BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig13090

Length=1220
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009593328.1|  PREDICTED: uncharacterized aarF domain-conta...    505   3e-169   Nicotiana tomentosiformis
ref|XP_009769152.1|  PREDICTED: uncharacterized aarF domain-conta...    503   3e-168   Nicotiana sylvestris
ref|XP_004502859.1|  PREDICTED: uncharacterized protein sll1770-l...    493   9e-165   
gb|ABK95603.1|  unknown                                                 476   1e-164   Populus trichocarpa [western balsam poplar]
gb|ACR37873.1|  unknown                                                 474   6e-164   Zea mays [maize]
ref|XP_009333770.1|  PREDICTED: uncharacterized aarF domain-conta...    490   1e-163   Pyrus x bretschneideri [bai li]
ref|XP_010261131.1|  PREDICTED: uncharacterized aarF domain-conta...    490   2e-163   Nelumbo nucifera [Indian lotus]
ref|XP_009342814.1|  PREDICTED: uncharacterized aarF domain-conta...    489   3e-163   Pyrus x bretschneideri [bai li]
ref|XP_011021917.1|  PREDICTED: uncharacterized aarF domain-conta...    489   8e-163   Populus euphratica
ref|XP_011021920.1|  PREDICTED: uncharacterized aarF domain-conta...    488   1e-162   Populus euphratica
ref|XP_008342858.1|  PREDICTED: uncharacterized protein LOC103405622    470   6e-162   
gb|KJB18304.1|  hypothetical protein B456_003G046300                    485   2e-161   Gossypium raimondii
ref|XP_008809510.1|  PREDICTED: uncharacterized aarF domain-conta...    483   1e-160   Phoenix dactylifera
ref|XP_009416860.1|  PREDICTED: uncharacterized aarF domain-conta...    483   1e-160   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002276397.3|  PREDICTED: uncharacterized aarF domain-conta...    482   2e-160   Vitis vinifera
ref|XP_003526823.1|  PREDICTED: uncharacterized aarF domain-conta...    482   2e-160   
ref|XP_007159753.1|  hypothetical protein PHAVU_002G264200g             482   3e-160   Phaseolus vulgaris [French bean]
ref|XP_011100883.1|  PREDICTED: uncharacterized aarF domain-conta...    481   5e-160   Sesamum indicum [beniseed]
ref|XP_010025499.1|  PREDICTED: uncharacterized aarF domain-conta...    482   6e-160   Eucalyptus grandis [rose gum]
emb|CDP12922.1|  unnamed protein product                                481   8e-160   Coffea canephora [robusta coffee]
ref|XP_007048092.1|  ABC2 isoform 2                                     481   1e-159   
ref|XP_007048091.1|  ABC2 isoform 1                                     481   2e-159   
ref|XP_008440677.1|  PREDICTED: uncharacterized aarF domain-conta...    480   2e-159   Cucumis melo [Oriental melon]
ref|XP_008440678.1|  PREDICTED: uncharacterized aarF domain-conta...    480   2e-159   Cucumis melo [Oriental melon]
ref|XP_003531376.1|  PREDICTED: uncharacterized aarF domain-conta...    479   4e-159   Glycine max [soybeans]
ref|XP_010937033.1|  PREDICTED: uncharacterized aarF domain-conta...    479   4e-159   Elaeis guineensis
ref|XP_009407360.1|  PREDICTED: uncharacterized aarF domain-conta...    478   1e-158   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006578821.1|  PREDICTED: uncharacterized aarF domain-conta...    477   2e-158   Glycine max [soybeans]
ref|XP_003602469.1|  ABC transporter-like protein                       476   3e-158   
ref|XP_012075202.1|  PREDICTED: uncharacterized aarF domain-conta...    477   4e-158   Jatropha curcas
ref|XP_003630100.1|  ABC transporter-like protein                       476   5e-158   Medicago truncatula
ref|XP_006827080.1|  PREDICTED: uncharacterized aarF domain-conta...    476   5e-158   Amborella trichopoda
ref|XP_004237437.1|  PREDICTED: uncharacterized aarF domain-conta...    476   8e-158   Solanum lycopersicum
dbj|BAD33355.1|  putative ABC transporter                               462   8e-158   Oryza sativa Japonica Group [Japonica rice]
ref|XP_011657999.1|  PREDICTED: uncharacterized aarF domain-conta...    476   9e-158   Cucumis sativus [cucumbers]
ref|XP_004143496.1|  PREDICTED: uncharacterized aarF domain-conta...    476   1e-157   Cucumis sativus [cucumbers]
ref|XP_006354710.1|  PREDICTED: uncharacterized aarF domain-conta...    475   1e-157   Solanum tuberosum [potatoes]
gb|AES72720.2|  ABC transporter-like protein                            474   1e-157   Medicago truncatula
gb|KHN29105.1|  Hypothetical protein glysoja_008440                     474   2e-157   Glycine soja [wild soybean]
ref|XP_007137605.1|  hypothetical protein PHAVU_009G140400g             474   3e-157   Phaseolus vulgaris [French bean]
ref|XP_002452330.1|  hypothetical protein SORBIDRAFT_04g023800          474   3e-157   Sorghum bicolor [broomcorn]
ref|XP_010519924.1|  PREDICTED: uncharacterized aarF domain-conta...    473   7e-157   Tarenaya hassleriana [spider flower]
ref|XP_008643622.1|  PREDICTED: LOC100281496 isoform X2                 473   9e-157   Zea mays [maize]
ref|NP_001147886.1|  LOC100281496                                       473   9e-157   Zea mays [maize]
gb|AFW71972.1|  ABC1 protein                                            473   1e-156   
gb|ACG29222.1|  ATATH13                                                 473   1e-156   Zea mays [maize]
gb|ADB13188.1|  ABC1 protein                                            473   1e-156   Zea mays [maize]
ref|XP_002307123.2|  hypothetical protein POPTR_0005s08490g             473   1e-156   
ref|XP_008643621.1|  PREDICTED: LOC100281496 isoform X1                 473   2e-156   
ref|XP_006428063.1|  hypothetical protein CICLE_v10024947mg             473   2e-156   Citrus clementina [clementine]
ref|XP_007208067.1|  hypothetical protein PRUPE_ppa001814mg             472   3e-156   Prunus persica
ref|XP_003525072.1|  PREDICTED: uncharacterized aarF domain-conta...    471   3e-156   Glycine max [soybeans]
ref|XP_008392537.1|  PREDICTED: uncharacterized aarF domain-conta...    471   4e-156   
ref|XP_010099897.1|  hypothetical protein L484_020081                   471   7e-156   Morus notabilis
emb|CBI21492.3|  unnamed protein product                                469   2e-155   Vitis vinifera
ref|XP_004302218.1|  PREDICTED: uncharacterized aarF domain-conta...    468   9e-155   Fragaria vesca subsp. vesca
gb|KHN38216.1|  Hypothetical protein glysoja_003881                     467   2e-154   Glycine soja [wild soybean]
ref|XP_008233504.1|  PREDICTED: uncharacterized aarF domain-conta...    466   3e-154   Prunus mume [ume]
ref|XP_004504029.1|  PREDICTED: uncharacterized protein sll1770-l...    466   3e-154   Cicer arietinum [garbanzo]
ref|XP_003575213.1|  PREDICTED: uncharacterized aarF domain-conta...    464   1e-153   
ref|XP_006382920.1|  hypothetical protein POPTR_0005s08490g             463   7e-153   
ref|NP_001047212.1|  Os02g0575500                                       463   8e-153   
ref|XP_006648776.1|  PREDICTED: uncharacterized aarF domain-conta...    457   7e-152   Oryza brachyantha
ref|XP_010681103.1|  PREDICTED: uncharacterized aarF domain-conta...    457   9e-151   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004952869.1|  PREDICTED: uncharacterized aarF domain-conta...    456   4e-150   Setaria italica
dbj|BAF01914.1|  ABC transporter-like                                   442   5e-149   Arabidopsis thaliana [mouse-ear cress]
ref|NP_201299.2|  oxidative stress-related ABC1-like protein 1          446   2e-146   Arabidopsis thaliana [mouse-ear cress]
gb|ABK25165.1|  unknown                                                 446   6e-146   Picea sitchensis
ref|XP_006394092.1|  hypothetical protein EUTSA_v10003690mg             445   6e-146   
dbj|BAA97306.1|  ABC transporter-like                                   446   9e-146   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002864932.1|  hypothetical protein ARALYDRAFT_919821             444   1e-145   Arabidopsis lyrata subsp. lyrata
ref|XP_006394093.1|  hypothetical protein EUTSA_v10003690mg             444   1e-145   Eutrema salsugineum [saltwater cress]
ref|XP_010444454.1|  PREDICTED: uncharacterized aarF domain-conta...    442   1e-144   Camelina sativa [gold-of-pleasure]
emb|CDY14523.1|  BnaC03g49360D                                          442   1e-144   Brassica napus [oilseed rape]
emb|CDY08837.1|  BnaA06g23870D                                          441   1e-144   Brassica napus [oilseed rape]
ref|XP_009150571.1|  PREDICTED: uncharacterized aarF domain-conta...    441   1e-144   Brassica rapa
ref|XP_006281672.1|  hypothetical protein CARUB_v10027811mg             441   3e-144   Capsella rubella
ref|XP_010462545.1|  PREDICTED: uncharacterized aarF domain-conta...    441   3e-144   Camelina sativa [gold-of-pleasure]
ref|XP_008809512.1|  PREDICTED: uncharacterized aarF domain-conta...    437   3e-143   
ref|XP_010937035.1|  PREDICTED: uncharacterized aarF domain-conta...    433   2e-141   
gb|EMS66269.1|  hypothetical protein TRIUR3_01462                       423   1e-136   Triticum urartu
ref|XP_002533759.1|  ATATH13, putative                                  417   5e-136   
ref|XP_006382922.1|  hypothetical protein POPTR_0005s08490g             415   2e-134   
ref|XP_003602471.1|  ABC transporter-like protein                       412   3e-134   
gb|AES72722.2|  ABC transporter-like protein                            411   3e-133   Medicago truncatula
ref|XP_006428062.1|  hypothetical protein CICLE_v10024947mg             411   3e-133   
ref|XP_001766214.1|  predicted protein                                  405   2e-132   
ref|XP_006380463.1|  hypothetical protein POPTR_0007s064502g            385   5e-130   
ref|XP_002989389.1|  hypothetical protein SELMODRAFT_235769             393   3e-127   
ref|XP_002962434.1|  hypothetical protein SELMODRAFT_78366              391   6e-127   
gb|KCW62173.1|  hypothetical protein EUGRSUZ_H04831                     386   3e-122   Eucalyptus grandis [rose gum]
gb|ABK94805.1|  unknown                                                 349   4e-116   Populus trichocarpa [western balsam poplar]
gb|EMT33740.1|  hypothetical protein F775_00845                         362   4e-114   
gb|KDO59967.1|  hypothetical protein CISIN_1g0041151mg                  333   6e-110   Citrus sinensis [apfelsine]
gb|EPS65160.1|  hypothetical protein M569_09620                         328   7e-108   Genlisea aurea
gb|KDO59973.1|  hypothetical protein CISIN_1g0041151mg                  326   2e-107   Citrus sinensis [apfelsine]
ref|XP_001693469.1|  ABC-1-like kinase                                  282   7e-85    Chlamydomonas reinhardtii
ref|XP_002949242.1|  hypothetical protein VOLCADRAFT_104180             275   2e-79    Volvox carteri f. nagariensis
ref|XP_005646355.1|  ABC-1-like kinase                                  264   1e-77    Coccomyxa subellipsoidea C-169
gb|KDO59974.1|  hypothetical protein CISIN_1g0041151mg                  241   4e-75    Citrus sinensis [apfelsine]
gb|KIZ01364.1|  Uncharacterized protein MNEG_6596                       254   9e-73    Monoraphidium neglectum
ref|XP_003054952.1|  predicted protein                                  243   4e-70    Micromonas pusilla CCMP1545
ref|XP_008675337.1|  PREDICTED: uncharacterized protein LOC103651...    234   9e-70    Zea mays [maize]
ref|XP_008675336.1|  PREDICTED: uncharacterized protein LOC103651...    234   2e-69    
ref|XP_008675334.1|  PREDICTED: uncharacterized protein LOC103651...    234   2e-69    Zea mays [maize]
ref|XP_008675333.1|  PREDICTED: uncharacterized protein LOC103651...    234   2e-69    Zea mays [maize]
ref|XP_006382925.1|  hypothetical protein POPTR_0005s08490g             241   4e-69    
ref|XP_008675335.1|  PREDICTED: uncharacterized protein LOC103651...    233   5e-69    Zea mays [maize]
ref|XP_011400484.1|  Uncharacterized protein F751_6088                  240   1e-68    Auxenochlorella protothecoides
ref|XP_002503992.1|  predicted protein                                  241   3e-68    Micromonas commoda
tpg|DAA58517.1|  TPA: hypothetical protein ZEAMMB73_453288              235   4e-68    
ref|XP_001420615.1|  predicted protein                                  238   1e-67    Ostreococcus lucimarinus CCE9901
tpg|DAA58520.1|  TPA: hypothetical protein ZEAMMB73_453288              218   9e-66    
emb|CEF99842.1|  Protein kinase-like domain                             233   1e-65    Ostreococcus tauri
ref|XP_008662178.1|  PREDICTED: uncharacterized protein LOC103640...    207   3e-59    Zea mays [maize]
ref|XP_008662184.1|  PREDICTED: uncharacterized protein LOC103640...    206   6e-59    
ref|XP_008662084.1|  PREDICTED: uncharacterized protein LOC103640...    207   1e-58    Zea mays [maize]
ref|XP_008662156.1|  PREDICTED: uncharacterized protein LOC103640...    207   1e-58    Zea mays [maize]
ref|XP_008662174.1|  PREDICTED: uncharacterized protein LOC103640...    206   1e-58    Zea mays [maize]
ref|XP_008662158.1|  PREDICTED: uncharacterized protein LOC103640...    205   3e-58    Zea mays [maize]
gb|EYU31071.1|  hypothetical protein MIMGU_mgv1a003362mg                211   4e-58    Erythranthe guttata [common monkey flower]
ref|XP_007511850.1|  predicted protein                                  213   7e-58    Bathycoccus prasinos
ref|XP_003082273.1|  putative ABC transporter protein (ISS)             209   1e-56    
gb|KIZ02197.1|  Uncharacterized protein MNEG_5768                       185   2e-52    Monoraphidium neglectum
gb|KJB10241.1|  hypothetical protein B456_001G191200                    184   2e-49    Gossypium raimondii
ref|XP_004243575.1|  PREDICTED: uncharacterized aarF domain-conta...    188   2e-49    Solanum lycopersicum
gb|KJB10243.1|  hypothetical protein B456_001G191200                    185   2e-49    Gossypium raimondii
ref|XP_008464152.1|  PREDICTED: uncharacterized aarF domain-conta...    187   3e-49    Cucumis melo [Oriental melon]
ref|XP_006357645.1|  PREDICTED: uncharacterized aarF domain-conta...    187   4e-49    Solanum tuberosum [potatoes]
ref|XP_011100511.1|  PREDICTED: uncharacterized aarF domain-conta...    187   4e-49    Sesamum indicum [beniseed]
gb|EYU42774.1|  hypothetical protein MIMGU_mgv1a002313mg                187   5e-49    Erythranthe guttata [common monkey flower]
gb|EYU42775.1|  hypothetical protein MIMGU_mgv1a002313mg                187   5e-49    Erythranthe guttata [common monkey flower]
ref|XP_011656889.1|  PREDICTED: uncharacterized aarF domain-conta...    187   6e-49    Cucumis sativus [cucumbers]
emb|CBJ28359.1|  conserved unknown protein                              187   8e-49    Ectocarpus siliculosus
gb|KCW45286.1|  hypothetical protein EUGRSUZ_L01057                     179   9e-49    Eucalyptus grandis [rose gum]
ref|XP_010040364.1|  PREDICTED: uncharacterized aarF domain-conta...    186   1e-48    Eucalyptus grandis [rose gum]
gb|KJB10238.1|  hypothetical protein B456_001G191200                    185   2e-48    Gossypium raimondii
gb|KJB10239.1|  hypothetical protein B456_001G191200                    185   2e-48    Gossypium raimondii
gb|KJB10240.1|  hypothetical protein B456_001G191200                    185   2e-48    Gossypium raimondii
gb|KHG12439.1|  Uncharacterized protein F383_16816                      185   3e-48    Gossypium arboreum [tree cotton]
ref|XP_009590949.1|  PREDICTED: uncharacterized aarF domain-conta...    184   4e-48    Nicotiana tomentosiformis
gb|ACN40297.1|  unknown                                                 179   4e-48    Picea sitchensis
ref|XP_010689235.1|  PREDICTED: uncharacterized aarF domain-conta...    184   4e-48    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_005718773.1|  unnamed protein product                            186   5e-48    Chondrus crispus [carageen]
emb|CDP18955.1|  unnamed protein product                                183   9e-48    Coffea canephora [robusta coffee]
ref|XP_006447817.1|  hypothetical protein CICLE_v10014451mg             183   1e-47    Citrus clementina [clementine]
ref|XP_006469437.1|  PREDICTED: uncharacterized aarF domain-conta...    183   1e-47    Citrus sinensis [apfelsine]
ref|XP_010069707.1|  PREDICTED: uncharacterized aarF domain-conta...    183   1e-47    Eucalyptus grandis [rose gum]
ref|XP_003542175.1|  PREDICTED: uncharacterized aarF domain-conta...    183   1e-47    Glycine max [soybeans]
ref|XP_009774821.1|  PREDICTED: uncharacterized aarF domain-conta...    183   1e-47    Nicotiana sylvestris
gb|KDO50944.1|  hypothetical protein CISIN_1g0053091mg                  183   1e-47    Citrus sinensis [apfelsine]
tpg|DAA47529.1|  TPA: hypothetical protein ZEAMMB73_771547              173   2e-47    
ref|XP_007145996.1|  hypothetical protein PHAVU_006G004300g             182   2e-47    Phaseolus vulgaris [French bean]
ref|XP_008783035.1|  PREDICTED: uncharacterized aarF domain-conta...    182   3e-47    Phoenix dactylifera
ref|XP_012081503.1|  PREDICTED: uncharacterized aarF domain-conta...    182   3e-47    Jatropha curcas
ref|XP_002532202.1|  Protein ABC1, mitochondrial precursor, putative    182   3e-47    
emb|CBI28456.3|  unnamed protein product                                181   5e-47    Vitis vinifera
ref|XP_002268128.2|  PREDICTED: uncharacterized aarF domain-conta...    181   7e-47    Vitis vinifera
ref|XP_008229932.1|  PREDICTED: uncharacterized aarF domain-conta...    181   8e-47    Prunus mume [ume]
ref|XP_010551963.1|  PREDICTED: uncharacterized aarF domain-conta...    179   2e-46    Tarenaya hassleriana [spider flower]
ref|XP_010929058.1|  PREDICTED: uncharacterized aarF domain-conta...    179   3e-46    Elaeis guineensis
ref|XP_002320527.1|  ABC1 family protein                                179   3e-46    Populus trichocarpa [western balsam poplar]
gb|AAL87300.1|  unknown protein                                         177   4e-46    Arabidopsis thaliana [mouse-ear cress]
ref|NP_566315.1|  ABC1 kinase                                           178   5e-46    Arabidopsis thaliana [mouse-ear cress]
ref|XP_007217010.1|  hypothetical protein PRUPE_ppa002186mg             178   5e-46    Prunus persica
gb|AAM67100.1|  unknown                                                 178   5e-46    Arabidopsis thaliana [mouse-ear cress]
ref|XP_011008064.1|  PREDICTED: uncharacterized aarF domain-conta...    178   5e-46    Populus euphratica
ref|XP_003563071.1|  PREDICTED: uncharacterized aarF domain-conta...    178   6e-46    
gb|AAL10497.1|  At3g07700/F17A17.4                                      178   6e-46    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010252775.1|  PREDICTED: uncharacterized aarF domain-conta...    178   6e-46    Nelumbo nucifera [Indian lotus]
ref|XP_009147041.1|  PREDICTED: uncharacterized aarF domain-conta...    178   6e-46    Brassica rapa
ref|XP_002948655.1|  hypothetical protein VOLCADRAFT_58671              177   7e-46    Volvox carteri f. nagariensis
ref|XP_007049375.1|  Kinase superfamily protein isoform 1               178   7e-46    
emb|CDY35956.1|  BnaA05g29940D                                          178   7e-46    Brassica napus [oilseed rape]
ref|XP_006297088.1|  hypothetical protein CARUB_v10013091mg             177   9e-46    Capsella rubella
ref|XP_001779083.1|  predicted protein                                  177   1e-45    
ref|XP_010069706.1|  PREDICTED: uncharacterized aarF domain-conta...    177   1e-45    Eucalyptus grandis [rose gum]
gb|KCW58129.1|  hypothetical protein EUGRSUZ_H00851                     177   1e-45    Eucalyptus grandis [rose gum]
ref|XP_004502149.1|  PREDICTED: uncharacterized protein sll1770-l...    177   2e-45    Cicer arietinum [garbanzo]
ref|XP_002884663.1|  hypothetical protein ARALYDRAFT_478103             177   2e-45    
gb|KJB10242.1|  hypothetical protein B456_001G191200                    176   2e-45    Gossypium raimondii
ref|XP_009395833.1|  PREDICTED: uncharacterized aarF domain-conta...    177   2e-45    Musa acuminata subsp. malaccensis [pisang utan]
gb|KCW58128.1|  hypothetical protein EUGRSUZ_H00850                     176   2e-45    Eucalyptus grandis [rose gum]
ref|XP_010456734.1|  PREDICTED: uncharacterized aarF domain-conta...    176   2e-45    Camelina sativa [gold-of-pleasure]
ref|XP_003605253.1|  hypothetical protein MTR_4g027180                  176   3e-45    
ref|XP_010486338.1|  PREDICTED: uncharacterized aarF domain-conta...    176   3e-45    Camelina sativa [gold-of-pleasure]
ref|XP_010464409.1|  PREDICTED: uncharacterized aarF domain-conta...    176   3e-45    Camelina sativa [gold-of-pleasure]
ref|XP_003601534.1|  hypothetical protein MTR_3g082750                  176   4e-45    
emb|CDY28024.1|  BnaC05g44260D                                          176   5e-45    Brassica napus [oilseed rape]
ref|XP_006407806.1|  hypothetical protein EUTSA_v10020179mg             175   7e-45    Eutrema salsugineum [saltwater cress]
ref|XP_006595653.1|  PREDICTED: uncharacterized aarF domain-conta...    174   1e-44    Glycine max [soybeans]
ref|XP_007142530.1|  hypothetical protein PHAVU_008G288500g             174   1e-44    Phaseolus vulgaris [French bean]
ref|XP_004956388.1|  PREDICTED: uncharacterized aarF domain-conta...    174   1e-44    
ref|XP_005651797.1|  ABC1-domain-containing protein                     173   1e-44    Coccomyxa subellipsoidea C-169
ref|XP_003518576.2|  PREDICTED: uncharacterized aarF domain-conta...    173   3e-44    Glycine max [soybeans]
ref|XP_002464851.1|  hypothetical protein SORBIDRAFT_01g027550          173   3e-44    Sorghum bicolor [broomcorn]
ref|XP_004303572.1|  PREDICTED: uncharacterized aarF domain-conta...    173   3e-44    Fragaria vesca subsp. vesca
ref|WP_018398664.1|  hypothetical protein                               172   4e-44    filamentous cyanobacterium ESFC-1
gb|AGI37816.1|  chloroplast ABC1-like family protein                    172   5e-44    Triticum aestivum [Canadian hard winter wheat]
gb|KIY97471.1|  Uncharacterized protein MNEG_10493                      165   6e-44    Monoraphidium neglectum
gb|EMS49182.1|  hypothetical protein TRIUR3_21765                       172   7e-44    Triticum urartu
gb|EWM26267.1|  abc transporter                                         173   1e-43    Nannochloropsis gaditana
emb|CBI28458.3|  unnamed protein product                                171   1e-43    Vitis vinifera
ref|XP_002974815.1|  hypothetical protein SELMODRAFT_101886             170   2e-43    
ref|XP_002266310.1|  PREDICTED: uncharacterized aarF domain-conta...    171   2e-43    Vitis vinifera
emb|CAN66349.1|  hypothetical protein VITISV_016570                     171   2e-43    Vitis vinifera
ref|XP_006660453.1|  PREDICTED: uncharacterized aarF domain-conta...    171   2e-43    Oryza brachyantha
ref|XP_002963731.1|  hypothetical protein SELMODRAFT_79664              169   4e-43    
ref|XP_006469441.1|  PREDICTED: uncharacterized aarF domain-conta...    170   4e-43    
ref|XP_006447815.1|  hypothetical protein CICLE_v10014453mg             170   4e-43    Citrus clementina [clementine]
ref|NP_001062679.1|  Os09g0250700                                       169   6e-43    
ref|NP_001189839.1|  ABC1 kinase                                        169   7e-43    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010942704.1|  PREDICTED: uncharacterized aarF domain-conta...    164   2e-42    
gb|AAF21180.1|AC013483_4  unknown protein                               168   2e-42    Arabidopsis thaliana [mouse-ear cress]
ref|XP_004956386.1|  PREDICTED: uncharacterized aarF domain-conta...    168   2e-42    
ref|XP_004956385.1|  PREDICTED: uncharacterized aarF domain-conta...    168   3e-42    
ref|WP_036485586.1|  hypothetical protein                               166   5e-42    
ref|WP_023068475.1|  ABC1 family protein                                165   1e-41    Lyngbya aestuarii
ref|WP_039897389.1|  hypothetical protein                               164   2e-41    Lyngbya sp. PCC 8106
gb|EAW33714.1|  hypothetical protein L8106_10257                        164   3e-41    Lyngbya sp. PCC 8106
ref|WP_040467304.1|  hypothetical protein                               163   7e-41    
ref|WP_019487347.1|  hypothetical protein                               162   1e-40    Kamptonema formosum
ref|WP_026734099.1|  hypothetical protein                               162   2e-40    Fischerella sp. PCC 9605
ref|WP_040553139.1|  hypothetical protein                               161   2e-40    Raphidiopsis brookii
gb|EFA74230.1|  ABC-1                                                   161   2e-40    Raphidiopsis brookii D9
ref|WP_015191474.1|  ABC-1 domain-containing protein                    160   4e-40    Stanieria cyanosphaera
ref|WP_006277336.1|  hypothetical protein                               160   4e-40    Cylindrospermopsis raciborskii
ref|WP_009455634.1|  MULTISPECIES: hypothetical protein                 160   4e-40    Fischerella thermalis
gb|EPS58071.1|  hypothetical protein M569_16745                         158   5e-40    Genlisea aurea
ref|XP_001696153.1|  hypothetical protein CHLREDRAFT_104846             159   6e-40    Chlamydomonas reinhardtii
ref|WP_017309950.1|  MULTISPECIES: hypothetical protein                 160   6e-40    Hapalosiphonaceae
ref|WP_026720499.1|  hypothetical protein                               159   9e-40    Fischerella sp. PCC 9431
dbj|BAQ65650.1|  ubiquinone biosynthesis monooxygenase UbiB             159   1e-39    Geminocystis sp. NIES-3709
ref|WP_016866629.1|  hypothetical protein                               159   1e-39    Fischerella muscicola
ref|WP_008276047.1|  hypothetical protein                               159   1e-39    Cyanothece sp. CCY0110
ref|XP_009396137.1|  PREDICTED: uncharacterized aarF domain-conta...    160   1e-39    Musa acuminata subsp. malaccensis [pisang utan]
ref|WP_039717273.1|  hypothetical protein                               159   2e-39    
ref|WP_016864239.1|  hypothetical protein                               158   2e-39    Fischerella muscicola
ref|WP_015222033.1|  ABC-1 domain-containing protein                    158   3e-39    
ref|WP_041462299.1|  hypothetical protein                               157   4e-39    Chroococcidiopsis thermalis
gb|AFY85560.1|  ABC-1 domain-containing protein                         157   4e-39    Chroococcidiopsis thermalis PCC 7203
ref|WP_045869017.1|  hypothetical protein                               157   4e-39    Nostocales
gb|KIJ84347.1|  hypothetical protein SD80_04935                         157   5e-39    Scytonema tolypothrichoides VB-61278
ref|WP_006635257.1|  hypothetical protein                               157   5e-39    Microcoleus vaginatus
gb|KJB10237.1|  hypothetical protein B456_001G191200                    157   5e-39    Gossypium raimondii
gb|ELS33524.1|  ABC-1 domain-containing protein                         157   5e-39    Pseudanabaena biceps PCC 7429
ref|WP_040687584.1|  hypothetical protein                               157   5e-39    Pseudanabaena biceps
emb|CCE16417.1|  Putative Ser/thr protein kinase of th ABC1 subfa...    157   5e-39    Arthrospira sp. PCC 8005
gb|ABG52521.1|  ABC-1                                                   157   6e-39    Trichodesmium erythraeum IMS101
ref|WP_044136875.1|  hypothetical protein                               157   7e-39    Trichodesmium erythraeum
ref|WP_017319605.1|  hypothetical protein                               157   7e-39    cyanobacterium PCC 7702
ref|WP_015176198.1|  ABC-1 domain-containing protein                    157   7e-39    Oscillatoria nigro-viridis
ref|WP_006625767.1|  MULTISPECIES: hypothetical protein                 157   8e-39    Arthrospira
ref|WP_041565840.1|  hypothetical protein                               157   8e-39    Nostoc punctiforme
ref|WP_019489539.1|  hypothetical protein                               157   8e-39    Calothrix sp. PCC 7103
gb|ACC79074.1|  ABC-1 domain protein                                    157   9e-39    Nostoc punctiforme PCC 73102
ref|WP_014276850.1|  hypothetical protein                               157   9e-39    Arthrospira platensis
ref|WP_006617514.1|  hypothetical protein                               157   1e-38    Arthrospira platensis
ref|WP_016953143.1|  hypothetical protein                               156   1e-38    Anabaena sp. PCC 7108
ref|WP_019506910.1|  hypothetical protein                               156   1e-38    
ref|WP_026079906.1|  hypothetical protein                               156   1e-38    Spirulina subsalsa
gb|AAF13088.1|AC009176_15  unknown protein                              156   2e-38    Arabidopsis thaliana [mouse-ear cress]
ref|XP_008813063.1|  PREDICTED: uncharacterized aarF domain-conta...    156   2e-38    
ref|XP_008813062.1|  PREDICTED: uncharacterized aarF domain-conta...    156   2e-38    Phoenix dactylifera
ref|WP_015145584.1|  putative unusual protein kinase                    155   2e-38    Pleurocapsa minor
ref|WP_013322631.1|  hypothetical protein                               155   2e-38    Cyanothece sp. PCC 7822
ref|WP_015196667.1|  ABC-1 domain-containing protein                    155   3e-38    Calothrix parietina
emb|CDN11519.1|  Ubiquinone biosynthesis monooxygenase UbiB             154   4e-38    Richelia intracellularis
ref|WP_007306696.1|  hypothetical protein                               155   4e-38    Crocosphaera watsonii
ref|WP_037217877.1|  hypothetical protein                               154   5e-38    
ref|WP_042341287.1|  hypothetical protein                               154   6e-38    Calothrix sp. PCC 7507
ref|WP_015219716.1|  ABC-1 domain-containing protein                    154   6e-38    Cyanobacterium aponinum
ref|WP_016872721.1|  hypothetical protein                               154   7e-38    Chlorogloeopsis fritschii
gb|KDO50947.1|  hypothetical protein CISIN_1g0053091mg                  154   7e-38    Citrus sinensis [apfelsine]
gb|AFY32897.1|  ABC-1 domain-containing protein                         154   8e-38    Calothrix sp. PCC 7507
ref|WP_009546809.1|  MULTISPECIES: hypothetical protein                 154   8e-38    Cyanothece
dbj|BAQ60254.1|  ubiquinone biosynthesis monooxygenase UbiB             154   8e-38    Geminocystis sp. NIES-3708
gb|KEI67017.1|  hypothetical protein A19Y_2049                          153   8e-38    Planktothrix agardhii NIVA-CYA 126/8
dbj|BAB76214.1|  alr4515                                                154   9e-38    Nostoc sp. PCC 7120
ref|WP_015140924.1|  putative unusual protein kinase                    154   9e-38    
ref|WP_044523285.1|  hypothetical protein                               154   9e-38    
gb|ABA22988.1|  ABC-1                                                   154   9e-38    
ref|WP_041456885.1|  hypothetical protein                               154   9e-38    
ref|WP_040629716.1|  hypothetical protein                               154   1e-37    
ref|WP_042157436.1|  hypothetical protein                               153   1e-37    
ref|WP_015113602.1|  ABC-1 domain-containing protein                    153   1e-37    
ref|WP_015079227.1|  ABC-1 domain-containing protein                    153   1e-37    
ref|WP_026796398.1|  hypothetical protein                               153   1e-37    
ref|WP_012598033.1|  hypothetical protein                               153   1e-37    
ref|WP_041233088.1|  hypothetical protein                               153   1e-37    
gb|AFZ24862.1|  putative unusual protein kinase                         153   2e-37    
ref|WP_041035589.1|  hypothetical protein                               153   2e-37    
ref|WP_015121452.1|  putative unusual protein kinase                    152   2e-37    
ref|WP_022608947.1|  putative unusual protein kinase                    152   2e-37    
ref|WP_006198362.1|  hypothetical protein                               152   2e-37    
ref|XP_006844050.2|  PREDICTED: uncharacterized aarF domain-conta...    153   3e-37    
emb|CCI02221.1|  conserved hypothetical protein                         147   4e-37    
ref|WP_011242984.1|  MULTISPECIES: hypothetical protein                 152   4e-37    
ref|WP_039739245.1|  hypothetical protein                               152   4e-37    
ref|WP_027402127.1|  hypothetical protein                               152   4e-37    
ref|WP_036833016.1|  MULTISPECIES: hypothetical protein                 151   5e-37    
gb|KIE10452.1|  hypothetical protein DA73_0218025                       151   5e-37    
ref|WP_015202852.1|  ABC-1 domain-containing protein                    151   5e-37    
ref|WP_026785321.1|  MULTISPECIES: hypothetical protein                 151   5e-37    
ref|WP_042464466.1|  hypothetical protein                               151   7e-37    
ref|WP_017712317.1|  hypothetical protein                               151   7e-37    
ref|WP_017744343.1|  hypothetical protein                               151   8e-37    
ref|WP_028089977.1|  hypothetical protein                               151   8e-37    
ref|WP_028083487.1|  hypothetical protein                               150   8e-37    
gb|AFZ56027.1|  ABC-1 domain-containing protein                         151   9e-37    
ref|WP_006507942.1|  putative unusual protein kinase                    150   1e-36    
ref|WP_035149423.1|  hypothetical protein                               150   1e-36    
ref|WP_013192468.1|  hypothetical protein                               150   2e-36    
ref|WP_026082643.1|  hypothetical protein                               150   2e-36    
ref|WP_004162703.1|  hypothetical protein                               149   3e-36    
gb|KJB18305.1|  hypothetical protein B456_003G046300                    149   3e-36    
ref|WP_040938032.1|  hypothetical protein                               149   3e-36    
ref|WP_012267075.1|  hypothetical protein                               149   4e-36    
ref|WP_017287067.1|  hypothetical protein                               149   4e-36    
dbj|GAL93693.1|  ubiquinone biosynthesis monooxygenase UbiB             149   5e-36    
gb|ACK64263.1|  ABC-1 domain protein                                    149   5e-36    
ref|WP_012796663.1|  hypothetical protein                               149   5e-36    
ref|WP_044492442.1|  hypothetical protein                               148   5e-36    
gb|EGJ33915.1|  putative unusual protein kinase                         148   6e-36    
ref|WP_041229705.1|  hypothetical protein                               148   6e-36    
ref|WP_045359547.1|  hypothetical protein                               148   7e-36    
ref|WP_012306086.1|  hypothetical protein                               148   9e-36    
ref|WP_044208241.1|  hypothetical protein                               147   1e-35    
gb|EDX74394.1|  ABC1 family protein                                     147   1e-35    
ref|WP_030007073.1|  hypothetical protein                               147   1e-35    
ref|WP_008232774.1|  Ubiquinone biosynthesis monooxygenase UbiB         147   1e-35    
emb|CCH98194.1|  conserved hypothetical protein                         147   1e-35    
ref|WP_043999235.1|  hypothetical protein                               147   2e-35    
ref|WP_036400048.1|  hypothetical protein                               147   2e-35    
ref|WP_008200502.1|  hypothetical protein                               147   2e-35    
emb|CCI20071.1|  conserved hypothetical protein                         147   2e-35    
ref|WP_008227806.1|  Ubiquinone biosynthesis monooxygenase UbiB         147   2e-35    
ref|WP_024545946.1|  hypothetical protein                               147   2e-35    
ref|WP_043995450.1|  hypothetical protein                               146   3e-35    
gb|ELS49031.1|  ABC1 family protein                                     146   3e-35    
emb|CCI23029.1|  conserved hypothetical protein                         146   3e-35    
ref|WP_042790838.1|  hypothetical protein                               146   3e-35    
ref|WP_016516688.1|  Aminoglycoside acetyltransferase regulator         146   3e-35    
ref|WP_002751993.1|  hypothetical protein                               146   3e-35    
gb|KDO50943.1|  hypothetical protein CISIN_1g006291mg                   147   3e-35    
emb|CCI09914.1|  conserved hypothetical protein                         146   3e-35    
ref|XP_007048093.1|  ABC2 isoform 3                                     146   3e-35    
ref|WP_015133778.1|  ABC-1 domain-containing protein                    146   3e-35    
ref|WP_027844801.1|  hypothetical protein                               146   4e-35    
ref|WP_043998388.1|  hypothetical protein                               146   4e-35    
ref|WP_024125233.1|  ABC1 family kinase-like protein                    146   4e-35    
ref|WP_044034153.1|  hypothetical protein                               146   4e-35    
ref|WP_043997219.1|  hypothetical protein                               146   4e-35    
gb|ELP53234.1|  ABC1 family protein                                     146   4e-35    
emb|CCI36125.1|  conserved hypothetical protein                         145   4e-35    
ref|WP_043997882.1|  hypothetical protein                               145   5e-35    
emb|CCI15493.1|  conserved hypothetical protein                         145   5e-35    
ref|WP_011058075.1|  hypothetical protein                               145   5e-35    
ref|WP_041918759.1|  hypothetical protein                               145   6e-35    
ref|WP_009768653.1|  putative unusual protein kinase                    145   7e-35    
gb|AFZ28656.1|  ABC-1 domain-containing protein                         145   7e-35    
ref|WP_029633702.1|  hypothetical protein [                             145   8e-35    
ref|WP_043999753.1|  hypothetical protein                               145   8e-35    
ref|WP_015125077.1|  putative unusual protein kinase                    145   8e-35    
ref|WP_041235429.1|  hypothetical protein                               145   1e-34    
ref|WP_010469235.1|  hypothetical protein                               145   1e-34    
gb|AFZ50633.1|  putative unusual protein kinase                         145   1e-34    
emb|CBJ28793.1|  ABC transporter-like                                   147   1e-34    
ref|WP_015227810.1|  ABC-1 domain-containing protein                    144   1e-34    
ref|WP_045053344.1|  hypothetical protein                               144   1e-34    
ref|WP_012165777.1|  hypothetical protein                               144   1e-34    
ref|WP_036003568.1|  hypothetical protein                               144   2e-34    
ref|XP_008783037.1|  PREDICTED: uncharacterized aarF domain-conta...    145   2e-34    
ref|WP_015181886.1|  protein kinase                                     144   2e-34    
gb|EMT28667.1|  hypothetical protein F775_06747                         144   7e-34    
ref|WP_019502909.1|  hypothetical protein                               142   8e-34    
ref|WP_044172412.1|  hypothetical protein                               141   2e-33    
gb|KDO59966.1|  hypothetical protein CISIN_1g0041152mg                  138   2e-33    
ref|XP_005537800.1|  unknown kinase with aarF domain                    143   2e-33    
ref|WP_035994873.1|  hypothetical protein                               140   2e-33    
ref|WP_011432580.1|  hypothetical protein                               140   3e-33    
ref|WP_017301433.1|  hypothetical protein                               140   3e-33    
gb|ELR99465.1|  putative unusual protein kinase                         140   3e-33    
ref|WP_034935360.1|  hypothetical protein                               140   3e-33    
ref|WP_015173367.1|  ABC-1 domain-containing protein                    140   4e-33    
ref|WP_015165094.1|  ABC-1 domain-containing protein                    139   7e-33    
gb|KDO59964.1|  hypothetical protein CISIN_1g0041152mg                  138   1e-32    
ref|WP_028954402.1|  hypothetical protein                               138   1e-32    
gb|KDO59958.1|  hypothetical protein CISIN_1g0041152mg                  138   2e-32    
gb|KDO59960.1|  hypothetical protein CISIN_1g0041152mg                  138   2e-32    
gb|KDO59961.1|  hypothetical protein CISIN_1g0041152mg                  138   2e-32    
gb|KDO59963.1|  hypothetical protein CISIN_1g0041152mg                  138   2e-32    
ref|WP_044198242.1|  hypothetical protein                               137   2e-32    
gb|AGY57712.1|  ubiquinone biosynthesis protein UbiB                    137   3e-32    
ref|WP_012625720.1|  hypothetical protein                               137   3e-32    
ref|WP_015168435.1|  putative unusual protein kinase                    137   3e-32    
ref|WP_041243791.1|  hypothetical protein                               137   4e-32    
gb|AFY85439.1|  putative unusual protein kinase                         137   4e-32    
ref|WP_012954178.1|  hypothetical protein                               137   4e-32    
ref|WP_039730282.1|  MULTISPECIES: hypothetical protein                 137   5e-32    
emb|CAN67706.1|  hypothetical protein VITISV_022432                     137   5e-32    
ref|WP_006515794.1|  putative unusual protein kinase                    135   2e-31    
ref|XP_008380073.1|  PREDICTED: uncharacterized protein LOC103443064    132   2e-31    
ref|WP_006454789.1|  hypothetical protein                               136   2e-31    
ref|WP_036030346.1|  hypothetical protein                               134   5e-31    
gb|KDO50948.1|  hypothetical protein CISIN_1g0053091mg                  134   9e-31    
ref|WP_015158242.1|  putative unusual protein kinase                    134   1e-30    
ref|XP_006447816.1|  hypothetical protein CICLE_v10014451mg             134   1e-30    
ref|WP_023073753.1|  unusual protein kinase                             133   1e-30    
gb|ERN05725.1|  hypothetical protein AMTR_s00006p00243670               133   1e-30    
ref|WP_011429128.1|  hypothetical protein                               132   3e-30    
ref|XP_006469439.1|  PREDICTED: uncharacterized aarF domain-conta...    133   3e-30    
ref|WP_010872302.1|  hypothetical protein                               132   3e-30    
ref|XP_005535882.1|  unknown kinase with aarF domain                    133   3e-30    
gb|KDO50946.1|  hypothetical protein CISIN_1g0053091mg                  133   3e-30    
ref|XP_005843049.1|  hypothetical protein CHLNCDRAFT_33282              130   4e-30    
ref|XP_006483683.1|  PREDICTED: uncharacterized protein LOC102611013    125   4e-30    
dbj|BAP17136.1|  ABC transporter                                        131   5e-30    
ref|WP_044107528.1|  hypothetical protein                               131   5e-30    
ref|XP_002286321.1|  predicted protein                                  130   9e-30    
ref|WP_017327947.1|  hypothetical protein                               129   2e-29    
ref|WP_028947263.1|  hypothetical protein                               129   3e-29    
ref|XP_002179879.1|  predicted protein                                  129   4e-29    
ref|XP_005776464.1|  hypothetical protein EMIHUDRAFT_435521             127   1e-28    
ref|WP_017663374.1|  hypothetical protein                               125   4e-28    
ref|WP_040055074.1|  hypothetical protein                               125   8e-28    
gb|KFF41153.1|  putative unusual protein kinase                         124   8e-28    
gb|AAK32842.1|AF361830_1  AT5g64940/MXK3_17                             124   1e-27    
gb|EEC84167.1|  hypothetical protein OsI_30542                          125   1e-27    
ref|WP_011144164.1|  hypothetical protein                               123   3e-27    
gb|EJK44316.1|  hypothetical protein THAOC_37151                        124   4e-27    
ref|XP_005718132.1|  unnamed protein product                            122   1e-26    
gb|KHN43977.1|  Hypothetical protein glysoja_026016                     117   6e-25    
ref|WP_017711849.1|  hypothetical protein                               114   3e-24    
ref|XP_010104067.1|  hypothetical protein L484_014252                   115   3e-24    
ref|WP_040940058.1|  hypothetical protein                               110   8e-23    
ref|WP_015144142.1|  putative unusual protein kinase                    109   1e-22    
ref|XP_005844022.1|  hypothetical protein CHLNCDRAFT_139566             103   2e-22    
ref|WP_007356604.1|  MULTISPECIES: hypothetical protein                 108   3e-22    
ref|WP_040935819.1|  hypothetical protein                               108   3e-22    
ref|WP_015214005.1|  ABC-1 domain-containing protein                    108   3e-22    
ref|XP_011008066.1|  PREDICTED: uncharacterized aarF domain-conta...    108   3e-22    
ref|WP_015954283.1|  hypothetical protein                               108   4e-22    
gb|ADN14153.1|  ABC-1 domain protein                                    107   5e-22    
ref|WP_041933206.1|  hypothetical protein                               107   6e-22    
ref|WP_026104120.1|  hypothetical protein                               107   1e-21    
ref|WP_006105208.1|  hypothetical protein                               106   1e-21    
ref|WP_036486182.1|  hypothetical protein                               106   2e-21    
ref|XP_002176306.1|  predicted protein                                  106   2e-21    
ref|WP_008277261.1|  hypothetical protein                               104   5e-21    
ref|WP_027403243.1|  hypothetical protein                               104   5e-21    
ref|WP_006617937.1|  hypothetical protein                               104   5e-21    
ref|WP_006634151.1|  hypothetical protein                               104   6e-21    
ref|WP_006626146.1|  hypothetical protein                               104   6e-21    
dbj|BAK02615.1|  predicted protein                                      104   6e-21    
ref|WP_015163413.1|  ABC-1 domain-containing protein                    104   7e-21    
gb|EHJ13247.1|  Ubiquinone biosynthesis monooxygenase UbiB              103   1e-20    
emb|CCQ61554.1|  Ubiquinone biosynthesis monooxygenase UbiB             103   2e-20    
ref|WP_021832319.1|  Ubiquinone biosynthesis monooxygenase UbiB         103   2e-20    
ref|WP_012594648.1|  MULTISPECIES: hypothetical protein                 102   3e-20    
gb|EPS60015.1|  hypothetical protein M569_14788                         102   3e-20    
ref|WP_009786507.1|  hypothetical protein                               102   4e-20    
ref|WP_015078843.1|  AarF-like protein kinase                           102   4e-20    
ref|WP_015146767.1|  putative unusual protein kinase                    101   7e-20    
ref|WP_023068606.1|  ABC1 family protein                                101   7e-20    
ref|WP_019508744.1|  hypothetical protein                               101   8e-20    
ref|XP_002293800.1|  hypothetical protein THAPSDRAFT_37294              101   8e-20    
ref|WP_021829408.1|  Ubiquinone biosynthesis monooxygenase UbiB         101   9e-20    
ref|WP_015185276.1|  protein kinase                                     100   1e-19    
ref|WP_007305081.1|  hypothetical protein                               100   1e-19    
ref|WP_015223418.1|  ABC-1 domain-containing protein                    100   2e-19    
dbj|BAQ64321.1|  ubiquinone biosynthesis monooxygenase UbiB             100   2e-19    
ref|WP_026098477.1|  hypothetical protein                               100   2e-19    
gb|AFZ37632.1|  ABC-1 domain-containing protein                       99.8    2e-19    
ref|WP_041620242.1|  hypothetical protein                             99.8    3e-19    
ref|WP_017660900.1|  hypothetical protein                             99.4    4e-19    
ref|WP_015178744.1|  ABC-1 domain-containing protein                  99.0    5e-19    
emb|CCQ67489.1|  Ubiquinone biosynthesis monooxygenase UbiB           98.6    6e-19    
ref|WP_038014325.1|  kinase                                           98.6    7e-19    
gb|EHA61885.1|  ABC-1 domain-containing protein                       98.2    9e-19    
ref|XP_005778492.1|  hypothetical protein EMIHUDRAFT_469077           97.8    1e-18    
ref|WP_028947753.1|  hypothetical protein                             97.4    2e-18    
ref|WP_009544341.1|  MULTISPECIES: hypothetical protein               97.4    2e-18    
ref|WP_006530258.1|  putative unusual protein kinase                  97.1    2e-18    
ref|WP_017296332.1|  hypothetical protein                             96.3    3e-18    
ref|WP_038552473.1|  kinase                                           96.3    4e-18    
ref|WP_015132787.1|  ABC-1 domain-containing protein                  96.3    4e-18    
ref|WP_018399561.1|  hypothetical protein                             96.3    4e-18    
ref|WP_041443648.1|  hypothetical protein                             95.9    5e-18    
gb|ACB00580.1|  ABC1 family domain protein                            95.9    6e-18    
ref|XP_009039017.1|  hypothetical protein AURANDRAFT_29234            95.9    6e-18    
ref|WP_011365404.1|  kinase                                           95.5    7e-18    
ref|WP_024125274.1|  ABC1 family kinase-like protein                  95.5    8e-18    
ref|WP_045442428.1|  hypothetical protein                             95.1    8e-18    
ref|WP_041427142.1|  kinase                                           95.1    9e-18    
ref|WP_030007955.1|  hypothetical protein                             95.1    9e-18    
gb|ABI46681.1|  ABC1 domain protein                                   95.1    9e-18    
gb|AFW70153.1|  hypothetical protein ZEAMMB73_996126                  91.3    1e-17    
ref|WP_024546901.1|  hypothetical protein                             94.7    1e-17    
ref|WP_038547327.1|  kinase                                           94.4    1e-17    



>ref|XP_009593328.1| PREDICTED: uncharacterized aarF domain-containing protein kinase 
At1g79600, chloroplastic [Nicotiana tomentosiformis]
 ref|XP_009593329.1| PREDICTED: uncharacterized aarF domain-containing protein kinase 
At1g79600, chloroplastic [Nicotiana tomentosiformis]
Length=760

 Score =   505 bits (1300),  Expect = 3e-169, Method: Compositional matrix adjust.
 Identities = 245/275 (89%), Positives = 266/275 (97%), Gaps = 0/275 (0%)
 Frame = +2

Query  2    EGLLEVFYGVYEKDPDKVLQAMVQMGVLVPTGDMTAVRRTAQFFLNSFEERLATQRRERE  181
            EGLLE FYGVYEKDPDKV+QA +QMGVLVPTGDMTAVRRTAQFFLNSFEERLA QR+ERE
Sbjct  486  EGLLETFYGVYEKDPDKVVQAAIQMGVLVPTGDMTAVRRTAQFFLNSFEERLAAQRKERE  545

Query  182  LAKAELGFKKPLTKEEKIEKKKQRLAAIGEDLLSIAADQPFRFPATFTFVVRAFSVLHGI  361
            +A+AELGFKKPL+KEE+IEKKKQRLAAIGEDLLSIAADQPFRFPATFTFVVRAFSVL GI
Sbjct  546  MAQAELGFKKPLSKEEQIEKKKQRLAAIGEDLLSIAADQPFRFPATFTFVVRAFSVLDGI  605

Query  362  GKGLDPRFDITEIAKPYALELLRFREAGVEVILKDFKTRWDRQNRAFYNLFRQADRVEKL  541
            GKGLDPRFDITEIAKPYALELLRFREAGVEV+LKDF+ RWDRQ+RAFYNLFRQADRVE+L
Sbjct  606  GKGLDPRFDITEIAKPYALELLRFREAGVEVVLKDFRNRWDRQSRAFYNLFRQADRVERL  665

Query  542  AEIIQRLEQGDLKLRVRALESERAFQRVAAVQKTILSAVAAGSLINLATVLYLNAIRMPA  721
            AEIIQRLEQGDLKLRVRALESERAFQRVAAVQKTI SAVAAGSL+NLAT+LYLN+IRMP+
Sbjct  666  AEIIQRLEQGDLKLRVRALESERAFQRVAAVQKTIGSAVAAGSLVNLATMLYLNSIRMPS  725

Query  722  MAAYGLCAFFGFQVLIGIVKVKKIDQRERLITGTA  826
            + AY +CAFFGFQVL G++KVKK+DQRE+LITGTA
Sbjct  726  IIAYAVCAFFGFQVLFGLLKVKKLDQREKLITGTA  760



>ref|XP_009769152.1| PREDICTED: uncharacterized aarF domain-containing protein kinase 
At1g79600, chloroplastic [Nicotiana sylvestris]
 ref|XP_009769153.1| PREDICTED: uncharacterized aarF domain-containing protein kinase 
At1g79600, chloroplastic [Nicotiana sylvestris]
Length=762

 Score =   503 bits (1294),  Expect = 3e-168, Method: Compositional matrix adjust.
 Identities = 243/275 (88%), Positives = 266/275 (97%), Gaps = 0/275 (0%)
 Frame = +2

Query  2    EGLLEVFYGVYEKDPDKVLQAMVQMGVLVPTGDMTAVRRTAQFFLNSFEERLATQRRERE  181
            EGLLE FYGVYEKDPDKV+QA +QMGVLVPTGDMTAVRRTAQFFLNSFEERLA QR+ERE
Sbjct  488  EGLLETFYGVYEKDPDKVVQAAIQMGVLVPTGDMTAVRRTAQFFLNSFEERLAAQRKERE  547

Query  182  LAKAELGFKKPLTKEEKIEKKKQRLAAIGEDLLSIAADQPFRFPATFTFVVRAFSVLHGI  361
            +A+AELGFKKPL+KEE++EKKKQRLAAIGEDLLSIAADQPFRFPATFTFVVRAFSVL GI
Sbjct  548  MAQAELGFKKPLSKEEQMEKKKQRLAAIGEDLLSIAADQPFRFPATFTFVVRAFSVLDGI  607

Query  362  GKGLDPRFDITEIAKPYALELLRFREAGVEVILKDFKTRWDRQNRAFYNLFRQADRVEKL  541
            GKGLDPRFDITEIAKPYALELLRFREAGVEV+LKDF+ RWDRQ+RAFYNLFRQADRVE+L
Sbjct  608  GKGLDPRFDITEIAKPYALELLRFREAGVEVVLKDFRNRWDRQSRAFYNLFRQADRVERL  667

Query  542  AEIIQRLEQGDLKLRVRALESERAFQRVAAVQKTILSAVAAGSLINLATVLYLNAIRMPA  721
            AEIIQRLEQGDLKLRVRALESERAFQRVAAVQKTI SAVAAGSL+NLAT+LYLN+IRMP+
Sbjct  668  AEIIQRLEQGDLKLRVRALESERAFQRVAAVQKTIGSAVAAGSLVNLATMLYLNSIRMPS  727

Query  722  MAAYGLCAFFGFQVLIGIVKVKKIDQRERLITGTA  826
            + AY +CAFFGFQVL G++KVKK+D+RE+LITGTA
Sbjct  728  IIAYAVCAFFGFQVLFGLLKVKKLDEREKLITGTA  762



>ref|XP_004502859.1| PREDICTED: uncharacterized protein sll1770-like isoform X1 [Cicer 
arietinum]
 ref|XP_004502860.1| PREDICTED: uncharacterized protein sll1770-like isoform X2 [Cicer 
arietinum]
Length=746

 Score =   493 bits (1269),  Expect = 9e-165, Method: Compositional matrix adjust.
 Identities = 243/275 (88%), Positives = 258/275 (94%), Gaps = 0/275 (0%)
 Frame = +2

Query  2    EGLLEVFYGVYEKDPDKVLQAMVQMGVLVPTGDMTAVRRTAQFFLNSFEERLATQRRERE  181
            EGLLE FYGVYEKDPDKVLQ+M+QMGVLVPTGDMTAVRRTAQFFLNSFEERLA QRRERE
Sbjct  472  EGLLETFYGVYEKDPDKVLQSMIQMGVLVPTGDMTAVRRTAQFFLNSFEERLAAQRRERE  531

Query  182  LAKAELGFKKPLTKEEKIEKKKQRLAAIGEDLLSIAADQPFRFPATFTFVVRAFSVLHGI  361
             A  ELGFKKPL+KEEKI KKKQRLAAIGEDLLSIA DQPFRFPATFTFVVRAFSVL GI
Sbjct  532  EATGELGFKKPLSKEEKIMKKKQRLAAIGEDLLSIAGDQPFRFPATFTFVVRAFSVLDGI  591

Query  362  GKGLDPRFDITEIAKPYALELLRFREAGVEVILKDFKTRWDRQNRAFYNLFRQADRVEKL  541
            GKGLDPRFDITEIAKPYALELLRFREAGVEV LKDF+ RWDRQ++AFYNLFRQADRV+KL
Sbjct  592  GKGLDPRFDITEIAKPYALELLRFREAGVEVALKDFRKRWDRQSQAFYNLFRQADRVDKL  651

Query  542  AEIIQRLEQGDLKLRVRALESERAFQRVAAVQKTILSAVAAGSLINLATVLYLNAIRMPA  721
            A +IQRLEQGDLKLRVR LESERAFQRVA VQKTI +AVAAGSLINLATVLYLN+IR+PA
Sbjct  652  ATVIQRLEQGDLKLRVRTLESERAFQRVATVQKTIGNAVAAGSLINLATVLYLNSIRVPA  711

Query  722  MAAYGLCAFFGFQVLIGIVKVKKIDQRERLITGTA  826
            +AAY  CAFFGFQVL GIVKVKK+D++ERLITGTA
Sbjct  712  IAAYVFCAFFGFQVLFGIVKVKKLDEQERLITGTA  746



>gb|ABK95603.1| unknown [Populus trichocarpa]
Length=285

 Score =   476 bits (1224),  Expect = 1e-164, Method: Compositional matrix adjust.
 Identities = 232/275 (84%), Positives = 256/275 (93%), Gaps = 0/275 (0%)
 Frame = +2

Query  2    EGLLEVFYGVYEKDPDKVLQAMVQMGVLVPTGDMTAVRRTAQFFLNSFEERLATQRRERE  181
            EGLLE FYG+YEKDPDKVL+AM+QMGVLVPTGDMTAVRRTA FFLNSFEERLA QRRE E
Sbjct  11   EGLLEAFYGIYEKDPDKVLEAMIQMGVLVPTGDMTAVRRTALFFLNSFEERLAAQRREGE  70

Query  182  LAKAELGFKKPLTKEEKIEKKKQRLAAIGEDLLSIAADQPFRFPATFTFVVRAFSVLHGI  361
            +  A+LGFKKPL+K+EKIEKKKQRLAAIGEDLLSIAADQPFRFPATFTFVVRAFSVL GI
Sbjct  71   IETAQLGFKKPLSKDEKIEKKKQRLAAIGEDLLSIAADQPFRFPATFTFVVRAFSVLDGI  130

Query  362  GKGLDPRFDITEIAKPYALELLRFREAGVEVILKDFKTRWDRQNRAFYNLFRQADRVEKL  541
            GKGLDPRFDITEIAKPYALELL+FREAGVEV+LKDF+ RWDRQ+RA YNLFRQADRV+KL
Sbjct  131  GKGLDPRFDITEIAKPYALELLKFREAGVEVLLKDFRKRWDRQSRAIYNLFRQADRVQKL  190

Query  542  AEIIQRLEQGDLKLRVRALESERAFQRVAAVQKTILSAVAAGSLINLATVLYLNAIRMPA  721
            A+ IQRLEQGDLKLRVR LE+ERAFQRVAAVQK + SAVA GSL+NLAT+LYLN+IR+PA
Sbjct  191  ADTIQRLEQGDLKLRVRTLEAERAFQRVAAVQKIVGSAVAVGSLVNLATILYLNSIRVPA  250

Query  722  MAAYGLCAFFGFQVLIGIVKVKKIDQRERLITGTA  826
            +AA   CAFF FQVL G++KVKK+DQ+ERLITGTA
Sbjct  251  IAASIFCAFFSFQVLFGLIKVKKLDQQERLITGTA  285



>gb|ACR37873.1| unknown [Zea mays]
Length=285

 Score =   474 bits (1220),  Expect = 6e-164, Method: Compositional matrix adjust.
 Identities = 234/275 (85%), Positives = 255/275 (93%), Gaps = 0/275 (0%)
 Frame = +2

Query  2    EGLLEVFYGVYEKDPDKVLQAMVQMGVLVPTGDMTAVRRTAQFFLNSFEERLATQRRERE  181
            EGLLEVFYGVYEKDPDKVLQAMVQMGVLVPTGDMTAVRRTAQFFLNSF+ERLA QR+ERE
Sbjct  11   EGLLEVFYGVYEKDPDKVLQAMVQMGVLVPTGDMTAVRRTAQFFLNSFQERLAAQRKERE  70

Query  182  LAKAELGFKKPLTKEEKIEKKKQRLAAIGEDLLSIAADQPFRFPATFTFVVRAFSVLHGI  361
            +A AELGFKK LTKEEK EK+KQRLAAIGEDLL+IAADQPFRFPATFTFVVRAFSVL GI
Sbjct  71   MATAELGFKKQLTKEEKFEKRKQRLAAIGEDLLAIAADQPFRFPATFTFVVRAFSVLDGI  130

Query  362  GKGLDPRFDITEIAKPYALELLRFREAGVEVILKDFKTRWDRQNRAFYNLFRQADRVEKL  541
            GKGLDPRFDITEIAKPYA ELLRF +AGVE+++KD K RW+RQ+RAFYNLFRQ DRVEKL
Sbjct  131  GKGLDPRFDITEIAKPYAKELLRFNDAGVEIVVKDAKKRWERQSRAFYNLFRQPDRVEKL  190

Query  542  AEIIQRLEQGDLKLRVRALESERAFQRVAAVQKTILSAVAAGSLINLATVLYLNAIRMPA  721
            A+II+RLEQG+LKLRVR LESERAFQRVAAVQKTI   VAAGSL+NLAT+LY N+IR PA
Sbjct  191  AQIIERLEQGELKLRVRTLESERAFQRVAAVQKTIGYGVAAGSLMNLATMLYFNSIRGPA  250

Query  722  MAAYGLCAFFGFQVLIGIVKVKKIDQRERLITGTA  826
              AY LCAFFG QVLIG+VKVKK+D++ERLITGTA
Sbjct  251  TIAYSLCAFFGLQVLIGLVKVKKLDRQERLITGTA  285



>ref|XP_009333770.1| PREDICTED: uncharacterized aarF domain-containing protein kinase 
At1g79600, chloroplastic-like [Pyrus x bretschneideri]
 ref|XP_009333771.1| PREDICTED: uncharacterized aarF domain-containing protein kinase 
At1g79600, chloroplastic-like [Pyrus x bretschneideri]
Length=757

 Score =   490 bits (1262),  Expect = 1e-163, Method: Compositional matrix adjust.
 Identities = 239/275 (87%), Positives = 260/275 (95%), Gaps = 0/275 (0%)
 Frame = +2

Query  2    EGLLEVFYGVYEKDPDKVLQAMVQMGVLVPTGDMTAVRRTAQFFLNSFEERLATQRRERE  181
            EGLLE FYGVYEKDPDKVLQAM+QMGVLVPTGDMTAVRRTA FFLNSFEERLA QR+E+E
Sbjct  483  EGLLETFYGVYEKDPDKVLQAMIQMGVLVPTGDMTAVRRTALFFLNSFEERLAAQRKEKE  542

Query  182  LAKAELGFKKPLTKEEKIEKKKQRLAAIGEDLLSIAADQPFRFPATFTFVVRAFSVLHGI  361
            LA AELGFKKPL+KEE+I KKK+RLAAIGEDLL+IAADQPFRFPATFTFVVRAFSVL GI
Sbjct  543  LATAELGFKKPLSKEERIMKKKERLAAIGEDLLAIAADQPFRFPATFTFVVRAFSVLDGI  602

Query  362  GKGLDPRFDITEIAKPYALELLRFREAGVEVILKDFKTRWDRQNRAFYNLFRQADRVEKL  541
            GKGLDPRFDITEIAKPYALELL+FREAGVEVI+KD + RWDRQ+RAFYNLFRQADRVEKL
Sbjct  603  GKGLDPRFDITEIAKPYALELLKFREAGVEVIIKDLRNRWDRQSRAFYNLFRQADRVEKL  662

Query  542  AEIIQRLEQGDLKLRVRALESERAFQRVAAVQKTILSAVAAGSLINLATVLYLNAIRMPA  721
            AEIIQRLEQGDLKLRVRALESERAFQRVA VQKT+ +AVAAGSLINLAT+LY+N+IR+PA
Sbjct  663  AEIIQRLEQGDLKLRVRALESERAFQRVATVQKTVGNAVAAGSLINLATILYINSIRVPA  722

Query  722  MAAYGLCAFFGFQVLIGIVKVKKIDQRERLITGTA  826
            + AY  CAFFG QVLIG++KVKK D+RERLITGTA
Sbjct  723  IVAYVFCAFFGLQVLIGLIKVKKFDERERLITGTA  757



>ref|XP_010261131.1| PREDICTED: uncharacterized aarF domain-containing protein kinase 
At1g79600, chloroplastic [Nelumbo nucifera]
 ref|XP_010261132.1| PREDICTED: uncharacterized aarF domain-containing protein kinase 
At1g79600, chloroplastic [Nelumbo nucifera]
Length=763

 Score =   490 bits (1261),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 238/275 (87%), Positives = 259/275 (94%), Gaps = 0/275 (0%)
 Frame = +2

Query  2    EGLLEVFYGVYEKDPDKVLQAMVQMGVLVPTGDMTAVRRTAQFFLNSFEERLATQRRERE  181
            EGLLE FY +YEKDPDKVLQAM+QMGVLVPTGDMTAVRRTAQFFLNSFEERLA QR+ERE
Sbjct  489  EGLLEAFYAIYEKDPDKVLQAMIQMGVLVPTGDMTAVRRTAQFFLNSFEERLAAQRKERE  548

Query  182  LAKAELGFKKPLTKEEKIEKKKQRLAAIGEDLLSIAADQPFRFPATFTFVVRAFSVLHGI  361
            +AK ELGFKKPLTKEE+IEKKKQRLAAIGEDLL+IAADQPFRFPATFTFVVRAFSVL GI
Sbjct  549  IAKTELGFKKPLTKEERIEKKKQRLAAIGEDLLAIAADQPFRFPATFTFVVRAFSVLDGI  608

Query  362  GKGLDPRFDITEIAKPYALELLRFREAGVEVILKDFKTRWDRQNRAFYNLFRQADRVEKL  541
            GKGLDPRFDITEIAKPYA+ELLRFREAGVEVI+KDFK RWDRQ+RAF N+FRQADRVEKL
Sbjct  609  GKGLDPRFDITEIAKPYAMELLRFREAGVEVIIKDFKKRWDRQSRAFANIFRQADRVEKL  668

Query  542  AEIIQRLEQGDLKLRVRALESERAFQRVAAVQKTILSAVAAGSLINLATVLYLNAIRMPA  721
            AEIIQRLEQG+LKLRVR LESERAFQRVAAVQKT+ +AV AGSL+NLATVLYLN+IR+PA
Sbjct  669  AEIIQRLEQGNLKLRVRTLESERAFQRVAAVQKTVGNAVVAGSLLNLATVLYLNSIRVPA  728

Query  722  MAAYGLCAFFGFQVLIGIVKVKKIDQRERLITGTA  826
            M  Y LCAFFG Q+  GI+KVKK+DQ+E+LITGTA
Sbjct  729  MVGYVLCAFFGIQIFFGILKVKKLDQQEKLITGTA  763



>ref|XP_009342814.1| PREDICTED: uncharacterized aarF domain-containing protein kinase 
At1g79600, chloroplastic-like [Pyrus x bretschneideri]
 ref|XP_009342815.1| PREDICTED: uncharacterized aarF domain-containing protein kinase 
At1g79600, chloroplastic-like [Pyrus x bretschneideri]
Length=757

 Score =   489 bits (1260),  Expect = 3e-163, Method: Compositional matrix adjust.
 Identities = 238/275 (87%), Positives = 260/275 (95%), Gaps = 0/275 (0%)
 Frame = +2

Query  2    EGLLEVFYGVYEKDPDKVLQAMVQMGVLVPTGDMTAVRRTAQFFLNSFEERLATQRRERE  181
            EGLLE FYGVYEKDPDKVLQAM+QMGVLVPTGDMTAVRRTA FFLNSFEERLA QR+E+E
Sbjct  483  EGLLETFYGVYEKDPDKVLQAMIQMGVLVPTGDMTAVRRTALFFLNSFEERLAAQRKEKE  542

Query  182  LAKAELGFKKPLTKEEKIEKKKQRLAAIGEDLLSIAADQPFRFPATFTFVVRAFSVLHGI  361
            LA AELGFKKPL+KEE+I KKK+RLAAIGEDLL+IAADQPFRFPATFTFVVRAFSVL GI
Sbjct  543  LATAELGFKKPLSKEERIMKKKERLAAIGEDLLAIAADQPFRFPATFTFVVRAFSVLDGI  602

Query  362  GKGLDPRFDITEIAKPYALELLRFREAGVEVILKDFKTRWDRQNRAFYNLFRQADRVEKL  541
            GKGLDPRFDITEIAKPYALELL+FREAGVEVI+KD + RWDRQ+RAFYNLFRQADRVEKL
Sbjct  603  GKGLDPRFDITEIAKPYALELLKFREAGVEVIIKDLRNRWDRQSRAFYNLFRQADRVEKL  662

Query  542  AEIIQRLEQGDLKLRVRALESERAFQRVAAVQKTILSAVAAGSLINLATVLYLNAIRMPA  721
            AEIIQRLEQGDLKLRVRALESER+FQRVA VQKT+ +AVAAGSLINLAT+LY+N+IR+PA
Sbjct  663  AEIIQRLEQGDLKLRVRALESERSFQRVATVQKTVGNAVAAGSLINLATILYINSIRVPA  722

Query  722  MAAYGLCAFFGFQVLIGIVKVKKIDQRERLITGTA  826
            + AY  CAFFG QVLIG++KVKK D+RERLITGTA
Sbjct  723  IVAYVFCAFFGLQVLIGLIKVKKFDERERLITGTA  757



>ref|XP_011021917.1| PREDICTED: uncharacterized aarF domain-containing protein kinase 
At1g79600, chloroplastic-like isoform X1 [Populus euphratica]
 ref|XP_011021918.1| PREDICTED: uncharacterized aarF domain-containing protein kinase 
At1g79600, chloroplastic-like isoform X1 [Populus euphratica]
 ref|XP_011021919.1| PREDICTED: uncharacterized aarF domain-containing protein kinase 
At1g79600, chloroplastic-like isoform X1 [Populus euphratica]
Length=764

 Score =   489 bits (1258),  Expect = 8e-163, Method: Compositional matrix adjust.
 Identities = 240/275 (87%), Positives = 259/275 (94%), Gaps = 0/275 (0%)
 Frame = +2

Query  2    EGLLEVFYGVYEKDPDKVLQAMVQMGVLVPTGDMTAVRRTAQFFLNSFEERLATQRRERE  181
            EGLLE FYGVYEKDPDKVL+AMVQMGVLVPTGDMTAVRRTAQFFLNSFEERLA QRRERE
Sbjct  490  EGLLETFYGVYEKDPDKVLEAMVQMGVLVPTGDMTAVRRTAQFFLNSFEERLAAQRRERE  549

Query  182  LAKAELGFKKPLTKEEKIEKKKQRLAAIGEDLLSIAADQPFRFPATFTFVVRAFSVLHGI  361
            +A  ELGFKK LTKEEK+EK+KQRLAAIGEDLLSIAAD PFRFPATFTFVVRAFSVL GI
Sbjct  550  MATTELGFKKQLTKEEKMEKRKQRLAAIGEDLLSIAADHPFRFPATFTFVVRAFSVLDGI  609

Query  362  GKGLDPRFDITEIAKPYALELLRFREAGVEVILKDFKTRWDRQNRAFYNLFRQADRVEKL  541
            GKGLDPRFDITEIAKPYALELLRFREAGVEV+LKDF+ RWDRQ+RAF+NLFRQADRV+KL
Sbjct  610  GKGLDPRFDITEIAKPYALELLRFREAGVEVLLKDFRKRWDRQSRAFHNLFRQADRVQKL  669

Query  542  AEIIQRLEQGDLKLRVRALESERAFQRVAAVQKTILSAVAAGSLINLATVLYLNAIRMPA  721
            AE IQRLEQGDLKLRVR LE+ERAFQRVAAVQKT+ SAVAAGSLINLAT+L+LN+IR+PA
Sbjct  670  AETIQRLEQGDLKLRVRTLEAERAFQRVAAVQKTVGSAVAAGSLINLATILFLNSIRVPA  729

Query  722  MAAYGLCAFFGFQVLIGIVKVKKIDQRERLITGTA  826
             AA  LCAFF FQVL GI+KVK++DQ+ERLITGTA
Sbjct  730  TAASILCAFFSFQVLFGIIKVKRLDQQERLITGTA  764



>ref|XP_011021920.1| PREDICTED: uncharacterized aarF domain-containing protein kinase 
At1g79600, chloroplastic-like isoform X2 [Populus euphratica]
Length=762

 Score =   488 bits (1257),  Expect = 1e-162, Method: Compositional matrix adjust.
 Identities = 240/275 (87%), Positives = 259/275 (94%), Gaps = 0/275 (0%)
 Frame = +2

Query  2    EGLLEVFYGVYEKDPDKVLQAMVQMGVLVPTGDMTAVRRTAQFFLNSFEERLATQRRERE  181
            EGLLE FYGVYEKDPDKVL+AMVQMGVLVPTGDMTAVRRTAQFFLNSFEERLA QRRERE
Sbjct  488  EGLLETFYGVYEKDPDKVLEAMVQMGVLVPTGDMTAVRRTAQFFLNSFEERLAAQRRERE  547

Query  182  LAKAELGFKKPLTKEEKIEKKKQRLAAIGEDLLSIAADQPFRFPATFTFVVRAFSVLHGI  361
            +A  ELGFKK LTKEEK+EK+KQRLAAIGEDLLSIAAD PFRFPATFTFVVRAFSVL GI
Sbjct  548  MATTELGFKKQLTKEEKMEKRKQRLAAIGEDLLSIAADHPFRFPATFTFVVRAFSVLDGI  607

Query  362  GKGLDPRFDITEIAKPYALELLRFREAGVEVILKDFKTRWDRQNRAFYNLFRQADRVEKL  541
            GKGLDPRFDITEIAKPYALELLRFREAGVEV+LKDF+ RWDRQ+RAF+NLFRQADRV+KL
Sbjct  608  GKGLDPRFDITEIAKPYALELLRFREAGVEVLLKDFRKRWDRQSRAFHNLFRQADRVQKL  667

Query  542  AEIIQRLEQGDLKLRVRALESERAFQRVAAVQKTILSAVAAGSLINLATVLYLNAIRMPA  721
            AE IQRLEQGDLKLRVR LE+ERAFQRVAAVQKT+ SAVAAGSLINLAT+L+LN+IR+PA
Sbjct  668  AETIQRLEQGDLKLRVRTLEAERAFQRVAAVQKTVGSAVAAGSLINLATILFLNSIRVPA  727

