacterized protein LOC103846904 [Brassica rapa]
Length=1083

 Score =   153 bits (387),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 80/229 (35%), Positives = 131/229 (57%), Gaps = 22/229 (10%)
 Frame = +2

Query  2    GVPPGALLLAYDSIQKILAISTKDGRIKVFGKDGAQALLESPNIVPSKFMQFMENQGFLI  181
            G+P  A LLA+D IQ +LA+ T DGRIKV G D  +A+L SP  +P K ++F+ENQGFL+
Sbjct  41   GIPSTASLLAFDPIQCLLAVGTLDGRIKVIGGDNIEAILSSPKQLPFKNLEFIENQGFLV  100

Query  182  KINVDNHIEVWNVDQKSLSNIHEFKRDITSFKIIQHTPYMYIGDSLGYVWVLKLEKEPCN  361
             I+ DN IEVW++D +  ++   ++ +IT+F I+  T YMY+GD  G V V+K   +   
Sbjct  101  SISNDNEIEVWDLDLRKTASSLLWESNITAFSILHGTGYMYVGDEYGMVSVVKYNADEGK  160

Query  362  VVKMKYHIP---FSESHGNSNKDGDNAIVEILPQPTAESKRVLIIYRDGLIILWAVQESK  532
            +V++ Y++P    +E+ G S+   D  +V +L QP++   R+LI + +GL+ LW   E +
Sbjct  161  LVQLPYYVPTDALAEAAGLSSPI-DYPVVGLLSQPSSRGTRLLIAFSNGLLFLWDASEDR  219

Query  533  TIFTTGG------------------NALQSVNHEAXKATAACWACPNGT  625
             +   G                   + L  +  +  + ++ CWA  +G+
Sbjct  220  VVLVRGNKDLPMEGKTANDSLEASHDELSDLELDGKEISSLCWASADGS  268



>emb|CDX70143.1| BnaA10g24920D [Brassica napus]
Length=1088

 Score =   153 bits (387),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 80/229 (35%), Positives = 131/229 (57%), Gaps = 22/229 (10%)
 Frame = +2

Query  2    GVPPGALLLAYDSIQKILAISTKDGRIKVFGKDGAQALLESPNIVPSKFMQFMENQGFLI  181
            G+P  A LLA+D IQ +LA+ T DGRIKV G D  +A+L SP  +P K ++F+ENQGFL+
Sbjct  41   GIPSTASLLAFDPIQCLLAVGTLDGRIKVIGGDNIEAILSSPKQLPFKNLEFIENQGFLV  100

Query  182  KINVDNHIEVWNVDQKSLSNIHEFKRDITSFKIIQHTPYMYIGDSLGYVWVLKLEKEPCN  361
             I+ DN IEVW++D +  ++   ++ +IT+F I+  T YMY+GD  G V V+K   +   
Sbjct  101  SISNDNEIEVWDLDLRKTASSLLWESNITAFSILHGTGYMYVGDEYGMVSVVKYNADEGK  160

Query  362  VVKMKYHIP---FSESHGNSNKDGDNAIVEILPQPTAESKRVLIIYRDGLIILWAVQESK  532
            +V++ Y++P    +E+ G S+   D  +V +L QP++   R+LI + +GL+ LW   E +
Sbjct  161  LVQLPYYVPTDALAEAAGLSSPI-DYPVVGLLSQPSSRGTRLLIAFSNGLLFLWDASEDR  219

Query  533  TIFTTGG------------------NALQSVNHEAXKATAACWACPNGT  625
             +   G                   + L  +  +  + ++ CWA  +G+
Sbjct  220  VVLVRGNKDLPTEGKTANDSLEASHDELSDLELDGKEISSLCWASADGS  268



>emb|CDX98850.1| BnaC09g49850D [Brassica napus]
Length=1083

 Score =   153 bits (387),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 80/229 (35%), Positives = 131/229 (57%), Gaps = 22/229 (10%)
 Frame = +2

Query  2    GVPPGALLLAYDSIQKILAISTKDGRIKVFGKDGAQALLESPNIVPSKFMQFMENQGFLI  181
            G+P  A LLA+D IQ +LA+ T DGRIKV G D  +A+L SP  +P K ++F+ENQGFL+
Sbjct  41   GIPSTASLLAFDPIQCLLAVGTLDGRIKVIGGDNIEAILASPKQLPFKNLEFIENQGFLV  100

Query  182  KINVDNHIEVWNVDQKSLSNIHEFKRDITSFKIIQHTPYMYIGDSLGYVWVLKLEKEPCN  361
             I+ DN IEVW++D +  ++   ++ +IT+F I+  T YMY+GD  G V V+K   +   
Sbjct  101  SISNDNEIEVWDLDLRKTASSLLWESNITAFSILHGTGYMYVGDEYGMVSVVKYNADEGK  160

Query  362  VVKMKYHIP---FSESHGNSNKDGDNAIVEILPQPTAESKRVLIIYRDGLIILWAVQESK  532
            +V++ Y++P    +E+ G S+   D  +V +L QP++   R+LI + +GL+ LW   E +
Sbjct  161  LVQLPYYVPTDALAEAAGLSSPI-DYPVVGLLSQPSSRGTRLLIAFSNGLLFLWDASEDR  219

Query  533  TIFTTGG------------------NALQSVNHEAXKATAACWACPNGT  625
             +   G                   + L  +  +  + ++ CWA  +G+
Sbjct  220  VVLVRGNKDLPMEGKTANDSLEASHDELSDLELDGKEISSLCWASADGS  268



>ref|XP_009612132.1| PREDICTED: uncharacterized protein LOC104105514 isoform X2 [Nicotiana 
tomentosiformis]
Length=1076

 Score =   153 bits (386),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 78/183 (43%), Positives = 119/183 (65%), Gaps = 4/183 (2%)
 Frame = +2

Query  2    GVPPGALLLAYDSIQKILAISTKDGRIKVFGKDGAQALLESPNIVPSKFMQFMENQGFLI  181
            G+P  A +LA+D IQ++LAI T DGRIKV G    + LL SP  +P K ++F++NQGFL+
Sbjct  36   GIPSTASILAFDPIQQLLAIGTLDGRIKVIGGSNVEGLLFSPKPLPFKNLEFLQNQGFLV  95

Query  182  KINVDNHIEVWNVDQKSLSNIHEFKRDITSFKIIQHTPYMYIGDSLGYVWVLKLEKEPCN  361
             ++  N I+VW+++ + +S+  +++ +IT+F +I  T YM++GD  GY+ VLK E    +
Sbjct  96   GVSNGNEIQVWDLENRRMSSNLQWESNITAFSMIYDTHYMFVGDEYGYLSVLKYESREGS  155

Query  362  VVKMKYHIP---FSESHGNSNKDGDNAIVEILPQPTAESKRVLIIYRDGLIILWAVQESK  532
            +  + YHIP    +E+   S  D   AIV +LPQP++   RVLI Y +GLIILW V E +
Sbjct  156  LELLPYHIPPNLIAEAAEISMPD-QLAIVGLLPQPSSLGNRVLIAYENGLIILWDVTEDR  214

Query  533  TIF  541
             + 
Sbjct  215  AVL  217



>ref|XP_010558072.1| PREDICTED: uncharacterized protein LOC104826848 isoform X2 [Tarenaya 
hassleriana]
Length=1089

 Score =   153 bits (386),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 80/229 (35%), Positives = 132/229 (58%), Gaps = 22/229 (10%)
 Frame = +2

Query  2    GVPPGALLLAYDSIQKILAISTKDGRIKVFGKDGAQALLESPNIVPSKFMQFMENQGFLI  181
            G+P  A +LA+D +Q +LAI T DGRIKV G D  +A+L SP  +P K ++F++NQGFL+
Sbjct  25   GIPSTASVLAFDPVQSLLAIGTLDGRIKVIGGDNIEAILASPKQLPFKNLEFIQNQGFLV  84

Query  182  KINVDNHIEVWNVDQKSLSNIHEFKRDITSFKIIQHTPYMYIGDSLGYVWVLKLEKEPCN  361
             I+ +N I+VW++D +  ++  +++ +IT+F I+Q T YM+IGD  G V V+K   E   
Sbjct  85   SISSENEIQVWDLDLRQTASSFQWESNITAFSILQGTGYMHIGDEYGMVSVIKYNAEEGK  144

Query  362  VVKMKYHIP---FSESHGNSNKDGDNAIVEILPQPTAESKRVLIIYRDGLIILWAVQESK  532
            +V++ Y++P    +E+ G S+   ++ IV +L QP ++  R+LI +  GL+ LW   E  
Sbjct  145  LVQLPYYVPTDALAEAAGLSSPI-EHPIVGLLSQPCSKGNRLLIAFSTGLLFLWDASEDH  203

Query  533  TIFTTGG------------------NALQSVNHEAXKATAACWACPNGT  625
             +F  G                     L  +  E  + ++ CWA  +G+
Sbjct  204  VVFVRGNKDLPLEGKTVANSPEATHTELSDLELEGKEISSLCWASDDGS  252



>ref|XP_009612131.1| PREDICTED: uncharacterized protein LOC104105514 isoform X1 [Nicotiana 
tomentosiformis]
Length=1081

 Score =   153 bits (386),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 78/183 (43%), Positives = 119/183 (65%), Gaps = 4/183 (2%)
 Frame = +2

Query  2    GVPPGALLLAYDSIQKILAISTKDGRIKVFGKDGAQALLESPNIVPSKFMQFMENQGFLI  181
            G+P  A +LA+D IQ++LAI T DGRIKV G    + LL SP  +P K ++F++NQGFL+
Sbjct  36   GIPSTASILAFDPIQQLLAIGTLDGRIKVIGGSNVEGLLFSPKPLPFKNLEFLQNQGFLV  95

Query  182  KINVDNHIEVWNVDQKSLSNIHEFKRDITSFKIIQHTPYMYIGDSLGYVWVLKLEKEPCN  361
             ++  N I+VW+++ + +S+  +++ +IT+F +I  T YM++GD  GY+ VLK E    +
Sbjct  96   GVSNGNEIQVWDLENRRMSSNLQWESNITAFSMIYDTHYMFVGDEYGYLSVLKYESREGS  155

Query  362  VVKMKYHIP---FSESHGNSNKDGDNAIVEILPQPTAESKRVLIIYRDGLIILWAVQESK  532
            +  + YHIP    +E+   S  D   AIV +LPQP++   RVLI Y +GLIILW V E +
Sbjct  156  LELLPYHIPPNLIAEAAEISMPD-QLAIVGLLPQPSSLGNRVLIAYENGLIILWDVTEDR  214

Query  533  TIF  541
             + 
Sbjct  215  AVL  217



>ref|XP_010558071.1| PREDICTED: uncharacterized protein LOC104826848 isoform X1 [Tarenaya 
hassleriana]
Length=1104

 Score =   153 bits (386),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 80/229 (35%), Positives = 132/229 (58%), Gaps = 22/229 (10%)
 Frame = +2

Query  2    GVPPGALLLAYDSIQKILAISTKDGRIKVFGKDGAQALLESPNIVPSKFMQFMENQGFLI  181
            G+P  A +LA+D +Q +LAI T DGRIKV G D  +A+L SP  +P K ++F++NQGFL+
Sbjct  40   GIPSTASVLAFDPVQSLLAIGTLDGRIKVIGGDNIEAILASPKQLPFKNLEFIQNQGFLV  99

Query  182  KINVDNHIEVWNVDQKSLSNIHEFKRDITSFKIIQHTPYMYIGDSLGYVWVLKLEKEPCN  361
             I+ +N I+VW++D +  ++  +++ +IT+F I+Q T YM+IGD  G V V+K   E   
Sbjct  100  SISSENEIQVWDLDLRQTASSFQWESNITAFSILQGTGYMHIGDEYGMVSVIKYNAEEGK  159

Query  362  VVKMKYHIP---FSESHGNSNKDGDNAIVEILPQPTAESKRVLIIYRDGLIILWAVQESK  532
            +V++ Y++P    +E+ G S+   ++ IV +L QP ++  R+LI +  GL+ LW   E  
Sbjct  160  LVQLPYYVPTDALAEAAGLSSPI-EHPIVGLLSQPCSKGNRLLIAFSTGLLFLWDASEDH  218

Query  533  TIFTTGG------------------NALQSVNHEAXKATAACWACPNGT  625
             +F  G                     L  +  E  + ++ CWA  +G+
Sbjct  219  VVFVRGNKDLPLEGKTVANSPEATHTELSDLELEGKEISSLCWASDDGS  267



>ref|XP_008793107.1| PREDICTED: uncharacterized protein LOC103709502 [Phoenix dactylifera]
Length=1117

 Score =   152 bits (385),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 76/188 (40%), Positives = 114/188 (61%), Gaps = 0/188 (0%)
 Frame = +2

Query  2    GVPPGALLLAYDSIQKILAISTKDGRIKVFGKDGAQALLESPNIVPSKFMQFMENQGFLI  181
            G+P  A  LA+D IQ++LAI T DGRIK+ G D  + LL SP  VP K+++F+ NQGFL+
Sbjct  35   GIPYTASHLAFDPIQRLLAIGTLDGRIKIIGGDNIEGLLISPKKVPYKYLEFLHNQGFLV  94

Query  182  KINVDNHIEVWNVDQKSLSNIHEFKRDITSFKIIQHTPYMYIGDSLGYVWVLKLEKEPCN  361
             ++ +N I+VWN++ + L    +++ ++T+F ++Q T  MYIGD  G   VLK   E   
Sbjct  95   GVSNENEIQVWNLEFRQLVYCLQWEANMTAFAVVQGTYLMYIGDENGLFSVLKYNDEDGK  154

Query  362  VVKMKYHIPFSESHGNSNKDGDNAIVEILPQPTAESKRVLIIYRDGLIILWAVQESKTIF  541
            ++++ YHIP +      +      I+ ILPQP     RVLI Y +GL+ILW + E + + 
Sbjct  155  LLRLPYHIPANVVTAGISFVSPQPIIGILPQPCTSGTRVLIAYENGLLILWDISEGQVVT  214

Query  542  TTGGNALQ  565
              G   LQ
Sbjct  215  VRGYTDLQ  222



>gb|KJB76196.1| hypothetical protein B456_012G077100 [Gossypium raimondii]
Length=1103

 Score =   152 bits (384),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 72/189 (38%), Positives = 122/189 (65%), Gaps = 1/189 (1%)
 Frame = +2

Query  2    GVPPGALLLAYDSIQKILAISTKDGRIKVFGKDGAQALLESPNIVPSKFMQFMENQGFLI  181
            G+P  A +LA D IQ+++A+ T DGRIKV G +  +ALL SP  +P K ++F++NQGFL+
Sbjct  41   GIPATASILACDLIQRLVAVGTLDGRIKVIGGEYVEALLVSPKHIPFKNLEFLQNQGFLV  100

Query  182  KINVDNHIEVWNVDQKSLSNIHEFKRDITSFKIIQHTPYMYIGDSLGYVWVLKLEKEPCN  361
             ++ +N I+VW++ Q+ +++  +++ +IT+FK I  T YMY+GD  G V+VLK + +   
Sbjct  101  SVSNENEIQVWDLGQRQIASSIKWESNITAFKAIHGTSYMYLGDEHGMVYVLKYDADQRK  160

Query  362  VVKMKYHIPFSE-SHGNSNKDGDNAIVEILPQPTAESKRVLIIYRDGLIILWAVQESKTI  538
            +  + Y++P +  +    +     ++V +LPQP ++  RVLI Y +GLI++W V + K +
Sbjct  161  LTNLPYYVPTNVIAEAGISSPNHPSVVGVLPQPCSQGNRVLIAYVNGLIVIWDVSDDKVV  220

Query  539  FTTGGNALQ  565
               G   LQ
Sbjct  221  LVRGNKDLQ  229



>ref|XP_006286944.1| hypothetical protein CARUB_v10000088mg [Capsella rubella]
 gb|EOA19842.1| hypothetical protein CARUB_v10000088mg [Capsella rubella]
Length=1103

 Score =   152 bits (384),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 81/229 (35%), Positives = 134/229 (59%), Gaps = 22/229 (10%)
 Frame = +2

Query  2    GVPPGALLLAYDSIQKILAISTKDGRIKVFGKDGAQALLESPNIVPSKFMQFMENQGFLI  181
            G+P  A LLA+D IQ +LA+ T DGRIKV G D  +A+L SP  +P K ++FM+NQGFL+
Sbjct  42   GIPSTASLLAFDPIQCLLAVGTLDGRIKVIGGDNIEAILASPKQLPFKNLEFMQNQGFLV  101

Query  182  KINVDNHIEVWNVDQKSLSNIHEFKRDITSFKIIQHTPYMYIGDSLGYVWVLKLEKEPCN  361
             I+ +N I+VW++D +  ++  +++ +IT+F I+  T YMY+GD  G V VLK   +   
Sbjct  102  SISNENEIQVWDLDLRQPASSLQWESNITAFAILHGTGYMYVGDEYGMVSVLKYSADEGK  161

Query  362  VVKMKYHIP---FSESHGNSNKDGDNAIVEILPQPTAESKRVLIIYRDGLIILWAVQESK  532
            +V++ Y++P    +E+ G S+   D  +V +L QP +   R+LI + +GL+ LW   E +
Sbjct  162  LVQLPYYVPTDALAEAGGLSSPI-DYPVVGLLSQPCSRGTRLLIAFSNGLLFLWDASEDR  220

