BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig13057

Length=861
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_011094208.1|  PREDICTED: uncharacterized protein LOC105173965    172   3e-49   Sesamum indicum [beniseed]
ref|XP_009621601.1|  PREDICTED: uncharacterized protein LOC104113199    155   7e-43   Nicotiana tomentosiformis
gb|EYU18150.1|  hypothetical protein MIMGU_mgv1a015404mg                155   1e-42   Erythranthe guttata [common monkey flower]
ref|XP_009794112.1|  PREDICTED: uncharacterized protein LOC104240905    152   1e-41   Nicotiana sylvestris
emb|CDP10564.1|  unnamed protein product                                150   8e-41   Coffea canephora [robusta coffee]
ref|XP_006339183.1|  PREDICTED: uncharacterized protein LOC102590923    139   2e-36   Solanum tuberosum [potatoes]
ref|XP_002270752.1|  PREDICTED: uncharacterized protein LOC100259819    138   2e-36   Vitis vinifera
ref|XP_004249389.1|  PREDICTED: uncharacterized protein LOC101268731    136   2e-35   Solanum lycopersicum
ref|XP_006348427.1|  PREDICTED: uncharacterized protein LOC102594000    133   3e-34   Solanum tuberosum [potatoes]
ref|XP_009779394.1|  PREDICTED: uncharacterized protein LOC104228610    133   3e-34   Nicotiana sylvestris
ref|XP_010315839.1|  PREDICTED: uncharacterized protein LOC101264148    132   4e-34   Solanum lycopersicum
gb|EYU38705.1|  hypothetical protein MIMGU_mgv1a015517mg                132   7e-34   Erythranthe guttata [common monkey flower]
ref|XP_009598143.1|  PREDICTED: uncharacterized protein LOC104094007    127   4e-32   
gb|KDO70694.1|  hypothetical protein CISIN_1g040225mg                   127   5e-32   Citrus sinensis [apfelsine]
ref|XP_008367356.1|  PREDICTED: uncharacterized protein LOC103430987    127   5e-32   
ref|XP_006430012.1|  hypothetical protein CICLE_v10012921mg             127   1e-31   Citrus clementina [clementine]
emb|CDY72642.1|  BnaAnng41820D                                          127   3e-31   Brassica napus [oilseed rape]
ref|XP_009121232.1|  PREDICTED: uncharacterized protein LOC103846060    127   4e-31   Brassica rapa
emb|CDY47923.1|  BnaAnng09550D                                          126   1e-30   Brassica napus [oilseed rape]
ref|XP_006481639.1|  PREDICTED: uncharacterized protein LOC102612483    124   1e-30   
ref|XP_011467168.1|  PREDICTED: uncharacterized protein LOC101295551    123   3e-30   Fragaria vesca subsp. vesca
gb|KJB61966.1|  hypothetical protein B456_009G394800                    122   5e-30   Gossypium raimondii
ref|XP_011042545.1|  PREDICTED: uncharacterized protein LOC105138206    122   7e-30   Populus euphratica
ref|XP_010036579.1|  PREDICTED: uncharacterized protein LOC104425557    121   9e-30   Eucalyptus grandis [rose gum]
ref|XP_002322767.1|  hypothetical protein POPTR_0016s06660g             119   4e-29   Populus trichocarpa [western balsam poplar]
ref|XP_009362653.1|  PREDICTED: uncharacterized protein LOC103952714    119   6e-29   Pyrus x bretschneideri [bai li]
ref|XP_003553628.1|  PREDICTED: uncharacterized protein LOC100794951    119   9e-29   Glycine max [soybeans]
ref|XP_006577719.1|  PREDICTED: uncharacterized protein LOC102660779    117   3e-28   Glycine max [soybeans]
ref|XP_010677586.1|  PREDICTED: uncharacterized protein LOC104893191    117   3e-28   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_011077779.1|  PREDICTED: uncharacterized protein LOC105161694    116   5e-28   
ref|XP_011652052.1|  PREDICTED: uncharacterized protein LOC105434984    115   1e-27   Cucumis sativus [cucumbers]
ref|XP_010278068.1|  PREDICTED: uncharacterized protein LOC104612373    114   2e-27   Nelumbo nucifera [Indian lotus]
ref|XP_008359520.1|  PREDICTED: uncharacterized protein LOC103423227    113   8e-27   
gb|KFK38537.1|  hypothetical protein AALP_AA3G126800                    112   1e-25   Arabis alpina [alpine rockcress]
gb|KJB16515.1|  hypothetical protein B456_002G233600                    110   1e-25   Gossypium raimondii
ref|XP_010464901.1|  PREDICTED: uncharacterized protein LOC104745388    112   2e-25   Camelina sativa [gold-of-pleasure]
ref|XP_006296618.1|  hypothetical protein CARUB_v10014493mg             111   2e-25   Capsella rubella
ref|XP_002524096.1|  conserved hypothetical protein                     111   3e-25   Ricinus communis
ref|XP_002882743.1|  hypothetical protein ARALYDRAFT_478514             111   3e-25   
ref|XP_010497983.1|  PREDICTED: uncharacterized protein LOC104775762    111   3e-25   Camelina sativa [gold-of-pleasure]
ref|XP_007028055.1|  Uncharacterized protein TCM_023118                 108   6e-25   
ref|XP_010486837.1|  PREDICTED: uncharacterized protein LOC104764926    110   7e-25   Camelina sativa [gold-of-pleasure]
ref|NP_566397.1|  uncharacterized protein                               109   1e-24   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011044152.1|  PREDICTED: uncharacterized protein LOC105139423    107   2e-24   Populus euphratica
ref|XP_008350240.1|  PREDICTED: uncharacterized protein LOC103413552    107   2e-24   
ref|XP_006407422.1|  hypothetical protein EUTSA_v10021370mg             108   2e-24   Eutrema salsugineum [saltwater cress]
ref|XP_007163005.1|  hypothetical protein PHAVU_001G198100g             106   5e-24   Phaseolus vulgaris [French bean]
ref|XP_010248041.1|  PREDICTED: uncharacterized protein LOC104590965    103   1e-23   Nelumbo nucifera [Indian lotus]
ref|XP_007145910.1|  hypothetical protein PHAVU_007G278000g             105   1e-23   Phaseolus vulgaris [French bean]
ref|XP_004142253.1|  PREDICTED: uncharacterized protein LOC101219884    104   1e-23   Cucumis sativus [cucumbers]
ref|XP_008241102.1|  PREDICTED: uncharacterized protein LOC103339566    103   4e-23   Prunus mume [ume]
ref|XP_007202667.1|  hypothetical protein PRUPE_ppa012433mg             102   1e-22   Prunus persica
ref|XP_002312881.2|  hypothetical protein POPTR_0009s15370g             100   2e-22   
ref|XP_010543841.1|  PREDICTED: uncharacterized protein LOC104816625    102   4e-22   Tarenaya hassleriana [spider flower]
ref|XP_008449841.1|  PREDICTED: uncharacterized protein LOC103491601  99.4    9e-22   Cucumis melo [Oriental melon]
ref|XP_012074264.1|  PREDICTED: uncharacterized protein LOC105635777    101   1e-21   Jatropha curcas
ref|XP_006575261.1|  PREDICTED: uncharacterized protein LOC102665591  98.6    4e-21   Glycine max [soybeans]
ref|XP_004494918.1|  PREDICTED: uncharacterized protein LOC101488959  98.6    4e-21   Cicer arietinum [garbanzo]
ref|XP_010270822.1|  PREDICTED: uncharacterized protein LOC104607031  95.5    3e-20   Nelumbo nucifera [Indian lotus]
ref|XP_010671673.1|  PREDICTED: uncharacterized protein LOC104888408  95.1    4e-20   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006295144.1|  hypothetical protein CARUB_v10024215mg           94.0    9e-20   Capsella rubella
ref|XP_006487824.1|  PREDICTED: uncharacterized protein LOC102622103  93.6    1e-19   Citrus sinensis [apfelsine]
ref|XP_006589885.1|  PREDICTED: uncharacterized protein LOC102667474  94.0    2e-19   Glycine max [soybeans]
gb|KJB36160.1|  hypothetical protein B456_006G147300                  93.6    2e-19   Gossypium raimondii
emb|CDY01049.1|  BnaC05g41510D                                        94.0    2e-19   
ref|XP_010110453.1|  hypothetical protein L484_006446                 92.8    2e-19   Morus notabilis
ref|XP_004228873.1|  PREDICTED: uncharacterized protein LOC101249571  92.4    3e-19   Solanum lycopersicum
ref|XP_009146691.1|  PREDICTED: uncharacterized protein LOC103870319  94.0    3e-19   Brassica rapa
gb|KGN63891.1|  hypothetical protein Csa_1G025240                     91.7    5e-19   Cucumis sativus [cucumbers]
ref|XP_006424049.1|  hypothetical protein CICLE_v10029482mg           91.3    9e-19   Citrus clementina [clementine]
gb|KJB14940.1|  hypothetical protein B456_002G153700                  91.7    9e-19   Gossypium raimondii
ref|NP_196256.1|  uncharacterized protein                             90.5    1e-18   Arabidopsis thaliana [mouse-ear cress]
gb|EPS69946.1|  hypothetical protein M569_04817                       90.5    1e-18   Genlisea aurea
ref|NP_565639.1|  uncharacterized protein                             90.9    1e-18   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010452563.1|  PREDICTED: uncharacterized protein LOC104734646  89.7    3e-18   Camelina sativa [gold-of-pleasure]
ref|XP_010491196.1|  PREDICTED: uncharacterized protein LOC104768832  89.0    5e-18   Camelina sativa [gold-of-pleasure]
ref|XP_010534383.1|  PREDICTED: uncharacterized protein LOC104809949  90.1    5e-18   Tarenaya hassleriana [spider flower]
ref|XP_006594906.1|  PREDICTED: uncharacterized protein LOC102665048  88.6    7e-18   Glycine max [soybeans]
ref|XP_002871216.1|  hypothetical protein ARALYDRAFT_908566           88.2    8e-18   Arabidopsis lyrata subsp. lyrata
ref|XP_007015616.1|  Uncharacterized protein TCM_041188               87.8    1e-17   Theobroma cacao [chocolate]
ref|XP_010510802.1|  PREDICTED: uncharacterized protein LOC104787009  87.8    2e-17   Camelina sativa [gold-of-pleasure]
ref|XP_006399109.1|  hypothetical protein EUTSA_v10016087mg           87.4    2e-17   Eutrema salsugineum [saltwater cress]
gb|KJB35494.1|  hypothetical protein B456_006G117400                  86.7    3e-17   Gossypium raimondii
gb|KFK32411.1|  hypothetical protein AALP_AA6G238300                  86.3    4e-17   Arabis alpina [alpine rockcress]
ref|XP_009393985.1|  PREDICTED: uncharacterized protein LOC103979537  86.3    5e-17   Musa acuminata subsp. malaccensis [pisang utan]
gb|AAM67029.1|  unknown                                               85.5    7e-17   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009412934.1|  PREDICTED: uncharacterized protein LOC103994335  85.5    1e-16   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004241363.1|  PREDICTED: uncharacterized protein LOC101264331  84.7    1e-16   Solanum lycopersicum
emb|CAA78966.1|  pollen preferential protein                          84.0    5e-16   Lilium longiflorum [Easter lily]
ref|XP_002309264.1|  hypothetical protein POPTR_0006s21440g           83.2    8e-16   
ref|XP_006289850.1|  hypothetical protein CARUB_v10003460mg           82.0    1e-15   
emb|CDY04987.1|  BnaAnng01690D                                        82.0    2e-15   
ref|XP_011047139.1|  PREDICTED: uncharacterized protein LOC105141580  82.0    2e-15   Populus euphratica
ref|XP_009415689.1|  PREDICTED: uncharacterized protein LOC103996494  81.3    3e-15   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010423346.1|  PREDICTED: uncharacterized protein LOC104708468  81.3    3e-15   Camelina sativa [gold-of-pleasure]
ref|XP_012066335.1|  PREDICTED: uncharacterized protein LOC105629366  80.5    6e-15   
ref|XP_010090525.1|  hypothetical protein L484_017152                 79.7    9e-15   Morus notabilis
ref|XP_007145764.1|  hypothetical protein PHAVU_007G265700g           79.7    1e-14   Phaseolus vulgaris [French bean]
emb|CDY14083.1|  BnaC02g02000D                                        79.0    2e-14   Brassica napus [oilseed rape]
ref|XP_004497626.1|  PREDICTED: uncharacterized protein LOC101495448  78.2    6e-14   Cicer arietinum [garbanzo]
ref|XP_006408635.1|  hypothetical protein EUTSA_v10002111mg           76.6    1e-13   Eutrema salsugineum [saltwater cress]
ref|XP_008230595.1|  PREDICTED: uncharacterized protein LOC103329849  75.9    1e-13   Prunus mume [ume]
ref|XP_006592799.1|  PREDICTED: uncharacterized protein LOC102667734  75.5    2e-13   Glycine max [soybeans]
ref|XP_009764931.1|  PREDICTED: uncharacterized protein LOC104216555  75.1    4e-13   Nicotiana sylvestris
gb|AFK49614.1|  unknown                                               74.3    6e-13   Medicago truncatula
gb|AES67187.2|  hypothetical protein MTR_2g087830                     74.3    6e-13   Medicago truncatula
ref|XP_002272763.1|  PREDICTED: uncharacterized protein LOC100244371  74.7    8e-13   Vitis vinifera
ref|XP_010417870.1|  PREDICTED: uncharacterized protein LOC104703541  74.3    1e-12   Camelina sativa [gold-of-pleasure]
ref|XP_002515860.1|  conserved hypothetical protein                   72.8    2e-12   
emb|CDX83256.1|  BnaA03g22500D                                        72.8    3e-12   
ref|XP_009594831.1|  PREDICTED: uncharacterized protein LOC104091253  72.8    3e-12   Nicotiana tomentosiformis
gb|KEH24288.1|  hypothetical protein MTR_7g106820                     72.8    4e-12   Medicago truncatula
ref|XP_009418969.1|  PREDICTED: uncharacterized protein LOC103999051  72.8    5e-12   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDY63609.1|  BnaC03g72760D                                        72.0    5e-12   Brassica napus [oilseed rape]
ref|XP_010473110.1|  PREDICTED: uncharacterized protein LOC104752617  71.6    7e-12   Camelina sativa [gold-of-pleasure]
ref|XP_009760948.1|  PREDICTED: uncharacterized protein LOC104213201  70.5    1e-11   Nicotiana sylvestris
ref|XP_003596936.1|  hypothetical protein MTR_2g087830                73.6    1e-11   
ref|XP_008442966.1|  PREDICTED: uncharacterized protein LOC103486710  70.1    1e-11   
ref|XP_010686148.1|  PREDICTED: uncharacterized protein LOC104900431  70.9    2e-11   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002862773.1|  hypothetical protein ARALYDRAFT_497300           70.1    2e-11   
gb|KJB54161.1|  hypothetical protein B456_009G081700                  70.1    3e-11   Gossypium raimondii
ref|XP_011005858.1|  PREDICTED: uncharacterized protein LOC105112014  69.3    6e-11   Populus euphratica
emb|CDX71471.1|  BnaC04g17060D                                        68.6    8e-11   
ref|XP_009125644.1|  PREDICTED: uncharacterized protein LOC103850619  68.2    1e-10   Brassica rapa
ref|XP_009103580.1|  PREDICTED: uncharacterized protein LOC103829651  67.8    1e-10   Brassica rapa
ref|XP_008778376.1|  PREDICTED: uncharacterized protein LOC103698166  67.8    3e-10   
ref|XP_010058753.1|  PREDICTED: uncharacterized protein LOC104446615  67.4    4e-10   Eucalyptus grandis [rose gum]
gb|EYU45228.1|  hypothetical protein MIMGU_mgv1a021343mg              65.5    4e-10   Erythranthe guttata [common monkey flower]
emb|CDY71899.1|  BnaAnng39210D                                        66.2    6e-10   Brassica napus [oilseed rape]
ref|XP_009417076.1|  PREDICTED: uncharacterized protein LOC103997547  66.6    7e-10   Musa acuminata subsp. malaccensis [pisang utan]
gb|EPS68681.1|  hypothetical protein M569_06090                       65.1    1e-09   Genlisea aurea
ref|XP_011461807.1|  PREDICTED: uncharacterized protein LOC105350703  65.1    1e-09   Fragaria vesca subsp. vesca
ref|XP_006384687.1|  hypothetical protein POPTR_0004s20180g           64.3    2e-09   
ref|XP_006847831.1|  PREDICTED: uncharacterized protein LOC18437561   64.3    3e-09   Amborella trichopoda
ref|XP_009804871.1|  PREDICTED: uncharacterized protein LOC104250040  64.3    3e-09   Nicotiana sylvestris
emb|CDX98918.1|  BnaC09g49170D                                        63.5    6e-09   
ref|XP_009140772.1|  PREDICTED: uncharacterized protein LOC103864759  62.8    1e-08   Brassica rapa
gb|KEH41815.1|  hypothetical protein MTR_1g054990                     62.4    2e-08   Medicago truncatula
ref|XP_008378262.1|  PREDICTED: uncharacterized protein LOC103441365  62.0    2e-08   
ref|XP_004251435.1|  PREDICTED: uncharacterized protein LOC101260996  61.6    3e-08   Solanum lycopersicum
ref|XP_006582800.1|  PREDICTED: uncharacterized protein LOC100796231  61.2    3e-08   
gb|AFW68128.1|  hypothetical protein ZEAMMB73_262336                  61.2    4e-08   
ref|XP_010909500.1|  PREDICTED: uncharacterized protein LOC105035598  61.6    4e-08   
emb|CDY57481.1|  BnaAnng14620D                                        60.8    4e-08   Brassica napus [oilseed rape]
ref|XP_009363700.1|  PREDICTED: uncharacterized protein LOC103953653  60.8    5e-08   Pyrus x bretschneideri [bai li]
ref|XP_004487434.1|  PREDICTED: uncharacterized protein LOC101515047  60.8    5e-08   Cicer arietinum [garbanzo]
ref|XP_008780325.1|  PREDICTED: uncharacterized protein LOC103700136  60.8    7e-08   
ref|XP_009391465.1|  PREDICTED: uncharacterized protein LOC103977621  60.8    7e-08   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008365866.1|  PREDICTED: uncharacterized protein LOC103429499  59.7    1e-07   Malus domestica [apple tree]
ref|XP_010544320.1|  PREDICTED: uncharacterized protein LOC104816969  60.1    1e-07   Tarenaya hassleriana [spider flower]
ref|NP_001168992.1|  uncharacterized protein LOC100382821             60.8    1e-07   Zea mays [maize]
ref|XP_007149998.1|  hypothetical protein PHAVU_005G117300g           59.7    1e-07   Phaseolus vulgaris [French bean]
ref|XP_009378608.1|  PREDICTED: uncharacterized protein LOC103967087  59.3    2e-07   
ref|XP_008337098.1|  PREDICTED: uncharacterized protein LOC103400217  58.9    2e-07   
ref|XP_010917914.1|  PREDICTED: uncharacterized protein LOC105042416  58.2    7e-07   Elaeis guineensis
ref|XP_009378628.1|  PREDICTED: uncharacterized protein LOC103967106  57.0    8e-07   
ref|XP_004506249.1|  PREDICTED: uncharacterized protein LOC101514172  57.0    9e-07   Cicer arietinum [garbanzo]
gb|EAY83943.1|  hypothetical protein OsI_39163                        57.8    1e-06   Oryza sativa Indica Group [Indian rice]
ref|XP_002464157.1|  hypothetical protein SORBIDRAFT_01g013260        58.9    1e-06   
ref|XP_011089214.1|  PREDICTED: uncharacterized protein LOC105170241  56.6    1e-06   Sesamum indicum [beniseed]
ref|XP_009122239.1|  PREDICTED: uncharacterized protein LOC103846973  56.2    2e-06   Brassica rapa
ref|NP_001067301.2|  Os12g0621400                                     57.4    2e-06   
dbj|BAK06956.1|  predicted protein                                    56.2    4e-06   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_003540827.1|  PREDICTED: uncharacterized protein LOC100792178  54.3    9e-06   Glycine max [soybeans]
ref|XP_009407080.1|  PREDICTED: uncharacterized protein LOC103989859  54.7    9e-06   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDY57988.1|  BnaA10g30350D                                        54.3    1e-05   Brassica napus [oilseed rape]
gb|ABF97913.1|  expressed protein                                     53.9    3e-05   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001159142.1|  uncharacterized protein LOC100304221             52.8    7e-05   Zea mays [maize]
gb|AGO59364.1|  hypothetical protein OG_BBa0035M03.12                 52.0    9e-05   Oryza glaberrima
ref|XP_007132517.1|  hypothetical protein PHAVU_011G101000g           51.2    1e-04   Phaseolus vulgaris [French bean]
ref|XP_009394273.1|  PREDICTED: uncharacterized protein LOC103979785  51.2    1e-04   Musa acuminata subsp. malaccensis [pisang utan]
gb|AGO59345.1|  hypothetical protein OB_ABa0085D15.10                 52.0    1e-04   Oryza barthii [African wild rice]
gb|EMT21933.1|  hypothetical protein F775_52541                       52.0    1e-04   
ref|XP_006826414.1|  PREDICTED: uncharacterized protein LOC18421609   50.1    3e-04   Amborella trichopoda
gb|AGT16534.1|  hypothetical protein SHCRBa_224_D04_R_290             51.2    3e-04   Saccharum hybrid cultivar R570
ref|XP_008798689.1|  PREDICTED: uncharacterized protein LOC103713512  48.5    0.001   Phoenix dactylifera