Query  722  MAAYGLCAFFGFQVLIGIVKVKKIDQRERLITGTA  826
             AA  LCAFF FQVL GI+KVK++DQ+ERLITGTA
Sbjct  728  TAASILCAFFSFQVLFGIIKVKRLDQQERLITGTA  762



>ref|XP_008342858.1| PREDICTED: uncharacterized protein LOC103405622 [Malus domestica]
 ref|XP_008342859.1| PREDICTED: uncharacterized protein LOC103405622 [Malus domestica]
Length=308

 Score =   470 bits (1209),  Expect = 6e-162, Method: Compositional matrix adjust.
 Identities = 239/275 (87%), Positives = 259/275 (94%), Gaps = 0/275 (0%)
 Frame = +2

Query  2    EGLLEVFYGVYEKDPDKVLQAMVQMGVLVPTGDMTAVRRTAQFFLNSFEERLATQRRERE  181
            EGLLE FYGVYEKDPDKVLQAM+QMGVLVPTGDMTAVRRTA FFLNSFEERLA QR+E+E
Sbjct  34   EGLLETFYGVYEKDPDKVLQAMIQMGVLVPTGDMTAVRRTALFFLNSFEERLAAQRKEKE  93

Query  182  LAKAELGFKKPLTKEEKIEKKKQRLAAIGEDLLSIAADQPFRFPATFTFVVRAFSVLHGI  361
            LA AELGFKKPL+KEEKI KKK+RLAAIGEDLL+IAADQPFRFPATFTFVVRAFSVL GI
Sbjct  94   LATAELGFKKPLSKEEKIMKKKERLAAIGEDLLAIAADQPFRFPATFTFVVRAFSVLDGI  153

Query  362  GKGLDPRFDITEIAKPYALELLRFREAGVEVILKDFKTRWDRQNRAFYNLFRQADRVEKL  541
            GKGLDPRFDITEIAKPYALELL+FREAGVEVI+KD + RWDRQ+RA YNLFRQADRVEKL
Sbjct  154  GKGLDPRFDITEIAKPYALELLKFREAGVEVIIKDLRNRWDRQSRALYNLFRQADRVEKL  213

Query  542  AEIIQRLEQGDLKLRVRALESERAFQRVAAVQKTILSAVAAGSLINLATVLYLNAIRMPA  721
            AEIIQRLEQGDLKLRVRALESERAFQRVA VQKT+ +AVAAGSLINLAT+LY+N+IR+PA
Sbjct  214  AEIIQRLEQGDLKLRVRALESERAFQRVATVQKTVGNAVAAGSLINLATILYINSIRVPA  273

Query  722  MAAYGLCAFFGFQVLIGIVKVKKIDQRERLITGTA  826
            + AY  CAFFG QVLIG++KVKK D+RERLITGTA
Sbjct  274  IVAYVFCAFFGLQVLIGLIKVKKFDERERLITGTA  308



>gb|KJB18304.1| hypothetical protein B456_003G046300 [Gossypium raimondii]
 gb|KJB18306.1| hypothetical protein B456_003G046300 [Gossypium raimondii]
 gb|KJB18307.1| hypothetical protein B456_003G046300 [Gossypium raimondii]
 gb|KJB18308.1| hypothetical protein B456_003G046300 [Gossypium raimondii]
 gb|KJB18309.1| hypothetical protein B456_003G046300 [Gossypium raimondii]
Length=777

 Score =   485 bits (1249),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 245/275 (89%), Positives = 263/275 (96%), Gaps = 0/275 (0%)
 Frame = +2

Query  2    EGLLEVFYGVYEKDPDKVLQAMVQMGVLVPTGDMTAVRRTAQFFLNSFEERLATQRRERE  181
            EGLLE FYG+YEKDPDKVLQAM+QMGVLVPTGDMTAVRRTAQFFLNSFEERLA QRRERE
Sbjct  503  EGLLEAFYGIYEKDPDKVLQAMIQMGVLVPTGDMTAVRRTAQFFLNSFEERLAAQRRERE  562

Query  182  LAKAELGFKKPLTKEEKIEKKKQRLAAIGEDLLSIAADQPFRFPATFTFVVRAFSVLHGI  361
            +A  ELGFKKPLTKEEKI KKK+RLAAIGEDLL+IAADQPFRFPATFTFVVR+FSVL GI
Sbjct  563  MATTELGFKKPLTKEEKIAKKKERLAAIGEDLLAIAADQPFRFPATFTFVVRSFSVLDGI  622

Query  362  GKGLDPRFDITEIAKPYALELLRFREAGVEVILKDFKTRWDRQNRAFYNLFRQADRVEKL  541
            GKGLDPRFDITEIAKPYALELL+FREAGVEV+LKDF+ RWDRQ+RAFYNLFRQADRVEKL
Sbjct  623  GKGLDPRFDITEIAKPYALELLKFREAGVEVVLKDFRKRWDRQSRAFYNLFRQADRVEKL  682

Query  542  AEIIQRLEQGDLKLRVRALESERAFQRVAAVQKTILSAVAAGSLINLATVLYLNAIRMPA  721
            AEIIQRLEQGDLKLRVRALESERAFQRVA VQKT+ SAVAAGSLINLAT+LYLN+IR+PA
Sbjct  683  AEIIQRLEQGDLKLRVRALESERAFQRVATVQKTVGSAVAAGSLINLATILYLNSIRVPA  742

Query  722  MAAYGLCAFFGFQVLIGIVKVKKIDQRERLITGTA  826
            +AAY +CAFF FQVLIGI+KVK+ DQRERLITGTA
Sbjct  743  VAAYVICAFFSFQVLIGIIKVKRFDQRERLITGTA  777



>ref|XP_008809510.1| PREDICTED: uncharacterized aarF domain-containing protein kinase 
At1g79600, chloroplastic isoform X1 [Phoenix dactylifera]
 ref|XP_008809511.1| PREDICTED: uncharacterized aarF domain-containing protein kinase 
At1g79600, chloroplastic isoform X1 [Phoenix dactylifera]
Length=761

 Score =   483 bits (1243),  Expect = 1e-160, Method: Compositional matrix adjust.
 Identities = 236/275 (86%), Positives = 260/275 (95%), Gaps = 0/275 (0%)
 Frame = +2

Query  2    EGLLEVFYGVYEKDPDKVLQAMVQMGVLVPTGDMTAVRRTAQFFLNSFEERLATQRRERE  181
            EGLLE FYGVYEKDPDKVLQAM+QMGVLVPTGDMTAVRRTAQFFLNSFEERLA QR+ERE
Sbjct  487  EGLLETFYGVYEKDPDKVLQAMIQMGVLVPTGDMTAVRRTAQFFLNSFEERLAAQRKERE  546

Query  182  LAKAELGFKKPLTKEEKIEKKKQRLAAIGEDLLSIAADQPFRFPATFTFVVRAFSVLHGI  361
            +A  ELGFKKPL++EE++EKKKQRLAAIGEDLL+IAADQPFRFPATFTFVVRAFSVL GI
Sbjct  547  MATTELGFKKPLSREERLEKKKQRLAAIGEDLLAIAADQPFRFPATFTFVVRAFSVLDGI  606

Query  362  GKGLDPRFDITEIAKPYALELLRFREAGVEVILKDFKTRWDRQNRAFYNLFRQADRVEKL  541
            GKGLDPRFDITEIAKPYALELLRF+EAG EV++KDFK R +RQ+RAFYN+FRQADRVEKL
Sbjct  607  GKGLDPRFDITEIAKPYALELLRFQEAGFEVVVKDFKKRLERQSRAFYNIFRQADRVEKL  666

Query  542  AEIIQRLEQGDLKLRVRALESERAFQRVAAVQKTILSAVAAGSLINLATVLYLNAIRMPA  721
            AEIIQRLE+GDLKLRVR LESERAFQRVAAVQKTI +A+ AGSLINLAT+LYLN+IR+PA
Sbjct  667  AEIIQRLEKGDLKLRVRTLESERAFQRVAAVQKTIGNAIVAGSLINLATILYLNSIRVPA  726

Query  722  MAAYGLCAFFGFQVLIGIVKVKKIDQRERLITGTA  826
            M AY LCAFFG QVL GI+KVK++DQ+ERLITGTA
Sbjct  727  MTAYILCAFFGMQVLFGILKVKRLDQQERLITGTA  761



>ref|XP_009416860.1| PREDICTED: uncharacterized aarF domain-containing protein kinase 
At1g79600, chloroplastic-like [Musa acuminata subsp. malaccensis]
Length=756

 Score =   483 bits (1242),  Expect = 1e-160, Method: Compositional matrix adjust.
 Identities = 235/275 (85%), Positives = 259/275 (94%), Gaps = 0/275 (0%)
 Frame = +2

Query  2    EGLLEVFYGVYEKDPDKVLQAMVQMGVLVPTGDMTAVRRTAQFFLNSFEERLATQRRERE  181
            EGLLE FYG+YEKDPD+VLQAM+QMGVLVPTGDMTAVRRTAQFFLNSFEERLA Q +ERE
Sbjct  482  EGLLEAFYGIYEKDPDRVLQAMIQMGVLVPTGDMTAVRRTAQFFLNSFEERLAAQVKERE  541

Query  182  LAKAELGFKKPLTKEEKIEKKKQRLAAIGEDLLSIAADQPFRFPATFTFVVRAFSVLHGI  361
            +A  ELGFKKPLTKEE++EKKKQRLAAIGEDLL+IAADQPFRFPATFTFVVRAFSVL GI
Sbjct  542  MATTELGFKKPLTKEERLEKKKQRLAAIGEDLLAIAADQPFRFPATFTFVVRAFSVLDGI  601

Query  362  GKGLDPRFDITEIAKPYALELLRFREAGVEVILKDFKTRWDRQNRAFYNLFRQADRVEKL  541
            GKGLDPRFDITEIAKPYALELLRFREAG+EVI+KD K RW+RQ+ AFYNLFRQADRVEKL
Sbjct  602  GKGLDPRFDITEIAKPYALELLRFREAGIEVIVKDVKKRWERQSSAFYNLFRQADRVEKL  661

Query  542  AEIIQRLEQGDLKLRVRALESERAFQRVAAVQKTILSAVAAGSLINLATVLYLNAIRMPA  721
            A+IIQRLE+GDLKLRVR LESERAFQRVAAVQ+TI + VAAGSL+NLAT+LY N+IR+PA
Sbjct  662  AQIIQRLEKGDLKLRVRTLESERAFQRVAAVQRTIGNGVAAGSLVNLATILYFNSIRVPA  721

Query  722  MAAYGLCAFFGFQVLIGIVKVKKIDQRERLITGTA  826
            MAAY LCAFFG QVL GI+K+KK+DQ+ERLITGTA
Sbjct  722  MAAYLLCAFFGAQVLFGILKIKKLDQQERLITGTA  756



>ref|XP_002276397.3| PREDICTED: uncharacterized aarF domain-containing protein kinase 
At1g79600, chloroplastic [Vitis vinifera]
Length=749

 Score =   482 bits (1241),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 246/275 (89%), Positives = 264/275 (96%), Gaps = 0/275 (0%)
 Frame = +2

Query  2    EGLLEVFYGVYEKDPDKVLQAMVQMGVLVPTGDMTAVRRTAQFFLNSFEERLATQRRERE  181
            EGLLE FYG+YEKDPDKV+QAM+QMGVLVPTGDMTAVRRTAQFFLNSFEERLA QR+ERE
Sbjct  475  EGLLESFYGIYEKDPDKVVQAMIQMGVLVPTGDMTAVRRTAQFFLNSFEERLAAQRKERE  534

Query  182  LAKAELGFKKPLTKEEKIEKKKQRLAAIGEDLLSIAADQPFRFPATFTFVVRAFSVLHGI  361
            +A  ELGFKKPL+KEEKIEKKKQRLAAIGEDLL+IAADQPFRFPATFTFVVRAFSVL GI
Sbjct  535  MATQELGFKKPLSKEEKIEKKKQRLAAIGEDLLAIAADQPFRFPATFTFVVRAFSVLDGI  594

Query  362  GKGLDPRFDITEIAKPYALELLRFREAGVEVILKDFKTRWDRQNRAFYNLFRQADRVEKL  541
            GKGLDPRFDITEIAKPYALELL+FREAGVEVILKDF+ RWDRQ RAFYNLFRQADRVEKL
Sbjct  595  GKGLDPRFDITEIAKPYALELLKFREAGVEVILKDFRKRWDRQARAFYNLFRQADRVEKL  654

Query  542  AEIIQRLEQGDLKLRVRALESERAFQRVAAVQKTILSAVAAGSLINLATVLYLNAIRMPA  721
            AEIIQRLE+GDLKLRVRALESERAFQRVAAVQKT+ +AVAAGSLINLAT+LYLN+IR+PA
Sbjct  655  AEIIQRLEKGDLKLRVRALESERAFQRVAAVQKTVGNAVAAGSLINLATILYLNSIRVPA  714

Query  722  MAAYGLCAFFGFQVLIGIVKVKKIDQRERLITGTA  826
            +AAY  CAFFGFQVL GI+KVKK+DQRERLITGTA
Sbjct  715  IAAYVFCAFFGFQVLFGIIKVKKLDQRERLITGTA  749



>ref|XP_003526823.1| PREDICTED: uncharacterized aarF domain-containing protein kinase 
At1g79600, chloroplastic-like [Glycine max]
Length=752

 Score =   482 bits (1241),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 247/275 (90%), Positives = 263/275 (96%), Gaps = 0/275 (0%)
 Frame = +2

Query  2    EGLLEVFYGVYEKDPDKVLQAMVQMGVLVPTGDMTAVRRTAQFFLNSFEERLATQRRERE  181
            EGLLE FYGVYEKDPDKVLQAM+QMGVLVPTGDMTAVRRTAQFFLNSFEERLA QR+ERE
Sbjct  478  EGLLETFYGVYEKDPDKVLQAMIQMGVLVPTGDMTAVRRTAQFFLNSFEERLAAQRQERE  537

Query  182  LAKAELGFKKPLTKEEKIEKKKQRLAAIGEDLLSIAADQPFRFPATFTFVVRAFSVLHGI  361
             A  ELGFKKPL+KEEKI+KKKQRLAAIGEDLLSIAADQPFRFPATFTFVVRAFSVL GI
Sbjct  538  EATTELGFKKPLSKEEKIKKKKQRLAAIGEDLLSIAADQPFRFPATFTFVVRAFSVLDGI  597

Query  362  GKGLDPRFDITEIAKPYALELLRFREAGVEVILKDFKTRWDRQNRAFYNLFRQADRVEKL  541
            GKGLDPRFDITEIAKPYALELLRFREAGVEV+LKDF+ RWDRQ++AFYNLFRQADRV+KL
Sbjct  598  GKGLDPRFDITEIAKPYALELLRFREAGVEVVLKDFRKRWDRQSQAFYNLFRQADRVDKL  657

Query  542  AEIIQRLEQGDLKLRVRALESERAFQRVAAVQKTILSAVAAGSLINLATVLYLNAIRMPA  721
            A+IIQRLEQGDLKLRVR LESERAFQRVAAVQKTI SAVAAGSLINLATVLYLN+IR+PA
Sbjct  658  ADIIQRLEQGDLKLRVRTLESERAFQRVAAVQKTIGSAVAAGSLINLATVLYLNSIRVPA  717

Query  722  MAAYGLCAFFGFQVLIGIVKVKKIDQRERLITGTA  826
            +AAY  CA FGFQVL+GIVKVKK+D+RERLITGTA
Sbjct  718  IAAYIFCALFGFQVLLGIVKVKKLDERERLITGTA  752



>ref|XP_007159753.1| hypothetical protein PHAVU_002G264200g [Phaseolus vulgaris]
 gb|ESW31747.1| hypothetical protein PHAVU_002G264200g [Phaseolus vulgaris]
Length=756

 Score =   482 bits (1240),  Expect = 3e-160, Method: Compositional matrix adjust.
 Identities = 233/275 (85%), Positives = 257/275 (93%), Gaps = 0/275 (0%)
 Frame = +2

Query  2    EGLLEVFYGVYEKDPDKVLQAMVQMGVLVPTGDMTAVRRTAQFFLNSFEERLATQRRERE  181
            EGLLE FYG+YEK+P+KVLQ+M+QMGVLVPTGDMTAVRRTAQFFLNSFEERLA QRRERE
Sbjct  482  EGLLEAFYGIYEKNPEKVLQSMIQMGVLVPTGDMTAVRRTAQFFLNSFEERLAAQRRERE  541

Query  182  LAKAELGFKKPLTKEEKIEKKKQRLAAIGEDLLSIAADQPFRFPATFTFVVRAFSVLHGI  361
            +A AELGFKKPL+K+EK+ KKK+RLAAIGEDLL+IAADQPFRFPATFTFVVRAFSVL GI
Sbjct  542  MATAELGFKKPLSKDEKVMKKKERLAAIGEDLLAIAADQPFRFPATFTFVVRAFSVLDGI  601

Query  362  GKGLDPRFDITEIAKPYALELLRFREAGVEVILKDFKTRWDRQNRAFYNLFRQADRVEKL  541
            GKGLDPRFDITEIAKPYALELLRFREAGVEVILKD + RWDRQ++AFYNLFRQADRVEKL
Sbjct  602  GKGLDPRFDITEIAKPYALELLRFREAGVEVILKDLRKRWDRQSQAFYNLFRQADRVEKL  661

Query  542  AEIIQRLEQGDLKLRVRALESERAFQRVAAVQKTILSAVAAGSLINLATVLYLNAIRMPA  721
            A IIQRLEQGDLKLRVR LESERAFQR+A VQKTI +A+AAGSLINLAT+LYLN+IR+PA
Sbjct  662  AAIIQRLEQGDLKLRVRTLESERAFQRIATVQKTIGNAIAAGSLINLATILYLNSIRVPA  721

Query  722  MAAYGLCAFFGFQVLIGIVKVKKIDQRERLITGTA  826
              AY  C  FGFQVL GIVK+KK+D+RERL+TGTA
Sbjct  722  TIAYVFCVIFGFQVLFGIVKIKKLDERERLVTGTA  756



>ref|XP_011100883.1| PREDICTED: uncharacterized aarF domain-containing protein kinase 
At1g79600, chloroplastic [Sesamum indicum]
Length=757

 Score =   481 bits (1239),  Expect = 5e-160, Method: Compositional matrix adjust.
 Identities = 249/275 (91%), Positives = 262/275 (95%), Gaps = 0/275 (0%)
 Frame = +2

Query  2    EGLLEVFYGVYEKDPDKVLQAMVQMGVLVPTGDMTAVRRTAQFFLNSFEERLATQRRERE  181
            EGLLEVFYGVYEKD +KVLQAMVQMGVLVPTGDMTAVRRTAQFFLNSFEERLA QRRERE
Sbjct  483  EGLLEVFYGVYEKDAEKVLQAMVQMGVLVPTGDMTAVRRTAQFFLNSFEERLAAQRRERE  542

Query  182  LAKAELGFKKPLTKEEKIEKKKQRLAAIGEDLLSIAADQPFRFPATFTFVVRAFSVLHGI  361
            +A AELGFKKPLTKEEKIEKKKQRLAAIGEDLL+IAADQPFRFPATFTFVVRAFSVL GI
Sbjct  543  MATAELGFKKPLTKEEKIEKKKQRLAAIGEDLLAIAADQPFRFPATFTFVVRAFSVLDGI  602

Query  362  GKGLDPRFDITEIAKPYALELLRFREAGVEVILKDFKTRWDRQNRAFYNLFRQADRVEKL  541
            GKGLDPRFDITEIAKPYALELLRFREAGVEVI+KDF+ RWDRQ++AFYNLFRQADRVEKL
Sbjct  603  GKGLDPRFDITEIAKPYALELLRFREAGVEVIIKDFRKRWDRQSQAFYNLFRQADRVEKL  662

Query  542  AEIIQRLEQGDLKLRVRALESERAFQRVAAVQKTILSAVAAGSLINLATVLYLNAIRMPA  721
            A+ IQRLEQGDLKLRVRALESERAFQRVAAVQ TI SAVAAGSLINLAT+LYLN+I+MPA
Sbjct  663  AQTIQRLEQGDLKLRVRALESERAFQRVAAVQNTIGSAVAAGSLINLATILYLNSIQMPA  722

Query  722  MAAYGLCAFFGFQVLIGIVKVKKIDQRERLITGTA  826
              AY LCA+FG +VLIGIVKVKK DQRERLITGTA
Sbjct  723  TIAYFLCAYFGLKVLIGIVKVKKFDQRERLITGTA  757



>ref|XP_010025499.1| PREDICTED: uncharacterized aarF domain-containing protein kinase 
At4g31390, chloroplastic [Eucalyptus grandis]
 gb|KCW62174.1| hypothetical protein EUGRSUZ_H04831 [Eucalyptus grandis]
 gb|KCW62175.1| hypothetical protein EUGRSUZ_H04831 [Eucalyptus grandis]
 gb|KCW62176.1| hypothetical protein EUGRSUZ_H04831 [Eucalyptus grandis]
Length=786

 Score =   482 bits (1240),  Expect = 6e-160, Method: Compositional matrix adjust.
 Identities = 247/275 (90%), Positives = 264/275 (96%), Gaps = 0/275 (0%)
 Frame = +2

Query  2    EGLLEVFYGVYEKDPDKVLQAMVQMGVLVPTGDMTAVRRTAQFFLNSFEERLATQRRERE  181
            EGLLE FYGVYEKDPDKVLQAM+QMGVLVPTGDMTAVRRTAQFFLNSFEERLA QRRE E
Sbjct  512  EGLLETFYGVYEKDPDKVLQAMIQMGVLVPTGDMTAVRRTAQFFLNSFEERLAAQRREAE  571

Query  182  LAKAELGFKKPLTKEEKIEKKKQRLAAIGEDLLSIAADQPFRFPATFTFVVRAFSVLHGI  361
            +A AELGFKKPL+KEEKIEKKKQRLAAIGEDLL+IAADQPFRFPATFTFVVRAFSVL GI
Sbjct  572  MATAELGFKKPLSKEEKIEKKKQRLAAIGEDLLAIAADQPFRFPATFTFVVRAFSVLDGI  631

Query  362  GKGLDPRFDITEIAKPYALELLRFREAGVEVILKDFKTRWDRQNRAFYNLFRQADRVEKL  541
            GKGLDPRFDITEIAKPYALELL+FREAGVEVILKDF+ RWDRQ+RAFYNLFRQADRVEKL
Sbjct  632  GKGLDPRFDITEIAKPYALELLKFREAGVEVILKDFRKRWDRQSRAFYNLFRQADRVEKL  691

Query  542  AEIIQRLEQGDLKLRVRALESERAFQRVAAVQKTILSAVAAGSLINLATVLYLNAIRMPA  721
            AEIIQRLEQGDLKLRVR LESERAFQRVAAVQKT+ +AVAAGSL+NLAT+LYLN+IR+PA
Sbjct  692  AEIIQRLEQGDLKLRVRTLESERAFQRVAAVQKTVGNAVAAGSLMNLATLLYLNSIRVPA  751

Query  722  MAAYGLCAFFGFQVLIGIVKVKKIDQRERLITGTA  826
            + AY LCAFFGFQVL G++KVKK+DQRERLITGTA
Sbjct  752  VVAYVLCAFFGFQVLFGLIKVKKLDQRERLITGTA  786



>emb|CDP12922.1| unnamed protein product [Coffea canephora]
Length=766

 Score =   481 bits (1238),  Expect = 8e-160, Method: Compositional matrix adjust.
 Identities = 246/275 (89%), Positives = 263/275 (96%), Gaps = 0/275 (0%)
 Frame = +2

Query  2    EGLLEVFYGVYEKDPDKVLQAMVQMGVLVPTGDMTAVRRTAQFFLNSFEERLATQRRERE  181
            +GLL+VFYGVYEKD DKVLQAM+QMGVLVPTGD+TAVRRTAQFFLNSFEERLA QRRERE
Sbjct  492  KGLLDVFYGVYEKDADKVLQAMIQMGVLVPTGDVTAVRRTAQFFLNSFEERLAAQRRERE  551

Query  182  LAKAELGFKKPLTKEEKIEKKKQRLAAIGEDLLSIAADQPFRFPATFTFVVRAFSVLHGI  361
            +A  ELGFKKPL+KEEKIEKKKQRLAAIGEDLL+IAADQPFRFPATFTFVVRAFSVL GI
Sbjct  552  MAATELGFKKPLSKEEKIEKKKQRLAAIGEDLLAIAADQPFRFPATFTFVVRAFSVLDGI  611

Query  362  GKGLDPRFDITEIAKPYALELLRFREAGVEVILKDFKTRWDRQNRAFYNLFRQADRVEKL  541
            GKGLDPRFDITEIAKPYALELLRFREAGVEVILKDF+ RWDRQ+RAFYNLFRQADRVEKL
Sbjct  612  GKGLDPRFDITEIAKPYALELLRFREAGVEVILKDFRKRWDRQSRAFYNLFRQADRVEKL  671

Query  542  AEIIQRLEQGDLKLRVRALESERAFQRVAAVQKTILSAVAAGSLINLATVLYLNAIRMPA  721
            AEIIQRLEQGDLKLRVRALESERAFQR+AAVQKT+ SAVAAGSLINLAT+LY+N+I MPA
Sbjct  672  AEIIQRLEQGDLKLRVRALESERAFQRIAAVQKTLGSAVAAGSLINLATILYINSITMPA  731

Query  722  MAAYGLCAFFGFQVLIGIVKVKKIDQRERLITGTA  826
              AY +CAFFG QVLIG+VKVKK+DQRERLITGTA
Sbjct  732  SIAYAICAFFGLQVLIGVVKVKKLDQRERLITGTA  766



>ref|XP_007048092.1| ABC2 isoform 2 [Theobroma cacao]
 gb|EOX92249.1| ABC2 isoform 2 [Theobroma cacao]
Length=775

 Score =   481 bits (1237),  Expect = 1e-159, Method: Compositional matrix adjust.
 Identities = 244/275 (89%), Positives = 262/275 (95%), Gaps = 0/275 (0%)
 Frame = +2

Query  2    EGLLEVFYGVYEKDPDKVLQAMVQMGVLVPTGDMTAVRRTAQFFLNSFEERLATQRRERE  181
            EGLLE FYGVYEKDPD+VLQAM+QMGVLVPTGDMTAVRRTAQFFLNSFEERLA QR+ERE
Sbjct  501  EGLLETFYGVYEKDPDRVLQAMIQMGVLVPTGDMTAVRRTAQFFLNSFEERLAAQRKERE  560

Query  182  LAKAELGFKKPLTKEEKIEKKKQRLAAIGEDLLSIAADQPFRFPATFTFVVRAFSVLHGI  361
            +A  ELGFK+ LTKEEK+EKKKQRLAAIGEDLL+IAADQPFRFPATFTFVVRAFSVL GI
Sbjct  561  MATTELGFKRQLTKEEKMEKKKQRLAAIGEDLLAIAADQPFRFPATFTFVVRAFSVLDGI  620

Query  362  GKGLDPRFDITEIAKPYALELLRFREAGVEVILKDFKTRWDRQNRAFYNLFRQADRVEKL  541
            GKGLDPRFDITEIAKPYALELLRFREAGVEV+LKDF+ RWDRQ+RAFYNLFRQADRVEKL
Sbjct  621  GKGLDPRFDITEIAKPYALELLRFREAGVEVVLKDFRKRWDRQSRAFYNLFRQADRVEKL  680

Query  542  AEIIQRLEQGDLKLRVRALESERAFQRVAAVQKTILSAVAAGSLINLATVLYLNAIRMPA  721
            AE IQRLEQGDLKLRVR LESERAFQRVAAVQKT+ SAVAAGSLINLAT+LYLN++R+PA
Sbjct  681  AETIQRLEQGDLKLRVRTLESERAFQRVAAVQKTVGSAVAAGSLINLATILYLNSLRVPA  740

Query  722  MAAYGLCAFFGFQVLIGIVKVKKIDQRERLITGTA  826
            +AAY  CAFF FQVLIGI+KVKK+DQRERLITGTA
Sbjct  741  VAAYVFCAFFSFQVLIGIIKVKKLDQRERLITGTA  775



>ref|XP_007048091.1| ABC2 isoform 1 [Theobroma cacao]
 gb|EOX92248.1| ABC2 isoform 1 [Theobroma cacao]
Length=810

 Score =   481 bits (1239),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 244/275 (89%), Positives = 262/275 (95%), Gaps = 0/275 (0%)
 Frame = +2

Query  2    EGLLEVFYGVYEKDPDKVLQAMVQMGVLVPTGDMTAVRRTAQFFLNSFEERLATQRRERE  181
            EGLLE FYGVYEKDPD+VLQAM+QMGVLVPTGDMTAVRRTAQFFLNSFEERLA QR+ERE
Sbjct  536  EGLLETFYGVYEKDPDRVLQAMIQMGVLVPTGDMTAVRRTAQFFLNSFEERLAAQRKERE  595

Query  182  LAKAELGFKKPLTKEEKIEKKKQRLAAIGEDLLSIAADQPFRFPATFTFVVRAFSVLHGI  361
            +A  ELGFK+ LTKEEK+EKKKQRLAAIGEDLL+IAADQPFRFPATFTFVVRAFSVL GI
Sbjct  596  MATTELGFKRQLTKEEKMEKKKQRLAAIGEDLLAIAADQPFRFPATFTFVVRAFSVLDGI  655

Query  362  GKGLDPRFDITEIAKPYALELLRFREAGVEVILKDFKTRWDRQNRAFYNLFRQADRVEKL  541
            GKGLDPRFDITEIAKPYALELLRFREAGVEV+LKDF+ RWDRQ+RAFYNLFRQADRVEKL
Sbjct  656  GKGLDPRFDITEIAKPYALELLRFREAGVEVVLKDFRKRWDRQSRAFYNLFRQADRVEKL  715

Query  542  AEIIQRLEQGDLKLRVRALESERAFQRVAAVQKTILSAVAAGSLINLATVLYLNAIRMPA  721
            AE IQRLEQGDLKLRVR LESERAFQRVAAVQKT+ SAVAAGSLINLAT+LYLN++R+PA
Sbjct  716  AETIQRLEQGDLKLRVRTLESERAFQRVAAVQKTVGSAVAAGSLINLATILYLNSLRVPA  775

Query  722  MAAYGLCAFFGFQVLIGIVKVKKIDQRERLITGTA  826
            +AAY  CAFF FQVLIGI+KVKK+DQRERLITGTA
Sbjct  776  VAAYVFCAFFSFQVLIGIIKVKKLDQRERLITGTA  810



>ref|XP_008440677.1| PREDICTED: uncharacterized aarF domain-containing protein kinase 
At1g79600, chloroplastic isoform X1 [Cucumis melo]
Length=761

 Score =   480 bits (1235),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 242/275 (88%), Positives = 262/275 (95%), Gaps = 0/275 (0%)
 Frame = +2

Query  2    EGLLEVFYGVYEKDPDKVLQAMVQMGVLVPTGDMTAVRRTAQFFLNSFEERLATQRRERE  181
            EGLLE FYGVYEKDPDKVLQAM+QMGVLVPTGDMTAVRRTAQFFLNSFEERLA QRRERE
Sbjct  487  EGLLETFYGVYEKDPDKVLQAMIQMGVLVPTGDMTAVRRTAQFFLNSFEERLAAQRRERE  546

Query  182  LAKAELGFKKPLTKEEKIEKKKQRLAAIGEDLLSIAADQPFRFPATFTFVVRAFSVLHGI  361
            +A AELGFKKPLTKEEK+ KKK+RLAAIGEDLL+IAADQPFRFPATFTFVVRAFSVL GI
Sbjct  547  MATAELGFKKPLTKEEKLMKKKERLAAIGEDLLAIAADQPFRFPATFTFVVRAFSVLDGI  606

Query  362  GKGLDPRFDITEIAKPYALELLRFREAGVEVILKDFKTRWDRQNRAFYNLFRQADRVEKL  541
            GKGLDPRFDITEIAKPYALELL+FREAGVEV LKDF+ RWDRQ+RAFYNLFRQADRVEKL
Sbjct  607  GKGLDPRFDITEIAKPYALELLKFREAGVEVALKDFRKRWDRQSRAFYNLFRQADRVEKL  666

Query  542  AEIIQRLEQGDLKLRVRALESERAFQRVAAVQKTILSAVAAGSLINLATVLYLNAIRMPA  721
            AEIIQRLEQGDLKLRVRALESER+FQRVA VQKT+ +A+AAGSLINLAT+LY+N+IRMPA
Sbjct  667  AEIIQRLEQGDLKLRVRALESERSFQRVATVQKTLGNAIAAGSLINLATILYINSIRMPA  726

Query  722  MAAYGLCAFFGFQVLIGIVKVKKIDQRERLITGTA  826
              AY  CAFFGFQVLIG++KVK++D+RERLITGTA
Sbjct  727  TIAYIFCAFFGFQVLIGLIKVKRLDERERLITGTA  761



>ref|XP_008440678.1| PREDICTED: uncharacterized aarF domain-containing protein kinase 
At1g79600, chloroplastic isoform X2 [Cucumis melo]
Length=759

 Score =   480 bits (1235),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 242/275 (88%), Positives = 262/275 (95%), Gaps = 0/275 (0%)
 Frame = +2

Query  2    EGLLEVFYGVYEKDPDKVLQAMVQMGVLVPTGDMTAVRRTAQFFLNSFEERLATQRRERE  181
            EGLLE FYGVYEKDPDKVLQAM+QMGVLVPTGDMTAVRRTAQFFLNSFEERLA QRRERE
Sbjct  485  EGLLETFYGVYEKDPDKVLQAMIQMGVLVPTGDMTAVRRTAQFFLNSFEERLAAQRRERE  544

Query  182  LAKAELGFKKPLTKEEKIEKKKQRLAAIGEDLLSIAADQPFRFPATFTFVVRAFSVLHGI  361
            +A AELGFKKPLTKEEK+ KKK+RLAAIGEDLL+IAADQPFRFPATFTFVVRAFSVL GI
Sbjct  545  MATAELGFKKPLTKEEKLMKKKERLAAIGEDLLAIAADQPFRFPATFTFVVRAFSVLDGI  604

Query  362  GKGLDPRFDITEIAKPYALELLRFREAGVEVILKDFKTRWDRQNRAFYNLFRQADRVEKL  541
            GKGLDPRFDITEIAKPYALELL+FREAGVEV LKDF+ RWDRQ+RAFYNLFRQADRVEKL
Sbjct  605  GKGLDPRFDITEIAKPYALELLKFREAGVEVALKDFRKRWDRQSRAFYNLFRQADRVEKL  664

Query  542  AEIIQRLEQGDLKLRVRALESERAFQRVAAVQKTILSAVAAGSLINLATVLYLNAIRMPA  721
            AEIIQRLEQGDLKLRVRALESER+FQRVA VQKT+ +A+AAGSLINLAT+LY+N+IRMPA
Sbjct  665  AEIIQRLEQGDLKLRVRALESERSFQRVATVQKTLGNAIAAGSLINLATILYINSIRMPA  724

Query  722  MAAYGLCAFFGFQVLIGIVKVKKIDQRERLITGTA  826
              AY  CAFFGFQVLIG++KVK++D+RERLITGTA
Sbjct  725  TIAYIFCAFFGFQVLIGLIKVKRLDERERLITGTA  759



>ref|XP_003531376.1| PREDICTED: uncharacterized aarF domain-containing protein kinase 
At1g79600, chloroplastic-like [Glycine max]
Length=757

 Score =   479 bits (1233),  Expect = 4e-159, Method: Compositional matrix adjust.
 Identities = 231/275 (84%), Positives = 258/275 (94%), Gaps = 0/275 (0%)
 Frame = +2

Query  2    EGLLEVFYGVYEKDPDKVLQAMVQMGVLVPTGDMTAVRRTAQFFLNSFEERLATQRRERE  181
            EGLLE FYG+YEK+PDKVLQ+M+QMGVLVPTGDMTAV+RTAQFFLNSFEERLA QRRERE
Sbjct  483  EGLLEAFYGIYEKNPDKVLQSMIQMGVLVPTGDMTAVKRTAQFFLNSFEERLAAQRRERE  542

Query  182  LAKAELGFKKPLTKEEKIEKKKQRLAAIGEDLLSIAADQPFRFPATFTFVVRAFSVLHGI  361
            +  AELGFK+PL+KEE++ KKK+RLAAIGEDLL+IAADQPFRFPATFTFVVRAFSVL GI
Sbjct  543  METAELGFKQPLSKEEQVMKKKERLAAIGEDLLAIAADQPFRFPATFTFVVRAFSVLDGI  602

Query  362  GKGLDPRFDITEIAKPYALELLRFREAGVEVILKDFKTRWDRQNRAFYNLFRQADRVEKL  541
            GKGLDPRFDITEIAKPYALELLRFREAGVEVILKD + RWDRQ++AFYNLFRQADRVEKL
Sbjct  603  GKGLDPRFDITEIAKPYALELLRFREAGVEVILKDLRKRWDRQSQAFYNLFRQADRVEKL  662

Query  542  AEIIQRLEQGDLKLRVRALESERAFQRVAAVQKTILSAVAAGSLINLATVLYLNAIRMPA  721
            AEII+RLEQGDLKLRVR LESERAFQR+A VQ+TI +A+AAGSLINLAT+L+LN+IR+PA
Sbjct  663  AEIIERLEQGDLKLRVRTLESERAFQRIATVQRTIGNAIAAGSLINLATILFLNSIRVPA  722

Query  722  MAAYGLCAFFGFQVLIGIVKVKKIDQRERLITGTA  826
              AY  CA FGFQVL GIVK+KK+D+RERLITGTA
Sbjct  723  TIAYVFCAIFGFQVLFGIVKIKKLDERERLITGTA  757



>ref|XP_010937033.1| PREDICTED: uncharacterized aarF domain-containing protein kinase 
At1g79600, chloroplastic isoform X1 [Elaeis guineensis]
 ref|XP_010937034.1| PREDICTED: uncharacterized aarF domain-containing protein kinase 
At1g79600, chloroplastic isoform X1 [Elaeis guineensis]
Length=762

 Score =   479 bits (1233),  Expect = 4e-159, Method: Compositional matrix adjust.
 Identities = 235/275 (85%), Positives = 259/275 (94%), Gaps = 0/275 (0%)
 Frame = +2

Query  2    EGLLEVFYGVYEKDPDKVLQAMVQMGVLVPTGDMTAVRRTAQFFLNSFEERLATQRRERE  181
            EGLLE FYG+YEKDP+KVLQAM+QMGVLVPTGDMTAVRRTAQFFLNSFEERLA QR+ERE
Sbjct  488  EGLLEAFYGIYEKDPEKVLQAMIQMGVLVPTGDMTAVRRTAQFFLNSFEERLAAQRKERE  547

Query  182  LAKAELGFKKPLTKEEKIEKKKQRLAAIGEDLLSIAADQPFRFPATFTFVVRAFSVLHGI  361
            +A  ELGFKKPL++EE++EKKKQRLAAIGEDLL+IAADQPFRFPATFTFVVRAFSVL GI
Sbjct  548  MATTELGFKKPLSREERLEKKKQRLAAIGEDLLAIAADQPFRFPATFTFVVRAFSVLDGI  607

Query  362  GKGLDPRFDITEIAKPYALELLRFREAGVEVILKDFKTRWDRQNRAFYNLFRQADRVEKL  541
            GKGLDPRFDITEIAKPYALELLRFREAG EV++KD K R +RQ+RAFYNLFRQADRVEKL
Sbjct  608  GKGLDPRFDITEIAKPYALELLRFREAGFEVVVKDVKKRLERQSRAFYNLFRQADRVEKL  667

Query  542  AEIIQRLEQGDLKLRVRALESERAFQRVAAVQKTILSAVAAGSLINLATVLYLNAIRMPA  721
            AEII+RLE+GDLKLRVR LESERAFQRVAAVQKTI +AV AGSLINLAT+LYLN+IR+PA
Sbjct  668  AEIIERLEKGDLKLRVRTLESERAFQRVAAVQKTIGNAVVAGSLINLATILYLNSIRVPA  727

Query  722  MAAYGLCAFFGFQVLIGIVKVKKIDQRERLITGTA  826
            M AY LCAFFG QVL GI+KVK++DQ+ERLITGTA
Sbjct  728  MTAYMLCAFFGMQVLFGILKVKRLDQQERLITGTA  762



>ref|XP_009407360.1| PREDICTED: uncharacterized aarF domain-containing protein kinase 
At1g79600, chloroplastic-like [Musa acuminata subsp. malaccensis]
Length=755

 Score =   478 bits (1229),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 233/275 (85%), Positives = 258/275 (94%), Gaps = 0/275 (0%)
 Frame = +2

Query  2    EGLLEVFYGVYEKDPDKVLQAMVQMGVLVPTGDMTAVRRTAQFFLNSFEERLATQRRERE  181
            EGLLE FYG+Y+KDPD+V+QAM+QMGVLVPTGDMTAVRRTAQFFLNSFEERLA QR+ERE
Sbjct  481  EGLLEAFYGIYDKDPDRVVQAMIQMGVLVPTGDMTAVRRTAQFFLNSFEERLAAQRKERE  540

Query  182  LAKAELGFKKPLTKEEKIEKKKQRLAAIGEDLLSIAADQPFRFPATFTFVVRAFSVLHGI  361
            +A AELGFKK LTKEE++EKKKQRLAAIGEDLL+IAADQPFRFPATFTFVVRAFSVL GI
Sbjct  541  MASAELGFKKQLTKEERLEKKKQRLAAIGEDLLAIAADQPFRFPATFTFVVRAFSVLDGI  600

Query  362  GKGLDPRFDITEIAKPYALELLRFREAGVEVILKDFKTRWDRQNRAFYNLFRQADRVEKL  541
            GKGLDPRFDITEIAKPYALELLRFREAG+EVI+KD K RW+RQ+ AFYNLFRQADRVEKL
Sbjct  601  GKGLDPRFDITEIAKPYALELLRFREAGLEVIVKDIKKRWERQSSAFYNLFRQADRVEKL  660

Query  542  AEIIQRLEQGDLKLRVRALESERAFQRVAAVQKTILSAVAAGSLINLATVLYLNAIRMPA  721
            A+ IQRLE+GDLKLRVR LESERAFQRVAAVQKTI +AVA GSL+NLAT+LY N++R+PA
Sbjct  661  AQTIQRLEEGDLKLRVRTLESERAFQRVAAVQKTIGNAVALGSLVNLATILYFNSVRVPA  720

Query  722  MAAYGLCAFFGFQVLIGIVKVKKIDQRERLITGTA  826
            MAAY LCAFFG QVL G +KVKK+DQ+ERLITGTA
Sbjct  721  MAAYLLCAFFGAQVLFGFLKVKKLDQQERLITGTA  755



>ref|XP_006578821.1| PREDICTED: uncharacterized aarF domain-containing protein kinase 
At1g79600, chloroplastic-like [Glycine max]
Length=747

 Score =   477 bits (1227),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 245/275 (89%), Positives = 260/275 (95%), Gaps = 0/275 (0%)
 Frame = +2

Query  2    EGLLEVFYGVYEKDPDKVLQAMVQMGVLVPTGDMTAVRRTAQFFLNSFEERLATQRRERE  181
            EGLLE FYGVYEKDPDKVLQAM+QMGVLVPTGDMTAVRRTAQFFLNSFEERLA QRRERE
Sbjct  473  EGLLETFYGVYEKDPDKVLQAMIQMGVLVPTGDMTAVRRTAQFFLNSFEERLAAQRRERE  532

Query  182  LAKAELGFKKPLTKEEKIEKKKQRLAAIGEDLLSIAADQPFRFPATFTFVVRAFSVLHGI  361
             A  ELGFKKPL+KEEKI+KKKQRLAAIGEDLLSIAADQPFRFPATFTFVVRAFSVL GI
Sbjct  533  EATTELGFKKPLSKEEKIKKKKQRLAAIGEDLLSIAADQPFRFPATFTFVVRAFSVLDGI  592

Query  362  GKGLDPRFDITEIAKPYALELLRFREAGVEVILKDFKTRWDRQNRAFYNLFRQADRVEKL  541
            GKGLDPRFDITEIAKPYALELLRFREAGVEV+LKDF+ RWDRQ++AFYNL RQADRV+KL
Sbjct  593  GKGLDPRFDITEIAKPYALELLRFREAGVEVVLKDFRKRWDRQSQAFYNLIRQADRVDKL  652

Query  542  AEIIQRLEQGDLKLRVRALESERAFQRVAAVQKTILSAVAAGSLINLATVLYLNAIRMPA  721
            A IIQRLEQGDLKLRVR LESERAFQRVAAVQKTI +AVAAGSLINLATVLYLN+IR+PA
Sbjct  653  ANIIQRLEQGDLKLRVRTLESERAFQRVAAVQKTIGNAVAAGSLINLATVLYLNSIRVPA  712

Query  722  MAAYGLCAFFGFQVLIGIVKVKKIDQRERLITGTA  826
            +AAY  CA FGFQVL+GIVKVKK+D+RERLITG A
Sbjct  713  IAAYIFCAIFGFQVLLGIVKVKKLDERERLITGIA  747



>ref|XP_003602469.1| ABC transporter-like protein [Medicago truncatula]
Length=722

 Score =   476 bits (1224),  Expect = 3e-158, Method: Compositional matrix adjust.
 Identities = 241/289 (83%), Positives = 262/289 (91%), Gaps = 6/289 (2%)
 Frame = +2

Query  2    EGLLEVFYGVYEKDPDKVLQAMVQMGVLVPTGDMTAVRRTAQFFLNSFEERLATQRRERE  181
            EGLLE FYGVYEKDPD+VLQ+M+QMGVLVPTGDMTAVRRTAQFFLNSFEERLA QR+E+E
Sbjct  411  EGLLETFYGVYEKDPDRVLQSMIQMGVLVPTGDMTAVRRTAQFFLNSFEERLAAQRKEKE  470

Query  182  LAKAELGFKKPLTKEEKIEKKKQRLAAIGEDLLSIAADQPFRFPATFTFVVRAFSVLHGI  361
             A  ELGFKKPL+KEEK+ KKKQRLAAIGEDLLSI++DQPFRFPATFTFVVRAFSVL GI
Sbjct  471  EATGELGFKKPLSKEEKMMKKKQRLAAIGEDLLSISSDQPFRFPATFTFVVRAFSVLDGI  530

Query  362  GKGLDPRFDITEIAKPYALELLRFREAGVEVILKDFKTRWDRQNRAFYNLFRQADRVEKL  541
            GKGLDPRFDITEIAKPYALELLRFREAGVEV+LKDF  RWDRQ++AFYNLFRQADRV+KL
Sbjct  531  GKGLDPRFDITEIAKPYALELLRFREAGVEVVLKDFTKRWDRQSQAFYNLFRQADRVDKL  590

Query  542  AEIIQRLEQGDLKLRVRALESERAFQRVAAVQKTILSAVAAGSLINLATVLYLNAIRMPA  721
            A IIQRLEQGDLKLRVR LESERAFQRVA VQKTI +AVAAGSLINLAT+LYLN+IR+PA
Sbjct  591  ASIIQRLEQGDLKLRVRTLESERAFQRVATVQKTIGNAVAAGSLINLATILYLNSIRVPA  650

Query  722  MAAYGLCAFFGFQVLIGIVKVKKIDQRERLITGTA*TQVADSDQSRDYW  868
            +AAY  CAFFGFQVL+GIVKVKK+D+ ERLITGT        D  R YW
Sbjct  651  IAAYVFCAFFGFQVLLGIVKVKKLDETERLITGTV------LDMCRIYW  693



>ref|XP_012075202.1| PREDICTED: uncharacterized aarF domain-containing protein kinase 
At1g79600, chloroplastic [Jatropha curcas]
 ref|XP_012075203.1| PREDICTED: uncharacterized aarF domain-containing protein kinase 
At1g79600, chloroplastic [Jatropha curcas]
 ref|XP_012075204.1| PREDICTED: uncharacterized aarF domain-containing protein kinase 
At1g79600, chloroplastic [Jatropha curcas]
 gb|KDP35226.1| hypothetical protein JCGZ_09385 [Jatropha curcas]
Length=767

 Score =   477 bits (1227),  Expect = 4e-158, Method: Compositional matrix adjust.
 Identities = 239/275 (87%), Positives = 261/275 (95%), Gaps = 0/275 (0%)
 Frame = +2

Query  2    EGLLEVFYGVYEKDPDKVLQAMVQMGVLVPTGDMTAVRRTAQFFLNSFEERLATQRRERE  181
            EGLLE FYG+YEKDPDKVLQAM+QMGVLVPTGDMTAVRRTA+FF+NSFEERLA QR+ERE
Sbjct  493  EGLLEAFYGIYEKDPDKVLQAMIQMGVLVPTGDMTAVRRTAKFFINSFEERLAAQRKERE  552

Query  182  LAKAELGFKKPLTKEEKIEKKKQRLAAIGEDLLSIAADQPFRFPATFTFVVRAFSVLHGI  361
            +   ELGFKKPLTKEEK+EKKKQRLAAIGEDLL+IAADQPFRFPATFTFVVRAFSVL GI
Sbjct  553  MGITELGFKKPLTKEEKMEKKKQRLAAIGEDLLAIAADQPFRFPATFTFVVRAFSVLDGI  612

Query  362  GKGLDPRFDITEIAKPYALELLRFREAGVEVILKDFKTRWDRQNRAFYNLFRQADRVEKL  541
            GKGLDPRFDITEIAKPYALELLRFREAGVEV+LKDF+ RWDRQ+RAFYNLFRQADR++KL
Sbjct  613  GKGLDPRFDITEIAKPYALELLRFREAGVEVLLKDFRNRWDRQSRAFYNLFRQADRIQKL  672

Query  542  AEIIQRLEQGDLKLRVRALESERAFQRVAAVQKTILSAVAAGSLINLATVLYLNAIRMPA  721
            AE IQRLEQGDLKLRVR LESERAFQRVAAVQKT+ SAVAAGSL+NLAT+LYLN+IR+PA
Sbjct  673  AETIQRLEQGDLKLRVRTLESERAFQRVAAVQKTVGSAVAAGSLVNLATILYLNSIRVPA  732

Query  722  MAAYGLCAFFGFQVLIGIVKVKKIDQRERLITGTA  826
            +AAY  CAFF FQVL GI+KVKK+DQ+ERLITGTA
Sbjct  733  IAAYIFCAFFSFQVLFGIIKVKKLDQQERLITGTA  767



>ref|XP_003630100.1| ABC transporter-like protein [Medicago truncatula]
 gb|AET04576.1| ABC transporter-like protein [Medicago truncatula]
Length=735

 Score =   476 bits (1224),  Expect = 5e-158, Method: Compositional matrix adjust.
 Identities = 232/275 (84%), Positives = 255/275 (93%), Gaps = 0/275 (0%)
 Frame = +2

Query  2    EGLLEVFYGVYEKDPDKVLQAMVQMGVLVPTGDMTAVRRTAQFFLNSFEERLATQRRERE  181
            EGLLE FYGVYEK PDKVL AM+QMGVLVPTGDMTAVRRTAQFFLNSFEERLA QRRE+E
Sbjct  461  EGLLEAFYGVYEKSPDKVLDAMIQMGVLVPTGDMTAVRRTAQFFLNSFEERLAAQRREKE  520

Query  182  LAKAELGFKKPLTKEEKIEKKKQRLAAIGEDLLSIAADQPFRFPATFTFVVRAFSVLHGI  361
            +  AE+GFKKPL+KEE++ KKK+RLAAIGEDLLSIAADQPFRFPATFTFVVRAFSVL GI
Sbjct  521  MEAAEVGFKKPLSKEEQVMKKKERLAAIGEDLLSIAADQPFRFPATFTFVVRAFSVLDGI  580

Query  362  GKGLDPRFDITEIAKPYALELLRFREAGVEVILKDFKTRWDRQNRAFYNLFRQADRVEKL  541
            GKGLDPRFDITEIAKPYALELL+FREAGVEVI+KD K RWDRQ++AFYNLFRQADRVEKL
Sbjct  581  GKGLDPRFDITEIAKPYALELLKFREAGVEVIIKDIKKRWDRQSQAFYNLFRQADRVEKL  640

Query  542  AEIIQRLEQGDLKLRVRALESERAFQRVAAVQKTILSAVAAGSLINLATVLYLNAIRMPA  721
            A +I+RLEQGDLKLRVRALESERAFQR+A VQKTI +AV AGSLINLAT+L LN+IR+PA
Sbjct  641  ANVIERLEQGDLKLRVRALESERAFQRIATVQKTIGNAVGAGSLINLATILSLNSIRVPA  700

Query  722  MAAYGLCAFFGFQVLIGIVKVKKIDQRERLITGTA  826
              AY  CA FGFQVL+GIVK+KK+D+RERLITGTA
Sbjct  701  TIAYFFCAIFGFQVLLGIVKIKKLDERERLITGTA  735



>ref|XP_006827080.1| PREDICTED: uncharacterized aarF domain-containing protein kinase 
At1g79600, chloroplastic [Amborella trichopoda]
 gb|ERM94317.1| hypothetical protein AMTR_s00010p00237980 [Amborella trichopoda]
Length=753

 Score =   476 bits (1225),  Expect = 5e-158, Method: Compositional matrix adjust.
 Identities = 231/274 (84%), Positives = 256/274 (93%), Gaps = 0/274 (0%)
 Frame = +2

Query  5    GLLEVFYGVYEKDPDKVLQAMVQMGVLVPTGDMTAVRRTAQFFLNSFEERLATQRREREL  184
            GLLE FYGVYEKDPDKVLQAM+QMGVLVPTGDMTAVRRTAQFFL SFEERLA Q++E+E+
Sbjct  480  GLLETFYGVYEKDPDKVLQAMIQMGVLVPTGDMTAVRRTAQFFLKSFEERLAAQKKEKEM  539

Query  185  AKAELGFKKPLTKEEKIEKKKQRLAAIGEDLLSIAADQPFRFPATFTFVVRAFSVLHGIG  364
            A  ELGFKKPL+ E++++KKK+RLAAIGEDLL+IAADQPFRFPATFTFVVRAFSVL GIG
Sbjct  540  ATTELGFKKPLSNEDRLQKKKERLAAIGEDLLAIAADQPFRFPATFTFVVRAFSVLDGIG  599

Query  365  KGLDPRFDITEIAKPYALELLRFREAGVEVILKDFKTRWDRQNRAFYNLFRQADRVEKLA  544
            KGLDPRFDITEIAKPYALELLRFREAG+EVILKD + RWDRQ+RAFYNLFRQADRVEKLA
Sbjct  600  KGLDPRFDITEIAKPYALELLRFREAGIEVILKDIRKRWDRQSRAFYNLFRQADRVEKLA  659

Query  545  EIIQRLEQGDLKLRVRALESERAFQRVAAVQKTILSAVAAGSLINLATVLYLNAIRMPAM  724
            EIIQRLE+GDLKLRVR LESERAF+RVA VQKTI +AVAAGSLINLAT+LYLN+IR PAM
Sbjct  660  EIIQRLEKGDLKLRVRTLESERAFKRVATVQKTIGNAVAAGSLINLATMLYLNSIRFPAM  719

Query  725  AAYGLCAFFGFQVLIGIVKVKKIDQRERLITGTA  826
             AY  CA FG QVLIGI+KVK++DQ+E+LITGTA
Sbjct  720  VAYTFCAVFGAQVLIGILKVKRLDQQEKLITGTA  753



>ref|XP_004237437.1| PREDICTED: uncharacterized aarF domain-containing protein kinase 
At1g79600, chloroplastic [Solanum lycopersicum]
 ref|XP_010319774.1| PREDICTED: uncharacterized aarF domain-containing protein kinase 
At1g79600, chloroplastic [Solanum lycopersicum]
Length=754

 Score =   476 bits (1224),  Expect = 8e-158, Method: Compositional matrix adjust.
 Identities = 238/275 (87%), Positives = 260/275 (95%), Gaps = 0/275 (0%)
 Frame = +2

Query  2    EGLLEVFYGVYEKDPDKVLQAMVQMGVLVPTGDMTAVRRTAQFFLNSFEERLATQRRERE  181
            EGLLE FYGVYEKDPDKVLQA +QMG+LVPTGDMTAVRRTAQFFLNSFEERLA QR+ERE
Sbjct  480  EGLLETFYGVYEKDPDKVLQASIQMGILVPTGDMTAVRRTAQFFLNSFEERLAAQRKERE  539

Query  182  LAKAELGFKKPLTKEEKIEKKKQRLAAIGEDLLSIAADQPFRFPATFTFVVRAFSVLHGI  361
            +A+AELGFKKPLTKEE  EKKKQRLAAIGEDLL+IAADQPFRFPATFTFVVRAFSVL GI
Sbjct  540  MAQAELGFKKPLTKEELKEKKKQRLAAIGEDLLAIAADQPFRFPATFTFVVRAFSVLDGI  599

Query  362  GKGLDPRFDITEIAKPYALELLRFREAGVEVILKDFKTRWDRQNRAFYNLFRQADRVEKL  541
            GKGLDPRFDITEIAKPYALELLRFREAG+EV +KDF+ RWDRQ++AFYNLFRQADRVEKL
Sbjct  600  GKGLDPRFDITEIAKPYALELLRFREAGIEVAVKDFRKRWDRQSQAFYNLFRQADRVEKL  659

Query  542  AEIIQRLEQGDLKLRVRALESERAFQRVAAVQKTILSAVAAGSLINLATVLYLNAIRMPA  721
            A IIQRLEQGDLKLRVRALESERAFQRVAAVQKTI S VAAGSL+NLAT+LYLN++R+P+
Sbjct  660  AAIIQRLEQGDLKLRVRALESERAFQRVAAVQKTIGSGVAAGSLVNLATILYLNSVRIPS  719

Query  722  MAAYGLCAFFGFQVLIGIVKVKKIDQRERLITGTA  826
            + AY  CAFFGFQVL G++KVKK+D+RERLITGTA
Sbjct  720  IIAYTACAFFGFQVLFGLLKVKKLDERERLITGTA  754



>dbj|BAD33355.1| putative ABC transporter [Oryza sativa Japonica Group]
Length=373

 Score =   462 bits (1188),  Expect = 8e-158, Method: Compositional matrix adjust.
 Identities = 236/275 (86%), Positives = 256/275 (93%), Gaps = 0/275 (0%)
 Frame = +2

Query  2    EGLLEVFYGVYEKDPDKVLQAMVQMGVLVPTGDMTAVRRTAQFFLNSFEERLATQRRERE  181
            EGLLE FYGVYEKDPDKVLQ+M+QMGVLVPTGDMTAVRRTAQFFL+SFEERLA QR+ERE
Sbjct  99   EGLLEAFYGVYEKDPDKVLQSMIQMGVLVPTGDMTAVRRTAQFFLDSFEERLAAQRKERE  158

Query  182  LAKAELGFKKPLTKEEKIEKKKQRLAAIGEDLLSIAADQPFRFPATFTFVVRAFSVLHGI  361
            +A  ELGFKK LTKEEK EKKKQRLAAIGEDLLSIAADQPFRFPATFTFVVRAFSVL GI
Sbjct  159  MATEELGFKKQLTKEEKFEKKKQRLAAIGEDLLSIAADQPFRFPATFTFVVRAFSVLDGI  218

Query  362  GKGLDPRFDITEIAKPYALELLRFREAGVEVILKDFKTRWDRQNRAFYNLFRQADRVEKL  541
            GKGLDPRFDITEIAKPYA+ELLRF EAGVEVI+KD + RW+RQ+RAFYNLFRQ DRVEKL
Sbjct  219  GKGLDPRFDITEIAKPYAMELLRFNEAGVEVIVKDARKRWERQSRAFYNLFRQPDRVEKL  278

Query  542  AEIIQRLEQGDLKLRVRALESERAFQRVAAVQKTILSAVAAGSLINLATVLYLNAIRMPA  721
            A+II+RLEQGDLKLRVR LESERAFQRVAAVQKTI   VAAGSL+NLATVLYLN+IR+PA
Sbjct  279  AQIIERLEQGDLKLRVRTLESERAFQRVAAVQKTIGYGVAAGSLVNLATVLYLNSIRLPA  338

Query  722  MAAYGLCAFFGFQVLIGIVKVKKIDQRERLITGTA  826
              AY LCAFFG QVL+G++KVKK+DQ+ERLITGTA
Sbjct  339  TIAYSLCAFFGLQVLVGLLKVKKLDQQERLITGTA  373



>ref|XP_011657999.1| PREDICTED: uncharacterized aarF domain-containing protein kinase 
At1g79600, chloroplastic isoform X2 [Cucumis sativus]
Length=759

 Score =   476 bits (1224),  Expect = 9e-158, Method: Compositional matrix adjust.
 Identities = 240/275 (87%), Positives = 262/275 (95%), Gaps = 0/275 (0%)
 Frame = +2

Query  2    EGLLEVFYGVYEKDPDKVLQAMVQMGVLVPTGDMTAVRRTAQFFLNSFEERLATQRRERE  181
            EGLLE FYGVYEKDPDKVLQAM+QMGVLVPTGDMTAVRRTAQFFLNSFEERLA QRRERE
Sbjct  485  EGLLETFYGVYEKDPDKVLQAMIQMGVLVPTGDMTAVRRTAQFFLNSFEERLAAQRRERE  544

Query  182  LAKAELGFKKPLTKEEKIEKKKQRLAAIGEDLLSIAADQPFRFPATFTFVVRAFSVLHGI  361
            +A AELGFKKPLTKEEK+ KKK+RLAAIGEDLL+IAADQPFRFPATFTFVVRAFSVL GI
Sbjct  545  MATAELGFKKPLTKEEKLMKKKERLAAIGEDLLAIAADQPFRFPATFTFVVRAFSVLDGI  604

Query  362  GKGLDPRFDITEIAKPYALELLRFREAGVEVILKDFKTRWDRQNRAFYNLFRQADRVEKL  541
            GKGLDPRFDITEIAKPYALELL+FREAGVEV LKDF+ RWDRQ+RAFYNLFRQA+RVEKL
Sbjct  605  GKGLDPRFDITEIAKPYALELLKFREAGVEVALKDFRKRWDRQSRAFYNLFRQAERVEKL  664

Query  542  AEIIQRLEQGDLKLRVRALESERAFQRVAAVQKTILSAVAAGSLINLATVLYLNAIRMPA  721
            AEIIQRLEQGDLKLRVRALESER+FQRVA VQKT+ +A+AAGSLINLAT+L++N+IRMPA
Sbjct  665  AEIIQRLEQGDLKLRVRALESERSFQRVATVQKTLGNAIAAGSLINLATILHINSIRMPA  724

Query  722  MAAYGLCAFFGFQVLIGIVKVKKIDQRERLITGTA  826
              AY  CAFFGFQVLIG++KVK++D+RERLITGTA
Sbjct  725  TIAYIFCAFFGFQVLIGLIKVKRLDERERLITGTA  759



>ref|XP_004143496.1| PREDICTED: uncharacterized aarF domain-containing protein kinase 
At1g79600, chloroplastic isoform X1 [Cucumis sativus]
 gb|KGN48799.1| hypothetical protein Csa_6G501880 [Cucumis sativus]
Length=761

 Score =   476 bits (1224),  Expect = 1e-157, Method: Compositional matrix adjust.
 Identities = 240/275 (87%), Positives = 262/275 (95%), Gaps = 0/275 (0%)
 Frame = +2

Query  2    EGLLEVFYGVYEKDPDKVLQAMVQMGVLVPTGDMTAVRRTAQFFLNSFEERLATQRRERE  181
            EGLLE FYGVYEKDPDKVLQAM+QMGVLVPTGDMTAVRRTAQFFLNSFEERLA QRRERE
Sbjct  487  EGLLETFYGVYEKDPDKVLQAMIQMGVLVPTGDMTAVRRTAQFFLNSFEERLAAQRRERE  546

Query  182  LAKAELGFKKPLTKEEKIEKKKQRLAAIGEDLLSIAADQPFRFPATFTFVVRAFSVLHGI  361
            +A AELGFKKPLTKEEK+ KKK+RLAAIGEDLL+IAADQPFRFPATFTFVVRAFSVL GI
Sbjct  547  MATAELGFKKPLTKEEKLMKKKERLAAIGEDLLAIAADQPFRFPATFTFVVRAFSVLDGI  606

Query  362  GKGLDPRFDITEIAKPYALELLRFREAGVEVILKDFKTRWDRQNRAFYNLFRQADRVEKL  541
            GKGLDPRFDITEIAKPYALELL+FREAGVEV LKDF+ RWDRQ+RAFYNLFRQA+RVEKL
Sbjct  607  GKGLDPRFDITEIAKPYALELLKFREAGVEVALKDFRKRWDRQSRAFYNLFRQAERVEKL  666

Query  542  AEIIQRLEQGDLKLRVRALESERAFQRVAAVQKTILSAVAAGSLINLATVLYLNAIRMPA  721
            AEIIQRLEQGDLKLRVRALESER+FQRVA VQKT+ +A+AAGSLINLAT+L++N+IRMPA
Sbjct  667  AEIIQRLEQGDLKLRVRALESERSFQRVATVQKTLGNAIAAGSLINLATILHINSIRMPA  726

Query  722  MAAYGLCAFFGFQVLIGIVKVKKIDQRERLITGTA  826
              AY  CAFFGFQVLIG++KVK++D+RERLITGTA
Sbjct  727  TIAYIFCAFFGFQVLIGLIKVKRLDERERLITGTA  761



>ref|XP_006354710.1| PREDICTED: uncharacterized aarF domain-containing protein kinase 
At1g79600, chloroplastic-like isoform X1 [Solanum tuberosum]
 ref|XP_006354711.1| PREDICTED: uncharacterized aarF domain-containing protein kinase 
At1g79600, chloroplastic-like isoform X2 [Solanum tuberosum]
Length=756

 Score =   475 bits (1223),  Expect = 1e-157, Method: Compositional matrix adjust.
 Identities = 239/275 (87%), Positives = 262/275 (95%), Gaps = 0/275 (0%)
 Frame = +2

Query  2    EGLLEVFYGVYEKDPDKVLQAMVQMGVLVPTGDMTAVRRTAQFFLNSFEERLATQRRERE  181
            EGLLE FYGVYEKDPDKVLQA +QMG+LVPTGDMTAVRRTAQFFLNSFEERLA QR+ERE
Sbjct  482  EGLLETFYGVYEKDPDKVLQASIQMGILVPTGDMTAVRRTAQFFLNSFEERLAAQRKERE  541

Query  182  LAKAELGFKKPLTKEEKIEKKKQRLAAIGEDLLSIAADQPFRFPATFTFVVRAFSVLHGI  361
            +A+AELGFKKPLTKEE+ EKKKQRLAAIGEDLL+IAADQPFRFPATFTFVVRAFSVL GI
Sbjct  542  MAQAELGFKKPLTKEEQKEKKKQRLAAIGEDLLAIAADQPFRFPATFTFVVRAFSVLDGI  601

Query  362  GKGLDPRFDITEIAKPYALELLRFREAGVEVILKDFKTRWDRQNRAFYNLFRQADRVEKL  541
            GKGLDPRFDITEIAKPYALELLRFREAGVEV++KDF+ RWDRQ++AFYNLFRQADRVEKL
Sbjct  602  GKGLDPRFDITEIAKPYALELLRFREAGVEVVVKDFRKRWDRQSQAFYNLFRQADRVEKL  661

Query  542  AEIIQRLEQGDLKLRVRALESERAFQRVAAVQKTILSAVAAGSLINLATVLYLNAIRMPA  721
            A IIQRLEQGDLKLRVRALESERAFQRVAAVQKTI S VAAGSL+NLAT+LYLN++R+P+
Sbjct  662  AAIIQRLEQGDLKLRVRALESERAFQRVAAVQKTIGSGVAAGSLVNLATLLYLNSVRIPS  721

Query  722  MAAYGLCAFFGFQVLIGIVKVKKIDQRERLITGTA  826
            + AY  CAFFGFQVL G++KVKK+D+RERLITGTA
Sbjct  722  IIAYTACAFFGFQVLFGLLKVKKLDERERLITGTA  756



>gb|AES72720.2| ABC transporter-like protein [Medicago truncatula]
Length=744

 Score =   474 bits (1221),  Expect = 1e-157, Method: Compositional matrix adjust.
 Identities = 238/275 (87%), Positives = 259/275 (94%), Gaps = 0/275 (0%)
 Frame = +2

Query  2    EGLLEVFYGVYEKDPDKVLQAMVQMGVLVPTGDMTAVRRTAQFFLNSFEERLATQRRERE  181
            EGLLE FYGVYEKDPD+VLQ+M+QMGVLVPTGDMTAVRRTAQFFLNSFEERLA QR+E+E
Sbjct  470  EGLLETFYGVYEKDPDRVLQSMIQMGVLVPTGDMTAVRRTAQFFLNSFEERLAAQRKEKE  529

Query  182  LAKAELGFKKPLTKEEKIEKKKQRLAAIGEDLLSIAADQPFRFPATFTFVVRAFSVLHGI  361
             A  ELGFKKPL+KEEK+ KKKQRLAAIGEDLLSI++DQPFRFPATFTFVVRAFSVL GI
Sbjct  530  EATGELGFKKPLSKEEKMMKKKQRLAAIGEDLLSISSDQPFRFPATFTFVVRAFSVLDGI  589

Query  362  GKGLDPRFDITEIAKPYALELLRFREAGVEVILKDFKTRWDRQNRAFYNLFRQADRVEKL  541
            GKGLDPRFDITEIAKPYALELLRFREAGVEV+LKDF  RWDRQ++AFYNLFRQADRV+KL
Sbjct  590  GKGLDPRFDITEIAKPYALELLRFREAGVEVVLKDFTKRWDRQSQAFYNLFRQADRVDKL  649

Query  542  AEIIQRLEQGDLKLRVRALESERAFQRVAAVQKTILSAVAAGSLINLATVLYLNAIRMPA  721
            A IIQRLEQGDLKLRVR LESERAFQRVA VQKTI +AVAAGSLINLAT+LYLN+IR+PA
Sbjct  650  ASIIQRLEQGDLKLRVRTLESERAFQRVATVQKTIGNAVAAGSLINLATILYLNSIRVPA  709

Query  722  MAAYGLCAFFGFQVLIGIVKVKKIDQRERLITGTA  826
            +AAY  CAFFGFQVL+GIVKVKK+D+ ERLITGTA
Sbjct  710  IAAYVFCAFFGFQVLLGIVKVKKLDETERLITGTA  744



>gb|KHN29105.1| Hypothetical protein glysoja_008440 [Glycine soja]
Length=758

 Score =   474 bits (1221),  Expect = 2e-157, Method: Compositional matrix adjust.
 Identities = 231/276 (84%), Positives = 258/276 (93%), Gaps = 1/276 (0%)
 Frame = +2

Query  2    EGLLEVFYGVYEKDPDKVLQAMVQMGVLVPTGDMTAVRRTAQFFLNSFEERLATQRRERE  181
            EGLLE FYG+YEK+PDKVLQ+M+QMGVLVPTGDMTAV+RTAQFFLNSFEERLA QRRERE
Sbjct  483  EGLLEAFYGIYEKNPDKVLQSMIQMGVLVPTGDMTAVKRTAQFFLNSFEERLAAQRRERE  542

Query  182  LAKAELGFKKPLTKEEKIEKKKQRLAAIGEDLLSIAADQPFRFPATFTFVVRAFSVLHGI  361
            +  AELGFK+PL+KEE++ KKK+RLAAIGEDLL+IAADQPFRFPATFTFVVRAFSVL GI
Sbjct  543  METAELGFKQPLSKEEQVMKKKERLAAIGEDLLAIAADQPFRFPATFTFVVRAFSVLDGI  602

Query  362  GKGLDPRFDITEIAKPYALELLRFREAGVEVILK-DFKTRWDRQNRAFYNLFRQADRVEK  538
            GKGLDPRFDITEIAKPYALELLRFREAGVEVILK D + RWDRQ++AFYNLFRQADRVEK
Sbjct  603  GKGLDPRFDITEIAKPYALELLRFREAGVEVILKADLRKRWDRQSQAFYNLFRQADRVEK  662

Query  539  LAEIIQRLEQGDLKLRVRALESERAFQRVAAVQKTILSAVAAGSLINLATVLYLNAIRMP  718
            LAEII+RLEQGDLKLRVR LESERAFQR+A VQ+TI +A+AAGSLINLAT+L+LN+IR+P
Sbjct  663  LAEIIERLEQGDLKLRVRTLESERAFQRIATVQRTIGNAIAAGSLINLATILFLNSIRVP  722

Query  719  AMAAYGLCAFFGFQVLIGIVKVKKIDQRERLITGTA  826
            A  AY  CA FGFQVL GIVK+KK+D+RERLITGTA
Sbjct  723  ATIAYVFCAIFGFQVLFGIVKIKKLDERERLITGTA  758



>ref|XP_007137605.1| hypothetical protein PHAVU_009G140400g [Phaseolus vulgaris]
 gb|ESW09599.1| hypothetical protein PHAVU_009G140400g [Phaseolus vulgaris]
Length=755

 Score =   474 bits (1220),  Expect = 3e-157, Method: Compositional matrix adjust.
 Identities = 241/275 (88%), Positives = 261/275 (95%), Gaps = 0/275 (0%)
 Frame = +2

Query  2    EGLLEVFYGVYEKDPDKVLQAMVQMGVLVPTGDMTAVRRTAQFFLNSFEERLATQRRERE  181
            EGLLE FYGVYEKDP+KVLQAM+QMGVLVPTGDMTAVRRTAQFFL+SFEERLA QRRERE
Sbjct  481  EGLLEAFYGVYEKDPEKVLQAMIQMGVLVPTGDMTAVRRTAQFFLDSFEERLAAQRRERE  540

Query  182  LAKAELGFKKPLTKEEKIEKKKQRLAAIGEDLLSIAADQPFRFPATFTFVVRAFSVLHGI  361
            +A  ELGFKKPL+KEEKI+KKKQRLAAIGEDLLSIA DQPFRFPATFTFVVRAFSVL GI
Sbjct  541  VATTELGFKKPLSKEEKIKKKKQRLAAIGEDLLSIAGDQPFRFPATFTFVVRAFSVLDGI  600

Query  362  GKGLDPRFDITEIAKPYALELLRFREAGVEVILKDFKTRWDRQNRAFYNLFRQADRVEKL  541
            GKGLDPRFDITEIAKPYALELLRFREAGVEV+LKDF+ RWDRQ++AFYNLFRQADR++KL
Sbjct  601  GKGLDPRFDITEIAKPYALELLRFREAGVEVVLKDFRKRWDRQSQAFYNLFRQADRIDKL  660

Query  542  AEIIQRLEQGDLKLRVRALESERAFQRVAAVQKTILSAVAAGSLINLATVLYLNAIRMPA  721
            AEIIQ+LEQGDLKLRVR LESERAFQRVAAVQKTI +AVAAGSLINLATVLYLN+IR+PA
Sbjct  661  AEIIQKLEQGDLKLRVRTLESERAFQRVAAVQKTIGNAVAAGSLINLATVLYLNSIRVPA  720

Query  722  MAAYGLCAFFGFQVLIGIVKVKKIDQRERLITGTA  826
            +  Y  CA FGFQVL+GIVKVKK+D+RERLITGTA
Sbjct  721  IVGYIFCAIFGFQVLLGIVKVKKLDERERLITGTA  755



