BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig13108

Length=745
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_011079098.1|  PREDICTED: 4-alpha-glucanotransferase DPE2         447   8e-147   Sesamum indicum [beniseed]
ref|NP_001275176.1|  4-alpha-glucanotransferase                         444   5e-146   Solanum tuberosum [potatoes]
gb|EYU20828.1|  hypothetical protein MIMGU_mgv1a000923mg                441   6e-145   Erythranthe guttata [common monkey flower]
ref|XP_006345302.1|  PREDICTED: 4-alpha-glucanotransferase DPE2         440   2e-144   Solanum tuberosum [potatoes]
ref|XP_009624643.1|  PREDICTED: 4-alpha-glucanotransferase DPE2         439   4e-144   Nicotiana tomentosiformis
ref|XP_010315588.1|  PREDICTED: 4-alpha-glucanotransferase DPE2         436   6e-143   Solanum lycopersicum
ref|XP_009766995.1|  PREDICTED: 4-alpha-glucanotransferase DPE2         422   5e-142   Nicotiana sylvestris
gb|ACL54411.1|  unknown                                                 417   6e-142   Zea mays [maize]
emb|CDP16326.1|  unnamed protein product                                426   9e-142   Coffea canephora [robusta coffee]
gb|AJO70152.1|  disproportionating enzyme 2                             432   5e-141   Camellia sinensis [black tea]
ref|XP_002323208.2|  hypothetical protein POPTR_0016s02870g             429   5e-140   
ref|XP_012074687.1|  PREDICTED: 4-alpha-glucanotransferase DPE2         427   1e-139   Jatropha curcas
ref|XP_011041346.1|  PREDICTED: 4-alpha-glucanotransferase DPE2-like    428   1e-139   Populus euphratica
tpg|DAA64018.1|  TPA: LOW QUALITY PROTEIN: hypothetical protein Z...    411   2e-139   
ref|XP_007162030.1|  hypothetical protein PHAVU_001G117700g             417   6e-139   Phaseolus vulgaris [French bean]
ref|XP_010251909.1|  PREDICTED: 4-alpha-glucanotransferase DPE2 i...    426   6e-139   Nelumbo nucifera [Indian lotus]
ref|XP_010251907.1|  PREDICTED: 4-alpha-glucanotransferase DPE2 i...    426   7e-139   Nelumbo nucifera [Indian lotus]
ref|XP_010938680.1|  PREDICTED: 4-alpha-glucanotransferase DPE2         425   1e-138   Elaeis guineensis
ref|XP_003624890.1|  4-alpha-glucanotransferase                         418   4e-138   
ref|XP_008244084.1|  PREDICTED: 4-alpha-glucanotransferase DPE2         423   8e-138   Prunus mume [ume]
ref|XP_002523669.1|  4-alpha-glucanotransferase, putative               420   3e-137   
ref|XP_007204878.1|  hypothetical protein PRUPE_ppa000782mg             422   3e-137   
ref|XP_004958603.1|  PREDICTED: 4-alpha-glucanotransferase DPE2-l...    421   4e-137   Setaria italica
gb|KHF97420.1|  4-alpha-glucanotransferase DPE2 -like protein           419   7e-137   Gossypium arboreum [tree cotton]
ref|XP_008796184.1|  PREDICTED: 4-alpha-glucanotransferase DPE2 i...    421   8e-137   Phoenix dactylifera
ref|XP_008796181.1|  PREDICTED: 4-alpha-glucanotransferase DPE2 i...    421   9e-137   
ref|XP_002308854.2|  4-alpha-glucanotransferase -related family p...    421   1e-136   
ref|XP_002461165.1|  hypothetical protein SORBIDRAFT_02g042100          419   2e-136   Sorghum bicolor [broomcorn]
ref|NP_001060547.1|  Os07g0662900                                       418   6e-136   
gb|AES81107.2|  4-alpha-glucanotransferase DPE2                         419   7e-136   Medicago truncatula
gb|EEC82629.1|  hypothetical protein OsI_27219                          417   7e-136   Oryza sativa Indica Group [Indian rice]
ref|XP_009377648.1|  PREDICTED: 4-alpha-glucanotransferase DPE2         418   7e-136   Pyrus x bretschneideri [bai li]
gb|EEE67756.1|  hypothetical protein OsJ_25466                          417   8e-136   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004985612.1|  PREDICTED: 4-alpha-glucanotransferase DPE2-like    417   9e-136   Setaria italica
ref|XP_004493318.1|  PREDICTED: 4-alpha-glucanotransferase DPE2-l...    418   1e-135   Cicer arietinum [garbanzo]
ref|XP_004493319.1|  PREDICTED: 4-alpha-glucanotransferase DPE2-l...    418   1e-135   Cicer arietinum [garbanzo]
ref|XP_004309467.1|  PREDICTED: 4-alpha-glucanotransferase DPE2         417   2e-135   Fragaria vesca subsp. vesca
ref|XP_007028193.1|  Disproportionating enzyme 2 isoform 1              417   3e-135   
ref|XP_006576763.1|  PREDICTED: 4-alpha-glucanotransferase DPE2-like    415   9e-135   Glycine max [soybeans]
gb|KJB66143.1|  hypothetical protein B456_010G128900                    414   1e-134   Gossypium raimondii
gb|KJB66147.1|  hypothetical protein B456_010G128900                    414   1e-134   Gossypium raimondii
ref|XP_003554099.1|  PREDICTED: 4-alpha-glucanotransferase DPE2-like    415   1e-134   Glycine max [soybeans]
gb|KHN38798.1|  4-alpha-glucanotransferase DPE2                         415   2e-134   Glycine soja [wild soybean]
gb|KHN08918.1|  4-alpha-glucanotransferase DPE2                         416   2e-134   Glycine soja [wild soybean]
gb|ACN50178.1|  disproportionating enzyme 2                             414   2e-134   Annona cherimola [cherimoya]
ref|XP_010111246.1|  4-alpha-glucanotransferase DPE2                    414   3e-134   
ref|XP_011040702.1|  PREDICTED: 4-alpha-glucanotransferase DPE2-like    414   3e-134   Populus euphratica
emb|CAX51389.1|  disproportionating enzyme                              397   6e-134   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006658074.1|  PREDICTED: 4-alpha-glucanotransferase DPE2-like    412   7e-134   Oryza brachyantha
ref|XP_003624891.1|  4-alpha-glucanotransferase                         407   3e-133   
ref|XP_003562501.1|  PREDICTED: 4-alpha-glucanotransferase DPE2         410   3e-133   Brachypodium distachyon [annual false brome]
ref|XP_006482017.1|  PREDICTED: 4-alpha-glucanotransferase DPE2-l...    411   4e-133   Citrus sinensis [apfelsine]
gb|KDO57419.1|  hypothetical protein CISIN_1g002027mg                   411   5e-133   Citrus sinensis [apfelsine]
ref|XP_009142714.1|  PREDICTED: 4-alpha-glucanotransferase DPE2         409   9e-133   Brassica rapa
emb|CDX79967.1|  BnaA05g01890D                                          409   1e-132   
ref|XP_006430481.1|  hypothetical protein CICLE_v10010989mg             410   1e-132   Citrus clementina [clementine]
emb|CDY23877.1|  BnaC04g01600D                                          409   1e-132   Brassica napus [oilseed rape]
ref|NP_181616.3|  4-alpha-glucanotransferase DPE2                       409   2e-132   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006293633.1|  hypothetical protein CARUB_v10022587mg             409   2e-132   Capsella rubella
ref|XP_010525431.1|  PREDICTED: 4-alpha-glucanotransferase DPE2         408   3e-132   Tarenaya hassleriana [spider flower]
ref|XP_010508798.1|  PREDICTED: 4-alpha-glucanotransferase DPE2         408   5e-132   Camelina sativa [gold-of-pleasure]
gb|AAB86444.1|  4-alpha-glucanotransferase                              402   5e-132   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006411352.1|  hypothetical protein EUTSA_v10016195mg             407   7e-132   Eutrema salsugineum [saltwater cress]
ref|XP_009391559.1|  PREDICTED: 4-alpha-glucanotransferase DPE2 i...    407   8e-132   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009391560.1|  PREDICTED: 4-alpha-glucanotransferase DPE2 i...    407   8e-132   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002879894.1|  hypothetical protein ARALYDRAFT_483146             407   9e-132   
ref|XP_002278329.2|  PREDICTED: 4-alpha-glucanotransferase DPE2         406   3e-131   Vitis vinifera
ref|XP_010517527.1|  PREDICTED: 4-alpha-glucanotransferase DPE2-like    406   3e-131   Camelina sativa [gold-of-pleasure]
ref|XP_004144319.1|  PREDICTED: 4-alpha-glucanotransferase DPE2         406   3e-131   Cucumis sativus [cucumbers]
ref|XP_003624889.1|  4-alpha-glucanotransferase                         407   4e-131   
gb|KGN54674.1|  hypothetical protein Csa_4G420150                       407   5e-131   Cucumis sativus [cucumbers]
emb|CBI32836.3|  unnamed protein product                                407   6e-131   Vitis vinifera
gb|EPS63641.1|  4-alpha-glucanotransferase                              400   9e-131   Genlisea aurea
ref|XP_010036394.1|  PREDICTED: 4-alpha-glucanotransferase DPE2         403   4e-130   Eucalyptus grandis [rose gum]
gb|KDO57418.1|  hypothetical protein CISIN_1g002027mg                   403   4e-130   Citrus sinensis [apfelsine]
dbj|BAJ94874.1|  predicted protein                                      401   1e-129   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_011626502.1|  PREDICTED: 4-alpha-glucanotransferase DPE2         400   6e-129   Amborella trichopoda
gb|ERN14586.1|  hypothetical protein AMTR_s00038p00141420               400   1e-128   Amborella trichopoda
gb|EMS56480.1|  4-alpha-glucanotransferase DPE2                         396   3e-128   Triticum urartu
gb|EMT23324.1|  4-alpha-glucanotransferase                              396   3e-128   
ref|XP_010673114.1|  PREDICTED: 4-alpha-glucanotransferase DPE2         393   2e-126   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008455750.1|  PREDICTED: 4-alpha-glucanotransferase DPE2         389   1e-124   Cucumis melo [Oriental melon]
ref|XP_002979331.1|  hypothetical protein SELMODRAFT_268243             378   9e-121   
ref|XP_001779217.1|  predicted protein                                  369   1e-116   
ref|XP_002988641.1|  hypothetical protein SELMODRAFT_427302             364   4e-116   
ref|XP_007028194.1|  Disproportionating enzyme 2 isoform 2              340   1e-106   
gb|KJB66144.1|  hypothetical protein B456_010G128900                    336   3e-105   Gossypium raimondii
ref|XP_005844986.1|  hypothetical protein CHLNCDRAFT_58753              288   2e-87    Chlorella variabilis
ref|XP_003082031.1|  4-alpha-glucanotransferase; disproportionati...    273   7e-87    
ref|XP_005648012.1|  hypothetical protein COCSUDRAFT_28856              284   2e-85    Coccomyxa subellipsoidea C-169
ref|XP_003061752.1|  glycoside hydrolase family 77 protein              280   3e-85    Micromonas pusilla CCMP1545
gb|ABK93393.1|  unknown                                                 259   5e-84    Populus trichocarpa [western balsam poplar]
emb|CEF99666.1|  Carbohydrate binding module family 20                  275   9e-82    Ostreococcus tauri
ref|XP_001420502.1|  predicted protein                                  268   2e-80    Ostreococcus lucimarinus CCE9901
ref|XP_002509010.1|  glycoside hydrolase family 77 protein              266   2e-78    Micromonas commoda
ref|XP_638682.1|  hypothetical protein DDB_G0284259                     256   4e-75    Dictyostelium discoideum AX4
ref|XP_011395531.1|  4-alpha-glucanotransferase DPE2                    254   1e-74    Auxenochlorella protothecoides
ref|WP_027984123.1|  hypothetical protein                               253   3e-74    delta proteobacterium PSCGC 5296
dbj|GAM28256.1|  hypothetical protein SAMD00019534_114320               253   4e-74    Acytostelium subglobosum LB1
ref|XP_003286541.1|  hypothetical protein DICPUDRAFT_46840              249   1e-72    Dictyostelium purpureum
ref|XP_007028196.1|  4-alpha-glucanotransferase isoform 4               247   2e-72    
gb|EFA84397.1|  4-alpha-glucanotransferase                              248   5e-72    Heterostelium album PN500
ref|XP_001701179.1|  4-alpha-glucanotransferase                         247   7e-72    Chlamydomonas reinhardtii
ref|WP_022391417.1|  putative 4-alpha-glucanotransferase                233   4e-71    
ref|XP_004359265.1|  4-alpha-glucanotransferase                         243   2e-70    Cavenderia fasciculata
ref|XP_002956849.1|  cytosolic 4-alpha-glucanotransferase               243   3e-70    Volvox carteri f. nagariensis
ref|WP_026259966.1|  4-alpha-glucanotransferase                         239   5e-69    
ref|WP_014218816.1|  4-alpha-glucanotransferase                         239   5e-69    Niastella koreensis
ref|WP_007210299.1|  hypothetical protein                               233   6e-69    
ref|WP_020530494.1|  hypothetical protein                               238   9e-69    Flexithrix dorotheae
ref|WP_039129341.1|  4-alpha-glucanotransferase                         238   1e-68    Flavihumibacter sp. ZG627
ref|WP_005657332.1|  4-alpha-glucanotransferase                         238   1e-68    Bacteroides stercoris
ref|WP_016661854.1|  4-alpha-glucanotransferase                         237   2e-68    Bacteroides stercoris
ref|WP_022209830.1|  4-alpha-glucanotransferase                         234   3e-68    
ref|WP_022103310.1|  putative 4-alpha-glucanotransferase                236   4e-68    Bacteroides stercoris
ref|WP_029737177.1|  4-alpha-glucanotransferase                         234   5e-68    
ref|WP_021940588.1|  4-alpha-glucanotransferase                         236   5e-68    
ref|WP_004294012.1|  4-alpha-glucanotransferase                         236   5e-68    Bacteroides eggerthii
ref|XP_007028195.1|  Disproportionating enzyme 2 isoform 3              235   7e-68    
ref|WP_019946818.1|  hypothetical protein                               236   8e-68    Hymenobacter aerophilus
ref|WP_004288457.1|  4-alpha-glucanotransferase                         235   1e-67    Bacteroides eggerthii
ref|WP_044266402.1|  4-alpha-glucanotransferase                         235   1e-67    Bacteroides timonensis
ref|WP_025726017.1|  MULTISPECIES: 4-alpha-glucanotransferase           234   3e-67    Bacteroides
ref|WP_037328071.1|  4-alpha-glucanotransferase                         234   4e-67    Asinibacterium sp. OR43
ref|WP_018668757.1|  4-alpha-glucanotransferase                         233   7e-67    Bacteroides gallinarum
ref|WP_025831715.1|  4-alpha-glucanotransferase                         233   9e-67    Bacteroides stercorirosoris
ref|WP_037361958.1|  4-alpha-glucanotransferase                         232   1e-66    
ref|WP_007218930.1|  4-alpha-glucanotransferase                         232   2e-66    Bacteroides cellulosilyticus
ref|WP_007660001.1|  4-alpha-glucanotransferase                         231   2e-66    Bacteroides intestinalis
ref|WP_044532847.1|  4-alpha-glucanotransferase                         231   2e-66    Bacteroides intestinalis
ref|WP_022082018.1|  4-alpha-glucanotransferase                         231   2e-66    
ref|WP_009130629.1|  4-alpha-glucanotransferase                         231   3e-66    Bacteroides oleiciplenus
gb|EFV25987.1|  4-alpha-glucanotransferase                              220   3e-66    Bacteroides sp. 4_1_36
ref|WP_034532837.1|  4-alpha-glucanotransferase                         220   3e-66    
ref|XP_007509607.1|  4-alpha-glucanotransferase                         233   3e-66    Bathycoccus prasinos
dbj|GAK36780.1|  4-alpha-glucanotransferase                             217   4e-66    Bacteroides graminisolvens DSM 19988 = JCM 15093
ref|WP_004321973.1|  4-alpha-glucanotransferase                         231   4e-66    Bacteroides ovatus
ref|WP_032844011.1|  MULTISPECIES: 4-alpha-glucanotransferase           231   4e-66    Bacteroides
ref|WP_004299344.1|  4-alpha-glucanotransferase                         231   4e-66    Bacteroides
ref|WP_022219021.1|  putative 4-alpha-glucanotransferase                230   5e-66    
ref|WP_025862904.1|  hypothetical protein                               230   7e-66    Prolixibacter bellariivorans
ref|WP_009123083.1|  4-alpha-glucanotransferase                         230   7e-66    Bacteroides clarus
ref|WP_021848341.1|  hypothetical protein                               230   8e-66    
ref|WP_039141056.1|  4-alpha-glucanotransferase                         229   1e-65    Flavihumibacter solisilvae
ref|WP_008585018.1|  4-alpha-glucanotransferase                         229   1e-65    Niabella soli
gb|EGN08908.1|  hypothetical protein HMPREF0127_01074                   229   1e-65    Bacteroides sp. 1_1_30
ref|WP_009038847.1|  4-alpha-glucanotransferase                         229   1e-65    Bacteroides sp. D22
ref|WP_022275952.1|  4-alpha-glucanotransferase                         229   1e-65    
ref|WP_013545673.1|  4-alpha-glucanotransferase                         229   1e-65    Bacteroides helcogenes
ref|WP_004307977.1|  MULTISPECIES: 4-alpha-glucanotransferase           229   1e-65    Bacteroides
dbj|GAE21767.1|  4-alpha-glucanotransferase                             219   1e-65    Bacteroides pyogenes JCM 10003
ref|WP_004306622.1|  4-alpha-glucanotransferase                         229   2e-65    Bacteroides ovatus
gb|EGX26388.1|  putative 4-alpha-glucanotransferase                     229   2e-65    Bacteroides sp. D1
ref|XP_005705723.1|  4-alpha-glucanotransferase                         229   2e-65    Galdieria sulphuraria
ref|WP_004312551.1|  MULTISPECIES: 4-alpha-glucanotransferase           229   2e-65    Bacteroides
ref|WP_008024994.1|  4-alpha-glucanotransferase                         229   2e-65    Bacteroides xylanisolvens
ref|WP_008776252.1|  4-alpha-glucanotransferase                         229   2e-65    Bacteroides sp. 2_2_4
ref|WP_021891360.1|  4-alpha-glucanotransferase                         217   2e-65    
dbj|GAE85599.1|  4-alpha-glucanotransferase                             219   2e-65    Bacteroides reticulotermitis JCM 10512
ref|WP_004326207.1|  4-alpha-glucanotransferase                         228   2e-65    Bacteroides ovatus
ref|WP_007751911.1|  4-alpha-glucanotransferase                         228   3e-65    Bacteroides finegoldii
emb|CBK66288.1|  4-alpha-glucanotransferase                             228   3e-65    Bacteroides xylanisolvens XB1A
ref|WP_028786340.1|  4-alpha-glucanotransferase                         228   3e-65    Terrimonas ferruginea
ref|WP_022199218.1|  hypothetical protein                               228   3e-65    
ref|WP_008650141.1|  4-alpha-glucanotransferase                         228   3e-65    Bacteroides sp. 3_1_23
ref|WP_005682663.1|  4-alpha-glucanotransferase                         228   4e-65    Bacteroides caccae
ref|WP_007767042.1|  4-alpha-glucanotransferase                         228   5e-65    Bacteroides finegoldii
ref|WP_027317965.1|  4-alpha-glucanotransferase                         228   5e-65    Bacteroides graminisolvens
ref|WP_005678735.1|  4-alpha-glucanotransferase                         227   7e-65    Bacteroides caccae
ref|WP_022021132.1|  putative 4-alpha-glucanotransferase                227   9e-65    
ref|WP_008759757.1|  4-alpha-glucanotransferase                         226   1e-64    
ref|WP_009123612.1|  4-alpha-glucanotransferase                         226   1e-64    Bacteroides fluxus
ref|WP_007486957.1|  4-alpha-glucanotransferase                         226   2e-64    Bacteroides nordii
ref|WP_008763941.1|  4-alpha-glucanotransferase                         226   2e-64    Bacteroides thetaiotaomicron
ref|WP_022825021.1|  4-alpha-glucanotransferase                         226   2e-64    Hymenobacter norwichensis
ref|WP_011108155.1|  4-alpha-glucanotransferase                         226   2e-64    Bacteroides thetaiotaomicron
ref|WP_022471193.1|  4-alpha-glucanotransferase                         226   2e-64    
ref|WP_025866708.1|  4-alpha-glucanotransferase                         226   2e-64    Bacteroides nordii
ref|WP_022302025.1|  4-alpha-glucanotransferase                         226   2e-64    
ref|WP_021936659.1|  4-alpha-glucanotransferase                         226   2e-64    
ref|WP_016268614.1|  4-alpha-glucanotransferase                         226   2e-64    Bacteroides thetaiotaomicron
ref|WP_044656205.1|  4-alpha-glucanotransferase                         224   2e-64    Bacteroides acidifaciens
ref|WP_022041698.1|  putative 4-alpha-glucanotransferase                226   3e-64    
ref|WP_025818998.1|  4-alpha-glucanotransferase                         226   3e-64    Bacteroides salyersiae
gb|EIY56724.1|  4-alpha-glucanotransferase                              226   3e-64    Bacteroides salyersiae CL02T12C01
ref|WP_044094117.1|  4-alpha-glucanotransferase                         225   3e-64    Bacteroides salyersiae
gb|EOA48216.1|  4-alpha-glucanotransferase                              225   3e-64    Bacteroides salyersiae WAL 10018 = DSM 18765 = JCM 12988
ref|WP_010539382.1|  4-alpha-glucanotransferase                         225   3e-64    Bacteroides
ref|WP_032568523.1|  4-alpha-glucanotransferase                         225   5e-64    Bacteroides fragilis
ref|WP_044136693.1|  4-alpha-glucanotransferase                         225   5e-64    
ref|WP_032599403.1|  4-alpha-glucanotransferase                         225   5e-64    Bacteroides fragilis
ref|WP_032580412.1|  4-alpha-glucanotransferase                         224   6e-64    Bacteroides fragilis
ref|WP_042371062.1|  4-alpha-glucanotransferase                         224   6e-64    Bacteroides neonati
ref|WP_009597356.1|  hypothetical protein                               214   6e-64    
ref|WP_032598883.1|  4-alpha-glucanotransferase                         224   6e-64    Bacteroides fragilis
dbj|GAO45374.1|  putative 4-alpha-glucanotransferase                    224   6e-64    Flavihumibacter petaseus NBRC 106054
ref|WP_042985869.1|  4-alpha-glucanotransferase                         224   6e-64    
ref|WP_032602502.1|  4-alpha-glucanotransferase                         224   6e-64    Bacteroides fragilis
ref|WP_032590626.1|  4-alpha-glucanotransferase                         224   7e-64    Bacteroides fragilis
ref|WP_032559946.1|  4-alpha-glucanotransferase                         224   7e-64    Bacteroides fragilis
ref|WP_032579362.1|  4-alpha-glucanotransferase                         224   7e-64    Bacteroides fragilis
ref|WP_002562526.1|  4-alpha-glucanotransferase                         224   8e-64    Bacteroides sp. HPS0048
ref|WP_029903959.1|  hypothetical protein                               224   8e-64    Prevotella sp. 10(H)
ref|WP_032587218.1|  4-alpha-glucanotransferase                         224   9e-64    Bacteroides fragilis
ref|WP_008657591.1|  MULTISPECIES: 4-alpha-glucanotransferase           224   1e-63    Bacteroides
ref|WP_032574699.1|  4-alpha-glucanotransferase                         224   1e-63    Bacteroides fragilis
ref|WP_032594741.1|  4-alpha-glucanotransferase                         224   1e-63    Bacteroides fragilis
ref|WP_032557362.1|  4-alpha-glucanotransferase                         224   1e-63    Bacteroides fragilis
ref|WP_044820056.1|  4-alpha-glucanotransferase                         224   1e-63    Bacteroides fragilis
ref|WP_032573835.1|  4-alpha-glucanotransferase                         224   1e-63    Bacteroides fragilis
ref|WP_005817470.1|  4-alpha-glucanotransferase                         224   1e-63    Bacteroides fragilis
ref|WP_032601322.1|  4-alpha-glucanotransferase                         224   1e-63    Bacteroides fragilis
ref|WP_032529126.1|  4-alpha-glucanotransferase                         224   1e-63    Bacteroides fragilis
ref|WP_011203461.1|  4-alpha-glucanotransferase                         224   1e-63    Bacteroides fragilis
ref|WP_009292585.1|  MULTISPECIES: 4-alpha-glucanotransferase           224   1e-63    Bacteroides fragilis
ref|WP_022348360.1|  MULTISPECIES: 4-alpha-glucanotransferase           224   1e-63    Bacteroides fragilis
ref|WP_005802183.1|  4-alpha-glucanotransferase                         224   1e-63    Bacteroides fragilis
ref|WP_044015448.1|  hypothetical protein                               224   1e-63    Hymenobacter sp. APR13
ref|XP_005714071.1|  Disproportionating Enzyme type 2                   223   1e-63    Chondrus crispus [carageen]
ref|WP_032561759.1|  4-alpha-glucanotransferase                         224   1e-63    Bacteroides fragilis
ref|WP_032533995.1|  4-alpha-glucanotransferase                         224   1e-63    Bacteroides fragilis
emb|CDA86937.1|  4-alpha-glucanotransferase                             224   1e-63    Bacteroides sp. CAG:754
ref|WP_008769974.1|  4-alpha-glucanotransferase                         224   1e-63    Bacteroides fragilis
ref|WP_005790925.1|  4-alpha-glucanotransferase                         224   1e-63    Bacteroides fragilis
ref|WP_014299393.1|  4-alpha-glucanotransferase                         224   1e-63    Bacteroides fragilis
ref|WP_044222303.1|  hypothetical protein                               224   1e-63    Flammeovirga pacifica
ref|WP_032599755.1|  4-alpha-glucanotransferase                         224   1e-63    Bacteroides fragilis
ref|WP_032576974.1|  4-alpha-glucanotransferase                         224   1e-63    Bacteroides fragilis
ref|WP_037370011.1|  hypothetical protein                               223   2e-63    
ref|WP_022163936.1|  4-alpha-glucanotransferase                         223   2e-63    
ref|WP_032565355.1|  4-alpha-glucanotransferase                         223   2e-63    Bacteroides fragilis
ref|WP_010993489.1|  4-alpha-glucanotransferase                         223   2e-63    Bacteroides fragilis
ref|WP_042971685.1|  4-alpha-glucanotransferase                         223   2e-63    Bacteroides fragilis
ref|WP_042987441.1|  4-alpha-glucanotransferase                         223   2e-63    
ref|WP_032584492.1|  4-alpha-glucanotransferase                         223   2e-63    Bacteroides fragilis
ref|WP_044003721.1|  hypothetical protein                               223   2e-63    
ref|WP_022390399.1|  4-alpha-glucanotransferase                         223   3e-63    
ref|WP_032536991.1|  MULTISPECIES: 4-alpha-glucanotransferase           223   3e-63    Bacteroides
ref|WP_032566501.1|  4-alpha-glucanotransferase                         222   4e-63    Bacteroides fragilis
ref|WP_032592604.1|  4-alpha-glucanotransferase                         222   4e-63    Bacteroides fragilis
ref|WP_009317285.1|  4-alpha-glucanotransferase                         222   4e-63    Tannerella sp. 6_1_58FAA_CT1
ref|WP_022602509.1|  4-alpha-glucanotransferase                         222   4e-63    Coprobacter fastidiosus
ref|WP_009597074.1|  hypothetical protein                               212   4e-63    
ref|WP_032571265.1|  4-alpha-glucanotransferase                         222   5e-63    Bacteroides fragilis
ref|WP_022012177.1|  4-alpha-glucanotransferase                         221   7e-63    
ref|WP_005781429.1|  4-alpha-glucanotransferase                         221   7e-63    Bacteroides fragilis
ref|WP_032572551.1|  4-alpha-glucanotransferase                         221   8e-63    Bacteroides fragilis
ref|WP_032539693.1|  4-alpha-glucanotransferase                         221   9e-63    Bacteroides fragilis
ref|WP_016273032.1|  4-alpha-glucanotransferase                         221   9e-63    Bacteroides uniformis
ref|WP_035449136.1|  4-alpha-glucanotransferase                         221   9e-63    Bacteroides uniformis
ref|WP_032581750.1|  4-alpha-glucanotransferase                         221   1e-62    Bacteroides fragilis
ref|WP_005827292.1|  4-alpha-glucanotransferase                         221   1e-62    Bacteroides uniformis
ref|WP_044468086.1|  4-alpha-glucanotransferase                         221   1e-62    Bacteroides uniformis
ref|WP_032543937.1|  4-alpha-glucanotransferase                         221   1e-62    Bacteroides fragilis
ref|WP_005833224.1|  MULTISPECIES: 4-alpha-glucanotransferase           221   1e-62    Bacteroides
ref|WP_044200794.1|  hypothetical protein                               221   1e-62    Flammeovirga sp. OC4
ref|WP_005808459.1|  4-alpha-glucanotransferase                         221   1e-62    Bacteroides fragilis
ref|WP_005821823.1|  4-alpha-glucanotransferase                         221   1e-62    Bacteroides fragilis
ref|WP_009037932.1|  4-alpha-glucanotransferase                         221   1e-62    Bacteroides
ref|WP_044299476.1|  4-alpha-glucanotransferase                         221   2e-62    Bacteroides fragilis
ref|WP_032532010.1|  4-alpha-glucanotransferase                         220   2e-62    Bacteroides fragilis
ref|WP_032583031.1|  4-alpha-glucanotransferase                         220   2e-62    Bacteroides fragilis
ref|WP_044510481.1|  hypothetical protein                               220   3e-62    Hymenobacter sp. DG25B
ref|WP_020538626.1|  hypothetical protein                               220   3e-62    Lewinella cohaerens
ref|WP_021646429.1|  putative 4-alpha-glucanotransferase                218   9e-62    Bacteroides pyogenes
ref|XP_657483.1|  4-alpha-glucanotransferase                            218   1e-61    Entamoeba histolytica HM-1:IMSS
ref|XP_001738878.1|  hypothetical protein                               218   2e-61    Entamoeba dispar SAW760
ref|XP_008860087.1|  4-alpha-glucanotransferase, putative               218   2e-61    Entamoeba nuttalli P19
ref|WP_021899673.1|  4-alpha-glucanotransferase                         218   2e-61    
ref|WP_008861837.1|  4-alpha-glucanotransferase                         218   2e-61    Barnesiella intestinihominis
ref|WP_026763736.1|  4-alpha-glucanotransferase                         217   2e-61    Sediminibacterium salmoneum
ref|WP_039163274.1|  4-alpha-glucanotransferase                         217   3e-61    Bacteroides uniformis
ref|WP_022454938.1|  glycoside hydrolase family 77 candidate 4-al...    217   3e-61    
ref|WP_027324830.1|  4-alpha-glucanotransferase                         217   3e-61    Bacteroides pyogenes
ref|WP_035567249.1|  hypothetical protein                               216   8e-61    
ref|WP_019540872.1|  hypothetical protein                               215   1e-60    Proteiniphilum acetatigenes
ref|XP_004256227.1|  hypothetical protein EIN_390810                    214   4e-60    Entamoeba invadens IP1
ref|WP_022436136.1|  4-alpha-glucanotransferase                         214   4e-60    
ref|XP_004184163.1|  hypothetical protein EIN_283630                    214   4e-60    Entamoeba invadens IP1
ref|WP_024993024.1|  4-alpha-glucanotransferase                         213   8e-60    
ref|WP_021929333.1|  4-alpha-glucanotransferase                         213   1e-59    
ref|WP_044229010.1|  4-alpha-glucanotransferase                         213   1e-59    
ref|XP_005537970.1|  4-alpha-glucanotransferase                         213   1e-59    
ref|WP_022333344.1|  4-alpha-glucanotransferase                         212   1e-59    
ref|WP_044233349.1|  4-alpha-glucanotransferase                         212   2e-59    
gb|AEE47959.1|  4-alpha-glucanotransferase                              212   2e-59    
ref|WP_015545746.1|  4-alpha-glucanotransferase                         212   2e-59    
ref|WP_032136027.1|  4-alpha-glucanotransferase                         212   2e-59    
ref|WP_022062058.1|  4-alpha-glucanotransferase                         212   2e-59    
ref|WP_013444800.1|  4-alpha-glucanotransferase                         211   2e-59    
ref|WP_025277241.1|  4-alpha-glucanotransferase                         211   4e-59    
ref|WP_018695142.1|  4-alpha-glucanotransferase                         211   4e-59    
ref|WP_022043532.1|  4-alpha-glucanotransferase                         203   9e-59    
ref|WP_038656875.1|  hypothetical protein                               210   1e-58    
ref|WP_016275178.1|  4-alpha-glucanotransferase                         209   1e-58    
ref|WP_040311340.1|  4-alpha-glucanotransferase                         209   1e-58    
gb|EEF76420.1|  putative 4-alpha-glucanotransferase                     209   2e-58    
ref|WP_022148684.1|  4-alpha-glucanotransferase                         208   2e-58    
ref|WP_032952210.1|  4-alpha-glucanotransferase                         209   2e-58    
ref|WP_005849621.1|  4-alpha-glucanotransferase                         209   2e-58    
ref|WP_008668496.1|  MULTISPECIES: 4-alpha-glucanotransferase           209   2e-58    
ref|WP_011965164.1|  4-alpha-glucanotransferase                         209   2e-58    
ref|WP_022508114.1|  glycoside hydrolase family 77 candidate 4-al...    209   2e-58    
ref|WP_016271153.1|  4-alpha-glucanotransferase                         209   2e-58    
ref|WP_025018211.1|  4-alpha-glucanotransferase                         209   2e-58    
ref|WP_008152397.1|  4-alpha-glucanotransferase                         208   3e-58    
ref|WP_021863062.1|  hypothetical protein                               208   4e-58    
gb|AFL98082.1|  4-alpha-glucanotransferase                              208   4e-58    
ref|WP_036601942.1|  hypothetical protein                               208   5e-58    
gb|AIP99855.1|  4-alpha-glucanotransferase                              207   5e-58    
ref|WP_005838936.1|  4-alpha-glucanotransferase                         208   5e-58    
ref|WP_007855023.1|  4-alpha-glucanotransferase                         207   7e-58    
ref|WP_007834727.1|  4-alpha-glucanotransferase                         207   7e-58    
ref|WP_008655564.1|  MULTISPECIES: 4-alpha-glucanotransferase           207   7e-58    
ref|WP_022278145.1|  putative 4-alpha-glucanotransferase                207   8e-58    
ref|WP_008674311.1|  4-alpha-glucanotransferase                         207   8e-58    
ref|WP_006798566.1|  hypothetical protein                               207   8e-58    
ref|WP_022507408.1|  glycoside hydrolase family 77 candidate 4-al...    207   9e-58    
ref|WP_005942505.1|  4-alpha-glucanotransferase                         207   9e-58    
ref|WP_032949000.1|  4-alpha-glucanotransferase                         207   9e-58    
ref|WP_018627932.1|  hypothetical protein                               207   1e-57    
ref|WP_008154484.1|  4-alpha-glucanotransferase                         207   1e-57    
gb|EKD31281.1|  hypothetical protein ACD_77C00349G0013                  206   2e-57    
ref|WP_006842445.1|  hypothetical protein                               206   2e-57    
ref|WP_022317144.1|  putative 4-alpha-glucanotransferase                194   2e-57    
ref|WP_004358749.1|  4-alpha-glucanotransferase                         206   2e-57    
ref|WP_034737238.1|  4-alpha-glucanotransferase                         206   3e-57    
ref|WP_040310800.1|  hypothetical protein                               204   3e-57    
ref|WP_014775649.1|  4-alpha-glucanotransferase                         205   3e-57    
ref|WP_044259916.1|  4-alpha-glucanotransferase                         198   3e-57    
ref|WP_019129625.1|  hypothetical protein                               205   4e-57    
ref|WP_009010949.1|  4-alpha-glucanotransferase                         205   4e-57    
ref|WP_005648069.1|  4-alpha-glucanotransferase                         205   4e-57    
ref|WP_005637072.1|  4-alpha-glucanotransferase                         205   5e-57    
ref|WP_022322899.1|  putative 4-alpha-glucanotransferase                205   5e-57    
ref|WP_007369038.1|  4-alpha-glucanotransferase                         205   5e-57    
ref|WP_013444414.1|  4-alpha-glucanotransferase                         205   5e-57    
gb|EFI17528.1|  4-alpha-glucanotransferase                              204   6e-57    
ref|WP_022324459.1|  4-alpha-glucanotransferase                         204   7e-57    
ref|WP_007841990.1|  4-alpha-glucanotransferase                         204   8e-57    
ref|WP_009435496.1|  4-alpha-glucanotransferase                         204   8e-57    
ref|WP_021312296.1|  4-alpha-glucanotransferase                         204   8e-57    
ref|WP_004382878.1|  4-alpha-glucanotransferase                         204   8e-57    
ref|WP_019207498.1|  hypothetical protein                               204   9e-57    
gb|KFF73317.1|  4-alpha-glucanotransferase                              204   9e-57    
ref|WP_027373919.1|  4-alpha-glucanotransferase                         204   1e-56    
ref|WP_022453921.1|  4-alpha-glucanotransferase                         206   1e-56    
ref|WP_013264365.1|  4-alpha-glucanotransferase                         204   1e-56    
ref|WP_036896622.1|  4-alpha-glucanotransferase                         204   1e-56    
ref|WP_027376182.1|  4-alpha-glucanotransferase                         204   1e-56    
ref|WP_022016602.1|  4-alpha-glucanotransferase                         202   1e-56    
ref|WP_022157599.1|  putative 4-alpha-glucanotransferase                204   2e-56    
ref|WP_031533708.1|  MULTISPECIES: 4-alpha-glucanotransferase           204   2e-56    
ref|WP_014775946.1|  4-alpha-glucanotransferase                         203   2e-56    
ref|WP_025001029.1|  4-alpha-glucanotransferase                         204   2e-56    
ref|WP_036921660.1|  4-alpha-glucanotransferase                         204   2e-56    
ref|WP_006044347.1|  4-alpha-glucanotransferase                         204   2e-56    
ref|WP_028897457.1|  4-alpha-glucanotransferase                         203   2e-56    
ref|WP_022232102.1|  putative 4-alpha-glucanotransferase                204   2e-56    
ref|WP_025003084.1|  4-alpha-glucanotransferase                         203   2e-56    
ref|WP_021928046.1|  4-alpha-glucanotransferase                         203   2e-56    
ref|WP_029216332.1|  4-alpha-glucanotransferase                         203   2e-56    
ref|WP_013670900.1|  4-alpha-glucanotransferase                         203   2e-56    
ref|WP_025837029.1|  4-alpha-glucanotransferase                         203   2e-56    
gb|KEY18683.1|  4-alpha-glucanotransferase                              202   3e-56    
ref|WP_021963934.1|  putative 4-alpha-glucanotransferase                203   3e-56    
ref|WP_034719137.1|  4-alpha-glucanotransferase                         202   3e-56    
ref|WP_004381396.1|  4-alpha-glucanotransferase                         202   3e-56    
ref|WP_021671176.1|  putative 4-alpha-glucanotransferase                202   4e-56    
ref|WP_044074833.1|  4-alpha-glucanotransferase                         202   5e-56    
ref|WP_044072839.1|  4-alpha-glucanotransferase                         202   5e-56    
ref|WP_042518721.1|  4-alpha-glucanotransferase                         202   5e-56    
ref|WP_035590242.1|  4-alpha-glucanotransferase                         202   5e-56    
ref|WP_009085611.1|  4-alpha-glucanotransferase                         202   5e-56    
ref|WP_023925818.1|  4-alpha-glucanotransferase                         202   5e-56    
ref|WP_044064774.1|  4-alpha-glucanotransferase                         202   5e-56    
ref|WP_036866041.1|  4-alpha-glucanotransferase                         202   5e-56    
ref|WP_036855259.1|  4-alpha-glucanotransferase                         202   6e-56    
ref|WP_016412277.1|  4-alpha-glucanotransferase                         202   8e-56    
ref|WP_036865639.1|  4-alpha-glucanotransferase                         201   9e-56    
ref|WP_004336360.1|  4-alpha-glucanotransferase                         201   9e-56    
ref|WP_034678103.1|  4-alpha-glucanotransferase                         201   1e-55    
ref|WP_024564745.1|  4-alpha-glucanotransferase                         201   1e-55    
ref|WP_036886124.1|  4-alpha-glucanotransferase                         201   1e-55    
ref|WP_036862732.1|  4-alpha-glucanotransferase                         201   1e-55    
ref|WP_004353548.1|  4-alpha-glucanotransferase                         201   1e-55    
ref|WP_034848246.1|  4-alpha-glucanotransferase                         201   1e-55    
ref|WP_024566782.1|  4-alpha-glucanotransferase                         201   1e-55    
ref|WP_004364466.1|  4-alpha-glucanotransferase                         201   1e-55    
ref|WP_040556950.1|  4-alpha-glucanotransferase                         201   1e-55    
ref|WP_021853305.1|  putative 4-alpha-glucanotransferase                201   1e-55    
ref|WP_021991210.1|  4-alpha-glucanotransferase                         201   1e-55    
gb|EGQ12324.1|  4-alpha-glucanotransferase                              201   2e-55    
ref|WP_009142653.1|  4-alpha-glucanotransferase                         201   2e-55    
ref|WP_044080197.1|  4-alpha-glucanotransferase                         201   2e-55    
ref|WP_034867864.1|  4-alpha-glucanotransferase                         201   2e-55    
ref|WP_021992300.1|  4-alpha-glucanotransferase                         199   2e-55    
ref|WP_028898715.1|  4-alpha-glucanotransferase                         200   2e-55    
ref|WP_008565196.1|  4-alpha-glucanotransferase                         200   3e-55    
ref|WP_013616373.1|  4-alpha-glucanotransferase                         200   3e-55    
ref|WP_034695669.1|  4-alpha-glucanotransferase                         200   3e-55    
ref|WP_004371292.1|  4-alpha-glucanotransferase                         200   3e-55    
ref|WP_002981837.1|  4-alpha-glucanotransferase                         200   3e-55    
ref|WP_019966752.1|  4-alpha-glucanotransferase                         200   3e-55    
ref|WP_034766214.1|  4-alpha-glucanotransferase                         196   3e-55    
ref|WP_018919854.1|  4-alpha-glucanotransferase                         200   3e-55    
ref|WP_021583860.1|  4-alpha-glucanotransferase                         200   3e-55    
gb|AAK04794.1|AE006302_12  4-alpha-glucanotransferase                   195   4e-55    
ref|WP_025065016.1|  4-alpha-glucanotransferase                         200   4e-55    
ref|WP_019036340.1|  4-alpha-glucanotransferase                         200   4e-55    
ref|WP_022130260.1|  putative 4-alpha-glucanotransferase                200   4e-55    
ref|WP_036853695.1|  4-alpha-glucanotransferase                         199   4e-55    
ref|WP_008450798.1|  4-alpha-glucanotransferase                         199   4e-55    
ref|WP_009346989.1|  4-alpha-glucanotransferase                         199   5e-55    
ref|WP_039435200.1|  4-alpha-glucanotransferase                         199   5e-55    
ref|WP_007135395.1|  4-alpha-glucanotransferase                         199   6e-55    
ref|WP_008823581.1|  4-alpha-glucanotransferase                         199   6e-55    
ref|WP_036884779.1|  4-alpha-glucanotransferase                         199   6e-55    
ref|WP_016564758.1|  4-alpha-glucanotransferase                         199   6e-55    
ref|WP_040312203.1|  4-alpha-glucanotransferase                         199   7e-55    
ref|WP_045182260.1|  4-alpha-glucanotransferase                         199   7e-55    
gb|EDU99348.1|  putative 4-alpha-glucanotransferase                     199   7e-55    
ref|WP_006282881.1|  4-alpha-glucanotransferase                         199   8e-55    
ref|WP_004345018.1|  4-alpha-glucanotransferase                         199   8e-55    
ref|WP_021895781.1|  4-alpha-glucanotransferase                         199   8e-55    
gb|EDY97055.1|  putative 4-alpha-glucanotransferase                     198   8e-55    
ref|WP_028911240.1|  4-alpha-glucanotransferase                         199   9e-55    
ref|WP_025064510.1|  4-alpha-glucanotransferase                         199   1e-54    
ref|WP_022125224.1|  putative 4-alpha-glucanotransferase                199   1e-54    
ref|WP_040555850.1|  4-alpha-glucanotransferase                         199   1e-54    
gb|EFL46119.1|  putative 4-alpha-glucanotransferase                     199   1e-54    
ref|WP_036913929.1|  4-alpha-glucanotransferase                         198   1e-54    
gb|ERJ79348.1|  putative 4-alpha-glucanotransferase                     198   1e-54    
ref|WP_009018601.1|  4-alpha-glucanotransferase                         198   1e-54    
ref|WP_007410865.1|  4-alpha-glucanotransferase                         198   1e-54    
ref|WP_006949961.1|  4-alpha-glucanotransferase                         198   1e-54    
ref|WP_022286141.1|  4-alpha-glucanotransferase                         197   1e-54    
ref|WP_044545962.1|  4-alpha-glucanotransferase                         198   1e-54    
ref|WP_005865486.1|  MULTISPECIES: 4-alpha-glucanotransferase           198   1e-54    
ref|WP_036618310.1|  4-alpha-glucanotransferase                         198   1e-54    
ref|WP_009276785.1|  MULTISPECIES: 4-alpha-glucanotransferase           198   1e-54    
ref|WP_034702962.1|  4-alpha-glucanotransferase                         198   1e-54    
ref|WP_005855087.1|  MULTISPECIES: 4-alpha-glucanotransferase           198   1e-54    
ref|WP_009231788.1|  4-alpha-glucanotransferase                         198   1e-54    
ref|WP_011965851.1|  4-alpha-glucanotransferase                         198   1e-54    
ref|WP_036630293.1|  4-alpha-glucanotransferase                         198   1e-54    
ref|WP_039421486.1|  4-alpha-glucanotransferase                         198   1e-54    
ref|WP_021826204.1|  4-alpha-glucanotransferase                         198   2e-54    
ref|WP_004341165.1|  4-alpha-glucanotransferase                         198   2e-54    
gb|EIW93744.1|  4-alpha-glucanotransferase                              195   2e-54    
ref|WP_034712859.1|  4-alpha-glucanotransferase                         198   2e-54    
ref|WP_045089591.1|  hypothetical protein                               198   2e-54    
ref|WP_040312512.1|  4-alpha-glucanotransferase                         198   2e-54    
gb|ADE83753.1|  putative 4-alpha-glucanotransferase                     197   2e-54    
ref|WP_041386364.1|  4-alpha-glucanotransferase                         198   2e-54    
ref|WP_039114870.1|  4-alpha-glucanotransferase                         196   2e-54    
ref|WP_033150411.1|  4-alpha-glucanotransferase                         197   2e-54    
ref|WP_014708877.1|  4-alpha-glucanotransferase                         197   2e-54    
ref|WP_017864276.1|  4-alpha-glucanotransferase                         196   2e-54    
ref|WP_043890390.1|  4-alpha-glucanotransferase                         195   2e-54    
ref|WP_028906349.1|  4-alpha-glucanotransferase                         197   2e-54    
ref|WP_009163304.1|  putative 4-alpha-glucanotransferase                197   2e-54    
ref|WP_045167587.1|  4-alpha-glucanotransferase                         197   2e-54    
ref|WP_015426037.1|  4-alpha-glucanotransferase                         196   2e-54    
ref|WP_033898719.1|  4-alpha-glucanotransferase                         196   3e-54    
ref|WP_022054651.1|  hypothetical protein                               197   3e-54    
ref|WP_038599775.1|  4-alpha-glucanotransferase                         196   3e-54    
ref|WP_021722364.1|  4-alpha-glucanotransferase                         196   3e-54    
ref|WP_018965192.1|  4-alpha-glucanotransferase                         197   3e-54    
ref|WP_039441400.1|  4-alpha-glucanotransferase                         197   3e-54    
ref|WP_012897405.1|  4-alpha-glucanotransferase                         196   3e-54    
ref|WP_023188907.1|  4-alpha-glucanotransferase (amylomaltase)          196   3e-54    
ref|WP_023163862.1|  4-alpha-glucanotransferase                         196   3e-54    
ref|WP_039343000.1|  4-alpha-glucanotransferase                         197   3e-54    
ref|WP_039445938.1|  4-alpha-glucanotransferase                         197   3e-54    
ref|WP_039418279.1|  4-alpha-glucanotransferase                         197   3e-54    
ref|WP_039429257.1|  4-alpha-glucanotransferase                         197   3e-54    
ref|WP_003129628.1|  4-alpha-glucanotransferase                         196   4e-54    
ref|WP_028906834.1|  4-alpha-glucanotransferase                         197   4e-54    
ref|WP_027455236.1|  4-alpha-glucanotransferase                         197   4e-54    
ref|WP_027451095.1|  4-alpha-glucanotransferase                         196   5e-54    
ref|WP_021589536.1|  4-alpha-glucanotransferase                         197   5e-54    
ref|WP_021661883.1|  putative 4-alpha-glucanotransferase                197   5e-54    
gb|AAQ65928.1|  4-alpha-glucanotransferase                              195   5e-54    
ref|WP_009236366.1|  4-alpha-glucanotransferase                         197   5e-54    
ref|WP_018362962.1|  4-alpha-glucanotransferase                         197   5e-54    
ref|WP_022150378.1|  4-alpha-glucanotransferase                         196   5e-54    
ref|WP_013816459.1|  4-alpha-glucanotransferase                         196   6e-54    
ref|WP_013618047.1|  4-alpha-glucanotransferase                         196   6e-54    
ref|WP_021665190.1|  putative 4-alpha-glucanotransferase                196   6e-54    
ref|WP_028909249.1|  4-alpha-glucanotransferase                         196   6e-54    
ref|WP_045492401.1|  4-alpha-glucanotransferase                         196   7e-54    
ref|WP_039353745.1|  4-alpha-glucanotransferase                         196   8e-54    
ref|WP_004378436.1|  4-alpha-glucanotransferase                         196   9e-54    
ref|WP_022038949.1|  4-alpha-glucanotransferase                         196   1e-53    
ref|WP_021348426.1|  4-alpha-glucanotransferase                         196   1e-53    
ref|WP_036869168.1|  4-alpha-glucanotransferase                         196   1e-53    
ref|WP_039425730.1|  4-alpha-glucanotransferase                         196   1e-53    
ref|WP_018966991.1|  4-alpha-glucanotransferase                         196   1e-53    
ref|WP_023846808.1|  4-alpha-glucanotransferase                         195   1e-53    



>ref|XP_011079098.1| PREDICTED: 4-alpha-glucanotransferase DPE2 [Sesamum indicum]
Length=974

 Score =   447 bits (1149),  Expect = 8e-147, Method: Compositional matrix adjust.
 Identities = 204/248 (82%), Positives = 227/248 (92%), Gaps = 0/248 (0%)
 Frame = +1

Query  1    FVENEEKLRRNLFDLLQEVVLIRDREDPRKFYPRFNLEDTSSFKGLDQHSKNVLKRLYYD  180
            F+E+EEK+RRNLFDL+Q VVLI+DRED +KFYPRFNLEDTSSF  LD+HSKN+LKRLYYD
Sbjct  664  FLESEEKIRRNLFDLIQNVVLIKDREDSKKFYPRFNLEDTSSFSDLDEHSKNILKRLYYD  723

Query  181  YYFHRQESLWRQNALNTLPVLMNSSDMLTCGEDLGMIPACVNPVMQELGLIGLHIQRMPS  360
            YYF RQE+LWRQNAL TLPVL+NSSDML CGEDLG+IP+CV+PVMQELGLIGL IQRMPS
Sbjct  724  YYFQRQETLWRQNALKTLPVLLNSSDMLACGEDLGLIPSCVHPVMQELGLIGLRIQRMPS  783

Query  361  EPGREFGIPSEYSYMTVCAPSCHDCSTLRAWWEEDEGRRRRYFQTVVGSGAVPPDECTPE  540
            EPG EFGIPS+YSYMTVCAPSCHDCSTLRAWWEEDE RRRR+FQTVVGS  +PPD CTPE
Sbjct  784  EPGVEFGIPSQYSYMTVCAPSCHDCSTLRAWWEEDEDRRRRFFQTVVGSDLLPPDRCTPE  843

Query  541  IARFVLRKHVESPSMWSIFPLQDLLALKEDYATRPAVEETINDPTXPRHYWRYRMHVTME  720
            I  FVLR+HVE+PSMW+IFPLQDLLALK+ Y TRPA EETINDPT P+HYWRYR+HVT+E
Sbjct  844  IVEFVLRQHVEAPSMWAIFPLQDLLALKDKYTTRPAAEETINDPTNPKHYWRYRVHVTLE  903

Query  721  SLLNDKSL  744
            SLL DK L
Sbjct  904  SLLEDKEL  911



>ref|NP_001275176.1| 4-alpha-glucanotransferase [Solanum tuberosum]
 gb|AAR99599.1| 4-alpha-glucanotransferase [Solanum tuberosum]
Length=948

 Score =   444 bits (1142),  Expect = 5e-146, Method: Compositional matrix adjust.
 Identities = 204/248 (82%), Positives = 224/248 (90%), Gaps = 0/248 (0%)
 Frame = +1

Query  1    FVENEEKLRRNLFDLLQEVVLIRDREDPRKFYPRFNLEDTSSFKGLDQHSKNVLKRLYYD  180
            FVE+EEKLRR LFDLLQ V LI+D EDPRKFYPRFN+EDT+SF  LDQHS+NVLKRLYYD
Sbjct  656  FVESEEKLRRKLFDLLQNVALIKDPEDPRKFYPRFNVEDTTSFMDLDQHSQNVLKRLYYD  715

Query  181  YYFHRQESLWRQNALNTLPVLMNSSDMLTCGEDLGMIPACVNPVMQELGLIGLHIQRMPS  360
            YYFHRQE LWR NA  TLPVL+NSSDML CGEDLG+IP+CV+PVMQELGL+GL IQRMPS
Sbjct  716  YYFHRQEGLWRDNAFKTLPVLLNSSDMLACGEDLGLIPSCVHPVMQELGLVGLRIQRMPS  775

Query  361  EPGREFGIPSEYSYMTVCAPSCHDCSTLRAWWEEDEGRRRRYFQTVVGSGAVPPDECTPE  540
            EP  EFGIPS+Y+YMTVCAPSCHDCSTLRAWWEEDE RR R+FQ V+GS  +PPD+CTPE
Sbjct  776  EPDVEFGIPSQYNYMTVCAPSCHDCSTLRAWWEEDEERRHRFFQAVMGSDELPPDQCTPE  835

Query  541  IARFVLRKHVESPSMWSIFPLQDLLALKEDYATRPAVEETINDPTXPRHYWRYRMHVTME  720
            I  FVLR+HVE+PSMWSIFPLQDLLALKEDY TRPAVEETINDPT P+HYWRYR+HVTME
Sbjct  836  IVHFVLRQHVEAPSMWSIFPLQDLLALKEDYTTRPAVEETINDPTNPKHYWRYRVHVTME  895

Query  721  SLLNDKSL  744
            SLLNDK L
Sbjct  896  SLLNDKDL  903



>gb|EYU20828.1| hypothetical protein MIMGU_mgv1a000923mg [Erythranthe guttata]
Length=942

 Score =   441 bits (1134),  Expect = 6e-145, Method: Compositional matrix adjust.
 Identities = 205/248 (83%), Positives = 222/248 (90%), Gaps = 0/248 (0%)
 Frame = +1

Query  1    FVENEEKLRRNLFDLLQEVVLIRDREDPRKFYPRFNLEDTSSFKGLDQHSKNVLKRLYYD  180
             VE+EEKLRRNLFDLLQ VVLIRD ED + FYPRFNLEDTSSF  LD HSK+V+KRLYYD
Sbjct  642  LVESEEKLRRNLFDLLQNVVLIRDPEDSKSFYPRFNLEDTSSFNDLDNHSKDVMKRLYYD  701

Query  181  YYFHRQESLWRQNALNTLPVLMNSSDMLTCGEDLGMIPACVNPVMQELGLIGLHIQRMPS  360
            YYF RQE++WRQNAL TLPVLMNSSDML CGEDLGMIP+CV PVMQELGLIGL IQRMP+
Sbjct  702  YYFQRQETMWRQNALKTLPVLMNSSDMLACGEDLGMIPSCVYPVMQELGLIGLRIQRMPN  761

Query  361  EPGREFGIPSEYSYMTVCAPSCHDCSTLRAWWEEDEGRRRRYFQTVVGSGAVPPDECTPE  540
            EPG EFGIPS+YSYMTV APSCHDCSTLRAWWEEDE RR RYF+TVVG+   PPD CTPE
Sbjct  762  EPGLEFGIPSQYSYMTVNAPSCHDCSTLRAWWEEDEERRSRYFKTVVGADVAPPDRCTPE  821

Query  541  IARFVLRKHVESPSMWSIFPLQDLLALKEDYATRPAVEETINDPTXPRHYWRYRMHVTME  720
            IA FVLR+HVESPSMWSIFPLQDLLALKE+Y TRPAVEETINDPT P+HYWR+R+HVTME
Sbjct  822  IAHFVLRQHVESPSMWSIFPLQDLLALKEEYTTRPAVEETINDPTNPKHYWRFRVHVTME  881

Query  721  SLLNDKSL  744
            SLL D+ L
Sbjct  882  SLLKDREL  889



>ref|XP_006345302.1| PREDICTED: 4-alpha-glucanotransferase DPE2 [Solanum tuberosum]
Length=948

 Score =   440 bits (1131),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 202/248 (81%), Positives = 223/248 (90%), Gaps = 0/248 (0%)
 Frame = +1

Query  1    FVENEEKLRRNLFDLLQEVVLIRDREDPRKFYPRFNLEDTSSFKGLDQHSKNVLKRLYYD  180
            FVE+EEKLRR LFDLLQ V LI+D EDPRKFYPRFN+EDT+SF  LDQHS+NVLKR YYD
Sbjct  656  FVESEEKLRRILFDLLQNVALIKDPEDPRKFYPRFNVEDTTSFMDLDQHSQNVLKRFYYD  715

Query  181  YYFHRQESLWRQNALNTLPVLMNSSDMLTCGEDLGMIPACVNPVMQELGLIGLHIQRMPS  360
            YYFHRQE LWR NA  TLPVL+NSSDML CGEDLG+IP+CV+PVMQELGL+GL IQRMPS
Sbjct  716  YYFHRQEGLWRDNAFKTLPVLLNSSDMLACGEDLGLIPSCVHPVMQELGLVGLRIQRMPS  775

Query  361  EPGREFGIPSEYSYMTVCAPSCHDCSTLRAWWEEDEGRRRRYFQTVVGSGAVPPDECTPE  540
            EP  EFGIPS+Y+YMTVCAPSCHDCSTLRAWWEEDE RR R++Q V+GS  +PPD+CTPE
Sbjct  776  EPDVEFGIPSQYNYMTVCAPSCHDCSTLRAWWEEDEERRHRFYQAVMGSDELPPDQCTPE  835

Query  541  IARFVLRKHVESPSMWSIFPLQDLLALKEDYATRPAVEETINDPTXPRHYWRYRMHVTME  720
            I  FVLR+HVE+PSMWSIFPLQDLLALKEDY TRPAVEETINDPT P+HYWRYR+HVTME
Sbjct  836  IVHFVLRQHVEAPSMWSIFPLQDLLALKEDYTTRPAVEETINDPTNPKHYWRYRVHVTME  895

Query  721  SLLNDKSL  744
            SLLNDK L
Sbjct  896  SLLNDKDL  903



>ref|XP_009624643.1| PREDICTED: 4-alpha-glucanotransferase DPE2 [Nicotiana tomentosiformis]
 ref|XP_009624651.1| PREDICTED: 4-alpha-glucanotransferase DPE2 [Nicotiana tomentosiformis]
Length=966

 Score =   439 bits (1130),  Expect = 4e-144, Method: Compositional matrix adjust.
 Identities = 203/248 (82%), Positives = 223/248 (90%), Gaps = 0/248 (0%)
 Frame = +1

Query  1    FVENEEKLRRNLFDLLQEVVLIRDREDPRKFYPRFNLEDTSSFKGLDQHSKNVLKRLYYD  180
             VE+EEKLRR LFDLLQ V LI+D ED RKFYPRFN+EDT SFK LDQHS+NVLK+LYYD
Sbjct  662  LVESEEKLRRKLFDLLQNVALIKDPEDLRKFYPRFNIEDTKSFKDLDQHSQNVLKKLYYD  721

Query  181  YYFHRQESLWRQNALNTLPVLMNSSDMLTCGEDLGMIPACVNPVMQELGLIGLHIQRMPS  360
            YYF RQE LWRQNAL TLPVL+NSS+ML CGEDLG+IP+CV+PVMQELGL+GL IQRMPS
Sbjct  722  YYFQRQEGLWRQNALKTLPVLLNSSNMLACGEDLGLIPSCVHPVMQELGLVGLRIQRMPS  781

Query  361  EPGREFGIPSEYSYMTVCAPSCHDCSTLRAWWEEDEGRRRRYFQTVVGSGAVPPDECTPE  540
            EPG EFGIPS+YSYMTVCAPSCHDCSTLRAWWEEDE RR R+FQ VVGS  +PPD+CTPE
Sbjct  782  EPGLEFGIPSQYSYMTVCAPSCHDCSTLRAWWEEDEERRHRFFQAVVGSDELPPDQCTPE  841

Query  541  IARFVLRKHVESPSMWSIFPLQDLLALKEDYATRPAVEETINDPTXPRHYWRYRMHVTME  720
            I  FVLR+HVE+PSMWSIFPLQDLLALKEDY TR AVEETINDPT P+HYWRYR+HVTME
Sbjct  842  IVHFVLRQHVEAPSMWSIFPLQDLLALKEDYTTRSAVEETINDPTNPKHYWRYRVHVTME  901

Query  721  SLLNDKSL  744
            SLL+DK L
Sbjct  902  SLLDDKDL  909



>ref|XP_010315588.1| PREDICTED: 4-alpha-glucanotransferase DPE2 [Solanum lycopersicum]
Length=954

 Score =   436 bits (1121),  Expect = 6e-143, Method: Compositional matrix adjust.
 Identities = 201/248 (81%), Positives = 221/248 (89%), Gaps = 0/248 (0%)
 Frame = +1

Query  1    FVENEEKLRRNLFDLLQEVVLIRDREDPRKFYPRFNLEDTSSFKGLDQHSKNVLKRLYYD  180
            F+E+E KLRR LFDLLQ V LI D EDPRKFYPRFN+EDT+SF  LDQHS+NVLKRLYYD
Sbjct  656  FLESEVKLRRKLFDLLQNVALINDPEDPRKFYPRFNVEDTTSFMDLDQHSQNVLKRLYYD  715

Query  181  YYFHRQESLWRQNALNTLPVLMNSSDMLTCGEDLGMIPACVNPVMQELGLIGLHIQRMPS  360
            YYFHRQE LWR NA  TLPVL+NSSDML CGEDLG+IP+CV+PVMQELGL+GL IQRMPS
Sbjct  716  YYFHRQEGLWRDNAFKTLPVLLNSSDMLACGEDLGLIPSCVHPVMQELGLVGLRIQRMPS  775

Query  361  EPGREFGIPSEYSYMTVCAPSCHDCSTLRAWWEEDEGRRRRYFQTVVGSGAVPPDECTPE  540
            EP  EF IPS+Y+YMTVCAPSCHDCSTLRAWWEEDE RR R+FQ V+GS  +PPD+CTPE
Sbjct  776  EPDLEFDIPSQYNYMTVCAPSCHDCSTLRAWWEEDEERRHRFFQAVMGSDELPPDQCTPE  835

Query  541  IARFVLRKHVESPSMWSIFPLQDLLALKEDYATRPAVEETINDPTXPRHYWRYRMHVTME  720
            I  FVLR+HVE+PSMWSIFPLQDLLALKEDY TRPAVEETINDPT P+HYWRYR+HVTME
Sbjct  836  IVHFVLRQHVEAPSMWSIFPLQDLLALKEDYTTRPAVEETINDPTNPKHYWRYRVHVTME  895

Query  721  SLLNDKSL  744
            SLLNDK L
Sbjct  896  SLLNDKDL  903



>ref|XP_009766995.1| PREDICTED: 4-alpha-glucanotransferase DPE2 [Nicotiana sylvestris]
Length=574

 Score =   422 bits (1086),  Expect = 5e-142, Method: Compositional matrix adjust.
 Identities = 194/237 (82%), Positives = 214/237 (90%), Gaps = 0/237 (0%)
 Frame = +1

Query  1    FVENEEKLRRNLFDLLQEVVLIRDREDPRKFYPRFNLEDTSSFKGLDQHSKNVLKRLYYD  180
             V++EEKLRR LFDLLQ V LI+D ED RKFYPRFN+EDT+SFK LDQHS+NVLKRLYYD
Sbjct  321  LVKSEEKLRRKLFDLLQNVALIKDPEDLRKFYPRFNIEDTTSFKDLDQHSQNVLKRLYYD  380

Query  181  YYFHRQESLWRQNALNTLPVLMNSSDMLTCGEDLGMIPACVNPVMQELGLIGLHIQRMPS  360
            YYF RQE LWRQNAL TLPVL+NSS+ML CGEDLG+IP+CV+PVMQELGL+GL IQRMPS
Sbjct  381  YYFQRQEGLWRQNALKTLPVLLNSSNMLACGEDLGLIPSCVHPVMQELGLVGLRIQRMPS  440

Query  361  EPGREFGIPSEYSYMTVCAPSCHDCSTLRAWWEEDEGRRRRYFQTVVGSGAVPPDECTPE  540
            EPG EFGIPS+YSYMTVCAPSCHDCSTLRAWWEEDE RR R+FQ VVGS  +PPD+CTPE
Sbjct  441  EPGLEFGIPSQYSYMTVCAPSCHDCSTLRAWWEEDEERRHRFFQAVVGSDELPPDQCTPE  500

Query  541  IARFVLRKHVESPSMWSIFPLQDLLALKEDYATRPAVEETINDPTXPRHYWRYRMHV  711
            I  FVLR+HVE+PSMWSIFPLQDLLALKEDY TRPAVEETINDPT P+HYWRYRM +
Sbjct  501  IVHFVLRQHVEAPSMWSIFPLQDLLALKEDYTTRPAVEETINDPTNPKHYWRYRMCI  557



>gb|ACL54411.1| unknown [Zea mays]
Length=444

 Score =   417 bits (1073),  Expect = 6e-142, Method: Compositional matrix adjust.
 Identities = 189/248 (76%), Positives = 220/248 (89%), Gaps = 0/248 (0%)
 Frame = +1

Query  1    FVENEEKLRRNLFDLLQEVVLIRDREDPRKFYPRFNLEDTSSFKGLDQHSKNVLKRLYYD  180
            +VE E+ +RR LFDLLQ +VLIRD ED  KFYPRFNLEDTSSF+ LD+HSKN+L+RLYY+
Sbjct  158  WVEKEDNIRRGLFDLLQNIVLIRDPEDSTKFYPRFNLEDTSSFRDLDEHSKNILRRLYYN  217

Query  181  YYFHRQESLWRQNALNTLPVLMNSSDMLTCGEDLGMIPACVNPVMQELGLIGLHIQRMPS  360
            YYF RQE+LWRQNAL TLPVL+NSSDML CGEDLG+IPACV+PVMQELGLIGL IQRMPS
Sbjct  218  YYFVRQENLWRQNALKTLPVLLNSSDMLACGEDLGLIPACVHPVMQELGLIGLRIQRMPS  277

Query  361  EPGREFGIPSEYSYMTVCAPSCHDCSTLRAWWEEDEGRRRRYFQTVVGSGAVPPDECTPE  540
            EP  EFGIPS+YSYMTVCAPSCHDCSTLRAWWEEDEGRR R+++TVVGS   PP  CTPE
Sbjct  278  EPNLEFGIPSQYSYMTVCAPSCHDCSTLRAWWEEDEGRRSRFYKTVVGSDEEPPSRCTPE  337

Query  541  IARFVLRKHVESPSMWSIFPLQDLLALKEDYATRPAVEETINDPTXPRHYWRYRMHVTME  720
            +  F++++H ++PSMW+IFPLQDLLALK+ Y TRPA EETINDPT P+HYWR+R+HVT+E
Sbjct  338  VVHFIVQQHFDAPSMWAIFPLQDLLALKDKYTTRPAPEETINDPTNPKHYWRFRVHVTLE  397

Query  721  SLLNDKSL  744
            SLLNDK +
Sbjct  398  SLLNDKDI  405



>emb|CDP16326.1| unnamed protein product [Coffea canephora]
Length=712

 Score =   426 bits (1096),  Expect = 9e-142, Method: Compositional matrix adjust.
 Identities = 194/247 (79%), Positives = 224/247 (91%), Gaps = 0/247 (0%)
 Frame = +1

Query  4    VENEEKLRRNLFDLLQEVVLIRDREDPRKFYPRFNLEDTSSFKGLDQHSKNVLKRLYYDY  183
            +E+EEKLR  LFDLL+++VLIRD EDPRKFYPRF++EDTS+F+ LD+HSKN L+RLY DY
Sbjct  406  LESEEKLRLQLFDLLRDIVLIRDPEDPRKFYPRFSMEDTSNFRELDEHSKNTLRRLYNDY  465

Query  184  YFHRQESLWRQNALNTLPVLMNSSDMLTCGEDLGMIPACVNPVMQELGLIGLHIQRMPSE  363
            YFHRQESLWRQNA+ TLPVL+NSSDML CGEDLG+IP+CV+PVMQELGLIGL IQRMPSE
Sbjct  466  YFHRQESLWRQNAMKTLPVLLNSSDMLACGEDLGLIPSCVHPVMQELGLIGLRIQRMPSE  525

Query  364  PGREFGIPSEYSYMTVCAPSCHDCSTLRAWWEEDEGRRRRYFQTVVGSGAVPPDECTPEI  543
            PG EFGIPS+Y YMTVCAPSCHDCSTLRAWWEEDEGRR R+FQT +GS   PPD+C PEI
Sbjct  526  PGLEFGIPSQYPYMTVCAPSCHDCSTLRAWWEEDEGRRLRFFQTFLGSNNSPPDQCIPEI  585

Query  544  ARFVLRKHVESPSMWSIFPLQDLLALKEDYATRPAVEETINDPTXPRHYWRYRMHVTMES  723
            A F++++HVE+PSMWSIFP+QDLLALKE+Y TR AVEETINDPT P+HYWRYR+HVT+ES
Sbjct  586  AYFIIQQHVEAPSMWSIFPVQDLLALKEEYTTRLAVEETINDPTNPKHYWRYRVHVTLES  645

Query  724  LLNDKSL  744
            LL DK L
Sbjct  646  LLKDKDL  652



>gb|AJO70152.1| disproportionating enzyme 2 [Camellia sinensis]
Length=970

 Score =   432 bits (1110),  Expect = 5e-141, Method: Compositional matrix adjust.
 Identities = 198/248 (80%), Positives = 221/248 (89%), Gaps = 0/248 (0%)
 Frame = +1

Query  1    FVENEEKLRRNLFDLLQEVVLIRDREDPRKFYPRFNLEDTSSFKGLDQHSKNVLKRLYYD  180
             +++E+K+RRNLFDLLQ +VLIRD ED RKFYPRFNLEDTSSFK LD HSKNVLKR YYD
Sbjct  664  LLDSEDKIRRNLFDLLQNIVLIRDPEDARKFYPRFNLEDTSSFKDLDNHSKNVLKRFYYD  723

Query  181  YYFHRQESLWRQNALNTLPVLMNSSDMLTCGEDLGMIPACVNPVMQELGLIGLHIQRMPS  360
            YYF RQESLWRQNAL TLPVL+NSSDML CGEDLG+IP+CV+PVMQELGLIGL IQRMPS
Sbjct  724  YYFQRQESLWRQNALKTLPVLLNSSDMLACGEDLGLIPSCVHPVMQELGLIGLRIQRMPS  783

Query  361  EPGREFGIPSEYSYMTVCAPSCHDCSTLRAWWEEDEGRRRRYFQTVVGSGAVPPDECTPE  540
            EP  EFGIPS+Y YMTVCAPSCHDCSTLRAWWEEDE RR R+F+ V+GS ++PP +C PE
Sbjct  784  EPDLEFGIPSQYPYMTVCAPSCHDCSTLRAWWEEDEERRCRFFKNVIGSDSLPPSQCVPE  843

Query  541  IARFVLRKHVESPSMWSIFPLQDLLALKEDYATRPAVEETINDPTXPRHYWRYRMHVTME  720
            IA F+ R+HVESPSMW+IFPLQDLLALKE+Y TRPA EETINDPT P+HYWRYR+HVTME
Sbjct  844  IAYFIQRQHVESPSMWAIFPLQDLLALKEEYTTRPAAEETINDPTNPKHYWRYRVHVTME  903

Query  721  SLLNDKSL  744
            SLL DK L
Sbjct  904  SLLKDKXL  911



>ref|XP_002323208.2| hypothetical protein POPTR_0016s02870g [Populus trichocarpa]
 gb|EEF04969.2| hypothetical protein POPTR_0016s02870g [Populus trichocarpa]
Length=975

 Score =   429 bits (1104),  Expect = 5e-140, Method: Compositional matrix adjust.
 Identities = 197/248 (79%), Positives = 221/248 (89%), Gaps = 0/248 (0%)
 Frame = +1

Query  1    FVENEEKLRRNLFDLLQEVVLIRDREDPRKFYPRFNLEDTSSFKGLDQHSKNVLKRLYYD  180
             +E+E+K+RR+LFDLL+ +VLIRD ED  KFYPRFNLEDTSSF+ LD HSKNVLKRLYYD
Sbjct  665  LLESEDKIRRDLFDLLKNIVLIRDPEDESKFYPRFNLEDTSSFQDLDDHSKNVLKRLYYD  724

Query  181  YYFHRQESLWRQNALNTLPVLMNSSDMLTCGEDLGMIPACVNPVMQELGLIGLHIQRMPS  360
            YYFHRQE+LWRQNAL TLP L++SSDML CGEDLG+IPACV+PVMQELGLIGL IQRM S
Sbjct  725  YYFHRQENLWRQNALKTLPALLDSSDMLACGEDLGLIPACVHPVMQELGLIGLRIQRMSS  784