>ref|XP_011094208.1| PREDICTED: uncharacterized protein LOC105173965 [Sesamum indicum]
Length=153

 Score =   172 bits (435),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 98/155 (63%), Positives = 119/155 (77%), Gaps = 6/155 (4%)
 Frame = +1

Query  391  MTKRISLRSPGSG--REPLLNPARDSSSGPEAVRKARFAEVAGGTTADIAAVCCCCPCGL  564
            MT++I+LR+ GS   R+PLL     SS     VRK R AEVAGGTTA+ AAV CCCPCGL
Sbjct  1    MTRQITLRNTGSADRRQPLLENTDCSSQC--GVRKVRLAEVAGGTTAECAAVACCCPCGL  58

Query  565  VNLVVLAVYKLPAGICRKAIRSKRRRKMMKNGMWPVRHCSCPDSELQIHPISSPSAVAAA  744
            VNL+VL  YKLPAG+ RKA+R KR R++MK G+ P R C+C + E QIHP++SP A+  A
Sbjct  59   VNLLVLVAYKLPAGLARKALRRKRNRRLMKKGLLPPRRCNCDEKEFQIHPVTSPVAMFNA  118

Query  745  LES--DNEVVELEKEMWDRFYGAGFWRSPSQRTEV  843
            LE+  D EVVELEKEMWD+FYGAGFWRSPSQR+E+
Sbjct  119  LEASDDKEVVELEKEMWDKFYGAGFWRSPSQRSEI  153



>ref|XP_009621601.1| PREDICTED: uncharacterized protein LOC104113199 [Nicotiana tomentosiformis]
Length=162

 Score =   155 bits (393),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 97/159 (61%), Positives = 119/159 (75%), Gaps = 8/159 (5%)
 Frame = +1

Query  391  MTKRISLRSPGS----GREPLLNPARDSSSGPEAVRKARFAEVAGGTTADIAAVCCCCPC  558
            MT+ I++RSP S     R+PLL+    SSS    VRKARFAEVAGG TA+ AAV CCCPC
Sbjct  4    MTRPITIRSPPSLSLDKRQPLLSSQDSSSSRGGGVRKARFAEVAGGATAECAAVACCCPC  63

Query  559  GLVNLVVLAVYKLPAGICRKAIRSKRRRKMMKNGMWPVR-HCSCPDSEL-QIHPISSPSA  732
            G+VNL++LAVYK+PAG+CRKA+R  RR ++ K G+ P + HCSC + EL   +PISSP A
Sbjct  64   GIVNLLILAVYKVPAGLCRKALRKNRRNRLTKKGLLPSKGHCSCDEIELIHSYPISSPIA  123

Query  733  VAAA--LESDNEVVELEKEMWDRFYGAGFWRSPSQRTEV  843
            V     LESD + +ELEKEMWD+FYGAGFWRSPSQR E+
Sbjct  124  VVGGGNLESDKDALELEKEMWDKFYGAGFWRSPSQRAEI  162



>gb|EYU18150.1| hypothetical protein MIMGU_mgv1a015404mg [Erythranthe guttata]
Length=158

 Score =   155 bits (391),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 101/157 (64%), Positives = 123/157 (78%), Gaps = 6/157 (4%)
 Frame = +1

Query  391  MTKRISLRSPGSGR--EPLLNPARDSSSGPEAVRKARFAEVAGGTTADIAAVCCCCPCGL  564
            MT+++++RSP   R   PLL  +  SS G  A  K R AEVAGGT A+ AAVCCCCPCGL
Sbjct  1    MTRQMTMRSPALDRRQSPLLERSDYSSRGG-ARNKVRLAEVAGGTAAECAAVCCCCPCGL  59

Query  565  VNLVVLAVYKLPAGICRKAIRSKRRRKMMKNGMWPVRHCSCPDSELQIHPISSPSAVAAA  744
            VNL+VLAVYKLPAG+CRKA+R KR R+++K G+ P R C C ++E QIHP++SP A+  A
Sbjct  60   VNLIVLAVYKLPAGLCRKALRRKRHRRLLKKGLLPQRKCGCDENEFQIHPVTSPLAMVTA  119

Query  745  LES---DNEVVELEKEMWDRFYGAGFWRSPSQRTEVS  846
            LES   D+EV+ELEKEMWD+FYGAGFWRSPSQRTEVS
Sbjct  120  LESVSDDSEVIELEKEMWDKFYGAGFWRSPSQRTEVS  156



>ref|XP_009794112.1| PREDICTED: uncharacterized protein LOC104240905 [Nicotiana sylvestris]
Length=159

 Score =   152 bits (384),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 97/159 (61%), Positives = 117/159 (74%), Gaps = 8/159 (5%)
 Frame = +1

Query  391  MTKRISLRSPG----SGREPLLNPARDSSSGPEAVRKARFAEVAGGTTADIAAVCCCCPC  558
            MT+ I +RSP       R+PLL+    SSS    VRKAR AEVAGG TA+ AAV CCCPC
Sbjct  1    MTRPIIIRSPPLLSLDKRQPLLSSQDSSSSRGGGVRKARLAEVAGGATAECAAVACCCPC  60

Query  559  GLVNLVVLAVYKLPAGICRKAIRSKRRRKMMKNGMWPVR-HCSCPDSEL-QIHPISSPSA  732
            G+VNL+VLAVYK+PAG+CRKA+R KRR ++ K G+ P + HCSC + EL   +PISSP A
Sbjct  61   GIVNLLVLAVYKVPAGLCRKALRKKRRNRLTKKGLLPSKGHCSCDEIELIHSYPISSPIA  120

Query  733  VAAA--LESDNEVVELEKEMWDRFYGAGFWRSPSQRTEV  843
            V     LESD + +ELEKEMWD+FYGAGFWRSPSQR E+
Sbjct  121  VVGGGNLESDKDALELEKEMWDKFYGAGFWRSPSQRAEI  159



>emb|CDP10564.1| unnamed protein product [Coffea canephora]
Length=154

 Score =   150 bits (378),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 92/154 (60%), Positives = 108/154 (70%), Gaps = 11/154 (7%)
 Frame = +1

Query  391  MTKRISLRSPGSG---REPLLNPARDSSSGPEAVRKARFAEVAGGTTADIAAVCCCCPCG  561
            MTK+I LR+P S    R+PLL       +G     K R AEV GGTTA+  AVCCCCPCG
Sbjct  1    MTKQIVLRAPPSYTDRRQPLLT---QEETGSRRGSK-RVAEVVGGTTAECVAVCCCCPCG  56

Query  562  LVNLVVLAVYKLPAGICRKAIRSKRRRKMMKNGMWPVRHCSCPDSEL-QIHPISSPSAVA  738
            LVNL+VLAVYK+PAG+CRKA+R KRRRK+   G  P R C C D EL Q+HP+  P   A
Sbjct  57   LVNLLVLAVYKVPAGLCRKALRQKRRRKLKNGGHLPPRKCGCNDVELFQLHPLPGPLLTA  116

Query  739  AALESDNEVVELEKEMWDRFYGAGFWRSPSQRTE  840
               ESD +VVELEKEMWD+FY  GFWRSPSQR++
Sbjct  117  ---ESDKDVVELEKEMWDKFYSTGFWRSPSQRSD  147



>ref|XP_006339183.1| PREDICTED: uncharacterized protein LOC102590923 [Solanum tuberosum]
Length=171

 Score =   139 bits (350),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 77/124 (62%), Positives = 95/124 (77%), Gaps = 6/124 (5%)
 Frame = +1

Query  490  ARFAEVAGGTTADIAAVCCCCPCGLVNLVVLAVYKLPAGICRKAIRSKRRRKMMKNGMWP  669
            AR AEVAGGTTA+ AAV CCCPCG+ NL+VLAVYK+PAG+CRKA+R  RR ++MK G+ P
Sbjct  48   ARLAEVAGGTTAECAAVACCCPCGIANLLVLAVYKVPAGLCRKALRKNRRNRLMKKGLLP  107

Query  670  VR---HCSCPDSELQIHPISSPSAV---AAALESDNEVVELEKEMWDRFYGAGFWRSPSQ  831
                 HCSC + EL  + ISSP AV   A  L +D + +ELEKEMW++FYG GFWRSPSQ
Sbjct  108  ASGSGHCSCDEMELHAYQISSPIAVVGGAGNLATDKDALELEKEMWEKFYGTGFWRSPSQ  167

Query  832  RTEV  843
            R+E+
Sbjct  168  RSEM  171



>ref|XP_002270752.1| PREDICTED: uncharacterized protein LOC100259819 [Vitis vinifera]
Length=151

 Score =   138 bits (348),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 89/157 (57%), Positives = 110/157 (70%), Gaps = 16/157 (10%)
 Frame = +1

Query  391  MTKRISLRSPG-SGREPLLNPARDSSSGPEAVRKARFAEVAGGTTADIAAVCCCCPCGLV  567
            MT++I +R P  + R+PLL  A  SSSG       RFAEVAG TTA+ AAV CCCPCGLV
Sbjct  1    MTRQIVMRPPSLNRRQPLL--ASQSSSG-----SIRFAEVAGETTAECAAVACCCPCGLV  53

Query  568  NLVVLAVYKLPAGICRKAIRSKRRRKMMKNGMWPVRH----CSCPDSELQIHPISSPSAV  735
            NL+VLAVYK+PAG+CR+A++ KR R+M+K G+   R     C C D+ELQIHPIS     
Sbjct  54   NLLVLAVYKVPAGLCRRALKKKRLRRMIKKGLLQPRRRRCPCGCDDTELQIHPISGDVTD  113

Query  736  A----AALESDNEVVELEKEMWDRFYGAGFWRSPSQR  834
            A     + ES+ EV++LEKEMWD+FY  GFWRS SQR
Sbjct  114  ADISVKSNESEQEVMDLEKEMWDKFYSTGFWRSSSQR  150



>ref|XP_004249389.1| PREDICTED: uncharacterized protein LOC101268731 [Solanum lycopersicum]
Length=172

 Score =   136 bits (343),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 75/123 (61%), Positives = 93/123 (76%), Gaps = 7/123 (6%)
 Frame = +1

Query  496  FAEVAGGTTADIAAVCCCCPCGLVNLVVLAVYKLPAGICRKAIRSKRRRKMMKNGMWPVR  675
             AEVAGGTTA+ AAV CCCPCG+ NL+VLAVYK+PAG+CRKA+R  RR ++MK G+ P  
Sbjct  50   LAEVAGGTTAECAAVACCCPCGIANLLVLAVYKVPAGLCRKALRKNRRDRLMKKGLLPAT  109

Query  676  ---HCSCPDSELQIHPISSPSAVAAA----LESDNEVVELEKEMWDRFYGAGFWRSPSQR  834
               HCSC + EL  + ISSP A+  A    L +D + +ELEKEMWD+FYG GFWRSPSQR
Sbjct  110  GSGHCSCDEMELHAYQISSPIAMVGAGAGNLATDKDALELEKEMWDKFYGTGFWRSPSQR  169

Query  835  TEV  843
            +E+
Sbjct  170  SEM  172



>ref|XP_006348427.1| PREDICTED: uncharacterized protein LOC102594000 [Solanum tuberosum]
Length=159

 Score =   133 bits (334),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 95/161 (59%), Positives = 117/161 (73%), Gaps = 12/161 (7%)
 Frame = +1

Query  391  MTKRISLRSPGS-----GREPLLNPARDSSSGPEAVRKARFAEVAGGTTADIAAVCCCCP  555
            MTK+I LR+P S      R+PLL+    SS G   VRKAR AEVAGGT A+ AAVCCCCP
Sbjct  1    MTKQIVLRAPSSLSIDRRRQPLLSNQDTSSRG--GVRKARLAEVAGGTAAECAAVCCCCP  58

Query  556  CGLVNLVVLAVYKLPAGICRKAIRSKRRRKMMKNGMWPVRHCSCPDSELQIHPISSPSAV  735
            CGLVNL+V+AVYKLPAG+CRKA+R KRRR+ MK  +   +  SC DSEL IHPI   + +
Sbjct  59   CGLVNLLVMAVYKLPAGLCRKALRRKRRRRQMKKKILQSQCSSCDDSELSIHPIDGATTL  118

Query  736  AA-----ALESDNEVVELEKEMWDRFYGAGFWRSPSQRTEV  843
            A      +L+SD +VV LEKEMW +FYG GFWRSPSQ++++
Sbjct  119  AVVDGGNSLKSDKDVVALEKEMWSKFYGGGFWRSPSQKSDM  159



>ref|XP_009779394.1| PREDICTED: uncharacterized protein LOC104228610 [Nicotiana sylvestris]
Length=163

 Score =   133 bits (334),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 99/159 (62%), Positives = 121/159 (76%), Gaps = 14/159 (9%)
 Frame = +1

Query  391  MTKRISLRSPGS-----GREPLLNPARDSSSGPEAVRKARFAEVAGGTTADIAAVCCCCP  555
            MTK+I LR+P S      R+PLL+  +DSSS     + ARFAEVAGGTTA+ AAVCCCCP
Sbjct  1    MTKQIVLRAPSSLSVDRRRQPLLS-GQDSSSRGGVRKAARFAEVAGGTTAECAAVCCCCP  59

Query  556  CGLVNLVVLAVYKLPAGICRKAIRSKRRRKMMKNGMWPVRHCSCPDSELQIHPI-SSPSA  732
            CGLVNL+VLAVYKLPAG+CRKA+R KRRR++MK G+         D+EL IHPI ++P A
Sbjct  60   CGLVNLLVLAVYKLPAGLCRKALRKKRRRRLMKKGLL----VRSEDAELSIHPIGTTPLA  115