>ref|XP_002452330.1| hypothetical protein SORBIDRAFT_04g023800 [Sorghum bicolor]
 gb|EES05306.1| hypothetical protein SORBIDRAFT_04g023800 [Sorghum bicolor]
Length=752

 Score =   474 bits (1220),  Expect = 3e-157, Method: Compositional matrix adjust.
 Identities = 236/274 (86%), Positives = 254/274 (93%), Gaps = 0/274 (0%)
 Frame = +2

Query  5    GLLEVFYGVYEKDPDKVLQAMVQMGVLVPTGDMTAVRRTAQFFLNSFEERLATQRREREL  184
            GLLEVFYGVYEKDPDKVLQAMVQMGVLVPTGDMTAVRRTAQFFLNSFEERLA QR+ERE+
Sbjct  479  GLLEVFYGVYEKDPDKVLQAMVQMGVLVPTGDMTAVRRTAQFFLNSFEERLAAQRKEREM  538

Query  185  AKAELGFKKPLTKEEKIEKKKQRLAAIGEDLLSIAADQPFRFPATFTFVVRAFSVLHGIG  364
            A AELGFKK LTKEEK EK+KQRLAAIGEDLL+IAADQPFRFPATFTFVVRAFSVL GIG
Sbjct  539  ATAELGFKKQLTKEEKFEKRKQRLAAIGEDLLAIAADQPFRFPATFTFVVRAFSVLDGIG  598

Query  365  KGLDPRFDITEIAKPYALELLRFREAGVEVILKDFKTRWDRQNRAFYNLFRQADRVEKLA  544
            KGLDPRFDITEIAKPYA ELLRF EAGVEV++KD K RW+RQ+RAFYNLFRQ DRVEKLA
Sbjct  599  KGLDPRFDITEIAKPYAKELLRFNEAGVEVVVKDAKKRWERQSRAFYNLFRQPDRVEKLA  658

Query  545  EIIQRLEQGDLKLRVRALESERAFQRVAAVQKTILSAVAAGSLINLATVLYLNAIRMPAM  724
            +II+RLEQG+LKLRVR LESERAFQRVAAVQKTI   VAAGSL+NLAT+LY N+IR PA 
Sbjct  659  QIIERLEQGELKLRVRTLESERAFQRVAAVQKTIGYGVAAGSLVNLATMLYFNSIRGPAT  718

Query  725  AAYGLCAFFGFQVLIGIVKVKKIDQRERLITGTA  826
             AY LCAFFG QVLIG+VKVKK+D++ERLITGTA
Sbjct  719  IAYSLCAFFGLQVLIGLVKVKKLDRQERLITGTA  752



>ref|XP_010519924.1| PREDICTED: uncharacterized aarF domain-containing protein kinase 
At1g79600, chloroplastic [Tarenaya hassleriana]
Length=766

 Score =   473 bits (1218),  Expect = 7e-157, Method: Compositional matrix adjust.
 Identities = 240/275 (87%), Positives = 259/275 (94%), Gaps = 0/275 (0%)
 Frame = +2

Query  2    EGLLEVFYGVYEKDPDKVLQAMVQMGVLVPTGDMTAVRRTAQFFLNSFEERLATQRRERE  181
            EGLLE FYGVYEKDPDKVL+AMVQMGVLVPTGDMTAVRRTAQFFLNSFEERL  QR+ERE
Sbjct  492  EGLLETFYGVYEKDPDKVLEAMVQMGVLVPTGDMTAVRRTAQFFLNSFEERLVAQRKERE  551

Query  182  LAKAELGFKKPLTKEEKIEKKKQRLAAIGEDLLSIAADQPFRFPATFTFVVRAFSVLHGI  361
            +A AELGFKKPLTKEEKIEKKKQRLAAIGEDLLSIAADQPFRFPATFTFVVRAFSVL GI
Sbjct  552  MATAELGFKKPLTKEEKIEKKKQRLAAIGEDLLSIAADQPFRFPATFTFVVRAFSVLDGI  611

Query  362  GKGLDPRFDITEIAKPYALELLRFREAGVEVILKDFKTRWDRQNRAFYNLFRQADRVEKL  541
            GKGLDPRFDITEIAKPYALELLRFREAGVEV+LKD + RW+RQ++AFYNLFRQADRVEKL
Sbjct  612  GKGLDPRFDITEIAKPYALELLRFREAGVEVVLKDLRKRWNRQSQAFYNLFRQADRVEKL  671

Query  542  AEIIQRLEQGDLKLRVRALESERAFQRVAAVQKTILSAVAAGSLINLATVLYLNAIRMPA  721
            AE IQRLEQGDLKLRVR LE+ERAFQRV AVQKT+ SAVAAGSLINLAT+LYLN++++PA
Sbjct  672  AETIQRLEQGDLKLRVRTLEAERAFQRVGAVQKTVGSAVAAGSLINLATILYLNSVKVPA  731

Query  722  MAAYGLCAFFGFQVLIGIVKVKKIDQRERLITGTA  826
              AY LCAFF  QVL+GI+KVKK+DQRE+LITGTA
Sbjct  732  TIAYTLCAFFSVQVLVGIIKVKKLDQREKLITGTA  766



>ref|XP_008643622.1| PREDICTED: LOC100281496 isoform X2 [Zea mays]
 gb|AFW71971.1| hypothetical protein ZEAMMB73_616019 [Zea mays]
Length=752

 Score =   473 bits (1216),  Expect = 9e-157, Method: Compositional matrix adjust.
 Identities = 234/275 (85%), Positives = 255/275 (93%), Gaps = 0/275 (0%)
 Frame = +2

Query  2    EGLLEVFYGVYEKDPDKVLQAMVQMGVLVPTGDMTAVRRTAQFFLNSFEERLATQRRERE  181
            EGLLEVFYGVYEKDPDKVLQAMVQMGVLVPTGDMTAVRRTAQFFLNSF+ERLA QR+ERE
Sbjct  478  EGLLEVFYGVYEKDPDKVLQAMVQMGVLVPTGDMTAVRRTAQFFLNSFQERLAAQRKERE  537

Query  182  LAKAELGFKKPLTKEEKIEKKKQRLAAIGEDLLSIAADQPFRFPATFTFVVRAFSVLHGI  361
            +A AELGFKK LTKEEK EK+KQRLAAIGEDLL+IAADQPFRFPATFTFVVRAFSVL GI
Sbjct  538  MATAELGFKKQLTKEEKFEKRKQRLAAIGEDLLAIAADQPFRFPATFTFVVRAFSVLDGI  597

Query  362  GKGLDPRFDITEIAKPYALELLRFREAGVEVILKDFKTRWDRQNRAFYNLFRQADRVEKL  541
            GKGLDPRFDITEIAKPYA ELLRF +AGVE+++KD K RW+RQ+RAFYNLFRQ DRVEKL
Sbjct  598  GKGLDPRFDITEIAKPYAKELLRFNDAGVEIVVKDAKKRWERQSRAFYNLFRQPDRVEKL  657

Query  542  AEIIQRLEQGDLKLRVRALESERAFQRVAAVQKTILSAVAAGSLINLATVLYLNAIRMPA  721
            A+II+RLEQG+LKLRVR LESERAFQRVAAVQKTI   VAAGSL+NLAT+LY N+IR PA
Sbjct  658  AQIIERLEQGELKLRVRTLESERAFQRVAAVQKTIGYGVAAGSLMNLATMLYFNSIRGPA  717

Query  722  MAAYGLCAFFGFQVLIGIVKVKKIDQRERLITGTA  826
              AY LCAFFG QVLIG+VKVKK+D++ERLITGTA
Sbjct  718  TIAYSLCAFFGLQVLIGLVKVKKLDRQERLITGTA  752



>ref|NP_001147886.1| LOC100281496 [Zea mays]
 gb|ACG29020.1| ATATH13 [Zea mays]
Length=749

 Score =   473 bits (1216),  Expect = 9e-157, Method: Compositional matrix adjust.
 Identities = 234/275 (85%), Positives = 255/275 (93%), Gaps = 0/275 (0%)
 Frame = +2

Query  2    EGLLEVFYGVYEKDPDKVLQAMVQMGVLVPTGDMTAVRRTAQFFLNSFEERLATQRRERE  181
            EGLLEVFYGVYEKDPDKVLQAMVQMGVLVPTGDMTAVRRTAQFFLNSF+ERLA QR+ERE
Sbjct  475  EGLLEVFYGVYEKDPDKVLQAMVQMGVLVPTGDMTAVRRTAQFFLNSFQERLAAQRKERE  534

Query  182  LAKAELGFKKPLTKEEKIEKKKQRLAAIGEDLLSIAADQPFRFPATFTFVVRAFSVLHGI  361
            +A AELGFKK LTKEEK EK+KQRLAAIGEDLL+IAADQPFRFPATFTFVVRAFSVL GI
Sbjct  535  MATAELGFKKQLTKEEKFEKRKQRLAAIGEDLLAIAADQPFRFPATFTFVVRAFSVLDGI  594

Query  362  GKGLDPRFDITEIAKPYALELLRFREAGVEVILKDFKTRWDRQNRAFYNLFRQADRVEKL  541
            GKGLDPRFDITEIAKPYA ELLRF +AGVE+++KD K RW+RQ+RAFYNLFRQ DRVEKL
Sbjct  595  GKGLDPRFDITEIAKPYAKELLRFNDAGVEIVVKDAKKRWERQSRAFYNLFRQPDRVEKL  654

Query  542  AEIIQRLEQGDLKLRVRALESERAFQRVAAVQKTILSAVAAGSLINLATVLYLNAIRMPA  721
            A+II+RLEQG+LKLRVR LESERAFQRVAAVQKTI   VAAGSL+NLAT+LY N+IR PA
Sbjct  655  AQIIERLEQGELKLRVRTLESERAFQRVAAVQKTIGYGVAAGSLMNLATMLYFNSIRGPA  714

Query  722  MAAYGLCAFFGFQVLIGIVKVKKIDQRERLITGTA  826
              AY LCAFFG QVLIG+VKVKK+D++ERLITGTA
Sbjct  715  TIAYSLCAFFGLQVLIGLVKVKKLDRQERLITGTA  749



>gb|AFW71972.1| ABC1 protein [Zea mays]
Length=749

 Score =   473 bits (1216),  Expect = 1e-156, Method: Compositional matrix adjust.
 Identities = 234/275 (85%), Positives = 255/275 (93%), Gaps = 0/275 (0%)
 Frame = +2

Query  2    EGLLEVFYGVYEKDPDKVLQAMVQMGVLVPTGDMTAVRRTAQFFLNSFEERLATQRRERE  181
            EGLLEVFYGVYEKDPDKVLQAMVQMGVLVPTGDMTAVRRTAQFFLNSF+ERLA QR+ERE
Sbjct  475  EGLLEVFYGVYEKDPDKVLQAMVQMGVLVPTGDMTAVRRTAQFFLNSFQERLAAQRKERE  534

Query  182  LAKAELGFKKPLTKEEKIEKKKQRLAAIGEDLLSIAADQPFRFPATFTFVVRAFSVLHGI  361
            +A AELGFKK LTKEEK EK+KQRLAAIGEDLL+IAADQPFRFPATFTFVVRAFSVL GI
Sbjct  535  MATAELGFKKQLTKEEKFEKRKQRLAAIGEDLLAIAADQPFRFPATFTFVVRAFSVLDGI  594

Query  362  GKGLDPRFDITEIAKPYALELLRFREAGVEVILKDFKTRWDRQNRAFYNLFRQADRVEKL  541
            GKGLDPRFDITEIAKPYA ELLRF +AGVE+++KD K RW+RQ+RAFYNLFRQ DRVEKL
Sbjct  595  GKGLDPRFDITEIAKPYAKELLRFNDAGVEIVVKDAKKRWERQSRAFYNLFRQPDRVEKL  654

Query  542  AEIIQRLEQGDLKLRVRALESERAFQRVAAVQKTILSAVAAGSLINLATVLYLNAIRMPA  721
            A+II+RLEQG+LKLRVR LESERAFQRVAAVQKTI   VAAGSL+NLAT+LY N+IR PA
Sbjct  655  AQIIERLEQGELKLRVRTLESERAFQRVAAVQKTIGYGVAAGSLMNLATMLYFNSIRGPA  714

Query  722  MAAYGLCAFFGFQVLIGIVKVKKIDQRERLITGTA  826
              AY LCAFFG QVLIG+VKVKK+D++ERLITGTA
Sbjct  715  TIAYSLCAFFGLQVLIGLVKVKKLDRQERLITGTA  749



>gb|ACG29222.1| ATATH13 [Zea mays]
Length=749

 Score =   473 bits (1216),  Expect = 1e-156, Method: Compositional matrix adjust.
 Identities = 234/275 (85%), Positives = 255/275 (93%), Gaps = 0/275 (0%)
 Frame = +2

Query  2    EGLLEVFYGVYEKDPDKVLQAMVQMGVLVPTGDMTAVRRTAQFFLNSFEERLATQRRERE  181
            EGLLEVFYGVYEKDPDKVLQAMVQMGVLVPTGDMTAVRRTAQFFLNSF+ERLA QR+ERE
Sbjct  475  EGLLEVFYGVYEKDPDKVLQAMVQMGVLVPTGDMTAVRRTAQFFLNSFQERLAAQRKERE  534

Query  182  LAKAELGFKKPLTKEEKIEKKKQRLAAIGEDLLSIAADQPFRFPATFTFVVRAFSVLHGI  361
            +A AELGFKK LTKEEK EK+KQRLAAIGEDLL+IAADQPFRFPATFTFVVRAFSVL GI
Sbjct  535  MATAELGFKKQLTKEEKFEKRKQRLAAIGEDLLAIAADQPFRFPATFTFVVRAFSVLDGI  594

Query  362  GKGLDPRFDITEIAKPYALELLRFREAGVEVILKDFKTRWDRQNRAFYNLFRQADRVEKL  541
            GKGLDPRFDITEIAKPYA ELLRF +AGVE+++KD K RW+RQ+RAFYNLFRQ DRVEKL
Sbjct  595  GKGLDPRFDITEIAKPYAKELLRFNDAGVEIVVKDAKKRWERQSRAFYNLFRQPDRVEKL  654

Query  542  AEIIQRLEQGDLKLRVRALESERAFQRVAAVQKTILSAVAAGSLINLATVLYLNAIRMPA  721
            A+II+RLEQG+LKLRVR LESERAFQRVAAVQKTI   VAAGSL+NLAT+LY N+IR PA
Sbjct  655  AQIIERLEQGELKLRVRTLESERAFQRVAAVQKTIGYGVAAGSLMNLATMLYFNSIRGPA  714

Query  722  MAAYGLCAFFGFQVLIGIVKVKKIDQRERLITGTA  826
              AY LCAFFG QVLIG+VKVKK+D++ERLITGTA
Sbjct  715  TIAYSLCAFFGLQVLIGLVKVKKLDRQERLITGTA  749



>gb|ADB13188.1| ABC1 protein [Zea mays]
Length=749

 Score =   473 bits (1216),  Expect = 1e-156, Method: Compositional matrix adjust.
 Identities = 234/275 (85%), Positives = 255/275 (93%), Gaps = 0/275 (0%)
 Frame = +2

Query  2    EGLLEVFYGVYEKDPDKVLQAMVQMGVLVPTGDMTAVRRTAQFFLNSFEERLATQRRERE  181
            EGLLEVFYGVYEKDPDKVLQAMVQMGVLVPTGDMTAVRRTAQFFLNSF+ERLA QR+ERE
Sbjct  475  EGLLEVFYGVYEKDPDKVLQAMVQMGVLVPTGDMTAVRRTAQFFLNSFQERLAAQRKERE  534

Query  182  LAKAELGFKKPLTKEEKIEKKKQRLAAIGEDLLSIAADQPFRFPATFTFVVRAFSVLHGI  361
            +A AELGFKK LTKEEK EK+KQRLAAIGEDLL+IAADQPFRFPATFTFVVRAFSVL GI
Sbjct  535  MATAELGFKKQLTKEEKFEKRKQRLAAIGEDLLAIAADQPFRFPATFTFVVRAFSVLDGI  594

Query  362  GKGLDPRFDITEIAKPYALELLRFREAGVEVILKDFKTRWDRQNRAFYNLFRQADRVEKL  541
            GKGLDPRFDITEIAKPYA ELLRF +AGVE+++KD K RW+RQ+RAFYNLFRQ DRVEKL
Sbjct  595  GKGLDPRFDITEIAKPYAKELLRFNDAGVEIVVKDAKKRWERQSRAFYNLFRQPDRVEKL  654

Query  542  AEIIQRLEQGDLKLRVRALESERAFQRVAAVQKTILSAVAAGSLINLATVLYLNAIRMPA  721
            A+II+RLEQG+LKLRVR LESERAFQRVAAVQKTI   VAAGSL+NLAT+LY N+IR PA
Sbjct  655  AQIIERLEQGELKLRVRTLESERAFQRVAAVQKTIGYGVAAGSLMNLATMLYFNSIRGPA  714

Query  722  MAAYGLCAFFGFQVLIGIVKVKKIDQRERLITGTA  826
              AY LCAFFG QVLIG+VKVKK+D++ERLITGTA
Sbjct  715  TIAYSLCAFFGLQVLIGLVKVKKLDRQERLITGTA  749



>ref|XP_002307123.2| hypothetical protein POPTR_0005s08490g [Populus trichocarpa]
 ref|XP_006382919.1| hypothetical protein POPTR_0005s08490g [Populus trichocarpa]
 ref|XP_006382921.1| hypothetical protein POPTR_0005s08490g [Populus trichocarpa]
 ref|XP_006382923.1| hypothetical protein POPTR_0005s08490g [Populus trichocarpa]
 ref|XP_006382924.1| hypothetical protein POPTR_0005s08490g [Populus trichocarpa]
 gb|EEE94119.2| hypothetical protein POPTR_0005s08490g [Populus trichocarpa]
 gb|ERP60716.1| hypothetical protein POPTR_0005s08490g [Populus trichocarpa]
 gb|ERP60718.1| hypothetical protein POPTR_0005s08490g [Populus trichocarpa]
 gb|ERP60720.1| hypothetical protein POPTR_0005s08490g [Populus trichocarpa]
 gb|ERP60721.1| hypothetical protein POPTR_0005s08490g [Populus trichocarpa]
Length=764

 Score =   473 bits (1217),  Expect = 1e-156, Method: Compositional matrix adjust.
 Identities = 242/275 (88%), Positives = 260/275 (95%), Gaps = 0/275 (0%)
 Frame = +2

Query  2    EGLLEVFYGVYEKDPDKVLQAMVQMGVLVPTGDMTAVRRTAQFFLNSFEERLATQRRERE  181
            EGLLE FYGVYEKDPDKVL+AMVQMGVLVPTGDMTAVRRTAQFFLNSFEERLA QRRERE
Sbjct  490  EGLLETFYGVYEKDPDKVLEAMVQMGVLVPTGDMTAVRRTAQFFLNSFEERLAAQRRERE  549

Query  182  LAKAELGFKKPLTKEEKIEKKKQRLAAIGEDLLSIAADQPFRFPATFTFVVRAFSVLHGI  361
            +A  ELGFKK LTKEEK+EKKKQRLAAIGEDLLSIAADQPFRFPATFTFVVRAFSVL GI
Sbjct  550  MATTELGFKKQLTKEEKMEKKKQRLAAIGEDLLSIAADQPFRFPATFTFVVRAFSVLDGI  609

Query  362  GKGLDPRFDITEIAKPYALELLRFREAGVEVILKDFKTRWDRQNRAFYNLFRQADRVEKL  541
            GKGLDPRFDITEIAKPYALELLRFREAGVEV+LKDF+ RWDRQ+RAF+NLFRQADRV+KL
Sbjct  610  GKGLDPRFDITEIAKPYALELLRFREAGVEVLLKDFRKRWDRQSRAFHNLFRQADRVQKL  669

Query  542  AEIIQRLEQGDLKLRVRALESERAFQRVAAVQKTILSAVAAGSLINLATVLYLNAIRMPA  721
            AE IQRLEQGDLKLRVR LE+ERAFQRVAAVQKT+ SAVAAGSLINLAT+L+LN+IR+PA
Sbjct  670  AETIQRLEQGDLKLRVRTLEAERAFQRVAAVQKTVGSAVAAGSLINLATILFLNSIRVPA  729

Query  722  MAAYGLCAFFGFQVLIGIVKVKKIDQRERLITGTA  826
             AA  LCAFF FQVL GI+KVK++DQ+ERLITGTA
Sbjct  730  TAASILCAFFSFQVLFGIIKVKRLDQQERLITGTA  764



>ref|XP_008643621.1| PREDICTED: LOC100281496 isoform X1 [Zea mays]
Length=780

 Score =   473 bits (1217),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 234/275 (85%), Positives = 255/275 (93%), Gaps = 0/275 (0%)
 Frame = +2

Query  2    EGLLEVFYGVYEKDPDKVLQAMVQMGVLVPTGDMTAVRRTAQFFLNSFEERLATQRRERE  181
            EGLLEVFYGVYEKDPDKVLQAMVQMGVLVPTGDMTAVRRTAQFFLNSF+ERLA QR+ERE
Sbjct  506  EGLLEVFYGVYEKDPDKVLQAMVQMGVLVPTGDMTAVRRTAQFFLNSFQERLAAQRKERE  565

Query  182  LAKAELGFKKPLTKEEKIEKKKQRLAAIGEDLLSIAADQPFRFPATFTFVVRAFSVLHGI  361
            +A AELGFKK LTKEEK EK+KQRLAAIGEDLL+IAADQPFRFPATFTFVVRAFSVL GI
Sbjct  566  MATAELGFKKQLTKEEKFEKRKQRLAAIGEDLLAIAADQPFRFPATFTFVVRAFSVLDGI  625

Query  362  GKGLDPRFDITEIAKPYALELLRFREAGVEVILKDFKTRWDRQNRAFYNLFRQADRVEKL  541
            GKGLDPRFDITEIAKPYA ELLRF +AGVE+++KD K RW+RQ+RAFYNLFRQ DRVEKL
Sbjct  626  GKGLDPRFDITEIAKPYAKELLRFNDAGVEIVVKDAKKRWERQSRAFYNLFRQPDRVEKL  685

Query  542  AEIIQRLEQGDLKLRVRALESERAFQRVAAVQKTILSAVAAGSLINLATVLYLNAIRMPA  721
            A+II+RLEQG+LKLRVR LESERAFQRVAAVQKTI   VAAGSL+NLAT+LY N+IR PA
Sbjct  686  AQIIERLEQGELKLRVRTLESERAFQRVAAVQKTIGYGVAAGSLMNLATMLYFNSIRGPA  745

Query  722  MAAYGLCAFFGFQVLIGIVKVKKIDQRERLITGTA  826
              AY LCAFFG QVLIG+VKVKK+D++ERLITGTA
Sbjct  746  TIAYSLCAFFGLQVLIGLVKVKKLDRQERLITGTA  780



>ref|XP_006428063.1| hypothetical protein CICLE_v10024947mg [Citrus clementina]
 ref|XP_006493858.1| PREDICTED: uncharacterized aarF domain-containing protein kinase 
At1g79600, chloroplastic-like [Citrus sinensis]
 gb|ESR41303.1| hypothetical protein CICLE_v10024947mg [Citrus clementina]
Length=766

 Score =   473 bits (1216),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 242/275 (88%), Positives = 258/275 (94%), Gaps = 0/275 (0%)
 Frame = +2

Query  2    EGLLEVFYGVYEKDPDKVLQAMVQMGVLVPTGDMTAVRRTAQFFLNSFEERLATQRRERE  181
            EGLLE FYGVYEKD DKVLQAMVQMGVLVPTGD TAVRRTAQFFLNSFEERLA QR+ERE
Sbjct  492  EGLLETFYGVYEKDADKVLQAMVQMGVLVPTGDTTAVRRTAQFFLNSFEERLAAQRKERE  551

Query  182  LAKAELGFKKPLTKEEKIEKKKQRLAAIGEDLLSIAADQPFRFPATFTFVVRAFSVLHGI  361
            +   ELGFKKPL+KEEKIEKKKQRLAAIGEDLL+IAADQPFRFPATFTFVVRAFSVL GI
Sbjct  552  ITTQELGFKKPLSKEEKIEKKKQRLAAIGEDLLAIAADQPFRFPATFTFVVRAFSVLDGI  611

Query  362  GKGLDPRFDITEIAKPYALELLRFREAGVEVILKDFKTRWDRQNRAFYNLFRQADRVEKL  541
            GKGLDPRFDITEIAKPYA+ELL+FREAGVEVILKDF+ RWDRQ RAFYNLFRQADRVEKL
Sbjct  612  GKGLDPRFDITEIAKPYAMELLKFREAGVEVILKDFRNRWDRQTRAFYNLFRQADRVEKL  671

Query  542  AEIIQRLEQGDLKLRVRALESERAFQRVAAVQKTILSAVAAGSLINLATVLYLNAIRMPA  721
            AE IQRLEQGDLKLRVR LESERAFQRVAAVQKT+ SAVAAGSL+NLAT+LYLN+IR+PA
Sbjct  672  AETIQRLEQGDLKLRVRTLESERAFQRVAAVQKTVGSAVAAGSLVNLATILYLNSIRVPA  731

Query  722  MAAYGLCAFFGFQVLIGIVKVKKIDQRERLITGTA  826
            + AY  CAFFGFQVL GI+KVKK+DQRE+LITGTA
Sbjct  732  ILAYVSCAFFGFQVLFGIIKVKKLDQREKLITGTA  766



>ref|XP_007208067.1| hypothetical protein PRUPE_ppa001814mg [Prunus persica]
 gb|EMJ09266.1| hypothetical protein PRUPE_ppa001814mg [Prunus persica]
Length=761

 Score =   472 bits (1214),  Expect = 3e-156, Method: Compositional matrix adjust.
 Identities = 240/275 (87%), Positives = 260/275 (95%), Gaps = 0/275 (0%)
 Frame = +2

Query  2    EGLLEVFYGVYEKDPDKVLQAMVQMGVLVPTGDMTAVRRTAQFFLNSFEERLATQRRERE  181
            EGLLE FYGVYEKDPDKVLQAM+QMGVLVPTGDMTAVRRTA FFLNSFEERLA QR+E+E
Sbjct  487  EGLLETFYGVYEKDPDKVLQAMIQMGVLVPTGDMTAVRRTALFFLNSFEERLAAQRKEKE  546

Query  182  LAKAELGFKKPLTKEEKIEKKKQRLAAIGEDLLSIAADQPFRFPATFTFVVRAFSVLHGI  361
            +A AELGFKKPL+KEE+IEKKK+RLAAIGEDLL+IAADQPFRFPATFTFVVRAFSVL GI
Sbjct  547  MATAELGFKKPLSKEERIEKKKERLAAIGEDLLAIAADQPFRFPATFTFVVRAFSVLDGI  606

Query  362  GKGLDPRFDITEIAKPYALELLRFREAGVEVILKDFKTRWDRQNRAFYNLFRQADRVEKL  541
            GKGLDPRFDITEIAKPYALELL+FREAGVEV+LKD + RWDRQ+RAFYNLFRQADRVEKL
Sbjct  607  GKGLDPRFDITEIAKPYALELLKFREAGVEVVLKDLRNRWDRQSRAFYNLFRQADRVEKL  666

Query  542  AEIIQRLEQGDLKLRVRALESERAFQRVAAVQKTILSAVAAGSLINLATVLYLNAIRMPA  721
            AEIIQRLEQGDLKLRVR LESERAFQRVA VQKT+ +AVAAGSLINLAT+LY+N+IR PA
Sbjct  667  AEIIQRLEQGDLKLRVRTLESERAFQRVATVQKTVGNAVAAGSLINLATILYINSIRFPA  726

Query  722  MAAYGLCAFFGFQVLIGIVKVKKIDQRERLITGTA  826
            + AY LCAFFG QVLIGI+KVKK D+RERLITGTA
Sbjct  727  IVAYVLCAFFGLQVLIGIIKVKKFDERERLITGTA  761



>ref|XP_003525072.1| PREDICTED: uncharacterized aarF domain-containing protein kinase 
At1g79600, chloroplastic-like [Glycine max]
Length=756

 Score =   471 bits (1213),  Expect = 3e-156, Method: Compositional matrix adjust.
 Identities = 236/275 (86%), Positives = 260/275 (95%), Gaps = 0/275 (0%)
 Frame = +2

Query  2    EGLLEVFYGVYEKDPDKVLQAMVQMGVLVPTGDMTAVRRTAQFFLNSFEERLATQRRERE  181
            EGLLE FYG+YEK+PDKVLQ+M+QMGVLVPTGDMTAV+RTAQFFLNSFEERLA QRRERE
Sbjct  482  EGLLEAFYGIYEKNPDKVLQSMIQMGVLVPTGDMTAVKRTAQFFLNSFEERLAAQRRERE  541

Query  182  LAKAELGFKKPLTKEEKIEKKKQRLAAIGEDLLSIAADQPFRFPATFTFVVRAFSVLHGI  361
            +A AELGFK+PL+KEEK+ KKK+RLAAIGEDLL+IAADQPFRFPATFTFVVRAFSVL GI
Sbjct  542  MATAELGFKQPLSKEEKVMKKKERLAAIGEDLLAIAADQPFRFPATFTFVVRAFSVLDGI  601

Query  362  GKGLDPRFDITEIAKPYALELLRFREAGVEVILKDFKTRWDRQNRAFYNLFRQADRVEKL  541
            GKGLDPRFDITEIAKPYALELLRFREAGVEVILKDF+ RWDRQ++AFYNLFRQADRVEKL
Sbjct  602  GKGLDPRFDITEIAKPYALELLRFREAGVEVILKDFRKRWDRQSQAFYNLFRQADRVEKL  661

Query  542  AEIIQRLEQGDLKLRVRALESERAFQRVAAVQKTILSAVAAGSLINLATVLYLNAIRMPA  721
            AEIIQRLEQGDLKLRVR LESERAFQR+A VQKTI +A+A+GSLINLAT+LYLN+IR+PA
Sbjct  662  AEIIQRLEQGDLKLRVRTLESERAFQRIATVQKTIGNAIASGSLINLATILYLNSIRVPA  721

Query  722  MAAYGLCAFFGFQVLIGIVKVKKIDQRERLITGTA  826
              AY  CA FGFQVL GIVK+KK+D+RERLITGTA
Sbjct  722  TIAYVFCAIFGFQVLFGIVKIKKLDERERLITGTA  756



>ref|XP_008392537.1| PREDICTED: uncharacterized aarF domain-containing protein kinase 
At1g79600, chloroplastic-like [Malus domestica]
Length=764

 Score =   471 bits (1213),  Expect = 4e-156, Method: Compositional matrix adjust.
 Identities = 240/275 (87%), Positives = 259/275 (94%), Gaps = 0/275 (0%)
 Frame = +2

Query  2    EGLLEVFYGVYEKDPDKVLQAMVQMGVLVPTGDMTAVRRTAQFFLNSFEERLATQRRERE  181
            EGLLE FYGVYEKDPDKVLQAMVQMGVLVPTGDMTAVRRTA FFLNSFEERLA QR+E+E
Sbjct  490  EGLLETFYGVYEKDPDKVLQAMVQMGVLVPTGDMTAVRRTALFFLNSFEERLAAQRKEKE  549

Query  182  LAKAELGFKKPLTKEEKIEKKKQRLAAIGEDLLSIAADQPFRFPATFTFVVRAFSVLHGI  361
            LA AELGFKKPL+KEEKI KKK+RLAAIGEDLL+IAADQPFRFPATFTFVVRAFSVL GI
Sbjct  550  LATAELGFKKPLSKEEKIMKKKERLAAIGEDLLAIAADQPFRFPATFTFVVRAFSVLDGI  609

Query  362  GKGLDPRFDITEIAKPYALELLRFREAGVEVILKDFKTRWDRQNRAFYNLFRQADRVEKL  541
            GKGLDPRFDITEIAKPYALELL+FREAGVEVI+KD + RWDRQ+RAFYNLFRQADRVEKL
Sbjct  610  GKGLDPRFDITEIAKPYALELLKFREAGVEVIIKDLRNRWDRQSRAFYNLFRQADRVEKL  669

Query  542  AEIIQRLEQGDLKLRVRALESERAFQRVAAVQKTILSAVAAGSLINLATVLYLNAIRMPA  721
            AEIIQRLEQGDLKLRVR LESERAFQRVA VQKT+ +AVAAGSLINLAT+LY+N+IR+PA
Sbjct  670  AEIIQRLEQGDLKLRVRTLESERAFQRVATVQKTVGNAVAAGSLINLATILYINSIRVPA  729

Query  722  MAAYGLCAFFGFQVLIGIVKVKKIDQRERLITGTA  826
            +AAY  CAFF  QVLIG++KVKK D+RERLITGTA
Sbjct  730  IAAYVFCAFFSLQVLIGLIKVKKFDERERLITGTA  764



>ref|XP_010099897.1| hypothetical protein L484_020081 [Morus notabilis]
 gb|EXB80826.1| hypothetical protein L484_020081 [Morus notabilis]
Length=766

 Score =   471 bits (1211),  Expect = 7e-156, Method: Compositional matrix adjust.
 Identities = 238/275 (87%), Positives = 260/275 (95%), Gaps = 0/275 (0%)
 Frame = +2

Query  2    EGLLEVFYGVYEKDPDKVLQAMVQMGVLVPTGDMTAVRRTAQFFLNSFEERLATQRRERE  181
            EGLLEVFYGVYEKDPDKVLQAM+QMGVLVPTGDMTAVRRTA FFLNSFEERLA QR ERE
Sbjct  492  EGLLEVFYGVYEKDPDKVLQAMIQMGVLVPTGDMTAVRRTALFFLNSFEERLAAQREERE  551

Query  182  LAKAELGFKKPLTKEEKIEKKKQRLAAIGEDLLSIAADQPFRFPATFTFVVRAFSVLHGI  361
            +A  ELGFK+PLTKEEK  KKK+RLAAIGEDLL+IAADQPFRFPATFTFVVRAFSVL GI
Sbjct  552  MATTELGFKRPLTKEEKTMKKKERLAAIGEDLLAIAADQPFRFPATFTFVVRAFSVLDGI  611

Query  362  GKGLDPRFDITEIAKPYALELLRFREAGVEVILKDFKTRWDRQNRAFYNLFRQADRVEKL  541
            GKGLDPRFDITEIAKPYALELL+FREAG+EVILKD + RWDRQ++AFYNLFRQADRV KL
Sbjct  612  GKGLDPRFDITEIAKPYALELLKFREAGIEVILKDVRKRWDRQSQAFYNLFRQADRVAKL  671

Query  542  AEIIQRLEQGDLKLRVRALESERAFQRVAAVQKTILSAVAAGSLINLATVLYLNAIRMPA  721
            AEIIQRLEQGDLKLRVRALESERAFQRVA VQKTI +AVAAGSL+NLAT+LY+N+IR+PA
Sbjct  672  AEIIQRLEQGDLKLRVRALESERAFQRVATVQKTIGNAVAAGSLVNLATILYINSIRVPA  731

Query  722  MAAYGLCAFFGFQVLIGIVKVKKIDQRERLITGTA  826
            + AY +CAFFGFQVLIG++KVKK+D+RERLITGTA
Sbjct  732  IGAYTICAFFGFQVLIGLIKVKKLDERERLITGTA  766



>emb|CBI21492.3| unnamed protein product [Vitis vinifera]
Length=745

 Score =   469 bits (1207),  Expect = 2e-155, Method: Compositional matrix adjust.
 Identities = 242/275 (88%), Positives = 260/275 (95%), Gaps = 4/275 (1%)
 Frame = +2

Query  2    EGLLEVFYGVYEKDPDKVLQAMVQMGVLVPTGDMTAVRRTAQFFLNSFEERLATQRRERE  181
            EGLLE FYG+YEKDPDKV+QAM+QMGVLVPTGDMTAVRRTAQFFLNSFEERLA QR+ERE
Sbjct  475  EGLLESFYGIYEKDPDKVVQAMIQMGVLVPTGDMTAVRRTAQFFLNSFEERLAAQRKERE  534

Query  182  LAKAELGFKKPLTKEEKIEKKKQRLAAIGEDLLSIAADQPFRFPATFTFVVRAFSVLHGI  361
            +A  ELGFKKPL+KEEKIEKKKQRLAAIGEDLL+IAADQPFRFPATFTFVVRAFSVL GI
Sbjct  535  MATQELGFKKPLSKEEKIEKKKQRLAAIGEDLLAIAADQPFRFPATFTFVVRAFSVLDGI  594

Query  362  GKGLDPRFDITEIAKPYALELLRFREAGVEVILKDFKTRWDRQNRAFYNLFRQADRVEKL  541
            GKGLDPRFDITEIAKPYALELL+FREAGVE    DF+ RWDRQ RAFYNLFRQADRVEKL
Sbjct  595  GKGLDPRFDITEIAKPYALELLKFREAGVE----DFRKRWDRQARAFYNLFRQADRVEKL  650

Query  542  AEIIQRLEQGDLKLRVRALESERAFQRVAAVQKTILSAVAAGSLINLATVLYLNAIRMPA  721
            AEIIQRLE+GDLKLRVRALESERAFQRVAAVQKT+ +AVAAGSLINLAT+LYLN+IR+PA
Sbjct  651  AEIIQRLEKGDLKLRVRALESERAFQRVAAVQKTVGNAVAAGSLINLATILYLNSIRVPA  710

Query  722  MAAYGLCAFFGFQVLIGIVKVKKIDQRERLITGTA  826
            +AAY  CAFFGFQVL GI+KVKK+DQRERLITGTA
Sbjct  711  IAAYVFCAFFGFQVLFGIIKVKKLDQRERLITGTA  745



>ref|XP_004302218.1| PREDICTED: uncharacterized aarF domain-containing protein kinase 
At4g31390, chloroplastic [Fragaria vesca subsp. vesca]
Length=750

 Score =   468 bits (1203),  Expect = 9e-155, Method: Compositional matrix adjust.
 Identities = 238/275 (87%), Positives = 258/275 (94%), Gaps = 0/275 (0%)
 Frame = +2

Query  2    EGLLEVFYGVYEKDPDKVLQAMVQMGVLVPTGDMTAVRRTAQFFLNSFEERLATQRRERE  181
            EGLLE FYGVYEKDPDKVLQAM+QMGVLVPTGDMTAVRRTAQFFL SFEERLA QR+ERE
Sbjct  476  EGLLETFYGVYEKDPDKVLQAMIQMGVLVPTGDMTAVRRTAQFFLRSFEERLAAQRKERE  535

Query  182  LAKAELGFKKPLTKEEKIEKKKQRLAAIGEDLLSIAADQPFRFPATFTFVVRAFSVLHGI  361
            +A  ELGFKKPL+KEEKI KKK+RLAAIGEDLL+IAADQPFRFPATFTFVVRAFSVL GI
Sbjct  536  MATKELGFKKPLSKEEKIMKKKERLAAIGEDLLAIAADQPFRFPATFTFVVRAFSVLDGI  595

Query  362  GKGLDPRFDITEIAKPYALELLRFREAGVEVILKDFKTRWDRQNRAFYNLFRQADRVEKL  541
            GKGLDPRFDITEIAKPYALELL+FREAGVEV+ KD + RWDRQ++AFYNLFRQADRVEKL
Sbjct  596  GKGLDPRFDITEIAKPYALELLKFREAGVEVVWKDIRKRWDRQSQAFYNLFRQADRVEKL  655

Query  542  AEIIQRLEQGDLKLRVRALESERAFQRVAAVQKTILSAVAAGSLINLATVLYLNAIRMPA  721
            AEIIQRLEQGDLKLRVR LESERAFQRVA VQKT+ +AVAAGSLINLAT+LY+N+IR+PA
Sbjct  656  AEIIQRLEQGDLKLRVRTLESERAFQRVATVQKTVGNAVAAGSLINLATLLYINSIRVPA  715

Query  722  MAAYGLCAFFGFQVLIGIVKVKKIDQRERLITGTA  826
            +AAY  CAFFG QVLIGI+KVKK D+RERLITGTA
Sbjct  716  IAAYISCAFFGVQVLIGIIKVKKFDERERLITGTA  750



>gb|KHN38216.1| Hypothetical protein glysoja_003881 [Glycine soja]
Length=757

 Score =   467 bits (1201),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 236/276 (86%), Positives = 260/276 (94%), Gaps = 1/276 (0%)
 Frame = +2

Query  2    EGLLEVFYGVYEKDPDKVLQAMVQMGVLVPTGDMTAVRRTAQFFLNSFEERLATQRRERE  181
            EGLLE FYG+YEK+PDKVLQ+M+QMGVLVPTGDMTAV+RTAQFFLNSFEERLA QRRERE
Sbjct  482  EGLLEAFYGIYEKNPDKVLQSMIQMGVLVPTGDMTAVKRTAQFFLNSFEERLAAQRRERE  541

Query  182  LAKAELGFKKPLTKEEKIEKKKQRLAAIGEDLLSIAADQPFRFPATFTFVVRAFSVLHGI  361
            +A AELGFK+PL+KEEK+ KKK+RLAAIGEDLL+IAADQPFRFPATFTFVVRAFSVL GI
Sbjct  542  MATAELGFKQPLSKEEKVMKKKERLAAIGEDLLAIAADQPFRFPATFTFVVRAFSVLDGI  601

Query  362  GKGLDPRFDITEIAKPYALELLRFREAGVEVILK-DFKTRWDRQNRAFYNLFRQADRVEK  538
            GKGLDPRFDITEIAKPYALELLRFREAGVEVILK DF+ RWDRQ++AFYNLFRQADRVEK
Sbjct  602  GKGLDPRFDITEIAKPYALELLRFREAGVEVILKADFRKRWDRQSQAFYNLFRQADRVEK  661

Query  539  LAEIIQRLEQGDLKLRVRALESERAFQRVAAVQKTILSAVAAGSLINLATVLYLNAIRMP  718
            LAEIIQRLEQGDLKLRVR LESERAFQR+A VQKTI +A+A+GSLINLAT+LYLN+IR+P
Sbjct  662  LAEIIQRLEQGDLKLRVRTLESERAFQRIATVQKTIGNAIASGSLINLATILYLNSIRVP  721

Query  719  AMAAYGLCAFFGFQVLIGIVKVKKIDQRERLITGTA  826
            A  AY  CA FGFQVL GIVK+KK+D+RERLITGTA
Sbjct  722  ATIAYVFCAIFGFQVLFGIVKIKKLDERERLITGTA  757



>ref|XP_008233504.1| PREDICTED: uncharacterized aarF domain-containing protein kinase 
At1g79600, chloroplastic [Prunus mume]
Length=761

 Score =   466 bits (1200),  Expect = 3e-154, Method: Compositional matrix adjust.
 Identities = 238/275 (87%), Positives = 258/275 (94%), Gaps = 0/275 (0%)
 Frame = +2

Query  2    EGLLEVFYGVYEKDPDKVLQAMVQMGVLVPTGDMTAVRRTAQFFLNSFEERLATQRRERE  181
            EGLLE FYGVYEKDPDKVLQAM+QMGVLVPTGDMTAVRRTA FFLNS+ ERLA QR+E+E
Sbjct  487  EGLLETFYGVYEKDPDKVLQAMIQMGVLVPTGDMTAVRRTALFFLNSYGERLAAQRKEKE  546

Query  182  LAKAELGFKKPLTKEEKIEKKKQRLAAIGEDLLSIAADQPFRFPATFTFVVRAFSVLHGI  361
            +A AELGFKKPL+KEE+IEKKK+RLAAIGEDLL+IAADQPFRFPATFTFVVRAFSVL GI
Sbjct  547  MATAELGFKKPLSKEERIEKKKERLAAIGEDLLAIAADQPFRFPATFTFVVRAFSVLDGI  606

Query  362  GKGLDPRFDITEIAKPYALELLRFREAGVEVILKDFKTRWDRQNRAFYNLFRQADRVEKL  541
            GKGLDPRFDITEIAKPYALELL+FREAGVEVILKD + RWDRQ+RAFYNLFRQADRVEKL
Sbjct  607  GKGLDPRFDITEIAKPYALELLKFREAGVEVILKDLRNRWDRQSRAFYNLFRQADRVEKL  666

Query  542  AEIIQRLEQGDLKLRVRALESERAFQRVAAVQKTILSAVAAGSLINLATVLYLNAIRMPA  721
            AEIIQRLEQGDLKLRVR LESERAFQRVA VQKT+ +AVAAGSLINLAT+LY+N+IR PA
Sbjct  667  AEIIQRLEQGDLKLRVRTLESERAFQRVATVQKTVGNAVAAGSLINLATILYINSIRFPA  726

Query  722  MAAYGLCAFFGFQVLIGIVKVKKIDQRERLITGTA  826
            + AY  CAFFG QVLIGI+KVKK D+RERLITGTA
Sbjct  727  IVAYVFCAFFGLQVLIGIIKVKKFDERERLITGTA  761



>ref|XP_004504029.1| PREDICTED: uncharacterized protein sll1770-like isoform X1 [Cicer 
arietinum]
 ref|XP_004504030.1| PREDICTED: uncharacterized protein sll1770-like isoform X2 [Cicer 
arietinum]
Length=753

 Score =   466 bits (1200),  Expect = 3e-154, Method: Compositional matrix adjust.
 Identities = 239/275 (87%), Positives = 256/275 (93%), Gaps = 0/275 (0%)
 Frame = +2

Query  2    EGLLEVFYGVYEKDPDKVLQAMVQMGVLVPTGDMTAVRRTAQFFLNSFEERLATQRRERE  181
            EGLLE FYG+YEK PDKVLQAM+QMGVLVPTGDMTAV+RTAQFFLNSFEERLA QRRERE
Sbjct  479  EGLLEAFYGIYEKSPDKVLQAMIQMGVLVPTGDMTAVKRTAQFFLNSFEERLAAQRRERE  538

Query  182  LAKAELGFKKPLTKEEKIEKKKQRLAAIGEDLLSIAADQPFRFPATFTFVVRAFSVLHGI  361
            L  AE GFKKPL+KEEK+ KKK+RLAAIGEDLL+IAADQPFRFPATFTFVVRAFSVL GI
Sbjct  539  LEAAEDGFKKPLSKEEKVMKKKERLAAIGEDLLAIAADQPFRFPATFTFVVRAFSVLDGI  598

Query  362  GKGLDPRFDITEIAKPYALELLRFREAGVEVILKDFKTRWDRQNRAFYNLFRQADRVEKL  541
            GKGLD RFDITEIAKPYALELLRFREAGVEVI+KDF+ RWDRQ++AFYNLFRQADRVEKL
Sbjct  599  GKGLDTRFDITEIAKPYALELLRFREAGVEVIIKDFRKRWDRQSQAFYNLFRQADRVEKL  658

Query  542  AEIIQRLEQGDLKLRVRALESERAFQRVAAVQKTILSAVAAGSLINLATVLYLNAIRMPA  721
            A +IQRLEQGDLKLRVRALESERAFQRVAAVQKTI +AVAAGSLINLAT+LYLN+IR PA
Sbjct  659  ANVIQRLEQGDLKLRVRALESERAFQRVAAVQKTIGNAVAAGSLINLATILYLNSIRGPA  718

Query  722  MAAYGLCAFFGFQVLIGIVKVKKIDQRERLITGTA  826
              AY  CA FGFQVL GIVKVKK+D+RERLITGTA
Sbjct  719  TIAYFFCAIFGFQVLFGIVKVKKLDERERLITGTA  753



>ref|XP_003575213.1| PREDICTED: uncharacterized aarF domain-containing protein kinase 
At1g79600, chloroplastic [Brachypodium distachyon]
Length=755

 Score =   464 bits (1195),  Expect = 1e-153, Method: Compositional matrix adjust.
 Identities = 236/275 (86%), Positives = 258/275 (94%), Gaps = 0/275 (0%)
 Frame = +2

Query  2    EGLLEVFYGVYEKDPDKVLQAMVQMGVLVPTGDMTAVRRTAQFFLNSFEERLATQRRERE  181
            EGLLEVFYGVYEKDPDKVLQAMVQMGVLVPTGDMTAVRRTAQFFL+SFEERL  QR+ERE
Sbjct  481  EGLLEVFYGVYEKDPDKVLQAMVQMGVLVPTGDMTAVRRTAQFFLDSFEERLVAQRKERE  540

Query  182  LAKAELGFKKPLTKEEKIEKKKQRLAAIGEDLLSIAADQPFRFPATFTFVVRAFSVLHGI  361
            +A AELGFKK L+KEEK EKKKQRLAAIGEDLLSIAADQPFRFPATFTFVVRAFSVL GI
Sbjct  541  MATAELGFKKQLSKEEKFEKKKQRLAAIGEDLLSIAADQPFRFPATFTFVVRAFSVLDGI  600

Query  362  GKGLDPRFDITEIAKPYALELLRFREAGVEVILKDFKTRWDRQNRAFYNLFRQADRVEKL  541
            GKGLDPRFDITEIAKPYA+ELLRF EAGVEVI+KD K RW+RQ+RAFYNLFRQ DRVEKL
Sbjct  601  GKGLDPRFDITEIAKPYAMELLRFNEAGVEVIVKDAKKRWERQSRAFYNLFRQPDRVEKL  660

Query  542  AEIIQRLEQGDLKLRVRALESERAFQRVAAVQKTILSAVAAGSLINLATVLYLNAIRMPA  721
            A+II+RLEQGDLKLRVRALESER+FQRVAAVQKTI   VAAGSL+NLAT+L+LN+IRMPA
Sbjct  661  AQIIERLEQGDLKLRVRALESERSFQRVAAVQKTIGYGVAAGSLVNLATILHLNSIRMPA  720

Query  722  MAAYGLCAFFGFQVLIGIVKVKKIDQRERLITGTA  826
              AY +CA+FG Q+L+G+VKVKK+DQ+ERLITGTA
Sbjct  721  TIAYSICAYFGLQILLGLVKVKKLDQQERLITGTA  755



>ref|XP_006382920.1| hypothetical protein POPTR_0005s08490g [Populus trichocarpa]
 gb|ERP60717.1| hypothetical protein POPTR_0005s08490g [Populus trichocarpa]
Length=767

 Score =   463 bits (1191),  Expect = 7e-153, Method: Compositional matrix adjust.
 Identities = 242/288 (84%), Positives = 260/288 (90%), Gaps = 11/288 (4%)
 Frame = +2

Query  2    EGLLEVFYGVYEKDPDKVLQAMVQMGVLVPTGDMTAVRRTAQFFLNSFEERLATQRRERE  181
            EGLLE FYGVYEKDPDKVL+AMVQMGVLVPTGDMTAVRRTAQFFLNSFEERLA QRRERE
Sbjct  490  EGLLETFYGVYEKDPDKVLEAMVQMGVLVPTGDMTAVRRTAQFFLNSFEERLAAQRRERE  549

Query  182  LAKAELGFKKPLTKEEKIEKKKQRLAAIGEDLLSIAADQPFRFPATFTFVVRAFSVLHGI  361
            +A  ELGFKK LTKEEK+EKKKQRLAAIGEDLLSIAADQPFRFPATFTFVVRAFSVL GI
Sbjct  550  MATTELGFKKQLTKEEKMEKKKQRLAAIGEDLLSIAADQPFRFPATFTFVVRAFSVLDGI  609

Query  362  GKGLDPRFDITEIAKPYALELLRFREAGVEVILKDFKTRWDRQNRAFYNLFRQADRVEKL  541
            GKGLDPRFDITEIAKPYALELLRFREAGVEV+LKDF+ RWDRQ+RAF+NLFRQADRV+KL
Sbjct  610  GKGLDPRFDITEIAKPYALELLRFREAGVEVLLKDFRKRWDRQSRAFHNLFRQADRVQKL  669

Query  542  AEIIQRLEQGDLKLRVRALESERAFQRVAAVQKTILSAVAAGSLINLATVLYLNAIRMPA  721
            AE IQRLEQGDLKLRVR LE+ERAFQRVAAVQKT+ SAVAAGSLINLAT+L+LN+IR+PA
Sbjct  670  AETIQRLEQGDLKLRVRTLEAERAFQRVAAVQKTVGSAVAAGSLINLATILFLNSIRVPA  729

Query  722  MAAYGLCAFFGFQVLIGIVKVKKIDQRERLITGTA*TQVADSDQSRDY  865
             AA  LCAFF FQVL GI+KVK++DQ+ERL           S Q RDY
Sbjct  730  TAASILCAFFSFQVLFGIIKVKRLDQQERL-----------SIQLRDY  766



>ref|NP_001047212.1| Os02g0575500 [Oryza sativa Japonica Group]
 dbj|BAD33354.1| putative ABC transporter [Oryza sativa Japonica Group]
 dbj|BAF09126.1| Os02g0575500 [Oryza sativa Japonica Group]
 gb|EEC73462.1| hypothetical protein OsI_07774 [Oryza sativa Indica Group]
 gb|EEE57241.1| hypothetical protein OsJ_07239 [Oryza sativa Japonica Group]
Length=763

 Score =   463 bits (1191),  Expect = 8e-153, Method: Compositional matrix adjust.
 Identities = 236/275 (86%), Positives = 256/275 (93%), Gaps = 0/275 (0%)
 Frame = +2

Query  2    EGLLEVFYGVYEKDPDKVLQAMVQMGVLVPTGDMTAVRRTAQFFLNSFEERLATQRRERE  181
            EGLLE FYGVYEKDPDKVLQ+M+QMGVLVPTGDMTAVRRTAQFFL+SFEERLA QR+ERE
Sbjct  489  EGLLEAFYGVYEKDPDKVLQSMIQMGVLVPTGDMTAVRRTAQFFLDSFEERLAAQRKERE  548

Query  182  LAKAELGFKKPLTKEEKIEKKKQRLAAIGEDLLSIAADQPFRFPATFTFVVRAFSVLHGI  361
            +A  ELGFKK LTKEEK EKKKQRLAAIGEDLLSIAADQPFRFPATFTFVVRAFSVL GI
Sbjct  549  MATEELGFKKQLTKEEKFEKKKQRLAAIGEDLLSIAADQPFRFPATFTFVVRAFSVLDGI  608

Query  362  GKGLDPRFDITEIAKPYALELLRFREAGVEVILKDFKTRWDRQNRAFYNLFRQADRVEKL  541
            GKGLDPRFDITEIAKPYA+ELLRF EAGVEVI+KD + RW+RQ+RAFYNLFRQ DRVEKL
Sbjct  609  GKGLDPRFDITEIAKPYAMELLRFNEAGVEVIVKDARKRWERQSRAFYNLFRQPDRVEKL  668

Query  542  AEIIQRLEQGDLKLRVRALESERAFQRVAAVQKTILSAVAAGSLINLATVLYLNAIRMPA  721
            A+II+RLEQGDLKLRVR LESERAFQRVAAVQKTI   VAAGSL+NLATVLYLN+IR+PA
Sbjct  669  AQIIERLEQGDLKLRVRTLESERAFQRVAAVQKTIGYGVAAGSLVNLATVLYLNSIRLPA  728

Query  722  MAAYGLCAFFGFQVLIGIVKVKKIDQRERLITGTA  826
              AY LCAFFG QVL+G++KVKK+DQ+ERLITGTA
Sbjct  729  TIAYSLCAFFGLQVLVGLLKVKKLDQQERLITGTA  763



>ref|XP_006648776.1| PREDICTED: uncharacterized aarF domain-containing protein kinase 
At1g79600, chloroplastic-like [Oryza brachyantha]
Length=661

 Score =   457 bits (1176),  Expect = 7e-152, Method: Compositional matrix adjust.
 Identities = 232/275 (84%), Positives = 255/275 (93%), Gaps = 0/275 (0%)
 Frame = +2

Query  2    EGLLEVFYGVYEKDPDKVLQAMVQMGVLVPTGDMTAVRRTAQFFLNSFEERLATQRRERE  181
            EGLLE FYGVYEKDPD+VLQ+M+QMGVLVPTGDMTAVRRTAQFFL+SFEERLA QR+ERE
Sbjct  387  EGLLEAFYGVYEKDPDRVLQSMIQMGVLVPTGDMTAVRRTAQFFLDSFEERLAAQRKERE  446

Query  182  LAKAELGFKKPLTKEEKIEKKKQRLAAIGEDLLSIAADQPFRFPATFTFVVRAFSVLHGI  361
            +A  +LGFKK LTKEEK EKKKQRLAAIGEDLL+IAADQPFRFPATFTFVVRAFSVL GI
Sbjct  447  MATEQLGFKKQLTKEEKFEKKKQRLAAIGEDLLAIAADQPFRFPATFTFVVRAFSVLDGI  506

Query  362  GKGLDPRFDITEIAKPYALELLRFREAGVEVILKDFKTRWDRQNRAFYNLFRQADRVEKL  541
            GKGLDPRFDITEIAKPYA+ELL+F EAGVEVI+KD K RW+RQ+RAFYNLFRQ DRVEKL
Sbjct  507  GKGLDPRFDITEIAKPYAMELLKFNEAGVEVIVKDAKKRWERQSRAFYNLFRQPDRVEKL  566

Query  542  AEIIQRLEQGDLKLRVRALESERAFQRVAAVQKTILSAVAAGSLINLATVLYLNAIRMPA  721
            A+II+RLEQGDLKLRVR LESERAF+RVAAVQKTI   VAAGSL+NLATVLYLN+IR PA
Sbjct  567  AQIIERLEQGDLKLRVRTLESERAFKRVAAVQKTIGYGVAAGSLVNLATVLYLNSIRFPA  626

Query  722  MAAYGLCAFFGFQVLIGIVKVKKIDQRERLITGTA  826
              AY LCAFFG QVL+G++KVKK+DQ+ERLITGTA
Sbjct  627  TIAYSLCAFFGLQVLVGLIKVKKLDQQERLITGTA  661



>ref|XP_010681103.1| PREDICTED: uncharacterized aarF domain-containing protein kinase 
At1g79600, chloroplastic [Beta vulgaris subsp. vulgaris]
 ref|XP_010681104.1| PREDICTED: uncharacterized aarF domain-containing protein kinase 
At1g79600, chloroplastic [Beta vulgaris subsp. vulgaris]
Length=749

 Score =   457 bits (1176),  Expect = 9e-151, Method: Compositional matrix adjust.
 Identities = 230/275 (84%), Positives = 261/275 (95%), Gaps = 0/275 (0%)
 Frame = +2

Query  2    EGLLEVFYGVYEKDPDKVLQAMVQMGVLVPTGDMTAVRRTAQFFLNSFEERLATQRRERE  181
            EGLLE FYG+YEKDPDKVLQ+MVQMGVLVPTGDMTAVRRTA+FFLNSFEERLA Q++E+E
Sbjct  475  EGLLEAFYGIYEKDPDKVLQSMVQMGVLVPTGDMTAVRRTAKFFLNSFEERLAAQKKEKE  534

Query  182  LAKAELGFKKPLTKEEKIEKKKQRLAAIGEDLLSIAADQPFRFPATFTFVVRAFSVLHGI  361
            +A AELGFKKPL+KEEKI+KKKQRLAAIGEDLL+IAADQPFRFPATFTFVVRAFSVL GI
Sbjct  535  IAAAELGFKKPLSKEEKIQKKKQRLAAIGEDLLAIAADQPFRFPATFTFVVRAFSVLDGI  594

Query  362  GKGLDPRFDITEIAKPYALELLRFREAGVEVILKDFKTRWDRQNRAFYNLFRQADRVEKL  541
            GKGLDPRFDITEIAKPYALELL+FREAGVEV++KDF+ RWDRQ++AFYNLFRQADRVEKL
Sbjct  595  GKGLDPRFDITEIAKPYALELLKFREAGVEVLVKDFRKRWDRQSQAFYNLFRQADRVEKL  654

Query  542  AEIIQRLEQGDLKLRVRALESERAFQRVAAVQKTILSAVAAGSLINLATVLYLNAIRMPA  721
            A II+RLE+GDLKLRVRALESERAFQRVAAVQKTI +AV AG+L+NLAT+L L++IR+PA
Sbjct  655  ANIIERLEKGDLKLRVRALESERAFQRVAAVQKTIGNAVVAGTLVNLATLLQLHSIRVPA  714

Query  722  MAAYGLCAFFGFQVLIGIVKVKKIDQRERLITGTA  826
            +AAY +CA FG Q L G++KVKK+DQRERL+TGTA
Sbjct  715  VAAYAVCALFGLQALFGVLKVKKLDQRERLVTGTA  749



>ref|XP_004952869.1| PREDICTED: uncharacterized aarF domain-containing protein kinase 
At1g79600, chloroplastic-like [Setaria italica]
Length=761

 Score =   456 bits (1173),  Expect = 4e-150, Method: Compositional matrix adjust.
 Identities = 232/275 (84%), Positives = 254/275 (92%), Gaps = 0/275 (0%)
 Frame = +2

Query  2    EGLLEVFYGVYEKDPDKVLQAMVQMGVLVPTGDMTAVRRTAQFFLNSFEERLATQRRERE  181
            EGLLEVFYGVYEKDPDKVLQAMVQMGVLVPTGDMTAVRRTAQFFLNSF+ERLA QR+ERE
Sbjct  487  EGLLEVFYGVYEKDPDKVLQAMVQMGVLVPTGDMTAVRRTAQFFLNSFQERLAAQRKERE  546

Query  182  LAKAELGFKKPLTKEEKIEKKKQRLAAIGEDLLSIAADQPFRFPATFTFVVRAFSVLHGI  361
            +  AELGFKK LTKEEK EKKKQRLAAIGEDLL+IAADQPFRFPATFTFVVRAFSVL GI
Sbjct  547  MTTAELGFKKQLTKEEKFEKKKQRLAAIGEDLLAIAADQPFRFPATFTFVVRAFSVLDGI  606

Query  362  GKGLDPRFDITEIAKPYALELLRFREAGVEVILKDFKTRWDRQNRAFYNLFRQADRVEKL  541
            GKGLDPRFDITEIAKPYA ELLRF EAGVEV++KD K RW+RQ+RAFYNLFRQ DRVEKL
Sbjct  607  GKGLDPRFDITEIAKPYAKELLRFNEAGVEVVVKDAKKRWERQSRAFYNLFRQPDRVEKL  666

Query  542  AEIIQRLEQGDLKLRVRALESERAFQRVAAVQKTILSAVAAGSLINLATVLYLNAIRMPA  721
            A+II+RLEQG+LKLRVR LESERAFQRVAAVQKTI   +AAGSL+NLAT+LY N+IR PA
Sbjct  667  AQIIERLEQGELKLRVRTLESERAFQRVAAVQKTIGYGIAAGSLVNLATMLYFNSIRGPA  726

Query  722  MAAYGLCAFFGFQVLIGIVKVKKIDQRERLITGTA  826
              AY LCAFFG QV++G++KVKK+D++ERLITGTA
Sbjct  727  TVAYSLCAFFGLQVVVGLIKVKKLDRQERLITGTA  761



>dbj|BAF01914.1| ABC transporter-like [Arabidopsis thaliana]
Length=450

 Score =   442 bits (1138),  Expect = 5e-149, Method: Compositional matrix adjust.
 Identities = 234/277 (84%), Positives = 254/277 (92%), Gaps = 2/277 (1%)
 Frame = +2

Query  2    EGLLEVFYGVYEKDPDKVLQAMVQMGVLVPTGDMTAVRRTAQFFLNSFEERLATQRRERE  181
            EGLLE FYGVYEKDPDKVLQAMVQMGVLVPTGD+TAVRRTA FFLNSFEERLA QR+E+E
Sbjct  174  EGLLEAFYGVYEKDPDKVLQAMVQMGVLVPTGDLTAVRRTALFFLNSFEERLAAQRKEKE  233

Query  182  LAKAE--LGFKKPLTKEEKIEKKKQRLAAIGEDLLSIAADQPFRFPATFTFVVRAFSVLH  355
               A   LGFKKPL+KEEK EKKKQRLAAIGEDLL+IAADQPFRFPATFTFVVRAFSVL 
Sbjct  234  EIAAAEELGFKKPLSKEEKQEKKKQRLAAIGEDLLAIAADQPFRFPATFTFVVRAFSVLD  293

Query  356  GIGKGLDPRFDITEIAKPYALELLRFREAGVEVILKDFKTRWDRQNRAFYNLFRQADRVE  535
            GIGKGLDPRFDITEIAKPYALELLRFREAGVEV++KD + RWDRQ++AFYNLFRQADRVE
Sbjct  294  GIGKGLDPRFDITEIAKPYALELLRFREAGVEVVVKDLRKRWDRQSQAFYNLFRQADRVE  353

Query  536  KLAEIIQRLEQGDLKLRVRALESERAFQRVAAVQKTILSAVAAGSLINLATVLYLNAIRM  715
            KLA +I+RLEQGDLK RVRALESERAFQRVAAVQKT+ SAVAAGSL+NLAT+LYLN+I+ 
Sbjct  354  KLAVVIERLEQGDLKPRVRALESERAFQRVAAVQKTVGSAVAAGSLVNLATILYLNSIKT  413

Query  716  PAMAAYGLCAFFGFQVLIGIVKVKKIDQRERLITGTA  826
            PA  AY +CAFF  QVLIGI+KVKK DQRE+LITGTA
Sbjct  414  PATIAYTVCAFFSLQVLIGIIKVKKFDQREKLITGTA  450



>ref|NP_201299.2| oxidative stress-related ABC1-like protein 1 [Arabidopsis thaliana]
 ref|NP_851271.1| oxidative stress-related ABC1-like protein 1 [Arabidopsis thaliana]
 gb|AAL24359.1| ABC transporter-like [Arabidopsis thaliana]
 gb|AAL36400.1| putative ABC transporter protein [Arabidopsis thaliana]
 gb|AAM20023.1| putative ABC transporter protein [Arabidopsis thaliana]
 gb|AED97972.1| putative ABC transporter [Arabidopsis thaliana]
 gb|AED97973.1| putative ABC transporter [Arabidopsis thaliana]
Length=761

 Score =   446 bits (1148),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 235/277 (85%), Positives = 255/277 (92%), Gaps = 2/277 (1%)
 Frame = +2

Query  2    EGLLEVFYGVYEKDPDKVLQAMVQMGVLVPTGDMTAVRRTAQFFLNSFEERLATQRRERE  181
            EGLLE FYGVYEKDPDKVLQAMVQMGVLVPTGD+TAVRRTA FFLNSFEERLA QR+E+E
Sbjct  485  EGLLEAFYGVYEKDPDKVLQAMVQMGVLVPTGDLTAVRRTALFFLNSFEERLAAQRKEKE  544

Query  182  LAKAE--LGFKKPLTKEEKIEKKKQRLAAIGEDLLSIAADQPFRFPATFTFVVRAFSVLH  355
               A   LGFKKPL+KEEK EKKKQRLAAIGEDLL+IAADQPFRFPATFTFVVRAFSVL 
Sbjct  545  EIAAAEELGFKKPLSKEEKQEKKKQRLAAIGEDLLAIAADQPFRFPATFTFVVRAFSVLD  604

Query  356  GIGKGLDPRFDITEIAKPYALELLRFREAGVEVILKDFKTRWDRQNRAFYNLFRQADRVE  535
            GIGKGLDPRFDITEIAKPYALELLRFREAGVEV++KD + RWDRQ++AFYNLFRQADRVE
Sbjct  605  GIGKGLDPRFDITEIAKPYALELLRFREAGVEVVVKDLRKRWDRQSQAFYNLFRQADRVE  664

Query  536  KLAEIIQRLEQGDLKLRVRALESERAFQRVAAVQKTILSAVAAGSLINLATVLYLNAIRM  715
            KLA +I+RLEQGDLKLRVRALESERAFQRVAAVQKT+ SAVAAGSL+NLAT+LYLN+I+ 
Sbjct  665  KLAVVIERLEQGDLKLRVRALESERAFQRVAAVQKTVGSAVAAGSLVNLATILYLNSIKT  724

Query  716  PAMAAYGLCAFFGFQVLIGIVKVKKIDQRERLITGTA  826
            PA  AY +CAFF  QVLIGI+KVKK DQRE+LITGTA
Sbjct  725  PATIAYTVCAFFSLQVLIGIIKVKKFDQREKLITGTA  761



>gb|ABK25165.1| unknown [Picea sitchensis]
Length=777

 Score =   446 bits (1146),  Expect = 6e-146, Method: Compositional matrix adjust.
 Identities = 223/275 (81%), Positives = 254/275 (92%), Gaps = 0/275 (0%)
 Frame = +2

Query  2    EGLLEVFYGVYEKDPDKVLQAMVQMGVLVPTGDMTAVRRTAQFFLNSFEERLATQRRERE  181
            EGLLE FYGVYEKDP+KVLQAM+QMGVLVP+ DMTAVRRTAQFFLNSFEERL  Q++E+E
Sbjct  503  EGLLETFYGVYEKDPNKVLQAMIQMGVLVPSSDMTAVRRTAQFFLNSFEERLTAQKQEKE  562

Query  182  LAKAELGFKKPLTKEEKIEKKKQRLAAIGEDLLSIAADQPFRFPATFTFVVRAFSVLHGI  361
             AK+ELGFKKPLTKEEK+EKKK RLAAIGEDLLSIA DQPFRFPATFTFVVRAFSVL GI
Sbjct  563  TAKSELGFKKPLTKEEKVEKKKLRLAAIGEDLLSIAVDQPFRFPATFTFVVRAFSVLDGI  622

Query  362  GKGLDPRFDITEIAKPYALELLRFREAGVEVILKDFKTRWDRQNRAFYNLFRQADRVEKL  541
            GKGLDPRFDI+EIAKPYALELLRFREAG+EV++ DFK RWDRQ+RAF NLFRQADRVEKL
Sbjct  623  GKGLDPRFDISEIAKPYALELLRFREAGIEVLITDFKKRWDRQSRAFSNLFRQADRVEKL  682

Query  542  AEIIQRLEQGDLKLRVRALESERAFQRVAAVQKTILSAVAAGSLINLATVLYLNAIRMPA  721
            AE+IQRLEQGDLKLRVR LESERAF+RVA+ QK I +AV AG+L+NLAT+LY+N+IR+PA
Sbjct  683  AEVIQRLEQGDLKLRVRTLESERAFKRVASAQKAIGNAVFAGTLVNLATILYINSIRLPA  742

Query  722  MAAYGLCAFFGFQVLIGIVKVKKIDQRERLITGTA  826
            MAAY   A FG QVL+G++K++++DQ+ERLITGTA
Sbjct  743  MAAYMGSAMFGMQVLLGVLKIRRLDQQERLITGTA  777



>ref|XP_006394092.1| hypothetical protein EUTSA_v10003690mg [Eutrema salsugineum]
 gb|ESQ31378.1| hypothetical protein EUTSA_v10003690mg [Eutrema salsugineum]
Length=754

 Score =   445 bits (1144),  Expect = 6e-146, Method: Compositional matrix adjust.
 Identities = 233/277 (84%), Positives = 255/277 (92%), Gaps = 2/277 (1%)
 Frame = +2

Query  2    EGLLEVFYGVYEKDPDKVLQAMVQMGVLVPTGDMTAVRRTAQFFLNSFEERLATQRRERE  181
            EGLLE FYGVYEKDPDKV+QAMVQMGVLVPTGD+T+VRRTA FFLNSFEERLA QR+E+E
Sbjct  478  EGLLEAFYGVYEKDPDKVIQAMVQMGVLVPTGDLTSVRRTALFFLNSFEERLAAQRKEKE  537

Query  182  LAKAE--LGFKKPLTKEEKIEKKKQRLAAIGEDLLSIAADQPFRFPATFTFVVRAFSVLH  355
               A   LGFKKPL+KEEK EKKKQRLAAIGEDLL+IAADQPFRFPATFTFVVRAFSVL 
Sbjct  538  EIAAAEELGFKKPLSKEEKQEKKKQRLAAIGEDLLAIAADQPFRFPATFTFVVRAFSVLD  597

Query  356  GIGKGLDPRFDITEIAKPYALELLRFREAGVEVILKDFKTRWDRQNRAFYNLFRQADRVE  535
            GIGKGLDPRFDITEIAKPYALELLRFREAGVEV++KD + RWDRQ++AFYNLFRQADRVE
Sbjct  598  GIGKGLDPRFDITEIAKPYALELLRFREAGVEVVVKDLRKRWDRQSQAFYNLFRQADRVE  657

Query  536  KLAEIIQRLEQGDLKLRVRALESERAFQRVAAVQKTILSAVAAGSLINLATVLYLNAIRM  715
            KLA IIQRLEQGDLKLRVRALESERAFQRVAAVQKT+ SAVAAGSL+NLAT+LYLN+++ 
Sbjct  658  KLAVIIQRLEQGDLKLRVRALESERAFQRVAAVQKTVGSAVAAGSLVNLATILYLNSLKT  717

Query  716  PAMAAYGLCAFFGFQVLIGIVKVKKIDQRERLITGTA  826
            PA  AY +CAFF  QVLIG++KVKK DQRE+LITGTA
Sbjct  718  PATIAYTVCAFFSLQVLIGVIKVKKFDQREKLITGTA  754



>dbj|BAA97306.1| ABC transporter-like [Arabidopsis thaliana]
Length=795

 Score =   446 bits (1146),  Expect = 9e-146, Method: Compositional matrix adjust.
 Identities = 235/277 (85%), Positives = 255/277 (92%), Gaps = 2/277 (1%)
 Frame = +2

Query  2    EGLLEVFYGVYEKDPDKVLQAMVQMGVLVPTGDMTAVRRTAQFFLNSFEERLATQRRERE  181
            EGLLE FYGVYEKDPDKVLQAMVQMGVLVPTGD+TAVRRTA FFLNSFEERLA QR+E+E
Sbjct  519  EGLLEAFYGVYEKDPDKVLQAMVQMGVLVPTGDLTAVRRTALFFLNSFEERLAAQRKEKE  578

Query  182  LAKAE--LGFKKPLTKEEKIEKKKQRLAAIGEDLLSIAADQPFRFPATFTFVVRAFSVLH  355
               A   LGFKKPL+KEEK EKKKQRLAAIGEDLL+IAADQPFRFPATFTFVVRAFSVL 
Sbjct  579  EIAAAEELGFKKPLSKEEKQEKKKQRLAAIGEDLLAIAADQPFRFPATFTFVVRAFSVLD  638

Query  356  GIGKGLDPRFDITEIAKPYALELLRFREAGVEVILKDFKTRWDRQNRAFYNLFRQADRVE  535
            GIGKGLDPRFDITEIAKPYALELLRFREAGVEV++KD + RWDRQ++AFYNLFRQADRVE
Sbjct  639  GIGKGLDPRFDITEIAKPYALELLRFREAGVEVVVKDLRKRWDRQSQAFYNLFRQADRVE  698

Query  536  KLAEIIQRLEQGDLKLRVRALESERAFQRVAAVQKTILSAVAAGSLINLATVLYLNAIRM  715
            KLA +I+RLEQGDLKLRVRALESERAFQRVAAVQKT+ SAVAAGSL+NLAT+LYLN+I+ 
Sbjct  699  KLAVVIERLEQGDLKLRVRALESERAFQRVAAVQKTVGSAVAAGSLVNLATILYLNSIKT  758

Query  716  PAMAAYGLCAFFGFQVLIGIVKVKKIDQRERLITGTA  826
            PA  AY +CAFF  QVLIGI+KVKK DQRE+LITGTA
Sbjct  759  PATIAYTVCAFFSLQVLIGIIKVKKFDQREKLITGTA  795