Query  533  TIFTTG-----------GNALQSVNHE-------AXKATAACWACPNGT  625
             +   G           G++L + + E         + ++ CWA  +G+
Sbjct  221  VMLVRGNKNLPVEGNTVGDSLDASHDELSDLELDGKEISSLCWASTDGS  269



>ref|XP_011623149.1| PREDICTED: uncharacterized protein LOC18433437 [Amborella trichopoda]
Length=1105

 Score =   152 bits (384),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 78/232 (34%), Positives = 130/232 (56%), Gaps = 24/232 (10%)
 Frame = +2

Query  2    GVPPGALLLAYDSIQKILAISTKDGRIKVFGKDGAQALLESPNIVPSKFMQFMENQGFLI  181
            G+P  A +LA+D IQ+ILAI T DGRIK+ G D  + LL SP   P K ++F+ NQG+++
Sbjct  25   GIPSTASILAFDPIQRILAIGTLDGRIKIIGGDNIECLLVSPIKAPYKHLEFLHNQGYVV  84

Query  182  KINVDNHIEVWNVDQKSLSNIHEFKRDITSFKIIQHTPYMYIGDSLGYVWVLKLEKEPCN  361
             ++ +N I VW+++ + ++   +++ +IT+F +IQ T +MY+GD  G + VL+ + E   
Sbjct  85   SVSNENDIRVWDLEHRHVACYLQWESNITAFSVIQGTAFMYVGDEYGVMSVLRFDVEEAK  144

Query  362  VVKMKYHIPFSESHGNS--NKDGDNAIVEILPQPTAESKRVLIIYRDGLIILWAVQESKT  535
            ++ + Y IP + +   +  +     ++V + PQP   ++RVLI Y +GLIILW V E + 
Sbjct  145  LLLLPYRIPATVALDAAKISVTLHPSVVGVFPQPCIANRRVLIAYDNGLIILWDVSEDRI  204

Query  536  IFTTGGNALQSVN----------------------HEAXKATAACWACPNGT  625
            +   G   LQ+ N                      HE  +  + CWA  +G+
Sbjct  205  VLVRGYTDLQAKNEGGAKNQSSTETETCGQSSDLDHEEKEICSLCWASADGS  256



>ref|XP_010326061.1| PREDICTED: uncharacterized protein LOC101248608 [Solanum lycopersicum]
Length=1103

 Score =   152 bits (384),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 86/229 (38%), Positives = 127/229 (55%), Gaps = 21/229 (9%)
 Frame = +2

Query  2    GVPPGALLLAYDSIQKILAISTKDGRIKVFGKDGAQALLESPNIVPSKFMQFMENQGFLI  181
            G+P  A +LA DS+Q++LAI T DGRIKV G D  + LL SP  +P K+++F++NQGFL+
Sbjct  40   GIPSTASILAVDSVQRLLAIGTLDGRIKVIGGDNIEGLLISPKQLPYKYLEFLQNQGFLV  99

Query  182  KINVDNHIEVWNVDQKSLSNIHEFKRDITSFKIIQHTPYMYIGDSLGYVWVLKLEKEPCN  361
             I  +N I+VWN+  +S++   +++ +IT+F +I  + +MY+GD  G + VLK   E   
Sbjct  100  NITNENDIQVWNLKSRSVACDLQWESNITAFSVINGSSFMYVGDEYGTISVLKFHVENRE  159

Query  362  VVKMKYHIPFSE-SHGNSNKDGDNA-IVEILPQPTAESKRVLIIYRDGLIILWAVQESKT  535
            ++++ Y I +S  S   S    D+  +V ILPQP     R+LI Y  GLIILW V E+  
Sbjct  160  LLQLPYQIIWSSLSEATSFPYSDHQPVVGILPQPFTSGNRLLIAYECGLIILWDVVEAHV  219

Query  536  IFTTGG-------------------NALQSVNHEAXKATAACWACPNGT  625
            I   G                    N L     E  + T  CWA  +G+
Sbjct  220  IIVKGDKDLHLKDGAFKKNADSSSPNDLLQHQFEEKEITTLCWASIDGS  268



>ref|XP_007140270.1| hypothetical protein PHAVU_008G098000g [Phaseolus vulgaris]
 gb|ESW12264.1| hypothetical protein PHAVU_008G098000g [Phaseolus vulgaris]
Length=1116

 Score =   152 bits (383),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 77/201 (38%), Positives = 124/201 (62%), Gaps = 4/201 (2%)
 Frame = +2

Query  2    GVPPGALLLAYDSIQKILAISTKDGRIKVFGKDGAQALLESPNIVPSKFMQFMENQGFLI  181
            G+P  A +LA+D IQ++LAI T DGR+KV G D  + LL SP  +P K+++F++NQG L+
Sbjct  38   GIPSTASVLAFDPIQRLLAIGTLDGRLKVIGGDNIEGLLVSPKQLPYKYLEFLQNQGHLV  97

Query  182  KINVDNHIEVWNVDQKSLSNIHEFKRDITSFKIIQHTPYMYIGDSLGYVWVLKLEKEPCN  361
             +  DN I+VWN++ +SL    +++ DIT+F ++  + ++Y+GD  G   V+K E E   
Sbjct  98   GVLNDNDIQVWNLESRSLVCSLKWESDITAFSVVSGSHFIYVGDQHGLFSVIKFEAEKGQ  157

Query  362  VVKMKYHIP---FSESHGNSNKDGDNAIVEILPQPTAESKRVLIIYRDGLIILWAVQESK  532
            ++K  Y++      E+ G S+      I+ IL QP++   R+LI + DGL+ILW V E++
Sbjct  158  LLKASYNLSAKFLREAAGFSDPSV-QPIIGILLQPSSSGNRLLIAFEDGLLILWDVSEAR  216

Query  533  TIFTTGGNALQSVNHEAXKAT  595
              F  GG  LQ  + +   +T
Sbjct  217  IAFLGGGKDLQLKDEDGNPST  237



>ref|XP_010552925.1| PREDICTED: uncharacterized protein LOC104823185 [Tarenaya hassleriana]
Length=1101

 Score =   152 bits (383),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 79/229 (34%), Positives = 135/229 (59%), Gaps = 22/229 (10%)
 Frame = +2

Query  2    GVPPGALLLAYDSIQKILAISTKDGRIKVFGKDGAQALLESPNIVPSKFMQFMENQGFLI  181
            G+P  A +LA+D +Q +LAI T DGRIKV G D  +A+L SP  +P K ++F++NQGFL+
Sbjct  40   GIPSTASVLAFDPVQSLLAIGTLDGRIKVIGGDNIEAILASPKQLPFKNLEFIQNQGFLV  99

Query  182  KINVDNHIEVWNVDQKSLSNIHEFKRDITSFKIIQHTPYMYIGDSLGYVWVLKLEKEPCN  361
             ++ +N I+VW++D +  ++  +++ +IT+F I+  T YM+IGD  G V V+K   E   
Sbjct  100  SVSNENEIQVWDLDLRQTASSLQWESNITAFSILHGTGYMFIGDEYGMVSVMKYNAEEGK  159

Query  362  VVKMKYHIP---FSESHGNSNKDGDNAIVEILPQPTAESKRVLIIYRDGLIILWAVQESK  532
            +V++ Y++P    +E+ G S+   ++ IV +L QP ++  R+LI + +GL+ LW   E +
Sbjct  160  LVQLPYYVPTDALAEAAGLSSPI-EHPIVGLLSQPCSKGSRLLIAFSNGLLFLWDASEDR  218

Query  533  TIFTTG-----------GNA-------LQSVNHEAXKATAACWACPNGT  625
             +   G           GN+       L  +  E  + ++ CWA  +G+
Sbjct  219  VLLVRGNKDLPLEGKTVGNSPEVFHTELSDLELEGKEISSLCWASTDGS  267



>ref|XP_006399016.1| hypothetical protein EUTSA_v10012508mg [Eutrema salsugineum]
 gb|ESQ40469.1| hypothetical protein EUTSA_v10012508mg [Eutrema salsugineum]
Length=1100

 Score =   151 bits (382),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 79/229 (34%), Positives = 130/229 (57%), Gaps = 22/229 (10%)
 Frame = +2

Query  2    GVPPGALLLAYDSIQKILAISTKDGRIKVFGKDGAQALLESPNIVPSKFMQFMENQGFLI  181
            G+P  A LLA+D IQ +LA+ T DGRIKV G D  +A+L SP  +P K ++F+ENQGFL+
Sbjct  40   GIPSTASLLAFDPIQCLLAVGTLDGRIKVIGGDNIEAILASPKQLPFKNLEFIENQGFLV  99

Query  182  KINVDNHIEVWNVDQKSLSNIHEFKRDITSFKIIQHTPYMYIGDSLGYVWVLKLEKEPCN  361
             I+ +N I+VW++D +  ++   ++ +IT+F I+  T YMY+GD  G V VLK   +   
Sbjct  100  SISNENEIQVWDLDLRQTASSLHWESNITAFSILHGTGYMYVGDEYGMVSVLKYSADEGK  159

Query  362  VVKMKYHIP---FSESHGNSNKDGDNAIVEILPQPTAESKRVLIIYRDGLIILWAVQESK  532
            +V++ Y++P    +E+ G S+   D  +V +L QP +   R+LI + +GL+ LW   E +
Sbjct  160  LVQLPYYVPTDALAEAAGLSSPI-DYPVVGLLSQPCSRGTRLLIAFSNGLLFLWDASEDR  218

Query  533  TIFTTGG------------------NALQSVNHEAXKATAACWACPNGT  625
             +   G                   + L  +  +  + ++ CWA  +G+
Sbjct  219  VVLVRGNKDLPVEGKTVDDSLEASHDELSDLELDGKEISSLCWASADGS  267



>ref|XP_006366943.1| PREDICTED: uncharacterized protein LOC102587909 [Solanum tuberosum]
Length=1114

 Score =   151 bits (382),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 86/232 (37%), Positives = 128/232 (55%), Gaps = 25/232 (11%)
 Frame = +2

Query  2    GVPPGALLLAYDSIQKILAISTKDGRIKVFGKDGAQALLESPNIVPSKFMQFMENQGFLI  181
            G+P  A +LA DS+Q++LAI T DGRIKV G D  + LL SP  +P K+++F++NQGFL+
Sbjct  40   GIPSTASILAVDSVQRLLAIGTLDGRIKVIGGDNIEGLLISPKQLPYKYLEFLQNQGFLV  99

Query  182  KINVDNHIEVWNVDQKSLSNIHEFKRDITSFKIIQHTPYMYIGDSLGYVWVLKLEKEPCN  361
             I  +N I+VWN+  +S++   +++ +IT+F +I  + +MY+GD  G + VLK   E   
Sbjct  100  SITNENDIQVWNLKSRSVACDLQWESNITAFSVINGSSFMYVGDEYGTISVLKFHVENRE  159

Query  362  VVKMKYHI---PFSESHGNSNKDGDNAIVEILPQPTAESKRVLIIYRDGLIILWAVQESK  532
            ++++ Y I     SE+ G    D    +V ILPQP     R+LI Y  GLIILW V E+ 
Sbjct  160  LLQLPYQILWSSLSEATGFPYSD-HQPVVGILPQPFTSGNRLLIAYECGLIILWDVVEAH  218

Query  533  TIFTTGGNALQ----SVNH-----------------EAXKATAACWACPNGT  625
             I   G   L     ++N                  E  + T  CWA  +G+
Sbjct  219  VIIVKGDKDLHLKDGALNFKKNADSSSPDDLMQHQLEEKEITTLCWASTDGS  270



>ref|XP_002312164.2| transducin family protein [Populus trichocarpa]
 gb|EEE89531.2| transducin family protein [Populus trichocarpa]
Length=1063

 Score =   151 bits (382),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 78/238 (33%), Positives = 126/238 (53%), Gaps = 50/238 (21%)
 Frame = +2

Query  2    GVPPGALLLAYDSIQKILAISTKDGRIKVFGKDGAQALLESPNIVPSKFMQFMENQGFLI  181
            G+P  A +LA+D IQ +LAI T DGRIKV G D  + LL SP  +P K+++F++NQG L+
Sbjct  54   GIPSTASVLAFDHIQSLLAIGTLDGRIKVIGGDSIEGLLVSPKTLPFKYLEFLQNQGILV  113

Query  182  KINVDNHIEVWNVDQKSLSNIHEFKRDITSFKIIQHTPYMYIGDSLGYVWVLKLEKEPCN  361
             ++ DN I+VW+++Q+ +++  ++  +IT+F +I  + YMYIGD  G V+VLK + E   
Sbjct  114  SVSSDNEIQVWDLEQRQIASTLQWDSNITAFSVIFASSYMYIGDEYGMVYVLKYDAEEVK  173

Query  362  VVKMKYHIP--FSESHGNSNKDGDNAIVEILPQPTAESKR--------------------  475
            +V+M YH+P   +E     +   ++++V +LPQP+++  +                    
Sbjct  174  LVQMPYHVPADVAEDASGMSSPKNHSVVGVLPQPSSQGNKHVDWTLASGPSVRFGDLVIM  233

Query  476  ----------------------------VLIIYRDGLIILWAVQESKTIFTTGGNALQ  565
                                        VLI Y DGL+ILW V E K +   G   ++
Sbjct  234  LVLLSAYMMEHVSINVESDTCTICHGDGVLIAYEDGLMILWDVSEDKVVLVKGNKDIE  291



>ref|XP_006659002.1| PREDICTED: uncharacterized protein LOC102719885 [Oryza brachyantha]
Length=1141

 Score =   151 bits (382),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 87/203 (43%), Positives = 124/203 (61%), Gaps = 8/203 (4%)
 Frame = +2

Query  2    GVPPGALLLAYDSIQKILAISTKDGRIKVFGKDGAQALLESPNIVPSKFMQFMENQGFLI  181
            GVP  A LLA+D +Q++LA++T DGRIK+ G D  + LL SPN +P KF+QF++NQG LI
Sbjct  66   GVPYTASLLAFDPVQRLLAVATLDGRIKIIGGDNIEGLLISPNSLPYKFLQFIQNQGLLI  125

Query  182  KINVDNHIEVWNVDQKSLSNIHEFKRDITSFKIIQHTPYMYIGDSLGYVWVLKLEKEPCN  361
             I+ +N I+VWN++ + L    ++  +IT+F +I+ T  MYIGD  G + VLK + +   
Sbjct  126  AISNENEIQVWNLEFRQLFYSSQWDINITAFAVIEGTFLMYIGDENGLLSVLKYDVDDGK  185

Query  362  VVKMKYHIP---FSESHGNSNKDGDNAIVEILPQPTAESKRVLIIYRDGLIILWAVQESK  532
            + KM Y++P    +E+   S +D   +IV ILPQP     RVLI Y  GL++LW V E  
Sbjct  186  LQKMPYNVPIHSLAEATCVSLED-PQSIVGILPQPDTFGTRVLIAYEKGLLVLWDVSEDC  244

Query  533  TIFTTGGNALQSVNHEAXKATAA  601
             I   G   L    H   + TAA
Sbjct  245  AIAVRGYGDL----HMKNQVTAA  263



>gb|KHN44705.1| Syntaxin-binding protein 5 [Glycine soja]
Length=1024

 Score =   151 bits (381),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 82/232 (35%), Positives = 129/232 (56%), Gaps = 24/232 (10%)
 Frame = +2

Query  2    GVPPGALLLAYDSIQKILAISTKDGRIKVFGKDGAQALLESPNIVPSKFMQFMENQGFLI  181
            G+P  A +LA+D IQ++LAI T DGR+KV G D  + LL SP  +P K+++F++NQG L+
Sbjct  38   GIPSTASVLAFDPIQRLLAIGTLDGRLKVIGGDNIEGLLVSPKQLPYKYLEFLQNQGHLV  97

Query  182  KINVDNHIEVWNVDQKSLSNIHEFKRDITSFKIIQHTPYMYIGDSLGYVWVLKLEKEPCN  361
             +  DN I+VWN++ +SL    +++ DIT+F +I  + ++Y+GD  G   V+K E E   
Sbjct  98   GVLNDNDIQVWNLESRSLVCSLQWEFDITAFSVISGSHFIYVGDQHGLFSVIKFEAEEGQ  157

Query  362  VVKMKYHIP--FSESHGNSNKDGDNAIVEILPQPTAESKR-VLIIYRDGLIILWAVQESK  532
            ++K  Y++   F        +  +  IV +L QP++   R +LI + DGL+ILW V ES+
Sbjct  158  LLKSSYYLSAKFLREAAGFPEPSEQPIVGVLLQPSSFGNRQLLIAFEDGLLILWDVSESR  217

Query  533  TIFTTGGNALQSVNHEAXKA---------------------TAACWACPNGT  625
             +F  GG  LQ  + +   +                     TA CWA   G+
Sbjct  218  IVFLGGGKDLQLKDEDGNSSSETGTNPPADIVEQNLGDKEITALCWASSTGS  269



>ref|XP_009763492.1| PREDICTED: uncharacterized protein LOC104215408 isoform X1 [Nicotiana 
sylvestris]
Length=1078

 Score =   151 bits (381),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 77/183 (42%), Positives = 118/183 (64%), Gaps = 4/183 (2%)
 Frame = +2

Query  2    GVPPGALLLAYDSIQKILAISTKDGRIKVFGKDGAQALLESPNIVPSKFMQFMENQGFLI  181
            G+P  A +LA+D IQ++L I T DGRIKV G    + LL SP  +P K ++F++NQGFL+
Sbjct  36   GIPSTASILAFDPIQQLLVIGTLDGRIKVIGGSNVEGLLFSPKPLPFKNLEFLQNQGFLV  95