Query  733  V---AAALESDNEVVELEKEMWDRFYGAGFWRSPSQRTE  840
            V     +LESD +VV LEKEMW++FYGAGFWRSPSQR++
Sbjct  116  VGDGGNSLESDKDVVALEKEMWNKFYGAGFWRSPSQRSD  154



>ref|XP_010315839.1| PREDICTED: uncharacterized protein LOC101264148 [Solanum lycopersicum]
Length=159

 Score =   132 bits (333),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 94/161 (58%), Positives = 119/161 (74%), Gaps = 12/161 (7%)
 Frame = +1

Query  391  MTKRISLRSPGS-----GREPLLNPARDSSSGPEAVRKARFAEVAGGTTADIAAVCCCCP  555
            MTK+I LR+P S      R+PLL+    SS G   VRKAR AEVAGGTTA+ AAVCCCCP
Sbjct  1    MTKQIVLRAPSSLSIDRRRQPLLSNQDTSSRG--GVRKARLAEVAGGTTAECAAVCCCCP  58

Query  556  CGLVNLVVLAVYKLPAGICRKAIRSKRRRKMMKNGMWPVRHCSCPDSELQIHPISSPSAV  735
            CGLVNL+V+A+YKLPAG+CRKA+R KRRR++MK  +   +  SC DS+L IH I   + +
Sbjct  59   CGLVNLLVMAIYKLPAGLCRKALRRKRRRRLMKKKILQSQCSSCDDSDLSIHHIDGATTL  118

Query  736  AA-----ALESDNEVVELEKEMWDRFYGAGFWRSPSQRTEV  843
            A      +L+SD +VV LEKEMW +FYGAGFWRSPSQ++++
Sbjct  119  AVVDGGNSLKSDKDVVALEKEMWSKFYGAGFWRSPSQKSDM  159



>gb|EYU38705.1| hypothetical protein MIMGU_mgv1a015517mg [Erythranthe guttata]
Length=155

 Score =   132 bits (331),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 94/157 (60%), Positives = 118/157 (75%), Gaps = 8/157 (5%)
 Frame = +1

Query  391  MTKRISLRSPGSG---REPLLNPARDSSSGPEAVRKARFAEVAGGTTADIAAVCCCCPCG  561
            MT++I LR  GS    R+PLL  +  SS    +VRK R AE+AGGT A+ AAVCCCCPCG
Sbjct  1    MTRQIVLRPAGSMADRRQPLLENSDYSSQS--SVRKVRLAELAGGTAAECAAVCCCCPCG  58

Query  562  LVNLVVLAVYKLPAGICRKAIRSKRRRKMMKNGMWPVRHCSCPDSELQIHPISSPSAVAA  741
            LVNL+VLAVYKLPAG+CRKA+R KRRR++MK G+ P R CSC + E QIH ++ P AV +
Sbjct  59   LVNLLVLAVYKLPAGLCRKALRRKRRRRLMKMGLLPPRKCSCDEQEFQIHAVAPPLAVLS  118

Query  742  ALES---DNEVVELEKEMWDRFYGAGFWRSPSQRTEV  843
            ALES   + EV+EL+KEM ++FYG GFWRS S+R E+
Sbjct  119  ALESGTENEEVIELDKEMMEKFYGGGFWRSFSRRDEI  155



>ref|XP_009598143.1| PREDICTED: uncharacterized protein LOC104094007 [Nicotiana tomentosiformis]
Length=163

 Score =   127 bits (319),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 96/159 (60%), Positives = 119/159 (75%), Gaps = 14/159 (9%)
 Frame = +1

Query  391  MTKRISLRSPGS-----GREPLLNPARDSSSGPEAVRKARFAEVAGGTTADIAAVCCCCP  555
            MTK+I LR+P S      R+PLL+  +DS S     + ARFAEVAGGTTA+ AAVCCCCP
Sbjct  1    MTKQIVLRAPSSLSVDRRRQPLLS-GQDSYSRGGVRKAARFAEVAGGTTAECAAVCCCCP  59

Query  556  CGLVNLVVLAVYKLPAGICRKAIRSKRRRKMMKNGMWPVRHCSCPDSELQIHPI-SSPSA  732
            CGLVNL+VLAVYKLPAG+CRKA+R KRRR++MK G+         D+EL  HPI ++P A
Sbjct  60   CGLVNLLVLAVYKLPAGLCRKALRRKRRRRLMKKGLL----VRSEDTELSKHPIGTTPLA  115

Query  733  V---AAALESDNEVVELEKEMWDRFYGAGFWRSPSQRTE  840
            +     +LESD +VV LEKEMW++FYGAGFWRSPSQR++
Sbjct  116  MLDDGNSLESDKDVVALEKEMWNKFYGAGFWRSPSQRSD  154



>gb|KDO70694.1| hypothetical protein CISIN_1g040225mg [Citrus sinensis]
Length=172

 Score =   127 bits (320),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 83/166 (50%), Positives = 109/166 (66%), Gaps = 18/166 (11%)
 Frame = +1

Query  391  MTKRISLRSPG-SGREPLL-------NPARDSSSGPEAVRKARFAEVAGGTTADIAAVCC  546
            M+++I LRSP  + R+PLL       +     S+       + FAEVAGGTTA+ AAVCC
Sbjct  1    MSRQIVLRSPTVNKRQPLLLSSSGSSSSNGSKSTRSGGGSGSSFAEVAGGTTAECAAVCC  60

Query  547  CCPCGLVNLVVLAVYKLPAGICRKAIRSKRRRKMMKNGMWPVR-----HCSCPDSELQIH  711
            CCPCGLVNL+V+A+YKLPAG+CRKA + KR+++++K G+ P R      C C D E+QIH
Sbjct  61   CCPCGLVNLLVMAIYKLPAGLCRKAWKEKRKQQLIKKGLLPKRKRSKCKCGCDDLEMQIH  120

Query  712  PISS-----PSAVAAALESDNEVVELEKEMWDRFYGAGFWRSPSQR  834
            P+             + ES+  VVELEKEMW+RFY AGFWR+ SQR
Sbjct  121  PVVDLQNCLTDRAMNSDESERRVVELEKEMWERFYSAGFWRTASQR  166



>ref|XP_008367356.1| PREDICTED: uncharacterized protein LOC103430987 [Malus domestica]
Length=171

 Score =   127 bits (320),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 84/166 (51%), Positives = 110/166 (66%), Gaps = 19/166 (11%)
 Frame = +1

Query  394  TKRISLRSPGSGREPLLNPARDSSSGPEAVRKARFAEVAGGTTADIAAVCCCCPCGLVNL  573
            ++++ LR   S R   L   + S+S       ARFAEV GGTTAD AAVCCCCP GLVNL
Sbjct  8    SRQLFLRQTSSPRRQXLLRTQVSTS------TARFAEVVGGTTADCAAVCCCCPWGLVNL  61

Query  574  VVLAVYKLPAGICRKAIRSKRRRKMMKNGMWPVRH--CSC--PDSELQIHP--------I  717
            +VLA+YK+PAG+CR+ ++ KRR++++K G+   R+  CSC    SELQ HP        I
Sbjct  62   LVLAIYKVPAGLCRRVLKKKRRQRLIKKGLLQPRNRKCSCGFAGSELQFHPMGLQCMAEI  121

Query  718  SSPSAVAAALES-DNEVVELEKEMWDRFYGAGFWRSPSQRTEVSQI  852
            ++ S   A  ES D +V++LEKEMWDRFY  GFWRSPSQR   S++
Sbjct  122  NNRSQKVADDESCDKDVMQLEKEMWDRFYSTGFWRSPSQREPSSKV  167



>ref|XP_006430012.1| hypothetical protein CICLE_v10012921mg [Citrus clementina]
 gb|ESR43252.1| hypothetical protein CICLE_v10012921mg [Citrus clementina]
Length=174

 Score =   127 bits (318),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 83/168 (49%), Positives = 109/168 (65%), Gaps = 20/168 (12%)
 Frame = +1

Query  391  MTKRISLRSPG-SGREPLL---------NPARDSSSGPEAVRKARFAEVAGGTTADIAAV  540
            M+++I LRSP  + R+PLL         +     S+       + FAEVAGGTTA+ AAV
Sbjct  1    MSRQIVLRSPTVNKRQPLLLSSSGSSTSSSNGSKSTRSGGGSGSSFAEVAGGTTAECAAV  60

Query  541  CCCCPCGLVNLVVLAVYKLPAGICRKAIRSKRRRKMMKNGMWPVR-----HCSCPDSELQ  705
            CCCCPCGLVNL+V+A+YKLPAG+CRKA + KR+++++K G+ P R      C C D E+Q
Sbjct  61   CCCCPCGLVNLLVMAIYKLPAGLCRKAWKEKRKQQLIKKGLLPKRKRSKCKCGCDDLEMQ  120

Query  706  IHPISS-----PSAVAAALESDNEVVELEKEMWDRFYGAGFWRSPSQR  834
            IHP+             + ES+  VVELEKEMW+RFY AGFWR+ SQR
Sbjct  121  IHPVVDLQNCLTDRAMNSDESERRVVELEKEMWERFYSAGFWRTASQR  168



>emb|CDY72642.1| BnaAnng41820D [Brassica napus]
Length=240

 Score =   127 bits (319),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 81/170 (48%), Positives = 97/170 (57%), Gaps = 32/170 (19%)
 Frame = +1

Query  433  EPLLNPARDSSSGPEAVRKARFAEVAGGTTADIAAVCCCCPCGLVNLVVLAVYKLPAGIC  612
             PLL  +  S S       +  AE  GGTTA  AAV CCCPCG+VNLVVLAVYK+P GIC
Sbjct  33   HPLLQRSLSSPSPNATCGGSTPAEFCGGTTASCAAVWCCCPCGIVNLVVLAVYKVPRGIC  92

Query  613  RKAIRSKRRRKMMKNGMWPVRHCS------CPDSELQIHPISSP----------------  726
            R+AIRS RR++++KNG+ P             +SE  I P+ S                 
Sbjct  93   RRAIRSHRRKQLVKNGILPPLPSGERVQRVFQNSEFAIFPLDSNDVSEEEDDGFFDPKYF  152

Query  727  ---SAVAAALESDNE-------VVELEKEMWDRFYGAGFWRSPSQRTEVS  846
               +AVAA L +D E       V+ LEKEMW+RFYGAGFWRSPSQR  VS
Sbjct  153  GKGAAVAAELTTDEETDEEDEAVLALEKEMWNRFYGAGFWRSPSQRESVS  202



>ref|XP_009121232.1| PREDICTED: uncharacterized protein LOC103846060 [Brassica rapa]
Length=240

 Score =   127 bits (318),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 76/148 (51%), Positives = 90/148 (61%), Gaps = 32/148 (22%)
 Frame = +1

Query  499  AEVAGGTTADIAAVCCCCPCGLVNLVVLAVYKLPAGICRKAIRSKRRRKMMKNGMWPVRH  678
            AE  GGTTA  AAV CCCPCG+VNLVVLAVYK+P GICR+AIRS RR++++KNG+ P   
Sbjct  55   AEFCGGTTASCAAVWCCCPCGIVNLVVLAVYKVPRGICRRAIRSHRRKQLVKNGILPPLP  114

Query  679  CS------CPDSELQIHPISSP-------------------SAVAAALESDNE-------  762
                      +SE  I P+ S                    +AVAA L +D E       
Sbjct  115  SGERVQRVFQNSEFAIFPLDSNDVSEEEDDGFFDPKYFGKGAAVAAELTTDEETDEEDEA  174

Query  763  VVELEKEMWDRFYGAGFWRSPSQRTEVS  846
            V+ LEKEMW+RFYGAGFWRSPSQR  VS
Sbjct  175  VLALEKEMWNRFYGAGFWRSPSQRESVS  202



>emb|CDY47923.1| BnaAnng09550D [Brassica napus]
Length=240

 Score =   126 bits (316),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 75/148 (51%), Positives = 90/148 (61%), Gaps = 32/148 (22%)
 Frame = +1

Query  499  AEVAGGTTADIAAVCCCCPCGLVNLVVLAVYKLPAGICRKAIRSKRRRKMMKNGMWPVRH  678
            AE  GGTTA  AAV CCCPCG+VNLVVLAVYK+P GICR+A+RS RR++++KNG+ P   
Sbjct  55   AEFCGGTTASCAAVWCCCPCGIVNLVVLAVYKVPRGICRRALRSHRRKQLVKNGILPPLP  114

Query  679  CS------CPDSELQIHPISSP-------------------SAVAAALESDNE-------  762
                      +SE  I P+ S                    +AVAA L +D E       
Sbjct  115  SGERVQRVFQNSEFAIFPLDSNDVSEEEDDVFFDPKYFGKGAAVAAELTTDEETDEEDEA  174

Query  763  VVELEKEMWDRFYGAGFWRSPSQRTEVS  846
            V+ LEKEMW+RFYGAGFWRSPSQR  VS
Sbjct  175  VLALEKEMWNRFYGAGFWRSPSQRESVS  202



>ref|XP_006481639.1| PREDICTED: uncharacterized protein LOC102612483 [Citrus sinensis]
Length=172

 Score =   124 bits (310),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 82/166 (49%), Positives = 109/166 (66%), Gaps = 18/166 (11%)
 Frame = +1

Query  391  MTKRISLRSPG-SGREPLL-------NPARDSSSGPEAVRKARFAEVAGGTTADIAAVCC  546
            M+++I LRSP  + R+PLL       +     S+       + FAEVAGGTTA+ AAVCC
Sbjct  1    MSRQIVLRSPTVNKRQPLLLSSSGSSSSNGSKSTRSGGGSGSSFAEVAGGTTAECAAVCC  60

Query  547  CCPCGLVNLVVLAVYKLPAGICRKAIRSKRRRKMMKNGMWPVRHCS-----CPDSELQIH  711
            CCPCGLVNL+V+A+YKLPAG+CRKA + KR+++++K G+ P R  S     C + E+QIH
Sbjct  61   CCPCGLVNLLVMAIYKLPAGLCRKAWKEKRKQQLIKKGLLPKRKRSKCKYGCDELEMQIH  120

Query  712  PISS-----PSAVAAALESDNEVVELEKEMWDRFYGAGFWRSPSQR  834
            P+             + ES+  VVELEKEMW+RFY AGFWR+ SQR
Sbjct  121  PVVDLQNCLTDRAMNSDESERRVVELEKEMWERFYSAGFWRTASQR  166



>ref|XP_011467168.1| PREDICTED: uncharacterized protein LOC101295551 [Fragaria vesca 
subsp. vesca]
Length=178

 Score =   123 bits (308),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 70/128 (55%), Positives = 89/128 (70%), Gaps = 12/128 (9%)
 Frame = +1

Query  487  KARFAEVAGGTTADIAAVCCCCPCGLVNLVVLAVYKLPAGICRKAIRSKRRRKMMKNGMW  666
            K R AEVAGGT A+ AAVCCCCPCGLVNL+VL +YK+PAG+CR+ +R KRR++++K G+ 
Sbjct  30   KDRLAEVAGGTAAECAAVCCCCPCGLVNLLVLVIYKVPAGLCRRVLRKKRRQRLIKKGLL  89

Query  667  PVRH----CSCPDSELQIHPISSPSAVAAALE--------SDNEVVELEKEMWDRFYGAG  810
               H    C C   ELQ HP+   S  +   +        SD +V++LEKEMWDRFYG G
Sbjct  90   QPSHLHCTCGCDGRELQFHPVGFESLSSEFKKYMMEDDESSDQDVIQLEKEMWDRFYGTG  149

Query  811  FWRSPSQR  834
            FWRSP+QR
Sbjct  150  FWRSPTQR  157



>gb|KJB61966.1| hypothetical protein B456_009G394800 [Gossypium raimondii]
 gb|KJB61967.1| hypothetical protein B456_009G394800 [Gossypium raimondii]
 gb|KJB61968.1| hypothetical protein B456_009G394800 [Gossypium raimondii]
Length=166

 Score =   122 bits (306),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 80/165 (48%), Positives = 103/165 (62%), Gaps = 17/165 (10%)
 Frame = +1

Query  364  ISAPLPL*IMTKRISLRSPGSGREPLLNP---ARDSSSGPEAVRKARFAEVAGGTTADIA  534
            +S+P+   I+  R SL+     R+PLL+    + DS   P      RF EV GGTTAD+A
Sbjct  1    MSSPM---ILKNRNSLQR----RQPLLHSRSNSVDSCITPRGNTNLRFGEVCGGTTADVA  53

Query  535  AVCCCCPCGLVNLVVLAVYKLPAGICRKAIRSKRRRKMMKNGMWPVR----HCSCPDSEL  702
            AVCCCCPCGL NLVVLA+YK+PAG+ R+A+R KR RK+ K G+   +    H  C D EL
Sbjct  54   AVCCCCPCGLANLVVLAIYKVPAGLYRRALRQKRLRKLHKKGLLQPKNHGAHFRCNDPEL  113

Query  703  Q-IHPISSPSAVAAALESDNEVVELEKEMWDRFYGAGFWRSPSQR  834
              +      + V+   E++   VELE EMW RFYG GFWRSPSQ+
Sbjct  114  LCLEDYFQDAGVSE--ETEKAAVELENEMWQRFYGTGFWRSPSQK  156



>ref|XP_011042545.1| PREDICTED: uncharacterized protein LOC105138206 [Populus euphratica]
Length=172

 Score =   122 bits (305),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 73/145 (50%), Positives = 99/145 (68%), Gaps = 13/145 (9%)
 Frame = +1