>ref|XP_002864932.1| hypothetical protein ARALYDRAFT_919821 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH41191.1| hypothetical protein ARALYDRAFT_919821 [Arabidopsis lyrata subsp. 
lyrata]
Length=755

 Score =   444 bits (1143),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 233/277 (84%), Positives = 255/277 (92%), Gaps = 2/277 (1%)
 Frame = +2

Query  2    EGLLEVFYGVYEKDPDKVLQAMVQMGVLVPTGDMTAVRRTAQFFLNSFEERLATQRRERE  181
            EGLLE FYGVYEKDPDKVLQAMVQMGVLVPTGD+TAVRRTA FFLNSFEERLA QR+E+E
Sbjct  479  EGLLEAFYGVYEKDPDKVLQAMVQMGVLVPTGDLTAVRRTALFFLNSFEERLAAQRKEKE  538

Query  182  LAKAE--LGFKKPLTKEEKIEKKKQRLAAIGEDLLSIAADQPFRFPATFTFVVRAFSVLH  355
               A   LGFKKPL+KEEK EKKKQRLAAIGEDLL+IAADQPFRFPATFTFVVRAFSVL 
Sbjct  539  EIAAAEELGFKKPLSKEEKQEKKKQRLAAIGEDLLAIAADQPFRFPATFTFVVRAFSVLD  598

Query  356  GIGKGLDPRFDITEIAKPYALELLRFREAGVEVILKDFKTRWDRQNRAFYNLFRQADRVE  535
            GIGKGLDPRFDITEIAKPYALELLRFREAGVEV++KD + RWDRQ++AFYNLFRQADRVE
Sbjct  599  GIGKGLDPRFDITEIAKPYALELLRFREAGVEVVVKDLRKRWDRQSQAFYNLFRQADRVE  658

Query  536  KLAEIIQRLEQGDLKLRVRALESERAFQRVAAVQKTILSAVAAGSLINLATVLYLNAIRM  715
            KLA +I+RLEQGDLKLRVRALESERAFQRVAAVQKT+ SAVAAGSL+NLAT+LYLN+++ 
Sbjct  659  KLAVVIERLEQGDLKLRVRALESERAFQRVAAVQKTVGSAVAAGSLVNLATILYLNSLKT  718

Query  716  PAMAAYGLCAFFGFQVLIGIVKVKKIDQRERLITGTA  826
            PA  AY +CAFF  QVLIG++KVKK DQRE+LITGTA
Sbjct  719  PATIAYTVCAFFSLQVLIGVIKVKKFDQREKLITGTA  755



>ref|XP_006394093.1| hypothetical protein EUTSA_v10003690mg [Eutrema salsugineum]
 gb|ESQ31379.1| hypothetical protein EUTSA_v10003690mg [Eutrema salsugineum]
Length=761

 Score =   444 bits (1143),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 233/277 (84%), Positives = 255/277 (92%), Gaps = 2/277 (1%)
 Frame = +2

Query  2    EGLLEVFYGVYEKDPDKVLQAMVQMGVLVPTGDMTAVRRTAQFFLNSFEERLATQRRERE  181
            EGLLE FYGVYEKDPDKV+QAMVQMGVLVPTGD+T+VRRTA FFLNSFEERLA QR+E+E
Sbjct  485  EGLLEAFYGVYEKDPDKVIQAMVQMGVLVPTGDLTSVRRTALFFLNSFEERLAAQRKEKE  544

Query  182  LAKAE--LGFKKPLTKEEKIEKKKQRLAAIGEDLLSIAADQPFRFPATFTFVVRAFSVLH  355
               A   LGFKKPL+KEEK EKKKQRLAAIGEDLL+IAADQPFRFPATFTFVVRAFSVL 
Sbjct  545  EIAAAEELGFKKPLSKEEKQEKKKQRLAAIGEDLLAIAADQPFRFPATFTFVVRAFSVLD  604

Query  356  GIGKGLDPRFDITEIAKPYALELLRFREAGVEVILKDFKTRWDRQNRAFYNLFRQADRVE  535
            GIGKGLDPRFDITEIAKPYALELLRFREAGVEV++KD + RWDRQ++AFYNLFRQADRVE
Sbjct  605  GIGKGLDPRFDITEIAKPYALELLRFREAGVEVVVKDLRKRWDRQSQAFYNLFRQADRVE  664

Query  536  KLAEIIQRLEQGDLKLRVRALESERAFQRVAAVQKTILSAVAAGSLINLATVLYLNAIRM  715
            KLA IIQRLEQGDLKLRVRALESERAFQRVAAVQKT+ SAVAAGSL+NLAT+LYLN+++ 
Sbjct  665  KLAVIIQRLEQGDLKLRVRALESERAFQRVAAVQKTVGSAVAAGSLVNLATILYLNSLKT  724

Query  716  PAMAAYGLCAFFGFQVLIGIVKVKKIDQRERLITGTA  826
            PA  AY +CAFF  QVLIG++KVKK DQRE+LITGTA
Sbjct  725  PATIAYTVCAFFSLQVLIGVIKVKKFDQREKLITGTA  761



>ref|XP_010444454.1| PREDICTED: uncharacterized aarF domain-containing protein kinase 
At1g79600, chloroplastic-like [Camelina sativa]
 ref|XP_010444455.1| PREDICTED: uncharacterized aarF domain-containing protein kinase 
At1g79600, chloroplastic-like [Camelina sativa]
Length=766

 Score =   442 bits (1137),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 233/277 (84%), Positives = 253/277 (91%), Gaps = 2/277 (1%)
 Frame = +2

Query  2    EGLLEVFYGVYEKDPDKVLQAMVQMGVLVPTGDMTAVRRTAQFFLNSFEERLATQRRERE  181
            EGLLE FYGVYEKDPDKVL AMVQMGVLVPTGD+TAVRRTA FFLNSFEERLA QR+E+E
Sbjct  490  EGLLEAFYGVYEKDPDKVLDAMVQMGVLVPTGDLTAVRRTALFFLNSFEERLAAQRKEKE  549

Query  182  LAKAEL--GFKKPLTKEEKIEKKKQRLAAIGEDLLSIAADQPFRFPATFTFVVRAFSVLH  355
               A    GFKKPL+KEEK EKKKQRLAAIGEDLL+IAADQPFRFPATFTFVVRAFSVL 
Sbjct  550  ELAAAEELGFKKPLSKEEKQEKKKQRLAAIGEDLLAIAADQPFRFPATFTFVVRAFSVLD  609

Query  356  GIGKGLDPRFDITEIAKPYALELLRFREAGVEVILKDFKTRWDRQNRAFYNLFRQADRVE  535
            GIGKGLDPRFDITEIAKPYALELLRFREAGVEV++KD K RWDRQ++AFYNLFRQADRVE
Sbjct  610  GIGKGLDPRFDITEIAKPYALELLRFREAGVEVVVKDLKKRWDRQSQAFYNLFRQADRVE  669

Query  536  KLAEIIQRLEQGDLKLRVRALESERAFQRVAAVQKTILSAVAAGSLINLATVLYLNAIRM  715
            KLA +I+RLEQGDLKLRVRALESERAFQRVAAVQKT+ SAVAAGSL+NLAT+LYLN+++ 
Sbjct  670  KLAVVIERLEQGDLKLRVRALESERAFQRVAAVQKTVGSAVAAGSLVNLATILYLNSLKT  729

Query  716  PAMAAYGLCAFFGFQVLIGIVKVKKIDQRERLITGTA  826
            PA  AY +CAFF  QVLIGI+KVKK DQRE+LITGTA
Sbjct  730  PATLAYTVCAFFSLQVLIGIIKVKKFDQREKLITGTA  766



>emb|CDY14523.1| BnaC03g49360D [Brassica napus]
Length=751

 Score =   442 bits (1136),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 230/277 (83%), Positives = 254/277 (92%), Gaps = 2/277 (1%)
 Frame = +2

Query  2    EGLLEVFYGVYEKDPDKVLQAMVQMGVLVPTGDMTAVRRTAQFFLNSFEERLATQRRERE  181
            EGLLE FYGVYEKDPDKV+QAMVQMGVLVPTGD+T++RRTA FFLNSFEERLA QR+E+E
Sbjct  475  EGLLEAFYGVYEKDPDKVIQAMVQMGVLVPTGDLTSIRRTALFFLNSFEERLAAQRKEKE  534

Query  182  LAKAEL--GFKKPLTKEEKIEKKKQRLAAIGEDLLSIAADQPFRFPATFTFVVRAFSVLH  355
               A    GFKKPLTKEEK EKKKQRLAAIGEDLL+I+ADQPFRFPATFTFVVRAFSVL 
Sbjct  535  ELAAAEELGFKKPLTKEEKQEKKKQRLAAIGEDLLAISADQPFRFPATFTFVVRAFSVLD  594

Query  356  GIGKGLDPRFDITEIAKPYALELLRFREAGVEVILKDFKTRWDRQNRAFYNLFRQADRVE  535
            GIGKGLDPRFDITEIAKPYALELLRFREAGVEV++KD + RWDRQ++AFYN+FRQADRVE
Sbjct  595  GIGKGLDPRFDITEIAKPYALELLRFREAGVEVVVKDLRKRWDRQSQAFYNVFRQADRVE  654

Query  536  KLAEIIQRLEQGDLKLRVRALESERAFQRVAAVQKTILSAVAAGSLINLATVLYLNAIRM  715
            KLA IIQRLEQGDLKLRVRALESERAFQRVAAVQKT+ SAVAAGSL+NLAT+LYLN+++ 
Sbjct  655  KLAVIIQRLEQGDLKLRVRALESERAFQRVAAVQKTVGSAVAAGSLVNLATILYLNSLKT  714

Query  716  PAMAAYGLCAFFGFQVLIGIVKVKKIDQRERLITGTA  826
            PA  AY +CAFF  QVLIG++KVKK DQRE+LITGTA
Sbjct  715  PATIAYTVCAFFSLQVLIGVIKVKKFDQREKLITGTA  751



>emb|CDY08837.1| BnaA06g23870D [Brassica napus]
Length=753

 Score =   441 bits (1135),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 230/277 (83%), Positives = 254/277 (92%), Gaps = 2/277 (1%)
 Frame = +2

Query  2    EGLLEVFYGVYEKDPDKVLQAMVQMGVLVPTGDMTAVRRTAQFFLNSFEERLATQRRERE  181
            EGLLE FYGVYEKDPDKV+QAMVQMGVLVPTGD+T++RRTA FFLNSFEERLA QR+E+E
Sbjct  477  EGLLEAFYGVYEKDPDKVIQAMVQMGVLVPTGDLTSIRRTALFFLNSFEERLAAQRKEKE  536

Query  182  LAKAEL--GFKKPLTKEEKIEKKKQRLAAIGEDLLSIAADQPFRFPATFTFVVRAFSVLH  355
               A    GFKKPLTKEEK EKKKQRLAAIGEDLL+I+ADQPFRFPATFTFVVRAFSVL 
Sbjct  537  ELAAAEELGFKKPLTKEEKQEKKKQRLAAIGEDLLAISADQPFRFPATFTFVVRAFSVLD  596

Query  356  GIGKGLDPRFDITEIAKPYALELLRFREAGVEVILKDFKTRWDRQNRAFYNLFRQADRVE  535
            GIGKGLDPRFDITEIAKPYALELLRFREAGVEV++KD + RWDRQ++AFYN+FRQADRVE
Sbjct  597  GIGKGLDPRFDITEIAKPYALELLRFREAGVEVVVKDLRKRWDRQSQAFYNVFRQADRVE  656

Query  536  KLAEIIQRLEQGDLKLRVRALESERAFQRVAAVQKTILSAVAAGSLINLATVLYLNAIRM  715
            KLA IIQRLEQGDLKLRVRALESERAFQRVAAVQKT+ SAVAAGSL+NLAT+LYLN+++ 
Sbjct  657  KLAVIIQRLEQGDLKLRVRALESERAFQRVAAVQKTVGSAVAAGSLVNLATILYLNSLKT  716

Query  716  PAMAAYGLCAFFGFQVLIGIVKVKKIDQRERLITGTA  826
            PA  AY +CAFF  QVLIG++KVKK DQRE+LITGTA
Sbjct  717  PATIAYTVCAFFSLQVLIGVIKVKKFDQREKLITGTA  753



>ref|XP_009150571.1| PREDICTED: uncharacterized aarF domain-containing protein kinase 
At1g79600, chloroplastic [Brassica rapa]
Length=752

 Score =   441 bits (1135),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 230/277 (83%), Positives = 254/277 (92%), Gaps = 2/277 (1%)
 Frame = +2

Query  2    EGLLEVFYGVYEKDPDKVLQAMVQMGVLVPTGDMTAVRRTAQFFLNSFEERLATQRRERE  181
            EGLLE FYGVYEKDPDKV+QAMVQMGVLVPTGD+T++RRTA FFLNSFEERLA QR+E+E
Sbjct  476  EGLLEAFYGVYEKDPDKVIQAMVQMGVLVPTGDLTSIRRTALFFLNSFEERLAAQRKEKE  535

Query  182  LAKAEL--GFKKPLTKEEKIEKKKQRLAAIGEDLLSIAADQPFRFPATFTFVVRAFSVLH  355
               A    GFKKPLTKEEK EKKKQRLAAIGEDLL+I+ADQPFRFPATFTFVVRAFSVL 
Sbjct  536  ELAAAEELGFKKPLTKEEKQEKKKQRLAAIGEDLLAISADQPFRFPATFTFVVRAFSVLD  595

Query  356  GIGKGLDPRFDITEIAKPYALELLRFREAGVEVILKDFKTRWDRQNRAFYNLFRQADRVE  535
            GIGKGLDPRFDITEIAKPYALELLRFREAGVEV++KD + RWDRQ++AFYN+FRQADRVE
Sbjct  596  GIGKGLDPRFDITEIAKPYALELLRFREAGVEVVVKDLRKRWDRQSQAFYNVFRQADRVE  655

Query  536  KLAEIIQRLEQGDLKLRVRALESERAFQRVAAVQKTILSAVAAGSLINLATVLYLNAIRM  715
            KLA IIQRLEQGDLKLRVRALESERAFQRVAAVQKT+ SAVAAGSL+NLAT+LYLN+++ 
Sbjct  656  KLAVIIQRLEQGDLKLRVRALESERAFQRVAAVQKTVGSAVAAGSLVNLATILYLNSLKT  715

Query  716  PAMAAYGLCAFFGFQVLIGIVKVKKIDQRERLITGTA  826
            PA  AY +CAFF  QVLIG++KVKK DQRE+LITGTA
Sbjct  716  PATIAYTVCAFFSLQVLIGVIKVKKFDQREKLITGTA  752



>ref|XP_006281672.1| hypothetical protein CARUB_v10027811mg [Capsella rubella]
 gb|EOA14570.1| hypothetical protein CARUB_v10027811mg [Capsella rubella]
Length=764

 Score =   441 bits (1134),  Expect = 3e-144, Method: Compositional matrix adjust.
 Identities = 231/277 (83%), Positives = 254/277 (92%), Gaps = 2/277 (1%)
 Frame = +2

Query  2    EGLLEVFYGVYEKDPDKVLQAMVQMGVLVPTGDMTAVRRTAQFFLNSFEERLATQRRERE  181
            EGLLE FYGVYEKDPDKVL+AMVQMGVLVPTGD+TAVRRTA FFLNSFEERLA QR+E+E
Sbjct  488  EGLLEAFYGVYEKDPDKVLEAMVQMGVLVPTGDLTAVRRTALFFLNSFEERLAAQRKEKE  547

Query  182  LAKAEL--GFKKPLTKEEKIEKKKQRLAAIGEDLLSIAADQPFRFPATFTFVVRAFSVLH  355
               A    GFKKPL+KEEK EKKKQRLAAIGEDLL+IAADQPFRFPATFTFVVRAFSVL 
Sbjct  548  ELAAAEELGFKKPLSKEEKQEKKKQRLAAIGEDLLAIAADQPFRFPATFTFVVRAFSVLD  607

Query  356  GIGKGLDPRFDITEIAKPYALELLRFREAGVEVILKDFKTRWDRQNRAFYNLFRQADRVE  535
            GIGKGLDPRFDITEIAKPYALELLRFREAGVEV++KD + RWDRQ++AFYNLFRQADRVE
Sbjct  608  GIGKGLDPRFDITEIAKPYALELLRFREAGVEVVVKDLRKRWDRQSQAFYNLFRQADRVE  667

Query  536  KLAEIIQRLEQGDLKLRVRALESERAFQRVAAVQKTILSAVAAGSLINLATVLYLNAIRM  715
            KLA +I+RLEQGDLKLRVRALESERAFQRVAAVQKT+ SAVAAGSL+NLAT+LYLN+++ 
Sbjct  668  KLAVVIERLEQGDLKLRVRALESERAFQRVAAVQKTVGSAVAAGSLVNLATILYLNSLKT  727

Query  716  PAMAAYGLCAFFGFQVLIGIVKVKKIDQRERLITGTA  826
            PA  AY +CAFF  QVLIG++KVKK DQRE+LITGTA
Sbjct  728  PATLAYTVCAFFSLQVLIGVIKVKKFDQREKLITGTA  764



>ref|XP_010462545.1| PREDICTED: uncharacterized aarF domain-containing protein kinase 
At1g79600, chloroplastic-like [Camelina sativa]
Length=762

 Score =   441 bits (1133),  Expect = 3e-144, Method: Compositional matrix adjust.
 Identities = 232/277 (84%), Positives = 253/277 (91%), Gaps = 2/277 (1%)
 Frame = +2

Query  2    EGLLEVFYGVYEKDPDKVLQAMVQMGVLVPTGDMTAVRRTAQFFLNSFEERLATQRRERE  181
            EGLLE FYGVYEKDPDKVL AMVQMGVLVPTGD+TAVRRTA FFLNSFEERLA QR+E+E
Sbjct  486  EGLLEAFYGVYEKDPDKVLDAMVQMGVLVPTGDLTAVRRTALFFLNSFEERLAAQRKEKE  545

Query  182  LAKAEL--GFKKPLTKEEKIEKKKQRLAAIGEDLLSIAADQPFRFPATFTFVVRAFSVLH  355
               A    GFKKPL+KEEK EKKKQRLAAIGEDLL+IAADQPFRFPATFTFVVRAFSVL 
Sbjct  546  ELAAAEELGFKKPLSKEEKQEKKKQRLAAIGEDLLAIAADQPFRFPATFTFVVRAFSVLD  605

Query  356  GIGKGLDPRFDITEIAKPYALELLRFREAGVEVILKDFKTRWDRQNRAFYNLFRQADRVE  535
            GIGKGLDPRFDITEIAKPYALELLRFREAGVEV++KD + RWDRQ++AFYNLFRQADRVE
Sbjct  606  GIGKGLDPRFDITEIAKPYALELLRFREAGVEVVVKDLRKRWDRQSQAFYNLFRQADRVE  665

Query  536  KLAEIIQRLEQGDLKLRVRALESERAFQRVAAVQKTILSAVAAGSLINLATVLYLNAIRM  715
            KLA +I+RLEQGDLKLRVRALESERAFQRVAAVQKT+ SAVAAGSL+NLAT+LYLN+++ 
Sbjct  666  KLAVVIERLEQGDLKLRVRALESERAFQRVAAVQKTVGSAVAAGSLVNLATILYLNSLKT  725

Query  716  PAMAAYGLCAFFGFQVLIGIVKVKKIDQRERLITGTA  826
            PA  AY +CAFF  QVLIGI+KVKK DQRE+LITGTA
Sbjct  726  PATLAYTVCAFFSLQVLIGIIKVKKFDQREKLITGTA  762



>ref|XP_008809512.1| PREDICTED: uncharacterized aarF domain-containing protein kinase 
At1g79600, chloroplastic isoform X2 [Phoenix dactylifera]
 ref|XP_008809513.1| PREDICTED: uncharacterized aarF domain-containing protein kinase 
At1g79600, chloroplastic isoform X2 [Phoenix dactylifera]
Length=741

 Score =   437 bits (1125),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 220/275 (80%), Positives = 241/275 (88%), Gaps = 20/275 (7%)
 Frame = +2

Query  2    EGLLEVFYGVYEKDPDKVLQAMVQMGVLVPTGDMTAVRRTAQFFLNSFEERLATQRRERE  181
            EGLLE FYGVYEKDPDKVLQAM+QMGVLVPTGDMTAVRRTAQFFLNSFEERLA QR+ERE
Sbjct  487  EGLLETFYGVYEKDPDKVLQAMIQMGVLVPTGDMTAVRRTAQFFLNSFEERLAAQRKERE  546

Query  182  LAKAELGFKKPLTKEEKIEKKKQRLAAIGEDLLSIAADQPFRFPATFTFVVRAFSVLHGI  361
            +A  ELGFKKPL++EE++EKKKQRLAAIGEDLL+IAADQPFRFPATFTFVVRAFSVL GI
Sbjct  547  MATTELGFKKPLSREERLEKKKQRLAAIGEDLLAIAADQPFRFPATFTFVVRAFSVLDGI  606

Query  362  GKGLDPRFDITEIAKPYALELLRFREAGVEVILKDFKTRWDRQNRAFYNLFRQADRVEKL  541
            GKGLDPRFDITEIAKPYALELLRF+EAG EV++KDFK R +RQ+RAFYN+FRQADRVEKL
Sbjct  607  GKGLDPRFDITEIAKPYALELLRFQEAGFEVVVKDFKKRLERQSRAFYNIFRQADRVEKL  666

Query  542  AEIIQRLEQGDLKLRVRALESERAFQRVAAVQKTILSAVAAGSLINLATVLYLNAIRMPA  721
            AEIIQRLE+GDLKLRVR LESERAFQRVAAVQKTI +                    +PA
Sbjct  667  AEIIQRLEKGDLKLRVRTLESERAFQRVAAVQKTIGN--------------------VPA  706

Query  722  MAAYGLCAFFGFQVLIGIVKVKKIDQRERLITGTA  826
            M AY LCAFFG QVL GI+KVK++DQ+ERLITGTA
Sbjct  707  MTAYILCAFFGMQVLFGILKVKRLDQQERLITGTA  741



>ref|XP_010937035.1| PREDICTED: uncharacterized aarF domain-containing protein kinase 
At1g79600, chloroplastic isoform X2 [Elaeis guineensis]
Length=742

 Score =   433 bits (1114),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 218/275 (79%), Positives = 240/275 (87%), Gaps = 20/275 (7%)
 Frame = +2

Query  2    EGLLEVFYGVYEKDPDKVLQAMVQMGVLVPTGDMTAVRRTAQFFLNSFEERLATQRRERE  181
            EGLLE FYG+YEKDP+KVLQAM+QMGVLVPTGDMTAVRRTAQFFLNSFEERLA QR+ERE
Sbjct  488  EGLLEAFYGIYEKDPEKVLQAMIQMGVLVPTGDMTAVRRTAQFFLNSFEERLAAQRKERE  547

Query  182  LAKAELGFKKPLTKEEKIEKKKQRLAAIGEDLLSIAADQPFRFPATFTFVVRAFSVLHGI  361
            +A  ELGFKKPL++EE++EKKKQRLAAIGEDLL+IAADQPFRFPATFTFVVRAFSVL GI
Sbjct  548  MATTELGFKKPLSREERLEKKKQRLAAIGEDLLAIAADQPFRFPATFTFVVRAFSVLDGI  607

Query  362  GKGLDPRFDITEIAKPYALELLRFREAGVEVILKDFKTRWDRQNRAFYNLFRQADRVEKL  541
            GKGLDPRFDITEIAKPYALELLRFREAG EV++KD K R +RQ+RAFYNLFRQADRVEKL
Sbjct  608  GKGLDPRFDITEIAKPYALELLRFREAGFEVVVKDVKKRLERQSRAFYNLFRQADRVEKL  667

Query  542  AEIIQRLEQGDLKLRVRALESERAFQRVAAVQKTILSAVAAGSLINLATVLYLNAIRMPA  721
            AEII+RLE+GDLKLRVR LESERAFQRVAAVQKTI +                    +PA
Sbjct  668  AEIIERLEKGDLKLRVRTLESERAFQRVAAVQKTIGN--------------------VPA  707

Query  722  MAAYGLCAFFGFQVLIGIVKVKKIDQRERLITGTA  826
            M AY LCAFFG QVL GI+KVK++DQ+ERLITGTA
Sbjct  708  MTAYMLCAFFGMQVLFGILKVKRLDQQERLITGTA  742



>gb|EMS66269.1| hypothetical protein TRIUR3_01462 [Triticum urartu]
Length=831

 Score =   423 bits (1088),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 217/263 (83%), Positives = 239/263 (91%), Gaps = 4/263 (2%)
 Frame = +2

Query  2    EGLLEVFYGVYEKDPDKVLQAMVQMGVLVPTGDMTAVRRTAQFFLNSFEERLATQRRERE  181
            EGLLEVFYGVYEKDPDKVLQAMVQMGVLVPTGDMTAVRRTAQFFL+SFEERLA QR+ERE
Sbjct  455  EGLLEVFYGVYEKDPDKVLQAMVQMGVLVPTGDMTAVRRTAQFFLDSFEERLAAQRKERE  514

Query  182  LAKAELGFKKPLTKEEKIEKKKQRLAAIGEDLLSIAADQPFRFPATFTFVVRAFSVLHGI  361
            +A  E GFKK L+KEEK EKKKQRLAAIGEDLL+IAADQPFRFPATFTFVVRAFSVL GI
Sbjct  515  MATVEPGFKKQLSKEEKFEKKKQRLAAIGEDLLAIAADQPFRFPATFTFVVRAFSVLDGI  574

Query  362  GKGLDPRFDITEIAKPYALELLRFREAGVEVILKDFKTRWDRQNRAFYNLFRQADRVEKL  541
            GKGLDPRFDITEIAKPYA+ELLRF EAGVE    D + RWDRQ+RAFYN+FRQ DRVEKL
Sbjct  575  GKGLDPRFDITEIAKPYAMELLRFNEAGVE----DARKRWDRQSRAFYNVFRQPDRVEKL  630

Query  542  AEIIQRLEQGDLKLRVRALESERAFQRVAAVQKTILSAVAAGSLINLATVLYLNAIRMPA  721
            A+II+RLEQGDLKLRVRALESER+FQRVAAVQKTI   VAAGSL+NLAT+L+LN+IRMPA
Sbjct  631  AQIIERLEQGDLKLRVRALESERSFQRVAAVQKTIGYGVAAGSLVNLATILHLNSIRMPA  690

Query  722  MAAYGLCAFFGFQVLIGIVKVKK  790
               Y LCAFFG Q+L+G++K+ +
Sbjct  691  TIGYCLCAFFGLQILLGVLKLSE  713



>ref|XP_002533759.1| ATATH13, putative [Ricinus communis]
 gb|EEF28625.1| ATATH13, putative, partial [Ricinus communis]
Length=671

 Score =   417 bits (1071),  Expect = 5e-136, Method: Compositional matrix adjust.
 Identities = 213/237 (90%), Positives = 228/237 (96%), Gaps = 0/237 (0%)
 Frame = +2

Query  2    EGLLEVFYGVYEKDPDKVLQAMVQMGVLVPTGDMTAVRRTAQFFLNSFEERLATQRRERE  181
            EGLL+ FYG+YEKDPDKVLQAM+QMGVLVPTGDMTAVRRTAQFFLNSFEERLA QR+ERE
Sbjct  435  EGLLDAFYGIYEKDPDKVLQAMIQMGVLVPTGDMTAVRRTAQFFLNSFEERLAAQRKERE  494

Query  182  LAKAELGFKKPLTKEEKIEKKKQRLAAIGEDLLSIAADQPFRFPATFTFVVRAFSVLHGI  361
            +A AELGFKKPLTKEEKIEKKKQRLAAIGEDLL+IAADQPFRFPATFTFVVRAFSVL GI
Sbjct  495  MATAELGFKKPLTKEEKIEKKKQRLAAIGEDLLAIAADQPFRFPATFTFVVRAFSVLDGI  554

Query  362  GKGLDPRFDITEIAKPYALELLRFREAGVEVILKDFKTRWDRQNRAFYNLFRQADRVEKL  541
            GKGLDPRFDITEI+KPYALELLRFREAGVEV++KD + RWDRQ+RAFYNLFRQADRVE+L
Sbjct  555  GKGLDPRFDITEISKPYALELLRFREAGVEVLVKDIRKRWDRQSRAFYNLFRQADRVERL  614

Query  542  AEIIQRLEQGDLKLRVRALESERAFQRVAAVQKTILSAVAAGSLINLATVLYLNAIR  712
            AE IQRLEQGDLKLRVR LESERAFQRVAAVQKT+ SAVAAGSLINLAT+LYLN+IR
Sbjct  615  AETIQRLEQGDLKLRVRTLESERAFQRVAAVQKTVGSAVAAGSLINLATILYLNSIR  671



>ref|XP_006382922.1| hypothetical protein POPTR_0005s08490g [Populus trichocarpa]
 gb|ERP60719.1| hypothetical protein POPTR_0005s08490g [Populus trichocarpa]
Length=731

 Score =   415 bits (1066),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 214/238 (90%), Positives = 228/238 (96%), Gaps = 0/238 (0%)
 Frame = +2

Query  2    EGLLEVFYGVYEKDPDKVLQAMVQMGVLVPTGDMTAVRRTAQFFLNSFEERLATQRRERE  181
            EGLLE FYGVYEKDPDKVL+AMVQMGVLVPTGDMTAVRRTAQFFLNSFEERLA QRRERE
Sbjct  490  EGLLETFYGVYEKDPDKVLEAMVQMGVLVPTGDMTAVRRTAQFFLNSFEERLAAQRRERE  549

Query  182  LAKAELGFKKPLTKEEKIEKKKQRLAAIGEDLLSIAADQPFRFPATFTFVVRAFSVLHGI  361
            +A  ELGFKK LTKEEK+EKKKQRLAAIGEDLLSIAADQPFRFPATFTFVVRAFSVL GI
Sbjct  550  MATTELGFKKQLTKEEKMEKKKQRLAAIGEDLLSIAADQPFRFPATFTFVVRAFSVLDGI  609

Query  362  GKGLDPRFDITEIAKPYALELLRFREAGVEVILKDFKTRWDRQNRAFYNLFRQADRVEKL  541
            GKGLDPRFDITEIAKPYALELLRFREAGVEV+LKDF+ RWDRQ+RAF+NLFRQADRV+KL
Sbjct  610  GKGLDPRFDITEIAKPYALELLRFREAGVEVLLKDFRKRWDRQSRAFHNLFRQADRVQKL  669

Query  542  AEIIQRLEQGDLKLRVRALESERAFQRVAAVQKTILSAVAAGSLINLATVLYLNAIRM  715
            AE IQRLEQGDLKLRVR LE+ERAFQRVAAVQKT+ SAVAAGSLINLAT+L+LN+IR+
Sbjct  670  AETIQRLEQGDLKLRVRTLEAERAFQRVAAVQKTVGSAVAAGSLINLATILFLNSIRV  727



>ref|XP_003602471.1| ABC transporter-like protein [Medicago truncatula]
Length=666

 Score =   412 bits (1059),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 208/240 (87%), Positives = 225/240 (94%), Gaps = 0/240 (0%)
 Frame = +2

Query  2    EGLLEVFYGVYEKDPDKVLQAMVQMGVLVPTGDMTAVRRTAQFFLNSFEERLATQRRERE  181
            EGLLE FYGVYEKDPD+VLQ+M+QMGVLVPTGDMTAVRRTAQFFLNSFEERLA QR+E+E
Sbjct  411  EGLLETFYGVYEKDPDRVLQSMIQMGVLVPTGDMTAVRRTAQFFLNSFEERLAAQRKEKE  470

Query  182  LAKAELGFKKPLTKEEKIEKKKQRLAAIGEDLLSIAADQPFRFPATFTFVVRAFSVLHGI  361
             A  ELGFKKPL+KEEK+ KKKQRLAAIGEDLLSI++DQPFRFPATFTFVVRAFSVL GI
Sbjct  471  EATGELGFKKPLSKEEKMMKKKQRLAAIGEDLLSISSDQPFRFPATFTFVVRAFSVLDGI  530

Query  362  GKGLDPRFDITEIAKPYALELLRFREAGVEVILKDFKTRWDRQNRAFYNLFRQADRVEKL  541
            GKGLDPRFDITEIAKPYALELLRFREAGVEV+LKDF  RWDRQ++AFYNLFRQADRV+KL
Sbjct  531  GKGLDPRFDITEIAKPYALELLRFREAGVEVVLKDFTKRWDRQSQAFYNLFRQADRVDKL  590

Query  542  AEIIQRLEQGDLKLRVRALESERAFQRVAAVQKTILSAVAAGSLINLATVLYLNAIRMPA  721
            A IIQRLEQGDLKLRVR LESERAFQRVA VQKTI +AVAAGSLINLAT+LYLN+IR+  
Sbjct  591  ASIIQRLEQGDLKLRVRTLESERAFQRVATVQKTIGNAVAAGSLINLATILYLNSIRVSC  650



>gb|AES72722.2| ABC transporter-like protein [Medicago truncatula]
Length=725

 Score =   411 bits (1057),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 208/240 (87%), Positives = 225/240 (94%), Gaps = 0/240 (0%)
 Frame = +2

Query  2    EGLLEVFYGVYEKDPDKVLQAMVQMGVLVPTGDMTAVRRTAQFFLNSFEERLATQRRERE  181
            EGLLE FYGVYEKDPD+VLQ+M+QMGVLVPTGDMTAVRRTAQFFLNSFEERLA QR+E+E
Sbjct  470  EGLLETFYGVYEKDPDRVLQSMIQMGVLVPTGDMTAVRRTAQFFLNSFEERLAAQRKEKE  529

Query  182  LAKAELGFKKPLTKEEKIEKKKQRLAAIGEDLLSIAADQPFRFPATFTFVVRAFSVLHGI  361
             A  ELGFKKPL+KEEK+ KKKQRLAAIGEDLLSI++DQPFRFPATFTFVVRAFSVL GI
Sbjct  530  EATGELGFKKPLSKEEKMMKKKQRLAAIGEDLLSISSDQPFRFPATFTFVVRAFSVLDGI  589

Query  362  GKGLDPRFDITEIAKPYALELLRFREAGVEVILKDFKTRWDRQNRAFYNLFRQADRVEKL  541
            GKGLDPRFDITEIAKPYALELLRFREAGVEV+LKDF  RWDRQ++AFYNLFRQADRV+KL
Sbjct  590  GKGLDPRFDITEIAKPYALELLRFREAGVEVVLKDFTKRWDRQSQAFYNLFRQADRVDKL  649

Query  542  AEIIQRLEQGDLKLRVRALESERAFQRVAAVQKTILSAVAAGSLINLATVLYLNAIRMPA  721
            A IIQRLEQGDLKLRVR LESERAFQRVA VQKTI +AVAAGSLINLAT+LYLN+IR+  
Sbjct  650  ASIIQRLEQGDLKLRVRTLESERAFQRVATVQKTIGNAVAAGSLINLATILYLNSIRVSC  709



>ref|XP_006428062.1| hypothetical protein CICLE_v10024947mg [Citrus clementina]
 gb|ESR41302.1| hypothetical protein CICLE_v10024947mg [Citrus clementina]
Length=730

 Score =   411 bits (1057),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 213/237 (90%), Positives = 224/237 (95%), Gaps = 0/237 (0%)
 Frame = +2

Query  2    EGLLEVFYGVYEKDPDKVLQAMVQMGVLVPTGDMTAVRRTAQFFLNSFEERLATQRRERE  181
            EGLLE FYGVYEKD DKVLQAMVQMGVLVPTGD TAVRRTAQFFLNSFEERLA QR+ERE
Sbjct  492  EGLLETFYGVYEKDADKVLQAMVQMGVLVPTGDTTAVRRTAQFFLNSFEERLAAQRKERE  551

Query  182  LAKAELGFKKPLTKEEKIEKKKQRLAAIGEDLLSIAADQPFRFPATFTFVVRAFSVLHGI  361
            +   ELGFKKPL+KEEKIEKKKQRLAAIGEDLL+IAADQPFRFPATFTFVVRAFSVL GI
Sbjct  552  ITTQELGFKKPLSKEEKIEKKKQRLAAIGEDLLAIAADQPFRFPATFTFVVRAFSVLDGI  611

Query  362  GKGLDPRFDITEIAKPYALELLRFREAGVEVILKDFKTRWDRQNRAFYNLFRQADRVEKL  541
            GKGLDPRFDITEIAKPYA+ELL+FREAGVEVILKDF+ RWDRQ RAFYNLFRQADRVEKL
Sbjct  612  GKGLDPRFDITEIAKPYAMELLKFREAGVEVILKDFRNRWDRQTRAFYNLFRQADRVEKL  671

Query  542  AEIIQRLEQGDLKLRVRALESERAFQRVAAVQKTILSAVAAGSLINLATVLYLNAIR  712
            AE IQRLEQGDLKLRVR LESERAFQRVAAVQKT+ SAVAAGSL+NLAT+LYLN+IR
Sbjct  672  AETIQRLEQGDLKLRVRTLESERAFQRVAAVQKTVGSAVAAGSLVNLATILYLNSIR  728



>ref|XP_001766214.1| predicted protein [Physcomitrella patens]
 gb|EDQ68846.1| predicted protein, partial [Physcomitrella patens]
Length=605

 Score =   405 bits (1042),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 212/278 (76%), Positives = 243/278 (87%), Gaps = 3/278 (1%)
 Frame = +2

Query  2    EGLLEVFYGVYEKDPDKVLQAMVQMGVLVPTGDMTAVRRTAQFFLNSFEERLATQRRERE  181
            EGLLEVFYGVYEKDPDKVL AMVQMGVLVP+ D+TAVRRTAQFFLNSFEERLA QR E+E
Sbjct  328  EGLLEVFYGVYEKDPDKVLAAMVQMGVLVPSSDLTAVRRTAQFFLNSFEERLAAQRAEKE  387

Query  182  LAKAE---LGFKKPLTKEEKIEKKKQRLAAIGEDLLSIAADQPFRFPATFTFVVRAFSVL  352
              +AE   LGFKK LTKEEK EKKK RLAAIGEDLLSI ADQPFRFPATFTFVVRAFSVL
Sbjct  388  RMEAESKKLGFKKQLTKEEKAEKKKLRLAAIGEDLLSIGADQPFRFPATFTFVVRAFSVL  447

Query  353  HGIGKGLDPRFDITEIAKPYALELLRFREAGVEVILKDFKTRWDRQNRAFYNLFRQADRV  532
             GIGKGLDPRFDI+EIAKPYALELLRFREAGVEV++KD + RWDRQ++AF N+FRQADRV
Sbjct  448  DGIGKGLDPRFDISEIAKPYALELLRFREAGVEVVVKDLRKRWDRQSQAFVNVFRQADRV  507

Query  533  EKLAEIIQRLEQGDLKLRVRALESERAFQRVAAVQKTILSAVAAGSLINLATVLYLNAIR  712
            EK++ +IQRLEQGDLKLRVR LESERAF+RVA +Q+TI  A+ A + + +AT+L+L+AI 
Sbjct  508  EKISNMIQRLEQGDLKLRVRVLESERAFKRVATMQQTIGQAILAATCLQIATMLHLSAIT  567

Query  713  MPAMAAYGLCAFFGFQVLIGIVKVKKIDQRERLITGTA  826
            +PA AA+   A FG Q  IGI+KVKK+D++E+LITGTA
Sbjct  568  VPATAAFTGSALFGLQAFIGIMKVKKLDKQEKLITGTA  605



>ref|XP_006380463.1| hypothetical protein POPTR_0007s064502g, partial [Populus trichocarpa]
 gb|ERP58260.1| hypothetical protein POPTR_0007s064502g, partial [Populus trichocarpa]
Length=228

 Score =   385 bits (990),  Expect = 5e-130, Method: Compositional matrix adjust.
 Identities = 190/228 (83%), Positives = 211/228 (93%), Gaps = 0/228 (0%)
 Frame = +2

Query  143  FEERLATQRRERELAKAELGFKKPLTKEEKIEKKKQRLAAIGEDLLSIAADQPFRFPATF  322
            FEERLA QRRE E+  A+LGFKKPL+K+EKIEKKKQRLAAIGEDLLSIAADQPFRFPATF
Sbjct  1    FEERLAAQRREGEIETAQLGFKKPLSKDEKIEKKKQRLAAIGEDLLSIAADQPFRFPATF  60

Query  323  TFVVRAFSVLHGIGKGLDPRFDITEIAKPYALELLRFREAGVEVILKDFKTRWDRQNRAF  502
            TFVVRAFSVL GIGKGLDPRFDITEIAKPYALELL+FREAGVEV+LKDF+ RWDRQ+RA 
Sbjct  61   TFVVRAFSVLDGIGKGLDPRFDITEIAKPYALELLKFREAGVEVLLKDFRKRWDRQSRAI  120

Query  503  YNLFRQADRVEKLAEIIQRLEQGDLKLRVRALESERAFQRVAAVQKTILSAVAAGSLINL  682
            YNLFRQADRV+KLA+ IQRLEQGDLKLRVR LE+ERAFQRVAAVQK + SAVA GSL+NL
Sbjct  121  YNLFRQADRVQKLADTIQRLEQGDLKLRVRTLEAERAFQRVAAVQKIVGSAVAVGSLVNL  180

Query  683  ATVLYLNAIRMPAMAAYGLCAFFGFQVLIGIVKVKKIDQRERLITGTA  826
            AT+LYLN+IR+PA+AA   CAFF FQVL G++KVKK+DQ+ERLITGTA
Sbjct  181  ATILYLNSIRVPAIAASIFCAFFSFQVLFGLIKVKKLDQQERLITGTA  228



>ref|XP_002989389.1| hypothetical protein SELMODRAFT_235769 [Selaginella moellendorffii]
 gb|EFJ09480.1| hypothetical protein SELMODRAFT_235769 [Selaginella moellendorffii]
Length=622

 Score =   393 bits (1009),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 192/275 (70%), Positives = 234/275 (85%), Gaps = 0/275 (0%)
 Frame = +2

Query  2    EGLLEVFYGVYEKDPDKVLQAMVQMGVLVPTGDMTAVRRTAQFFLNSFEERLATQRRERE  181
            EGLLE FYGVYEKD DKVL+AMVQMGVLVPTGDMTAVRRTAQFFL SF++RLA Q+ ++ 
Sbjct  348  EGLLEAFYGVYEKDADKVLEAMVQMGVLVPTGDMTAVRRTAQFFLKSFQDRLAAQKEQKA  407

Query  182  LAKAELGFKKPLTKEEKIEKKKQRLAAIGEDLLSIAADQPFRFPATFTFVVRAFSVLHGI  361
            LA++E    K L+K E+ +KKK RLAAIGEDLLSI++DQPFRFPATFTFVVRAFSVL GI
Sbjct  408  LAESEESGYKRLSKGEREDKKKLRLAAIGEDLLSISSDQPFRFPATFTFVVRAFSVLDGI  467

Query  362  GKGLDPRFDITEIAKPYALELLRFREAGVEVILKDFKTRWDRQNRAFYNLFRQADRVEKL  541
            GKGLDP FDI+EIAKPYALE+LRFRE G +V+++DFK RW RQ  AF NLFRQ DRV KL
Sbjct  468  GKGLDPYFDISEIAKPYALEILRFREVGYDVVIRDFKKRWQRQAEAFNNLFRQPDRVAKL  527

Query  542  AEIIQRLEQGDLKLRVRALESERAFQRVAAVQKTILSAVAAGSLINLATVLYLNAIRMPA  721
            A++I+RLEQGDLKLRVR LESER+F+RV+AVQ+ I  AV AG+ +NL T+LY+NA+R+  
Sbjct  528  ADVIERLEQGDLKLRVRTLESERSFKRVSAVQQNIAQAVFAGTFLNLGTLLYINAMRVQG  587

Query  722  MAAYGLCAFFGFQVLIGIVKVKKIDQRERLITGTA  826
             AA+   A FG ++L+G+ KVK++D++E+LITGTA
Sbjct  588  TAAFFCSALFGLKLLVGLFKVKRLDKQEKLITGTA  622



>ref|XP_002962434.1| hypothetical protein SELMODRAFT_78366 [Selaginella moellendorffii]
 gb|EFJ35897.1| hypothetical protein SELMODRAFT_78366 [Selaginella moellendorffii]
Length=603

 Score =   391 bits (1005),  Expect = 6e-127, Method: Compositional matrix adjust.
 Identities = 191/274 (70%), Positives = 233/274 (85%), Gaps = 0/274 (0%)
 Frame = +2

Query  2    EGLLEVFYGVYEKDPDKVLQAMVQMGVLVPTGDMTAVRRTAQFFLNSFEERLATQRRERE  181
            EGLLE FYGVYEKD DKVL+AMVQMGVLVPTGDMTAVRRTAQFFL SF++RLA Q+ ++ 
Sbjct  329  EGLLEAFYGVYEKDADKVLEAMVQMGVLVPTGDMTAVRRTAQFFLKSFQDRLAAQKEQKA  388

Query  182  LAKAELGFKKPLTKEEKIEKKKQRLAAIGEDLLSIAADQPFRFPATFTFVVRAFSVLHGI  361
            LA++E    K L+K E+ +KKK RLAAIGEDLLSI++DQPFRFPATFTFVVRAFSVL GI
Sbjct  389  LAESEESGYKRLSKGEREDKKKLRLAAIGEDLLSISSDQPFRFPATFTFVVRAFSVLDGI  448

Query  362  GKGLDPRFDITEIAKPYALELLRFREAGVEVILKDFKTRWDRQNRAFYNLFRQADRVEKL  541
            GKGLDP FDI+EIAKPYALE+LRFRE G +V+++DFK RW RQ  AF NLFRQ DRV KL
Sbjct  449  GKGLDPYFDISEIAKPYALEILRFREVGYDVVIRDFKKRWQRQAEAFNNLFRQPDRVAKL  508

Query  542  AEIIQRLEQGDLKLRVRALESERAFQRVAAVQKTILSAVAAGSLINLATVLYLNAIRMPA  721
            A++I+RLEQGDLKLRVR LESER+F+RV+AVQ+ I  AV AG+ +NL T+LY+NA+R+  
Sbjct  509  ADVIERLEQGDLKLRVRTLESERSFKRVSAVQQNIAQAVFAGTFLNLGTLLYINAMRVQG  568

Query  722  MAAYGLCAFFGFQVLIGIVKVKKIDQRERLITGT  823
             AA+   A FG ++L+G+ KVK++D++E+LITGT
Sbjct  569  TAAFFCSALFGLKLLVGLFKVKRLDKQEKLITGT  602



>gb|KCW62173.1| hypothetical protein EUGRSUZ_H04831 [Eucalyptus grandis]
Length=840

 Score =   386 bits (991),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 203/247 (82%), Positives = 220/247 (89%), Gaps = 1/247 (0%)
 Frame = +2

Query  2    EGLLEVFYGVYEKDPDKVLQAMVQMGVLVPTGDMTAVRRTAQFFLNSFEERLATQRRERE  181
            EGLLE FYGVYEKDPDKVLQAM+QMGVLVPTGDMTAVRRTAQFFLNSFEERLA QRRE E
Sbjct  512  EGLLETFYGVYEKDPDKVLQAMIQMGVLVPTGDMTAVRRTAQFFLNSFEERLAAQRREAE  571

Query  182  LAKAELGFKKPLTKEEKIEKKKQRLAAIGEDLLSIAADQPFRFPATFTFVVRAFSVLHGI  361
            +A AELGFKKPL+KEEKIEKKKQRLAAIGEDLL+IAADQPFRFPATFTFVVRAFSVL GI
Sbjct  572  MATAELGFKKPLSKEEKIEKKKQRLAAIGEDLLAIAADQPFRFPATFTFVVRAFSVLDGI  631

Query  362  GKGLDPRFDITEIAKPYALELLRFREAGVEVILKDFKTRWDRQNRAFYNLFRQADRVEKL  541
            GKGLDPRFDITEIAKPYALELL+FREAGVEVILKDF+ RWDRQ+RAFYNLFRQADRVEKL
Sbjct  632  GKGLDPRFDITEIAKPYALELLKFREAGVEVILKDFRKRWDRQSRAFYNLFRQADRVEKL  691

Query  542  AEIIQRLEQGDLKLRVRALESERAFQRVAAVQKTILSAVAAGSLINLATVLYLNAIRMPA  721
            AEIIQRLEQGDLKLRVR LESERAFQRVAAVQKT+ +   +    +     +++     A
Sbjct  692  AEIIQRLEQGDLKLRVRTLESERAFQRVAAVQKTVGNVSCSCWKPDEPCNTFVSQFNSSA  751

Query  722  MAAYGLC  742
             ++ G+C
Sbjct  752  CSS-GIC  757



>gb|ABK94805.1| unknown [Populus trichocarpa]
Length=198

 Score =   349 bits (895),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 172/198 (87%), Positives = 188/198 (95%), Gaps = 0/198 (0%)
 Frame = +2

Query  233  IEKKKQRLAAIGEDLLSIAADQPFRFPATFTFVVRAFSVLHGIGKGLDPRFDITEIAKPY  412
            +EKKKQRLAAIGEDLLSIAADQPFRFPATFTFVVRAFSVL GIGKGLDPRFDITEIAKPY
Sbjct  1    MEKKKQRLAAIGEDLLSIAADQPFRFPATFTFVVRAFSVLDGIGKGLDPRFDITEIAKPY  60

Query  413  ALELLRFREAGVEVILKDFKTRWDRQNRAFYNLFRQADRVEKLAEIIQRLEQGDLKLRVR  592
            ALELLRFREAGVEV+LKDF+ RWDRQ+RAF+NLFRQADRV+KLAE IQRLEQGDLKLRVR
Sbjct  61   ALELLRFREAGVEVLLKDFRKRWDRQSRAFHNLFRQADRVQKLAETIQRLEQGDLKLRVR  120

Query  593  ALESERAFQRVAAVQKTILSAVAAGSLINLATVLYLNAIRMPAMAAYGLCAFFGFQVLIG  772
             LE+ERAFQRVAAVQKT+ SAVAAGSLINLAT+L+LN+IR+PA AA  LCAFF FQVL G
Sbjct  121  TLEAERAFQRVAAVQKTVGSAVAAGSLINLATILFLNSIRVPATAASILCAFFSFQVLFG  180

Query  773  IVKVKKIDQRERLITGTA  826
            I+KVK++DQ+ERLITGTA
Sbjct  181  IIKVKRLDQQERLITGTA  198



>gb|EMT33740.1| hypothetical protein F775_00845 [Aegilops tauschii]
Length=736

 Score =   362 bits (929),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 188/260 (72%), Positives = 210/260 (81%), Gaps = 18/260 (7%)
 Frame = +2

Query  2    EGLLEVFYGVYEKDPDKVLQAMVQMGVLVPTGDMTAVRRTAQFFLNSFEERLATQRRERE  181
            EGLLEVFYGVYEKDPDKVLQAMVQMGVLVPTGDMTAVRRTAQFFL+   +R   ++    
Sbjct  487  EGLLEVFYGVYEKDPDKVLQAMVQMGVLVPTGDMTAVRRTAQFFLDRGHDR---RKHAIH  543

Query  182  LAKAELGFKKPLTKEEKIEKKKQRLAAIGEDLLSIAADQPFRFPATFTFVVRAFSVLHGI  361
            +    L F   L +              GEDLL+IAADQPFRFPATFTFVVRAFSVL GI
Sbjct  544  VILLVLLFCFNLHQN-----------FTGEDLLAIAADQPFRFPATFTFVVRAFSVLDGI  592

Query  362  GKGLDPRFDITEIAKPYALELLRFREAGVEVILKDFKTRWDRQNRAFYNLFRQADRVEKL  541
            GKGLDPRFDITEIAKPYA+ELLRF EAGVE    D + RWDRQ+RAFYN+FRQ DRVEKL
Sbjct  593  GKGLDPRFDITEIAKPYAMELLRFNEAGVE----DARKRWDRQSRAFYNVFRQPDRVEKL  648

Query  542  AEIIQRLEQGDLKLRVRALESERAFQRVAAVQKTILSAVAAGSLINLATVLYLNAIRMPA  721
            A+II+RLEQGDLKLRVRALESER+FQRVAAVQKTI   VAAGSL+NLAT+L+LN+IRMPA
Sbjct  649  AQIIERLEQGDLKLRVRALESERSFQRVAAVQKTIGYGVAAGSLVNLATILHLNSIRMPA  708

Query  722  MAAYGLCAFFGFQVLIGIVK  781
               Y LCAFFG Q+L+G++K
Sbjct  709  TIGYCLCAFFGLQILLGVLK  728



>gb|KDO59967.1| hypothetical protein CISIN_1g0041151mg, partial [Citrus sinensis]
 gb|KDO59968.1| hypothetical protein CISIN_1g0041151mg, partial [Citrus sinensis]
 gb|KDO59969.1| hypothetical protein CISIN_1g0041151mg, partial [Citrus sinensis]
 gb|KDO59970.1| hypothetical protein CISIN_1g0041151mg, partial [Citrus sinensis]
 gb|KDO59971.1| hypothetical protein CISIN_1g0041151mg, partial [Citrus sinensis]
 gb|KDO59972.1| hypothetical protein CISIN_1g0041151mg, partial [Citrus sinensis]
Length=186

 Score =   333 bits (853),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 162/186 (87%), Positives = 175/186 (94%), Gaps = 0/186 (0%)
 Frame = +2

Query  269  EDLLSIAADQPFRFPATFTFVVRAFSVLHGIGKGLDPRFDITEIAKPYALELLRFREAGV  448
            EDLL+IAADQPFRFPATFTFVVRAFSVL GIGKGLDPRFDITEIAKPYA+ELL+FREAGV
Sbjct  1    EDLLAIAADQPFRFPATFTFVVRAFSVLDGIGKGLDPRFDITEIAKPYAMELLKFREAGV  60

Query  449  EVILKDFKTRWDRQNRAFYNLFRQADRVEKLAEIIQRLEQGDLKLRVRALESERAFQRVA  628
            EVILKDF+ RWDRQ RAFYNLFRQADRVEKLAE IQRLEQGDLKLRVR LESERAFQRVA
Sbjct  61   EVILKDFRNRWDRQTRAFYNLFRQADRVEKLAETIQRLEQGDLKLRVRTLESERAFQRVA  120

Query  629  AVQKTILSAVAAGSLINLATVLYLNAIRMPAMAAYGLCAFFGFQVLIGIVKVKKIDQRER  808
            AVQKT+ SAV AGSL+NLAT+LYLN+IR+PA+ AY  CAFFGFQVL GI+KVKK+DQRE+
Sbjct  121  AVQKTVGSAVGAGSLVNLATILYLNSIRVPAILAYVSCAFFGFQVLFGIIKVKKLDQREK  180

Query  809  LITGTA  826
            LITGTA
Sbjct  181  LITGTA  186



>gb|EPS65160.1| hypothetical protein M569_09620, partial [Genlisea aurea]
Length=195

 Score =   328 bits (840),  Expect = 7e-108, Method: Compositional matrix adjust.
 Identities = 166/195 (85%), Positives = 177/195 (91%), Gaps = 8/195 (4%)
 Frame = +2

Query  266  GEDLLSIAADQPFRFPATFTFVVRAFSVLHGIGKGLDPRFDITEIAKPYALELLRFREAG  445
            GEDLL+IAADQPFRFPATFTFVVRAFSVL GIGKGLDPRFDITEIAKPYALELL+FREAG
Sbjct  1    GEDLLAIAADQPFRFPATFTFVVRAFSVLDGIGKGLDPRFDITEIAKPYALELLKFREAG  60

Query  446  VEVILK--------DFKTRWDRQNRAFYNLFRQADRVEKLAEIIQRLEQGDLKLRVRALE  601
             EVILK        DFK RWDRQ+RAFYNLFRQADR+EKLAEIIQRLEQGDLKLRVRALE
Sbjct  61   FEVILKACFLDCLNDFKKRWDRQSRAFYNLFRQADRIEKLAEIIQRLEQGDLKLRVRALE  120

Query  602  SERAFQRVAAVQKTILSAVAAGSLINLATVLYLNAIRMPAMAAYGLCAFFGFQVLIGIVK  781
            SERAFQRVAAVQ TI SAVAAGSLINLAT+LYLN+IR PAM AY L AFFG +VLIGIVK
Sbjct  121  SERAFQRVAAVQTTIGSAVAAGSLINLATILYLNSIRTPAMVAYSLFAFFGLKVLIGIVK  180

Query  782  VKKIDQRERLITGTA  826
            VK++D+RERL+TGTA
Sbjct  181  VKRLDERERLVTGTA  195



>gb|KDO59973.1| hypothetical protein CISIN_1g0041151mg, partial [Citrus sinensis]
Length=185

 Score =   326 bits (836),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 161/186 (87%), Positives = 174/186 (94%), Gaps = 1/186 (1%)
 Frame = +2

Query  269  EDLLSIAADQPFRFPATFTFVVRAFSVLHGIGKGLDPRFDITEIAKPYALELLRFREAGV  448
            EDLL+IAADQPFRFPATFTFVVRAFSVL GIGKGLDPRFDITEIAKPYA+ELL+FREAGV
Sbjct  1    EDLLAIAADQPFRFPATFTFVVRAFSVLDGIGKGLDPRFDITEIAKPYAMELLKFREAGV  60

Query  449  EVILKDFKTRWDRQNRAFYNLFRQADRVEKLAEIIQRLEQGDLKLRVRALESERAFQRVA  628
            EVILKDF+ RWDRQ RAFYNLFRQADRVEKLAE IQRL QGDLKLRVR LESERAFQRVA
Sbjct  61   EVILKDFRNRWDRQTRAFYNLFRQADRVEKLAETIQRL-QGDLKLRVRTLESERAFQRVA  119

Query  629  AVQKTILSAVAAGSLINLATVLYLNAIRMPAMAAYGLCAFFGFQVLIGIVKVKKIDQRER  808
            AVQKT+ SAV AGSL+NLAT+LYLN+IR+PA+ AY  CAFFGFQVL GI+KVKK+DQRE+
Sbjct  120  AVQKTVGSAVGAGSLVNLATILYLNSIRVPAILAYVSCAFFGFQVLFGIIKVKKLDQREK  179

Query  809  LITGTA  826
            LITGTA
Sbjct  180  LITGTA  185



>ref|XP_001693469.1| ABC-1-like kinase [Chlamydomonas reinhardtii]
 gb|EDP08723.1| ABC-1-like kinase, partial [Chlamydomonas reinhardtii]
Length=600

 Score =   282 bits (721),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 148/274 (54%), Positives = 196/274 (72%), Gaps = 2/274 (1%)
 Frame = +2

Query  5    GLLEVFYGVYEKDPDKVLQAMVQMGVLVPTGDMTAVRRTAQFFLNSFEERLATQRREREL  184
            GLLE+FYGVY +DPD+ L+A+  MGV VP+GD TAVRRTA+FFL  F++RLATQR ERE+
Sbjct  324  GLLELFYGVYNRDPDRCLEALTAMGVYVPSGDKTAVRRTAEFFLKGFQDRLATQRAEREV  383

Query  185  AKAELG--FKKPLTKEEKIEKKKQRLAAIGEDLLSIAADQPFRFPATFTFVVRAFSVLHG  358
               +    FK   +K+E  E++KQ L++IGEDLL  A DQPFRFPATFTFVVR+F+VL G
Sbjct  384  KGDDYSKSFKPQRSKDEAKERRKQILSSIGEDLLLAANDQPFRFPATFTFVVRSFTVLDG  443

Query  359  IGKGLDPRFDITEIAKPYALELLRFREAGVEVILKDFKTRWDRQNRAFYNLFRQADRVEK  538
            IGK LDPRFDI+EIA PYA ELL           K+F     +QNRA  NLF   +++E 
Sbjct  444  IGKSLDPRFDISEIAAPYARELLLEGNPVGAKFQKEFAKGLQQQNRALKNLFVGPNKIED  503

Query  539  LAEIIQRLEQGDLKLRVRALESERAFQRVAAVQKTILSAVAAGSLINLATVLYLNAIRMP  718
            +A  +QRLE+GDLKLRVRALE+ERA  RV A Q+ I +A+AA +L+N+ TVL ++A+   
Sbjct  504  IALTMQRLERGDLKLRVRALEAERALTRVQAWQRVIAAALAASTLVNIGTVLSVSALTAG  563

Query  719  AMAAYGLCAFFGFQVLIGIVKVKKIDQRERLITG  820
            A A++   A FGF +L   + V K++++E  ++G
Sbjct  564  ATASFAGAALFGFMLLKNWLTVVKLEKKELQLSG  597



>ref|XP_002949242.1| hypothetical protein VOLCADRAFT_104180 [Volvox carteri f. nagariensis]
 gb|EFJ49735.1| hypothetical protein VOLCADRAFT_104180 [Volvox carteri f. nagariensis]
Length=1007

 Score =   275 bits (703),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 146/286 (51%), Positives = 196/286 (69%), Gaps = 13/286 (5%)
 Frame = +2

Query  2     EGLLEVFYGVYEKDPDKVLQAMVQMGVLVPTGDMTAVRRTAQFFLNSFEERLATQRRERE  181
              GLLE+FYGVY +DPD+ L+A+  MGV +PTGD TAVRRTA+FFL  F+ERL +QR ERE
Sbjct  719   SGLLELFYGVYNRDPDRCLEALTTMGVYLPTGDKTAVRRTAEFFLKGFQERLDSQRAERE  778

Query  182   L-------------AKAELGFKKPLTKEEKIEKKKQRLAAIGEDLLSIAADQPFRFPATF  322
                            KA  G  +    +E  E+++Q LA+IGEDLL  A DQPFRFPATF
Sbjct  779   AKGVDYNKSFKPQRTKASAGSFREERHDEAKERRRQILASIGEDLLLAANDQPFRFPATF  838

Query  323   TFVVRAFSVLHGIGKGLDPRFDITEIAKPYALELLRFREAGVEVILKDFKTRWDRQNRAF  502
             TFVVR+F+VL GIGK LDPRFDI+EIA PYA ELL         + ++FK   + QNRA 
Sbjct  839   TFVVRSFTVLDGIGKSLDPRFDISEIAAPYARELLLEGNPVGSKLQREFKKGLENQNRAL  898

Query  503   YNLFRQADRVEKLAEIIQRLEQGDLKLRVRALESERAFQRVAAVQKTILSAVAAGSLINL  682
              NLF   ++++ +A  +QRLE+GDLKLRVRALE+ERA  RV A Q+ I +A+AA +L+N+
Sbjct  899   KNLFVGPNKIDDIAVTMQRLERGDLKLRVRALEAERALTRVQAWQRVIAAALAASTLVNI  958

Query  683   ATVLYLNAIRMPAMAAYGLCAFFGFQVLIGIVKVKKIDQRERLITG  820
              TVL ++A+   A A++   A FGF +L   +KV +++++E  ++G
Sbjct  959   GTVLSVSALTTGATASFVGAALFGFMLLKNYLKVLQLEKKELQLSG  1004



>ref|XP_005646355.1| ABC-1-like kinase [Coccomyxa subellipsoidea C-169]
 gb|EIE21811.1| ABC-1-like kinase [Coccomyxa subellipsoidea C-169]
Length=643

 Score =   264 bits (675),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 144/274 (53%), Positives = 193/274 (70%), Gaps = 3/274 (1%)
 Frame = +2

Query  5    GLLEVFYGVYEKDPDKVLQAMVQMGVLVPTGDMTAVRRTAQFFLNSFEERLATQRREREL  184
            GLLE+FYGVY+KDPD+ ++A++ MGVLVP GD  AVRRTA FFL SFEERL  Q+ E + 
Sbjct  370  GLLELFYGVYQKDPDRCIEALISMGVLVPGGDRVAVRRTAVFFLKSFEERLQQQKEEAK-  428

Query  185  AKAELG--FKKPLTKEEKIEKKKQRLAAIGEDLLSIAADQPFRFPATFTFVVRAFSVLHG  358
               E G  FK  L+K+EK  ++KQ LA IGEDLL  +AD+PFRFPATFTFVVR+F+VL G
Sbjct  429  NNPEYGATFKNQLSKDEKKVRRKQILANIGEDLLVASADKPFRFPATFTFVVRSFTVLDG  488

Query  359  IGKGLDPRFDITEIAKPYALELLRFREAGVEVILKDFKTRWDRQNRAFYNLFRQADRVEK  538
            IGKGLDPRFDI+EIA PYA  L+   +     + +DF  R   QNRA  NLFR  + +E 
Sbjct  489  IGKGLDPRFDISEIAAPYARSLILEAKPQFAKLQQDFNKRLATQNRAVVNLFRGPNMIED  548

Query  539  LAEIIQRLEQGDLKLRVRALESERAFQRVAAVQKTILSAVAAGSLINLATVLYLNAIRMP  718
            +A  ++RLE GDLKLRVRAL++ERA  RV A Q  + S + AG+++N+ T+  ++A+   
Sbjct  549  VAVTMRRLEDGDLKLRVRALDAERALTRVLANQNMMSSMLLAGTMMNIGTLFSVSAMASA  608

Query  719  AMAAYGLCAFFGFQVLIGIVKVKKIDQRERLITG  820
            A A++   + FGF  L+  +KVK ++++E  + G
Sbjct  609  ATASFVGASVFGFFSLVNFLKVKNLEKKEAQLLG  642



>gb|KDO59974.1| hypothetical protein CISIN_1g0041151mg, partial [Citrus sinensis]
Length=134

 Score =   241 bits (616),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 119/134 (89%), Positives = 125/134 (93%), Gaps = 0/134 (0%)
 Frame = +2

Query  269  EDLLSIAADQPFRFPATFTFVVRAFSVLHGIGKGLDPRFDITEIAKPYALELLRFREAGV  448
            EDLL+IAADQPFRFPATFTFVVRAFSVL GIGKGLDPRFDITEIAKPYA+ELL+FREAGV
Sbjct  1    EDLLAIAADQPFRFPATFTFVVRAFSVLDGIGKGLDPRFDITEIAKPYAMELLKFREAGV  60

Query  449  EVILKDFKTRWDRQNRAFYNLFRQADRVEKLAEIIQRLEQGDLKLRVRALESERAFQRVA  628
            EVILKDF+ RWDRQ RAFYNLFRQADRVEKLAE IQRLEQGDLKLRVR LESERAFQRVA
Sbjct  61   EVILKDFRNRWDRQTRAFYNLFRQADRVEKLAETIQRLEQGDLKLRVRTLESERAFQRVA  120

Query  629  AVQKTILSAVAAGS  670
            AVQKT+ S   +GS
Sbjct  121  AVQKTVGSVSYSGS  134



>gb|KIZ01364.1| Uncharacterized protein MNEG_6596 [Monoraphidium neglectum]
Length=790

 Score =   254 bits (649),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 141/276 (51%), Positives = 186/276 (67%), Gaps = 6/276 (2%)
 Frame = +2

Query  5    GLLEVFYGVYEKDPDKVLQAMVQMGVLVPTGDMTAVRRTAQFFLNSFEERLATQRREREL  184
            GL+E+FYGVY  D D+ L A++ MGVLVPTG+  A+RRTAQ+ L +F +RL  QR ER+ 
Sbjct  515  GLMELFYGVYNLDADRCLDALIAMGVLVPTGERQAIRRTAQYLLTTFNQRLVAQREERKA  574

Query  185  AKAELGFKKPLTKEEKIE----KKKQRLAAIGEDLLSIAADQPFRFPATFTFVVRAFSVL  352
              A  G+    + EE  +    +KK  +A IGE++L  AA QPFRFPATFTFVVR+F+VL
Sbjct  575  KGA--GYNADWSAEENKQEMERQKKLAIANIGEEILVAAAGQPFRFPATFTFVVRSFTVL  632

Query  353  HGIGKGLDPRFDITEIAKPYALELLRFREAGVEVILKDFKTRWDRQNRAFYNLFRQADRV  532
             GIGK LDPRFD+TE+A PYA ELL         I +DFK R   QNRA  NLF+  +R+
Sbjct  633  DGIGKTLDPRFDMTELAAPYARELLLEAAPKFAQIAEDFKRRVANQNRAVANLFKSPNRL  692

Query  533  EKLAEIIQRLEQGDLKLRVRALESERAFQRVAAVQKTILSAVAAGSLINLATVLYLNAIR  712
            E +  +I RLE GDLKLRVRALE+ERA QRV A QK I SA+ A +L+N+ TVL ++A  
Sbjct  693  EDIGGVISRLESGDLKLRVRALEAERALQRVQAWQKVISSALVASTLVNVGTVLSVSAAT  752

Query  713  MPAMAAYGLCAFFGFQVLIGIVKVKKIDQRERLITG  820
              A   +   A FG  ++   ++V ++++RERL+ G
Sbjct  753  TGAALCFAGAAAFGALLIASYLQVAQLEKRERLLAG  788



>ref|XP_003054952.1| predicted protein, partial [Micromonas pusilla CCMP1545]
 gb|EEH60204.1| predicted protein, partial [Micromonas pusilla CCMP1545]
Length=606

 Score =   243 bits (621),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 132/282 (47%), Positives = 186/282 (66%), Gaps = 8/282 (3%)
 Frame = +2

Query  5    GLLEVFYGVYEKDPDKVLQAMVQMGVLVPTG-DMTAVRRTAQFFLNSFEERLATQRRERE  181
            G L++FY V+EK+ D  ++A+ +MGVLV TG D+TAV+RTA FFL SF+ R+ TQ  +R 
Sbjct  325  GFLDLFYAVFEKNSDNAVKALSKMGVLVETGGDLTAVKRTADFFLGSFDNRVETQETQRS  384

Query  182  LAKAELG--FKKPLTKEEKIEKKKQRLAAIGEDLLSIAADQPFRFPATFTFVVRAFSVLH  355
              K E    FK   TKEEK  ++KQ L+ IGEDLL ++ DQPFRFPA  TFVVRAFSVL 
Sbjct  385  QNKEEYEAEFKPQRTKEEKKARRKQILSNIGEDLLVVSKDQPFRFPAELTFVVRAFSVLD  444

Query  356  GIGKGLDPRFDITEIAKPYALELLRFREAG-----VEVILKDFKTRWDRQNRAFYNLFRQ  520
            GIGKGL+ +FDI EI+ PYA  LL           V    +DF+ R+D+ N+A  NLF+ 
Sbjct  445  GIGKGLNKKFDIGEISAPYARNLLIEENPSSLPPQVVARQRDFQRRFDKNNKAIINLFKG  504

Query  521  ADRVEKLAEIIQRLEQGDLKLRVRALESERAFQRVAAVQKTILSAVAAGSLINLATVLYL  700
             D +E++AEI++ +E+G LK+RVRALE+ERA +RVA +Q  +L A+ A   +N+  VLY+
Sbjct  505  PDAIEEIAEIVRDIERGKLKIRVRALEAERALERVAVMQDLMLKAMVACCAVNIGVVLYV  564

Query  701  NAIRMPAMAAYGLCAFFGFQVLIGIVKVKKIDQRERLITGTA  826
            + + + A  A+G+      Q     +K+ K+ ++E   +G A
Sbjct  565  SGLLVQAKGAFGVSGVAMLQAAAASMKLSKLTKKEAAFSGAA  606



>ref|XP_008675337.1| PREDICTED: uncharacterized protein LOC103651476 isoform X5 [Zea 
mays]
Length=302

 Score =   234 bits (596),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 117/152 (77%), Positives = 128/152 (84%), Gaps = 0/152 (0%)
 Frame = +2

Query  53   VLQAMVQMGVLVPTGDMTAVRRTAQFFLNSFEERLATQRRERELAKAELGFKKPLTKEEK  232
            VLQAMVQMGVLVPTGDMT VRRTAQFFLNSF+E L  QR+ERE+A AELGFKK LTKEEK
Sbjct  145  VLQAMVQMGVLVPTGDMTVVRRTAQFFLNSFQECLTAQRKEREMATAELGFKKQLTKEEK  204

Query  233  IEKKKQRLAAIGEDLLSIAADQPFRFPATFTFVVRAFSVLHGIGKGLDPRFDITEIAKPY  412
             EK+KQRLAAIGEDLL+IAADQPFRFPATFTFVVRAFSVL G GKGLDPRF ITEIAKP 
Sbjct  205  FEKRKQRLAAIGEDLLAIAADQPFRFPATFTFVVRAFSVLDGTGKGLDPRFHITEIAKPN  264

Query  413  ALELLRFREAGVEVILKDFKTRWDRQNRAFYN  508
            A ELLRF +AGVE+++K     W +     Y+
Sbjct  265  AKELLRFNDAGVEIVVKASFNIWSKLLTYLYD  296



>ref|XP_008675336.1| PREDICTED: uncharacterized protein LOC103651476 isoform X4 [Zea 
mays]
Length=334

 Score =   234 bits (597),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 117/153 (76%), Positives = 129/153 (84%), Gaps = 0/153 (0%)
 Frame = +2

Query  50   KVLQAMVQMGVLVPTGDMTAVRRTAQFFLNSFEERLATQRRERELAKAELGFKKPLTKEE  229
            +VLQAMVQMGVLVPTGDMT VRRTAQFFLNSF+E L  QR+ERE+A AELGFKK LTKEE
Sbjct  176  EVLQAMVQMGVLVPTGDMTVVRRTAQFFLNSFQECLTAQRKEREMATAELGFKKQLTKEE  235

Query  230  KIEKKKQRLAAIGEDLLSIAADQPFRFPATFTFVVRAFSVLHGIGKGLDPRFDITEIAKP  409
            K EK+KQRLAAIGEDLL+IAADQPFRFPATFTFVVRAFSVL G GKGLDPRF ITEIAKP
Sbjct  236  KFEKRKQRLAAIGEDLLAIAADQPFRFPATFTFVVRAFSVLDGTGKGLDPRFHITEIAKP  295

Query  410  YALELLRFREAGVEVILKDFKTRWDRQNRAFYN  508
             A ELLRF +AGVE+++K     W +     Y+
Sbjct  296  NAKELLRFNDAGVEIVVKASFNIWSKLLTYLYD  328



>ref|XP_008675334.1| PREDICTED: uncharacterized protein LOC103651476 isoform X2 [Zea 
mays]
Length=350

 Score =   234 bits (597),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 117/153 (76%), Positives = 129/153 (84%), Gaps = 0/153 (0%)
 Frame = +2

Query  50   KVLQAMVQMGVLVPTGDMTAVRRTAQFFLNSFEERLATQRRERELAKAELGFKKPLTKEE  229
            +VLQAMVQMGVLVPTGDMT VRRTAQFFLNSF+E L  QR+ERE+A AELGFKK LTKEE
Sbjct  192  EVLQAMVQMGVLVPTGDMTVVRRTAQFFLNSFQECLTAQRKEREMATAELGFKKQLTKEE  251

Query  230  KIEKKKQRLAAIGEDLLSIAADQPFRFPATFTFVVRAFSVLHGIGKGLDPRFDITEIAKP  409
            K EK+KQRLAAIGEDLL+IAADQPFRFPATFTFVVRAFSVL G GKGLDPRF ITEIAKP
Sbjct  252  KFEKRKQRLAAIGEDLLAIAADQPFRFPATFTFVVRAFSVLDGTGKGLDPRFHITEIAKP  311