Query  182  KINVDNHIEVWNVDQKSLSNIHEFKRDITSFKIIQHTPYMYIGDSLGYVWVLKLEKEPCN  361
             ++  N I+VW+++ + +S+  +++ +IT+F +I  T YM++GD  GY+ VLK E    +
Sbjct  96   GVSNGNEIQVWDLENRRMSSNLQWESNITAFSMIYDTHYMFVGDEYGYLSVLKYESREGS  155

Query  362  VVKMKYHIP---FSESHGNSNKDGDNAIVEILPQPTAESKRVLIIYRDGLIILWAVQESK  532
            +  + YHIP    +E+   S  D   AIV +LPQP++   RVLI Y +GLIILW V E +
Sbjct  156  LELLPYHIPPNLIAEAAEISMPD-QLAIVGLLPQPSSLGNRVLIAYENGLIILWDVTEDR  214

Query  533  TIF  541
             + 
Sbjct  215  AVL  217



>gb|KHN20308.1| Syntaxin-binding protein 5 [Glycine soja]
Length=1026

 Score =   150 bits (378),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 80/232 (34%), Positives = 130/232 (56%), Gaps = 24/232 (10%)
 Frame = +2

Query  2    GVPPGALLLAYDSIQKILAISTKDGRIKVFGKDGAQALLESPNIVPSKFMQFMENQGFLI  181
            G+P  A +LA+D IQ++LAI T DGR+KV G D  + LL SP  +P K+++F++NQG L+
Sbjct  38   GIPSTASVLAFDPIQRLLAIGTLDGRLKVIGGDNIEGLLVSPKQLPYKYLEFLQNQGHLV  97

Query  182  KINVDNHIEVWNVDQKSLSNIHEFKRDITSFKIIQHTPYMYIGDSLGYVWVLKLEKEPCN  361
             +  DN I+VWN++ +SL    +++ DIT+F +I  + ++Y+GD  G   V+K E E   
Sbjct  98   GVLNDNDIQVWNLESRSLVCSLQWEFDITAFSVISGSHFIYVGDQHGLFSVIKFEAEEGQ  157

Query  362  VVKMKYHIP--FSESHGNSNKDGDNAIVEILPQPTAESKR-VLIIYRDGLIILWAVQESK  532
            ++K  Y++   F       ++  +  I+ +L QP++   R +LI + DGL+ILW V E++
Sbjct  158  LLKSSYNLSAKFLREAAGFSEASEQPIIGVLLQPSSFGNRQLLIAFEDGLLILWDVSEAR  217

Query  533  TIFTTGGNALQSVNHEAXKA---------------------TAACWACPNGT  625
             +F  GG  LQ  + +   +                     TA CWA   G+
Sbjct  218  IVFLGGGKDLQLKDEDGNSSSESGANPPADIVEQNLGDKEITALCWASSTGS  269



>ref|XP_010491088.1| PREDICTED: uncharacterized protein LOC104768753 [Camelina sativa]
Length=1096

 Score =   150 bits (378),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 80/229 (35%), Positives = 134/229 (59%), Gaps = 22/229 (10%)
 Frame = +2

Query  2    GVPPGALLLAYDSIQKILAISTKDGRIKVFGKDGAQALLESPNIVPSKFMQFMENQGFLI  181
            G+P  A LLA+D IQ +LA+ T DGRIKV G D  +A+L SP  +P K ++FM+NQGFL+
Sbjct  39   GIPSTASLLAFDPIQCLLAVGTLDGRIKVIGGDNIEAILASPKQLPFKNLEFMQNQGFLV  98

Query  182  KINVDNHIEVWNVDQKSLSNIHEFKRDITSFKIIQHTPYMYIGDSLGYVWVLKLEKEPCN  361
             I+ +N I+VW++D +  ++  +++ +IT+F I+  T YMY+GD  G V VL    +   
Sbjct  99   SISNENEIQVWDLDLRQPASSLQWESNITAFAILHGTGYMYVGDEYGMVSVLNYNADEGK  158

Query  362  VVKMKYHIP---FSESHGNSNKDGDNAIVEILPQPTAESKRVLIIYRDGLIILWAVQESK  532
            ++++ Y++P    +E+ G S+   D  +V IL QP +   R+LI + +GL+ LW   E +
Sbjct  159  LLQLPYYVPTDALAEAAGLSSPI-DYPVVGILSQPCSWGTRLLIAFSNGLLFLWDASEDR  217

Query  533  TIFTTG-----------GNALQSVNHE-------AXKATAACWACPNGT  625
             +   G           G++L++ + E         + ++ CWA  +G+
Sbjct  218  VVLVRGNKDLPVEGKTVGDSLEASHDEFSDLELDGKEISSLCWASTDGS  266



>gb|KEH23187.1| nucleotide-binding protein [Medicago truncatula]
Length=1120

 Score =   149 bits (376),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 78/230 (34%), Positives = 127/230 (55%), Gaps = 22/230 (10%)
 Frame = +2

Query  2    GVPPGALLLAYDSIQKILAISTKDGRIKVFGKDGAQALLESPNIVPSKFMQFMENQGFLI  181
            G+P  + +LA+D IQ++LAI T DGR+KV G D  + LL S   +P K+++F++NQG+L+
Sbjct  39   GIPSSSSVLAFDPIQRLLAIGTLDGRLKVIGGDNIEGLLISSKQLPYKYLEFLQNQGYLV  98

Query  182  KINVDNHIEVWNVDQKSLSNIHEFKRDITSFKIIQHTPYMYIGDSLGYVWVLKLEKEPCN  361
             +  DN I+VWN++ +SL    +++ +IT+F +I  + ++Y+GD      V+K + E   
Sbjct  99   GVLNDNDIQVWNLESRSLICSLQWESNITAFSVISGSHFIYVGDEHSLFSVIKFDAEERQ  158

Query  362  VVKMKYHIP--FSESHGNSNKDGDNAIVEILPQPTAESKRVLIIYRDGLIILWAVQESKT  535
            ++K   H+   F        +  D  IV IL QP +   R+LI ++DGL+ILW V E+K 
Sbjct  159  LLKSSNHLSAKFLRETAGFPESSDQPIVGILSQPYSSGNRLLIAFQDGLLILWDVSEAKI  218

Query  536  IFTTGGNALQSVNHEAXKA--------------------TAACWACPNGT  625
            +F  GG  LQ  + +                        +A CWA  +G+
Sbjct  219  VFLGGGKDLQLKDDDGNSTETDTNLPADILEQNLGDKEISALCWASSDGS  268



>gb|ERN05265.1| hypothetical protein AMTR_s00007p00123180 [Amborella trichopoda]
Length=1099

 Score =   149 bits (375),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 79/233 (34%), Positives = 129/233 (55%), Gaps = 25/233 (11%)
 Frame = +2

Query  2    GVPPGALLLAYDSIQKILAISTKDGRIKVFGKDGAQALLESPNIVPSKFMQFMENQGFLI  181
            G+P  A +LA+D IQ+ILAI T DGRIK+ G D  + LL SP   P K ++F+ NQG+++
Sbjct  35   GIPSTASILAFDPIQRILAIGTLDGRIKIIGGDNIECLLVSPIKAPYKHLEFLHNQGYVV  94

Query  182  KINVDNHIEVWNVDQKSLSNIHEFKRDITSFKIIQHTPYMYIGDSLGYVWVLKLEKEPCN  361
             ++ +N I VW+++ + ++   +++ +IT+F +IQ T +MY+GD  G + VL+ + E   
Sbjct  95   SVSNENDIRVWDLEHRHVACYLQWESNITAFSVIQGTAFMYVGDEYGVMSVLRFDVEEAK  154

Query  362  VVKMKYHIPFSESHGNS--NKDGDNAIVEILPQPT-AESKRVLIIYRDGLIILWAVQESK  532
            ++ + Y IP + +   +  +     ++V + PQP  A   RVLI Y +GLIILW V E +
Sbjct  155  LLLLPYRIPATVALDAAKISVTLHPSVVGVFPQPCIANRSRVLIAYDNGLIILWDVSEDR  214

Query  533  TIFTTGGNALQSVN----------------------HEAXKATAACWACPNGT  625
             +   G   LQ+ N                      HE  +  + CWA  +G+
Sbjct  215  IVLVRGYTDLQAKNEGGAKNQSSTETETCGQSSDLDHEEKEICSLCWASADGS  267



>ref|NP_196176.1| transducin family protein / WD-40 repeat family protein [Arabidopsis 
thaliana]
 dbj|BAB11546.1| unnamed protein product [Arabidopsis thaliana]
 gb|AED90890.1| transducin family protein / WD-40 repeat family protein [Arabidopsis 
thaliana]
Length=1124

 Score =   148 bits (374),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 78/229 (34%), Positives = 131/229 (57%), Gaps = 22/229 (10%)
 Frame = +2

Query  2    GVPPGALLLAYDSIQKILAISTKDGRIKVFGKDGAQALLESPNIVPSKFMQFMENQGFLI  181
            G+P  A LLA+D IQ +LA+ T DGRIKV G D  +A+L SP  +P K ++FM+NQGFL+
Sbjct  42   GIPSTASLLAFDPIQCLLAVGTLDGRIKVIGGDNIEAILASPKQLPFKNLEFMQNQGFLV  101

Query  182  KINVDNHIEVWNVDQKSLSNIHEFKRDITSFKIIQHTPYMYIGDSLGYVWVLKLEKEPCN  361
             I+ +N I+VW++D +  ++  +++ +IT+F I+  T YMY+GD  G V VL    +   
Sbjct  102  SISNENEIQVWDLDLRQPASSLKWESNITAFAILHGTGYMYVGDEYGMVSVLNYSADEGK  161

Query  362  VVKMKYHIP---FSESHGNSNKDGDNAIVEILPQPTAESKRVLIIYRDGLIILWAVQESK  532
            ++++ Y++P    SE+ G S+   D  +V +L QP ++  R+LI + +GL+ LW   E  
Sbjct  162  LLQLPYYVPTDALSEAAGLSSPI-DYPVVGLLSQPCSKGTRLLIAFSNGLLFLWDASEDH  220

Query  533  TIFTTGG------------------NALQSVNHEAXKATAACWACPNGT  625
             +   G                   + L ++  +  + ++ CWA  +G+
Sbjct  221  VVLVRGNKDLPVEGKTVADSLEASHDELSNLELDGKEISSLCWASTDGS  269



>ref|NP_001190229.1| transducin family protein / WD-40 repeat family protein [Arabidopsis 
thaliana]
 gb|AED90891.1| transducin family protein / WD-40 repeat family protein [Arabidopsis 
thaliana]
Length=1099

 Score =   148 bits (374),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 78/229 (34%), Positives = 131/229 (57%), Gaps = 22/229 (10%)
 Frame = +2

Query  2    GVPPGALLLAYDSIQKILAISTKDGRIKVFGKDGAQALLESPNIVPSKFMQFMENQGFLI  181
            G+P  A LLA+D IQ +LA+ T DGRIKV G D  +A+L SP  +P K ++FM+NQGFL+
Sbjct  42   GIPSTASLLAFDPIQCLLAVGTLDGRIKVIGGDNIEAILASPKQLPFKNLEFMQNQGFLV  101

Query  182  KINVDNHIEVWNVDQKSLSNIHEFKRDITSFKIIQHTPYMYIGDSLGYVWVLKLEKEPCN  361
             I+ +N I+VW++D +  ++  +++ +IT+F I+  T YMY+GD  G V VL    +   
Sbjct  102  SISNENEIQVWDLDLRQPASSLKWESNITAFAILHGTGYMYVGDEYGMVSVLNYSADEGK  161

Query  362  VVKMKYHIP---FSESHGNSNKDGDNAIVEILPQPTAESKRVLIIYRDGLIILWAVQESK  532
            ++++ Y++P    SE+ G S+   D  +V +L QP ++  R+LI + +GL+ LW   E  
Sbjct  162  LLQLPYYVPTDALSEAAGLSSPI-DYPVVGLLSQPCSKGTRLLIAFSNGLLFLWDASEDH  220

Query  533  TIFTTGG------------------NALQSVNHEAXKATAACWACPNGT  625
             +   G                   + L ++  +  + ++ CWA  +G+
Sbjct  221  VVLVRGNKDLPVEGKTVADSLEASHDELSNLELDGKEISSLCWASTDGS  269



>ref|XP_006378656.1| hypothetical protein POPTR_0010s19500g [Populus trichocarpa]
 gb|ERP56453.1| hypothetical protein POPTR_0010s19500g [Populus trichocarpa]
Length=1129

 Score =   147 bits (372),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 83/233 (36%), Positives = 127/233 (55%), Gaps = 37/233 (16%)
 Frame = +2

Query  2    GVPPGALLLAYDSIQKILAISTKDGRIKVFGKDGAQALLESPNIVPSKFMQFMENQGFLI  181
            G+P  A +LA+D IQ +LAI T DGRIKV G +  + LL SP   P K+++F++NQGFL+
Sbjct  68   GIPSTASILAFDHIQSLLAIGTLDGRIKVIGGNNIEGLLVSPKQSPFKYLEFLQNQGFLV  127

Query  182  KINVDNHIEVWNVDQKSLSNIHEFKRDITSFKIIQHTPYMYIGDSLGYVWVLKLEKEPCN  361
             ++ +N I+              F   IT+F +I  + YMY+GD  G V+VLK + E   
Sbjct  128  SVSNENEIQT-----------DCFLFTITAFSVIFCSSYMYVGDEYGMVYVLKYDAEEVK  176

Query  362  VVKMKYHIP---FSESHGNSNKDGDNAIVEILPQPTAESKRVLIIYRDGLIILWAVQESK  532
            +V M YH+P    +++ G S+   + ++V +LPQP+++  +VLI Y DGLII+W V E K
Sbjct  177  LVPMPYHVPADVAADASGMSSPK-NRSVVGVLPQPSSQGNKVLIAYEDGLIIIWDVSEDK  235

Query  533  TIFTTGGNALQ---SVNHEAXKAT-------------------AACWACPNGT  625
             +   G   L+    +  ++ K T                   A CWA  +G+
Sbjct  236  VVLVKGNKDLELKCKITADSHKDTGPELSDDISDYQPLEKEIAALCWASTDGS  288



>ref|XP_010452462.1| PREDICTED: uncharacterized protein LOC104734561 [Camelina sativa]
Length=1092

 Score =   147 bits (371),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 79/229 (34%), Positives = 133/229 (58%), Gaps = 22/229 (10%)
 Frame = +2

Query  2    GVPPGALLLAYDSIQKILAISTKDGRIKVFGKDGAQALLESPNIVPSKFMQFMENQGFLI  181
            G+P  A LLA+D IQ +LA+ T DGRIKV G D  +A+L S   +P K ++FM+NQGFL+
Sbjct  36   GIPSTASLLAFDPIQCLLAVGTLDGRIKVIGGDNIEAILASHKQLPFKNLEFMQNQGFLV  95

Query  182  KINVDNHIEVWNVDQKSLSNIHEFKRDITSFKIIQHTPYMYIGDSLGYVWVLKLEKEPCN  361
             I+ +N I+VW++D +  ++  +++ +IT+F I+  T YMY+GD  G V VL    +   
Sbjct  96   SISNENEIQVWDLDLRQPASSLQWESNITAFAILHGTGYMYVGDEYGMVSVLNYNADEGK  155

Query  362  VVKMKYHIP---FSESHGNSNKDGDNAIVEILPQPTAESKRVLIIYRDGLIILWAVQESK  532
            ++++ Y++P    +E+ G S+   D  +V IL QP +   R+LI + +GL+ LW   E +
Sbjct  156  LLQLPYYVPTDALAEAAGLSSPI-DYPVVGILSQPCSRGTRLLIAFSNGLLFLWDASEDR  214

Query  533  TIFTTG-----------GNALQSVNHE-------AXKATAACWACPNGT  625
             +   G           G++L++ + E         + ++ CWA  +G+
Sbjct  215  VVLVRGNKDLPVEGKTVGDSLEASHDEFSDLEIDGKEISSICWASTDGS  263



>ref|XP_002315153.2| transducin family protein [Populus trichocarpa]
 gb|EEF01324.2| transducin family protein [Populus trichocarpa]
Length=1133

 Score =   147 bits (371),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 83/233 (36%), Positives = 127/233 (55%), Gaps = 37/233 (16%)
 Frame = +2

Query  2    GVPPGALLLAYDSIQKILAISTKDGRIKVFGKDGAQALLESPNIVPSKFMQFMENQGFLI  181
            G+P  A +LA+D IQ +LAI T DGRIKV G +  + LL SP   P K+++F++NQGFL+
Sbjct  68   GIPSTASILAFDHIQSLLAIGTLDGRIKVIGGNNIEGLLVSPKQSPFKYLEFLQNQGFLV  127

Query  182  KINVDNHIEVWNVDQKSLSNIHEFKRDITSFKIIQHTPYMYIGDSLGYVWVLKLEKEPCN  361
             ++ +N I+              F   IT+F +I  + YMY+GD  G V+VLK + E   
Sbjct  128  SVSNENEIQT-----------DCFLFTITAFSVIFCSSYMYVGDEYGMVYVLKYDAEEVK  176

Query  362  VVKMKYHIP---FSESHGNSNKDGDNAIVEILPQPTAESKRVLIIYRDGLIILWAVQESK  532
            +V M YH+P    +++ G S+   + ++V +LPQP+++  +VLI Y DGLII+W V E K
Sbjct  177  LVPMPYHVPADVAADASGMSSPK-NRSVVGVLPQPSSQGNKVLIAYEDGLIIIWDVSEDK  235