Query  430  REPLLNPARDSSSGPEAVRKARFAEVAGGTTADIAAVCCCCPCGLVNLVVLAVYKLPAGI  609
            R PLL   R ++S   +    RF E+AGGTTA+ AA+CCCCPCGLVNL+VL +YK+PAGI
Sbjct  12   RRPLL---RHANSSGSSCCSGRFGEIAGGTTAECAAICCCCPCGLVNLLVLTIYKIPAGI  68

Query  610  CRKAIRSKRRRKMMKNGMWPVR----HCSCPDSELQIHPISSPSAV------AAALESDN  759
            CR+A++ K+R+K++K G++P R     C C D EL IHP++             A++ + 
Sbjct  69   CRRALKRKQRKKLIKKGLFPPRGRGYGCGCDDPELHIHPMARVEDSLREFDGEEAVKKEE  128

Query  760  EVVELEKEMWDRFYGAGFWRSPSQR  834
             ++ LEKEMW+ FYG GFWRSPSQR
Sbjct  129  AMLRLEKEMWETFYGTGFWRSPSQR  153



>ref|XP_010036579.1| PREDICTED: uncharacterized protein LOC104425557 [Eucalyptus grandis]
 gb|KCW48185.1| hypothetical protein EUGRSUZ_K01912 [Eucalyptus grandis]
Length=178

 Score =   121 bits (304),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 86/174 (49%), Positives = 111/174 (64%), Gaps = 22/174 (13%)
 Frame = +1

Query  391  MTKRISLRSPG-SGREPLLNPARDSSSGPEAVRK--------ARFAEVAGGTTADIAAVC  543
            M ++I LR P  S REPLL  ++ +SS   A            RFAEVAGGT A+ A VC
Sbjct  1    MPRQIVLRPPSVSRREPLLRASKSTSSSASASSGSSAGGRGSVRFAEVAGGTAAECAVVC  60

Query  544  CCCPCGLVNLVVLAVYKLPAGICRKAIRSKRRRKMMKNGMWPVR----HCSCPDSELQIH  711
            CCCPCG+VNL++LAVYK+PAG+CR+A R  RR++++K G+   +     C C + ELQIH
Sbjct  61   CCCPCGIVNLILLAVYKVPAGLCRRAWRKTRRKRLIKKGLLSPKGRRLTCGCEEKELQIH  120

Query  712  PIS---------SPSAVAAALESDNEVVELEKEMWDRFYGAGFWRSPSQRTEVS  846
            P +         +P+A AA  E D +V +LEKEMW+RFY  GFWRSPSQR   S
Sbjct  121  PFAANEAAPEMKTPAAAAADAEVDKQVAKLEKEMWERFYSTGFWRSPSQREPAS  174



>ref|XP_002322767.1| hypothetical protein POPTR_0016s06660g [Populus trichocarpa]
 gb|EEF04528.1| hypothetical protein POPTR_0016s06660g [Populus trichocarpa]
Length=171

 Score =   119 bits (299),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 73/146 (50%), Positives = 99/146 (68%), Gaps = 14/146 (10%)
 Frame = +1

Query  430  REPLLNPARDSSSGPEAVRKARFAEVAGGTTADIAAVCCCCPCGLVNLVVLAVYKLPAGI  609
            R PLL   R ++S   +    RF E+AGGTTA+ AA+CCCCPCGLVNL+VL +YK+PAGI
Sbjct  12   RRPLL---RHANSSGSSCCSGRFGEIAGGTTAECAAICCCCPCGLVNLLVLTIYKIPAGI  68

Query  610  CRKAIRSKRRRKMMKNGMWPVRH-----CSCPDSELQIHPISSPSAV------AAALESD  756
            CR+A++ K+R+K++K G++P R       SC D EL IHP++             A++ +
Sbjct  69   CRRALKRKQRKKLIKKGLFPPRGRGYGCGSCDDPELHIHPMARVEDSLREFDGEEAVKKE  128

Query  757  NEVVELEKEMWDRFYGAGFWRSPSQR  834
              ++ LEKEMW+ FYG GFWRSPSQR
Sbjct  129  EAMLRLEKEMWETFYGTGFWRSPSQR  154



>ref|XP_009362653.1| PREDICTED: uncharacterized protein LOC103952714 [Pyrus x bretschneideri]
Length=167

 Score =   119 bits (298),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 79/159 (50%), Positives = 103/159 (65%), Gaps = 20/159 (13%)
 Frame = +1

Query  394  TKRISLRSPGS-GREPLLNPARDSSSGPEAVRKARFAEVAGGTTADIAAVCCCCPCGLVN  570
            ++++ LR   S  R+PLL     +SS       ARFAEVAGGT A   AVCCCCPCGL N
Sbjct  8    SRQLFLRQTSSPRRQPLLRTQVSTSS-------ARFAEVAGGTAAACRAVCCCCPCGLAN  60

Query  571  LVVLAVYKLPAGICRKAIRSKRRRKMMKNGMWPVRHCSC--PDSELQIHP--------IS  720
            L+VL +YK+PAG+CR+ ++ +RR++++K G+   R CSC    SELQ H         I+
Sbjct  61   LLVLVIYKVPAGLCRRVLKKRRRQRLIKKGLQH-RKCSCGFAGSELQFHTVGLECVAGIN  119

Query  721  SPSAVAAALES-DNEVVELEKEMWDRFYGAGFWRSPSQR  834
              S   +  ES D +V++LEKEMWDRFY  GFWRSPSQR
Sbjct  120  DMSQKVSDDESYDEDVMQLEKEMWDRFYSTGFWRSPSQR  158



>ref|XP_003553628.1| PREDICTED: uncharacterized protein LOC100794951 [Glycine max]
Length=195

 Score =   119 bits (299),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 71/166 (43%), Positives = 93/166 (56%), Gaps = 24/166 (14%)
 Frame = +1

Query  391  MTKRISLRSPGSG---REPLLNPARDSSSGPEAVRKARFAEVAGGTTADIAAVCCCCPCG  561
            M+ RI LR  G     R+PLL   R S          R  EV GGT A+  AVCCC PCG
Sbjct  1    MSNRIILRQAGGSTNRRQPLLLQRRPSKMA------TRVGEVVGGTAAECVAVCCCFPCG  54

Query  562  LVNLVVLAVYKLPAGICRKAIRSKRRRKMMKNGMW--PVRHCSC----PDSELQIHPISS  723
            + N ++LA+YK+PAG+ R+ ++ +R +KM+K G+     RHCSC      S  +I+P+ +
Sbjct  55   VANFLLLAIYKVPAGLYRRVLKKRRHQKMLKEGLRKPTRRHCSCGCCDDVSGSRIYPMCA  114

Query  724  PSAV------AAALESDNE---VVELEKEMWDRFYGAGFWRSPSQR  834
              AV      +   E DN       LEKEMWD+FYG GFWRS S R
Sbjct  115  NDAVDIKRLRSTTTELDNNDDATRALEKEMWDQFYGTGFWRSSSNR  160



>ref|XP_006577719.1| PREDICTED: uncharacterized protein LOC102660779 [Glycine max]
Length=175

 Score =   117 bits (294),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 71/171 (42%), Positives = 96/171 (56%), Gaps = 24/171 (14%)
 Frame = +1

Query  391  MTKRISLRSPG--SGREPLLNPARDSSSGPEAVRKARFAEVAGGTTADIAAVCCCCPCGL  564
            M+  I LR PG  + R   L   R S +        R  EV GGT A+  AVCCC PCG+
Sbjct  1    MSNGIILRQPGGSTNRRQPLQQRRPSKAA------TRVGEVVGGTAAECVAVCCCFPCGV  54

Query  565  VNLVVLAVYKLPAGICRKAIRSKRRRKMMKNGMW--PVRHCSC----PDSELQIHPISSP  726
             N ++LA+YK+PAG+CR+ ++ +R +KM+K G+     RHCSC      S  +I+P+ + 
Sbjct  55   ANFLLLAIYKVPAGLCRRVLKKRRHQKMLKEGLRKPTRRHCSCGCCDDVSGSRIYPMCAN  114

Query  727  SAV------AAALESDNE---VVELEKEMWDRFYGAGFWRSPSQRTEVSQI  852
             AV      +   E DN       LEKEMWD+FY  GFWRS S R EV ++
Sbjct  115  DAVDVKRLCSTTTELDNNDDATRALEKEMWDQFYSTGFWRSSSNR-EVREV  164



>ref|XP_010677586.1| PREDICTED: uncharacterized protein LOC104893191 [Beta vulgaris 
subsp. vulgaris]
Length=183

 Score =   117 bits (294),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 75/174 (43%), Positives = 102/174 (59%), Gaps = 33/174 (19%)
 Frame = +1

Query  400  RISLRSPGSG------REPLLNPARDSSSGPEAVRKARFAEVAGGTTADIAAVCCCCPCG  561
            +I LR  GSG      R+PLL+    +SS   +    R AEVAGGTTA+ AAV CCCPC 
Sbjct  5    KIVLRPTGSGSTVYRRRQPLLH----ASSSSWSSTSGRMAEVAGGTTAECAAVWCCCPCS  60

Query  562  LVNLVVLAVYKLPAGICRKAIRSKRRRKMMKNGMWPVR----------HCSCPDSELQIH  711
            LVNL+VL VYK+PAGIC+KA+R +RR++M K G+ P+            C C    + + 
Sbjct  61   LVNLLVLVVYKVPAGICKKALRMRRRKQMFKKGLLPLPSSAPSSRRSCECKCTSHHVDLD  120

Query  712  PISSPSAVAAALE-------------SDNEVVELEKEMWDRFYGAGFWRSPSQR  834
             + + +    A+              +D E+++LE+EMW+RFY  GFWRSPSQR
Sbjct  121  GVGNKTEELMAVVVMGGTSSDENINITDKELMQLEEEMWERFYSTGFWRSPSQR  174



>ref|XP_011077779.1| PREDICTED: uncharacterized protein LOC105161694 [Sesamum indicum]
Length=157

 Score =   116 bits (291),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 83/143 (58%), Positives = 111/143 (78%), Gaps = 7/143 (5%)
 Frame = +1

Query  430  REPLLNPARDSSSGPEAVR-KARFAEVAGGTTADIAAVCCCCPCGLVNLVVLAVYKLPAG  606
            R+PLL+    SS G   VR  AR AEVAGGT A+ AAVCCCCPCGLV+L+VLAVYK+PAG
Sbjct  17   RQPLLSGVDYSSRG--GVRSNARLAEVAGGTAAECAAVCCCCPCGLVDLLVLAVYKVPAG  74

Query  607  ICRKAIRSKRRRKMMKNGMWPVRHCSCPDSELQIHPISSPSAVAAALES----DNEVVEL  774
            +CRKA+R KRRRK+MK G+ P R+C C + E++IHP+++P ++ ++LES    D EV+EL
Sbjct  75   LCRKALRKKRRRKLMKMGVLPRRNCHCDEHEVEIHPVTAPLSMVSSLESGPDTDKEVIEL  134

Query  775  EKEMWDRFYGAGFWRSPSQRTEV  843
            +KEM ++F+  GFWRS S+R E+
Sbjct  135  DKEMLEKFFSGGFWRSSSRRNEL  157



>ref|XP_011652052.1| PREDICTED: uncharacterized protein LOC105434984 [Cucumis sativus]
 gb|KGN59241.1| hypothetical protein Csa_3G784360 [Cucumis sativus]
Length=159

 Score =   115 bits (288),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 76/163 (47%), Positives = 104/163 (64%), Gaps = 18/163 (11%)
 Frame = +1

Query  391  MTKRISLRSPGSGR-EPLLNPARDSSSGPEAVRKARFAEVAGGTTADIAAVCCCCPCGLV  567
            M+  I  R P S R +PLL     S S        RFAEVAGGTTA+ AAVCCCCPC ++
Sbjct  1    MSNTIMFRPPSSNRRQPLLTSKSASGS-------VRFAEVAGGTTAECAAVCCCCPCVVI  53

Query  568  NLVVLAVYKLPAGICRKAIRSKRRRKMMKNGMWPVR-----HCSCPDSELQIHP-----I  717
            N +VLA+YK+PAG+CR+A+R+KRR+++ K G+ P R          ++++QI        
Sbjct  54   NFLVLAIYKVPAGLCRRALRTKRRQRLKKKGVTPARRGRFSFGGYDETDIQILSAGKLVY  113

Query  718  SSPSAVAAALESDNEVVELEKEMWDRFYGAGFWRSPSQRTEVS  846
            SS      A+E++ +V+ELEKEMW+ FY  GFWRSPS+R + S
Sbjct  114  SSEPRGQQAVETERKVMELEKEMWEIFYSTGFWRSPSRRDQTS  156



>ref|XP_010278068.1| PREDICTED: uncharacterized protein LOC104612373 [Nelumbo nucifera]
 ref|XP_010248087.1| PREDICTED: uncharacterized protein LOC104591015 [Nelumbo nucifera]
Length=129

 Score =   114 bits (285),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 57/117 (49%), Positives = 79/117 (68%), Gaps = 4/117 (3%)
 Frame = +1

Query  487  KARFAEVAGGTTADIAAVCCCCPCGLVNLVVLAVYKLPAGICRKAI--RSKRRRKMMKNG  660
            + RF+E+AG T A+  AVCCC PCG+V+++VLAVY++PAG+CRKA+  RS++R+K     
Sbjct  11   RIRFSELAGETAAECMAVCCCFPCGVVDMLVLAVYRVPAGLCRKAMKKRSQQRKKGSPLS  70

Query  661  MWPVRHCSCPDSELQIHPISSPSAVAAALESDNEVVELEKEMWDRFYGAGFWRSPSQ  831
               V    C ++E +IH +S       A     EV+EL+KEMWDRFY  GFWRS S+
Sbjct  71   QQQVFPYGCDEAEFEIHIVSQMELDEIA--KTKEVIELDKEMWDRFYETGFWRSLSR  125



>ref|XP_008359520.1| PREDICTED: uncharacterized protein LOC103423227 [Malus domestica]
Length=167

 Score =   113 bits (283),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 80/167 (48%), Positives = 106/167 (63%), Gaps = 20/167 (12%)
 Frame = +1

Query  394  TKRISLRSPGS-GREPLLNPARDSSSGPEAVRKARFAEVAGGTTADIAAVCCCCPCGLVN  570
            ++++ LR   S  R+PLL     +SS       AR AEVAGGT AD AAVCCCCPCGL N
Sbjct  8    SRQLFLRQTSSPRRQPLLRTQVSTSS-------ARLAEVAGGTAADCAAVCCCCPCGLAN  60

Query  571  LVVLAVYKLPAGICRKAIRSKRRRKMMKNGMWPVRHCSC--PDSELQIHP--------IS  720
            L+VL +YK+PAG+CR+ ++ +RR++++K G+   R CSC    SELQ           I+
Sbjct  61   LLVLVIYKVPAGLCRRVLKKRRRQRLIKKGLQH-RKCSCGFAGSELQFDTVGLECVAGIN  119

Query  721  SPSAVAAALES-DNEVVELEKEMWDRFYGAGFWRSPSQRTEVSQISG  858
              S   +  ES D +V++LEKEMWDRFY  GFWRSPSQR     ++G
Sbjct  120  DMSQKISDDESYDEDVMQLEKEMWDRFYSTGFWRSPSQREPSKVLTG  166



>gb|KFK38537.1| hypothetical protein AALP_AA3G126800 [Arabis alpina]
Length=242

 Score =   112 bits (280),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 75/171 (44%), Positives = 94/171 (55%), Gaps = 33/171 (19%)
 Frame = +1

Query  433  EPLLNPARDSSSGPEAVRKARFAEVAGGTTADIAAVCCCCPCGLVNLVVLAVYKLPAGIC  612
            +PLL  +  + S       +  AE  GGTTA  AAV CCCPCGLVNL+VLA+YK+P GIC
Sbjct  35   QPLLQRSLSTPSPRATCGGSTPAEFCGGTTASCAAVWCCCPCGLVNLLVLAIYKVPKGIC  94

Query  613  RKAIRSKRRRKMMKNGMWPVRHCS---------CPDSELQIHPIS---------------  720
            R+A+R++RR+ ++KNGM P                +SE  IHP+                
Sbjct  95   RRALRNRRRKHLVKNGMLPPLPIDGKTERIQRVFQNSEFAIHPLDSNDVSDDDDDDDFLD  154

Query  721  ----SPSAVAAALE-----SDNEVVELEKEMWDRFYGAGFWRSPSQRTEVS  846
                  S  AA  E      D  V+ LEKEMW+RFYGAGFWRSPSQR  +S
Sbjct  155  LKYIGKSTTAAKEEEIGDDDDAAVLALEKEMWNRFYGAGFWRSPSQRESIS  205



>gb|KJB16515.1| hypothetical protein B456_002G233600 [Gossypium raimondii]
Length=173

 Score =   110 bits (275),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 63/123 (51%), Positives = 82/123 (67%), Gaps = 8/123 (7%)
 Frame = +1

Query  490  ARFAEVAGGTTADIAAVCCCCPCGLVNLVVLAVYKLPAGICRKAIRSKRRRKMMKNGM--  663
            A F E+ GG TA+  A+CCC P G+ N +VLA+YK+PAG+CR+AIR ++RRK++K G+  
Sbjct  51   ASFGEICGGATAECTAICCCAPFGIANFLVLAMYKIPAGLCRRAIRQRQRRKLVKKGLIQ  110

Query  664  -WPVRHCSCPDSELQIHPISSP-SAVAAALESDNEVVELEKEMWDRFYGAGFWRSPSQRT  837
             W  R C      LQI P+      V  + E++  V ELEKEMW RFYG GFWRSPSQR 
Sbjct  111  PWDHRGC----EGLQIRPVEEIFPIVNGSEETEKAVNELEKEMWQRFYGTGFWRSPSQRE  166