Query  410  YALELLRFREAGVEVILKDFKTRWDRQNRAFYN  508
             A ELLRF +AGVE+++K     W +     Y+
Sbjct  312  NAKELLRFNDAGVEIVVKASFNIWSKLLTYLYD  344



>ref|XP_008675333.1| PREDICTED: uncharacterized protein LOC103651476 isoform X1 [Zea 
mays]
Length=352

 Score =   234 bits (598),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 117/153 (76%), Positives = 129/153 (84%), Gaps = 0/153 (0%)
 Frame = +2

Query  50   KVLQAMVQMGVLVPTGDMTAVRRTAQFFLNSFEERLATQRRERELAKAELGFKKPLTKEE  229
            +VLQAMVQMGVLVPTGDMT VRRTAQFFLNSF+E L  QR+ERE+A AELGFKK LTKEE
Sbjct  194  EVLQAMVQMGVLVPTGDMTVVRRTAQFFLNSFQECLTAQRKEREMATAELGFKKQLTKEE  253

Query  230  KIEKKKQRLAAIGEDLLSIAADQPFRFPATFTFVVRAFSVLHGIGKGLDPRFDITEIAKP  409
            K EK+KQRLAAIGEDLL+IAADQPFRFPATFTFVVRAFSVL G GKGLDPRF ITEIAKP
Sbjct  254  KFEKRKQRLAAIGEDLLAIAADQPFRFPATFTFVVRAFSVLDGTGKGLDPRFHITEIAKP  313

Query  410  YALELLRFREAGVEVILKDFKTRWDRQNRAFYN  508
             A ELLRF +AGVE+++K     W +     Y+
Sbjct  314  NAKELLRFNDAGVEIVVKASFNIWSKLLTYLYD  346



>ref|XP_006382925.1| hypothetical protein POPTR_0005s08490g [Populus trichocarpa]
 gb|ERP60722.1| hypothetical protein POPTR_0005s08490g [Populus trichocarpa]
Length=625

 Score =   241 bits (615),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 127/136 (93%), Positives = 130/136 (96%), Gaps = 0/136 (0%)
 Frame = +2

Query  2    EGLLEVFYGVYEKDPDKVLQAMVQMGVLVPTGDMTAVRRTAQFFLNSFEERLATQRRERE  181
            EGLLE FYGVYEKDPDKVL+AMVQMGVLVPTGDMTAVRRTAQFFLNSFEERLA QRRERE
Sbjct  490  EGLLETFYGVYEKDPDKVLEAMVQMGVLVPTGDMTAVRRTAQFFLNSFEERLAAQRRERE  549

Query  182  LAKAELGFKKPLTKEEKIEKKKQRLAAIGEDLLSIAADQPFRFPATFTFVVRAFSVLHGI  361
            +A  ELGFKK LTKEEK+EKKKQRLAAIGEDLLSIAADQPFRFPATFTFVVRAFSVL GI
Sbjct  550  MATTELGFKKQLTKEEKMEKKKQRLAAIGEDLLSIAADQPFRFPATFTFVVRAFSVLDGI  609

Query  362  GKGLDPRFDITEIAKP  409
            GKGLDPRFDITEIAKP
Sbjct  610  GKGLDPRFDITEIAKP  625



>ref|XP_008675335.1| PREDICTED: uncharacterized protein LOC103651476 isoform X3 [Zea 
mays]
Length=341

 Score =   233 bits (594),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 115/138 (83%), Positives = 125/138 (91%), Gaps = 0/138 (0%)
 Frame = +2

Query  50   KVLQAMVQMGVLVPTGDMTAVRRTAQFFLNSFEERLATQRRERELAKAELGFKKPLTKEE  229
            +VLQAMVQMGVLVPTGDMT VRRTAQFFLNSF+E L  QR+ERE+A AELGFKK LTKEE
Sbjct  194  EVLQAMVQMGVLVPTGDMTVVRRTAQFFLNSFQECLTAQRKEREMATAELGFKKQLTKEE  253

Query  230  KIEKKKQRLAAIGEDLLSIAADQPFRFPATFTFVVRAFSVLHGIGKGLDPRFDITEIAKP  409
            K EK+KQRLAAIGEDLL+IAADQPFRFPATFTFVVRAFSVL G GKGLDPRF ITEIAKP
Sbjct  254  KFEKRKQRLAAIGEDLLAIAADQPFRFPATFTFVVRAFSVLDGTGKGLDPRFHITEIAKP  313

Query  410  YALELLRFREAGVEVILK  463
             A ELLRF +AGVE+++K
Sbjct  314  NAKELLRFNDAGVEIVVK  331



>ref|XP_011400484.1| Uncharacterized protein F751_6088 [Auxenochlorella protothecoides]
 gb|KFM27507.1| Uncharacterized protein F751_6088 [Auxenochlorella protothecoides]
Length=652

 Score =   240 bits (613),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 136/274 (50%), Positives = 179/274 (65%), Gaps = 14/274 (5%)
 Frame = +2

Query  5    GLLEVFYGVYEKDPDKVLQAMVQMGVLVPTGDMTAVRRTAQFFLNSFEERLATQRREREL  184
            GLLE+FYGVYEKD D+ L A+  MGVLVPTGDMTAVRRTA FFL SF +RL  Q+  +  
Sbjct  393  GLLELFYGVYEKDADRCLTALTAMGVLVPTGDMTAVRRTADFFLRSFSDRLTNQKEPQRR  452

Query  185  AKAELGFKKPLTKEEKIEKKKQRLAAIGEDLLSIAADQPFRFPATFTFVVRAFSVLHGIG  364
                       TKEEK  K+K+ L++IGEDLL  AAD+PFRFPATFTFVVR+F+VL GIG
Sbjct  453  -----------TKEEKRMKRKEILSSIGEDLLLAAADKPFRFPATFTFVVRSFTVLDGIG  501

Query  365  KGLDPRFDITEIAKPYALELLRFREAGVEVILKDFKTRWDRQNRAFYNLFRQADRVEKLA  544
            K L P FDI++IA PYA +LL      +    +DF+ R   QNRA  NLFR  + V+  A
Sbjct  502  KTLAPGFDISKIAAPYARDLLLEGRPLLAKASQDFRGRLALQNRAVVNLFRAPNLVQDSA  561

Query  545  EIIQRLEQGDLKLRVRALESERAFQRVAAVQKTILSAVAAGSLINLATVLYLNAIRMPAM  724
            +++QRLE+G+LKLRVRALE+ERA  RVA +Q   L A+ A +L+ + +      +   A 
Sbjct  562  DLLQRLERGELKLRVRALEAERALDRVARMQTATLYALLASALVQVGSAATRQLLAQAAF  621

Query  725  AAYGLCAFFGFQVLIGIVKVKKIDQRERLITGTA  826
               G+   F    ++ + KV+ + ++E L TG+ 
Sbjct  622  GGAGVAGMF---AILSLAKVRSLQKKESLYTGSG  652



>ref|XP_002503992.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO65250.1| predicted protein [Micromonas sp. RCC299]
Length=774

 Score =   241 bits (616),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 128/281 (46%), Positives = 188/281 (67%), Gaps = 7/281 (2%)
 Frame = +2

Query  5    GLLEVFYGVYEKDPDKVLQAMVQMGVLVPTGDMTAVRRTAQFFLNSFEERLATQRREREL  184
            G L++FY V+EK+ D  ++A+ +MGVLV  GDMTAV+RTA FFL SF+ R+  Q+++R  
Sbjct  494  GFLDLFYAVFEKNSDSAVKALGKMGVLVEGGDMTAVKRTADFFLGSFDNRVEEQQKQRTE  553

Query  185  AKAELG--FKKPLTKEEKIEKKKQRLAAIGEDLLSIAADQPFRFPATFTFVVRAFSVLHG  358
             K E    FK+  TKEEK  ++KQ L+ IGEDLL ++ DQPFRFPA  TFVVRAFSVL G
Sbjct  554  NKEEYEAEFKQKRTKEEKKARRKQILSNIGEDLLVVSKDQPFRFPAELTFVVRAFSVLDG  613

Query  359  IGKGLDPRFDITEIAKPYALELLRFREAGV---EVILK--DFKTRWDRQNRAFYNLFRQA  523
            IGK L+ +FDI EI+ PYA  LL          +V+ +  D++ R+DRQN+A  NLF+  
Sbjct  614  IGKSLNKKFDIGEISAPYARNLLIDDNPSALPPQVVARQRDWERRFDRQNKAIVNLFKGP  673

Query  524  DRVEKLAEIIQRLEQGDLKLRVRALESERAFQRVAAVQKTILSAVAAGSLINLATVLYLN  703
            D +E++A++++ +E+G LK+RVRALE+ERA +RV  +Q  +L  + A +  N+  VLY++
Sbjct  674  DAIEEIADVVRAIERGRLKIRVRALEAERALERVQVMQGLMLKMMVACAACNVGVVLYVS  733

Query  704  AIRMPAMAAYGLCAFFGFQVLIGIVKVKKIDQRERLITGTA  826
             + + A   +G+   F  Q L+  +K+ K+ ++E    G A
Sbjct  734  GMLLQAKGVFGVAGLFAMQALVAQMKLGKLIKKEAQYAGAA  774



>tpg|DAA58517.1| TPA: hypothetical protein ZEAMMB73_453288 [Zea mays]
Length=492

 Score =   235 bits (600),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 121/177 (68%), Positives = 139/177 (79%), Gaps = 4/177 (2%)
 Frame = +2

Query  26   GVYEKDPDKVLQAMVQMGVLVPTGDMTAVRRTAQFFLNSFEERLATQRRERELAKAELGF  205
             ++E+    VLQAMVQMGVLVPTGDMT VRRTAQFFLNSF+E L  QR+ERE+A AELGF
Sbjct  268  ALHEEHIGMVLQAMVQMGVLVPTGDMTVVRRTAQFFLNSFQECLTAQRKEREMATAELGF  327

Query  206  KKPLTKEEKIEKKKQRLAAIGEDLLSIAADQPFRFPATFTFVVRAFSVLHGIGKGLDPRF  385
            KK LTKEEK EK+KQRLAAIGEDLL+IAADQPFRFPATFTFVVRAFSVL G GKGLDPRF
Sbjct  328  KKQLTKEEKFEKRKQRLAAIGEDLLAIAADQPFRFPATFTFVVRAFSVLDGTGKGLDPRF  387

Query  386  DITEIAKPYALELLRFREAGVEVILKDFKTRWDRQNRAFYNLFRQADRVEKLAEIIQ  556
             ITEIAKP A ELLRF +AGVE+++K     W  +     +++   D   +L E+ Q
Sbjct  388  HITEIAKPNAKELLRFNDAGVEIVVKASFNIWCVER----HVYSSYDEFLRLHEVYQ  440



>ref|XP_001420615.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO98908.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=660

 Score =   238 bits (607),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 130/281 (46%), Positives = 181/281 (64%), Gaps = 8/281 (3%)
 Frame = +2

Query  2    EGLLEVFYGVYEKDPDKVLQAMVQMGVLVPTG-DMTAVRRTAQFFLNSFEERLATQRRER  178
            +GLL++FY  YE   D  ++A+++MGVLV TG D+TAV+RTA FFL  F+ R+  Q++ R
Sbjct  379  DGLLDLFYATYEGQSDSAVKALMKMGVLVDTGADLTAVKRTADFFLTQFDARINAQKKAR  438

Query  179  ELAKAELG--FKKPLTKEEKIEKKKQRLAAIGEDLLSIAADQPFRFPATFTFVVRAFSVL  352
            E  K E    FK P TKEEK + +K+ L+ IGEDLL ++ DQPFRFPA FTFVVRAFSVL
Sbjct  439  ETNKEEFEAEFKAPRTKEEKQQVRKRILSNIGEDLLVVSKDQPFRFPAEFTFVVRAFSVL  498

Query  353  HGIGKGLDPRFDITEIAKPYALELL-----RFREAGVEVILKDFKTRWDRQNRAFYNLFR  517
             GIGK L+ +FDI+EIA PYA  LL           V    +D+  R D Q +A  NLF+
Sbjct  499  DGIGKTLNKKFDISEIAAPYARNLLIEANPNSLPPQVVTAQRDWLRRADAQTKAIVNLFK  558

Query  518  QADRVEKLAEIIQRLEQGDLKLRVRALESERAFQRVAAVQKTILSAVAAGSLINLATVLY  697
              D +  +A+ ++R+E G LK+RVRALE+ERA  R+A +Q   + A+ A    N+  VLY
Sbjct  559  GPDAIYDIADTMRRIETGKLKIRVRALEAERALDRMAIMQGVTIQALLAACATNIGVVLY  618

Query  698  LNAIRMPAMAAYGLCAFFGFQVLIGIVKVKKIDQRERLITG  820
            ++++ + A  A+G      F+ L G +KV K+ ++E  I G
Sbjct  619  VSSLTLYAQCAFGAAGLLAFKALTGQLKVAKLLKKENSILG  659



>tpg|DAA58520.1| TPA: hypothetical protein ZEAMMB73_453288 [Zea mays]
 tpg|DAA58521.1| TPA: hypothetical protein ZEAMMB73_453288 [Zea mays]
 tpg|DAA58522.1| TPA: hypothetical protein ZEAMMB73_453288 [Zea mays]
Length=152

 Score =   218 bits (555),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 110/141 (78%), Positives = 120/141 (85%), Gaps = 2/141 (1%)
 Frame = +2

Query  65   MVQMGVLVPTGDMTAVRRTAQFFLNSFEERLATQRRERELAKAELGFKKPLTKEEKIEKK  244
            MVQMGVLVPTGDMT VRRTAQFFLNSF+E L  QR+ERE+A AELGFKK LTKEEK EK+
Sbjct  1    MVQMGVLVPTGDMTVVRRTAQFFLNSFQECLTAQRKEREMATAELGFKKQLTKEEKFEKR  60

Query  245  KQRLAAIGEDLLSIAADQPFRFPATFTFVVRAFSVLHGIGKGLDPRFDITEIAKPYALEL  424
            KQRLAAIGEDLL+IAADQPFRFPATFTFVVRAFS   G GKGLDPRF ITEIAKP A EL
Sbjct  61   KQRLAAIGEDLLAIAADQPFRFPATFTFVVRAFS--DGTGKGLDPRFHITEIAKPNAKEL  118

Query  425  LRFREAGVEVILKDFKTRWDR  487
            LRF +AGVE+++K     W +
Sbjct  119  LRFNDAGVEIVVKASFNIWSK  139



>emb|CEF99842.1| Protein kinase-like domain [Ostreococcus tauri]
Length=714

 Score =   233 bits (594),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 126/281 (45%), Positives = 181/281 (64%), Gaps = 8/281 (3%)
 Frame = +2

Query  2    EGLLEVFYGVYEKDPDKVLQAMVQMGVLVPTG-DMTAVRRTAQFFLNSFEERLATQRRER  178
            +GLL++FY  YE   D  ++A+++MGVLV  G D+TAV+RTA FFL  F+ R+  Q++ R
Sbjct  433  DGLLDLFYATYEGQSDSAVKALMKMGVLVDGGADLTAVKRTADFFLTQFDARINAQKKAR  492

Query  179  ELAKAELG--FKKPLTKEEKIEKKKQRLAAIGEDLLSIAADQPFRFPATFTFVVRAFSVL  352
            E  + E    FK P TKEEK   +K+ L+ IGEDLL ++ DQPFRFPA FTFVVRAFSVL
Sbjct  493  ETNREEYEAEFKAPRTKEEKQAVRKKILSNIGEDLLVVSKDQPFRFPAEFTFVVRAFSVL  552

Query  353  HGIGKGLDPRFDITEIAKPYALELL-----RFREAGVEVILKDFKTRWDRQNRAFYNLFR  517
             GIGK L+ +FDI+EIA PYA  LL           V    +++  R D Q +A  NL +
Sbjct  553  DGIGKTLNKKFDISEIAAPYARNLLIEANPNSLPPQVVTAQREWLRRADAQTKALVNLIK  612

Query  518  QADRVEKLAEIIQRLEQGDLKLRVRALESERAFQRVAAVQKTILSAVAAGSLINLATVLY  697
              D +  +A+I++R+E G LK+RVRALE+ERA +R++ +Q  ++ AV A +  N+  V+Y
Sbjct  613  GPDAISDVADILRRIETGKLKIRVRALEAERAIERMSIMQGVMMQAVIACAATNIGVVMY  672

Query  698  LNAIRMPAMAAYGLCAFFGFQVLIGIVKVKKIDQRERLITG  820
            ++ + + A  A+G      F+ L G +KV K+ ++E  I G
Sbjct  673  VSGLMLQAQCAFGFAGLLAFKALTGQLKVAKLLKKENSILG  713



>ref|XP_008662178.1| PREDICTED: uncharacterized protein LOC103640607 isoform X5 [Zea 
mays]
Length=331

 Score =   207 bits (527),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 102/121 (84%), Positives = 108/121 (89%), Gaps = 0/121 (0%)
 Frame = +2

Query  47   DKVLQAMVQMGVLVPTGDMTAVRRTAQFFLNSFEERLATQRRERELAKAELGFKKPLTKE  226
             +VLQAMVQMGVLVPTGDMT VRRTAQFFLNSF+E L  QR+ERE+A AELGFKK LTKE
Sbjct  211  SEVLQAMVQMGVLVPTGDMTVVRRTAQFFLNSFQECLTAQRKEREMATAELGFKKQLTKE  270

Query  227  EKIEKKKQRLAAIGEDLLSIAADQPFRFPATFTFVVRAFSVLHGIGKGLDPRFDITEIAK  406
            EK EK+KQRLA IGEDLL+IAADQPFRFPATFTFVVRAFSVL G GKGL PRF ITEIAK
Sbjct  271  EKFEKRKQRLATIGEDLLAIAADQPFRFPATFTFVVRAFSVLDGTGKGLHPRFHITEIAK  330

Query  407  P  409
            P
Sbjct  331  P  331



>ref|XP_008662184.1| PREDICTED: uncharacterized protein LOC103640607 isoform X6 [Zea 
mays]
Length=323

 Score =   206 bits (524),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 106/145 (73%), Positives = 116/145 (80%), Gaps = 9/145 (6%)
 Frame = +2

Query  53   VLQAMVQMGVLVPTGDMTAVRRTAQFFLNSFEERLATQRRERELAKAELGFKKPLTKEEK  232
            VLQAMVQMGVLVPTGDMT VRRTAQFFLNSF+E L  QR+ERE+A AELGFKK LTKEEK
Sbjct  175  VLQAMVQMGVLVPTGDMTVVRRTAQFFLNSFQECLTAQRKEREMATAELGFKKQLTKEEK  234

Query  233  IEKKKQRLAAIGEDLLSIAADQPFRFPATFTFVVRAFSVLHGIGKGLDPRFDITEIAKPY  412
             EK+KQRLA IGEDLL+IAADQPFRFPATFTFVVRAFSVL G GKGL PR          
Sbjct  235  FEKRKQRLATIGEDLLAIAADQPFRFPATFTFVVRAFSVLDGTGKGLHPR---------N  285

Query  413  ALELLRFREAGVEVILKDFKTRWDR  487
            A ELLRF +AGVE+++K     W +
Sbjct  286  AKELLRFNDAGVEIVVKASFNIWSK  310



>ref|XP_008662084.1| PREDICTED: uncharacterized protein LOC103640607 isoform X1 [Zea 
mays]
 ref|XP_008662090.1| PREDICTED: uncharacterized protein LOC103640607 isoform X1 [Zea 
mays]
 ref|XP_008662095.1| PREDICTED: uncharacterized protein LOC103640607 isoform X1 [Zea 
mays]
 ref|XP_008662099.1| PREDICTED: uncharacterized protein LOC103640607 isoform X1 [Zea 
mays]
 ref|XP_008662102.1| PREDICTED: uncharacterized protein LOC103640607 isoform X1 [Zea 
mays]
 ref|XP_008662106.1| PREDICTED: uncharacterized protein LOC103640607 isoform X1 [Zea 
mays]
 ref|XP_008662111.1| PREDICTED: uncharacterized protein LOC103640607 isoform X1 [Zea 
mays]
 ref|XP_008662114.1| PREDICTED: uncharacterized protein LOC103640607 isoform X1 [Zea 
mays]
 ref|XP_008662119.1| PREDICTED: uncharacterized protein LOC103640607 isoform X1 [Zea 
mays]
 ref|XP_008662122.1| PREDICTED: uncharacterized protein LOC103640607 isoform X1 [Zea 
mays]
 ref|XP_008662126.1| PREDICTED: uncharacterized protein LOC103640607 isoform X1 [Zea 
mays]
 ref|XP_008662136.1| PREDICTED: uncharacterized protein LOC103640607 isoform X1 [Zea 
mays]
 ref|XP_008662140.1| PREDICTED: uncharacterized protein LOC103640607 isoform X1 [Zea 
mays]
 ref|XP_008662142.1| PREDICTED: uncharacterized protein LOC103640607 isoform X1 [Zea 
mays]
 ref|XP_008662145.1| PREDICTED: uncharacterized protein LOC103640607 isoform X1 [Zea 
mays]
 ref|XP_008662148.1| PREDICTED: uncharacterized protein LOC103640607 isoform X1 [Zea 
mays]
 ref|XP_008662151.1| PREDICTED: uncharacterized protein LOC103640607 isoform X1 [Zea 
mays]
 ref|XP_008662152.1| PREDICTED: uncharacterized protein LOC103640607 isoform X1 [Zea 
mays]
Length=361

 Score =   207 bits (526),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 107/154 (69%), Positives = 119/154 (77%), Gaps = 9/154 (6%)
 Frame = +2

Query  47   DKVLQAMVQMGVLVPTGDMTAVRRTAQFFLNSFEERLATQRRERELAKAELGFKKPLTKE  226
             +VLQAMVQMGVLVPTGDMT VRRTAQFFLNSF+E L  QR+ERE+A AELGFKK LTKE
Sbjct  211  SEVLQAMVQMGVLVPTGDMTVVRRTAQFFLNSFQECLTAQRKEREMATAELGFKKQLTKE  270

Query  227  EKIEKKKQRLAAIGEDLLSIAADQPFRFPATFTFVVRAFSVLHGIGKGLDPRFDITEIAK  406
            EK EK+KQRLA IGEDLL+IAADQPFRFPATFTFVVRAFSVL G GKGL PR        
Sbjct  271  EKFEKRKQRLATIGEDLLAIAADQPFRFPATFTFVVRAFSVLDGTGKGLHPR--------  322

Query  407  PYALELLRFREAGVEVILKDFKTRWDRQNRAFYN  508
              A ELLRF +AGVE+++K     W +     Y+
Sbjct  323  -NAKELLRFNDAGVEIVVKASFNIWSKLLTYLYD  355



>ref|XP_008662156.1| PREDICTED: uncharacterized protein LOC103640607 isoform X2 [Zea 
mays]
Length=359

 Score =   207 bits (526),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 107/153 (70%), Positives = 119/153 (78%), Gaps = 9/153 (6%)
 Frame = +2

Query  50   KVLQAMVQMGVLVPTGDMTAVRRTAQFFLNSFEERLATQRRERELAKAELGFKKPLTKEE  229
            +VLQAMVQMGVLVPTGDMT VRRTAQFFLNSF+E L  QR+ERE+A AELGFKK LTKEE
Sbjct  210  EVLQAMVQMGVLVPTGDMTVVRRTAQFFLNSFQECLTAQRKEREMATAELGFKKQLTKEE  269

Query  230  KIEKKKQRLAAIGEDLLSIAADQPFRFPATFTFVVRAFSVLHGIGKGLDPRFDITEIAKP  409
            K EK+KQRLA IGEDLL+IAADQPFRFPATFTFVVRAFSVL G GKGL PR         
Sbjct  270  KFEKRKQRLATIGEDLLAIAADQPFRFPATFTFVVRAFSVLDGTGKGLHPR---------  320

Query  410  YALELLRFREAGVEVILKDFKTRWDRQNRAFYN  508
             A ELLRF +AGVE+++K     W +     Y+
Sbjct  321  NAKELLRFNDAGVEIVVKASFNIWSKLLTYLYD  353



>ref|XP_008662174.1| PREDICTED: uncharacterized protein LOC103640607 isoform X4 [Zea 
mays]
Length=343

 Score =   206 bits (523),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 107/153 (70%), Positives = 119/153 (78%), Gaps = 9/153 (6%)
 Frame = +2

Query  50   KVLQAMVQMGVLVPTGDMTAVRRTAQFFLNSFEERLATQRRERELAKAELGFKKPLTKEE  229
            +VLQAMVQMGVLVPTGDMT VRRTAQFFLNSF+E L  QR+ERE+A AELGFKK LTKEE
Sbjct  194  EVLQAMVQMGVLVPTGDMTVVRRTAQFFLNSFQECLTAQRKEREMATAELGFKKQLTKEE  253

Query  230  KIEKKKQRLAAIGEDLLSIAADQPFRFPATFTFVVRAFSVLHGIGKGLDPRFDITEIAKP  409
            K EK+KQRLA IGEDLL+IAADQPFRFPATFTFVVRAFSVL G GKGL PR         
Sbjct  254  KFEKRKQRLATIGEDLLAIAADQPFRFPATFTFVVRAFSVLDGTGKGLHPR---------  304

Query  410  YALELLRFREAGVEVILKDFKTRWDRQNRAFYN  508
             A ELLRF +AGVE+++K     W +     Y+
Sbjct  305  NAKELLRFNDAGVEIVVKASFNIWSKLLTYLYD  337



>ref|XP_008662158.1| PREDICTED: uncharacterized protein LOC103640607 isoform X3 [Zea 
mays]
 ref|XP_008662164.1| PREDICTED: uncharacterized protein LOC103640607 isoform X3 [Zea 
mays]
 ref|XP_008662168.1| PREDICTED: uncharacterized protein LOC103640607 isoform X3 [Zea 
mays]
Length=350

 Score =   205 bits (522),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 105/139 (76%), Positives = 115/139 (83%), Gaps = 9/139 (6%)
 Frame = +2

Query  47   DKVLQAMVQMGVLVPTGDMTAVRRTAQFFLNSFEERLATQRRERELAKAELGFKKPLTKE  226
             +VLQAMVQMGVLVPTGDMT VRRTAQFFLNSF+E L  QR+ERE+A AELGFKK LTKE
Sbjct  211  SEVLQAMVQMGVLVPTGDMTVVRRTAQFFLNSFQECLTAQRKEREMATAELGFKKQLTKE  270

Query  227  EKIEKKKQRLAAIGEDLLSIAADQPFRFPATFTFVVRAFSVLHGIGKGLDPRFDITEIAK  406
            EK EK+KQRLA IGEDLL+IAADQPFRFPATFTFVVRAFSVL G GKGL PR        
Sbjct  271  EKFEKRKQRLATIGEDLLAIAADQPFRFPATFTFVVRAFSVLDGTGKGLHPR--------  322

Query  407  PYALELLRFREAGVEVILK  463
              A ELLRF +AGVE+++K
Sbjct  323  -NAKELLRFNDAGVEIVVK  340



>gb|EYU31071.1| hypothetical protein MIMGU_mgv1a003362mg [Erythranthe guttata]
Length=590

 Score =   211 bits (536),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 103/115 (90%), Positives = 110/115 (96%), Gaps = 0/115 (0%)
 Frame = +2

Query  2    EGLLEVFYGVYEKDPDKVLQAMVQMGVLVPTGDMTAVRRTAQFFLNSFEERLATQRRERE  181
            EGLLEVFYGVYEKD +KVLQAMVQMGVLVPTGDMTAVRRTAQFFLNSFEERLA QR+E+E
Sbjct  470  EGLLEVFYGVYEKDAEKVLQAMVQMGVLVPTGDMTAVRRTAQFFLNSFEERLAAQRKEKE  529

Query  182  LAKAELGFKKPLTKEEKIEKKKQRLAAIGEDLLSIAADQPFRFPATFTFVVRAFS  346
            LA  ELGFKKPL+KEE +EKKKQRLAAIGEDLL+IAADQPFRFPATFTFVVR+FS
Sbjct  530  LATQELGFKKPLSKEEMVEKKKQRLAAIGEDLLAIAADQPFRFPATFTFVVRSFS  584



>ref|XP_007511850.1| predicted protein [Bathycoccus prasinos]
 emb|CCO65938.1| predicted protein [Bathycoccus prasinos]
Length=828

 Score =   213 bits (542),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 129/285 (45%), Positives = 174/285 (61%), Gaps = 15/285 (5%)
 Frame = +2

Query  5    GLLEVFYGVYEKDPDKVLQAMVQMGVLVPTG-DMTAVRRTAQFFLNSFEERLATQRRERE  181
            GLL++FY  YE       +A+++MGVLV TG D+TAV RTA FFL +F +R+  Q  +R 
Sbjct  544  GLLDLFYATYEGSSKSATKALIKMGVLVDTGGDLTAVERTAGFFLEAFGKRINYQESKRA  603

Query  182  LAKA--ELGFKKPLTKEEKIEKKKQRLAAIGEDLLSIAADQPFRFPATFTFVVRAFSVLH  355
              K   E  FK+P TKEEK   +K+ L  IGEDL+ ++ DQPFRFPA FTFVVRAFSVL 
Sbjct  604  EDKEAFEKEFKEPRTKEEKQAVRKKILTNIGEDLMVVSKDQPFRFPAEFTFVVRAFSVLD  663

Query  356  GIGKGLDPRFDITEIAKPYALELLRFREAGVEVIL-------KDFKTRWDRQNRAFYNLF  514
            GIGK L+ +FDI EIA PYA  LL   EA  + +        +++  R D Q RA  NLF
Sbjct  664  GIGKTLNKKFDIGEIAAPYARNLL--IEANPDALPPQVVTAQREWLKRADAQTRAVVNLF  721

Query  515  RQADRVEKLAEIIQRLEQGDLKLRVRALESERAFQRVAAVQKTILSAVAAGSLINLATVL  694
            +  D +E +A+II+R+E G LK+RVRALE ERA +RVA  Q   L A+ A  + N+  VL
Sbjct  722  KAPDAIESIADIIRRIETGKLKIRVRALEVERAVERVAVTQDITLKALIASCMANIGCVL  781

Query  695  YLNAIRM---PAMAAYGLCAFFGFQVLIGIVKVKKIDQRERLITG  820
            ++    +    A  A GL      Q + G + + K+ ++E   +G
Sbjct  782  WVTNPGLYLIQAKIALGLATVMMLQAVKGQLTLSKMLKKEAKYSG  826



>ref|XP_003082273.1| putative ABC transporter protein (ISS) [Ostreococcus tauri]
Length=756

 Score =   209 bits (533),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 126/332 (38%), Positives = 181/332 (55%), Gaps = 59/332 (18%)
 Frame = +2

Query  2    EGLLEVFYGVYEKDPDKVLQAMVQMGVLVPTG-DMTAVRRTAQFFLNSFEERLATQRRER  178
            +GLL++FY  YE   D  ++A+++MGVLV  G D+TAV+RTA FFL  F+ R+  Q++ R
Sbjct  424  DGLLDLFYATYEGQSDSAVKALMKMGVLVDGGADLTAVKRTADFFLTQFDARINAQKKAR  483

Query  179  ELAKAELG--FKKPLTKEEKIEKKKQRLAAIGEDLLSIAADQPFRFPATFTFVV------  334
            E  + E    FK P TKEEK   +K+ L+ IGEDLL ++ DQPFRFPA FTFVV      
Sbjct  484  ETNREEYEAEFKAPRTKEEKQAVRKKILSNIGEDLLVVSKDQPFRFPAEFTFVVVRILDC  543

Query  335  ---------------------------------------------RAFSVLHGIGKGLDP  379
                                                         RAFSVL GIGK L+ 
Sbjct  544  ARSPRKIGRFAMMRKRYLDTLYDECFWQCGFSEHITDENCSSQSQRAFSVLDGIGKTLNK  603

Query  380  RFDITEIAKPYALELL-----RFREAGVEVILKDFKTRWDRQNRAFYNLFRQADRVEKLA  544
            +FDI+EIA PYA  LL           V    +++  R D Q +A  NL +  D +  +A
Sbjct  604  KFDISEIAAPYARNLLIEANPNSLPPQVVTAQREWLRRADAQTKALVNLIKGPDAISDVA  663

Query  545  EIIQRLEQGDLKLRVRALESERAFQRVAAVQKTILSAVAAGSLINLATVLYLNAIRMPAM  724
            +I++R+E G LK+RVRALE+ERA +R++ +Q  ++ AV A +  N+  V+Y++ + + A 
Sbjct  664  DILRRIETGKLKIRVRALEAERAIERMSIMQGVMMQAVIACAATNIGVVMYVSGLMLQAQ  723

Query  725  AAYGLCAFFGFQVLIGIVKVKKIDQRERLITG  820
             A+G      F+ L G +KV K+ ++E  I G
Sbjct  724  CAFGFAGLLAFKALTGQLKVAKLLKKENSILG  755



>gb|KIZ02197.1| Uncharacterized protein MNEG_5768 [Monoraphidium neglectum]
Length=200

 Score =   185 bits (470),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 96/184 (52%), Positives = 124/184 (67%), Gaps = 0/184 (0%)
 Frame = +2

Query  269  EDLLSIAADQPFRFPATFTFVVRAFSVLHGIGKGLDPRFDITEIAKPYALELLRFREAGV  448
            +DLL  AADQPFRFPATFTFVVR+F+VL GIGK LDPRFDITEI+ PYA  LL   +   
Sbjct  15   QDLLVAAADQPFRFPATFTFVVRSFTVLDGIGKTLDPRFDITEISAPYARGLLLEAKPQF  74

Query  449  EVILKDFKTRWDRQNRAFYNLFRQADRVEKLAEIIQRLEQGDLKLRVRALESERAFQRVA  628
                 +FK R D QNRA  NLF+  +R+E +  +I RLE GDLKLRVRALE+ERA  RV 
Sbjct  75   AKWADEFKKRSDNQNRAVANLFKSPNRLEDIGSVISRLESGDLKLRVRALEAERALTRVQ  134

Query  629  AVQKTILSAVAAGSLINLATVLYLNAIRMPAMAAYGLCAFFGFQVLIGIVKVKKIDQRER  808
            A Q  + SA+ A +L+N+ TVL ++A+   A   +G  A FG  +    +KV  ++++ER
Sbjct  135  AWQGVVSSALVASTLVNVGTVLSVSAVTTGATLCFGGAAVFGVLLAKSYLKVAALEKKER  194

Query  809  LITG  820
             + G
Sbjct  195  QLAG  198



>gb|KJB10241.1| hypothetical protein B456_001G191200 [Gossypium raimondii]
Length=451

 Score =   184 bits (468),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 110/274 (40%), Positives = 160/274 (58%), Gaps = 33/274 (12%)
 Frame = +2

Query  2    EGLLEVFYGVYEKDPDKVLQAMVQMGVLVPTGDMTAVRRTAQFFLNSFEERLATQRRERE  181
            E LLE+FY VYEKD  KV+Q+++ +G L PTGD+++VRR+ QFFL++    L  QR +++
Sbjct  208  ERLLELFYAVYEKDAKKVMQSLIDLGALQPTGDLSSVRRSVQFFLDN----LLDQRPDQD  263

Query  182  LAKAELGFKKPLTKEEKIEKKKQRLAAIGEDLLSIAADQPFRFPATFTFVVRAFSVLHGI  361
                                    LAAIGEDL +IA DQPFRFP+TFTFV+RAFS L GI
Sbjct  264  TT----------------------LAAIGEDLFAIAQDQPFRFPSTFTFVLRAFSTLEGI  301

Query  362  GKGLDPRFDITEIAKPYALELLRFRE---AGVEVILKDFKTRWDRQNRAFYNLFRQADRV  532
            G  LDP F   +IA PYA ELL  R+    G +++ +  K   D ++      +    RV
Sbjct  302  GYILDPNFSFAKIAAPYAQELLDIRQRQRTGSQLVQEIRKQADDARSYTMSMPY----RV  357

Query  533  EKLAEIIQRLEQGDLKLRVRALESERAFQRVAAVQKTILSAVAAGSLINLATVLYLNAIR  712
            +++ EI+++LE GDL+LRVR LESERA ++   +Q   +  V  G+L+NL         +
Sbjct  358  QRIEEILKQLESGDLRLRVRVLESERAARKATILQMATMYTVLGGTLVNLGVTFSSQGSQ  417

Query  713  MPAMAAYGLCAFFGFQVLIGIVKVKKIDQRERLI  814
            + A  ++     F    L  + +VKK+D+ E++I
Sbjct  418  IIANGSFVGAGVFLTLFLRSMQRVKKLDKFEKMI  451



>ref|XP_004243575.1| PREDICTED: uncharacterized aarF domain-containing protein kinase 
At1g79600, chloroplastic [Solanum lycopersicum]
Length=702

 Score =   188 bits (477),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 113/274 (41%), Positives = 160/274 (58%), Gaps = 33/274 (12%)
 Frame = +2

Query  2    EGLLEVFYGVYEKDPDKVLQAMVQMGVLVPTGDMTAVRRTAQFFLNSFEERLATQRRERE  181
            E LL +FY VYEKD  KV+Q ++ +  L PTGDM+AVRR+ QFFL++    L  QR +++
Sbjct  459  ERLLGLFYSVYEKDAKKVMQGLIDLEALQPTGDMSAVRRSVQFFLDN----LLNQRPDQQ  514

Query  182  LAKAELGFKKPLTKEEKIEKKKQRLAAIGEDLLSIAADQPFRFPATFTFVVRAFSVLHGI  361
                                  Q LAAIGEDL +IA DQPFRFP+TFTFV+RAFS L GI
Sbjct  515  ----------------------QTLAAIGEDLFAIATDQPFRFPSTFTFVLRAFSTLEGI  552

Query  362  GKGLDPRFDITEIAKPYALELLRFRE---AGVEVILKDFKTRWDRQNRAFYNLFRQADRV  532
            G  LDP F   +IA PYA ELL  R+   +G +++ +  K    + N A  +      RV
Sbjct  553  GYILDPNFSFPKIAAPYAQELLDLRQQQRSGPQLVQEIRK----QANDARTSTISMPYRV  608

Query  533  EKLAEIIQRLEQGDLKLRVRALESERAFQRVAAVQKTILSAVAAGSLINLATVLYLNAIR  712
            +++ EI+++LE GDLKLRVR LESERA ++   +Q   +  V  G+L+NL         +
Sbjct  609  QQIEEIVKQLESGDLKLRVRVLESERAARKATILQMATMYTVIGGTLLNLGVTFTSQGSQ  668

Query  713  MPAMAAYGLCAFFGFQVLIGIVKVKKIDQRERLI  814
            M A  ++     F   ++  + +VKK+D+ E++I
Sbjct  669  MFANGSFIGAGVFLTLLIRSMQRVKKLDKFEKMI  702



>gb|KJB10243.1| hypothetical protein B456_001G191200 [Gossypium raimondii]
Length=472

 Score =   185 bits (469),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 110/274 (40%), Positives = 160/274 (58%), Gaps = 33/274 (12%)
 Frame = +2

Query  2    EGLLEVFYGVYEKDPDKVLQAMVQMGVLVPTGDMTAVRRTAQFFLNSFEERLATQRRERE  181
            E LLE+FY VYEKD  KV+Q+++ +G L PTGD+++VRR+ QFFL++    L  QR +++
Sbjct  229  ERLLELFYAVYEKDAKKVMQSLIDLGALQPTGDLSSVRRSVQFFLDN----LLDQRPDQD  284

Query  182  LAKAELGFKKPLTKEEKIEKKKQRLAAIGEDLLSIAADQPFRFPATFTFVVRAFSVLHGI  361
                                    LAAIGEDL +IA DQPFRFP+TFTFV+RAFS L GI
Sbjct  285  TT----------------------LAAIGEDLFAIAQDQPFRFPSTFTFVLRAFSTLEGI  322

Query  362  GKGLDPRFDITEIAKPYALELLRFRE---AGVEVILKDFKTRWDRQNRAFYNLFRQADRV  532
            G  LDP F   +IA PYA ELL  R+    G +++ +  K   D ++      +    RV
Sbjct  323  GYILDPNFSFAKIAAPYAQELLDIRQRQRTGSQLVQEIRKQADDARSYTMSMPY----RV  378

Query  533  EKLAEIIQRLEQGDLKLRVRALESERAFQRVAAVQKTILSAVAAGSLINLATVLYLNAIR  712
            +++ EI+++LE GDL+LRVR LESERA ++   +Q   +  V  G+L+NL         +
Sbjct  379  QRIEEILKQLESGDLRLRVRVLESERAARKATILQMATMYTVLGGTLVNLGVTFSSQGSQ  438

Query  713  MPAMAAYGLCAFFGFQVLIGIVKVKKIDQRERLI  814
            + A  ++     F    L  + +VKK+D+ E++I
Sbjct  439  IIANGSFVGAGVFLTLFLRSMQRVKKLDKFEKMI  472



>ref|XP_008464152.1| PREDICTED: uncharacterized aarF domain-containing protein kinase 
At1g79600, chloroplastic [Cucumis melo]
Length=707

 Score =   187 bits (476),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 112/274 (41%), Positives = 157/274 (57%), Gaps = 33/274 (12%)
 Frame = +2

Query  2    EGLLEVFYGVYEKDPDKVLQAMVQMGVLVPTGDMTAVRRTAQFFLNSFEERLATQRRERE  181
            E LL++FY VYEKD  KV+Q +V +  L PTGDM++VRR+ QFFL++   +   Q     
Sbjct  464  ERLLDLFYAVYEKDAKKVMQRLVDLEALQPTGDMSSVRRSIQFFLDNLLSQSPDQ-----  518

Query  182  LAKAELGFKKPLTKEEKIEKKKQRLAAIGEDLLSIAADQPFRFPATFTFVVRAFSVLHGI  361
                                 +Q LAAIGEDL +IA DQPFRFP+TFTFV+RAFS L GI
Sbjct  519  ---------------------QQTLAAIGEDLFAIAQDQPFRFPSTFTFVLRAFSTLEGI  557

Query  362  GKGLDPRFDITEIAKPYALELLRFRE---AGVEVILKDFKTRWDRQNRAFYNLFRQADRV  532
            G  LDP F   +IA PYA ELL  ++   +G +++ +  K    + N A  +      RV
Sbjct  558  GYTLDPDFSFVKIAAPYAQELLDLKQKERSGTQLVQEIRK----QANDARTSTISMPYRV  613

Query  533  EKLAEIIQRLEQGDLKLRVRALESERAFQRVAAVQKTILSAVAAGSLINLATVLYLNAIR  712
            +K+ E +Q+LE GDLKLRVR LESERA ++   +Q   +  V  G+L+NL   L     +
Sbjct  614  QKIEEFVQQLESGDLKLRVRVLESERAARKATILQMATMYTVMGGTLLNLGITLSSQGNQ  673

Query  713  MPAMAAYGLCAFFGFQVLIGIVKVKKIDQRERLI  814
              A  ++     F   VL  + +VKK+D+ E+++
Sbjct  674  AVAGGSFVGAGVFMTLVLRCMQRVKKLDKFEKMV  707



>ref|XP_006357645.1| PREDICTED: uncharacterized aarF domain-containing protein kinase 
At1g79600, chloroplastic-like [Solanum tuberosum]
Length=696

 Score =   187 bits (475),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 113/274 (41%), Positives = 159/274 (58%), Gaps = 33/274 (12%)
 Frame = +2

Query  2    EGLLEVFYGVYEKDPDKVLQAMVQMGVLVPTGDMTAVRRTAQFFLNSFEERLATQRRERE  181
            E LL +FY VYEKD  KV+Q ++ +  L PTGDM+AVRR+ QFFL++    L  QR +++
Sbjct  453  ERLLGLFYSVYEKDAKKVMQGLIDLEALQPTGDMSAVRRSIQFFLDN----LLNQRPDQQ  508

Query  182  LAKAELGFKKPLTKEEKIEKKKQRLAAIGEDLLSIAADQPFRFPATFTFVVRAFSVLHGI  361
                                  Q LAAIGEDL +IA DQPFRFP+TFTFV+RAFS L GI
Sbjct  509  ----------------------QTLAAIGEDLFAIATDQPFRFPSTFTFVIRAFSTLEGI  546

Query  362  GKGLDPRFDITEIAKPYALELLRFRE---AGVEVILKDFKTRWDRQNRAFYNLFRQADRV  532
            G  LDP F   +IA PYA ELL  R+   +G +++ +  K    + N A  +      RV
Sbjct  547  GYILDPDFSFPKIAAPYAQELLDLRQQQRSGPQLVQEIRK----QANDARTSTISMPYRV  602

Query  533  EKLAEIIQRLEQGDLKLRVRALESERAFQRVAAVQKTILSAVAAGSLINLATVLYLNAIR  712
            +++ EI+++LE GDLKLRVR LESERA ++   +Q   +  V  G+L+NL         +
Sbjct  603  QQIEEIVKQLESGDLKLRVRVLESERAARKATILQMATMYTVIGGTLLNLGVTFTSQGSQ  662

Query  713  MPAMAAYGLCAFFGFQVLIGIVKVKKIDQRERLI  814
            M A  ++     F   +L  + +V K+D+ E++I
Sbjct  663  MFANGSFIGAGVFLTLLLRSMQRVNKLDKFEKMI  696



>ref|XP_011100511.1| PREDICTED: uncharacterized aarF domain-containing protein kinase 
At1g79600, chloroplastic [Sesamum indicum]
Length=710

 Score =   187 bits (475),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 107/272 (39%), Positives = 159/272 (58%), Gaps = 30/272 (11%)
 Frame = +2

Query  2    EGLLEVFYGVYEKDPDKVLQAMVQMGVLVPTGDMTAVRRTAQFFLNSFEERLATQRRERE  181
            E LLEVFY VYEKD  KV+Q ++ +G L PTGDMT+VRR+ QFFL++    L  QR +++
Sbjct  468  ERLLEVFYAVYEKDAKKVMQGLIDLGALQPTGDMTSVRRSVQFFLDN----LLNQRPDQQ  523

Query  182  LAKAELGFKKPLTKEEKIEKKKQRLAAIGEDLLSIAADQPFRFPATFTFVVRAFSVLHGI  361
                                  Q L+AIGEDL +IA DQPFRFP+TFTFV+RAFS L GI
Sbjct  524  ----------------------QTLSAIGEDLFAIATDQPFRFPSTFTFVLRAFSTLEGI  561

Query  362  GKGLDPRFDITEIAKPYALELLRFREAG-VEVILKDFKTRWDRQNRAFYNLFRQADRVEK  538
            G  L+P F   +IA PYA ELL  R+      ++++ + + D    +  ++     R+++
Sbjct  562  GYTLNPDFSFPKIAAPYAQELLDLRQQQRTGTLVQEIRKQADDARSSTISM---PYRIQQ  618

Query  539  LAEIIQRLEQGDLKLRVRALESERAFQRVAAVQKTILSAVAAGSLINLATVLYLNAIRMP  718
            + +I+++LE GDLKLRVR LESERA ++   +Q   +  VA G+L+NL          + 
Sbjct  619  IEDIVKQLESGDLKLRVRVLESERAARKATVLQMATIYTVAGGTLLNLGVTFSNQGSEVI  678

Query  719  AMAAYGLCAFFGFQVLIGIVKVKKIDQRERLI  814
            A  ++     F    +  + +V ++D+ E++I
Sbjct  679  ANGSFVAAGVFFTLFIRSMQRVSRLDKFEKMI  710



>gb|EYU42774.1| hypothetical protein MIMGU_mgv1a002313mg [Erythranthe guttata]
Length=689

 Score =   187 bits (474),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 108/271 (40%), Positives = 158/271 (58%), Gaps = 32/271 (12%)
 Frame = +2

Query  8    LLEVFYGVYEKDPDKVLQAMVQMGVLVPTGDMTAVRRTAQFFLNSFEERLATQRRERELA  187
            LL+VFY VYEKD  KV+Q ++ +G L PTGD++AVRR+ QFFL++    L  QR +++  
Sbjct  449  LLDVFYAVYEKDAKKVMQGLIDLGALQPTGDLSAVRRSVQFFLDN----LLNQRPDQQ--  502

Query  188  KAELGFKKPLTKEEKIEKKKQRLAAIGEDLLSIAADQPFRFPATFTFVVRAFSVLHGIGK  367
                                Q L+AIGEDL +IA DQPFRFP+TFTFV+RAFS L GIG 
Sbjct  503  --------------------QTLSAIGEDLFAIATDQPFRFPSTFTFVLRAFSTLEGIGY  542

Query  368  GLDPRFDITEIAKPYALELLRFRE--AGVEVILKDFKTRWDRQNRAFYNLFRQADRVEKL  541
             LDP F   +IA PYA ELL  ++  +G +++ +  K    + N A  +      R++K+
Sbjct  543  TLDPDFSFPKIAAPYAQELLDLKQQRSGTQLVQEIRK----QANDARSSTISMPSRIQKI  598

Query  542  AEIIQRLEQGDLKLRVRALESERAFQRVAAVQKTILSAVAAGSLINLATVLYLNAIRMPA  721
             +I+++LE GDLKLRVR LESERA ++   +Q   +  V  G+L+N+          + A
Sbjct  599  EDIVKQLENGDLKLRVRVLESERAARKATILQMATIYTVFGGTLLNIGMTFSNQGSEVIA  658

Query  722  MAAYGLCAFFGFQVLIGIVKVKKIDQRERLI  814
              A+     F    +  + +V+K+D+ E +I
Sbjct  659  NGAFVAAGVFLTLFVRSMQRVQKLDKFETMI  689



>gb|EYU42775.1| hypothetical protein MIMGU_mgv1a002313mg [Erythranthe guttata]
Length=679

 Score =   187 bits (474),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 108/271 (40%), Positives = 158/271 (58%), Gaps = 32/271 (12%)
 Frame = +2

Query  8    LLEVFYGVYEKDPDKVLQAMVQMGVLVPTGDMTAVRRTAQFFLNSFEERLATQRRERELA  187
            LL+VFY VYEKD  KV+Q ++ +G L PTGD++AVRR+ QFFL++    L  QR +++  
Sbjct  439  LLDVFYAVYEKDAKKVMQGLIDLGALQPTGDLSAVRRSVQFFLDN----LLNQRPDQQ--  492

Query  188  KAELGFKKPLTKEEKIEKKKQRLAAIGEDLLSIAADQPFRFPATFTFVVRAFSVLHGIGK  367
                                Q L+AIGEDL +IA DQPFRFP+TFTFV+RAFS L GIG 
Sbjct  493  --------------------QTLSAIGEDLFAIATDQPFRFPSTFTFVLRAFSTLEGIGY  532

Query  368  GLDPRFDITEIAKPYALELLRFRE--AGVEVILKDFKTRWDRQNRAFYNLFRQADRVEKL  541
             LDP F   +IA PYA ELL  ++  +G +++ +  K    + N A  +      R++K+
Sbjct  533  TLDPDFSFPKIAAPYAQELLDLKQQRSGTQLVQEIRK----QANDARSSTISMPSRIQKI  588

Query  542  AEIIQRLEQGDLKLRVRALESERAFQRVAAVQKTILSAVAAGSLINLATVLYLNAIRMPA  721
             +I+++LE GDLKLRVR LESERA ++   +Q   +  V  G+L+N+          + A
Sbjct  589  EDIVKQLENGDLKLRVRVLESERAARKATILQMATIYTVFGGTLLNIGMTFSNQGSEVIA  648

Query  722  MAAYGLCAFFGFQVLIGIVKVKKIDQRERLI  814
              A+     F    +  + +V+K+D+ E +I
Sbjct  649  NGAFVAAGVFLTLFVRSMQRVQKLDKFETMI  679



>ref|XP_011656889.1| PREDICTED: uncharacterized aarF domain-containing protein kinase 
At1g79600, chloroplastic [Cucumis sativus]
 gb|KGN46613.1| hypothetical protein Csa_6G113500 [Cucumis sativus]
Length=707

 Score =   187 bits (474),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 111/274 (41%), Positives = 157/274 (57%), Gaps = 33/274 (12%)
 Frame = +2

Query  2    EGLLEVFYGVYEKDPDKVLQAMVQMGVLVPTGDMTAVRRTAQFFLNSFEERLATQRRERE  181
            E LL++FY VYEKD  KV+Q ++ +  L PTGD+++VRR+ QFFL++   +   Q     
Sbjct  464  ERLLDLFYAVYEKDAKKVMQRLIDLEALQPTGDLSSVRRSIQFFLDNLLSQSPDQ-----  518

Query  182  LAKAELGFKKPLTKEEKIEKKKQRLAAIGEDLLSIAADQPFRFPATFTFVVRAFSVLHGI  361
                                 +Q LAAIGEDL +IA DQPFRFP+TFTFV+RAFS L GI
Sbjct  519  ---------------------QQTLAAIGEDLFAIAQDQPFRFPSTFTFVLRAFSTLEGI  557

Query  362  GKGLDPRFDITEIAKPYALELLRFRE---AGVEVILKDFKTRWDRQNRAFYNLFRQADRV  532
            G  LDP F   +IA PYA ELL  ++   +G +++ +  K    + N A  +      RV
Sbjct  558  GYTLDPDFSFVKIAAPYAQELLDLKQKERSGTQLVQEIRK----QANDARTSTISMPYRV  613

Query  533  EKLAEIIQRLEQGDLKLRVRALESERAFQRVAAVQKTILSAVAAGSLINLATVLYLNAIR  712
            +K+ E +Q+LE GDLKLRVR LESERA ++   +Q   +  V  G+L+NL   L     +
Sbjct  614  QKIEEFVQQLESGDLKLRVRVLESERAARKATILQMATMYTVMGGTLLNLGITLSAQGNQ  673

Query  713  MPAMAAYGLCAFFGFQVLIGIVKVKKIDQRERLI  814
              A  ++     F   VL  + +VKK+D+ E++I
Sbjct  674  AVASGSFVGAGVFMTLVLRCMQRVKKLDKFEKMI  707



>emb|CBJ28359.1| conserved unknown protein [Ectocarpus siliculosus]
Length=758

 Score =   187 bits (474),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 103/271 (38%), Positives = 157/271 (58%), Gaps = 13/271 (5%)
 Frame = +2

Query  5    GLLEVFYGVYEKDPDKVLQAMVQMGVLVPTGDMTAVRRTAQFFLNSFEERLATQRREREL  184
            GL+ + +  YE DP  V  A+V+MG+L    D  +V + A+ FL  F   L   +  +  
Sbjct  489  GLVNLIFSTYENDPRAVCDALVEMGILKAGSDRISVEKIARSFLGEFTNTLNQGQDGKWT  548

Query  185  AKAELGFKKPLTKEEKIEKKKQRLAAIGEDLLSIAADQPFRFPATFTFVVRAFSVLHGIG  364
            A+        LTKE+K   +K+R A +GEDLLS++ D PF+FP TFTFV RAF+ L GIG
Sbjct  549  AE--------LTKEDKTRLRKERRAKLGEDLLSVSGDVPFKFPPTFTFVFRAFTSLDGIG  600

Query  365  KGLDPRFDITEIAKPYALELLRFREAGVEV-ILKDFKTRWDRQNRAFYNLFRQADRVEKL  541
            KGLD ++D+T +A+PY  ELL  R+    + + K F  +   +      + +    V  +
Sbjct  601  KGLDTKYDLTRLAQPYLKELLDVRDGSFALSVAKTFVKKVGWRPEDLEAVVKSPRNVAYV  660

Query  542  AEIIQRLEQGDLKLRVRALESERAFQRVAAVQKTILSAVAAGSLIN----LATVLYLNAI  709
             +I ++LEQGDLKLRVR LESERAF+R+   Q ++  A+A  + +N    L+  L   + 
Sbjct  661  EDITRKLEQGDLKLRVRVLESERAFERLELTQTSMYDAIAFSTFLNAALILSATLSAGSP  720

Query  710  RMPAMAAYGLCAFFGFQVLIGIVKVKKIDQR  802
             +P   A+ L   FG ++ +G+ K++K DQ+
Sbjct  721  LLPVRVAWTLAGVFGLRIPVGLFKIRKQDQK  751



>gb|KCW45286.1| hypothetical protein EUGRSUZ_L01057 [Eucalyptus grandis]
Length=296

 Score =   179 bits (453),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 100/234 (43%), Positives = 138/234 (59%), Gaps = 33/234 (14%)
 Frame = +2

Query  2    EGLLEVFYGVYEKDPDKVLQAMVQMGVLVPTGDMTAVRRTAQFFLNSFEERLATQRRERE  181
            E LLE+FY VYEKD  KV+Q+++ +G L PTGD+++VRR+ +FFL++   +   Q     
Sbjct  64   ERLLELFYAVYEKDAKKVMQSLIDIGALQPTGDLSSVRRSVKFFLDNLLSQTPDQ-----  118

Query  182  LAKAELGFKKPLTKEEKIEKKKQRLAAIGEDLLSIAADQPFRFPATFTFVVRAFSVLHGI  361
                                 +Q  AAIGEDL +IA DQPFRFP+TFTFV+RAFS L GI
Sbjct  119  ---------------------QQTFAAIGEDLFAIAQDQPFRFPSTFTFVLRAFSTLEGI  157

Query  362  GKGLDPRFDITEIAKPYALELLRF---REAGVEVILKDFKTRWDRQNRAFYNLFRQADRV  532
            G  LDP F   +IA PYA ELL     R+ G +++ +  K   D +  A    +    RV
Sbjct  158  GYTLDPNFSFVKIAAPYAQELLDIRQKRQTGTQLVEQIRKQADDARTSAVSMPY----RV  213

Query  533  EKLAEIIQRLEQGDLKLRVRALESERAFQRVAAVQKTILSAVAAGSLINLATVL  694
            +++ EI+ +L+ GDLKLRVR LESERA ++   +Q   +  V  G+L+NL   L
Sbjct  214  QRIEEIVNQLDSGDLKLRVRVLESERAARKATILQMATMYTVFGGTLLNLGVTL  267



>ref|XP_010040364.1| PREDICTED: uncharacterized aarF domain-containing protein kinase 
At1g79600, chloroplastic-like [Eucalyptus grandis]
Length=665

 Score =   186 bits (471),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 110/275 (40%), Positives = 160/275 (58%), Gaps = 35/275 (13%)
 Frame = +2

Query  2    EGLLEVFYGVYEKDPDKVLQAMVQMGVLVPTGDMTAVRRTAQFFLNSFEERLATQRRERE  181
            E LLE+FY VYEKD  KV+Q+++ +G L PTGD+++VRR+ +FFL++   +   Q     
Sbjct  422  ERLLELFYAVYEKDAKKVMQSLIDIGALQPTGDLSSVRRSVKFFLDNLLSQTPDQ-----  476

Query  182  LAKAELGFKKPLTKEEKIEKKKQRLAAIGEDLLSIAADQPFRFPATFTFVVRAFSVLHGI  361
                                 +Q  AAIGEDL +IA DQPFRFP+TFTFV+RAFS L GI
Sbjct  477  ---------------------QQTFAAIGEDLFAIAQDQPFRFPSTFTFVLRAFSTLEGI  515

Query  362  GKGLDPRFDITEIAKPYALELLRF---REAGVEVILKDFKTRWDRQNRAFYNLFRQADRV  532
            G  LDP F   +IA PYA ELL     R+ G +++ +  K   D +  A    +    RV
Sbjct  516  GYTLDPNFSFVKIAAPYAQELLDIRQKRQTGTQLVEQIRKQADDARTSAVSMPY----RV  571

Query  533  EKLAEIIQRLEQGDLKLRVRALESERAFQRVAAVQKTILSAVAAGSLINLATVLYLNAIR  712
            +++ EI+ +L+ GDLKLRVR LESERA ++   +Q   +  V  G+L+NL   L     +
Sbjct  572  QRIEEIVNQLDSGDLKLRVRVLESERAARKATILQMATMYTVFGGTLLNLGVTLTNQGSQ  631

Query  713  MPAMAAY-GLCAFFGFQVLIGIVKVKKIDQRERLI  814
            + A  ++ G   FF   +L  + +VKK+++ E++I
Sbjct  632  ILANGSFIGAGVFFTL-LLRSMQRVKKLEKFEKMI  665



>gb|KJB10238.1| hypothetical protein B456_001G191200 [Gossypium raimondii]
Length=649

 Score =   185 bits (470),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 110/274 (40%), Positives = 160/274 (58%), Gaps = 33/274 (12%)
 Frame = +2

Query  2    EGLLEVFYGVYEKDPDKVLQAMVQMGVLVPTGDMTAVRRTAQFFLNSFEERLATQRRERE  181
            E LLE+FY VYEKD  KV+Q+++ +G L PTGD+++VRR+ QFFL++    L  QR +++
Sbjct  406  ERLLELFYAVYEKDAKKVMQSLIDLGALQPTGDLSSVRRSVQFFLDN----LLDQRPDQD  461

Query  182  LAKAELGFKKPLTKEEKIEKKKQRLAAIGEDLLSIAADQPFRFPATFTFVVRAFSVLHGI  361
                                    LAAIGEDL +IA DQPFRFP+TFTFV+RAFS L GI
Sbjct  462  TT----------------------LAAIGEDLFAIAQDQPFRFPSTFTFVLRAFSTLEGI  499

Query  362  GKGLDPRFDITEIAKPYALELLRFRE---AGVEVILKDFKTRWDRQNRAFYNLFRQADRV  532
            G  LDP F   +IA PYA ELL  R+    G +++ +  K   D ++      +    RV
Sbjct  500  GYILDPNFSFAKIAAPYAQELLDIRQRQRTGSQLVQEIRKQADDARSYTMSMPY----RV  555

Query  533  EKLAEIIQRLEQGDLKLRVRALESERAFQRVAAVQKTILSAVAAGSLINLATVLYLNAIR  712
            +++ EI+++LE GDL+LRVR LESERA ++   +Q   +  V  G+L+NL         +
Sbjct  556  QRIEEILKQLESGDLRLRVRVLESERAARKATILQMATMYTVLGGTLVNLGVTFSSQGSQ  615

Query  713  MPAMAAYGLCAFFGFQVLIGIVKVKKIDQRERLI  814
            + A  ++     F    L  + +VKK+D+ E++I
Sbjct  616  IIANGSFVGAGVFLTLFLRSMQRVKKLDKFEKMI  649



>gb|KJB10239.1| hypothetical protein B456_001G191200 [Gossypium raimondii]
Length=708

 Score =   185 bits (470),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 110/274 (40%), Positives = 160/274 (58%), Gaps = 33/274 (12%)
 Frame = +2

Query  2    EGLLEVFYGVYEKDPDKVLQAMVQMGVLVPTGDMTAVRRTAQFFLNSFEERLATQRRERE  181
            E LLE+FY VYEKD  KV+Q+++ +G L PTGD+++VRR+ QFFL++    L  QR +++
Sbjct  465  ERLLELFYAVYEKDAKKVMQSLIDLGALQPTGDLSSVRRSVQFFLDN----LLDQRPDQD  520

Query  182  LAKAELGFKKPLTKEEKIEKKKQRLAAIGEDLLSIAADQPFRFPATFTFVVRAFSVLHGI  361
                                    LAAIGEDL +IA DQPFRFP+TFTFV+RAFS L GI
Sbjct  521  TT----------------------LAAIGEDLFAIAQDQPFRFPSTFTFVLRAFSTLEGI  558

Query  362  GKGLDPRFDITEIAKPYALELLRFRE---AGVEVILKDFKTRWDRQNRAFYNLFRQADRV  532
            G  LDP F   +IA PYA ELL  R+    G +++ +  K   D ++      +    RV
Sbjct  559  GYILDPNFSFAKIAAPYAQELLDIRQRQRTGSQLVQEIRKQADDARSYTMSMPY----RV  614

Query  533  EKLAEIIQRLEQGDLKLRVRALESERAFQRVAAVQKTILSAVAAGSLINLATVLYLNAIR  712
            +++ EI+++LE GDL+LRVR LESERA ++   +Q   +  V  G+L+NL         +
Sbjct  615  QRIEEILKQLESGDLRLRVRVLESERAARKATILQMATMYTVLGGTLVNLGVTFSSQGSQ  674

Query  713  MPAMAAYGLCAFFGFQVLIGIVKVKKIDQRERLI  814
            + A  ++     F    L  + +VKK+D+ E++I
Sbjct  675  IIANGSFVGAGVFLTLFLRSMQRVKKLDKFEKMI  708



>gb|KJB10240.1| hypothetical protein B456_001G191200 [Gossypium raimondii]
Length=682

 Score =   185 bits (469),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 110/274 (40%), Positives = 160/274 (58%), Gaps = 33/274 (12%)
 Frame = +2

Query  2    EGLLEVFYGVYEKDPDKVLQAMVQMGVLVPTGDMTAVRRTAQFFLNSFEERLATQRRERE  181
            E LLE+FY VYEKD  KV+Q+++ +G L PTGD+++VRR+ QFFL++    L  QR +++
Sbjct  439  ERLLELFYAVYEKDAKKVMQSLIDLGALQPTGDLSSVRRSVQFFLDN----LLDQRPDQD  494

Query  182  LAKAELGFKKPLTKEEKIEKKKQRLAAIGEDLLSIAADQPFRFPATFTFVVRAFSVLHGI  361
                                    LAAIGEDL +IA DQPFRFP+TFTFV+RAFS L GI
Sbjct  495  TT----------------------LAAIGEDLFAIAQDQPFRFPSTFTFVLRAFSTLEGI  532

Query  362  GKGLDPRFDITEIAKPYALELLRFRE---AGVEVILKDFKTRWDRQNRAFYNLFRQADRV  532
            G  LDP F   +IA PYA ELL  R+    G +++ +  K   D ++      +    RV
Sbjct  533  GYILDPNFSFAKIAAPYAQELLDIRQRQRTGSQLVQEIRKQADDARSYTMSMPY----RV  588

Query  533  EKLAEIIQRLEQGDLKLRVRALESERAFQRVAAVQKTILSAVAAGSLINLATVLYLNAIR  712
            +++ EI+++LE GDL+LRVR LESERA ++   +Q   +  V  G+L+NL         +
Sbjct  589  QRIEEILKQLESGDLRLRVRVLESERAARKATILQMATMYTVLGGTLVNLGVTFSSQGSQ  648

Query  713  MPAMAAYGLCAFFGFQVLIGIVKVKKIDQRERLI  814
            + A  ++     F    L  + +VKK+D+ E++I
Sbjct  649  IIANGSFVGAGVFLTLFLRSMQRVKKLDKFEKMI  682



>gb|KHG12439.1| Uncharacterized protein F383_16816 [Gossypium arboreum]
Length=675

 Score =   185 bits (469),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 110/272 (40%), Positives = 158/272 (58%), Gaps = 33/272 (12%)
 Frame = +2

Query  8    LLEVFYGVYEKDPDKVLQAMVQMGVLVPTGDMTAVRRTAQFFLNSFEERLATQRRERELA  187
            LLE+FY VYEKD  KV+Q+++ +G L PTGD+++VRR+ QFFL    E L  QR +++  
Sbjct  434  LLELFYAVYEKDAKKVMQSLIDLGALQPTGDLSSVRRSVQFFL----ENLLDQRPDQDTT  489

Query  188  KAELGFKKPLTKEEKIEKKKQRLAAIGEDLLSIAADQPFRFPATFTFVVRAFSVLHGIGK  367
                                  LAAIGEDL +IA DQPFRFP+TFTFV+RAFS L GIG 
Sbjct  490  ----------------------LAAIGEDLFAIAQDQPFRFPSTFTFVLRAFSTLEGIGY  527

Query  368  GLDPRFDITEIAKPYALELLRFRE---AGVEVILKDFKTRWDRQNRAFYNLFRQADRVEK  538
             LDP F   +IA PYA ELL  R+    G +++ +  K   D ++      +    RV++
Sbjct  528  ILDPNFSFAKIAAPYAQELLDIRQRQRTGSQLVQEIRKQADDARSYTMSMPY----RVQR  583

Query  539  LAEIIQRLEQGDLKLRVRALESERAFQRVAAVQKTILSAVAAGSLINLATVLYLNAIRMP  718
            + EI+++LE GDL+LRVR LESERA ++   +Q   +  V  G+L+NL         ++ 
Sbjct  584  IEEILKQLESGDLRLRVRVLESERAARKATILQMATMYTVLGGTLLNLGVTFSSQGSQII  643

Query  719  AMAAYGLCAFFGFQVLIGIVKVKKIDQRERLI  814
            A  ++     F    L  + +VKK+D+ E++I
Sbjct  644  ANGSFVGAGVFLTLFLRSMQRVKKLDKFEKMI  675



>ref|XP_009590949.1| PREDICTED: uncharacterized aarF domain-containing protein kinase 
At1g79600, chloroplastic [Nicotiana tomentosiformis]
Length=702

 Score =   184 bits (468),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 111/274 (41%), Positives = 158/274 (58%), Gaps = 33/274 (12%)
 Frame = +2

Query  2    EGLLEVFYGVYEKDPDKVLQAMVQMGVLVPTGDMTAVRRTAQFFLNSFEERLATQRRERE  181
            E LL VFY VYEKD  KV+Q ++ +G L PTGDM+AVRR+ QFFL++    L  QR +++
Sbjct  459  ERLLGVFYAVYEKDAKKVMQGLIDLGALQPTGDMSAVRRSVQFFLDN----LLNQRPDQQ  514

Query  182  LAKAELGFKKPLTKEEKIEKKKQRLAAIGEDLLSIAADQPFRFPATFTFVVRAFSVLHGI  361
                                  Q L+AIGEDL +IA DQPFRFP+TFTFV+RAFS L GI
Sbjct  515  ----------------------QTLSAIGEDLFAIATDQPFRFPSTFTFVLRAFSTLEGI  552

Query  362  GKGLDPRFDITEIAKPYALELLRFRE---AGVEVILKDFKTRWDRQNRAFYNLFRQADRV  532
            G  LDP F   +IA PYA ELL  R+   +G +++ +  K   D +       +    RV
Sbjct  553  GYILDPDFSFPKIAAPYAQELLDLRQKQRSGPQLVQEIRKQADDARTYTISMPY----RV  608

Query  533  EKLAEIIQRLEQGDLKLRVRALESERAFQRVAAVQKTILSAVAAGSLINLATVLYLNAIR  712
            +++ EI+++LE GDLKLRVR LESERA ++   +Q   +  V  G+L+NL         +
Sbjct  609  QRIEEIVKQLESGDLKLRVRVLESERAARKATILQMATMYTVIGGTLLNLGVTFSNQGSQ  668

Query  713  MPAMAAYGLCAFFGFQVLIGIVKVKKIDQRERLI  814
            + A  ++     F    +  + +V K+D+ E++I
Sbjct  669  IFANGSFIGAGVFLALFIRSMQRVNKLDKFEKMI  702



>gb|ACN40297.1| unknown [Picea sitchensis]
Length=369

 Score =   179 bits (453),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 105/273 (38%), Positives = 155/273 (57%), Gaps = 35/273 (13%)
 Frame = +2

Query  8    LLEVFYGVYEKDPDKVLQAMVQMGVLVPTGDMTAVRRTAQFFLNSFEERLATQRRERELA  187
            LL++FY VYEKD  KV+Q+++ +G L PTGDM +VRR+ QFFL    +R+  Q+ +++  
Sbjct  128  LLQMFYAVYEKDAKKVIQSLIDLGALQPTGDMASVRRSIQFFL----DRILNQKPDQQAT  183

Query  188  KAELGFKKPLTKEEKIEKKKQRLAAIGEDLLSIAADQPFRFPATFTFVVRAFSVLHGIGK  367
                                  L+AIGEDL ++A DQPFRFP+TFTFV+RAFS L GIG 
Sbjct  184  ----------------------LSAIGEDLFAVAVDQPFRFPSTFTFVLRAFSTLEGIGY  221

Query  368  GLDPRFDITEIAKPYALELLRFREA---GVEVILKDFKTRWDRQ-NRAFYNLFRQADRVE  535
             L+P F   +IA PYA ELL  RE+   G  ++         RQ N A         +++
Sbjct  222  TLNPDFSFAKIAAPYAQELLDMRESKRNGTSIV-----QEIQRQANDAREATISMPYKIQ  276

Query  536  KLAEIIQRLEQGDLKLRVRALESERAFQRVAAVQKTILSAVAAGSLINLATVLYLNAIRM  715
            ++ E IQ+L+ GDLKLRVR LE+ERA +R + +Q   +  V   +L+N+   L    +  
Sbjct  277  RIDEFIQQLDAGDLKLRVRVLEAERAARRASVMQMATIHTVLGATLLNVGVTLTAQGMEN  336

Query  716  PAMAAYGLCAFFGFQVLIGIVKVKKIDQRERLI  814
             A  +Y     F   V+  + +V+++D+ E+ I
Sbjct  337  FATVSYIGAGLFAILVVRSMKRVQRLDKFEKQI  369



>ref|XP_010689235.1| PREDICTED: uncharacterized aarF domain-containing protein kinase 
At1g79600, chloroplastic [Beta vulgaris subsp. vulgaris]
 ref|XP_010689236.1| PREDICTED: uncharacterized aarF domain-containing protein kinase 
At1g79600, chloroplastic [Beta vulgaris subsp. vulgaris]
Length=729

 Score =   184 bits (468),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 106/274 (39%), Positives = 157/274 (57%), Gaps = 33/274 (12%)
 Frame = +2

Query  2    EGLLEVFYGVYEKDPDKVLQAMVQMGVLVPTGDMTAVRRTAQFFLNSFEERLATQRRERE  181
            E LL++FY VYEKD  KV++ ++ +G L PTGD++AV+R+ Q+FL++   +   Q     
Sbjct  486  ERLLDLFYAVYEKDATKVMKNLIDLGALQPTGDLSAVKRSVQYFLDNLLSQTPDQ-----  540

Query  182  LAKAELGFKKPLTKEEKIEKKKQRLAAIGEDLLSIAADQPFRFPATFTFVVRAFSVLHGI  361
                                 +Q LAAIGEDL +IA DQPFRFP+TFTFV+RAFS L G+
Sbjct  541  ---------------------QQTLAAIGEDLFAIAQDQPFRFPSTFTFVIRAFSTLEGV  579

Query  362  GKGLDPRFDITEIAKPYALELLRFREA---GVEVILKDFKTRWDRQNRAFYNLFRQADRV  532
            GK +DP F   +IA PYA ELL  +E    GV+++ +  K   D ++      +    RV
Sbjct  580  GKFVDPNFSFVKIAAPYAQELLDLKEGRRTGVQLVREIRKQAEDARDYTVSMPY----RV  635

Query  533  EKLAEIIQRLEQGDLKLRVRALESERAFQRVAAVQKTILSAVAAGSLINLATVLYLNAIR  712
            +++ E +++LE GDLKLRVR LESERA ++   +Q   +  V  G+L+NL          
Sbjct  636  QRIEEFVKQLETGDLKLRVRVLESERAARKATILQMATMYTVLGGTLLNLGVTFSSQGSE  695

Query  713  MPAMAAYGLCAFFGFQVLIGIVKVKKIDQRERLI  814
            M A  ++     F   ++  + +VKK+D+ E +I
Sbjct  696  MVANGSFVGAGVFLTLLIRSMQRVKKLDKFETMI  729



>ref|XP_005718773.1| unnamed protein product [Chondrus crispus]
 emb|CDF38868.1| unnamed protein product [Chondrus crispus]
Length=895

 Score =   186 bits (471),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 105/272 (39%), Positives = 157/272 (58%), Gaps = 16/272 (6%)
 Frame = +2