Query  361  EPGREFGIPSEYSYMTVCAPSCHDCSTLRAWWEEDEGRRRRYFQTVVGSGAVPPDECTPE  540
            EP  EFGIPS+YSYMTVCAPSCHDCSTLRAWWEEDE RR RYF+ VVGS  +PP  C PE
Sbjct  785  EPDLEFGIPSQYSYMTVCAPSCHDCSTLRAWWEEDEERRCRYFKNVVGSDGIPPSRCVPE  844

Query  541  IARFVLRKHVESPSMWSIFPLQDLLALKEDYATRPAVEETINDPTXPRHYWRYRMHVTME  720
            IA FVLR+HVE+PSMW+IFPLQDLLALKE+Y TRPA EETINDPT P+HYWRYR+HVT+E
Sbjct  845  IAHFVLRQHVEAPSMWAIFPLQDLLALKEEYTTRPAAEETINDPTNPKHYWRYRVHVTLE  904

Query  721  SLLNDKSL  744
            SL+NDK L
Sbjct  905  SLMNDKEL  912



>ref|XP_012074687.1| PREDICTED: 4-alpha-glucanotransferase DPE2 [Jatropha curcas]
 gb|KDP35768.1| hypothetical protein JCGZ_10848 [Jatropha curcas]
Length=944

 Score =   427 bits (1099),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 194/248 (78%), Positives = 224/248 (90%), Gaps = 0/248 (0%)
 Frame = +1

Query  1    FVENEEKLRRNLFDLLQEVVLIRDREDPRKFYPRFNLEDTSSFKGLDQHSKNVLKRLYYD  180
             +E+E+K+R +LFDLL+ +VLIRD ED RKFYPRFNLEDTSSF+ LD HSKNVLKRLY+D
Sbjct  663  LLESEDKIRNDLFDLLKNIVLIRDPEDSRKFYPRFNLEDTSSFQALDDHSKNVLKRLYHD  722

Query  181  YYFHRQESLWRQNALNTLPVLMNSSDMLTCGEDLGMIPACVNPVMQELGLIGLHIQRMPS  360
            YYFHRQE+LWRQNA+ TLPVL+NSSDML CGEDLG+IPACV+PVMQ+LGLIGL IQRMPS
Sbjct  723  YYFHRQETLWRQNAMKTLPVLLNSSDMLACGEDLGLIPACVHPVMQDLGLIGLRIQRMPS  782

Query  361  EPGREFGIPSEYSYMTVCAPSCHDCSTLRAWWEEDEGRRRRYFQTVVGSGAVPPDECTPE  540
            EPG EFG PS YSYMTVCAPSCHDCST+RAWWEEDE RR R+F+ VVGS A+PP  CTPE
Sbjct  783  EPGVEFGNPSHYSYMTVCAPSCHDCSTMRAWWEEDEERRFRFFKNVVGSDALPPSRCTPE  842

Query  541  IARFVLRKHVESPSMWSIFPLQDLLALKEDYATRPAVEETINDPTXPRHYWRYRMHVTME  720
            IA F++R+HVE+PSMW+IFPLQDLLALKE+Y TRPA EETINDPT P+HYWRYR+HVT+E
Sbjct  843  IADFIIRQHVEAPSMWAIFPLQDLLALKEEYMTRPATEETINDPTNPKHYWRYRVHVTLE  902

Query  721  SLLNDKSL  744
            SL+ DK+L
Sbjct  903  SLMKDKAL  910



>ref|XP_011041346.1| PREDICTED: 4-alpha-glucanotransferase DPE2-like [Populus euphratica]
 ref|XP_011041347.1| PREDICTED: 4-alpha-glucanotransferase DPE2-like [Populus euphratica]
Length=974

 Score =   428 bits (1100),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 197/248 (79%), Positives = 221/248 (89%), Gaps = 0/248 (0%)
 Frame = +1

Query  1    FVENEEKLRRNLFDLLQEVVLIRDREDPRKFYPRFNLEDTSSFKGLDQHSKNVLKRLYYD  180
             +E+E+K+R +LFDLL+ +VLIRD ED  KFYPRFNLEDTSSF+ LD HSKNVLKRLYYD
Sbjct  664  LLESEDKIRCDLFDLLKNIVLIRDPEDESKFYPRFNLEDTSSFQDLDDHSKNVLKRLYYD  723

Query  181  YYFHRQESLWRQNALNTLPVLMNSSDMLTCGEDLGMIPACVNPVMQELGLIGLHIQRMPS  360
            YYFHRQE+LWRQNAL TLP L++SSDML CGEDLG+IPACV+PVMQELGLIGL IQRMPS
Sbjct  724  YYFHRQENLWRQNALKTLPALLDSSDMLACGEDLGLIPACVHPVMQELGLIGLRIQRMPS  783

Query  361  EPGREFGIPSEYSYMTVCAPSCHDCSTLRAWWEEDEGRRRRYFQTVVGSGAVPPDECTPE  540
            EP  EFGIPS+YSYMTVCAPSCHDCSTLRAWWEEDE RR RYF+ VVGS  +PP  C PE
Sbjct  784  EPDLEFGIPSQYSYMTVCAPSCHDCSTLRAWWEEDEERRCRYFKNVVGSDGIPPSRCVPE  843

Query  541  IARFVLRKHVESPSMWSIFPLQDLLALKEDYATRPAVEETINDPTXPRHYWRYRMHVTME  720
            IA FVLR+HVE+PSMW+IFPLQDLLALKE+Y TRPA EETINDPT P+HYWRYR+HVT+E
Sbjct  844  IAHFVLRQHVEAPSMWAIFPLQDLLALKEEYMTRPAAEETINDPTNPKHYWRYRVHVTLE  903

Query  721  SLLNDKSL  744
            SL+NDK L
Sbjct  904  SLMNDKEL  911



>tpg|DAA64018.1| TPA: LOW QUALITY PROTEIN: hypothetical protein ZEAMMB73_565446 
[Zea mays]
Length=443

 Score =   411 bits (1056),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 188/248 (76%), Positives = 219/248 (88%), Gaps = 1/248 (0%)
 Frame = +1

Query  1    FVENEEKLRRNLFDLLQEVVLIRDREDPRKFYPRFNLEDTSSFKGLDQHSKNVLKRLYYD  180
            +VE E+ +RR LFDLLQ +VLIRD ED  KFYP FNLEDTSSF+ LD+HSKN+L+RLYY+
Sbjct  158  WVEKEDNIRRGLFDLLQNIVLIRDPEDSTKFYP-FNLEDTSSFRDLDEHSKNILRRLYYN  216

Query  181  YYFHRQESLWRQNALNTLPVLMNSSDMLTCGEDLGMIPACVNPVMQELGLIGLHIQRMPS  360
            YYF RQE+LWRQNAL TLPVL+NSSDML CGEDLG+IPACV+PVMQELGLIGL IQRMPS
Sbjct  217  YYFVRQENLWRQNALKTLPVLLNSSDMLACGEDLGLIPACVHPVMQELGLIGLRIQRMPS  276

Query  361  EPGREFGIPSEYSYMTVCAPSCHDCSTLRAWWEEDEGRRRRYFQTVVGSGAVPPDECTPE  540
            EP  EFGIPS+YSYMTVCAPSCHDCSTLRAWWEEDEGRR R+++TVVGS   PP  CTPE
Sbjct  277  EPNLEFGIPSQYSYMTVCAPSCHDCSTLRAWWEEDEGRRSRFYKTVVGSDEEPPSRCTPE  336

Query  541  IARFVLRKHVESPSMWSIFPLQDLLALKEDYATRPAVEETINDPTXPRHYWRYRMHVTME  720
            +  F++++H ++PSMW+IFPLQDLLALK+ Y TRPA EETINDPT P+HYWR+R+HVT+E
Sbjct  337  VVHFIVQQHFDAPSMWAIFPLQDLLALKDKYTTRPAPEETINDPTNPKHYWRFRVHVTLE  396

Query  721  SLLNDKSL  744
            SLLNDK +
Sbjct  397  SLLNDKDI  404



>ref|XP_007162030.1| hypothetical protein PHAVU_001G117700g, partial [Phaseolus vulgaris]
 gb|ESW34024.1| hypothetical protein PHAVU_001G117700g, partial [Phaseolus vulgaris]
Length=646

 Score =   417 bits (1072),  Expect = 6e-139, Method: Compositional matrix adjust.
 Identities = 191/248 (77%), Positives = 218/248 (88%), Gaps = 0/248 (0%)
 Frame = +1

Query  1    FVENEEKLRRNLFDLLQEVVLIRDREDPRKFYPRFNLEDTSSFKGLDQHSKNVLKRLYYD  180
             +E+E+KLRRNLFDL Q +VLIRD E PRKFYPRFNLEDTSSF+ LD HSKNVLKRLY D
Sbjct  337  LLESEDKLRRNLFDLSQNIVLIRDPEYPRKFYPRFNLEDTSSFQDLDDHSKNVLKRLYND  396

Query  181  YYFHRQESLWRQNALNTLPVLMNSSDMLTCGEDLGMIPACVNPVMQELGLIGLHIQRMPS  360
            YYF RQE+LW QNAL TLPVL+NSSDML CGEDLG+IP+CV+PVMQELGL+GL IQRMP+
Sbjct  397  YYFCRQENLWSQNALKTLPVLLNSSDMLACGEDLGLIPSCVHPVMQELGLVGLRIQRMPN  456

Query  361  EPGREFGIPSEYSYMTVCAPSCHDCSTLRAWWEEDEGRRRRYFQTVVGSGAVPPDECTPE  540
            EP  EFGIPS+YSYMTVCAPSCHDCSTLRAWWEEDE RR R+F+ VV S  +PPD+C PE
Sbjct  457  EPDLEFGIPSQYSYMTVCAPSCHDCSTLRAWWEEDEDRRLRFFKNVVESDELPPDQCVPE  516

Query  541  IARFVLRKHVESPSMWSIFPLQDLLALKEDYATRPAVEETINDPTXPRHYWRYRMHVTME  720
            +A FVLR+H E+PSMW+IFPLQDLLALKE+Y TRPA EETINDPT P+HYWRYR+HV++E
Sbjct  517  VAHFVLRQHFEAPSMWAIFPLQDLLALKEEYTTRPATEETINDPTNPKHYWRYRVHVSLE  576

Query  721  SLLNDKSL  744
            SL+ D  L
Sbjct  577  SLIKDIEL  584



>ref|XP_010251909.1| PREDICTED: 4-alpha-glucanotransferase DPE2 isoform X2 [Nelumbo 
nucifera]
Length=946

 Score =   426 bits (1094),  Expect = 6e-139, Method: Compositional matrix adjust.
 Identities = 193/248 (78%), Positives = 223/248 (90%), Gaps = 0/248 (0%)
 Frame = +1

Query  1    FVENEEKLRRNLFDLLQEVVLIRDREDPRKFYPRFNLEDTSSFKGLDQHSKNVLKRLYYD  180
            ++ENE+K++R LFDLLQ +VLIRD ED RKFYPRFNLEDTSSFK LD HSKNVLKRLY+D
Sbjct  663  WLENEDKIQRGLFDLLQNIVLIRDPEDARKFYPRFNLEDTSSFKNLDDHSKNVLKRLYHD  722

Query  181  YYFHRQESLWRQNALNTLPVLMNSSDMLTCGEDLGMIPACVNPVMQELGLIGLHIQRMPS  360
            YYFHRQE+LWRQN+L TLPVL+NSSDML CGEDLG+IP+CV+PVMQELGLIGL IQRMPS
Sbjct  723  YYFHRQETLWRQNSLKTLPVLLNSSDMLACGEDLGLIPSCVHPVMQELGLIGLRIQRMPS  782

Query  361  EPGREFGIPSEYSYMTVCAPSCHDCSTLRAWWEEDEGRRRRYFQTVVGSGAVPPDECTPE  540
            EPG  FGIPS+YSYMTVCAPSCHDCST+RAWWEEDE RR ++F+TVVGS  VPPD+C P+
Sbjct  783  EPGLVFGIPSQYSYMTVCAPSCHDCSTMRAWWEEDEERRYQFFRTVVGSSDVPPDQCVPD  842

Query  541  IARFVLRKHVESPSMWSIFPLQDLLALKEDYATRPAVEETINDPTXPRHYWRYRMHVTME  720
            IA F+L++HVE+PSMW+IFP QDLL LKE+Y TRPA EETINDPT P+HYWRYR+HVT+E
Sbjct  843  IAYFILQQHVEAPSMWAIFPFQDLLTLKEEYTTRPAREETINDPTNPKHYWRYRIHVTLE  902

Query  721  SLLNDKSL  744
             LL DK +
Sbjct  903  HLLEDKDI  910



>ref|XP_010251907.1| PREDICTED: 4-alpha-glucanotransferase DPE2 isoform X1 [Nelumbo 
nucifera]
 ref|XP_010251908.1| PREDICTED: 4-alpha-glucanotransferase DPE2 isoform X1 [Nelumbo 
nucifera]
Length=947

 Score =   426 bits (1094),  Expect = 7e-139, Method: Compositional matrix adjust.
 Identities = 193/248 (78%), Positives = 223/248 (90%), Gaps = 0/248 (0%)
 Frame = +1

Query  1    FVENEEKLRRNLFDLLQEVVLIRDREDPRKFYPRFNLEDTSSFKGLDQHSKNVLKRLYYD  180
            ++ENE+K++R LFDLLQ +VLIRD ED RKFYPRFNLEDTSSFK LD HSKNVLKRLY+D
Sbjct  664  WLENEDKIQRGLFDLLQNIVLIRDPEDARKFYPRFNLEDTSSFKNLDDHSKNVLKRLYHD  723

Query  181  YYFHRQESLWRQNALNTLPVLMNSSDMLTCGEDLGMIPACVNPVMQELGLIGLHIQRMPS  360
            YYFHRQE+LWRQN+L TLPVL+NSSDML CGEDLG+IP+CV+PVMQELGLIGL IQRMPS
Sbjct  724  YYFHRQETLWRQNSLKTLPVLLNSSDMLACGEDLGLIPSCVHPVMQELGLIGLRIQRMPS  783

Query  361  EPGREFGIPSEYSYMTVCAPSCHDCSTLRAWWEEDEGRRRRYFQTVVGSGAVPPDECTPE  540
            EPG  FGIPS+YSYMTVCAPSCHDCST+RAWWEEDE RR ++F+TVVGS  VPPD+C P+
Sbjct  784  EPGLVFGIPSQYSYMTVCAPSCHDCSTMRAWWEEDEERRYQFFRTVVGSSDVPPDQCVPD  843

Query  541  IARFVLRKHVESPSMWSIFPLQDLLALKEDYATRPAVEETINDPTXPRHYWRYRMHVTME  720
            IA F+L++HVE+PSMW+IFP QDLL LKE+Y TRPA EETINDPT P+HYWRYR+HVT+E
Sbjct  844  IAYFILQQHVEAPSMWAIFPFQDLLTLKEEYTTRPAREETINDPTNPKHYWRYRIHVTLE  903

Query  721  SLLNDKSL  744
             LL DK +
Sbjct  904  HLLEDKDI  911



>ref|XP_010938680.1| PREDICTED: 4-alpha-glucanotransferase DPE2 [Elaeis guineensis]
Length=966

 Score =   425 bits (1093),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 195/248 (79%), Positives = 224/248 (90%), Gaps = 0/248 (0%)
 Frame = +1

Query  1    FVENEEKLRRNLFDLLQEVVLIRDREDPRKFYPRFNLEDTSSFKGLDQHSKNVLKRLYYD  180
            ++E E+K+R++LFDLLQ +VLIRD ED RKFYPRFNLEDTSSFK LD+HSKNVLKRLYYD
Sbjct  665  WLEKEDKIRKDLFDLLQNIVLIRDPEDSRKFYPRFNLEDTSSFKDLDEHSKNVLKRLYYD  724

Query  181  YYFHRQESLWRQNALNTLPVLMNSSDMLTCGEDLGMIPACVNPVMQELGLIGLHIQRMPS  360
            YYF RQE+LWRQNAL TLPVL+NSSDML CGEDLG+IP+CV+PVMQELGLIGL IQRMPS
Sbjct  725  YYFCRQEALWRQNALKTLPVLLNSSDMLACGEDLGLIPSCVHPVMQELGLIGLRIQRMPS  784

Query  361  EPGREFGIPSEYSYMTVCAPSCHDCSTLRAWWEEDEGRRRRYFQTVVGSGAVPPDECTPE  540
            EPG EFGIPS+YSYMTVCAPSCHDCSTLRAWWEEDE R  RY++TVVG   VPP  CTPE
Sbjct  785  EPGLEFGIPSQYSYMTVCAPSCHDCSTLRAWWEEDEERSCRYYKTVVGCNDVPPSCCTPE  844

Query  541  IARFVLRKHVESPSMWSIFPLQDLLALKEDYATRPAVEETINDPTXPRHYWRYRMHVTME  720
            IA F++++H ++PSMW+IFPLQDLLALKE+Y +RPAVEETINDPT P+HYWRYR+HVT+E
Sbjct  845  IAYFIIQQHCQAPSMWAIFPLQDLLALKEEYRSRPAVEETINDPTNPKHYWRYRVHVTLE  904

Query  721  SLLNDKSL  744
            SLL D+ L
Sbjct  905  SLLGDEDL  912



>ref|XP_003624890.1| 4-alpha-glucanotransferase [Medicago truncatula]
Length=760

 Score =   418 bits (1075),  Expect = 4e-138, Method: Compositional matrix adjust.
 Identities = 186/248 (75%), Positives = 220/248 (89%), Gaps = 0/248 (0%)
 Frame = +1

Query  1    FVENEEKLRRNLFDLLQEVVLIRDREDPRKFYPRFNLEDTSSFKGLDQHSKNVLKRLYYD  180
             +E+E+K+RRNL DLLQ +VLIRD E+P+ FYPRFNLEDTSSF+ LD HSKNVLKRLYYD
Sbjct  449  LLESEDKMRRNLIDLLQNIVLIRDPENPKDFYPRFNLEDTSSFQALDDHSKNVLKRLYYD  508

Query  181  YYFHRQESLWRQNALNTLPVLMNSSDMLTCGEDLGMIPACVNPVMQELGLIGLHIQRMPS  360
            YYFHRQE+LWRQNAL TLP L+NSS+ML CGEDLG+IP+CV+PVMQELGL+GL IQRMP+
Sbjct  509  YYFHRQENLWRQNALKTLPALLNSSEMLACGEDLGLIPSCVHPVMQELGLVGLRIQRMPN  568

Query  361  EPGREFGIPSEYSYMTVCAPSCHDCSTLRAWWEEDEGRRRRYFQTVVGSGAVPPDECTPE  540
            E   EFGIPS+YSYMTVCAPSCHDCSTLRAWWEEDE RR+R+F+ V+ S  +PPD+C PE
Sbjct  569  ESDLEFGIPSQYSYMTVCAPSCHDCSTLRAWWEEDEERRQRFFKNVMESDELPPDQCVPE  628

Query  541  IARFVLRKHVESPSMWSIFPLQDLLALKEDYATRPAVEETINDPTXPRHYWRYRMHVTME  720
            +A F++R+H+ESPSMW+IFPLQDLLALKE+Y  RPA+EETINDPT P+HYWRYR+HVT+E
Sbjct  629  VAHFIIRQHIESPSMWAIFPLQDLLALKEEYTARPAIEETINDPTNPKHYWRYRVHVTLE  688

Query  721  SLLNDKSL  744
            SL  D  L
Sbjct  689  SLNKDNEL  696



>ref|XP_008244084.1| PREDICTED: 4-alpha-glucanotransferase DPE2 [Prunus mume]
 ref|XP_008244085.1| PREDICTED: 4-alpha-glucanotransferase DPE2 [Prunus mume]
Length=972

 Score =   423 bits (1088),  Expect = 8e-138, Method: Compositional matrix adjust.
 Identities = 191/248 (77%), Positives = 220/248 (89%), Gaps = 0/248 (0%)
 Frame = +1

Query  1    FVENEEKLRRNLFDLLQEVVLIRDREDPRKFYPRFNLEDTSSFKGLDQHSKNVLKRLYYD  180
             +++E+K+RR LFDL+Q +VLIRD E+PR FYPRFNLEDT SFK LD HSKNV+KRLYYD
Sbjct  663  LLQDEDKIRRELFDLVQNIVLIRDPENPRNFYPRFNLEDTPSFKDLDDHSKNVMKRLYYD  722

Query  181  YYFHRQESLWRQNALNTLPVLMNSSDMLTCGEDLGMIPACVNPVMQELGLIGLHIQRMPS  360
            YYFHRQE+LW+QNAL TLP L+NSSDML CGEDLG+IP+CV+PVMQELGLIGL IQRMPS
Sbjct  723  YYFHRQENLWQQNALKTLPALLNSSDMLACGEDLGLIPSCVHPVMQELGLIGLRIQRMPS  782

Query  361  EPGREFGIPSEYSYMTVCAPSCHDCSTLRAWWEEDEGRRRRYFQTVVGSGAVPPDECTPE  540
            EP  EFGIPS+YSYMTVCAPSCHDCSTLRAWWEEDE RR+RYF+ VVGS   PP  C P+
Sbjct  783  EPDLEFGIPSQYSYMTVCAPSCHDCSTLRAWWEEDEERRQRYFKNVVGSDTSPPARCVPD  842

Query  541  IARFVLRKHVESPSMWSIFPLQDLLALKEDYATRPAVEETINDPTXPRHYWRYRMHVTME  720
            IA F++R+HVESPSMW+IFPLQDLLALKE+Y TRPA EETINDPT P+HYWRYR+HVT+E
Sbjct  843  IAHFIIREHVESPSMWAIFPLQDLLALKEEYTTRPATEETINDPTNPKHYWRYRVHVTVE  902

Query  721  SLLNDKSL  744
            +L+ DK L
Sbjct  903  ALIKDKEL  910



>ref|XP_002523669.1| 4-alpha-glucanotransferase, putative [Ricinus communis]
 gb|EEF38704.1| 4-alpha-glucanotransferase, putative [Ricinus communis]
Length=901

 Score =   420 bits (1079),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 190/246 (77%), Positives = 221/246 (90%), Gaps = 0/246 (0%)
 Frame = +1

Query  7    ENEEKLRRNLFDLLQEVVLIRDREDPRKFYPRFNLEDTSSFKGLDQHSKNVLKRLYYDYY  186
            E+E+K+R  LFDLL+ +VLIRD ED RKFYPRFNLEDTSSF+ LD HSKNVLKRLYYDYY
Sbjct  593  ESEDKIRHGLFDLLKNIVLIRDPEDARKFYPRFNLEDTSSFEDLDDHSKNVLKRLYYDYY  652

Query  187  FHRQESLWRQNALNTLPVLMNSSDMLTCGEDLGMIPACVNPVMQELGLIGLHIQRMPSEP  366
            F+RQE+LWR+NA+ TLPVL+NSSDML CGEDLG+IPACV+PVMQELGLIGL IQRMPSEP
Sbjct  653  FNRQENLWRKNAMKTLPVLLNSSDMLACGEDLGLIPACVHPVMQELGLIGLRIQRMPSEP  712

Query  367  GREFGIPSEYSYMTVCAPSCHDCSTLRAWWEEDEGRRRRYFQTVVGSGAVPPDECTPEIA  546
              EFGIPS+YSYMTVCAPSCHDCST RAWWEEDE RR R+F+ VVGS  +PP +CTP++A
Sbjct  713  DLEFGIPSKYSYMTVCAPSCHDCSTFRAWWEEDEERRLRFFKIVVGSDILPPSQCTPDVA  772

Query  547  RFVLRKHVESPSMWSIFPLQDLLALKEDYATRPAVEETINDPTXPRHYWRYRMHVTMESL  726
             F++R+HVE+PSMW+IFPLQDLLALK++Y TRPA EETINDPT P+HYWRYR+HVT+ESL
Sbjct  773  CFIIRQHVEAPSMWAIFPLQDLLALKKEYMTRPATEETINDPTNPKHYWRYRVHVTLESL  832

Query  727  LNDKSL  744
            + DK L
Sbjct  833  MKDKEL  838



>ref|XP_007204878.1| hypothetical protein PRUPE_ppa000782mg [Prunus persica]
 gb|EMJ06077.1| hypothetical protein PRUPE_ppa000782mg [Prunus persica]
Length=1005

 Score =   422 bits (1086),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 191/248 (77%), Positives = 219/248 (88%), Gaps = 0/248 (0%)
 Frame = +1

Query  1    FVENEEKLRRNLFDLLQEVVLIRDREDPRKFYPRFNLEDTSSFKGLDQHSKNVLKRLYYD  180
             +++E+K+RR LFDL+Q +VLIRD E+PR FYPRFNLEDT SFK LD HSKNVLKRLYYD
Sbjct  696  LLQDEDKIRRELFDLVQNIVLIRDPENPRNFYPRFNLEDTPSFKDLDDHSKNVLKRLYYD  755

Query  181  YYFHRQESLWRQNALNTLPVLMNSSDMLTCGEDLGMIPACVNPVMQELGLIGLHIQRMPS  360
            YYFHRQE+LW+QNAL TLP L+NSSDML CGEDLG+IP+CV+PVMQELGLIGL IQRMPS
Sbjct  756  YYFHRQENLWQQNALKTLPALLNSSDMLACGEDLGLIPSCVHPVMQELGLIGLRIQRMPS  815

Query  361  EPGREFGIPSEYSYMTVCAPSCHDCSTLRAWWEEDEGRRRRYFQTVVGSGAVPPDECTPE  540
            EP  EFGIPS+YSYMTVCAPSCHDCSTLRAWWEEDE RR+RYF+ VVGS   PP  C P+
Sbjct  816  EPDLEFGIPSQYSYMTVCAPSCHDCSTLRAWWEEDEERRQRYFKNVVGSDMSPPARCVPD  875

Query  541  IARFVLRKHVESPSMWSIFPLQDLLALKEDYATRPAVEETINDPTXPRHYWRYRMHVTME  720
            IA F++R+HVESPSMW+IFPLQDLL LKE+Y TRPA EETINDPT P+HYWRYR+HVT+E
Sbjct  876  IAHFIIREHVESPSMWAIFPLQDLLVLKEEYTTRPATEETINDPTNPKHYWRYRVHVTVE  935

Query  721  SLLNDKSL  744
            +L+ DK L
Sbjct  936  ALIKDKEL  943



>ref|XP_004958603.1| PREDICTED: 4-alpha-glucanotransferase DPE2-like isoform X1 [Setaria 
italica]
 ref|XP_004958604.1| PREDICTED: 4-alpha-glucanotransferase DPE2-like isoform X2 [Setaria 
italica]
Length=944

 Score =   421 bits (1081),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 190/248 (77%), Positives = 219/248 (88%), Gaps = 0/248 (0%)
 Frame = +1

Query  1    FVENEEKLRRNLFDLLQEVVLIRDREDPRKFYPRFNLEDTSSFKGLDQHSKNVLKRLYYD  180
            ++E E+ +RR L DLLQ VVLIRD EDP KFYPRFNLEDTSSF  LD+HSKNVL+RLYYD
Sbjct  658  WLEKEDSIRRGLLDLLQNVVLIRDPEDPTKFYPRFNLEDTSSFSDLDEHSKNVLRRLYYD  717

Query  181  YYFHRQESLWRQNALNTLPVLMNSSDMLTCGEDLGMIPACVNPVMQELGLIGLHIQRMPS  360
            YYF RQE+LWRQNAL TLPVL+NSSDML CGEDLG+IPACV+PVMQELGLIGL IQRMPS
Sbjct  718  YYFARQENLWRQNALKTLPVLLNSSDMLACGEDLGLIPACVHPVMQELGLIGLRIQRMPS  777

Query  361  EPGREFGIPSEYSYMTVCAPSCHDCSTLRAWWEEDEGRRRRYFQTVVGSGAVPPDECTPE  540
            EP  EFGIPS+YSYMTVCAPSCHDCSTLRAWWEEDEGRR R+++TVVGS   PP  CTPE
Sbjct  778  EPNLEFGIPSQYSYMTVCAPSCHDCSTLRAWWEEDEGRRSRFYKTVVGSNEEPPSRCTPE  837

Query  541  IARFVLRKHVESPSMWSIFPLQDLLALKEDYATRPAVEETINDPTXPRHYWRYRMHVTME  720
            +  F++++H ++PSMW+IFPLQDLLALK+ Y TRPA EETINDPT P+HYWR+R+HVT+E
Sbjct  838  VVHFIVQQHFDAPSMWAIFPLQDLLALKDKYTTRPAPEETINDPTNPKHYWRFRVHVTLE  897

Query  721  SLLNDKSL  744
            SLL+DK +
Sbjct  898  SLLDDKDI  905



>gb|KHF97420.1| 4-alpha-glucanotransferase DPE2 -like protein [Gossypium arboreum]
Length=879

 Score =   419 bits (1076),  Expect = 7e-137, Method: Compositional matrix adjust.
 Identities = 189/246 (77%), Positives = 218/246 (89%), Gaps = 0/246 (0%)
 Frame = +1

Query  7    ENEEKLRRNLFDLLQEVVLIRDREDPRKFYPRFNLEDTSSFKGLDQHSKNVLKRLYYDYY  186
            E+E+K+R +LFDLL+ +VLIRD E  + FYPRFNLEDTSSF+ LD HSKNVLKRLYYDYY
Sbjct  597  ESEDKIRCDLFDLLKNIVLIRDPEHDKSFYPRFNLEDTSSFRDLDDHSKNVLKRLYYDYY  656

Query  187  FHRQESLWRQNALNTLPVLMNSSDMLTCGEDLGMIPACVNPVMQELGLIGLHIQRMPSEP  366
            FHRQ+ LWRQNAL TLP L+NSSDML CGEDLG+IPACV+PVMQELGLIGL IQRMPSEP
Sbjct  657  FHRQDKLWRQNALKTLPALLNSSDMLACGEDLGLIPACVHPVMQELGLIGLRIQRMPSEP  716

Query  367  GREFGIPSEYSYMTVCAPSCHDCSTLRAWWEEDEGRRRRYFQTVVGSGAVPPDECTPEIA  546
              EFGIPS+YSYMTVCAPSCHDCSTLRAWWEEDE RR R+F++V+GS  +PP +C PE+A
Sbjct  717  DLEFGIPSQYSYMTVCAPSCHDCSTLRAWWEEDEERRHRFFKSVIGSDDLPPSQCVPELA  776

Query  547  RFVLRKHVESPSMWSIFPLQDLLALKEDYATRPAVEETINDPTXPRHYWRYRMHVTMESL  726
              ++R+H+ESPSMW+IFPLQDLLALKE+Y TRPA EETINDPT P+HYWRYR+HVTMESL
Sbjct  777  HLIIRQHIESPSMWAIFPLQDLLALKEEYMTRPATEETINDPTNPKHYWRYRVHVTMESL  836

Query  727  LNDKSL  744
            + DK L
Sbjct  837  IKDKEL  842



>ref|XP_008796184.1| PREDICTED: 4-alpha-glucanotransferase DPE2 isoform X2 [Phoenix 
dactylifera]
Length=966

 Score =   421 bits (1081),  Expect = 8e-137, Method: Compositional matrix adjust.
 Identities = 190/248 (77%), Positives = 224/248 (90%), Gaps = 0/248 (0%)
 Frame = +1

Query  1    FVENEEKLRRNLFDLLQEVVLIRDREDPRKFYPRFNLEDTSSFKGLDQHSKNVLKRLYYD  180
            +++ E+K++++LFDLLQ +VLIRD +D RKFYPRFNLEDTSSFK LD+HSKNVLKRLYYD
Sbjct  665  WLDKEDKIQKDLFDLLQNIVLIRDPDDSRKFYPRFNLEDTSSFKDLDEHSKNVLKRLYYD  724

Query  181  YYFHRQESLWRQNALNTLPVLMNSSDMLTCGEDLGMIPACVNPVMQELGLIGLHIQRMPS  360
            YYF RQE+LWRQNAL TLPVL+NSSDML CGEDLG+IP+CV+PVMQELGLIGL IQRMPS
Sbjct  725  YYFCRQETLWRQNALKTLPVLLNSSDMLACGEDLGLIPSCVHPVMQELGLIGLRIQRMPS  784

Query  361  EPGREFGIPSEYSYMTVCAPSCHDCSTLRAWWEEDEGRRRRYFQTVVGSGAVPPDECTPE  540
            EP  EFGIPS+YSYMTVCAPSCHDCSTLRAWWEEDE RR RY++TVVG   VPP  CTPE
Sbjct  785  EPDLEFGIPSQYSYMTVCAPSCHDCSTLRAWWEEDEERRCRYYKTVVGCNDVPPSCCTPE  844

Query  541  IARFVLRKHVESPSMWSIFPLQDLLALKEDYATRPAVEETINDPTXPRHYWRYRMHVTME  720
            +A F++++H ++PSMW+IFPLQDLLA+KE+Y TRPAVEETINDPT P+HYW+YR+HVT+E
Sbjct  845  VAYFIIQQHFQAPSMWAIFPLQDLLAMKEEYTTRPAVEETINDPTNPKHYWQYRVHVTLE  904

Query  721  SLLNDKSL  744
            SLL D+ L
Sbjct  905  SLLGDEDL  912



>ref|XP_008796181.1| PREDICTED: 4-alpha-glucanotransferase DPE2 isoform X1 [Phoenix 
dactylifera]
 ref|XP_008796182.1| PREDICTED: 4-alpha-glucanotransferase DPE2 isoform X1 [Phoenix 
dactylifera]
 ref|XP_008796183.1| PREDICTED: 4-alpha-glucanotransferase DPE2 isoform X1 [Phoenix 
dactylifera]
Length=968

 Score =   421 bits (1081),  Expect = 9e-137, Method: Compositional matrix adjust.
 Identities = 190/248 (77%), Positives = 224/248 (90%), Gaps = 0/248 (0%)
 Frame = +1

Query  1    FVENEEKLRRNLFDLLQEVVLIRDREDPRKFYPRFNLEDTSSFKGLDQHSKNVLKRLYYD  180
            +++ E+K++++LFDLLQ +VLIRD +D RKFYPRFNLEDTSSFK LD+HSKNVLKRLYYD
Sbjct  667  WLDKEDKIQKDLFDLLQNIVLIRDPDDSRKFYPRFNLEDTSSFKDLDEHSKNVLKRLYYD  726

Query  181  YYFHRQESLWRQNALNTLPVLMNSSDMLTCGEDLGMIPACVNPVMQELGLIGLHIQRMPS  360
            YYF RQE+LWRQNAL TLPVL+NSSDML CGEDLG+IP+CV+PVMQELGLIGL IQRMPS
Sbjct  727  YYFCRQETLWRQNALKTLPVLLNSSDMLACGEDLGLIPSCVHPVMQELGLIGLRIQRMPS  786

Query  361  EPGREFGIPSEYSYMTVCAPSCHDCSTLRAWWEEDEGRRRRYFQTVVGSGAVPPDECTPE  540
            EP  EFGIPS+YSYMTVCAPSCHDCSTLRAWWEEDE RR RY++TVVG   VPP  CTPE
Sbjct  787  EPDLEFGIPSQYSYMTVCAPSCHDCSTLRAWWEEDEERRCRYYKTVVGCNDVPPSCCTPE  846

Query  541  IARFVLRKHVESPSMWSIFPLQDLLALKEDYATRPAVEETINDPTXPRHYWRYRMHVTME  720
            +A F++++H ++PSMW+IFPLQDLLA+KE+Y TRPAVEETINDPT P+HYW+YR+HVT+E
Sbjct  847  VAYFIIQQHFQAPSMWAIFPLQDLLAMKEEYTTRPAVEETINDPTNPKHYWQYRVHVTLE  906

Query  721  SLLNDKSL  744
            SLL D+ L
Sbjct  907  SLLGDEDL  914



>ref|XP_002308854.2| 4-alpha-glucanotransferase -related family protein [Populus trichocarpa]
 gb|EEE92377.2| 4-alpha-glucanotransferase -related family protein [Populus trichocarpa]
Length=992

 Score =   421 bits (1081),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 191/248 (77%), Positives = 219/248 (88%), Gaps = 0/248 (0%)
 Frame = +1

Query  1    FVENEEKLRRNLFDLLQEVVLIRDREDPRKFYPRFNLEDTSSFKGLDQHSKNVLKRLYYD  180
             +E+E+K+RR+LFDLL+ +VLIRD ED  KFYPRFNLEDTSSF+ LD HSKNVL+RLYYD
Sbjct  679  LLESEDKIRRDLFDLLKNIVLIRDPEDASKFYPRFNLEDTSSFQDLDDHSKNVLRRLYYD  738

Query  181  YYFHRQESLWRQNALNTLPVLMNSSDMLTCGEDLGMIPACVNPVMQELGLIGLHIQRMPS  360
            YYFHRQE+LWRQNAL TLP L+NSSDML CGEDLG+IPACV+PVMQELG+IGL IQRMPS
Sbjct  739  YYFHRQENLWRQNALKTLPALLNSSDMLACGEDLGLIPACVHPVMQELGMIGLRIQRMPS  798

Query  361  EPGREFGIPSEYSYMTVCAPSCHDCSTLRAWWEEDEGRRRRYFQTVVGSGAVPPDECTPE  540
            E   EFGIPS+YSYMTVCAPSCHDCST RAWWEEDE RR RYF+ +VG  A+P  +C P+
Sbjct  799  ESDLEFGIPSQYSYMTVCAPSCHDCSTFRAWWEEDEERRCRYFKNLVGPDAIPSSQCVPD  858

Query  541  IARFVLRKHVESPSMWSIFPLQDLLALKEDYATRPAVEETINDPTXPRHYWRYRMHVTME  720
            IA FV+R+HVE+PSMW+IFPLQDLLALKE+Y TRPA EETINDPT P+HYWRYR+HVT+E
Sbjct  859  IAHFVIRQHVEAPSMWAIFPLQDLLALKEEYTTRPATEETINDPTNPKHYWRYRVHVTLE  918

Query  721  SLLNDKSL  744
            SLL DK L
Sbjct  919  SLLKDKEL  926



>ref|XP_002461165.1| hypothetical protein SORBIDRAFT_02g042100 [Sorghum bicolor]
 gb|EER97686.1| hypothetical protein SORBIDRAFT_02g042100 [Sorghum bicolor]
Length=946

 Score =   419 bits (1077),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 188/248 (76%), Positives = 219/248 (88%), Gaps = 0/248 (0%)
 Frame = +1

Query  1    FVENEEKLRRNLFDLLQEVVLIRDREDPRKFYPRFNLEDTSSFKGLDQHSKNVLKRLYYD  180
            ++E E+ +R  LFDLLQ +VLIRD ED  KFYPRFNLEDTSSF+ LD+HSKNVL+RLYYD
Sbjct  660  WLEKEDSIRSGLFDLLQNIVLIRDPEDSTKFYPRFNLEDTSSFRDLDEHSKNVLRRLYYD  719

Query  181  YYFHRQESLWRQNALNTLPVLMNSSDMLTCGEDLGMIPACVNPVMQELGLIGLHIQRMPS  360
            YYF RQE+LWRQNAL TLPVL+NSSDML CGEDLG+IPACV+PVMQELGLIGL IQRMPS
Sbjct  720  YYFARQENLWRQNALKTLPVLLNSSDMLACGEDLGLIPACVHPVMQELGLIGLRIQRMPS  779

Query  361  EPGREFGIPSEYSYMTVCAPSCHDCSTLRAWWEEDEGRRRRYFQTVVGSGAVPPDECTPE  540
            EP  EFGIPS+YSYMTVCAPSCHDCSTLRAWWEEDEGRR R+++TVVGS   PP  CTPE
Sbjct  780  EPNTEFGIPSQYSYMTVCAPSCHDCSTLRAWWEEDEGRRSRFYKTVVGSDEEPPSRCTPE  839

Query  541  IARFVLRKHVESPSMWSIFPLQDLLALKEDYATRPAVEETINDPTXPRHYWRYRMHVTME  720
            +  F++++H ++PSMW+IFPLQDLLALK+ Y TRPA EETINDPT P+HYWR+R+HVT+E
Sbjct  840  VVHFIVQQHFDAPSMWAIFPLQDLLALKDKYTTRPAPEETINDPTNPKHYWRFRVHVTLE  899

Query  721  SLLNDKSL  744
            SLL+DK +
Sbjct  900  SLLDDKDI  907



>ref|NP_001060547.1| Os07g0662900 [Oryza sativa Japonica Group]
 sp|Q69Q02.1|DPE2_ORYSJ RecName: Full=4-alpha-glucanotransferase DPE2; AltName: Full=Amylomaltase; 
AltName: Full=Disproportionating enzyme; Short=D-enzyme; 
AltName: Full=Protein DISPROPORTIONATING ENZYME 2 
[Oryza sativa Japonica Group]
 dbj|BAD31425.1| putative 4-alpha-glucanotransferase [Oryza sativa Japonica Group]
 dbj|BAF22461.1| Os07g0662900 [Oryza sativa Japonica Group]
Length=946

 Score =   418 bits (1074),  Expect = 6e-136, Method: Compositional matrix adjust.
 Identities = 186/248 (75%), Positives = 218/248 (88%), Gaps = 0/248 (0%)
 Frame = +1

Query  1    FVENEEKLRRNLFDLLQEVVLIRDREDPRKFYPRFNLEDTSSFKGLDQHSKNVLKRLYYD  180
            ++E E+ +RR LFDLLQ +VLIRD ED  KFYPRFN EDTSSF  LD+HSKN+L+RLYYD
Sbjct  661  WLEKEDSIRRGLFDLLQNIVLIRDPEDSTKFYPRFNQEDTSSFNDLDEHSKNILRRLYYD  720

Query  181  YYFHRQESLWRQNALNTLPVLMNSSDMLTCGEDLGMIPACVNPVMQELGLIGLHIQRMPS  360
            YYF RQE+LWRQNAL TLPVL+NSSDML CGEDLG+IPACV+PVMQELGLIGL IQRMPS
Sbjct  721  YYFARQENLWRQNALKTLPVLLNSSDMLACGEDLGLIPACVHPVMQELGLIGLRIQRMPS  780

Query  361  EPGREFGIPSEYSYMTVCAPSCHDCSTLRAWWEEDEGRRRRYFQTVVGSGAVPPDECTPE  540
            EP  EFGIPS+YSYMTVCAPSCHDCSTLRAWWEED GRR R++QTV+GS   PP  CTPE
Sbjct  781  EPNLEFGIPSQYSYMTVCAPSCHDCSTLRAWWEEDGGRRSRFYQTVIGSDDEPPSRCTPE  840

Query  541  IARFVLRKHVESPSMWSIFPLQDLLALKEDYATRPAVEETINDPTXPRHYWRYRMHVTME  720
            +A F++++H ++PSMW+IFPLQDLLALK+ Y TRPA EETINDPT P+HYWR+R+HVT++
Sbjct  841  VANFIVKQHFDAPSMWAIFPLQDLLALKDKYTTRPAKEETINDPTNPKHYWRFRLHVTLD  900

Query  721  SLLNDKSL  744
            SLL+DK +
Sbjct  901  SLLDDKDI  908



>gb|AES81107.2| 4-alpha-glucanotransferase DPE2 [Medicago truncatula]
Length=981

 Score =   419 bits (1076),  Expect = 7e-136, Method: Compositional matrix adjust.
 Identities = 186/248 (75%), Positives = 220/248 (89%), Gaps = 0/248 (0%)
 Frame = +1

Query  1    FVENEEKLRRNLFDLLQEVVLIRDREDPRKFYPRFNLEDTSSFKGLDQHSKNVLKRLYYD  180
             +E+E+K+RRNL DLLQ +VLIRD E+P+ FYPRFNLEDTSSF+ LD HSKNVLKRLYYD
Sbjct  670  LLESEDKMRRNLIDLLQNIVLIRDPENPKDFYPRFNLEDTSSFQALDDHSKNVLKRLYYD  729

Query  181  YYFHRQESLWRQNALNTLPVLMNSSDMLTCGEDLGMIPACVNPVMQELGLIGLHIQRMPS  360
            YYFHRQE+LWRQNAL TLP L+NSS+ML CGEDLG+IP+CV+PVMQELGL+GL IQRMP+
Sbjct  730  YYFHRQENLWRQNALKTLPALLNSSEMLACGEDLGLIPSCVHPVMQELGLVGLRIQRMPN  789

Query  361  EPGREFGIPSEYSYMTVCAPSCHDCSTLRAWWEEDEGRRRRYFQTVVGSGAVPPDECTPE  540
            E   EFGIPS+YSYMTVCAPSCHDCSTLRAWWEEDE RR+R+F+ V+ S  +PPD+C PE
Sbjct  790  ESDLEFGIPSQYSYMTVCAPSCHDCSTLRAWWEEDEERRQRFFKNVMESDELPPDQCVPE  849

Query  541  IARFVLRKHVESPSMWSIFPLQDLLALKEDYATRPAVEETINDPTXPRHYWRYRMHVTME  720
            +A F++R+H+ESPSMW+IFPLQDLLALKE+Y  RPA+EETINDPT P+HYWRYR+HVT+E
Sbjct  850  VAHFIIRQHIESPSMWAIFPLQDLLALKEEYTARPAIEETINDPTNPKHYWRYRVHVTLE  909

Query  721  SLLNDKSL  744
            SL  D  L
Sbjct  910  SLNKDNEL  917



>gb|EEC82629.1| hypothetical protein OsI_27219 [Oryza sativa Indica Group]
Length=946

 Score =   417 bits (1073),  Expect = 7e-136, Method: Compositional matrix adjust.
 Identities = 186/248 (75%), Positives = 218/248 (88%), Gaps = 0/248 (0%)
 Frame = +1

Query  1    FVENEEKLRRNLFDLLQEVVLIRDREDPRKFYPRFNLEDTSSFKGLDQHSKNVLKRLYYD  180
            ++E E+ +RR LFDLLQ +VLIRD ED  KFYPRFN EDTSSF  LD+HSKN+L+RLYYD
Sbjct  661  WLEKEDSIRRGLFDLLQNIVLIRDPEDSTKFYPRFNQEDTSSFNDLDEHSKNILRRLYYD  720

Query  181  YYFHRQESLWRQNALNTLPVLMNSSDMLTCGEDLGMIPACVNPVMQELGLIGLHIQRMPS  360
            YYF RQE+LWRQNAL TLPVL+NSSDML CGEDLG+IPACV+PVMQELGLIGL IQRMPS
Sbjct  721  YYFARQENLWRQNALKTLPVLLNSSDMLACGEDLGLIPACVHPVMQELGLIGLRIQRMPS  780

Query  361  EPGREFGIPSEYSYMTVCAPSCHDCSTLRAWWEEDEGRRRRYFQTVVGSGAVPPDECTPE  540
            EP  EFGIPS+YSYMTVCAPSCHDCSTLRAWWEED GRR R++QTV+GS   PP  CTPE
Sbjct  781  EPNLEFGIPSQYSYMTVCAPSCHDCSTLRAWWEEDGGRRSRFYQTVIGSDDEPPSRCTPE  840

Query  541  IARFVLRKHVESPSMWSIFPLQDLLALKEDYATRPAVEETINDPTXPRHYWRYRMHVTME  720
            +A F++++H ++PSMW+IFPLQDLLALK+ Y TRPA EETINDPT P+HYWR+R+HVT++
Sbjct  841  VANFIVKQHFDAPSMWAIFPLQDLLALKDKYTTRPAKEETINDPTNPKHYWRFRLHVTLD  900

Query  721  SLLNDKSL  744
            SLL+DK +
Sbjct  901  SLLDDKDI  908



>ref|XP_009377648.1| PREDICTED: 4-alpha-glucanotransferase DPE2 [Pyrus x bretschneideri]
 ref|XP_009377649.1| PREDICTED: 4-alpha-glucanotransferase DPE2 [Pyrus x bretschneideri]
Length=978

 Score =   418 bits (1075),  Expect = 7e-136, Method: Compositional matrix adjust.
 Identities = 189/248 (76%), Positives = 216/248 (87%), Gaps = 0/248 (0%)
 Frame = +1

Query  1    FVENEEKLRRNLFDLLQEVVLIRDREDPRKFYPRFNLEDTSSFKGLDQHSKNVLKRLYYD  180
             +++E+K+R  LFDL+Q +VLIRD E+PR FYPRFNLEDT SF  LD HSKNVLKRLYYD
Sbjct  667  LLQDEDKIRHELFDLIQNIVLIRDTENPRNFYPRFNLEDTPSFNDLDDHSKNVLKRLYYD  726

Query  181  YYFHRQESLWRQNALNTLPVLMNSSDMLTCGEDLGMIPACVNPVMQELGLIGLHIQRMPS  360
            YYFHRQE+LWR+NAL TLP L+NSSDML CGEDLG+IP+CV+PVMQELGLIGL IQRMPS
Sbjct  727  YYFHRQENLWRENALKTLPALLNSSDMLACGEDLGLIPSCVHPVMQELGLIGLRIQRMPS  786

Query  361  EPGREFGIPSEYSYMTVCAPSCHDCSTLRAWWEEDEGRRRRYFQTVVGSGAVPPDECTPE  540
            EP  EFGIPS+Y YMTVCAPSCHDCSTLRAWWEED+ RR+RYF+ VVGS   PP  C PE
Sbjct  787  EPDLEFGIPSQYGYMTVCAPSCHDCSTLRAWWEEDDERRQRYFKNVVGSDMSPPARCVPE  846

Query  541  IARFVLRKHVESPSMWSIFPLQDLLALKEDYATRPAVEETINDPTXPRHYWRYRMHVTME  720
            IA F+LR+HVE+PSMW+IFPLQDLLALKE+Y TRPA EETINDPT P+HYWRYR+HVTME
Sbjct  847  IAHFILRQHVEAPSMWAIFPLQDLLALKEEYTTRPAKEETINDPTNPKHYWRYRVHVTME  906

Query  721  SLLNDKSL  744
            +L+ D  L
Sbjct  907  ALIKDNEL  914



>gb|EEE67756.1| hypothetical protein OsJ_25466 [Oryza sativa Japonica Group]
Length=951

 Score =   417 bits (1073),  Expect = 8e-136, Method: Compositional matrix adjust.
 Identities = 186/248 (75%), Positives = 218/248 (88%), Gaps = 0/248 (0%)
 Frame = +1

Query  1    FVENEEKLRRNLFDLLQEVVLIRDREDPRKFYPRFNLEDTSSFKGLDQHSKNVLKRLYYD  180
            ++E E+ +RR LFDLLQ +VLIRD ED  KFYPRFN EDTSSF  LD+HSKN+L+RLYYD
Sbjct  666  WLEKEDSIRRGLFDLLQNIVLIRDPEDSTKFYPRFNQEDTSSFNDLDEHSKNILRRLYYD  725

Query  181  YYFHRQESLWRQNALNTLPVLMNSSDMLTCGEDLGMIPACVNPVMQELGLIGLHIQRMPS  360
            YYF RQE+LWRQNAL TLPVL+NSSDML CGEDLG+IPACV+PVMQELGLIGL IQRMPS
Sbjct  726  YYFARQENLWRQNALKTLPVLLNSSDMLACGEDLGLIPACVHPVMQELGLIGLRIQRMPS  785

Query  361  EPGREFGIPSEYSYMTVCAPSCHDCSTLRAWWEEDEGRRRRYFQTVVGSGAVPPDECTPE  540
            EP  EFGIPS+YSYMTVCAPSCHDCSTLRAWWEED GRR R++QTV+GS   PP  CTPE
Sbjct  786  EPNLEFGIPSQYSYMTVCAPSCHDCSTLRAWWEEDGGRRSRFYQTVIGSDDEPPSRCTPE  845

Query  541  IARFVLRKHVESPSMWSIFPLQDLLALKEDYATRPAVEETINDPTXPRHYWRYRMHVTME  720
            +A F++++H ++PSMW+IFPLQDLLALK+ Y TRPA EETINDPT P+HYWR+R+HVT++
Sbjct  846  VANFIVKQHFDAPSMWAIFPLQDLLALKDKYTTRPAKEETINDPTNPKHYWRFRLHVTLD  905

Query  721  SLLNDKSL  744
            SLL+DK +
Sbjct  906  SLLDDKDI  913



>ref|XP_004985612.1| PREDICTED: 4-alpha-glucanotransferase DPE2-like [Setaria italica]
Length=949

 Score =   417 bits (1073),  Expect = 9e-136, Method: Compositional matrix adjust.
 Identities = 187/248 (75%), Positives = 219/248 (88%), Gaps = 0/248 (0%)
 Frame = +1

Query  1    FVENEEKLRRNLFDLLQEVVLIRDREDPRKFYPRFNLEDTSSFKGLDQHSKNVLKRLYYD  180
            ++E E+ +RR LFD +Q +VLIRD EDP KFYPRFNLEDTSSF+ LD+HSKNVL+RLYYD
Sbjct  664  WLEKEDSIRRGLFDFIQNIVLIRDPEDPTKFYPRFNLEDTSSFRDLDEHSKNVLRRLYYD  723

Query  181  YYFHRQESLWRQNALNTLPVLMNSSDMLTCGEDLGMIPACVNPVMQELGLIGLHIQRMPS  360
            YYF RQE+LWRQNAL TLPVL+NSSDML CGEDLG+IPACV+PVMQELGLIGL IQRMPS
Sbjct  724  YYFARQENLWRQNALKTLPVLLNSSDMLACGEDLGLIPACVHPVMQELGLIGLRIQRMPS  783

Query  361  EPGREFGIPSEYSYMTVCAPSCHDCSTLRAWWEEDEGRRRRYFQTVVGSGAVPPDECTPE  540
            EP  EFGIPS+YSYMTVCAPSCHDCSTLRAWWEEDE RR R+++TVVGS   PP  CTPE
Sbjct  784  EPNLEFGIPSQYSYMTVCAPSCHDCSTLRAWWEEDEERRSRFYKTVVGSDEEPPSRCTPE  843

Query  541  IARFVLRKHVESPSMWSIFPLQDLLALKEDYATRPAVEETINDPTXPRHYWRYRMHVTME  720
            +  F++++H ++PSMW+IFPLQDLLALK+ Y TRPA EETINDPT P+HYWR+R+HVT+E
Sbjct  844  VVHFIVQQHFDAPSMWAIFPLQDLLALKDKYTTRPAPEETINDPTNPKHYWRFRVHVTLE  903

Query  721  SLLNDKSL  744
            SLL+DK +
Sbjct  904  SLLDDKDI  911



>ref|XP_004493318.1| PREDICTED: 4-alpha-glucanotransferase DPE2-like isoform X1 [Cicer 
arietinum]
Length=977

 Score =   418 bits (1074),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 186/248 (75%), Positives = 219/248 (88%), Gaps = 0/248 (0%)
 Frame = +1

Query  1    FVENEEKLRRNLFDLLQEVVLIRDREDPRKFYPRFNLEDTSSFKGLDQHSKNVLKRLYYD  180
             ++ E+K+RR+LFDLLQ +VLIRD EDP+ FYPRFNLEDTSSF+ LD HSKNVLKRLYYD
Sbjct  663  LLDGEDKIRRSLFDLLQNIVLIRDPEDPKSFYPRFNLEDTSSFQALDDHSKNVLKRLYYD  722

Query  181  YYFHRQESLWRQNALNTLPVLMNSSDMLTCGEDLGMIPACVNPVMQELGLIGLHIQRMPS  360
            YYFHRQE+LWRQNAL TLP L+NSSDML CGEDLG+IP+CV+PVMQELGL+GL IQRMP+
Sbjct  723  YYFHRQETLWRQNALKTLPALLNSSDMLACGEDLGLIPSCVHPVMQELGLVGLRIQRMPN  782

Query  361  EPGREFGIPSEYSYMTVCAPSCHDCSTLRAWWEEDEGRRRRYFQTVVGSGAVPPDECTPE  540
            E   EFGIPS+YSYMTVCAPSCHDCSTLRAWWEED+ RR+R+F+ V+ S  +PPD+C PE
Sbjct  783  ESDLEFGIPSQYSYMTVCAPSCHDCSTLRAWWEEDDERRQRFFKNVMESNELPPDQCVPE  842

Query  541  IARFVLRKHVESPSMWSIFPLQDLLALKEDYATRPAVEETINDPTXPRHYWRYRMHVTME  720
            IA F++R+H+ESPSMW+IFPLQDLLALKE+Y  RPA EETINDPT P+HYWR+R+HVT+E
Sbjct  843  IAHFIIRQHIESPSMWAIFPLQDLLALKEEYTARPATEETINDPTNPKHYWRFRVHVTLE  902

Query  721  SLLNDKSL  744
            SL  D  L
Sbjct  903  SLNEDNKL  910



>ref|XP_004493319.1| PREDICTED: 4-alpha-glucanotransferase DPE2-like isoform X2 [Cicer 
arietinum]
Length=976

 Score =   418 bits (1074),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 186/248 (75%), Positives = 219/248 (88%), Gaps = 0/248 (0%)
 Frame = +1

Query  1    FVENEEKLRRNLFDLLQEVVLIRDREDPRKFYPRFNLEDTSSFKGLDQHSKNVLKRLYYD  180
             ++ E+K+RR+LFDLLQ +VLIRD EDP+ FYPRFNLEDTSSF+ LD HSKNVLKRLYYD
Sbjct  662  LLDGEDKIRRSLFDLLQNIVLIRDPEDPKSFYPRFNLEDTSSFQALDDHSKNVLKRLYYD  721

Query  181  YYFHRQESLWRQNALNTLPVLMNSSDMLTCGEDLGMIPACVNPVMQELGLIGLHIQRMPS  360
            YYFHRQE+LWRQNAL TLP L+NSSDML CGEDLG+IP+CV+PVMQELGL+GL IQRMP+
Sbjct  722  YYFHRQETLWRQNALKTLPALLNSSDMLACGEDLGLIPSCVHPVMQELGLVGLRIQRMPN  781

Query  361  EPGREFGIPSEYSYMTVCAPSCHDCSTLRAWWEEDEGRRRRYFQTVVGSGAVPPDECTPE  540
            E   EFGIPS+YSYMTVCAPSCHDCSTLRAWWEED+ RR+R+F+ V+ S  +PPD+C PE
Sbjct  782  ESDLEFGIPSQYSYMTVCAPSCHDCSTLRAWWEEDDERRQRFFKNVMESNELPPDQCVPE  841

Query  541  IARFVLRKHVESPSMWSIFPLQDLLALKEDYATRPAVEETINDPTXPRHYWRYRMHVTME  720
            IA F++R+H+ESPSMW+IFPLQDLLALKE+Y  RPA EETINDPT P+HYWR+R+HVT+E
Sbjct  842  IAHFIIRQHIESPSMWAIFPLQDLLALKEEYTARPATEETINDPTNPKHYWRFRVHVTLE  901

Query  721  SLLNDKSL  744
            SL  D  L
Sbjct  902  SLNEDNKL  909



>ref|XP_004309467.1| PREDICTED: 4-alpha-glucanotransferase DPE2 [Fragaria vesca subsp. 
vesca]
Length=969

 Score =   417 bits (1072),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 188/248 (76%), Positives = 217/248 (88%), Gaps = 0/248 (0%)
 Frame = +1

Query  1    FVENEEKLRRNLFDLLQEVVLIRDREDPRKFYPRFNLEDTSSFKGLDQHSKNVLKRLYYD  180
             ++NE+ +R+ LFD+LQ +VLIRD E+PR FYPRFNLE+TSSFK LD H KNVLKRLYYD
Sbjct  658  LLQNEDHIRQELFDILQNIVLIRDPENPRNFYPRFNLEETSSFKDLDDHCKNVLKRLYYD  717

Query  181  YYFHRQESLWRQNALNTLPVLMNSSDMLTCGEDLGMIPACVNPVMQELGLIGLHIQRMPS  360
            YYFHRQE LWR+NAL TLP L+NSSDML CGEDLG+IP+CV PVMQELGLIGL IQRMPS
Sbjct  718  YYFHRQEILWRENALKTLPALLNSSDMLACGEDLGLIPSCVYPVMQELGLIGLRIQRMPS  777

Query  361  EPGREFGIPSEYSYMTVCAPSCHDCSTLRAWWEEDEGRRRRYFQTVVGSGAVPPDECTPE  540
            EPG EFGIPS+YSYMTVCAPSCHDCSTLRAWWEEDE RR+RYF ++VGS  +PP  C PE
Sbjct  778  EPGLEFGIPSQYSYMTVCAPSCHDCSTLRAWWEEDEERRQRYFSSMVGSDLLPPSRCVPE  837

Query  541  IARFVLRKHVESPSMWSIFPLQDLLALKEDYATRPAVEETINDPTXPRHYWRYRMHVTME  720
            IA F++R+H E+PSMW+IFPLQDLL LKE+Y TRPA EETINDPT P+HYWRYR+HVT+E
Sbjct  838  IANFIIRQHFEAPSMWAIFPLQDLLILKEEYTTRPAKEETINDPTNPKHYWRYRVHVTLE  897

Query  721  SLLNDKSL  744
            +L+ DK L
Sbjct  898  ALIKDKEL  905



>ref|XP_007028193.1| Disproportionating enzyme 2 isoform 1 [Theobroma cacao]
 gb|EOY08695.1| Disproportionating enzyme 2 isoform 1 [Theobroma cacao]
Length=970

 Score =   417 bits (1071),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 189/246 (77%), Positives = 218/246 (89%), Gaps = 0/246 (0%)
 Frame = +1

Query  7    ENEEKLRRNLFDLLQEVVLIRDREDPRKFYPRFNLEDTSSFKGLDQHSKNVLKRLYYDYY  186
            E+E+K+R +LFDLL+ +VLIRD E  R FYPRFNLEDTSSF+ LD HSKNVLKRLYYDYY
Sbjct  666  ESEDKIRHDLFDLLKNIVLIRDPEYARNFYPRFNLEDTSSFRDLDDHSKNVLKRLYYDYY  725

Query  187  FHRQESLWRQNALNTLPVLMNSSDMLTCGEDLGMIPACVNPVMQELGLIGLHIQRMPSEP  366
            FHRQE LW+QNAL TLPVL+NSSDML CGEDLG+IPACV+PVMQELGLIGL IQRMPSEP
Sbjct  726  FHRQEKLWQQNALKTLPVLLNSSDMLACGEDLGLIPACVHPVMQELGLIGLRIQRMPSEP  785

Query  367  GREFGIPSEYSYMTVCAPSCHDCSTLRAWWEEDEGRRRRYFQTVVGSGAVPPDECTPEIA  546
              EFG PS+YSYMTVCAPSCHDCSTLRAWWEEDE RR R+F +V+GS  +PP +C P++A
Sbjct  786  DLEFGFPSQYSYMTVCAPSCHDCSTLRAWWEEDEERRHRFFNSVMGSDELPPTQCVPDVA  845

Query  547  RFVLRKHVESPSMWSIFPLQDLLALKEDYATRPAVEETINDPTXPRHYWRYRMHVTMESL  726
             F++R+HVE+PSMW+IFPLQDLLALKE+Y TRPA EETINDPT P+HYWRYR+HVTMESL
Sbjct  846  YFIIRQHVEAPSMWAIFPLQDLLALKEEYTTRPAAEETINDPTNPKHYWRYRVHVTMESL  905

Query  727  LNDKSL  744
            + D+ L
Sbjct  906  MKDEEL  911



>ref|XP_006576763.1| PREDICTED: 4-alpha-glucanotransferase DPE2-like [Glycine max]
Length=965

 Score =   415 bits (1067),  Expect = 9e-135, Method: Compositional matrix adjust.
 Identities = 190/248 (77%), Positives = 217/248 (88%), Gaps = 0/248 (0%)
 Frame = +1

Query  1    FVENEEKLRRNLFDLLQEVVLIRDREDPRKFYPRFNLEDTSSFKGLDQHSKNVLKRLYYD  180
             +E+ +KLR NLFDL Q +VLIRD EDPRKFYPRFNLEDTSSF+ LD HSKNVLKRLY D
Sbjct  664  LLESVDKLRHNLFDLSQNIVLIRDSEDPRKFYPRFNLEDTSSFQDLDDHSKNVLKRLYND  723

Query  181  YYFHRQESLWRQNALNTLPVLMNSSDMLTCGEDLGMIPACVNPVMQELGLIGLHIQRMPS  360
            YYF RQE+LWRQNAL TLPVL+NSSDML CGEDLG+IP+CV+PVMQELGL+GL IQRMP+
Sbjct  724  YYFCRQENLWRQNALKTLPVLLNSSDMLACGEDLGLIPSCVHPVMQELGLVGLRIQRMPN  783

Query  361  EPGREFGIPSEYSYMTVCAPSCHDCSTLRAWWEEDEGRRRRYFQTVVGSGAVPPDECTPE  540
            EP  EFGIPS+YSYMTVCAPSCHDCSTLRAWWEEDE RR R+F+ V+ S  +PPD+C PE
Sbjct  784  EPDLEFGIPSKYSYMTVCAPSCHDCSTLRAWWEEDEERRLRFFKNVMESDELPPDQCVPE  843

Query  541  IARFVLRKHVESPSMWSIFPLQDLLALKEDYATRPAVEETINDPTXPRHYWRYRMHVTME  720
            +  FVLR+H E+PSMW+IFPLQDLLALKE+Y TRPA EETINDPT P+HYWRYR+HVT+E
Sbjct  844  VVHFVLRQHFEAPSMWAIFPLQDLLALKEEYTTRPATEETINDPTNPKHYWRYRVHVTLE  903

Query  721  SLLNDKSL  744
            SL+ D  L
Sbjct  904  SLIKDNDL  911



>gb|KJB66143.1| hypothetical protein B456_010G128900 [Gossypium raimondii]
 gb|KJB66145.1| hypothetical protein B456_010G128900 [Gossypium raimondii]
 gb|KJB66146.1| hypothetical protein B456_010G128900 [Gossypium raimondii]
Length=947

 Score =   414 bits (1065),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 187/246 (76%), Positives = 218/246 (89%), Gaps = 0/246 (0%)
 Frame = +1

Query  7    ENEEKLRRNLFDLLQEVVLIRDREDPRKFYPRFNLEDTSSFKGLDQHSKNVLKRLYYDYY  186
            E+E+K+R +LFDLL+ +VLIRD E  + FYPRFNLEDTSSF+ LD HSKNVLKRLYYDYY
Sbjct  665  ESEDKIRCDLFDLLKNIVLIRDPEHDKSFYPRFNLEDTSSFRDLDDHSKNVLKRLYYDYY  724

Query  187  FHRQESLWRQNALNTLPVLMNSSDMLTCGEDLGMIPACVNPVMQELGLIGLHIQRMPSEP  366
            FHRQ+ LW+QNAL TLP L+NSSDML CGEDLG+IPACV+PVMQELGLIGL IQRMPSEP
Sbjct  725  FHRQDKLWQQNALKTLPALLNSSDMLACGEDLGLIPACVHPVMQELGLIGLRIQRMPSEP  784

Query  367  GREFGIPSEYSYMTVCAPSCHDCSTLRAWWEEDEGRRRRYFQTVVGSGAVPPDECTPEIA  546
              EFGIPS+YSYMTVCAPSCHDCSTLRAWWEEDE RR R+F++V+GS  +PP +C P++A
Sbjct  785  DLEFGIPSQYSYMTVCAPSCHDCSTLRAWWEEDEERRHRFFKSVIGSDDLPPSQCVPDLA  844

Query  547  RFVLRKHVESPSMWSIFPLQDLLALKEDYATRPAVEETINDPTXPRHYWRYRMHVTMESL  726
              ++R+H+ESPSMW+IFPLQDLLALKE+Y TRPA EETINDPT P+HYWRYR+HVTMESL
Sbjct  845  HLIIRQHIESPSMWAIFPLQDLLALKEEYMTRPATEETINDPTNPKHYWRYRVHVTMESL  904

Query  727  LNDKSL  744
            + DK L
Sbjct  905  IKDKEL  910



>gb|KJB66147.1| hypothetical protein B456_010G128900 [Gossypium raimondii]
Length=935

 Score =   414 bits (1064),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 187/246 (76%), Positives = 218/246 (89%), Gaps = 0/246 (0%)
 Frame = +1

Query  7    ENEEKLRRNLFDLLQEVVLIRDREDPRKFYPRFNLEDTSSFKGLDQHSKNVLKRLYYDYY  186
            E+E+K+R +LFDLL+ +VLIRD E  + FYPRFNLEDTSSF+ LD HSKNVLKRLYYDYY
Sbjct  653  ESEDKIRCDLFDLLKNIVLIRDPEHDKSFYPRFNLEDTSSFRDLDDHSKNVLKRLYYDYY  712

Query  187  FHRQESLWRQNALNTLPVLMNSSDMLTCGEDLGMIPACVNPVMQELGLIGLHIQRMPSEP  366
            FHRQ+ LW+QNAL TLP L+NSSDML CGEDLG+IPACV+PVMQELGLIGL IQRMPSEP
Sbjct  713  FHRQDKLWQQNALKTLPALLNSSDMLACGEDLGLIPACVHPVMQELGLIGLRIQRMPSEP  772

Query  367  GREFGIPSEYSYMTVCAPSCHDCSTLRAWWEEDEGRRRRYFQTVVGSGAVPPDECTPEIA  546
              EFGIPS+YSYMTVCAPSCHDCSTLRAWWEEDE RR R+F++V+GS  +PP +C P++A
Sbjct  773  DLEFGIPSQYSYMTVCAPSCHDCSTLRAWWEEDEERRHRFFKSVIGSDDLPPSQCVPDLA  832

Query  547  RFVLRKHVESPSMWSIFPLQDLLALKEDYATRPAVEETINDPTXPRHYWRYRMHVTMESL  726
              ++R+H+ESPSMW+IFPLQDLLALKE+Y TRPA EETINDPT P+HYWRYR+HVTMESL
Sbjct  833  HLIIRQHIESPSMWAIFPLQDLLALKEEYMTRPATEETINDPTNPKHYWRYRVHVTMESL  892

Query  727  LNDKSL  744
            + DK L
Sbjct  893  IKDKEL  898



>ref|XP_003554099.1| PREDICTED: 4-alpha-glucanotransferase DPE2-like [Glycine max]
Length=965

 Score =   415 bits (1066),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 188/248 (76%), Positives = 219/248 (88%), Gaps = 0/248 (0%)
 Frame = +1

Query  1    FVENEEKLRRNLFDLLQEVVLIRDREDPRKFYPRFNLEDTSSFKGLDQHSKNVLKRLYYD  180
             +E+ +KL+RNLFDL Q +VLIRD EDPRKFYPRFNLEDT SF+ LD HSKNVLKRLY+D
Sbjct  664  LLESVDKLQRNLFDLSQNIVLIRDPEDPRKFYPRFNLEDTISFQDLDDHSKNVLKRLYHD  723

Query  181  YYFHRQESLWRQNALNTLPVLMNSSDMLTCGEDLGMIPACVNPVMQELGLIGLHIQRMPS  360
            YYF RQE+LWRQNAL TLPVL+NSSDML CGEDLG+IP+CV+PVMQELGL+GL IQRMP+
Sbjct  724  YYFCRQENLWRQNALKTLPVLLNSSDMLACGEDLGLIPSCVHPVMQELGLVGLRIQRMPN  783

Query  361  EPGREFGIPSEYSYMTVCAPSCHDCSTLRAWWEEDEGRRRRYFQTVVGSGAVPPDECTPE  540
            EP  EFGIPS+YSYMTVCAPSCHDCSTLRAWWEEDE RR R+F+ V+ S  +PPD+C PE
Sbjct  784  EPDLEFGIPSKYSYMTVCAPSCHDCSTLRAWWEEDEERRLRFFKNVMESDGLPPDQCVPE  843

Query  541  IARFVLRKHVESPSMWSIFPLQDLLALKEDYATRPAVEETINDPTXPRHYWRYRMHVTME  720
            +A FV+R+H E+PSMW+IFPLQDLLALKE+Y TRPA EETINDPT P+HYWR+R+HVT+E
Sbjct  844  VAHFVIRQHFEAPSMWAIFPLQDLLALKEEYTTRPATEETINDPTNPKHYWRFRVHVTLE  903

Query  721  SLLNDKSL  744
            SL+ D  L
Sbjct  904  SLIKDNDL  911



>gb|KHN38798.1| 4-alpha-glucanotransferase DPE2 [Glycine soja]
Length=974

 Score =   415 bits (1066),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 190/248 (77%), Positives = 217/248 (88%), Gaps = 0/248 (0%)
 Frame = +1

Query  1    FVENEEKLRRNLFDLLQEVVLIRDREDPRKFYPRFNLEDTSSFKGLDQHSKNVLKRLYYD  180
             +E+ +KLR NLFDL Q +VLIRD EDPRKFYPRFNLEDTSSF+ LD HSKNVLKRLY D
Sbjct  673  LLESVDKLRHNLFDLSQNIVLIRDSEDPRKFYPRFNLEDTSSFQDLDDHSKNVLKRLYND  732

Query  181  YYFHRQESLWRQNALNTLPVLMNSSDMLTCGEDLGMIPACVNPVMQELGLIGLHIQRMPS  360
            YYF RQE+LWRQNAL TLPVL+NSSDML CGEDLG+IP+CV+PVMQELGL+GL IQRMP+
Sbjct  733  YYFCRQENLWRQNALKTLPVLLNSSDMLACGEDLGLIPSCVHPVMQELGLVGLRIQRMPN  792

Query  361  EPGREFGIPSEYSYMTVCAPSCHDCSTLRAWWEEDEGRRRRYFQTVVGSGAVPPDECTPE  540
            EP  EFGIPS+YSYMTVCAPSCHDCSTLRAWWEEDE RR R+F+ V+ S  +PPD+C PE
Sbjct  793  EPDLEFGIPSKYSYMTVCAPSCHDCSTLRAWWEEDEERRLRFFKNVMESDELPPDQCVPE  852

Query  541  IARFVLRKHVESPSMWSIFPLQDLLALKEDYATRPAVEETINDPTXPRHYWRYRMHVTME  720
            +  FVLR+H E+PSMW+IFPLQDLLALKE+Y TRPA EETINDPT P+HYWRYR+HVT+E
Sbjct  853  VVHFVLRQHFEAPSMWAIFPLQDLLALKEEYTTRPATEETINDPTNPKHYWRYRVHVTLE  912

Query  721  SLLNDKSL  744
            SL+ D  L
Sbjct  913  SLIKDNDL  920



>gb|KHN08918.1| 4-alpha-glucanotransferase DPE2 [Glycine soja]
Length=1023

 Score =   416 bits (1069),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 188/248 (76%), Positives = 219/248 (88%), Gaps = 0/248 (0%)
 Frame = +1