Query  838  EVS  846
            + S
Sbjct  167  DDS  169



>ref|XP_010464901.1| PREDICTED: uncharacterized protein LOC104745388 [Camelina sativa]
Length=254

 Score =   112 bits (279),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 74/168 (44%), Positives = 93/168 (55%), Gaps = 30/168 (18%)
 Frame = +1

Query  433  EPLLNPARDSSSGPEAVRKARFAEVAGGTTADIAAVCCCCPCGLVNLVVLAVYKLPAGIC  612
            +PLL  +  S S       +  AE  GGTTA  AAV CCCPCGLVNL+VLA+YK+P GIC
Sbjct  35   QPLLQRSLSSPSPRATCGGSTPAEFCGGTTASCAAVWCCCPCGLVNLLVLAIYKVPKGIC  94

Query  613  RKAIRSKRRRKMMKNGMWPVRHCS----CPDSELQIHPISSPSAVAAALESD--------  756
            R+AIR++RR++++KNG+ P           +SE  IHP+ S        + +        
Sbjct  95   RRAIRNRRRKQLVKNGILPPLPTDERRVFQNSEFAIHPLDSEDVSEDDDDDNFLDLKYIG  154

Query  757  ------------------NEVVELEKEMWDRFYGAGFWRSPSQRTEVS  846
                                VV LEKEMW+RFYGAGFWRSPSQR  VS
Sbjct  155  KPISAGFTTEEEETDEDDEAVVALEKEMWNRFYGAGFWRSPSQRESVS  202



>ref|XP_006296618.1| hypothetical protein CARUB_v10014493mg [Capsella rubella]
 gb|EOA29516.1| hypothetical protein CARUB_v10014493mg [Capsella rubella]
Length=244

 Score =   111 bits (278),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 80/174 (46%), Positives = 98/174 (56%), Gaps = 36/174 (21%)
 Frame = +1

Query  433  EPLLNPARDSSSGPEAVRKARFAEVAGGTTADIAAVCCCCPCGLVNLVVLAVYKLPAGIC  612
            +PLL  +  S S       +  AE  GGTTA  AAV CCCPCGLVNL+VLA+YK+P GIC
Sbjct  33   QPLLQRSLSSPSPRATCGGSTPAEFCGGTTASCAAVWCCCPCGLVNLLVLAIYKVPKGIC  92

Query  613  RKAIRSKRRRKMMKNGMWPVRHCS---------CPDSELQIHP-----------------  714
            R+AIRS+RR++++K+GM P    +           +SE  IHP                 
Sbjct  93   RRAIRSRRRKQLVKSGMLPPLLSAGKNERMQRVFQNSEFAIHPLDSEDVSEDEDDDNFLD  152

Query  715  ---ISSP-SAVAA------ALESDNEVVELEKEMWDRFYGAGFWRSPSQRTEVS  846
               I  P +AV A        E D  V+ LEKEMW+RFYGAGFWRSPSQR  VS
Sbjct  153  LKYIGKPVTAVFATEEEEETGEDDAAVLALEKEMWNRFYGAGFWRSPSQRESVS  206



>ref|XP_002524096.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF38306.1| conserved hypothetical protein [Ricinus communis]
Length=252

 Score =   111 bits (278),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 73/143 (51%), Positives = 95/143 (66%), Gaps = 15/143 (10%)
 Frame = +1

Query  451  ARDSSSGPEAVRKARFAEVAGGTTADIAAVCCCCPCGLVNLVVLAVYKLPAGICRKAIRS  630
            A  S+S   ++R   FAE AGGTTA+ AA+CCCCPCGLVNL+ LA+YK+PAG+CR+A+R 
Sbjct  89   AHSSASTNSSIRSGHFAEFAGGTTAECAAICCCCPCGLVNLLYLAIYKVPAGLCRRALRR  148

Query  631  KRRRKMMKNGMWPVR----HCSCPDSELQIHP-----------ISSPSAVAAALESDNEV  765
            KRR+++MK G+ P R     C C ++E+QIHP                    A E D+ +
Sbjct  149  KRRKQLMKEGLLPARTKRCRCGCDETEIQIHPEMIRLDEEETENGDDDDNNVADEEDDAM  208

Query  766  VELEKEMWDRFYGAGFWRSPSQR  834
            V+LEKEMW+ FY  GFWRSPSQR
Sbjct  209  VKLEKEMWETFYSTGFWRSPSQR  231



>ref|XP_002882743.1| hypothetical protein ARALYDRAFT_478514 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH59002.1| hypothetical protein ARALYDRAFT_478514 [Arabidopsis lyrata subsp. 
lyrata]
Length=251

 Score =   111 bits (278),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 79/173 (46%), Positives = 99/173 (57%), Gaps = 35/173 (20%)
 Frame = +1

Query  433  EPLLNPARDSSSGPEAVRKARFAEVAGGTTADIAAVCCCCPCGLVNLVVLAVYKLPAGIC  612
            +PLL  +  S S   +   +  AE  GGTTA  AAV CCCPCGLVNL+VLA+YK+P GIC
Sbjct  33   QPLLQRSLSSPSPRASCGGSTPAEFCGGTTASCAAVWCCCPCGLVNLLVLAIYKVPKGIC  92

Query  613  RKAIRSKRRRKMMKNGMWPVRHCS---------CPDSELQIHPISSP-------------  726
            R+AIR++RR++++KNG+ P                +SE  IHP+ S              
Sbjct  93   RRAIRNRRRKQLVKNGILPPLPTDGKNERMQRVFQNSEFAIHPLDSDDVSDDEDDDNFLD  152

Query  727  -----SAVAAA--------LESDNEVVELEKEMWDRFYGAGFWRSPSQRTEVS  846
                  +VAAA         E D  V+ LEKEMW+RFYGAGFWRSPSQR  VS
Sbjct  153  LKYIGKSVAAAGFTTEEETDEDDEAVLALEKEMWNRFYGAGFWRSPSQRESVS  205



>ref|XP_010497983.1| PREDICTED: uncharacterized protein LOC104775762 [Camelina sativa]
Length=254

 Score =   111 bits (277),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 76/168 (45%), Positives = 97/168 (58%), Gaps = 30/168 (18%)
 Frame = +1

Query  433  EPLLNPARDSSSGPEAVRKARFAEVAGGTTADIAAVCCCCPCGLVNLVVLAVYKLPAGIC  612
            +PLL  +  S S       +  AE  GGTTA  AAV CCCPCGLVNL+VLA+YK+P GIC
Sbjct  34   QPLLQRSLSSPSPRATCGGSTPAEFCGGTTASCAAVWCCCPCGLVNLLVLAIYKVPKGIC  93

Query  613  RKAIRSKRRRKMMKNGMWPVRHCS----CPDSELQIHPISSPSA----------------  732
            R+AIR++RR++++KNG+ P           +SE  IHP+ S                   
Sbjct  94   RRAIRNRRRKQLVKNGILPPLPTDERRVFQNSEFAIHPLDSEDVSEDDDDDNFLDLKYIG  153

Query  733  --VAAALESDNE--------VVELEKEMWDRFYGAGFWRSPSQRTEVS  846
              +AA   ++ E        V+ LEKEMW+RFYGAGFWRSPSQR  VS
Sbjct  154  KPIAAGFTTEEEETDEDDEAVLALEKEMWNRFYGAGFWRSPSQRESVS  201



>ref|XP_007028055.1| Uncharacterized protein TCM_023118 [Theobroma cacao]
 gb|EOY08557.1| Uncharacterized protein TCM_023118 [Theobroma cacao]
Length=180

 Score =   108 bits (271),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 85/170 (50%), Positives = 110/170 (65%), Gaps = 22/170 (13%)
 Frame = +1

Query  391  MTKRISLRSPGS--GREPLLNPARDSSSGPE------------AVRKARFAEVAGGTTAD  528
            M+++I LR+P S   R+PLL     SSS               + + A+F E  G TTA+
Sbjct  1    MSRQIILRTPTSVRRRQPLLQSRSSSSSCSSSVDDGGSSTRRTSQKSAKFGEFCGETTAE  60

Query  529  IAAVCCCCPCGLVNLVVLAVYKLPAGICRKAIRSKRRRKMMKNGMWPVR----HCSCPDS  696
             AA+CCCCPCG+ NL+VLA+YK+PAG+CR+A+R KRRRK++K G+   R    HC C DS
Sbjct  61   CAAICCCCPCGIANLLVLAIYKVPAGLCRRALRQKRRRKLLKKGLLQPRTHRGHCGCDDS  120

Query  697  ELQIHPI----SSPSAVAAALESDNEVVELEKEMWDRFYGAGFWRSPSQR  834
            ELQ+HP+         V  + E++  VVELEKEMW RFYG GFWRSPSQR
Sbjct  121  ELQVHPVVCLEDFFPDVEVSEEAEKAVVELEKEMWQRFYGTGFWRSPSQR  170



>ref|XP_010486837.1| PREDICTED: uncharacterized protein LOC104764926 [Camelina sativa]
Length=256

 Score =   110 bits (275),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 77/171 (45%), Positives = 95/171 (56%), Gaps = 33/171 (19%)
 Frame = +1

Query  433  EPLLNPARDSSSGPEAVRKARFAEVAGGTTADIAAVCCCCPCGLVNLVVLAVYKLPAGIC  612
            +PLL  +  S S       +  AE  GGTTA  AAV CCCPCGLVNL+VLA+YK+P GIC
Sbjct  34   QPLLQRSLSSPSPRATCGGSTPAEFCGGTTASCAAVWCCCPCGLVNLLVLAIYKVPKGIC  93

Query  613  RKAIRSKRRRKMMKNGMWPVRHCS-------CPDSELQIHP-------------------  714
            R+AIR++RR++++KNG+ P              +SE  IHP                   
Sbjct  94   RRAIRNRRRKQLVKNGILPPLPTDERRMQRVFQNSEFAIHPLDSEDVSEDDDDDNFLDLK  153

Query  715  -ISSPSAVA------AALESDNEVVELEKEMWDRFYGAGFWRSPSQRTEVS  846
             I  P +V          E D  V+ LEKEMW+RFYGAGFWRSPSQR  VS
Sbjct  154  YIGKPISVGFTTEEEETDEDDEAVLALEKEMWNRFYGAGFWRSPSQRESVS  204



>ref|NP_566397.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AAF02136.1|AC009918_8 unknown protein [Arabidopsis thaliana]
 gb|ACF75544.1| At3g11690 [Arabidopsis thaliana]
 gb|AEE75084.1| uncharacterized protein AT3G11690 [Arabidopsis thaliana]
Length=252

 Score =   109 bits (273),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 77/172 (45%), Positives = 98/172 (57%), Gaps = 34/172 (20%)
 Frame = +1

Query  433  EPLLNPARDSSSGPEAVRKARFAEVAGGTTADIAAVCCCCPCGLVNLVVLAVYKLPAGIC  612
            +PLL  +  S S   +   +  AE  GGTTA  AAV CCCPCGLVNL+VLA+YK+P GIC
Sbjct  33   QPLLQRSLSSPSPRASCGGSTPAEFCGGTTASCAAVWCCCPCGLVNLLVLAIYKVPKGIC  92

Query  613  RKAIRSKRRRKMMKNGMWPVRHCS---------CPDSELQIHPISSP-------------  726
            R+AIRS+RR++++KNG+ P                +SE  IHP+ S              
Sbjct  93   RRAIRSRRRKQLVKNGILPPLPTDGKNERMQRVFQNSEFAIHPLDSDDVSDDEDDDNFLD  152

Query  727  -----SAVAAALESDNE-------VVELEKEMWDRFYGAGFWRSPSQRTEVS  846
                  +VA    ++ E       V+ LEKEMW+RFYGAGFWRSPSQR  VS
Sbjct  153  LKYIGKSVATGFTTEEETDEDDEAVLALEKEMWNRFYGAGFWRSPSQRESVS  204



>ref|XP_011044152.1| PREDICTED: uncharacterized protein LOC105139423 [Populus euphratica]
Length=168

 Score =   107 bits (267),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 68/170 (40%), Positives = 88/170 (52%), Gaps = 26/170 (15%)
 Frame = +1

Query  391  MTKR-ISLRSPGSGR--EPLLNPARDSSSGPEA---------VRKARFAEVAGGTTADIA  534
            MT++ I LRSP S R  +PLL  A  S   P            +   F EVAGGT    A
Sbjct  1    MTRQGILLRSPSSNRRMQPLLTEATGSKMVPTGEGREKNLARTKTQSFGEVAGGT----A  56

Query  535  AVCCCCPCGLVNLVVLAVYKLPAGICRKAIRSKRRRKMMKNGMWPVRHCSCPDSELQIHP  714
            AVCCCCPC ++NL+VLAVYK+PA +C+KA    R RK  +     +   S    E ++  
Sbjct  57   AVCCCCPCTVINLLVLAVYKVPACLCKKAKTRHRLRKKKQKERSLLSPSSGGSREEELQS  116

Query  715  ISSPSAVAAA----------LESDNEVVELEKEMWDRFYGAGFWRSPSQR  834
                + V              + + E  +LEK+MWD+FY  GFWRSPSQR
Sbjct  117  EKKATEVVEKGICCDQHDHNHDEETEAADLEKQMWDQFYNTGFWRSPSQR  166



>ref|XP_008350240.1| PREDICTED: uncharacterized protein LOC103413552 [Malus domestica]
Length=185

 Score =   107 bits (267),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 70/134 (52%), Positives = 90/134 (67%), Gaps = 12/134 (9%)
 Frame = +1

Query  490  ARFAEVAGGTTADIAAVCCCCPCGLVNLVVLAVYKLPAGICRKAIRSKRRRKMMKNGMWP  669
            AR AEVAGGT AD AAVCCCCPCGL NL+VL +YK+PAG+CR+ ++ +RR++++K G+  
Sbjct  52   ARLAEVAGGTAADCAAVCCCCPCGLANLLVLVIYKVPAGLCRRVLKKRRRQRLIKKGLQH  111

Query  670  VRHCSC--PDSELQIHP--------ISSPSAVAAALES-DNEVVELEKEMWDRFYGAGFW  816
             R CSC    SELQ           I+  S   +  ES D +V++LEKEMWDRFY  G W
Sbjct  112  -RKCSCGFAGSELQFDTVGLECVAGINDMSQKISDDESYDEDVMQLEKEMWDRFYSTGXW  170

Query  817  RSPSQRTEVSQISG  858
            RSPSQR     ++G
Sbjct  171  RSPSQREPSKVLTG  184



>ref|XP_006407422.1| hypothetical protein EUTSA_v10021370mg [Eutrema salsugineum]
 gb|ESQ48875.1| hypothetical protein EUTSA_v10021370mg [Eutrema salsugineum]
Length=255

 Score =   108 bits (271),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 76/174 (44%), Positives = 96/174 (55%), Gaps = 36/174 (21%)
 Frame = +1

Query  433  EPLLNPARDSSSGPEAVRKARFAEVAGGTTADIAAVCCCCPCGLVNLVVLAVYKLPAGIC  612
            +PLL  +  S S       +  AE  GGTTA  AAV CCCPCGLVNL+VLA+YK+P G+C
Sbjct  33   QPLLQRSLSSPSPRATCGGSTPAEFCGGTTASCAAVWCCCPCGLVNLLVLAIYKVPRGLC  92

Query  613  RKAIRSKRRRKMMKNGMWPVRHCS----------CPDSELQIHPISSPSA----------  732
            R+A+R++RR++++KNG+ P                 +SE  IHP+ S             
Sbjct  93   RRALRNRRRKQLVKNGILPPLPTDGKKNERIQRVFQNSEFAIHPLDSNDVSEEDDDEDEF  152

Query  733  --------VAAAL--------ESDNEVVELEKEMWDRFYGAGFWRSPSQRTEVS  846
                     AA L        E D  V+ LEKEMW+RFYGAGFWRSPSQR  VS
Sbjct  153  LDLKYIGKSAAGLMTTDEETDEDDEAVLALEKEMWNRFYGAGFWRSPSQRESVS  206



>ref|XP_007163005.1| hypothetical protein PHAVU_001G198100g [Phaseolus vulgaris]
 gb|ESW34999.1| hypothetical protein PHAVU_001G198100g [Phaseolus vulgaris]
Length=177

 Score =   106 bits (264),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 68/162 (42%), Positives = 96/162 (59%), Gaps = 24/162 (15%)
 Frame = +1

Query  391  MTKRISLRSPGSGREPLLN--PARDSSSGPEAVRKARFAEVAGGTTADIAAVCCCCPCGL  564
            M+ R+ LR+  + R+PLL   P++ ++         R  EV GGT A+  AVCCC PCG+
Sbjct  1    MSNRMMLRA-SNRRQPLLQRRPSKLAT---------RVGEVVGGTAAECVAVCCCIPCGV  50

Query  565  VNLVVLAVYKLPAGICRKAIRSKRRRKMMKNGMW--PVRHCSCPDSE----LQIHPISSP  726
             N +VLA+YK+PA +CR+ +R +R RK+ K G+     RHCSC   E     +I P+ + 
Sbjct  51   ANFLVLAIYKVPAALCRRMLRQRRHRKIAKEGLLKPTRRHCSCGCCEDVNGSRIFPMCAN  110

Query  727  SAV------AAALESDNEVVELEKEMWDRFYGAGFWRSPSQR  834
             A       +   +SD+E + LEKEMWD+FY  GFWRS S R
Sbjct  111  DAFDIKRLHSPEPDSDDETLALEKEMWDQFYSTGFWRSSSNR  152



>ref|XP_010248041.1| PREDICTED: uncharacterized protein LOC104590965 [Nelumbo nucifera]
Length=122