Query  533  TIFTTGGNALQ---SVNHEAXKAT-------------------AACWACPNGT  625
             +   G   L+    +  ++ K T                   A CWA  +G+
Sbjct  236  VVLVKGNKDLELKCKITADSHKDTGPELSDDISDYQPLEKEIAALCWASTDGS  288



>gb|EYU26793.1| hypothetical protein MIMGU_mgv1a0006321mg, partial [Erythranthe 
guttata]
Length=821

 Score =   146 bits (369),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 89/233 (38%), Positives = 127/233 (55%), Gaps = 42/233 (18%)
 Frame = +2

Query  2    GVPPGALLLAYDSIQKILAISTKDGRIKVFGKDGAQALLESPNIVPSKFMQFMENQGFLI  181
            G+P  A +LA+D IQ++LA+ T DGRIKV G D  + LL SP  +P K ++F++NQGFL+
Sbjct  43   GIPSTASVLAFDPIQRLLAVGTLDGRIKVIGGDNIEVLLISPKPLPFKNLEFLQNQGFLV  102

Query  182  KINVDNHIEVWNVDQKSLSNIHEFKRDITSFKIIQHTPYMYIGDSLGYVWVLKLEKEPCN  361
                            S+SN +E +  IT+F +I  T YMY+GD  G++ VLK + E  N
Sbjct  103  ----------------SVSNENEIQSSITAFSLIIGTNYMYVGDEYGFLSVLKYDTEEGN  146

Query  362  VVKMKYHIP---FSESHGNSNKDGDNAIVEILPQPTAESKRVLIIYRDGLIILWAVQESK  532
            +V++ YH+P    +E  G +  D   +IV +L  P +   RVLI Y +GLIILW V E +
Sbjct  147  IVQLPYHVPPNLIAEGAGITLPD-QQSIVGVLSHPCSCGNRVLIAYENGLIILWDVTEDR  205

Query  533  TIFTTGGNALQ----------------SV-----NHEAXKATAA-CWACPNGT  625
             +   G   LQ                SV     N EA K  ++ CWA P+G+
Sbjct  206  AVHIKGYKDLQLKEAMTVNVSDNQSQTSVNDSLDNEEAEKEISSLCWASPDGS  258



>ref|XP_002972980.1| hypothetical protein SELMODRAFT_413341 [Selaginella moellendorffii]
 gb|EFJ26201.1| hypothetical protein SELMODRAFT_413341 [Selaginella moellendorffii]
Length=1111

 Score =   147 bits (370),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 77/224 (34%), Positives = 122/224 (54%), Gaps = 28/224 (13%)
 Frame = +2

Query  2    GVPPGALLLAYDSIQKILAISTKDGRIKVFGKDGAQALLESPNIVPSKFMQFMENQGFLI  181
            G+P  A +LAY+  Q++LAI+++DGRIK+FG++G + L +SP   P K+++F+ N+G LI
Sbjct  39   GIPASASVLAYEPGQRLLAIASRDGRIKIFGREGVEVLFKSPANAPCKYLEFVNNEGRLI  98

Query  182  KINVDNHIEVWNVDQKSLSNIHEFKRDITSFKIIQHTPYM------YIGDSLGYVWVLKL  343
             +   N IEVW++  K L +   ++ DIT+F +IQ T +M      Y+GD  G V VL  
Sbjct  99   HVTTRNEIEVWDLSTKELVSSKTWEADITAFAVIQATAFMYEFFVWYVGDETGQVSVLHF  158

Query  344  EKEPCNVVKMKYHIPFSESHGNSNKDGDNAIVEILPQPTAESKRVLIIYRDGLIILWAVQ  523
              E    V+M+Y +P             +  +  L      S  V+I+Y +G+I+LW + 
Sbjct  159  NNEDRCFVEMQYTVPA------------HLTLSGLIDTDDSSAPVVIVYGNGVIVLWGLH  206

Query  524  ESKTIFTTGGNALQ----------SVNHEAXKATAACWACPNGT  625
            E++ +   GG   Q            + E  +   ACWACP+GT
Sbjct  207  EAQVLAIRGGTEDQQRKLSGGKSSGSDEEEKEPCCACWACPSGT  250



>gb|EYU26792.1| hypothetical protein MIMGU_mgv1a0006321mg, partial [Erythranthe 
guttata]
Length=832

 Score =   146 bits (368),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 89/233 (38%), Positives = 127/233 (55%), Gaps = 42/233 (18%)
 Frame = +2

Query  2    GVPPGALLLAYDSIQKILAISTKDGRIKVFGKDGAQALLESPNIVPSKFMQFMENQGFLI  181
            G+P  A +LA+D IQ++LA+ T DGRIKV G D  + LL SP  +P K ++F++NQGFL+
Sbjct  43   GIPSTASVLAFDPIQRLLAVGTLDGRIKVIGGDNIEVLLISPKPLPFKNLEFLQNQGFLV  102

Query  182  KINVDNHIEVWNVDQKSLSNIHEFKRDITSFKIIQHTPYMYIGDSLGYVWVLKLEKEPCN  361
                            S+SN +E +  IT+F +I  T YMY+GD  G++ VLK + E  N
Sbjct  103  ----------------SVSNENEIQSSITAFSLIIGTNYMYVGDEYGFLSVLKYDTEEGN  146

Query  362  VVKMKYHIP---FSESHGNSNKDGDNAIVEILPQPTAESKRVLIIYRDGLIILWAVQESK  532
            +V++ YH+P    +E  G +  D   +IV +L  P +   RVLI Y +GLIILW V E +
Sbjct  147  IVQLPYHVPPNLIAEGAGITLPD-QQSIVGVLSHPCSCGNRVLIAYENGLIILWDVTEDR  205

Query  533  TIFTTGGNALQ----------------SV-----NHEAXKATAA-CWACPNGT  625
             +   G   LQ                SV     N EA K  ++ CWA P+G+
Sbjct  206  AVHIKGYKDLQLKEAMTVNVSDNQSQTSVNDSLDNEEAEKEISSLCWASPDGS  258



>ref|XP_010689562.1| PREDICTED: uncharacterized protein LOC104903240 isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=1101

 Score =   146 bits (369),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 69/187 (37%), Positives = 117/187 (63%), Gaps = 2/187 (1%)
 Frame = +2

Query  2    GVPPGALLLAYDSIQKILAISTKDGRIKVFGKDGAQALLESPNIVPSKFMQFMENQGFLI  181
            G+P  A  LAYD IQ++LAI T DGRIK+ G D  + LL SP  +P K ++F+ NQG L+
Sbjct  32   GIPSTASCLAYDPIQQLLAIGTLDGRIKIIGSDNIEGLLTSPKEIPFKNLEFLHNQGLLV  91

Query  182  KINVDNHIEVWNVDQKSLSNIHEFKRDITSFKIIQHTPYMYIGDSLGYVWVLKLEKEPCN  361
             ++ +N I+VW+++ + ++++ +++ +IT+F +IQ T YMY+GD  G V V+K + E   
Sbjct  92   AVSNENDIQVWDLEHRFIASLFQWESNITAFSVIQETNYMYLGDDCGLVSVVKYDIEDRK  151

Query  362  VVKMKYHIPFSESHGNSN--KDGDNAIVEILPQPTAESKRVLIIYRDGLIILWAVQESKT  535
            +++ +Y I        +      D ++V ILPQP +   R+L  Y +G+I+LW + + + 
Sbjct  152  IMRQQYSITAHSVFEVAEIPLRNDPSVVGILPQPCSGGNRLLFAYDNGVIVLWDIAKDQL  211

Query  536  IFTTGGN  556
            ++  G N
Sbjct  212  VYVRGRN  218



>ref|XP_010689554.1| PREDICTED: uncharacterized protein LOC104903240 isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=1102

 Score =   146 bits (369),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 69/187 (37%), Positives = 117/187 (63%), Gaps = 2/187 (1%)
 Frame = +2

Query  2    GVPPGALLLAYDSIQKILAISTKDGRIKVFGKDGAQALLESPNIVPSKFMQFMENQGFLI  181
            G+P  A  LAYD IQ++LAI T DGRIK+ G D  + LL SP  +P K ++F+ NQG L+
Sbjct  32   GIPSTASCLAYDPIQQLLAIGTLDGRIKIIGSDNIEGLLTSPKEIPFKNLEFLHNQGLLV  91

Query  182  KINVDNHIEVWNVDQKSLSNIHEFKRDITSFKIIQHTPYMYIGDSLGYVWVLKLEKEPCN  361
             ++ +N I+VW+++ + ++++ +++ +IT+F +IQ T YMY+GD  G V V+K + E   
Sbjct  92   AVSNENDIQVWDLEHRFIASLFQWESNITAFSVIQETNYMYLGDDCGLVSVVKYDIEDRK  151

Query  362  VVKMKYHIPFSESHGNSN--KDGDNAIVEILPQPTAESKRVLIIYRDGLIILWAVQESKT  535
            +++ +Y I        +      D ++V ILPQP +   R+L  Y +G+I+LW + + + 
Sbjct  152  IMRQQYSITAHSVFEVAEIPLRNDPSVVGILPQPCSGGNRLLFAYDNGVIVLWDIAKDQL  211

Query  536  IFTTGGN  556
            ++  G N
Sbjct  212  VYVRGRN  218



>ref|XP_004514217.1| PREDICTED: uncharacterized protein LOC101513772 isoform X1 [Cicer 
arietinum]
Length=1146

 Score =   146 bits (369),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 81/231 (35%), Positives = 128/231 (55%), Gaps = 24/231 (10%)
 Frame = +2

Query  2    GVPPGALLLAYDSIQKILAISTKDGRIKVFGKDGAQALLESPNIVPSKFMQFMENQGFLI  181
            G+P  A +LA+D IQ++LAI T DGR+KV G D  + LL S   +P K+++F++NQG L+
Sbjct  38   GIPSTASVLAFDPIQRLLAIGTLDGRLKVIGGDNIEGLLISSKQLPYKYLEFLQNQGHLV  97

Query  182  KINVDNHIEVWNVDQKSLSNIHEFKRDITSFKIIQHTPYMYIGDSLGYVWVLKLEKEPCN  361
             +  DN I+VWN++ +SL    +++ +IT+F +I  + ++Y+GD  G   V+K + E   
Sbjct  98   GVLNDNDIQVWNLENRSLICSLQWESNITAFSVISGSHFIYVGDEHGLFSVIKFDVEEGQ  157

Query  362  VVKMKYHIP--FSESHGNSNKDGDNAIVEILPQPTAESKRVLIIYRDGLIILWAVQESKT  535
            ++K   ++   F        +  D  IV IL QP +   R+LI ++DGL+ILW V E+K 
Sbjct  158  LLKSTNNLSAQFLREAAGFPESSDQPIVGILSQPYSSGNRLLIAFQDGLLILWDVSEAKI  217

Query  536  IFTTGGNALQSVNHEAXKAT---------------------AACWACPNGT  625
            +F  GG  LQ +  E   +T                     A CWA  +G+
Sbjct  218  VFLGGGKDLQ-LKDEGGNSTETNTDLPDDVLEQNLGDKEISALCWASSDGS  267



>ref|XP_010920833.1| PREDICTED: uncharacterized protein LOC105044594 isoform X2 [Elaeis 
guineensis]
Length=1124

 Score =   146 bits (369),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 78/191 (41%), Positives = 115/191 (60%), Gaps = 4/191 (2%)
 Frame = +2

Query  2    GVPPGALLLAYDSIQKILAISTKDGRIKVFGKDGAQALLESPNIVPSKFMQFMENQGFLI  181
            G+P  A LLA+D IQ++LAI T DGRIK+ G D  + LL SP  VP K+++F+ N  FL+
Sbjct  44   GIPYTASLLAFDPIQRLLAIGTLDGRIKIIGGDNIEGLLISPKKVPYKYLEFLYNHEFLV  103

Query  182  KINVDNHIEVWNVDQKSLSNIHEFKRDITSFKIIQHTPYMYIGDSLGYVWVLKLEKEPCN  361
             ++ +N I+VWN++ + L    +++ ++T+F ++Q T  MYIGD  G   VLK   E   
Sbjct  104  GVSNENEIQVWNLEFRQLVYCLQWEANMTAFAVVQGTYLMYIGDESGLFSVLKYNDEDGK  163

Query  362  VVKMKYHIP---FSESHGNSNKDGDNAIVEILPQPTAESKRVLIIYRDGLIILWAVQESK  532
            ++K+ YHIP    +E+ G S       I+ ILPQ      RVLI Y +GL+ILW + E +
Sbjct  164  LLKLPYHIPANVVTEAAGISFL-SPQPIIGILPQTCTSGTRVLIAYENGLLILWDISEGQ  222

Query  533  TIFTTGGNALQ  565
             +   G   LQ
Sbjct  223  VVTVRGYTDLQ  233



>ref|XP_010423454.1| PREDICTED: uncharacterized protein LOC104708556 [Camelina sativa]
Length=1093

 Score =   146 bits (369),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 79/229 (34%), Positives = 133/229 (58%), Gaps = 22/229 (10%)
 Frame = +2

Query  2    GVPPGALLLAYDSIQKILAISTKDGRIKVFGKDGAQALLESPNIVPSKFMQFMENQGFLI  181
            G+P  A LLA+D IQ +LA+ T DGRIKV G D  +A+L S   +P K ++FM+NQGFL+
Sbjct  36   GIPSTASLLAFDPIQCLLAVGTLDGRIKVIGGDNIEAILASHKQLPFKNLEFMQNQGFLV  95

Query  182  KINVDNHIEVWNVDQKSLSNIHEFKRDITSFKIIQHTPYMYIGDSLGYVWVLKLEKEPCN  361
             I+ +N I+VW++D +  ++  +++ +IT+F I+  T YMY+GD  G V VL    +   
Sbjct  96   SISNENEIQVWDLDLRQPASSLQWESNITAFAILHGTGYMYVGDEYGMVSVLNYNVDEGK  155

Query  362  VVKMKYHIP---FSESHGNSNKDGDNAIVEILPQPTAESKRVLIIYRDGLIILWAVQESK  532
            ++++ Y++P    +E+ G S+   D  +V IL QP +   R+LI + +GL+ LW   E +
Sbjct  156  LLQLPYYVPTDALAEAAGLSSPI-DFPVVGILSQPCSRGTRLLIAFSNGLLFLWDASEDR  214

Query  533  TIFTTG-----------GNALQSVNHE-------AXKATAACWACPNGT  625
             +   G           G++L++ + E         + ++ CWA  +G+
Sbjct  215  VVLVRGNKDLPVEGKTVGDSLEASHDEFSDLELDGKEISSLCWASTDGS  263



>ref|XP_004514218.1| PREDICTED: uncharacterized protein LOC101513772 isoform X2 [Cicer 
arietinum]
Length=1121

 Score =   146 bits (368),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 81/231 (35%), Positives = 128/231 (55%), Gaps = 24/231 (10%)
 Frame = +2

Query  2    GVPPGALLLAYDSIQKILAISTKDGRIKVFGKDGAQALLESPNIVPSKFMQFMENQGFLI  181
            G+P  A +LA+D IQ++LAI T DGR+KV G D  + LL S   +P K+++F++NQG L+
Sbjct  38   GIPSTASVLAFDPIQRLLAIGTLDGRLKVIGGDNIEGLLISSKQLPYKYLEFLQNQGHLV  97

Query  182  KINVDNHIEVWNVDQKSLSNIHEFKRDITSFKIIQHTPYMYIGDSLGYVWVLKLEKEPCN  361
             +  DN I+VWN++ +SL    +++ +IT+F +I  + ++Y+GD  G   V+K + E   
Sbjct  98   GVLNDNDIQVWNLENRSLICSLQWESNITAFSVISGSHFIYVGDEHGLFSVIKFDVEEGQ  157

Query  362  VVKMKYHIP--FSESHGNSNKDGDNAIVEILPQPTAESKRVLIIYRDGLIILWAVQESKT  535
            ++K   ++   F        +  D  IV IL QP +   R+LI ++DGL+ILW V E+K 
Sbjct  158  LLKSTNNLSAQFLREAAGFPESSDQPIVGILSQPYSSGNRLLIAFQDGLLILWDVSEAKI  217

Query  536  IFTTGGNALQSVNHEAXKAT---------------------AACWACPNGT  625
            +F  GG  LQ +  E   +T                     A CWA  +G+
Sbjct  218  VFLGGGKDLQ-LKDEGGNSTETNTDLPDDVLEQNLGDKEISALCWASSDGS  267



>ref|XP_010233571.1| PREDICTED: uncharacterized protein LOC100837017 isoform X2 [Brachypodium 
distachyon]
Length=1080

 Score =   146 bits (368),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 82/231 (35%), Positives = 126/231 (55%), Gaps = 24/231 (10%)
 Frame = +2

Query  2    GVPPGALLLAYDSIQKILAISTKDGRIKVFGKDGAQALLESPNIVPSKFMQFMENQGFLI  181
            GVP  A ++A+D +Q++LA+ T DGRIK+ G D  + +L SPN +P K++QF++NQG L+
Sbjct  10   GVPYAASVMAFDPVQRLLAVGTLDGRIKIIGGDNIEGILISPNSLPYKYLQFIQNQGLLV  69