Query  1    FVENEEKLRRNLFDLLQEVVLIRDREDPRKFYPRFNLEDTSSFKGLDQHSKNVLKRLYYD  180
             +E+ +KL+RNLFDL Q +VLIRD EDPRKFYPRFNLEDT SF+ LD HSKNVLKRLY+D
Sbjct  722  LLESVDKLQRNLFDLSQNIVLIRDPEDPRKFYPRFNLEDTISFQDLDDHSKNVLKRLYHD  781

Query  181  YYFHRQESLWRQNALNTLPVLMNSSDMLTCGEDLGMIPACVNPVMQELGLIGLHIQRMPS  360
            YYF RQE+LWRQNAL TLPVL+NSSDML CGEDLG+IP+CV+PVMQELGL+GL IQRMP+
Sbjct  782  YYFCRQENLWRQNALKTLPVLLNSSDMLACGEDLGLIPSCVHPVMQELGLVGLRIQRMPN  841

Query  361  EPGREFGIPSEYSYMTVCAPSCHDCSTLRAWWEEDEGRRRRYFQTVVGSGAVPPDECTPE  540
            EP  EFGIPS+YSYMTVCAPSCHDCSTLRAWWEEDE RR R+F+ V+ S  +PPD+C PE
Sbjct  842  EPDLEFGIPSKYSYMTVCAPSCHDCSTLRAWWEEDEERRLRFFKNVMESDGLPPDQCVPE  901

Query  541  IARFVLRKHVESPSMWSIFPLQDLLALKEDYATRPAVEETINDPTXPRHYWRYRMHVTME  720
            +A FV+R+H E+PSMW+IFPLQDLLALKE+Y TRPA EETINDPT P+HYWR+R+HVT+E
Sbjct  902  VAHFVIRQHFEAPSMWAIFPLQDLLALKEEYTTRPATEETINDPTNPKHYWRFRVHVTLE  961

Query  721  SLLNDKSL  744
            SL+ D  L
Sbjct  962  SLIKDNDL  969



>gb|ACN50178.1| disproportionating enzyme 2 [Annona cherimola]
Length=953

 Score =   414 bits (1063),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 188/248 (76%), Positives = 217/248 (88%), Gaps = 0/248 (0%)
 Frame = +1

Query  1    FVENEEKLRRNLFDLLQEVVLIRDREDPRKFYPRFNLEDTSSFKGLDQHSKNVLKRLYYD  180
            +++ E+ +R  LFD+L+ +VLIRD ED RKFYPRFNLEDTSSFK LD HSKNVLKRLYYD
Sbjct  665  WMDKEDNIRSGLFDILKNIVLIRDPEDQRKFYPRFNLEDTSSFKDLDDHSKNVLKRLYYD  724

Query  181  YYFHRQESLWRQNALNTLPVLMNSSDMLTCGEDLGMIPACVNPVMQELGLIGLHIQRMPS  360
            YYF+RQE+LWRQNAL TLPVL+NSSDML CGEDLG+IP+CV+PVM ELGL+GL IQRMPS
Sbjct  725  YYFYRQENLWRQNALKTLPVLLNSSDMLACGEDLGLIPSCVHPVMLELGLVGLRIQRMPS  784

Query  361  EPGREFGIPSEYSYMTVCAPSCHDCSTLRAWWEEDEGRRRRYFQTVVGSGAVPPDECTPE  540
            EP  EFGIPS+YSYMTVCAPSCHDCSTLRAWWEEDEGRRRR+F+ VVGS   PP  C PE
Sbjct  785  EPDLEFGIPSQYSYMTVCAPSCHDCSTLRAWWEEDEGRRRRFFEAVVGSDDEPPACCAPE  844

Query  541  IARFVLRKHVESPSMWSIFPLQDLLALKEDYATRPAVEETINDPTXPRHYWRYRMHVTME  720
            IA FVL++H ++PSMW+IFPLQDLLALKE+Y  RPA EETINDPT P+HYWR+R+HVT+E
Sbjct  845  IAHFVLQQHFDAPSMWAIFPLQDLLALKEEYTARPAAEETINDPTNPKHYWRFRVHVTLE  904

Query  721  SLLNDKSL  744
            SL+ D  L
Sbjct  905  SLMKDSDL  912



>ref|XP_010111246.1| 4-alpha-glucanotransferase DPE2 [Morus notabilis]
 gb|EXC30724.1| 4-alpha-glucanotransferase DPE2 [Morus notabilis]
Length=990

 Score =   414 bits (1065),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 194/248 (78%), Positives = 223/248 (90%), Gaps = 0/248 (0%)
 Frame = +1

Query  1    FVENEEKLRRNLFDLLQEVVLIRDREDPRKFYPRFNLEDTSSFKGLDQHSKNVLKRLYYD  180
             ++NE+K+RR+LFDLL+ +VLIRD EDP+KFYPRFNLEDTSSF+ LD HSKNVLKRLYYD
Sbjct  686  LLDNEDKIRRDLFDLLRNIVLIRDPEDPKKFYPRFNLEDTSSFQDLDDHSKNVLKRLYYD  745

Query  181  YYFHRQESLWRQNALNTLPVLMNSSDMLTCGEDLGMIPACVNPVMQELGLIGLHIQRMPS  360
            YYFHRQE+LWRQNAL TLPVL+NSSDML CGEDLG+IP+CV+PVMQELGL+GL IQRMPS
Sbjct  746  YYFHRQENLWRQNALKTLPVLLNSSDMLACGEDLGLIPSCVHPVMQELGLVGLRIQRMPS  805

Query  361  EPGREFGIPSEYSYMTVCAPSCHDCSTLRAWWEEDEGRRRRYFQTVVGSGAVPPDECTPE  540
            EPG EFGIPS+YSYMTVCAPSCHDCSTLRAWWEEDE RRRRYF+TVVGS  +PP  C P+
Sbjct  806  EPGLEFGIPSQYSYMTVCAPSCHDCSTLRAWWEEDEERRRRYFKTVVGSDLLPPSTCVPD  865

Query  541  IARFVLRKHVESPSMWSIFPLQDLLALKEDYATRPAVEETINDPTXPRHYWRYRMHVTME  720
            +A FV+++HVE+PSMW+IFPLQDL ALKE Y  RPA EETINDPT P+HYWRYR+HVT+E
Sbjct  866  VAYFVIKQHVEAPSMWAIFPLQDLFALKEKYTRRPATEETINDPTNPKHYWRYRVHVTLE  925

Query  721  SLLNDKSL  744
            SL+ D  L
Sbjct  926  SLIKDNEL  933



>ref|XP_011040702.1| PREDICTED: 4-alpha-glucanotransferase DPE2-like [Populus euphratica]
Length=976

 Score =   414 bits (1064),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 189/245 (77%), Positives = 215/245 (88%), Gaps = 0/245 (0%)
 Frame = +1

Query  10   NEEKLRRNLFDLLQEVVLIRDREDPRKFYPRFNLEDTSSFKGLDQHSKNVLKRLYYDYYF  189
            +E+K+RR+LFDLL+ +VLIRD ED  KFYP FNLEDTSSF+ LD HSKNVL+RLYYDYYF
Sbjct  666  SEDKIRRDLFDLLKNIVLIRDPEDASKFYPLFNLEDTSSFQDLDDHSKNVLRRLYYDYYF  725

Query  190  HRQESLWRQNALNTLPVLMNSSDMLTCGEDLGMIPACVNPVMQELGLIGLHIQRMPSEPG  369
            HRQE+LWRQNAL TLP L+NSSDML CGEDLG+IPACV+PVMQELGLIGL IQRMPSE  
Sbjct  726  HRQENLWRQNALKTLPALLNSSDMLACGEDLGLIPACVHPVMQELGLIGLRIQRMPSESD  785

Query  370  REFGIPSEYSYMTVCAPSCHDCSTLRAWWEEDEGRRRRYFQTVVGSGAVPPDECTPEIAR  549
             EFGIPS+YSYMTVCAPSCHDCST RAWWEED  RR RYF+ +VG  A+P  +C P+IA 
Sbjct  786  LEFGIPSQYSYMTVCAPSCHDCSTFRAWWEEDAERRCRYFKNMVGPDAIPSSQCVPDIAH  845

Query  550  FVLRKHVESPSMWSIFPLQDLLALKEDYATRPAVEETINDPTXPRHYWRYRMHVTMESLL  729
            FV+R+HVE+PSMW+IFPLQDLLALKE+Y TRPA EETINDPT P+HYWRYR+HVT+ESLL
Sbjct  846  FVIRQHVEAPSMWAIFPLQDLLALKEEYTTRPATEETINDPTNPKHYWRYRVHVTLESLL  905

Query  730  NDKSL  744
             DK L
Sbjct  906  KDKEL  910



>emb|CAX51389.1| disproportionating enzyme [Hordeum vulgare subsp. vulgare]
Length=448

 Score =   397 bits (1021),  Expect = 6e-134, Method: Compositional matrix adjust.
 Identities = 179/248 (72%), Positives = 212/248 (85%), Gaps = 0/248 (0%)
 Frame = +1

Query  1    FVENEEKLRRNLFDLLQEVVLIRDREDPRKFYPRFNLEDTSSFKGLDQHSKNVLKRLYYD  180
            ++E E+ +RR LFDLLQ +VLIRD ED  K+YPRFNLEDTSSF+ LD+HSKNVL+RLY+D
Sbjct  171  WLEKEDSIRRGLFDLLQNIVLIRDPEDSTKYYPRFNLEDTSSFRDLDEHSKNVLRRLYHD  230

Query  181  YYFHRQESLWRQNALNTLPVLMNSSDMLTCGEDLGMIPACVNPVMQELGLIGLHIQRMPS  360
            YYF RQE+LWRQNAL TLPVL+N SDML CGEDLG+IPACV+PVMQELGLIGL IQRMPS
Sbjct  231  YYFVRQENLWRQNALKTLPVLLNCSDMLACGEDLGLIPACVHPVMQELGLIGLRIQRMPS  290

Query  361  EPGREFGIPSEYSYMTVCAPSCHDCSTLRAWWEEDEGRRRRYFQTVVGSGAVPPDECTPE  540
            EPG EF IPS YSYMTVCAPSCHDCSTLRAWWE DEG R R+++TV+GS    P  CTPE
Sbjct  291  EPGLEFDIPSNYSYMTVCAPSCHDCSTLRAWWEGDEGTRSRFYKTVIGSDKEAPSRCTPE  350

Query  541  IARFVLRKHVESPSMWSIFPLQDLLALKEDYATRPAVEETINDPTXPRHYWRYRMHVTME  720
            +  F++++H ++PSMW+IFPLQDLLALK+ Y  RPA EETINDPT P+HYWR+R+HV +E
Sbjct  351  VVHFIVQQHFDAPSMWAIFPLQDLLALKDKYTARPAAEETINDPTNPKHYWRFRLHVPLE  410

Query  721  SLLNDKSL  744
            S+L DK +
Sbjct  411  SMLEDKDI  418



>ref|XP_006658074.1| PREDICTED: 4-alpha-glucanotransferase DPE2-like [Oryza brachyantha]
Length=950

 Score =   412 bits (1060),  Expect = 7e-134, Method: Compositional matrix adjust.
 Identities = 185/248 (75%), Positives = 218/248 (88%), Gaps = 0/248 (0%)
 Frame = +1

Query  1    FVENEEKLRRNLFDLLQEVVLIRDREDPRKFYPRFNLEDTSSFKGLDQHSKNVLKRLYYD  180
            ++E E+ +RR LFDL+Q +VLIRD ED  KFYPRFNLEDTSSF+ LD+HSKNVL+RLYYD
Sbjct  664  WLEKEDNIRRGLFDLIQNIVLIRDPEDNTKFYPRFNLEDTSSFRDLDEHSKNVLRRLYYD  723

Query  181  YYFHRQESLWRQNALNTLPVLMNSSDMLTCGEDLGMIPACVNPVMQELGLIGLHIQRMPS  360
            YYF RQE+LWR+NAL TLPVL+NSSDML CGEDLG+IPACV+PVMQELGLIGL IQRMPS
Sbjct  724  YYFARQENLWRENALKTLPVLLNSSDMLACGEDLGLIPACVHPVMQELGLIGLRIQRMPS  783

Query  361  EPGREFGIPSEYSYMTVCAPSCHDCSTLRAWWEEDEGRRRRYFQTVVGSGAVPPDECTPE  540
            E   EFGIPS+YSYMTVCAPSCHDCSTLRAWWEED GRR R+++TVVGS   PP  CTPE
Sbjct  784  ESNLEFGIPSQYSYMTVCAPSCHDCSTLRAWWEEDAGRRSRFYKTVVGSDDEPPSRCTPE  843

Query  541  IARFVLRKHVESPSMWSIFPLQDLLALKEDYATRPAVEETINDPTXPRHYWRYRMHVTME  720
            +  F++++H ++PSMW+IFPLQDLLALK+ Y TRPA EETINDPT P+HYWR+R+HVT+E
Sbjct  844  VVHFIVQQHFDAPSMWAIFPLQDLLALKDKYTTRPAPEETINDPTNPKHYWRFRVHVTLE  903

Query  721  SLLNDKSL  744
            SLL+DK +
Sbjct  904  SLLDDKDI  911



>ref|XP_003624891.1| 4-alpha-glucanotransferase [Medicago truncatula]
Length=790

 Score =   407 bits (1045),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 186/267 (70%), Positives = 220/267 (82%), Gaps = 19/267 (7%)
 Frame = +1

Query  1    FVENEEKLRRNLFDLLQEVVLIRDREDPRKFYPRFNLEDTSSFKGLDQHSKNVLKRLYYD  180
             +E+E+K+RRNL DLLQ +VLIRD E+P+ FYPRFNLEDTSSF+ LD HSKNVLKRLYYD
Sbjct  460  LLESEDKMRRNLIDLLQNIVLIRDPENPKDFYPRFNLEDTSSFQALDDHSKNVLKRLYYD  519

Query  181  YYFHRQESLWRQNALNTLPVLMNSSDMLTCGEDLGMIPACVNPV----------------  312
            YYFHRQE+LWRQNAL TLP L+NSS+ML CGEDLG+IP+CV+PV                
Sbjct  520  YYFHRQENLWRQNALKTLPALLNSSEMLACGEDLGLIPSCVHPVCQLYSLSSNKQEPPSH  579

Query  313  ---MQELGLIGLHIQRMPSEPGREFGIPSEYSYMTVCAPSCHDCSTLRAWWEEDEGRRRR  483
               MQELGL+GL IQRMP+E   EFGIPS+YSYMTVCAPSCHDCSTLRAWWEEDE RR+R
Sbjct  580  SCVMQELGLVGLRIQRMPNESDLEFGIPSQYSYMTVCAPSCHDCSTLRAWWEEDEERRQR  639

Query  484  YFQTVVGSGAVPPDECTPEIARFVLRKHVESPSMWSIFPLQDLLALKEDYATRPAVEETI  663
            +F+ V+ S  +PPD+C PE+A F++R+H+ESPSMW+IFPLQDLLALKE+Y  RPA+EETI
Sbjct  640  FFKNVMESDELPPDQCVPEVAHFIIRQHIESPSMWAIFPLQDLLALKEEYTARPAIEETI  699

Query  664  NDPTXPRHYWRYRMHVTMESLLNDKSL  744
            NDPT P+HYWRYR+HVT+ESL  D  L
Sbjct  700  NDPTNPKHYWRYRVHVTLESLNKDNEL  726



>ref|XP_003562501.1| PREDICTED: 4-alpha-glucanotransferase DPE2 [Brachypodium distachyon]
 ref|XP_010234353.1| PREDICTED: 4-alpha-glucanotransferase DPE2 [Brachypodium distachyon]
Length=929

 Score =   410 bits (1054),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 182/248 (73%), Positives = 218/248 (88%), Gaps = 0/248 (0%)
 Frame = +1

Query  1    FVENEEKLRRNLFDLLQEVVLIRDREDPRKFYPRFNLEDTSSFKGLDQHSKNVLKRLYYD  180
            ++E E+ +RR LFDLLQ +VLIRD EDP KFYPRFNLEDTS+F+ LD+HSKNVL+RLYYD
Sbjct  651  WLEKEDSVRRGLFDLLQNIVLIRDPEDPTKFYPRFNLEDTSNFRDLDEHSKNVLRRLYYD  710

Query  181  YYFHRQESLWRQNALNTLPVLMNSSDMLTCGEDLGMIPACVNPVMQELGLIGLHIQRMPS  360
            YYF RQE+LWRQNAL TLPVL+++SDML CGEDLG+IPACV+PVMQELGLIGL IQRMPS
Sbjct  711  YYFTRQENLWRQNALKTLPVLLDASDMLACGEDLGLIPACVHPVMQELGLIGLRIQRMPS  770

Query  361  EPGREFGIPSEYSYMTVCAPSCHDCSTLRAWWEEDEGRRRRYFQTVVGSGAVPPDECTPE  540
            EP  EFGIPS+YSYMTVCAPSCHDCSTLRAWWEE+ GRR R+++ V+GS   PP  CTPE
Sbjct  771  EPNCEFGIPSQYSYMTVCAPSCHDCSTLRAWWEEEAGRRSRFYKGVIGSDKEPPSRCTPE  830

Query  541  IARFVLRKHVESPSMWSIFPLQDLLALKEDYATRPAVEETINDPTXPRHYWRYRMHVTME  720
            +  F++++H ++PSMW+IFPLQDLLALK+ Y TRPAVEETINDPT P+HYWR+R+HV +E
Sbjct  831  VVHFIVQQHFDAPSMWAIFPLQDLLALKDKYTTRPAVEETINDPTNPKHYWRFRLHVPLE  890

Query  721  SLLNDKSL  744
            S+L DK +
Sbjct  891  SMLEDKDI  898



>ref|XP_006482017.1| PREDICTED: 4-alpha-glucanotransferase DPE2-like isoform X1 [Citrus 
sinensis]
 ref|XP_006482018.1| PREDICTED: 4-alpha-glucanotransferase DPE2-like isoform X2 [Citrus 
sinensis]
Length=975

 Score =   411 bits (1057),  Expect = 4e-133, Method: Compositional matrix adjust.
 Identities = 194/248 (78%), Positives = 223/248 (90%), Gaps = 0/248 (0%)
 Frame = +1

Query  1    FVENEEKLRRNLFDLLQEVVLIRDREDPRKFYPRFNLEDTSSFKGLDQHSKNVLKRLYYD  180
             +++E+K RR+LFDL+Q +VLIRD ED +KFYPRFNLEDTSSF  LD HSKNVLKRLYYD
Sbjct  671  LLDSEDKTRRDLFDLIQNIVLIRDPEDSKKFYPRFNLEDTSSFMDLDDHSKNVLKRLYYD  730

Query  181  YYFHRQESLWRQNALNTLPVLMNSSDMLTCGEDLGMIPACVNPVMQELGLIGLHIQRMPS  360
            YYFHRQE+LWR+NAL TLP L+NSSDM+ CGEDLG+IP+CV+PVM+ELGLIGL IQRMPS
Sbjct  731  YYFHRQENLWRENALKTLPALLNSSDMMACGEDLGLIPSCVHPVMEELGLIGLRIQRMPS  790

Query  361  EPGREFGIPSEYSYMTVCAPSCHDCSTLRAWWEEDEGRRRRYFQTVVGSGAVPPDECTPE  540
            EPG EFGIPS+Y+YMTVCAPSCHDCSTLRAWWEEDE RRRR+F+ VVGS A+PP +C P+
Sbjct  791  EPGLEFGIPSQYNYMTVCAPSCHDCSTLRAWWEEDEERRRRFFKNVVGSDALPPSQCLPD  850

Query  541  IARFVLRKHVESPSMWSIFPLQDLLALKEDYATRPAVEETINDPTXPRHYWRYRMHVTME  720
            I  F+LR+HVESPSMW+IFPLQDLLALKEDY+TRPA EETINDPT PRHYWRYR+HVT+E
Sbjct  851  ITHFILRQHVESPSMWAIFPLQDLLALKEDYSTRPATEETINDPTNPRHYWRYRVHVTLE  910

Query  721  SLLNDKSL  744
            SL  DK L
Sbjct  911  SLQKDKEL  918



>gb|KDO57419.1| hypothetical protein CISIN_1g002027mg [Citrus sinensis]
 gb|KDO57420.1| hypothetical protein CISIN_1g002027mg [Citrus sinensis]
Length=975

 Score =   411 bits (1056),  Expect = 5e-133, Method: Compositional matrix adjust.
 Identities = 194/248 (78%), Positives = 222/248 (90%), Gaps = 0/248 (0%)
 Frame = +1

Query  1    FVENEEKLRRNLFDLLQEVVLIRDREDPRKFYPRFNLEDTSSFKGLDQHSKNVLKRLYYD  180
             +++E+K RR+LFDL+Q +VLIRD ED +KFYPRFNLEDTSSF  LD HSKNVLKRLYYD
Sbjct  671  LLDSEDKTRRDLFDLIQNIVLIRDPEDSKKFYPRFNLEDTSSFMDLDDHSKNVLKRLYYD  730

Query  181  YYFHRQESLWRQNALNTLPVLMNSSDMLTCGEDLGMIPACVNPVMQELGLIGLHIQRMPS  360
            YYFHRQE+LWR+NAL TLP L+NSSDM+ CGEDLG+IP+CV+PVM+ELGLIGL IQRMPS
Sbjct  731  YYFHRQENLWRENALKTLPALLNSSDMMACGEDLGLIPSCVHPVMEELGLIGLRIQRMPS  790

Query  361  EPGREFGIPSEYSYMTVCAPSCHDCSTLRAWWEEDEGRRRRYFQTVVGSGAVPPDECTPE  540
            EPG EFGIPS+Y+YMTVCAPSCHDCSTLRAWWEEDE RRRR+F+ VVGS A+PP +C P+
Sbjct  791  EPGLEFGIPSQYNYMTVCAPSCHDCSTLRAWWEEDEERRRRFFKNVVGSDALPPSQCLPD  850

Query  541  IARFVLRKHVESPSMWSIFPLQDLLALKEDYATRPAVEETINDPTXPRHYWRYRMHVTME  720
            I  F+LR+HVESPSMW+IFPLQDLLALKEDY TRPA EETINDPT PRHYWRYR+HVT+E
Sbjct  851  ITHFILRQHVESPSMWAIFPLQDLLALKEDYTTRPATEETINDPTNPRHYWRYRVHVTLE  910

Query  721  SLLNDKSL  744
            SL  DK L
Sbjct  911  SLQKDKEL  918



>ref|XP_009142714.1| PREDICTED: 4-alpha-glucanotransferase DPE2 [Brassica rapa]
Length=941

 Score =   409 bits (1052),  Expect = 9e-133, Method: Compositional matrix adjust.
 Identities = 181/248 (73%), Positives = 216/248 (87%), Gaps = 0/248 (0%)
 Frame = +1

Query  1    FVENEEKLRRNLFDLLQEVVLIRDREDPRKFYPRFNLEDTSSFKGLDQHSKNVLKRLYYD  180
             +ENE+K+RR++FD+L+ VVLI+D ED RKFYPRFN+EDTSSF+ LD HSKNVLKRLYYD
Sbjct  668  LLENEDKVRRDVFDILRNVVLIKDPEDARKFYPRFNIEDTSSFQDLDDHSKNVLKRLYYD  727

Query  181  YYFHRQESLWRQNALNTLPVLMNSSDMLTCGEDLGMIPACVNPVMQELGLIGLHIQRMPS  360
            YYFHRQE LWR+NAL TLP L+NSS+ML CGEDLG++PACV+PVM+EL L+GL IQRMPS
Sbjct  728  YYFHRQEDLWRKNALKTLPALLNSSNMLACGEDLGLVPACVHPVMKELALVGLRIQRMPS  787

Query  361  EPGREFGIPSEYSYMTVCAPSCHDCSTLRAWWEEDEGRRRRYFQTVVGSGAVPPDECTPE  540
            E   EFG+PS Y YMTVCAPSCHDCSTLRAWWEEDE RR+RYF+ V+G  A+PP +C PE
Sbjct  788  ESDVEFGVPSNYDYMTVCAPSCHDCSTLRAWWEEDEERRQRYFKEVIGLDAIPPSQCVPE  847

Query  541  IARFVLRKHVESPSMWSIFPLQDLLALKEDYATRPAVEETINDPTXPRHYWRYRMHVTME  720
            I  F+LR+HVE+PSMW+IFPLQD+LALKE+Y  RPA EETINDPT P+HYWRYR+HVT++
Sbjct  848  ITHFILRQHVEAPSMWAIFPLQDMLALKEEYTARPAKEETINDPTNPKHYWRYRVHVTLD  907

Query  721  SLLNDKSL  744
            SL+ D  L
Sbjct  908  SLMKDVDL  915



>emb|CDX79967.1| BnaA05g01890D [Brassica napus]
Length=941

 Score =   409 bits (1052),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 181/248 (73%), Positives = 216/248 (87%), Gaps = 0/248 (0%)
 Frame = +1

Query  1    FVENEEKLRRNLFDLLQEVVLIRDREDPRKFYPRFNLEDTSSFKGLDQHSKNVLKRLYYD  180
             +ENE+K+RR++FD+L+ VVLI+D ED RKFYPRFN+EDTSSF+ LD HSKNVLKRLYYD
Sbjct  668  LLENEDKVRRDVFDILRNVVLIKDPEDARKFYPRFNIEDTSSFQDLDDHSKNVLKRLYYD  727

Query  181  YYFHRQESLWRQNALNTLPVLMNSSDMLTCGEDLGMIPACVNPVMQELGLIGLHIQRMPS  360
            YYFHRQE LWR+NAL TLP L+NSS+ML CGEDLG++PACV+PVM+EL L+GL IQRMPS
Sbjct  728  YYFHRQEDLWRKNALKTLPALLNSSNMLACGEDLGLVPACVHPVMKELALVGLRIQRMPS  787

Query  361  EPGREFGIPSEYSYMTVCAPSCHDCSTLRAWWEEDEGRRRRYFQTVVGSGAVPPDECTPE  540
            E   EFG+PS Y YMTVCAPSCHDCSTLRAWWEEDE RR+RYF+ V+G  A+PP +C PE
Sbjct  788  ESDVEFGVPSNYDYMTVCAPSCHDCSTLRAWWEEDEERRQRYFKEVIGLDAIPPSQCVPE  847

Query  541  IARFVLRKHVESPSMWSIFPLQDLLALKEDYATRPAVEETINDPTXPRHYWRYRMHVTME  720
            I  F+LR+HVE+PSMW+IFPLQD+LALKE+Y  RPA EETINDPT P+HYWRYR+HVT++
Sbjct  848  ITHFILRQHVEAPSMWAIFPLQDMLALKEEYTARPAKEETINDPTNPKHYWRYRVHVTLD  907

Query  721  SLLNDKSL  744
            SL+ D  L
Sbjct  908  SLMKDVDL  915



>ref|XP_006430481.1| hypothetical protein CICLE_v10010989mg [Citrus clementina]
 gb|ESR43721.1| hypothetical protein CICLE_v10010989mg [Citrus clementina]
Length=975

 Score =   410 bits (1053),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 194/248 (78%), Positives = 222/248 (90%), Gaps = 0/248 (0%)
 Frame = +1

Query  1    FVENEEKLRRNLFDLLQEVVLIRDREDPRKFYPRFNLEDTSSFKGLDQHSKNVLKRLYYD  180
             +++E+K RR+LFDL+Q +VLIRD ED +KFYPRFNLEDTSSF  LD HSKNVLKRLYYD
Sbjct  671  LLDSEDKTRRDLFDLIQNIVLIRDPEDSKKFYPRFNLEDTSSFMDLDDHSKNVLKRLYYD  730

Query  181  YYFHRQESLWRQNALNTLPVLMNSSDMLTCGEDLGMIPACVNPVMQELGLIGLHIQRMPS  360
            YYFHRQE+LWR+NAL TLP L+NSSDM+ CGEDLG+IP+CV+PVM+ELGLIGL IQRMPS
Sbjct  731  YYFHRQENLWRENALKTLPALLNSSDMMACGEDLGLIPSCVHPVMEELGLIGLRIQRMPS  790

Query  361  EPGREFGIPSEYSYMTVCAPSCHDCSTLRAWWEEDEGRRRRYFQTVVGSGAVPPDECTPE  540
            EPG EFGIPS+Y+YMTVCAPSCHDCSTLRAWWEEDE RRRR+F+ VVGS A+PP +C P+
Sbjct  791  EPGLEFGIPSQYNYMTVCAPSCHDCSTLRAWWEEDEERRRRFFKNVVGSDALPPSQCLPD  850

Query  541  IARFVLRKHVESPSMWSIFPLQDLLALKEDYATRPAVEETINDPTXPRHYWRYRMHVTME  720
            I  F+LR+HVESPSMW+IFPLQDLLALKEDY TRPA EETINDPT PRHYWRYR+HVT+E
Sbjct  851  IIHFILRQHVESPSMWAIFPLQDLLALKEDYTTRPATEETINDPTNPRHYWRYRVHVTLE  910

Query  721  SLLNDKSL  744
            SL  DK L
Sbjct  911  SLRKDKEL  918



>emb|CDY23877.1| BnaC04g01600D [Brassica napus]
Length=941

 Score =   409 bits (1051),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 180/248 (73%), Positives = 217/248 (88%), Gaps = 0/248 (0%)
 Frame = +1

Query  1    FVENEEKLRRNLFDLLQEVVLIRDREDPRKFYPRFNLEDTSSFKGLDQHSKNVLKRLYYD  180
             +ENE+K+RR++FD+L+ VVLI+D ED RKFYPRFN+EDTSSF+ LD+HS+NVLKRLYYD
Sbjct  668  LLENEDKVRRDVFDILRNVVLIKDPEDARKFYPRFNIEDTSSFQDLDEHSRNVLKRLYYD  727

Query  181  YYFHRQESLWRQNALNTLPVLMNSSDMLTCGEDLGMIPACVNPVMQELGLIGLHIQRMPS  360
            YYFHRQE LWR+NAL TLP L+NSS+ML CGEDLG++PACV+PVM+EL L+GL IQRMPS
Sbjct  728  YYFHRQEDLWRKNALKTLPALLNSSNMLACGEDLGLVPACVHPVMKELALVGLRIQRMPS  787

Query  361  EPGREFGIPSEYSYMTVCAPSCHDCSTLRAWWEEDEGRRRRYFQTVVGSGAVPPDECTPE  540
            E   EFG+PS Y YMTVCAPSCHDCSTLRAWWEEDE RR+RYF+ V+G  A+PP +C PE
Sbjct  788  ESDVEFGVPSNYDYMTVCAPSCHDCSTLRAWWEEDEERRQRYFKEVIGLDAIPPSQCVPE  847

Query  541  IARFVLRKHVESPSMWSIFPLQDLLALKEDYATRPAVEETINDPTXPRHYWRYRMHVTME  720
            I  F+LR+HVE+PSMW+IFPLQD+LALKE+Y  RPA EETINDPT P+HYWRYR+HVT++
Sbjct  848  ITHFILRQHVEAPSMWAIFPLQDMLALKEEYTARPAKEETINDPTNPKHYWRYRVHVTLD  907

Query  721  SLLNDKSL  744
            SL+ D  L
Sbjct  908  SLMKDVDL  915



>ref|NP_181616.3| 4-alpha-glucanotransferase DPE2 [Arabidopsis thaliana]
 sp|Q8RXD9.1|DPE2_ARATH RecName: Full=4-alpha-glucanotransferase DPE2; AltName: Full=Amylomaltase; 
AltName: Full=Disproportionating enzyme; Short=D-enzyme; 
AltName: Full=Protein DISPROPORTIONATING ENZYME 2 
[Arabidopsis thaliana]
 gb|AAL91204.1| 4-alpha-glucanotransferase [Arabidopsis thaliana]
 gb|AAQ56807.1| At2g40840 [Arabidopsis thaliana]
 gb|AEC09889.1| 4-alpha-glucanotransferase DPE2 [Arabidopsis thaliana]
Length=955

 Score =   409 bits (1051),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 181/248 (73%), Positives = 216/248 (87%), Gaps = 0/248 (0%)
 Frame = +1

Query  1    FVENEEKLRRNLFDLLQEVVLIRDREDPRKFYPRFNLEDTSSFKGLDQHSKNVLKRLYYD  180
             +ENE+K+RR++FD+L+ VVLI+D ED RKFYPRFN+EDTSSF+ LD HSKNVLKRLYYD
Sbjct  667  LLENEDKVRRDVFDILRNVVLIKDPEDARKFYPRFNIEDTSSFQDLDDHSKNVLKRLYYD  726

Query  181  YYFHRQESLWRQNALNTLPVLMNSSDMLTCGEDLGMIPACVNPVMQELGLIGLHIQRMPS  360
            YYF RQE LWR+NAL TLP L+NSS+ML CGEDLG+IP+CV+PVMQELGL+GL IQRMPS
Sbjct  727  YYFQRQEDLWRKNALKTLPALLNSSNMLACGEDLGLIPSCVHPVMQELGLVGLRIQRMPS  786

Query  361  EPGREFGIPSEYSYMTVCAPSCHDCSTLRAWWEEDEGRRRRYFQTVVGSGAVPPDECTPE  540
            E   +FGIPS Y YMTVCAPSCHDCSTLRAWWEEDE RR++YF+ V+G   +PP +C PE
Sbjct  787  ESDVKFGIPSNYDYMTVCAPSCHDCSTLRAWWEEDEERRQQYFKEVIGVDGIPPSQCIPE  846

Query  541  IARFVLRKHVESPSMWSIFPLQDLLALKEDYATRPAVEETINDPTXPRHYWRYRMHVTME  720
            I  F+LR+HVE+PSMW+IFPLQD++ALKE+Y TRPA EETINDPT P+HYWRYR+HVT++
Sbjct  847  ITHFILRQHVEAPSMWAIFPLQDMMALKEEYTTRPATEETINDPTNPKHYWRYRVHVTLD  906

Query  721  SLLNDKSL  744
            SLL D  L
Sbjct  907  SLLKDTDL  914



>ref|XP_006293633.1| hypothetical protein CARUB_v10022587mg [Capsella rubella]
 gb|EOA26531.1| hypothetical protein CARUB_v10022587mg [Capsella rubella]
Length=955

 Score =   409 bits (1050),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 182/248 (73%), Positives = 214/248 (86%), Gaps = 0/248 (0%)
 Frame = +1

Query  1    FVENEEKLRRNLFDLLQEVVLIRDREDPRKFYPRFNLEDTSSFKGLDQHSKNVLKRLYYD  180
             +ENE+K+RR++FD+L+ VVLI+D ED RKFYPRFNLEDTSSF+ LD HSKNVLKRLYYD
Sbjct  667  LLENEDKVRRDVFDILRNVVLIKDPEDARKFYPRFNLEDTSSFQDLDDHSKNVLKRLYYD  726

Query  181  YYFHRQESLWRQNALNTLPVLMNSSDMLTCGEDLGMIPACVNPVMQELGLIGLHIQRMPS  360
            YYF RQE LWR+NAL TLP L+NSS+ML CGEDLG+IP+CV+PVMQELGL+GL IQRMPS
Sbjct  727  YYFQRQEDLWRKNALKTLPALLNSSNMLACGEDLGLIPSCVHPVMQELGLVGLRIQRMPS  786

Query  361  EPGREFGIPSEYSYMTVCAPSCHDCSTLRAWWEEDEGRRRRYFQTVVGSGAVPPDECTPE  540
            E   +FGIPS Y YMTVCAPSCHDCSTLRAWWEEDE RR+ YF+ V+G   +PP +C PE
Sbjct  787  ESDVKFGIPSNYGYMTVCAPSCHDCSTLRAWWEEDEERRQHYFKEVIGVDEIPPSQCVPE  846

Query  541  IARFVLRKHVESPSMWSIFPLQDLLALKEDYATRPAVEETINDPTXPRHYWRYRMHVTME  720
            I  FVLR+HVE+PSMW+IFPLQD++ALKEDY  RPA EETINDPT P+HYWRYR+HVT++
Sbjct  847  ITHFVLRQHVEAPSMWAIFPLQDMMALKEDYTNRPATEETINDPTNPKHYWRYRVHVTLD  906

Query  721  SLLNDKSL  744
            SL+ D  L
Sbjct  907  SLMKDTDL  914



>ref|XP_010525431.1| PREDICTED: 4-alpha-glucanotransferase DPE2 [Tarenaya hassleriana]
Length=948

 Score =   408 bits (1049),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 183/248 (74%), Positives = 218/248 (88%), Gaps = 0/248 (0%)
 Frame = +1

Query  1    FVENEEKLRRNLFDLLQEVVLIRDREDPRKFYPRFNLEDTSSFKGLDQHSKNVLKRLYYD  180
             +++E+K+RR++FD+L+ +VLI+D ED RKFYPRFNLED SSF+ LD  SKNVLKRLY+D
Sbjct  667  LLDDEDKVRRDIFDILRNIVLIKDPEDERKFYPRFNLEDISSFQDLDDKSKNVLKRLYHD  726

Query  181  YYFHRQESLWRQNALNTLPVLMNSSDMLTCGEDLGMIPACVNPVMQELGLIGLHIQRMPS  360
            YYFHRQE LWR+NAL TLPVL+NSS+ML CGEDLG+IP+CV+PVMQELGL+GL IQRMPS
Sbjct  727  YYFHRQEDLWRKNALKTLPVLLNSSNMLACGEDLGLIPSCVHPVMQELGLVGLRIQRMPS  786

Query  361  EPGREFGIPSEYSYMTVCAPSCHDCSTLRAWWEEDEGRRRRYFQTVVGSGAVPPDECTPE  540
            + G EFGIPS Y YMTVCAPSCHDCSTLRAWWEED+ RR+RYF+ VVGS  +PP +C PE
Sbjct  787  DAGVEFGIPSTYDYMTVCAPSCHDCSTLRAWWEEDQERRQRYFKDVVGSDELPPSQCVPE  846

Query  541  IARFVLRKHVESPSMWSIFPLQDLLALKEDYATRPAVEETINDPTXPRHYWRYRMHVTME  720
            I  FVLR+HVE+PSMW+IFPLQDL ALKE+Y TRPA EETINDPT P+HYWRYR+HVT++
Sbjct  847  ITYFVLRQHVEAPSMWAIFPLQDLFALKEEYTTRPATEETINDPTNPKHYWRYRVHVTLD  906

Query  721  SLLNDKSL  744
            SL+ DK L
Sbjct  907  SLMEDKDL  914



>ref|XP_010508798.1| PREDICTED: 4-alpha-glucanotransferase DPE2 [Camelina sativa]
Length=955

 Score =   408 bits (1048),  Expect = 5e-132, Method: Compositional matrix adjust.
 Identities = 181/248 (73%), Positives = 215/248 (87%), Gaps = 0/248 (0%)
 Frame = +1

Query  1    FVENEEKLRRNLFDLLQEVVLIRDREDPRKFYPRFNLEDTSSFKGLDQHSKNVLKRLYYD  180
             +ENE+K+RR++FD+L+ VVLI+D ED RKFYPRFNLEDTSSF+ LD HSKNVLKRLYYD
Sbjct  667  LLENEDKVRRDVFDILRNVVLIKDPEDARKFYPRFNLEDTSSFQDLDDHSKNVLKRLYYD  726

Query  181  YYFHRQESLWRQNALNTLPVLMNSSDMLTCGEDLGMIPACVNPVMQELGLIGLHIQRMPS  360
            YYF RQE LWR+NAL TLP L+NSS+ML CGEDLG+IP+CV+PVMQELGL+GL IQRMPS
Sbjct  727  YYFQRQEDLWRKNALKTLPALLNSSNMLACGEDLGLIPSCVHPVMQELGLVGLRIQRMPS  786

Query  361  EPGREFGIPSEYSYMTVCAPSCHDCSTLRAWWEEDEGRRRRYFQTVVGSGAVPPDECTPE  540
            E   +FGIPS Y YMTVCAPSCHDCSTLRAWWEEDE RR+ YF+ V+G   +PP +C PE
Sbjct  787  ESDVKFGIPSNYGYMTVCAPSCHDCSTLRAWWEEDEERRQHYFKEVIGVDEIPPSQCVPE  846

Query  541  IARFVLRKHVESPSMWSIFPLQDLLALKEDYATRPAVEETINDPTXPRHYWRYRMHVTME  720
            I  F+LR+HVE+PSMW+IFPLQD++ALKE+Y TRPA EETINDPT P+HYWRYR+HVT++
Sbjct  847  ITHFILRQHVEAPSMWAIFPLQDMMALKEEYTTRPATEETINDPTNPKHYWRYRVHVTLD  906

Query  721  SLLNDKSL  744
            SL+ D  L
Sbjct  907  SLIKDTDL  914



>gb|AAB86444.1| 4-alpha-glucanotransferase [Arabidopsis thaliana]
Length=738

 Score =   402 bits (1032),  Expect = 5e-132, Method: Compositional matrix adjust.
 Identities = 181/258 (70%), Positives = 216/258 (84%), Gaps = 10/258 (4%)
 Frame = +1

Query  1    FVENEEKLRRNLFDLLQEVVLIRDREDPRKFYPRFNLEDTSSFKGLDQHSKNVLKRLYYD  180
             +ENE+K+RR++FD+L+ VVLI+D ED RKFYPRFN+EDTSSF+ LD HSKNVLKRLYYD
Sbjct  440  LLENEDKVRRDVFDILRNVVLIKDPEDARKFYPRFNIEDTSSFQDLDDHSKNVLKRLYYD  499

Query  181  YYFHRQESLWRQNALNTLPVLMNSSDMLTCGEDLGMIPACVNP----------VMQELGL  330
            YYF RQE LWR+NAL TLP L+NSS+ML CGEDLG+IP+CV+P          VMQELGL
Sbjct  500  YYFQRQEDLWRKNALKTLPALLNSSNMLACGEDLGLIPSCVHPKHMLKLIVTQVMQELGL  559

Query  331  IGLHIQRMPSEPGREFGIPSEYSYMTVCAPSCHDCSTLRAWWEEDEGRRRRYFQTVVGSG  510
            +GL IQRMPSE   +FGIPS Y YMTVCAPSCHDCSTLRAWWEEDE RR++YF+ V+G  
Sbjct  560  VGLRIQRMPSESDVKFGIPSNYDYMTVCAPSCHDCSTLRAWWEEDEERRQQYFKEVIGVD  619

Query  511  AVPPDECTPEIARFVLRKHVESPSMWSIFPLQDLLALKEDYATRPAVEETINDPTXPRHY  690
             +PP +C PEI  F+LR+HVE+PSMW+IFPLQD++ALKE+Y TRPA EETINDPT P+HY
Sbjct  620  GIPPSQCIPEITHFILRQHVEAPSMWAIFPLQDMMALKEEYTTRPATEETINDPTNPKHY  679

Query  691  WRYRMHVTMESLLNDKSL  744
            WRYR+HVT++SLL D  L
Sbjct  680  WRYRVHVTLDSLLKDTDL  697



>ref|XP_006411352.1| hypothetical protein EUTSA_v10016195mg [Eutrema salsugineum]
 gb|ESQ52805.1| hypothetical protein EUTSA_v10016195mg [Eutrema salsugineum]
Length=943

 Score =   407 bits (1046),  Expect = 7e-132, Method: Compositional matrix adjust.
 Identities = 181/248 (73%), Positives = 214/248 (86%), Gaps = 0/248 (0%)
 Frame = +1

Query  1    FVENEEKLRRNLFDLLQEVVLIRDREDPRKFYPRFNLEDTSSFKGLDQHSKNVLKRLYYD  180
             +ENE+K+RR++FD+L+ VVLI+D ED RKFYPRFNLEDTSSF+ LD HSKNVLKRLYYD
Sbjct  667  LLENEDKVRRDVFDILRNVVLIKDPEDARKFYPRFNLEDTSSFQDLDDHSKNVLKRLYYD  726

Query  181  YYFHRQESLWRQNALNTLPVLMNSSDMLTCGEDLGMIPACVNPVMQELGLIGLHIQRMPS  360
            YYF RQE LWR+NAL TLP L+NSS+ML CGEDLG+IP+CV+PVMQEL L+GL IQRMPS
Sbjct  727  YYFQRQEDLWRKNALKTLPALLNSSNMLACGEDLGLIPSCVHPVMQELALVGLRIQRMPS  786

Query  361  EPGREFGIPSEYSYMTVCAPSCHDCSTLRAWWEEDEGRRRRYFQTVVGSGAVPPDECTPE  540
            E   EFGIPS Y YMTVCAPSCHDCSTLRAWWEEDE RR+RYF+ V+    +PP +C PE
Sbjct  787  ESDVEFGIPSNYDYMTVCAPSCHDCSTLRAWWEEDEERRQRYFKEVIAVDEIPPSQCVPE  846

Query  541  IARFVLRKHVESPSMWSIFPLQDLLALKEDYATRPAVEETINDPTXPRHYWRYRMHVTME  720
            I  F+LR+HVE+PSMW+IFPLQD+LALKE+Y TRPA EETINDPT P+HYWRYR+HVT++
Sbjct  847  ITHFILRQHVEAPSMWAIFPLQDMLALKEEYTTRPATEETINDPTNPKHYWRYRVHVTLD  906

Query  721  SLLNDKSL  744
            +L+ D  L
Sbjct  907  ALMKDTDL  914



>ref|XP_009391559.1| PREDICTED: 4-alpha-glucanotransferase DPE2 isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=960

 Score =   407 bits (1047),  Expect = 8e-132, Method: Compositional matrix adjust.
 Identities = 182/248 (73%), Positives = 222/248 (90%), Gaps = 0/248 (0%)
 Frame = +1

Query  1    FVENEEKLRRNLFDLLQEVVLIRDREDPRKFYPRFNLEDTSSFKGLDQHSKNVLKRLYYD  180
            ++E E+K++++LFD+LQ +VLIRD ED RKFYPRFN+EDTSSFK LD+HSKNVLKRLYYD
Sbjct  667  WLEKEDKIKKDLFDILQNIVLIRDPEDARKFYPRFNIEDTSSFKNLDEHSKNVLKRLYYD  726

Query  181  YYFHRQESLWRQNALNTLPVLMNSSDMLTCGEDLGMIPACVNPVMQELGLIGLHIQRMPS  360
            YYF RQE+LWRQNA+ TLPVL+NSSDML CGEDLG+IP+CV+PVMQELGLIGL IQRMPS
Sbjct  727  YYFCRQENLWRQNAMKTLPVLLNSSDMLACGEDLGLIPSCVHPVMQELGLIGLRIQRMPS  786

Query  361  EPGREFGIPSEYSYMTVCAPSCHDCSTLRAWWEEDEGRRRRYFQTVVGSGAVPPDECTPE  540
            EP  EFGIPS+YSYMTVCAPSCHDCST+RAWWEEDE RR  Y+++V G   +PP  CT E
Sbjct  787  EPDVEFGIPSQYSYMTVCAPSCHDCSTMRAWWEEDEERRCCYYKSVAGCNDMPPPRCTTE  846

Query  541  IARFVLRKHVESPSMWSIFPLQDLLALKEDYATRPAVEETINDPTXPRHYWRYRMHVTME  720
            +A F++++H+++PSMW+IFPLQDLLAL+E+Y TRPAVEETINDPT P+HYWRYR+HVT++
Sbjct  847  VAYFIIQQHMQAPSMWAIFPLQDLLALREEYTTRPAVEETINDPTNPKHYWRYRVHVTLD  906

Query  721  SLLNDKSL  744
            SL+ D+ L
Sbjct  907  SLMLDEDL  914



>ref|XP_009391560.1| PREDICTED: 4-alpha-glucanotransferase DPE2 isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=959

 Score =   407 bits (1047),  Expect = 8e-132, Method: Compositional matrix adjust.
 Identities = 182/248 (73%), Positives = 222/248 (90%), Gaps = 0/248 (0%)
 Frame = +1

Query  1    FVENEEKLRRNLFDLLQEVVLIRDREDPRKFYPRFNLEDTSSFKGLDQHSKNVLKRLYYD  180
            ++E E+K++++LFD+LQ +VLIRD ED RKFYPRFN+EDTSSFK LD+HSKNVLKRLYYD
Sbjct  666  WLEKEDKIKKDLFDILQNIVLIRDPEDARKFYPRFNIEDTSSFKNLDEHSKNVLKRLYYD  725

Query  181  YYFHRQESLWRQNALNTLPVLMNSSDMLTCGEDLGMIPACVNPVMQELGLIGLHIQRMPS  360
            YYF RQE+LWRQNA+ TLPVL+NSSDML CGEDLG+IP+CV+PVMQELGLIGL IQRMPS
Sbjct  726  YYFCRQENLWRQNAMKTLPVLLNSSDMLACGEDLGLIPSCVHPVMQELGLIGLRIQRMPS  785

Query  361  EPGREFGIPSEYSYMTVCAPSCHDCSTLRAWWEEDEGRRRRYFQTVVGSGAVPPDECTPE  540
            EP  EFGIPS+YSYMTVCAPSCHDCST+RAWWEEDE RR  Y+++V G   +PP  CT E
Sbjct  786  EPDVEFGIPSQYSYMTVCAPSCHDCSTMRAWWEEDEERRCCYYKSVAGCNDMPPPRCTTE  845

Query  541  IARFVLRKHVESPSMWSIFPLQDLLALKEDYATRPAVEETINDPTXPRHYWRYRMHVTME  720
            +A F++++H+++PSMW+IFPLQDLLAL+E+Y TRPAVEETINDPT P+HYWRYR+HVT++
Sbjct  846  VAYFIIQQHMQAPSMWAIFPLQDLLALREEYTTRPAVEETINDPTNPKHYWRYRVHVTLD  905

Query  721  SLLNDKSL  744
            SL+ D+ L
Sbjct  906  SLMLDEDL  913



>ref|XP_002879894.1| hypothetical protein ARALYDRAFT_483146 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH56153.1| hypothetical protein ARALYDRAFT_483146 [Arabidopsis lyrata subsp. 
lyrata]
Length=948

 Score =   407 bits (1046),  Expect = 9e-132, Method: Compositional matrix adjust.
 Identities = 180/248 (73%), Positives = 216/248 (87%), Gaps = 0/248 (0%)
 Frame = +1

Query  1    FVENEEKLRRNLFDLLQEVVLIRDREDPRKFYPRFNLEDTSSFKGLDQHSKNVLKRLYYD  180
             +ENE+K+RR++FD+L+ VVLI+D ED RKFYPRFN+EDTSSF+ LD HSKNVLKRLYYD
Sbjct  667  LLENEDKVRRDVFDILRNVVLIKDPEDARKFYPRFNIEDTSSFQDLDDHSKNVLKRLYYD  726

Query  181  YYFHRQESLWRQNALNTLPVLMNSSDMLTCGEDLGMIPACVNPVMQELGLIGLHIQRMPS  360
            YYF RQE LWR+NAL TLP L+NSS+ML CGEDLG+IP+CV+PVMQELGL+GL IQRMPS
Sbjct  727  YYFQRQEDLWRKNALKTLPALLNSSNMLACGEDLGLIPSCVHPVMQELGLVGLRIQRMPS  786

Query  361  EPGREFGIPSEYSYMTVCAPSCHDCSTLRAWWEEDEGRRRRYFQTVVGSGAVPPDECTPE  540
            E   +FGIP+ Y YMTVCAPSCHDCSTLRAWWEEDE RR++YF+ V+G   +PP +C PE
Sbjct  787  ESDVKFGIPANYDYMTVCAPSCHDCSTLRAWWEEDEERRQQYFKEVIGVDEIPPSQCVPE  846

Query  541  IARFVLRKHVESPSMWSIFPLQDLLALKEDYATRPAVEETINDPTXPRHYWRYRMHVTME  720
            I  F+LR+HVE+PSMW+IFPLQD++ALKE+Y TRPA EETINDPT P+HYWRYR+HVT++
Sbjct  847  ITHFILRQHVEAPSMWAIFPLQDMMALKEEYTTRPATEETINDPTNPKHYWRYRVHVTLD  906

Query  721  SLLNDKSL  744
            SLL D  L
Sbjct  907  SLLKDTDL  914



>ref|XP_002278329.2| PREDICTED: 4-alpha-glucanotransferase DPE2 [Vitis vinifera]
 ref|XP_010653652.1| PREDICTED: 4-alpha-glucanotransferase DPE2 [Vitis vinifera]
 ref|XP_010653653.1| PREDICTED: 4-alpha-glucanotransferase DPE2 [Vitis vinifera]
 ref|XP_010653654.1| PREDICTED: 4-alpha-glucanotransferase DPE2 [Vitis vinifera]
 ref|XP_010653655.1| PREDICTED: 4-alpha-glucanotransferase DPE2 [Vitis vinifera]
 ref|XP_010653656.1| PREDICTED: 4-alpha-glucanotransferase DPE2 [Vitis vinifera]
 ref|XP_010653657.1| PREDICTED: 4-alpha-glucanotransferase DPE2 [Vitis vinifera]
Length=965

 Score =   406 bits (1043),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 192/246 (78%), Positives = 221/246 (90%), Gaps = 0/246 (0%)
 Frame = +1

Query  7    ENEEKLRRNLFDLLQEVVLIRDREDPRKFYPRFNLEDTSSFKGLDQHSKNVLKRLYYDYY  186
            E+E+K+R +LF LLQ +VLIRD +D +KFYPRFNLEDTSSFK LD HSKNVLKRLYYDYY
Sbjct  665  ESEDKIRLDLFALLQNIVLIRDPKDAKKFYPRFNLEDTSSFKDLDDHSKNVLKRLYYDYY  724

Query  187  FHRQESLWRQNALNTLPVLMNSSDMLTCGEDLGMIPACVNPVMQELGLIGLHIQRMPSEP  366
            FHRQE LW  NAL TLPVL+NSSDML CGEDLG+IP+CV+PVMQELGLIGL IQRMPSEP
Sbjct  725  FHRQEDLWHHNALKTLPVLLNSSDMLACGEDLGLIPSCVHPVMQELGLIGLRIQRMPSEP  784

Query  367  GREFGIPSEYSYMTVCAPSCHDCSTLRAWWEEDEGRRRRYFQTVVGSGAVPPDECTPEIA  546
            G EFGIPS+YSYMTVCAPSCHDCST+RAWWEEDE RRRR+F+TVVGS  +PP +C PE+A
Sbjct  785  GLEFGIPSQYSYMTVCAPSCHDCSTMRAWWEEDEERRRRFFKTVVGSDELPPSQCVPEVA  844

Query  547  RFVLRKHVESPSMWSIFPLQDLLALKEDYATRPAVEETINDPTXPRHYWRYRMHVTMESL  726
             F++++HVE+PSMW+IFPLQDLLALK++Y TRPA EETINDPT P+HYWRYR+HVT+ESL
Sbjct  845  EFIIQQHVEAPSMWAIFPLQDLLALKKEYTTRPAAEETINDPTNPKHYWRYRVHVTLESL  904

Query  727  LNDKSL  744
            L DK L
Sbjct  905  LKDKEL  910



>ref|XP_010517527.1| PREDICTED: 4-alpha-glucanotransferase DPE2-like [Camelina sativa]
Length=955

 Score =   406 bits (1043),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 180/248 (73%), Positives = 214/248 (86%), Gaps = 0/248 (0%)
 Frame = +1

Query  1    FVENEEKLRRNLFDLLQEVVLIRDREDPRKFYPRFNLEDTSSFKGLDQHSKNVLKRLYYD  180
             +ENE+K+RR++FD+L+ VVLI+D ED RKFYPRFNLEDTSSF+ LD HSKNVLKRLYYD
Sbjct  667  LLENEDKVRRDVFDILRNVVLIKDPEDARKFYPRFNLEDTSSFQDLDDHSKNVLKRLYYD  726

Query  181  YYFHRQESLWRQNALNTLPVLMNSSDMLTCGEDLGMIPACVNPVMQELGLIGLHIQRMPS  360
            YYF RQE LWR+NAL TLP L+NSS+ML CGEDLG+IP+CV+PVMQELGL+GL IQRMPS
Sbjct  727  YYFQRQEDLWRKNALKTLPALLNSSNMLACGEDLGLIPSCVHPVMQELGLVGLRIQRMPS  786

Query  361  EPGREFGIPSEYSYMTVCAPSCHDCSTLRAWWEEDEGRRRRYFQTVVGSGAVPPDECTPE  540
            E   +FGIPS Y YMTVCAPSCHDCSTLRAWWEEDE RR+ YF+ V+G   +PP +C PE
Sbjct  787  ESDVKFGIPSNYGYMTVCAPSCHDCSTLRAWWEEDEERRQHYFKEVIGVDEIPPSQCVPE  846

Query  541  IARFVLRKHVESPSMWSIFPLQDLLALKEDYATRPAVEETINDPTXPRHYWRYRMHVTME  720
            I  F+LR+HVE+PSMW+IFPLQD++ALK +Y TRPA EETINDPT P+HYWRYR+HVT++
Sbjct  847  ITHFILRQHVEAPSMWAIFPLQDMMALKAEYTTRPATEETINDPTNPKHYWRYRVHVTLD  906

Query  721  SLLNDKSL  744
            SL+ D  L
Sbjct  907  SLIKDTDL  914



>ref|XP_004144319.1| PREDICTED: 4-alpha-glucanotransferase DPE2 [Cucumis sativus]
Length=966

 Score =   406 bits (1043),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 180/247 (73%), Positives = 218/247 (88%), Gaps = 0/247 (0%)
 Frame = +1

Query  4    VENEEKLRRNLFDLLQEVVLIRDREDPRKFYPRFNLEDTSSFKGLDQHSKNVLKRLYYDY  183
            ++N +++RR+LFDL+Q +VL+RD E+PR FYPRFNLEDTSSF  LD HSK+VLKRLYYDY
Sbjct  664  LQNPDQIRRSLFDLIQNIVLMRDLENPRSFYPRFNLEDTSSFNDLDDHSKDVLKRLYYDY  723

Query  184  YFHRQESLWRQNALNTLPVLMNSSDMLTCGEDLGMIPACVNPVMQELGLIGLHIQRMPSE  363
            YFHRQE LWR+NAL TLPVL++SSDML CGEDLG+IP+CV+PVM+ELGLIGL IQRMP+E
Sbjct  724  YFHRQEDLWRKNALKTLPVLLDSSDMLACGEDLGLIPSCVHPVMEELGLIGLRIQRMPNE  783

Query  364  PGREFGIPSEYSYMTVCAPSCHDCSTLRAWWEEDEGRRRRYFQTVVGSGAVPPDECTPEI  543
            P  EFGIPS+YSYMTVCAPSCHDCSTLRAWW+EDE RR+R+ + V+ S  +PP +C PEI
Sbjct  784  PDLEFGIPSQYSYMTVCAPSCHDCSTLRAWWDEDEERRQRFMKNVIESDILPPSQCIPEI  843

Query  544  ARFVLRKHVESPSMWSIFPLQDLLALKEDYATRPAVEETINDPTXPRHYWRYRMHVTMES  723
            A F++++H E+PSMW+IFPLQDLLALKE+Y TRPA EETINDPT P+HYWR+R HVT+ES
Sbjct  844  AHFIIKQHFEAPSMWAIFPLQDLLALKEEYTTRPAKEETINDPTNPKHYWRFRSHVTLES  903

Query  724  LLNDKSL  744
            L+ DK L
Sbjct  904  LMKDKEL  910



>ref|XP_003624889.1| 4-alpha-glucanotransferase [Medicago truncatula]
Length=1022

 Score =   407 bits (1046),  Expect = 4e-131, Method: Compositional matrix adjust.
 Identities = 186/267 (70%), Positives = 220/267 (82%), Gaps = 19/267 (7%)
 Frame = +1

Query  1    FVENEEKLRRNLFDLLQEVVLIRDREDPRKFYPRFNLEDTSSFKGLDQHSKNVLKRLYYD  180
             +E+E+K+RRNL DLLQ +VLIRD E+P+ FYPRFNLEDTSSF+ LD HSKNVLKRLYYD
Sbjct  692  LLESEDKMRRNLIDLLQNIVLIRDPENPKDFYPRFNLEDTSSFQALDDHSKNVLKRLYYD  751

Query  181  YYFHRQESLWRQNALNTLPVLMNSSDMLTCGEDLGMIPACVNPV----------------  312
            YYFHRQE+LWRQNAL TLP L+NSS+ML CGEDLG+IP+CV+PV                
Sbjct  752  YYFHRQENLWRQNALKTLPALLNSSEMLACGEDLGLIPSCVHPVCQLYSLSSNKQEPPSH  811

Query  313  ---MQELGLIGLHIQRMPSEPGREFGIPSEYSYMTVCAPSCHDCSTLRAWWEEDEGRRRR  483
               MQELGL+GL IQRMP+E   EFGIPS+YSYMTVCAPSCHDCSTLRAWWEEDE RR+R
Sbjct  812  SCVMQELGLVGLRIQRMPNESDLEFGIPSQYSYMTVCAPSCHDCSTLRAWWEEDEERRQR  871

Query  484  YFQTVVGSGAVPPDECTPEIARFVLRKHVESPSMWSIFPLQDLLALKEDYATRPAVEETI  663
            +F+ V+ S  +PPD+C PE+A F++R+H+ESPSMW+IFPLQDLLALKE+Y  RPA+EETI
Sbjct  872  FFKNVMESDELPPDQCVPEVAHFIIRQHIESPSMWAIFPLQDLLALKEEYTARPAIEETI  931

Query  664  NDPTXPRHYWRYRMHVTMESLLNDKSL  744
            NDPT P+HYWRYR+HVT+ESL  D  L
Sbjct  932  NDPTNPKHYWRYRVHVTLESLNKDNEL  958



>gb|KGN54674.1| hypothetical protein Csa_4G420150 [Cucumis sativus]
Length=1007

 Score =   407 bits (1045),  Expect = 5e-131, Method: Compositional matrix adjust.
 Identities = 180/247 (73%), Positives = 218/247 (88%), Gaps = 0/247 (0%)
 Frame = +1

Query  4    VENEEKLRRNLFDLLQEVVLIRDREDPRKFYPRFNLEDTSSFKGLDQHSKNVLKRLYYDY  183
            ++N +++RR+LFDL+Q +VL+RD E+PR FYPRFNLEDTSSF  LD HSK+VLKRLYYDY
Sbjct  705  LQNPDQIRRSLFDLIQNIVLMRDLENPRSFYPRFNLEDTSSFNDLDDHSKDVLKRLYYDY  764

Query  184  YFHRQESLWRQNALNTLPVLMNSSDMLTCGEDLGMIPACVNPVMQELGLIGLHIQRMPSE  363
            YFHRQE LWR+NAL TLPVL++SSDML CGEDLG+IP+CV+PVM+ELGLIGL IQRMP+E
Sbjct  765  YFHRQEDLWRKNALKTLPVLLDSSDMLACGEDLGLIPSCVHPVMEELGLIGLRIQRMPNE  824

Query  364  PGREFGIPSEYSYMTVCAPSCHDCSTLRAWWEEDEGRRRRYFQTVVGSGAVPPDECTPEI  543
            P  EFGIPS+YSYMTVCAPSCHDCSTLRAWW+EDE RR+R+ + V+ S  +PP +C PEI
Sbjct  825  PDLEFGIPSQYSYMTVCAPSCHDCSTLRAWWDEDEERRQRFMKNVIESDILPPSQCIPEI  884

Query  544  ARFVLRKHVESPSMWSIFPLQDLLALKEDYATRPAVEETINDPTXPRHYWRYRMHVTMES  723
            A F++++H E+PSMW+IFPLQDLLALKE+Y TRPA EETINDPT P+HYWR+R HVT+ES
Sbjct  885  AHFIIKQHFEAPSMWAIFPLQDLLALKEEYTTRPAKEETINDPTNPKHYWRFRSHVTLES  944

Query  724  LLNDKSL  744
            L+ DK L
Sbjct  945  LMKDKEL  951



>emb|CBI32836.3| unnamed protein product [Vitis vinifera]
Length=1035

 Score =   407 bits (1046),  Expect = 6e-131, Method: Compositional matrix adjust.
 Identities = 192/246 (78%), Positives = 221/246 (90%), Gaps = 0/246 (0%)
 Frame = +1

Query  7    ENEEKLRRNLFDLLQEVVLIRDREDPRKFYPRFNLEDTSSFKGLDQHSKNVLKRLYYDYY  186
            E+E+K+R +LF LLQ +VLIRD +D +KFYPRFNLEDTSSFK LD HSKNVLKRLYYDYY
Sbjct  667  ESEDKIRLDLFALLQNIVLIRDPKDAKKFYPRFNLEDTSSFKDLDDHSKNVLKRLYYDYY  726

Query  187  FHRQESLWRQNALNTLPVLMNSSDMLTCGEDLGMIPACVNPVMQELGLIGLHIQRMPSEP  366
            FHRQE LW  NAL TLPVL+NSSDML CGEDLG+IP+CV+PVMQELGLIGL IQRMPSEP
Sbjct  727  FHRQEDLWHHNALKTLPVLLNSSDMLACGEDLGLIPSCVHPVMQELGLIGLRIQRMPSEP  786

Query  367  GREFGIPSEYSYMTVCAPSCHDCSTLRAWWEEDEGRRRRYFQTVVGSGAVPPDECTPEIA  546
            G EFGIPS+YSYMTVCAPSCHDCST+RAWWEEDE RRRR+F+TVVGS  +PP +C PE+A
Sbjct  787  GLEFGIPSQYSYMTVCAPSCHDCSTMRAWWEEDEERRRRFFKTVVGSDELPPSQCVPEVA  846

Query  547  RFVLRKHVESPSMWSIFPLQDLLALKEDYATRPAVEETINDPTXPRHYWRYRMHVTMESL  726
             F++++HVE+PSMW+IFPLQDLLALK++Y TRPA EETINDPT P+HYWRYR+HVT+ESL
Sbjct  847  EFIIQQHVEAPSMWAIFPLQDLLALKKEYTTRPAAEETINDPTNPKHYWRYRVHVTLESL  906

Query  727  LNDKSL  744
            L DK L
Sbjct  907  LKDKEL  912



>gb|EPS63641.1| 4-alpha-glucanotransferase, partial [Genlisea aurea]
Length=795

 Score =   400 bits (1028),  Expect = 9e-131, Method: Compositional matrix adjust.
 Identities = 181/241 (75%), Positives = 212/241 (88%), Gaps = 0/241 (0%)
 Frame = +1

Query  22   LRRNLFDLLQEVVLIRDREDPRKFYPRFNLEDTSSFKGLDQHSKNVLKRLYYDYYFHRQE  201
            L+  LFDL Q VVLIRD ED   FYPRFNL++TSSF  LD++SKNVL++LY+DYYFHRQE
Sbjct  539  LQTQLFDLHQNVVLIRDPEDSGAFYPRFNLQNTSSFNALDENSKNVLRKLYFDYYFHRQE  598

Query  202  SLWRQNALNTLPVLMNSSDMLTCGEDLGMIPACVNPVMQELGLIGLHIQRMPSEPGREFG  381
            SLWR+NAL TLPVLMNSSDML CGEDLGMIP+CV+PVM ELGL+GL IQRMP+E G EFG
Sbjct  599  SLWRRNALKTLPVLMNSSDMLACGEDLGMIPSCVHPVMWELGLVGLRIQRMPNEVGLEFG  658

Query  382  IPSEYSYMTVCAPSCHDCSTLRAWWEEDEGRRRRYFQTVVGSGAVPPDECTPEIARFVLR  561
            +P++Y YMTVCAPSCHDCSTLRAWWEED  RRRR+F  VVGS ++PP++CTPEI RFVL+
Sbjct  659  VPAQYDYMTVCAPSCHDCSTLRAWWEEDGDRRRRFFDAVVGSDSMPPEKCTPEIVRFVLQ  718

Query  562  KHVESPSMWSIFPLQDLLALKEDYATRPAVEETINDPTXPRHYWRYRMHVTMESLLNDKS  741
            +HVESPSMW+IFPLQDL+A+K +Y TRPA EETINDPT P+HYWRYR+HVT+ESLL D+ 
Sbjct  719  QHVESPSMWAIFPLQDLMAMKREYTTRPATEETINDPTNPKHYWRYRVHVTVESLLRDEE  778

Query  742  L  744
            L
Sbjct  779  L  779



>ref|XP_010036394.1| PREDICTED: 4-alpha-glucanotransferase DPE2 [Eucalyptus grandis]
 ref|XP_010036395.1| PREDICTED: 4-alpha-glucanotransferase DPE2 [Eucalyptus grandis]
 gb|KCW47942.1| hypothetical protein EUGRSUZ_K01679 [Eucalyptus grandis]
Length=970

 Score =   403 bits (1036),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 189/248 (76%), Positives = 219/248 (88%), Gaps = 0/248 (0%)
 Frame = +1

Query  1    FVENEEKLRRNLFDLLQEVVLIRDREDPRKFYPRFNLEDTSSFKGLDQHSKNVLKRLYYD  180
             +E+E K+RRNLFDLLQ +VLIRD ED +KFYPRFNLEDT+SF  LD HSKN+LKRLYYD
Sbjct  663  LLEDENKIRRNLFDLLQNIVLIRDPEDAKKFYPRFNLEDTTSFMDLDDHSKNILKRLYYD  722

Query  181  YYFHRQESLWRQNALNTLPVLMNSSDMLTCGEDLGMIPACVNPVMQELGLIGLHIQRMPS  360
            YYFHRQ++LWRQNAL TLPVL+N SDML CGEDLG+IP+CV+PVMQELGL+GL IQRMPS
Sbjct  723  YYFHRQDNLWRQNALKTLPVLLNCSDMLACGEDLGLIPSCVHPVMQELGLVGLRIQRMPS  782

Query  361  EPGREFGIPSEYSYMTVCAPSCHDCSTLRAWWEEDEGRRRRYFQTVVGSGAVPPDECTPE  540
            EP  EFGIPS+YSYMTVCAPSCHDCSTLRAWWEEDE RRRR+F+ VVGS  +PP +C P+
Sbjct  783  EPDLEFGIPSQYSYMTVCAPSCHDCSTLRAWWEEDEERRRRFFKNVVGSDKLPPSKCVPD  842

Query  541  IARFVLRKHVESPSMWSIFPLQDLLALKEDYATRPAVEETINDPTXPRHYWRYRMHVTME  720
            +A FVLR+HVE+PSMW+IFPLQDLL LK +Y TRPA EETINDPT P+HYWRYR HVT+E
Sbjct  843  VAYFVLRQHVEAPSMWAIFPLQDLLVLKGEYMTRPATEETINDPTNPKHYWRYRAHVTLE  902

Query  721  SLLNDKSL  744
            +L+ D+ L
Sbjct  903  ALMKDRDL  910



>gb|KDO57418.1| hypothetical protein CISIN_1g002027mg [Citrus sinensis]
Length=978

 Score =   403 bits (1036),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 193/251 (77%), Positives = 221/251 (88%), Gaps = 3/251 (1%)
 Frame = +1

Query  1    FVENEEKLRRNLFDLLQEVVLIRDREDPRKFYPRFNLEDTSSFKGLDQH---SKNVLKRL  171
             +++E+K RR+LFDL+Q +VLIRD ED +KFYPRFNLEDTSSF  LD H    KNVLKRL
Sbjct  671  LLDSEDKTRRDLFDLIQNIVLIRDPEDSKKFYPRFNLEDTSSFMDLDDHRCICKNVLKRL  730

Query  172  YYDYYFHRQESLWRQNALNTLPVLMNSSDMLTCGEDLGMIPACVNPVMQELGLIGLHIQR  351
            YYDYYFHRQE+LWR+NAL TLP L+NSSDM+ CGEDLG+IP+CV+PVM+ELGLIGL IQR
Sbjct  731  YYDYYFHRQENLWRENALKTLPALLNSSDMMACGEDLGLIPSCVHPVMEELGLIGLRIQR  790

Query  352  MPSEPGREFGIPSEYSYMTVCAPSCHDCSTLRAWWEEDEGRRRRYFQTVVGSGAVPPDEC  531
            MPSEPG EFGIPS+Y+YMTVCAPSCHDCSTLRAWWEEDE RRRR+F+ VVGS A+PP +C
Sbjct  791  MPSEPGLEFGIPSQYNYMTVCAPSCHDCSTLRAWWEEDEERRRRFFKNVVGSDALPPSQC  850

Query  532  TPEIARFVLRKHVESPSMWSIFPLQDLLALKEDYATRPAVEETINDPTXPRHYWRYRMHV  711
             P+I  F+LR+HVESPSMW+IFPLQDLLALKEDY TRPA EETINDPT PRHYWRYR+HV
Sbjct  851  LPDITHFILRQHVESPSMWAIFPLQDLLALKEDYTTRPATEETINDPTNPRHYWRYRVHV  910

Query  712  TMESLLNDKSL  744
            T+ESL  DK L
Sbjct  911  TLESLQKDKEL  921



>dbj|BAJ94874.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=931

 Score =   401 bits (1031),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 179/248 (72%), Positives = 212/248 (85%), Gaps = 0/248 (0%)
 Frame = +1

Query  1    FVENEEKLRRNLFDLLQEVVLIRDREDPRKFYPRFNLEDTSSFKGLDQHSKNVLKRLYYD  180
            ++E E+ +RR LFDLLQ +VLIRD ED  K+YPRFNLEDTSSF+ LD+HSKNVL+RLY+D
Sbjct  654  WLEKEDSIRRGLFDLLQNIVLIRDPEDSTKYYPRFNLEDTSSFRDLDEHSKNVLRRLYHD  713

Query  181  YYFHRQESLWRQNALNTLPVLMNSSDMLTCGEDLGMIPACVNPVMQELGLIGLHIQRMPS  360
            YYF RQE+LWRQNAL TLPVL+N SDML CGEDLG+IPACV+PVMQELGLIGL IQRMPS
Sbjct  714  YYFVRQENLWRQNALKTLPVLLNCSDMLACGEDLGLIPACVHPVMQELGLIGLRIQRMPS  773

Query  361  EPGREFGIPSEYSYMTVCAPSCHDCSTLRAWWEEDEGRRRRYFQTVVGSGAVPPDECTPE  540
            EPG EF IPS YSYMTVCAPSCHDCSTLRAWWE DEG R R+++TV+GS    P  CTPE
Sbjct  774  EPGLEFDIPSNYSYMTVCAPSCHDCSTLRAWWEGDEGTRSRFYKTVIGSDKEAPSRCTPE  833