 Score =   103 bits (258),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 63/124 (51%), Positives = 83/124 (67%), Gaps = 14/124 (11%)
 Frame = +1

Query  490  ARFAEVAGGTTADIAAVCCCCPCGLVNLVVLAVYKLPAGICRKAIRSKRRRKMMKNGMWP  669
             R AE+AG T AD A +CCCCPCGLVNL+VLAVYK+P G+CR+A+R  ++ K        
Sbjct  4    GRCAEIAGRTAADCAVICCCCPCGLVNLLVLAVYKVPTGLCRRALRKHKKLKQR------  57

Query  670  VRHCSC--PDSELQIHPISSPSAVA-----AALESDNEVVELEKEMWDRFYGAGFWRSPS  828
             R CSC   ++E+QIH +S  + VA     + L  D EV +LEKEM +RF+  GFWRSPS
Sbjct  58   -RRCSCGRDETEMQIHRVSFETLVADNSENSELIDDREVGQLEKEMLERFHNTGFWRSPS  116

Query  829  QRTE  840
            Q ++
Sbjct  117  QTSQ  120



>ref|XP_007145910.1| hypothetical protein PHAVU_007G278000g [Phaseolus vulgaris]
 gb|ESW17904.1| hypothetical protein PHAVU_007G278000g [Phaseolus vulgaris]
Length=176

 Score =   105 bits (261),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 77/169 (46%), Positives = 100/169 (59%), Gaps = 27/169 (16%)
 Frame = +1

Query  388  IMTKRISLRSPGSGR-EPLLNPARDSSSGPEAVRKARFAEVAGGTTADIAAVCCCCPCGL  564
            +M+K++ LR   S R +PLL   + S S P+A    R  E  GGT    AAVCCC   GL
Sbjct  3    VMSKKVILRPAVSRRRQPLL---QQSHSYPQA--GTRLGEAVGGT----AAVCCCFSFGL  53

Query  565  VNLVVLAVYKLPAGICRKAIRSKRRR-KMMKNGMWPVRH-----CSCPDSEL---QIHPI  717
             N+V LAVYK+PA + +KA+R KRRR + M  G+    H     C C D  +   +++P+
Sbjct  54   ANMVYLAVYKVPASLFQKALRRKRRRLQSMGEGLEMAAHVRRCTCGCCDDIMGLGRLYPL  113

Query  718  SSPSA--VAAAL------ESDNEVVELEKEMWDRFYGAGFWRSPSQRTE  840
             S     VAA +      E D +VVELE EMW+RFYG+GFWRSPSQR E
Sbjct  114  CSDDEGDVAAVMRRRSVAEKDADVVELENEMWERFYGSGFWRSPSQRNE  162



>ref|XP_004142253.1| PREDICTED: uncharacterized protein LOC101219884 [Cucumis sativus]
 gb|KGN54056.1| hypothetical protein Csa_4G279850 [Cucumis sativus]
Length=147

 Score =   104 bits (259),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 72/154 (47%), Positives = 95/154 (62%), Gaps = 15/154 (10%)
 Frame = +1

Query  391  MTKRISLRSP-GSGREPLLNPARDSSSGPEAVRKARFAEVAGGTTADIAAVCCCCPCGLV  567
            M + + LRSP G+ ++PLL   RD S G     K RFAEVAGGT A+ AA+CCC PC ++
Sbjct  1    MNQGVLLRSPPGTRQQPLL---RDKS-GNRVKEKRRFAEVAGGTAAECAAICCCFPCSMM  56

Query  568  NLVVLAVYKLPAGICRKAI--RSKRRRKMMKNGMWPVRHCSCPDS---ELQIHPISSPSA  732
            NL++L VYK+P G+C+K    R KRR    KN     +  +  D    E +    S PS+
Sbjct  57   NLLILTVYKVPVGLCKKVWNKRGKRREIAKKNAGAGGKEWAGNDDGGGEKEDWGESLPSS  116

Query  733  VAAALESDNEVVELEKEMWDRFYGAGFWRSPSQR  834
              ++     E +ELEKEMW+RFYG GFWR+PSQR
Sbjct  117  YLSS-----EDIELEKEMWERFYGTGFWRTPSQR  145



>ref|XP_008241102.1| PREDICTED: uncharacterized protein LOC103339566 [Prunus mume]
Length=170

 Score =   103 bits (257),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 81/161 (50%), Positives = 102/161 (63%), Gaps = 21/161 (13%)
 Frame = +1

Query  394  TKRISLRSPGSGR-EPLLNPARDSSSGPEAVRKARFAEVAGGTTADIAAVCCCCPCGLVN  570
            ++++ LR   S R +PLL      S+        R AEVAGGT A+ AAVCCCCPCGLVN
Sbjct  8    SRQLFLRQTSSNRRQPLLRTQVSHST-------VRLAEVAGGTAAECAAVCCCCPCGLVN  60

Query  571  LVVLAVYKLPAGICRKAIRSKRRRKMMKNGMWPVRHCSCP----DSELQIH--------P  714
            L+VL +YK+PAGICR+ ++ KRR++ +K G+   RHC C      SELQ H         
Sbjct  61   LLVLVIYKVPAGICRRVLKKKRRKRHVKKGLLQPRHCKCTCGFDGSELQFHQVGFDCGLE  120

Query  715  ISSPSAVAAALES-DNEVVELEKEMWDRFYGAGFWRSPSQR  834
            I+  S   A  ES D +V++LEKEMWDRFY  GFWRSPSQR
Sbjct  121  INDMSHKVADDESVDEDVLKLEKEMWDRFYSTGFWRSPSQR  161



>ref|XP_007202667.1| hypothetical protein PRUPE_ppa012433mg [Prunus persica]
 gb|EMJ03866.1| hypothetical protein PRUPE_ppa012433mg [Prunus persica]
Length=170

 Score =   102 bits (254),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 78/148 (53%), Positives = 96/148 (65%), Gaps = 20/148 (14%)
 Frame = +1

Query  430  REPLLNPARDSSSGPEAVRKARFAEVAGGTTADIAAVCCCCPCGLVNLVVLAVYKLPAGI  609
            R+PLL      S+        R AEVAGGT A+ AAVCCCCPCGLVNL+VL +YK+PAGI
Sbjct  21   RQPLLRTQVSHST-------VRLAEVAGGTAAECAAVCCCCPCGLVNLLVLVIYKVPAGI  73

Query  610  CRKAIRSKRRRKMMKNGMWPVRHCSCP----DSELQIHP--------ISSPSAVAAALES  753
            CR+ ++ KRR++ +K G+   RHC+C      SELQ H         I+  S   A  ES
Sbjct  74   CRRVLKKKRRKRHVKQGLLQPRHCNCTCGFDGSELQFHQVGFDCGLEINDMSHKVADDES  133

Query  754  -DNEVVELEKEMWDRFYGAGFWRSPSQR  834
             D +V++LEKEMWDRFY  GFWRSPSQR
Sbjct  134  VDEDVLKLEKEMWDRFYSTGFWRSPSQR  161



>ref|XP_002312881.2| hypothetical protein POPTR_0009s15370g, partial [Populus trichocarpa]
 gb|EEE86836.2| hypothetical protein POPTR_0009s15370g, partial [Populus trichocarpa]
Length=137

 Score =   100 bits (250),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 54/123 (44%), Positives = 70/123 (57%), Gaps = 14/123 (11%)
 Frame = +1

Query  496  FAEVAGGTTADIAAVCCCCPCGLVNLVVLAVYKLPAGICRKAIRSKRRRKMMKNGMWPVR  675
            F EVAGGT    AAVCCCCPC ++NL+VLAVYK+PA +C+KA    R RK  +     + 
Sbjct  15   FGEVAGGT----AAVCCCCPCTVINLLVLAVYKVPACLCKKAKTRHRLRKKKQKERSLLS  70

Query  676  HCSCPDSELQIHPISSPSAVAAA----------LESDNEVVELEKEMWDRFYGAGFWRSP  825
              S    E ++      + V              + + E V+LEK+MWD+FY  GFWRSP
Sbjct  71   PSSSGSREEELQSEKKATEVVEKGKCCDHHDHNHDEETEAVDLEKQMWDQFYNTGFWRSP  130

Query  826  SQR  834
            SQR
Sbjct  131  SQR  133



>ref|XP_010543841.1| PREDICTED: uncharacterized protein LOC104816625 [Tarenaya hassleriana]
Length=252

 Score =   102 bits (255),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 85/206 (41%), Positives = 110/206 (53%), Gaps = 41/206 (20%)
 Frame = +1

Query  349  FRFVSISAPLPL*IMTKRISLRSPGSGREPLLNPARDSSSGPEA---VRKARFAEVAGGT  519
             RF +   P P+   T   S     S R+PLL  +    + P A      A  AE  GGT
Sbjct  5    LRFDTKQMPSPIRTTTDTPSSSPSLSRRQPLLKRSLSMPTTPRASSCTGGATAAEFCGGT  64

Query  520  TADIAAVCCCCPCGLVNLVVLAVYKLPAGICRKAIRSKRRRKMMKNGMWPVRH-CSCPD-  693
            TA  AAV CCCPCGL  L+VLAVYK+PAG+CR+A+R +RR++++K+G+ P +H  S P+ 
Sbjct  65   TASCAAVWCCCPCGLGKLLVLAVYKVPAGLCRRALRHRRRKRLVKSGLLPPQHPPSLPET  124

Query  694  ----------SELQIHPISS-------------------PSAVAAAL-------ESDNEV  765
                      SE  +HP+ S                    S++A  L       E D  V
Sbjct  125  DRRGRNRFGSSEFAVHPLESRDVSDEDDEDDFLELKVFGKSSMATLLAAEAAEEEEDAAV  184

Query  766  VELEKEMWDRFYGAGFWRSPSQRTEV  843
            + LEKEMW+RFYGAGFWRSPSQR  V
Sbjct  185  MALEKEMWNRFYGAGFWRSPSQRETV  210



>ref|XP_008449841.1| PREDICTED: uncharacterized protein LOC103491601 [Cucumis melo]
Length=146

 Score = 99.4 bits (246),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 72/153 (47%), Positives = 94/153 (61%), Gaps = 14/153 (9%)
 Frame = +1

Query  391  MTKRISLRSP-GSGREPLLNPARDSSSGPEAVRKARFAEVAGGTTADIAAVCCCCPCGLV  567
            M + + LRSP G+ ++PLL   RD S G     K RFAEVAGGT A+ AA+CCC PC ++
Sbjct  1    MNQGVLLRSPPGTRQQPLL---RDKS-GNIVKEKRRFAEVAGGTAAECAAICCCFPCSMM  56

Query  568  NLVVLAVYKLPAGICRKAI--RSKRRRKMMKNGMWPV--RHCSCPDSELQIHPISSPSAV  735
            NL++L VYK+P G+C+K    R KRR    KN    V  +     D E +    S PS+ 
Sbjct  57   NLLILTVYKVPVGLCKKVWNKRGKRREIAKKNAGAVVGGKEWGNDDREKEDWGESLPSSY  116

Query  736  AAALESDNEVVELEKEMWDRFYGAGFWRSPSQR  834
             ++     E +ELEKEMW+RFYG GF R+PSQR
Sbjct  117  LSS-----EDMELEKEMWERFYGNGFLRTPSQR  144



>ref|XP_012074264.1| PREDICTED: uncharacterized protein LOC105635777 [Jatropha curcas]
 gb|KDP36075.1| hypothetical protein JCGZ_08719 [Jatropha curcas]
Length=250

 Score =   101 bits (251),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 76/152 (50%), Positives = 101/152 (66%), Gaps = 17/152 (11%)
 Frame = +1

Query  424  SGREPLLNPARDS-SSGPEAVRKARFAEVAGGTTADIAAVCCCCPCGLVNLVVLAVYKLP  600
            + R PLL     S SS P      RFAE AGGTTA+ AAVCCCCPCGL NL+ L +YK+P
Sbjct  79   NNRRPLLRRKSHSISSNP--YYGDRFAEFAGGTTAECAAVCCCCPCGLANLLYLTIYKVP  136

Query  601  AGICRKAIRSKRRRKMMKNGMWPVR----HCSCPDSELQIHPISSPSAVAAALESDNE--  762
            AG+CR+A+R KRR++++K G+ P R    +C C D+ELQIHP +        L+SD++  
Sbjct  137  AGLCRRALRKKRRKQLIKKGLLPARVKRCYCGCDDTELQIHPANGFHDSLHILKSDDDES  196

Query  763  --------VVELEKEMWDRFYGAGFWRSPSQR  834
                    +++LE+EMW+ FYG GFWRSPSQ+
Sbjct  197  SDEEEEEAMMKLEQEMWETFYGTGFWRSPSQK  228



>ref|XP_006575261.1| PREDICTED: uncharacterized protein LOC102665591 [Glycine max]
Length=184

 Score = 98.6 bits (244),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 74/174 (43%), Positives = 102/174 (59%), Gaps = 32/174 (18%)
 Frame = +1

Query  391  MTKRISLRSPGSGR-EPLLNPARDSSSGPEAVRKA---RFAEVAGGTTADIAAVCCCCPC  558
            M+K++ L +  S R +PLL          E+ RKA      E  GGT    AAVCCC   
Sbjct  1    MSKKVILPTVASHRRQPLL------LQQSESYRKAGTRLMGEAVGGT----AAVCCCFSF  50

Query  559  GLVNLVVLAVYKLPAGICRKAIRSKRRRKMMKNGM-----WPVR---HCSCPDSEL---Q  705
            GL N++ LA+YK+PA +C++A+R KRRR+ ++  M      P R    C C D  +   +
Sbjct  51   GLANIIYLAIYKVPAKLCQEALRRKRRRRRLQISMEEGAAIPSRPRCTCGCCDDIVGAGR  110

Query  706  IHPISSP--SAVA-----AALESDNEVVELEKEMWDRFYGAGFWRSPSQRTEVS  846
            ++P+ S   S VA     +++E D EVVELE+EMW+RFYG+GFWRSPSQR   S
Sbjct  111  VYPLCSDDGSDVAVLRSRSSVEKDKEVVELEEEMWERFYGSGFWRSPSQRENSS  164



>ref|XP_004494918.1| PREDICTED: uncharacterized protein LOC101488959 [Cicer arietinum]
Length=187

 Score = 98.6 bits (244),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 66/157 (42%), Positives = 93/157 (59%), Gaps = 22/157 (14%)
 Frame = +1

Query  391  MTKRISLRSPGSG--REPLLNPARDSSSGPEAVRKARFAEVAGGTTADIAAVCCCCPCGL  564
            M+ +I LR   S   R+PLL   + S +G      + F EV G TTA+  AVCCC PCGL
Sbjct  1    MSNKIVLRQAASAHRRQPLLQ-VQSSKTG------SSFGEVVGATTAECVAVCCCFPCGL  53

Query  565  VNLVVLAVYKLPAGICRKAIRSKRRRKMMKNGMWP--VRHCSCPDSEL----QIHPI--S  720
             N +VLA+YK+P G+CR+ +R ++RR+++K G+ P   R+CSC   E     +IHP+  +
Sbjct  54   ANFLVLAIYKVPTGLCRRILRKRQRRRIIKEGLLPPKRRNCSCGCCEDVNGPRIHPMCAN  113

Query  721  SPSAVAAALES-----DNEVVELEKEMWDRFYGAGFW  816
              S +     S     D + + LEKEMW+RF  AGFW
Sbjct  114  DDSDIKRVYSSESVVKDKDAIALEKEMWERFDSAGFW  150



>ref|XP_010270822.1| PREDICTED: uncharacterized protein LOC104607031 [Nelumbo nucifera]
Length=157

 Score = 95.5 bits (236),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 79/149 (53%), Positives = 99/149 (66%), Gaps = 15/149 (10%)
 Frame = +1

Query  430  REPLLN-----PARDSSSGPEAVRKARFAEVAGGTTADIAAVCCCCPCGLVNLVVLAVYK  594
            R P LN     P  +  S   +  ++R AE+AG TTA+  AVCCCCPCGL+NL+VL VYK
Sbjct  9    RHPSLNLNRRRPFLERQSHWRSPSRSRIAELAGETTAECVAVCCCCPCGLMNLLVLTVYK  68

Query  595  LPAGICRKAIRSKRRRKMMKN-GMWP-VRHCSCPDSE---LQIHPISS----PSAVAAAL  747
            LPAG+CRKA+R KR+ +M+KN G+ P  R C+C   E   LQI P+S     P     + 
Sbjct  69   LPAGLCRKALR-KRKLRMLKNVGLLPQQRGCTCGYDETDHLQICPMSMDEWLPMVDNKSD  127

Query  748  ESDNEVVELEKEMWDRFYGAGFWRSPSQR  834
            +S+ EV+ELEKEMW RFY  GFWRSPSQR
Sbjct  128  DSEKEVLELEKEMWKRFYSTGFWRSPSQR  156



>ref|XP_010671673.1| PREDICTED: uncharacterized protein LOC104888408 [Beta vulgaris 
subsp. vulgaris]
Length=164

 Score = 95.1 bits (235),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 58/153 (38%), Positives = 81/153 (53%), Gaps = 24/153 (16%)
 Frame = +1

Query  430  REPLLNPARDSSSGPEAVRKARFAEVAGGTTADIAAVCCCCPCGLVNLVVLAVYKLPAGI  609
            R  LL P   S   P +    R AEVAGG TAD A V CC P    NL+ L +YK+P  I
Sbjct  15   RHILLRPT-SSMGSPTS---TRLAEVAGGVTADCATVWCCFPYTAANLLTLVIYKVPTRI  70