Query  182  KINVDNHIEVWNVDQKSLSNIHEFKRDITSFKIIQHTPYMYIGDSLGYVWVLKLEKEPCN  361
             ++ +N I+VWN++ + L    ++  +IT+F +I+ T  MY+GD  G + VLK + +   
Sbjct  70   AVSNENEIQVWNLEFRQLFYSSQWDVNITAFAVIEGTFLMYVGDENGLLSVLKYDVDDGK  129

Query  362  VVKMKYHI---PFSESHGNSNKDGDNAIVEILPQPTAESKRVLIIYRDGLIILWAVQESK  532
            ++KM Y++     +E+ G S  D    IV ILPQP     RVLI Y  GL++LW V E  
Sbjct  130  LLKMPYNVTIHSLAEAAGVSLLD-TQPIVGILPQPDTLGTRVLIAYEKGLLVLWDVPEDC  188

Query  533  TIFTTGGNALQ--------------------SVNHEAXKATAACWACPNGT  625
             I   G   L                       N E  +  + CWA   G+
Sbjct  189  AIAVRGYGDLHMKGQVTGAQMSASEEHIDNVDENEEEREICSLCWASRGGS  239



>ref|XP_003559744.1| PREDICTED: uncharacterized protein LOC100837017 isoform X1 [Brachypodium 
distachyon]
Length=1109

 Score =   145 bits (367),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 82/231 (35%), Positives = 126/231 (55%), Gaps = 24/231 (10%)
 Frame = +2

Query  2    GVPPGALLLAYDSIQKILAISTKDGRIKVFGKDGAQALLESPNIVPSKFMQFMENQGFLI  181
            GVP  A ++A+D +Q++LA+ T DGRIK+ G D  + +L SPN +P K++QF++NQG L+
Sbjct  39   GVPYAASVMAFDPVQRLLAVGTLDGRIKIIGGDNIEGILISPNSLPYKYLQFIQNQGLLV  98

Query  182  KINVDNHIEVWNVDQKSLSNIHEFKRDITSFKIIQHTPYMYIGDSLGYVWVLKLEKEPCN  361
             ++ +N I+VWN++ + L    ++  +IT+F +I+ T  MY+GD  G + VLK + +   
Sbjct  99   AVSNENEIQVWNLEFRQLFYSSQWDVNITAFAVIEGTFLMYVGDENGLLSVLKYDVDDGK  158

Query  362  VVKMKYHI---PFSESHGNSNKDGDNAIVEILPQPTAESKRVLIIYRDGLIILWAVQESK  532
            ++KM Y++     +E+ G S  D    IV ILPQP     RVLI Y  GL++LW V E  
Sbjct  159  LLKMPYNVTIHSLAEAAGVSLLD-TQPIVGILPQPDTLGTRVLIAYEKGLLVLWDVPEDC  217

Query  533  TIFTTGGNALQ--------------------SVNHEAXKATAACWACPNGT  625
             I   G   L                       N E  +  + CWA   G+
Sbjct  218  AIAVRGYGDLHMKGQVTGAQMSASEEHIDNVDENEEEREICSLCWASRGGS  268



>emb|CDY14108.1| BnaC02g02250D [Brassica napus]
Length=1100

 Score =   145 bits (367),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 75/228 (33%), Positives = 131/228 (57%), Gaps = 21/228 (9%)
 Frame = +2

Query  2    GVPPGALLLAYDSIQKILAISTKDGRIKVFGKDGAQALLESPNIVPSKFMQFMENQGFLI  181
            G+P  A +LA+DSIQ +LA+ T DGRIKV G D  +A+L SP  +P K ++F+ENQGFL+
Sbjct  39   GIPSTASILAFDSIQSLLAVGTLDGRIKVIGGDNIEAVLASPKQLPFKNLEFIENQGFLV  98

Query  182  KINVDNHIEVWNVD-QKSLSNIHEFKRDITSFKIIQHTPYMYIGDSLGYVWVLKLEKEPC  358
             I+ +N I+VW++D ++++S++H ++ +IT+F I+  T YMY+GD  G V V+K   +  
Sbjct  99   SISNENDIQVWDLDLRQTMSSLH-WESNITAFSILPGTGYMYVGDEYGMVSVVKYNADEG  157

Query  359  NVVKMKYHIPFSE-SHGNSNKDGDNAIVEILPQPTAESKRVLIIYRDGLIILWAVQESKT  535
             +V + Y++P    +    +   +  +V +L QP +   R+LI + +GL+ +W   E + 
Sbjct  158  KLVHLPYYVPTDALAEAGLSSPIEYPVVGLLSQPCSRGTRLLIAFSNGLLFIWDASEDRV  217

Query  536  IFTTGG------------------NALQSVNHEAXKATAACWACPNGT  625
            +   G                   + L  +  +  + ++ CWA  +G+
Sbjct  218  VLVRGNKYLPMEGKTVDVSLEASHDELSDLKLDGKEISSLCWASADGS  265



>ref|XP_002871170.1| transducin family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH47429.1| transducin family protein [Arabidopsis lyrata subsp. lyrata]
Length=1100

 Score =   145 bits (366),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 76/229 (33%), Positives = 130/229 (57%), Gaps = 22/229 (10%)
 Frame = +2

Query  2    GVPPGALLLAYDSIQKILAISTKDGRIKVFGKDGAQALLESPNIVPSKFMQFMENQGFLI  181
            G+P  A LLA+D IQ +LA+ T DGRIKV G D  +A+L SP  +P K ++FM+NQGFL+
Sbjct  37   GIPSTASLLAFDPIQCLLAVGTLDGRIKVIGGDNIEAILASPKQLPFKNLEFMQNQGFLV  96

Query  182  KINVDNHIEVWNVDQKSLSNIHEFKRDITSFKIIQHTPYMYIGDSLGYVWVLKLEKEPCN  361
             I+ +N I+VW++D +  ++  +++ +IT+F I+  T YMY+GD  G V V+    +   
Sbjct  97   SISNENEIQVWDLDLRQPASSLKWESNITAFAILHGTGYMYVGDEYGMVSVINYSADEGK  156

Query  362  VVKMKYHIP---FSESHGNSNKDGDNAIVEILPQPTAESKRVLIIYRDGLIILWAVQESK  532
            ++++ Y++P    +E+ G S+   D  +V +L QP ++  R+LI + +GL+ LW   E  
Sbjct  157  LLQLPYYVPTDALAEAAGLSSPI-DYPVVGLLSQPCSKGTRLLIAFSNGLLFLWDALEDH  215

Query  533  TIFTTGG------------------NALQSVNHEAXKATAACWACPNGT  625
             +   G                   + L  +  +  + ++ CWA  +G+
Sbjct  216  VVLVRGNKDLPVEGSTVADTLEASHDELSDLELDGKEISSLCWASTDGS  264



>emb|CDY04957.1| BnaAnng01390D [Brassica napus]
Length=1096

 Score =   145 bits (365),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 78/230 (34%), Positives = 134/230 (58%), Gaps = 24/230 (10%)
 Frame = +2

Query  2    GVPPGALLLAYDSIQKILAISTKDGRIKVFGKDGAQALLESPNIVPSKFMQFMENQGFLI  181
            G+P  A +LA+DSIQ +LA+ T DGRIKV G D  +A+L SP  +P K ++F+ENQGFL+
Sbjct  44   GIPSTASILAFDSIQSLLAVGTLDGRIKVIGGDNIEAVLASPKQLPFKNLEFIENQGFLV  103

Query  182  KINVDNHIEVWNVD-QKSLSNIHEFKRDITSFKIIQHTPYMYIGDSLGYVWVLKLEKEPC  358
             I+ +N I+VW++D ++++S++H ++ +IT+F I+  T YMY+GD  G V V+K   +  
Sbjct  104  SISNENDIQVWDLDLRQTMSSLH-WESNITAFSILPGTGYMYVGDEYGTVSVVKYNADEG  162

Query  359  NVVKMKYHIP---FSESHGNSNKDGDNAIVEILPQPTAESKRVLIIYRDGLIILWAVQES  529
             +V + Y++P    +E+ G S+   +  +V +L QP +   R+LI + +GL+ +W   E 
Sbjct  163  KLVHLPYYVPTDALAEAAGLSSPI-EYPVVGLLSQPCSRGTRLLIAFSNGLLFIWDASED  221

Query  530  KTIFTTGG------------------NALQSVNHEAXKATAACWACPNGT  625
            +     G                   + L  +  +  + ++ CWA  +G+
Sbjct  222  RVELVRGNKDLPMEGKTVDVSLEASHDELSDLKLDGKEISSLCWASADGS  271



>ref|XP_010658263.1| PREDICTED: uncharacterized protein LOC100250143 isoform X2 [Vitis 
vinifera]
Length=942

 Score =   144 bits (364),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 82/233 (35%), Positives = 129/233 (55%), Gaps = 26/233 (11%)
 Frame = +2

Query  2    GVPPGALLLAYDSIQKILAISTKDGRIKVFGKDGAQALLESPNIVPSKFMQFMENQGFLI  181
            G+P  A +LA D IQ +LA+ T DGRIKV G D  + LL SP  +P K ++F+ NQGFL+
Sbjct  37   GIPSTASILAVDPIQGLLAVGTLDGRIKVIGGDNIECLLISPKQLPFKNLEFLRNQGFLV  96

Query  182  KINVDNHIEVWNVDQKSLSNIHEFKRDITSFKIIQHTPYMYIGDSLGYVWVLKLEKEPCN  361
             ++ +N ++VW+++ + L++  +++ +IT+F +I  T YMY+GD  G ++VLK + +   
Sbjct  97   SVSNENEVQVWDLECRHLASNLQWESNITAFSVIYGTQYMYVGDEHGSLFVLKYDHQEGK  156

Query  362  VVKMKYHIP---FSESHGNSNKDGDNAIVEILPQPTAESKRVLIIYRDGLIILWAVQESK  532
            ++   YHIP    +E  G S     ++IV +LPQP +   R+LI Y +GL+I+W   +  
Sbjct  157  LLHQPYHIPANAVAEVAGISVPI-HHSIVGVLPQPCSHGNRMLIAYENGLLIVWDAFQDS  215

Query  533  TIFTTGGNALQSVN-----------HEAXKATAA-----------CWACPNGT  625
             +   G   LQ  N           HE    T+            CWA  NG+
Sbjct  216  VVCVRGYKDLQVKNKTVVNSPNDMRHELSNDTSENIPMEKDISSLCWASANGS  268



>ref|XP_009125606.1| PREDICTED: uncharacterized protein LOC103850590 isoform X1 [Brassica 
rapa]
Length=1121

 Score =   144 bits (364),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 78/230 (34%), Positives = 134/230 (58%), Gaps = 24/230 (10%)
 Frame = +2

Query  2    GVPPGALLLAYDSIQKILAISTKDGRIKVFGKDGAQALLESPNIVPSKFMQFMENQGFLI  181
            G+P  A +LA+DSIQ +LA+ T DGRIKV G D  +A+L SP  +P K ++F+ENQGFL+
Sbjct  44   GIPSTASILAFDSIQSLLAVGTLDGRIKVIGGDNIEAVLASPKQLPFKNLEFIENQGFLV  103

Query  182  KINVDNHIEVWNVD-QKSLSNIHEFKRDITSFKIIQHTPYMYIGDSLGYVWVLKLEKEPC  358
             I+ +N I+VW++D ++++S++H ++ +IT+F I+  T YMY+GD  G V V+K   +  
Sbjct  104  SISNENDIQVWDLDLRQTVSSLH-WESNITAFSILPGTGYMYVGDEYGTVSVVKYNADEG  162

Query  359  NVVKMKYHIP---FSESHGNSNKDGDNAIVEILPQPTAESKRVLIIYRDGLIILWAVQES  529
             +V + Y++P    +E+ G S+   +  +V +L QP +   R+LI + +GL+ +W   E 
Sbjct  163  KLVHLPYYVPTDALAEAAGLSSPI-EYPVVGLLSQPCSRGTRLLIAFSNGLLFIWDASED  221

Query  530  KTIFTTGG------------------NALQSVNHEAXKATAACWACPNGT  625
            +     G                   + L  +  +  + ++ CWA  +G+
Sbjct  222  RVELVRGNKDLPMEGKTVDVSLEASHDELSDLKLDGKEISSLCWASADGS  271



>ref|XP_006338829.1| PREDICTED: uncharacterized protein LOC102596591 isoform X2 [Solanum 
tuberosum]
Length=1073

 Score =   144 bits (364),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 75/180 (42%), Positives = 117/180 (65%), Gaps = 6/180 (3%)
 Frame = +2

Query  2    GVPPGALLLAYDSIQKILAISTKDGRIKVFGKDGAQALLESPNIVPSKFMQFMENQGFLI  181
            G+P  A +LA+D IQ++LAI T DGRIKV G    + LL SP  +  K ++F++NQGFL+
Sbjct  36   GIPSTASILAFDPIQQLLAIGTLDGRIKVIGGSNVEGLLFSPKPLAFKNLEFLQNQGFLV  95

Query  182  KINVDNHIEVWNVDQKSLSNIHEFKRDITSFKIIQHTPYMYIGDSLGYVWVLKLEKEPCN  361
             ++  N I+VW+++ + +S+  +++ +IT+F II  T YM++GD  GY+ VLK E+    
Sbjct  96   GVSNGNEIQVWDLENRRISSSLQWESNITAFSIIYDTHYMFVGDEYGYLSVLKYEEGIME  155

Query  362  VVKMKYHIP---FSESHGNSNKDGDNAIVEILPQPTAESKRVLIIYRDGLIILWAVQESK  532
            +  + YH+P    +E+   S  D   AIV +LPQP++   RVLI Y +GLI+LW + E +
Sbjct  156  L--LPYHMPPNLIAEAANISMPD-QLAIVGLLPQPSSHGNRVLIAYENGLIVLWDITEDR  212



>ref|XP_002272182.1| PREDICTED: uncharacterized protein LOC100250143 isoform X1 [Vitis 
vinifera]
Length=1108

 Score =   144 bits (364),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 82/233 (35%), Positives = 129/233 (55%), Gaps = 26/233 (11%)
 Frame = +2

Query  2    GVPPGALLLAYDSIQKILAISTKDGRIKVFGKDGAQALLESPNIVPSKFMQFMENQGFLI  181
            G+P  A +LA D IQ +LA+ T DGRIKV G D  + LL SP  +P K ++F+ NQGFL+
Sbjct  37   GIPSTASILAVDPIQGLLAVGTLDGRIKVIGGDNIECLLISPKQLPFKNLEFLRNQGFLV  96

Query  182  KINVDNHIEVWNVDQKSLSNIHEFKRDITSFKIIQHTPYMYIGDSLGYVWVLKLEKEPCN  361
             ++ +N ++VW+++ + L++  +++ +IT+F +I  T YMY+GD  G ++VLK + +   
Sbjct  97   SVSNENEVQVWDLECRHLASNLQWESNITAFSVIYGTQYMYVGDEHGSLFVLKYDHQEGK  156

Query  362  VVKMKYHIP---FSESHGNSNKDGDNAIVEILPQPTAESKRVLIIYRDGLIILWAVQESK  532
            ++   YHIP    +E  G S     ++IV +LPQP +   R+LI Y +GL+I+W   +  
Sbjct  157  LLHQPYHIPANAVAEVAGISVPI-HHSIVGVLPQPCSHGNRMLIAYENGLLIVWDAFQDS  215

Query  533  TIFTTGGNALQSVN-----------HEAXKATAA-----------CWACPNGT  625
             +   G   LQ  N           HE    T+            CWA  NG+
Sbjct  216  VVCVRGYKDLQVKNKTVVNSPNDMRHELSNDTSENIPMEKDISSLCWASANGS  268



>emb|CBI25466.3| unnamed protein product [Vitis vinifera]
Length=1137

 Score =   144 bits (364),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 82/233 (35%), Positives = 129/233 (55%), Gaps = 26/233 (11%)
 Frame = +2

Query  2    GVPPGALLLAYDSIQKILAISTKDGRIKVFGKDGAQALLESPNIVPSKFMQFMENQGFLI  181
            G+P  A +LA D IQ +LA+ T DGRIKV G D  + LL SP  +P K ++F+ NQGFL+
Sbjct  37   GIPSTASILAVDPIQGLLAVGTLDGRIKVIGGDNIECLLISPKQLPFKNLEFLRNQGFLV  96

Query  182  KINVDNHIEVWNVDQKSLSNIHEFKRDITSFKIIQHTPYMYIGDSLGYVWVLKLEKEPCN  361
             ++ +N ++VW+++ + L++  +++ +IT+F +I  T YMY+GD  G ++VLK + +   
Sbjct  97   SVSNENEVQVWDLECRHLASNLQWESNITAFSVIYGTQYMYVGDEHGSLFVLKYDHQEGK  156

Query  362  VVKMKYHIP---FSESHGNSNKDGDNAIVEILPQPTAESKRVLIIYRDGLIILWAVQESK  532
            ++   YHIP    +E  G S     ++IV +LPQP +   R+LI Y +GL+I+W   +  
Sbjct  157  LLHQPYHIPANAVAEVAGISVPI-HHSIVGVLPQPCSHGNRMLIAYENGLLIVWDAFQDS  215

Query  533  TIFTTGGNALQSVN-----------HEAXKATAA-----------CWACPNGT  625
             +   G   LQ  N           HE    T+            CWA  NG+
Sbjct  216  VVCVRGYKDLQVKNKTVVNSPNDMRHELSNDTSENIPMEKDISSLCWASANGS  268



>ref|XP_009125607.1| PREDICTED: uncharacterized protein LOC103850590 isoform X2 [Brassica 
rapa]
Length=1096