Query  2    EGLLEVFYGVYEKDPDKVLQAMVQMGVLVPTGDMTAVRRTAQFFLNSFEERLATQRRERE  181
            +GL++V +G+YE +   +  AMV MGVL  + D   V +  ++FL  F   L  + R + 
Sbjct  630  KGLVDVVFGIYEGNAKDICDAMVNMGVLSGSADRITVEKVGRYFLGLFRVNLDQENRRK-  688

Query  182  LAKAELGFKKPLTKEEKIEKKKQRLAAIGEDLLSIAADQPFRFPATFTFVVRAFSVLHGI  361
                        +KEEK  +  +RL +IGEDLL+++ D+ F FP  FTFV RAF+ L GI
Sbjct  689  ------------SKEEKRAEMIKRLDSIGEDLLAVSEDECFNFPPVFTFVFRAFTTLEGI  736

Query  362  GKGLDPRFDITEIAKPYALELLRFREAGVEVI-LKDFKTRWDRQNRAFYNLFRQADRVEK  538
            GKGLDP++D+T IA PY  EL+  ++    +  +K FK +   +N+    L  Q  +   
Sbjct  737  GKGLDPKYDLTIIAGPYLKELIDLKDGSAAITAMKSFKKKVGWRNKDISALVTQPRKTAY  796

Query  539  LAEIIQRLEQGDLKLRVRALESERAFQRVAAVQKTILSAVAAGSLINLATVLYLNAIRMP  718
            + E I+R+E GDL+LRVR LESERAF+RV+ +Q  +   + A +L N+A VL   A R  
Sbjct  797  IEETIKRMESGDLRLRVRVLESERAFKRVSLMQSNMALGLVAATLTNMALVLTTAAERFA  856

Query  719  AMA--AYGLCAFFGFQVLIGIVKVKKIDQRER  808
              A   + L A    ++LIG++K + +D R R
Sbjct  857  IQARLLWLLAAIVSVRLLIGMLKYRSLDARLR  888



>emb|CDP18955.1| unnamed protein product [Coffea canephora]
Length=626

 Score =   183 bits (464),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 112/285 (39%), Positives = 157/285 (55%), Gaps = 55/285 (19%)
 Frame = +2

Query  2    EGLLEVFYGVYEKDPDKVLQAMVQMGVLVPTGDMTAVRRTAQFFLNSFEERLATQRRERE  181
            E LLE+FY VYEKD  KV+Q+++ +G L PTGDM++VRR+ QFFL++    L  QR +++
Sbjct  383  ERLLELFYAVYEKDAKKVMQSLIDLGALQPTGDMSSVRRSVQFFLDN----LLDQRPDQQ  438

Query  182  LAKAELGFKKPLTKEEKIEKKKQRLAAIGEDLLSIAADQPFRFPATFTFVVRAFSVLHGI  361
                                  Q L+AIGEDL +IA DQPFRFP+TFTFV+RAFS L GI
Sbjct  439  ----------------------QTLSAIGEDLFAIATDQPFRFPSTFTFVLRAFSTLEGI  476

Query  362  GKGLDPRFDITEIAKPYALELLRFRE---AGVEVILKDFKTRWDRQNRAFYNLFRQAD--  526
            G  LDP F   +IA PYA ELL  R+    G +++ +               + RQAD  
Sbjct  477  GYVLDPEFSFAKIAAPYAQELLDMRQKQRTGTQLVQE---------------IRRQADDA  521

Query  527  ---------RVEKLAEIIQRLEQGDLKLRVRALESERAFQRVAAVQKTILSAVAAGSLIN  679
                     RV+++ E +  LE GDLKLRVR LESERA ++   +Q   +  V  G+L+N
Sbjct  522  RTYTMSMPYRVQRIEEFVNELESGDLKLRVRVLESERAARKANILQMATIYTVLGGTLLN  581

Query  680  LATVLYLNAIRMPAMAAYGLCAFFGFQVLIGIVKVKKIDQRERLI  814
            L         ++ A  ++     F    +  + +VKK+D+ E +I
Sbjct  582  LGVTFTNQGSQIIANGSFLGAGVFLTLFMRSMQRVKKLDKFESMI  626



>ref|XP_006447817.1| hypothetical protein CICLE_v10014451mg [Citrus clementina]
 gb|ESR61057.1| hypothetical protein CICLE_v10014451mg [Citrus clementina]
Length=703

 Score =   183 bits (465),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 108/275 (39%), Positives = 159/275 (58%), Gaps = 35/275 (13%)
 Frame = +2

Query  2    EGLLEVFYGVYEKDPDKVLQAMVQMGVLVPTGDMTAVRRTAQFFLNSFEERLATQRRERE  181
            E LL++FY VYEKD  KV+Q ++ +  L PTGDM++VRR+ QFFL++   +   Q     
Sbjct  460  ERLLDLFYAVYEKDAKKVIQRLIDLEALQPTGDMSSVRRSVQFFLDNLLSQSPDQ-----  514

Query  182  LAKAELGFKKPLTKEEKIEKKKQRLAAIGEDLLSIAADQPFRFPATFTFVVRAFSVLHGI  361
                                 +Q LAAIGEDL +IA DQPFRFP+TFTFV+RAFS L GI
Sbjct  515  ---------------------QQTLAAIGEDLFAIAQDQPFRFPSTFTFVIRAFSTLEGI  553

Query  362  GKGLDPRFDITEIAKPYALELLRFR---EAGVEVILKDFKTRWDRQNRAFYNLFRQADRV  532
            G  LDP F   ++A PYA ELL  +   ++G +++ +  K    + + A  +      RV
Sbjct  554  GNILDPDFSFVKVAAPYAQELLDLKQQQQSGTQLVEQIRK----QADDARSSTMSMPSRV  609

Query  533  EKLAEIIQRLEQGDLKLRVRALESERAFQRVAAVQKTILSAVAAGSLINLATVLYLNAIR  712
            +++ E +++LE GDLKLRVR LESERA ++   +Q   +  V  G+L+NL         +
Sbjct  610  QRIEEFVKQLEAGDLKLRVRVLESERAARKATILQMATMYTVCGGTLLNLGVTFTGQGSQ  669

Query  713  MPAMAAY-GLCAFFGFQVLIGIVKVKKIDQRERLI  814
            + A  ++ G   FF   +L  + +VKK+D+ E++I
Sbjct  670  IIANGSFIGAGVFFTL-LLRSMQRVKKLDKFEKMI  703



>ref|XP_006469437.1| PREDICTED: uncharacterized aarF domain-containing protein kinase 
At1g79600, chloroplastic-like isoform X1 [Citrus sinensis]
 ref|XP_006469438.1| PREDICTED: uncharacterized aarF domain-containing protein kinase 
At1g79600, chloroplastic-like isoform X2 [Citrus sinensis]
Length=703

 Score =   183 bits (465),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 108/275 (39%), Positives = 159/275 (58%), Gaps = 35/275 (13%)
 Frame = +2

Query  2    EGLLEVFYGVYEKDPDKVLQAMVQMGVLVPTGDMTAVRRTAQFFLNSFEERLATQRRERE  181
            E LL++FY VYEKD  KV+Q ++ +  L PTGDM++VRR+ QFFL++   +   Q     
Sbjct  460  ERLLDLFYAVYEKDAKKVIQRLIDLEALQPTGDMSSVRRSVQFFLDNLLSQSPDQ-----  514

Query  182  LAKAELGFKKPLTKEEKIEKKKQRLAAIGEDLLSIAADQPFRFPATFTFVVRAFSVLHGI  361
                                 +Q LAAIGEDL +IA DQPFRFP+TFTFV+RAFS L GI
Sbjct  515  ---------------------QQTLAAIGEDLFAIAQDQPFRFPSTFTFVIRAFSTLEGI  553

Query  362  GKGLDPRFDITEIAKPYALELLRFR---EAGVEVILKDFKTRWDRQNRAFYNLFRQADRV  532
            G  LDP F   ++A PYA ELL  +   ++G +++ +  K    + + A  +      RV
Sbjct  554  GNILDPDFSFVKVAAPYAQELLDLKQQQQSGTQLVEQIRK----QADDARSSTMSMPSRV  609

Query  533  EKLAEIIQRLEQGDLKLRVRALESERAFQRVAAVQKTILSAVAAGSLINLATVLYLNAIR  712
            +++ E +++LE GDLKLRVR LESERA ++   +Q   +  V  G+L+NL         +
Sbjct  610  QRIEEFVKQLEAGDLKLRVRVLESERAARKATILQMATMYTVCGGTLLNLGVTFTGQGSQ  669

Query  713  MPAMAAY-GLCAFFGFQVLIGIVKVKKIDQRERLI  814
            + A  ++ G   FF   +L  + +VKK+D+ E++I
Sbjct  670  IIANGSFIGAGVFFTL-LLRSMQRVKKLDKFEKMI  703



>ref|XP_010069707.1| PREDICTED: uncharacterized aarF domain-containing protein kinase 
At1g79600, chloroplastic-like [Eucalyptus grandis]
 gb|KCW58127.1| hypothetical protein EUGRSUZ_H00850 [Eucalyptus grandis]
Length=707

 Score =   183 bits (465),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 109/275 (40%), Positives = 159/275 (58%), Gaps = 35/275 (13%)
 Frame = +2

Query  2    EGLLEVFYGVYEKDPDKVLQAMVQMGVLVPTGDMTAVRRTAQFFLNSFEERLATQRRERE  181
            E LLE+FY VYEKD  KV+++++ +G L PTGD+++VRR+ +FFL++   +   Q     
Sbjct  464  ERLLELFYAVYEKDAKKVMESLIDIGALQPTGDLSSVRRSVKFFLDNLLSQTPDQ-----  518

Query  182  LAKAELGFKKPLTKEEKIEKKKQRLAAIGEDLLSIAADQPFRFPATFTFVVRAFSVLHGI  361
                                 +Q  AAIGEDL +IA DQPFRFP+TFTFV+RAFS L GI
Sbjct  519  ---------------------QQTFAAIGEDLFAIAQDQPFRFPSTFTFVLRAFSTLEGI  557

Query  362  GKGLDPRFDITEIAKPYALELLRF---REAGVEVILKDFKTRWDRQNRAFYNLFRQADRV  532
            G  LDP F   +IA PYA ELL     R+ G +++ +  K   D +  A    +    RV
Sbjct  558  GYTLDPNFSFVKIAAPYAQELLDIRQKRQTGTQLVEQIRKQADDARTSAVSMPY----RV  613

Query  533  EKLAEIIQRLEQGDLKLRVRALESERAFQRVAAVQKTILSAVAAGSLINLATVLYLNAIR  712
            +++ EI+ +L+ GDLKLRVR LESERA ++   +Q   +  V  G+L+NL   L     +
Sbjct  614  QRIEEIVNQLDSGDLKLRVRVLESERAARKATILQMATMYTVFGGTLLNLGVTLTNQGSQ  673

Query  713  MPAMAAY-GLCAFFGFQVLIGIVKVKKIDQRERLI  814
            + A  ++ G   FF    L  + +VKK+++ E++I
Sbjct  674  ILANGSFIGAGVFFTL-FLRSMQRVKKLEKFEKMI  707



>ref|XP_003542175.1| PREDICTED: uncharacterized aarF domain-containing protein kinase 
At1g79600, chloroplastic-like [Glycine max]
 gb|KHN37979.1| Hypothetical protein glysoja_042080 [Glycine soja]
Length=708

 Score =   183 bits (464),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 108/274 (39%), Positives = 156/274 (57%), Gaps = 33/274 (12%)
 Frame = +2

Query  2    EGLLEVFYGVYEKDPDKVLQAMVQMGVLVPTGDMTAVRRTAQFFLNSFEERLATQRRERE  181
            E LLE+FY VYEKD  KV+Q ++ +G L PTGD+++VRR+ QFFL++   +   Q     
Sbjct  465  ERLLELFYAVYEKDAKKVMQCLIDLGALQPTGDLSSVRRSIQFFLDNLLSQTPDQ-----  519

Query  182  LAKAELGFKKPLTKEEKIEKKKQRLAAIGEDLLSIAADQPFRFPATFTFVVRAFSVLHGI  361
                                 +Q L+AIGEDL +IA DQPFRFP+TFTFV+RAFS L G+
Sbjct  520  ---------------------QQTLSAIGEDLFAIAQDQPFRFPSTFTFVIRAFSTLEGL  558

Query  362  GKGLDPRFDITEIAKPYALELLRFRE---AGVEVILKDFKTRWDRQNRAFYNLFRQADRV  532
            G  L+P F   +IA PYA ELL  R+    G +++ +  K    + + A  N      RV
Sbjct  559  GYILNPDFSFVKIAAPYAQELLDIRQKRPTGPQLVEEIRK----QADDARTNSISMPYRV  614

Query  533  EKLAEIIQRLEQGDLKLRVRALESERAFQRVAAVQKTILSAVAAGSLINLATVLYLNAIR  712
            +++ E +++LE GDLKLRVR LESERA ++   +Q   + +V  G+L+NL   L     +
Sbjct  615  QRIEEFVKQLEAGDLKLRVRVLESERAARKATILQMATMYSVLGGTLLNLGVTLSSQGNQ  674

Query  713  MPAMAAYGLCAFFGFQVLIGIVKVKKIDQRERLI  814
              A  ++      G   L  + +VKK+D+ E +I
Sbjct  675  AFANGSFIGAGILGALFLRSMQRVKKLDKFENMI  708



>ref|XP_009774821.1| PREDICTED: uncharacterized aarF domain-containing protein kinase 
At1g79600, chloroplastic [Nicotiana sylvestris]
Length=702

 Score =   183 bits (464),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 110/274 (40%), Positives = 158/274 (58%), Gaps = 33/274 (12%)
 Frame = +2

Query  2    EGLLEVFYGVYEKDPDKVLQAMVQMGVLVPTGDMTAVRRTAQFFLNSFEERLATQRRERE  181
            E LL +FY VYEKD  KV+Q ++ +G L PTGDM+AVRR+ QFFL++    L  QR +++
Sbjct  459  ERLLGLFYAVYEKDAKKVMQGLIDLGALQPTGDMSAVRRSIQFFLDN----LLNQRPDQQ  514

Query  182  LAKAELGFKKPLTKEEKIEKKKQRLAAIGEDLLSIAADQPFRFPATFTFVVRAFSVLHGI  361
                                  Q L+AIGEDL +IA DQPFRFP+TFTFV+RAFS L GI
Sbjct  515  ----------------------QTLSAIGEDLFAIATDQPFRFPSTFTFVLRAFSTLEGI  552

Query  362  GKGLDPRFDITEIAKPYALELLRFRE---AGVEVILKDFKTRWDRQNRAFYNLFRQADRV  532
            G  LDP F   +IA PYA ELL  R+   +G +++ +  K   D +       +    RV
Sbjct  553  GYILDPDFSFPKIAAPYAQELLDLRQKQRSGPQLVQEIRKQADDARTYTISMPY----RV  608

Query  533  EKLAEIIQRLEQGDLKLRVRALESERAFQRVAAVQKTILSAVAAGSLINLATVLYLNAIR  712
            +++ EI+++LE GDLKLRVR LESERA ++   +Q   +  V  G+L+NL         +
Sbjct  609  QRIEEIVKQLESGDLKLRVRVLESERAARKATILQMATMYTVIGGTLLNLGVTFSNQGSQ  668

Query  713  MPAMAAYGLCAFFGFQVLIGIVKVKKIDQRERLI  814
            + A  ++     F    +  + +V K+D+ E++I
Sbjct  669  IFANGSFIGAGVFLTLFIRSMQRVNKLDKFEKMI  702



>gb|KDO50944.1| hypothetical protein CISIN_1g0053091mg [Citrus sinensis]
 gb|KDO50945.1| hypothetical protein CISIN_1g0053091mg [Citrus sinensis]
Length=703

 Score =   183 bits (464),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 108/275 (39%), Positives = 159/275 (58%), Gaps = 35/275 (13%)
 Frame = +2

Query  2    EGLLEVFYGVYEKDPDKVLQAMVQMGVLVPTGDMTAVRRTAQFFLNSFEERLATQRRERE  181
            E LL++FY VYEKD  KV+Q ++ +  L PTGDM++VRR+ QFFL++   +   Q     
Sbjct  460  ERLLDLFYAVYEKDAKKVIQRLIDLEALQPTGDMSSVRRSVQFFLDNLLSQSPDQ-----  514

Query  182  LAKAELGFKKPLTKEEKIEKKKQRLAAIGEDLLSIAADQPFRFPATFTFVVRAFSVLHGI  361
                                 +Q LAAIGEDL +IA DQPFRFP+TFTFV+RAFS L GI
Sbjct  515  ---------------------QQTLAAIGEDLFAIAQDQPFRFPSTFTFVIRAFSTLEGI  553

Query  362  GKGLDPRFDITEIAKPYALELLRFR---EAGVEVILKDFKTRWDRQNRAFYNLFRQADRV  532
            G  LDP F   ++A PYA ELL  +   ++G +++ +  K    + + A  +      RV
Sbjct  554  GNILDPDFSFVKVAAPYAQELLDLKQQQQSGTQLVEQIRK----QADDARSSTMSMPSRV  609

Query  533  EKLAEIIQRLEQGDLKLRVRALESERAFQRVAAVQKTILSAVAAGSLINLATVLYLNAIR  712
            +++ E +++LE GDLKLRVR LESERA ++   +Q   +  V  G+L+NL         +
Sbjct  610  QRIEEFVKQLEAGDLKLRVRVLESERAARKATILQMATMYTVCGGTLLNLGVTFTGQGSQ  669

Query  713  MPAMAAY-GLCAFFGFQVLIGIVKVKKIDQRERLI  814
            + A  ++ G   FF   +L  + +VKK+D+ E++I
Sbjct  670  IIANGSFIGAGVFFTL-LLRSMQRVKKLDKFEKMI  703



>tpg|DAA47529.1| TPA: hypothetical protein ZEAMMB73_771547 [Zea mays]
 tpg|DAA47530.1| TPA: hypothetical protein ZEAMMB73_771547 [Zea mays]
 tpg|DAA47531.1| TPA: hypothetical protein ZEAMMB73_771547 [Zea mays]
Length=246

 Score =   173 bits (439),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 85/100 (85%), Positives = 91/100 (91%), Gaps = 0/100 (0%)
 Frame = +2

Query  47   DKVLQAMVQMGVLVPTGDMTAVRRTAQFFLNSFEERLATQRRERELAKAELGFKKPLTKE  226
             +VLQAMVQMGVLVPTGDMT VRRTAQFFLNSF+E L  QR+ERE+A AELGFKK LTKE
Sbjct  124  SEVLQAMVQMGVLVPTGDMTVVRRTAQFFLNSFQECLTAQRKEREMATAELGFKKQLTKE  183

Query  227  EKIEKKKQRLAAIGEDLLSIAADQPFRFPATFTFVVRAFS  346
            EK EK+KQRLA IGEDLL+IAADQPFRFPATFTFVVRAFS
Sbjct  184  EKFEKRKQRLATIGEDLLAIAADQPFRFPATFTFVVRAFS  223



>ref|XP_007145996.1| hypothetical protein PHAVU_006G004300g [Phaseolus vulgaris]
 gb|ESW17990.1| hypothetical protein PHAVU_006G004300g [Phaseolus vulgaris]
Length=708

 Score =   182 bits (462),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 107/274 (39%), Positives = 157/274 (57%), Gaps = 33/274 (12%)
 Frame = +2

Query  2    EGLLEVFYGVYEKDPDKVLQAMVQMGVLVPTGDMTAVRRTAQFFLNSFEERLATQRRERE  181
            E LLE+FY VYEKD  KV+Q ++ +G L PTGD+++VRR+ QFFL++   +   Q     
Sbjct  465  ERLLELFYAVYEKDAKKVMQCLIDLGALQPTGDLSSVRRSVQFFLDNLLSQTPDQ-----  519

Query  182  LAKAELGFKKPLTKEEKIEKKKQRLAAIGEDLLSIAADQPFRFPATFTFVVRAFSVLHGI  361
                                 +Q L+AIGEDL +IA DQPFRFP+TFTFV+RAFS L G+
Sbjct  520  ---------------------QQTLSAIGEDLFAIAQDQPFRFPSTFTFVIRAFSTLEGL  558

Query  362  GKGLDPRFDITEIAKPYALELLRFRE---AGVEVILKDFKTRWDRQNRAFYNLFRQADRV  532
            G  L+P F   +IA PYA ELL  R+    G +++ +  K   D +     N      RV
Sbjct  559  GYILNPDFSFVKIAAPYAQELLDIRQKQRTGPQLVEEIRKQADDVRT----NSITMPYRV  614

Query  533  EKLAEIIQRLEQGDLKLRVRALESERAFQRVAAVQKTILSAVAAGSLINLATVLYLNAIR  712
            +++ E +++LE GDLKLRVR LESERA ++   +Q   + +V  G+L+NL   L     +
Sbjct  615  QRIEEFVKQLESGDLKLRVRVLESERAARKATILQMATMYSVLGGTLLNLGITLSSQGNQ  674

Query  713  MPAMAAYGLCAFFGFQVLIGIVKVKKIDQRERLI  814
              A  ++     F   +L  + +VKK+++ E++I
Sbjct  675  AFANGSFLGAGVFAALLLRSMQRVKKLEKFEKMI  708



>ref|XP_008783035.1| PREDICTED: uncharacterized aarF domain-containing protein kinase 
At1g79600, chloroplastic-like isoform X1 [Phoenix dactylifera]
Length=706

 Score =   182 bits (462),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 105/274 (38%), Positives = 158/274 (58%), Gaps = 33/274 (12%)
 Frame = +2

Query  2    EGLLEVFYGVYEKDPDKVLQAMVQMGVLVPTGDMTAVRRTAQFFLNSFEERLATQRRERE  181
            E LLE+FY VYEKD +KV++ ++ +  L PTGD+++VRR+ QFFL++   + + Q     
Sbjct  463  ERLLELFYAVYEKDANKVMRCLIDLEALQPTGDLSSVRRSIQFFLDNLLSQTSDQ-----  517

Query  182  LAKAELGFKKPLTKEEKIEKKKQRLAAIGEDLLSIAADQPFRFPATFTFVVRAFSVLHGI  361
                                 +Q L+AIGEDL +IA DQPFRFP+TFTFV+RAFS L GI
Sbjct  518  ---------------------QQTLSAIGEDLFAIATDQPFRFPSTFTFVLRAFSTLEGI  556

Query  362  GKGLDPRFDITEIAKPYALELLRFRE---AGVEVILKDFKTRWDRQNRAFYNLFRQADRV  532
            G  LDP F   +IA PYA ELL  R+    G E + +  K   D +N      +    R+
Sbjct  557  GYTLDPEFSFVKIAAPYAQELLDIRQKRRGGAEFVEEIQKQANDARNYTISMPY----RI  612

Query  533  EKLAEIIQRLEQGDLKLRVRALESERAFQRVAAVQKTILSAVAAGSLINLATVLYLNAIR  712
            +++ + +++LE GDLKLRVR LESERA ++ + +Q   +    +G+L+N+   L     +
Sbjct  613  QRIEKFVKQLESGDLKLRVRVLESERAARKASILQMATMYTATSGTLLNVGLTLISQGNQ  672

Query  713  MPAMAAYGLCAFFGFQVLIGIVKVKKIDQRERLI  814
              A  ++     F   V+  + +VKK+D+ E++I
Sbjct  673  PIANVSFIGAGIFLTLVIRSMQRVKKLDKFEKMI  706



>ref|XP_012081503.1| PREDICTED: uncharacterized aarF domain-containing protein kinase 
At1g79600, chloroplastic [Jatropha curcas]
 gb|KDP29949.1| hypothetical protein JCGZ_18518 [Jatropha curcas]
Length=706

 Score =   182 bits (461),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 107/274 (39%), Positives = 156/274 (57%), Gaps = 33/274 (12%)
 Frame = +2

Query  2    EGLLEVFYGVYEKDPDKVLQAMVQMGVLVPTGDMTAVRRTAQFFLNSFEERLATQRRERE  181
            E LLE+FY VYEKD  KV+Q+++ +  L PTGD+++VRR+ QFFL++   +   Q     
Sbjct  463  ERLLELFYAVYEKDAKKVMQSLIDLEALQPTGDLSSVRRSVQFFLDNLLSQTPDQ-----  517

Query  182  LAKAELGFKKPLTKEEKIEKKKQRLAAIGEDLLSIAADQPFRFPATFTFVVRAFSVLHGI  361
                                 +Q LAAIGEDL +IA DQPFRFP+TFTFV+RAFS L GI
Sbjct  518  ---------------------QQTLAAIGEDLFAIAQDQPFRFPSTFTFVIRAFSTLEGI  556

Query  362  GKGLDPRFDITEIAKPYALELLRFRE---AGVEVILKDFKTRWDRQNRAFYNLFRQADRV  532
            G  LDP F   +IA PYA ELL  R     G +++ +  +    + N A  +      RV
Sbjct  557  GYILDPDFSFVKIAAPYAQELLDLRNKQRTGTQLVEEIRR----QANDARSSTISMPSRV  612

Query  533  EKLAEIIQRLEQGDLKLRVRALESERAFQRVAAVQKTILSAVAAGSLINLATVLYLNAIR  712
            +++ E +++LE G+LKLRVR LESERA ++   +Q   +  V  G+L+NL         +
Sbjct  613  QRIEEFVKQLEAGELKLRVRVLESERAARKATVLQMATMYTVLGGTLLNLGVTFSSQGSQ  672

Query  713  MPAMAAYGLCAFFGFQVLIGIVKVKKIDQRERLI  814
            + A  ++     F   +L  + +VKK+D+ E++I
Sbjct  673  VFANGSFIGAGVFLTLLLRSMQRVKKLDKFEKMI  706



>ref|XP_002532202.1| Protein ABC1, mitochondrial precursor, putative [Ricinus communis]
 gb|EEF30171.1| Protein ABC1, mitochondrial precursor, putative [Ricinus communis]
Length=707

 Score =   182 bits (461),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 108/274 (39%), Positives = 155/274 (57%), Gaps = 33/274 (12%)
 Frame = +2

Query  2    EGLLEVFYGVYEKDPDKVLQAMVQMGVLVPTGDMTAVRRTAQFFLNSFEERLATQRRERE  181
            E LLE+FY VYEKD  KV+Q+++ +  L PTGD+++VRR+ QFFL++   +   Q     
Sbjct  464  ERLLELFYAVYEKDAKKVMQSLIDLEALQPTGDLSSVRRSVQFFLDNLLSQTPDQ-----  518

Query  182  LAKAELGFKKPLTKEEKIEKKKQRLAAIGEDLLSIAADQPFRFPATFTFVVRAFSVLHGI  361
                                 +Q LA IGEDL +IA DQPFRFP+TFTFV+RAFS L GI
Sbjct  519  ---------------------QQTLATIGEDLFAIAQDQPFRFPSTFTFVLRAFSTLEGI  557

Query  362  GKGLDPRFDITEIAKPYALELLRFRE---AGVEVILKDFKTRWDRQNRAFYNLFRQADRV  532
            G  LDP F   +IA PYA ELL  R+    G +++ +  K    + N A  +      RV
Sbjct  558  GYILDPDFSFVKIAAPYAQELLDLRKRQSTGTQLVEEIRK----QANDARSSTMSMPARV  613

Query  533  EKLAEIIQRLEQGDLKLRVRALESERAFQRVAAVQKTILSAVAAGSLINLATVLYLNAIR  712
            +++ E +++LE GDLKLRVR LESERA ++   +Q   +  V  G+L+NL         +
Sbjct  614  QRIEEFVKQLESGDLKLRVRVLESERAARKATVLQMATMYTVLGGTLLNLGVTFGSQGSQ  673

Query  713  MPAMAAYGLCAFFGFQVLIGIVKVKKIDQRERLI  814
              A  ++     F   +L  + +VKK+D+ E++I
Sbjct  674  AIANGSFIGAGVFLALLLRSMQRVKKLDKFEKMI  707



>emb|CBI28456.3| unnamed protein product [Vitis vinifera]
Length=629

 Score =   181 bits (459),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 107/274 (39%), Positives = 154/274 (56%), Gaps = 33/274 (12%)
 Frame = +2

Query  2    EGLLEVFYGVYEKDPDKVLQAMVQMGVLVPTGDMTAVRRTAQFFLNSFEERLATQRRERE  181
            E LLE+FY +YEKD  KV+Q+++ +  L P GDM+ VRR+ QFFL++   +   Q     
Sbjct  386  ERLLELFYAIYEKDAKKVMQSLIDLEALQPMGDMSPVRRSVQFFLDNLLSQTPDQ-----  440

Query  182  LAKAELGFKKPLTKEEKIEKKKQRLAAIGEDLLSIAADQPFRFPATFTFVVRAFSVLHGI  361
                                 +Q  AAIGEDL +IA DQPFRFP+TFTFV+RAFS L GI
Sbjct  441  ---------------------QQTFAAIGEDLFAIATDQPFRFPSTFTFVLRAFSTLEGI  479

Query  362  GKGLDPRFDITEIAKPYALELLRFRE---AGVEVILKDFKTRWDRQNRAFYNLFRQADRV  532
            G  LDP F   +IA PYA ELL  R+   +G +++ +  K   D +       +     V
Sbjct  480  GYSLDPDFSFVKIAAPYAQELLDTRQQQRSGPQLVQEIRKQADDARTYTMSMPY----SV  535

Query  533  EKLAEIIQRLEQGDLKLRVRALESERAFQRVAAVQKTILSAVAAGSLINLATVLYLNAIR  712
            +++ EI+++LE GDLKLRVR LESERA ++   +Q   +  V  G+L+NL   L     +
Sbjct  536  QRIEEIVKQLESGDLKLRVRVLESERAARKATILQMATMYTVLGGTLLNLGVTLGNQGSQ  595

Query  713  MPAMAAYGLCAFFGFQVLIGIVKVKKIDQRERLI  814
            + A  +Y     F    +  + +VKK+D+ E++I
Sbjct  596  VIANGSYVGAGVFLILFIRSMQRVKKLDKFEKMI  629



>ref|XP_002268128.2| PREDICTED: uncharacterized aarF domain-containing protein kinase 
At1g79600, chloroplastic-like [Vitis vinifera]
Length=707

 Score =   181 bits (459),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 107/274 (39%), Positives = 154/274 (56%), Gaps = 33/274 (12%)
 Frame = +2

Query  2    EGLLEVFYGVYEKDPDKVLQAMVQMGVLVPTGDMTAVRRTAQFFLNSFEERLATQRRERE  181
            E LLE+FY +YEKD  KV+Q+++ +  L P GDM+ VRR+ QFFL++   +   Q     
Sbjct  464  ERLLELFYAIYEKDAKKVMQSLIDLEALQPMGDMSPVRRSVQFFLDNLLSQTPDQ-----  518

Query  182  LAKAELGFKKPLTKEEKIEKKKQRLAAIGEDLLSIAADQPFRFPATFTFVVRAFSVLHGI  361
                                 +Q  AAIGEDL +IA DQPFRFP+TFTFV+RAFS L GI
Sbjct  519  ---------------------QQTFAAIGEDLFAIATDQPFRFPSTFTFVLRAFSTLEGI  557

Query  362  GKGLDPRFDITEIAKPYALELLRFRE---AGVEVILKDFKTRWDRQNRAFYNLFRQADRV  532
            G  LDP F   +IA PYA ELL  R+   +G +++ +  K   D +       +     V
Sbjct  558  GYSLDPDFSFVKIAAPYAQELLDTRQQQRSGPQLVQEIRKQADDARTYTMSMPY----SV  613

Query  533  EKLAEIIQRLEQGDLKLRVRALESERAFQRVAAVQKTILSAVAAGSLINLATVLYLNAIR  712
            +++ EI+++LE GDLKLRVR LESERA ++   +Q   +  V  G+L+NL   L     +
Sbjct  614  QRIEEIVKQLESGDLKLRVRVLESERAARKATILQMATMYTVLGGTLLNLGVTLGNQGSQ  673

Query  713  MPAMAAYGLCAFFGFQVLIGIVKVKKIDQRERLI  814
            + A  +Y     F    +  + +VKK+D+ E++I
Sbjct  674  VIANGSYVGAGVFLILFIRSMQRVKKLDKFEKMI  707



>ref|XP_008229932.1| PREDICTED: uncharacterized aarF domain-containing protein kinase 
At1g79600, chloroplastic [Prunus mume]
Length=703

 Score =   181 bits (458),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 107/272 (39%), Positives = 157/272 (58%), Gaps = 33/272 (12%)
 Frame = +2

Query  8    LLEVFYGVYEKDPDKVLQAMVQMGVLVPTGDMTAVRRTAQFFLNSFEERLATQRRERELA  187
            LLE+FY VYEKD  KV+Q ++ +G L PTGD+++VRR+ Q+FL++    L +QR +    
Sbjct  462  LLELFYSVYEKDAKKVIQCLIDLGALQPTGDLSSVRRSVQYFLDN----LLSQRPD----  513

Query  188  KAELGFKKPLTKEEKIEKKKQRLAAIGEDLLSIAADQPFRFPATFTFVVRAFSVLHGIGK  367
                              + Q L+AIGEDL +IA DQPFRFP+TFTFV+RAFS L GIG 
Sbjct  514  ------------------QAQTLSAIGEDLFAIALDQPFRFPSTFTFVLRAFSTLEGIGY  555

Query  368  GLDPRFDITEIAKPYALELLRFRE---AGVEVILKDFKTRWDRQNRAFYNLFRQADRVEK  538
             LDP F   +IA PYA ELL  R+    G +++ +  K   D ++      +    RV++
Sbjct  556  ALDPDFSFAKIAAPYAQELLDLRQKQRTGTQLVNEIRKQADDARSYTMSMPY----RVQR  611

Query  539  LAEIIQRLEQGDLKLRVRALESERAFQRVAAVQKTILSAVAAGSLINLATVLYLNAIRMP  718
            + E ++ LE GDLKLRVR LESERA ++   +Q   +  V  G+L+NL   L     +  
Sbjct  612  IEEFVKELESGDLKLRVRVLESERAARKATILQMATMYTVLGGTLLNLGVTLSSQGSQAI  671

Query  719  AMAAYGLCAFFGFQVLIGIVKVKKIDQRERLI  814
            A  ++     F   +   + +VKK+++ E++I
Sbjct  672  ANGSFIGAGVFLTLLARSMQRVKKLEKFEKMI  703



>ref|XP_010551963.1| PREDICTED: uncharacterized aarF domain-containing protein kinase 
At1g79600, chloroplastic [Tarenaya hassleriana]
Length=681

 Score =   179 bits (454),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 104/273 (38%), Positives = 157/273 (58%), Gaps = 35/273 (13%)
 Frame = +2

Query  8    LLEVFYGVYEKDPDKVLQAMVQMGVLVPTGDMTAVRRTAQFFLNSFEERLATQRRERELA  187
            LL++FY VYEKD  KV+Q ++++  L PTGD+++VRR+ Q+FL++   +   Q       
Sbjct  440  LLDLFYAVYEKDAKKVMQNLIELEALQPTGDLSSVRRSIQYFLDNLLSQSPDQ-------  492

Query  188  KAELGFKKPLTKEEKIEKKKQRLAAIGEDLLSIAADQPFRFPATFTFVVRAFSVLHGIGK  367
                               +Q LAAIGEDL +IA DQPFRFP+TFTFV+RAFS L GIG 
Sbjct  493  -------------------QQTLAAIGEDLFAIAQDQPFRFPSTFTFVLRAFSTLEGIGY  533

Query  368  GLDPRFDITEIAKPYALELLRF---REAGVEVILKDFKTRWDRQNRAFYNLFRQADRVEK  538
             LDP F   ++A PYA ELL     R  G +++ +  K    + + A  +      R+++
Sbjct  534  TLDPDFSFVKVAAPYAQELLDLRTKRPTGTQLVQEIRK----QADDARSSTLSMPTRIQR  589

Query  539  LAEIIQRLEQGDLKLRVRALESERAFQRVAAVQKTILSAVAAGSLINLATVLYLNAIRMP  718
            + E +++LE GD+KLRVR LESERA ++   +Q   +  V  G+L+NL         ++ 
Sbjct  590  IEEFVKQLESGDMKLRVRVLESERAARKATILQMATMYTVLGGTLLNLGVTFSNQGSQVI  649

Query  719  AMAAY-GLCAFFGFQVLIGIVKVKKIDQRERLI  814
            A  ++ G   F G  +L  + +VKK+D+ E++I
Sbjct  650  ANGSFIGAGIFMGL-ILRSMQRVKKLDKFEKMI  681



>ref|XP_010929058.1| PREDICTED: uncharacterized aarF domain-containing protein kinase 
At1g79600, chloroplastic [Elaeis guineensis]
 ref|XP_010929059.1| PREDICTED: uncharacterized aarF domain-containing protein kinase 
At1g79600, chloroplastic [Elaeis guineensis]
 ref|XP_010929060.1| PREDICTED: uncharacterized aarF domain-containing protein kinase 
At1g79600, chloroplastic [Elaeis guineensis]
 ref|XP_010929061.1| PREDICTED: uncharacterized aarF domain-containing protein kinase 
At1g79600, chloroplastic [Elaeis guineensis]
Length=706

 Score =   179 bits (454),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 104/274 (38%), Positives = 157/274 (57%), Gaps = 33/274 (12%)
 Frame = +2

Query  2    EGLLEVFYGVYEKDPDKVLQAMVQMGVLVPTGDMTAVRRTAQFFLNSFEERLATQRRERE  181
            E LLE+FY +YEKD +KV++ ++ +  L PTGD++ VRR+ QFFL++   +   Q     
Sbjct  463  ERLLELFYAIYEKDANKVMRCLIDLEALQPTGDLSPVRRSIQFFLDNLLSQTPDQ-----  517

Query  182  LAKAELGFKKPLTKEEKIEKKKQRLAAIGEDLLSIAADQPFRFPATFTFVVRAFSVLHGI  361
                                 +Q  +AIGEDL +IA DQPFRFP+TFTFV+RAFS L GI
Sbjct  518  ---------------------QQTFSAIGEDLFAIATDQPFRFPSTFTFVLRAFSTLEGI  556

Query  362  GKGLDPRFDITEIAKPYALELLRFRE---AGVEVILKDFKTRWDRQNRAFYNLFRQADRV  532
            G  LDP F   +IA PYA ELL  R+    G E + +  K   D ++      +    R+
Sbjct  557  GYTLDPEFSFAKIAAPYAQELLDIRQKRRGGAEFVGEIQKQANDARDYTISMPY----RI  612

Query  533  EKLAEIIQRLEQGDLKLRVRALESERAFQRVAAVQKTILSAVAAGSLINLATVLYLNAIR  712
            +++ E +++LE GDLKLRVR LESERA ++ + +Q   + A  +G+L+N+   L     +
Sbjct  613  QRIEEFVKQLESGDLKLRVRVLESERAARKASILQMATMYAAISGTLLNVGVTLSSQGNQ  672

Query  713  MPAMAAYGLCAFFGFQVLIGIVKVKKIDQRERLI  814
              A A++     F   V+  + +V+K+D+ E++I
Sbjct  673  PIANASFVAAGIFLTLVIRYMQRVEKLDKFEKMI  706



>ref|XP_002320527.1| ABC1 family protein [Populus trichocarpa]
 gb|EEE98842.1| ABC1 family protein [Populus trichocarpa]
Length=719

 Score =   179 bits (454),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 107/274 (39%), Positives = 155/274 (57%), Gaps = 33/274 (12%)
 Frame = +2

Query  2    EGLLEVFYGVYEKDPDKVLQAMVQMGVLVPTGDMTAVRRTAQFFLNSFEERLATQRRERE  181
            E LLE+FY VYEKD  KV+Q+++ +  L PTGD+++VRR+ QFFLN+   +   Q     
Sbjct  476  ERLLELFYAVYEKDAKKVIQSLIDLEALQPTGDLSSVRRSVQFFLNNLLSQTPDQ-----  530

Query  182  LAKAELGFKKPLTKEEKIEKKKQRLAAIGEDLLSIAADQPFRFPATFTFVVRAFSVLHGI  361
                                 +Q LAAIGEDL +IA DQPF FP+TFTFV+RAFS L GI
Sbjct  531  ---------------------QQTLAAIGEDLFAIAQDQPFLFPSTFTFVIRAFSTLEGI  569

Query  362  GKGLDPRFDITEIAKPYALELLRFRE---AGVEVILKDFKTRWDRQNRAFYNLFRQADRV  532
            G  LDP F   +IA PYA ELL  R+    G  ++ +  K    + N A  +      R+
Sbjct  570  GYILDPDFSFVKIAAPYAQELLDGRQRPRNGTRLVEEIRK----QANDARSSTISMPYRI  625

Query  533  EKLAEIIQRLEQGDLKLRVRALESERAFQRVAAVQKTILSAVAAGSLINLATVLYLNAIR  712
            +++ + +++LE GDLKLRVR LESERA Q+   +Q   +  V  G+L+NL         +
Sbjct  626  QRIEDFVKQLEAGDLKLRVRVLESERAAQKATILQMATMYTVLGGTLLNLGVTFSNQGSQ  685

Query  713  MPAMAAYGLCAFFGFQVLIGIVKVKKIDQRERLI  814
            + A  ++     F   +L  + +VKK+D+ E+++
Sbjct  686  VFANGSFIGAGVFLTLLLRSMQRVKKLDKFEKMV  719



>gb|AAL87300.1| unknown protein [Arabidopsis thaliana]
Length=566

 Score =   177 bits (450),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 101/272 (37%), Positives = 154/272 (57%), Gaps = 33/272 (12%)
 Frame = +2

Query  8    LLEVFYGVYEKDPDKVLQAMVQMGVLVPTGDMTAVRRTAQFFLNSFEERLATQRRERELA  187
            LL++FY VYEKD  KV+Q ++ +  L PTGD+++VRR+ QFFL++   +   Q       
Sbjct  325  LLDLFYSVYEKDAKKVMQNLIDLEALQPTGDLSSVRRSVQFFLDNLLSQSPDQ-------  377

Query  188  KAELGFKKPLTKEEKIEKKKQRLAAIGEDLLSIAADQPFRFPATFTFVVRAFSVLHGIGK  367
                               +Q LAAIGEDL +I+ DQPFRFP+TFTFV+RAFS L GIG 
Sbjct  378  -------------------QQTLAAIGEDLFAISQDQPFRFPSTFTFVIRAFSTLEGIGY  418

Query  368  GLDPRFDITEIAKPYALELLRFRE---AGVEVILKDFKTRWDRQNRAFYNLFRQADRVEK  538
             LDP F   ++A PYA ELL  ++   +G +++ +  K   D ++      +    RV++
Sbjct  419  ILDPEFSFVKVAAPYAQELLDLKQRQRSGTQLVQEIRKQADDARSSTLSMPY----RVQR  474

Query  539  LAEIIQRLEQGDLKLRVRALESERAFQRVAAVQKTILSAVAAGSLINLATVLYLNAIRMP  718
            + E ++ L+ GDLKLRVR LESERA ++   +Q   +  V  G+L+N+         ++ 
Sbjct  475  IEEFVKELDSGDLKLRVRVLESERAARKATILQMATMYTVLGGTLLNIGVTFSNQGSQLV  534

Query  719  AMAAYGLCAFFGFQVLIGIVKVKKIDQRERLI  814
            A  ++     F   VL  + +V K+D+ E++I
Sbjct  535  ANGSFIGAGIFMLLVLRSMQRVNKLDKFEKMI  566



>ref|NP_566315.1| ABC1 kinase [Arabidopsis thaliana]
 ref|NP_850536.1| ABC1 kinase [Arabidopsis thaliana]
 dbj|BAH19998.1| AT3G07700 [Arabidopsis thaliana]
 gb|AEE74588.1| ABC1 kinase [Arabidopsis thaliana]
 gb|AEE74589.1| ABC1 kinase [Arabidopsis thaliana]
Length=695

 Score =   178 bits (452),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 101/272 (37%), Positives = 154/272 (57%), Gaps = 33/272 (12%)
 Frame = +2

Query  8    LLEVFYGVYEKDPDKVLQAMVQMGVLVPTGDMTAVRRTAQFFLNSFEERLATQRRERELA  187
            LL++FY VYEKD  KV+Q ++ +  L PTGD+++VRR+ QFFL++   +   Q       
Sbjct  454  LLDLFYSVYEKDAKKVMQNLIDLEALQPTGDLSSVRRSVQFFLDNLLSQSPDQ-------  506

Query  188  KAELGFKKPLTKEEKIEKKKQRLAAIGEDLLSIAADQPFRFPATFTFVVRAFSVLHGIGK  367
                               +Q LAAIGEDL +I+ DQPFRFP+TFTFV+RAFS L GIG 
Sbjct  507  -------------------QQTLAAIGEDLFAISQDQPFRFPSTFTFVIRAFSTLEGIGY  547

Query  368  GLDPRFDITEIAKPYALELLRFRE---AGVEVILKDFKTRWDRQNRAFYNLFRQADRVEK  538
             LDP F   ++A PYA ELL  ++   +G +++ +  K   D ++      +    RV++
Sbjct  548  ILDPEFSFVKVAAPYAQELLDLKQRQRSGTQLVQEIRKQADDARSSTLSMPY----RVQR  603

Query  539  LAEIIQRLEQGDLKLRVRALESERAFQRVAAVQKTILSAVAAGSLINLATVLYLNAIRMP  718
            + E ++ L+ GDLKLRVR LESERA ++   +Q   +  V  G+L+N+         ++ 
Sbjct  604  IEEFVKELDSGDLKLRVRVLESERAARKATILQMATMYTVLGGTLLNIGVTFSNQGSQLV  663

Query  719  AMAAYGLCAFFGFQVLIGIVKVKKIDQRERLI  814
            A  ++     F   VL  + +V K+D+ E++I
Sbjct  664  ANGSFIGAGIFMLLVLRSMQRVNKLDKFEKMI  695



>ref|XP_007217010.1| hypothetical protein PRUPE_ppa002186mg [Prunus persica]
 gb|EMJ18209.1| hypothetical protein PRUPE_ppa002186mg [Prunus persica]
Length=703

 Score =   178 bits (452),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 105/274 (38%), Positives = 154/274 (56%), Gaps = 33/274 (12%)
 Frame = +2

Query  2    EGLLEVFYGVYEKDPDKVLQAMVQMGVLVPTGDMTAVRRTAQFFLNSFEERLATQRRERE  181
            E LLE+FY VYEKD  KV+Q ++ +G L PTGD+++VRR+ Q+FL++   +   Q +   
Sbjct  460  ERLLELFYSVYEKDAKKVIQCLIDLGALQPTGDLSSVRRSVQYFLDNLLSQTPDQAKT--  517

Query  182  LAKAELGFKKPLTKEEKIEKKKQRLAAIGEDLLSIAADQPFRFPATFTFVVRAFSVLHGI  361
                                    L+AIGEDL +IA DQPFRFP+TFTFV+RAFS L GI
Sbjct  518  ------------------------LSAIGEDLFAIAQDQPFRFPSTFTFVLRAFSTLEGI  553

Query  362  GKGLDPRFDITEIAKPYALELLRFRE---AGVEVILKDFKTRWDRQNRAFYNLFRQADRV  532
            G  LDP F   +IA PYA ELL  R+    G +++ +  K   D ++      +    RV
Sbjct  554  GYTLDPDFSFVKIAAPYAQELLDLRQKQRTGTQLVNEIRKQADDARSYTMSMPY----RV  609

Query  533  EKLAEIIQRLEQGDLKLRVRALESERAFQRVAAVQKTILSAVAAGSLINLATVLYLNAIR  712
            +++ E ++ LE GDLKLRVR LESERA ++   +Q   +  V  G+L+NL   L     +
Sbjct  610  QRIEEFVKELESGDLKLRVRVLESERAARKATILQMATMYTVLGGTLLNLGVTLSSQGSQ  669

Query  713  MPAMAAYGLCAFFGFQVLIGIVKVKKIDQRERLI  814
              A  ++     F   +   + +VKK+++ E++I
Sbjct  670  AIANGSFIGAGVFLTLLARSMQRVKKLEKFEKMI  703



>gb|AAM67100.1| unknown [Arabidopsis thaliana]
Length=695

 Score =   178 bits (452),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 101/272 (37%), Positives = 154/272 (57%), Gaps = 33/272 (12%)
 Frame = +2

Query  8    LLEVFYGVYEKDPDKVLQAMVQMGVLVPTGDMTAVRRTAQFFLNSFEERLATQRRERELA  187
            LL++FY VYEKD  KV+Q ++ +  L PTGD+++VRR+ QFFL++   +   Q       
Sbjct  454  LLDLFYSVYEKDAKKVMQNLIDLEALQPTGDLSSVRRSVQFFLDNLLSQSPDQ-------  506

Query  188  KAELGFKKPLTKEEKIEKKKQRLAAIGEDLLSIAADQPFRFPATFTFVVRAFSVLHGIGK  367
                               +Q LAAIGEDL +I+ DQPFRFP+TFTFV+RAFS L GIG 
Sbjct  507  -------------------QQTLAAIGEDLFAISQDQPFRFPSTFTFVIRAFSTLEGIGY  547

Query  368  GLDPRFDITEIAKPYALELLRFRE---AGVEVILKDFKTRWDRQNRAFYNLFRQADRVEK  538
             LDP F   ++A PYA ELL  ++   +G +++ +  K   D ++      +    RV++
Sbjct  548  ILDPEFSFVKVAAPYAQELLDLKQRQRSGTQLVQEIRKQADDARSSTLSMPY----RVQR  603

Query  539  LAEIIQRLEQGDLKLRVRALESERAFQRVAAVQKTILSAVAAGSLINLATVLYLNAIRMP  718
            + E ++ L+ GDLKLRVR LESERA ++   +Q   +  V  G+L+N+         ++ 
Sbjct  604  IEEFVKELDSGDLKLRVRVLESERAARKATILQMATMYTVLGGTLLNIGVTFSNQGSQLV  663

Query  719  AMAAYGLCAFFGFQVLIGIVKVKKIDQRERLI  814
            A  ++     F   VL  + +V K+D+ E++I
Sbjct  664  ANGSFIGAGIFMLLVLRSMQRVNKLDKFEKMI  695



>ref|XP_011008064.1| PREDICTED: uncharacterized aarF domain-containing protein kinase 
At1g79600, chloroplastic isoform X1 [Populus euphratica]
 ref|XP_011008065.1| PREDICTED: uncharacterized aarF domain-containing protein kinase 
At1g79600, chloroplastic isoform X1 [Populus euphratica]
Length=719

 Score =   178 bits (452),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 105/272 (39%), Positives = 155/272 (57%), Gaps = 33/272 (12%)
 Frame = +2

Query  8    LLEVFYGVYEKDPDKVLQAMVQMGVLVPTGDMTAVRRTAQFFLNSFEERLATQRRERELA  187
            LLE+FY VYEKD  KV+Q+++ +  L PTGD+++VRR+ QFFLN+   +   Q       
Sbjct  478  LLELFYAVYEKDAKKVMQSLIDLEALQPTGDLSSVRRSVQFFLNNLLSQTPDQ-------  530

Query  188  KAELGFKKPLTKEEKIEKKKQRLAAIGEDLLSIAADQPFRFPATFTFVVRAFSVLHGIGK  367
                               +Q LAAIGEDL +IA DQPF FP+TFTFV+RAFS L GIG 
Sbjct  531  -------------------QQTLAAIGEDLFAIAQDQPFLFPSTFTFVIRAFSTLEGIGY  571

Query  368  GLDPRFDITEIAKPYALELLRFRE---AGVEVILKDFKTRWDRQNRAFYNLFRQADRVEK  538
             LDP F   +IA PYA ELL  R+    G +++ +  K    + N A  +      R+++
Sbjct  572  ILDPDFSFVKIAAPYAQELLDGRQRPRNGTQLVEEIRK----QANDARSSTISMPYRIQR  627

Query  539  LAEIIQRLEQGDLKLRVRALESERAFQRVAAVQKTILSAVAAGSLINLATVLYLNAIRMP  718
            + + +++LE GDLKLRVR LESERA ++   +Q   +  V  G+L+NL         ++ 
Sbjct  628  IEDFVKQLEAGDLKLRVRVLESERAARKATILQMATMYTVLGGTLLNLGVTFNNQGSQVI  687

Query  719  AMAAYGLCAFFGFQVLIGIVKVKKIDQRERLI  814
            A  ++     F   +L  + +VKK+D+ E+++
Sbjct  688  ANGSFVGAGVFLTLLLRSMQRVKKLDKFEKMV  719



>ref|XP_003563071.1| PREDICTED: uncharacterized aarF domain-containing protein kinase 
At1g79600, chloroplastic [Brachypodium distachyon]
Length=719

 Score =   178 bits (452),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 102/272 (38%), Positives = 153/272 (56%), Gaps = 33/272 (12%)
 Frame = +2

Query  8    LLEVFYGVYEKDPDKVLQAMVQMGVLVPTGDMTAVRRTAQFFLNSFEERLATQRRERELA  187
            LL +FY VYEKD +KV++A++ +  L PTGD++ VRR+ Q+FL++   +   Q       
Sbjct  478  LLSLFYAVYEKDANKVMKALIDLEALQPTGDLSPVRRSIQYFLDNLLSQSPDQ-------  530

Query  188  KAELGFKKPLTKEEKIEKKKQRLAAIGEDLLSIAADQPFRFPATFTFVVRAFSVLHGIGK  367
                               +Q LAAIGEDL +IA DQPFRFP+TFTFV+RAFS L GIG 
Sbjct  531  -------------------QQTLAAIGEDLFAIAQDQPFRFPSTFTFVIRAFSTLEGIGY  571

Query  368  GLDPRFDITEIAKPYALELLRF---REAGVEVILKDFKTRWDRQNRAFYNLFRQADRVEK  538
             LDP F   ++A PYA ELL     R  G E++ +  K    + N A  +      R+++
Sbjct  572  SLDPDFSFVKVAAPYAQELLDMKTRRRGGPELVQEIRK----QANDARESTISMPYRIQR  627

Query  539  LAEIIQRLEQGDLKLRVRALESERAFQRVAAVQKTILSAVAAGSLINLATVLYLNAIRMP  718
            + + + +LE GDLKLRVR LESERA ++   +Q   +     G+L+N+   +     +M 
Sbjct  628  IEDFVGQLESGDLKLRVRVLESERAARKANILQMATMHTAMGGTLLNIGVTMGSQGNQMV  687

Query  719  AMAAYGLCAFFGFQVLIGIVKVKKIDQRERLI  814
            A  ++     F   +++ I +VKK+D+ E ++
Sbjct  688  ANGSFVGAGIFLALLVLSIRRVKKLDKFETMV  719



>gb|AAL10497.1| At3g07700/F17A17.4 [Arabidopsis thaliana]
Length=695

 Score =   178 bits (452),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 101/272 (37%), Positives = 154/272 (57%), Gaps = 33/272 (12%)
 Frame = +2

Query  8    LLEVFYGVYEKDPDKVLQAMVQMGVLVPTGDMTAVRRTAQFFLNSFEERLATQRRERELA  187
            LL++FY VYEKD  KV+Q ++ +  L PTGD+++VRR+ QFFL++   +   Q       
Sbjct  454  LLDLFYSVYEKDAKKVMQNLIDLEALQPTGDLSSVRRSVQFFLDNLLSQSPDQ-------  506

Query  188  KAELGFKKPLTKEEKIEKKKQRLAAIGEDLLSIAADQPFRFPATFTFVVRAFSVLHGIGK  367
                               +Q LAAIGEDL +I+ DQPFRFP+TFTFV+RAFS L GIG 
Sbjct  507  -------------------QQTLAAIGEDLFAISQDQPFRFPSTFTFVIRAFSTLEGIGY  547

Query  368  GLDPRFDITEIAKPYALELLRFRE---AGVEVILKDFKTRWDRQNRAFYNLFRQADRVEK  538
             LDP F   ++A PYA ELL  ++   +G +++ +  K   D ++      +    RV++
Sbjct  548  ILDPEFSFVKVAAPYAQELLDLKQRQRSGTQLVQEIRKQADDARSSTLSMPY----RVQR  603

Query  539  LAEIIQRLEQGDLKLRVRALESERAFQRVAAVQKTILSAVAAGSLINLATVLYLNAIRMP  718
            + E ++ L+ GDLKLRVR LESERA ++   +Q   +  V  G+L+N+         ++ 
Sbjct  604  IEEFVKELDSGDLKLRVRVLESERAARKATILQMATMYTVLGGTLLNIGVTFSNQGSQLV  663

Query  719  AMAAYGLCAFFGFQVLIGIVKVKKIDQRERLI  814
            A  ++     F   VL  + +V K+D+ E++I
Sbjct  664  ANGSFIGAGIFMLLVLRSMQRVNKLDKFEKMI  695



>ref|XP_010252775.1| PREDICTED: uncharacterized aarF domain-containing protein kinase 
At1g79600, chloroplastic [Nelumbo nucifera]
 ref|XP_010252776.1| PREDICTED: uncharacterized aarF domain-containing protein kinase 
At1g79600, chloroplastic [Nelumbo nucifera]
Length=708

 Score =   178 bits (451),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 104/274 (38%), Positives = 159/274 (58%), Gaps = 33/274 (12%)
 Frame = +2

Query  2    EGLLEVFYGVYEKDPDKVLQAMVQMGVLVPTGDMTAVRRTAQFFLNSFEERLATQRRERE  181
            E LL++FY VYEKD  KV+Q+++++  L PTGDM++VRR+ QFFL++    L +Q  ++E
Sbjct  465  ERLLDLFYAVYEKDAKKVMQSLIELEALQPTGDMSSVRRSVQFFLDN----LLSQTPDQE  520

Query  182  LAKAELGFKKPLTKEEKIEKKKQRLAAIGEDLLSIAADQPFRFPATFTFVVRAFSVLHGI  361
                                  Q L+ IGEDL +IA DQPFRFP+TFTFV+RAFS L GI
Sbjct  521  ----------------------QTLSTIGEDLFAIATDQPFRFPSTFTFVIRAFSTLEGI  558

Query  362  GKGLDPRFDITEIAKPYALELLRFR---EAGVEVILKDFKTRWDRQNRAFYNLFRQADRV  532
            G  LDP F   +IA PYA ELL  +   + G +++ +  +    + N A         R+
Sbjct  559  GYTLDPEFSFVKIAAPYAQELLDLKKNQQNGTQLVEEIRR----QANDARTYTISMPYRI  614

Query  533  EKLAEIIQRLEQGDLKLRVRALESERAFQRVAAVQKTILSAVAAGSLINLATVLYLNAIR  712
            +++ E +++LE GDLKLRVR LESERA ++   +Q   +  V  G+L+N+         +
Sbjct  615  QRIEEFVKQLESGDLKLRVRVLESERAARKATILQMATIYTVLGGTLLNVGITFSSQGGQ  674

Query  713  MPAMAAYGLCAFFGFQVLIGIVKVKKIDQRERLI  814
            + A  ++     F   +L  + +V+K+D+ E++I
Sbjct  675  VIANGSFLGAGVFLTLLLRSMQRVRKLDKFEKMI  708



>ref|XP_009147041.1| PREDICTED: uncharacterized aarF domain-containing protein kinase 
At1g79600, chloroplastic [Brassica rapa]
Length=700

 Score =   178 bits (451),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 101/272 (37%), Positives = 154/272 (57%), Gaps = 33/272 (12%)
 Frame = +2

Query  8    LLEVFYGVYEKDPDKVLQAMVQMGVLVPTGDMTAVRRTAQFFLNSFEERLATQRRERELA  187
            LL++FY VYEKD  KV+Q ++ +  L PTGD+++VRR+ QFFL++   +   Q       
Sbjct  459  LLDLFYSVYEKDAKKVMQNLIDLEALQPTGDLSSVRRSIQFFLDNLLSQSPDQ-------  511

Query  188  KAELGFKKPLTKEEKIEKKKQRLAAIGEDLLSIAADQPFRFPATFTFVVRAFSVLHGIGK  367
                               +Q LAAIGEDL +I+ DQPFRFP+TFTFV+RAFS L GIG 
Sbjct  512  -------------------QQTLAAIGEDLFAISQDQPFRFPSTFTFVIRAFSTLEGIGY  552

Query  368  GLDPRFDITEIAKPYALELLRFRE---AGVEVILKDFKTRWDRQNRAFYNLFRQADRVEK  538
             LDP F   ++A PYA ELL  ++   +G +++ +  K   D ++      +    RV++
Sbjct  553  ILDPDFSFVKVAAPYAQELLDLKQKQNSGTQLVQQIRKQADDARSSTLSMPY----RVQR  608

Query  539  LAEIIQRLEQGDLKLRVRALESERAFQRVAAVQKTILSAVAAGSLINLATVLYLNAIRMP  718
            + E ++ L+ GDLKLRVR LESERA ++   +Q   +  V  G+L+N+         ++ 
Sbjct  609  IEEFVKELDSGDLKLRVRVLESERAARKATILQMATMYTVLGGTLLNIGVTFSNQGSQLV  668

Query  719  AMAAYGLCAFFGFQVLIGIVKVKKIDQRERLI  814
            A  ++     F   VL  + +V K+D+ E++I
Sbjct  669  ANGSFVGAGIFMLLVLRSMQRVNKLDKFEKMI  700



>ref|XP_002948655.1| hypothetical protein VOLCADRAFT_58671 [Volvox carteri f. nagariensis]
 gb|EFJ50035.1| hypothetical protein VOLCADRAFT_58671 [Volvox carteri f. nagariensis]
Length=574

 Score =   177 bits (448),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 110/290 (38%), Positives = 161/290 (56%), Gaps = 49/290 (17%)
 Frame = +2

Query  8    LLEVFYGVYEKDPDKVLQAMVQMGVLVPTGDMTAVRRTAQFFLNSFEERLATQRRERELA  187
            LL+VFYGVY KD D+VL+A+V + V+ PTGD  ++RR   +F+    E L+ Q       
Sbjct  315  LLDVFYGVYRKDTDQVLRALVALQVIKPTGDSLSLRRAINYFI----ENLSRQ-------  363

Query  188  KAELGFKKPLTKEEKIEKKKQRLAAIGEDLLSIAADQPFRFPATFTFVVRAFSVLHGIGK  367
                             ++++ + AIGEDL +IA DQPFRFPATFTFV+RAFS L GIGK
Sbjct  364  ----------------AERQETIQAIGEDLFAIALDQPFRFPATFTFVLRAFSTLEGIGK  407

Query  368  GLDPRFDITEIAKPYALELLRFREA----GVEVILKDFKTRWDRQNRAFYNLFRQADRVE  535
             L+P +   E+A+PYA ELL+ ++A    G   +L+  + +      A   +     R+ 
Sbjct  408  TLNPNYRFNEVAQPYAAELLQLQDATGARGGAALLEQVQQQASELGAAAAAM---PLRIR  464

Query  536  KLAEIIQRLEQGDLKLRVRALESERAFQRVAAVQKTILSAVAAGSLINLATVLYLNA---  706
            ++   + +LE GDLKLRVR LE ERA +R   +Q   L+ VA   L+N+ T+L +N+   
Sbjct  465  RIEATVAQLETGDLKLRVRVLEGERADRRAGVLQMATLNTVACMGLLNVGTMLAINSGGP  524

Query  707  ------------IRMPAMAAYGLCAFFGFQVLIGIVKVKKIDQRERLITG  820
                        +  PA    GL A FG  V  G+ +V+++D+ E+ I G
Sbjct  525  GAAAAVATGGMNLEGPAALCLGLSAVFGVLVFRGLKRVQRLDKFEKEIKG  574



>ref|XP_007049375.1| Kinase superfamily protein isoform 1 [Theobroma cacao]
 gb|EOX93532.1| Kinase superfamily protein isoform 1 [Theobroma cacao]
Length=706

 Score =   178 bits (451),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 108/275 (39%), Positives = 159/275 (58%), Gaps = 35/275 (13%)
 Frame = +2

Query  2    EGLLEVFYGVYEKDPDKVLQAMVQMGVLVPTGDMTAVRRTAQFFLNSFEERLATQRRERE  181
            E LL +FY VYEKD  KV+Q+++ +G L PTGD+++VRR+ QFFL++    L  QR ++E
Sbjct  463  ERLLGLFYAVYEKDAKKVMQSLIDLGALQPTGDLSSVRRSVQFFLDN----LLDQRPDQE  518

Query  182  LAKAELGFKKPLTKEEKIEKKKQRLAAIGEDLLSIAADQPFRFPATFTFVVRAFSVLHGI  361
                                    L AIGEDL +IA DQPFRFP+TFTFV++AFS L GI
Sbjct  519  TT----------------------LTAIGEDLFAIAQDQPFRFPSTFTFVLKAFSTLEGI  556

Query  362  GKGLDPRFDITEIAKPYALELLRFR---EAGVEVILKDFKTRWDRQNRAFYNLFRQADRV  532
            G  LDP F   +IA PYA ELL  R   + G +++ +  K   D ++      +    RV
Sbjct  557  GYTLDPNFSFAKIAAPYAQELLDIRQRQQTGTQLVEQIRKQADDARSYTMSMPY----RV  612

Query  533  EKLAEIIQRLEQGDLKLRVRALESERAFQRVAAVQKTILSAVAAGSLINLATVLYLNAIR  712
            +++ E +++LE GDLKLRVR LESERA ++   +Q   +  V  G+L+NL         +
Sbjct  613  QQIEEFVKQLESGDLKLRVRVLESERAARKARILQMATMYTVLGGTLLNLGVTFGSQGSQ  672

Query  713  MPAMAAY-GLCAFFGFQVLIGIVKVKKIDQRERLI  814
            + A  ++ G   FF   +L  + ++K +D+ E++I
Sbjct  673  IIANGSFLGAGVFFTL-LLRSMQRLKTLDKFEKMI  706



>emb|CDY35956.1| BnaA05g29940D [Brassica napus]
Length=700

 Score =   178 bits (451),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 101/272 (37%), Positives = 154/272 (57%), Gaps = 33/272 (12%)
 Frame = +2

Query  8    LLEVFYGVYEKDPDKVLQAMVQMGVLVPTGDMTAVRRTAQFFLNSFEERLATQRRERELA  187
            LL++FY VYEKD  KV+Q ++ +  L PTGD+++VRR+ QFFL++   +   Q       
Sbjct  459  LLDLFYSVYEKDAKKVMQNLIDLEALQPTGDLSSVRRSIQFFLDNLLSQSPDQ-------  511

Query  188  KAELGFKKPLTKEEKIEKKKQRLAAIGEDLLSIAADQPFRFPATFTFVVRAFSVLHGIGK  367
                               +Q LAAIGEDL +I+ DQPFRFP+TFTFV+RAFS L GIG 
Sbjct  512  -------------------QQTLAAIGEDLFAISQDQPFRFPSTFTFVIRAFSTLEGIGY  552

Query  368  GLDPRFDITEIAKPYALELLRFRE---AGVEVILKDFKTRWDRQNRAFYNLFRQADRVEK  538
             LDP F   ++A PYA ELL  ++   +G +++ +  K   D ++      +    RV++
Sbjct  553  ILDPDFSFVKVAAPYAQELLDLKQKQNSGTQLVQQIRKQADDARSSTLSMPY----RVQR  608

Query  539  LAEIIQRLEQGDLKLRVRALESERAFQRVAAVQKTILSAVAAGSLINLATVLYLNAIRMP  718
            + E ++ L+ GDLKLRVR LESERA ++   +Q   +  V  G+L+N+         ++ 
Sbjct  609  IEEFVKELDSGDLKLRVRVLESERAARKATILQMATMYTVLGGTLLNIGVTFSNQGSQLV  668

Query  719  AMAAYGLCAFFGFQVLIGIVKVKKIDQRERLI  814
            A  ++     F   VL  + +V K+D+ E++I
Sbjct  669  ANGSFVGAGIFMLLVLRSMQRVNKLDKFEKMI  700



>ref|XP_006297088.1| hypothetical protein CARUB_v10013091mg [Capsella rubella]
 gb|EOA29986.1| hypothetical protein CARUB_v10013091mg [Capsella rubella]
Length=701

 Score =   177 bits (450),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 101/272 (37%), Positives = 154/272 (57%), Gaps = 33/272 (12%)
 Frame = +2

Query  8    LLEVFYGVYEKDPDKVLQAMVQMGVLVPTGDMTAVRRTAQFFLNSFEERLATQRRERELA  187
            LL++FY VYEKD  KV+Q ++ +  L PTGD+++VRR+ QFFL++   +   Q       
Sbjct  460  LLDLFYSVYEKDAKKVMQNLIDLEALQPTGDLSSVRRSVQFFLDNLLSQSPDQ-------  512

Query  188  KAELGFKKPLTKEEKIEKKKQRLAAIGEDLLSIAADQPFRFPATFTFVVRAFSVLHGIGK  367
                               +Q LAAIGEDL +I+ DQPFRFP+TFTFV+RAFS L GIG 
Sbjct  513  -------------------QQTLAAIGEDLFAISQDQPFRFPSTFTFVIRAFSTLEGIGY  553

Query  368  GLDPRFDITEIAKPYALELLRFR---EAGVEVILKDFKTRWDRQNRAFYNLFRQADRVEK  538
             LDP F   ++A PYA ELL  +   ++G +++ +  K    + + A  +      RV++
Sbjct  554  ILDPDFSFVKVAAPYAQELLDLKQRQQSGTQLVQQIRK----QADDARSSTLSMPSRVQR  609

Query  539  LAEIIQRLEQGDLKLRVRALESERAFQRVAAVQKTILSAVAAGSLINLATVLYLNAIRMP  718
            + E ++ L+ GDLKLRVR LESERA ++   +Q   +  V  G+L+N+         ++ 
Sbjct  610  IEEFVKELDSGDLKLRVRVLESERAARKATILQMATMYTVLGGTLLNIGVTFSNQGSQLV  669

Query  719  AMAAYGLCAFFGFQVLIGIVKVKKIDQRERLI  814
            A  ++     F   VL  + +V K+D+ E++I
Sbjct  670  ANGSFIGAGIFMALVLRSMQRVNKLDKFEKMI  701



>ref|XP_001779083.1| predicted protein [Physcomitrella patens]
 gb|EDQ56120.1| predicted protein [Physcomitrella patens]
Length=589

 Score =   177 bits (448),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 106/273 (39%), Positives = 159/273 (58%), Gaps = 29/273 (11%)
 Frame = +2

Query  2    EGLLEVFYGVYEKDPDKVLQAMVQMGVLVPTGDMTAVRRTAQFFLNSFEERLATQRRERE  181
            E LLE+FY VYEKD  K++QA++ +G LVPTGDM +VRR+ Q+FL++  +          
Sbjct  344  EKLLEMFYAVYEKDARKIIQALIDLGALVPTGDMGSVRRSVQYFLDNLMD----------  393

Query  182  LAKAELGFKKPLTKEEKIEKKKQRLAAIGEDLLSIAADQPFRFPATFTFVVRAFSVLHGI  361
                    +KP         +    +AIGEDL +IA DQPFRFPATFTFV+RAFS L GI
Sbjct  394  --------QKP--------DQAATFSAIGEDLFAIAVDQPFRFPATFTFVLRAFSTLEGI  437

Query  362  GKGLDPRFDITEIAKPYALELLRFREAGVEVILKDFKTRWDRQ-NRAFYNLFRQADRVEK  538
            G  LDP F   +IA PYA ELL  R  G     + F     RQ N A     +   RV++
Sbjct  438  GNTLDPDFSFAKIAAPYAQELLDTRN-GQRNGSRYFVEELQRQANDARDATVQMPQRVQR  496

Query  539  LAEIIQRLEQGDLKLRVRALESERAFQRVAAVQKTILSAVAAGSLINLATVLYL-NAIRM  715
            + +I+++LE GDLKLRVR+LE+ERA +R + +Q+ I++++ +  L N+   L     I  
Sbjct  497  VDQIMRQLESGDLKLRVRSLEAERAARRASVMQEAIINSLFSVGLANIGVTLSTAQGITA  556

Query  716  PAMAAYGLCAFFGFQVLIGIVKVKKIDQRERLI  814
             + +++     F   +   + +++ +D+ E+++
Sbjct  557  VSNSSFVGAGIFLLLLANNVRRIRNLDKFEKML  589



>ref|XP_010069706.1| PREDICTED: uncharacterized aarF domain-containing protein kinase 
At1g79600, chloroplastic-like [Eucalyptus grandis]
Length=705

 Score =   177 bits (449),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 107/275 (39%), Positives = 156/275 (57%), Gaps = 35/275 (13%)
 Frame = +2

Query  2    EGLLEVFYGVYEKDPDKVLQAMVQMGVLVPTGDMTAVRRTAQFFLNSFEERLATQRRERE  181
            E LLE+FY VYEKD  +V+Q+++ +G L PTGD+++VRR+ +FFL++   +   Q     
Sbjct  462  ERLLELFYAVYEKDAKRVMQSLIDLGALQPTGDLSSVRRSVKFFLDNLLSQTTDQ-----  516

Query  182  LAKAELGFKKPLTKEEKIEKKKQRLAAIGEDLLSIAADQPFRFPATFTFVVRAFSVLHGI  361
                                 +Q  AAIGEDL +IA DQ FRFP+T TFV++AFS L GI
Sbjct  517  ---------------------QQTFAAIGEDLFAIAQDQSFRFPSTVTFVLKAFSTLEGI  555

Query  362  GKGLDPRFDITEIAKPYALELLRFR---EAGVEVILKDFKTRWDRQNRAFYNLFRQADRV  532
            G  LDP F   +IA PYA ELL  R   + G +++ +  K   D +  A    +    RV
Sbjct  556  GYTLDPNFSFVKIAAPYAQELLDIRPKQQTGTQLVEQIRKQADDVRTSAISMPY----RV  611

Query  533  EKLAEIIQRLEQGDLKLRVRALESERAFQRVAAVQKTILSAVAAGSLINLATVLYLNAIR  712
            +++ EI+ +L+ GDLKLRVR LESERA ++   +Q   +  V  G+L+NL   L      
Sbjct  612  QRIEEIVNQLDSGDLKLRVRVLESERAARKATILQMATMYTVFGGTLLNLGVTLTNQGSL  671

Query  713  MPAMAAY-GLCAFFGFQVLIGIVKVKKIDQRERLI  814
            + A  ++ G   FF    L  + +VKK+D+ E++I
Sbjct  672  ILANGSFIGAGVFFTL-FLRSMQRVKKLDKFEKMI  705



>gb|KCW58129.1| hypothetical protein EUGRSUZ_H00851 [Eucalyptus grandis]
Length=707

 Score =   177 bits (449),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 107/275 (39%), Positives = 156/275 (57%), Gaps = 35/275 (13%)
 Frame = +2

Query  2    EGLLEVFYGVYEKDPDKVLQAMVQMGVLVPTGDMTAVRRTAQFFLNSFEERLATQRRERE  181
            E LLE+FY VYEKD  +V+Q+++ +G L PTGD+++VRR+ +FFL++   +   Q     
Sbjct  464  ERLLELFYAVYEKDAKRVMQSLIDLGALQPTGDLSSVRRSVKFFLDNLLSQTTDQ-----  518

Query  182  LAKAELGFKKPLTKEEKIEKKKQRLAAIGEDLLSIAADQPFRFPATFTFVVRAFSVLHGI  361
                                 +Q  AAIGEDL +IA DQ FRFP+T TFV++AFS L GI
Sbjct  519  ---------------------QQTFAAIGEDLFAIAQDQSFRFPSTVTFVLKAFSTLEGI  557