Query  610  CRKAIRSKRRRKMMKNGMWP----------VRHCSCPDSEL--------QIHPISSPSAV  735
            CRKA++  ++R+MMK G+ P          VRH +  + ++         +H  +  + V
Sbjct  71   CRKALKRHKKREMMKKGLLPLNSGITLSTTVRHQNNVEGDIPEFQRAIKVVHEGAEVTFV  130

Query  736  AAALESDNEVVELEKEMWDRFYGAGFWRSPSQR  834
                + D E++EL+KEM  +F   GFWRS S+R
Sbjct  131  IGGSKMDEELMELDKEMIRKF--TGFWRSYSER  161



>ref|XP_006295144.1| hypothetical protein CARUB_v10024215mg [Capsella rubella]
 gb|EOA28042.1| hypothetical protein CARUB_v10024215mg [Capsella rubella]
Length=162

 Score = 94.0 bits (232),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 69/159 (43%), Positives = 93/159 (58%), Gaps = 15/159 (9%)
 Frame = +1

Query  391  MTKRISLRSPGSGREPLLNPARDSSSGPEAVRKAR--FAEVAGGTTADIAAVCCCCPCGL  564
            MT+ + L+SP S   P +   R+ SS P ++ K R    EVAGG  A+ AAV CCCPC +
Sbjct  1    MTRHVILKSP-SEESPTM---RNLSSPPTSLSKERRKVGEVAGGAAAECAAVWCCCPCAV  56

Query  565  VNLVVLAVYKLPAGICRKAIRSKRRRKMMKNGMWPVRHCSCPDSELQIHPISSPSAVAAA  744
            VNL+VLAVYK+PA +C+KA R  +RR+  +     +   +   SE  +H       + A 
Sbjct  57   VNLMVLAVYKVPAAVCKKAWRRSKRRRFTRKRHGLLASATAEGSESTVHARLKEDDLTAE  116

Query  745  LESD---------NEVVELEKEMWDRFYGAGFWRSPSQR  834
            +  +         N+VV LE EM +RFYGAGFWRSPSQR
Sbjct  117  IVFEECHVSGGDLNDVVRLENEMLERFYGAGFWRSPSQR  155



>ref|XP_006487824.1| PREDICTED: uncharacterized protein LOC102622103 [Citrus sinensis]
 gb|KDO48941.1| hypothetical protein CISIN_1g031729mg [Citrus sinensis]
Length=154

 Score = 93.6 bits (231),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 68/151 (45%), Positives = 92/151 (61%), Gaps = 15/151 (10%)
 Frame = +1

Query  409  LRSPG--SGREPLLNPARDSSSGPEAVRKARFAEVAGGTTADIAAVCCCCPCGLVNLVVL  582
            +RSP     R+PLL     + +G E  R  +F E  GGTTA+ AAVCCCCPC ++NL+VL
Sbjct  7    IRSPSLTQRRQPLL-----AKNGQER-RGNKFGEFVGGTTAECAAVCCCCPCTVMNLLVL  60

Query  583  AVYKLPAGICRKAIRSKRRRKMMK-----NGMWPVRHCSCPDSELQIHPISSPSAVAAAL  747
            AVYK+PAG+C+KA R +R+R  +       G+        P++E ++         AA  
Sbjct  61   AVYKVPAGLCKKAWRKQRKRHRIARRKQVGGLLMGPTTGGPNAEEKVAQTEELLVAAADQ  120

Query  748  E--SDNEVVELEKEMWDRFYGAGFWRSPSQR  834
            +   D +  ELEK MWDRF+GAGFWRSPSQ+
Sbjct  121  QEGEDEKAAELEKAMWDRFHGAGFWRSPSQK  151



>ref|XP_006589885.1| PREDICTED: uncharacterized protein LOC102667474 [Glycine max]
 ref|XP_006589890.1| PREDICTED: uncharacterized protein LOC100807859 [Glycine max]
Length=189

 Score = 94.0 bits (232),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 69/176 (39%), Positives = 92/176 (52%), Gaps = 34/176 (19%)
 Frame = +1

Query  391  MTKRISLRSPGSGR-EPLLNPARDSSSGPEAVRKAR---FAEVAGGTTADIAAVCCCCPC  558
            M+K++ L +  S R +PLL          E+ RKA      E  GGT    AAVCCC   
Sbjct  1    MSKKVILPTAASHRRQPLL------LQQSESYRKAGTRVMGEAVGGT----AAVCCCFSF  50

Query  559  GLVNLVVLAVYKLPAGICRKAIRS----------KRRRKMMKNGMWPVRHCSCPDSEL--  702
            GL N++ LA+YK+PA +C+KA+R           + R +       P   C C D  +  
Sbjct  51   GLANIMYLAMYKVPAMLCQKALRRKRRSRRLLLLQTREEAAAVPSRPRCTCGCCDDIISA  110

Query  703  -QIHPISSPSAVAAAL-------ESDNEVVELEKEMWDRFYGAGFWRSPSQRTEVS  846
             +++P+ S      A+       E D EVVELEKEMW+RFYG+GFWRSPSQR   S
Sbjct  111  GRVYPLCSNDGGDVAVLRSRSSVEKDKEVVELEKEMWERFYGSGFWRSPSQRENSS  166



>gb|KJB36160.1| hypothetical protein B456_006G147300 [Gossypium raimondii]
Length=184

 Score = 93.6 bits (231),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 68/123 (55%), Positives = 86/123 (70%), Gaps = 8/123 (7%)
 Frame = +1

Query  490  ARFAEVAGGTTADIAAVCCCCPCGLVNLVVLAVYKLPAGICRKAIRSKRRRKMMKNGMWP  669
            A+F E  GGTTA+ A +CCCCPC + NL+VLA YK+PAG+CR+A+R KRRRK+ + G+  
Sbjct  52   AKFGEFCGGTTAECAVICCCCPCTIANLLVLAFYKVPAGLCRRALRLKRRRKLKEKGLLQ  111

Query  670  VR----HCSCPD-SELQIHPISSPSA---VAAALESDNEVVELEKEMWDRFYGAGFWRSP  825
             +    HC   D SELQIH +        V A+ E++  V+ELEKEMW RFYG GFWRSP
Sbjct  112  PKNHRPHCGIEDNSELQIHTVVVEDFFPDVEASEEAEKAVMELEKEMWQRFYGTGFWRSP  171

Query  826  SQR  834
            SQR
Sbjct  172  SQR  174



>emb|CDY01049.1| BnaC05g41510D [Brassica napus]
Length=207

 Score = 94.0 bits (232),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 72/148 (49%), Positives = 92/148 (62%), Gaps = 27/148 (18%)
 Frame = +1

Query  499  AEVAGGTTADIAAVCCCCPCGLVNLVVLAVYKLPAGICRKAIRSKRRRKMMKNGMWPVRH  678
            AE  GGTTA  AAVCCCCPCGLVNL+VLAVYK+P GICR+A+R +RR+ ++KN + P   
Sbjct  55   AEFCGGTTASCAAVCCCCPCGLVNLLVLAVYKVPRGICRRALRIRRRKHLVKNRILPPLP  114

Query  679  CS---CPDSELQIHPI---------------------SSPSAVAAALESDNE---VVELE  777
             +     +SE  IHP+                     S+ + +A   E+D +   V+ LE
Sbjct  115  ANGRVFQNSEFAIHPVDSNDVSDEDDDDFLDLKYFGKSAAAGLATDYETDEDDEAVLALE  174

Query  778  KEMWDRFYGAGFWRSPSQRTEVSQISGA  861
            KEMW+RFYGAGFWRSPSQR  VS   G+
Sbjct  175  KEMWNRFYGAGFWRSPSQRESVSSPRGS  202



>ref|XP_010110453.1| hypothetical protein L484_006446 [Morus notabilis]
 gb|EXC26395.1| hypothetical protein L484_006446 [Morus notabilis]
Length=162

 Score = 92.8 bits (229),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 82/161 (51%), Positives = 102/161 (63%), Gaps = 10/161 (6%)
 Frame = +1

Query  391  MTKR-ISLRSPGSGREPLLNPARDSSSGPEAVRKARFAEVAGGTTADIAAVCCCCPCGLV  567
            M+K+ I LR P S R   L     SSS        R AEVAGGT A+ AAVCCCCPCGL+
Sbjct  1    MSKQPIILRHPSSNRRQPLLRPPPSSSYSSGGSSRRLAEVAGGTAAECAAVCCCCPCGLL  60

Query  568  NLVVLAVYKLPAGICRKAIRSKRRRKMMKNGMWPV---RHCSCPDSELQIHPISSPSAVA  738
            NL+VLAVYK+PAG+CR+A+R K   +  + G+ P    RH       +Q+HP+S  + V 
Sbjct  61   NLLVLAVYKIPAGLCRRAMRKK---RRRRKGVLPPPCRRHAGDESEIVQVHPVSVQNDVV  117

Query  739  --AALESDNEVVELEKEMWDRFYGAGFWRSPSQRTEVSQIS  855
              A+  S+ EV  LEKEMW+RFY  GFWRSPSQR E+ Q S
Sbjct  118  SDASCSSNKEVEALEKEMWERFYSTGFWRSPSQR-EIEQPS  157



>ref|XP_004228873.1| PREDICTED: uncharacterized protein LOC101249571 [Solanum lycopersicum]
Length=156

 Score = 92.4 bits (228),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 44/118 (37%), Positives = 66/118 (56%), Gaps = 3/118 (3%)
 Frame = +1

Query  487  KARFAEVAGGTTADIAAVCCCCPCGLVNLVVLAVYKLPAGICRKAIRSKRRRKMMKNGMW  666
            + R  EVAG T A+ A VCCC PC +++ ++LAVYK+P G+CRK +R  ++++++ N   
Sbjct  41   RNRKGEVAGRTAAECATVCCCLPCAMIHFLILAVYKVPTGLCRKLLRKNKQKRLLNNNNK  100

Query  667  PVRHCSCPDSELQIHPISSPSAVAAALESDNEVVELEKEMWDRFYGAGFWRSPSQRTE  840
             +    C   +L        S    A+       E E EMW RFY  GFWR+ S++ E
Sbjct  101  KIESKCC---QLTGAGDGKESENVKAIGEKPASAESETEMWGRFYEGGFWRNSSEKKE  155



>ref|XP_009146691.1| PREDICTED: uncharacterized protein LOC103870319 [Brassica rapa]
 emb|CDY08503.1| BnaA05g27390D [Brassica napus]
Length=207

 Score = 94.0 bits (232),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 74/148 (50%), Positives = 91/148 (61%), Gaps = 27/148 (18%)
 Frame = +1

Query  499  AEVAGGTTADIAAVCCCCPCGLVNLVVLAVYKLPAGICRKAIRSKRRRKMMKNGMWPVRH  678
            AE  GGTTA  AAVCCCCPCGLVNL+VLAVYK+P GICR+A+R +RR+ ++KN + P   
Sbjct  55   AEFCGGTTASCAAVCCCCPCGLVNLLVLAVYKVPRGICRRALRIRRRKHLVKNRILPPLP  114

Query  679  CS---CPDSELQIHPISSPS-----------------AVAAALESDNE-------VVELE  777
             +     +SE  IHP+ S                   + AA L +D E       V+ LE
Sbjct  115  ANGRVFQNSEFAIHPVDSNDVSDEDDDDFLDLKYFGKSAAAGLTTDYETDEDDEAVLALE  174

Query  778  KEMWDRFYGAGFWRSPSQRTEVSQISGA  861
            KEMW+RFYGAGFWRSPSQR  VS   G+
Sbjct  175  KEMWNRFYGAGFWRSPSQRESVSSPRGS  202



>gb|KGN63891.1| hypothetical protein Csa_1G025240 [Cucumis sativus]
Length=150

 Score = 91.7 bits (226),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 60/153 (39%), Positives = 90/153 (59%), Gaps = 10/153 (7%)
 Frame = +1

Query  391  MTKRISLRSPG-SGREPLLNPARDSSSGPEAVRKARFAEVAGGTTADIAAVCCCCPCGLV  567
            MT+++ LRS     R PL +   D+   P   R+  FAEVAGG+ A+  AVCCCCP  ++
Sbjct  1    MTRKVLLRSAAIRHRSPLRDGKIDA---PRERRQ--FAEVAGGSAAECTAVCCCCPWTVL  55

Query  568  NLVVLAVYKLPAGICRKAIRSKRRRKMMKNG-MWPVRHCSCPD-SELQIHPISSPSAVAA  741
            N+++ A+Y++PAG+CRKAI  ++R + MK   +   R  +  D ++  + PI        
Sbjct  56   NILIFAIYRMPAGLCRKAINRRKRHRRMKRKYLIQQRKAASEDFTDGSVGPIIDGYGTHE  115

Query  742  A--LESDNEVVELEKEMWDRFYGAGFWRSPSQR  834
            A  + +  ++ +LE EMW RF   GFWRS SQR
Sbjct  116  ANDVAAGEDLKKLEDEMWGRFSQTGFWRSSSQR  148



>ref|XP_006424049.1| hypothetical protein CICLE_v10029482mg [Citrus clementina]
 gb|ESR37289.1| hypothetical protein CICLE_v10029482mg [Citrus clementina]
Length=154

 Score = 91.3 bits (225),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 67/151 (44%), Positives = 91/151 (60%), Gaps = 15/151 (10%)
 Frame = +1

Query  409  LRSPG--SGREPLLNPARDSSSGPEAVRKARFAEVAGGTTADIAAVCCCCPCGLVNLVVL  582
            +RSP     R+PLL     + +G E  R  +F E  GGTTA+ AAVCCCCPC ++NL+VL
Sbjct  7    IRSPSLTQRRQPLL-----AKNGQER-RGNKFGEFVGGTTAECAAVCCCCPCTVMNLLVL  60

Query  583  AVYKLPAGICRKAIRSKRRRKMMK-----NGMWPVRHCSCPDSELQIHPISSPSAVAAAL  747
            AVYK+PAG+C+KA R +R+R  +       G+        P++E ++         AA  
Sbjct  61   AVYKVPAGLCKKAWRKQRKRHRIARRKQVGGLLMGPTTGGPNAEEKVAQKEELLVAAADQ  120

Query  748  E--SDNEVVELEKEMWDRFYGAGFWRSPSQR  834
            +   D +  ELEK MWDRF+G GFWRSPSQ+
Sbjct  121  QEGEDEKAAELEKAMWDRFHGGGFWRSPSQK  151



>gb|KJB14940.1| hypothetical protein B456_002G153700 [Gossypium raimondii]
Length=176

 Score = 91.7 bits (226),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 68/168 (40%), Positives = 105/168 (63%), Gaps = 20/168 (12%)
 Frame = +1

Query  391  MTKRISLRSPGSGREP------------LLNPARDSSSGPEAVRKARFAEVAGGTTADIA  534
            M++RI +R+P + R+P            +++     S    + + A+F E+ GGT A+ A
Sbjct  1    MSRRIIVRTPTTRRQPLLQSRSTSSSLSMVDDGSRYSRSSSSRKSAKFGELCGGTAAECA  60

Query  535  AVCCCCPCGLVNLVVLAVYKLPAGICRKAIRSKRRRKMMKNGMWPVRHC----SCPDSEL  702
            AVCCCCPCG+ NL+VL +YK+PAG+ R+A+R KRR+K+ K G++  R+      C + EL
Sbjct  61   AVCCCCPCGIANLLVLVIYKVPAGLYRRALRQKRRKKLQKKGLFQPRNYGSRHGCEEREL  120

Query  703  QIHPISSPSAVAAAL----ESDNEVVELEKEMWDRFYGAGFWRSPSQR  834
            + HP+     +   +    E+D  + +LE+EMW+RF+G GFWRSPSQR
Sbjct  121  RNHPMVCAKELMVEMEVSEEADKALFQLEEEMWERFHGTGFWRSPSQR  168



>ref|NP_196256.1| uncharacterized protein [Arabidopsis thaliana]
 dbj|BAB08960.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAU44544.1| hypothetical protein AT5G06380 [Arabidopsis thaliana]
 gb|AAV63922.1| hypothetical protein At5g06380 [Arabidopsis thaliana]
 gb|AED91008.1| uncharacterized protein AT5G06380 [Arabidopsis thaliana]
Length=146

 Score = 90.5 bits (223),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 54/116 (47%), Positives = 68/116 (59%), Gaps = 8/116 (7%)
 Frame = +1

Query  499  AEVAGGTTADIAAVCCCCPCGLVNLVVLAVYKLPAGIC-----RKAIRSKRRRKMMKNGM  663
            AE  GGTTA  AA+C C PC +VNLVVLAVYKLP G+C     R   +   +++ +++G 
Sbjct  24   AECCGGTTASCAALCLCAPCSVVNLVVLAVYKLPRGLCRRAIRRIRRKRLAKKEFVESGR  83

Query  664  WPVRHCSCPDSELQIHPISSPSAVAAALESDNEVVELEKEMWDRFYGAGFWRSPSQ  831
               R  S   S+  +HP+ S        E D  V+ LEKEMW RFY  GFWRS SQ
Sbjct  84   EFGRGGS---SQFAVHPLESRDEEEEEEEEDEAVIALEKEMWSRFYSGGFWRSLSQ  136



>gb|EPS69946.1| hypothetical protein M569_04817, partial [Genlisea aurea]
Length=147

 Score = 90.5 bits (223),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 68/141 (48%), Positives = 87/141 (62%), Gaps = 8/141 (6%)
 Frame = +1

Query  433  EPLLNPARD-SSSGPEAVRKARFAEVAGGTTADIAAVCCCCPCGLVNLVVLAVYKLPAGI  609
            EPLL+ + D SS      RKAR AE AG  T + AAVCCCCPC + + +VLAVY+LPAG+
Sbjct  7    EPLLDYSVDCSSPRGGGSRKARLAEAAGVATVECAAVCCCCPCVVADFLVLAVYRLPAGL  66