Query  541  IARFVLRKHVESPSMWSIFPLQDLLALKEDYATRPAVEETINDPTXPRHYWRYRMHVTME  720
            +  F++++H ++PSMW+IFPLQDLLALK+ Y  RPA EETINDPT P+HYWR+R+HV +E
Sbjct  834  VVHFIVQQHFDAPSMWAIFPLQDLLALKDKYTARPAAEETINDPTNPKHYWRFRLHVPLE  893

Query  721  SLLNDKSL  744
            S+L DK +
Sbjct  894  SMLEDKDI  901



>ref|XP_011626502.1| PREDICTED: 4-alpha-glucanotransferase DPE2 [Amborella trichopoda]
Length=968

 Score =   400 bits (1028),  Expect = 6e-129, Method: Compositional matrix adjust.
 Identities = 182/246 (74%), Positives = 212/246 (86%), Gaps = 0/246 (0%)
 Frame = +1

Query  7    ENEEKLRRNLFDLLQEVVLIRDREDPRKFYPRFNLEDTSSFKGLDQHSKNVLKRLYYDYY  186
            + E+ +++ LF+LL++VVLIRD ED RKFYPRFNLEDTSSFK LD HSKNVL+  Y DYY
Sbjct  670  DKEDMIKQGLFNLLKDVVLIRDSEDTRKFYPRFNLEDTSSFKDLDDHSKNVLRGKYDDYY  729

Query  187  FHRQESLWRQNALNTLPVLMNSSDMLTCGEDLGMIPACVNPVMQELGLIGLHIQRMPSEP  366
            FHRQE+LWRQNAL TLPVL+NSSDML CGEDLG+IP+CV+PVMQELGLIGL IQRMPSEP
Sbjct  730  FHRQENLWRQNALKTLPVLLNSSDMLACGEDLGLIPSCVHPVMQELGLIGLRIQRMPSEP  789

Query  367  GREFGIPSEYSYMTVCAPSCHDCSTLRAWWEEDEGRRRRYFQTVVGSGAVPPDECTPEIA  546
              EFGIPS+Y YMTVCAPSCHDCSTLRAWWEEDE RR R+++T +GS  VPP  C P IA
Sbjct  790  DLEFGIPSKYDYMTVCAPSCHDCSTLRAWWEEDEERRYRFYKTFLGSDEVPPPRCVPSIA  849

Query  547  RFVLRKHVESPSMWSIFPLQDLLALKEDYATRPAVEETINDPTXPRHYWRYRMHVTMESL  726
             F++ +HV++PSMW+IFPLQDLLALKE+Y  RPA EETINDPT P+HYWRYR+HVT+E+L
Sbjct  850  YFIIHQHVDAPSMWAIFPLQDLLALKEEYTKRPAAEETINDPTNPKHYWRYRLHVTVETL  909

Query  727  LNDKSL  744
            L D  L
Sbjct  910  LADNEL  915



>gb|ERN14586.1| hypothetical protein AMTR_s00038p00141420 [Amborella trichopoda]
Length=1027

 Score =   400 bits (1029),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 182/246 (74%), Positives = 212/246 (86%), Gaps = 0/246 (0%)
 Frame = +1

Query  7    ENEEKLRRNLFDLLQEVVLIRDREDPRKFYPRFNLEDTSSFKGLDQHSKNVLKRLYYDYY  186
            + E+ +++ LF+LL++VVLIRD ED RKFYPRFNLEDTSSFK LD HSKNVL+  Y DYY
Sbjct  729  DKEDMIKQGLFNLLKDVVLIRDSEDTRKFYPRFNLEDTSSFKDLDDHSKNVLRGKYDDYY  788

Query  187  FHRQESLWRQNALNTLPVLMNSSDMLTCGEDLGMIPACVNPVMQELGLIGLHIQRMPSEP  366
            FHRQE+LWRQNAL TLPVL+NSSDML CGEDLG+IP+CV+PVMQELGLIGL IQRMPSEP
Sbjct  789  FHRQENLWRQNALKTLPVLLNSSDMLACGEDLGLIPSCVHPVMQELGLIGLRIQRMPSEP  848

Query  367  GREFGIPSEYSYMTVCAPSCHDCSTLRAWWEEDEGRRRRYFQTVVGSGAVPPDECTPEIA  546
              EFGIPS+Y YMTVCAPSCHDCSTLRAWWEEDE RR R+++T +GS  VPP  C P IA
Sbjct  849  DLEFGIPSKYDYMTVCAPSCHDCSTLRAWWEEDEERRYRFYKTFLGSDEVPPPRCVPSIA  908

Query  547  RFVLRKHVESPSMWSIFPLQDLLALKEDYATRPAVEETINDPTXPRHYWRYRMHVTMESL  726
             F++ +HV++PSMW+IFPLQDLLALKE+Y  RPA EETINDPT P+HYWRYR+HVT+E+L
Sbjct  909  YFIIHQHVDAPSMWAIFPLQDLLALKEEYTKRPAAEETINDPTNPKHYWRYRLHVTVETL  968

Query  727  LNDKSL  744
            L D  L
Sbjct  969  LADNEL  974



>gb|EMS56480.1| 4-alpha-glucanotransferase DPE2 [Triticum urartu]
Length=877

 Score =   396 bits (1018),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 177/248 (71%), Positives = 212/248 (85%), Gaps = 0/248 (0%)
 Frame = +1

Query  1    FVENEEKLRRNLFDLLQEVVLIRDREDPRKFYPRFNLEDTSSFKGLDQHSKNVLKRLYYD  180
            ++E E+ ++R LFDLLQ +VLIRD ED  K+YPRFNLEDTSSF+ LD+HSKNVL+RLY+D
Sbjct  607  WLEKEDSIQRGLFDLLQNIVLIRDPEDSTKYYPRFNLEDTSSFRDLDEHSKNVLRRLYHD  666

Query  181  YYFHRQESLWRQNALNTLPVLMNSSDMLTCGEDLGMIPACVNPVMQELGLIGLHIQRMPS  360
            YYF RQE+LWRQNAL TLPVL++ SDML CGEDLG+IPACV+PVM EL LIGL IQRMPS
Sbjct  667  YYFVRQENLWRQNALKTLPVLLDCSDMLACGEDLGLIPACVHPVMLELALIGLRIQRMPS  726

Query  361  EPGREFGIPSEYSYMTVCAPSCHDCSTLRAWWEEDEGRRRRYFQTVVGSGAVPPDECTPE  540
            EPG EF IPS+YSYMTVCAPSCHDCSTLRAWWE DEG R R+++TV+GS    P  CTPE
Sbjct  727  EPGLEFDIPSKYSYMTVCAPSCHDCSTLRAWWEGDEGTRSRFYKTVIGSDKEAPSRCTPE  786

Query  541  IARFVLRKHVESPSMWSIFPLQDLLALKEDYATRPAVEETINDPTXPRHYWRYRMHVTME  720
            +  F+L++H ++PSMW+IFPLQDLLALK+ Y  RPA EETINDPT PRHYWR+R+HV++E
Sbjct  787  VVNFILQQHFDAPSMWAIFPLQDLLALKDKYTARPAAEETINDPTNPRHYWRFRLHVSLE  846

Query  721  SLLNDKSL  744
            S+L DK +
Sbjct  847  SILEDKDI  854



>gb|EMT23324.1| 4-alpha-glucanotransferase [Aegilops tauschii]
Length=877

 Score =   396 bits (1018),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 177/248 (71%), Positives = 212/248 (85%), Gaps = 0/248 (0%)
 Frame = +1

Query  1    FVENEEKLRRNLFDLLQEVVLIRDREDPRKFYPRFNLEDTSSFKGLDQHSKNVLKRLYYD  180
            ++E E+ ++R LFDLLQ +VLIRD ED  K+YPRFNLEDTSSF+ LD+HSKNVL+RLY+D
Sbjct  607  WLEKEDSIQRGLFDLLQNIVLIRDPEDSTKYYPRFNLEDTSSFRDLDEHSKNVLRRLYHD  666

Query  181  YYFHRQESLWRQNALNTLPVLMNSSDMLTCGEDLGMIPACVNPVMQELGLIGLHIQRMPS  360
            YYF RQE+LWRQNAL TLPVL++ SDML CGEDLG+IPACV+PVM EL LIGL IQRMPS
Sbjct  667  YYFVRQENLWRQNALKTLPVLLDCSDMLACGEDLGLIPACVHPVMLELALIGLRIQRMPS  726

Query  361  EPGREFGIPSEYSYMTVCAPSCHDCSTLRAWWEEDEGRRRRYFQTVVGSGAVPPDECTPE  540
            EPG EF IPS+YSYMTVCAPSCHDCSTLRAWWE DEG R R+++TV+GS    P  CTPE
Sbjct  727  EPGLEFDIPSKYSYMTVCAPSCHDCSTLRAWWEGDEGTRSRFYKTVIGSDKEAPSRCTPE  786

Query  541  IARFVLRKHVESPSMWSIFPLQDLLALKEDYATRPAVEETINDPTXPRHYWRYRMHVTME  720
            +  F+L++H ++PSMW+IFPLQDLLALK+ Y  RPA EETINDPT PRHYWR+R+HV++E
Sbjct  787  VVNFILQQHFDAPSMWAIFPLQDLLALKDKYTARPAAEETINDPTNPRHYWRFRLHVSLE  846

Query  721  SLLNDKSL  744
            S+L DK +
Sbjct  847  SILEDKDI  854



>ref|XP_010673114.1| PREDICTED: 4-alpha-glucanotransferase DPE2 [Beta vulgaris subsp. 
vulgaris]
 ref|XP_010673115.1| PREDICTED: 4-alpha-glucanotransferase DPE2 [Beta vulgaris subsp. 
vulgaris]
Length=966

 Score =   393 bits (1010),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 186/245 (76%), Positives = 216/245 (88%), Gaps = 0/245 (0%)
 Frame = +1

Query  10   NEEKLRRNLFDLLQEVVLIRDREDPRKFYPRFNLEDTSSFKGLDQHSKNVLKRLYYDYYF  189
            +E +LR NLFDLL+ +VLIRD ED  KFYPRFNLEDT+SF  LD HSKNV++RLYYDYYF
Sbjct  667  SEAELRLNLFDLLRNIVLIRDPEDACKFYPRFNLEDTTSFNDLDDHSKNVMRRLYYDYYF  726

Query  190  HRQESLWRQNALNTLPVLMNSSDMLTCGEDLGMIPACVNPVMQELGLIGLHIQRMPSEPG  369
            HRQE+LWRQNAL TLPVL+NSSDML+CGEDLG+IP+CV+PVMQELGLIGL IQRMP+E  
Sbjct  727  HRQENLWRQNALKTLPVLLNSSDMLSCGEDLGLIPSCVHPVMQELGLIGLRIQRMPNESD  786

Query  370  REFGIPSEYSYMTVCAPSCHDCSTLRAWWEEDEGRRRRYFQTVVGSGAVPPDECTPEIAR  549
             EFGIPS+Y YMTVCAPSCHDCST+RAWWEEDE RRRR+F+TVVGS  +PP +C PEIA 
Sbjct  787  LEFGIPSQYGYMTVCAPSCHDCSTMRAWWEEDEERRRRFFKTVVGSNKLPPSKCIPEIAY  846

Query  550  FVLRKHVESPSMWSIFPLQDLLALKEDYATRPAVEETINDPTXPRHYWRYRMHVTMESLL  729
            F++R+HVESPSMW+IFPLQDLLALK +Y  RPA EETINDPT P+HYWR+R HVT+E+LL
Sbjct  847  FIIRQHVESPSMWAIFPLQDLLALKNEYTARPATEETINDPTNPKHYWRFRSHVTLEALL  906

Query  730  NDKSL  744
             D+ L
Sbjct  907  KDQEL  911



>ref|XP_008455750.1| PREDICTED: 4-alpha-glucanotransferase DPE2 [Cucumis melo]
Length=966

 Score =   389 bits (999),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 181/247 (73%), Positives = 218/247 (88%), Gaps = 0/247 (0%)
 Frame = +1

Query  4    VENEEKLRRNLFDLLQEVVLIRDREDPRKFYPRFNLEDTSSFKGLDQHSKNVLKRLYYDY  183
            ++N +++RR+LFDL+Q +VL+RD E+PR FYPRFNLEDTSSF  LD HSK+VLKRLYYDY
Sbjct  664  LQNPDQIRRSLFDLIQNIVLMRDPENPRSFYPRFNLEDTSSFNDLDDHSKDVLKRLYYDY  723

Query  184  YFHRQESLWRQNALNTLPVLMNSSDMLTCGEDLGMIPACVNPVMQELGLIGLHIQRMPSE  363
            YFHRQE LWR+NAL TLPVL++SSDML CGEDLG+IP+CV+PVM+ELGLIGL IQRMP+E
Sbjct  724  YFHRQEDLWRKNALKTLPVLLDSSDMLACGEDLGLIPSCVHPVMEELGLIGLRIQRMPNE  783

Query  364  PGREFGIPSEYSYMTVCAPSCHDCSTLRAWWEEDEGRRRRYFQTVVGSGAVPPDECTPEI  543
            P  EFGIPS+YSYMTVCAPSCHDCSTLRAWWEEDE RRRR+ + ++ S  +PP +C PEI
Sbjct  784  PDLEFGIPSQYSYMTVCAPSCHDCSTLRAWWEEDEERRRRFMKNIIESDILPPSQCIPEI  843

Query  544  ARFVLRKHVESPSMWSIFPLQDLLALKEDYATRPAVEETINDPTXPRHYWRYRMHVTMES  723
            A F++++H E+PSMW+IFPLQDLLALKE+Y TRPA EETINDPT P+HYWR+R HVT+ES
Sbjct  844  AYFIIKQHFEAPSMWAIFPLQDLLALKEEYTTRPAKEETINDPTNPKHYWRFRSHVTLES  903

Query  724  LLNDKSL  744
            L+ DK L
Sbjct  904  LMKDKEL  910



>ref|XP_002979331.1| hypothetical protein SELMODRAFT_268243 [Selaginella moellendorffii]
 gb|EFJ19739.1| hypothetical protein SELMODRAFT_268243 [Selaginella moellendorffii]
Length=930

 Score =   378 bits (970),  Expect = 9e-121, Method: Compositional matrix adjust.
 Identities = 167/246 (68%), Positives = 209/246 (85%), Gaps = 0/246 (0%)
 Frame = +1

Query  7    ENEEKLRRNLFDLLQEVVLIRDREDPRKFYPRFNLEDTSSFKGLDQHSKNVLKRLYYDYY  186
            + +E+++  LFDLL++VVL+RD ED RKFYPRF +EDTS+FK LD+HSKNVL+RLYYDY+
Sbjct  657  KKQEQIKGALFDLLRDVVLMRDPEDSRKFYPRFGMEDTSNFKELDEHSKNVLQRLYYDYF  716

Query  187  FHRQESLWRQNALNTLPVLMNSSDMLTCGEDLGMIPACVNPVMQELGLIGLHIQRMPSEP  366
            +HRQE LWR+NAL TLPVLM+SS+MLTCGEDLGM+PACV PV+ ELGL+GL IQRMPS P
Sbjct  717  YHRQEGLWRENALKTLPVLMSSSEMLTCGEDLGMVPACVAPVLNELGLLGLRIQRMPSTP  776

Query  367  GREFGIPSEYSYMTVCAPSCHDCSTLRAWWEEDEGRRRRYFQTVVGSGAVPPDECTPEIA  546
            G+EFG P EY YMTVCAPSCHDCST+RAWWE+DEGRR R+++  +G    PP +C P++A
Sbjct  777  GQEFGNPLEYEYMTVCAPSCHDCSTMRAWWEDDEGRRIRFYKDYLGMSESPPAQCVPDVA  836

Query  547  RFVLRKHVESPSMWSIFPLQDLLALKEDYATRPAVEETINDPTXPRHYWRYRMHVTMESL  726
            R ++ +H++SPSMW+IFPLQDLLALKE+Y  RPA EETINDPT P+HYWR+R    +E+L
Sbjct  837  RVIIEQHMKSPSMWAIFPLQDLLALKEEYTGRPANEETINDPTNPKHYWRFRTLTHVETL  896

Query  727  LNDKSL  744
            L D+ L
Sbjct  897  LEDREL  902



>ref|XP_001779217.1| predicted protein [Physcomitrella patens]
 gb|EDQ55980.1| predicted protein [Physcomitrella patens]
Length=1006

 Score =   369 bits (947),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 164/244 (67%), Positives = 199/244 (82%), Gaps = 0/244 (0%)
 Frame = +1

Query  4    VENEEKLRRNLFDLLQEVVLIRDREDPRKFYPRFNLEDTSSFKGLDQHSKNVLKRLYYDY  183
            ++  E  R  LFDLL EV+L+RDR+DP KFYPRF ++ T SF  LD HSKNVLK  Y DY
Sbjct  679  IQEAEADRTRLFDLLHEVILMRDRDDPSKFYPRFGMDKTVSFDELDDHSKNVLKSKYNDY  738

Query  184  YFHRQESLWRQNALNTLPVLMNSSDMLTCGEDLGMIPACVNPVMQELGLIGLHIQRMPSE  363
            +FHRQE LWR NAL TLP L+NSSDML CGEDLGM+PACV PV+ ELGL+GL IQRMPS 
Sbjct  739  FFHRQEQLWRDNALMTLPALLNSSDMLCCGEDLGMVPACVQPVLSELGLLGLRIQRMPSA  798

Query  364  PGREFGIPSEYSYMTVCAPSCHDCSTLRAWWEEDEGRRRRYFQTVVGSGAVPPDECTPEI  543
            PG+EFG P++Y YMTVCAPSCHD ST+RAWWEEDEGRR R+F+ ++G    PP+ C P +
Sbjct  799  PGQEFGNPADYEYMTVCAPSCHDSSTMRAWWEEDEGRRERFFRNMLGLTDPPPETCDPHV  858

Query  544  ARFVLRKHVESPSMWSIFPLQDLLALKEDYATRPAVEETINDPTXPRHYWRYRMHVTMES  723
            +  +L++H+ESPSMW+IFPLQDL+ALK++YA RPA EETINDPT PRHYWR+R+H+ ME+
Sbjct  859  SHLILQQHLESPSMWAIFPLQDLMALKDEYAKRPANEETINDPTNPRHYWRFRVHIPMET  918

Query  724  LLND  735
            LL D
Sbjct  919  LLCD  922



>ref|XP_002988641.1| hypothetical protein SELMODRAFT_427302 [Selaginella moellendorffii]
 gb|EFJ10437.1| hypothetical protein SELMODRAFT_427302 [Selaginella moellendorffii]
Length=883

 Score =   364 bits (935),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 160/231 (69%), Positives = 200/231 (87%), Gaps = 0/231 (0%)
 Frame = +1

Query  7    ENEEKLRRNLFDLLQEVVLIRDREDPRKFYPRFNLEDTSSFKGLDQHSKNVLKRLYYDYY  186
            + +E+++  LFDLL++VVL+RD ED RKFYPRF +E+TS+FK LD+HSKNVL+RLYYDY+
Sbjct  641  KKQEQIKGALFDLLRDVVLMRDPEDSRKFYPRFGMENTSNFKELDEHSKNVLQRLYYDYF  700

Query  187  FHRQESLWRQNALNTLPVLMNSSDMLTCGEDLGMIPACVNPVMQELGLIGLHIQRMPSEP  366
            +HRQE LWR+NAL TLPVLM+SS+MLTCGEDLGM+PACV PV+ ELGL+GL IQRMPS P
Sbjct  701  YHRQEGLWRENALKTLPVLMSSSEMLTCGEDLGMVPACVAPVLNELGLLGLRIQRMPSTP  760

Query  367  GREFGIPSEYSYMTVCAPSCHDCSTLRAWWEEDEGRRRRYFQTVVGSGAVPPDECTPEIA  546
            G+EFG P EY YMTVCAPSCHDCST+RAWWE+DEGRR R+++  +G    PP +C P++A
Sbjct  761  GQEFGNPLEYEYMTVCAPSCHDCSTMRAWWEDDEGRRIRFYKDYLGMSESPPAQCLPDVA  820

Query  547  RFVLRKHVESPSMWSIFPLQDLLALKEDYATRPAVEETINDPTXPRHYWRY  699
            R ++ +H++SPSMW+IFPLQDLLALKE+Y  RPA EETINDPT P+HYWR+
Sbjct  821  RVIIEQHMKSPSMWAIFPLQDLLALKEEYTGRPANEETINDPTNPKHYWRF  871



>ref|XP_007028194.1| Disproportionating enzyme 2 isoform 2 [Theobroma cacao]
 gb|EOY08696.1| Disproportionating enzyme 2 isoform 2 [Theobroma cacao]
Length=872

 Score =   340 bits (871),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 154/205 (75%), Positives = 179/205 (87%), Gaps = 0/205 (0%)
 Frame = +1

Query  7    ENEEKLRRNLFDLLQEVVLIRDREDPRKFYPRFNLEDTSSFKGLDQHSKNVLKRLYYDYY  186
            E+E+K+R +LFDLL+ +VLIRD E  R FYPRFNLEDTSSF+ LD HSKNVLKRLYYDYY
Sbjct  666  ESEDKIRHDLFDLLKNIVLIRDPEYARNFYPRFNLEDTSSFRDLDDHSKNVLKRLYYDYY  725

Query  187  FHRQESLWRQNALNTLPVLMNSSDMLTCGEDLGMIPACVNPVMQELGLIGLHIQRMPSEP  366
            FHRQE LW+QNAL TLPVL+NSSDML CGEDLG+IPACV+PVMQELGLIGL IQRMPSEP
Sbjct  726  FHRQEKLWQQNALKTLPVLLNSSDMLACGEDLGLIPACVHPVMQELGLIGLRIQRMPSEP  785

Query  367  GREFGIPSEYSYMTVCAPSCHDCSTLRAWWEEDEGRRRRYFQTVVGSGAVPPDECTPEIA  546
              EFG PS+YSYMTVCAPSCHDCSTLRAWWEEDE RR R+F +V+GS  +PP +C P++A
Sbjct  786  DLEFGFPSQYSYMTVCAPSCHDCSTLRAWWEEDEERRHRFFNSVMGSDELPPTQCVPDVA  845

Query  547  RFVLRKHVESPSMWSIFPLQDLLAL  621
             F++R+HVE+PSMW+IFPLQ  + L
Sbjct  846  YFIIRQHVEAPSMWAIFPLQKCVKL  870



>gb|KJB66144.1| hypothetical protein B456_010G128900 [Gossypium raimondii]
Length=866

 Score =   336 bits (861),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 150/200 (75%), Positives = 177/200 (89%), Gaps = 0/200 (0%)
 Frame = +1

Query  7    ENEEKLRRNLFDLLQEVVLIRDREDPRKFYPRFNLEDTSSFKGLDQHSKNVLKRLYYDYY  186
            E+E+K+R +LFDLL+ +VLIRD E  + FYPRFNLEDTSSF+ LD HSKNVLKRLYYDYY
Sbjct  665  ESEDKIRCDLFDLLKNIVLIRDPEHDKSFYPRFNLEDTSSFRDLDDHSKNVLKRLYYDYY  724

Query  187  FHRQESLWRQNALNTLPVLMNSSDMLTCGEDLGMIPACVNPVMQELGLIGLHIQRMPSEP  366
            FHRQ+ LW+QNAL TLP L+NSSDML CGEDLG+IPACV+PVMQELGLIGL IQRMPSEP
Sbjct  725  FHRQDKLWQQNALKTLPALLNSSDMLACGEDLGLIPACVHPVMQELGLIGLRIQRMPSEP  784

Query  367  GREFGIPSEYSYMTVCAPSCHDCSTLRAWWEEDEGRRRRYFQTVVGSGAVPPDECTPEIA  546
              EFGIPS+YSYMTVCAPSCHDCSTLRAWWEEDE RR R+F++V+GS  +PP +C P++A
Sbjct  785  DLEFGIPSQYSYMTVCAPSCHDCSTLRAWWEEDEERRHRFFKSVIGSDDLPPSQCVPDLA  844

Query  547  RFVLRKHVESPSMWSIFPLQ  606
              ++R+H+ESPSMW+IFPLQ
Sbjct  845  HLIIRQHIESPSMWAIFPLQ  864



>ref|XP_005844986.1| hypothetical protein CHLNCDRAFT_58753 [Chlorella variabilis]
 gb|EFN52884.1| hypothetical protein CHLNCDRAFT_58753 [Chlorella variabilis]
Length=842

 Score =   288 bits (737),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 134/246 (54%), Positives = 173/246 (70%), Gaps = 0/246 (0%)
 Frame = +1

Query  7    ENEEKLRRNLFDLLQEVVLIRDREDPRKFYPRFNLEDTSSFKGLDQHSKNVLKRLYYDYY  186
            +  + +RR L  L Q VVL+RD EDP  FYPRF L  TSSFKGL+QH +  L RL+ DYY
Sbjct  575  DEADNVRRGLLTLRQNVVLLRDNEDPNAFYPRFALNTTSSFKGLEQHWREELLRLHNDYY  634

Query  187  FHRQESLWRQNALNTLPVLMNSSDMLTCGEDLGMIPACVNPVMQELGLIGLHIQRMPSEP  366
             HRQ++LWR+ +  TLP LM ++DML CGEDLGMIPACV+PVM ELGLIGL IQRMP+E 
Sbjct  635  HHRQDALWRKQSHRTLPALMGATDMLVCGEDLGMIPACVHPVMAELGLIGLRIQRMPAEE  694

Query  367  GREFGIPSEYSYMTVCAPSCHDCSTLRAWWEEDEGRRRRYFQTVVGSGAVPPDECTPEIA  546
            G +FG P  Y YMTV +PS HD ST R WWE+++ RR+ +++ ++      P  CTP + 
Sbjct  695  GVKFGDPLAYPYMTVASPSSHDISTTRGWWEQEKQRRQEFYEEMLNGEGEAPRHCTPAVL  754

Query  547  RFVLRKHVESPSMWSIFPLQDLLALKEDYATRPAVEETINDPTXPRHYWRYRMHVTMESL  726
              +L++H++SPS+ +IFPLQDLL L       P   + INDPT P+HYWRYR+HVT+E +
Sbjct  755  EHILQQHMDSPSLLAIFPLQDLLPLSPRLPDCPPERQQINDPTNPQHYWRYRLHVTLEDI  814

Query  727  LNDKSL  744
              D  L
Sbjct  815  AADADL  820



>ref|XP_003082031.1| 4-alpha-glucanotransferase; disproportionating enzyme (ISS) [Ostreococcus 
tauri]
Length=336

 Score =   273 bits (699),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 131/249 (53%), Positives = 166/249 (67%), Gaps = 4/249 (2%)
 Frame = +1

Query  1    FVENEEKLRRNLFDLLQEVVLIRDREDPRKFYPRFNLEDTSSFKGLDQHSKNVLKRLYYD  180
             + ++  +R  L  L Q   L+ D+E+   FYPRF LEDTSS++ L+   +  L+ L  D
Sbjct  68   LIGDQLAIRDGLMKLFQNRCLLTDKENYDNFYPRFGLEDTSSYQALEGWQRETLRELAND  127

Query  181  YYFHRQESLWRQNALNTLPVLMNSSDMLTCGEDLGMIPACVNPVMQELGLIGLHIQRMPS  360
            YYF RQ   WR  A   LP L+ SSDML CGEDLG  P CV PVM ELG++GL IQRMP 
Sbjct  128  YYFGRQMDTWRNQARMVLPALLRSSDMLVCGEDLGFTPTCVPPVMDELGILGLRIQRMPP  187

Query  361  -EPGREFGIPSEYSYMTVCAPSCHDCSTLRAWWEEDEGRRRRYFQTVVGSGAVPPDECTP  537
                 EFG P  YSY+TVC+PSCHD  T RAWWE+DE RR+RY     G      ++CTP
Sbjct  188  VGESAEFGQPHTYSYLTVCSPSCHDTMTTRAWWEQDEARRQRYDAMFHGG---TDEKCTP  244

Query  538  EIARFVLRKHVESPSMWSIFPLQDLLALKEDYATRPAVEETINDPTXPRHYWRYRMHVTM  717
             + R +L +H+ESPS+ +IFP+QDLLAL  +YA RPA+EETINDPT P+HYWRYR+HV  
Sbjct  245  NVMRNILVQHIESPSVLAIFPIQDLLALDAEYAKRPALEETINDPTNPKHYWRYRLHVPC  304

Query  718  ESLLNDKSL  744
            E +L + + 
Sbjct  305  EDMLANGAF  313



>ref|XP_005648012.1| hypothetical protein COCSUDRAFT_28856 [Coccomyxa subellipsoidea 
C-169]
 gb|EIE23468.1| hypothetical protein COCSUDRAFT_28856 [Coccomyxa subellipsoidea 
C-169]
Length=914

 Score =   284 bits (727),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 137/246 (56%), Positives = 173/246 (70%), Gaps = 1/246 (0%)
 Frame = +1

Query  1    FVENEEKLRRNLFDLLQEVVLIRDREDPRKFYPRFNLEDTSSFKGLDQHSKNVLKRLYYD  180
             V   + +R+ L DL   VVL+R  + P  F PRFNL  T+SF  LD H K  L RL+ D
Sbjct  627  LVSEVDAIRQGLLDLRHNVVLLRSPDSPNDFTPRFNLASTTSFASLDPHWKAHLVRLHDD  686

Query  181  YYFHRQESLWRQNALNTLPVLMNSSDMLTCGEDLGMIPACVNPVMQELGLIGLHIQRMPS  360
            Y   RQ  LW  +A  +LPVLM ++DML CGEDLG +  CV+P+M++LGL+GL IQRMPS
Sbjct  687  YLETRQLDLWWDHAHMSLPVLMRATDMLVCGEDLGFLAPCVHPLMKKLGLVGLRIQRMPS  746

Query  361  EPGREFGIPSEYSYMTVCAPSCHDCSTLRAWWEEDEGRRRRYFQTVVGSGAVPPDECTPE  540
            EP  EFG P+ Y YM V +PSCHD ST RAW+EED  RR+R F   +G     P+ CTPE
Sbjct  747  EPDAEFGDPANYPYMCVASPSCHDTSTTRAWYEEDPSRRQR-FTEFLGLPGPAPEHCTPE  805

Query  541  IARFVLRKHVESPSMWSIFPLQDLLALKEDYATRPAVEETINDPTXPRHYWRYRMHVTME  720
            +   V+++HVESP+MW+IFP+QDLLAL ++YA RPA EETIN+PT  +HYWRYR HV +E
Sbjct  806  VMHAVVKQHVESPAMWAIFPIQDLLALSDEYAARPAGEETINNPTVRKHYWRYRCHVELE  865

Query  721  SLLNDK  738
            SLL D+
Sbjct  866  SLLEDR  871



>ref|XP_003061752.1| glycoside hydrolase family 77 protein [Micromonas pusilla CCMP1545]
 gb|EEH54382.1| glycoside hydrolase family 77 protein [Micromonas pusilla CCMP1545]
Length=742

 Score =   280 bits (717),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 133/247 (54%), Positives = 174/247 (70%), Gaps = 6/247 (2%)
 Frame = +1

Query  1    FVENEEKLRRNLFDLLQEVVLIRDREDPRKFYPRFNLEDTSSFKGLDQHSKNVLKRLYYD  180
             V+  E+LRR L  LLQ V+L+RD +D   FYPR   E T+SF+ LD  +++ L  LY D
Sbjct  483  LVKETEELRRGLMTLLQNVILLRDPDDADAFYPRIEFEKTTSFRDLDDWARDALSWLYDD  542

Query  181  YYFHRQESLWRQNALNTLPVLMNSSDMLTCGEDLGMIPACVNPVMQELGLIGLHIQRMPS  360
            Y+  RQ++ WR+NA  TLP LM+ +  L CGEDLGM+P CV PV++ELG++GL IQRMP 
Sbjct  543  YFNARQDATWRENARRTLPALMSCTGQLVCGEDLGMVPPCVPPVLEELGILGLRIQRMPH  602

Query  361  EPGREFGIPSEYSYMTVCAPSCHDCSTLRAWWEEDEGRRRRYFQTVVGSGAVPPDECTPE  540
            + G EFG P  Y Y TVC+PSCHD ST RAW+E D  RR RY + V       P++C P 
Sbjct  603  DGG-EFGRPERYPYETVCSPSCHDTSTTRAWYEADPARRDRYAKLVSA-----PEKCEPH  656

Query  541  IARFVLRKHVESPSMWSIFPLQDLLALKEDYATRPAVEETINDPTXPRHYWRYRMHVTME  720
            + R ++R+H+ SPS  +IFP QDLLAL  +YATRPA EETINDPT P+HYWR+R+HV +E
Sbjct  657  VMRAIVRQHMASPSSIAIFPAQDLLALVGEYATRPAEEETINDPTNPKHYWRFRLHVRLE  716

Query  721  SLLNDKS  741
             +L +K+
Sbjct  717  DMLANKA  723



>gb|ABK93393.1| unknown [Populus trichocarpa]
Length=152

 Score =   259 bits (662),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 116/150 (77%), Positives = 132/150 (88%), Gaps = 0/150 (0%)
 Frame = +1

Query  259  MLTCGEDLGMIPACVNPVMQELGLIGLHIQRMPSEPGREFGIPSEYSYMTVCAPSCHDCS  438
            ML CGEDLG+IPACV+PVMQELG+IGL IQRMPSE   EFGIPS+YSYMTVCAPSCHDCS
Sbjct  1    MLACGEDLGLIPACVHPVMQELGMIGLRIQRMPSESDLEFGIPSQYSYMTVCAPSCHDCS  60

Query  439  TLRAWWEEDEGRRRRYFQTVVGSGAVPPDECTPEIARFVLRKHVESPSMWSIFPLQDLLA  618
            T RAWWEEDE RR RYF+ +VG  A+P  +C P+IA FV+R+HVE+PSMW+IFPLQDLLA
Sbjct  61   TFRAWWEEDEERRCRYFKNLVGPDAIPSSQCVPDIAHFVIRQHVEAPSMWAIFPLQDLLA  120

Query  619  LKEDYATRPAVEETINDPTXPRHYWRYRMH  708
            LKE+Y TRPA EETINDPT P+HYWRYR+H
Sbjct  121  LKEEYTTRPATEETINDPTNPKHYWRYRVH  150



>emb|CEF99666.1| Carbohydrate binding module family 20 [Ostreococcus tauri]
Length=961

 Score =   275 bits (702),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 131/249 (53%), Positives = 166/249 (67%), Gaps = 4/249 (2%)
 Frame = +1

Query  1    FVENEEKLRRNLFDLLQEVVLIRDREDPRKFYPRFNLEDTSSFKGLDQHSKNVLKRLYYD  180
             + ++  +R  L  L Q   L+ D+E+   FYPRF LEDTSS++ L+   +  L+ L  D
Sbjct  693  LIGDQLAIRDGLMKLFQNRCLLTDKENYDNFYPRFGLEDTSSYQALEGWQRETLRELAND  752

Query  181  YYFHRQESLWRQNALNTLPVLMNSSDMLTCGEDLGMIPACVNPVMQELGLIGLHIQRM-P  357
            YYF RQ   WR  A   LP L+ SSDML CGEDLG  P CV PVM ELG++GL IQRM P
Sbjct  753  YYFGRQMDTWRNQARMVLPALLRSSDMLVCGEDLGFTPTCVPPVMDELGILGLRIQRMPP  812

Query  358  SEPGREFGIPSEYSYMTVCAPSCHDCSTLRAWWEEDEGRRRRYFQTVVGSGAVPPDECTP  537
                 EFG P  YSY+TVC+PSCHD  T RAWWE+DE RR+RY     G      ++CTP
Sbjct  813  VGESAEFGQPHTYSYLTVCSPSCHDTMTTRAWWEQDEARRQRYDAMFHGG---TDEKCTP  869

Query  538  EIARFVLRKHVESPSMWSIFPLQDLLALKEDYATRPAVEETINDPTXPRHYWRYRMHVTM  717
             + R +L +H+ESPS+ +IFP+QDLLAL  +YA RPA+EETINDPT P+HYWRYR+HV  
Sbjct  870  NVMRNILVQHIESPSVLAIFPIQDLLALDAEYAKRPALEETINDPTNPKHYWRYRLHVPC  929

Query  718  ESLLNDKSL  744
            E +L + + 
Sbjct  930  EDMLANGAF  938



>ref|XP_001420502.1| predicted protein, partial [Ostreococcus lucimarinus CCE9901]
 gb|ABO98795.1| predicted protein, partial [Ostreococcus lucimarinus CCE9901]
Length=729

 Score =   268 bits (684),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 132/248 (53%), Positives = 166/248 (67%), Gaps = 6/248 (2%)
 Frame = +1

Query  10   NEEKL--RRNLFDLLQEVVLIRDREDPRKFYPRFNLEDTSSFKGLDQHSKNVLKRLYYDY  183
            N+E+L  R  L  L Q   L+ D E+   FYPRF LE+T+SF+ L+   ++ L+ L  DY
Sbjct  468  NDEQLLVRAGLMQLFQNRCLLTDVENIDHFYPRFGLEETTSFQALEGWMRDALRDLSNDY  527

Query  184  YFHRQESLWRQNALNTLPVLMNSSDMLTCGEDLGMIPACVNPVMQELGLIGLHIQRM-PS  360
            YF RQ + WR+ A   LP L+ S++ML CGEDLG  P CV PVM ELG++GL IQRM P 
Sbjct  528  YFGRQTNTWRKQARKVLPALLKSTEMLVCGEDLGFTPMCVPPVMDELGILGLRIQRMPPV  587

Query  361  EPGREFGIPSEYSYMTVCAPSCHDCSTLRAWWEEDEGRRRRYFQTVVGSGAVPPDECTPE  540
                EFG P  YSY+TVC+PSCHD  T RAWWEED  RR RY +          D CTP 
Sbjct  588  GESSEFGRPHTYSYLTVCSPSCHDTMTTRAWWEEDAERRARYDEMFQCGN---DDACTPS  644

Query  541  IARFVLRKHVESPSMWSIFPLQDLLALKEDYATRPAVEETINDPTXPRHYWRYRMHVTME  720
            + R +L +H+ESPS+ +IFP+QD+LAL E YA RPA+EETINDPT P+HYWR+R+HV  E
Sbjct  645  VMRRILTQHIESPSVLAIFPIQDVLALDERYAKRPALEETINDPTNPKHYWRFRIHVACE  704

Query  721  SLLNDKSL  744
             LL + S 
Sbjct  705  ELLANASF  712



>ref|XP_002509010.1| glycoside hydrolase family 77 protein [Micromonas sp. RCC299]
 gb|ACO70268.1| glycoside hydrolase family 77 protein [Micromonas sp. RCC299]
Length=975

 Score =   266 bits (680),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 131/247 (53%), Positives = 164/247 (66%), Gaps = 2/247 (1%)
 Frame = +1

Query  1    FVENEEKLRRNLFDLLQEVVLIRDREDPRKFYPRFNLEDTSSFKGLDQHSKNVLKRLYYD  180
             VE  E +R+ L  L   V L+RD EDP  FYPR  ++ TSSF  L+  SK+ L  LY D
Sbjct  708  LVEETEAMRKGLLHLQHNVCLLRDPEDPDAFYPRIEMQKTSSFNELEGWSKDALNWLYDD  767

Query  181  YYFHRQESLWRQNALNTLPVLMNSSDMLTCGEDLGMIPACVNPVMQELGLIGLHIQRMPS  360
            Y+  RQ++LWR+NA  TLP LM  +  L CGEDLGM+P CV PV+ ELG++GL IQRMP 
Sbjct  768  YFGARQDTLWRENARRTLPALMTCTGQLVCGEDLGMVPPCVPPVLDELGILGLRIQRMPH  827

Query  361  EPGREFGIPSEYSYMTVCAPSCHDCSTLRAWWEEDEGRRRRYFQTVVG-SGAVPPDECTP  537
            + G EFG P+ Y Y TVC+PSCHD +T RAW+E D  RR RY   V+G  G      C P
Sbjct  828  DEG-EFGRPNRYPYATVCSPSCHDTTTTRAWYEADRHRRARYAHQVLGMQGDGQLASCFP  886

Query  538  EIARFVLRKHVESPSMWSIFPLQDLLALKEDYATRPAVEETINDPTXPRHYWRYRMHVTM  717
                 ++R+H+ SPS  +IFP QDLLAL+  YA RPA EETINDPT  RHYWR+R+HV +
Sbjct  887  PPMAAIVRQHMASPSALAIFPAQDLLALESSYAQRPAEEETINDPTNNRHYWRFRLHVRL  946

Query  718  ESLLNDK  738
            E +L + 
Sbjct  947  EDMLANS  953



>ref|XP_638682.1| hypothetical protein DDB_G0284259 [Dictyostelium discoideum AX4]
 gb|EAL65318.1| hypothetical protein DDB_G0284259 [Dictyostelium discoideum AX4]
Length=907

 Score =   256 bits (654),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 115/243 (47%), Positives = 157/243 (65%), Gaps = 0/243 (0%)
 Frame = +1

Query  7    ENEEKLRRNLFDLLQEVVLIRDREDPRKFYPRFNLEDTSSFKGLDQHSKNVLKRLYYDYY  186
            E +   +  LF L+Q V L+ D ED  +FYPR  +  TS+F  L    K +L RLY  YY
Sbjct  646  EEDAMYKSGLFKLVQNVSLLADAEDENRFYPRIEITKTSNFNELSDDIKTILHRLYISYY  705

Query  187  FHRQESLWRQNALNTLPVLMNSSDMLTCGEDLGMIPACVNPVMQELGLIGLHIQRMPSEP  366
            + RQE LW Q AL  LP++   + ML CGEDLGM+P CV PV+ +LG++GL IQRMPS+ 
Sbjct  706  YERQEELWAQIALQRLPLIKGCTKMLVCGEDLGMVPKCVEPVLNDLGILGLRIQRMPSDS  765

Query  367  GREFGIPSEYSYMTVCAPSCHDCSTLRAWWEEDEGRRRRYFQTVVGSGAVPPDECTPEIA  546
             ++F  P+EYSY+TV   S HD STLR WWEED  R + ++  ++G     P  C P ++
Sbjct  766  NKDFYHPNEYSYLTVNTTSSHDMSTLRGWWEEDRARSQVFYNKILGMFGDAPYFCEPYVS  825

Query  547  RFVLRKHVESPSMWSIFPLQDLLALKEDYATRPAVEETINDPTXPRHYWRYRMHVTMESL  726
              V+ +H+ S SM SIFP+QD   +  +Y +R   EE IN+P+ P HYWRYRMH+ +E+L
Sbjct  826  EAVITQHLHSQSMISIFPIQDWFGISSEYGSRDPKEEKINEPSNPMHYWRYRMHINLETL  885

Query  727  LND  735
            +ND
Sbjct  886  VND  888



>ref|XP_011395531.1| 4-alpha-glucanotransferase DPE2 [Auxenochlorella protothecoides]
 gb|KFM22675.1| 4-alpha-glucanotransferase DPE2 [Auxenochlorella protothecoides]
Length=921

 Score =   254 bits (650),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 122/237 (51%), Positives = 163/237 (69%), Gaps = 2/237 (1%)
 Frame = +1

Query  19   KLRRNLFDLLQEVVLIRDREDPRKFYPRFNLEDTSSFKGLDQHS-KNVLKRLYYDYYFHR  195
            ++   L  + + V+L+RD EDP+K YPRF+L  T+SF  LD  +    L   + DY++ R
Sbjct  655  RIHETLLLMRRNVLLLRDPEDPQKLYPRFDLTKTTSFAALDNVAWAEELAWQHDDYFYRR  714

Query  196  QESLWRQNALNTLPVLMNSSDMLTCGEDLGMIPACVNPVMQELGLIGLHIQRMPSEPGRE  375
            QE LWR     TLP L++SSDML CGEDLG  PACV P+M+ELG++ L IQRMPS    E
Sbjct  715  QEELWRAQGHRTLPALLSSSDMLMCGEDLGFTPACVRPIMEELGILALRIQRMPSSQ-EE  773

Query  376  FGIPSEYSYMTVCAPSCHDCSTLRAWWEEDEGRRRRYFQTVVGSGAVPPDECTPEIARFV  555
            FG P++Y YM V +PS HD +T RAW+EED  RR+RY+  V+G     P  CTPEI R +
Sbjct  774  FGDPADYPYMCVASPSSHDTTTTRAWYEEDAPRRQRYYAQVLGGEGPAPASCTPEIMRAI  833

Query  556  LRKHVESPSMWSIFPLQDLLALKEDYATRPAVEETINDPTXPRHYWRYRMHVTMESL  726
             ++HV+SP++ +IFP+QD++AL+     RPA EETIN P+ P HYWRYRMH+T+  L
Sbjct  834  AQQHVDSPAVLAIFPIQDIIALETWDRVRPASEETINAPSNPEHYWRYRMHLTLREL  890



>ref|WP_027984123.1| hypothetical protein [delta proteobacterium PSCGC 5296]
Length=911

 Score =   253 bits (647),  Expect = 3e-74, Method: Composition-based stats.
 Identities = 105/238 (44%), Positives = 162/238 (68%), Gaps = 0/238 (0%)
 Frame = +1

Query  22   LRRNLFDLLQEVVLIRDREDPRKFYPRFNLEDTSSFKGLDQHSKNVLKRLYYDYYFHRQE  201
            L+  LF L+ EV+ I+D      ++PR + + T+S++ L+ + ++ +  LY DY+++RQE
Sbjct  653  LKEILFSLVSEVLFIKDTHKKNCYHPRISFDKTNSYQALNSNIRDKIYNLYLDYFYNRQE  712

Query  202  SLWRQNALNTLPVLMNSSDMLTCGEDLGMIPACVNPVMQELGLIGLHIQRMPSEPGREFG  381
             LW++ AL  LP L+N+++ML CGEDLGMIP CV  +M++L L+ L IQRMP E   EFG
Sbjct  713  KLWKKQALIKLPALINATNMLVCGEDLGMIPDCVPGIMEQLALLSLKIQRMPKETHLEFG  772

Query  382  IPSEYSYMTVCAPSCHDCSTLRAWWEEDEGRRRRYFQTVVGSGAVPPDECTPEIARFVLR  561
            IPS Y Y++VC  S HD STLR WWEE+  + +R++  ++    + P  C P I + ++ 
Sbjct  773  IPSNYPYISVCTTSSHDMSTLRGWWEENRDKTQRFYNNILKHKGIAPQYCEPSICKEIIN  832

Query  562  KHVESPSMWSIFPLQDLLALKEDYATRPAVEETINDPTXPRHYWRYRMHVTMESLLND  735
            +H++SP MW++FP+QDLLA+ E+   +   EE IN+P+ P HYW+YR H+ +E LL +
Sbjct  833  QHLDSPCMWAVFPIQDLLAIDENLRRKNPYEERINEPSNPNHYWQYRFHINLEDLLEE  890



>dbj|GAM28256.1| hypothetical protein SAMD00019534_114320 [Acytostelium subglobosum 
LB1]
Length=918

 Score =   253 bits (647),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 119/237 (50%), Positives = 155/237 (65%), Gaps = 0/237 (0%)
 Frame = +1

Query  34   LFDLLQEVVLIRDREDPRKFYPRFNLEDTSSFKGLDQHSKNVLKRLYYDYYFHRQESLWR  213
            L  L+Q V LI+D+ED  KFYPR  L  TSS+  L    K+ L RLY  YYF RQE LW 
Sbjct  666  LLKLVQNVCLIQDKEDENKFYPRIELIKTSSYNELSDDLKSALYRLYISYYFERQEDLWT  725

Query  214  QNALNTLPVLMNSSDMLTCGEDLGMIPACVNPVMQELGLIGLHIQRMPSEPGREFGIPSE  393
             +AL  LP++   + ML CGEDLGM+P CV PV+++LG++GL IQRMPS+  +EF  PSE
Sbjct  726  HSALQRLPIIKGCTRMLVCGEDLGMVPKCVEPVLKDLGILGLRIQRMPSDSTKEFYYPSE  785

Query  394  YSYMTVCAPSCHDCSTLRAWWEEDEGRRRRYFQTVVGSGAVPPDECTPEIARFVLRKHVE  573
            YSY+TV   S HD  TLR WWEED  R + ++  V+      P  C P +   V+ +H++
Sbjct  786  YSYLTVNTTSSHDMVTLRGWWEEDRARSQTFYNNVLNMYGEAPYFCEPYVTETVIMQHLQ  845

Query  574  SPSMWSIFPLQDLLALKEDYATRPAVEETINDPTXPRHYWRYRMHVTMESLLNDKSL  744
            SPSM SIFPLQD   L  + ++R   EE IN+P+ P HYW+YRMHV +E LL + +L
Sbjct  846  SPSMISIFPLQDWFGLSSELSSRDPKEEKINEPSNPFHYWQYRMHVDLEDLLENTNL  902



>ref|XP_003286541.1| hypothetical protein DICPUDRAFT_46840 [Dictyostelium purpureum]
 gb|EGC36898.1| hypothetical protein DICPUDRAFT_46840 [Dictyostelium purpureum]
Length=909

 Score =   249 bits (636),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 115/234 (49%), Positives = 150/234 (64%), Gaps = 0/234 (0%)
 Frame = +1

Query  34   LFDLLQEVVLIRDREDPRKFYPRFNLEDTSSFKGLDQHSKNVLKRLYYDYYFHRQESLWR  213
            LF L+Q V L  D ED  +FYPR  +  TS+F  L    K+ L RLY  Y+F RQE LW 
Sbjct  657  LFKLVQNVSLCADSEDENRFYPRIEITKTSNFNELSDDMKSTLHRLYISYFFERQEELWA  716

Query  214  QNALNTLPVLMNSSDMLTCGEDLGMIPACVNPVMQELGLIGLHIQRMPSEPGREFGIPSE  393
            Q AL  LP++   + ML CGEDLGM+P CV PV+ +LG++GL IQRMPS+  ++F  P+E
Sbjct  717  QVALQRLPLIKKCTSMLVCGEDLGMVPKCVEPVLHDLGILGLRIQRMPSDSNKDFYHPNE  776

Query  394  YSYMTVCAPSCHDCSTLRAWWEEDEGRRRRYFQTVVGSGAVPPDECTPEIARFVLRKHVE  573
            YSY+TV   S HD STLR WWEED  R + ++  ++G     P  C P ++  V+ +H+ 
Sbjct  777  YSYLTVNTTSSHDMSTLRGWWEEDRARAQVFYNRILGMFGDAPYFCEPYVSEAVIAQHLH  836

Query  574  SPSMWSIFPLQDLLALKEDYATRPAVEETINDPTXPRHYWRYRMHVTMESLLND  735
            S SM SIFPLQD   L  +Y  R   EE IN+P+ P HYWRYR+HV +E L+ D
Sbjct  837  SSSMISIFPLQDWFGLSTEYGKRDPKEEKINEPSNPMHYWRYRVHVNLEDLIED  890



>ref|XP_007028196.1| 4-alpha-glucanotransferase isoform 4, partial [Theobroma cacao]
 gb|EOY08698.1| 4-alpha-glucanotransferase isoform 4, partial [Theobroma cacao]
Length=807

 Score =   247 bits (630),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 115/142 (81%), Positives = 127/142 (89%), Gaps = 0/142 (0%)
 Frame = +1

Query  7    ENEEKLRRNLFDLLQEVVLIRDREDPRKFYPRFNLEDTSSFKGLDQHSKNVLKRLYYDYY  186
            E+E+K+R +LFDLL+ +VLIRD E  R FYPRFNLEDTSSF+ LD HSKNVLKRLYYDYY
Sbjct  666  ESEDKIRHDLFDLLKNIVLIRDPEYARNFYPRFNLEDTSSFRDLDDHSKNVLKRLYYDYY  725

Query  187  FHRQESLWRQNALNTLPVLMNSSDMLTCGEDLGMIPACVNPVMQELGLIGLHIQRMPSEP  366
            FHRQE LW+QNAL TLPVL+NSSDML CGEDLG+IPACV+PVMQELGLIGL IQRMPSEP
Sbjct  726  FHRQEKLWQQNALKTLPVLLNSSDMLACGEDLGLIPACVHPVMQELGLIGLRIQRMPSEP  785

Query  367  GREFGIPSEYSYMTVCAPSCHD  432
              EFG PS+YSYMTVCAPSCHD
Sbjct  786  DLEFGFPSQYSYMTVCAPSCHD  807



>gb|EFA84397.1| 4-alpha-glucanotransferase [Polysphondylium pallidum PN500]
Length=1070

 Score =   248 bits (633),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 112/232 (48%), Positives = 152/232 (66%), Gaps = 0/232 (0%)
 Frame = +1

Query  34   LFDLLQEVVLIRDREDPRKFYPRFNLEDTSSFKGLDQHSKNVLKRLYYDYYFHRQESLWR  213
            L  L+Q V L++D+ED  +FYPR  +  TSS+  L    KN L RLY  YYF RQE LW 
Sbjct  687  LLKLVQNVCLVKDKEDEHRFYPRIEITKTSSYNELSDDLKNTLYRLYISYYFERQEELWS  746

Query  214  QNALNTLPVLMNSSDMLTCGEDLGMIPACVNPVMQELGLIGLHIQRMPSEPGREFGIPSE  393
            Q  L  LP++   ++ML CGEDLGM+P CV PV+++LG++GL IQRMP++  +EF +PSE
Sbjct  747  QIGLQRLPLIKGCTNMLVCGEDLGMVPKCVEPVLKDLGILGLRIQRMPADSTKEFYVPSE  806

Query  394  YSYMTVCAPSCHDCSTLRAWWEEDEGRRRRYFQTVVGSGAVPPDECTPEIARFVLRKHVE  573
            YSY+TV   S HD STLR WWEED  R + ++  ++G     P  C P +   V+ +H++
Sbjct  807  YSYLTVNTTSSHDMSTLRGWWEEDRPRSQNFYNNILGMYGEAPYFCEPYVTEAVITQHLQ  866

Query  574  SPSMWSIFPLQDLLALKEDYATRPAVEETINDPTXPRHYWRYRMHVTMESLL  729
            S SM SIFPLQD   L  + + R   EE IN+P+ P HYW+YR+ + +E LL
Sbjct  867  SQSMMSIFPLQDWFGLSSELSQRDPKEERINEPSNPFHYWQYRIQINIEDLL  918



>ref|XP_001701179.1| 4-alpha-glucanotransferase [Chlamydomonas reinhardtii]
 gb|EDO97689.1| 4-alpha-glucanotransferase, partial [Chlamydomonas reinhardtii]
Length=941

 Score =   247 bits (631),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 123/246 (50%), Positives = 166/246 (67%), Gaps = 2/246 (1%)
 Frame = +1

Query  1    FVENEEKLRRNLFDLLQEVVLIRDREDPRKFYPRFNLEDTSSFKGLDQHSKNVLKRLYYD  180
             V   E+ R  L  L Q VVL+ D EDP  F+PRF L  TSS+  L    +  L+ ++ D
Sbjct  690  LVREVEETRAGLMRLRQNVVLLADPEDPEAFHPRFGLMGTSSYAALPAPWRATLRHMHDD  749

Query  181  YYFHRQESLWRQNALNTLPVLMNSSDMLTCGEDLGMIPACVNPVMQELGLIGLHIQRMPS  360
            Y++ RQE +WR +A++ LP L  ++DML CGEDLG +P CV PVM+ELGL+GL IQRM +
Sbjct  750  YFYRRQEDVWRTSAMSKLPALQAATDMLVCGEDLGFVPTCVPPVMKELGLLGLRIQRMAT  809

Query  361  EPGREFGIPSEYSYMTVCAPSCHDCSTLRAWWEEDEGRRRRYFQTVVGSGAVPPDECTPE  540
            E  +EF  P+ Y Y+TV +PSCHD + LRAWW + E R  R++   +G    PP  C P 
Sbjct  810  ERDKEFNNPAAYPYLTVASPSCHDVTPLRAWWSDPE-RAERFYYHQLGGCGPPPPTCGPN  868

Query  541  IARFVLRKHVESPSMWSIFPLQDLLALKEDYAT-RPAVEETINDPTXPRHYWRYRMHVTM  717
            + R VL++H+  PSM +IFPLQDL+AL  +YA+ RP+ EE INDPT P+HYWR+R+H  +
Sbjct  869  VVRAVLQQHINCPSMLTIFPLQDLMALSSEYASQRPSQEEVINDPTVPKHYWRFRIHTPL  928

Query  718  ESLLND  735
            E+LL D
Sbjct  929  EALLAD  934



>ref|WP_022391417.1| putative 4-alpha-glucanotransferase [Bacteroides intestinalis 
CAG:315]
 emb|CDD94892.1| putative 4-alpha-glucanotransferase [Bacteroides intestinalis 
CAG:315]
Length=325

 Score =   233 bits (593),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 110/241 (46%), Positives = 147/241 (61%), Gaps = 0/241 (0%)
 Frame = +1

Query  22   LRRNLFDLLQEVVLIRDREDPRKFYPRFNLEDTSSFKGLDQHSKNVLKRLYYDYYFHRQE  201
            +R  L+ L+ +V+ + DREDP KF+PR  ++    ++ L+   K    RLY  YY+HR  
Sbjct  70   IRDGLYALISDVLFVPDREDPNKFHPRIGVQHDYIYRALNDWEKAAFNRLYDQYYYHRHN  129

Query  202  SLWRQNALNTLPVLMNSSDMLTCGEDLGMIPACVNPVMQELGLIGLHIQRMPSEPGREFG  381
              WR+ A+  LP L  S+ ML CGEDLGMIP CV  VM +L ++ L IQRMP +P +EFG
Sbjct  130  EFWREQAMKKLPQLTQSTRMLVCGEDLGMIPDCVAWVMNDLRILSLEIQRMPKDPSQEFG  189

Query  382  IPSEYSYMTVCAPSCHDCSTLRAWWEEDEGRRRRYFQTVVGSGAVPPDECTPEIARFVLR  561
             P  Y Y +VC  S HD STLR WWEED  + +RY+ T++G     P   TPE+   V+R
Sbjct  190  HPDWYPYRSVCTISTHDMSTLRGWWEEDFQQTQRYYNTMLGHYGAAPAVATPELCEQVVR  249

Query  562  KHVESPSMWSIFPLQDLLALKEDYATRPAVEETINDPTXPRHYWRYRMHVTMESLLNDKS  741
             H+ S S+  I  LQD +A+   +      EE IN P  PRHYWRYRMH+T+E L+   S
Sbjct  250  NHLYSNSILCILSLQDWMAMDGKWRNPNVQEERINVPANPRHYWRYRMHLTLEQLMKADS  309

Query  742  L  744
            L
Sbjct  310  L  310



>ref|XP_004359265.1| 4-alpha-glucanotransferase [Dictyostelium fasciculatum]
 gb|EGG21415.1| 4-alpha-glucanotransferase [Dictyostelium fasciculatum]
Length=919

 Score =   243 bits (620),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 111/246 (45%), Positives = 155/246 (63%), Gaps = 0/246 (0%)
 Frame = +1

Query  7    ENEEKLRRNLFDLLQEVVLIRDREDPRKFYPRFNLEDTSSFKGLDQHSKNVLKRLYYDYY  186
            ++++  +  L  L+Q V L++D++D  ++YPR  +  T+SF  L    K  L R+Y  YY
Sbjct  654  KDDQMYKPGLLKLVQNVSLLKDQDDENRYYPRIEINKTTSFNELSDDLKATLYRMYISYY  713

Query  187  FHRQESLWRQNALNTLPVLMNSSDMLTCGEDLGMIPACVNPVMQELGLIGLHIQRMPSEP  366
            F RQE LW Q  +  LP + + + ML CGEDLGM+P CV P ++ LG++GL IQRMPSE 
Sbjct  714  FERQEELWTQIGMQRLPAIRDCTRMLVCGEDLGMVPKCVEPTLKNLGILGLRIQRMPSES  773

Query  367  GREFGIPSEYSYMTVCAPSCHDCSTLRAWWEEDEGRRRRYFQTVVGSGAVPPDECTPEIA  546
             +EF  PSEYSY+TV   S HD STLR WWEED  R + ++  ++G     P  C P + 
Sbjct  774  AKEFYHPSEYSYLTVNTTSSHDMSTLRGWWEEDRTRSQNFYNNILGMYGEAPYFCEPYVT  833

Query  547  RFVLRKHVESPSMWSIFPLQDLLALKEDYATRPAVEETINDPTXPRHYWRYRMHVTMESL  726
              V+ +H++S SM SIFPLQD   L  + ++R   EE IN+P+ P HYWRYR HV +E L
Sbjct  834  EAVIVQHLQSQSMISIFPLQDWFGLSSELSSRDPKEEKINEPSNPFHYWRYRCHVNLEDL  893

Query  727  LNDKSL  744
            L ++  
Sbjct  894  LENQEF  899



>ref|XP_002956849.1| cytosolic 4-alpha-glucanotransferase [Volvox carteri f. nagariensis]
 gb|EFJ42152.1| cytosolic 4-alpha-glucanotransferase [Volvox carteri f. nagariensis]
Length=995

 Score =   243 bits (620),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 119/246 (48%), Positives = 151/246 (61%), Gaps = 30/246 (12%)
 Frame = +1

Query  1    FVENEEKLRRNLFDLLQEVVLIRDREDPRKFYPRFNLEDTSSFKGLDQHSKNVLKRLYYD  180
             V   E+ R  L  L Q VVL+ D EDP  F+PR                          
Sbjct  731  LVREVEETRAGLIKLRQNVVLLPDPEDPDAFHPR--------------------------  764

Query  181  YYFHRQESLWRQNALNTLPVLMNSSDMLTCGEDLGMIPACVNPVMQELGLIGLHIQRMPS  360
                RQE +WR +AL+ LP L  +SDML CGEDLG +PACV PVM+ELGLIGL IQRM +
Sbjct  765  ----RQEDVWRSSALSKLPALQAASDMLVCGEDLGFVPACVPPVMKELGLIGLRIQRMAT  820

Query  361  EPGREFGIPSEYSYMTVCAPSCHDCSTLRAWWEEDEGRRRRYFQTVVGSGAVPPDECTPE  540
            EPG+EF  P  Y+Y+TV +PSCHD + LRAW+E D  R  R++   +G    PP  CTP+
Sbjct  821  EPGKEFNNPGTYTYLTVASPSCHDVTPLRAWYESDPDRAERFYYHQLGGCGPPPPVCTPD  880

Query  541  IARFVLRKHVESPSMWSIFPLQDLLALKEDYATRPAVEETINDPTXPRHYWRYRMHVTME  720
            + R VL++H+   SM ++FP+QDL AL   Y TRPA  E INDPT  +HYWR+R+HVT+E
Sbjct  881  VVRAVLQQHINCGSMLAVFPIQDLTALSLQYTTRPASAEVINDPTVSKHYWRFRIHVTLE  940

Query  721  SLLNDK  738
            +LL D 
Sbjct  941  TLLADS  946



>ref|WP_026259966.1| 4-alpha-glucanotransferase [Segetibacter koreensis]
Length=897

 Score =   239 bits (609),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 108/245 (44%), Positives = 159/245 (65%), Gaps = 1/245 (0%)
 Frame = +1

Query  4    VENEEKLRRNLFDLLQEVVLIRDRE-DPRKFYPRFNLEDTSSFKGLDQHSKNVLKRLYYD  180
             E  +K++  LFDL+  V+L    E + ++F+ R ++  T S++ LD H++ +LK LY +
Sbjct  637  TEQNKKIKLGLFDLISNVILFEVEESEGQEFHFRIDMASTPSYRHLDGHTQYLLKELYVN  696

Query  181  YYFHRQESLWRQNALNTLPVLMNSSDMLTCGEDLGMIPACVNPVMQELGLIGLHIQRMPS  360
            YY+ RQ+  W++ A+  LP L +S++ML CGEDLGM+P CV  VM+EL ++ L IQRMP 
Sbjct  697  YYYRRQDDFWKKEAMLKLPALKHSTNMLICGEDLGMVPECVPGVMKELAILSLEIQRMPK  756

Query  361  EPGREFGIPSEYSYMTVCAPSCHDCSTLRAWWEEDEGRRRRYFQTVVGSGAVPPDECTPE  540
            +P REF  P++  Y++V  PS HD ST+R WWEED    +R+F   +G     P  C P 
Sbjct  757  DPTREFFHPNDAPYLSVVTPSTHDMSTIRGWWEEDRAATQRFFNNELGQWGTAPFFCEPW  816

Query  541  IARFVLRKHVESPSMWSIFPLQDLLALKEDYATRPAVEETINDPTXPRHYWRYRMHVTME  720
            I + +L +H+ SP+MWSIF LQDLL +          EE IN P  P+HYW YRMH+++E
Sbjct  817  INKIILLQHLYSPAMWSIFQLQDLLGINGSLRRENPNEERINIPADPKHYWNYRMHLSLE  876

Query  721  SLLND  735
            +L+N+
Sbjct  877  NLINE  881



>ref|WP_014218816.1| 4-alpha-glucanotransferase [Niastella koreensis]
 gb|AEV98902.1| 4-alpha-glucanotransferase [Niastella koreensis GR20-10]
Length=895

 Score =   239 bits (609),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 109/242 (45%), Positives = 157/242 (65%), Gaps = 1/242 (0%)
 Frame = +1

Query  7    ENEEKLRRNLFDLLQEVVLIRD-REDPRKFYPRFNLEDTSSFKGLDQHSKNVLKRLYYDY  183
            E  + LR+ L+DL+  V+L      + R+F+ R ++E+T+SFK L+ + ++ LK LY +Y
Sbjct  636  EENQHLRQGLYDLISNVILFEQPGSNGREFHFRISMENTTSFKHLEGYVQDRLKELYINY  695

Query  184  YFHRQESLWRQNALNTLPVLMNSSDMLTCGEDLGMIPACVNPVMQELGLIGLHIQRMPSE  363
            ++ RQE  W Q  L  LP L  S++ML CGEDLGM+P CV  VM++LG++ L IQRMP +
Sbjct  696  FYQRQEHFWMQEGLRKLPALKRSTNMLICGEDLGMVPQCVPVVMKQLGIVSLEIQRMPKD  755

Query  364  PGREFGIPSEYSYMTVCAPSCHDCSTLRAWWEEDEGRRRRYFQTVVGSGAVPPDECTPEI  543
               EF  P++  Y++V  PS HD ST+R WWEED  + +R+F TV+G     P  C   I
Sbjct  756  IHSEFFHPAQAPYLSVVTPSTHDMSTIRGWWEEDRTKTQRFFNTVLGQWGEAPATCEAWI  815

Query  544  ARFVLRKHVESPSMWSIFPLQDLLALKEDYATRPAVEETINDPTXPRHYWRYRMHVTMES  723
             + ++ +H++SP+MW+ F LQDLL + E        EE IN P  P+HYWRYRMH+T+E 
Sbjct  816  NKAIVIQHLQSPAMWATFQLQDLLGMNETLRRENPAEERINIPAIPKHYWRYRMHLTLEQ  875

Query  724  LL  729
            LL
Sbjct  876  LL  877



>ref|WP_007210299.1| hypothetical protein, partial [Bacteroides cellulosilyticus]
 gb|EEF91445.1| 4-alpha-glucanotransferase, partial [Bacteroides cellulosilyticus 
DSM 14838]
Length=567

 Score =   233 bits (595),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 110/241 (46%), Positives = 148/241 (61%), Gaps = 0/241 (0%)
 Frame = +1

Query  22   LRRNLFDLLQEVVLIRDREDPRKFYPRFNLEDTSSFKGLDQHSKNVLKRLYYDYYFHRQE  201
            +R  L+ L+ +V+ + DREDP KF+PR  ++    ++ L+   K    RLY  YY+HR  
Sbjct  312  IRDGLYALISDVLFVPDREDPHKFHPRIGVQHDYIYRALNDWEKAAFNRLYDQYYYHRHN  371

Query  202  SLWRQNALNTLPVLMNSSDMLTCGEDLGMIPACVNPVMQELGLIGLHIQRMPSEPGREFG  381
              WR+ A+  LP L  S+ ML CGEDLGMIP CV  VM +L ++ L IQRMP +P +EFG
Sbjct  372  EFWREQAMKKLPQLTQSTRMLVCGEDLGMIPDCVAWVMNDLRILSLEIQRMPKDPSQEFG  431

Query  382  IPSEYSYMTVCAPSCHDCSTLRAWWEEDEGRRRRYFQTVVGSGAVPPDECTPEIARFVLR  561
             P  Y Y +VC  S HD STLR WWEED  + +RY+ T++G     P   TPE+   V+R
Sbjct  432  HPDWYPYRSVCTISTHDMSTLRGWWEEDFQQTQRYYNTMLGHYGAAPAVATPELCEQVVR  491

Query  562  KHVESPSMWSIFPLQDLLALKEDYATRPAVEETINDPTXPRHYWRYRMHVTMESLLNDKS  741
             H+ S S+  I  LQD +A+   +      EE IN P  PRHYWRYRMH+T+E L+  +S
Sbjct  492  NHLYSNSILCILSLQDWMAMDGKWRNPNVQEERINVPANPRHYWRYRMHLTLEQLMKAES  551

Query  742  L  744
            L
Sbjct  552  L  552



>ref|WP_020530494.1| hypothetical protein [Flexithrix dorotheae]
Length=916

 Score =   238 bits (608),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 106/243 (44%), Positives = 157/243 (65%), Gaps = 1/243 (0%)
 Frame = +1

Query  4    VENEEKLRRNLFDLLQEVVLI-RDREDPRKFYPRFNLEDTSSFKGLDQHSKNVLKRLYYD  180
            +  + +L++ LF LL EV+L+  +  D R + PR  +  T SFK LD H++ +L   Y D
Sbjct  652  ITQKHQLKKGLFKLLGEVLLLPVENSDGRLWNPRNAMHFTQSFKELDGHAQRILDEAYVD  711

Query  181  YYFHRQESLWRQNALNTLPVLMNSSDMLTCGEDLGMIPACVNPVMQELGLIGLHIQRMPS  360
            Y++HR    W++ A+  LP L  +++ML CGEDLGM+PACV  VM ELG + L IQRMP+
Sbjct  712  YFYHRHNDFWKEKAMVKLPALKAATNMLICGEDLGMVPACVPGVMDELGFLSLAIQRMPN  771

Query  361  EPGREFGIPSEYSYMTVCAPSCHDCSTLRAWWEEDEGRRRRYFQTVVGSGAVPPDECTPE  540
                EFG P E  Y++VC+PS HD S +R WWEED  + +RYF  V+G     P E  P 
Sbjct  772  NSDLEFGKPWENPYLSVCSPSTHDMSNIRGWWEEDANKTQRYFNQVMGQHGEAPKEGEPW  831

Query  541  IARFVLRKHVESPSMWSIFPLQDLLALKEDYATRPAVEETINDPTXPRHYWRYRMHVTME  720
            + + ++ +H+ S SMW++FP+QDLLA+  +   +  ++E IN P+ P+HYW+YR H+ +E
Sbjct  832  VCQEIVLQHLHSSSMWAVFPIQDLLAISAELRRKNHLKEQINVPSNPKHYWKYRFHLNLE  891

Query  721  SLL  729
             L+
Sbjct  892  ELI  894



>ref|WP_039129341.1| 4-alpha-glucanotransferase [Flavihumibacter sp. ZG627]
 gb|KIC91846.1| 4-alpha-glucanotransferase [Flavihumibacter sp. ZG627]
Length=896

 Score =   238 bits (606),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 112/254 (44%), Positives = 162/254 (64%), Gaps = 6/254 (2%)
 Frame = +1

Query  1    FVENEEK-----LRRNLFDLLQEVVLIRDR-EDPRKFYPRFNLEDTSSFKGLDQHSKNVL  162
            F+ +E+K     L++ L DL   V+L  +   + +KF+ RF +E TSS++ L+ ++K  L
Sbjct  629  FLAHEDKDHLQGLKQGLLDLHTNVILFEEAGSEGKKFHFRFAMEHTSSYQDLEWNTKEQL  688

Query  163  KRLYYDYYFHRQESLWRQNALNTLPVLMNSSDMLTCGEDLGMIPACVNPVMQELGLIGLH  342
            K LY DY++ RQ+  W Q A+N LP L  S++ML CGEDLGM+PACV  VM+ LG++ L 
Sbjct  689  KALYVDYFYRRQDDFWMQEAMNKLPALKASTNMLICGEDLGMVPACVPDVMRHLGILSLE  748

Query  343  IQRMPSEPGREFGIPSEYSYMTVCAPSCHDCSTLRAWWEEDEGRRRRYFQTVVGSGAVPP  522
            IQRMP +P  EF  P+   Y++V  PS HD ST+R WWEED  + +R+F   +G     P
Sbjct  749  IQRMPKDPAHEFFHPNNAPYLSVVTPSTHDMSTIRGWWEEDREKTQRFFNNELGQWGEAP  808

Query  523  DECTPEIARFVLRKHVESPSMWSIFPLQDLLALKEDYATRPAVEETINDPTXPRHYWRYR  702
              C   I + ++ +H+ SP+MW++F LQDL+ +  D       EE IN P+ P+HYWRYR
Sbjct  809  AFCEAWINKAIVIQHLYSPAMWAVFQLQDLMGVDGDLRRSDPSEERINIPSNPKHYWRYR  868

Query  703  MHVTMESLLNDKSL  744
            MH+T+E LL +K  
Sbjct  869  MHMTLEELLKEKEF  882



>ref|WP_005657332.1| 4-alpha-glucanotransferase [Bacteroides stercoris]
 gb|EDS14099.1| putative 4-alpha-glucanotransferase [Bacteroides stercoris ATCC 
43183]
Length=896

 Score =   238 bits (606),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 110/241 (46%), Positives = 152/241 (63%), Gaps = 0/241 (0%)
 Frame = +1

Query  22   LRRNLFDLLQEVVLIRDREDPRKFYPRFNLEDTSSFKGLDQHSKNVLKRLYYDYYFHRQE  201
            +R  L+ L+ +V+ + DR DP KF+PR  ++    ++ L+   K    RLY  YY+HR  
Sbjct  643  IRDGLYALISDVLFVPDRNDPYKFHPRIGVQHDYIYRSLNDWEKAAFNRLYDQYYYHRHN  702

Query  202  SLWRQNALNTLPVLMNSSDMLTCGEDLGMIPACVNPVMQELGLIGLHIQRMPSEPGREFG  381
              WR+ A+N LP L  S+ ML CGEDLGMIP CV  VM +L ++ L IQRMP +P +EFG
Sbjct  703  EFWREQAMNKLPQLTQSTRMLVCGEDLGMIPGCVAWVMNDLRILSLEIQRMPKDPAQEFG  762