 Score =   144 bits (364),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 78/230 (34%), Positives = 134/230 (58%), Gaps = 24/230 (10%)
 Frame = +2

Query  2    GVPPGALLLAYDSIQKILAISTKDGRIKVFGKDGAQALLESPNIVPSKFMQFMENQGFLI  181
            G+P  A +LA+DSIQ +LA+ T DGRIKV G D  +A+L SP  +P K ++F+ENQGFL+
Sbjct  44   GIPSTASILAFDSIQSLLAVGTLDGRIKVIGGDNIEAVLASPKQLPFKNLEFIENQGFLV  103

Query  182  KINVDNHIEVWNVD-QKSLSNIHEFKRDITSFKIIQHTPYMYIGDSLGYVWVLKLEKEPC  358
             I+ +N I+VW++D ++++S++H ++ +IT+F I+  T YMY+GD  G V V+K   +  
Sbjct  104  SISNENDIQVWDLDLRQTVSSLH-WESNITAFSILPGTGYMYVGDEYGTVSVVKYNADEG  162

Query  359  NVVKMKYHIP---FSESHGNSNKDGDNAIVEILPQPTAESKRVLIIYRDGLIILWAVQES  529
             +V + Y++P    +E+ G S+   +  +V +L QP +   R+LI + +GL+ +W   E 
Sbjct  163  KLVHLPYYVPTDALAEAAGLSSPI-EYPVVGLLSQPCSRGTRLLIAFSNGLLFIWDASED  221

Query  530  KTIFTTGG------------------NALQSVNHEAXKATAACWACPNGT  625
            +     G                   + L  +  +  + ++ CWA  +G+
Sbjct  222  RVELVRGNKDLPMEGKTVDVSLEASHDELSDLKLDGKEISSLCWASADGS  271



>ref|XP_008465213.1| PREDICTED: lethal(2) giant larvae protein homolog SRO77 isoform 
X1 [Cucumis melo]
Length=1108

 Score =   144 bits (364),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 72/191 (38%), Positives = 114/191 (60%), Gaps = 4/191 (2%)
 Frame = +2

Query  2    GVPPGALLLAYDSIQKILAISTKDGRIKVFGKDGAQALLESPNIVPSKFMQFMENQGFLI  181
            G+PP A +LAYD IQ +LA+ T DGRIKV G D  +A+   P  +P K ++F+ NQGFL+
Sbjct  43   GIPPTASILAYDPIQSLLAVGTLDGRIKVLGGDTIEAIFTCPKSLPFKNLEFLHNQGFLV  102

Query  182  KINVDNHIEVWNVDQKSLSNIHEFKRDITSFKIIQHTPYMYIGDSLGYVWVLKLEKEPCN  361
             I+ DN I+VW+++ + L +  +++ +IT+F ++  T YMY+G     V VLK + E   
Sbjct  103  SISNDNEIQVWDLEHRQLVSTLQWESNITAFSVLFGTCYMYVGSEYAMVAVLKFDAEERK  162

Query  362  VVKMKYHIP---FSESHGNSNKDGDNAIVEILPQPTAESKRVLIIYRDGLIILWAVQESK  532
            + ++ Y++     SE  G    D   ++V +L QP +   RVLI Y +GL++LW   E +
Sbjct  163  IKQLPYYLTANVISEVIGVELPD-QTSVVGVLLQPCSLGNRVLIAYENGLLVLWDASEDR  221

Query  533  TIFTTGGNALQ  565
             +   G   L+
Sbjct  222  AVIVRGHKDLE  232



>ref|XP_006338828.1| PREDICTED: uncharacterized protein LOC102596591 isoform X1 [Solanum 
tuberosum]
Length=1089

 Score =   144 bits (364),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 75/180 (42%), Positives = 117/180 (65%), Gaps = 6/180 (3%)
 Frame = +2

Query  2    GVPPGALLLAYDSIQKILAISTKDGRIKVFGKDGAQALLESPNIVPSKFMQFMENQGFLI  181
            G+P  A +LA+D IQ++LAI T DGRIKV G    + LL SP  +  K ++F++NQGFL+
Sbjct  36   GIPSTASILAFDPIQQLLAIGTLDGRIKVIGGSNVEGLLFSPKPLAFKNLEFLQNQGFLV  95

Query  182  KINVDNHIEVWNVDQKSLSNIHEFKRDITSFKIIQHTPYMYIGDSLGYVWVLKLEKEPCN  361
             ++  N I+VW+++ + +S+  +++ +IT+F II  T YM++GD  GY+ VLK E+    
Sbjct  96   GVSNGNEIQVWDLENRRISSSLQWESNITAFSIIYDTHYMFVGDEYGYLSVLKYEEGIME  155

Query  362  VVKMKYHIP---FSESHGNSNKDGDNAIVEILPQPTAESKRVLIIYRDGLIILWAVQESK  532
            +  + YH+P    +E+   S  D   AIV +LPQP++   RVLI Y +GLI+LW + E +
Sbjct  156  L--LPYHMPPNLIAEAANISMPD-QLAIVGLLPQPSSHGNRVLIAYENGLIVLWDITEDR  212



>ref|XP_004491029.1| PREDICTED: lethal(2) giant larvae protein homolog SRO77-like 
isoform X1 [Cicer arietinum]
Length=1110

 Score =   144 bits (363),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 73/206 (35%), Positives = 123/206 (60%), Gaps = 10/206 (5%)
 Frame = +2

Query  2    GVPPGALLLAYDSIQKILAISTKDGRIKVFGKDGAQALLESPNIVPSKFMQFMENQGFLI  181
            GVP  A +LA+D +Q++LA+ T DGRIKVFG D  + ++ SP     K ++F+ENQGFL 
Sbjct  43   GVPSTATILAFDRVQRLLAVGTLDGRIKVFGGDNIEGIMISPKQTSFKNLEFLENQGFLA  102

Query  182  KINVDNHIEVWNVDQKSLSNIHEFKRDITSFKIIQHTPYMYIGDSLGYVWVLKLEKEPCN  361
             ++ DN ++VW++  + +++  +++  ITSF II  T YM +G   G V++LK + +   
Sbjct  103  SVSSDNEVQVWDLRNRQIASALQWESIITSFSIIFGTSYMLVGTEHGLVYLLKFDSQDRK  162

Query  362  VVKMKYHIP---FSESHGNSNKDGDNAIVEILPQPTAESKRVLIIYRDGLIILWAVQESK  532
            V  + Y++P    SE+ G S      ++V +L QP ++ KR+L+ Y +G+++LW   E +
Sbjct  163  VKILPYYVPTNVISEAVGMSLDHV--SVVRVLLQPCSDGKRLLVAYENGMMVLWDASEDR  220

Query  533  TIFTTGGNALQSVNHEAXKATAACWA  610
             + T G      +N E      AC++
Sbjct  221  IVLTRG-----HMNIELKTKKVACYS  241



>ref|XP_004958799.1| PREDICTED: uncharacterized protein LOC101753058 [Setaria italica]
Length=1107

 Score =   144 bits (363),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 77/186 (41%), Positives = 115/186 (62%), Gaps = 4/186 (2%)
 Frame = +2

Query  2    GVPPGALLLAYDSIQKILAISTKDGRIKVFGKDGAQALLESPNIVPSKFMQFMENQGFLI  181
            GVP  A LLA+D +Q++LA+ T DGRIK+FG D  + LL SP  VP KF+QF+ NQG L+
Sbjct  34   GVPYTASLLAFDPVQRLLAVGTLDGRIKIFGGDSIEGLLISPKSVPYKFLQFIINQGLLV  93

Query  182  KINVDNHIEVWNVDQKSLSNIHEFKRDITSFKIIQHTPYMYIGDSLGYVWVLKLEKEPCN  361
             I+ +N I+VWN++ + L    ++  +IT+F +I+ +  MY+GD  G + VLK E +   
Sbjct  94   AISNENEIQVWNLEFRQLFCSSQWDVNITAFAVIEGSFLMYLGDENGLLSVLKYEVDDGK  153

Query  362  VVKMKYHIP---FSESHGNSNKDGDNAIVEILPQPTAESKRVLIIYRDGLIILWAVQESK  532
            + +M Y++P    +E+ G   +D    IV IL QP     RVLI Y  GL++LW V ++ 
Sbjct  154  LQRMPYNVPIQSLAETAGVCLQD-PQPIVGILIQPETFGTRVLIAYEKGLLVLWDVSDNN  212

Query  533  TIFTTG  550
             +   G
Sbjct  213  AVSVRG  218



>ref|XP_008465214.1| PREDICTED: lethal(2) giant larvae protein homolog SRO77 isoform 
X2 [Cucumis melo]
Length=1098

 Score =   144 bits (363),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 72/191 (38%), Positives = 114/191 (60%), Gaps = 4/191 (2%)
 Frame = +2

Query  2    GVPPGALLLAYDSIQKILAISTKDGRIKVFGKDGAQALLESPNIVPSKFMQFMENQGFLI  181
            G+PP A +LAYD IQ +LA+ T DGRIKV G D  +A+   P  +P K ++F+ NQGFL+
Sbjct  43   GIPPTASILAYDPIQSLLAVGTLDGRIKVLGGDTIEAIFTCPKSLPFKNLEFLHNQGFLV  102

Query  182  KINVDNHIEVWNVDQKSLSNIHEFKRDITSFKIIQHTPYMYIGDSLGYVWVLKLEKEPCN  361
             I+ DN I+VW+++ + L +  +++ +IT+F ++  T YMY+G     V VLK + E   
Sbjct  103  SISNDNEIQVWDLEHRQLVSTLQWESNITAFSVLFGTCYMYVGSEYAMVAVLKFDAEERK  162

Query  362  VVKMKYHIP---FSESHGNSNKDGDNAIVEILPQPTAESKRVLIIYRDGLIILWAVQESK  532
            + ++ Y++     SE  G    D   ++V +L QP +   RVLI Y +GL++LW   E +
Sbjct  163  IKQLPYYLTANVISEVIGVELPD-QTSVVGVLLQPCSLGNRVLIAYENGLLVLWDASEDR  221

Query  533  TIFTTGGNALQ  565
             +   G   L+
Sbjct  222  AVIVRGHKDLE  232



>ref|XP_010920834.1| PREDICTED: uncharacterized protein LOC105044594 isoform X3 [Elaeis 
guineensis]
Length=1123

 Score =   144 bits (363),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 75/189 (40%), Positives = 113/189 (60%), Gaps = 1/189 (1%)
 Frame = +2

Query  2    GVPPGALLLAYDSIQKILAISTKDGRIKVFGKDGAQALLESPNIVPSKFMQFMENQGFLI  181
            G+P  A LLA+D IQ++LAI T DGRIK+ G D  + LL SP  VP K+++F+ N  FL+
Sbjct  44   GIPYTASLLAFDPIQRLLAIGTLDGRIKIIGGDNIEGLLISPKKVPYKYLEFLYNHEFLV  103

Query  182  KINVDNHIEVWNVDQKSLSNIHEFKRDITSFKIIQHTPYMYIGDSLGYVWVLKLEKEPCN  361
             ++ +N I+VWN++ + L    +++ ++T+F ++Q T  MYIGD  G   VLK   E   
Sbjct  104  GVSNENEIQVWNLEFRQLVYCLQWEANMTAFAVVQGTYLMYIGDESGLFSVLKYNDEDGK  163

Query  362  VVKMKYHIPFS-ESHGNSNKDGDNAIVEILPQPTAESKRVLIIYRDGLIILWAVQESKTI  538
            ++K+ YHIP +  +    +      I+ ILPQ      RVLI Y +GL+ILW + E + +
Sbjct  164  LLKLPYHIPANVVTAAGISFLSPQPIIGILPQTCTSGTRVLIAYENGLLILWDISEGQVV  223

Query  539  FTTGGNALQ  565
               G   LQ
Sbjct  224  TVRGYTDLQ  232



>ref|XP_007220439.1| hypothetical protein PRUPE_ppa000521mg [Prunus persica]
 gb|EMJ21638.1| hypothetical protein PRUPE_ppa000521mg [Prunus persica]
Length=1115

 Score =   144 bits (362),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 82/233 (35%), Positives = 126/233 (54%), Gaps = 26/233 (11%)
 Frame = +2

Query  2    GVPPGALLLAYDSIQKILAISTKDGRIKVFGKDGAQALLESPNIVPSKFMQFMENQGFLI  181
            G+P  A +LA D  Q +LAI T DGRIKV G D  Q LL SP  +P K ++F++NQGFL 
Sbjct  35   GIPSTASILALDRTQSLLAIGTLDGRIKVIGGDNIQELLTSPKPLPFKNLEFLQNQGFLA  94

Query  182  KINVDNHIEVWNVDQKSLSNIHEFKRDITSFKIIQHTPYMYIGDSLGYVWVLKLEKEPCN  361
             ++ +N I+VW+++Q+ +++  +++ +IT+F +I  T YMYIG     V VLK + E   
Sbjct  95   SVSSENEIQVWDLEQRRIASSLQWECNITAFSVIYGTNYMYIGSEYAIVSVLKYDVEDGK  154

Query  362  VVKMKYHIP---FSESHGNSNKDGDNAIVEILPQPTAESKRVLIIYRDGLIILWAVQESK  532
            +  + Y+I     +E+ G S  D   ++V +L QP +   R+L+ Y +GLIILW   E +
Sbjct  155  IKLLPYYITANFIAEAAGMSLPD-HLSVVGVLHQPNSLGNRLLVAYENGLIILWDASEDR  213

Query  533  TIFTTGG------------------NALQSVNHEAXKA----TAACWACPNGT  625
             +   G                   N L     E+ +     +A CWA  NG+
Sbjct  214  VVLVRGSKDLKVKEKTVTSSPKDTRNELSDATEESKQVEKEISALCWASDNGS  266



>emb|CDP06470.1| unnamed protein product [Coffea canephora]
Length=723

 Score =   142 bits (358),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 84/230 (37%), Positives = 125/230 (54%), Gaps = 26/230 (11%)
 Frame = +2

Query  2    GVPPGALLLAYDSIQKILAISTKDGRIKVFGKDGAQALLESPNIVPSKFMQFMENQGFLI  181
            G+P  A +LA+D IQ +LA+ T DGRIK+ G D  + LL SP     K+++F+ N+G LI
Sbjct  43   GIPSTASILAFDPIQNLLAVGTLDGRIKLIGGDNIEGLLISPEQHAYKYLEFIHNEGSLI  102

Query  182  KINVDNHIEVWNVDQKSLSNIHEFKRDITSFKIIQHTPYMYIGDSLGYVWVLKLEKEPCN  361
             I +DN I+VWN+  + L+    ++ +IT+F II  +  MY+GD  G + V+K + E   
Sbjct  103  SITIDNSIQVWNLKSRCLACSLCWESNITAFSIISSSNLMYVGDEYGVISVVKYDAENAE  162

Query  362  VVKMKYHIPFSESHGNSNKDGDNAIVEILPQPTAESKR---VLIIYRDGLIILWAVQESK  532
            ++ + YHIP   S G S       +V +LPQP +   R   VLI Y+ GLIILW V E++
Sbjct  163  LLHLPYHIP---SVGFS-VPFHQPVVGVLPQPCSSGTRQDLVLIAYQSGLIILWDVLEAQ  218

Query  533  TIFTTGGNAL-----------------QSVNHEAXKA--TAACWACPNGT  625
             +   G   L                 +  +HE  +   TA CWA  +G+
Sbjct  219  IVIVRGNKVLWLKNEVGNPSNGDLGLPRDASHELEEKEITALCWASCDGS  268



>gb|EMT18415.1| hypothetical protein F775_52555 [Aegilops tauschii]
Length=1048

 Score =   143 bits (361),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 81/231 (35%), Positives = 123/231 (53%), Gaps = 24/231 (10%)
 Frame = +2

Query  2    GVPPGALLLAYDSIQKILAISTKDGRIKVFGKDGAQALLESPNIVPSKFMQFMENQGFLI  181
            GVP  A ++A+D +Q++LA+ T DGRIK+FG D  + +L SP  +P K++QF++NQG LI
Sbjct  44   GVPYAASVMAFDPVQRLLAVGTLDGRIKIFGGDNIEGILISPKSMPYKYLQFIQNQGLLI  103

Query  182  KINVDNHIEVWNVDQKSLSNIHEFKRDITSFKIIQHTPYMYIGDSLGYVWVLKLEKEPCN  361
             ++ +N I+VWN++ + L +  ++  +IT+F +I+ T  MY+GD  G + VLK +     
Sbjct  104  AVSNENEIQVWNLEFRQLFHSSQWDTNITAFSVIEGTFLMYLGDENGLLSVLKYDLYDGK  163

Query  362  VVKMKYHI---PFSESHGNSNKDGDNAIVEILPQPTAESKRVLIIYRDGLIILWAVQESK  532
            + KM Y++     +E+ G    D    IV ILPQP     RVLI Y  G ++LW V E  
Sbjct  164  LQKMPYNVSIHSLAEAAGVPLLD-TQPIVGILPQPNTLGTRVLIAYEKGFLVLWDVSEDH  222

Query  533  TIFTTGGNALQ--------------------SVNHEAXKATAACWACPNGT  625
             I   G   L                       N E  +  + CWA   G+
Sbjct  223  AIAVRGYGDLHMKGQVTGAQTHASEDQIDNVDENEEEREICSLCWASRGGS  273