Query  362  GKGLDPRFDITEIAKPYALELLRFR---EAGVEVILKDFKTRWDRQNRAFYNLFRQADRV  532
            G  LDP F   +IA PYA ELL  R   + G +++ +  K   D +  A    +    RV
Sbjct  558  GYTLDPNFSFVKIAAPYAQELLDIRPKQQTGTQLVEQIRKQADDVRTSAISMPY----RV  613

Query  533  EKLAEIIQRLEQGDLKLRVRALESERAFQRVAAVQKTILSAVAAGSLINLATVLYLNAIR  712
            +++ EI+ +L+ GDLKLRVR LESERA ++   +Q   +  V  G+L+NL   L      
Sbjct  614  QRIEEIVNQLDSGDLKLRVRVLESERAARKATILQMATMYTVFGGTLLNLGVTLTNQGSL  673

Query  713  MPAMAAY-GLCAFFGFQVLIGIVKVKKIDQRERLI  814
            + A  ++ G   FF    L  + +VKK+D+ E++I
Sbjct  674  ILANGSFIGAGVFFTL-FLRSMQRVKKLDKFEKMI  707



>ref|XP_004502149.1| PREDICTED: uncharacterized protein sll1770-like isoform X1 [Cicer 
arietinum]
 ref|XP_004502150.1| PREDICTED: uncharacterized protein sll1770-like isoform X2 [Cicer 
arietinum]
 ref|XP_004502151.1| PREDICTED: uncharacterized protein sll1770-like isoform X3 [Cicer 
arietinum]
 ref|XP_004502152.1| PREDICTED: uncharacterized protein sll1770-like isoform X4 [Cicer 
arietinum]
Length=709

 Score =   177 bits (448),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 109/282 (39%), Positives = 154/282 (55%), Gaps = 49/282 (17%)
 Frame = +2

Query  2    EGLLEVFYGVYEKDPDKVLQAMVQMGVLVPTGDMTAVRRTAQFFLNSFEERLATQRRERE  181
            E LLE+FY VYEKD  KV+Q ++ +G L PTGD++AVRR+ QFFL++   +   Q     
Sbjct  466  ERLLELFYAVYEKDAKKVMQCLIDLGALQPTGDLSAVRRSVQFFLDNLLSQTPDQ-----  520

Query  182  LAKAELGFKKPLTKEEKIEKKKQRLAAIGEDLLSIAADQPFRFPATFTFVVRAFSVLHGI  361
                                 +Q L+AIGEDL +IA DQPFRFP+TFTFV+RAFS L GI
Sbjct  521  ---------------------QQTLSAIGEDLFAIAQDQPFRFPSTFTFVIRAFSTLEGI  559

Query  362  GKGLDPRFDITEIAKPYALELLRFREAG------VEVILKDFKTRWDRQNRAFYNLFRQA  523
            G  L+P F   +IA PYA ELL  R+        VE I K       + N    N     
Sbjct  560  GYILNPDFSFVKIAAPYAQELLDVRQNQRTGPQFVEQIRK-------QANDVRTNSMSMP  612

Query  524  DRVEKLAEIIQRLEQGDLKLRVRALESERAFQRVAAVQKTILSAVAAGSLINLATVLYLN  703
             RV+++ E ++++E GDLKLRVR LESERA ++   +Q   +  V  G+L+N+   L   
Sbjct  613  YRVQRIEEFVKQVEAGDLKLRVRVLESERAARKATVLQMATMYTVLGGALLNIGVNLSSQ  672

Query  704  AIRMPAMAAYGLCAFFGFQVLI-----GIVKVKKIDQRERLI  814
              +     A+   +F G  +L       + +V K+D+ E+++
Sbjct  673  GNQ-----AFANGSFVGAGILFTLFLRSMQRVNKLDKFEKML  709



>ref|XP_002884663.1| hypothetical protein ARALYDRAFT_478103 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH60922.1| hypothetical protein ARALYDRAFT_478103 [Arabidopsis lyrata subsp. 
lyrata]
Length=698

 Score =   177 bits (448),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 101/272 (37%), Positives = 154/272 (57%), Gaps = 33/272 (12%)
 Frame = +2

Query  8    LLEVFYGVYEKDPDKVLQAMVQMGVLVPTGDMTAVRRTAQFFLNSFEERLATQRRERELA  187
            LL++FY VYEKD  KV+Q ++ +  L PTGD+++VRR+ QFFL++   +   Q       
Sbjct  457  LLDLFYSVYEKDAKKVMQNLIDLEALQPTGDLSSVRRSVQFFLDNLLSQSPDQ-------  509

Query  188  KAELGFKKPLTKEEKIEKKKQRLAAIGEDLLSIAADQPFRFPATFTFVVRAFSVLHGIGK  367
                               +Q LAAIGEDL +I+ DQPFRFP+TFTFV+RAFS L GIG 
Sbjct  510  -------------------QQTLAAIGEDLFAISQDQPFRFPSTFTFVIRAFSTLEGIGY  550

Query  368  GLDPRFDITEIAKPYALELLRFRE---AGVEVILKDFKTRWDRQNRAFYNLFRQADRVEK  538
             LDP F   ++A PYA ELL  ++   +G +++ +  K   D ++      +    RV++
Sbjct  551  ILDPDFSFVKVAAPYAQELLDLKQRQRSGTQLVQEIRKQADDARSSTLSMPY----RVQR  606

Query  539  LAEIIQRLEQGDLKLRVRALESERAFQRVAAVQKTILSAVAAGSLINLATVLYLNAIRMP  718
            + E ++ L+ GDLKLRVR LESERA ++   +Q   +  V  G+L+N+         ++ 
Sbjct  607  IEEFVKELDSGDLKLRVRVLESERAARKATILQMATMYTVLGGTLLNIGVTFSNQGSQLV  666

Query  719  AMAAYGLCAFFGFQVLIGIVKVKKIDQRERLI  814
            A  ++     F   VL  + +V K+D+ E++I
Sbjct  667  ANGSFIGAGIFMALVLRSMQRVNKLDKFEKMI  698



>gb|KJB10242.1| hypothetical protein B456_001G191200 [Gossypium raimondii]
Length=691

 Score =   176 bits (447),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 102/247 (41%), Positives = 146/247 (59%), Gaps = 33/247 (13%)
 Frame = +2

Query  2    EGLLEVFYGVYEKDPDKVLQAMVQMGVLVPTGDMTAVRRTAQFFLNSFEERLATQRRERE  181
            E LLE+FY VYEKD  KV+Q+++ +G L PTGD+++VRR+ QFFL++    L  QR +++
Sbjct  465  ERLLELFYAVYEKDAKKVMQSLIDLGALQPTGDLSSVRRSVQFFLDN----LLDQRPDQD  520

Query  182  LAKAELGFKKPLTKEEKIEKKKQRLAAIGEDLLSIAADQPFRFPATFTFVVRAFSVLHGI  361
                                    LAAIGEDL +IA DQPFRFP+TFTFV+RAFS L GI
Sbjct  521  TT----------------------LAAIGEDLFAIAQDQPFRFPSTFTFVLRAFSTLEGI  558

Query  362  GKGLDPRFDITEIAKPYALELLRFRE---AGVEVILKDFKTRWDRQNRAFYNLFRQADRV  532
            G  LDP F   +IA PYA ELL  R+    G +++ +  K   D ++      +    RV
Sbjct  559  GYILDPNFSFAKIAAPYAQELLDIRQRQRTGSQLVQEIRKQADDARSYTMSMPY----RV  614

Query  533  EKLAEIIQRLEQGDLKLRVRALESERAFQRVAAVQKTILSAVAAGSLINLATVLYLNAIR  712
            +++ EI+++LE GDL+LRVR LESERA ++   +Q   +  V  G+L+NL         +
Sbjct  615  QRIEEILKQLESGDLRLRVRVLESERAARKATILQMATMYTVLGGTLVNLGVTFSSQGSQ  674

Query  713  MPAMAAY  733
            + A  ++
Sbjct  675  IIANGSF  681



>ref|XP_009395833.1| PREDICTED: uncharacterized aarF domain-containing protein kinase 
At1g79600, chloroplastic-like [Musa acuminata subsp. malaccensis]
Length=759

 Score =   177 bits (448),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 102/273 (37%), Positives = 157/273 (58%), Gaps = 31/273 (11%)
 Frame = +2

Query  2    EGLLEVFYGVYEKDPDKVLQAMVQMGVLVPTGDMTAVRRTAQFFLNSFEERLATQRRERE  181
            E LLE+FY VYEKD +KV+++++ +  L PTGD++ VRR+ QFFL++   +  +Q     
Sbjct  516  ERLLELFYAVYEKDANKVMKSLIDLEALQPTGDLSPVRRSIQFFLDNLLSQTPSQ-----  570

Query  182  LAKAELGFKKPLTKEEKIEKKKQRLAAIGEDLLSIAADQPFRFPATFTFVVRAFSVLHGI  361
                                 +Q LAAIGEDL +IA DQPFRFP+TFTFV+RAFS L GI
Sbjct  571  ---------------------QQTLAAIGEDLFAIATDQPFRFPSTFTFVLRAFSTLEGI  609

Query  362  GKGLDPRFDITEIAKPYALELLRFREA--GVEVILKDFKTRWDRQNRAFYNLFRQADRVE  535
            G  LDP F   +IA PYA ELL  ++   G   ++++ +    + N A         R++
Sbjct  610  GYTLDPDFSFVKIAAPYAQELLDIKQKQRGGSQLVQEIRK---QANDARDYTISMPYRIQ  666

Query  536  KLAEIIQRLEQGDLKLRVRALESERAFQRVAAVQKTILSAVAAGSLINLATVLYLNAIRM  715
            ++ E +++LE GDLKLRVR LESERA ++ + +Q   +    +G+L+N+   L     + 
Sbjct  667  RIEEFMKQLESGDLKLRVRVLESERAARKASVLQMATMYTALSGTLLNVGVTLSSQGNQT  726

Query  716  PAMAAYGLCAFFGFQVLIGIVKVKKIDQRERLI  814
             A  ++     F   +L  + +VK +D+ E+++
Sbjct  727  FANGSFIGAGVFLALLLRSMQRVKMLDKFEKML  759



>gb|KCW58128.1| hypothetical protein EUGRSUZ_H00850 [Eucalyptus grandis]
Length=703

 Score =   176 bits (447),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 99/234 (42%), Positives = 138/234 (59%), Gaps = 33/234 (14%)
 Frame = +2

Query  2    EGLLEVFYGVYEKDPDKVLQAMVQMGVLVPTGDMTAVRRTAQFFLNSFEERLATQRRERE  181
            E LLE+FY VYEKD  KV+++++ +G L PTGD+++VRR+ +FFL++   +   Q     
Sbjct  464  ERLLELFYAVYEKDAKKVMESLIDIGALQPTGDLSSVRRSVKFFLDNLLSQTPDQ-----  518

Query  182  LAKAELGFKKPLTKEEKIEKKKQRLAAIGEDLLSIAADQPFRFPATFTFVVRAFSVLHGI  361
                                 +Q  AAIGEDL +IA DQPFRFP+TFTFV+RAFS L GI
Sbjct  519  ---------------------QQTFAAIGEDLFAIAQDQPFRFPSTFTFVLRAFSTLEGI  557

Query  362  GKGLDPRFDITEIAKPYALELLRF---REAGVEVILKDFKTRWDRQNRAFYNLFRQADRV  532
            G  LDP F   +IA PYA ELL     R+ G +++ +  K   D +  A    +    RV
Sbjct  558  GYTLDPNFSFVKIAAPYAQELLDIRQKRQTGTQLVEQIRKQADDARTSAVSMPY----RV  613

Query  533  EKLAEIIQRLEQGDLKLRVRALESERAFQRVAAVQKTILSAVAAGSLINLATVL  694
            +++ EI+ +L+ GDLKLRVR LESERA ++   +Q   +  V  G+L+NL   L
Sbjct  614  QRIEEIVNQLDSGDLKLRVRVLESERAARKATILQMATMYTVFGGTLLNLGVTL  667



>ref|XP_010456734.1| PREDICTED: uncharacterized aarF domain-containing protein kinase 
At1g79600, chloroplastic-like [Camelina sativa]
Length=701

 Score =   176 bits (447),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 100/272 (37%), Positives = 154/272 (57%), Gaps = 33/272 (12%)
 Frame = +2

Query  8    LLEVFYGVYEKDPDKVLQAMVQMGVLVPTGDMTAVRRTAQFFLNSFEERLATQRRERELA  187
            LL++FY VYEKD  KV++ ++ +  L PTGD+++VRR+ QFFL++   +   Q       
Sbjct  460  LLDLFYSVYEKDAKKVMKNLIDLEALQPTGDLSSVRRSVQFFLDNLLSQSPDQ-------  512

Query  188  KAELGFKKPLTKEEKIEKKKQRLAAIGEDLLSIAADQPFRFPATFTFVVRAFSVLHGIGK  367
                               +Q LAAIGEDL +I+ DQPFRFP+TFTFV+RAFS L GIG 
Sbjct  513  -------------------QQTLAAIGEDLFAISQDQPFRFPSTFTFVIRAFSTLEGIGY  553

Query  368  GLDPRFDITEIAKPYALELLRFRE---AGVEVILKDFKTRWDRQNRAFYNLFRQADRVEK  538
             LDP F   ++A PYA ELL  ++   +G +++ +  K    + + A  +      RV++
Sbjct  554  ILDPEFSFVKVAAPYAQELLDLKQRQRSGTQLVQEIRK----QADDARSSTLSMPSRVQR  609

Query  539  LAEIIQRLEQGDLKLRVRALESERAFQRVAAVQKTILSAVAAGSLINLATVLYLNAIRMP  718
            + E ++ L+ GDLKLRVR LESERA ++   +Q   +  V  G+L+N+         ++ 
Sbjct  610  IEEFVKELDSGDLKLRVRVLESERAARKATILQMATMYTVLGGTLLNIGVTFSNQGSQLV  669

Query  719  AMAAYGLCAFFGFQVLIGIVKVKKIDQRERLI  814
            A  ++     F   VL  + +V K+D+ E++I
Sbjct  670  ANGSFVAAGIFLALVLRSMQRVSKLDKFEKMI  701



>ref|XP_003605253.1| hypothetical protein MTR_4g027180 [Medicago truncatula]
Length=704

 Score =   176 bits (446),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 104/274 (38%), Positives = 151/274 (55%), Gaps = 33/274 (12%)
 Frame = +2

Query  2    EGLLEVFYGVYEKDPDKVLQAMVQMGVLVPTGDMTAVRRTAQFFLNSFEERLATQRRERE  181
            E LLE+FY VYEKD  KV+Q ++ +G L PTGD++AVRR+ QFFL++   +   Q     
Sbjct  461  ERLLELFYSVYEKDAKKVIQCLIDLGALQPTGDLSAVRRSVQFFLDNLLNQSPDQ-----  515

Query  182  LAKAELGFKKPLTKEEKIEKKKQRLAAIGEDLLSIAADQPFRFPATFTFVVRAFSVLHGI  361
                                  Q L+AIGEDL +IA DQPFRFP+TFTFV+RAFS L GI
Sbjct  516  ---------------------DQTLSAIGEDLFAIAQDQPFRFPSTFTFVIRAFSTLEGI  554

Query  362  GKGLDPRFDITEIAKPYALELLRFRE---AGVEVILKDFKTRWDRQNRAFYNLFRQADRV  532
            G  L P F   +IA PYA ELL  R+    G +++ +  K    + N    N      RV
Sbjct  555  GYTLTPDFSFVKIAAPYAQELLDIRQRQPTGPQLVGQIAK----QANDVRTNSMSMPLRV  610

Query  533  EKLAEIIQRLEQGDLKLRVRALESERAFQRVAAVQKTILSAVAAGSLINLATVLYLNAIR  712
            +++ E ++++E GDLKLRVR LESERA ++   +Q   +  V  G+ +N+   L     +
Sbjct  611  QRIEEFVKQVEAGDLKLRVRVLESERAARKATVLQMATMYTVLGGTFLNIGVNLTSQGNQ  670

Query  713  MPAMAAYGLCAFFGFQVLIGIVKVKKIDQRERLI  814
              A  ++          L  + +V+K+D+ E+++
Sbjct  671  TFANGSFVGAGILFILFLRSMQRVQKLDKFEKML  704



>ref|XP_010486338.1| PREDICTED: uncharacterized aarF domain-containing protein kinase 
At1g79600, chloroplastic-like [Camelina sativa]
Length=701

 Score =   176 bits (446),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 100/272 (37%), Positives = 154/272 (57%), Gaps = 33/272 (12%)
 Frame = +2

Query  8    LLEVFYGVYEKDPDKVLQAMVQMGVLVPTGDMTAVRRTAQFFLNSFEERLATQRRERELA  187
            LL++FY VYEKD  KV++ ++ +  L PTGD+++VRR+ QFFL++   +   Q       
Sbjct  460  LLDLFYSVYEKDAKKVMKNLIDLEALQPTGDLSSVRRSVQFFLDNLLSQSPDQ-------  512

Query  188  KAELGFKKPLTKEEKIEKKKQRLAAIGEDLLSIAADQPFRFPATFTFVVRAFSVLHGIGK  367
                               +Q LAAIGEDL +I+ DQPFRFP+TFTFV+RAFS L GIG 
Sbjct  513  -------------------QQTLAAIGEDLFAISQDQPFRFPSTFTFVIRAFSTLEGIGY  553

Query  368  GLDPRFDITEIAKPYALELLRFRE---AGVEVILKDFKTRWDRQNRAFYNLFRQADRVEK  538
             LDP F   ++A PYA ELL  ++   +G +++ +  K    + + A  +      RV++
Sbjct  554  ILDPDFSFVKVAAPYAQELLDLKQRQRSGTQLVQEIRK----QADDARSSTLSMPSRVQR  609

Query  539  LAEIIQRLEQGDLKLRVRALESERAFQRVAAVQKTILSAVAAGSLINLATVLYLNAIRMP  718
            + E ++ L+ GDLKLRVR LESERA ++   +Q   +  V  G+L+N+         ++ 
Sbjct  610  IEEFVKELDSGDLKLRVRVLESERAARKATILQMATMYTVLGGTLLNIGVTFSNQGSQLV  669

Query  719  AMAAYGLCAFFGFQVLIGIVKVKKIDQRERLI  814
            A  ++     F   VL  + +V K+D+ E++I
Sbjct  670  ANGSFVAAGIFLALVLRSMQRVSKLDKFEKMI  701



>ref|XP_010464409.1| PREDICTED: uncharacterized aarF domain-containing protein kinase 
At1g79600, chloroplastic-like [Camelina sativa]
Length=702

 Score =   176 bits (446),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 100/272 (37%), Positives = 154/272 (57%), Gaps = 33/272 (12%)
 Frame = +2

Query  8    LLEVFYGVYEKDPDKVLQAMVQMGVLVPTGDMTAVRRTAQFFLNSFEERLATQRRERELA  187
            LL++FY VYEKD  KV++ ++ +  L PTGD+++VRR+ QFFL++   +   Q       
Sbjct  461  LLDLFYSVYEKDAKKVMKNLIDLEALQPTGDLSSVRRSVQFFLDNLLSQSPDQ-------  513

Query  188  KAELGFKKPLTKEEKIEKKKQRLAAIGEDLLSIAADQPFRFPATFTFVVRAFSVLHGIGK  367
                               +Q LAAIGEDL +I+ DQPFRFP+TFTFV+RAFS L GIG 
Sbjct  514  -------------------QQTLAAIGEDLFAISQDQPFRFPSTFTFVIRAFSTLEGIGY  554

Query  368  GLDPRFDITEIAKPYALELLRFRE---AGVEVILKDFKTRWDRQNRAFYNLFRQADRVEK  538
             LDP F   ++A PYA ELL  ++   +G +++ +  K    + + A  +      RV++
Sbjct  555  ILDPDFSFVKVAAPYAQELLDLKQRQRSGTQLVQEIRK----QADDARSSTLSMPSRVQR  610

Query  539  LAEIIQRLEQGDLKLRVRALESERAFQRVAAVQKTILSAVAAGSLINLATVLYLNAIRMP  718
            + E ++ L+ GDLKLRVR LESERA ++   +Q   +  V  G+L+N+         ++ 
Sbjct  611  IEEFVKELDSGDLKLRVRVLESERAARKATILQMATMYTVLGGTLLNIGVTFSNQGSQLV  670

Query  719  AMAAYGLCAFFGFQVLIGIVKVKKIDQRERLI  814
            A  ++     F   VL  + +V K+D+ E++I
Sbjct  671  ANGSFVAAGIFLALVLRSMQRVSKLDKFEKMI  702



>ref|XP_003601534.1| hypothetical protein MTR_3g082750 [Medicago truncatula]
 gb|AES71785.1| unusual kinase, putative [Medicago truncatula]
Length=708

 Score =   176 bits (445),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 104/274 (38%), Positives = 151/274 (55%), Gaps = 33/274 (12%)
 Frame = +2

Query  2    EGLLEVFYGVYEKDPDKVLQAMVQMGVLVPTGDMTAVRRTAQFFLNSFEERLATQRRERE  181
            E LLE+FY VYEKD  KV+Q ++ +G L PTGD++AVRR+ QFFL++   +   Q     
Sbjct  465  ERLLELFYSVYEKDAKKVIQCLIDLGALQPTGDLSAVRRSVQFFLDNLLNQSPDQ-----  519

Query  182  LAKAELGFKKPLTKEEKIEKKKQRLAAIGEDLLSIAADQPFRFPATFTFVVRAFSVLHGI  361
                                  Q L+AIGEDL +IA DQPFRFP+TFTFV+RAFS L GI
Sbjct  520  ---------------------DQTLSAIGEDLFAIAQDQPFRFPSTFTFVIRAFSTLEGI  558

Query  362  GKGLDPRFDITEIAKPYALELLRFRE---AGVEVILKDFKTRWDRQNRAFYNLFRQADRV  532
            G  L P F   +IA PYA ELL  R+    G +++ +  K    + N    N      RV
Sbjct  559  GYTLTPDFSFVKIAAPYAQELLDIRQRQPTGPQLVGQIAK----QANDVRTNSMSMPLRV  614

Query  533  EKLAEIIQRLEQGDLKLRVRALESERAFQRVAAVQKTILSAVAAGSLINLATVLYLNAIR  712
            +++ E ++++E GDLKLRVR LESERA ++   +Q   +  V  G+ +N+   L     +
Sbjct  615  QRIEEFVKQVEAGDLKLRVRVLESERAARKATVLQMATMYTVLGGTFLNIGVNLTSQGNQ  674

Query  713  MPAMAAYGLCAFFGFQVLIGIVKVKKIDQRERLI  814
              A  ++          L  + +V+K+D+ E+++
Sbjct  675  TFANGSFVGAGILFILFLRSMQRVQKLDKFEKML  708



>emb|CDY28024.1| BnaC05g44260D [Brassica napus]
Length=700

 Score =   176 bits (445),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 100/272 (37%), Positives = 153/272 (56%), Gaps = 33/272 (12%)
 Frame = +2

Query  8    LLEVFYGVYEKDPDKVLQAMVQMGVLVPTGDMTAVRRTAQFFLNSFEERLATQRRERELA  187
            LL++FY VYEKD  KV+Q ++ +  L PTGD+++VRR+ QFFL++   +   Q       
Sbjct  459  LLDLFYSVYEKDAKKVMQNLIDLEALQPTGDLSSVRRSIQFFLDNLLSQSPDQ-------  511

Query  188  KAELGFKKPLTKEEKIEKKKQRLAAIGEDLLSIAADQPFRFPATFTFVVRAFSVLHGIGK  367
                               +Q LAAIGEDL +I+ DQPFRFP+TFTFV+RAFS L GIG 
Sbjct  512  -------------------QQTLAAIGEDLFAISQDQPFRFPSTFTFVIRAFSTLEGIGY  552

Query  368  GLDPRFDITEIAKPYALELLRFRE---AGVEVILKDFKTRWDRQNRAFYNLFRQADRVEK  538
             LDP F   ++A PYA ELL  ++   +G +++ +  K   D ++      +    RV++
Sbjct  553  ILDPDFSFVKVAAPYAQELLDLKQKQNSGTQLVQQIRKQADDARSSTLSMPY----RVQR  608

Query  539  LAEIIQRLEQGDLKLRVRALESERAFQRVAAVQKTILSAVAAGSLINLATVLYLNAIRMP  718
            + E ++ L+ GDLKLRVR LESERA ++   +Q   +  V  G+L+N+         ++ 
Sbjct  609  IEEFVKELDSGDLKLRVRVLESERAARKATILQMATMYTVLGGTLLNIGVTFSNQGSQLV  668

Query  719  AMAAYGLCAFFGFQVLIGIVKVKKIDQRERLI  814
            A  ++     F   V   + +V K+D+ E++I
Sbjct  669  ANGSFVGAGIFMLLVARSMQRVNKLDKFEKMI  700



>ref|XP_006407806.1| hypothetical protein EUTSA_v10020179mg [Eutrema salsugineum]
 gb|ESQ49259.1| hypothetical protein EUTSA_v10020179mg [Eutrema salsugineum]
Length=698

 Score =   175 bits (444),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 100/272 (37%), Positives = 154/272 (57%), Gaps = 33/272 (12%)
 Frame = +2

Query  8    LLEVFYGVYEKDPDKVLQAMVQMGVLVPTGDMTAVRRTAQFFLNSFEERLATQRRERELA  187
            LL++FY VYEKD  KV++ ++ +  L PTGD+++VRR+ QFFL++   +   Q       
Sbjct  457  LLDLFYSVYEKDAKKVMKNLIDLEALQPTGDLSSVRRSVQFFLDNLLSQSPDQ-------  509

Query  188  KAELGFKKPLTKEEKIEKKKQRLAAIGEDLLSIAADQPFRFPATFTFVVRAFSVLHGIGK  367
                               +Q LAAIGEDL +I+ DQPFRFP+TFTFV+RAFS L GIG 
Sbjct  510  -------------------QQTLAAIGEDLFAISQDQPFRFPSTFTFVIRAFSTLEGIGY  550

Query  368  GLDPRFDITEIAKPYALELLRFRE---AGVEVILKDFKTRWDRQNRAFYNLFRQADRVEK  538
             LDP F   ++A PYA ELL  ++   +G +++ +  K   D ++      +    RV++
Sbjct  551  ILDPDFSFVKVAAPYAQELLDLKQRQRSGTQLVQQIRKQADDARSSTLSMPY----RVQR  606

Query  539  LAEIIQRLEQGDLKLRVRALESERAFQRVAAVQKTILSAVAAGSLINLATVLYLNAIRMP  718
            + E ++ L+ GDLKLRVR LESERA ++   +Q   +  V  G+L+N+         ++ 
Sbjct  607  IEEFVKELDSGDLKLRVRVLESERAARKATILQMATMYTVLGGTLLNIGVTFNNQGSQLI  666

Query  719  AMAAYGLCAFFGFQVLIGIVKVKKIDQRERLI  814
            A  ++     F   VL  + +V K+D+ E++I
Sbjct  667  ANGSFVGAGIFMALVLRSMQRVNKLDKFEKMI  698



>ref|XP_006595653.1| PREDICTED: uncharacterized aarF domain-containing protein kinase 
At1g79600, chloroplastic-like [Glycine max]
 gb|KHN46893.1| Hypothetical protein glysoja_031193 [Glycine soja]
Length=696

 Score =   174 bits (442),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 104/273 (38%), Positives = 155/273 (57%), Gaps = 31/273 (11%)
 Frame = +2

Query  2    EGLLEVFYGVYEKDPDKVLQAMVQMGVLVPTGDMTAVRRTAQFFLNSFEERLATQRRERE  181
            E LLE+FY +YEKD  KV+Q ++ +G L PTGD+++VRR+ QFFL    + L +Q  ++E
Sbjct  453  ERLLELFYAIYEKDSKKVMQRLIDLGALQPTGDLSSVRRSVQFFL----DHLLSQAPDQE  508

Query  182  LAKAELGFKKPLTKEEKIEKKKQRLAAIGEDLLSIAADQPFRFPATFTFVVRAFSVLHGI  361
                                  Q L+AIGEDL +IA DQPFRFP+TF FV+RAFS L GI
Sbjct  509  ----------------------QTLSAIGEDLFAIAQDQPFRFPSTFAFVLRAFSTLEGI  546

Query  362  GKGLDPRFDITEIAKPYALELLRFREA--GVEVILKDFKTRWDRQNRAFYNLFRQADRVE  535
            G  L+P F  ++IA PYA ELL  R+       ++++ + + D  +   Y +     RV+
Sbjct  547  GYTLNPNFSFSKIAAPYAQELLEIRQKQRTAPQLVEEIRKQAD--DATTYTM-SMPYRVQ  603

Query  536  KLAEIIQRLEQGDLKLRVRALESERAFQRVAAVQKTILSAVAAGSLINLATVLYLNAIRM  715
            ++ E  ++LE GDLKLRVR LESERA ++   +Q   +  V  G+L+NL   +       
Sbjct  604  RIEEFTKQLEAGDLKLRVRVLESERAARKATGLQMATMYTVLGGTLLNLGITMSSQGNIT  663

Query  716  PAMAAYGLCAFFGFQVLIGIVKVKKIDQRERLI  814
             A  ++     F    +  + +VK +D+ E++I
Sbjct  664  IANGSFIGAGIFMTLFVRSMQRVKMLDKFEKMI  696



>ref|XP_007142530.1| hypothetical protein PHAVU_008G288500g [Phaseolus vulgaris]
 gb|ESW14524.1| hypothetical protein PHAVU_008G288500g [Phaseolus vulgaris]
Length=711

 Score =   174 bits (442),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 101/273 (37%), Positives = 151/273 (55%), Gaps = 31/273 (11%)
 Frame = +2

Query  2    EGLLEVFYGVYEKDPDKVLQAMVQMGVLVPTGDMTAVRRTAQFFLNSFEERLATQRRERE  181
            E LLE+FY +YEKD  KV+Q ++++G L PTGD+++VRR+ QFFL+  + +   Q     
Sbjct  468  ERLLELFYAMYEKDAKKVMQRLIELGALQPTGDLSSVRRSVQFFLDHLQSQAPDQ-----  522

Query  182  LAKAELGFKKPLTKEEKIEKKKQRLAAIGEDLLSIAADQPFRFPATFTFVVRAFSVLHGI  361
                                 +Q L+AIGEDL +IA DQPFRFP+TF FV+RAFS L GI
Sbjct  523  ---------------------QQTLSAIGEDLFAIAQDQPFRFPSTFAFVLRAFSTLEGI  561

Query  362  GKGLDPRFDITEIAKPYALELLRFREAGVEV--ILKDFKTRWDRQNRAFYNLFRQADRVE  535
            G  L+P F    IA PYA ELL  R+  +    ++++ + + D   R++        RV+
Sbjct  562  GYTLNPNFSFANIAAPYAQELLDIRQKQITAPQLVEEIRKQAD-DARSY--TMSMPYRVQ  618

Query  536  KLAEIIQRLEQGDLKLRVRALESERAFQRVAAVQKTILSAVAAGSLINLATVLYLNAIRM  715
            ++ E  ++LE GDLKLRVR LESERA ++   +Q   +  V  G+L+NL   +       
Sbjct  619  RIEEFTKQLEAGDLKLRVRVLESERAARKATTLQMATMYTVLGGTLLNLGITMSNQGNAA  678

Query  716  PAMAAYGLCAFFGFQVLIGIVKVKKIDQRERLI  814
                ++     F    +  + +VK +D+ E +I
Sbjct  679  MGNGSFIAAGIFMTLFVRSMQRVKMLDKFEEMI  711



>ref|XP_004956388.1| PREDICTED: uncharacterized aarF domain-containing protein kinase 
At1g79600, chloroplastic-like isoform X4 [Setaria italica]
Length=732

 Score =   174 bits (442),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 102/273 (37%), Positives = 154/273 (56%), Gaps = 31/273 (11%)
 Frame = +2

Query  2    EGLLEVFYGVYEKDPDKVLQAMVQMGVLVPTGDMTAVRRTAQFFLNSFEERLATQRRERE  181
            E LL +FY VYEKD +KV++A++ +  L PTGD++ VRR+ QFFL++   +   Q     
Sbjct  489  ERLLSLFYSVYEKDANKVMKALIDLEALQPTGDLSPVRRSIQFFLDNLLSQTPDQ-----  543

Query  182  LAKAELGFKKPLTKEEKIEKKKQRLAAIGEDLLSIAADQPFRFPATFTFVVRAFSVLHGI  361
                                 +Q LAAIGEDL +IA DQPFRFP+TFTFV+RAFS L GI
Sbjct  544  ---------------------QQTLAAIGEDLFAIAQDQPFRFPSTFTFVIRAFSTLEGI  582

Query  362  GKGLDPRFDITEIAKPYALELLRF--REAGVEVILKDFKTRWDRQNRAFYNLFRQADRVE  535
            G  LDP F   ++A PYA ELL    R+ G   ++++ +    + N A  +      R++
Sbjct  583  GYILDPDFSFVKVAAPYAQELLDLKQRQQGGPELVQEIRK---QANDARDSTISMPYRIQ  639

Query  536  KLAEIIQRLEQGDLKLRVRALESERAFQRVAAVQKTILSAVAAGSLINLATVLYLNAIRM  715
            ++ + + +LE GDLKLRVR LESERA ++   +Q   +     G+L+N+   L     ++
Sbjct  640  RIEDFVGQLESGDLKLRVRVLESERAARKATVLQMATMYTALGGTLLNVGVTLNGQGNQI  699

Query  716  PAMAAYGLCAFFGFQVLIGIVKVKKIDQRERLI  814
             A  ++     F   ++  + +VKK+D+ E +I
Sbjct  700  IANGSFIGAGIFLALLIRSMQRVKKLDKFETMI  732



>ref|XP_005651797.1| ABC1-domain-containing protein [Coccomyxa subellipsoidea C-169]
 gb|EIE27253.1| ABC1-domain-containing protein [Coccomyxa subellipsoidea C-169]
Length=584

 Score =   173 bits (439),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 106/277 (38%), Positives = 153/277 (55%), Gaps = 36/277 (13%)
 Frame = +2

Query  2    EGLLEVFYGVYEKDPDKVLQAMVQMGVLVPTGDMTAVRRTAQFFLNSFEERLATQRRERE  181
            E L+E+FY VY  D D VL A++ + ++VPT D  ++RR   F L++   ++        
Sbjct  340  ESLVELFYAVYRADADGVLAALIDLNIIVPTADALSLRRAIAFGLDNLMRKV--------  391

Query  182  LAKAELGFKKPLTKEEKIEKKKQRLAAIGEDLLSIAADQPFRFPATFTFVVRAFSVLHGI  361
                                +K+ +A IGEDL +IA DQPFRFPA+FTFV+RAF+ L G 
Sbjct  392  -------------------DEKEAVAGIGEDLFAIALDQPFRFPASFTFVLRAFTTLEGF  432

Query  362  GKGLDPRFDITEIAKPYALELLRFREAGVEVILKDFKTRWDRQNRAFYNLFRQA----DR  529
            G+ LDP +    +A+PYALELL+ ++A      +DF    D+  R    +   A     R
Sbjct  433  GRTLDPNYKFAAVAQPYALELLQLQDAQAR---QDFVL--DQMQREAVKVGSAAMAMPGR  487

Query  530  VEKLAEIIQRLEQGDLKLRVRALESERAFQRVAAVQKTILSAVAAGSLINLATVLYLNAI  709
            VEK+ E +Q+L  GDLKLRVRALE ERA +R + +Q   +SA+A G+L+NL + L ++  
Sbjct  488  VEKIDETLQQLRGGDLKLRVRALELERAARRSSILQGATMSAIAGGTLVNLGSQLIISGQ  547

Query  710  RMPAMAAYGLCAFFGFQVLIGIVKVKKIDQRERLITG  820
                       A FG  V     +VK+ID+ E+ I G
Sbjct  548  SGVGGTLLAGSAVFGALVWRAFWRVKRIDRFEKNIRG  584



>ref|XP_003518576.2| PREDICTED: uncharacterized aarF domain-containing protein kinase 
At1g79600, chloroplastic-like [Glycine max]
Length=685

 Score =   173 bits (439),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 105/273 (38%), Positives = 155/273 (57%), Gaps = 31/273 (11%)
 Frame = +2

Query  2    EGLLEVFYGVYEKDPDKVLQAMVQMGVLVPTGDMTAVRRTAQFFLNSFEERLATQRRERE  181
            E LLE+FY +YEKD  KV+Q ++++G L PTGD+++VRR+ QFFL    + L +Q  ++E
Sbjct  442  ERLLELFYAMYEKDAKKVMQRLIELGALQPTGDLSSVRRSVQFFL----DHLLSQAPDQE  497

Query  182  LAKAELGFKKPLTKEEKIEKKKQRLAAIGEDLLSIAADQPFRFPATFTFVVRAFSVLHGI  361
                                  Q L+AIGEDL +IA DQPFRFP+TF FV+RAFS L GI
Sbjct  498  ----------------------QTLSAIGEDLFAIAQDQPFRFPSTFAFVLRAFSTLEGI  535

Query  362  GKGLDPRFDITEIAKPYALELLRFREA--GVEVILKDFKTRWDRQNRAFYNLFRQADRVE  535
            G  L+P F   +IA PYA ELL  R+       ++++ + + D  +   Y +     RV+
Sbjct  536  GYTLNPNFSFAKIATPYAQELLEIRQKQRTAPQLVEEIRKQAD--DATTYTM-SMPYRVQ  592

Query  536  KLAEIIQRLEQGDLKLRVRALESERAFQRVAAVQKTILSAVAAGSLINLATVLYLNAIRM  715
            ++ E  ++LE GDLKLRVR LESERA ++  A+Q   +  V   +L+NL   L       
Sbjct  593  RIEEFTKQLEAGDLKLRVRVLESERAARKATALQMATMYTVLGATLLNLGITLSSQGNIT  652

Query  716  PAMAAYGLCAFFGFQVLIGIVKVKKIDQRERLI  814
             A  ++     F    +  + +VK +D+ E++I
Sbjct  653  IANGSFIGAGIFMTLFVRSMQRVKMLDKFEKMI  685



>ref|XP_002464851.1| hypothetical protein SORBIDRAFT_01g027550 [Sorghum bicolor]
 gb|EER91849.1| hypothetical protein SORBIDRAFT_01g027550 [Sorghum bicolor]
Length=719

 Score =   173 bits (439),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 104/277 (38%), Positives = 153/277 (55%), Gaps = 39/277 (14%)
 Frame = +2

Query  2    EGLLEVFYGVYEKDPDKVLQAMVQMGVLVPTGDMTAVRRTAQFFLNSFEERLATQRRERE  181
            E LL +FY VYEKD +KV++A++ +  L PTGD++ VRR+ QFFL++   +   Q     
Sbjct  476  ERLLSLFYSVYEKDANKVMKALIDLEALQPTGDLSPVRRSIQFFLDNLLNQTPDQ-----  530

Query  182  LAKAELGFKKPLTKEEKIEKKKQRLAAIGEDLLSIAADQPFRFPATFTFVVRAFSVLHGI  361
                                 +Q LAAIGEDL +IA DQPFRFP+TFTFV+RAFS L GI
Sbjct  531  ---------------------QQTLAAIGEDLFAIAQDQPFRFPSTFTFVIRAFSTLEGI  569

Query  362  GKGLDPRFDITEIAKPYALELLRFRE------AGVEVILKDFKTRWDRQNRAFYNLFRQA  523
            G  LDP F   ++A PYA ELL  ++      A V+ I K       + N A  +     
Sbjct  570  GYILDPEFSFVKVAAPYAQELLDLKQRQQRGPALVQEIRK-------QANDARDSTISMP  622

Query  524  DRVEKLAEIIQRLEQGDLKLRVRALESERAFQRVAAVQKTILSAVAAGSLINLATVLYLN  703
             R++++ + + +LE GDLKLRVR LESERA ++   +Q   +     G+L+N+   L   
Sbjct  623  YRIQRIEDFVGQLESGDLKLRVRVLESERAARKATVLQMATMYTALGGTLLNVGVTLNTQ  682

Query  704  AIRMPAMAAYGLCAFFGFQVLIGIVKVKKIDQRERLI  814
              ++ A  ++     F   ++  + +VKK+D+ E +I
Sbjct  683  GNQIIANGSFIGAGIFLALLVRSMQRVKKLDKFETMI  719



>ref|XP_004303572.1| PREDICTED: uncharacterized aarF domain-containing protein kinase 
At1g79600, chloroplastic [Fragaria vesca subsp. vesca]
Length=713

 Score =   173 bits (439),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 105/279 (38%), Positives = 153/279 (55%), Gaps = 43/279 (15%)
 Frame = +2

Query  2    EGLLEVFYGVYEKDPDKVLQAMVQMGVLVPTGDMTAVRRTAQFFLNSFEERLATQRRERE  181
            E LLE+FY +YEKD  KV+Q ++ +G L PTGD+++VRR+ QFFLN+  ++   Q     
Sbjct  470  ERLLELFYSIYEKDAKKVMQCLIDLGALQPTGDLSSVRRSVQFFLNNLLDQTPDQ-----  524

Query  182  LAKAELGFKKPLTKEEKIEKKKQRLAAIGEDLLSIAADQPFRFPATFTFVVRAFSVLHGI  361
                                 +   +AIGEDL +IA DQPFRFP+TFTFV+RAFS L GI
Sbjct  525  ---------------------QTTFSAIGEDLFAIAQDQPFRFPSTFTFVLRAFSTLEGI  563

Query  362  GKGLDPRFDITEIAKPYALELLRFRE---AGVEVILKDFKTRWDRQNRAFYNLFRQADRV  532
            G  L+P F   +IA PYA ELL  R+    G +++ +  K   D ++      +    RV
Sbjct  564  GYILNPDFSFVKIAAPYAQELLDLRQKRRTGTQLVNEIRKQADDARSYTMSMPY----RV  619

Query  533  EKLAEIIQRLEQGDLKLRVRALESERAFQRVAAVQKTILSAVAAGSLINLATVLYLNAIR  712
            +++ E ++ LE GDLKLRVR LESERA ++   +Q   +  V   +L+NL   L      
Sbjct  620  QRIEEFVKELESGDLKLRVRVLESERAAKKANILQMATMYTVLGSTLLNLGVTL-----G  674

Query  713  MPAMAAYGLCAFFGFQVLIGIV-----KVKKIDQRERLI  814
                 A+   ++ G  VL  +      +VK +D+ E++I
Sbjct  675  SQGNLAFANGSYVGAGVLFALFARCMQRVKNLDKFEKMI  713



>ref|WP_018398664.1| hypothetical protein [filamentous cyanobacterium ESFC-1]
Length=583

 Score =   172 bits (435),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 97/274 (35%), Positives = 153/274 (56%), Gaps = 48/274 (18%)
 Frame = +2

Query  2    EGLLEVFYGVYEKDPDKVLQAMVQMGVLVPTGDMTAVRRTAQFFLNSFEERLATQRRERE  181
            E L++  +G+ EK+ D+V+ +++++G L PTGDM  VRR+ QF L++F +          
Sbjct  348  EKLMQTLFGIAEKNADRVVSSLIELGALAPTGDMGPVRRSVQFMLDNFMD----------  397

Query  182  LAKAELGFKKPLTKEEKIEKKKQRLAAIGEDLLSIAADQPFRFPATFTFVVRAFSVLHGI  361
                     KP         ++Q ++AIGEDL  IA DQPFRFPATFTFV+RAFS L G+
Sbjct  398  ---------KPF--------EEQSVSAIGEDLYEIAYDQPFRFPATFTFVMRAFSTLEGV  440

Query  362  GKGLDPRFDITEIAKPYALELLRFREAGVEVILKDFKTRWDRQNRAFYNLFRQADRVEKL  541
            GKGLDP F+  E+A+P+A+E++    A     L D              L RQA ++   
Sbjct  441  GKGLDPDFNFMEVAQPFAMEIMTNSSASNGNSLLD-------------ELGRQAAQMSST  487

Query  542  A--------EIIQRLEQGDLKLRVRALESERAFQRVAAVQKTILSAVAAGSLINLATVLY  697
            A        + I++L++GD++LRVR++ES+R  +R++++Q      +  G+ I  AT+ +
Sbjct  488  ALGLPRRIEDTIEKLDRGDIRLRVRSIESDRILRRMSSMQLLTNYTILVGTFILSATIFW  547

Query  698  LNAIRMPAMAAYGLCAFFGFQVLIGIVKVKKIDQ  799
            +NA    A  A  L +F G        K+ ++D+
Sbjct  548  VNAWPWLAAIALVLASFLGVSTFRQWRKINRLDR  581



>gb|AGI37816.1| chloroplast ABC1-like family protein, partial [Triticum aestivum]
Length=717

 Score =   172 bits (437),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 101/272 (37%), Positives = 154/272 (57%), Gaps = 33/272 (12%)
 Frame = +2

Query  8    LLEVFYGVYEKDPDKVLQAMVQMGVLVPTGDMTAVRRTAQFFLNSFEERLATQRRERELA  187
            LL +FY VYEKD +KV++A++ +  L PTGD++ VRR+ Q+FL++   +   Q       
Sbjct  476  LLSLFYAVYEKDANKVIKALIDLEALQPTGDLSPVRRSVQYFLDNLLSQSPDQ-------  528

Query  188  KAELGFKKPLTKEEKIEKKKQRLAAIGEDLLSIAADQPFRFPATFTFVVRAFSVLHGIGK  367
                               +Q LAAIGEDL +IA DQPFRFP+TFTFV+RAFS L GIG 
Sbjct  529  -------------------QQTLAAIGEDLFAIAQDQPFRFPSTFTFVIRAFSTLEGIGY  569

Query  368  GLDPRFDITEIAKPYALELLRF---REAGVEVILKDFKTRWDRQNRAFYNLFRQADRVEK  538
             LDP F   ++A PYA ELL     R AG E++ +  K    + N A  +      R+++
Sbjct  570  ILDPDFSFVKVAAPYAQELLDLKTRRRAGPELVQEIRK----QANDARDSTISMPYRIQR  625

Query  539  LAEIIQRLEQGDLKLRVRALESERAFQRVAAVQKTILSAVAAGSLINLATVLYLNAIRMP  718
            + + + +LE GDLKLRVR LESERA ++   +Q   +     G+L+N+  V+     ++ 
Sbjct  626  IEDFVGQLESGDLKLRVRVLESERAARKANVLQMATMYTAMGGTLLNIGVVMGSQGNQIV  685

Query  719  AMAAYGLCAFFGFQVLIGIVKVKKIDQRERLI  814
            A  ++     F   ++  + +VKK+++ E ++
Sbjct  686  ANGSFIGAGIFLALLVASMRRVKKLEKFETMM  717



>gb|KIY97471.1| Uncharacterized protein MNEG_10493 [Monoraphidium neglectum]
Length=267

 Score =   165 bits (417),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 103/282 (37%), Positives = 151/282 (54%), Gaps = 43/282 (15%)
 Frame = +2

Query  2    EGLLEVFYGVYE-----------KDPDKVLQAMVQMGVLVPTGDMTAVRRTAQFFLNSFE  148
            E L+EVFYG+Y            KD  +V+ A+ ++GV+  TGD  +VRR   FFL + +
Sbjct  10   ENLMEVFYGIYRRVDPGMGRGWGKDTGQVVDALTELGVIRATGDRLSVRRAIAFFLENLQ  69

Query  149  ERLATQRRERELAKAELGFKKPLTKEEKIEKKKQRLAAIGEDLLSIAADQPFRFPATFTF  328
             +L     ERE                      + L AIGEDL +IA D PFRFPATFTF
Sbjct  70   RQL-----ERE----------------------ETLGAIGEDLFAIALDSPFRFPATFTF  102

Query  329  VVRAFSVLHGIGKGLDPRFDITEIAKPYALELLRFREAG--VEVILKDFKTRWDRQNRAF  502
            V+RAFS L GIGK L P +  +E+A+PYA ELL+ ++A    + +L   + +     +A 
Sbjct  103  VLRAFSTLEGIGKTLVPTYRFSEVAQPYATELLQLQDASGRNDFVLAQLQQQATELGQAA  162

Query  503  YNLFRQADRVEKLAEIIQRLEQGDLKLRVRALESERAFQRVAAVQKTILSAVAAGSLINL  682
              +     RV  +++ I ++  GDLKLRVR LE ERA +R   +Q   L  VA   ++N+
Sbjct  163  AAM---PTRVAAISDTIDQITAGDLKLRVRDLEGERAARRAGIMQSVTLQTVAGLGVMNV  219

Query  683  ATVLYLNAIRMPAMAAYGLCAFFGFQVLIGIVKVKKIDQRER  808
               L L     P  A + +   FG   L+G+ +V+++D+ E+
Sbjct  220  GVQLSLAGRDGPGAAVFAVAGVFGVLALLGLRRVQRLDKFEK  261



>gb|EMS49182.1| hypothetical protein TRIUR3_21765 [Triticum urartu]
Length=730

 Score =   172 bits (436),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 101/272 (37%), Positives = 154/272 (57%), Gaps = 33/272 (12%)
 Frame = +2

Query  8    LLEVFYGVYEKDPDKVLQAMVQMGVLVPTGDMTAVRRTAQFFLNSFEERLATQRRERELA  187
            LL +FY VYEKD +KV++A++ +  L PTGD++ VRR+ Q+FL++   +   Q       
Sbjct  489  LLSLFYAVYEKDANKVIKALIDLEALQPTGDLSPVRRSVQYFLDNLLSQSPDQ-------  541

Query  188  KAELGFKKPLTKEEKIEKKKQRLAAIGEDLLSIAADQPFRFPATFTFVVRAFSVLHGIGK  367
                               +Q LAAIGEDL +IA DQPFRFP+TFTFV+RAFS L GIG 
Sbjct  542  -------------------QQTLAAIGEDLFAIAQDQPFRFPSTFTFVIRAFSTLEGIGY  582

Query  368  GLDPRFDITEIAKPYALELLRF---REAGVEVILKDFKTRWDRQNRAFYNLFRQADRVEK  538
             LDP F   ++A PYA ELL     R AG E++ +  K    + N A  +      R+++
Sbjct  583  ILDPDFSFVKVAAPYAQELLDLKTRRRAGPELVQEIRK----QANDARDSTISMPYRIQR  638

Query  539  LAEIIQRLEQGDLKLRVRALESERAFQRVAAVQKTILSAVAAGSLINLATVLYLNAIRMP  718
            + + + +LE GDLKLRVR LESERA ++   +Q   +     G+L+N+  V+     ++ 
Sbjct  639  IEDFVGQLESGDLKLRVRVLESERAARKANVLQMATMYTAMGGTLLNIGVVMGSQGNQIV  698

Query  719  AMAAYGLCAFFGFQVLIGIVKVKKIDQRERLI  814
            A  ++     F   ++  + +VKK+++ E ++
Sbjct  699  ANGSFIGAGIFLALLVASMRRVKKLEKFETMM  730



>gb|EWM26267.1| abc transporter [Nannochloropsis gaditana]
Length=928

 Score =   173 bits (439),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 97/274 (35%), Positives = 157/274 (57%), Gaps = 19/274 (7%)
 Frame = +2

Query  2    EGLLEVFYGVYEKDPDKVLQAMVQMGVLVPTGDMTAVRRTAQFFLNSFEERLATQRRERE  181
            +GL+++ + VYE D      AM  +G+L    D  +V + A+FFL  F   L T  +   
Sbjct  655  KGLVDLIFSVYEGDAKATCDAMESVGILRRGADRVSVEKIARFFLAEFGSTLNTGGK---  711

Query  182  LAKAELGFKKPLTKEEKIEKKKQRLAAIGEDLLSIAADQPFRFPATFTFVVRAFSVLHGI  361
                   +   L KE + +++  R A +G DLLS++ D PF+FP TFTFV RAF+ L GI
Sbjct  712  -------WVNELDKETQKQQRASRRAQLGADLLSLSTDLPFKFPPTFTFVFRAFTSLDGI  764

Query  362  GKGLDPRFDITEIAKPYALELLRFREAGVEV-ILKDFKTRWDRQNRAFYNLFRQADRVEK  538
            GKGLD R+D+T +A+P+  EL+  R+    + +LK ++ +   + +    +     +V +
Sbjct  765  GKGLDSRYDLTRLAQPFLKELVDLRDGSATLSLLKGWQKKLGWRPQDLAAVVTSPRKVAQ  824

Query  539  LAEIIQRLEQGDLKLRVRALESERAFQRVAAVQKTILSAVAAGSLINLATVLYLNAIRMP  718
            + + ++R EQGDLKLRVR LESERAF+R+  VQ T+++A+ +   +N A +L  NA+  P
Sbjct  825  IEDTLRRAEQGDLKLRVRVLESERAFKRIDIVQSTMVNAIMSSMFLNAAIMLSANAVS-P  883

Query  719  AM-------AAYGLCAFFGFQVLIGIVKVKKIDQ  799
             +         +G    FG ++ +  +K++K DQ
Sbjct  884  TLVNRFFIKGLFGAATLFGLKIPVNYMKLRKFDQ  917



>emb|CBI28458.3| unnamed protein product [Vitis vinifera]
Length=573

 Score =   171 bits (432),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 102/274 (37%), Positives = 150/274 (55%), Gaps = 33/274 (12%)
 Frame = +2

Query  2    EGLLEVFYGVYEKDPDKVLQAMVQMGVLVPTGDMTAVRRTAQFFLNSFEERLATQRRERE  181
            E LLE+FY +YEKD  KV+Q++  +  L PTGD+++VRR+ QFFL++   +   Q     
Sbjct  330  ERLLELFYAIYEKDAKKVMQSLTDLEALQPTGDLSSVRRSVQFFLDNLLSQTPDQ-----  384

Query  182  LAKAELGFKKPLTKEEKIEKKKQRLAAIGEDLLSIAADQPFRFPATFTFVVRAFSVLHGI  361
                                  Q LAAIGEDL +IA DQP RFP+T TFV++AFS L GI
Sbjct  385  ---------------------PQTLAAIGEDLFAIATDQPIRFPSTITFVLKAFSTLEGI  423

Query  362  GKGLDPRFDITEIAKPYALELLRFRE---AGVEVILKDFKTRWDRQNRAFYNLFRQADRV  532
            G  LDP F   +IA PYA ELL  R+    G + + +  K   D +       +     V
Sbjct  424  GYSLDPDFSFVKIAAPYAQELLDIRQQQRTGPQFVQEIRKQADDARTYTMSMPY----SV  479

Query  533  EKLAEIIQRLEQGDLKLRVRALESERAFQRVAAVQKTILSAVAAGSLINLATVLYLNAIR  712
            +++ E +++LE GDLKLRVR LESERA ++   +Q   +  V  G+L++L   L     +
Sbjct  480  QRIEEFVKQLESGDLKLRVRVLESERAARKATILQMATMYTVLGGTLLSLGVTLSNQGSQ  539

Query  713  MPAMAAYGLCAFFGFQVLIGIVKVKKIDQRERLI  814
            + A  +Y     F    +  + +VK++D+ E++I
Sbjct  540  VIANGSYVGAGVFLVLFIRSMQRVKRLDKFEKMI  573



>ref|XP_002974815.1| hypothetical protein SELMODRAFT_101886, partial [Selaginella 
moellendorffii]
 gb|EFJ24335.1| hypothetical protein SELMODRAFT_101886, partial [Selaginella 
moellendorffii]
Length=536

 Score =   170 bits (430),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 99/244 (41%), Positives = 139/244 (57%), Gaps = 52/244 (21%)
 Frame = +2

Query  2    EGLLEVFYGVYEKDPDKVLQAMVQMGVLVPTGDMTAVRRTAQFFLNSFEERLATQRRERE  181
            E LLE+FY VYE+D  KV+Q +V +G LVPTGDM  VR+T QFFL +    L +QR ++ 
Sbjct  340  EKLLELFYAVYEEDASKVIQGLVDLGALVPTGDMGPVRKTIQFFLKN----LTSQRPDQA  395

Query  182  LAKAELGFKKPLTKEEKIEKKKQRLAAIGEDLLSIAADQPFRFPATFTFVVRAFSVLHGI  361
                                      AIGEDL +IA DQPFRFP+TFTFV+RAFS L GI
Sbjct  396  TT----------------------FTAIGEDLFAIAVDQPFRFPSTFTFVLRAFSTLEGI  433

Query  362  GKGLDPRFDITEIAKPYALELLRFREAGVEVILKDFKTRWDRQNRAFYNLFRQADRVEKL  541
            G  LDP+F   +IA PYA    + R+A V + +                      RV+ +
Sbjct  434  GYILDPKFSFAKIAAPYA----QTRDATVAMPM----------------------RVQHI  467

Query  542  AEIIQRLEQGDLKLRVRALESERAFQRVAAVQKTILSAVAAGSLINLATVLYLNAIRMPA  721
             + +Q+LE GD+KLRVR LE+ERA ++ + +Q T ++ VAA +L+N+   L    ++  A
Sbjct  468  EKFMQQLEDGDIKLRVRVLEAERAARKSSVLQTTTMNLVAAATLVNVGVTLSTQGLQDFA  527

Query  722  MAAY  733
            +A++
Sbjct  528  IASF  531



>ref|XP_002266310.1| PREDICTED: uncharacterized aarF domain-containing protein kinase 
At1g79600, chloroplastic [Vitis vinifera]
Length=707

 Score =   171 bits (433),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 102/274 (37%), Positives = 150/274 (55%), Gaps = 33/274 (12%)
 Frame = +2

Query  2    EGLLEVFYGVYEKDPDKVLQAMVQMGVLVPTGDMTAVRRTAQFFLNSFEERLATQRRERE  181
            E LLE+FY +YEKD  KV+Q++  +  L PTGD+++VRR+ QFFL++   +   Q     
Sbjct  464  ERLLELFYAIYEKDAKKVMQSLTDLEALQPTGDLSSVRRSVQFFLDNLLSQTPDQ-----  518

Query  182  LAKAELGFKKPLTKEEKIEKKKQRLAAIGEDLLSIAADQPFRFPATFTFVVRAFSVLHGI  361
                                  Q LAAIGEDL +IA DQP RFP+T TFV++AFS L GI
Sbjct  519  ---------------------PQTLAAIGEDLFAIATDQPIRFPSTITFVLKAFSTLEGI  557

Query  362  GKGLDPRFDITEIAKPYALELLRFRE---AGVEVILKDFKTRWDRQNRAFYNLFRQADRV  532
            G  LDP F   +IA PYA ELL  R+    G + + +  K   D +       +     V
Sbjct  558  GYSLDPDFSFVKIAAPYAQELLDIRQQQRTGPQFVQEIRKQADDARTYTMSMPY----SV  613

Query  533  EKLAEIIQRLEQGDLKLRVRALESERAFQRVAAVQKTILSAVAAGSLINLATVLYLNAIR  712
            +++ E +++LE GDLKLRVR LESERA ++   +Q   +  V  G+L++L   L     +
Sbjct  614  QRIEEFVKQLESGDLKLRVRVLESERAARKATILQMATMYTVLGGTLLSLGVTLSNQGSQ  673

Query  713  MPAMAAYGLCAFFGFQVLIGIVKVKKIDQRERLI  814
            + A  +Y     F    +  + +VK++D+ E++I
Sbjct  674  VIANGSYVGAGVFLVLFIRSMQRVKRLDKFEKMI  707



>emb|CAN66349.1| hypothetical protein VITISV_016570 [Vitis vinifera]
Length=707

 Score =   171 bits (432),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 102/274 (37%), Positives = 150/274 (55%), Gaps = 33/274 (12%)
 Frame = +2

Query  2    EGLLEVFYGVYEKDPDKVLQAMVQMGVLVPTGDMTAVRRTAQFFLNSFEERLATQRRERE  181
            E LLE+FY +YEKD  KV+Q++  +  L PTGD ++VRR+ QFFL++   +   Q     
Sbjct  464  ERLLELFYAIYEKDAKKVMQSLTDLEALQPTGDXSSVRRSVQFFLDNLLSQXPDQ-----  518

Query  182  LAKAELGFKKPLTKEEKIEKKKQRLAAIGEDLLSIAADQPFRFPATFTFVVRAFSVLHGI  361
                                  Q LAAIGEDL +IA DQP RFP+T TFV++AFS L GI
Sbjct  519  ---------------------PQTLAAIGEDLFAIATDQPIRFPSTITFVLKAFSTLEGI  557

Query  362  GKGLDPRFDITEIAKPYALELLRFRE---AGVEVILKDFKTRWDRQNRAFYNLFRQADRV  532
            G  LDP F   +IA PYA ELL  R+    G +++ +  K   D +       +     V
Sbjct  558  GYSLDPDFSFVKIAAPYAQELLDIRQQQRTGPQLVQEIRKQADDARTYTMSMPY----SV  613

Query  533  EKLAEIIQRLEQGDLKLRVRALESERAFQRVAAVQKTILSAVAAGSLINLATVLYLNAIR  712
            +++ E +++LE GDLKLRVR LESERA ++   +Q   +  V  G+L++L   L     +
Sbjct  614  QRIEEFVKQLESGDLKLRVRVLESERAARKATILQMATMYTVLGGTLLSLGVTLSNQGSQ  673

Query  713  MPAMAAYGLCAFFGFQVLIGIVKVKKIDQRERLI  814
            + A  +Y     F    +  + +VK++D+ E++I
Sbjct  674  VIANGSYVGAGVFLVLFIRSMQRVKRLDKFEKMI  707



>ref|XP_006660453.1| PREDICTED: uncharacterized aarF domain-containing protein kinase 
At1g79600, chloroplastic-like [Oryza brachyantha]
Length=719

 Score =   171 bits (432),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 102/274 (37%), Positives = 151/274 (55%), Gaps = 33/274 (12%)
 Frame = +2

Query  2    EGLLEVFYGVYEKDPDKVLQAMVQMGVLVPTGDMTAVRRTAQFFLNSFEERLATQRRERE  181
            E LL +FY VYEKD +KV++A++ +  L  TGD++ VRR+ QFFL++   +   Q     
Sbjct  476  ERLLSLFYAVYEKDANKVMKALIDLEALQATGDLSPVRRSIQFFLDNLLSQTPDQ-----  530

Query  182  LAKAELGFKKPLTKEEKIEKKKQRLAAIGEDLLSIAADQPFRFPATFTFVVRAFSVLHGI  361
                                 +Q LA IGEDL +IA DQPFRFP+TFTFV+RAFS L GI
Sbjct  531  ---------------------QQTLATIGEDLFAIAQDQPFRFPSTFTFVIRAFSTLEGI  569

Query  362  GKGLDPRFDITEIAKPYALELLRF---REAGVEVILKDFKTRWDRQNRAFYNLFRQADRV  532
            G  LDP F   ++A PYA ELL     R +G E++ +  K    + N A  +      R+
Sbjct  570  GYILDPDFSFVKVAAPYAQELLDLKQRRTSGPELVREIRK----QANSARDSTISMPYRI  625

Query  533  EKLAEIIQRLEQGDLKLRVRALESERAFQRVAAVQKTILSAVAAGSLINLATVLYLNAIR  712
            +++ + + +LE GDLKLRVR LESERA ++   +Q   +     G+ +N+   L     +
Sbjct  626  QRIEDFVGQLESGDLKLRVRVLESERAARKANILQMATMYTAMGGTFLNVGVTLSSQGNQ  685

Query  713  MPAMAAYGLCAFFGFQVLIGIVKVKKIDQRERLI  814
            M A  ++     F   ++  + +VKK+D+ E +I
Sbjct  686  MIANGSFVGAGIFLALLIRSMQRVKKLDKFETMI  719



>ref|XP_002963731.1| hypothetical protein SELMODRAFT_79664, partial [Selaginella moellendorffii]
 gb|EFJ35602.1| hypothetical protein SELMODRAFT_79664, partial [Selaginella moellendorffii]
Length=536

 Score =   169 bits (427),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 98/244 (40%), Positives = 139/244 (57%), Gaps = 52/244 (21%)
 Frame = +2

Query  2    EGLLEVFYGVYEKDPDKVLQAMVQMGVLVPTGDMTAVRRTAQFFLNSFEERLATQRRERE  181
            E LLE+FY VYE+D  KV+Q +V +G LVPTGDM  V++T QFFL +    L +QR ++ 
Sbjct  340  EKLLELFYAVYEEDASKVIQGLVDLGALVPTGDMGPVKKTIQFFLKN----LTSQRPDQA  395

Query  182  LAKAELGFKKPLTKEEKIEKKKQRLAAIGEDLLSIAADQPFRFPATFTFVVRAFSVLHGI  361
                                      AIGEDL +IA DQPFRFP+TFTFV+RAFS L GI
Sbjct  396  TT----------------------FTAIGEDLFAIAVDQPFRFPSTFTFVLRAFSTLEGI  433

Query  362  GKGLDPRFDITEIAKPYALELLRFREAGVEVILKDFKTRWDRQNRAFYNLFRQADRVEKL  541
            G  LDP+F   +IA PYA    + R+A V + +                      RV+ +
Sbjct  434  GYILDPKFSFAKIAAPYA----QTRDATVAMPM----------------------RVQHI  467

Query  542  AEIIQRLEQGDLKLRVRALESERAFQRVAAVQKTILSAVAAGSLINLATVLYLNAIRMPA  721
             + +Q+LE GD+KLRVR LE+ERA ++ + +Q T ++ VAA +L+N+   L    ++  A
Sbjct  468  EKFMQQLEDGDIKLRVRVLEAERAARKSSVLQTTTMNLVAAATLVNVGVTLSTQGLQDFA  527

Query  722  MAAY  733
            +A++
Sbjct  528  IASF  531



>ref|XP_006469441.1| PREDICTED: uncharacterized aarF domain-containing protein kinase 
At1g79600, chloroplastic-like isoform X1 [Citrus sinensis]
 ref|XP_006469442.1| PREDICTED: uncharacterized aarF domain-containing protein kinase 
At1g79600, chloroplastic-like isoform X2 [Citrus sinensis]
 ref|XP_006469443.1| PREDICTED: uncharacterized aarF domain-containing protein kinase 
At1g79600, chloroplastic-like isoform X3 [Citrus sinensis]
Length=701

 Score =   170 bits (430),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 99/269 (37%), Positives = 152/269 (57%), Gaps = 27/269 (10%)
 Frame = +2

Query  8    LLEVFYGVYEKDPDKVLQAMVQMGVLVPTGDMTAVRRTAQFFLNSFEERLATQRRERELA  187
            LLE+F+ VYE++  KV+Q+++ +  L PTGD+++V+R  QFFL++               
Sbjct  460  LLELFFAVYERNAKKVIQSLIDLEALQPTGDLSSVKRFVQFFLDNL--------------  505

Query  188  KAELGFKKPLTKEEKIEKKKQRLAAIGEDLLSIAADQPFRFPATFTFVVRAFSVLHGIGK  367
                 F +P         K+Q LAA+GEDL +IA DQPF+FP+ F FVVRAFS L G G 
Sbjct  506  -----FSRP--------DKEQTLAAVGEDLFAIAHDQPFQFPSIFAFVVRAFSTLEGNGY  552

Query  368  GLDPRFDITEIAKPYALELLRFREAGVEVILKDFKTRWDRQNRAFYNLFRQADRVEKLAE  547
             LDP F   ++A PY  ELL  R+  +    +  +    + + A  +      RV+++ E
Sbjct  553  MLDPDFSFMKVAAPYLQELLEMRQKQMIAKTQPVENIRKQIDHARSSTVSMPYRVQRIEE  612

Query  548  IIQRLEQGDLKLRVRALESERAFQRVAAVQKTILSAVAAGSLINLATVLYLNAIRMPAMA  727
            ++ +LE GDLKLRVR LESERA ++   +Q   + AV  GSL+NL   L   A ++ A  
Sbjct  613  VVNQLEAGDLKLRVRVLESERAAKKATILQIATIRAVFGGSLLNLGVTLSGQAHKVLATG  672

Query  728  AYGLCAFFGFQVLIGIVKVKKIDQRERLI  814
            ++     F    L  + +VK++++ E++I
Sbjct  673  SFIGAGVFFILFLWSMQRVKELNKIEKMI  701



>ref|XP_006447815.1| hypothetical protein CICLE_v10014453mg [Citrus clementina]
 gb|ESR61055.1| hypothetical protein CICLE_v10014453mg [Citrus clementina]
Length=701

 Score =   170 bits (430),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 99/269 (37%), Positives = 152/269 (57%), Gaps = 27/269 (10%)
 Frame = +2

Query  8    LLEVFYGVYEKDPDKVLQAMVQMGVLVPTGDMTAVRRTAQFFLNSFEERLATQRRERELA  187
            LLE+F+ VYE++  KV+Q+++ +  L PTGD+++V+R  QFFL++               
Sbjct  460  LLELFFAVYERNAKKVIQSLIDLEALQPTGDLSSVKRFVQFFLDNL--------------  505

Query  188  KAELGFKKPLTKEEKIEKKKQRLAAIGEDLLSIAADQPFRFPATFTFVVRAFSVLHGIGK  367
                 F +P         K+Q LAA+GEDL +IA DQPF+FP+ F FVVRAFS L G G 
Sbjct  506  -----FSRP--------DKEQTLAAVGEDLFAIAHDQPFQFPSIFAFVVRAFSTLEGNGY  552

Query  368  GLDPRFDITEIAKPYALELLRFREAGVEVILKDFKTRWDRQNRAFYNLFRQADRVEKLAE  547
             LDP F   ++A PY  ELL  R+  +    +  +    + + A  +      RV+++ E
Sbjct  553  MLDPDFSFMKVAAPYLQELLEMRQKQMIAKTQPVENIRKQIDHARSSTVSMPYRVQRIEE  612

Query  548  IIQRLEQGDLKLRVRALESERAFQRVAAVQKTILSAVAAGSLINLATVLYLNAIRMPAMA  727
            ++ +LE GDLKLRVR LESERA ++   +Q   + AV  GSL+NL   L   A ++ A  
Sbjct  613  VVNQLEAGDLKLRVRVLESERAAKKATILQIATIRAVFGGSLLNLGVTLSGQAHKVLATG  672

Query  728  AYGLCAFFGFQVLIGIVKVKKIDQRERLI  814
            ++     F    L  + +VK++++ E++I
Sbjct  673  SFIGAGVFFILFLWSMQRVKELNKIEKMI  701



>ref|NP_001062679.1| Os09g0250700 [Oryza sativa Japonica Group]
 dbj|BAD22484.1| ABC1 family protein-like [Oryza sativa Japonica Group]
 dbj|BAF24593.1| Os09g0250700 [Oryza sativa Japonica Group]
 gb|EEE69270.1| hypothetical protein OsJ_28532 [Oryza sativa Japonica Group]
Length=716

 Score =   169 bits (429),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 99/273 (36%), Positives = 151/273 (55%), Gaps = 31/273 (11%)
 Frame = +2

Query  2    EGLLEVFYGVYEKDPDKVLQAMVQMGVLVPTGDMTAVRRTAQFFLNSFEERLATQRRERE  181
            E LL +FY VYEKD +KV++A++ +  L  TGD++ VRR+ QFFL++   +   Q     
Sbjct  473  ERLLSLFYAVYEKDANKVMKALIDLEALQATGDLSPVRRSIQFFLDNLLSQTPDQ-----  527

Query  182  LAKAELGFKKPLTKEEKIEKKKQRLAAIGEDLLSIAADQPFRFPATFTFVVRAFSVLHGI  361
                                 +Q LAAIGEDL +I+ DQPFRFP+TFTFV+RAFS L GI
Sbjct  528  ---------------------QQTLAAIGEDLFAISQDQPFRFPSTFTFVIRAFSTLEGI  566

Query  362  GKGLDPRFDITEIAKPYALELLRF--REAGVEVILKDFKTRWDRQNRAFYNLFRQADRVE  535
            G  LDP F   ++A PYA ELL    R      ++++ +    + N A  +      R++
Sbjct  567  GYILDPDFSFVKVAAPYAQELLDLKQRRTSAPELVREIRK---QANSARDSTISMPYRIQ  623

Query  536  KLAEIIQRLEQGDLKLRVRALESERAFQRVAAVQKTILSAVAAGSLINLATVLYLNAIRM  715
            ++ + + +LE GDLKLRVR LESERA ++   +Q   +     G+L+N+   L     ++
Sbjct  624  RIEDFVGQLESGDLKLRVRVLESERAARKANVLQMATMYTAIGGTLLNVGVTLSSQGNQI  683

Query  716  PAMAAYGLCAFFGFQVLIGIVKVKKIDQRERLI  814
             A  ++     F   ++  + +VKK+D+ E +I
Sbjct  684  VANGSFVGAGIFLALLIRSMQRVKKLDKFETMI  716



>ref|NP_001189839.1| ABC1 kinase [Arabidopsis thaliana]
 gb|AEE74590.1| ABC1 kinase [Arabidopsis thaliana]
Length=724

 Score =   169 bits (429),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 100/279 (36%), Positives = 161/279 (58%), Gaps = 18/279 (6%)
 Frame = +2

Query  8    LLEVFYGVYEKDPDKVLQAMVQMGVLVPTGDMTAVRRTAQFFLNSFEERLATQRRERELA  187
            LL++FY VYEKD  KV+Q ++ +  L PTGD+++VRR+ QFFL++    L +Q  +++  
Sbjct  454  LLDLFYSVYEKDAKKVMQNLIDLEALQPTGDLSSVRRSVQFFLDN----LLSQSPDQQQT  509

Query  188  KAELGFKKPLTKEEK-------IEKKKQRLAAIGEDLLSIAADQPFRFPATFTFVVRAFS  346
             A +G     T  EK       +    +  + + +DL +I+ DQPFRFP+TFTFV+RAFS
Sbjct  510  LAAIGEVPIKTVPEKEAELYLYVVLTLKNSSFLWQDLFAISQDQPFRFPSTFTFVIRAFS  569

Query  347  VLHGIGKGLDPRFDITEIAKPYALELLRFRE---AGVEVILKDFKTRWDRQNRAFYNLFR  517
             L GIG  LDP F   ++A PYA ELL  ++   +G +++ +  K   D ++      + 
Sbjct  570  TLEGIGYILDPEFSFVKVAAPYAQELLDLKQRQRSGTQLVQEIRKQADDARSSTLSMPY-  628

Query  518  QADRVEKLAEIIQRLEQGDLKLRVRALESERAFQRVAAVQKTILSAVAAGSLINLATVLY  697
               RV+++ E ++ L+ GDLKLRVR LESERA ++   +Q   +  V  G+L+N+     
Sbjct  629  ---RVQRIEEFVKELDSGDLKLRVRVLESERAARKATILQMATMYTVLGGTLLNIGVTFS  685

Query  698  LNAIRMPAMAAYGLCAFFGFQVLIGIVKVKKIDQRERLI  814
                ++ A  ++     F   VL  + +V K+D+ E++I
Sbjct  686  NQGSQLVANGSFIGAGIFMLLVLRSMQRVNKLDKFEKMI  724



>ref|XP_010942704.1| PREDICTED: uncharacterized aarF domain-containing protein kinase 
At1g79600, chloroplastic-like [Elaeis guineensis]
Length=378

 Score =   164 bits (415),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 100/274 (36%), Positives = 153/274 (56%), Gaps = 33/274 (12%)
 Frame = +2