Query  382  IPSEYSYMTVCAPSCHDCSTLRAWWEEDEGRRRRYFQTVVGSGAVPPDECTPEIARFVLR  561
             P  Y Y +VC  S HD STLR WWEED  + +RY+ T++G     P   TPE+   V+R
Sbjct  763  HPDWYPYRSVCTISTHDMSTLRGWWEEDFQQTQRYYNTMLGHYGAAPAVATPELCEEVVR  822

Query  562  KHVESPSMWSIFPLQDLLALKEDYATRPAVEETINDPTXPRHYWRYRMHVTMESLLNDKS  741
            KH++S S+ +I  LQD +++   +    A EE IN P  PRHYWR+RMH+T+E L+  +S
Sbjct  823  KHLQSNSILAILSLQDWMSMDGKWRNPNAQEERINVPANPRHYWRWRMHLTLEQLMKAES  882

Query  742  L  744
            L
Sbjct  883  L  883



>ref|WP_016661854.1| 4-alpha-glucanotransferase [Bacteroides stercoris]
 gb|EPH20148.1| 4-alpha-glucanotransferase [Bacteroides stercoris CC31F]
Length=896

 Score =   237 bits (605),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 110/241 (46%), Positives = 153/241 (63%), Gaps = 0/241 (0%)
 Frame = +1

Query  22   LRRNLFDLLQEVVLIRDREDPRKFYPRFNLEDTSSFKGLDQHSKNVLKRLYYDYYFHRQE  201
            +R  L+ L+ +V+ + DR DP K++PR  ++    ++ L+   K    RLY  YY+HR  
Sbjct  643  IRDGLYALISDVLFVPDRNDPYKYHPRIGVQHDYIYRSLNDWEKAAFNRLYDQYYYHRHN  702

Query  202  SLWRQNALNTLPVLMNSSDMLTCGEDLGMIPACVNPVMQELGLIGLHIQRMPSEPGREFG  381
              WR+ A+N LP L  S+ ML CGEDLGMIP CV  VM +L ++ L IQRMP +P +EFG
Sbjct  703  EFWREQAMNKLPQLTQSTRMLVCGEDLGMIPGCVAWVMNDLRILSLEIQRMPKDPTQEFG  762

Query  382  IPSEYSYMTVCAPSCHDCSTLRAWWEEDEGRRRRYFQTVVGSGAVPPDECTPEIARFVLR  561
             P  Y Y +VC  S HD STLR WWEED  + +RY+ T++G     P   TPE+   V+R
Sbjct  763  HPDWYPYRSVCTISTHDMSTLRGWWEEDFQQTQRYYNTMLGHYGAAPAVATPELCEEVVR  822

Query  562  KHVESPSMWSIFPLQDLLALKEDYATRPAVEETINDPTXPRHYWRYRMHVTMESLLNDKS  741
            KH++S S+ +I  LQD +++   +    A EE IN PT PRHYWR+RMH+T+E L+  +S
Sbjct  823  KHLQSNSILAILSLQDWMSMDGKWRNPNAQEERINVPTNPRHYWRWRMHLTLEQLMKAES  882

Query  742  L  744
            L
Sbjct  883  L  883



>ref|WP_022209830.1| 4-alpha-glucanotransferase [Bacteroides cellulosilyticus CAG:158]
 emb|CDB71355.1| 4-alpha-glucanotransferase [Bacteroides cellulosilyticus CAG:158]
Length=685

 Score =   234 bits (596),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 110/241 (46%), Positives = 148/241 (61%), Gaps = 0/241 (0%)
 Frame = +1

Query  22   LRRNLFDLLQEVVLIRDREDPRKFYPRFNLEDTSSFKGLDQHSKNVLKRLYYDYYFHRQE  201
            +R  L+ L+ +V+ + DREDP KF+PR  ++    ++ L+   K    RLY  YY+HR  
Sbjct  430  IRDGLYALISDVLFVPDREDPHKFHPRIGVQHDYIYRALNDWEKAAFNRLYDQYYYHRHN  489

Query  202  SLWRQNALNTLPVLMNSSDMLTCGEDLGMIPACVNPVMQELGLIGLHIQRMPSEPGREFG  381
              WR+ A+  LP L  S+ ML CGEDLGMIP CV  VM +L ++ L IQRMP +P +EFG
Sbjct  490  EFWREQAMKKLPQLTQSTRMLVCGEDLGMIPDCVAWVMNDLRILSLEIQRMPKDPSQEFG  549

Query  382  IPSEYSYMTVCAPSCHDCSTLRAWWEEDEGRRRRYFQTVVGSGAVPPDECTPEIARFVLR  561
             P  Y Y +VC  S HD STLR WWEED  + +RY+ T++G     P   TPE+   V+R
Sbjct  550  HPDWYPYRSVCTISTHDMSTLRGWWEEDFQQTQRYYNTMLGHYGAAPAVATPELCEQVVR  609

Query  562  KHVESPSMWSIFPLQDLLALKEDYATRPAVEETINDPTXPRHYWRYRMHVTMESLLNDKS  741
             H+ S S+  I  LQD +A+   +      EE IN P  PRHYWRYRMH+T+E L+  +S
Sbjct  610  NHLYSNSILCILSLQDWMAMDGKWRNPNVQEERINVPANPRHYWRYRMHLTLEQLMKAES  669

Query  742  L  744
            L
Sbjct  670  L  670



>ref|WP_022103310.1| putative 4-alpha-glucanotransferase [Bacteroides stercoris CAG:120]
 emb|CDA49723.1| putative 4-alpha-glucanotransferase [Bacteroides stercoris CAG:120]
Length=896

 Score =   236 bits (603),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 109/241 (45%), Positives = 152/241 (63%), Gaps = 0/241 (0%)
 Frame = +1

Query  22   LRRNLFDLLQEVVLIRDREDPRKFYPRFNLEDTSSFKGLDQHSKNVLKRLYYDYYFHRQE  201
            +R  L+ L+ +V+ + DR DP K++PR  ++    ++ L+   K    RLY  YY+HR  
Sbjct  643  IRDGLYALISDVLFVPDRNDPYKYHPRIGVQHDYIYRSLNDWEKAAFNRLYDQYYYHRHN  702

Query  202  SLWRQNALNTLPVLMNSSDMLTCGEDLGMIPACVNPVMQELGLIGLHIQRMPSEPGREFG  381
              WR+ A+N LP L  S+ ML CGEDLGMIP CV  VM +L ++ L IQRMP +P +EFG
Sbjct  703  EFWREQAMNKLPQLTQSTRMLVCGEDLGMIPGCVAWVMNDLRILSLEIQRMPKDPAQEFG  762

Query  382  IPSEYSYMTVCAPSCHDCSTLRAWWEEDEGRRRRYFQTVVGSGAVPPDECTPEIARFVLR  561
             P  Y Y +VC  S HD STLR WWEED  + +RY+ T++G     P   TPE+   V+R
Sbjct  763  HPDWYPYRSVCTISTHDMSTLRGWWEEDFQQTQRYYNTMLGHYGAAPAVATPELCEEVVR  822

Query  562  KHVESPSMWSIFPLQDLLALKEDYATRPAVEETINDPTXPRHYWRYRMHVTMESLLNDKS  741
            KH++S S+ +I  LQD +++   +    A EE IN P  PRHYWR+RMH+T+E L+  +S
Sbjct  823  KHLQSNSILAILSLQDWMSMDGKWRNPNAQEERINVPANPRHYWRWRMHLTLEQLMKAES  882

Query  742  L  744
            L
Sbjct  883  L  883



>ref|WP_029737177.1| 4-alpha-glucanotransferase, partial [Chitinophagaceae bacterium 
JGI 0001013-J17]
Length=751

 Score =   234 bits (598),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 105/242 (43%), Positives = 159/242 (66%), Gaps = 1/242 (0%)
 Frame = +1

Query  7    ENEEKLRRNLFDLLQEVVLIRDRE-DPRKFYPRFNLEDTSSFKGLDQHSKNVLKRLYYDY  183
            ++ + L+++L  LL  V+L   ++ + ++F+ RF +E T S+K LD H++ +LK LY +Y
Sbjct  491  QHNKWLKQSLLGLLSNVILFEAKDSNGQQFHFRFGMETTISYKLLDAHTQYLLKELYVNY  550

Query  184  YFHRQESLWRQNALNTLPVLMNSSDMLTCGEDLGMIPACVNPVMQELGLIGLHIQRMPSE  363
            +F RQ++ W+  A+  LP L   ++ML CGEDLG++PACV  VM++LG++ L IQRMP +
Sbjct  551  FFRRQDNFWQIEAMQKLPGLKRVTNMLVCGEDLGLVPACVPDVMKQLGILSLEIQRMPKD  610

Query  364  PGREFGIPSEYSYMTVCAPSCHDCSTLRAWWEEDEGRRRRYFQTVVGSGAVPPDECTPEI  543
              +EF  P +  Y++V  PS HD STLRAWWEED  + +R++  V+G     P  C   +
Sbjct  611  SSQEFSHPGKAPYLSVVTPSTHDMSTLRAWWEEDRAKSQRFYNQVMGENGYAPYLCDAWV  670

Query  544  ARFVLRKHVESPSMWSIFPLQDLLALKEDYATRPAVEETINDPTXPRHYWRYRMHVTMES  723
             + ++ +H+ SP+MWSIF +QDLL +          EE IN P  PRHYWRYRMH+++E 
Sbjct  671  NKAIVLQHLHSPAMWSIFQVQDLLGINAKIRRDDPFEERINVPANPRHYWRYRMHISLED  730

Query  724  LL  729
            LL
Sbjct  731  LL  732



>ref|WP_021940588.1| 4-alpha-glucanotransferase [Bacteroides eggerthii CAG:109]
 emb|CCY55974.1| 4-alpha-glucanotransferase [Bacteroides eggerthii CAG:109]
Length=896

 Score =   236 bits (602),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 109/241 (45%), Positives = 153/241 (63%), Gaps = 0/241 (0%)
 Frame = +1

Query  22   LRRNLFDLLQEVVLIRDREDPRKFYPRFNLEDTSSFKGLDQHSKNVLKRLYYDYYFHRQE  201
            +R  L+ L+ +V+ + DR DP K++PR  ++    ++ L+   K+   RLY  YY+HR  
Sbjct  643  VRDGLYALISDVLFVPDRHDPYKYHPRIGVQHDYVYRSLNDWEKSAFNRLYDHYYYHRHN  702

Query  202  SLWRQNALNTLPVLMNSSDMLTCGEDLGMIPACVNPVMQELGLIGLHIQRMPSEPGREFG  381
              WR+ A+N LP L  S+ ML CGEDLGMIP CV  VM +L ++ L IQRMP +P +EFG
Sbjct  703  EFWREQAMNKLPQLTQSTRMLVCGEDLGMIPDCVAWVMNDLRILSLEIQRMPKDPAQEFG  762

Query  382  IPSEYSYMTVCAPSCHDCSTLRAWWEEDEGRRRRYFQTVVGSGAVPPDECTPEIARFVLR  561
             P  Y Y +VC  S HD STLR WWEED  + +RY+ T++G     P   TPE+   V+R
Sbjct  763  HPEWYPYRSVCTISTHDMSTLRGWWEEDFQQTQRYYNTMLGHYGAAPATATPELCEEVVR  822

Query  562  KHVESPSMWSIFPLQDLLALKEDYATRPAVEETINDPTXPRHYWRYRMHVTMESLLNDKS  741
            KH++S S+ +I  LQD +++   +    A EE IN P  PRHYWR+RMH+T+E L+  +S
Sbjct  823  KHLQSNSILAILSLQDWMSMDGKWRNPNAQEERINVPANPRHYWRWRMHLTLEQLMKAES  882

Query  742  L  744
            L
Sbjct  883  L  883



>ref|WP_004294012.1| 4-alpha-glucanotransferase [Bacteroides eggerthii]
 gb|EFV29975.1| 4-alpha-glucanotransferase [Bacteroides eggerthii 1_2_48FAA]
Length=896

 Score =   236 bits (602),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 109/241 (45%), Positives = 153/241 (63%), Gaps = 0/241 (0%)
 Frame = +1

Query  22   LRRNLFDLLQEVVLIRDREDPRKFYPRFNLEDTSSFKGLDQHSKNVLKRLYYDYYFHRQE  201
            +R  L+ L+ +V+ + DR DP K++PR  ++    ++ L+   K+   RLY  YY+HR  
Sbjct  643  VRDGLYALISDVLFVPDRHDPYKYHPRIGVQHDYVYRSLNDWEKSAFNRLYDHYYYHRHN  702

Query  202  SLWRQNALNTLPVLMNSSDMLTCGEDLGMIPACVNPVMQELGLIGLHIQRMPSEPGREFG  381
              WR+ A+N LP L  S+ ML CGEDLGMIP CV  VM +L ++ L IQRMP +P +EFG
Sbjct  703  EFWREQAMNKLPQLTQSTRMLVCGEDLGMIPDCVAWVMNDLRILSLEIQRMPKDPAQEFG  762

Query  382  IPSEYSYMTVCAPSCHDCSTLRAWWEEDEGRRRRYFQTVVGSGAVPPDECTPEIARFVLR  561
             P  Y Y +VC  S HD STLR WWEED  + +RY+ T++G     P   TPE+   V+R
Sbjct  763  HPEWYPYRSVCTISTHDMSTLRGWWEEDFQQTQRYYNTMLGHYGAAPATATPELCEEVVR  822

Query  562  KHVESPSMWSIFPLQDLLALKEDYATRPAVEETINDPTXPRHYWRYRMHVTMESLLNDKS  741
            KH++S S+ +I  LQD +++   +    A EE IN P  PRHYWR+RMH+T+E L+  +S
Sbjct  823  KHLQSNSILAILSLQDWMSMDGKWRNPNAQEERINVPANPRHYWRWRMHLTLEQLMKAES  882

Query  742  L  744
            L
Sbjct  883  L  883



>ref|XP_007028195.1| Disproportionating enzyme 2 isoform 3 [Theobroma cacao]
 gb|EOY08697.1| Disproportionating enzyme 2 isoform 3 [Theobroma cacao]
Length=831

 Score =   235 bits (600),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 110/138 (80%), Positives = 122/138 (88%), Gaps = 0/138 (0%)
 Frame = +1

Query  7    ENEEKLRRNLFDLLQEVVLIRDREDPRKFYPRFNLEDTSSFKGLDQHSKNVLKRLYYDYY  186
            E+E+K+R +LFDLL+ +VLIRD E  R FYPRFNLEDTSSF+ LD HSKNVLKRLYYDYY
Sbjct  668  ESEDKIRHDLFDLLKNIVLIRDPEYARNFYPRFNLEDTSSFRDLDDHSKNVLKRLYYDYY  727

Query  187  FHRQESLWRQNALNTLPVLMNSSDMLTCGEDLGMIPACVNPVMQELGLIGLHIQRMPSEP  366
            FHRQE LW+QNAL TLPVL+NSSDML CGEDLG+IPACV+PVMQELGLIGL IQRMPSEP
Sbjct  728  FHRQEKLWQQNALKTLPVLLNSSDMLACGEDLGLIPACVHPVMQELGLIGLRIQRMPSEP  787

Query  367  GREFGIPSEYSYMTVCAP  420
              EFG PS+YSYMTVC P
Sbjct  788  DLEFGFPSQYSYMTVCVP  805



>ref|WP_019946818.1| hypothetical protein [Hymenobacter aerophilus]
Length=907

 Score =   236 bits (601),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 106/242 (44%), Positives = 156/242 (64%), Gaps = 1/242 (0%)
 Frame = +1

Query  22   LRRNLFDLLQEVVLIRDREDPRKFYPRFNLEDTSSFKGLDQHSKNVLKRLYYDYYFHRQE  201
            LR  LF L  EV+L+ D + P  ++PR  L  + SF+ L++ ++  L+ LY D+++ R E
Sbjct  650  LRAGLFGLANEVLLVPDDQQPDHYHPRITLTLSRSFRELNEATRPRLEALYNDFFYQRHE  709

Query  202  SLWRQNALNTLPVLMNSSDMLTCGEDLGMIPACVNPVMQELGLIGLHIQRMPSEPGREFG  381
              WR+  L  LP +  +++ML CGEDLGM+PA V  VM++LG++GLHIQRMP++P  EFG
Sbjct  710  GFWREQGLTKLPPVRWATNMLICGEDLGMVPASVPGVMKDLGILGLHIQRMPADPSTEFG  769

Query  382  IPSEYSYMTVCAPSCHDCSTLRAWWEEDEGRRRRYFQTVVG-SGAVPPDECTPEIARFVL  558
             P    Y++V +P  HD STLR WWEED  R +R+F+T++G      P  C P + R +L
Sbjct  770  HPDRAPYLSVVSPGSHDMSTLRGWWEEDPTRTQRFFETILGHHHEAAPFYCEPWVVREIL  829

Query  559  RKHVESPSMWSIFPLQDLLALKEDYATRPAVEETINDPTXPRHYWRYRMHVTMESLLNDK  738
             +H+ SP+MW+IFPLQD++AL  D   +    E IN P+ P H+W+YR H+ +E L+   
Sbjct  830  EQHLHSPAMWAIFPLQDIVALSADLRRQDPQAEQINVPSNPTHFWKYRFHLPLEELVGQA  889

Query  739  SL  744
              
Sbjct  890  GF  891



>ref|WP_004288457.1| 4-alpha-glucanotransferase [Bacteroides eggerthii]
 gb|EEC55533.1| putative 4-alpha-glucanotransferase [Bacteroides eggerthii DSM 
20697]
Length=896

 Score =   235 bits (599),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 109/241 (45%), Positives = 153/241 (63%), Gaps = 0/241 (0%)
 Frame = +1

Query  22   LRRNLFDLLQEVVLIRDREDPRKFYPRFNLEDTSSFKGLDQHSKNVLKRLYYDYYFHRQE  201
            +R  L+ L+ +V+ + DR DP K++PR  ++    ++ L+   K+   RLY  YY+HR  
Sbjct  643  VRDGLYALISDVLFVPDRHDPYKYHPRIGVQHDYVYRSLNDWEKSAFNRLYDHYYYHRHN  702

Query  202  SLWRQNALNTLPVLMNSSDMLTCGEDLGMIPACVNPVMQELGLIGLHIQRMPSEPGREFG  381
              WR+ A+N LP L  S+ ML CGEDLGMIP CV  VM +L ++ L IQRMP +P +EFG
Sbjct  703  EFWREQAMNKLPQLTQSTRMLVCGEDLGMIPDCVAWVMNDLRILSLEIQRMPKDPTQEFG  762

Query  382  IPSEYSYMTVCAPSCHDCSTLRAWWEEDEGRRRRYFQTVVGSGAVPPDECTPEIARFVLR  561
             P  Y Y +VC  S HD STLR WWEED  + +RY+ T++G     P   TPE+   V+R
Sbjct  763  HPEWYPYRSVCTISTHDMSTLRGWWEEDFQQTQRYYNTMLGHYGAAPATATPELCEEVVR  822

Query  562  KHVESPSMWSIFPLQDLLALKEDYATRPAVEETINDPTXPRHYWRYRMHVTMESLLNDKS  741
            KH++S S+ +I  LQD +++   +    A EE IN P  PRHYWR+RMH+T+E L+  +S
Sbjct  823  KHLQSNSILAILSLQDWMSMDGKWRNPNAQEERINVPANPRHYWRWRMHLTLEQLMKAES  882

Query  742  L  744
            L
Sbjct  883  L  883



>ref|WP_044266402.1| 4-alpha-glucanotransferase [Candidatus Bacteroides timonensis]
Length=899

 Score =   235 bits (599),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 110/241 (46%), Positives = 149/241 (62%), Gaps = 0/241 (0%)
 Frame = +1

Query  22   LRRNLFDLLQEVVLIRDREDPRKFYPRFNLEDTSSFKGLDQHSKNVLKRLYYDYYFHRQE  201
            +R  L+ L+ +V+ + DREDP KF+PR  ++    ++ L+   K    RLY  YY+HR  
Sbjct  644  IRDGLYALISDVLFVPDREDPHKFHPRIGVQHDYIYRALNDWEKAAFNRLYDQYYYHRHN  703

Query  202  SLWRQNALNTLPVLMNSSDMLTCGEDLGMIPACVNPVMQELGLIGLHIQRMPSEPGREFG  381
              WR+ A+  LP L  S+ ML CGEDLGMIP CV  VM +L ++ L IQRMP +P +EFG
Sbjct  704  EFWREQAMKKLPQLTQSTRMLVCGEDLGMIPDCVAWVMNDLRILSLEIQRMPKDPSQEFG  763

Query  382  IPSEYSYMTVCAPSCHDCSTLRAWWEEDEGRRRRYFQTVVGSGAVPPDECTPEIARFVLR  561
             P  Y Y +VC  S HD STLR WWEED  + +RY+ +++G     P   TPE+   V+R
Sbjct  764  HPDWYPYRSVCTISTHDMSTLRGWWEEDFQQTQRYYNSMLGHYGAAPAVATPELCEQVVR  823

Query  562  KHVESPSMWSIFPLQDLLALKEDYATRPAVEETINDPTXPRHYWRYRMHVTMESLLNDKS  741
             H+ S S+  I  LQD +A+ E +      EE IN P  PRHYWRYRMH+T+E L+  +S
Sbjct  824  NHLYSNSILCILSLQDWMAMDEKWRNPNVQEERINVPANPRHYWRYRMHLTLEQLMKAES  883

Query  742  L  744
            L
Sbjct  884  L  884



>ref|WP_025726017.1| MULTISPECIES: 4-alpha-glucanotransferase [Bacteroides]
Length=899

 Score =   234 bits (596),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 110/241 (46%), Positives = 148/241 (61%), Gaps = 0/241 (0%)
 Frame = +1

Query  22   LRRNLFDLLQEVVLIRDREDPRKFYPRFNLEDTSSFKGLDQHSKNVLKRLYYDYYFHRQE  201
            +R  L+ L+ +V+ + DREDP KF+PR  ++    ++ L+   K    RLY  YY+HR  
Sbjct  644  IRDGLYALISDVLFVPDREDPHKFHPRIGVQHDYIYRALNDWEKAAFNRLYDQYYYHRHN  703

Query  202  SLWRQNALNTLPVLMNSSDMLTCGEDLGMIPACVNPVMQELGLIGLHIQRMPSEPGREFG  381
              WR+ A+  LP L  S+ ML CGEDLGMIP CV  VM +L ++ L IQRMP +P +EFG
Sbjct  704  EFWREQAMKKLPQLTQSTRMLVCGEDLGMIPDCVAWVMNDLRILSLEIQRMPKDPSQEFG  763

Query  382  IPSEYSYMTVCAPSCHDCSTLRAWWEEDEGRRRRYFQTVVGSGAVPPDECTPEIARFVLR  561
             P  Y Y +VC  S HD STLR WWEED  + +RY+ T++G     P   TPE+   V+R
Sbjct  764  HPDWYPYRSVCTISTHDMSTLRGWWEEDFQQTQRYYNTMLGHYGAAPAVATPELCEQVVR  823

Query  562  KHVESPSMWSIFPLQDLLALKEDYATRPAVEETINDPTXPRHYWRYRMHVTMESLLNDKS  741
             H+ S S+  I  LQD +A+   +      EE IN P  PRHYWRYRMH+T+E L+  +S
Sbjct  824  NHLYSNSILCILSLQDWMAMDGKWRNPNVQEERINVPANPRHYWRYRMHLTLEQLMKAES  883

Query  742  L  744
            L
Sbjct  884  L  884



>ref|WP_037328071.1| 4-alpha-glucanotransferase [Sediminibacterium sp. OR43]
Length=899

 Score =   234 bits (596),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 108/242 (45%), Positives = 155/242 (64%), Gaps = 1/242 (0%)
 Frame = +1

Query  7    ENEEKLRRNLFDLLQEVVLIR-DREDPRKFYPRFNLEDTSSFKGLDQHSKNVLKRLYYDY  183
            E+ +K++  LFDL+  V+L   ++ D   F+ RF +E+TSS++ LD+ +K  L  LY DY
Sbjct  637  EHHQKVKTGLFDLISNVILFEAEQADGMHFHFRFGMENTSSYRHLDEQTKQALHELYIDY  696

Query  184  YFHRQESLWRQNALNTLPVLMNSSDMLTCGEDLGMIPACVNPVMQELGLIGLHIQRMPSE  363
            +F RQ+  W++ AL  LP L   ++ML CGEDLG++PACV  VM +LGL+ L IQRMP  
Sbjct  697  FFRRQDEFWKKEALLKLPALKRVTNMLVCGEDLGLVPACVPDVMHQLGLLSLEIQRMPKA  756

Query  364  PGREFGIPSEYSYMTVCAPSCHDCSTLRAWWEEDEGRRRRYFQTVVGSGAVPPDECTPEI  543
               +F  P +  Y++V  PS HD ST+R WWEED+   ++++   +      P  C P I
Sbjct  757  SHTKFFNPKDAPYLSVVTPSTHDMSTIRGWWEEDKTTIQQFYNEELEEPGTAPYYCEPWI  816

Query  544  ARFVLRKHVESPSMWSIFPLQDLLALKEDYATRPAVEETINDPTXPRHYWRYRMHVTMES  723
             + ++ +H+ SP+MWSIF LQD+L + E        EE IN P  PRHYW+YRMH+T+ES
Sbjct  817  NKAIVLQHLHSPAMWSIFQLQDILGISEQLRRENPGEERINVPANPRHYWQYRMHLTLES  876

Query  724  LL  729
            LL
Sbjct  877  LL  878



>ref|WP_018668757.1| 4-alpha-glucanotransferase [Bacteroides gallinarum]
Length=896

 Score =   233 bits (594),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 109/241 (45%), Positives = 150/241 (62%), Gaps = 0/241 (0%)
 Frame = +1

Query  22   LRRNLFDLLQEVVLIRDREDPRKFYPRFNLEDTSSFKGLDQHSKNVLKRLYYDYYFHRQE  201
            +R  L+ L+ +V+ + DR DP K++PR  ++    ++ L+   K    RLY  YY+HR  
Sbjct  643  VRDGLYALISDVLFVPDRNDPYKYHPRIGVQHDFIYRSLNDWEKAAFNRLYDQYYYHRHN  702

Query  202  SLWRQNALNTLPVLMNSSDMLTCGEDLGMIPACVNPVMQELGLIGLHIQRMPSEPGREFG  381
              WR+ A+N LP L  S+ ML CGEDLGMIP CV  VM +L ++ L IQRMP +P +EFG
Sbjct  703  EFWREQAMNKLPQLTQSTRMLVCGEDLGMIPGCVAWVMNDLRILSLEIQRMPKDPAQEFG  762

Query  382  IPSEYSYMTVCAPSCHDCSTLRAWWEEDEGRRRRYFQTVVGSGAVPPDECTPEIARFVLR  561
             P  Y Y +VC  S HD STLR WWEED  + +RY+ T++G   V P   TPE+   V+R
Sbjct  763  HPDWYPYRSVCTISTHDMSTLRGWWEEDFQQTQRYYNTMLGHYGVAPAVATPELCEEVVR  822

Query  562  KHVESPSMWSIFPLQDLLALKEDYATRPAVEETINDPTXPRHYWRYRMHVTMESLLNDKS  741
            KH+ S S+  I  LQD +++   +      EE IN P  PRHYWR+RMH+T+E L+  +S
Sbjct  823  KHLYSNSILCILSLQDWMSMDGKWRNPNVQEERINIPANPRHYWRWRMHLTLEQLMKAES  882

Query  742  L  744
            L
Sbjct  883  L  883



>ref|WP_025831715.1| 4-alpha-glucanotransferase [Bacteroides stercorirosoris]
Length=899

 Score =   233 bits (593),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 109/241 (45%), Positives = 146/241 (61%), Gaps = 0/241 (0%)
 Frame = +1

Query  22   LRRNLFDLLQEVVLIRDREDPRKFYPRFNLEDTSSFKGLDQHSKNVLKRLYYDYYFHRQE  201
            +R  L+ L+ +V+ + DREDP KF+PR  ++    ++ L+   K    RLY  YY+HR  
Sbjct  644  IRDGLYALISDVLFVSDREDPHKFHPRIGVQHDYIYRALNDWEKAAFNRLYDQYYYHRHN  703

Query  202  SLWRQNALNTLPVLMNSSDMLTCGEDLGMIPACVNPVMQELGLIGLHIQRMPSEPGREFG  381
              WR  A+  LP L  S+ ML CGEDLGMIP CV  VM +L ++ L IQRMP +P +EFG
Sbjct  704  DFWRDQAMKKLPQLTQSTRMLVCGEDLGMIPDCVAWVMNDLRILSLEIQRMPKDPSQEFG  763

Query  382  IPSEYSYMTVCAPSCHDCSTLRAWWEEDEGRRRRYFQTVVGSGAVPPDECTPEIARFVLR  561
             P  Y Y +VC  S HD STLR WWEED  + +RY+  ++G     P   TPE+   V+R
Sbjct  764  HPDWYPYRSVCTISTHDMSTLRGWWEEDFQQTQRYYNAILGHYGAAPAVATPELCEEVVR  823

Query  562  KHVESPSMWSIFPLQDLLALKEDYATRPAVEETINDPTXPRHYWRYRMHVTMESLLNDKS  741
             H+ S S+  I  LQD L++   +      EE IN P  PRHYWRYRMH+T+E L+  +S
Sbjct  824  NHLYSNSILCILSLQDWLSMDGKWRNPNVQEERINVPANPRHYWRYRMHLTLEQLMKAES  883

Query  742  L  744
            L
Sbjct  884  L  884



>ref|WP_037361958.1| 4-alpha-glucanotransferase [Sediminibacterium sp. OR53]
Length=899

 Score =   232 bits (592),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 107/241 (44%), Positives = 154/241 (64%), Gaps = 1/241 (0%)
 Frame = +1

Query  10   NEEKLRRNLFDLLQEVVLIR-DREDPRKFYPRFNLEDTSSFKGLDQHSKNVLKRLYYDYY  186
            + +K++  LFDL+  V+L   ++ D   F+ RF +E+TSS++ LD+ +K  L  LY DY+
Sbjct  638  HHQKVKTGLFDLISNVILFEAEQADGMHFHFRFGMENTSSYRHLDEQTKQALHELYIDYF  697

Query  187  FHRQESLWRQNALNTLPVLMNSSDMLTCGEDLGMIPACVNPVMQELGLIGLHIQRMPSEP  366
            F RQ+  W++ AL  LP L   ++ML CGEDLG++PACV  VM +LGL+ L IQRMP   
Sbjct  698  FRRQDEFWKKEALLKLPALKRVTNMLVCGEDLGLVPACVPDVMHQLGLLSLEIQRMPKAS  757

Query  367  GREFGIPSEYSYMTVCAPSCHDCSTLRAWWEEDEGRRRRYFQTVVGSGAVPPDECTPEIA  546
              +F  P +  Y++V  PS HD ST+R WWEED+   ++++   +      P  C P I 
Sbjct  758  HTKFFNPKDAPYLSVVTPSTHDMSTIRGWWEEDKTTIQQFYNEELEEPGTAPYYCEPWIN  817

Query  547  RFVLRKHVESPSMWSIFPLQDLLALKEDYATRPAVEETINDPTXPRHYWRYRMHVTMESL  726
            + ++ +H+ SP+MWSIF LQD+L + E        EE IN P  PRHYW+YRMH+T+ESL
Sbjct  818  KAIVLQHLHSPAMWSIFQLQDILGISEQLRRENPGEERINIPANPRHYWQYRMHLTLESL  877

Query  727  L  729
            L
Sbjct  878  L  878



>ref|WP_007218930.1| 4-alpha-glucanotransferase [Bacteroides cellulosilyticus]
 gb|EIY23750.1| 4-alpha-glucanotransferase [Bacteroides cellulosilyticus CL02T12C19]
Length=899

 Score =   232 bits (591),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 109/241 (45%), Positives = 147/241 (61%), Gaps = 0/241 (0%)
 Frame = +1

Query  22   LRRNLFDLLQEVVLIRDREDPRKFYPRFNLEDTSSFKGLDQHSKNVLKRLYYDYYFHRQE  201
            +R  L+ L+ +V+ + DREDP KF+P   ++    ++ L+   K    RLY  YY+HR  
Sbjct  644  IRDGLYALISDVLFVPDREDPHKFHPHIGVQHDYIYRALNDWEKAAFNRLYDQYYYHRHN  703

Query  202  SLWRQNALNTLPVLMNSSDMLTCGEDLGMIPACVNPVMQELGLIGLHIQRMPSEPGREFG  381
              WR+ A+  LP L  S+ ML CGEDLGMIP CV  VM +L ++ L IQRMP +P +EFG
Sbjct  704  EFWREQAMKKLPQLTQSTRMLVCGEDLGMIPDCVAWVMNDLRILSLEIQRMPKDPSQEFG  763

Query  382  IPSEYSYMTVCAPSCHDCSTLRAWWEEDEGRRRRYFQTVVGSGAVPPDECTPEIARFVLR  561
             P  Y Y +VC  S HD STLR WWEED  + +RY+ T++G     P   TPE+   V+R
Sbjct  764  HPDWYPYRSVCTISTHDMSTLRGWWEEDFQQTQRYYNTMLGHYGAAPAVATPELCEQVVR  823

Query  562  KHVESPSMWSIFPLQDLLALKEDYATRPAVEETINDPTXPRHYWRYRMHVTMESLLNDKS  741
             H+ S S+  I  LQD +A+   +      EE IN P  PRHYWRYRMH+T+E L+  +S
Sbjct  824  NHLYSNSILCILSLQDWMAMDGKWRNPNVQEERINVPANPRHYWRYRMHLTLEQLMKAES  883

Query  742  L  744
            L
Sbjct  884  L  884



>ref|WP_007660001.1| 4-alpha-glucanotransferase [Bacteroides intestinalis]
 gb|EDV07518.1| putative 4-alpha-glucanotransferase [Bacteroides intestinalis 
DSM 17393]
Length=899

 Score =   231 bits (590),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 109/241 (45%), Positives = 146/241 (61%), Gaps = 0/241 (0%)
 Frame = +1

Query  22   LRRNLFDLLQEVVLIRDREDPRKFYPRFNLEDTSSFKGLDQHSKNVLKRLYYDYYFHRQE  201
            +R  L+ L+ +V+ + DREDP KF+PR  ++    ++ L+   K    RLY  YY+HR  
Sbjct  644  IRDGLYALISDVLFVPDREDPHKFHPRIGVQHDYIYRALNDWEKAAFNRLYDQYYYHRHN  703

Query  202  SLWRQNALNTLPVLMNSSDMLTCGEDLGMIPACVNPVMQELGLIGLHIQRMPSEPGREFG  381
              WR+ A+  LP L  S+ ML CGEDLGMIP CV  VM +L ++ L IQRMP +P +EFG
Sbjct  704  EFWREQAMKKLPQLTQSTRMLVCGEDLGMIPDCVAWVMNDLRILSLEIQRMPKDPSQEFG  763

Query  382  IPSEYSYMTVCAPSCHDCSTLRAWWEEDEGRRRRYFQTVVGSGAVPPDECTPEIARFVLR  561
             P  Y Y +VC  S HD STLR WWEED  + +RY+  ++G     P   TPE+   V+R
Sbjct  764  HPDWYPYRSVCTISTHDMSTLRGWWEEDFQQTQRYYNAMLGHYGAAPAVATPELCEQVVR  823

Query  562  KHVESPSMWSIFPLQDLLALKEDYATRPAVEETINDPTXPRHYWRYRMHVTMESLLNDKS  741
             H+ S S+  I  LQD +A+   +      EE IN P  PRHYWRYRMH+T+E L+   S
Sbjct  824  NHLYSNSILCILSLQDWMAMDGKWRNPNVQEERINVPANPRHYWRYRMHLTLEQLMKADS  883

Query  742  L  744
            L
Sbjct  884  L  884



>ref|WP_044532847.1| 4-alpha-glucanotransferase [Bacteroides intestinalis]
Length=899

 Score =   231 bits (590),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 109/241 (45%), Positives = 146/241 (61%), Gaps = 0/241 (0%)
 Frame = +1

Query  22   LRRNLFDLLQEVVLIRDREDPRKFYPRFNLEDTSSFKGLDQHSKNVLKRLYYDYYFHRQE  201
            +R  L+ L+ +V+ + DREDP KF+PR  ++    ++ L+   K    RLY  YY+HR  
Sbjct  644  IRDGLYALISDVLFVPDREDPHKFHPRIGVQHDYIYRALNDWEKAAFNRLYDQYYYHRHN  703

Query  202  SLWRQNALNTLPVLMNSSDMLTCGEDLGMIPACVNPVMQELGLIGLHIQRMPSEPGREFG  381
              WR+ A+  LP L  S+ ML CGEDLGMIP CV  VM +L ++ L IQRMP +P +EFG
Sbjct  704  EFWREQAMKKLPQLTQSTRMLVCGEDLGMIPDCVAWVMNDLRILSLEIQRMPKDPSQEFG  763

Query  382  IPSEYSYMTVCAPSCHDCSTLRAWWEEDEGRRRRYFQTVVGSGAVPPDECTPEIARFVLR  561
             P  Y Y +VC  S HD STLR WWEED  + +RY+  ++G     P   TPE+   V+R
Sbjct  764  HPDWYPYRSVCTISTHDMSTLRGWWEEDFQQTQRYYNAMLGHYGAAPAVATPELCEQVVR  823

Query  562  KHVESPSMWSIFPLQDLLALKEDYATRPAVEETINDPTXPRHYWRYRMHVTMESLLNDKS  741
             H+ S S+  I  LQD +A+   +      EE IN P  PRHYWRYRMH+T+E L+   S
Sbjct  824  NHLYSNSILCILSLQDWMAMDGKWRNPNVQEERINVPANPRHYWRYRMHLTLEQLMKADS  883

Query  742  L  744
            L
Sbjct  884  L  884



>ref|WP_022082018.1| 4-alpha-glucanotransferase [Bacteroides sp. CAG:144]
 emb|CDA22497.1| 4-alpha-glucanotransferase [Bacteroides sp. CAG:144]
Length=830

 Score =   231 bits (589),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 111/241 (46%), Positives = 150/241 (62%), Gaps = 0/241 (0%)
 Frame = +1

Query  22   LRRNLFDLLQEVVLIRDREDPRKFYPRFNLEDTSSFKGLDQHSKNVLKRLYYDYYFHRQE  201
            ++  LF L  E++ +RD      ++PR N +DT SFK L    +   +RL+ D+Y+HR +
Sbjct  576  IKEGLFRLTDEILFVRDPYAAYAWHPRINAQDTYSFKDLPADMQRDFRRLHDDFYYHRHD  635

Query  202  SLWRQNALNTLPVLMNSSDMLTCGEDLGMIPACVNPVMQELGLIGLHIQRMPSEPGREFG  381
              WR  AL  LP L+ S+DML CGEDLGMIP CV  VM  L ++ L IQRMP EP  EFG
Sbjct  636  EFWRNEALKKLPALVLSTDMLVCGEDLGMIPHCVPDVMNRLQILSLEIQRMPKEPYCEFG  695

Query  382  IPSEYSYMTVCAPSCHDCSTLRAWWEEDEGRRRRYFQTVVGSGAVPPDECTPEIARFVLR  561
               +Y Y++VC  S HD S +R WWEED  + +RY+  V+      P++C P I + ++R
Sbjct  696  DTRKYPYLSVCTTSTHDMSGIRGWWEEDRSKTQRYYNVVLHREGEAPEQCPPYICQEIIR  755

Query  562  KHVESPSMWSIFPLQDLLALKEDYATRPAVEETINDPTXPRHYWRYRMHVTMESLLNDKS  741
            +H+ESPSM  I PLQD L++  D        E IN P+ PR+YWRYRMH+T+ESLL    
Sbjct  756  QHLESPSMLVILPLQDWLSVNLDVRVPDPSVERINVPSDPRNYWRYRMHLTLESLLRQDK  815

Query  742  L  744
            L
Sbjct  816  L  816



>ref|WP_009130629.1| 4-alpha-glucanotransferase [Bacteroides oleiciplenus]
 gb|EKU89655.1| 4-alpha-glucanotransferase [Bacteroides oleiciplenus YIT 12058]
Length=899

 Score =   231 bits (590),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 109/241 (45%), Positives = 146/241 (61%), Gaps = 0/241 (0%)
 Frame = +1

Query  22   LRRNLFDLLQEVVLIRDREDPRKFYPRFNLEDTSSFKGLDQHSKNVLKRLYYDYYFHRQE  201
            +R  L+ L+  V+ + DREDP KF+PR  ++    ++ L+   K    RLY  YY+HR  
Sbjct  644  IRDGLYALISNVLFVPDREDPNKFHPRIGVQHDYIYRALNDWDKAAFNRLYDQYYYHRHN  703

Query  202  SLWRQNALNTLPVLMNSSDMLTCGEDLGMIPACVNPVMQELGLIGLHIQRMPSEPGREFG  381
              WR  A+  LP L  S+ ML CGEDLGMIP CV  VM +L ++ L IQRMP +P +EFG
Sbjct  704  DFWRDQAMKKLPQLTQSTRMLVCGEDLGMIPDCVAWVMNDLRILSLEIQRMPKDPSQEFG  763

Query  382  IPSEYSYMTVCAPSCHDCSTLRAWWEEDEGRRRRYFQTVVGSGAVPPDECTPEIARFVLR  561
             P  Y Y +VC  S HD STLR WWEED  + +RY+ +++G     P   TPE+   V+R
Sbjct  764  HPDWYPYRSVCTISTHDMSTLRGWWEEDFQQTQRYYNSILGHYGTAPAFATPELCEEVVR  823

Query  562  KHVESPSMWSIFPLQDLLALKEDYATRPAVEETINDPTXPRHYWRYRMHVTMESLLNDKS  741
             H+ S S+  I  LQD +A+   +      EE IN P  PRHYWRYRMH+T+E L+  +S
Sbjct  824  AHLYSNSILCILSLQDWMAMDGKWRNPNVQEERINVPANPRHYWRYRMHLTLEQLMKAES  883

Query  742  L  744
            L
Sbjct  884  L  884



>gb|EFV25987.1| 4-alpha-glucanotransferase [Bacteroides sp. 4_1_36]
Length=333

 Score =   220 bits (561),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 103/241 (43%), Positives = 145/241 (60%), Gaps = 0/241 (0%)
 Frame = +1

Query  22   LRRNLFDLLQEVVLIRDREDPRKFYPRFNLEDTSSFKGLDQHSKNVLKRLYYDYYFHRQE  201
            +R  L+ L+ +V+ + DR +P +++PR  ++    ++ L+   K    RLY  YY+HR  
Sbjct  80   IRDGLYALISDVLFVPDRNNPHEYHPRIGVQHDYIYRALNDWEKAAFNRLYDQYYYHRHN  139

Query  202  SLWRQNALNTLPVLMNSSDMLTCGEDLGMIPACVNPVMQELGLIGLHIQRMPSEPGREFG  381
              W Q A+  LP L  S+ ML CGEDLGMIP CV  VM +L ++ L IQRMP +P +EFG
Sbjct  140  DFWGQQAMKKLPQLTQSTRMLVCGEDLGMIPDCVAWVMNDLRILSLEIQRMPKDPKQEFG  199

Query  382  IPSEYSYMTVCAPSCHDCSTLRAWWEEDEGRRRRYFQTVVGSGAVPPDECTPEIARFVLR  561
                Y Y +VC  S HD STLR WWEED  + +RY+ T++G     P   TPE+   V+R
Sbjct  200  HTDWYPYRSVCTISTHDMSTLRGWWEEDFQQTQRYYNTMLGHYGAAPATATPELCEEVVR  259

Query  562  KHVESPSMWSIFPLQDLLALKEDYATRPAVEETINDPTXPRHYWRYRMHVTMESLLNDKS  741
             H+ S S+  I  LQD +++   +      EE IN P  PRHYWR+RMH+T+E L+  +S
Sbjct  260  NHLHSNSILCILSLQDWMSMDGKWRNPNVQEERINIPANPRHYWRWRMHLTLEQLMKAES  319

Query  742  L  744
            L
Sbjct  320  L  320



>ref|WP_034532837.1| 4-alpha-glucanotransferase, partial [Bacteroides sp. 4_1_36]
Length=335

 Score =   220 bits (561),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 103/241 (43%), Positives = 145/241 (60%), Gaps = 0/241 (0%)
 Frame = +1

Query  22   LRRNLFDLLQEVVLIRDREDPRKFYPRFNLEDTSSFKGLDQHSKNVLKRLYYDYYFHRQE  201
            +R  L+ L+ +V+ + DR +P +++PR  ++    ++ L+   K    RLY  YY+HR  
Sbjct  82   IRDGLYALISDVLFVPDRNNPHEYHPRIGVQHDYIYRALNDWEKAAFNRLYDQYYYHRHN  141

Query  202  SLWRQNALNTLPVLMNSSDMLTCGEDLGMIPACVNPVMQELGLIGLHIQRMPSEPGREFG  381
              W Q A+  LP L  S+ ML CGEDLGMIP CV  VM +L ++ L IQRMP +P +EFG
Sbjct  142  DFWGQQAMKKLPQLTQSTRMLVCGEDLGMIPDCVAWVMNDLRILSLEIQRMPKDPKQEFG  201

Query  382  IPSEYSYMTVCAPSCHDCSTLRAWWEEDEGRRRRYFQTVVGSGAVPPDECTPEIARFVLR  561
                Y Y +VC  S HD STLR WWEED  + +RY+ T++G     P   TPE+   V+R
Sbjct  202  HTDWYPYRSVCTISTHDMSTLRGWWEEDFQQTQRYYNTMLGHYGAAPATATPELCEEVVR  261

Query  562  KHVESPSMWSIFPLQDLLALKEDYATRPAVEETINDPTXPRHYWRYRMHVTMESLLNDKS  741
             H+ S S+  I  LQD +++   +      EE IN P  PRHYWR+RMH+T+E L+  +S
Sbjct  262  NHLHSNSILCILSLQDWMSMDGKWRNPNVQEERINIPANPRHYWRWRMHLTLEQLMKAES  321

Query  742  L  744
            L
Sbjct  322  L  322



>ref|XP_007509607.1| 4-alpha-glucanotransferase [Bathycoccus prasinos]
 emb|CCO19410.1| 4-alpha-glucanotransferase [Bathycoccus prasinos]
Length=1209

 Score =   233 bits (594),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 118/269 (44%), Positives = 165/269 (61%), Gaps = 21/269 (8%)
 Frame = +1

Query  1     FVENEEKLRRNLFDLLQEVVLIRDREDPRK--------------FYPRFNLEDTSSFKGL  138
              V    +++  L +L + V L+R   DP                FYPRF++E T  F+ L
Sbjct  924   LVAETNEIKNGLLELTRNVCLLRSAYDPSATEGVHSVAMFDKDAFYPRFDMERTRLFQKL  983

Query  139   DQHSKNVLKRLYYDYYFHRQESLWRQNALNTLPVLMNSSDMLTCGEDLGMIPACVNPVMQ  318
             +   ++ L R+ +++Y  RQ  LW QNA  T+P + NS++ML CGEDLG++P  V   MQ
Sbjct  984   ECWQRSALSRISHEHYTTRQRFLWTQNAHTTIPAITNSTNMLVCGEDLGLVPDFVPGEMQ  1043

Query  319   ELGLIGLHIQRMPS-EPGR----EFGIPSEYSYMTVCAPSCHDCSTLRAWWEEDEGRRRR  483
              LG++GL IQRMP+ E G     EFGIPS Y Y TVC+PSCHD +T RAW+EEDE RR++
Sbjct  1044  NLGILGLRIQRMPAPEQGENNNSEFGIPSRYPYDTVCSPSCHDTTTFRAWFEEDENRRKK  1103

Query  484   YFQTVVGSG-AVPPDECTPEIARFVLRKHVESPSMWSIFPLQDLLALKEDYAT-RPAVEE  657
             Y+  ++G   +  P  CT E  R V+++H+ESPS  +IF L D+LA+  +Y   R   EE
Sbjct  1104  YYSQILGQDISTTPKRCTTETMRAVIKQHLESPSALAIFALADVLAMDTNYINERDPKEE  1163

Query  658   TINDPTXPRHYWRYRMHVTMESLLNDKSL  744
             TINDPT  RHYWR+R H  +E +  ++ L
Sbjct  1164  TINDPTNSRHYWRFRFHTNLEDMKKNEQL  1192



>dbj|GAK36780.1| 4-alpha-glucanotransferase [Bacteroides graminisolvens DSM 19988 
= JCM 15093]
Length=244

 Score =   217 bits (552),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 102/225 (45%), Positives = 135/225 (60%), Gaps = 0/225 (0%)
 Frame = +1

Query  70   DREDPRKFYPRFNLEDTSSFKGLDQHSKNVLKRLYYDYYFHRQESLWRQNALNTLPVLMN  249
            D ++P K++PR  ++    ++ L+   K    RLY  YY+HR    W Q A+  LP L  
Sbjct  3    DHKEPHKYHPRIGVQHDFIYRALNDGEKEAFNRLYDQYYYHRHNEFWHQQAMKKLPQLTQ  62

Query  250  SSDMLTCGEDLGMIPACVNPVMQELGLIGLHIQRMPSEPGREFGIPSEYSYMTVCAPSCH  429
            S+ ML CGEDLGMIP CV  VM +L ++ L IQRMP  P  EFG    Y Y +VC  S H
Sbjct  63   STRMLVCGEDLGMIPDCVAWVMNDLRILSLEIQRMPKNPAEEFGNLHHYPYRSVCTISTH  122

Query  430  DCSTLRAWWEEDEGRRRRYFQTVVGSGAVPPDECTPEIARFVLRKHVESPSMWSIFPLQD  609
            D STLR WWEED  + +RY+  ++G     P   TPE+   V+R H+ S S++ I  LQD
Sbjct  123  DMSTLRGWWEEDRQQTQRYYNNMLGHYGEAPQTATPEVCEEVVRNHLYSQSIFCILSLQD  182

Query  610  LLALKEDYATRPAVEETINDPTXPRHYWRYRMHVTMESLLNDKSL  744
             L++  ++    A EE IN P  PRHYWRYRMH+T+E LL  +SL
Sbjct  183  WLSMDGNWRRTVADEERINIPANPRHYWRYRMHLTLEQLLGAESL  227



>ref|WP_004321973.1| 4-alpha-glucanotransferase [Bacteroides ovatus]
 gb|EIY60311.1| 4-alpha-glucanotransferase [Bacteroides ovatus CL02T12C04]
Length=893

 Score =   231 bits (588),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 106/241 (44%), Positives = 147/241 (61%), Gaps = 0/241 (0%)
 Frame = +1

Query  22   LRRNLFDLLQEVVLIRDREDPRKFYPRFNLEDTSSFKGLDQHSKNVLKRLYYDYYFHRQE  201
            +R  L+ L+  V+ + D+++  K++PR  ++    F+ L++  KN   RLY  YY+HR  
Sbjct  636  IREGLYSLISNVLFVADKKEEGKYHPRIGVQRDFVFRSLNEEEKNAFNRLYDQYYYHRHN  695

Query  202  SLWRQNALNTLPVLMNSSDMLTCGEDLGMIPACVNPVMQELGLIGLHIQRMPSEPGREFG  381
              W Q A+  LP L  S+ ML CGEDLGMIPACV+ VM EL ++ L IQRMP  P  EFG
Sbjct  696  EFWYQQAMKKLPQLTQSTRMLVCGEDLGMIPACVSSVMNELRILSLEIQRMPKNPMHEFG  755

Query  382  IPSEYSYMTVCAPSCHDCSTLRAWWEEDEGRRRRYFQTVVGSGAVPPDECTPEIARFVLR  561
              +EY Y +VC  S HD STLR WWEED  + +RY+   +G   V P   TPE+   ++R
Sbjct  756  HLNEYPYRSVCTISTHDMSTLRGWWEEDYQQTQRYYNATLGHYGVAPTTATPELCEEIVR  815

Query  562  KHVESPSMWSIFPLQDLLALKEDYATRPAVEETINDPTXPRHYWRYRMHVTMESLLNDKS  741
             H+ S S+  I   QD L++   +      EE IN P+ PR+YWRYRMH+T+E L+  K+
Sbjct  816  NHLNSNSILCILSFQDWLSIDGKWRNPNVAEERINVPSNPRNYWRYRMHLTLEQLMKAKT  875

Query  742  L  744
            L
Sbjct  876  L  876



>ref|WP_032844011.1| MULTISPECIES: 4-alpha-glucanotransferase [Bacteroides]
 gb|KDS12229.1| starch binding domain protein [Bacteroides ovatus str. 3725 D1 
iv]
 gb|KDS17409.1| starch binding domain protein [Bacteroides fragilis str. 3725 
D9 ii]
 gb|KDS43217.1| starch binding domain protein [Bacteroides ovatus str. 3725 D9 
iii]
Length=893

 Score =   231 bits (588),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 106/241 (44%), Positives = 147/241 (61%), Gaps = 0/241 (0%)
 Frame = +1

Query  22   LRRNLFDLLQEVVLIRDREDPRKFYPRFNLEDTSSFKGLDQHSKNVLKRLYYDYYFHRQE  201
            +R  L+ L+  V+ + D+++  K++PR  ++    F+ L++  KN   RLY  YY+HR  
Sbjct  636  IREGLYSLISNVLFVADKKEEGKYHPRIGVQRDFVFRSLNEEEKNAFNRLYDQYYYHRHN  695

Query  202  SLWRQNALNTLPVLMNSSDMLTCGEDLGMIPACVNPVMQELGLIGLHIQRMPSEPGREFG  381
              W Q A+  LP L  S+ ML CGEDLGMIPACV+ VM EL ++ L IQRMP  P  EFG
Sbjct  696  EFWYQQAMKKLPQLTQSTRMLVCGEDLGMIPACVSSVMNELRILSLEIQRMPKNPMHEFG  755

Query  382  IPSEYSYMTVCAPSCHDCSTLRAWWEEDEGRRRRYFQTVVGSGAVPPDECTPEIARFVLR  561
              +EY Y +VC  S HD STLR WWEED  + +RY+   +G   V P   TPE+   ++R
Sbjct  756  HLNEYPYRSVCTISTHDMSTLRGWWEEDYQQTQRYYNATLGHYGVAPTTATPELCEEIVR  815

Query  562  KHVESPSMWSIFPLQDLLALKEDYATRPAVEETINDPTXPRHYWRYRMHVTMESLLNDKS  741
             H+ S S+  I   QD L++   +      EE IN P+ PR+YWRYRMH+T+E L+  K+
Sbjct  816  NHLNSNSILCILSFQDWLSIDGKWRNPNVAEERINVPSNPRNYWRYRMHLTLEQLMKAKT  875

Query  742  L  744
            L
Sbjct  876  L  876



>ref|WP_004299344.1| 4-alpha-glucanotransferase [Bacteroides sp. D2]
 gb|EDO11296.1| putative 4-alpha-glucanotransferase [Bacteroides ovatus ATCC 
8483]
 gb|EFS33122.1| 4-alpha-glucanotransferase [Bacteroides sp. D2]
Length=893

 Score =   231 bits (588),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 106/241 (44%), Positives = 147/241 (61%), Gaps = 0/241 (0%)
 Frame = +1

Query  22   LRRNLFDLLQEVVLIRDREDPRKFYPRFNLEDTSSFKGLDQHSKNVLKRLYYDYYFHRQE  201
            +R  L+ L+  V+ + D+++  K++PR  ++    F+ L++  KN   RLY  YY+HR  
Sbjct  636  IREGLYSLISNVLFVADKKEEGKYHPRIGVQRDFVFRSLNEEEKNAFNRLYDQYYYHRHN  695

Query  202  SLWRQNALNTLPVLMNSSDMLTCGEDLGMIPACVNPVMQELGLIGLHIQRMPSEPGREFG  381
              W Q A+  LP L  S+ ML CGEDLGMIPACV+ VM EL ++ L IQRMP  P  EFG
Sbjct  696  EFWYQQAMKKLPQLTQSTRMLVCGEDLGMIPACVSSVMNELRILSLEIQRMPKNPMHEFG  755

Query  382  IPSEYSYMTVCAPSCHDCSTLRAWWEEDEGRRRRYFQTVVGSGAVPPDECTPEIARFVLR  561
              +EY Y +VC  S HD STLR WWEED  + +RY+   +G   V P   TPE+   ++R
Sbjct  756  HLNEYPYRSVCTISTHDMSTLRGWWEEDYQQTQRYYNATLGHYGVAPTTATPELCEEIVR  815

Query  562  KHVESPSMWSIFPLQDLLALKEDYATRPAVEETINDPTXPRHYWRYRMHVTMESLLNDKS  741
             H+ S S+  I   QD L++   +      EE IN P+ PR+YWRYRMH+T+E L+  K+
Sbjct  816  NHLNSNSILCILSFQDWLSIDGKWRNPNVAEERINVPSNPRNYWRYRMHLTLEQLMKAKT  875

Query  742  L  744
            L
Sbjct  876  L  876



>ref|WP_022219021.1| putative 4-alpha-glucanotransferase [Bacteroides clarus CAG:160]
 emb|CDB81866.1| putative 4-alpha-glucanotransferase [Bacteroides clarus CAG:160]
Length=896

 Score =   230 bits (587),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 108/241 (45%), Positives = 149/241 (62%), Gaps = 0/241 (0%)
 Frame = +1

Query  22   LRRNLFDLLQEVVLIRDREDPRKFYPRFNLEDTSSFKGLDQHSKNVLKRLYYDYYFHRQE  201
            +R  L+ L+ +V+ + DR DP K++PR  ++    ++ L+   K    RLY  YY+HR  
Sbjct  643  IRDGLYALISDVLFVPDRNDPYKYHPRIGVQHDYIYRSLNDWEKAAFNRLYDQYYYHRHN  702

Query  202  SLWRQNALNTLPVLMNSSDMLTCGEDLGMIPACVNPVMQELGLIGLHIQRMPSEPGREFG  381
              WR+ A+N LP L  S+ ML CGEDLGMIP CV  VM +L ++ L IQRMP +P +EFG
Sbjct  703  EFWREQAMNKLPQLTQSTRMLVCGEDLGMIPDCVAWVMNDLRILSLEIQRMPKDPAQEFG  762

Query  382  IPSEYSYMTVCAPSCHDCSTLRAWWEEDEGRRRRYFQTVVGSGAVPPDECTPEIARFVLR  561
             P  Y Y +VC  S HD STLR WWEED  + +RY+ T++G     P   TPE+   V+R
Sbjct  763  HPDWYPYRSVCTISTHDMSTLRGWWEEDFLQTQRYYNTMLGHYGAAPAVATPELCEEVVR  822

Query  562  KHVESPSMWSIFPLQDLLALKEDYATRPAVEETINDPTXPRHYWRYRMHVTMESLLNDKS  741
            KH+ S S+  I  LQD +++   +      EE IN P  PRHYWR+RMH+T+E L+  +S
Sbjct  823  KHLYSNSILCILSLQDWMSMDGKWRNPNVQEERINVPANPRHYWRWRMHLTLEQLMKAES  882

Query  742  L  744
            L
Sbjct  883  L  883



>ref|WP_025862904.1| hypothetical protein [Prolixibacter bellariivorans]
Length=906

 Score =   230 bits (587),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 107/246 (43%), Positives = 155/246 (63%), Gaps = 0/246 (0%)
 Frame = +1

Query  7    ENEEKLRRNLFDLLQEVVLIRDREDPRKFYPRFNLEDTSSFKGLDQHSKNVLKRLYYDYY  186
            + E ++   L  L+ EV+ +RD  D  KF+PR  L+DT SF  LD+ +++  ++LY DY+
Sbjct  644  DKENRIMEGLNSLVSEVLFLRDPYDRYKFHPRIRLQDTYSFINLDEETRHNFEQLYVDYF  703

Query  187  FHRQESLWRQNALNTLPVLMNSSDMLTCGEDLGMIPACVNPVMQELGLIGLHIQRMPSEP  366
            + R E LWR NA+  LP L+ +SDM+  G+D GM P CV  +++ELG++ L +QR P + 
Sbjct  704  YKRHEDLWRDNAMIKLPALLRTSDMMAFGDDFGMNPDCVQRILKELGILTLEVQRRPHDT  763

Query  367  GREFGIPSEYSYMTVCAPSCHDCSTLRAWWEEDEGRRRRYFQTVVGSGAVPPDECTPEIA  546
              EFG PS+  Y++VC  S HD +T+R WWEED  R +R+F T++G     P    P IA
Sbjct  764  EVEFGHPSDAPYLSVCTTSSHDMTTIRGWWEEDYDRSKRFFHTLLGHAGEVPRFMEPWIA  823

Query  547  RFVLRKHVESPSMWSIFPLQDLLALKEDYATRPAVEETINDPTXPRHYWRYRMHVTMESL  726
            R ++ +H+ SP+MW+IFPLQDLLA+  +        E IN P    +YWRYRMH+ ME L
Sbjct  824  RDIISQHLWSPAMWAIFPLQDLLAMDGELRWEKIWNERINIPGITYYYWRYRMHLKMEDL  883

Query  727  LNDKSL  744
            L+    
Sbjct  884  LHSDGF  889



>ref|WP_009123083.1| 4-alpha-glucanotransferase [Bacteroides clarus]
 gb|EGF49651.1| putative 4-alpha-glucanotransferase [Bacteroides clarus YIT 12056]
Length=896

 Score =   230 bits (586),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 108/241 (45%), Positives = 149/241 (62%), Gaps = 0/241 (0%)
 Frame = +1

Query  22   LRRNLFDLLQEVVLIRDREDPRKFYPRFNLEDTSSFKGLDQHSKNVLKRLYYDYYFHRQE  201
            +R  L+ L+ +V+ + DR DP K++PR  ++    ++ L+   K    RLY  YY+HR  
Sbjct  643  IRDGLYALISDVLFVPDRNDPYKYHPRIGVQHDYIYRSLNDWEKAAFNRLYDQYYYHRHN  702

Query  202  SLWRQNALNTLPVLMNSSDMLTCGEDLGMIPACVNPVMQELGLIGLHIQRMPSEPGREFG  381
              WR+ A+N LP L  S+ ML CGEDLGMIP CV  VM +L ++ L IQRMP +P +EFG
Sbjct  703  EFWREQAMNKLPQLTQSTRMLVCGEDLGMIPDCVAWVMNDLRILSLEIQRMPKDPAQEFG  762

Query  382  IPSEYSYMTVCAPSCHDCSTLRAWWEEDEGRRRRYFQTVVGSGAVPPDECTPEIARFVLR  561
             P  Y Y +VC  S HD STLR WWEED  + +RY+ T++G     P   TPE+   V+R
Sbjct  763  HPDWYPYRSVCTISTHDMSTLRGWWEEDFLQTQRYYNTMLGHYGAAPAVATPELCEEVVR  822

Query  562  KHVESPSMWSIFPLQDLLALKEDYATRPAVEETINDPTXPRHYWRYRMHVTMESLLNDKS  741
            KH+ S S+  I  LQD +++   +      EE IN P  PRHYWR+RMH+T+E L+  +S
Sbjct  823  KHLYSNSILCILSLQDWMSMDGKWRNPNVQEERINVPANPRHYWRWRMHLTLEQLMKAES  882

Query  742  L  744
            L
Sbjct  883  L  883



>ref|WP_021848341.1| hypothetical protein [Bacteroides sp. CAG:598]
 emb|CCX61485.1| putative uncharacterized protein [Bacteroides sp. CAG:598]
Length=896

 Score =   230 bits (586),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 108/241 (45%), Positives = 142/241 (59%), Gaps = 0/241 (0%)
 Frame = +1

Query  22   LRRNLFDLLQEVVLIRDREDPRKFYPRFNLEDTSSFKGLDQHSKNVLKRLYYDYYFHRQE  201
            +R  L+ L+ +V+ + DR DP K++PR  ++    ++ L+   K    RLY  YY+HR  
Sbjct  643  IRDGLYALISDVLFVSDRNDPSKYHPRIGVQHDYIYRSLNDWEKAAFNRLYDQYYYHRHN  702

Query  202  SLWRQNALNTLPVLMNSSDMLTCGEDLGMIPACVNPVMQELGLIGLHIQRMPSEPGREFG  381
              W Q A+  LP L  S+ ML CGEDLGMIPACV  VM EL ++ L IQRMP +P +EFG
Sbjct  703  DFWGQQAMKKLPQLTQSTRMLVCGEDLGMIPACVAWVMNELRILSLEIQRMPKDPSQEFG  762

Query  382  IPSEYSYMTVCAPSCHDCSTLRAWWEEDEGRRRRYFQTVVGSGAVPPDECTPEIARFVLR  561
             P  Y Y +VC  S HD STLR WWEED  + +RY+   +G     P   TPE+   V+R
Sbjct  763  HPEWYPYRSVCTISTHDMSTLRGWWEEDAQQTQRYYNHALGHYGTAPAVATPELCEQVVR  822

Query  562  KHVESPSMWSIFPLQDLLALKEDYATRPAVEETINDPTXPRHYWRYRMHVTMESLLNDKS  741
             H+ S SM SI   QD +++          EE IN P  PRHYWRYRMH+T+E L+    
Sbjct  823  AHLTSNSMLSILSFQDWMSIDGQLRNPNVAEERINVPANPRHYWRYRMHLTLEQLMAADD  882

Query  742  L  744
            L
Sbjct  883  L  883



>ref|WP_039141056.1| 4-alpha-glucanotransferase [Flavihumibacter solisilvae]
 gb|KIC93819.1| 4-alpha-glucanotransferase [Flavihumibacter solisilvae]
Length=896

 Score =   229 bits (585),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 103/240 (43%), Positives = 155/240 (65%), Gaps = 1/240 (0%)
 Frame = +1

Query  28   RNLFDLLQEVVLIRDREDPR-KFYPRFNLEDTSSFKGLDQHSKNVLKRLYYDYYFHRQES  204
            + L+DL   V+L  +      +F+ RF +E+TSS++ L+  +K  L  LY +Y++HRQ+ 
Sbjct  643  QGLYDLHANVILFEEEGSKGLQFHFRFGMENTSSYQALEAATKKGLYDLYVNYFYHRQDD  702

Query  205  LWRQNALNTLPVLMNSSDMLTCGEDLGMIPACVNPVMQELGLIGLHIQRMPSEPGREFGI  384
             W++ AL  LP L  S++ML CGEDLGM+P CV  VM++LG++ L IQRMP  P +EF  
Sbjct  703  SWKEEALRKLPALKASTEMLICGEDLGMVPHCVPDVMKQLGILSLEIQRMPKNPAQEFFH  762

Query  385  PSEYSYMTVCAPSCHDCSTLRAWWEEDEGRRRRYFQTVVGSGAVPPDECTPEIARFVLRK  564
            P +  Y++V  PS HD ST+R WWEED  + +R+F   +G     P+ C   I + ++ +
Sbjct  763  PDDAPYLSVVTPSTHDMSTIRGWWEEDRDKTQRFFNNELGQWGEAPEYCEAWINKAIVIQ  822

Query  565  HVESPSMWSIFPLQDLLALKEDYATRPAVEETINDPTXPRHYWRYRMHVTMESLLNDKSL  744
            H+ SP+MWSIF LQDLL + +    +  ++E IN P+  +HYWRYRMH+T+E L  +K+ 
Sbjct  823  HLYSPAMWSIFQLQDLLGMDDQLRRKEHIDERINIPSVAKHYWRYRMHMTLEELAKEKTF  882



>ref|WP_008585018.1| 4-alpha-glucanotransferase [Niabella soli]
 gb|AHF14989.1| 4-alpha-glucanotransferase [Niabella soli DSM 19437]
Length=894

 Score =   229 bits (585),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 107/248 (43%), Positives = 155/248 (63%), Gaps = 1/248 (0%)
 Frame = +1

Query  4    VENEEKLRRNLFDLLQEVVLIRDREDPRKFY-PRFNLEDTSSFKGLDQHSKNVLKRLYYD  180
            V  E  L+ +LF LL  V+L++       FY PRF+L+ T+SF+ L    +  L  LY D
Sbjct  634  VHGEPNLKESLFQLLSNVLLLKQSSGDGVFYHPRFDLQKTASFQALPYEQQQKLTELYND  693

Query  181  YYFHRQESLWRQNALNTLPVLMNSSDMLTCGEDLGMIPACVNPVMQELGLIGLHIQRMPS  360
            Y+F RQ++ WR+ +L  LP L  +++ML CGEDLG++P+ V  VM+ELG++ L IQRMP 
Sbjct  694  YFFRRQDAFWRKESLKKLPQLKAATNMLVCGEDLGLVPSSVPEVMKELGILSLEIQRMPK  753

Query  361  EPGREFGIPSEYSYMTVCAPSCHDCSTLRAWWEEDEGRRRRYFQTVVGSGAVPPDECTPE  540
            +PG  F  P++  Y++V +PS HD ST+R WWEED    + ++   +      P  C   
Sbjct  754  QPGIRFFDPAKAPYLSVVSPSTHDMSTIRGWWEEDSAVTQDFYTHTLHLQGEAPVSCEGW  813

Query  541  IARFVLRKHVESPSMWSIFPLQDLLALKEDYATRPAVEETINDPTXPRHYWRYRMHVTME  720
            I R ++++H+ SP+MWSIF LQDLL + E +      EE IN P  P+HYWRYRMH+ + 
Sbjct  814  INREIVKQHLSSPAMWSIFQLQDLLGMDEQFRREHPAEERINIPANPQHYWRYRMHLPLS  873

Query  721  SLLNDKSL  744
            +LL + S 
Sbjct  874  ALLANTSF  881



>gb|EGN08908.1| hypothetical protein HMPREF0127_01074 [Bacteroides sp. 1_1_30]
Length=904

 Score =   229 bits (585),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 105/241 (44%), Positives = 147/241 (61%), Gaps = 0/241 (0%)
 Frame = +1

Query  22   LRRNLFDLLQEVVLIRDREDPRKFYPRFNLEDTSSFKGLDQHSKNVLKRLYYDYYFHRQE  201
            +R  L+ L+  V+ + D+++  K++PR  ++    F+ L++  KN   RLY  YY+HR  
Sbjct  647  IREGLYSLISNVLFVADKKEEGKYHPRIGVQRDFVFRSLNEEEKNAFNRLYDQYYYHRHN  706

Query  202  SLWRQNALNTLPVLMNSSDMLTCGEDLGMIPACVNPVMQELGLIGLHIQRMPSEPGREFG  381
              W Q A+  LP L  S+ ML CGEDLGMIPACV+ VM +L ++ L IQRMP  P  EFG
Sbjct  707  EFWYQQAMKKLPQLTQSTRMLVCGEDLGMIPACVSSVMNDLRILSLEIQRMPKNPMHEFG  766

Query  382  IPSEYSYMTVCAPSCHDCSTLRAWWEEDEGRRRRYFQTVVGSGAVPPDECTPEIARFVLR  561
              +EY Y +VC  S HD STLR WWEED  + +RY+   +G   V P   TPE+   ++R
Sbjct  767  HLNEYPYRSVCTISTHDMSTLRGWWEEDYQQTQRYYNATLGHYGVAPTTATPELCEEIVR  826

Query  562  KHVESPSMWSIFPLQDLLALKEDYATRPAVEETINDPTXPRHYWRYRMHVTMESLLNDKS  741
             H+ S S+  I   QD L++   +      EE IN P+ PR+YWRYRMH+T+E L+  K+
Sbjct  827  NHLNSNSILCILSFQDWLSIDGKWRNPNVAEERINVPSNPRNYWRYRMHLTLEQLMKAKT  886

Query  742  L  744
            L
Sbjct  887  L  887



>ref|WP_009038847.1| 4-alpha-glucanotransferase [Bacteroides sp. D22]
 gb|EFI15819.1| 4-alpha-glucanotransferase [Bacteroides sp. D22]
Length=893

 Score =   229 bits (585),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 105/241 (44%), Positives = 147/241 (61%), Gaps = 0/241 (0%)
 Frame = +1

Query  22   LRRNLFDLLQEVVLIRDREDPRKFYPRFNLEDTSSFKGLDQHSKNVLKRLYYDYYFHRQE  201
            +R  L+ L+  V+ + D+++  K++PR  ++    F+ L++  KN   RLY  YY+HR  
Sbjct  636  IREGLYSLISNVLFVADKKEEGKYHPRIGVQRDFVFRSLNEEEKNAFNRLYDQYYYHRHN  695

Query  202  SLWRQNALNTLPVLMNSSDMLTCGEDLGMIPACVNPVMQELGLIGLHIQRMPSEPGREFG  381
              W Q A+  LP L  S+ ML CGEDLGMIPACV+ VM +L ++ L IQRMP  P  EFG
Sbjct  696  EFWYQQAMKKLPQLTQSTRMLVCGEDLGMIPACVSSVMNDLRILSLEIQRMPKNPMHEFG  755

Query  382  IPSEYSYMTVCAPSCHDCSTLRAWWEEDEGRRRRYFQTVVGSGAVPPDECTPEIARFVLR  561
              +EY Y +VC  S HD STLR WWEED  + +RY+   +G   V P   TPE+   ++R
Sbjct  756  HLNEYPYRSVCTISTHDMSTLRGWWEEDYQQTQRYYNATLGHYGVAPTTATPELCEEIVR  815

Query  562  KHVESPSMWSIFPLQDLLALKEDYATRPAVEETINDPTXPRHYWRYRMHVTMESLLNDKS  741
             H+ S S+  I   QD L++   +      EE IN P+ PR+YWRYRMH+T+E L+  K+
Sbjct  816  NHLNSNSILCILSFQDWLSIDGKWRNPNVTEERINVPSNPRNYWRYRMHLTLEQLMKAKT  875

Query  742  L  744
            L
Sbjct  876  L  876



>ref|WP_022275952.1| 4-alpha-glucanotransferase [Bacteroides finegoldii CAG:203]
 emb|CDC51301.1| 4-alpha-glucanotransferase [Bacteroides finegoldii CAG:203]
Length=893

 Score =   229 bits (585),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 109/246 (44%), Positives = 148/246 (60%), Gaps = 0/246 (0%)
 Frame = +1

Query  7    ENEEKLRRNLFDLLQEVVLIRDREDPRKFYPRFNLEDTSSFKGLDQHSKNVLKRLYYDYY  186
            EN   +R  L+ L+  V+ I D ++  K++PR   +  S F+ L +  KN   +LY  YY
Sbjct  631  ENSIWVRDGLYSLISNVLFIPDNKEQGKYHPRIGAQRDSIFRSLSEEDKNAFNKLYNQYY  690