>ref|XP_010676760.1| PREDICTED: uncharacterized protein LOC104892503 isoform X3 [Beta 
vulgaris subsp. vulgaris]
Length=1104

 Score =   143 bits (361),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 80/195 (41%), Positives = 118/195 (61%), Gaps = 4/195 (2%)
 Frame = +2

Query  2    GVPPGALLLAYDSIQKILAISTKDGRIKVFGKDGAQALLESPNIVPSKFMQFMENQGFLI  181
            GVP  A +LA D IQ++LAI T DGRIKV G    +ALL SP  +P K ++FM+NQG+L+
Sbjct  41   GVPNTASILAIDPIQQLLAIGTLDGRIKVIGGYNIEALLISPKQMPYKNLEFMQNQGYLV  100

Query  182  KINVDNHIEVWNVDQKSLSNIHEFKRDITSFKIIQHTPYMYIGDSLGYVWVLKLEKEPCN  361
             +  DN I+VWN++ + ++   +++ +IT+F +I  + +M++GD  G V  LK   E   
Sbjct  101  GVFNDNEIQVWNLESRCITCSLQWESNITAFSVISGSAFMFVGDEHGIVSALKYGAEDKT  160

Query  362  VVKMKYHIP---FSESHGNSNKDGDNAIVEILPQPTAESKRVLIIYRDGLIILWAVQESK  532
            +V+M YHI      E  G S  + D  +V +LPQP+    R+LI Y+ GL +LW V ES+
Sbjct  161  LVQMPYHISPDYILEKTGISLSN-DQPVVGVLPQPSFFGNRLLIAYQYGLFVLWDVLESE  219

Query  533  TIFTTGGNALQSVNH  577
             I   G   L   +H
Sbjct  220  VIVIKGDKDLVIKDH  234



>ref|XP_010676759.1| PREDICTED: uncharacterized protein LOC104892503 isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=1104

 Score =   143 bits (361),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 80/195 (41%), Positives = 118/195 (61%), Gaps = 4/195 (2%)
 Frame = +2

Query  2    GVPPGALLLAYDSIQKILAISTKDGRIKVFGKDGAQALLESPNIVPSKFMQFMENQGFLI  181
            GVP  A +LA D IQ++LAI T DGRIKV G    +ALL SP  +P K ++FM+NQG+L+
Sbjct  40   GVPNTASILAIDPIQQLLAIGTLDGRIKVIGGYNIEALLISPKQMPYKNLEFMQNQGYLV  99

Query  182  KINVDNHIEVWNVDQKSLSNIHEFKRDITSFKIIQHTPYMYIGDSLGYVWVLKLEKEPCN  361
             +  DN I+VWN++ + ++   +++ +IT+F +I  + +M++GD  G V  LK   E   
Sbjct  100  GVFNDNEIQVWNLESRCITCSLQWESNITAFSVISGSAFMFVGDEHGIVSALKYGAEDKT  159

Query  362  VVKMKYHIP---FSESHGNSNKDGDNAIVEILPQPTAESKRVLIIYRDGLIILWAVQESK  532
            +V+M YHI      E  G S  + D  +V +LPQP+    R+LI Y+ GL +LW V ES+
Sbjct  160  LVQMPYHISPDYILEKTGISLSN-DQPVVGVLPQPSFFGNRLLIAYQYGLFVLWDVLESE  218

Query  533  TIFTTGGNALQSVNH  577
             I   G   L   +H
Sbjct  219  VIVIKGDKDLVIKDH  233



>ref|XP_010676758.1| PREDICTED: uncharacterized protein LOC104892503 isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=1105

 Score =   143 bits (361),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 80/195 (41%), Positives = 118/195 (61%), Gaps = 4/195 (2%)
 Frame = +2

Query  2    GVPPGALLLAYDSIQKILAISTKDGRIKVFGKDGAQALLESPNIVPSKFMQFMENQGFLI  181
            GVP  A +LA D IQ++LAI T DGRIKV G    +ALL SP  +P K ++FM+NQG+L+
Sbjct  41   GVPNTASILAIDPIQQLLAIGTLDGRIKVIGGYNIEALLISPKQMPYKNLEFMQNQGYLV  100

Query  182  KINVDNHIEVWNVDQKSLSNIHEFKRDITSFKIIQHTPYMYIGDSLGYVWVLKLEKEPCN  361
             +  DN I+VWN++ + ++   +++ +IT+F +I  + +M++GD  G V  LK   E   
Sbjct  101  GVFNDNEIQVWNLESRCITCSLQWESNITAFSVISGSAFMFVGDEHGIVSALKYGAEDKT  160

Query  362  VVKMKYHIP---FSESHGNSNKDGDNAIVEILPQPTAESKRVLIIYRDGLIILWAVQESK  532
            +V+M YHI      E  G S  + D  +V +LPQP+    R+LI Y+ GL +LW V ES+
Sbjct  161  LVQMPYHISPDYILEKTGISLSN-DQPVVGVLPQPSFFGNRLLIAYQYGLFVLWDVLESE  219

Query  533  TIFTTGGNALQSVNH  577
             I   G   L   +H
Sbjct  220  VIVIKGDKDLVIKDH  234



>ref|XP_006575540.1| PREDICTED: uncharacterized protein LOC100777534 isoform X1 [Glycine 
max]
Length=1106

 Score =   143 bits (360),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 73/186 (39%), Positives = 114/186 (61%), Gaps = 5/186 (3%)
 Frame = +2

Query  2    GVPPGALLLAYDSIQKILAISTKDGRIKVFGKDGAQALLESPNIVPSKFMQFMENQGFLI  181
            GVP  A +LA+D IQ++LA+ T DGR+KVFG D  +  L SP     K ++F+ENQGFL 
Sbjct  39   GVPSNASILAFDHIQRLLAVGTLDGRMKVFGGDNIEGTLISPKQAFFKNLEFLENQGFLA  98

Query  182  KINVDNHIEVWNVDQKSLSNIHEFKRDITSFKIIQHTPYMYIGDSLGYVWVLKLEKEPCN  361
             ++ DN I+VW++  K +++  +++  IT+F +I  T YMYIG   G V+VL  + E   
Sbjct  99   SVSSDNEIQVWDLKSKQIASALQWESIITAFSVIYGTSYMYIGTEHGMVYVLMFDSEDRK  158

Query  362  VVKMKYHIP---FSESHGNSNKDGDNAIVEILPQPTAESKRVLIIYRDGLIILWAVQESK  532
            +  + Y++P    SE+ G S      ++V +L QP++  KR+LI Y +GL++LW   E +
Sbjct  159  IKILPYYVPTNVISEAVGMSLDHV--SVVRVLHQPSSNGKRLLIAYENGLMVLWDASEDR  216

Query  533  TIFTTG  550
             +   G
Sbjct  217  IVLIRG  222



>gb|KDP43769.1| hypothetical protein JCGZ_22396 [Jatropha curcas]
Length=854

 Score =   142 bits (357),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 61/110 (55%), Positives = 85/110 (77%), Gaps = 1/110 (1%)
 Frame = +2

Query  302  YIGDSLGYVWVLKLEKEPCNVVKMKYHIPFSESHGNS-NKDGDNAIVEILPQPTAESKRV  478
            Y+GD +G + +LKL++E C +++MKY IP S SHGNS     D A++ I+PQP AESKRV
Sbjct  60   YVGDHVGNISILKLDEETCRILQMKYTIPLSASHGNSIEASADAAVLHIIPQPMAESKRV  119

Query  479  LIIYRDGLIILWAVQESKTIFTTGGNALQSVNHEAXKATAACWACPNGTK  628
            LI++RDGLI LW ++ES++IFTTGG+ L S +++  K T+ACWACP G+K
Sbjct  120  LIVFRDGLITLWDIRESRSIFTTGGSLLHSQHNDTKKVTSACWACPFGSK  169



>ref|XP_008653533.1| PREDICTED: uncharacterized protein LOC103633604 isoform X1 [Zea 
mays]
Length=1128

 Score =   142 bits (359),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 79/192 (41%), Positives = 116/192 (60%), Gaps = 10/192 (5%)
 Frame = +2

Query  2    GVPPGALLLAYDSIQKILAISTKDGRIKVFGKDGAQALLESPNIVPSKFMQFMENQGFLI  181
            GVP  A LLA+D +Q++LA++T DGRIK+FG D  + LL SP  VP KF+QF+ NQG L+
Sbjct  48   GVPYTASLLAFDPVQRLLAVATLDGRIKIFGGDNIEGLLISPKSVPYKFLQFITNQGLLV  107

Query  182  KINVDNHIEVWNVDQKSLSNIHEFKRDITSFKIIQHTPYMYIGDSLGYVWVLKLEKEPCN  361
             I+ +N I+VWN++ + L    ++  +IT+F +I+ T  MY+GD  G + VLK + +   
Sbjct  108  AISNENEIQVWNLEFRQLFYSSQWDVNITAFAVIERTFMMYLGDENGLLSVLKYDVDDGK  167

Query  362  VVKMKYH-------IPF--SESHGNSNKDGDNAIVEILPQPTAESKRVLIIYRDGLIILW  514
            +  M Y+       +PF  +E  G S +D    IV IL QP     R+LI Y  GL++LW
Sbjct  168  LQIMPYNVHIHSLIVPFFSTERSGVSLQD-PQPIVGILIQPDTFGTRLLIAYERGLLVLW  226

Query  515  AVQESKTIFTTG  550
             V E + +   G
Sbjct  227  DVSEDRAVSVRG  238



>ref|XP_008653535.1| PREDICTED: uncharacterized protein LOC103633604 isoform X2 [Zea 
mays]
Length=1126

 Score =   142 bits (359),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 79/192 (41%), Positives = 116/192 (60%), Gaps = 10/192 (5%)
 Frame = +2

Query  2    GVPPGALLLAYDSIQKILAISTKDGRIKVFGKDGAQALLESPNIVPSKFMQFMENQGFLI  181
            GVP  A LLA+D +Q++LA++T DGRIK+FG D  + LL SP  VP KF+QF+ NQG L+
Sbjct  48   GVPYTASLLAFDPVQRLLAVATLDGRIKIFGGDNIEGLLISPKSVPYKFLQFITNQGLLV  107

Query  182  KINVDNHIEVWNVDQKSLSNIHEFKRDITSFKIIQHTPYMYIGDSLGYVWVLKLEKEPCN  361
             I+ +N I+VWN++ + L    ++  +IT+F +I+ T  MY+GD  G + VLK + +   
Sbjct  108  AISNENEIQVWNLEFRQLFYSSQWDVNITAFAVIERTFMMYLGDENGLLSVLKYDVDDGK  167

Query  362  VVKMKYH-------IPF--SESHGNSNKDGDNAIVEILPQPTAESKRVLIIYRDGLIILW  514
            +  M Y+       +PF  +E  G S +D    IV IL QP     R+LI Y  GL++LW
Sbjct  168  LQIMPYNVHIHSLIVPFFSTERSGVSLQD-PQPIVGILIQPDTFGTRLLIAYERGLLVLW  226

Query  515  AVQESKTIFTTG  550
             V E + +   G
Sbjct  227  DVSEDRAVSVRG  238



>tpg|DAA64252.1| TPA: hypothetical protein ZEAMMB73_724610 [Zea mays]
Length=1060

 Score =   142 bits (357),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 77/186 (41%), Positives = 113/186 (61%), Gaps = 4/186 (2%)
 Frame = +2

Query  2    GVPPGALLLAYDSIQKILAISTKDGRIKVFGKDGAQALLESPNIVPSKFMQFMENQGFLI  181
            GVP  A LLA+D +Q++LA++T DGRIK+FG D  + LL SP  VP KF+QF+ NQG L+
Sbjct  10   GVPYTASLLAFDPVQRLLAVATLDGRIKIFGGDNIEGLLISPKSVPYKFLQFITNQGLLV  69

Query  182  KINVDNHIEVWNVDQKSLSNIHEFKRDITSFKIIQHTPYMYIGDSLGYVWVLKLEKEPCN  361
             I+ +N I+VWN++ + L    ++  +IT+F +I+ T  MY+GD  G + VLK + +   
Sbjct  70   AISNENEIQVWNLEFRQLFYSSQWDVNITAFAVIERTFMMYLGDENGLLSVLKYDVDDGK  129

Query  362  VVKMKYHI---PFSESHGNSNKDGDNAIVEILPQPTAESKRVLIIYRDGLIILWAVQESK  532
            +  M Y++      E  G S +D    IV IL QP     R+LI Y  GL++LW V E +
Sbjct  130  LQIMPYNVHIHSLIERSGVSLQD-PQPIVGILIQPDTFGTRLLIAYERGLLVLWDVSEDR  188

Query  533  TIFTTG  550
             +   G
Sbjct  189  AVSVRG  194



>ref|XP_008653536.1| PREDICTED: uncharacterized protein LOC103633604 isoform X3 [Zea 
mays]
Length=1122

 Score =   142 bits (357),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 77/186 (41%), Positives = 113/186 (61%), Gaps = 4/186 (2%)
 Frame = +2

Query  2    GVPPGALLLAYDSIQKILAISTKDGRIKVFGKDGAQALLESPNIVPSKFMQFMENQGFLI  181
            GVP  A LLA+D +Q++LA++T DGRIK+FG D  + LL SP  VP KF+QF+ NQG L+
Sbjct  48   GVPYTASLLAFDPVQRLLAVATLDGRIKIFGGDNIEGLLISPKSVPYKFLQFITNQGLLV  107

Query  182  KINVDNHIEVWNVDQKSLSNIHEFKRDITSFKIIQHTPYMYIGDSLGYVWVLKLEKEPCN  361
             I+ +N I+VWN++ + L    ++  +IT+F +I+ T  MY+GD  G + VLK + +   
Sbjct  108  AISNENEIQVWNLEFRQLFYSSQWDVNITAFAVIERTFMMYLGDENGLLSVLKYDVDDGK  167

Query  362  VVKMKYHI---PFSESHGNSNKDGDNAIVEILPQPTAESKRVLIIYRDGLIILWAVQESK  532
            +  M Y++      E  G S +D    IV IL QP     R+LI Y  GL++LW V E +
Sbjct  168  LQIMPYNVHIHSLIERSGVSLQD-PQPIVGILIQPDTFGTRLLIAYERGLLVLWDVSEDR  226

Query  533  TIFTTG  550
             +   G
Sbjct  227  AVSVRG  232



>ref|XP_011654993.1| PREDICTED: uncharacterized protein LOC101208658 isoform X1 [Cucumis 
sativus]
 gb|KGN50668.1| hypothetical protein Csa_5G208460 [Cucumis sativus]
Length=1107

 Score =   141 bits (355),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 69/191 (36%), Positives = 114/191 (60%), Gaps = 4/191 (2%)
 Frame = +2

Query  2    GVPPGALLLAYDSIQKILAISTKDGRIKVFGKDGAQALLESPNIVPSKFMQFMENQGFLI  181
            G+PP A +LAYD +Q +LA+ T DGRIKV G D  +A+   P  +P K ++F+ NQGFL+
Sbjct  43   GIPPTASILAYDPMQSLLAVGTLDGRIKVLGGDNIEAIFTCPKSLPFKNLEFLHNQGFLV  102

Query  182  KINVDNHIEVWNVDQKSLSNIHEFKRDITSFKIIQHTPYMYIGDSLGYVWVLKLEKEPCN  361
             I+ DN I+VW+++ + L +  +++ +IT+F ++  T YMY+G     V VLK + E   
Sbjct  103  SISNDNEIQVWDLEHRQLVSTLQWESNITAFSVLFGTCYMYVGSEYAMVAVLKFDAEERK  162

Query  362  VVKMKYHIP---FSESHGNSNKDGDNAIVEILPQPTAESKRVLIIYRDGLIILWAVQESK  532
            + ++ Y++     S+  G    D   ++V +L QP +   R+LI Y +GL++LW   E +
Sbjct  163  IKQLPYYLTANVISDVIGVELPD-QTSVVGVLLQPCSLGNRLLIAYENGLLVLWDASEDR  221

Query  533  TIFTTGGNALQ  565
             +   G   L+
Sbjct  222  AVIVRGHKDLE  232



>ref|XP_011654994.1| PREDICTED: uncharacterized protein LOC101208658 isoform X2 [Cucumis 
sativus]
Length=1099

 Score =   141 bits (355),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 69/191 (36%), Positives = 114/191 (60%), Gaps = 4/191 (2%)
 Frame = +2

Query  2    GVPPGALLLAYDSIQKILAISTKDGRIKVFGKDGAQALLESPNIVPSKFMQFMENQGFLI  181
            G+PP A +LAYD +Q +LA+ T DGRIKV G D  +A+   P  +P K ++F+ NQGFL+
Sbjct  43   GIPPTASILAYDPMQSLLAVGTLDGRIKVLGGDNIEAIFTCPKSLPFKNLEFLHNQGFLV  102

Query  182  KINVDNHIEVWNVDQKSLSNIHEFKRDITSFKIIQHTPYMYIGDSLGYVWVLKLEKEPCN  361
             I+ DN I+VW+++ + L +  +++ +IT+F ++  T YMY+G     V VLK + E   
Sbjct  103  SISNDNEIQVWDLEHRQLVSTLQWESNITAFSVLFGTCYMYVGSEYAMVAVLKFDAEERK  162

Query  362  VVKMKYHIP---FSESHGNSNKDGDNAIVEILPQPTAESKRVLIIYRDGLIILWAVQESK  532
            + ++ Y++     S+  G    D   ++V +L QP +   R+LI Y +GL++LW   E +
Sbjct  163  IKQLPYYLTANVISDVIGVELPD-QTSVVGVLLQPCSLGNRLLIAYENGLLVLWDASEDR  221