Query  2    EGLLEVFYGVYEKDPDKVLQAMVQMGVLVPTGDMTAVRRTAQFFLNSFEERLATQRRERE  181
            E L E+FY VYEKD +KV++ ++ +  L PTGD+  VRR+ QF L+              
Sbjct  135  ERLRELFYAVYEKDANKVIRCLIDLEALRPTGDLAPVRRSIQFLLD--------------  180

Query  182  LAKAELGFKKPLTKEEKIEKKKQRLAAIGEDLLSIAADQPFRFPATFTFVVRAFSVLHGI  361
                +L  + P         ++Q LAAIGEDL +IA DQ F FP++ TFV++AFS L GI
Sbjct  181  ----KLLIQTP--------DQQQTLAAIGEDLFAIATDQTFCFPSSITFVMKAFSTLEGI  228

Query  362  GKGLDPRFDITEIAKPYALELLRFRE---AGVEVILKDFKTRWDRQNRAFYNLFRQADRV  532
            G  LDP +   +IA PYA ELL  R+   +G E++    K   D  N      +    RV
Sbjct  229  GYSLDPEYSFAKIAAPYAQELLNIRQQQRSGAELVEDIQKQANDAGNYTILMPY----RV  284

Query  533  EKLAEIIQRLEQGDLKLRVRALESERAFQRVAAVQKTILSAVAAGSLINLATVLYLNAIR  712
            +++ E +++LE GDLKLRVR LESERA ++ + +Q + +    +G+L+N+   L     +
Sbjct  285  QRIEEFVKQLESGDLKLRVRVLESERAARKASILQMSAMYTAMSGTLLNVGVTLSSQGNQ  344

Query  713  MPAMAAYGLCAFFGFQVLIGIVKVKKIDQRERLI  814
              A  ++     F   V+  + +VK++D+ E++I
Sbjct  345  AIANGSFIGAGIFLTLVVRSMKRVKQLDKLEKMI  378



>gb|AAF21180.1|AC013483_4 unknown protein [Arabidopsis thaliana]
Length=693

 Score =   168 bits (425),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 93/245 (38%), Positives = 140/245 (57%), Gaps = 33/245 (13%)
 Frame = +2

Query  8    LLEVFYGVYEKDPDKVLQAMVQMGVLVPTGDMTAVRRTAQFFLNSFEERLATQRRERELA  187
            LL++FY VYEKD  KV+Q ++ +  L PTGD+++VRR+ QFFL++   +   Q       
Sbjct  454  LLDLFYSVYEKDAKKVMQNLIDLEALQPTGDLSSVRRSVQFFLDNLLSQSPDQ-------  506

Query  188  KAELGFKKPLTKEEKIEKKKQRLAAIGEDLLSIAADQPFRFPATFTFVVRAFSVLHGIGK  367
                               +Q LAAIGEDL +I+ DQPFRFP+TFTFV+RAFS L GIG 
Sbjct  507  -------------------QQTLAAIGEDLFAISQDQPFRFPSTFTFVIRAFSTLEGIGY  547

Query  368  GLDPRFDITEIAKPYALELLRFRE---AGVEVILKDFKTRWDRQNRAFYNLFRQADRVEK  538
             LDP F   ++A PYA ELL  ++   +G +++ +  K   D ++      +    RV++
Sbjct  548  ILDPEFSFVKVAAPYAQELLDLKQRQRSGTQLVQEIRKQADDARSSTLSMPY----RVQR  603

Query  539  LAEIIQRLEQGDLKLRVRALESERAFQRVAAVQKTILSAVAAGSLINLATVLYLNAIRMP  718
            + E ++ L+ GDLKLRVR LESERA ++   +Q   +  V  G+L+N+         ++ 
Sbjct  604  IEEFVKELDSGDLKLRVRVLESERAARKATILQMATMYTVLGGTLLNIGVTFSNQGSQLV  663

Query  719  AMAAY  733
            A  ++
Sbjct  664  ANGSF  668



>ref|XP_004956386.1| PREDICTED: uncharacterized aarF domain-containing protein kinase 
At1g79600, chloroplastic-like isoform X2 [Setaria italica]
 ref|XP_004956387.1| PREDICTED: uncharacterized aarF domain-containing protein kinase 
At1g79600, chloroplastic-like isoform X3 [Setaria italica]
Length=734

 Score =   168 bits (425),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 94/233 (40%), Positives = 135/233 (58%), Gaps = 31/233 (13%)
 Frame = +2

Query  2    EGLLEVFYGVYEKDPDKVLQAMVQMGVLVPTGDMTAVRRTAQFFLNSFEERLATQRRERE  181
            E LL +FY VYEKD +KV++A++ +  L PTGD++ VRR+ QFFL++   +   Q     
Sbjct  470  ERLLSLFYSVYEKDANKVMKALIDLEALQPTGDLSPVRRSIQFFLDNLLSQTPDQ-----  524

Query  182  LAKAELGFKKPLTKEEKIEKKKQRLAAIGEDLLSIAADQPFRFPATFTFVVRAFSVLHGI  361
                                 +Q LAAIGEDL +IA DQPFRFP+TFTFV+RAFS L GI
Sbjct  525  ---------------------QQTLAAIGEDLFAIAQDQPFRFPSTFTFVIRAFSTLEGI  563

Query  362  GKGLDPRFDITEIAKPYALELLRF--REAGVEVILKDFKTRWDRQNRAFYNLFRQADRVE  535
            G  LDP F   ++A PYA ELL    R+ G   ++++ +    + N A  +      R++
Sbjct  564  GYILDPDFSFVKVAAPYAQELLDLKQRQQGGPELVQEIRK---QANDARDSTISMPYRIQ  620

Query  536  KLAEIIQRLEQGDLKLRVRALESERAFQRVAAVQKTILSAVAAGSLINLATVL  694
            ++ + + +LE GDLKLRVR LESERA ++   +Q   +     G+L+N+   L
Sbjct  621  RIEDFVGQLESGDLKLRVRVLESERAARKATVLQMATMYTALGGTLLNVGVTL  673



>ref|XP_004956385.1| PREDICTED: uncharacterized aarF domain-containing protein kinase 
At1g79600, chloroplastic-like isoform X1 [Setaria italica]
Length=753

 Score =   168 bits (425),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 94/233 (40%), Positives = 135/233 (58%), Gaps = 31/233 (13%)
 Frame = +2

Query  2    EGLLEVFYGVYEKDPDKVLQAMVQMGVLVPTGDMTAVRRTAQFFLNSFEERLATQRRERE  181
            E LL +FY VYEKD +KV++A++ +  L PTGD++ VRR+ QFFL++   +   Q     
Sbjct  489  ERLLSLFYSVYEKDANKVMKALIDLEALQPTGDLSPVRRSIQFFLDNLLSQTPDQ-----  543

Query  182  LAKAELGFKKPLTKEEKIEKKKQRLAAIGEDLLSIAADQPFRFPATFTFVVRAFSVLHGI  361
                                 +Q LAAIGEDL +IA DQPFRFP+TFTFV+RAFS L GI
Sbjct  544  ---------------------QQTLAAIGEDLFAIAQDQPFRFPSTFTFVIRAFSTLEGI  582

Query  362  GKGLDPRFDITEIAKPYALELLRF--REAGVEVILKDFKTRWDRQNRAFYNLFRQADRVE  535
            G  LDP F   ++A PYA ELL    R+ G   ++++ +    + N A  +      R++
Sbjct  583  GYILDPDFSFVKVAAPYAQELLDLKQRQQGGPELVQEIRK---QANDARDSTISMPYRIQ  639

Query  536  KLAEIIQRLEQGDLKLRVRALESERAFQRVAAVQKTILSAVAAGSLINLATVL  694
            ++ + + +LE GDLKLRVR LESERA ++   +Q   +     G+L+N+   L
Sbjct  640  RIEDFVGQLESGDLKLRVRVLESERAARKATVLQMATMYTALGGTLLNVGVTL  692



>ref|WP_036485586.1| hypothetical protein [Myxosarcina sp. GI1]
Length=598

 Score =   166 bits (420),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 95/233 (41%), Positives = 135/233 (58%), Gaps = 33/233 (14%)
 Frame = +2

Query  2    EGLLEVFYGVYEKDPDKVLQAMVQMGVLVPTGDMTAVRRTAQFFLNSFEERLATQRRERE  181
            E LL+  +G+ +KD D V+Q+++++G L PTGDMT VRR+ QF L++F +          
Sbjct  364  EKLLDTLFGIAQKDGDLVVQSLIEVGALAPTGDMTPVRRSVQFMLDNFMD----------  413

Query  182  LAKAELGFKKPLTKEEKIEKKKQRLAAIGEDLLSIAADQPFRFPATFTFVVRAFSVLHGI  361
                     KP         ++Q + AI EDL  IA  QPFRFPATFTFV+RAFS L G+
Sbjct  414  ---------KPF--------EQQSVDAISEDLYQIAYGQPFRFPATFTFVMRAFSTLEGV  456

Query  362  GKGLDPRFDITEIAKPYALELLRFREAGVEVILKDFKTRWDRQNRAFYNLFRQADRVEKL  541
            GKGLDP F+  E+A+PYA++L+         I  +   +  R       L R+ D     
Sbjct  457  GKGLDPEFNFMEVAQPYAMQLMTNTNGDGNTIFDELGKQAARVGSTALGLPRRID-----  511

Query  542  AEIIQRLEQGDLKLRVRALESERAFQRVAAVQKTILSAVAAGSLINLATVLYL  700
             + I +LE+GDL+LRVR++ESER  +R+ AVQ     A+  G+LI  AT+L +
Sbjct  512  -DTIDKLERGDLRLRVRSIESERVLRRLGAVQLCTNYALLFGALIVSATLLLI  563



>ref|WP_023068475.1| ABC1 family protein [Lyngbya aestuarii]
 gb|ERT05275.1| ABC1 family protein [Lyngbya aestuarii BL J]
Length=588

 Score =   165 bits (417),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 100/281 (36%), Positives = 157/281 (56%), Gaps = 54/281 (19%)
 Frame = +2

Query  2    EGLLEVFYGVYEKDPDKVLQAMVQMGVLVPTGDMTAVRRTAQFFLNSFEERLATQRRERE  181
            E L++  +G+ +KD D+V++++V +G L PTGDM AVRR+ Q+ L+ F +          
Sbjct  352  EKLMQTLFGIAQKDADRVVKSLVDLGALTPTGDMGAVRRSIQYMLDHFMD----------  401

Query  182  LAKAELGFKKPLTKEEKIEKKKQRLAAIGEDLLSIAADQPFRFPATFTFVVRAFSVLHGI  361
                     KP         ++Q +AAI +DL  IA DQPFRFPATFTFV+RAFS L G+
Sbjct  402  ---------KPF--------EEQSVAAISDDLYEIAYDQPFRFPATFTFVMRAFSTLEGV  444

Query  362  GKGLDPRFDITEIAKPYALELLRFREAGVEVILKDFKTRWDRQNRAFYNLF-RQADRVEK  538
            GKGLDP F+  E+A+P+A++L+              +T       + +N F RQA +V  
Sbjct  445  GKGLDPEFNFMEVAQPFAMQLMS-------------ETNLSETTNSLFNEFGRQAAQVSS  491

Query  539  LA--------EIIQRLEQGDLKLRVRALESERAFQRVAAVQKTILSAVAAGSLINLATVL  694
             A        + + RL+QGDL++RVRA E++R  +RV+ VQ     A+  G+    AT+L
Sbjct  492  TALGLPRRIEDTLDRLDQGDLRMRVRATETDRILRRVSNVQMGTNYALLMGAFTISATLL  551

Query  695  YLNAIRMPAMAAYGLCAFFGFQVLIGIVK-VKKIDQRERLI  814
            +++     A    G+  F  F + I   + +++ID+ +R++
Sbjct  552  FISDKVWLA----GVVVFLAFVMGIAFFRLLRRIDRFDRMM  588



>ref|WP_039897389.1| hypothetical protein [Lyngbya sp. PCC 8106]
Length=588

 Score =   164 bits (415),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 99/281 (35%), Positives = 157/281 (56%), Gaps = 54/281 (19%)
 Frame = +2

Query  2    EGLLEVFYGVYEKDPDKVLQAMVQMGVLVPTGDMTAVRRTAQFFLNSFEERLATQRRERE  181
            E L++  +G+ +KD D+V+++++ +G L PTGDM AVRR+ Q+ L+ F +          
Sbjct  352  EKLMQTLFGIAQKDADRVVKSLIDLGALTPTGDMGAVRRSIQYMLDHFMD----------  401

Query  182  LAKAELGFKKPLTKEEKIEKKKQRLAAIGEDLLSIAADQPFRFPATFTFVVRAFSVLHGI  361
                     KP         ++Q +AAI +DL  IA DQPFRFPATFTFV+RAFS L G+
Sbjct  402  ---------KPF--------EEQSVAAISDDLYEIAYDQPFRFPATFTFVMRAFSTLEGV  444

Query  362  GKGLDPRFDITEIAKPYALELLRFREAGVEVILKDFKTRWDRQNRAFYNLF-RQADRVEK  538
            GKGLDP F+  E+A+P+A++L+              +T       + +N F RQA +V  
Sbjct  445  GKGLDPDFNFMEVAQPFAMQLMS-------------ETNLSETTNSLFNEFGRQAAQVSS  491

Query  539  LA--------EIIQRLEQGDLKLRVRALESERAFQRVAAVQKTILSAVAAGSLINLATVL  694
             A        + + RL+QGDL++RVRA E++R  +RV+ VQ     A+  G+    AT+L
Sbjct  492  TALGLPRRIEDTLDRLDQGDLRMRVRATETDRILRRVSNVQMGTNYALLTGAFTISATLL  551

Query  695  YLNAIRMPAMAAYGLCAFFGFQVLIGIVK-VKKIDQRERLI  814
            +++     A    G+  F  F + I   + +++ID+ +R++
Sbjct  552  FISDKVWLA----GVVVFLAFIMGIAFFRLLRRIDRFDRMM  588



>gb|EAW33714.1| hypothetical protein L8106_10257 [Lyngbya sp. PCC 8106]
Length=592

 Score =   164 bits (415),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 99/281 (35%), Positives = 157/281 (56%), Gaps = 54/281 (19%)
 Frame = +2

Query  2    EGLLEVFYGVYEKDPDKVLQAMVQMGVLVPTGDMTAVRRTAQFFLNSFEERLATQRRERE  181
            E L++  +G+ +KD D+V+++++ +G L PTGDM AVRR+ Q+ L+ F +          
Sbjct  356  EKLMQTLFGIAQKDADRVVKSLIDLGALTPTGDMGAVRRSIQYMLDHFMD----------  405

Query  182  LAKAELGFKKPLTKEEKIEKKKQRLAAIGEDLLSIAADQPFRFPATFTFVVRAFSVLHGI  361
                     KP         ++Q +AAI +DL  IA DQPFRFPATFTFV+RAFS L G+
Sbjct  406  ---------KPF--------EEQSVAAISDDLYEIAYDQPFRFPATFTFVMRAFSTLEGV  448

Query  362  GKGLDPRFDITEIAKPYALELLRFREAGVEVILKDFKTRWDRQNRAFYNLF-RQADRVEK  538
            GKGLDP F+  E+A+P+A++L+              +T       + +N F RQA +V  
Sbjct  449  GKGLDPDFNFMEVAQPFAMQLMS-------------ETNLSETTNSLFNEFGRQAAQVSS  495

Query  539  LA--------EIIQRLEQGDLKLRVRALESERAFQRVAAVQKTILSAVAAGSLINLATVL  694
             A        + + RL+QGDL++RVRA E++R  +RV+ VQ     A+  G+    AT+L
Sbjct  496  TALGLPRRIEDTLDRLDQGDLRMRVRATETDRILRRVSNVQMGTNYALLTGAFTISATLL  555

Query  695  YLNAIRMPAMAAYGLCAFFGFQVLIGIVK-VKKIDQRERLI  814
            +++     A    G+  F  F + I   + +++ID+ +R++
Sbjct  556  FISDKVWLA----GVVVFLAFIMGIAFFRLLRRIDRFDRMM  592



>ref|WP_040467304.1| hypothetical protein [Geminocystis herdmanii]
Length=586

 Score =   163 bits (412),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 99/269 (37%), Positives = 156/269 (58%), Gaps = 35/269 (13%)
 Frame = +2

Query  2    EGLLEVFYGVYEKDPDKVLQAMVQMGVLVPTGDMTAVRRTAQFFLNSFEERLATQRRERE  181
            E L+E+ +GV EK+ D+V+ A++ +  L    D   VRR+ QF L++F +          
Sbjct  350  EKLIEMLFGVTEKNADRVVSALIDLEALAVMDDPGPVRRSVQFMLDNFMD----------  399

Query  182  LAKAELGFKKPLTKEEKIEKKKQRLAAIGEDLLSIAADQPFRFPATFTFVVRAFSVLHGI  361
                     KP         ++Q +  I EDL  IA DQPFRFPATFTFV+RAFS L G+
Sbjct  400  ---------KPF--------EEQSIGKISEDLYEIAYDQPFRFPATFTFVMRAFSTLEGV  442

Query  362  GKGLDPRFDITEIAKPYALELLR-FREAGVEVILKDFKTRWDRQNRAFYNLFRQADRVE-  535
            GKGLDP F+  E+A+P+AL+++  F   GV       K+ +D  +R  + +   A  +  
Sbjct  443  GKGLDPDFNFMEVAQPFALQVMNDFNNNGVG------KSIFDEISRQAFQVSNSALSLPR  496

Query  536  KLAEIIQRLEQGDLKLRVRALESERAFQRVAAVQKTILSAVAAGSLINLATVLYLNAIRM  715
            +L + I++LE+GDL+LRVR+LESER  +RVA++Q T   ++   +LI  +T+L +N +  
Sbjct  497  RLEDTIEKLERGDLRLRVRSLESERLLRRVASMQMTTNYSLFMSALILSSTILVVNGLWQ  556

Query  716  PAMAAYGLCAFFGFQVLIGIVKVKKIDQR  802
             A+A   +  F GF +   + ++ K+D++
Sbjct  557  LAIAVAIISIFPGFSLFRLLKQLDKVDRK  585



>ref|WP_019487347.1| hypothetical protein [Kamptonema formosum]
Length=588

 Score =   162 bits (411),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 97/278 (35%), Positives = 153/278 (55%), Gaps = 50/278 (18%)
 Frame = +2

Query  2    EGLLEVFYGVYEKDPDKVLQAMVQMGVLVPTGDMTAVRRTAQFFLNSFEERLATQRRERE  181
            EGL+E  YG+  KD  +++ ++V +G LVPTGDM  VRR+ QF L++F +          
Sbjct  352  EGLMETLYGIASKDGQRIINSLVNLGALVPTGDMGPVRRSIQFMLDNFMD----------  401

Query  182  LAKAELGFKKPLTKEEKIEKKKQRLAAIGEDLLSIAADQPFRFPATFTFVVRAFSVLHGI  361
                     KP         + Q +  I +DL  IA DQPFRFPATFTFV+RAFS + G+
Sbjct  402  ---------KPF--------EAQSVTKITDDLYEIAYDQPFRFPATFTFVMRAFSTIDGV  444

Query  362  GKGLDPRFDITEIAKPYALELLRFREAGVEVILKDFKTRWDRQNRAFYNLFRQADRVE--  535
            G+GLDP+F+  E+A+P+A+EL++   A             +  +  F  + RQA +V   
Sbjct  445  GRGLDPKFNFMEVAQPFAMELMKSGSAQ------------ETTSSIFNEIGRQAAQVSSS  492

Query  536  ------KLAEIIQRLEQGDLKLRVRALESERAFQRVAAVQKTILSAVAAGSLINLATVLY  697
                  ++ E I +LEQGD+++RVRA E++R  +R++ VQ     A+   +    AT+L+
Sbjct  493  ALGLPRRIEETIDKLEQGDIRVRVRATETDRLLRRISIVQMGTNYALLFSAFTLSATILF  552

Query  698  LNAIRMPAMAAYGLCAFFGFQVLIGIVKVKKIDQRERL  811
            +      A+A   L A  GF +     ++++ID+ +R+
Sbjct  553  VYDRVWLAVAVIILAAIVGFALW---RQLRRIDRMDRM  587



>ref|WP_026734099.1| hypothetical protein [Fischerella sp. PCC 9605]
Length=563

 Score =   162 bits (409),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 90/242 (37%), Positives = 136/242 (56%), Gaps = 47/242 (19%)
 Frame = +2

Query  2    EGLLEVFYGVYEKDPDKVLQAMVQMGVLVPTGDMTAVRRTAQFFLNSFEERLATQRRERE  181
            EGL+E  +G+  KD D+V+ +++ +G L PT DM  VRR+ Q+ L+ F +          
Sbjct  327  EGLMETLFGIASKDGDRVVNSLIDLGALAPTEDMGPVRRSVQYMLDHFMD----------  376

Query  182  LAKAELGFKKPLTKEEKIEKKKQRLAAIGEDLLSIAADQPFRFPATFTFVVRAFSVLHGI  361
                     +P         + Q +AAI +DL  IA +QPFRFPATFTFV+RAFS L G+
Sbjct  377  ---------QPF--------ENQSVAAISDDLYEIAYNQPFRFPATFTFVMRAFSTLEGV  419

Query  362  GKGLDPRFDITEIAKPYALELLRFREAGVEVILKDFKTRWDRQNRAFYNLFRQADRVE--  535
            GKGLDP F+  E+AKPYA++L+                  D  N  F  L RQA +V   
Sbjct  420  GKGLDPEFNFMEVAKPYAMQLMTNMNGS------------DAGNSFFNELGRQAAQVSST  467

Query  536  ------KLAEIIQRLEQGDLKLRVRALESERAFQRVAAVQKTILSAVAAGSLINLATVLY  697
                  +L + ++ LE+GD++LRVR++E+ER  +R +++Q  I+ A+   +    AT+L+
Sbjct  468  ALGLPRRLEDTLENLERGDVRLRVRSIETERLLRRQSSIQIGIVYALIISAFTLSATILF  527

Query  698  LN  703
            +N
Sbjct  528  VN  529



>ref|WP_040553139.1| hypothetical protein [Raphidiopsis brookii]
Length=562

 Score =   161 bits (408),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 98/276 (36%), Positives = 147/276 (53%), Gaps = 49/276 (18%)
 Frame = +2

Query  2    EGLLEVFYGVYEKDPDKVLQAMVQMGVLVPTGDMTAVRRTAQFFLNSFEERLATQRRERE  181
            EGL+E  +G+ +KD D+V+Q+++ +G + P  DM  VRR+ Q+ L++F +          
Sbjct  326  EGLMETLFGIAQKDGDRVVQSLINLGAIAPVEDMGPVRRSVQYMLDNFMD----------  375

Query  182  LAKAELGFKKPLTKEEKIEKKKQRLAAIGEDLLSIAADQPFRFPATFTFVVRAFSVLHGI  361
                     KP         + Q +A I EDL  IA +QPFRFPATFTFV+RAFS L G+
Sbjct  376  ---------KPF--------ENQSVATISEDLYEIAYNQPFRFPATFTFVMRAFSTLEGV  418

Query  362  GKGLDPRFDITEIAKPYALELLRFREAGVEVILKDFKTRWDRQNRAFYN-LFRQADRVE-  535
            GKGLDP F+   +A+PYA+EL+                    Q   F N L RQA +V  
Sbjct  419  GKGLDPEFNFMAVAQPYAMELMNNNNGA-------------SQANTFLNELSRQAVQVSS  465

Query  536  -------KLAEIIQRLEQGDLKLRVRALESERAFQRVAAVQKTILSAVAAGSLINLATVL  694
                   +L + +++LE+GD++LRVRALE+ER  +R + +Q  I  A+   +    AT+L
Sbjct  466  SALSLPRRLEDTLEKLERGDIRLRVRALETERLLRRQSNIQMGISYALIISAFTISATIL  525

Query  695  YLNAIRMPAMAAYGLCAFFGFQVLIGIVKVKKIDQR  802
             +N     A  A  + A   F  L  + ++ + DQ+
Sbjct  526  LVNRFYWLATIAGLIVAGISFIFLRLVSRLDRYDQK  561



>gb|EFA74230.1| ABC-1 [Raphidiopsis brookii D9]
Length=597

 Score =   161 bits (408),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 98/276 (36%), Positives = 147/276 (53%), Gaps = 49/276 (18%)
 Frame = +2

Query  2    EGLLEVFYGVYEKDPDKVLQAMVQMGVLVPTGDMTAVRRTAQFFLNSFEERLATQRRERE  181
            EGL+E  +G+ +KD D+V+Q+++ +G + P  DM  VRR+ Q+ L++F +          
Sbjct  361  EGLMETLFGIAQKDGDRVVQSLINLGAIAPVEDMGPVRRSVQYMLDNFMD----------  410

Query  182  LAKAELGFKKPLTKEEKIEKKKQRLAAIGEDLLSIAADQPFRFPATFTFVVRAFSVLHGI  361
                     KP         + Q +A I EDL  IA +QPFRFPATFTFV+RAFS L G+
Sbjct  411  ---------KPF--------ENQSVATISEDLYEIAYNQPFRFPATFTFVMRAFSTLEGV  453

Query  362  GKGLDPRFDITEIAKPYALELLRFREAGVEVILKDFKTRWDRQNRAFYN-LFRQADRVE-  535
            GKGLDP F+   +A+PYA+EL+                    Q   F N L RQA +V  
Sbjct  454  GKGLDPEFNFMAVAQPYAMELMNNNNGA-------------SQANTFLNELSRQAVQVSS  500

Query  536  -------KLAEIIQRLEQGDLKLRVRALESERAFQRVAAVQKTILSAVAAGSLINLATVL  694
                   +L + +++LE+GD++LRVRALE+ER  +R + +Q  I  A+   +    AT+L
Sbjct  501  SALSLPRRLEDTLEKLERGDIRLRVRALETERLLRRQSNIQMGISYALIISAFTISATIL  560

Query  695  YLNAIRMPAMAAYGLCAFFGFQVLIGIVKVKKIDQR  802
             +N     A  A  + A   F  L  + ++ + DQ+
Sbjct  561  LVNRFYWLATIAGLIVAGISFIFLRLVSRLDRYDQK  596



>ref|WP_015191474.1| ABC-1 domain-containing protein [Stanieria cyanosphaera]
 gb|AFZ33801.1| ABC-1 domain-containing protein [Stanieria cyanosphaera PCC 7437]
Length=585

 Score =   160 bits (406),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 89/244 (36%), Positives = 140/244 (57%), Gaps = 50/244 (20%)
 Frame = +2

Query  2    EGLLEVFYGVYEKDPDKVLQAMVQMGVLVPTGDMTAVRRTAQFFLNSFEERLATQRRERE  181
            E L++  +G+ +K+ D V+ +++++G L PTGD++ VRR+ Q+ L++F            
Sbjct  350  EKLMDTLFGIAQKNADLVVNSLIEVGALTPTGDLSPVRRSVQYMLDNF------------  397

Query  182  LAKAELGFKKPLTKEEKIEKKKQRLAAIGEDLLSIAADQPFRFPATFTFVVRAFSVLHGI  361
                     KP         ++Q + AI EDL  IA  QPFRFPATFTFV+RAFS L G+
Sbjct  398  -------MDKPF--------EEQSIEAISEDLYDIAYGQPFRFPATFTFVMRAFSTLEGV  442

Query  362  GKGLDPRFDITEIAKPYALELLRFREAGVEVILKDFKTRWDRQNRAFYN-LFRQADRV--  532
            GKGLDP F+  E+A+P+A++L+                   R N   ++ + RQA +V  
Sbjct  443  GKGLDPEFNFMEVAQPFAMQLMTNSNG--------------RNNSTIFDEIGRQAAQVGS  488

Query  533  ------EKLAEIIQRLEQGDLKLRVRALESERAFQRVAAVQKTILSAVAAGSLINLATVL  694
                   ++ + I +LE+GDL++RVR++ESERA +R++AVQ      +  G+LI  AT+L
Sbjct  489  TALGLPRRIEDTIDKLERGDLRVRVRSIESERALRRLSAVQMGTNHTILIGALILSATLL  548

Query  695  YLNA  706
            ++N 
Sbjct  549  FVNG  552



>ref|WP_006277336.1| hypothetical protein [Cylindrospermopsis raciborskii]
 gb|EFA69763.1| ABC-1 [Cylindrospermopsis raciborskii CS-505]
Length=562

 Score =   160 bits (405),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 97/276 (35%), Positives = 147/276 (53%), Gaps = 49/276 (18%)
 Frame = +2

Query  2    EGLLEVFYGVYEKDPDKVLQAMVQMGVLVPTGDMTAVRRTAQFFLNSFEERLATQRRERE  181
            EGL+E  +G+ +KD D+V+Q+++ +G + P  D+  VRR+ Q+ L++F +          
Sbjct  326  EGLMETLFGIAQKDGDRVVQSLINLGAIAPVEDIGPVRRSVQYMLDNFMD----------  375

Query  182  LAKAELGFKKPLTKEEKIEKKKQRLAAIGEDLLSIAADQPFRFPATFTFVVRAFSVLHGI  361
                     KP         + Q +A I EDL  IA +QPFRFPATFTFV+RAFS L G+
Sbjct  376  ---------KPF--------ENQSVATISEDLYEIAYNQPFRFPATFTFVMRAFSTLEGV  418

Query  362  GKGLDPRFDITEIAKPYALELLRFREAGVEVILKDFKTRWDRQNRAFYN-LFRQADRVE-  535
            GKGLDP F+  E+A+PYA+EL+                    Q   F N L RQA +V  
Sbjct  419  GKGLDPEFNFMEVAQPYAMELMNNNNGA-------------SQANTFLNELSRQAVQVSS  465

Query  536  -------KLAEIIQRLEQGDLKLRVRALESERAFQRVAAVQKTILSAVAAGSLINLATVL  694
                   +L + +++LE+GD++LRVRALE+ER  +R + +Q  I  A+   +    AT+L
Sbjct  466  TALGLPRRLEDTLEKLERGDIRLRVRALETERLLRRQSNIQMGISYALIISAFTISATIL  525

Query  695  YLNAIRMPAMAAYGLCAFFGFQVLIGIVKVKKIDQR  802
             +N     A  A  +     F  L  + ++ + DQ+
Sbjct  526  LVNRFYWLAAIAGLIVTGISFIFLRLVSRLDRYDQK  561



>ref|WP_009455634.1| MULTISPECIES: hypothetical protein [Fischerella]
 gb|EHC18189.1| ABC-1 domain-containing protein [Fischerella sp. JSC-11]
Length=561

 Score =   160 bits (405),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 90/243 (37%), Positives = 138/243 (57%), Gaps = 50/243 (21%)
 Frame = +2

Query  2    EGLLEVFYGVYEKDPDKVLQAMVQMGVLVPTGDMTAVRRTAQFFLNSFEERLATQRRERE  181
            EGL+E  +G+  KD D+V+Q+++ +G L P  DM  VRR+ Q+ L++F +          
Sbjct  326  EGLMETLFGIASKDGDRVVQSLINLGALAPVEDMGPVRRSVQYMLDNFMD----------  375

Query  182  LAKAELGFKKPLTKEEKIEKKKQRLAAIGEDLLSIAADQPFRFPATFTFVVRAFSVLHGI  361
                     KP         + Q +AAI +DL  IA DQPFRFPATFTFV+RAFS L G+
Sbjct  376  ---------KPF--------ENQSVAAISDDLYEIAYDQPFRFPATFTFVMRAFSTLEGV  418

Query  362  GKGLDPRFDITEIAKPYALELLRFREAGVEVILKDFKTRWDRQNRAFYN-LFRQADRVE-  535
            GKGLDP F+  E+A+PYA++L+                    +  +F+N L RQA +V  
Sbjct  419  GKGLDPEFNFMEVAQPYAMQLMTNMNGS--------------EGNSFFNELSRQAAQVSS  464

Query  536  -------KLAEIIQRLEQGDLKLRVRALESERAFQRVAAVQKTILSAVAAGSLINLATVL  694
                   +L + +++LE+GD++LRVR++E+ER  +R + +Q  I  A+   +    AT+L
Sbjct  465  TAFGLPRRLEDTLEKLERGDVRLRVRSIETERLLRRQSNIQLGIAYALIISAFTLSATIL  524

Query  695  YLN  703
            ++N
Sbjct  525  FVN  527



>gb|EPS58071.1| hypothetical protein M569_16745, partial [Genlisea aurea]
Length=418

 Score =   158 bits (399),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 77/90 (86%), Positives = 85/90 (94%), Gaps = 0/90 (0%)
 Frame = +2

Query  2    EGLLEVFYGVYEKDPDKVLQAMVQMGVLVPTGDMTAVRRTAQFFLNSFEERLATQRRERE  181
            EGL+EVFYGVYEKD +KVLQAM QMGVLVPTGDMTAVRRTAQFFLNSFEERLA QR+ERE
Sbjct  329  EGLIEVFYGVYEKDAEKVLQAMFQMGVLVPTGDMTAVRRTAQFFLNSFEERLAAQRKERE  388

Query  182  LAKAELGFKKPLTKEEKIEKKKQRLAAIGE  271
            +A AELG+KKP +KEE+IEKKKQRLAAIG+
Sbjct  389  MANAELGWKKPPSKEERIEKKKQRLAAIGK  418



>ref|XP_001696153.1| hypothetical protein CHLREDRAFT_104846 [Chlamydomonas reinhardtii]
 gb|EDP01102.1| predicted protein, partial [Chlamydomonas reinhardtii]
Length=527

 Score =   159 bits (403),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 105/274 (38%), Positives = 147/274 (54%), Gaps = 28/274 (10%)
 Frame = +2

Query  2    EGLLEVFYGVYEKDPDKVLQAMVQMGVLVPTGDMTAVRRTAQFFLNSFEERLATQRRERE  181
            E LL+VFYG+Y K+PD+VL+A+V + V+ PTGD  +VRR   FF+    E LA Q     
Sbjct  281  ERLLDVFYGIYRKEPDQVLKALVDLKVIKPTGDTLSVRRAINFFI----ENLARQ-----  331

Query  182  LAKAELGFKKPLTKEEKIEKKKQRLAAIGEDLLSIAADQPFRFPATFTFVVRAFSVLHGI  361
                               ++++ +A IGEDL +IA DQPFRFPATFTFV+RAFS L GI
Sbjct  332  ------------------TERQETIANIGEDLFAIAVDQPFRFPATFTFVLRAFSTLEGI  373

Query  362  GKGLDPRFDITEIAKPYALELLRFREAGVEVILKDFKTRWDRQNRAFYNLFRQADRVEKL  541
            GK L+P +  +E +   +  LL   +  V              +           RV+++
Sbjct  374  GKTLNPDYRFSEDSGSNSRLLLEQVQQQVRGSSSGASHVRAAASELGAAAAAMPLRVQRI  433

Query  542  AEIIQRLEQGDLKLRVRALESERAFQRVAAVQKTILSAVAAGSLINLATVLYLNAIRMPA  721
               + +LE GDLKLRVR LE ERA +R   +Q   L  VA+  L+N+ T L L+  R  A
Sbjct  434  ESTLSQLEAGDLKLRVRVLEGERANRRQGIMQAATLHTVASVGLLNVGTQLALSGGRDGA  493

Query  722  MA-AYGLCAFFGFQVLIGIVKVKKIDQRERLITG  820
                  L A FG   L G+ +V+++D+ E+ I G
Sbjct  494  AGVVLALSAVFGGLALAGLKRVQRLDKFEKEIRG  527



>ref|WP_017309950.1| MULTISPECIES: hypothetical protein [Stigonematales]
 gb|KIY11337.1| hypothetical protein SP67_24425 [Mastigocladus laminosus UU774]
Length=561

 Score =   160 bits (404),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 92/243 (38%), Positives = 135/243 (56%), Gaps = 50/243 (21%)
 Frame = +2

Query  2    EGLLEVFYGVYEKDPDKVLQAMVQMGVLVPTGDMTAVRRTAQFFLNSFEERLATQRRERE  181
            EGL+E  +G+  KD D+V+Q++V +G L P  DM  VRR+ Q+ L+ F +          
Sbjct  326  EGLMETLFGIASKDGDRVVQSLVNLGALAPVEDMGPVRRSVQYMLDHFMD----------  375

Query  182  LAKAELGFKKPLTKEEKIEKKKQRLAAIGEDLLSIAADQPFRFPATFTFVVRAFSVLHGI  361
                     KP         + Q +AAI +DL  IA DQPFRFPATFTFV+RAFS L G+
Sbjct  376  ---------KPF--------ENQSVAAISDDLYEIAYDQPFRFPATFTFVMRAFSTLEGV  418

Query  362  GKGLDPRFDITEIAKPYALELLRFREAGVEVILKDFKTRWDRQNRAFYN-LFRQADRVE-  535
            GKGLDP F+  E+A+PYA++L+                       +F N L RQA +V  
Sbjct  419  GKGLDPEFNFMEVAQPYAMQLMTNMNGS--------------DGNSFLNELSRQAAQVSS  464

Query  536  -------KLAEIIQRLEQGDLKLRVRALESERAFQRVAAVQKTILSAVAAGSLINLATVL  694
                   +L + +++LE+GD++LRVR+LE+ER  +R + +Q  I  A+   +    AT+L
Sbjct  465  TALGLPRRLEDTLEKLERGDVRLRVRSLETERLLRRQSNIQLAIAYALMISAFTISATIL  524

Query  695  YLN  703
            ++N
Sbjct  525  FVN  527



>ref|WP_026720499.1| hypothetical protein [Fischerella sp. PCC 9431]
Length=561

 Score =   159 bits (403),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 91/243 (37%), Positives = 136/243 (56%), Gaps = 50/243 (21%)
 Frame = +2

Query  2    EGLLEVFYGVYEKDPDKVLQAMVQMGVLVPTGDMTAVRRTAQFFLNSFEERLATQRRERE  181
            EGL+E  +G+  KD D+V+Q+++ +G L P  DM  VRR+ Q+ L++F +          
Sbjct  326  EGLMETLFGIASKDGDRVVQSLINLGALAPVEDMGPVRRSVQYMLDNFMD----------  375

Query  182  LAKAELGFKKPLTKEEKIEKKKQRLAAIGEDLLSIAADQPFRFPATFTFVVRAFSVLHGI  361
                     KP         + Q +AAI +DL  IA DQPFRFPATFTFV+RAFS L G+
Sbjct  376  ---------KPF--------ENQSVAAISDDLYEIAYDQPFRFPATFTFVMRAFSTLEGV  418

Query  362  GKGLDPRFDITEIAKPYALELLRFREAGVEVILKDFKTRWDRQNRAFYN-LFRQADRVE-  535
            GKGLDP F+  E+A+PYA++L+                       +F N L RQA +V  
Sbjct  419  GKGLDPEFNFMEVAQPYAMQLMTNMNGS--------------DGNSFLNELSRQAAQVSS  464

Query  536  -------KLAEIIQRLEQGDLKLRVRALESERAFQRVAAVQKTILSAVAAGSLINLATVL  694
                   +L + +++LE+GD++LRVR+LE+ER  +R + +Q  I  A+   +    AT+L
Sbjct  465  TALGLPRRLEDTLEKLERGDVRLRVRSLETERLLRRQSNIQLGIAYALIISAFTLSATIL  524

Query  695  YLN  703
            ++N
Sbjct  525  FVN  527



>dbj|BAQ65650.1| ubiquinone biosynthesis monooxygenase UbiB [Geminocystis sp. 
NIES-3709]
Length=586

 Score =   159 bits (403),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 98/269 (36%), Positives = 154/269 (57%), Gaps = 35/269 (13%)
 Frame = +2

Query  2    EGLLEVFYGVYEKDPDKVLQAMVQMGVLVPTGDMTAVRRTAQFFLNSFEERLATQRRERE  181
            E L+E+ +G+ EK+ D+V+ A++ +  L    D   VRR+ QF L++F +          
Sbjct  350  EKLIEMLFGITEKNADRVVSALIDLEALAVMDDPGPVRRSVQFMLDNFMD----------  399

Query  182  LAKAELGFKKPLTKEEKIEKKKQRLAAIGEDLLSIAADQPFRFPATFTFVVRAFSVLHGI  361
                     KP         ++Q ++ I EDL  IA DQPFRFPATFTFV+RAFS L G+
Sbjct  400  ---------KPF--------EEQSISQISEDLYEIAYDQPFRFPATFTFVMRAFSTLEGV  442

Query  362  GKGLDPRFDITEIAKPYALELLR-FREAGVEVILKDFKTRWDRQNRAFYNLFRQADRVE-  535
            GKGLDP F+  E+A+P+AL+++  F   GV       K+ +D  +R  + +   A  +  
Sbjct  443  GKGLDPEFNFMEVAQPFALQVMNDFNNNGVG------KSIFDEISRQAFQVSNTALSLPR  496

Query  536  KLAEIIQRLEQGDLKLRVRALESERAFQRVAAVQKTILSAVAAGSLINLATVLYLNAIRM  715
            +L + I +LE+GDL+LRVR+LESER  +RVA++Q T   ++   +LI  +T+L +N +  
Sbjct  497  RLEDTIDKLERGDLRLRVRSLESERLLRRVASMQMTTNYSLFMSALILSSTILVVNGLWQ  556

Query  716  PAMAAYGLCAFFGFQVLIGIVKVKKIDQR  802
             A+A   L  F  F +   + ++ K D++
Sbjct  557  LAIAVAILSIFPAFSLFRLLRQLDKFDRK  585



>ref|WP_016866629.1| hypothetical protein [Fischerella muscicola]
Length=561

 Score =   159 bits (402),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 90/243 (37%), Positives = 137/243 (56%), Gaps = 50/243 (21%)
 Frame = +2

Query  2    EGLLEVFYGVYEKDPDKVLQAMVQMGVLVPTGDMTAVRRTAQFFLNSFEERLATQRRERE  181
            EGL+E  +G+  KD D+V+Q+++ +G L P  DM  VRR+ Q+ L++F +          
Sbjct  326  EGLMETLFGIASKDGDRVVQSLINLGALAPVEDMGPVRRSVQYMLDNFMD----------  375

Query  182  LAKAELGFKKPLTKEEKIEKKKQRLAAIGEDLLSIAADQPFRFPATFTFVVRAFSVLHGI  361
                     KP         + Q +AAI +DL  IA DQPFRFPATFTFV+RAFS L G+
Sbjct  376  ---------KPF--------ENQSVAAISDDLYEIAYDQPFRFPATFTFVMRAFSTLEGV  418

Query  362  GKGLDPRFDITEIAKPYALELLRFREAGVEVILKDFKTRWDRQNRAFYN-LFRQADRVE-  535
            GKGLDP F+  E+A+PYA++L+                    +  +F N L RQA +V  
Sbjct  419  GKGLDPEFNFMEVAQPYAMQLMTNMNGS--------------EGNSFLNELSRQAAQVSS  464

Query  536  -------KLAEIIQRLEQGDLKLRVRALESERAFQRVAAVQKTILSAVAAGSLINLATVL  694
                   +L + +++LE+GD++LRVR++E+ER  +R + +Q  I  A+   +    AT+L
Sbjct  465  TAFGLPRRLEDTLEKLERGDVRLRVRSIETERLLRRQSNIQLGIAYALIISAFTLSATIL  524

Query  695  YLN  703
            ++N
Sbjct  525  FVN  527



>ref|WP_008276047.1| hypothetical protein [Cyanothece sp. CCY0110]
 gb|EAZ90887.1| ABC1-like protein [Cyanothece sp. CCY0110]
Length=584

 Score =   159 bits (402),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 95/255 (37%), Positives = 144/255 (56%), Gaps = 36/255 (14%)
 Frame = +2

Query  2    EGLLEVFYGVYEKDPDKVLQAMVQMGVLVPTGDMTAVRRTAQFFLNSFEERLATQRRERE  181
            E L++  +G+ +KD D+V+ A++ +G L PT DM  VRR+ QF L++F +          
Sbjct  349  EKLMDTLFGIAQKDGDRVVSALISLGALSPTDDMGPVRRSVQFMLDNFMD----------  398

Query  182  LAKAELGFKKPLTKEEKIEKKKQRLAAIGEDLLSIAADQPFRFPATFTFVVRAFSVLHGI  361
                     KP         ++Q +AAI +DL  IA DQPFRFPATFTFV+RAFS L G+
Sbjct  399  ---------KPF--------EEQSIAAISDDLYEIAYDQPFRFPATFTFVMRAFSTLEGV  441

Query  362  GKGLDPRFDITEIAKPYALELLRFREAGVEVILKDFKTRWDRQ-NRAFYNLFRQADRVEK  538
            GKGLDP F+  E+A+P+AL+L+          + D  TR   Q +     L R+ D    
Sbjct  442  GKGLDPNFNFMEVAQPFALDLVADMNGSTGNSIIDEITRQATQVSNTALGLPRRID----  497

Query  539  LAEIIQRLEQGDLKLRVRALESERAFQRVAAVQKTILSAVAAGSLINLATVLYLNAIRMP  718
              + I++L++GD+KLRVR++ES+R  +R+  +Q     +V   +L+   T+L++N     
Sbjct  498  --DTIEKLDRGDIKLRVRSVESDRLLRRLGMMQMATNYSVFLSALVICGTLLFINGYIKI  555

Query  719  AMAA--YGLCAFFGF  757
            A+ A   GL   +GF
Sbjct  556  AVVAILLGLVPAWGF  570



>ref|XP_009396137.1| PREDICTED: uncharacterized aarF domain-containing protein kinase 
At1g79600, chloroplastic-like [Musa acuminata subsp. malaccensis]
Length=706

 Score =   160 bits (404),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 95/274 (35%), Positives = 149/274 (54%), Gaps = 33/274 (12%)
 Frame = +2

Query  2    EGLLEVFYGVYEKDPDKVLQAMVQMGVLVPTGDMTAVRRTAQFFLNSFEERLATQRRERE  181
            E LL++FY VYEKD +KV++ ++++  L PTGD+++VRR+  F L+    +         
Sbjct  463  ERLLQLFYAVYEKDVNKVVRCLIELEALQPTGDLSSVRRSINFVLDGILSQTTDH-----  517

Query  182  LAKAELGFKKPLTKEEKIEKKKQRLAAIGEDLLSIAADQPFRFPATFTFVVRAFSVLHGI  361
                                 +Q +A IGEDL +IA DQPFRFP+TFTFV+RAF  L GI
Sbjct  518  ---------------------QQTVAVIGEDLFAIATDQPFRFPSTFTFVLRAFMTLEGI  556

Query  362  GKGLDPRFDITEIAKPYALELLRFRE---AGVEVILKDFKTRWDRQNRAFYNLFRQADRV  532
            G  LDP+F   +IA PYA ELL  R+    G E++ +  K   D ++      +    R+
Sbjct  557  GYMLDPKFSFPKIAAPYAQELLDIRQKQPGGTELVEEIRKQANDARDLTISMPY----RI  612

Query  533  EKLAEIIQRLEQGDLKLRVRALESERAFQRVAAVQKTILSAVAAGSLINLATVLYLNAIR  712
            +++   + +LE GDLKLRVR LESER+ +R + +Q   +    +G+L+N+   L     +
Sbjct  613  QRIENFVGQLESGDLKLRVRVLESERSARRASVLQMATMCLALSGTLLNVGVTLGSQGQQ  672

Query  713  MPAMAAYGLCAFFGFQVLIGIVKVKKIDQRERLI  814
              A  ++     F       + KVK +++ E+++
Sbjct  673  AIANGSFIGAGIFLALAFRSMGKVKNLEKIEKMM  706



>ref|WP_039717273.1| hypothetical protein [Scytonema millei]
 gb|KIF17161.1| hypothetical protein QH73_27270 [Scytonema millei VB511283]
Length=562

 Score =   159 bits (401),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 95/275 (35%), Positives = 152/275 (55%), Gaps = 49/275 (18%)
 Frame = +2

Query  2    EGLLEVFYGVYEKDPDKVLQAMVQMGVLVPTGDMTAVRRTAQFFLNSFEERLATQRRERE  181
            E L++  +G+ +KD D+V+ ++V++G L PT DM  VRR+ QF L++F +          
Sbjct  326  EQLMKTLFGIAQKDGDRVVASLVELGALAPTDDMGPVRRSVQFMLDNFMD----------  375

Query  182  LAKAELGFKKPLTKEEKIEKKKQRLAAIGEDLLSIAADQPFRFPATFTFVVRAFSVLHGI  361
                     KP         + Q ++AI +DL  IA  QPFRFPATFTFV+RAFS L G+
Sbjct  376  ---------KPF--------ENQSVSAISDDLYEIAYGQPFRFPATFTFVMRAFSTLEGV  418

Query  362  GKGLDPRFDITEIAKPYALELLRFREAGVEVILKDFKTRWDRQNRAFYN-LFRQADRV--  532
            GKGLDP F+  E+AKP+A +L+      V+               +F N L RQA +V  
Sbjct  419  GKGLDPEFNFMEVAKPFAFQLMTDGNGSVD-------------GNSFLNELSRQAAQVGS  465

Query  533  ------EKLAEIIQRLEQGDLKLRVRALESERAFQRVAAVQKTILSAVAAGSLINLATVL  694
                   +L + +++LE+GDL++RVR++E+ER  +R ++VQ  I  A+   S    AT+L
Sbjct  466  TAFGLPRRLEDTLEKLERGDLRVRVRSIETERLLRRQSSVQVAITYALIVSSFTISATIL  525

Query  695  YLNAIRMPAMAAYGLCAFFGFQVLIGIVKVKKIDQ  799
             ++     A+    + A  GF ++  ++++ + D+
Sbjct  526  LISQFAWLALIPGAIAAGTGFSLIRLLMRLDRYDK  560



>ref|WP_016864239.1| hypothetical protein [Fischerella muscicola]
Length=561

 Score =   158 bits (400),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 90/243 (37%), Positives = 136/243 (56%), Gaps = 50/243 (21%)
 Frame = +2

Query  2    EGLLEVFYGVYEKDPDKVLQAMVQMGVLVPTGDMTAVRRTAQFFLNSFEERLATQRRERE  181
            EGL+E  +G+  KD D+V+Q+++ +G L P  DM  VRR+ Q+ L++F +          
Sbjct  326  EGLMETLFGIASKDGDRVVQSLINLGALAPVEDMGPVRRSVQYMLDNFMD----------  375

Query  182  LAKAELGFKKPLTKEEKIEKKKQRLAAIGEDLLSIAADQPFRFPATFTFVVRAFSVLHGI  361
                     KP         + Q +AAI +DL  IA DQPFRFPATFTFV+RAFS L G+
Sbjct  376  ---------KPF--------ENQSVAAISDDLYEIAYDQPFRFPATFTFVMRAFSTLEGV  418

Query  362  GKGLDPRFDITEIAKPYALELLRFREAGVEVILKDFKTRWDRQNRAFYN-LFRQADRVE-  535
            GKGLDP F+  E+A+PYA++L+                       +F N L RQA +V  
Sbjct  419  GKGLDPEFNFMEVAQPYAMQLMTNMNGS--------------DGNSFLNELSRQAAQVSS  464

Query  536  -------KLAEIIQRLEQGDLKLRVRALESERAFQRVAAVQKTILSAVAAGSLINLATVL  694
                   +L + +++LE+GD++LRVR++E+ER  +R + +Q  I  A+   +    AT+L
Sbjct  465  TALGLPRRLEDTLEKLERGDVRLRVRSVETERLLRRQSNIQLGIAYALIISAFTVSATIL  524

Query  695  YLN  703
            ++N
Sbjct  525  FVN  527



>ref|WP_015222033.1| ABC-1 domain-containing protein [Cyanobacterium stanieri]
 gb|AFZ46715.1| ABC-1 domain-containing protein [Cyanobacterium stanieri PCC 
7202]
Length=585

 Score =   158 bits (400),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 94/269 (35%), Positives = 156/269 (58%), Gaps = 36/269 (13%)
 Frame = +2

Query  2    EGLLEVFYGVYEKDPDKVLQAMVQMGVLVPTGDMTAVRRTAQFFLNSFEERLATQRRERE  181
            E LLE+ +G+ EK+ D+V+ A+V +G L P  D   VRR+ QF L++F +          
Sbjct  350  EKLLEMLFGITEKNADRVVTALVDLGALAPMEDPGPVRRSVQFMLDNFMD----------  399

Query  182  LAKAELGFKKPLTKEEKIEKKKQRLAAIGEDLLSIAADQPFRFPATFTFVVRAFSVLHGI  361
                     KP         ++Q ++ I EDL  IA DQPFRFPATFTFV+RAFS L G+
Sbjct  400  ---------KPF--------EEQSISQISEDLFEIAYDQPFRFPATFTFVMRAFSTLEGV  442

Query  362  GKGLDPRFDITEIAKPYALELL-RFREAGVEVILKDFKTRWDRQNRAFYNLFRQADRVEK  538
            GKGLDP F+  E+A+P+AL ++ +F     + I+ +F  +  + +   + L        +
Sbjct  443  GKGLDPEFNFMEVAQPFALNVMNQFNAENGKSIIDEFSRQALQVSNTAFGL------PAR  496

Query  539  LAEIIQRLEQGDLKLRVRALESERAFQRVAAVQKTILSAVAAGSLINLATVLYLNAIRMP  718
            L + I +L++GD++LRVR+LE+ER  +R+++ Q      +   +L+  AT+L +N++   
Sbjct  497  LDDTIDKLDRGDIRLRVRSLEAERLLRRISSTQMATNYTLIVSTLVLSATILVVNSLWQV  556

Query  719  AMAAYGLCAFFGFQVLIGIVK-VKKIDQR  802
            A+ A G+ A      L+ +++ +KK+D++
Sbjct  557  AI-ALGVVAVLPTVALLKLLRQIKKLDRK  584



>ref|WP_041462299.1| hypothetical protein [Chroococcidiopsis thermalis]
Length=562

 Score =   157 bits (398),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 95/275 (35%), Positives = 151/275 (55%), Gaps = 49/275 (18%)
 Frame = +2

Query  2    EGLLEVFYGVYEKDPDKVLQAMVQMGVLVPTGDMTAVRRTAQFFLNSFEERLATQRRERE  181
            E L+E  +G+ +KD  +V+ ++V++G L PT DM  VRR+ QF L++F +          
Sbjct  326  EQLMETLFGIAQKDGGRVVASLVELGALAPTDDMGPVRRSVQFMLDNFMD----------  375

Query  182  LAKAELGFKKPLTKEEKIEKKKQRLAAIGEDLLSIAADQPFRFPATFTFVVRAFSVLHGI  361
                     KP         + Q ++AI +DL  IA  QPFRFPATFTFV+RAFS L G+
Sbjct  376  ---------KPF--------ENQSVSAISDDLYEIAYGQPFRFPATFTFVMRAFSTLEGV  418

Query  362  GKGLDPRFDITEIAKPYALELLRFREAGVEVILKDFKTRWDRQNRAFYN-LFRQADRV--  532
            GKGLDP F+  E+AKP+A +L+      V+               +F N L RQA +V  
Sbjct  419  GKGLDPEFNFMEVAKPFAFQLMTDGNGSVD-------------GNSFLNELSRQAAQVGS  465

Query  533  ------EKLAEIIQRLEQGDLKLRVRALESERAFQRVAAVQKTILSAVAAGSLINLATVL  694
                   +L + +++LE+GDL++RVR++E+ER  +R ++VQ  I  A+   S    AT+L
Sbjct  466  TAFGLPRRLEDTLEKLERGDLRVRVRSIETERLLRRQSSVQVAITYALIVSSFTISATIL  525

Query  695  YLNAIRMPAMAAYGLCAFFGFQVLIGIVKVKKIDQ  799
             ++     A+    + A  GF ++  ++++ + D+
Sbjct  526  LISQFAWLALIPGAIAAGTGFSLIRLLMRLDRYDK  560



>gb|AFY85560.1| ABC-1 domain-containing protein [Chroococcidiopsis thermalis 
PCC 7203]
Length=579

 Score =   157 bits (398),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 95/275 (35%), Positives = 151/275 (55%), Gaps = 49/275 (18%)
 Frame = +2

Query  2    EGLLEVFYGVYEKDPDKVLQAMVQMGVLVPTGDMTAVRRTAQFFLNSFEERLATQRRERE  181
            E L+E  +G+ +KD  +V+ ++V++G L PT DM  VRR+ QF L++F +          
Sbjct  343  EQLMETLFGIAQKDGGRVVASLVELGALAPTDDMGPVRRSVQFMLDNFMD----------  392

Query  182  LAKAELGFKKPLTKEEKIEKKKQRLAAIGEDLLSIAADQPFRFPATFTFVVRAFSVLHGI  361
                     KP         + Q ++AI +DL  IA  QPFRFPATFTFV+RAFS L G+
Sbjct  393  ---------KPF--------ENQSVSAISDDLYEIAYGQPFRFPATFTFVMRAFSTLEGV  435

Query  362  GKGLDPRFDITEIAKPYALELLRFREAGVEVILKDFKTRWDRQNRAFYN-LFRQADRV--  532
            GKGLDP F+  E+AKP+A +L+      V+               +F N L RQA +V  
Sbjct  436  GKGLDPEFNFMEVAKPFAFQLMTDGNGSVD-------------GNSFLNELSRQAAQVGS  482

Query  533  ------EKLAEIIQRLEQGDLKLRVRALESERAFQRVAAVQKTILSAVAAGSLINLATVL  694
                   +L + +++LE+GDL++RVR++E+ER  +R ++VQ  I  A+   S    AT+L
Sbjct  483  TAFGLPRRLEDTLEKLERGDLRVRVRSIETERLLRRQSSVQVAITYALIVSSFTISATIL  542

Query  695  YLNAIRMPAMAAYGLCAFFGFQVLIGIVKVKKIDQ  799
             ++     A+    + A  GF ++  ++++ + D+
Sbjct  543  LISQFAWLALIPGAIAAGTGFSLIRLLMRLDRYDK  577



>ref|WP_045869017.1| hypothetical protein [Tolypothrix sp. PCC 7601]
 gb|EKF03772.1| serine/threonine protein kinase [Tolypothrix sp. PCC 7601]
Length=561

 Score =   157 bits (398),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 89/243 (37%), Positives = 136/243 (56%), Gaps = 50/243 (21%)
 Frame = +2

Query  2    EGLLEVFYGVYEKDPDKVLQAMVQMGVLVPTGDMTAVRRTAQFFLNSFEERLATQRRERE  181
            EGL+E  +G+ +KD D+V+Q+++ +G + PT DM  VRR+ Q+ L++F +          
Sbjct  326  EGLMETLFGIAQKDGDRVVQSLIDLGAIAPTDDMGPVRRSVQYMLDNFMD----------  375

Query  182  LAKAELGFKKPLTKEEKIEKKKQRLAAIGEDLLSIAADQPFRFPATFTFVVRAFSVLHGI  361
                     KP         + Q +AAI +DL  IA +QPFRFPATFTFV+RAFS L G+
Sbjct  376  ---------KPF--------ENQSVAAISDDLYEIAYNQPFRFPATFTFVMRAFSTLEGV  418

Query  362  GKGLDPRFDITEIAKPYALELLRFREAGVEVILKDFKTRWDRQNRAFYN-LFRQADRVE-  535
            GKGLDP F+  E+AKPYA++L+                    +  +F N L RQA +V  
Sbjct  419  GKGLDPEFNFMEVAKPYAMQLMTDMNGS--------------EGNSFLNELSRQAVQVST  464

Query  536  -------KLAEIIQRLEQGDLKLRVRALESERAFQRVAAVQKTILSAVAAGSLINLATVL  694
                   +L + +++LE+GD+++RVR+LE+ER  +R + +Q  I  A+         T+L
Sbjct  465  TAFGLPRRLEDTLEKLERGDMRMRVRSLETERLLRRQSNIQIGISYALLVSGFTLSGTIL  524

Query  695  YLN  703
             +N
Sbjct  525  LVN  527



>gb|KIJ84347.1| hypothetical protein SD80_04935 [Scytonema tolypothrichoides 
VB-61278]
Length=561

 Score =   157 bits (398),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 98/279 (35%), Positives = 153/279 (55%), Gaps = 53/279 (19%)
 Frame = +2

Query  2    EGLLEVFYGVYEKDPDKVLQAMVQMGVLVPTGDMTAVRRTAQFFLNSFEERLATQRRERE  181
            +GL+E  +G+  KD D+V+Q+++ +G + P  DM  VRR+ Q+ L++F +          
Sbjct  326  DGLMETLFGIASKDGDRVVQSLIDLGAIAPVDDMGPVRRSVQYMLDNFMD----------  375

Query  182  LAKAELGFKKPLTKEEKIEKKKQRLAAIGEDLLSIAADQPFRFPATFTFVVRAFSVLHGI  361
                     KP         + Q +AAI +DL  IA DQPFRFPATFTFV+RAFS L G+
Sbjct  376  ---------KPF--------ENQSVAAISDDLYEIAYDQPFRFPATFTFVMRAFSTLEGV  418

Query  362  GKGLDPRFDITEIAKPYALELLRFREAGVEVILKDFKTRWDRQNRAFYN-LFRQADRVE-  535
            GKGLDP F+  E+A+PYA++L+                    Q+ +F N L RQA +V  
Sbjct  419  GKGLDPEFNFMEVAQPYAMQLMTNMNGS--------------QSNSFLNELSRQAVQVSN  464

Query  536  -------KLAEIIQRLEQGDLKLRVRALESERAFQRVAAVQKTILSAVAAGSLINLATVL  694
                   +L + +++LE+GD+++RVR+LE+ER  +R + +Q  +  AV        AT+L
Sbjct  465  TALGLPRRLEDTLEKLERGDVRVRVRSLETERLLRRQSNIQLGMTYAVIVSGFTLSATIL  524

Query  695  YLNAIRMPAMAAYGLCAFFGFQVLIGIVKVKKIDQRERL  811
             +      AM A GL A     +LI +  + ++D+ +R+
Sbjct  525  LVKDYIWLAMLA-GLIAVAVSSLLIRL--LMRLDRYDRM  560



>ref|WP_006635257.1| hypothetical protein [Microcoleus vaginatus]
 gb|EGK84506.1| ABC-1 domain-containing protein [Microcoleus vaginatus FGP-2]
Length=588

 Score =   157 bits (398),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 86/247 (35%), Positives = 137/247 (55%), Gaps = 47/247 (19%)
 Frame = +2

Query  2    EGLLEVFYGVYEKDPDKVLQAMVQMGVLVPTGDMTAVRRTAQFFLNSFEERLATQRRERE  181
            EGL+E  YG+  KD  +++ +++ +G LVPTGDM+ VRR+ Q+ L++F +          
Sbjct  352  EGLMETLYGIASKDGQRIMDSLINLGALVPTGDMSPVRRSIQYMLDNFMD----------  401

Query  182  LAKAELGFKKPLTKEEKIEKKKQRLAAIGEDLLSIAADQPFRFPATFTFVVRAFSVLHGI  361
                     KP         + Q ++AI +DL  IA +QPFRFPATFTFV+RAFS + G+
Sbjct  402  ---------KPF--------ENQSVSAITDDLYDIAYNQPFRFPATFTFVMRAFSTIEGV  444

Query  362  GKGLDPRFDITEIAKPYALELLRFREAGVEVILKDFKTRWDRQNRAFYNLFRQADRVE--  535
            G+GLDP F+  E+A+P+A++L+                  D  +  F  + RQA +V   
Sbjct  445  GRGLDPEFNFMEVAQPFAMQLMTNGNGH------------DTSSSIFNEIGRQAAQVSSS  492

Query  536  ------KLAEIIQRLEQGDLKLRVRALESERAFQRVAAVQKTILSAVAAGSLINLATVLY  697
                  ++ E I +LEQGDL++RVR+ E+ER  +R+++ Q     A+   +    AT+L+
Sbjct  493  ALGLPRRIEETIDKLEQGDLRIRVRSAETERLLRRMSSAQMGTNYALLMSAFTLSATILF  552

Query  698  LNAIRMP  718
            ++    P
Sbjct  553  VSNQVWP  559



>gb|KJB10237.1| hypothetical protein B456_001G191200 [Gossypium raimondii]
Length=642

 Score =   157 bits (398),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 91/204 (45%), Positives = 126/204 (62%), Gaps = 33/204 (16%)
 Frame = +2

Query  2    EGLLEVFYGVYEKDPDKVLQAMVQMGVLVPTGDMTAVRRTAQFFLNSFEERLATQRRERE  181
            E LLE+FY VYEKD  KV+Q+++ +G L PTGD+++VRR+ QFFL++    L  QR +++
Sbjct  465  ERLLELFYAVYEKDAKKVMQSLIDLGALQPTGDLSSVRRSVQFFLDN----LLDQRPDQD  520

Query  182  LAKAELGFKKPLTKEEKIEKKKQRLAAIGEDLLSIAADQPFRFPATFTFVVRAFSVLHGI  361
                                    LAAIGEDL +IA DQPFRFP+TFTFV+RAFS L GI
Sbjct  521  TT----------------------LAAIGEDLFAIAQDQPFRFPSTFTFVLRAFSTLEGI  558

Query  362  GKGLDPRFDITEIAKPYALELLRFRE---AGVEVILKDFKTRWDRQNRAFYNLFRQADRV  532
            G  LDP F   +IA PYA ELL  R+    G +++ +  K   D ++      +    RV
Sbjct  559  GYILDPNFSFAKIAAPYAQELLDIRQRQRTGSQLVQEIRKQADDARSYTMSMPY----RV  614

Query  533  EKLAEIIQRLEQGDLKLRVRALES  604
            +++ EI+++LE GDL+LRVR LE+
Sbjct  615  QRIEEILKQLESGDLRLRVRVLEN  638



>gb|ELS33524.1| ABC-1 domain-containing protein [Pseudanabaena biceps PCC 7429]
Length=563

 Score =   157 bits (397),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 96/277 (35%), Positives = 148/277 (53%), Gaps = 47/277 (17%)
 Frame = +2

Query  2    EGLLEVFYGVYEKDPDKVLQAMVQMGVLVPTGDMTAVRRTAQFFLNSFEERLATQRRERE  181
            E LL  F+G+ +KD + V+ +++ +G L  TGD   +RR+ Q+ L++F  +         
Sbjct  326  EKLLRTFFGIAQKDAEVVINSLIDLGALEVTGDTGPLRRSVQYMLDNFMGQ---------  376

Query  182  LAKAELGFKKPLTKEEKIEKKKQRLAAIGEDLLSIAADQPFRFPATFTFVVRAFSVLHGI  361
                                +KQ +AAI +DL  IA DQPFRFPATFTFV+RA S L G+
Sbjct  377  ------------------SMEKQSVAAISDDLYDIAYDQPFRFPATFTFVMRALSTLEGL  418

Query  362  GKGLDPRFDITEIAKPYALELLRFREAGVEVILKDFKTRWDRQNRAFYNLFRQADRVEKL  541
            GKGLDP F+  E+AKPYA  L+    A         K   +     F  L RQA +V   
Sbjct  419  GKGLDPSFNFMEVAKPYATNLMENGSA---------KESGNLSTAFFGELGRQATQVSST  469

Query  542  A--------EIIQRLEQGDLKLRVRALESERAFQRVAAVQKTILSAVAAGSLINLATVLY  697
            A        E + +L++GD+++RV++ E++R  +R++ V    + A+   +    AT+L+
Sbjct  470  AIALPRRIDETLSKLDRGDIRVRVKSQETDRLLRRLSNVGIGAIYALLGATCFLCATLLF  529

Query  698  LNAIRMPAMAAYGLCAFFGFQVLIGIVKVKKIDQRER  808
            +N +++PA+    L  FF   VLI +  + KID+ ER
Sbjct  530  INGLQIPAIITATLAGFF---VLILLRLLSKIDRPER  563



>ref|WP_040687584.1| hypothetical protein [Pseudanabaena biceps]
Length=564

 Score =   157 bits (397),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 96/277 (35%), Positives = 148/277 (53%), Gaps = 47/277 (17%)
 Frame = +2

Query  2    EGLLEVFYGVYEKDPDKVLQAMVQMGVLVPTGDMTAVRRTAQFFLNSFEERLATQRRERE  181
            E LL  F+G+ +KD + V+ +++ +G L  TGD   +RR+ Q+ L++F  +         
Sbjct  327  EKLLRTFFGIAQKDAEVVINSLIDLGALEVTGDTGPLRRSVQYMLDNFMGQ---------  377

Query  182  LAKAELGFKKPLTKEEKIEKKKQRLAAIGEDLLSIAADQPFRFPATFTFVVRAFSVLHGI  361
                                +KQ +AAI +DL  IA DQPFRFPATFTFV+RA S L G+
Sbjct  378  ------------------SMEKQSVAAISDDLYDIAYDQPFRFPATFTFVMRALSTLEGL  419

Query  362  GKGLDPRFDITEIAKPYALELLRFREAGVEVILKDFKTRWDRQNRAFYNLFRQADRVEKL  541
            GKGLDP F+  E+AKPYA  L+    A         K   +     F  L RQA +V   
Sbjct  420  GKGLDPSFNFMEVAKPYATNLMENGSA---------KESGNLSTAFFGELGRQATQVSST  470

Query  542  A--------EIIQRLEQGDLKLRVRALESERAFQRVAAVQKTILSAVAAGSLINLATVLY  697
            A        E + +L++GD+++RV++ E++R  +R++ V    + A+   +    AT+L+
Sbjct  471  AIALPRRIDETLSKLDRGDIRVRVKSQETDRLLRRLSNVGIGAIYALLGATCFLCATLLF  530

Query  698  LNAIRMPAMAAYGLCAFFGFQVLIGIVKVKKIDQRER  808
            +N +++PA+    L  FF   VLI +  + KID+ ER
Sbjct  531  INGLQIPAIITATLAGFF---VLILLRLLSKIDRPER  564



>emb|CCE16417.1| Putative Ser/thr protein kinase of th ABC1 subfamily [Arthrospira 
sp. PCC 8005]
 emb|CDM95065.1| Putative Ser/thr protein kinase of th ABC1 subfamily [Arthrospira 
sp. PCC 8005]
Length=566

 Score =   157 bits (397),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 88/242 (36%), Positives = 136/242 (56%), Gaps = 47/242 (19%)
 Frame = +2

Query  2    EGLLEVFYGVYEKDPDKVLQAMVQMGVLVPTGDMTAVRRTAQFFLNSFEERLATQRRERE  181
            E L+E  +G+  KD D+V+++++++G L PTGDM+ VRR+ Q+ L++F +          
Sbjct  330  EKLMETLFGIANKDADRVVKSLIEVGALAPTGDMSPVRRSIQYMLDNFMD----------  379

Query  182  LAKAELGFKKPLTKEEKIEKKKQRLAAIGEDLLSIAADQPFRFPATFTFVVRAFSVLHGI  361
                     +P         ++Q +AAI +DL  IA DQPFRFPATFTFV+RAFS L G+
Sbjct  380  ---------QPF--------EEQSIAAISDDLYEIAYDQPFRFPATFTFVMRAFSTLEGV  422

Query  362  GKGLDPRFDITEIAKPYALELLRFREAGVEVILKDFKTRWDRQNRAFYNLFRQADRVEKL  541
            GKGLDP F+  E+A+P+A++L+                     N     + RQA +V   
Sbjct  423  GKGLDPEFNFMEVAQPFAIQLMSNGNGSQTT------------NSIINEISRQAVQVSST  470

Query  542  A--------EIIQRLEQGDLKLRVRALESERAFQRVAAVQKTILSAVAAGSLINLATVLY  697
            A        + + +LEQGDL++RVRA E++R  +RV+ VQ     A+  G+    AT+L+
Sbjct  471  ALGLPSRIEQTLDKLEQGDLRMRVRATETDRLLRRVSNVQMGTNYALLVGAFTLSATLLF  530

Query  698  LN  703
            ++
Sbjct  531  IS  532



>gb|ABG52521.1| ABC-1 [Trichodesmium erythraeum IMS101]
Length=563

 Score =   157 bits (397),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 92/242 (38%), Positives = 129/242 (53%), Gaps = 50/242 (21%)
 Frame = +2

Query  2    EGLLEVFYGVYEKDPDKVLQAMVQMGVLVPTGDMTAVRRTAQFFLNSFEERLATQRRERE  181
            E L+E  YG+  KD ++V+ ++  +G L PTGDM  VRR+ Q+ L++F            
Sbjct  330  EKLMETLYGIASKDAERVIISLTDLGALKPTGDMGPVRRSIQYMLDNF------------  377

Query  182  LAKAELGFKKPLTKEEKIEKKKQRLAAIGEDLLSIAADQPFRFPATFTFVVRAFSVLHGI  361
                     KP         + Q + AI +DL  +A DQPFRFPATFTFV+RAFS L G+
Sbjct  378  -------MDKPF--------EAQSITAISDDLYEVAYDQPFRFPATFTFVMRAFSTLEGV  422

Query  362  GKGLDPRFDITEIAKPYALELLRFREAGVEVILKDFKTRWDRQNRAFYNLFRQADRVEKL  541
            GKGLDP F   E+A+P+A++L+                  D Q   F  L RQA +V   
Sbjct  423  GKGLDPDFSFMEVAQPFAMQLMSDE---------------DSQKTIFNELGRQAAQVSST  467

Query  542  A--------EIIQRLEQGDLKLRVRALESERAFQRVAAVQKTILSAVAAGSLINLATVLY  697
            A        + I +LEQGD+K+RVRA+E++R  +RV+ VQ     A+        AT+LY
Sbjct  468  ALGLPGRIEDAIDKLEQGDIKVRVRAVETDRLVRRVSNVQMGTNYALLISGFTLSATILY  527

Query  698  LN  703
            +N
Sbjct  528  VN  529



>ref|WP_044136875.1| hypothetical protein [Trichodesmium erythraeum]
Length=585

 Score =   157 bits (397),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 92/242 (38%), Positives = 129/242 (53%), Gaps = 50/242 (21%)
 Frame = +2

Query  2    EGLLEVFYGVYEKDPDKVLQAMVQMGVLVPTGDMTAVRRTAQFFLNSFEERLATQRRERE  181
            E L+E  YG+  KD ++V+ ++  +G L PTGDM  VRR+ Q+ L++F            
Sbjct  352  EKLMETLYGIASKDAERVIISLTDLGALKPTGDMGPVRRSIQYMLDNF------------  399

Query  182  LAKAELGFKKPLTKEEKIEKKKQRLAAIGEDLLSIAADQPFRFPATFTFVVRAFSVLHGI  361
                     KP         + Q + AI +DL  +A DQPFRFPATFTFV+RAFS L G+
Sbjct  400  -------MDKPF--------EAQSITAISDDLYEVAYDQPFRFPATFTFVMRAFSTLEGV  444

Query  362  GKGLDPRFDITEIAKPYALELLRFREAGVEVILKDFKTRWDRQNRAFYNLFRQADRVEKL  541
            GKGLDP F   E+A+P+A++L+                  D Q   F  L RQA +V   
Sbjct  445  GKGLDPDFSFMEVAQPFAMQLMSDE---------------DSQKTIFNELGRQAAQVSST  489

Query  542  A--------EIIQRLEQGDLKLRVRALESERAFQRVAAVQKTILSAVAAGSLINLATVLY  697
            A        + I +LEQGD+K+RVRA+E++R  +RV+ VQ     A+        AT+LY
Sbjct  490  ALGLPGRIEDAIDKLEQGDIKVRVRAVETDRLVRRVSNVQMGTNYALLISGFTLSATILY  549

Query  698  LN  703
            +N
Sbjct  550  VN  551



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3421465534246