Query  187  FHRQESLWRQNALNTLPVLMNSSDMLTCGEDLGMIPACVNPVMQELGLIGLHIQRMPSEP  366
            +HR    W Q A+  LP L  S+ ML CGEDLGMIPACV+ VM EL ++ L IQRMP +P
Sbjct  691  YHRHNDFWYQQAMKKLPQLTQSTRMLVCGEDLGMIPACVSSVMNELRILSLEIQRMPKDP  750

Query  367  GREFGIPSEYSYMTVCAPSCHDCSTLRAWWEEDEGRRRRYFQTVVGSGAVPPDECTPEIA  546
              EFG  +EY Y +VC  S HD STLR WWEED  + +RY+ T++G     P   TPE+ 
Sbjct  751  SYEFGHLNEYPYRSVCTISTHDMSTLRGWWEEDYQQTQRYYNTMLGHYGTAPAIATPELC  810

Query  547  RFVLRKHVESPSMWSIFPLQDLLALKEDYATRPAVEETINDPTXPRHYWRYRMHVTMESL  726
              ++R H+ S S+  I   QD L++   +      EE IN P+ PR+YWRYRMH+T+E L
Sbjct  811  EEIVRNHLNSNSILCILSFQDWLSVDGKWRNPNVEEERINVPSNPRNYWRYRMHITLEQL  870

Query  727  LNDKSL  744
            +  K L
Sbjct  871  MKAKEL  876



>ref|WP_013545673.1| 4-alpha-glucanotransferase [Bacteroides helcogenes]
 gb|ADV42034.1| 4-alpha-glucanotransferase [Bacteroides helcogenes P 36-108]
Length=901

 Score =   229 bits (585),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 106/241 (44%), Positives = 147/241 (61%), Gaps = 0/241 (0%)
 Frame = +1

Query  22   LRRNLFDLLQEVVLIRDREDPRKFYPRFNLEDTSSFKGLDQHSKNVLKRLYYDYYFHRQE  201
            +R  L+ L+ +V+ + DR D  K++PR  ++    ++ L+   K    RLY  YY+HR  
Sbjct  643  IRDGLYALISDVLFVPDRSDANKYHPRIGVQHDYIYRALNDWEKAAFNRLYDQYYYHRHN  702

Query  202  SLWRQNALNTLPVLMNSSDMLTCGEDLGMIPACVNPVMQELGLIGLHIQRMPSEPGREFG  381
              W Q A+  LP L  S+ ML CGEDLGMIP CV  VM +L ++ L IQRMP +P +EFG
Sbjct  703  DFWGQQAMKKLPQLTQSTRMLVCGEDLGMIPDCVAWVMNDLRILSLEIQRMPKDPSQEFG  762

Query  382  IPSEYSYMTVCAPSCHDCSTLRAWWEEDEGRRRRYFQTVVGSGAVPPDECTPEIARFVLR  561
             P +Y Y +VC  S HD STLR WWEED  + +RY+ T++G     P   TPE+   V+R
Sbjct  763  YPDQYPYRSVCTISTHDMSTLRGWWEEDFQQTQRYYNTILGHYGAAPAIATPELCEEVIR  822

Query  562  KHVESPSMWSIFPLQDLLALKEDYATRPAVEETINDPTXPRHYWRYRMHVTMESLLNDKS  741
             H+ S S+  I  LQD +++   +      EE IN P  PRHYWR+RMH+T+E L+N +S
Sbjct  823  NHLYSNSILCILSLQDWMSIDGKWRNPNVQEERINIPANPRHYWRWRMHLTLEQLMNAES  882

Query  742  L  744
            L
Sbjct  883  L  883



>ref|WP_004307977.1| MULTISPECIES: 4-alpha-glucanotransferase [Bacteroides]
 gb|EFF54645.1| putative 4-alpha-glucanotransferase [Bacteroides ovatus SD CMC 
3f]
Length=893

 Score =   229 bits (585),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 105/241 (44%), Positives = 147/241 (61%), Gaps = 0/241 (0%)
 Frame = +1

Query  22   LRRNLFDLLQEVVLIRDREDPRKFYPRFNLEDTSSFKGLDQHSKNVLKRLYYDYYFHRQE  201
            +R  L+ L+  V+ + D+++  K++PR  ++    F+ L++  KN   RLY  YY+HR  
Sbjct  636  IREGLYSLISNVLFVADKKEEGKYHPRIGVQRDFVFRSLNEEEKNAFNRLYDQYYYHRHN  695

Query  202  SLWRQNALNTLPVLMNSSDMLTCGEDLGMIPACVNPVMQELGLIGLHIQRMPSEPGREFG  381
              W Q A+  LP L  S+ ML CGEDLGMIPACV+ VM +L ++ L IQRMP  P  EFG
Sbjct  696  EFWYQQAMKKLPQLTQSTRMLVCGEDLGMIPACVSSVMNDLRILSLEIQRMPKNPMHEFG  755

Query  382  IPSEYSYMTVCAPSCHDCSTLRAWWEEDEGRRRRYFQTVVGSGAVPPDECTPEIARFVLR  561
              +EY Y +VC  S HD STLR WWEED  + +RY+   +G   V P   TPE+   ++R
Sbjct  756  HLNEYPYRSVCTISTHDMSTLRGWWEEDYQQTQRYYNATLGHYGVAPTTATPELCEEIVR  815

Query  562  KHVESPSMWSIFPLQDLLALKEDYATRPAVEETINDPTXPRHYWRYRMHVTMESLLNDKS  741
             H+ S S+  I   QD L++   +      EE IN P+ PR+YWRYRMH+T+E L+  K+
Sbjct  816  NHLNSNSILCILSFQDWLSIDGKWRNPNVAEERINVPSNPRNYWRYRMHLTLEQLMKAKT  875

Query  742  L  744
            L
Sbjct  876  L  876



>dbj|GAE21767.1| 4-alpha-glucanotransferase [Bacteroides pyogenes JCM 10003]
Length=336

 Score =   219 bits (557),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 103/247 (42%), Positives = 148/247 (60%), Gaps = 0/247 (0%)
 Frame = +1

Query  4    VENEEKLRRNLFDLLQEVVLIRDREDPRKFYPRFNLEDTSSFKGLDQHSKNVLKRLYYDY  183
             +++ +++  L+ L+  V+ I D ++  K++PR  ++    +  L    K    +LY  Y
Sbjct  73   TDSDTEIKEGLYSLISNVLFIPDPKEKGKYHPRIGVQRDFVYHALSHEEKAAFDKLYDRY  132

Query  184  YFHRQESLWRQNALNTLPVLMNSSDMLTCGEDLGMIPACVNPVMQELGLIGLHIQRMPSE  363
            Y+HR +  W+Q A+  LP L  ++ ML CGEDLGMIP CV  VM EL ++ L IQRMP  
Sbjct  133  YYHRHDLFWQQQAMKKLPQLTQATRMLICGEDLGMIPHCVPWVMNELRILSLEIQRMPKN  192

Query  364  PGREFGIPSEYSYMTVCAPSCHDCSTLRAWWEEDEGRRRRYFQTVVGSGAVPPDECTPEI  543
            P  EFG P  Y Y +VC  S HD STLR WWEE   + +RY++ V+G     P   TPE+
Sbjct  193  PAHEFGHPEAYPYPSVCTVSTHDMSTLRGWWEEGHQQTQRYYRDVLGHYGNAPASATPEL  252

Query  544  ARFVLRKHVESPSMWSIFPLQDLLALKEDYATRPAVEETINDPTXPRHYWRYRMHVTMES  723
               V+R+H+ S SM+ I  LQD L++ +        EE IN P+ PRHYWRYRMH+T+E 
Sbjct  253  CEEVIREHLGSRSMFCILSLQDWLSIDKKLRNPDVREERINVPSNPRHYWRYRMHLTLEE  312

Query  724  LLNDKSL  744
            L+  ++L
Sbjct  313  LMQTETL  319



>ref|WP_004306622.1| 4-alpha-glucanotransferase [Bacteroides ovatus]
 gb|EGM99593.1| hypothetical protein HMPREF1017_04079 [Bacteroides ovatus 3_8_47FAA]
Length=893

 Score =   229 bits (584),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 105/241 (44%), Positives = 147/241 (61%), Gaps = 0/241 (0%)
 Frame = +1

Query  22   LRRNLFDLLQEVVLIRDREDPRKFYPRFNLEDTSSFKGLDQHSKNVLKRLYYDYYFHRQE  201
            +R  L+ L+  V+ + D+++  K++PR  ++    F+ L++  KN   RLY  YY+HR  
Sbjct  636  IREGLYSLISNVLFVADKKEEGKYHPRIGVQRDFVFRSLNEEEKNAFNRLYDQYYYHRHN  695

Query  202  SLWRQNALNTLPVLMNSSDMLTCGEDLGMIPACVNPVMQELGLIGLHIQRMPSEPGREFG  381
              W Q A+  LP L  S+ ML CGEDLGMIPACV+ VM +L ++ L IQRMP  P  EFG
Sbjct  696  EFWYQQAMKKLPQLTQSTRMLVCGEDLGMIPACVSSVMNDLRILSLEIQRMPKNPMYEFG  755

Query  382  IPSEYSYMTVCAPSCHDCSTLRAWWEEDEGRRRRYFQTVVGSGAVPPDECTPEIARFVLR  561
              +EY Y +VC  S HD STLR WWEED  + +RY+   +G   V P   TPE+   ++R
Sbjct  756  HLNEYPYRSVCTISTHDMSTLRGWWEEDYQQTQRYYNATLGHYGVAPTTATPELCEEIVR  815

Query  562  KHVESPSMWSIFPLQDLLALKEDYATRPAVEETINDPTXPRHYWRYRMHVTMESLLNDKS  741
             H+ S S+  I   QD L++   +      EE IN P+ PR+YWRYRMH+T+E L+  K+
Sbjct  816  NHLNSNSILCILSFQDWLSIDGKWRNPNVAEERINVPSNPRNYWRYRMHLTLEQLMKAKT  875

Query  742  L  744
            L
Sbjct  876  L  876



>gb|EGX26388.1| putative 4-alpha-glucanotransferase [Bacteroides sp. D1]
Length=904

 Score =   229 bits (583),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 105/241 (44%), Positives = 147/241 (61%), Gaps = 0/241 (0%)
 Frame = +1

Query  22   LRRNLFDLLQEVVLIRDREDPRKFYPRFNLEDTSSFKGLDQHSKNVLKRLYYDYYFHRQE  201
            +R  L+ L+  V+ + D+++  K++PR  ++    F+ L++  KN   RLY  YY+HR  
Sbjct  647  IREGLYSLISNVLFVADKKEEGKYHPRIGVQRDFVFRSLNEEEKNAFNRLYDQYYYHRHN  706

Query  202  SLWRQNALNTLPVLMNSSDMLTCGEDLGMIPACVNPVMQELGLIGLHIQRMPSEPGREFG  381
              W Q A+  LP L  S+ ML CGEDLGMIPACV+ VM +L ++ L IQRMP  P  EFG
Sbjct  707  EFWYQQAMKKLPQLTQSTRMLVCGEDLGMIPACVSSVMNDLRILSLEIQRMPKNPMYEFG  766

Query  382  IPSEYSYMTVCAPSCHDCSTLRAWWEEDEGRRRRYFQTVVGSGAVPPDECTPEIARFVLR  561
              +EY Y +VC  S HD STLR WWEED  + +RY+   +G   V P   TPE+   ++R
Sbjct  767  HLNEYPYRSVCTISTHDMSTLRGWWEEDYQQTQRYYNATLGHYGVAPTTATPELCEEIVR  826

Query  562  KHVESPSMWSIFPLQDLLALKEDYATRPAVEETINDPTXPRHYWRYRMHVTMESLLNDKS  741
             H+ S S+  I   QD L++   +      EE IN P+ PR+YWRYRMH+T+E L+  K+
Sbjct  827  NHLNSNSILCILSFQDWLSIDGKWRNPNVAEERINVPSNPRNYWRYRMHLTLEQLMKAKT  886

Query  742  L  744
            L
Sbjct  887  L  887



>ref|XP_005705723.1| 4-alpha-glucanotransferase [Galdieria sulphuraria]
 gb|EME29203.1| 4-alpha-glucanotransferase [Galdieria sulphuraria]
Length=957

 Score =   229 bits (584),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 106/236 (45%), Positives = 157/236 (67%), Gaps = 3/236 (1%)
 Frame = +1

Query  34   LFDLLQEVVLIRDREDPRK-FYPRFNLEDTSSFKGL-DQHSKNVLKRLYYDYYFHRQESL  207
            L  L+  V+L+RD ++P + F+PR +L  T+S+  L D + K+    LY DY+FHRQ+ L
Sbjct  702  LLRLISNVILLRDEDEPNQLFHPRIDLMKTTSYNELMDDNWKHQFYELYEDYFFHRQDDL  761

Query  208  WRQNALNTLPVLMNSSDMLTCGEDLGMIPACVNPVMQELGLIGLHIQRMPSEPGREFGIP  387
            WR+ ++  LP++ NS+ ML  GEDLGMIPACV  VM  L +IG+ IQRMP++P  EFG P
Sbjct  762  WRKKSMLKLPMMKNSTGMLVIGEDLGMIPACVPDVMNALSIIGMRIQRMPADPKVEFGNP  821

Query  388  SEYSYMTVCAPSCHDCSTLRAWWEEDEG-RRRRYFQTVVGSGAVPPDECTPEIARFVLRK  564
              Y Y+T+  P  HD +T+R WWEE E  +R+R+++ ++      P +C  +I + +L +
Sbjct  822  QYYEYLTIATPGSHDMATIRGWWEEMENDQRQRFYEQMLARSGDAPRKCEADIVQQILEQ  881

Query  565  HVESPSMWSIFPLQDLLALKEDYATRPAVEETINDPTXPRHYWRYRMHVTMESLLN  732
            HV SPS+W+IF  QD+L + E        EE IN P  P+HYWRYR+HV++E++L+
Sbjct  882  HVSSPSIWAIFLFQDILGMDEKLRRDNPAEEQINVPANPKHYWRYRLHVSLETILS  937



>ref|WP_004312551.1| MULTISPECIES: 4-alpha-glucanotransferase [Bacteroides]
 gb|EEZ04686.1| putative 4-alpha-glucanotransferase [Bacteroides sp. 2_1_22]
 gb|EFF59769.1| putative 4-alpha-glucanotransferase [Bacteroides xylanisolvens 
SD CC 2a]
 gb|EFG13674.1| putative 4-alpha-glucanotransferase [Bacteroides xylanisolvens 
SD CC 1b]
 emb|CDL99389.1| 4-alpha-glucanotransferase (amylomaltase) [Bacteroides xylanisolvens 
SD CC 2a]
 emb|CDM05654.1| 4-alpha-glucanotransferase (amylomaltase) [Bacteroides xylanisolvens 
SD CC 1b]
Length=893

 Score =   229 bits (583),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 105/241 (44%), Positives = 147/241 (61%), Gaps = 0/241 (0%)
 Frame = +1

Query  22   LRRNLFDLLQEVVLIRDREDPRKFYPRFNLEDTSSFKGLDQHSKNVLKRLYYDYYFHRQE  201
            +R  L+ L+  V+ + D+++  K++PR  ++    F+ L++  KN   RLY  YY+HR  
Sbjct  636  IREGLYSLISNVLFVADKKEEGKYHPRIGVQRDFVFRSLNEEEKNAFNRLYDQYYYHRHN  695

Query  202  SLWRQNALNTLPVLMNSSDMLTCGEDLGMIPACVNPVMQELGLIGLHIQRMPSEPGREFG  381
              W Q A+  LP L  S+ ML CGEDLGMIPACV+ VM +L ++ L IQRMP  P  EFG
Sbjct  696  EFWYQQAMKKLPQLTQSTRMLVCGEDLGMIPACVSSVMNDLRILSLEIQRMPKNPMYEFG  755

Query  382  IPSEYSYMTVCAPSCHDCSTLRAWWEEDEGRRRRYFQTVVGSGAVPPDECTPEIARFVLR  561
              +EY Y +VC  S HD STLR WWEED  + +RY+   +G   V P   TPE+   ++R
Sbjct  756  HLNEYPYRSVCTISTHDMSTLRGWWEEDYQQTQRYYNATLGHYGVAPTTATPELCEEIVR  815

Query  562  KHVESPSMWSIFPLQDLLALKEDYATRPAVEETINDPTXPRHYWRYRMHVTMESLLNDKS  741
             H+ S S+  I   QD L++   +      EE IN P+ PR+YWRYRMH+T+E L+  K+
Sbjct  816  NHLNSNSILCILSFQDWLSIDGKWRNPNVAEERINVPSNPRNYWRYRMHLTLEQLMKAKT  875

Query  742  L  744
            L
Sbjct  876  L  876



>ref|WP_008024994.1| 4-alpha-glucanotransferase [Bacteroides xylanisolvens]
 gb|EIY84913.1| 4-alpha-glucanotransferase [Bacteroides xylanisolvens CL03T12C04]
Length=893

 Score =   229 bits (583),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 105/241 (44%), Positives = 147/241 (61%), Gaps = 0/241 (0%)
 Frame = +1

Query  22   LRRNLFDLLQEVVLIRDREDPRKFYPRFNLEDTSSFKGLDQHSKNVLKRLYYDYYFHRQE  201
            +R  L+ L+  V+ + D+++  K++PR  ++    F+ L++  KN   RLY  YY+HR  
Sbjct  636  IREGLYSLISNVLFVADKKEEDKYHPRIGVQRDFVFRSLNEEEKNAFNRLYDQYYYHRHN  695

Query  202  SLWRQNALNTLPVLMNSSDMLTCGEDLGMIPACVNPVMQELGLIGLHIQRMPSEPGREFG  381
              W Q A+  LP L  S+ ML CGEDLGMIPACV+ VM +L ++ L IQRMP  P  EFG
Sbjct  696  EFWYQQAMKKLPQLTQSTRMLVCGEDLGMIPACVSSVMNDLRILSLEIQRMPKNPMYEFG  755

Query  382  IPSEYSYMTVCAPSCHDCSTLRAWWEEDEGRRRRYFQTVVGSGAVPPDECTPEIARFVLR  561
              +EY Y +VC  S HD STLR WWEED  + +RY+   +G   V P   TPE+   ++R
Sbjct  756  HLNEYPYRSVCTISTHDMSTLRGWWEEDYQQTQRYYNATLGHYGVAPTTATPELCEEIVR  815

Query  562  KHVESPSMWSIFPLQDLLALKEDYATRPAVEETINDPTXPRHYWRYRMHVTMESLLNDKS  741
             H+ S S+  I   QD L++   +      EE IN P+ PR+YWRYRMH+T+E L+  K+
Sbjct  816  NHLNSNSILCILSFQDWLSIDGKWRNPNVAEERINVPSNPRNYWRYRMHLTLEQLMKAKT  875

Query  742  L  744
            L
Sbjct  876  L  876



>ref|WP_008776252.1| 4-alpha-glucanotransferase [Bacteroides sp. 2_2_4]
 gb|EEO56352.1| putative 4-alpha-glucanotransferase [Bacteroides sp. 2_2_4]
Length=893

 Score =   229 bits (583),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 105/241 (44%), Positives = 147/241 (61%), Gaps = 0/241 (0%)
 Frame = +1

Query  22   LRRNLFDLLQEVVLIRDREDPRKFYPRFNLEDTSSFKGLDQHSKNVLKRLYYDYYFHRQE  201
            +R  L+ L+  V+ + D+++  K++PR  ++    F+ L++  KN   RLY  YY+HR  
Sbjct  636  IREGLYSLISNVLFVADKKEEGKYHPRIGVQRDFVFRSLNEEEKNAFNRLYDQYYYHRHN  695

Query  202  SLWRQNALNTLPVLMNSSDMLTCGEDLGMIPACVNPVMQELGLIGLHIQRMPSEPGREFG  381
              W Q A+  LP L  S+ ML CGEDLGMIPACV+ VM +L ++ L IQRMP  P  EFG
Sbjct  696  EFWYQQAMKKLPQLTQSTRMLVCGEDLGMIPACVSSVMNDLRILSLEIQRMPKNPMYEFG  755

Query  382  IPSEYSYMTVCAPSCHDCSTLRAWWEEDEGRRRRYFQTVVGSGAVPPDECTPEIARFVLR  561
              +EY Y +VC  S HD STLR WWEED  + +RY+   +G   V P   TPE+   ++R
Sbjct  756  HLNEYPYRSVCTISTHDMSTLRGWWEEDYQQTQRYYNATLGHYGVAPTTATPELCEEIVR  815

Query  562  KHVESPSMWSIFPLQDLLALKEDYATRPAVEETINDPTXPRHYWRYRMHVTMESLLNDKS  741
             H+ S S+  I   QD L++   +      EE IN P+ PR+YWRYRMH+T+E L+  K+
Sbjct  816  NHLNSNSILCILSFQDWLSIDGKWRNPNVAEERINVPSNPRNYWRYRMHLTLEQLMKAKT  875

Query  742  L  744
            L
Sbjct  876  L  876



>ref|WP_021891360.1| 4-alpha-glucanotransferase [Bacteroides sp. CAG:20]
 emb|CCX96152.1| 4-alpha-glucanotransferase [Bacteroides sp. CAG:20]
Length=294

 Score =   217 bits (552),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 103/238 (43%), Positives = 143/238 (60%), Gaps = 0/238 (0%)
 Frame = +1

Query  22   LRRNLFDLLQEVVLIRDREDPRKFYPRFNLEDTSSFKGLDQHSKNVLKRLYYDYYFHRQE  201
            +R  L  L+ +V+ + D + P  ++PR + + T  +  LD+  K+   RLY D+Y+HR +
Sbjct  41   IRDGLMRLIDDVLFLEDPDRPGYYHPRISAQHTHVYHSLDEDQKSCFNRLYDDFYYHRHD  100

Query  202  SLWRQNALNTLPVLMNSSDMLTCGEDLGMIPACVNPVMQELGLIGLHIQRMPSEPGREFG  381
              W+  AL  LP L++S+DML CGEDLGMIP CV  VM+ L ++ L IQRMP E  REFG
Sbjct  101  VFWKDEALRKLPALISSTDMLVCGEDLGMIPHCVPEVMERLQILSLEIQRMPKESWREFG  160

Query  382  IPSEYSYMTVCAPSCHDCSTLRAWWEEDEGRRRRYFQTVVGSGAVPPDECTPEIARFVLR  561
                Y Y +VC  S HD S +R WWEED  R +R+F  ++G     P  C P I   ++ 
Sbjct  161  DTWAYPYRSVCTTSTHDMSGIRVWWEEDRARTQRFFNEILGEQGEAPSFCEPWICEKIVE  220

Query  562  KHVESPSMWSIFPLQDLLALKEDYATRPAVEETINDPTXPRHYWRYRMHVTMESLLND  735
             ++ SPSM +I PLQD L++          EE IN P   RHYWRYRMH+++E LL +
Sbjct  221  LNLFSPSMLAILPLQDWLSIDGRLRRENPQEERINIPAHSRHYWRYRMHLSIEQLLEE  278



>dbj|GAE85599.1| 4-alpha-glucanotransferase [Bacteroides reticulotermitis JCM 
10512]
Length=390

 Score =   219 bits (559),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 107/252 (42%), Positives = 150/252 (60%), Gaps = 4/252 (2%)
 Frame = +1

Query  1    FVENEEK----LRRNLFDLLQEVVLIRDREDPRKFYPRFNLEDTSSFKGLDQHSKNVLKR  168
            F E E+     +R  L+ L+  V+ I D ++  K++PR +++    ++ L++  K+   +
Sbjct  122  FAEKEDADSKWVRDGLYALISNVLFIPDNKESGKYHPRISVQHDYIYRSLNEQEKDNFNK  181

Query  169  LYYDYYFHRQESLWRQNALNTLPVLMNSSDMLTCGEDLGMIPACVNPVMQELGLIGLHIQ  348
            LY  YY+ R    W   A+  LP L  S+ ML CGEDLGMIP CV  VM EL ++ L IQ
Sbjct  182  LYDHYYYQRHNDFWYHQAMKKLPQLTQSTRMLVCGEDLGMIPDCVAWVMNELRILSLEIQ  241

Query  349  RMPSEPGREFGIPSEYSYMTVCAPSCHDCSTLRAWWEEDEGRRRRYFQTVVGSGAVPPDE  528
            RMP +P  EFGIPSEY Y +VC  S HD STLR WWEED  + +R++ +++      P  
Sbjct  242  RMPKDPSNEFGIPSEYPYRSVCTISTHDMSTLRGWWEEDYQQTQRFYNSMLRHYGTAPTV  301

Query  529  CTPEIARFVLRKHVESPSMWSIFPLQDLLALKEDYATRPAVEETINDPTXPRHYWRYRMH  708
             TPE+   V+R H+ S SM  I  LQD L++   +      EE IN P+ PR+YWRYRMH
Sbjct  302  ATPELCEEVVRNHLNSNSMLCILALQDWLSIDAKWRNPDVKEERINVPSNPRNYWRYRMH  361

Query  709  VTMESLLNDKSL  744
            +T+E LL   +L
Sbjct  362  LTLEQLLKADNL  373



>ref|WP_004326207.1| 4-alpha-glucanotransferase [Bacteroides ovatus]
 gb|EIY61888.1| 4-alpha-glucanotransferase [Bacteroides ovatus CL03T12C18]
Length=893

 Score =   228 bits (582),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 105/241 (44%), Positives = 147/241 (61%), Gaps = 0/241 (0%)
 Frame = +1

Query  22   LRRNLFDLLQEVVLIRDREDPRKFYPRFNLEDTSSFKGLDQHSKNVLKRLYYDYYFHRQE  201
            +R  L+ L+  V+ + D+++  KF+PR  ++    F+ L++  KN   +LY  YY+HR  
Sbjct  636  IREGLYSLISNVLFVADKKEEGKFHPRIGVQRDFVFRLLNEEEKNAFNKLYDQYYYHRHN  695

Query  202  SLWRQNALNTLPVLMNSSDMLTCGEDLGMIPACVNPVMQELGLIGLHIQRMPSEPGREFG  381
              W Q A+  LP L  S+ ML CGEDLGMIPACV+ VM +L ++ L IQRMP  P  EFG
Sbjct  696  EFWYQQAMKKLPQLTQSTRMLVCGEDLGMIPACVSSVMNDLRILSLEIQRMPKNPMYEFG  755

Query  382  IPSEYSYMTVCAPSCHDCSTLRAWWEEDEGRRRRYFQTVVGSGAVPPDECTPEIARFVLR  561
              +EY Y +VC  S HD STLR WWEED  + +RY+   +G     P   TPE+   ++R
Sbjct  756  HLNEYPYRSVCTISTHDMSTLRGWWEEDYQQTQRYYNATLGHYGAAPTTATPELCEEIVR  815

Query  562  KHVESPSMWSIFPLQDLLALKEDYATRPAVEETINDPTXPRHYWRYRMHVTMESLLNDKS  741
             H+ S S+  I   QD L++ E +      EE IN P+ PR+YWRYRMH+T+E L+  K+
Sbjct  816  NHLNSNSILCILSFQDWLSIDEKWRNPNVTEERINVPSNPRNYWRYRMHLTLEQLMKAKT  875

Query  742  L  744
            L
Sbjct  876  L  876



>ref|WP_007751911.1| 4-alpha-glucanotransferase [Bacteroides finegoldii]
 gb|EEX45921.1| putative 4-alpha-glucanotransferase [Bacteroides finegoldii DSM 
17565]
Length=893

 Score =   228 bits (582),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 109/246 (44%), Positives = 147/246 (60%), Gaps = 0/246 (0%)
 Frame = +1

Query  7    ENEEKLRRNLFDLLQEVVLIRDREDPRKFYPRFNLEDTSSFKGLDQHSKNVLKRLYYDYY  186
            EN   +R  L+ L+  V+ I D ++  K++PR   +    F+ L +  KN   +LY  YY
Sbjct  631  ENSIWVRDGLYSLISNVLFIPDNKEQGKYHPRIGAQRDFIFRSLSEEDKNAFNKLYNQYY  690

Query  187  FHRQESLWRQNALNTLPVLMNSSDMLTCGEDLGMIPACVNPVMQELGLIGLHIQRMPSEP  366
            +HR    W Q A+  LP L  S+ ML CGEDLGMIPACV+ VM EL ++ L IQRMP EP
Sbjct  691  YHRHNDFWYQQAMKKLPQLTQSTRMLVCGEDLGMIPACVSSVMNELRILSLEIQRMPKEP  750

Query  367  GREFGIPSEYSYMTVCAPSCHDCSTLRAWWEEDEGRRRRYFQTVVGSGAVPPDECTPEIA  546
              EFG  +EY Y +VC  S HD STLR WWEED  + +RY+ T++G     P   TPE+ 
Sbjct  751  SYEFGHLNEYPYRSVCTISTHDMSTLRGWWEEDYQQTQRYYNTMLGHYGTAPAIATPELC  810

Query  547  RFVLRKHVESPSMWSIFPLQDLLALKEDYATRPAVEETINDPTXPRHYWRYRMHVTMESL  726
              ++R H+ S S+  I   QD L++   +      EE IN P+ PR+YWRYRMH+T+E L
Sbjct  811  EEIVRNHLNSNSILCILSFQDWLSVDGKWRNPNVEEERINVPSNPRNYWRYRMHITLEQL  870

Query  727  LNDKSL  744
            +  K L
Sbjct  871  MKAKEL  876



>emb|CBK66288.1| 4-alpha-glucanotransferase [Bacteroides xylanisolvens XB1A]
Length=893

 Score =   228 bits (582),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 104/241 (43%), Positives = 147/241 (61%), Gaps = 0/241 (0%)
 Frame = +1

Query  22   LRRNLFDLLQEVVLIRDREDPRKFYPRFNLEDTSSFKGLDQHSKNVLKRLYYDYYFHRQE  201
            +R  L+ L+  V+ + D+++  K++PR  ++    F+ L++  KN   +LY  YY+HR  
Sbjct  636  IREGLYSLISNVLFVADKKEESKYHPRIGVQRDFVFRSLNEEEKNAFNKLYDQYYYHRHN  695

Query  202  SLWRQNALNTLPVLMNSSDMLTCGEDLGMIPACVNPVMQELGLIGLHIQRMPSEPGREFG  381
              W Q A+  LP L  S+ ML CGEDLGMIPACV+ VM +L ++ L IQRMP  P  EFG
Sbjct  696  EFWYQQAMKKLPQLTQSTRMLVCGEDLGMIPACVSSVMNDLRILSLEIQRMPKNPMYEFG  755

Query  382  IPSEYSYMTVCAPSCHDCSTLRAWWEEDEGRRRRYFQTVVGSGAVPPDECTPEIARFVLR  561
              +EY Y +VC  S HD STLR WWEED  + +RY+   +G   V P   TPE+   ++R
Sbjct  756  HLNEYPYRSVCTISTHDMSTLRGWWEEDYQQTQRYYNATLGHYGVAPTTATPELCEEIVR  815

Query  562  KHVESPSMWSIFPLQDLLALKEDYATRPAVEETINDPTXPRHYWRYRMHVTMESLLNDKS  741
             H+ S S+  I   QD L++   +      EE IN P+ PR+YWRYRMH+T+E L+  K+
Sbjct  816  NHLNSNSILCILSFQDWLSIDGKWRNPNVAEERINVPSNPRNYWRYRMHLTLEQLMKAKT  875

Query  742  L  744
            L
Sbjct  876  L  876



>ref|WP_028786340.1| 4-alpha-glucanotransferase [Terrimonas ferruginea]
Length=897

 Score =   228 bits (582),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 104/245 (42%), Positives = 158/245 (64%), Gaps = 1/245 (0%)
 Frame = +1

Query  13   EEKLRRNLFDLLQEVVLIRDR-EDPRKFYPRFNLEDTSSFKGLDQHSKNVLKRLYYDYYF  189
            +EK++  L++L+  V+L  +   +   ++ R ++E T S++ L  H +  L+ LY +Y++
Sbjct  640  QEKIKFGLYELVANVILFEEEGSNGLSYHFRISMESTWSYRFLIPHVQQKLRELYINYFY  699

Query  190  HRQESLWRQNALNTLPVLMNSSDMLTCGEDLGMIPACVNPVMQELGLIGLHIQRMPSEPG  369
            HRQ+  W++ A+  LP L  +++ML CGEDLGM+P  V  VMQELG++ L IQRMP +P 
Sbjct  700  HRQDDFWKKEAMQKLPYLKAATNMLICGEDLGMVPHSVPEVMQELGILSLEIQRMPKDPS  759

Query  370  REFGIPSEYSYMTVCAPSCHDCSTLRAWWEEDEGRRRRYFQTVVGSGAVPPDECTPEIAR  549
            + F IPSE  Y++V  PS HD ST+RAWWEE+  R + ++  V+G     P  C   + R
Sbjct  760  KPFFIPSEAPYLSVITPSTHDMSTVRAWWEENRERTQNFYNHVLGQWGDAPFYCEAWVNR  819

Query  550  FVLRKHVESPSMWSIFPLQDLLALKEDYATRPAVEETINDPTXPRHYWRYRMHVTMESLL  729
             ++ +H+ SP+MWSIF LQDLL + +        EE IN+P  P+HYWRYRMH+ +E LL
Sbjct  820  AIVLQHLYSPAMWSIFQLQDLLGMSDTLRRENPQEERINNPAVPQHYWRYRMHIKLEDLL  879

Query  730  NDKSL  744
            N+ + 
Sbjct  880  NEDAF  884



>ref|WP_022199218.1| hypothetical protein [Bacteroides ovatus CAG:22]
 emb|CDB60131.1| putative uncharacterized protein [Bacteroides ovatus CAG:22]
Length=904

 Score =   228 bits (581),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 104/241 (43%), Positives = 147/241 (61%), Gaps = 0/241 (0%)
 Frame = +1

Query  22   LRRNLFDLLQEVVLIRDREDPRKFYPRFNLEDTSSFKGLDQHSKNVLKRLYYDYYFHRQE  201
            +R  L+ L+  V+ + D+++  K++PR  ++    F+ L++  KN   RLY  YY+HR  
Sbjct  647  IREGLYSLISNVLFVADKKEEGKYHPRIGVQRDFVFRSLNEEEKNAFNRLYDQYYYHRHN  706

Query  202  SLWRQNALNTLPVLMNSSDMLTCGEDLGMIPACVNPVMQELGLIGLHIQRMPSEPGREFG  381
              W Q A+  LP L  S+ ML CGEDLGMIPACV+ VM +L ++ L IQRMP  P  EFG
Sbjct  707  DFWYQQAMKKLPQLTQSTRMLVCGEDLGMIPACVSSVMNDLRILSLEIQRMPKNPMHEFG  766

Query  382  IPSEYSYMTVCAPSCHDCSTLRAWWEEDEGRRRRYFQTVVGSGAVPPDECTPEIARFVLR  561
              +EY Y +VC  S HD STLR WW+ED  + +RY+   +G   V P   TPE+   ++R
Sbjct  767  HLNEYPYRSVCTISTHDMSTLRGWWKEDYQQTQRYYNATLGHYGVAPTTATPELCEEIVR  826

Query  562  KHVESPSMWSIFPLQDLLALKEDYATRPAVEETINDPTXPRHYWRYRMHVTMESLLNDKS  741
             H+ S S+  I   QD L++   +      EE IN P+ PR+YWRYRMH+T+E L+  K+
Sbjct  827  NHLNSNSILCILSFQDWLSIDGKWRNPNVAEERINVPSNPRNYWRYRMHLTLEQLMKAKT  886

Query  742  L  744
            L
Sbjct  887  L  887



>ref|WP_008650141.1| 4-alpha-glucanotransferase [Bacteroides sp. 3_1_23]
 gb|EFI37956.1| 4-alpha-glucanotransferase [Bacteroides sp. 3_1_23]
Length=893

 Score =   228 bits (581),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 104/241 (43%), Positives = 147/241 (61%), Gaps = 0/241 (0%)
 Frame = +1

Query  22   LRRNLFDLLQEVVLIRDREDPRKFYPRFNLEDTSSFKGLDQHSKNVLKRLYYDYYFHRQE  201
            +R  L+ L+  V+ + D+++  K++PR  ++    F+ L++  KN   +LY  YY+HR  
Sbjct  636  IREGLYSLISNVLFVADKKEESKYHPRIGVQRDFVFRSLNEAEKNAFNKLYDQYYYHRHN  695

Query  202  SLWRQNALNTLPVLMNSSDMLTCGEDLGMIPACVNPVMQELGLIGLHIQRMPSEPGREFG  381
              W Q A+  LP L  S+ ML CGEDLGMIPACV+ VM +L ++ L IQRMP  P  EFG
Sbjct  696  EFWYQQAMKKLPQLTQSTRMLVCGEDLGMIPACVSSVMNDLRILSLEIQRMPKNPMYEFG  755

Query  382  IPSEYSYMTVCAPSCHDCSTLRAWWEEDEGRRRRYFQTVVGSGAVPPDECTPEIARFVLR  561
              +EY Y +VC  S HD STLR WWEED  + +RY+   +G   V P   TPE+   ++R
Sbjct  756  HLNEYPYRSVCTISTHDMSTLRGWWEEDYQQTQRYYNATLGHYGVAPTTATPELCEEIVR  815

Query  562  KHVESPSMWSIFPLQDLLALKEDYATRPAVEETINDPTXPRHYWRYRMHVTMESLLNDKS  741
             H+ S S+  I   QD L++   +      EE IN P+ PR+YWRYRMH+T+E L+  K+
Sbjct  816  NHLNSNSILCILSFQDWLSIDGKWRNPNVAEERINVPSNPRNYWRYRMHLTLEQLMKAKT  875

Query  742  L  744
            L
Sbjct  876  L  876



>ref|WP_005682663.1| 4-alpha-glucanotransferase [Bacteroides caccae]
 gb|EIY16987.1| 4-alpha-glucanotransferase [Bacteroides caccae CL03T12C61]
Length=893

 Score =   228 bits (581),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 106/241 (44%), Positives = 148/241 (61%), Gaps = 0/241 (0%)
 Frame = +1

Query  22   LRRNLFDLLQEVVLIRDREDPRKFYPRFNLEDTSSFKGLDQHSKNVLKRLYYDYYFHRQE  201
            +R  L+ L+  V+ + D+++  K++PR  ++    F+ L +  KN   +LY  YY+HR  
Sbjct  636  IREGLYSLISNVLFVPDKKEEGKYHPRIGVQRDFIFRSLSEAEKNAFNKLYDQYYYHRHN  695

Query  202  SLWRQNALNTLPVLMNSSDMLTCGEDLGMIPACVNPVMQELGLIGLHIQRMPSEPGREFG  381
            + W+Q A+  LP L  S+ ML CGEDLGMIP CV  VM +L ++ L IQRMP  P  EFG
Sbjct  696  AFWQQQAMKKLPQLTQSTRMLVCGEDLGMIPDCVASVMNDLRILSLEIQRMPKNPLHEFG  755

Query  382  IPSEYSYMTVCAPSCHDCSTLRAWWEEDEGRRRRYFQTVVGSGAVPPDECTPEIARFVLR  561
              SEY Y +VC  S HD STLR WWEED  + +RY+ T++G   + P   TPE+   V+R
Sbjct  756  HLSEYPYRSVCTISTHDMSTLRGWWEEDYQQTQRYYNTILGHYGIAPTVATPELCEEVVR  815

Query  562  KHVESPSMWSIFPLQDLLALKEDYATRPAVEETINDPTXPRHYWRYRMHVTMESLLNDKS  741
             H+ S S+  I  LQD L++   +      EE IN P+ PR+YWRYRMH+T+E L+  K 
Sbjct  816  NHLNSNSILCILSLQDWLSIDGKWRNPNVQEERINVPSNPRNYWRYRMHLTLEQLMKAKE  875

Query  742  L  744
            L
Sbjct  876  L  876



>ref|WP_007767042.1| 4-alpha-glucanotransferase [Bacteroides finegoldii]
 gb|EKJ89140.1| 4-alpha-glucanotransferase [Bacteroides finegoldii CL09T03C10]
Length=893

 Score =   228 bits (580),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 108/246 (44%), Positives = 147/246 (60%), Gaps = 0/246 (0%)
 Frame = +1

Query  7    ENEEKLRRNLFDLLQEVVLIRDREDPRKFYPRFNLEDTSSFKGLDQHSKNVLKRLYYDYY  186
            EN   +R  L+ L+  V+ I D ++  K++PR   +    F+ L +  KN   +LY  YY
Sbjct  631  ENSIWVRDGLYSLISNVLFIPDNKEQGKYHPRIGAQRDFIFRSLSEEDKNAFNKLYNQYY  690

Query  187  FHRQESLWRQNALNTLPVLMNSSDMLTCGEDLGMIPACVNPVMQELGLIGLHIQRMPSEP  366
            +HR    W Q A+  LP L  S+ ML CGEDLGMIPACV+ VM EL ++ L IQRMP +P
Sbjct  691  YHRHNDFWYQQAMKKLPQLTQSTRMLVCGEDLGMIPACVSSVMNELRILSLEIQRMPKDP  750

Query  367  GREFGIPSEYSYMTVCAPSCHDCSTLRAWWEEDEGRRRRYFQTVVGSGAVPPDECTPEIA  546
              EFG  +EY Y +VC  S HD STLR WWEED  + +RY+ T++G     P   TPE+ 
Sbjct  751  SYEFGHLNEYPYRSVCTISTHDMSTLRGWWEEDYQQTQRYYNTMLGHYGTAPAIATPELC  810

Query  547  RFVLRKHVESPSMWSIFPLQDLLALKEDYATRPAVEETINDPTXPRHYWRYRMHVTMESL  726
              ++R H+ S S+  I   QD L++   +      EE IN P+ PR+YWRYRMH+T+E L
Sbjct  811  EEIVRNHLNSNSILCILSFQDWLSIDGKWRNPNVEEERINVPSNPRNYWRYRMHITLEQL  870

Query  727  LNDKSL  744
            +  K L
Sbjct  871  MKAKEL  876



>ref|WP_027317965.1| 4-alpha-glucanotransferase [Bacteroides graminisolvens]
Length=903

 Score =   228 bits (580),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 106/242 (44%), Positives = 146/242 (60%), Gaps = 0/242 (0%)
 Frame = +1

Query  19   KLRRNLFDLLQEVVLIRDREDPRKFYPRFNLEDTSSFKGLDQHSKNVLKRLYYDYYFHRQ  198
            ++R  L+ L+ +V+ + D ++P K++PR  ++    ++ L+   K    RLY  YY+HR 
Sbjct  645  RVRDGLYSLISDVLFVPDHKEPHKYHPRIGVQHDFIYRALNDGEKEAFNRLYDQYYYHRH  704

Query  199  ESLWRQNALNTLPVLMNSSDMLTCGEDLGMIPACVNPVMQELGLIGLHIQRMPSEPGREF  378
               W Q A+  LP L  S+ ML CGEDLGMIP CV  VM +L ++ L IQRMP  P  EF
Sbjct  705  NEFWHQQAMKKLPQLTQSTRMLVCGEDLGMIPDCVAWVMNDLRILSLEIQRMPKNPAEEF  764

Query  379  GIPSEYSYMTVCAPSCHDCSTLRAWWEEDEGRRRRYFQTVVGSGAVPPDECTPEIARFVL  558
            G    Y Y +VC  S HD STLR WWEED  + +RY+  ++G     P   TPE+   V+
Sbjct  765  GNLHHYPYRSVCTISTHDMSTLRGWWEEDRQQTQRYYNNMLGHYGEAPQTATPEVCEEVV  824

Query  559  RKHVESPSMWSIFPLQDLLALKEDYATRPAVEETINDPTXPRHYWRYRMHVTMESLLNDK  738
            R H+ S S++ I  LQD L++  ++    A EE IN P  PRHYWRYRMH+T+E LL  +
Sbjct  825  RNHLYSQSIFCILSLQDWLSMDGNWRRTVADEERINIPANPRHYWRYRMHLTLEQLLGAE  884

Query  739  SL  744
            SL
Sbjct  885  SL  886



>ref|WP_005678735.1| 4-alpha-glucanotransferase [Bacteroides caccae]
 gb|EDM19789.1| putative 4-alpha-glucanotransferase [Bacteroides caccae ATCC 
43185]
Length=893

 Score =   227 bits (579),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 106/241 (44%), Positives = 148/241 (61%), Gaps = 0/241 (0%)
 Frame = +1

Query  22   LRRNLFDLLQEVVLIRDREDPRKFYPRFNLEDTSSFKGLDQHSKNVLKRLYYDYYFHRQE  201
            +R  L+ L+  V+ + D+++  K++PR  ++    F+ L +  KN   +LY  YY+HR  
Sbjct  636  IREGLYSLISNVLFVPDKKEEGKYHPRIGVQRDFIFRSLSEVEKNAFNKLYDQYYYHRHN  695

Query  202  SLWRQNALNTLPVLMNSSDMLTCGEDLGMIPACVNPVMQELGLIGLHIQRMPSEPGREFG  381
            + W+Q A+  LP L  S+ ML CGEDLGMIP CV  VM +L ++ L IQRMP  P  EFG
Sbjct  696  AFWQQQAMKKLPQLTQSTRMLVCGEDLGMIPDCVASVMNDLRILSLEIQRMPKNPLHEFG  755

Query  382  IPSEYSYMTVCAPSCHDCSTLRAWWEEDEGRRRRYFQTVVGSGAVPPDECTPEIARFVLR  561
              SEY Y +VC  S HD STLR WWEED  + +RY+ T++G   + P   TPE+   V+R
Sbjct  756  HLSEYPYRSVCTISTHDMSTLRGWWEEDYQQTQRYYNTILGHYGIAPTVATPELCEEVVR  815

Query  562  KHVESPSMWSIFPLQDLLALKEDYATRPAVEETINDPTXPRHYWRYRMHVTMESLLNDKS  741
             H+ S S+  I  LQD L++   +      EE IN P+ PR+YWRYRMH+T+E L+  K 
Sbjct  816  NHLNSNSILCILSLQDWLSIDGKWRNPNVQEERINVPSNPRNYWRYRMHLTLEQLMKAKE  875

Query  742  L  744
            L
Sbjct  876  L  876



>ref|WP_022021132.1| putative 4-alpha-glucanotransferase [Bacteroides sp. CAG:661]
 emb|CCZ47372.1| putative 4-alpha-glucanotransferase [Bacteroides sp. CAG:661]
Length=896

 Score =   227 bits (578),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 107/241 (44%), Positives = 143/241 (59%), Gaps = 0/241 (0%)
 Frame = +1

Query  22   LRRNLFDLLQEVVLIRDREDPRKFYPRFNLEDTSSFKGLDQHSKNVLKRLYYDYYFHRQE  201
            +R  L+ L+ +V+ + DR DP K++PR  ++    ++ L+   K    RLY  YY+HR  
Sbjct  643  IRDGLYALISDVLFVPDRTDPTKYHPRIGVQHDYIYRSLNDWEKAAFNRLYDQYYYHRHN  702

Query  202  SLWRQNALNTLPVLMNSSDMLTCGEDLGMIPACVNPVMQELGLIGLHIQRMPSEPGREFG  381
              W Q A+  LP L  S+ ML CGEDLGMIPACV  VM EL ++ L IQRMP +P +EFG
Sbjct  703  DFWGQQAMKKLPQLTQSTRMLVCGEDLGMIPACVAWVMNELRILSLEIQRMPKDPSQEFG  762

Query  382  IPSEYSYMTVCAPSCHDCSTLRAWWEEDEGRRRRYFQTVVGSGAVPPDECTPEIARFVLR  561
             P  Y Y +VC  S HD STLR WWEED  + +R++   +G     P   TPE+   V+R
Sbjct  763  HPEWYPYRSVCTISTHDMSTLRGWWEEDYQQTQRFYNHALGHYGTAPATATPELCEEVVR  822

Query  562  KHVESPSMWSIFPLQDLLALKEDYATRPAVEETINDPTXPRHYWRYRMHVTMESLLNDKS  741
             H+ S SM  I   QD +++        A EE IN P  PRHYWRYRMH+T+E L+   +
Sbjct  823  AHLTSNSMLCILSFQDWMSIDGQLRNPNAAEERINVPANPRHYWRYRMHLTLEQLMAADA  882

Query  742  L  744
            L
Sbjct  883  L  883



>ref|WP_008759757.1| 4-alpha-glucanotransferase [Bacteroides sp. 1_1_14]
 gb|EFI06219.1| 4-alpha-glucanotransferase [Bacteroides sp. 1_1_14]
Length=893

 Score =   226 bits (577),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 107/246 (43%), Positives = 151/246 (61%), Gaps = 0/246 (0%)
 Frame = +1

Query  7    ENEEKLRRNLFDLLQEVVLIRDREDPRKFYPRFNLEDTSSFKGLDQHSKNVLKRLYYDYY  186
            EN   +R  L+ L+ +V+ + D ++  K++PR  ++    F+ L++  +N   RLY  YY
Sbjct  631  ENSLWIRDGLYTLISDVLFVPDTKEKDKYHPRIGIQRDFIFRSLNEQEQNAFNRLYDQYY  690

Query  187  FHRQESLWRQNALNTLPVLMNSSDMLTCGEDLGMIPACVNPVMQELGLIGLHIQRMPSEP  366
            +HR    WRQ A+  LP L  S+ ML CGEDLGMIP CV+ VM +L ++ L IQRMP  P
Sbjct  691  YHRHNEFWRQQAMKKLPQLTQSTRMLVCGEDLGMIPDCVSSVMNDLRILSLEIQRMPKNP  750

Query  367  GREFGIPSEYSYMTVCAPSCHDCSTLRAWWEEDEGRRRRYFQTVVGSGAVPPDECTPEIA  546
              EFG  +EY Y +VC  S HD STLR WWEED  + +RY+ T++G     P   TPE+ 
Sbjct  751  MHEFGYLNEYPYRSVCTISTHDMSTLRGWWEEDYLQTQRYYNTMLGHYGTAPTVATPELC  810

Query  547  RFVLRKHVESPSMWSIFPLQDLLALKEDYATRPAVEETINDPTXPRHYWRYRMHVTMESL  726
              V+R H++S S+  I  LQD L++   +      EE IN P  PR+YWRYRMH+T+E L
Sbjct  811  EEVVRNHLKSNSILCILSLQDWLSIDGKWRNPNVQEERINVPANPRNYWRYRMHLTLEQL  870

Query  727  LNDKSL  744
            +  ++L
Sbjct  871  MKAEAL  876



>ref|WP_009123612.1| 4-alpha-glucanotransferase [Bacteroides fluxus]
 gb|EGF59701.1| putative 4-alpha-glucanotransferase [Bacteroides fluxus YIT 12057]
Length=896

 Score =   226 bits (577),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 106/241 (44%), Positives = 147/241 (61%), Gaps = 0/241 (0%)
 Frame = +1

Query  22   LRRNLFDLLQEVVLIRDREDPRKFYPRFNLEDTSSFKGLDQHSKNVLKRLYYDYYFHRQE  201
            +R  L+ L+ +V+ + DR D  K++PR  ++    ++ L+   K+   RLY  YY+HR  
Sbjct  643  IRDGLYALISDVLFVPDRTDSHKYHPRIGVQHDFVYRALNDWEKSAFNRLYDQYYYHRHN  702

Query  202  SLWRQNALNTLPVLMNSSDMLTCGEDLGMIPACVNPVMQELGLIGLHIQRMPSEPGREFG  381
              W + A+  LP L  S+ ML CGEDLGMIP CV  VM +L ++ L IQRMP +P +EFG
Sbjct  703  DFWGEQAMKKLPQLTQSTRMLVCGEDLGMIPDCVAWVMNDLRILSLEIQRMPKDPSQEFG  762

Query  382  IPSEYSYMTVCAPSCHDCSTLRAWWEEDEGRRRRYFQTVVGSGAVPPDECTPEIARFVLR  561
             P  Y Y +VC  S HD STLR WWEED  + +RY+ T++G     P   TPE+   V+R
Sbjct  763  HPDWYPYRSVCTISTHDMSTLRGWWEEDFQQTQRYYNTMLGHYGTAPAVATPELCEEVVR  822

Query  562  KHVESPSMWSIFPLQDLLALKEDYATRPAVEETINDPTXPRHYWRYRMHVTMESLLNDKS  741
             H+ S S+ SI  LQD +++   +      EE IN P  PRHYWRYRMH+T+E L+  +S
Sbjct  823  NHLYSNSILSILSLQDWMSMDGKWRNPNVQEERINIPANPRHYWRYRMHLTLEQLMKAES  882

Query  742  L  744
            L
Sbjct  883  L  883



>ref|WP_007486957.1| 4-alpha-glucanotransferase [Bacteroides nordii]
 gb|EIY45035.1| 4-alpha-glucanotransferase [Bacteroides nordii CL02T12C05]
Length=900

 Score =   226 bits (577),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 108/241 (45%), Positives = 148/241 (61%), Gaps = 0/241 (0%)
 Frame = +1

Query  22   LRRNLFDLLQEVVLIRDREDPRKFYPRFNLEDTSSFKGLDQHSKNVLKRLYYDYYFHRQE  201
            +R  L+ L+ +V+ + DR++  K++PR +++    ++ L+   K    RLY  YY+HR  
Sbjct  643  IRDGLYALISDVLFVPDRQEADKYHPRISVQHDFIYRSLNDWEKAAFNRLYDQYYYHRHN  702

Query  202  SLWRQNALNTLPVLMNSSDMLTCGEDLGMIPACVNPVMQELGLIGLHIQRMPSEPGREFG  381
              W+Q A+N LP L  S+ ML CGEDLGMIP CV  VM +L ++ L IQRMP  P  EFG
Sbjct  703  QFWQQQAMNKLPQLTQSTRMLVCGEDLGMIPDCVPWVMNDLRILSLEIQRMPKNPTYEFG  762

Query  382  IPSEYSYMTVCAPSCHDCSTLRAWWEEDEGRRRRYFQTVVGSGAVPPDECTPEIARFVLR  561
              +EY Y +VC  S HD STLR WWEED  + +RY+ T++G     P   TPE+   V+R
Sbjct  763  HLNEYPYRSVCTISTHDMSTLRGWWEEDYQQTQRYYNTMLGHYGAAPAVATPELCEEVVR  822

Query  562  KHVESPSMWSIFPLQDLLALKEDYATRPAVEETINDPTXPRHYWRYRMHVTMESLLNDKS  741
             H+ S S+  I  LQD LA+   +      EE IN P  PRHYWRYRMH+T+E L+  +S
Sbjct  823  NHLYSNSILCILSLQDWLAIDGKWRNPNVQEERINIPANPRHYWRYRMHLTLEQLMKAES  882

Query  742  L  744
            L
Sbjct  883  L  883



>ref|WP_008763941.1| 4-alpha-glucanotransferase [Bacteroides sp. 1_1_6]
 gb|EES66284.1| 4-alpha-glucanotransferase [Bacteroides sp. 1_1_6]
Length=893

 Score =   226 bits (577),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 107/246 (43%), Positives = 151/246 (61%), Gaps = 0/246 (0%)
 Frame = +1

Query  7    ENEEKLRRNLFDLLQEVVLIRDREDPRKFYPRFNLEDTSSFKGLDQHSKNVLKRLYYDYY  186
            EN   +R  L+ L+ +V+ + D ++  K++PR  ++    F+ L++  +N   RLY  YY
Sbjct  631  ENSLWIRDGLYTLISDVLFVPDTKEKDKYHPRIGIQRDFIFRSLNEQEQNAFNRLYDQYY  690

Query  187  FHRQESLWRQNALNTLPVLMNSSDMLTCGEDLGMIPACVNPVMQELGLIGLHIQRMPSEP  366
            +HR    WRQ A+  LP L  S+ ML CGEDLGMIP CV+ VM +L ++ L IQRMP  P
Sbjct  691  YHRHNEFWRQQAMKKLPQLTQSTRMLVCGEDLGMIPDCVSSVMNDLRILSLEIQRMPKNP  750

Query  367  GREFGIPSEYSYMTVCAPSCHDCSTLRAWWEEDEGRRRRYFQTVVGSGAVPPDECTPEIA  546
              EFG  +EY Y +VC  S HD STLR WWEED  + +RY+ T++G     P   TPE+ 
Sbjct  751  MHEFGYLNEYPYRSVCTISTHDMSTLRGWWEEDYLQTQRYYNTMLGHYGTAPTVATPELC  810

Query  547  RFVLRKHVESPSMWSIFPLQDLLALKEDYATRPAVEETINDPTXPRHYWRYRMHVTMESL  726
              V+R H++S S+  I  LQD L++   +      EE IN P+ PR+YWRYRMH+T+E L
Sbjct  811  EEVVRNHLKSNSILCILSLQDWLSIDGKWRNPNVQEERINVPSNPRNYWRYRMHLTLEQL  870

Query  727  LNDKSL  744
            +  + L
Sbjct  871  MKAEEL  876



>ref|WP_022825021.1| 4-alpha-glucanotransferase [Hymenobacter norwichensis]
Length=907

 Score =   226 bits (577),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 109/243 (45%), Positives = 160/243 (66%), Gaps = 3/243 (1%)
 Frame = +1

Query  22   LRRNLFDLLQEVVLIRDREDPRKFYPRFNLEDTSSFKGLDQHSKNVL-KRLYYDYYFHRQ  198
            L+  L+ L+ EV+ + D   P  ++PR  L  ++SF  LD+ S++ L   +Y D+++ R 
Sbjct  652  LKTGLYQLINEVLFVPDDLWPDHYHPRITLNKSTSFAELDETSRHRLYDDIYIDFFYKRH  711

Query  199  ESLWRQNALNTLPVLMNSSDMLTCGEDLGMIPACVNPVMQELGLIGLHIQRMPSEPGREF  378
            ES WR+  L  LP +  +++ML CGEDLGM+P  V  VM+ LG++GL+IQRMPS P  EF
Sbjct  712  ESFWREQGLVKLPPVRYATNMLICGEDLGMVPDSVPGVMKALGILGLNIQRMPSNPRTEF  771

Query  379  GIPSEYSYMTVCAPSCHDCSTLRAWWEEDEGRRRRYFQTVVG-SGAVPPDECTPEIARFV  555
            G P++  Y++V +P  HD STLR WWEED    +R+F+T++G  G   P  C P + R +
Sbjct  772  GHPNDAPYLSVVSPGSHDMSTLRGWWEEDREITQRFFETILGHHGEQAPYYCEPWVIREI  831

Query  556  LRKHVESPSMWSIFPLQDLLALKEDYATRPAVEETINDPTXPRHYWRYRMHVTMESLLND  735
            L +H+ SP+MW+IFPLQDLLAL  +       +E IN P  P+H+W+YR+HV +ES LND
Sbjct  832  LVQHLHSPAMWAIFPLQDLLALSPELRRNNPQDEQINVPANPQHFWKYRLHVPLES-LND  890

Query  736  KSL  744
             ++
Sbjct  891  NAV  893



>ref|WP_011108155.1| 4-alpha-glucanotransferase [Bacteroides thetaiotaomicron]
 ref|NP_811059.1| 4-alpha-glucanotransferase [Bacteroides thetaiotaomicron VPI-5482]
 gb|AAO77253.1| 4-alpha-glucanotransferase [Bacteroides thetaiotaomicron VPI-5482]
Length=893

 Score =   226 bits (576),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 107/246 (43%), Positives = 151/246 (61%), Gaps = 0/246 (0%)
 Frame = +1

Query  7    ENEEKLRRNLFDLLQEVVLIRDREDPRKFYPRFNLEDTSSFKGLDQHSKNVLKRLYYDYY  186
            EN   +R  L+ L+ +V+ + D ++  K++PR  ++    F+ L++  +N   RLY  YY
Sbjct  631  ENSLWIRDGLYTLISDVLFVPDTKEKDKYHPRIGIQRDFIFRSLNEQEQNAFNRLYDQYY  690

Query  187  FHRQESLWRQNALNTLPVLMNSSDMLTCGEDLGMIPACVNPVMQELGLIGLHIQRMPSEP  366
            +HR    WRQ A+  LP L  S+ ML CGEDLGMIP CV+ VM +L ++ L IQRMP  P
Sbjct  691  YHRHNEFWRQQAMKKLPQLTQSTRMLVCGEDLGMIPDCVSSVMNDLRILSLEIQRMPKNP  750

Query  367  GREFGIPSEYSYMTVCAPSCHDCSTLRAWWEEDEGRRRRYFQTVVGSGAVPPDECTPEIA  546
              EFG  +EY Y +VC  S HD STLR WWEED  + +RY+ T++G     P   TPE+ 
Sbjct  751  MHEFGYLNEYPYRSVCTISTHDMSTLRGWWEEDYLQTQRYYNTMLGHYGTAPTVATPELC  810

Query  547  RFVLRKHVESPSMWSIFPLQDLLALKEDYATRPAVEETINDPTXPRHYWRYRMHVTMESL  726
              V+R H++S S+  I  LQD L++   +      EE IN P+ PR+YWRYRMH+T+E L
Sbjct  811  EEVVRNHLKSNSILCILSLQDWLSIDGKWRNPNVQEERINVPSNPRNYWRYRMHLTLEQL  870

Query  727  LNDKSL  744
            +  + L
Sbjct  871  MKAEEL  876



>ref|WP_022471193.1| 4-alpha-glucanotransferase [Bacteroides thetaiotaomicron CAG:40]
 emb|CDE77044.1| 4-alpha-glucanotransferase [Bacteroides thetaiotaomicron CAG:40]
Length=893

 Score =   226 bits (576),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 107/246 (43%), Positives = 151/246 (61%), Gaps = 0/246 (0%)
 Frame = +1

Query  7    ENEEKLRRNLFDLLQEVVLIRDREDPRKFYPRFNLEDTSSFKGLDQHSKNVLKRLYYDYY  186
            EN   +R  L+ L+ +V+ + D ++  K++PR  ++    F+ L++  +N   RLY  YY
Sbjct  631  ENSLWIRDGLYTLISDVLFVPDTKEKDKYHPRIGIQRDFIFRSLNEQEQNAFNRLYDQYY  690

Query  187  FHRQESLWRQNALNTLPVLMNSSDMLTCGEDLGMIPACVNPVMQELGLIGLHIQRMPSEP  366
            +HR    WRQ A+  LP L  S+ ML CGEDLGMIP CV+ VM +L ++ L IQRMP  P
Sbjct  691  YHRHNEFWRQQAMKKLPQLTQSTRMLVCGEDLGMIPDCVSSVMNDLRILSLEIQRMPKNP  750

Query  367  GREFGIPSEYSYMTVCAPSCHDCSTLRAWWEEDEGRRRRYFQTVVGSGAVPPDECTPEIA  546
              EFG  +EY Y +VC  S HD STLR WWEED  + +RY+ T++G     P   TPE+ 
Sbjct  751  MHEFGYLNEYPYRSVCTISTHDMSTLRGWWEEDYLQTQRYYNTMLGHYGTAPTVATPELC  810

Query  547  RFVLRKHVESPSMWSIFPLQDLLALKEDYATRPAVEETINDPTXPRHYWRYRMHVTMESL  726
              V+R H++S S+  I  LQD L++   +      EE IN P+ PR+YWRYRMH+T+E L
Sbjct  811  EEVVRNHLKSNSILCILSLQDWLSIDGKWRNPNVQEERINVPSNPRNYWRYRMHLTLEQL  870

Query  727  LNDKSL  744
            +  + L
Sbjct  871  MKAEEL  876



>ref|WP_025866708.1| 4-alpha-glucanotransferase [Bacteroides nordii]
Length=900

 Score =   226 bits (576),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 108/241 (45%), Positives = 148/241 (61%), Gaps = 0/241 (0%)
 Frame = +1

Query  22   LRRNLFDLLQEVVLIRDREDPRKFYPRFNLEDTSSFKGLDQHSKNVLKRLYYDYYFHRQE  201
            +R  L+ L+ +V+ + DR++  K++PR +++    ++ L+   K    RLY  YY+HR  
Sbjct  643  IRDGLYALISDVLFVPDRQEADKYHPRISVQHDFIYRSLNDWEKAAFNRLYDQYYYHRHN  702

Query  202  SLWRQNALNTLPVLMNSSDMLTCGEDLGMIPACVNPVMQELGLIGLHIQRMPSEPGREFG  381
              W+Q A+N LP L  S+ ML CGEDLGMIP CV  VM +L ++ L IQRMP  P  EFG
Sbjct  703  QFWQQQAMNKLPQLTQSTRMLVCGEDLGMIPDCVPWVMNDLRILSLEIQRMPKNPTYEFG  762

Query  382  IPSEYSYMTVCAPSCHDCSTLRAWWEEDEGRRRRYFQTVVGSGAVPPDECTPEIARFVLR  561
              +EY Y +VC  S HD STLR WWEED  + +RY+ T++G     P   TPE+   V+R
Sbjct  763  HLNEYPYRSVCTISTHDMSTLRGWWEEDYQQTQRYYNTMLGHYGAAPAVATPELCEEVVR  822

Query  562  KHVESPSMWSIFPLQDLLALKEDYATRPAVEETINDPTXPRHYWRYRMHVTMESLLNDKS  741
             H+ S S+  I  LQD LA+   +      EE IN P  PRHYWRYRMH+T+E L+  +S
Sbjct  823  NHLYSNSILCILSLQDWLAIDGKWRNPNVQEERINIPANPRHYWRYRMHLTLEQLMKAES  882

Query  742  L  744
            L
Sbjct  883  L  883



>ref|WP_022302025.1| 4-alpha-glucanotransferase [Bacteroides faecis CAG:32]
 emb|CDC89519.1| 4-alpha-glucanotransferase [Bacteroides faecis CAG:32]
Length=893

 Score =   226 bits (576),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 106/246 (43%), Positives = 150/246 (61%), Gaps = 0/246 (0%)
 Frame = +1

Query  7    ENEEKLRRNLFDLLQEVVLIRDREDPRKFYPRFNLEDTSSFKGLDQHSKNVLKRLYYDYY  186
            EN   +R  L+ L+ +V+ + D ++  K++PR  ++    F+ L +  +N   +LY  YY
Sbjct  631  ENSIWIRDGLYTLISDVLFVPDTKEKDKYHPRIGIQRDFIFRSLSEQEQNAFNKLYDQYY  690

Query  187  FHRQESLWRQNALNTLPVLMNSSDMLTCGEDLGMIPACVNPVMQELGLIGLHIQRMPSEP  366
            +HR    WRQ A+  LP L  S+ ML CGEDLGMIP CV+ VM +L ++ L IQRMP  P
Sbjct  691  YHRHNEFWRQQAMKKLPQLTQSTRMLVCGEDLGMIPDCVSSVMNDLRILSLEIQRMPKNP  750

Query  367  GREFGIPSEYSYMTVCAPSCHDCSTLRAWWEEDEGRRRRYFQTVVGSGAVPPDECTPEIA  546
              EFG  +EY Y +VC  S HD STLR WWEED  + +RY+ T++G     P   TPE+ 
Sbjct  751  MHEFGYLNEYPYRSVCTISTHDMSTLRGWWEEDYLQTQRYYNTMLGHYGTSPTVATPELC  810

Query  547  RFVLRKHVESPSMWSIFPLQDLLALKEDYATRPAVEETINDPTXPRHYWRYRMHVTMESL  726
              ++R H++S S+  I  LQD L++   +      EE IN P+ PR+YWRYRMH+T+E L
Sbjct  811  EEIVRNHLKSNSILCILSLQDWLSIDGKWRNPNVQEERINVPSNPRNYWRYRMHLTLEQL  870

Query  727  LNDKSL  744
            +  K L
Sbjct  871  MKAKEL  876



>ref|WP_021936659.1| 4-alpha-glucanotransferase [Bacteroides sp. CAG:189]
 emb|CCY50513.1| 4-alpha-glucanotransferase [Bacteroides sp. CAG:189]
Length=914

 Score =   226 bits (576),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 107/241 (44%), Positives = 147/241 (61%), Gaps = 0/241 (0%)
 Frame = +1

Query  22   LRRNLFDLLQEVVLIRDREDPRKFYPRFNLEDTSSFKGLDQHSKNVLKRLYYDYYFHRQE  201
            +R  L+ L+ +V+ + DR++  K++PR  ++    ++ L+   K    RLY  YY+HR  
Sbjct  657  IRDGLYALISDVLFVPDRQEAHKYHPRIGVQHDFIYRSLNDWEKAAFNRLYDQYYYHRHN  716

Query  202  SLWRQNALNTLPVLMNSSDMLTCGEDLGMIPACVNPVMQELGLIGLHIQRMPSEPGREFG  381
              W+Q A+  LP L  S+ ML CGEDLGMIP CV  VM +L ++ L IQRMP  P  EFG
Sbjct  717  QFWQQQAMKKLPQLTQSTRMLVCGEDLGMIPDCVAWVMNDLRILSLEIQRMPKNPAYEFG  776

Query  382  IPSEYSYMTVCAPSCHDCSTLRAWWEEDEGRRRRYFQTVVGSGAVPPDECTPEIARFVLR  561
              +EY Y +VC  S HD STLR WWEED  + +RY+ T++G     P   TPE+   V+R
Sbjct  777  HLNEYPYRSVCTISTHDMSTLRGWWEEDYQQTQRYYNTMLGHYGSAPSTATPELCEEVVR  836

Query  562  KHVESPSMWSIFPLQDLLALKEDYATRPAVEETINDPTXPRHYWRYRMHVTMESLLNDKS  741
            KH+ S S+  I  LQD L++   +      EE IN P  PRHYWRYRMH+T+E L+  +S
Sbjct  837  KHLYSNSILCILSLQDWLSIDGRWRNPNVQEERINVPANPRHYWRYRMHLTLEQLMKAES  896

Query  742  L  744
            L
Sbjct  897  L  897



>ref|WP_016268614.1| 4-alpha-glucanotransferase [Bacteroides thetaiotaomicron]
 gb|EOS00873.1| 4-alpha-glucanotransferase [Bacteroides thetaiotaomicron dnLKV9]
Length=893

 Score =   226 bits (575),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 107/246 (43%), Positives = 150/246 (61%), Gaps = 0/246 (0%)
 Frame = +1

Query  7    ENEEKLRRNLFDLLQEVVLIRDREDPRKFYPRFNLEDTSSFKGLDQHSKNVLKRLYYDYY  186
            EN   +R  L+ L+ +V+ + D ++  K++PR  ++    F+ L++  +N   RLY  YY
Sbjct  631  ENSLWIRDGLYTLISDVLFVPDTKEKDKYHPRIGIQRDFIFRSLNEQEQNAFNRLYDQYY  690

Query  187  FHRQESLWRQNALNTLPVLMNSSDMLTCGEDLGMIPACVNPVMQELGLIGLHIQRMPSEP  366
            +HR    WRQ A+  LP L  S+ ML CGEDLGMIP CV+ VM +L ++ L IQRMP  P
Sbjct  691  YHRHNEFWRQQAMKKLPQLTQSTRMLVCGEDLGMIPDCVSSVMNDLRILSLEIQRMPKNP  750

Query  367  GREFGIPSEYSYMTVCAPSCHDCSTLRAWWEEDEGRRRRYFQTVVGSGAVPPDECTPEIA  546
              EFG  +EY Y +VC  S HD STLR WWEED  + +RY+ T++G     P   TPE+ 
Sbjct  751  MHEFGYLNEYPYRSVCTISTHDMSTLRGWWEEDYLQTQRYYNTMLGHYGTAPTVATPELC  810

Query  547  RFVLRKHVESPSMWSIFPLQDLLALKEDYATRPAVEETINDPTXPRHYWRYRMHVTMESL  726
              V+R H++S S+  I  LQD L++   +      EE IN P  PR+YWRYRMH+T+E L
Sbjct  811  EEVVRNHLKSNSILCILSLQDWLSIDGKWRNPNVQEERINVPANPRNYWRYRMHLTLEQL  870

Query  727  LNDKSL  744
            +  + L
Sbjct  871  MKAEEL  876



>ref|WP_044656205.1| 4-alpha-glucanotransferase, partial [Bacteroides acidifaciens]
Length=709

 Score =   224 bits (570),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 104/241 (43%), Positives = 144/241 (60%), Gaps = 0/241 (0%)
 Frame = +1

Query  22   LRRNLFDLLQEVVLIRDREDPRKFYPRFNLEDTSSFKGLDQHSKNVLKRLYYDYYFHRQE  201
            +R  L+ L+  V+ + DR++  K++PR  ++    F+ L +  KN   +LY  YY+HR  
Sbjct  452  IRDGLYSLISNVLFVPDRKEEGKYHPRIGVQRDFIFRALSEEDKNAFNKLYDQYYYHRHN  511

Query  202  SLWRQNALNTLPVLMNSSDMLTCGEDLGMIPACVNPVMQELGLIGLHIQRMPSEPGREFG  381
              W Q A+  LP L  S+ ML CGEDLGMIPACV  VM +L ++ L IQRMP  P  EFG
Sbjct  512  EFWYQQAMKKLPQLTQSTRMLVCGEDLGMIPACVPSVMNDLRILSLEIQRMPKNPMHEFG  571

Query  382  IPSEYSYMTVCAPSCHDCSTLRAWWEEDEGRRRRYFQTVVGSGAVPPDECTPEIARFVLR  561
               EY Y +VC  S HD STLR WWEED  + +RY+ T++G   + P   TPE+   ++R
Sbjct  572  HLKEYPYRSVCTISTHDMSTLRGWWEEDYQQTQRYYNTMLGHYGIAPTVATPELCEEIVR  631

Query  562  KHVESPSMWSIFPLQDLLALKEDYATRPAVEETINDPTXPRHYWRYRMHVTMESLLNDKS  741
             H+ S S+  I   QD L++          EE IN P+ PR+YWRYRMH+T+E L+  + 
Sbjct  632  NHLNSNSILCILSFQDWLSIDGKLRNPNVQEERINVPSNPRNYWRYRMHITLEQLMKAQK  691

Query  742  L  744
            L
Sbjct  692  L  692



>ref|WP_022041698.1| putative 4-alpha-glucanotransferase [Bacteroides caccae CAG:21]
 emb|CCZ74453.1| putative 4-alpha-glucanotransferase [Bacteroides caccae CAG:21]
Length=893

 Score =   226 bits (575),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 105/241 (44%), Positives = 147/241 (61%), Gaps = 0/241 (0%)
 Frame = +1