Query  533  TIFTTGGNALQ  565
             +   G   L+
Sbjct  222  AVIVRGHKDLE  232



>ref|XP_008233769.1| PREDICTED: lethal(2) giant larvae protein homolog SRO77-like 
isoform X1 [Prunus mume]
Length=1118

 Score =   140 bits (353),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 80/233 (34%), Positives = 125/233 (54%), Gaps = 26/233 (11%)
 Frame = +2

Query  2    GVPPGALLLAYDSIQKILAISTKDGRIKVFGKDGAQALLESPNIVPSKFMQFMENQGFLI  181
            G+P  A +LA D  Q +LAI T DGRIKV G D  Q LL SP  +P K ++F++NQGFL 
Sbjct  35   GIPSTASILALDRTQSLLAIGTLDGRIKVIGGDNIQELLTSPKPLPFKNLEFLQNQGFLA  94

Query  182  KINVDNHIEVWNVDQKSLSNIHEFKRDITSFKIIQHTPYMYIGDSLGYVWVLKLEKEPCN  361
             ++ +N I+VW+++Q+ +++  +++ +IT+F +I  T YMYIG     V VLK + E   
Sbjct  95   SVSSENEIQVWDLEQRRIASSLQWECNITAFSVIYGTNYMYIGSEYAIVSVLKYDVEDGK  154

Query  362  VVKMKYHIP---FSESHGNSNKDGDNAIVEILPQPTAESKRVLIIYRDGLIILWAVQESK  532
            +  + Y+I     +E+ G S  D   ++V +L QP +   R+L+ Y +GLIILW   E +
Sbjct  155  IKLLPYYITANFIAEAAGMSLPD-HLSVVGVLHQPNSLGNRLLVAYENGLIILWDASEDQ  213

Query  533  TIFTTGG------------------NALQSVNHEAXKA----TAACWACPNGT  625
             +   G                   N L     E+ +     ++ CW   NG+
Sbjct  214  VVLVRGSKDLKVKEKTVTSSPKDTRNELSDATEESKQVEKEISSLCWVSDNGS  266



>ref|XP_008234069.1| PREDICTED: LOW QUALITY PROTEIN: lethal(2) giant larvae protein 
homolog SRO77-like [Prunus mume]
Length=934

 Score =   139 bits (351),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 79/233 (34%), Positives = 124/233 (53%), Gaps = 26/233 (11%)
 Frame = +2

Query  2    GVPPGALLLAYDSIQKILAISTKDGRIKVFGKDGAQALLESPNIVPSKFMQFMENQGFLI  181
            G+P  A +LA D  Q +LAI T DGRIKV G D  Q LL SP  +P K ++F++NQGFL 
Sbjct  35   GIPSPASILALDRTQSLLAIGTLDGRIKVIGGDNNQELLTSPKPLPFKNLEFLQNQGFLA  94

Query  182  KINVDNHIEVWNVDQKSLSNIHEFKRDITSFKIIQHTPYMYIGDSLGYVWVLKLEKEPCN  361
             ++ +N I+VW+++Q+ +++  +++ +IT+F +I  T YMYIG     V VLK + +   
Sbjct  95   SVSSENEIQVWDLEQRRIASSLQWECNITAFSVIYGTNYMYIGSECAIVSVLKYDVDDGK  154

Query  362  VVKMKYHIP---FSESHGNSNKDGDNAIVEILPQPTAESKRVLIIYRDGLIILWAVQESK  532
            +  + Y+I      E+ G S  D   ++V +L QP +   R+LI Y +GLIILW   E +
Sbjct  155  IKLLPYYITANFIDEAAGMSLPD-HLSVVGVLHQPNSLGNRLLIAYENGLIILWDASEDR  213

Query  533  TIFTTG----------------------GNALQSVNHEAXKATAACWACPNGT  625
             +   G                       +A +  N    + ++ CW   NG+
Sbjct  214  VVLVRGSKDLKVKEKTVTSSPKDTRNEVSDATEESNQVEKEISSLCWVSDNGS  266



>ref|XP_002461277.1| hypothetical protein SORBIDRAFT_02g043970 [Sorghum bicolor]
 gb|EER97798.1| hypothetical protein SORBIDRAFT_02g043970 [Sorghum bicolor]
Length=1058

 Score =   139 bits (351),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 77/194 (40%), Positives = 113/194 (58%), Gaps = 18/194 (9%)
 Frame = +2

Query  2    GVPPGALLLAYDSIQKILAISTKDGRIKVFGKDGAQALLESPNIVPSKFMQFMENQGFLI  181
            GVP  A LLA+DS+Q++LA++T DGRIK+FG D  + LL SP  VP KF+QF+ NQGFL+
Sbjct  10   GVPYTASLLAFDSVQRLLAVATLDGRIKIFGGDNIEGLLISPKSVPYKFLQFITNQGFLV  69

Query  182  KINVDNHIEVWNVDQKSLSNIHEFKRDITSFKIIQHTPYMYIGDSLGYVWVLKLEKEPCN  361
             I+ +N I+VWN++ + L    ++  +IT+F +I+ T  MY+GD  G + VLK + +   
Sbjct  70   AISNENEIQVWNLEFRQLFYSSQWDINITAFAVIEGTFMMYLGDENGLLSVLKYDVDDGK  129

Query  362  VVKMKYHI-----------PFSESHGNSNKDGDNAIVEILPQPTAESKRVLIIYRDGLII  508
            +  M Y++           PF         +    IV IL QP     R+LI Y  GL++
Sbjct  130  LQIMPYNVHIHSLIRITSTPFL-------PNDSQPIVGILIQPDTFGTRLLIAYERGLLV  182

Query  509  LWAVQESKTIFTTG  550
            LW V E + +   G
Sbjct  183  LWDVSEDRAVSVRG  196



>ref|XP_010322180.1| PREDICTED: uncharacterized protein LOC101264935 isoform X1 [Solanum 
lycopersicum]
Length=1074

 Score =   139 bits (351),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 72/180 (40%), Positives = 114/180 (63%), Gaps = 6/180 (3%)
 Frame = +2

Query  2    GVPPGALLLAYDSIQKILAISTKDGRIKVFGKDGAQALLESPNIVPSKFMQFMENQGFLI  181
            G+P  A +LA+D IQ++LAI T DGRIKV      + L  SP  +  K ++F++NQGFL+
Sbjct  36   GIPSTASILAFDPIQQLLAIGTLDGRIKVISGSNVEGLFFSPKPLAFKNLEFLQNQGFLV  95

Query  182  KINVDNHIEVWNVDQKSLSNIHEFKRDITSFKIIQHTPYMYIGDSLGYVWVLKLEKEPCN  361
             ++  N I+VW+++ + +S+  +++ +IT+F +I  T YM++GD  GY+ VLK E+    
Sbjct  96   GVSNGNEIQVWDLENRRISSSLQWESNITAFSVIYDTHYMFVGDEYGYLSVLKYEEGIME  155

Query  362  VVKMKYHIP---FSESHGNSNKDGDNAIVEILPQPTAESKRVLIIYRDGLIILWAVQESK  532
            +  + YH+P    +E+   S  D   AIV +LPQP +   RVLI Y +GLI+LW + E +
Sbjct  156  L--LPYHMPPNLIAEAANISMPD-QLAIVGLLPQPNSHGNRVLIAYENGLIVLWDITEDR  212



>gb|KCW50465.1| hypothetical protein EUGRSUZ_J00199 [Eucalyptus grandis]
Length=988

 Score =   139 bits (349),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 73/191 (38%), Positives = 117/191 (61%), Gaps = 4/191 (2%)
 Frame = +2

Query  2    GVPPGALLLAYDSIQKILAISTKDGRIKVFGKDGAQALLESPNIVPSKFMQFMENQGFLI  181
            GVP  A ++A D +Q +LAI T DGRIKV G +  +AL  S   +P K ++F++NQGFL+
Sbjct  74   GVPSTASIMALDPVQSLLAIGTLDGRIKVIGCENIEALFVSAKQMPFKHLEFLQNQGFLV  133

Query  182  KINVDNHIEVWNVDQKSLSNIHEFKRDITSFKIIQHTPYMYIGDSLGYVWVLKLEKEPCN  361
             I+ DN I+VW++  ++++   +++ +IT+F +IQ T  MYIGD  G V+VLK +     
Sbjct  134  CISTDNDIQVWDMKYRNVACTFQWESNITAFSVIQGTGCMYIGDENGMVFVLKCDTGQRQ  193

Query  362  VVKMKYHIP---FSESHGNSNKDGDNAIVEILPQPTAESKRVLIIYRDGLIILWAVQESK  532
            +V++ Y IP    +E+   S      ++V +L QP +   R+LI Y +GLI+LW +  ++
Sbjct  194  IVQLPYLIPADSVAEAAAISVPH-HQSVVGVLTQPGSLGNRLLIAYGNGLIVLWDISANQ  252

Query  533  TIFTTGGNALQ  565
             +   G   LQ
Sbjct  253  VVLARGQKDLQ  263



>ref|XP_007141757.1| hypothetical protein PHAVU_008G223200g [Phaseolus vulgaris]
 gb|ESW13751.1| hypothetical protein PHAVU_008G223200g [Phaseolus vulgaris]
Length=1133

 Score =   139 bits (349),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 71/183 (39%), Positives = 111/183 (61%), Gaps = 5/183 (3%)
 Frame = +2

Query  2    GVPPGALLLAYDSIQKILAISTKDGRIKVFGKDGAQALLESPNIVPSKFMQFMENQGFLI  181
            GVP  A +LA+D IQ +LAI T DGRIKVFG D  + +L SP     K ++F+ENQGFL 
Sbjct  39   GVPSTASILAFDHIQNLLAIGTLDGRIKVFGGDNIEGILISPKQASFKNLEFLENQGFLA  98

Query  182  KINVDNHIEVWNVDQKSLSNIHEFKRDITSFKIIQHTPYMYIGDSLGYVWVLKLEKEPCN  361
             ++ DN I+VW++  K +++   ++  IT+F +I  T YMY+G   G V+VL  + E   
Sbjct  99   SVSNDNEIQVWDLKSKQIASALHWESIITTFSVIYGTSYMYVGTEHGMVYVLMFDSEDRK  158

Query  362  VVKMKYHIP---FSESHGNSNKDGDNAIVEILPQPTAESKRVLIIYRDGLIILWAVQESK  532
            +  + Y++P    SE+ G S      ++V +L QP ++  R+LI Y +GL++LW   + +
Sbjct  159  IKILPYYVPTNVISEAAGMSLDHV--SVVRVLHQPCSDGNRLLIAYENGLMVLWDASKDR  216

Query  533  TIF  541
             + 
Sbjct  217  IVL  219



>ref|XP_003616655.1| Syntaxin-binding protein 5-like protein [Medicago truncatula]
Length=1114

 Score =   139 bits (349),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 69/184 (38%), Positives = 114/184 (62%), Gaps = 7/184 (4%)
 Frame = +2

Query  2    GVPPGALLLAYDSIQKILAISTKDGRIKVFGKDGAQALLESPNIVPSKFMQFMENQGFLI  181
            GVP  A +LA+D +Q+++A+ T DGRIKVFG D  + ++ SP     K ++F+ENQGFL 
Sbjct  39   GVPSTASILAFDCVQRLIAVGTLDGRIKVFGGDNIEGIMISPKQTSFKHLEFLENQGFLA  98

Query  182  KINVDNHIEVWNVDQKSLSNIHEFKRDITSFKIIQHTPYMYIGDSLGYVWVLKLEKEPCN  361
             ++ +N I+VW++  + +++  +++  ITSF +I  T YM +G   G V+VLK E E   
Sbjct  99   SVSSNNEIQVWDLRNRQIASALQWESIITSFSVIYGTSYMLVGTEHGLVYVLKFESEDRK  158

Query  362  VVKMKYHIP---FSESHGNSNKDGDN-AIVEILPQPTAESKRVLIIYRDGLIILWAVQES  529
            V  + Y++P    SE+ G S    DN ++  +L QP +  KR+L+ Y +G+++LW   E 
Sbjct  159  VNILPYYVPTNVISEAVGMS---LDNVSVARVLHQPCSNGKRLLVAYENGVMLLWDASED  215

Query  530  KTIF  541
            + + 
Sbjct  216  RIVL  219



>ref|XP_010253766.1| PREDICTED: uncharacterized protein LOC104594912 isoform X4 [Nelumbo 
nucifera]
Length=1062

 Score =   139 bits (349),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 76/211 (36%), Positives = 116/211 (55%), Gaps = 26/211 (12%)
 Frame = +2

Query  68   KDGRIKVFGKDGAQALLESPNIVPSKFMQFMENQGFLIKINVDNHIEVWNVDQKSLSNIH  247
            KDGRIKV G D  + LL SP  +P K ++F+ NQGF++ +  +N I+VW+++ + ++   
Sbjct  5    KDGRIKVIGGDNIEGLLISPKQLPFKNLEFLHNQGFIVSVTNENDIQVWDLENRHMACSL  64

Query  248  EFKRDITSFKIIQHTPYMYIGDSLGYVWVLKLEKEPCNVVKMKYHIP---FSESHGNSNK  418
             ++ +IT+F +I  TP+MY+GD  G + VLK +     ++K+ YHIP    +E+ G S  
Sbjct  65   VWETNITAFSVISGTPFMYVGDEYGLMSVLKYDANEGKLLKLPYHIPADLLAEAAGISLP  124

Query  419  DGDNAIVEILPQPTAESKRVLIIYRDGLIILWAVQESKTIFTTGGNALQ-----------  565
            D    IV +LPQP     RVLI Y  GL+ILW V E++ +   G   LQ           
Sbjct  125  D-HQTIVGLLPQPCTSGNRVLIAYEHGLLILWDVCENRVVLVRGYEDLQLKDEGVVNFPT  183

Query  566  ---------SVNHEAXKA--TAACWACPNGT  625
                     + NHE  +   ++ CWA  NG+
Sbjct  184  GADNEFTDDTSNHEQEEKEISSHCWASTNGS  214



>gb|AES99613.2| nucleotide-binding protein, putative [Medicago truncatula]
Length=1106

 Score =   139 bits (349),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 69/184 (38%), Positives = 114/184 (62%), Gaps = 7/184 (4%)
 Frame = +2

Query  2    GVPPGALLLAYDSIQKILAISTKDGRIKVFGKDGAQALLESPNIVPSKFMQFMENQGFLI  181
            GVP  A +LA+D +Q+++A+ T DGRIKVFG D  + ++ SP     K ++F+ENQGFL 
Sbjct  39   GVPSTASILAFDCVQRLIAVGTLDGRIKVFGGDNIEGIMISPKQTSFKHLEFLENQGFLA  98

Query  182  KINVDNHIEVWNVDQKSLSNIHEFKRDITSFKIIQHTPYMYIGDSLGYVWVLKLEKEPCN  361
             ++ +N I+VW++  + +++  +++  ITSF +I  T YM +G   G V+VLK E E   
Sbjct  99   SVSSNNEIQVWDLRNRQIASALQWESIITSFSVIYGTSYMLVGTEHGLVYVLKFESEDRK  158

Query  362  VVKMKYHIP---FSESHGNSNKDGDN-AIVEILPQPTAESKRVLIIYRDGLIILWAVQES  529
            V  + Y++P    SE+ G S    DN ++  +L QP +  KR+L+ Y +G+++LW   E 
Sbjct  159  VNILPYYVPTNVISEAVGMS---LDNVSVARVLHQPCSNGKRLLVAYENGVMLLWDASED  215

Query  530  KTIF  541
            + + 
Sbjct  216  RIVL  219



>ref|XP_010031200.1| PREDICTED: uncharacterized protein LOC104421067 isoform X1 [Eucalyptus 
grandis]
 gb|KCW50463.1| hypothetical protein EUGRSUZ_J00199 [Eucalyptus grandis]
Length=1158

 Score =   138 bits (348),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 73/191 (38%), Positives = 117/191 (61%), Gaps = 4/191 (2%)
 Frame = +2

Query  2    GVPPGALLLAYDSIQKILAISTKDGRIKVFGKDGAQALLESPNIVPSKFMQFMENQGFLI  181
            GVP  A ++A D +Q +LAI T DGRIKV G +  +AL  S   +P K ++F++NQGFL+
Sbjct  74   GVPSTASIMALDPVQSLLAIGTLDGRIKVIGCENIEALFVSAKQMPFKHLEFLQNQGFLV  133

Query  182  KINVDNHIEVWNVDQKSLSNIHEFKRDITSFKIIQHTPYMYIGDSLGYVWVLKLEKEPCN  361
             I+ DN I+VW++  ++++   +++ +IT+F +IQ T  MYIGD  G V+VLK +     
Sbjct  134  CISTDNDIQVWDMKYRNVACTFQWESNITAFSVIQGTGCMYIGDENGMVFVLKCDTGQRQ  193

Query  362  VVKMKYHIP---FSESHGNSNKDGDNAIVEILPQPTAESKRVLIIYRDGLIILWAVQESK  532
            +V++ Y IP    +E+   S      ++V +L QP +   R+LI Y +GLI+LW +  ++
Sbjct  194  IVQLPYLIPADSVAEAAAISVPH-HQSVVGVLTQPGSLGNRLLIAYGNGLIVLWDISANQ  252

Query  533  TIFTTGGNALQ  565
             +   G   LQ
Sbjct  253  VVLARGQKDLQ  263



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 927830764608