Query  22   LRRNLFDLLQEVVLIRDREDPRKFYPRFNLEDTSSFKGLDQHSKNVLKRLYYDYYFHRQE  201
            +R  L+ L+  V+ + D+++  K++PR  ++     + L +  KN   +LY  YY+HR  
Sbjct  636  IREGLYSLISNVLFVPDKKEEGKYHPRIGVQRDFILRSLSEAEKNAFNKLYDQYYYHRHN  695

Query  202  SLWRQNALNTLPVLMNSSDMLTCGEDLGMIPACVNPVMQELGLIGLHIQRMPSEPGREFG  381
            + W+Q A+  LP L  S+ ML CGEDLGMIP CV  VM +L ++ L IQRMP  P  EFG
Sbjct  696  AFWQQQAMKKLPQLTQSTRMLVCGEDLGMIPDCVASVMNDLRILSLEIQRMPKNPLHEFG  755

Query  382  IPSEYSYMTVCAPSCHDCSTLRAWWEEDEGRRRRYFQTVVGSGAVPPDECTPEIARFVLR  561
              SEY Y +VC  S HD STLR WWEED  + +RY+ T++G   + P   TPE+   V+R
Sbjct  756  HLSEYPYRSVCTISTHDMSTLRGWWEEDYQQTQRYYNTILGHYGIAPTVATPELCEEVVR  815

Query  562  KHVESPSMWSIFPLQDLLALKEDYATRPAVEETINDPTXPRHYWRYRMHVTMESLLNDKS  741
             H+ S S+  I  LQD L++   +      EE IN P+ PR+YWRYRMH+T+E L+  K 
Sbjct  816  NHLNSNSILCILSLQDWLSIDGKWRNPNVQEERINVPSNPRNYWRYRMHLTLEQLMKAKE  875

Query  742  L  744
            L
Sbjct  876  L  876



>ref|WP_025818998.1| 4-alpha-glucanotransferase [Bacteroides salyersiae]
Length=900

 Score =   226 bits (575),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 107/241 (44%), Positives = 146/241 (61%), Gaps = 0/241 (0%)
 Frame = +1

Query  22   LRRNLFDLLQEVVLIRDREDPRKFYPRFNLEDTSSFKGLDQHSKNVLKRLYYDYYFHRQE  201
            +R  L+ L+ +V+ + DR++  K++PR  ++    ++ L+   K    RLY  YY+HR  
Sbjct  643  IRDGLYALISDVLFVPDRQEAHKYHPRIGVQHDFIYRSLNDWEKAAFNRLYDQYYYHRHN  702

Query  202  SLWRQNALNTLPVLMNSSDMLTCGEDLGMIPACVNPVMQELGLIGLHIQRMPSEPGREFG  381
              W+Q A+  LP L  S+ ML CGEDLGMIP CV  VM +L ++ L IQRMP  P  EFG
Sbjct  703  QFWQQQAMKKLPQLTQSTRMLVCGEDLGMIPDCVAWVMNDLRILSLEIQRMPKNPAYEFG  762

Query  382  IPSEYSYMTVCAPSCHDCSTLRAWWEEDEGRRRRYFQTVVGSGAVPPDECTPEIARFVLR  561
               EY Y +VC  S HD STLR WWEED  + +RY+ T++G     P   TPE+   V+R
Sbjct  763  HLDEYPYRSVCTISTHDMSTLRGWWEEDYQQTQRYYNTMLGHYGSAPSTATPELCEEVVR  822

Query  562  KHVESPSMWSIFPLQDLLALKEDYATRPAVEETINDPTXPRHYWRYRMHVTMESLLNDKS  741
            KH+ S S+  I  LQD L++   +      EE IN P  PRHYWRYRMH+T+E L+  +S
Sbjct  823  KHLYSNSILCILSLQDWLSIDGRWRNPNVQEERINVPANPRHYWRYRMHLTLEQLMKAES  882

Query  742  L  744
            L
Sbjct  883  L  883



>gb|EIY56724.1| 4-alpha-glucanotransferase [Bacteroides salyersiae CL02T12C01]
Length=914

 Score =   226 bits (575),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 107/241 (44%), Positives = 146/241 (61%), Gaps = 0/241 (0%)
 Frame = +1

Query  22   LRRNLFDLLQEVVLIRDREDPRKFYPRFNLEDTSSFKGLDQHSKNVLKRLYYDYYFHRQE  201
            +R  L+ L+ +V+ + DR++  K++PR  ++    ++ L+   K    RLY  YY+HR  
Sbjct  657  IRDGLYALISDVLFVPDRQEAHKYHPRIGVQHDFIYRSLNDWEKAAFNRLYDQYYYHRHN  716

Query  202  SLWRQNALNTLPVLMNSSDMLTCGEDLGMIPACVNPVMQELGLIGLHIQRMPSEPGREFG  381
              W+Q A+  LP L  S+ ML CGEDLGMIP CV  VM +L ++ L IQRMP  P  EFG
Sbjct  717  QFWQQQAMKKLPQLTQSTRMLVCGEDLGMIPDCVAWVMNDLRILSLEIQRMPKNPAYEFG  776

Query  382  IPSEYSYMTVCAPSCHDCSTLRAWWEEDEGRRRRYFQTVVGSGAVPPDECTPEIARFVLR  561
               EY Y +VC  S HD STLR WWEED  + +RY+ T++G     P   TPE+   V+R
Sbjct  777  HLDEYPYRSVCTISTHDMSTLRGWWEEDYQQTQRYYNTMLGHYGSAPSTATPELCEEVVR  836

Query  562  KHVESPSMWSIFPLQDLLALKEDYATRPAVEETINDPTXPRHYWRYRMHVTMESLLNDKS  741
            KH+ S S+  I  LQD L++   +      EE IN P  PRHYWRYRMH+T+E L+  +S
Sbjct  837  KHLYSNSILCILSLQDWLSIDGRWRNPNVQEERINVPANPRHYWRYRMHLTLEQLMKAES  896

Query  742  L  744
            L
Sbjct  897  L  897



>ref|WP_044094117.1| 4-alpha-glucanotransferase [Bacteroides salyersiae]
Length=900

 Score =   225 bits (574),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 107/241 (44%), Positives = 146/241 (61%), Gaps = 0/241 (0%)
 Frame = +1

Query  22   LRRNLFDLLQEVVLIRDREDPRKFYPRFNLEDTSSFKGLDQHSKNVLKRLYYDYYFHRQE  201
            +R  L+ L+ +V+ + DR++  K++PR  ++    ++ L+   K    RLY  YY+HR  
Sbjct  643  IRDGLYALISDVLFVPDRQEAHKYHPRIGVQHDFIYRSLNDWEKAAFNRLYDQYYYHRHN  702

Query  202  SLWRQNALNTLPVLMNSSDMLTCGEDLGMIPACVNPVMQELGLIGLHIQRMPSEPGREFG  381
              W+Q A+  LP L  S+ ML CGEDLGMIP CV  VM +L ++ L IQRMP  P  EFG
Sbjct  703  QFWQQQAMKKLPQLTQSTRMLVCGEDLGMIPDCVAWVMNDLRILSLEIQRMPKNPAYEFG  762

Query  382  IPSEYSYMTVCAPSCHDCSTLRAWWEEDEGRRRRYFQTVVGSGAVPPDECTPEIARFVLR  561
               EY Y +VC  S HD STLR WWEED  + +RY+ T++G     P   TPE+   V+R
Sbjct  763  HLDEYPYRSVCTISTHDMSTLRGWWEEDYQQTQRYYNTMLGHYGSAPSTATPELCEEVVR  822

Query  562  KHVESPSMWSIFPLQDLLALKEDYATRPAVEETINDPTXPRHYWRYRMHVTMESLLNDKS  741
            KH+ S S+  I  LQD L++   +      EE IN P  PRHYWRYRMH+T+E L+  +S
Sbjct  823  KHLYSNSILCILSLQDWLSIDGRWRNPNVQEERINVPANPRHYWRYRMHLTLEQLMKAES  882

Query  742  L  744
            L
Sbjct  883  L  883



>gb|EOA48216.1| 4-alpha-glucanotransferase [Bacteroides salyersiae WAL 10018 
= DSM 18765 = JCM 12988]
Length=914

 Score =   225 bits (574),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 107/241 (44%), Positives = 146/241 (61%), Gaps = 0/241 (0%)
 Frame = +1

Query  22   LRRNLFDLLQEVVLIRDREDPRKFYPRFNLEDTSSFKGLDQHSKNVLKRLYYDYYFHRQE  201
            +R  L+ L+ +V+ + DR++  K++PR  ++    ++ L+   K    RLY  YY+HR  
Sbjct  657  IRDGLYALISDVLFVPDRQEAHKYHPRIGVQHDFIYRSLNDWEKAAFNRLYDQYYYHRHN  716

Query  202  SLWRQNALNTLPVLMNSSDMLTCGEDLGMIPACVNPVMQELGLIGLHIQRMPSEPGREFG  381
              W+Q A+  LP L  S+ ML CGEDLGMIP CV  VM +L ++ L IQRMP  P  EFG
Sbjct  717  QFWQQQAMKKLPQLTQSTRMLVCGEDLGMIPDCVAWVMNDLRILSLEIQRMPKNPAYEFG  776

Query  382  IPSEYSYMTVCAPSCHDCSTLRAWWEEDEGRRRRYFQTVVGSGAVPPDECTPEIARFVLR  561
               EY Y +VC  S HD STLR WWEED  + +RY+ T++G     P   TPE+   V+R
Sbjct  777  HLDEYPYRSVCTISTHDMSTLRGWWEEDYQQTQRYYNTMLGHYGSAPSTATPELCEEVVR  836

Query  562  KHVESPSMWSIFPLQDLLALKEDYATRPAVEETINDPTXPRHYWRYRMHVTMESLLNDKS  741
            KH+ S S+  I  LQD L++   +      EE IN P  PRHYWRYRMH+T+E L+  +S
Sbjct  837  KHLYSNSILCILSLQDWLSIDGRWRNPNVQEERINVPANPRHYWRYRMHLTLEQLMKAES  896

Query  742  L  744
            L
Sbjct  897  L  897



>ref|WP_010539382.1| 4-alpha-glucanotransferase [Bacteroides faecis]
Length=893

 Score =   225 bits (574),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 106/246 (43%), Positives = 149/246 (61%), Gaps = 0/246 (0%)
 Frame = +1

Query  7    ENEEKLRRNLFDLLQEVVLIRDREDPRKFYPRFNLEDTSSFKGLDQHSKNVLKRLYYDYY  186
            EN   +R  L+ L+ +V+ + D ++  K++PR  ++    F+ L +  +N   +LY  YY
Sbjct  631  ENSIWIRDGLYTLISDVLFVPDTKEKDKYHPRIGIQRDFIFRSLSEQEQNAFNKLYDQYY  690

Query  187  FHRQESLWRQNALNTLPVLMNSSDMLTCGEDLGMIPACVNPVMQELGLIGLHIQRMPSEP  366
            +HR    WRQ A+  LP L  S+ ML CGEDLGMIP CV  VM +L ++ L IQRMP  P
Sbjct  691  YHRHNEFWRQQAMKKLPQLTQSTRMLVCGEDLGMIPDCVPSVMNDLRILSLEIQRMPKNP  750

Query  367  GREFGIPSEYSYMTVCAPSCHDCSTLRAWWEEDEGRRRRYFQTVVGSGAVPPDECTPEIA  546
              EFG  +EY Y +VC  S HD STLR WWEED  + +RY+ T++G     P   TPE+ 
Sbjct  751  MHEFGYLNEYPYRSVCTISTHDMSTLRGWWEEDYLQTQRYYNTMLGHYGTAPTVATPELC  810

Query  547  RFVLRKHVESPSMWSIFPLQDLLALKEDYATRPAVEETINDPTXPRHYWRYRMHVTMESL  726
              ++R H++S S+  I  LQD L++   +      EE IN P+ PR+YWRYRMH+T+E L
Sbjct  811  EEIVRNHLKSNSILCILSLQDWLSIDGKWRNPNVQEERINVPSNPRNYWRYRMHLTLEQL  870

Query  727  LNDKSL  744
            +  K L
Sbjct  871  MKAKGL  876



>ref|WP_032568523.1| 4-alpha-glucanotransferase [Bacteroides fragilis]
 gb|EXZ47569.1| 4-alpha-glucanotransferase [Bacteroides fragilis str. 3397 N2]
Length=900

 Score =   225 bits (573),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 106/241 (44%), Positives = 145/241 (60%), Gaps = 0/241 (0%)
 Frame = +1

Query  22   LRRNLFDLLQEVVLIRDREDPRKFYPRFNLEDTSSFKGLDQHSKNVLKRLYYDYYFHRQE  201
            +R  L+ L+ +V+ + DR+DP  ++PR  ++    ++ L+   K    RLY  YY+HR  
Sbjct  643  VRDGLYALISDVLFVPDRKDPNLYHPRIGVQHDFIYRALNDWEKTAFNRLYDQYYYHRHN  702

Query  202  SLWRQNALNTLPVLMNSSDMLTCGEDLGMIPACVNPVMQELGLIGLHIQRMPSEPGREFG  381
              W+Q A+  LP L  S+ ML CGEDLGMIP CV  VM +L ++ L IQRMP  P  EFG
Sbjct  703  DFWQQQAMKKLPQLTQSTRMLVCGEDLGMIPDCVAWVMNDLRILSLEIQRMPKNPAEEFG  762

Query  382  IPSEYSYMTVCAPSCHDCSTLRAWWEEDEGRRRRYFQTVVGSGAVPPDECTPEIARFVLR  561
              +EY Y +VC  S HD STLR WWEED  + +RY+  ++G     P   TPE+   V+R
Sbjct  763  RLNEYPYRSVCTFSTHDMSTLRGWWEEDYQQTQRYYNQMLGHYGTAPAIATPELCEEVIR  822

Query  562  KHVESPSMWSIFPLQDLLALKEDYATRPAVEETINDPTXPRHYWRYRMHVTMESLLNDKS  741
             H+ S S+  I  LQD L++   +      EE IN P  PRHYWRYRMH+T+E L+  +S
Sbjct  823  NHLYSNSILCILSLQDWLSMDGKWRNPNVQEERINTPANPRHYWRYRMHLTLEQLMKAES  882

Query  742  L  744
            L
Sbjct  883  L  883



>ref|WP_044136693.1| 4-alpha-glucanotransferase [Bacteroides fragilis]
 gb|EXY26145.1| 4-alpha-glucanotransferase [Bacteroides fragilis str. 3397 T10]
Length=900

 Score =   225 bits (573),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 106/241 (44%), Positives = 145/241 (60%), Gaps = 0/241 (0%)
 Frame = +1

Query  22   LRRNLFDLLQEVVLIRDREDPRKFYPRFNLEDTSSFKGLDQHSKNVLKRLYYDYYFHRQE  201
            +R  L+ L+ +V+ + DR+DP  ++PR  ++    ++ L+   K    RLY  YY+HR  
Sbjct  643  VRDGLYALISDVLFVPDRKDPNLYHPRIGVQHDFIYRALNDWEKTAFNRLYDQYYYHRHN  702

Query  202  SLWRQNALNTLPVLMNSSDMLTCGEDLGMIPACVNPVMQELGLIGLHIQRMPSEPGREFG  381
              W+Q A+  LP L  S+ ML CGEDLGMIP CV  VM +L ++ L IQRMP  P  EFG
Sbjct  703  DFWQQQAMKKLPQLTQSTRMLVCGEDLGMIPDCVAWVMNDLRILSLEIQRMPKNPAEEFG  762

Query  382  IPSEYSYMTVCAPSCHDCSTLRAWWEEDEGRRRRYFQTVVGSGAVPPDECTPEIARFVLR  561
              +EY Y +VC  S HD STLR WWEED  + +RY+  ++G     P   TPE+   V+R
Sbjct  763  RLNEYPYRSVCTFSTHDMSTLRGWWEEDYQQTQRYYNQMLGHYGTAPAIATPELCEEVIR  822

Query  562  KHVESPSMWSIFPLQDLLALKEDYATRPAVEETINDPTXPRHYWRYRMHVTMESLLNDKS  741
             H+ S S+  I  LQD L++   +      EE IN P  PRHYWRYRMH+T+E L+  +S
Sbjct  823  NHLYSNSILCILSLQDWLSMDGKWRNPNVQEERINTPANPRHYWRYRMHLTLEQLMKAES  882

Query  742  L  744
            L
Sbjct  883  L  883



>ref|WP_032599403.1| 4-alpha-glucanotransferase [Bacteroides fragilis]
 gb|EXY68792.1| 4-alpha-glucanotransferase [Bacteroides fragilis str. 3986 T(B)9]
 gb|EYA55914.1| 4-alpha-glucanotransferase [Bacteroides fragilis str. 3986 T(B)13]
Length=900

 Score =   225 bits (573),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 106/241 (44%), Positives = 145/241 (60%), Gaps = 0/241 (0%)
 Frame = +1

Query  22   LRRNLFDLLQEVVLIRDREDPRKFYPRFNLEDTSSFKGLDQHSKNVLKRLYYDYYFHRQE  201
            +R  L+ L+ +V+ + DR+DP  ++PR  ++    ++ L+   K    RLY  YY+HR  
Sbjct  643  VRDGLYALISDVLFVPDRKDPNLYHPRIGVQHDFIYRALNDWEKTAFNRLYDQYYYHRHN  702

Query  202  SLWRQNALNTLPVLMNSSDMLTCGEDLGMIPACVNPVMQELGLIGLHIQRMPSEPGREFG  381
              W+Q A+  LP L  S+ ML CGEDLGMIP CV  VM +L ++ L IQRMP  P  EFG
Sbjct  703  DFWQQQAMKKLPQLTQSTRMLVCGEDLGMIPDCVAWVMNDLRILSLEIQRMPKNPAEEFG  762

Query  382  IPSEYSYMTVCAPSCHDCSTLRAWWEEDEGRRRRYFQTVVGSGAVPPDECTPEIARFVLR  561
              +EY Y +VC  S HD STLR WWEED  + +RY+  ++G     P   TPE+   V+R
Sbjct  763  RLNEYPYRSVCTFSTHDMSTLRGWWEEDYQQTQRYYNQMLGHYGTAPAIATPELCEEVIR  822

Query  562  KHVESPSMWSIFPLQDLLALKEDYATRPAVEETINDPTXPRHYWRYRMHVTMESLLNDKS  741
             H+ S S+  I  LQD L++   +      EE IN P  PRHYWRYRMH+T+E L+  +S
Sbjct  823  NHLYSNSILCILSLQDWLSMDGKWRNPNVQEERINTPANPRHYWRYRMHLTLEQLMKAES  882

Query  742  L  744
            L
Sbjct  883  L  883



>ref|WP_032580412.1| 4-alpha-glucanotransferase [Bacteroides fragilis]
 gb|EYA37785.1| starch binding domain protein [Bacteroides fragilis str. 20793-3]
Length=900

 Score =   224 bits (572),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 106/241 (44%), Positives = 145/241 (60%), Gaps = 0/241 (0%)
 Frame = +1

Query  22   LRRNLFDLLQEVVLIRDREDPRKFYPRFNLEDTSSFKGLDQHSKNVLKRLYYDYYFHRQE  201
            +R  L+ L+ +V+ + DR+DP  ++PR  ++    ++ L+   K    RLY  YY+HR  
Sbjct  643  VRDGLYALISDVLFVPDRKDPNLYHPRIGVQHDFIYRALNDWEKTAFNRLYDQYYYHRHN  702

Query  202  SLWRQNALNTLPVLMNSSDMLTCGEDLGMIPACVNPVMQELGLIGLHIQRMPSEPGREFG  381
              W+Q A+  LP L  S+ ML CGEDLGMIP CV  VM +L ++ L IQRMP  P  EFG
Sbjct  703  DFWQQQAMKKLPQLTQSTRMLVCGEDLGMIPDCVAWVMNDLRILSLEIQRMPKNPAEEFG  762

Query  382  IPSEYSYMTVCAPSCHDCSTLRAWWEEDEGRRRRYFQTVVGSGAVPPDECTPEIARFVLR  561
              +EY Y +VC  S HD STLR WWEED  + +RY+  ++G     P   TPE+   V+R
Sbjct  763  RLNEYPYRSVCTFSTHDMSTLRGWWEEDYQQTQRYYNQMLGHYGTAPAIATPELCEEVVR  822

Query  562  KHVESPSMWSIFPLQDLLALKEDYATRPAVEETINDPTXPRHYWRYRMHVTMESLLNDKS  741
             H+ S S+  I  LQD L++   +      EE IN P  PRHYWRYRMH+T+E L+  +S
Sbjct  823  NHLYSNSILCILSLQDWLSMDGKWRNPNVQEERINTPANPRHYWRYRMHLTLEQLMKAES  882

Query  742  L  744
            L
Sbjct  883  L  883



>ref|WP_042371062.1| 4-alpha-glucanotransferase [Bacteroidaceae bacterium MS4]
Length=906

 Score =   224 bits (572),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 105/246 (43%), Positives = 148/246 (60%), Gaps = 0/246 (0%)
 Frame = +1

Query  7    ENEEKLRRNLFDLLQEVVLIRDREDPRKFYPRFNLEDTSSFKGLDQHSKNVLKRLYYDYY  186
            E   +++  L+ L+ +V+ + D ++P+KF+PR  ++    ++ L++  K    RLY  YY
Sbjct  638  EESSRIKEGLYSLISDVLFVPDHKEPQKFHPRIGVQHDFIYRSLNEWEKTAFNRLYDQYY  697

Query  187  FHRQESLWRQNALNTLPVLMNSSDMLTCGEDLGMIPACVNPVMQELGLIGLHIQRMPSEP  366
            +HR    W Q A+  LP L  S+ ML CGEDLGMIP CV  VM +L ++ L IQRMP  P
Sbjct  698  YHRHNEFWHQQAMKKLPQLTQSTRMLVCGEDLGMIPECVAWVMNDLRILSLEIQRMPKNP  757

Query  367  GREFGIPSEYSYMTVCAPSCHDCSTLRAWWEEDEGRRRRYFQTVVGSGAVPPDECTPEIA  546
              EFG  +EY Y +VC  S HD STLR WWEED  + +RY+ +++G     P   T E+ 
Sbjct  758  TYEFGHLNEYPYRSVCTISTHDMSTLRGWWEEDYQQTQRYYNSMLGRHGNAPSVATAELC  817

Query  547  RFVLRKHVESPSMWSIFPLQDLLALKEDYATRPAVEETINDPTXPRHYWRYRMHVTMESL  726
              V+R H+ S S+  I   QD L++ E +      EE IN P+ PRHYWRYRMH+T+E L
Sbjct  818  EEVVRNHLYSNSILCILAWQDWLSIDETWRNPNVQEERINVPSNPRHYWRYRMHLTLEEL  877

Query  727  LNDKSL  744
            L  + L
Sbjct  878  LKAEGL  883



>ref|WP_009597356.1| hypothetical protein, partial [Alistipes sp. HGB5]
 gb|EFR57909.1| hypothetical protein HMPREF9720_2800, partial [Alistipes sp. 
HGB5]
Length=326

 Score =   214 bits (544),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 106/243 (44%), Positives = 147/243 (60%), Gaps = 6/243 (2%)
 Frame = +1

Query  19   KLRRNLFDLLQEVVLIRDREDPRK---FYPRFNLEDTSSFKGLDQHSKNVLKRLYYDYYF  189
            +LR  L  LL +V+ I   EDPR+   F+PR     T +++ LD   +    RLY D+++
Sbjct  71   RLREGLMTLLDDVLFI---EDPRRKGYFHPRIAPHSTHAYRRLDGERRAAFDRLYTDFFY  127

Query  190  HRQESLWRQNALNTLPVLMNSSDMLTCGEDLGMIPACVNPVMQELGLIGLHIQRMPSEPG  369
            HR    W+++AL  LPVL+++++MLTCGEDLGMIP  V   M+ L ++ L IQRMP  PG
Sbjct  128  HRHNRFWQESALRKLPVLLSATEMLTCGEDLGMIPDSVPETMRALQILSLEIQRMPKTPG  187

Query  370  REFGIPSEYSYMTVCAPSCHDCSTLRAWWEEDEGRRRRYFQTVVGSGAVPPDECTPEIAR  549
              F  P+ Y Y +VC  S HD + LRAWWEE+     R+++ V+G     P  C P I R
Sbjct  188  ELFADPAHYPYFSVCTTSTHDMNPLRAWWEENRELSERFYREVLGMEGDAPRTCEPWICR  247

Query  550  FVLRKHVESPSMWSIFPLQDLLALKEDYATRPAVEETINDPTXPRHYWRYRMHVTMESLL  729
             ++  H+ SP+M +I PLQD LA      +  A  E IN P  PR+YWRYRMH+T+E LL
Sbjct  248  RIVDMHLRSPAMLAILPLQDWLATDAALRSPHADRERINIPAAPRYYWRYRMHLTLEELL  307

Query  730  NDK  738
              +
Sbjct  308  RQE  310



>ref|WP_032598883.1| 4-alpha-glucanotransferase [Bacteroides fragilis]
 gb|EXZ71751.1| 4-alpha-glucanotransferase [Bacteroides fragilis str. 3976T8]
Length=900

 Score =   224 bits (572),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 106/241 (44%), Positives = 145/241 (60%), Gaps = 0/241 (0%)
 Frame = +1

Query  22   LRRNLFDLLQEVVLIRDREDPRKFYPRFNLEDTSSFKGLDQHSKNVLKRLYYDYYFHRQE  201
            +R  L+ L+ +V+ + DR+DP  ++PR  ++    ++ L+   K    RLY  YY+HR  
Sbjct  643  VRDGLYALISDVLFVPDRKDPNLYHPRIGVQHDFIYRALNDWEKTAFNRLYDQYYYHRHN  702

Query  202  SLWRQNALNTLPVLMNSSDMLTCGEDLGMIPACVNPVMQELGLIGLHIQRMPSEPGREFG  381
              W+Q A+  LP L  S+ ML CGEDLGMIP CV  VM +L ++ L IQRMP  P  EFG
Sbjct  703  DFWQQQAMKKLPQLTQSTRMLVCGEDLGMIPDCVAWVMNDLRILSLEIQRMPKNPAEEFG  762

Query  382  IPSEYSYMTVCAPSCHDCSTLRAWWEEDEGRRRRYFQTVVGSGAVPPDECTPEIARFVLR  561
              +EY Y +VC  S HD STLR WWEED  + +RY+  ++G     P   TPE+   V+R
Sbjct  763  RLNEYPYRSVCTFSTHDMSTLRGWWEEDYQQTQRYYNQMLGHYGTAPAIATPELCEEVVR  822

Query  562  KHVESPSMWSIFPLQDLLALKEDYATRPAVEETINDPTXPRHYWRYRMHVTMESLLNDKS  741
             H+ S S+  I  LQD L++   +      EE IN P  PRHYWRYRMH+T+E L+  +S
Sbjct  823  NHLYSNSILCILSLQDWLSMDGKWRNPNVQEERINTPANPRHYWRYRMHLTLEQLMKAES  882

Query  742  L  744
            L
Sbjct  883  L  883



>dbj|GAO45374.1| putative 4-alpha-glucanotransferase [Flavihumibacter petaseus 
NBRC 106054]
Length=893

 Score =   224 bits (572),  Expect = 6e-64, Method: Composition-based stats.
 Identities = 100/239 (42%), Positives = 152/239 (64%), Gaps = 1/239 (0%)
 Frame = +1

Query  25   RRNLFDLLQEVVLIR-DREDPRKFYPRFNLEDTSSFKGLDQHSKNVLKRLYYDYYFHRQE  201
            ++ L DL+  V+L      D ++F+ RF +EDTSSF+ L+ +++  LK LY DY+F RQ+
Sbjct  640  KQGLLDLMANVILFEVAGSDGQQFHFRFGIEDTSSFQALEHNTQQALKDLYVDYFFRRQD  699

Query  202  SLWRQNALNTLPVLMNSSDMLTCGEDLGMIPACVNPVMQELGLIGLHIQRMPSEPGREFG  381
              W+++A+  LP L  S++ML CGEDLG++P CV  VM++ G++ L IQRMP +P + F 
Sbjct  700  QQWQKDAMQKLPALKASTNMLICGEDLGLVPHCVPEVMEQTGILRLEIQRMPKDPSQTFF  759

Query  382  IPSEYSYMTVCAPSCHDCSTLRAWWEEDEGRRRRYFQTVVGSGAVPPDECTPEIARFVLR  561
             P+   Y++V  PS HD ST+R WWEED    ++++ T +      P  C P + + ++ 
Sbjct  760  HPASAPYLSVVTPSTHDMSTIRGWWEEDPQSIQQFYNTELSQWGQAPATCEPWLNKAIVL  819

Query  562  KHVESPSMWSIFPLQDLLALKEDYATRPAVEETINDPTXPRHYWRYRMHVTMESLLNDK  738
            +H+ SP+MW+IF LQDL     D        E IN P   +HYW+YRMH+T+E+LL +K
Sbjct  820  QHLHSPAMWAIFQLQDLFGSDGDLRVADPATERINVPAVAKHYWQYRMHLTLEALLKEK  878



>ref|WP_042985869.1| 4-alpha-glucanotransferase [Bacteroides fragilis]
 gb|EXZ93250.1| 4-alpha-glucanotransferase [Bacteroides fragilis str. Korea 419]
Length=900

 Score =   224 bits (572),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 106/241 (44%), Positives = 145/241 (60%), Gaps = 0/241 (0%)
 Frame = +1

Query  22   LRRNLFDLLQEVVLIRDREDPRKFYPRFNLEDTSSFKGLDQHSKNVLKRLYYDYYFHRQE  201
            +R  L+ L+ +V+ + DR+DP  ++PR  ++    ++ L+   K    RLY  YY+HR  
Sbjct  643  VRDGLYALISDVLFVPDRKDPNLYHPRIGVQHDFIYRALNDWEKTAFNRLYDQYYYHRHN  702

Query  202  SLWRQNALNTLPVLMNSSDMLTCGEDLGMIPACVNPVMQELGLIGLHIQRMPSEPGREFG  381
              W+Q A+  LP L  S+ ML CGEDLGMIP CV  VM +L ++ L IQRMP  P  EFG
Sbjct  703  DFWQQQAMKKLPQLTQSTRMLVCGEDLGMIPDCVAWVMNDLRILSLEIQRMPKNPAEEFG  762

Query  382  IPSEYSYMTVCAPSCHDCSTLRAWWEEDEGRRRRYFQTVVGSGAVPPDECTPEIARFVLR  561
              +EY Y +VC  S HD STLR WWEED  + +RY+  ++G     P   TPE+   V+R
Sbjct  763  RLNEYPYRSVCTFSTHDMSTLRGWWEEDYQQTQRYYNQMLGHYGTAPAIATPELCEEVVR  822

Query  562  KHVESPSMWSIFPLQDLLALKEDYATRPAVEETINDPTXPRHYWRYRMHVTMESLLNDKS  741
             H+ S S+  I  LQD L++   +      EE IN P  PRHYWRYRMH+T+E L+  +S
Sbjct  823  NHLYSNSILCILSLQDWLSMDGKWRNPNVQEERINTPANPRHYWRYRMHLTLEQLMKAES  882

Query  742  L  744
            L
Sbjct  883  L  883



>ref|WP_032602502.1| 4-alpha-glucanotransferase [Bacteroides fragilis]
 gb|EXY78921.1| 4-alpha-glucanotransferase [Bacteroides fragilis str. 3988 T1]
Length=900

 Score =   224 bits (572),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 106/241 (44%), Positives = 145/241 (60%), Gaps = 0/241 (0%)
 Frame = +1

Query  22   LRRNLFDLLQEVVLIRDREDPRKFYPRFNLEDTSSFKGLDQHSKNVLKRLYYDYYFHRQE  201
            +R  L+ L+ +V+ + DR+DP  ++PR  ++    ++ L+   K    RLY  YY+HR  
Sbjct  643  VRDGLYALISDVLFVPDRKDPNLYHPRIGVQHDFIYRALNDWEKTAFNRLYDQYYYHRHN  702

Query  202  SLWRQNALNTLPVLMNSSDMLTCGEDLGMIPACVNPVMQELGLIGLHIQRMPSEPGREFG  381
              W+Q A+  LP L  S+ ML CGEDLGMIP CV  VM +L ++ L IQRMP  P  EFG
Sbjct  703  DFWQQQAMKKLPQLTQSTRMLVCGEDLGMIPDCVAWVMNDLRILSLEIQRMPKNPAEEFG  762

Query  382  IPSEYSYMTVCAPSCHDCSTLRAWWEEDEGRRRRYFQTVVGSGAVPPDECTPEIARFVLR  561
              +EY Y +VC  S HD STLR WWEED  + +RY+  ++G     P   TPE+   V+R
Sbjct  763  RLNEYPYRSVCTFSTHDMSTLRGWWEEDYQQTQRYYNQMLGHYGAAPAIATPELCEEVVR  822

Query  562  KHVESPSMWSIFPLQDLLALKEDYATRPAVEETINDPTXPRHYWRYRMHVTMESLLNDKS  741
             H+ S S+  I  LQD L++   +      EE IN P  PRHYWRYRMH+T+E L+  +S
Sbjct  823  NHLYSNSILCILSLQDWLSMDGKWRNPNVQEERINTPANPRHYWRYRMHLTLEQLMKAES  882

Query  742  L  744
            L
Sbjct  883  L  883



>ref|WP_032590626.1| 4-alpha-glucanotransferase [Bacteroides fragilis]
 gb|EXZ08596.1| 4-alpha-glucanotransferase [Bacteroides fragilis str. DS-71]
Length=900

 Score =   224 bits (572),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 106/241 (44%), Positives = 145/241 (60%), Gaps = 0/241 (0%)
 Frame = +1

Query  22   LRRNLFDLLQEVVLIRDREDPRKFYPRFNLEDTSSFKGLDQHSKNVLKRLYYDYYFHRQE  201
            +R  L+ L+ +V+ + DR+DP  ++PR  ++    ++ L+   K    RLY  YY+HR  
Sbjct  643  VRDGLYALISDVLFVPDRKDPNLYHPRIGVQHDFIYRALNDWEKTAFNRLYDQYYYHRHN  702

Query  202  SLWRQNALNTLPVLMNSSDMLTCGEDLGMIPACVNPVMQELGLIGLHIQRMPSEPGREFG  381
              W+Q A+  LP L  S+ ML CGEDLGMIP CV  VM +L ++ L IQRMP  P  EFG
Sbjct  703  DFWQQQAMKKLPQLTQSTRMLVCGEDLGMIPDCVAWVMNDLRILSLEIQRMPKNPAEEFG  762

Query  382  IPSEYSYMTVCAPSCHDCSTLRAWWEEDEGRRRRYFQTVVGSGAVPPDECTPEIARFVLR  561
              +EY Y +VC  S HD STLR WWEED  + +RY+  ++G     P   TPE+   V+R
Sbjct  763  RLNEYPYRSVCTFSTHDMSTLRGWWEEDYQQTQRYYNQMLGHYGTAPAIATPELCEEVVR  822

Query  562  KHVESPSMWSIFPLQDLLALKEDYATRPAVEETINDPTXPRHYWRYRMHVTMESLLNDKS  741
             H+ S S+  I  LQD L++   +      EE IN P  PRHYWRYRMH+T+E L+  +S
Sbjct  823  NHLYSNSILCILSLQDWLSMDGKWRNPNVQEERINTPANPRHYWRYRMHLTLEQLMKAES  882

Query  742  L  744
            L
Sbjct  883  L  883



>ref|WP_032559946.1| 4-alpha-glucanotransferase [Bacteroides fragilis]
 gb|EXZ22980.1| 4-alpha-glucanotransferase [Bacteroides fragilis str. S13 L11]
Length=900

 Score =   224 bits (572),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 106/241 (44%), Positives = 145/241 (60%), Gaps = 0/241 (0%)
 Frame = +1

Query  22   LRRNLFDLLQEVVLIRDREDPRKFYPRFNLEDTSSFKGLDQHSKNVLKRLYYDYYFHRQE  201
            +R  L+ L+ +V+ + DR+DP  ++PR  ++    ++ L+   K    RLY  YY+HR  
Sbjct  643  VRDGLYALISDVLFVPDRKDPNLYHPRIGVQHDFIYRALNDWEKTAFNRLYDQYYYHRHN  702

Query  202  SLWRQNALNTLPVLMNSSDMLTCGEDLGMIPACVNPVMQELGLIGLHIQRMPSEPGREFG  381
              W+Q A+  LP L  S+ ML CGEDLGMIP CV  VM +L ++ L IQRMP  P  EFG
Sbjct  703  DFWQQQAMKKLPQLTQSTRMLVCGEDLGMIPDCVAWVMNDLRILSLEIQRMPKNPAEEFG  762

Query  382  IPSEYSYMTVCAPSCHDCSTLRAWWEEDEGRRRRYFQTVVGSGAVPPDECTPEIARFVLR  561
              +EY Y +VC  S HD STLR WWEED  + +RY+  ++G     P   TPE+   V+R
Sbjct  763  RLNEYPYRSVCTFSTHDMSTLRGWWEEDYQQTQRYYNQMLGHYGTAPAIATPELCEEVVR  822

Query  562  KHVESPSMWSIFPLQDLLALKEDYATRPAVEETINDPTXPRHYWRYRMHVTMESLLNDKS  741
             H+ S S+  I  LQD L++   +      EE IN P  PRHYWRYRMH+T+E L+  +S
Sbjct  823  NHLYSNSILCILSLQDWLSMDGKWRNPNVQEERINTPANPRHYWRYRMHLTLEQLMKAES  882

Query  742  L  744
            L
Sbjct  883  L  883



>ref|WP_032579362.1| 4-alpha-glucanotransferase [Bacteroides fragilis]
 gb|EXY82877.1| 4-alpha-glucanotransferase [Bacteroides fragilis str. 3996 N(B) 
6]
Length=900

 Score =   224 bits (572),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 106/241 (44%), Positives = 145/241 (60%), Gaps = 0/241 (0%)
 Frame = +1

Query  22   LRRNLFDLLQEVVLIRDREDPRKFYPRFNLEDTSSFKGLDQHSKNVLKRLYYDYYFHRQE  201
            +R  L+ L+ +V+ + DR+DP  ++PR  ++    ++ L+   K    RLY  YY+HR  
Sbjct  643  VRDGLYALISDVLFVPDRKDPNLYHPRIGVQHDFIYRALNDWEKTAFNRLYDQYYYHRHN  702

Query  202  SLWRQNALNTLPVLMNSSDMLTCGEDLGMIPACVNPVMQELGLIGLHIQRMPSEPGREFG  381
              W+Q A+  LP L  S+ ML CGEDLGMIP CV  VM +L ++ L IQRMP  P  EFG
Sbjct  703  DFWQQQAMKKLPQLTQSTRMLVCGEDLGMIPDCVAWVMNDLRILSLEIQRMPKNPAEEFG  762

Query  382  IPSEYSYMTVCAPSCHDCSTLRAWWEEDEGRRRRYFQTVVGSGAVPPDECTPEIARFVLR  561
              +EY Y +VC  S HD STLR WWEED  + +RY+  ++G     P   TPE+   V+R
Sbjct  763  RLNEYPYRSVCTFSTHDMSTLRGWWEEDYQQTQRYYNQMLGHYGTAPAIATPELCEEVVR  822

Query  562  KHVESPSMWSIFPLQDLLALKEDYATRPAVEETINDPTXPRHYWRYRMHVTMESLLNDKS  741
             H+ S S+  I  LQD L++   +      EE IN P  PRHYWRYRMH+T+E L+  +S
Sbjct  823  NHLYSNSILCILSLQDWLSMDGKWRNPNVQEERINTPANPRHYWRYRMHLTLEQLMKAES  882

Query  742  L  744
            L
Sbjct  883  L  883



>ref|WP_002562526.1| 4-alpha-glucanotransferase [Bacteroides sp. HPS0048]
 gb|EOA52583.1| 4-alpha-glucanotransferase [Bacteroides sp. HPS0048]
Length=900

 Score =   224 bits (571),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 107/241 (44%), Positives = 147/241 (61%), Gaps = 0/241 (0%)
 Frame = +1

Query  22   LRRNLFDLLQEVVLIRDREDPRKFYPRFNLEDTSSFKGLDQHSKNVLKRLYYDYYFHRQE  201
            +R  L+ L+ +V+ + DR++  K++PR +++    ++ L+   K    RLY  YY+HR  
Sbjct  643  IRDGLYALISDVLFVPDRQEADKYHPRISVQHDFIYRSLNDWEKAAFNRLYDQYYYHRHN  702

Query  202  SLWRQNALNTLPVLMNSSDMLTCGEDLGMIPACVNPVMQELGLIGLHIQRMPSEPGREFG  381
              W+Q A+N LP L  S+ ML CGEDLGMIP CV  VM +L ++ L IQRMP  P  EFG
Sbjct  703  QFWQQQAMNKLPQLTQSTRMLVCGEDLGMIPDCVPWVMNDLRILSLEIQRMPKNPTYEFG  762

Query  382  IPSEYSYMTVCAPSCHDCSTLRAWWEEDEGRRRRYFQTVVGSGAVPPDECTPEIARFVLR  561
              +EY Y +VC  S HD STLR WWEED  + +RY+ T++G     P   TPE+   V+R
Sbjct  763  HLNEYPYRSVCTISTHDMSTLRGWWEEDYQQTQRYYNTMLGHYGAAPAVATPELCEEVVR  822

Query  562  KHVESPSMWSIFPLQDLLALKEDYATRPAVEETINDPTXPRHYWRYRMHVTMESLLNDKS  741
             H+ S S+  I   QD LA+   +      EE IN P  PRHYWRYRMH+T+E L+  +S
Sbjct  823  NHLYSNSILCILSWQDWLAIDGKWRNPNVQEERINIPANPRHYWRYRMHLTLEQLMKAES  882

Query  742  L  744
            L
Sbjct  883  L  883



>ref|WP_029903959.1| hypothetical protein [Prevotella sp. 10(H)]
Length=891

 Score =   224 bits (571),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 105/237 (44%), Positives = 148/237 (62%), Gaps = 2/237 (1%)
 Frame = +1

Query  22   LRRNLFDLLQEVVLIRDREDPRKFYPRFNLEDTSSFKGLDQHSKNVLKRLYYDYYFHRQE  201
            +R  L+ L  EV+ +RD+ +P KF+PR   + + SFK LDQ ++N   R+Y D++F R  
Sbjct  637  IRDGLYSLCNEVLFVRDKREPEKFHPRITAQYSYSFKDLDQGTQNAFNRMYDDFFFRRHS  696

Query  202  SLWRQNALNTLPVLMNSSDMLTCGEDLGMIPACVNPVMQELGLIGLHIQRMPSEPGREFG  381
              WR+ A+  LP L+ S+DML CGEDLGM+P  V  VM EL ++ L I+RMP      F 
Sbjct  697  QFWREQAMIKLPPLIKSTDMLVCGEDLGMVPESVPSVMNELQILSLEIERMPKAMNLLFN  756

Query  382  IPSEYSYMTVCAPSCHDCSTLRAWWEEDEGRRRRYFQTVVGSGAVPPDECTPEIARFVLR  561
                  YM+VC  S HD S +R WWEED    ++Y+  ++G   + P+ECT +I   ++ 
Sbjct  757  DLHTLPYMSVCTTSTHDMSPIRLWWEEDRVNIQKYYNQILGRDGIAPEECTADICSQIVS  816

Query  562  KHVESPSMWSIFPLQDLLALKEDYATRP-AVEETINDPTXPRHYWRYRMHVTMESLL  729
             H+ SPSM ++ PLQD L++ +D   RP A EE IN P  P HYWRYRMH+T+E L+
Sbjct  817  NHLNSPSMLAVLPLQDWLSI-DDTLRRPEADEERINIPAVPMHYWRYRMHLTLEELI  872



>ref|WP_032587218.1| 4-alpha-glucanotransferase [Bacteroides fragilis]
 gb|EXZ52270.1| 4-alpha-glucanotransferase [Bacteroides fragilis str. 3397 T14]
 gb|EYA42185.1| 4-alpha-glucanotransferase [Bacteroides fragilis str. 3397 N3]
Length=900

 Score =   224 bits (571),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 106/241 (44%), Positives = 145/241 (60%), Gaps = 0/241 (0%)
 Frame = +1

Query  22   LRRNLFDLLQEVVLIRDREDPRKFYPRFNLEDTSSFKGLDQHSKNVLKRLYYDYYFHRQE  201
            +R  L+ L+ +V+ + DR+DP  ++PR  ++    ++ L+   K    RLY  YY+HR  
Sbjct  643  VRDGLYALISDVLFVPDRKDPNLYHPRIGVQHDFIYRALNDWEKTAFNRLYDQYYYHRHN  702

Query  202  SLWRQNALNTLPVLMNSSDMLTCGEDLGMIPACVNPVMQELGLIGLHIQRMPSEPGREFG  381
              W+Q A+  LP L  S+ ML CGEDLGMIP CV  VM +L ++ L IQRMP  P  EFG
Sbjct  703  DFWQQQAMKKLPQLTQSTRMLVCGEDLGMIPDCVAWVMNDLRILSLEIQRMPKNPAEEFG  762

Query  382  IPSEYSYMTVCAPSCHDCSTLRAWWEEDEGRRRRYFQTVVGSGAVPPDECTPEIARFVLR  561
              +EY Y +VC  S HD STLR WWEED  + +RY+  ++G     P   TPE+   V+R
Sbjct  763  RLNEYPYRSVCTFSTHDMSTLRGWWEEDYQQTQRYYNQMLGHYGTAPAIATPELCEEVIR  822

Query  562  KHVESPSMWSIFPLQDLLALKEDYATRPAVEETINDPTXPRHYWRYRMHVTMESLLNDKS  741
             H+ S S+  I  LQD L++   +      EE IN P  PRHYWRYRMH+T+E L+  +S
Sbjct  823  NHLYSNSILCILSLQDWLSMDGKWRNPNVQEERINIPANPRHYWRYRMHLTLEQLMKAES  882

Query  742  L  744
            L
Sbjct  883  L  883



>ref|WP_008657591.1| MULTISPECIES: 4-alpha-glucanotransferase [Bacteroides]
 gb|EES85805.1| 4-alpha-glucanotransferase [Bacteroides sp. 3_2_5]
 gb|EYA51407.1| 4-alpha-glucanotransferase [Bacteroides fragilis str. 3986 N(B)22]
 gb|EYE66615.1| 4-alpha-glucanotransferase [Bacteroides fragilis str. 3986 N3]
Length=900

 Score =   224 bits (571),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 106/241 (44%), Positives = 145/241 (60%), Gaps = 0/241 (0%)
 Frame = +1

Query  22   LRRNLFDLLQEVVLIRDREDPRKFYPRFNLEDTSSFKGLDQHSKNVLKRLYYDYYFHRQE  201
            +R  L+ L+ +V+ + DR+DP  ++PR  ++    ++ L+   K    RLY  YY+HR  
Sbjct  643  VRDGLYALISDVLFVPDRKDPNLYHPRIGVQHDFIYRALNDWEKTAFNRLYDQYYYHRHN  702

Query  202  SLWRQNALNTLPVLMNSSDMLTCGEDLGMIPACVNPVMQELGLIGLHIQRMPSEPGREFG  381
              W+Q A+  LP L  S+ ML CGEDLGMIP CV  VM +L ++ L IQRMP  P  EFG
Sbjct  703  DFWQQQAMKKLPQLTQSTRMLVCGEDLGMIPDCVAWVMNDLRILSLEIQRMPKNPAEEFG  762

Query  382  IPSEYSYMTVCAPSCHDCSTLRAWWEEDEGRRRRYFQTVVGSGAVPPDECTPEIARFVLR  561
              +EY Y +VC  S HD STLR WWEED  + +RY+  ++G     P   TPE+   V+R
Sbjct  763  RLNEYPYRSVCTFSTHDMSTLRGWWEEDYQQTQRYYNQMLGHYGTAPAIATPELCEEVIR  822

Query  562  KHVESPSMWSIFPLQDLLALKEDYATRPAVEETINDPTXPRHYWRYRMHVTMESLLNDKS  741
             H+ S S+  I  LQD L++   +      EE IN P  PRHYWRYRMH+T+E L+  +S
Sbjct  823  NHLYSNSILCILSLQDWLSMDGKWRNPNVQEERINIPANPRHYWRYRMHLTLEQLMKAES  882

Query  742  L  744
            L
Sbjct  883  L  883



>ref|WP_032574699.1| 4-alpha-glucanotransferase [Bacteroides fragilis]
 gb|EYA28751.1| 4-alpha-glucanotransferase [Bacteroides fragilis str. 1009-4-F 
#10]
 gb|EYA32376.1| 4-alpha-glucanotransferase [Bacteroides fragilis str. 1009-4-F 
#7]
Length=900

 Score =   224 bits (571),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 106/241 (44%), Positives = 145/241 (60%), Gaps = 0/241 (0%)
 Frame = +1

Query  22   LRRNLFDLLQEVVLIRDREDPRKFYPRFNLEDTSSFKGLDQHSKNVLKRLYYDYYFHRQE  201
            +R  L+ L+ +V+ + DR+DP  ++PR  ++    ++ L+   K    RLY  YY+HR  
Sbjct  643  VRDGLYALISDVLFVPDRKDPNLYHPRIGVQHDFIYRALNDWEKTAFNRLYDQYYYHRHN  702

Query  202  SLWRQNALNTLPVLMNSSDMLTCGEDLGMIPACVNPVMQELGLIGLHIQRMPSEPGREFG  381
              W+Q A+  LP L  S+ ML CGEDLGMIP CV  VM +L ++ L IQRMP  P  EFG
Sbjct  703  DFWQQQAMKKLPQLTQSTRMLVCGEDLGMIPDCVAWVMNDLRILSLEIQRMPKNPAEEFG  762

Query  382  IPSEYSYMTVCAPSCHDCSTLRAWWEEDEGRRRRYFQTVVGSGAVPPDECTPEIARFVLR  561
              +EY Y +VC  S HD STLR WWEED  + +RY+  ++G     P   TPE+   V+R
Sbjct  763  RLNEYPYRSVCTFSTHDMSTLRGWWEEDYQQTQRYYNQMLGHYGTAPAIATPELCEEVIR  822

Query  562  KHVESPSMWSIFPLQDLLALKEDYATRPAVEETINDPTXPRHYWRYRMHVTMESLLNDKS  741
             H+ S S+  I  LQD L++   +      EE IN P  PRHYWRYRMH+T+E L+  +S
Sbjct  823  NHLYSNSILCILSLQDWLSMDGKWRNPNVQEERINIPANPRHYWRYRMHLTLEQLMKAES  882

Query  742  L  744
            L
Sbjct  883  L  883



>ref|WP_032594741.1| 4-alpha-glucanotransferase [Bacteroides fragilis]
 gb|EXZ03986.1| 4-alpha-glucanotransferase [Bacteroides fragilis str. DS-208]
Length=900

 Score =   224 bits (571),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 106/241 (44%), Positives = 145/241 (60%), Gaps = 0/241 (0%)
 Frame = +1

Query  22   LRRNLFDLLQEVVLIRDREDPRKFYPRFNLEDTSSFKGLDQHSKNVLKRLYYDYYFHRQE  201
            +R  L+ L+ +V+ + DR+DP  ++PR  ++    ++ L+   K    RLY  YY+HR  
Sbjct  643  VRDGLYALISDVLFVPDRKDPNLYHPRIGVQHDFIYRALNDWEKTAFNRLYDQYYYHRHN  702

Query  202  SLWRQNALNTLPVLMNSSDMLTCGEDLGMIPACVNPVMQELGLIGLHIQRMPSEPGREFG  381
              W+Q A+  LP L  S+ ML CGEDLGMIP CV  VM +L ++ L IQRMP  P  EFG
Sbjct  703  DFWQQQAMKKLPQLTQSTRMLVCGEDLGMIPDCVAWVMNDLRILSLEIQRMPKNPAEEFG  762

Query  382  IPSEYSYMTVCAPSCHDCSTLRAWWEEDEGRRRRYFQTVVGSGAVPPDECTPEIARFVLR  561
              +EY Y +VC  S HD STLR WWEED  + +RY+  ++G     P   TPE+   V+R
Sbjct  763  RLNEYPYRSVCTFSTHDMSTLRGWWEEDYQQTQRYYNQMLGHYGTAPAIATPELCEEVVR  822

Query  562  KHVESPSMWSIFPLQDLLALKEDYATRPAVEETINDPTXPRHYWRYRMHVTMESLLNDKS  741
             H+ S S+  I  LQD L++   +      EE IN P  PRHYWRYRMH+T+E L+  +S
Sbjct  823  NHLYSNSILCILSLQDWLSMDGKWRNPNVQEERINIPANPRHYWRYRMHLTLEQLMKAES  882

Query  742  L  744
            L
Sbjct  883  L  883



>ref|WP_032557362.1| 4-alpha-glucanotransferase [Bacteroides fragilis]
 gb|EXY98954.1| 4-alpha-glucanotransferase [Bacteroides fragilis str. DS-166]
 gb|EXZ27022.1| 4-alpha-glucanotransferase [Bacteroides fragilis str. S36L11]
 gb|EYA05729.1| 4-alpha-glucanotransferase [Bacteroides fragilis str. S6L3]
 gb|EYA07806.1| 4-alpha-glucanotransferase [Bacteroides fragilis str. S6R6]
 gb|EYA83269.1| 4-alpha-glucanotransferase [Bacteroides fragilis str. S36L12]
 gb|EYA83517.1| 4-alpha-glucanotransferase [Bacteroides fragilis str. S36L12]
 gb|EYA86715.1| 4-alpha-glucanotransferase [Bacteroides fragilis str. S36L12]
 gb|EYA89047.1| 4-alpha-glucanotransferase [Bacteroides fragilis str. S36L5]
 gb|EYA98752.1| 4-alpha-glucanotransferase [Bacteroides fragilis str. S6L8]
 gb|EYB03421.1| 4-alpha-glucanotransferase [Bacteroides fragilis str. S6R5]
 gb|EYE44446.1| 4-alpha-glucanotransferase [Bacteroides fragilis str. S6L5]
 gb|EYE50263.1| 4-alpha-glucanotransferase [Bacteroides fragilis str. S6R8]
Length=900

 Score =   224 bits (570),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 106/241 (44%), Positives = 145/241 (60%), Gaps = 0/241 (0%)
 Frame = +1

Query  22   LRRNLFDLLQEVVLIRDREDPRKFYPRFNLEDTSSFKGLDQHSKNVLKRLYYDYYFHRQE  201
            +R  L+ L+ +V+ + DR+DP  ++PR  ++    ++ L+   K    RLY  YY+HR  
Sbjct  643  VRDGLYALISDVLFVPDRKDPNLYHPRIGVQHDFIYRALNDWEKTAFNRLYDQYYYHRHN  702

Query  202  SLWRQNALNTLPVLMNSSDMLTCGEDLGMIPACVNPVMQELGLIGLHIQRMPSEPGREFG  381
              W+Q A+  LP L  S+ ML CGEDLGMIP CV  VM +L ++ L IQRMP  P  EFG
Sbjct  703  DFWQQQAMKKLPQLTQSTRMLVCGEDLGMIPDCVAWVMNDLRILSLEIQRMPKNPAEEFG  762

Query  382  IPSEYSYMTVCAPSCHDCSTLRAWWEEDEGRRRRYFQTVVGSGAVPPDECTPEIARFVLR  561
              +EY Y +VC  S HD STLR WWEED  + +RY+  ++G     P   TPE+   V+R
Sbjct  763  RLNEYPYRSVCTFSTHDMSTLRGWWEEDYQQTQRYYNQMLGHYGTAPAIATPELCEEVVR  822

Query  562  KHVESPSMWSIFPLQDLLALKEDYATRPAVEETINDPTXPRHYWRYRMHVTMESLLNDKS  741
             H+ S S+  I  LQD L++   +      EE IN P  PRHYWRYRMH+T+E L+  +S
Sbjct  823  NHLYSNSILCILSLQDWLSMDGKWRNPNVQEERINIPANPRHYWRYRMHLTLEQLMKAES  882

Query  742  L  744
            L
Sbjct  883  L  883



>ref|WP_044820056.1| 4-alpha-glucanotransferase [Bacteroides fragilis]
Length=900

 Score =   224 bits (570),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 106/241 (44%), Positives = 145/241 (60%), Gaps = 0/241 (0%)
 Frame = +1

Query  22   LRRNLFDLLQEVVLIRDREDPRKFYPRFNLEDTSSFKGLDQHSKNVLKRLYYDYYFHRQE  201
            +R  L+ L+ +V+ + DR+DP  ++PR  ++    ++ L+   K    RLY  YY+HR  
Sbjct  643  VRDGLYALISDVLFVPDRKDPNLYHPRIGVQHDFIYRALNDWEKTAFNRLYDQYYYHRHN  702

Query  202  SLWRQNALNTLPVLMNSSDMLTCGEDLGMIPACVNPVMQELGLIGLHIQRMPSEPGREFG  381
              W+Q A+  LP L  S+ ML CGEDLGMIP CV  VM +L ++ L IQRMP  P  EFG
Sbjct  703  DFWQQQAMKKLPQLTQSTRMLVCGEDLGMIPDCVAWVMNDLRILSLEIQRMPKNPAEEFG  762

Query  382  IPSEYSYMTVCAPSCHDCSTLRAWWEEDEGRRRRYFQTVVGSGAVPPDECTPEIARFVLR  561
              +EY Y +VC  S HD STLR WWEED  + +RY+  ++G     P   TPE+   V+R
Sbjct  763  RLNEYPYRSVCTFSTHDMSTLRGWWEEDYQQTQRYYNQMLGHYGTAPAIATPELCEEVVR  822

Query  562  KHVESPSMWSIFPLQDLLALKEDYATRPAVEETINDPTXPRHYWRYRMHVTMESLLNDKS  741
             H+ S S+  I  LQD L++   +      EE IN P  PRHYWRYRMH+T+E L+  +S
Sbjct  823  NHLYSNSILCILSLQDWLSMDGKWRNPNVQEERINIPANPRHYWRYRMHLTLEQLMKAES  882

Query  742  L  744
            L
Sbjct  883  L  883



>ref|WP_032573835.1| 4-alpha-glucanotransferase [Bacteroides fragilis]
 gb|EYB17796.1| 4-alpha-glucanotransferase [Bacteroides fragilis str. I1345]
Length=900

 Score =   224 bits (570),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 106/241 (44%), Positives = 145/241 (60%), Gaps = 0/241 (0%)
 Frame = +1

Query  22   LRRNLFDLLQEVVLIRDREDPRKFYPRFNLEDTSSFKGLDQHSKNVLKRLYYDYYFHRQE  201
            +R  L+ L+ +V+ + DR+DP  ++PR  ++    ++ L+   K    RLY  YY+HR  
Sbjct  643  VRDGLYALISDVLFVPDRKDPNLYHPRIGVQHDFIYRALNDWEKTAFNRLYDQYYYHRHN  702

Query  202  SLWRQNALNTLPVLMNSSDMLTCGEDLGMIPACVNPVMQELGLIGLHIQRMPSEPGREFG  381
              W+Q A+  LP L  S+ ML CGEDLGMIP CV  VM +L ++ L IQRMP  P  EFG
Sbjct  703  DFWQQQAMKKLPQLTQSTRMLVCGEDLGMIPDCVAWVMNDLRILSLEIQRMPKNPAEEFG  762

Query  382  IPSEYSYMTVCAPSCHDCSTLRAWWEEDEGRRRRYFQTVVGSGAVPPDECTPEIARFVLR  561
              +EY Y +VC  S HD STLR WWEED  + +RY+  ++G     P   TPE+   V+R
Sbjct  763  RLNEYPYRSVCTFSTHDMSTLRGWWEEDYQQTQRYYNQMLGHYGTAPAIATPELCEEVVR  822

Query  562  KHVESPSMWSIFPLQDLLALKEDYATRPAVEETINDPTXPRHYWRYRMHVTMESLLNDKS  741
             H+ S S+  I  LQD L++   +      EE IN P  PRHYWRYRMH+T+E L+  +S
Sbjct  823  NHLYSNSILCILSLQDWLSMDGKWRNPNVQEERINIPANPRHYWRYRMHLTLEQLMKAES  882

Query  742  L  744
            L
Sbjct  883  L  883



>ref|WP_005817470.1| 4-alpha-glucanotransferase [Bacteroides fragilis]
 gb|EKA83755.1| 4-alpha-glucanotransferase [Bacteroides fragilis HMW 615]
 gb|EXZ56744.1| 4-alpha-glucanotransferase [Bacteroides fragilis str. 3719 A10]
Length=900

 Score =   224 bits (570),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 106/241 (44%), Positives = 145/241 (60%), Gaps = 0/241 (0%)
 Frame = +1

Query  22   LRRNLFDLLQEVVLIRDREDPRKFYPRFNLEDTSSFKGLDQHSKNVLKRLYYDYYFHRQE  201
            +R  L+ L+ +V+ + DR+DP  ++PR  ++    ++ L+   K    RLY  YY+HR  
Sbjct  643  VRDGLYALISDVLFVPDRKDPNLYHPRIGVQHDFIYRALNDWEKTAFNRLYDQYYYHRHN  702

Query  202  SLWRQNALNTLPVLMNSSDMLTCGEDLGMIPACVNPVMQELGLIGLHIQRMPSEPGREFG  381
              W+Q A+  LP L  S+ ML CGEDLGMIP CV  VM +L ++ L IQRMP  P  EFG
Sbjct  703  DFWQQQAMKKLPQLTQSTRMLVCGEDLGMIPDCVAWVMNDLRILSLEIQRMPKNPAEEFG  762

Query  382  IPSEYSYMTVCAPSCHDCSTLRAWWEEDEGRRRRYFQTVVGSGAVPPDECTPEIARFVLR  561
              +EY Y +VC  S HD STLR WWEED  + +RY+  ++G     P   TPE+   V+R
Sbjct  763  RLNEYPYRSVCTFSTHDMSTLRGWWEEDYQQTQRYYNQMLGHYGAAPAIATPELCEEVVR  822

Query  562  KHVESPSMWSIFPLQDLLALKEDYATRPAVEETINDPTXPRHYWRYRMHVTMESLLNDKS  741
             H+ S S+  I  LQD L++   +      EE IN P  PRHYWRYRMH+T+E L+  +S
Sbjct  823  NHLYSNSILCILSLQDWLSMDGKWRNPNVQEERINIPANPRHYWRYRMHLTLEQLMKAES  882

Query  742  L  744
            L
Sbjct  883  L  883



>ref|WP_032601322.1| 4-alpha-glucanotransferase [Bacteroides fragilis]
 gb|EXZ12624.1| 4-alpha-glucanotransferase [Bacteroides fragilis str. Ds-233]
Length=900

 Score =   224 bits (570),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 106/241 (44%), Positives = 145/241 (60%), Gaps = 0/241 (0%)
 Frame = +1

Query  22   LRRNLFDLLQEVVLIRDREDPRKFYPRFNLEDTSSFKGLDQHSKNVLKRLYYDYYFHRQE  201
            +R  L+ L+ +V+ + DR+DP  ++PR  ++    ++ L+   K    RLY  YY+HR  
Sbjct  643  VRDGLYALISDVLFVPDRKDPNLYHPRIGVQHDFIYRALNDWEKTAFNRLYDQYYYHRHN  702

Query  202  SLWRQNALNTLPVLMNSSDMLTCGEDLGMIPACVNPVMQELGLIGLHIQRMPSEPGREFG  381
              W+Q A+  LP L  S+ ML CGEDLGMIP CV  VM +L ++ L IQRMP  P  EFG
Sbjct  703  DFWQQQAMKKLPQLTQSTRMLVCGEDLGMIPDCVAWVMNDLRILSLEIQRMPKNPAEEFG  762

Query  382  IPSEYSYMTVCAPSCHDCSTLRAWWEEDEGRRRRYFQTVVGSGAVPPDECTPEIARFVLR  561
              +EY Y +VC  S HD STLR WWEED  + +RY+  ++G     P   TPE+   V+R
Sbjct  763  RLNEYPYRSVCTFSTHDMSTLRGWWEEDYQQTQRYYNQMLGHYGTAPAIATPELCEEVVR  822

Query  562  KHVESPSMWSIFPLQDLLALKEDYATRPAVEETINDPTXPRHYWRYRMHVTMESLLNDKS  741
             H+ S S+  I  LQD L++   +      EE IN P  PRHYWRYRMH+T+E L+  +S
Sbjct  823  NHLYSNSILCILSLQDWLSMDGKWRNPNVQEERINIPANPRHYWRYRMHLTLEQLMKAES  882

Query  742  L  744
            L
Sbjct  883  L  883



>ref|WP_032529126.1| 4-alpha-glucanotransferase [Bacteroides fragilis]
 gb|EXY39391.1| 4-alpha-glucanotransferase [Bacteroides fragilis str. 3774 T13]
 gb|KER52034.1| 4-alpha-glucanotransferase [Bacteroides fragilis]
Length=900

 Score =   224 bits (570),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 106/241 (44%), Positives = 145/241 (60%), Gaps = 0/241 (0%)
 Frame = +1

Query  22   LRRNLFDLLQEVVLIRDREDPRKFYPRFNLEDTSSFKGLDQHSKNVLKRLYYDYYFHRQE  201
            +R  L+ L+ +V+ + DR+DP  ++PR  ++    ++ L+   K    RLY  YY+HR  
Sbjct  643  VRDGLYALISDVLFVPDRKDPNLYHPRIGVQHDFIYRALNDWEKTAFNRLYDQYYYHRHN  702

Query  202  SLWRQNALNTLPVLMNSSDMLTCGEDLGMIPACVNPVMQELGLIGLHIQRMPSEPGREFG  381
              W+Q A+  LP L  S+ ML CGEDLGMIP CV  VM +L ++ L IQRMP  P  EFG
Sbjct  703  DFWQQQAMKKLPQLTQSTRMLVCGEDLGMIPDCVAWVMNDLRILSLEIQRMPKNPAEEFG  762

Query  382  IPSEYSYMTVCAPSCHDCSTLRAWWEEDEGRRRRYFQTVVGSGAVPPDECTPEIARFVLR  561
              +EY Y +VC  S HD STLR WWEED  + +RY+  ++G     P   TPE+   V+R
Sbjct  763  RLNEYPYRSVCTFSTHDMSTLRGWWEEDYQQTQRYYNQMLGHYGAAPAIATPELCEEVVR  822

Query  562  KHVESPSMWSIFPLQDLLALKEDYATRPAVEETINDPTXPRHYWRYRMHVTMESLLNDKS  741
             H+ S S+  I  LQD L++   +      EE IN P  PRHYWRYRMH+T+E L+  +S
Sbjct  823  NHLYSNSILCILSLQDWLSMDGKWRNPNVQEERINIPANPRHYWRYRMHLTLEQLMKAES  882

Query  742  L  744
            L
Sbjct  883  L  883



>ref|WP_011203461.1| 4-alpha-glucanotransferase [Bacteroides fragilis]
 ref|YP_101104.1| 4-alpha-glucanotransferase [Bacteroides fragilis YCH46]
 dbj|BAD50570.1| 4-alpha-glucanotransferase [Bacteroides fragilis YCH46]
 gb|EXZ62079.1| 4-alpha-glucanotransferase [Bacteroides fragilis str. 3725 D9(v)]
 gb|EYA60320.1| 4-alpha-glucanotransferase [Bacteroides fragilis str. A7 (UDC12-2)]
 gb|AKA53268.1| 4-alpha-glucanotransferase [Bacteroides fragilis]
Length=900

 Score =   224 bits (570),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 106/241 (44%), Positives = 145/241 (60%), Gaps = 0/241 (0%)
 Frame = +1

Query  22   LRRNLFDLLQEVVLIRDREDPRKFYPRFNLEDTSSFKGLDQHSKNVLKRLYYDYYFHRQE  201
            +R  L+ L+ +V+ + DR+DP  ++PR  ++    ++ L+   K    RLY  YY+HR  
Sbjct  643  VRDGLYALISDVLFVPDRKDPNLYHPRIGVQHDFIYRALNDWEKTAFNRLYDQYYYHRHN  702

Query  202  SLWRQNALNTLPVLMNSSDMLTCGEDLGMIPACVNPVMQELGLIGLHIQRMPSEPGREFG  381
              W+Q A+  LP L  S+ ML CGEDLGMIP CV  VM +L ++ L IQRMP  P  EFG
Sbjct  703  DFWQQQAMKKLPQLTQSTRMLVCGEDLGMIPDCVAWVMNDLRILSLEIQRMPKNPAEEFG  762

Query  382  IPSEYSYMTVCAPSCHDCSTLRAWWEEDEGRRRRYFQTVVGSGAVPPDECTPEIARFVLR  561
              +EY Y +VC  S HD STLR WWEED  + +RY+  ++G     P   TPE+   V+R
Sbjct  763  RLNEYPYRSVCTFSTHDMSTLRGWWEEDYQQTQRYYNQMLGHYGTAPAIATPELCEEVVR  822

Query  562  KHVESPSMWSIFPLQDLLALKEDYATRPAVEETINDPTXPRHYWRYRMHVTMESLLNDKS  741
             H+ S S+  I  LQD L++   +      EE IN P  PRHYWRYRMH+T+E L+  +S
Sbjct  823  NHLYSNSILCILSLQDWLSMDGKWRNPNVQEERINIPANPRHYWRYRMHLTLEQLMKAES  882

Query  742  L  744
            L
Sbjct  883  L  883



>ref|WP_009292585.1| MULTISPECIES: 4-alpha-glucanotransferase [Bacteroides]
 gb|EGN05957.1| hypothetical protein HMPREF1018_03051 [Bacteroides sp. 2_1_56FAA]
 gb|EYA69737.1| 4-alpha-glucanotransferase [Bacteroides fragilis str. S24L15]
 gb|EYA74200.1| 4-alpha-glucanotransferase [Bacteroides fragilis str. S24L26]
 gb|EYA78760.1| 4-alpha-glucanotransferase [Bacteroides fragilis str. S24L34]
Length=900

 Score =   224 bits (570),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 106/241 (44%), Positives = 145/241 (60%), Gaps = 0/241 (0%)
 Frame = +1

Query  22   LRRNLFDLLQEVVLIRDREDPRKFYPRFNLEDTSSFKGLDQHSKNVLKRLYYDYYFHRQE  201
            +R  L+ L+ +V+ + DR+DP  ++PR  ++    ++ L+   K    RLY  YY+HR  
Sbjct  643  VRDGLYALISDVLFVPDRKDPNLYHPRIGVQHDFIYRALNDWEKTAFNRLYDQYYYHRHN  702

Query  202  SLWRQNALNTLPVLMNSSDMLTCGEDLGMIPACVNPVMQELGLIGLHIQRMPSEPGREFG  381
              W+Q A+  LP L  S+ ML CGEDLGMIP CV  VM +L ++ L IQRMP  P  EFG
Sbjct  703  DFWQQQAMKKLPQLTQSTRMLVCGEDLGMIPDCVAWVMNDLRILSLEIQRMPKNPAEEFG  762

Query  382  IPSEYSYMTVCAPSCHDCSTLRAWWEEDEGRRRRYFQTVVGSGAVPPDECTPEIARFVLR  561
              +EY Y +VC  S HD STLR WWEED  + +RY+  ++G     P   TPE+   V+R
Sbjct  763  RLNEYPYRSVCTFSTHDMSTLRGWWEEDYQQTQRYYNQMLGHYGTAPAIATPELCEEVVR  822

Query  562  KHVESPSMWSIFPLQDLLALKEDYATRPAVEETINDPTXPRHYWRYRMHVTMESLLNDKS  741
             H+ S S+  I  LQD L++   +      EE IN P  PRHYWRYRMH+T+E L+  +S
Sbjct  823  NHLYSNSILCILSLQDWLSMDGKWRNPNVQEERINIPANPRHYWRYRMHLTLEQLMKAES  882

Query  742  L  744
            L
Sbjct  883  L  883



>ref|WP_022348360.1| MULTISPECIES: 4-alpha-glucanotransferase [Bacteroides]
 emb|CDD42576.1| 4-alpha-glucanotransferase [Bacteroides fragilis CAG:47]
 gb|EXY72919.1| 4-alpha-glucanotransferase [Bacteroides fragilis str. 3988T(B)14]
Length=900

 Score =   224 bits (570),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 106/241 (44%), Positives = 145/241 (60%), Gaps = 0/241 (0%)
 Frame = +1

Query  22   LRRNLFDLLQEVVLIRDREDPRKFYPRFNLEDTSSFKGLDQHSKNVLKRLYYDYYFHRQE  201
            +R  L+ L+ +V+ + DR+DP  ++PR  ++    ++ L+   K    RLY  YY+HR  
Sbjct  643  VRDGLYALISDVLFVPDRKDPNLYHPRIGVQHDFIYRALNDWEKTAFNRLYDQYYYHRHN  702

Query  202  SLWRQNALNTLPVLMNSSDMLTCGEDLGMIPACVNPVMQELGLIGLHIQRMPSEPGREFG  381
              W+Q A+  LP L  S+ ML CGEDLGMIP CV  VM +L ++ L IQRMP  P  EFG
Sbjct  703  DFWQQQAMKKLPQLTQSTRMLVCGEDLGMIPDCVAWVMNDLRILSLEIQRMPKNPAEEFG  762

Query  382  IPSEYSYMTVCAPSCHDCSTLRAWWEEDEGRRRRYFQTVVGSGAVPPDECTPEIARFVLR  561
              +EY Y +VC  S HD STLR WWEED  + +RY+  ++G     P   TPE+   V+R
Sbjct  763  RLNEYPYRSVCTFSTHDMSTLRGWWEEDYQQTQRYYNQMLGHYGAAPAIATPELCEEVVR  822

Query  562  KHVESPSMWSIFPLQDLLALKEDYATRPAVEETINDPTXPRHYWRYRMHVTMESLLNDKS  741
             H+ S S+  I  LQD L++   +      EE IN P  PRHYWRYRMH+T+E L+  +S
Sbjct  823  NHLYSNSILCILSLQDWLSMDGKWRNPNVQEERINIPANPRHYWRYRMHLTLEQLMKAES  882

Query  742  L  744
            L
Sbjct  883  L  883



>ref|WP_005802183.1| 4-alpha-glucanotransferase [Bacteroides fragilis]
 gb|EIY90748.1| 4-alpha-glucanotransferase [Bacteroides fragilis CL05T12C13]
 gb|EIY91361.1| 4-alpha-glucanotransferase [Bacteroides fragilis CL05T00C42]
Length=900

 Score =   224 bits (570),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 106/241 (44%), Positives = 145/241 (60%), Gaps = 0/241 (0%)
 Frame = +1

Query  22   LRRNLFDLLQEVVLIRDREDPRKFYPRFNLEDTSSFKGLDQHSKNVLKRLYYDYYFHRQE  201
            +R  L+ L+ +V+ + DR+DP  ++PR  ++    ++ L+   K    RLY  YY+HR  
Sbjct  643  VRDGLYALISDVLFVPDRKDPNLYHPRIGVQHDFIYRALNDWEKTAFNRLYDQYYYHRHN  702

Query  202  SLWRQNALNTLPVLMNSSDMLTCGEDLGMIPACVNPVMQELGLIGLHIQRMPSEPGREFG  381
              W+Q A+  LP L  S+ ML CGEDLGMIP CV  VM +L ++ L IQRMP  P  EFG
Sbjct  703  DFWQQQAMKKLPQLTQSTRMLVCGEDLGMIPDCVAWVMNDLRILSLEIQRMPKNPAEEFG  762

Query  382  IPSEYSYMTVCAPSCHDCSTLRAWWEEDEGRRRRYFQTVVGSGAVPPDECTPEIARFVLR  561
              +EY Y +VC  S HD STLR WWEED  + +RY+  ++G     P   TPE+   V+R
Sbjct  763  RLNEYPYRSVCTFSTHDMSTLRGWWEEDYQQTQRYYNQMLGHYGTAPAIATPELCEEVVR  822

Query  562  KHVESPSMWSIFPLQDLLALKEDYATRPAVEETINDPTXPRHYWRYRMHVTMESLLNDKS  741
             H+ S S+  I  LQD L++   +      EE IN P  PRHYWRYRMH+T+E L+  +S
Sbjct  823  NHLYSNSILCILSLQDWLSMDGKWRNPNVQEERINIPANPRHYWRYRMHLTLEQLMKAES  882

Query  742  L  744
            L
Sbjct  883  L  883



>ref|WP_044015448.1| hypothetical protein [Hymenobacter sp. APR13]
 gb|AII52163.1| hypothetical protein N008_09265 [Hymenobacter sp. APR13]
Length=911

 Score =   224 bits (570),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 103/242 (43%), Positives = 154/242 (64%), Gaps = 1/242 (0%)
 Frame = +1

Query  4    VENEEKLRRNLFDLLQEVVLIRDREDPRKFYPRFNLEDTSSFKGLDQHSKNVLKRLYYDY  183
             E+ + LR  L+ L  EV+ + D      ++PR  +  + SFK L+   ++ ++ +Y D+
Sbjct  647  TEHYQWLRSGLYSLANEVLFVPDDLRADFYHPRITVGKSLSFKELNGEDQHRMREIYNDF  706

Query  184  YFHRQESLWRQNALNTLPVLMNSSDMLTCGEDLGMIPACVNPVMQELGLIGLHIQRMPSE  363
            +F R E  WR+  L  LP +  +++ML CGEDLGM+PA V  VM+ LG++GL+IQRMPS+
Sbjct  707  FFQRHEEFWREQGLRKLPPVRYATNMLICGEDLGMVPASVPGVMRALGMLGLNIQRMPSD  766

Query  364  PGREFGIPSEYSYMTVCAPSCHDCSTLRAWWEEDEGRRRRYFQTVVGS-GAVPPDECTPE  540
            P  EFG P    Y++V +P  HD ST+R WWEED  + +R+F+T++G  G   P  C P 
Sbjct  767  PKVEFGHPDAAPYLSVVSPGSHDMSTVRGWWEEDHVKTQRFFETILGHWGEQAPYHCEPW  826

Query  541  IARFVLRKHVESPSMWSIFPLQDLLALKEDYATRPAVEETINDPTXPRHYWRYRMHVTME  720
            +AR +  +H+ SP+MW+IFPLQDLLA+  D       +E IN P  P H+W+YR+H+ +E
Sbjct  827  VAREITVQHLHSPAMWAIFPLQDLLAMSPDLRRANPDDEQINVPANPTHFWKYRLHLPLE  886

Query  721  SL  726
             L
Sbjct  887  EL  888



>ref|XP_005714071.1| Disproportionating Enzyme type 2 [Chondrus crispus]
 emb|CDF34252.1| Disproportionating Enzyme type 2 [Chondrus crispus]
Length=747

 Score =   223 bits (567),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 107/247 (43%), Positives = 152/247 (62%), Gaps = 5/247 (2%)
 Frame = +1

Query  16   EKLRRNLFDLLQEVVLIRDREDPRKFYPRFNLEDTSSFKGLDQHS-KNVLKRLYYDYYFH  192
            E ++ +LFD+   V L+ D EDP  F+PRF ++ T S+  LD +  K  L  L+ DYY  
Sbjct  485  ENVQNHLFDIFNNVCLLADVEDPNAFHPRFKMQTTKSYAELDSNEWKGALCNLHEDYYHR  544

Query  193  RQESLWRQNALNTLPVLMNSSDMLTCGEDLGMIPACVNPVMQELGLIGLHIQRMPSEPGR  372
            RQE LW++N L  LP++ ++S+ML CGEDLGM+P CV  VM+E  ++ L +QRMP+    
Sbjct  545  RQEELWKKNGLERLPMMKSASEMLVCGEDLGMVPHCVPAVMKETSILSLAVQRMPA-GDV  603

Query  373  EFGIPSEYSYMTVCAPSCHDCSTLRAWWEE-DEGRRRRYFQTVVGSG--AVPPDECTPEI  543
            EFG PSEY Y  V   S HD ST R WWEE     R +Y+  ++G      PP  CTPEI
Sbjct  604  EFGKPSEYPYECVATTSSHDTSTFRGWWEEIPRELRAQYWTEIMGRSRDTQPPAICTPEI  663

Query  544  ARFVLRKHVESPSMWSIFPLQDLLALKEDYATRPAVEETINDPTXPRHYWRYRMHVTMES  723
              + +  H+ SP+MW+IFPLQD+L + +    + A  E INDP+ P H W +R+H+ +E 
Sbjct  664  VEWAVADHLASPAMWTIFPLQDILGMDQKLRVKDAASERINDPSNPDHVWCFRLHLNIED  723

Query  724  LLNDKSL  744
            +  ++  
Sbjct  724  ITTNEGF  730



>ref|WP_032561759.1| 4-alpha-glucanotransferase [Bacteroides fragilis]
 gb|EXZ87858.1| 4-alpha-glucanotransferase [Bacteroides fragilis str. J38-1]
Length=900

 Score =   224 bits (570),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 106/241 (44%), Positives = 145/241 (60%), Gaps = 0/241 (0%)
 Frame = +1

Query  22   LRRNLFDLLQEVVLIRDREDPRKFYPRFNLEDTSSFKGLDQHSKNVLKRLYYDYYFHRQE  201
            +R  L+ L+ +V+ + DR+DP  ++PR  ++    ++ L+   K    RLY  YY+HR  
Sbjct  643  VRDGLYALISDVLFVPDRKDPNLYHPRIGVQHDFIYRALNDWEKTAFNRLYDQYYYHRHN  702

Query  202  SLWRQNALNTLPVLMNSSDMLTCGEDLGMIPACVNPVMQELGLIGLHIQRMPSEPGREFG  381
              W+Q A+  LP L  S+ ML CGEDLGMIP CV  VM +L ++ L IQRMP  P  EFG
Sbjct  703  DFWQQQAMKKLPQLTQSTRMLVCGEDLGMIPDCVAWVMNDLRILSLEIQRMPKNPAEEFG  762

Query  382  IPSEYSYMTVCAPSCHDCSTLRAWWEEDEGRRRRYFQTVVGSGAVPPDECTPEIARFVLR  561
              +EY Y +VC  S HD STLR WWEED  + +RY+  ++G     P   TPE+   V+R
Sbjct  763  RLNEYPYRSVCTFSTHDMSTLRGWWEEDYQQTQRYYNQMLGHYGTAPAIATPELCEEVVR  822

Query  562  KHVESPSMWSIFPLQDLLALKEDYATRPAVEETINDPTXPRHYWRYRMHVTMESLLNDKS  741
             H+ S S+  I  LQD L++   +      EE IN P  PRHYWRYRMH+T+E L+  +S
Sbjct  823  NHLYSNSILCILSLQDWLSMDGKWRNPNVQEERINIPANPRHYWRYRMHLTLEQLMKAES  882

Query  742  L  744
            L
Sbjct  883  L  883



>ref|WP_032533995.1| 4-alpha-glucanotransferase [Bacteroides fragilis]
 gb|EXY11651.1| 4-alpha-glucanotransferase [Bacteroides fragilis str. 1007-1-F 
#8]
 gb|EXZ32263.1| 4-alpha-glucanotransferase [Bacteroides fragilis str. 1007-1-F 
#4]
 gb|EXZ37728.1| 4-alpha-glucanotransferase [Bacteroides fragilis str. 1007-1-F 
#7]
 gb|EYA12691.1| 4-alpha-glucanotransferase [Bacteroides fragilis str. 1007-1-F 
#10]
 gb|EYA17490.1| 4-alpha-glucanotransferase [Bacteroides fragilis str. 1007-1-F 
#3]
 gb|EYA23917.1| 4-alpha-glucanotransferase [Bacteroides fragilis str. 1007-1-F 
#9]
 gb|EYE50065.1| 4-alpha-glucanotransferase [Bacteroides fragilis str. 1007-1-F 
#5]
 gb|EYE61729.1| 4-alpha-glucanotransferase [Bacteroides fragilis str. 1007-1-F 
#6]
Length=900

 Score =   224 bits (570),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 106/241 (44%), Positives = 145/241 (60%), Gaps = 0/241 (0%)
 Frame = +1

Query  22   LRRNLFDLLQEVVLIRDREDPRKFYPRFNLEDTSSFKGLDQHSKNVLKRLYYDYYFHRQE  201
            +R  L+ L+ +V+ + DR+DP  ++PR  ++    ++ L+   K    RLY  YY+HR  
Sbjct  643  VRDGLYALISDVLFVPDRKDPNLYHPRIGVQHDFIYRALNDWEKTAFNRLYDQYYYHRHN  702

Query  202  SLWRQNALNTLPVLMNSSDMLTCGEDLGMIPACVNPVMQELGLIGLHIQRMPSEPGREFG  381
              W+Q A+  LP L  S+ ML CGEDLGMIP CV  VM +L ++ L IQRMP  P  EFG
Sbjct  703  DFWQQQAMKKLPQLTQSTRMLVCGEDLGMIPDCVAWVMNDLRILSLEIQRMPKNPAEEFG  762

Query  382  IPSEYSYMTVCAPSCHDCSTLRAWWEEDEGRRRRYFQTVVGSGAVPPDECTPEIARFVLR  561
              +EY Y +VC  S HD STLR WWEED  + +RY+  ++G     P   TPE+   V+R
Sbjct  763  RLNEYPYRSVCTFSTHDMSTLRGWWEEDYQQTQRYYNQMLGHYGTAPAIATPELCEEVVR  822

Query  562  KHVESPSMWSIFPLQDLLALKEDYATRPAVEETINDPTXPRHYWRYRMHVTMESLLNDKS  741
             H+ S S+  I  LQD L++   +      EE IN P  PRHYWRYRMH+T+E L+  +S
Sbjct  823  NHLYSNSILCILSLQDWLSMDGKWRNPNVQEERINIPANPRHYWRYRMHLTLEQLMKAES  882

Query  742  L  744
            L
Sbjct  883  L  883



>emb|CDA86937.1| 4-alpha-glucanotransferase [Bacteroides sp. CAG:754]
Length=893

 Score =   224 bits (570),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 104/241 (43%), Positives = 144/241 (60%), Gaps = 0/241 (0%)
 Frame = +1

Query  22   LRRNLFDLLQEVVLIRDREDPRKFYPRFNLEDTSSFKGLDQHSKNVLKRLYYDYYFHRQE  201
            +R  L+ L+  V+ + DR++  K++PR  ++    F+ L +  KN   +LY  YY+HR  
Sbjct  636  IRDGLYSLISNVLFVPDRKEEGKYHPRIGVQRDFIFRALSEEDKNAFNKLYDQYYYHRHN  695

Query  202  SLWRQNALNTLPVLMNSSDMLTCGEDLGMIPACVNPVMQELGLIGLHIQRMPSEPGREFG  381
              W Q A+  LP L  S+ ML CGEDLGMIPACV  VM +L ++ L IQRMP  P  EFG
Sbjct  696  EFWYQQAMKKLPQLTQSTRMLVCGEDLGMIPACVPSVMNDLRILSLEIQRMPKNPMHEFG  755

Query  382  IPSEYSYMTVCAPSCHDCSTLRAWWEEDEGRRRRYFQTVVGSGAVPPDECTPEIARFVLR  561
               EY Y +VC  S HD STLR WWEED  + +RY+ T++G   + P   TPE+   ++R
Sbjct  756  HLKEYPYRSVCTISTHDMSTLRGWWEEDYQQTQRYYNTMLGHYGIAPTVATPELCEEIVR  815

Query  562  KHVESPSMWSIFPLQDLLALKEDYATRPAVEETINDPTXPRHYWRYRMHVTMESLLNDKS  741
             H+ S S+  I   QD L++          EE IN P+ PR+YWRYRMH+T+E L+  + 
Sbjct  816  NHLNSNSILCILSFQDWLSIDGKLRNPNVQEERINVPSNPRNYWRYRMHITLEQLMKAQK  875

Query  742  L  744
            L
Sbjct  876  L  876



>ref|WP_008769974.1| 4-alpha-glucanotransferase [Bacteroides sp. 2_1_16]
 gb|EEZ24816.1| putative 4-alpha-glucanotransferase [Bacteroides sp. 2_1_16]
Length=900

 Score =   224 bits (570),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 106/241 (44%), Positives = 145/241 (60%), Gaps = 0/241 (0%)
 Frame = +1

Query  22   LRRNLFDLLQEVVLIRDREDPRKFYPRFNLEDTSSFKGLDQHSKNVLKRLYYDYYFHRQE  201
            +R  L+ L+ +V+ + DR+DP  ++PR  ++    ++ L+   K    RLY  YY+HR  
Sbjct  643  VRDGLYALISDVLFVPDRKDPNLYHPRIGVQHDFIYRALNDWEKTAFNRLYDQYYYHRHN  702

Query  202  SLWRQNALNTLPVLMNSSDMLTCGEDLGMIPACVNPVMQELGLIGLHIQRMPSEPGREFG  381
              W+Q A+  LP L  S+ ML CGEDLGMIP CV  VM +L ++ L IQRMP  P  EFG
Sbjct  703  DFWQQQAMKKLPQLTQSTRMLVCGEDLGMIPDCVAWVMNDLRILSLEIQRMPKNPAEEFG  762

Query  382  IPSEYSYMTVCAPSCHDCSTLRAWWEEDEGRRRRYFQTVVGSGAVPPDECTPEIARFVLR  561
              +EY Y +VC  S HD STLR WWEED  + +RY+  ++G     P   TPE+   V+R
Sbjct  763  RLNEYPYRSVCTFSTHDMSTLRGWWEEDYQQTQRYYNQMLGHYGTAPAIATPELCEEVVR  822

Query  562  KHVESPSMWSIFPLQDLLALKEDYATRPAVEETINDPTXPRHYWRYRMHVTMESLLNDKS  741
             H+ S S+  I  LQD L++   +      EE IN P  PRHYWRYRMH+T+E L+  +S
Sbjct  823  NHLYSNSILCILSLQDWLSMDGKWRNPNVQEERINIPANPRHYWRYRMHLTLEQLMKAES  882

Query  742  L  744
            L
Sbjct  883  L  883



>ref|WP_005790925.1| 4-alpha-glucanotransferase [Bacteroides fragilis]
 gb|EIK37177.1| 4-alpha-glucanotransferase [Bacteroides fragilis CL07T00C01]
 gb|EIY43250.1| 4-alpha-glucanotransferase [Bacteroides fragilis CL03T00C08]
 gb|EIY47253.1| 4-alpha-glucanotransferase [Bacteroides fragilis CL03T12C07]
 gb|EIY93049.1| 4-alpha-glucanotransferase [Bacteroides fragilis CL07T12C05]
 gb|EXY94031.1| 4-alpha-glucanotransferase [Bacteroides fragilis str. 3998 T(B) 
4]
 gb|EYA64878.1| 4-alpha-glucanotransferase [Bacteroides fragilis str. S23L24]
 gb|EYA94684.1| 4-alpha-glucanotransferase [Bacteroides fragilis str. S38L5]
 gb|EYB13164.1| 4-alpha-glucanotransferase [Bacteroides fragilis str. S38L3]
 gb|EYE42317.1| 4-alpha-glucanotransferase [Bacteroides fragilis str. S23L17]
Length=900

 Score =   224 bits (570),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 106/241 (44%), Positives = 145/241 (60%), Gaps = 0/241 (0%)
 Frame = +1

Query  22   LRRNLFDLLQEVVLIRDREDPRKFYPRFNLEDTSSFKGLDQHSKNVLKRLYYDYYFHRQE  201
            +R  L+ L+ +V+ + DR+DP  ++PR  ++    ++ L+   K    RLY  YY+HR  
Sbjct  643  VRDGLYALISDVLFVPDRKDPNLYHPRIGVQHDFIYRALNDWEKTAFNRLYDQYYYHRHN  702

Query  202  SLWRQNALNTLPVLMNSSDMLTCGEDLGMIPACVNPVMQELGLIGLHIQRMPSEPGREFG  381
              W+Q A+  LP L  S+ ML CGEDLGMIP CV  VM +L ++ L IQRMP  P  EFG
Sbjct  703  DFWQQQAMKKLPQLTQSTRMLVCGEDLGMIPDCVAWVMNDLRILSLEIQRMPKNPAEEFG  762

Query  382  IPSEYSYMTVCAPSCHDCSTLRAWWEEDEGRRRRYFQTVVGSGAVPPDECTPEIARFVLR  561
              +EY Y +VC  S HD STLR WWEED  + +RY+  ++G     P   TPE+   V+R
Sbjct  763  RLNEYPYRSVCTFSTHDMSTLRGWWEEDYQQTQRYYNQMLGHYGTAPAIATPELCEEVVR  822

Query  562  KHVESPSMWSIFPLQDLLALKEDYATRPAVEETINDPTXPRHYWRYRMHVTMESLLNDKS  741
             H+ S S+  I  LQD L++   +      EE IN P  PRHYWRYRMH+T+E L+  +S
Sbjct  823  NHLYSNSILCILSLQDWLSMDGKWRNPNVQEERINIPANPRHYWRYRMHLTLEQLMKAES  882

Query  742  L  744
            L
Sbjct  883  L  883



>ref|WP_014299393.1| 4-alpha-glucanotransferase [Bacteroides fragilis]
 emb|CBW24144.1| putative alpha-glucanotransferase [Bacteroides fragilis 638R]
Length=900

 Score =   224 bits (570),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 106/241 (44%), Positives = 145/241 (60%), Gaps = 0/241 (0%)
 Frame = +1

Query  22   LRRNLFDLLQEVVLIRDREDPRKFYPRFNLEDTSSFKGLDQHSKNVLKRLYYDYYFHRQE  201
            +R  L+ L+ +V+ + DR+DP  ++PR  ++    ++ L+   K    RLY  YY+HR  
Sbjct  643  VRDGLYALISDVLFVPDRKDPNLYHPRIGVQHDFIYRALNDWEKTAFNRLYDQYYYHRHN  702

Query  202  SLWRQNALNTLPVLMNSSDMLTCGEDLGMIPACVNPVMQELGLIGLHIQRMPSEPGREFG  381
              W+Q A+  LP L  S+ ML CGEDLGMIP CV  VM +L ++ L IQRMP  P  EFG
Sbjct  703  DFWQQQAMKKLPQLTQSTRMLVCGEDLGMIPDCVAWVMNDLRILSLEIQRMPKNPAEEFG  762

Query  382  IPSEYSYMTVCAPSCHDCSTLRAWWEEDEGRRRRYFQTVVGSGAVPPDECTPEIARFVLR  561
              +EY Y +VC  S HD STLR WWEED  + +RY+  ++G     P   TPE+   V+R
Sbjct  763  RLNEYPYRSVCTFSTHDMSTLRGWWEEDYQQTQRYYNQMLGHYGTAPAIATPELCEEVVR  822

Query  562  KHVESPSMWSIFPLQDLLALKEDYATRPAVEETINDPTXPRHYWRYRMHVTMESLLNDKS  741
             H+ S S+  I  LQD L++   +      EE IN P  PRHYWRYRMH+T+E L+  +S
Sbjct  823  NHLYSNSILCILSLQDWLSMDGKWRNPNVQEERINIPANPRHYWRYRMHLTLEQLMKAES  882

Query  742  L  744
            L
Sbjct  883  L  883



>ref|WP_044222303.1| hypothetical protein [Flammeovirga pacifica]
Length=912

 Score =   224 bits (570),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 105/245 (43%), Positives = 151/245 (62%), Gaps = 2/245 (1%)
 Frame = +1

Query  16   EKLRRNLFDLLQEVVLIR--DREDPRKFYPRFNLEDTSSFKGLDQHSKNVLKRLYYDYYF  189
            E +R  L+ L  EV+LI+    +D + + PR  ++ + +F  L    +   + LY DY+F
Sbjct  651  EAIRDGLYSLHNEVLLIQALGYDDGQHYAPRVTMDKSRTFAELTPAQQYHFQELYVDYFF  710

Query  190  HRQESLWRQNALNTLPVLMNSSDMLTCGEDLGMIPACVNPVMQELGLIGLHIQRMPSEPG  369
             RQE LW   A+  LP +  +++ML CGEDLGM+P CV  VM+EL ++ L IQRMP +P 
Sbjct  711  KRQEELWSAQAMEKLPAIKEATNMLICGEDLGMVPDCVPGVMKELEILSLEIQRMPKDPS  770

Query  370  REFGIPSEYSYMTVCAPSCHDCSTLRAWWEEDEGRRRRYFQTVVGSGAVPPDECTPEIAR  549
              FG P+ Y Y +V +PS HD ST+R WW+ED G  +R++  V+G+    P +C P IA 
Sbjct  771  IAFGHPANYPYDSVASPSSHDMSTVRGWWQEDRGDTQRFYNEVLGNWGEAPQDCEPWIAE  830

Query  550  FVLRKHVESPSMWSIFPLQDLLALKEDYATRPAVEETINDPTXPRHYWRYRMHVTMESLL  729
             VL++H+ + S+W IFPLQD+LA+  +     A  E IN P    HYWRYRMH++ E L+
Sbjct  831  QVLKQHLYADSIWCIFPLQDILAIDSEVRREDAEAERINIPAIKYHYWRYRMHMSCEELV  890

Query  730  NDKSL  744
            N K  
Sbjct  891  NLKKF  895



>ref|WP_032599755.1| 4-alpha-glucanotransferase [Bacteroides fragilis]
 gb|EXY59062.1| 4-alpha-glucanotransferase [Bacteroides fragilis str. 3986T(B)10]
Length=900

 Score =   224 bits (570),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 106/241 (44%), Positives = 145/241 (60%), Gaps = 0/241 (0%)
 Frame = +1

Query  22   LRRNLFDLLQEVVLIRDREDPRKFYPRFNLEDTSSFKGLDQHSKNVLKRLYYDYYFHRQE  201
            +R  L+ L+ +V+ + DR+DP  ++PR  ++    ++ L+   K    RLY  YY+HR  
Sbjct  643  VRDGLYALISDVLFVPDRKDPNLYHPRIGVQHDFIYRALNDWEKTAFNRLYDQYYYHRHN  702

Query  202  SLWRQNALNTLPVLMNSSDMLTCGEDLGMIPACVNPVMQELGLIGLHIQRMPSEPGREFG  381
              W+Q A+  LP L  S+ ML CGEDLGMIP CV  VM +L ++ L IQRMP  P  EFG
Sbjct  703  DFWQQQAMKKLPQLTQSTRMLVCGEDLGMIPDCVAWVMNDLRILSLEIQRMPKNPAEEFG  762

Query  382  IPSEYSYMTVCAPSCHDCSTLRAWWEEDEGRRRRYFQTVVGSGAVPPDECTPEIARFVLR  561
              +EY Y +VC  S HD STLR WWEED  + +RY+  ++G     P   TPE+   V+R
Sbjct  763  RLNEYPYRSVCTFSTHDMSTLRGWWEEDYQQTQRYYNQMLGHYGPAPAIATPELCEEVIR  822

Query  562  KHVESPSMWSIFPLQDLLALKEDYATRPAVEETINDPTXPRHYWRYRMHVTMESLLNDKS  741
             H+ S S+  I  LQD L++   +      EE IN P  PRHYWRYRMH+T+E L+  +S
Sbjct  823  NHLYSNSILCILSLQDWLSMDGKWRNPNVQEERINTPANPRHYWRYRMHLTLEQLMKAES  882

Query  742  L  744
            L
Sbjct  883  L  883



>ref|WP_032576974.1| 4-alpha-glucanotransferase [Bacteroides fragilis]
 gb|EXY45069.1| 4-alpha-glucanotransferase [Bacteroides fragilis str. 3783N1-2]
 gb|EXY54559.1| 4-alpha-glucanotransferase [Bacteroides fragilis str. 3976T7]
 gb|EXZ66421.1| 4-alpha-glucanotransferase [Bacteroides fragilis str. 3783N1-8]
 gb|EYB08099.1| 4-alpha-glucanotransferase [Bacteroides fragilis str. 3783N1-6]
Length=900

 Score =   224 bits (570),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 106/241 (44%), Positives = 145/241 (60%), Gaps = 0/241 (0%)
 Frame = +1

Query  22   LRRNLFDLLQEVVLIRDREDPRKFYPRFNLEDTSSFKGLDQHSKNVLKRLYYDYYFHRQE  201
            +R  L+ L+ +V+ + DR+DP  ++PR  ++    ++ L+   K    RLY  YY+HR  
Sbjct  643  VRDGLYALISDVLFVPDRKDPNLYHPRIGVQHDFIYRALNDWEKTAFNRLYDQYYYHRHN  702

Query  202  SLWRQNALNTLPVLMNSSDMLTCGEDLGMIPACVNPVMQELGLIGLHIQRMPSEPGREFG  381
              W+Q A+  LP L  S+ ML CGEDLGMIP CV  VM +L ++ L IQRMP  P  EFG
Sbjct  703  DFWQQQAMKKLPQLTQSTRMLVCGEDLGMIPDCVAWVMNDLRILSLEIQRMPKNPAEEFG  762

Query  382  IPSEYSYMTVCAPSCHDCSTLRAWWEEDEGRRRRYFQTVVGSGAVPPDECTPEIARFVLR  561
              +EY Y +VC  S HD STLR WWEED  + +RY+  ++G     P   TPE+   V+R
Sbjct  763  RLNEYPYRSVCTFSTHDMSTLRGWWEEDYQQTQRYYNQMLGHYGTAPAIATPELCEEVVR  822

Query  562  KHVESPSMWSIFPLQDLLALKEDYATRPAVEETINDPTXPRHYWRYRMHVTMESLLNDKS  741
             H+ S S+  I  LQD L++   +      EE IN P  PRHYWRYRMH+T+E L+  +S
Sbjct  823  NHLYSNSILCILSLQDWLSMDGKWRNPNVQEERINIPANPRHYWRYRMHLTLEQLMKAES  882

Query  742  L  744
            L
Sbjct  883  L  883



>ref|WP_037370011.1| hypothetical protein, partial [Sediminibacterium sp. C3]
Length=899

 Score =   223 bits (569),  Expect = 2e-63, Method: Composition-based stats.
 Identities = 98/237 (41%), Positives = 148/237 (62%), Gaps = 0/237 (0%)
 Frame = +1

Query  16   EKLRRNLFDLLQEVVLIRDREDPRKFYPRFNLEDTSSFKGLDQHSKNVLKRLYYDYYFHR  195
            +K+++ L+ L+  ++L     D ++F+ RF +E+TSSFK L+  ++  LK LY  Y++  
Sbjct  644  QKIKQGLYSLISNIILFDANGDGQEFHFRFGIENTSSFKALEFGTQQQLKELYVQYFYKM  703

Query  196  QESLWRQNALNTLPVLMNSSDMLTCGEDLGMIPACVNPVMQELGLIGLHIQRMPSEPGRE  375
            Q+  W++ A   LP L   ++ML CGEDLGM+P CV  VMQ+LGL+ L IQRMP  P R 
Sbjct  704  QDDFWKKEAYKKLPSLKRVTNMLICGEDLGMVPGCVPEVMQQLGLLSLEIQRMPKNPERA  763

Query  376  FGIPSEYSYMTVCAPSCHDCSTLRAWWEEDEGRRRRYFQTVVGSGAVPPDECTPEIARFV  555
            F  P++  Y++V  PS HD ST+R WWEED    ++++   +G     P  C   I + V
Sbjct  764  FFHPNDAPYLSVVTPSTHDMSTIRGWWEEDRKTIQQFYNQELGQWGDAPAYCEAWINKAV  823

Query  556  LRKHVESPSMWSIFPLQDLLALKEDYATRPAVEETINDPTXPRHYWRYRMHVTMESL  726
            + +H+ SP+MW++F LQDL+ + E       ++E IN P  P H+WRYRMH+  E+L
Sbjct  824  VLQHLFSPAMWAVFQLQDLMGMHEQIRRENPLDEQINVPADPNHFWRYRMHLPFETL  880



>ref|WP_022163936.1| 4-alpha-glucanotransferase [Bacteroides sp. CAG:633]
 emb|CDB11218.1| 4-alpha-glucanotransferase [Bacteroides sp. CAG:633]
Length=900

 Score =   223 bits (569),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 106/241 (44%), Positives = 142/241 (59%), Gaps = 0/241 (0%)
 Frame = +1

Query  22   LRRNLFDLLQEVVLIRDREDPRKFYPRFNLEDTSSFKGLDQHSKNVLKRLYYDYYFHRQE  201
            +R  L+ L+ +V+ + DR DP K++PR  ++    ++ L+   K    RLY  YY+ R  
Sbjct  645  IRDGLYSLISDVLFVPDRNDPYKYHPRIGVQHDFVYRALNDWEKAAFNRLYDQYYYRRHN  704

Query  202  SLWRQNALNTLPVLMNSSDMLTCGEDLGMIPACVNPVMQELGLIGLHIQRMPSEPGREFG  381
              W Q A+  LP L  S+ ML CGEDLGMIP CV  VM +L ++ L IQRMP +P +EFG
Sbjct  705  EFWHQQAMKKLPQLTQSTRMLVCGEDLGMIPDCVAWVMNDLRILSLEIQRMPKDPAQEFG  764

Query  382  IPSEYSYMTVCAPSCHDCSTLRAWWEEDEGRRRRYFQTVVGSGAVPPDECTPEIARFVLR  561
             P  Y Y +VC  S HD STLR WWEE+  + +RYF +V+G     P E TPEI   ++ 
Sbjct  765  RPDWYPYRSVCTISTHDMSTLRGWWEENSQQTQRYFNSVLGRYGTAPAEATPEICEEIVC  824

Query  562  KHVESPSMWSIFPLQDLLALKEDYATRPAVEETINDPTXPRHYWRYRMHVTMESLLNDKS  741
             H+   S+  I  LQD L++        A EE IN P  PRHYWRYRMH+T+E L+    
Sbjct  825  NHLYGNSILCILSLQDWLSIDGKLRNPNAQEERINVPANPRHYWRYRMHLTLEQLMQADG  884

Query  742  L  744
            L
Sbjct  885  L  885



>ref|WP_032565355.1| 4-alpha-glucanotransferase [Bacteroides fragilis]
 gb|EXZ17872.1| 4-alpha-glucanotransferase [Bacteroides fragilis str. J-143-4]
Length=900

 Score =   223 bits (569),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 106/241 (44%), Positives = 145/241 (60%), Gaps = 0/241 (0%)
 Frame = +1

Query  22   LRRNLFDLLQEVVLIRDREDPRKFYPRFNLEDTSSFKGLDQHSKNVLKRLYYDYYFHRQE  201
            +R  L+ L+ +V+ + DR+DP  ++PR  ++    ++ L+   K    RLY  YY+HR  
Sbjct  643  VRDGLYALISDVLFVPDRKDPNLYHPRIGVQHDFIYRALNDWEKTAFNRLYDQYYYHRHN  702

Query  202  SLWRQNALNTLPVLMNSSDMLTCGEDLGMIPACVNPVMQELGLIGLHIQRMPSEPGREFG  381
              W+Q A+  LP L  S+ ML CGEDLGMIP CV  VM +L ++ L IQRMP  P  EFG
Sbjct  703  DFWQQQAMKKLPQLTQSTRMLVCGEDLGMIPDCVAWVMNDLRILSLEIQRMPKNPAEEFG  762

Query  382  IPSEYSYMTVCAPSCHDCSTLRAWWEEDEGRRRRYFQTVVGSGAVPPDECTPEIARFVLR  561
              +EY Y +VC  S HD STLR WWEED  + +RY+  ++G     P   TPE+   V+R
Sbjct  763  RLNEYPYRSVCTFSTHDMSTLRGWWEEDYQQTQRYYNQMLGHYGPAPAIATPELCEEVIR  822

Query  562  KHVESPSMWSIFPLQDLLALKEDYATRPAVEETINDPTXPRHYWRYRMHVTMESLLNDKS  741
             H+ S S+  I  LQD L++   +      EE IN P  PRHYWRYRMH+T+E L+  +S
Sbjct  823  NHLYSNSILCILSLQDWLSMDGKWRNPNVQEERINTPANPRHYWRYRMHLTLEQLMKAES  882

Query  742  L  744
            L
Sbjct  883  L  883



>ref|WP_010993489.1| 4-alpha-glucanotransferase [Bacteroides fragilis]
 emb|CAH09301.1| putative alpha-glucanotransferase [Bacteroides fragilis NCTC 
9343]
Length=900

 Score =   223 bits (569),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 105/241 (44%), Positives = 145/241 (60%), Gaps = 0/241 (0%)
 Frame = +1

Query  22   LRRNLFDLLQEVVLIRDREDPRKFYPRFNLEDTSSFKGLDQHSKNVLKRLYYDYYFHRQE  201
            +R  L+ L+ +V+ + DR+DP  ++PR  ++    ++ L+   K    RLY  YY+HR  
Sbjct  643  VRDGLYALISDVLFVPDRKDPNLYHPRIGVQHDFIYRALNDWEKTAFNRLYDQYYYHRHN  702

Query  202  SLWRQNALNTLPVLMNSSDMLTCGEDLGMIPACVNPVMQELGLIGLHIQRMPSEPGREFG  381
              W+Q A+  LP L  S+ ML CGEDLGMIP CV  VM +L ++ L IQRMP  P  EFG
Sbjct  703  DFWQQQAMKKLPQLTQSTRMLVCGEDLGMIPDCVAWVMNDLRILSLEIQRMPKNPAEEFG  762

Query  382  IPSEYSYMTVCAPSCHDCSTLRAWWEEDEGRRRRYFQTVVGSGAVPPDECTPEIARFVLR  561
              +EY Y +VC  S HD STLR WWEED  + +RY+  ++G     P   TPE+   ++R
Sbjct  763  RLNEYPYRSVCTFSTHDMSTLRGWWEEDYQQTQRYYNQMLGHYGTAPAIATPELCEEIVR  822

Query  562  KHVESPSMWSIFPLQDLLALKEDYATRPAVEETINDPTXPRHYWRYRMHVTMESLLNDKS  741
             H+ S S+  I  LQD L++   +      EE IN P  PRHYWRYRMH+T+E L+  +S
Sbjct  823  NHLYSNSILCILSLQDWLSMDGKWRNPNVQEERINIPANPRHYWRYRMHLTLEQLMKAES  882

Query  742  L  744
            L
Sbjct  883  L  883



>ref|WP_042971685.1| 4-alpha-glucanotransferase [Bacteroides fragilis]
 gb|EXY88933.1| 4-alpha-glucanotransferase [Bacteroides fragilis str. 3998T(B)3]
Length=900

 Score =   223 bits (568),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 106/241 (44%), Positives = 145/241 (60%), Gaps = 0/241 (0%)
 Frame = +1

Query  22   LRRNLFDLLQEVVLIRDREDPRKFYPRFNLEDTSSFKGLDQHSKNVLKRLYYDYYFHRQE  201
            +R  L+ L+ +V+ + DR+DP  ++PR  ++    ++ L+   K    RLY  YY+HR  
Sbjct  643  VRDGLYALISDVLFVPDRKDPNLYHPRIGVQHDFIYRALNDWEKTAFNRLYDQYYYHRHN  702

Query  202  SLWRQNALNTLPVLMNSSDMLTCGEDLGMIPACVNPVMQELGLIGLHIQRMPSEPGREFG  381
              W+Q A+  LP L  S+ ML CGEDLGMIP CV  VM +L ++ L IQRMP  P  EFG
Sbjct  703  DFWQQQAMKKLPQLTQSTRMLVCGEDLGMIPDCVAWVMNDLRILSLEIQRMPKNPAEEFG  762

Query  382  IPSEYSYMTVCAPSCHDCSTLRAWWEEDEGRRRRYFQTVVGSGAVPPDECTPEIARFVLR  561
              +EY Y +VC  S HD STLR WWEED  + +RY+  ++G     P   TPE+   V+R
Sbjct  763  RLNEYPYRSVCTFSTHDMSTLRGWWEEDYQQTQRYYNQMLGHYGPAPAIATPELCEEVVR  822

Query  562  KHVESPSMWSIFPLQDLLALKEDYATRPAVEETINDPTXPRHYWRYRMHVTMESLLNDKS  741
             H+ S S+  I  LQD L++   +      EE IN P  PRHYWRYRMH+T+E L+  +S
Sbjct  823  NHLYSNSILCILSLQDWLSMDGKWRNPNVQEERINTPANPRHYWRYRMHLTLEQLMKAES  882

Query  742  L  744
            L
Sbjct  883  L  883



>ref|WP_042987441.1| 4-alpha-glucanotransferase [Bacteroides fragilis]
 gb|EXZ81676.1| 4-alpha-glucanotransferase [Bacteroides fragilis str. B1 (UDC16-1)]
Length=900

 Score =   223 bits (568),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 106/241 (44%), Positives = 145/241 (60%), Gaps = 0/241 (0%)
 Frame = +1

Query  22   LRRNLFDLLQEVVLIRDREDPRKFYPRFNLEDTSSFKGLDQHSKNVLKRLYYDYYFHRQE  201
            +R  L+ L+ +V+ + DR+DP  ++PR  ++    ++ L+   K    RLY  YY+HR  
Sbjct  643  VRDGLYALISDVLFVPDRKDPNLYHPRIGVQHDFIYRALNDWEKTAFNRLYDQYYYHRHN  702

Query  202  SLWRQNALNTLPVLMNSSDMLTCGEDLGMIPACVNPVMQELGLIGLHIQRMPSEPGREFG  381
              W+Q A+  LP L  S+ ML CGEDLGMIP CV  VM +L ++ L IQRMP  P  EFG
Sbjct  703  DFWQQQAMKKLPQLTQSTRMLVCGEDLGMIPDCVAWVMNDLRILSLEIQRMPKNPAEEFG  762

Query  382  IPSEYSYMTVCAPSCHDCSTLRAWWEEDEGRRRRYFQTVVGSGAVPPDECTPEIARFVLR  561
              +EY Y +VC  S HD STLR WWEED  + +RY+  ++G     P   TPE+   V+R
Sbjct  763  RLNEYPYRSVCTFSTHDMSTLRGWWEEDYQQTQRYYNQMLGHYGPAPAIATPELCEEVIR  822

Query  562  KHVESPSMWSIFPLQDLLALKEDYATRPAVEETINDPTXPRHYWRYRMHVTMESLLNDKS  741
             H+ S S+  I  LQD L++   +      EE IN P  PRHYWRYRMH+T+E L+  +S
Sbjct  823  NHLYSNSILCILSLQDWLSMDGKWRNPNVQEERINIPANPRHYWRYRMHLTLEQLMKAES  882

Query  742  L  744
            L
Sbjct  883  L  883



>ref|WP_032584492.1| 4-alpha-glucanotransferase [Bacteroides fragilis]
 gb|EXY64145.1| 4-alpha-glucanotransferase [Bacteroides fragilis str. 3986 N(B)19]
 gb|EYA46974.1| 4-alpha-glucanotransferase [Bacteroides fragilis str. 3719 T6]
Length=900

 Score =   223 bits (568),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 106/241 (44%), Positives = 145/241 (60%), Gaps = 0/241 (0%)
 Frame = +1

Query  22   LRRNLFDLLQEVVLIRDREDPRKFYPRFNLEDTSSFKGLDQHSKNVLKRLYYDYYFHRQE  201
            +R  L+ L+ +V+ + DR+DP  ++PR  ++    ++ L+   K    RLY  YY+HR  
Sbjct  643  VRDGLYALISDVLFVPDRKDPNLYHPRIGVQHDFIYRDLNDWEKTAFNRLYDQYYYHRHN  702

Query  202  SLWRQNALNTLPVLMNSSDMLTCGEDLGMIPACVNPVMQELGLIGLHIQRMPSEPGREFG  381
              W+Q A+  LP L  S+ ML CGEDLGMIP CV  VM +L ++ L IQRMP  P  EFG
Sbjct  703  DFWQQQAMKKLPQLTQSTRMLVCGEDLGMIPDCVAWVMNDLRILSLEIQRMPKNPAEEFG  762

Query  382  IPSEYSYMTVCAPSCHDCSTLRAWWEEDEGRRRRYFQTVVGSGAVPPDECTPEIARFVLR  561
              +EY Y +VC  S HD STLR WWEED  + +RY+  ++G     P   TPE+   V+R
Sbjct  763  RLNEYPYRSVCTFSTHDMSTLRGWWEEDYQQTQRYYNQMLGHYGTAPAIATPELCEEVVR  822

Query  562  KHVESPSMWSIFPLQDLLALKEDYATRPAVEETINDPTXPRHYWRYRMHVTMESLLNDKS  741
             H+ S S+  I  LQD L++   +      EE IN P  PRHYWRYRMH+T+E L+  +S
Sbjct  823  NHLYSNSILCILSLQDWLSMDGKWRNPNVQEERINIPANPRHYWRYRMHLTLEQLMKAES  882

Query  742  L  744
            L
Sbjct  883  L  883



>ref|WP_044003721.1| hypothetical protein [Hymenobacter swuensis]
 gb|AHJ99663.1| hypothetical protein Hsw_4068 [Hymenobacter swuensis DY53]
Length=912

 Score =   223 bits (568),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 103/242 (43%), Positives = 153/242 (63%), Gaps = 1/242 (0%)
 Frame = +1

Query  4    VENEEKLRRNLFDLLQEVVLIRDREDPRKFYPRFNLEDTSSFKGLDQHSKNVLKRLYYDY  183
             E+   LR  L+ L+ EV+ + D +    F+PR  L  + SF+ LD+ ++  L+ LY D+
Sbjct  648  TEHYTWLRTGLYKLINEVLFVPDDQQADFFHPRITLHLSRSFQELDEATRPRLRELYVDF  707

Query  184  YFHRQESLWRQNALNTLPVLMNSSDMLTCGEDLGMIPACVNPVMQELGLIGLHIQRMPSE  363
            ++ R E  WR+  L  LP +  ++DML CGEDLGM+P  V  VM+ LG++GL+IQRMPS+
Sbjct  708  FYRRHEDFWRRQGLVKLPAVRWATDMLICGEDLGMVPKSVPGVMKALGILGLNIQRMPSD  767

Query  364  PGREFGIPSEYSYMTVCAPSCHDCSTLRAWWEEDEGRRRRYFQTVVGS-GAVPPDECTPE  540
               EFG P+   Y++V +P  HD ST+R WWEED  + +++F+T++G  G   P  C P 
Sbjct  768  STVEFGHPNAAPYLSVVSPGSHDMSTVRGWWEEDREQTQKFFETILGHWGEQAPQYCEPW  827

Query  541  IARFVLRKHVESPSMWSIFPLQDLLALKEDYATRPAVEETINDPTXPRHYWRYRMHVTME  720
            +AR V  +H+ SP+MW+IFPLQDL+A+         + E IN P  P H+W+YR H+ +E
Sbjct  828  VAREVTVQHLHSPAMWAIFPLQDLVAMDNRLRREDPLAEQINVPANPTHFWKYRFHIPLE  887

Query  721  SL  726
             L
Sbjct  888  DL  889



>ref|WP_022390399.1| 4-alpha-glucanotransferase [Tannerella sp. CAG:51]
 emb|CDD88780.1| 4-alpha-glucanotransferase [Tannerella sp. CAG:51]
Length=894

 Score =   223 bits (567),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 103/246 (42%), Positives = 148/246 (60%), Gaps = 0/246 (0%)
 Frame = +1

Query  7    ENEEKLRRNLFDLLQEVVLIRDREDPRKFYPRFNLEDTSSFKGLDQHSKNVLKRLYYDYY  186
            E   K++  LF L  E++ + D    RK++P  +   T S+K L  + +    RLY D++
Sbjct  635  EKSLKIKSGLFALTDEILFVEDPYQKRKYHPCISARQTYSYKSLTDYERWCYDRLYVDFF  694

Query  187  FHRQESLWRQNALNTLPVLMNSSDMLTCGEDLGMIPACVNPVMQELGLIGLHIQRMPSEP  366
            +HRQ++ W+  A+  LP L++S+ ML CGEDLGMIP  V  VM  L ++ L IQRMP +P
Sbjct  695  YHRQDAFWKNEAMKKLPPLISSTGMLVCGEDLGMIPQSVPEVMNALQILSLEIQRMPKDP  754

Query  367  GREFGIPSEYSYMTVCAPSCHDCSTLRAWWEEDEGRRRRYFQTVVGSGAVPPDECTPEIA  546
             +EFG  + Y Y++VC  S HD S +RAWWEED  + +RY+  ++      P  C P I 
Sbjct  755  DKEFGDVANYPYLSVCTTSTHDMSGIRAWWEEDRSKTQRYYNCILQEQGEAPYYCEPWIC  814

Query  547  RFVLRKHVESPSMWSIFPLQDLLALKEDYATRPAVEETINDPTXPRHYWRYRMHVTMESL  726
              +L  H+ SPSM +I PLQD  ++  +      VEE IN P  PR+YWRYRMH+T+E L
Sbjct  815  EKILAMHMHSPSMLAIIPLQDWFSIDGNIRRNNPVEERINVPANPRNYWRYRMHITIEDL  874

Query  727  LNDKSL  744
            L + + 
Sbjct  875  LKNSNF  880



>ref|WP_032536991.1| MULTISPECIES: 4-alpha-glucanotransferase [Bacteroides]
 gb|KER59786.1| 4-alpha-glucanotransferase [Bacteroides fragilis]
Length=900

 Score =   223 bits (567),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 107/241 (44%), Positives = 144/241 (60%), Gaps = 0/241 (0%)
 Frame = +1

Query  22   LRRNLFDLLQEVVLIRDREDPRKFYPRFNLEDTSSFKGLDQHSKNVLKRLYYDYYFHRQE  201
            +R  L+ L+ +V+ + DR+D   F+PR  ++    ++ L+   K    RLY  YY+HR  
Sbjct  643  IRDGLYALISDVLFVPDRKDTNLFHPRIGVQHDFIYRALNDWEKAAFNRLYDQYYYHRHN  702

Query  202  SLWRQNALNTLPVLMNSSDMLTCGEDLGMIPACVNPVMQELGLIGLHIQRMPSEPGREFG  381
              W+Q A+  LP L  S+ ML CGEDLGMIP CV  VM +L ++ L IQRMP  P  EFG
Sbjct  703  DFWQQQAMKKLPQLTQSTRMLVCGEDLGMIPDCVAWVMNDLRILSLEIQRMPKNPAEEFG  762

Query  382  IPSEYSYMTVCAPSCHDCSTLRAWWEEDEGRRRRYFQTVVGSGAVPPDECTPEIARFVLR  561
              SEY Y +VC  S HD STLR WWEED  + +RY+  ++G     P   TPE+   V+R
Sbjct  763  RLSEYPYRSVCTFSTHDMSTLRGWWEEDYQQTQRYYNQMLGHYGAAPAIATPELCEEVVR  822

Query  562  KHVESPSMWSIFPLQDLLALKEDYATRPAVEETINDPTXPRHYWRYRMHVTMESLLNDKS  741
             H+ S S+  I  LQD L++   +      EE IN P  PRHYWRYRMH+T+E L+  +S
Sbjct  823  NHLYSNSILCILSLQDWLSMDGRWRNPNVQEERINVPANPRHYWRYRMHLTLEQLMKAES  882

Query  742  L  744
            L
Sbjct  883  L  883



>ref|WP_032566501.1| 4-alpha-glucanotransferase [Bacteroides fragilis]
 gb|EXZ99013.1| 4-alpha-glucanotransferase [Bacteroides fragilis str. S23 R14]
Length=900

 Score =   222 bits (566),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 106/241 (44%), Positives = 145/241 (60%), Gaps = 0/241 (0%)
 Frame = +1

Query  22   LRRNLFDLLQEVVLIRDREDPRKFYPRFNLEDTSSFKGLDQHSKNVLKRLYYDYYFHRQE  201
            +R  L+ L+ +V+ + DR+DP  ++PR  ++    ++ L+   K    RLY  YY+HR  
Sbjct  643  VRDGLYALISDVLFVPDRKDPNLYHPRIGVQHDFIYRALNDWEKTAFNRLYDQYYYHRHN  702

Query  202  SLWRQNALNTLPVLMNSSDMLTCGEDLGMIPACVNPVMQELGLIGLHIQRMPSEPGREFG  381
              W+Q A+  LP L  S+ ML CGEDLGMIP CV  VM +L ++ L IQRMP  P  EFG
Sbjct  703  DFWQQQAMKKLPQLTQSTRMLVCGEDLGMIPDCVAWVMNDLRILSLEIQRMPKNPAEEFG  762

Query  382  IPSEYSYMTVCAPSCHDCSTLRAWWEEDEGRRRRYFQTVVGSGAVPPDECTPEIARFVLR  561
              +EY Y +VC  S HD STLR WWEED  + +RY+  ++G     P   TPE+   V+R
Sbjct  763  RLNEYPYRSVCTFSTHDMSTLRGWWEEDYQQTQRYYNQMLGHYGPAPAIATPELCEEVVR  822

Query  562  KHVESPSMWSIFPLQDLLALKEDYATRPAVEETINDPTXPRHYWRYRMHVTMESLLNDKS  741
             H+ S S+  I  LQD L++   +      EE IN P  PRHYWRYRMH+T+E L+  +S
Sbjct  823  NHLYSNSILCILSLQDWLSMDGKWRNPNVQEERINIPANPRHYWRYRMHLTLEQLMKAES  882

Query  742  L  744
            L
Sbjct  883  L  883



>ref|WP_032592604.1| 4-alpha-glucanotransferase [Bacteroides fragilis]
 gb|EXY49810.1| 4-alpha-glucanotransferase [Bacteroides fragilis str. 3783N2-1]
Length=900

 Score =   222 bits (566),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 106/241 (44%), Positives = 145/241 (60%), Gaps = 0/241 (0%)
 Frame = +1

Query  22   LRRNLFDLLQEVVLIRDREDPRKFYPRFNLEDTSSFKGLDQHSKNVLKRLYYDYYFHRQE  201
            +R  L+ L+ +V+ + DR+DP  ++PR  ++    ++ L+   K    RLY  YY+HR  
Sbjct  643  VRDGLYALISDVLFVPDRKDPNLYHPRIGVQHDFIYRALNDWEKTAFNRLYDQYYYHRHN  702

Query  202  SLWRQNALNTLPVLMNSSDMLTCGEDLGMIPACVNPVMQELGLIGLHIQRMPSEPGREFG  381
              W+Q A+  LP L  S+ ML CGEDLGMIP CV  VM +L ++ L IQRMP  P  EFG
Sbjct  703  DFWQQQAMKKLPQLTQSTRMLVCGEDLGMIPDCVAWVMNDLRILSLEIQRMPKNPAEEFG  762

Query  382  IPSEYSYMTVCAPSCHDCSTLRAWWEEDEGRRRRYFQTVVGSGAVPPDECTPEIARFVLR  561
              +EY Y +VC  S HD STLR WWEED  + +RY+  ++G     P   TPE+   V+R
Sbjct  763  RLNEYPYRSVCTFSTHDMSTLRGWWEEDYQQTQRYYNQMLGHYGPAPAIATPELCEEVVR  822

Query  562  KHVESPSMWSIFPLQDLLALKEDYATRPAVEETINDPTXPRHYWRYRMHVTMESLLNDKS  741
             H+ S S+  I  LQD L++   +      EE IN P  PRHYWRYRMH+T+E L+  +S
Sbjct  823  NHLYSNSILCILSLQDWLSMDGKWRNPNVQEERINIPANPRHYWRYRMHLTLEQLMKAES  882

Query  742  L  744
            L
Sbjct  883  L  883



>ref|WP_009317285.1| 4-alpha-glucanotransferase [Tannerella sp. 6_1_58FAA_CT1]
 gb|EHL87887.1| 4-alpha-glucanotransferase [Tannerella sp. 6_1_58FAA_CT1]
Length=894

 Score =   222 bits (566),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 103/246 (42%), Positives = 147/246 (60%), Gaps = 0/246 (0%)
 Frame = +1

Query  7    ENEEKLRRNLFDLLQEVVLIRDREDPRKFYPRFNLEDTSSFKGLDQHSKNVLKRLYYDYY  186
            E   K++  LF L  E++ + D    RK++P  +   T S+K L  + +    RLY D++
Sbjct  635  EKSLKIKSGLFALTDEILFVEDPYQKRKYHPCISARQTYSYKSLTDYERWCYDRLYVDFF  694

Query  187  FHRQESLWRQNALNTLPVLMNSSDMLTCGEDLGMIPACVNPVMQELGLIGLHIQRMPSEP  366
            +HRQ++ W+  A+  LP L++S+ ML CGEDLGMIP  V  VM  L ++ L IQRMP +P
Sbjct  695  YHRQDAFWKNEAMKKLPPLISSTGMLVCGEDLGMIPQSVPEVMNALQILSLEIQRMPKDP  754

Query  367  GREFGIPSEYSYMTVCAPSCHDCSTLRAWWEEDEGRRRRYFQTVVGSGAVPPDECTPEIA  546
             +EFG  + Y Y++VC  S HD S +RAWWEED  + +RY+  ++      P  C P I 
Sbjct  755  DKEFGDVANYPYLSVCTTSTHDMSGIRAWWEEDRSKTQRYYNCILQEQGEAPYYCEPWIC  814

Query  547  RFVLRKHVESPSMWSIFPLQDLLALKEDYATRPAVEETINDPTXPRHYWRYRMHVTMESL  726
              +L  H+ SPSM +I PLQD  ++  +      VEE IN P  PR+YWRYRMH+T+E L
Sbjct  815  EKILAMHMHSPSMLAIIPLQDWFSIDGNIRRNNPVEERINVPANPRNYWRYRMHITIEDL  874

Query  727  LNDKSL  744
            L +   
Sbjct  875  LKNSDF  880



>ref|WP_022602509.1| 4-alpha-glucanotransferase [Coprobacter fastidiosus]
 gb|ERM88409.1| 4-alpha-glucanotransferase [Coprobacter fastidiosus NSB1]
Length=894

 Score =   222 bits (566),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 103/246 (42%), Positives = 147/246 (60%), Gaps = 0/246 (0%)
 Frame = +1

Query  7    ENEEKLRRNLFDLLQEVVLIRDREDPRKFYPRFNLEDTSSFKGLDQHSKNVLKRLYYDYY  186
            E   K++  LF L  E++ + D    RK++P  +   T S+K L  + +    RLY D++
Sbjct  635  EKSLKIKSGLFALTDEILFVEDPYQKRKYHPCISARQTYSYKSLTDYERWCYDRLYVDFF  694

Query  187  FHRQESLWRQNALNTLPVLMNSSDMLTCGEDLGMIPACVNPVMQELGLIGLHIQRMPSEP  366
            +HRQ++ W+  A+  LP L++S+ ML CGEDLGMIP  V  VM  L ++ L IQRMP +P
Sbjct  695  YHRQDAFWKNEAMKKLPPLISSTGMLVCGEDLGMIPQSVPEVMNALQILSLEIQRMPKDP  754

Query  367  GREFGIPSEYSYMTVCAPSCHDCSTLRAWWEEDEGRRRRYFQTVVGSGAVPPDECTPEIA  546
             +EFG  + Y Y++VC  S HD S +RAWWEED  + +RY+  ++      P  C P I 
Sbjct  755  DKEFGDVANYPYLSVCTTSTHDMSGIRAWWEEDRSKTQRYYNCILQEQGEAPYYCEPWIC  814

Query  547  RFVLRKHVESPSMWSIFPLQDLLALKEDYATRPAVEETINDPTXPRHYWRYRMHVTMESL  726
              +L  H+ SPSM +I PLQD  ++  +      VEE IN P  PR+YWRYRMH+T+E L
Sbjct  815  EKILAMHMHSPSMLAIIPLQDWFSIDGNIRRNNPVEERINVPANPRNYWRYRMHITIEDL  874

Query  727  LNDKSL  744
            L +   
Sbjct  875  LKNSDF  880



>ref|WP_009597074.1| hypothetical protein, partial [Alistipes sp. HGB5]
 gb|EFR58327.1| hypothetical protein HMPREF9720_2071, partial [Alistipes sp. 
HGB5]
Length=326

 Score =   212 bits (539),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 105/249 (42%), Positives = 147/249 (59%), Gaps = 6/249 (2%)
 Frame = +1

Query  7    ENEEKLRRNLFDLLQEVVLIRDREDPRK---FYPRFNLEDTSSFKGLDQHSKNVLKRLYY  177
            E + +LR  L  LL +V+ I   EDPR+   F+PR     T +++ LD   +    RLY 
Sbjct  67   ERQTRLREGLMALLDDVLFI---EDPRRKGYFHPRIAPHSTHAYRRLDGERRAAFDRLYT  123

Query  178  DYYFHRQESLWRQNALNTLPVLMNSSDMLTCGEDLGMIPACVNPVMQELGLIGLHIQRMP  357
            D+++HR    W+++AL  LPVL+++++MLTCGEDLGMIP  V   M EL ++ L IQRMP
Sbjct  124  DFFYHRHNRFWQESALRKLPVLLSATEMLTCGEDLGMIPDSVPETMHELQILSLEIQRMP  183

Query  358  SEPGREFGIPSEYSYMTVCAPSCHDCSTLRAWWEEDEGRRRRYFQTVVGSGAVPPDECTP  537
              PG  F  P+ Y Y +VC  S HD + LRAWWEED     R++   +G G   P  C P
Sbjct  184  KTPGELFADPAHYPYFSVCTTSTHDMNPLRAWWEEDRELTARFYHEALGIGGDVPYFCEP  243

Query  538  EIARFVLRKHVESPSMWSIFPLQDLLALKEDYATRPAVEETINDPTXPRHYWRYRMHVTM  717
             I R +L  H+ SP+M +I PLQD  +   +       +E IN P   R+YWRYRMH+ +
Sbjct  244  WICRRILDMHLNSPAMLTILPLQDWFSTDGELRYPDPAKERINVPAVARYYWRYRMHLPL  303

Query  718  ESLLNDKSL  744
            E LL+ ++ 
Sbjct  304  EELLHKETF  312



>ref|WP_032571265.1| 4-alpha-glucanotransferase [Bacteroides fragilis]
 gb|EXY34503.1| 4-alpha-glucanotransferase [Bacteroides fragilis str. 34-F-2 
#13]
 gb|EXZ43136.1| 4-alpha-glucanotransferase [Bacteroides fragilis str. 2-F-2 #4]
Length=900

 Score =   222 bits (566),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 105/241 (44%), Positives = 144/241 (60%), Gaps = 0/241 (0%)
 Frame = +1

Query  22   LRRNLFDLLQEVVLIRDREDPRKFYPRFNLEDTSSFKGLDQHSKNVLKRLYYDYYFHRQE  201
            +R  L+ L+ +V+ + DR+DP  ++PR  ++    ++ L+   K     LY  YY+HR  
Sbjct  643  VRDGLYALISDVLFVPDRKDPNLYHPRIGVQHDFIYRALNDWEKTAFNSLYDQYYYHRHN  702

Query  202  SLWRQNALNTLPVLMNSSDMLTCGEDLGMIPACVNPVMQELGLIGLHIQRMPSEPGREFG  381
              W+Q A+  LP L  S+ ML CGEDLGMIP CV  VM +L ++ L IQRMP  P  EFG
Sbjct  703  DFWQQQAMKKLPQLTQSTRMLVCGEDLGMIPDCVAWVMNDLRILSLEIQRMPKNPAEEFG  762

Query  382  IPSEYSYMTVCAPSCHDCSTLRAWWEEDEGRRRRYFQTVVGSGAVPPDECTPEIARFVLR  561
              +EY Y +VC  S HD STLR WWEED  + +RY+  ++G     P   TPE+   V+R
Sbjct  763  RLNEYPYRSVCTFSTHDMSTLRGWWEEDYQQTQRYYNQMLGHYGTAPAIATPELCEEVVR  822

Query  562  KHVESPSMWSIFPLQDLLALKEDYATRPAVEETINDPTXPRHYWRYRMHVTMESLLNDKS  741
             H+ S S+  I  LQD L++   +      EE IN P  PRHYWRYRMH+T+E L+  +S
Sbjct  823  NHLYSNSILCILSLQDWLSMDGKWRNPNVQEERINTPANPRHYWRYRMHLTLEQLMKAES  882

Query  742  L  744
            L
Sbjct  883  L  883



>ref|WP_022012177.1| 4-alpha-glucanotransferase [Bacteroides fragilis CAG:558]
 emb|CCZ38281.1| 4-alpha-glucanotransferase [Bacteroides fragilis CAG:558]
Length=900

 Score =   221 bits (564),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 106/241 (44%), Positives = 144/241 (60%), Gaps = 0/241 (0%)
 Frame = +1

Query  22   LRRNLFDLLQEVVLIRDREDPRKFYPRFNLEDTSSFKGLDQHSKNVLKRLYYDYYFHRQE  201
            +R  L+ L+ +V+ + DR+D   F+PR  ++    ++ L+   K    RLY  YY+HR  
Sbjct  643  IRDGLYALISDVLFVPDRKDTNLFHPRIGVQHDFIYRALNDWEKAAFNRLYDQYYYHRHN  702

Query  202  SLWRQNALNTLPVLMNSSDMLTCGEDLGMIPACVNPVMQELGLIGLHIQRMPSEPGREFG  381
              W+Q A+  LP L  S+ ML CGEDLGMIP CV  VM +L ++ L IQRMP  P  EFG
Sbjct  703  DFWQQQAMKKLPQLTQSTRMLVCGEDLGMIPDCVAWVMNDLRILSLEIQRMPKNPAEEFG  762

Query  382  IPSEYSYMTVCAPSCHDCSTLRAWWEEDEGRRRRYFQTVVGSGAVPPDECTPEIARFVLR  561
              +EY Y +VC  S HD STLR WWEED  + +RY+  ++G     P   TPE+   V+R
Sbjct  763  RLNEYPYRSVCTFSTHDMSTLRGWWEEDYQQTQRYYNQMLGHYGAAPAVATPELCEEVVR  822

Query  562  KHVESPSMWSIFPLQDLLALKEDYATRPAVEETINDPTXPRHYWRYRMHVTMESLLNDKS  741
             H+ S S+  I  LQD L++   +      EE IN P  PRHYWRYRMH+T+E L+  +S
Sbjct  823  NHLYSNSILCILSLQDWLSMDGRWRNPNVQEERINVPANPRHYWRYRMHLTLEQLMKAES  882

Query  742  L  744
            L
Sbjct  883  L  883



>ref|WP_005781429.1| 4-alpha-glucanotransferase [Bacteroides fragilis]
 gb|EFR55197.1| putative 4-alpha-glucanotransferase [Bacteroides fragilis 3_1_12]
Length=900

 Score =   221 bits (564),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 106/241 (44%), Positives = 144/241 (60%), Gaps = 0/241 (0%)
 Frame = +1

Query  22   LRRNLFDLLQEVVLIRDREDPRKFYPRFNLEDTSSFKGLDQHSKNVLKRLYYDYYFHRQE  201
            +R  L+ L+ +V+ + DR+D   F+PR  ++    ++ L+   K    RLY  YY+HR  
Sbjct  643  IRDGLYALISDVLFVPDRKDTNLFHPRIGVQHDFIYRALNDWEKAAFNRLYDQYYYHRHN  702

Query  202  SLWRQNALNTLPVLMNSSDMLTCGEDLGMIPACVNPVMQELGLIGLHIQRMPSEPGREFG  381
              W+Q A+  LP L  S+ ML CGEDLGMIP CV  VM +L ++ L IQRMP  P  EFG
Sbjct  703  DFWQQQAMKKLPQLTQSTRMLVCGEDLGMIPDCVAWVMNDLRILSLEIQRMPKNPAEEFG  762

Query  382  IPSEYSYMTVCAPSCHDCSTLRAWWEEDEGRRRRYFQTVVGSGAVPPDECTPEIARFVLR  561
              +EY Y +VC  S HD STLR WWEED  + +RY+  ++G     P   TPE+   V+R
Sbjct  763  RLNEYPYRSVCTFSTHDMSTLRGWWEEDYQQTQRYYNQMLGHYGAAPAVATPELCEEVVR  822

Query  562  KHVESPSMWSIFPLQDLLALKEDYATRPAVEETINDPTXPRHYWRYRMHVTMESLLNDKS  741
             H+ S S+  I  LQD L++   +      EE IN P  PRHYWRYRMH+T+E L+  +S
Sbjct  823  NHLYSNSILCILSLQDWLSMDGRWRNPNVQEERINVPANPRHYWRYRMHLTLEQLMKAES  882

Query  742  L  744
            L
Sbjct  883  L  883



>ref|WP_032572551.1| 4-alpha-glucanotransferase [Bacteroides fragilis]
 gb|EXY16573.1| 4-alpha-glucanotransferase [Bacteroides fragilis str. 2-F-2 #5]
Length=900

 Score =   221 bits (564),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 105/241 (44%), Positives = 144/241 (60%), Gaps = 0/241 (0%)
 Frame = +1

Query  22   LRRNLFDLLQEVVLIRDREDPRKFYPRFNLEDTSSFKGLDQHSKNVLKRLYYDYYFHRQE  201
            +R  L+ L+ +V+ + DR+DP  ++PR  ++    ++ L+   K     LY  YY+HR  
Sbjct  643  VRDGLYALISDVLFVPDRKDPNLYHPRIGVQHDFIYRALNDWEKTAFNSLYDQYYYHRHN  702

Query  202  SLWRQNALNTLPVLMNSSDMLTCGEDLGMIPACVNPVMQELGLIGLHIQRMPSEPGREFG  381
              W+Q A+  LP L  S+ ML CGEDLGMIP CV  VM +L ++ L IQRMP  P  EFG
Sbjct  703  DFWQQQAMKKLPQLTQSTRMLVCGEDLGMIPDCVAWVMNDLRILSLEIQRMPKNPAEEFG  762

Query  382  IPSEYSYMTVCAPSCHDCSTLRAWWEEDEGRRRRYFQTVVGSGAVPPDECTPEIARFVLR  561
              +EY Y +VC  S HD STLR WWEED  + +RY+  ++G     P   TPE+   V+R
Sbjct  763  RLNEYPYRSVCTFSTHDMSTLRGWWEEDYQQTQRYYNQMLGHYGTAPAIATPELCEEVVR  822

Query  562  KHVESPSMWSIFPLQDLLALKEDYATRPAVEETINDPTXPRHYWRYRMHVTMESLLNDKS  741
             H+ S S+  I  LQD L++   +      EE IN P  PRHYWRYRMH+T+E L+  +S
Sbjct  823  NHLYSNSILCILSLQDWLSMDGKWRNPNVQEERINIPANPRHYWRYRMHLTLEQLMKAES  882

Query  742  L  744
            L
Sbjct  883  L  883



>ref|WP_032539693.1| 4-alpha-glucanotransferase [Bacteroides fragilis]
 gb|KER54315.1| 4-alpha-glucanotransferase [Bacteroides fragilis]
Length=900

 Score =   221 bits (564),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 106/241 (44%), Positives = 144/241 (60%), Gaps = 0/241 (0%)
 Frame = +1

Query  22   LRRNLFDLLQEVVLIRDREDPRKFYPRFNLEDTSSFKGLDQHSKNVLKRLYYDYYFHRQE  201
            +R  L+ L+ +V+ + DR+D   F+PR  ++    ++ L+   K    RLY  YY+HR  
Sbjct  643  IRDGLYALISDVLFVPDRKDTNLFHPRIGVQHDFIYRALNDWEKAAFNRLYDQYYYHRHN  702

Query  202  SLWRQNALNTLPVLMNSSDMLTCGEDLGMIPACVNPVMQELGLIGLHIQRMPSEPGREFG  381
              W+Q A+  LP L  S+ ML CGEDLGMIP CV  VM +L ++ L IQRMP  P  EFG
Sbjct  703  DFWQQQAMKKLPQLTQSTRMLVCGEDLGMIPDCVAWVMNDLRILSLEIQRMPKNPAEEFG  762

Query  382  IPSEYSYMTVCAPSCHDCSTLRAWWEEDEGRRRRYFQTVVGSGAVPPDECTPEIARFVLR  561
              +EY Y +VC  S HD STLR WWEED  + +RY+  ++G     P   TPE+   V+R
Sbjct  763  RLNEYPYRSVCTFSTHDMSTLRGWWEEDYQQTQRYYNQMLGHYGAAPAVATPELCEEVVR  822

Query  562  KHVESPSMWSIFPLQDLLALKEDYATRPAVEETINDPTXPRHYWRYRMHVTMESLLNDKS  741
             H+ S S+  I  LQD L++   +      EE IN P  PRHYWRYRMH+T+E L+  +S
Sbjct  823  NHLYSNSILCILSLQDWLSMDGRWRNPNVQEERINVPANPRHYWRYRMHLTLEQLMKAES  882

Query  742  L  744
            L
Sbjct  883  L  883



>ref|WP_016273032.1| 4-alpha-glucanotransferase [Bacteroides uniformis]
 gb|EOS08537.1| 4-alpha-glucanotransferase [Bacteroides uniformis dnLKV2]
Length=897

 Score =   221 bits (564),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 103/241 (43%), Positives = 145/241 (60%), Gaps = 0/241 (0%)
 Frame = +1

Query  22   LRRNLFDLLQEVVLIRDREDPRKFYPRFNLEDTSSFKGLDQHSKNVLKRLYYDYYFHRQE  201
            +R  L+ L+ +V+ + DR +P +++PR  ++    ++ L+   K    RLY  YY+HR  
Sbjct  644  IRDGLYALISDVLFVPDRNNPHEYHPRIGVQHDYIYRALNDWEKAAFNRLYDQYYYHRHN  703

Query  202  SLWRQNALNTLPVLMNSSDMLTCGEDLGMIPACVNPVMQELGLIGLHIQRMPSEPGREFG  381
              W Q A+  LP L  S+ ML CGEDLGMIP CV  VM +L ++ L IQRMP +P +EFG
Sbjct  704  DFWGQQAMKKLPQLTQSTRMLVCGEDLGMIPDCVAWVMNDLRILSLEIQRMPKDPKQEFG  763

Query  382  IPSEYSYMTVCAPSCHDCSTLRAWWEEDEGRRRRYFQTVVGSGAVPPDECTPEIARFVLR  561
                Y Y +VC  S HD STLR WWEED  + +RY+ T++G     P   TPE+   V+R
Sbjct  764  HTDWYPYRSVCTISTHDMSTLRGWWEEDFQQTQRYYNTMLGHYGAAPATATPELCEEVVR  823

Query  562  KHVESPSMWSIFPLQDLLALKEDYATRPAVEETINDPTXPRHYWRYRMHVTMESLLNDKS  741
             H+ S S+  I  LQD +++   +      EE IN P  PRHYWR+RMH+T+E L+  +S
Sbjct  824  NHLHSNSILCILSLQDWMSMDGKWCNPNVQEERINIPANPRHYWRWRMHLTLEQLMKAES  883

Query  742  L  744
            L
Sbjct  884  L  884



>ref|WP_035449136.1| 4-alpha-glucanotransferase [Bacteroides uniformis]
 gb|KDS61530.1| 4-alpha-glucanotransferase [Bacteroides uniformis str. 3978 T3 
i]
Length=897

 Score =   221 bits (563),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 103/241 (43%), Positives = 145/241 (60%), Gaps = 0/241 (0%)
 Frame = +1

Query  22   LRRNLFDLLQEVVLIRDREDPRKFYPRFNLEDTSSFKGLDQHSKNVLKRLYYDYYFHRQE  201
            +R  L+ L+ +V+ + DR +P +++PR  ++    ++ L+   K    RLY  YY+HR  
Sbjct  644  IRDGLYALISDVLFVPDRNNPHEYHPRIGVQHDYIYRALNDWEKAAFNRLYDQYYYHRHN  703

Query  202  SLWRQNALNTLPVLMNSSDMLTCGEDLGMIPACVNPVMQELGLIGLHIQRMPSEPGREFG  381
              W Q A+  LP L  S+ ML CGEDLGMIP CV  VM +L ++ L IQRMP +P +EFG
Sbjct  704  DFWGQQAMKKLPQLTQSTRMLVCGEDLGMIPDCVAWVMNDLRILSLEIQRMPKDPKQEFG  763

Query  382  IPSEYSYMTVCAPSCHDCSTLRAWWEEDEGRRRRYFQTVVGSGAVPPDECTPEIARFVLR  561
                Y Y +VC  S HD STLR WWEED  + +RY+ T++G     P   TPE+   V+R
Sbjct  764  HTDWYPYRSVCTISTHDMSTLRGWWEEDFQQTQRYYNTMLGHYGAAPATATPELCEEVVR  823

Query  562  KHVESPSMWSIFPLQDLLALKEDYATRPAVEETINDPTXPRHYWRYRMHVTMESLLNDKS  741
             H+ S S+  I  LQD +++   +      EE IN P  PRHYWR+RMH+T+E L+  +S
Sbjct  824  NHLHSNSILCILSLQDWMSMDGKWRNPNVQEERINIPANPRHYWRWRMHLTLEQLMKAES  883

Query  742  L  744
            L
Sbjct  884  L  884



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1413938297850