Query  610  CRKAIRSKRRRKMMKNGMWPVRHCSCPDS---ELQIHPISS-PSAVAAALES---DNEVV  768
            CRKAIR  RR K  K      R  S  +    E +I  +S    A+  A+ES   D EV+
Sbjct  67   CRKAIRRNRRLKKAKKVGGASRWGSDDEEFEFEFRIRSLSDHHQAIVNAVESLSHDEEVI  126

Query  769  ELEKEMWDRFYGAGFWRSPSQ  831
            +LE EMW++F  AGFWR+P +
Sbjct  127  KLENEMWEKFNAAGFWRAPDE  147



>ref|NP_565639.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AAD26886.2| expressed protein [Arabidopsis thaliana]
 gb|AAP04169.1| unknown protein [Arabidopsis thaliana]
 gb|AAP40405.1| unknown protein [Arabidopsis thaliana]
 dbj|BAF00541.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEC07950.1| uncharacterized protein AT2G27180 [Arabidopsis thaliana]
Length=165

 Score = 90.9 bits (224),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 65/159 (41%), Positives = 92/159 (58%), Gaps = 12/159 (8%)
 Frame = +1

Query  391  MTKRISLRSP--GSGREPLLNPARDSSSGPEAVRKARFAEVAGGTTADIAAVCCCCPCGL  564
            MT+ + L+SP   S  E  +  +  S++     R+ +  EVAGG  A+ AAV CCCPC +
Sbjct  1    MTRHVILKSPLLVSSEESTMRNSPPSTTSLSKERR-KVGEVAGGAAAECAAVWCCCPCAV  59

Query  565  VNLVVLAVYKLPAGICRKAIRSKRRRKMMKNGMWPVRHCSCPDSELQIHPISSPSAVAAA  744
            VNL+VLAVYK+PA +C+KA R  +RR+  +     +   +   SE  +H   +   + A 
Sbjct  60   VNLMVLAVYKVPAAVCKKAWRRSKRRRFTRKRHGLLASATAEGSESTVHARLNEEDLTAE  119

Query  745  LESD---------NEVVELEKEMWDRFYGAGFWRSPSQR  834
            +  +         N+VV LE EM DRFYGAGFWRSPSQ+
Sbjct  120  IVFEECHVSGGELNDVVRLENEMLDRFYGAGFWRSPSQK  158



>ref|XP_010452563.1| PREDICTED: uncharacterized protein LOC104734646 [Camelina sativa]
Length=153

 Score = 89.7 bits (221),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 52/126 (41%), Positives = 68/126 (54%), Gaps = 25/126 (20%)
 Frame = +1

Query  499  AEVAGGTTADIAAVCCCCPCGLVNLVVLAVYKLPAGICRKAIRSKR--------------  636
            AE  GGTTA  AA+C C PC +VNL VLA YK+P GICR+ +R ++              
Sbjct  31   AECCGGTTASFAALCLCAPCSVVNLFVLAFYKVPRGICRRIMRRRKSAKKELSESGGDCD  90

Query  637  RRKMMKNGMWPVRHCSCPDSELQIHPISSPSAVAAALESDNE-VVELEKEMWDRFYGAGF  813
            +RK+ K G           S   +HP+ S          D+E V+ LEKEMW+RF+  GF
Sbjct  91   QRKLGKVG----------SSHFAVHPLESKDNDEEDGLDDDEAVIALEKEMWNRFHSGGF  140

Query  814  WRSPSQ  831
            WRS S+
Sbjct  141  WRSLSR  146



>ref|XP_010491196.1| PREDICTED: uncharacterized protein LOC104768832 [Camelina sativa]
Length=159

 Score = 89.0 bits (219),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 54/121 (45%), Positives = 73/121 (60%), Gaps = 10/121 (8%)
 Frame = +1

Query  499  AEVAGGTTADIAAVCCCCPCGLVNLVVLAVYKLPAGICRKAIRSKR-----RRKMMKNG-  660
            AE  GGTTA  AA+C C PC +VNLVVLA YK+P GICR+AIR  R     +++++++G 
Sbjct  32   AECCGGTTASFAALCLCAPCSVVNLVVLAFYKVPRGICRRAIRRMRRRPSAKKEVLESGG  91

Query  661  -MWPVRHCSCPDSELQIHPISSPSAVAAAL---ESDNEVVELEKEMWDRFYGAGFWRSPS  828
                 + C    S   +HP+ S       L   + D  V+ LEKEMW+RF+  GFWRS S
Sbjct  92   DCDQKKLCKVGSSHFAVHPLESKDDEDDGLVDEKEDEAVIALEKEMWNRFHSGGFWRSLS  151

Query  829  Q  831
            +
Sbjct  152  R  152



>ref|XP_010534383.1| PREDICTED: uncharacterized protein LOC104809949 [Tarenaya hassleriana]
Length=206

 Score = 90.1 bits (222),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 70/152 (46%), Positives = 89/152 (59%), Gaps = 37/152 (24%)
 Frame = +1

Query  490  ARFAEVAGGTTADIAAVCCCCPCGLVNLVVLAVYKLPAGICRKAIRSKRRRKMMKNGMWP  669
            A  AE  GGTTA  AAV CCCPCGL  L++LAVYK+PAG+CR+A+R +RR++++K+G+ P
Sbjct  46   ATAAEFCGGTTASCAAVWCCCPCGLGKLLLLAVYKVPAGLCRRALRHRRRKRLVKSGLLP  105

Query  670  VRHCSCPD-----------SELQIHPISS----------------------PSAVAAALE  750
                  PD           SE  +HP+ S                       + +AA  E
Sbjct  106  ----PPPDNRSRRRNRFGRSEFAVHPLESRDVSDEEEEDLLELKVFGKSTMAAILAAEEE  161

Query  751  SDNEVVELEKEMWDRFYGAGFWRSPSQRTEVS  846
             D  V+ LEKEMW+RFYGAGFWRSPSQR  VS
Sbjct  162  EDAAVMALEKEMWERFYGAGFWRSPSQRETVS  193



>ref|XP_006594906.1| PREDICTED: uncharacterized protein LOC102665048 [Glycine max]
Length=159

 Score = 88.6 bits (218),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 61/169 (36%), Positives = 81/169 (48%), Gaps = 30/169 (18%)
 Frame = +1

Query  391  MTKRISLRSPGSGREPLLNPARDSSSGPEAVRKARFAEVAGGTTADIAAVCCCCPCGLVN  570
            MT++I LRSP     P+         G          EVAG  TA+ AAVCCC P  +++
Sbjct  1    MTQKILLRSP-----PVTRRRERRRVG----------EVAGNATAECAAVCCCVPLTVMD  45

Query  571  LVVLAVYKLPAGICRKAI----------RSKRRRKMMKNGMWPVRHCSCPDSELQIHPIS  720
            +VVLA YKLPAG+ +KA+          R K+   ++ +G  PV+  +          + 
Sbjct  46   MVVLATYKLPAGLLKKAMHKRKGRLLQKRKKKTEALLDHG--PVKADNSGHGLGLGLGLG  103

Query  721  SPSAVAAALESDNEVVE---LEKEMWDRFYGAGFWRSPSQRTEVSQISG  858
            S      A E   E +E   LE EMW +F G GFWRS SQR    Q  G
Sbjct  104  STLEEHLAKEVAEEKLEASRLEDEMWAQFNGTGFWRSASQRHHQQQTDG  152



>ref|XP_002871216.1| hypothetical protein ARALYDRAFT_908566 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH47475.1| hypothetical protein ARALYDRAFT_908566 [Arabidopsis lyrata subsp. 
lyrata]
Length=146

 Score = 88.2 bits (217),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 57/112 (51%), Positives = 67/112 (60%), Gaps = 3/112 (3%)
 Frame = +1

Query  499  AEVAGGTTADIAAVCCCCPCGLVNLVVLAVYKLPAGICRKAIRSKRRRKMMKNGMWPVRH  678
            AE  GGTTA  AA+C C PC +VNLVVLAVYKLP G+CR+AIR  RRR++ K        
Sbjct  27   AECCGGTTASCAALCLCAPCSVVNLVVLAVYKLPRGLCRRAIRRIRRRRLAKKECLESGE  86

Query  679  CS-CPDSELQIHPISSPSAVAAALESDNEVVELEKEMWDRFYGAGFWRSPSQ  831
                  S+  +HP+ S          D  V+ LEKEMW RFY  GFWRS SQ
Sbjct  87   LGKVGSSQFAVHPLESRDDEEEE--EDEAVIALEKEMWSRFYSGGFWRSLSQ  136



>ref|XP_007015616.1| Uncharacterized protein TCM_041188 [Theobroma cacao]
 gb|EOY33235.1| Uncharacterized protein TCM_041188 [Theobroma cacao]
Length=150

 Score = 87.8 bits (216),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 59/151 (39%), Positives = 88/151 (58%), Gaps = 6/151 (4%)
 Frame = +1

Query  391  MTKRISLRSPGSGREPLLNPARDSSSGPEAVRKARFAEVAGGTTADIAAVCCCCPCGLVN  570
            MT+++ +RSP   R+    P   S     A +  +F EVAGGT A+ AAVCCCCPC ++ 
Sbjct  1    MTRQVLIRSPPLTRK---QPFLLSEDQKTARKGKKFGEVAGGTAAECAAVCCCCPCTVLE  57

Query  571  LVVLAVYKLPAGICRKAIRSKRRRKMMKNGMWPVRHCSCPDSELQIHPISSPSAVAAALE  750
            L+VL +Y++P G+ RKA + ++R+++ K     +       +  ++             +
Sbjct  58   LLVLGLYRVPTGLYRKAWKRRKRQRLTKKNQGLLGQSKGGPTREELEAELDRMVGKVGQD  117

Query  751  SDNE---VVELEKEMWDRFYGAGFWRSPSQR  834
             ++E    V+LEKEMWDRFYG GFWRSPSQR
Sbjct  118  GNDESKGAVDLEKEMWDRFYGTGFWRSPSQR  148



>ref|XP_010510802.1| PREDICTED: uncharacterized protein LOC104787009 [Camelina sativa]
Length=167

 Score = 87.8 bits (216),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 76/162 (47%), Positives = 96/162 (59%), Gaps = 16/162 (10%)
 Frame = +1

Query  388  IMTKRISLRSP--GSGREPLLNPARDSSSGPE-AVRKAR--FAEVAGGTTADIAAVCCCC  552
            +MT+ + L+S    S  E  +   R+SSS P  A+ K R    EVAGG  A+ AAV CCC
Sbjct  2    LMTRHVILKSALLASSEESTM---RNSSSPPTMALGKERRKVGEVAGGVAAECAAVWCCC  58

Query  553  PCGLVNLVVLAVYKLPAGICRKAIRSKRRRKMMKNGMWPVRHCSCPDSELQIHP---ISS  723
            PC +VNLVVLAVYK+PA +C+KA R  +RR+  +     +   +   SE  +H       
Sbjct  59   PCAVVNLVVLAVYKVPAAVCKKAWRRSKRRRFTRKRHGLLASAAAEGSESTVHARLNEED  118

Query  724  PSAVAAALE---SD--NEVVELEKEMWDRFYGAGFWRSPSQR  834
            P+A     E   SD  N+VV LE EM DRFYGAGFWRSPSQR
Sbjct  119  PTAEIVFEECHVSDEINDVVRLENEMLDRFYGAGFWRSPSQR  160



>ref|XP_006399109.1| hypothetical protein EUTSA_v10016087mg [Eutrema salsugineum]
 gb|ESQ40562.1| hypothetical protein EUTSA_v10016087mg [Eutrema salsugineum]
Length=164

 Score = 87.4 bits (215),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 53/125 (42%), Positives = 67/125 (54%), Gaps = 9/125 (7%)
 Frame = +1

Query  499  AEVAGGTTADIAAVCCCCPCGLVNLVVLAVYKLPAGIC-----RKAIRSKRRRKMMKNGM  663
            AE  GGTTA+ AA+CCC PC +V LVVLAVYKLP GIC     R   R   ++  +++G 
Sbjct  35   AECCGGTTAECAALCCCGPCSVVKLVVLAVYKLPRGICRRATRRLRRRRLAKKGALESGD  94

Query  664  WPVRHCSCPDSELQIHPISS----PSAVAAALESDNEVVELEKEMWDRFYGAGFWRSPSQ  831
            +  +      S+  +HP+ S            E D  V+ LE EMW RF   GFWRS SQ
Sbjct  95   FEKKLSKSGSSQFAVHPLQSYGDEEEEEEEEEEEDEAVIALENEMWSRFCSGGFWRSHSQ  154

Query  832  RTEVS  846
                S
Sbjct  155  AETAS  159



>gb|KJB35494.1| hypothetical protein B456_006G117400 [Gossypium raimondii]
Length=146

 Score = 86.7 bits (213),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 51/149 (34%), Positives = 80/149 (54%), Gaps = 14/149 (9%)
 Frame = +1

Query  391  MTKRISLRSPGSGREPLLNPARDSSSGPEAVRKAR-FAEVAGGTTADIAAVCCCCPCGLV  567
            MT ++  RSP     P+ +    S  G +  RK R +  + GG+ A+  AVCCC P  ++
Sbjct  1    MTLQVLSRSP-----PVRHKRPCSPDGLKTERKGRNYGGMVGGSAAECTAVCCCFPLTIM  55

Query  568  NLVVLAVYKLPAGICRKAIRSKRRRKMMKNGMWPVRHCSCPDSELQIHPISSPSAVAAAL  747
             L+VL +YK+P G+C+KA R +++ K   +G  P    S  D + ++H +     V  A 
Sbjct  56   ELLVLGLYKVPTGLCKKACR-RKKGKHKSHGFHPTS--SSEDQDTELHQM-----VGNAD  107

Query  748  ESDNEVVELEKEMWDRFYGAGFWRSPSQR  834
            +     V+ E    DRF+G GFWR PS++
Sbjct  108  DGSRVTVDSEDNKSDRFFGTGFWRDPSEK  136



>gb|KFK32411.1| hypothetical protein AALP_AA6G238300 [Arabis alpina]
Length=156

 Score = 86.3 bits (212),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 66/160 (41%), Positives = 90/160 (56%), Gaps = 13/160 (8%)
 Frame = +1

Query  391  MTKRISLRSPGSGREPLLNPARDSSSGPEAVRKARFAEVAGGTTADIAAVCCCCPCGLVN  570
            MT+ + ++SP  G E  +     +S   E   + +  EVAGG  A+ AAV CCCPC +VN
Sbjct  1    MTRHVIMKSPLLGSEESMMKKTLTSKHGE---RRKVGEVAGGAAAECAAVWCCCPCAVVN  57

Query  571  LVVLAVYKLPAGICRKAIRSKRRRK-------MMKNGMWPVRHCSCPDSELQIHPISSPS  729
            LVVL VY++PA +C+KA R  +RR        ++  G     H    +++     +   S
Sbjct  58   LVVLVVYRVPAALCKKAWRQSKRRHFVRKRHGLLAQGSQSTVHARLNENDPTAQTVFQDS  117

Query  730  AVAAALESDNEVVELEKEMWDRFYGAGFWRSPSQRTEVSQ  849
              +A L   N+VV LE EM DRFYGAGFWRSPSQR   S+
Sbjct  118  EASAEL---NDVVMLENEMLDRFYGAGFWRSPSQRDTPSE  154



>ref|XP_009393985.1| PREDICTED: uncharacterized protein LOC103979537 [Musa acuminata 
subsp. malaccensis]
Length=167

 Score = 86.3 bits (212),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 59/137 (43%), Positives = 79/137 (58%), Gaps = 9/137 (7%)
 Frame = +1

Query  451  ARDSSSGPEAVRKARFAEVAGGTTADIAAVCCCCPCGLVNLVVLAVYKLPAGICRKAIRS  630
            A+ +   P+    AR  E AG T A+ AAV CCCPCGL NL  +A  KLPAG+ R+A+R 
Sbjct  30   AQIAEEKPKPKLAARVTEAAGETVAECAAVLCCCPCGLANLFFVAAVKLPAGLVRRALRL  89

Query  631  KRRRKM----MKNGMWPVRHCSCPDSELQIHPISSPSAVAA-----ALESDNEVVELEKE  783
            +R+R+     +K G+   R  S  D +  IH  +   A+ A     A     E+++LEKE
Sbjct  90   RRKRRAGYGKVKAGILRTRVGSFDDDDFSIHHGTFFMAMGAKEVWPAKAVSPELLQLEKE  149

Query  784  MWDRFYGAGFWRSPSQR  834
            M  RFY  GFWRSPSQ+
Sbjct  150  MTARFYSTGFWRSPSQK  166



>gb|AAM67029.1| unknown [Arabidopsis thaliana]
Length=146

 Score = 85.5 bits (210),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 56/123 (46%), Positives = 75/123 (61%), Gaps = 9/123 (7%)
 Frame = +1

Query  493  RFAEVAGGTTADIAAVCCCCPCGLVNLVVLAVYKLPAGICRKAIRSKRRRKMMKNGMWPV  672
            +  EVAGG  A+ AAV CCCPC +VNL+VLAVYK+PA +C+KA R  +RR+  +     +
Sbjct  17   KVGEVAGGAAAECAAVWCCCPCAVVNLMVLAVYKVPAAVCKKAWRRSKRRRFTRKRHGLL  76

Query  673  RHCSCPDSELQIHPISSPSAVAAALESD---------NEVVELEKEMWDRFYGAGFWRSP  825
               +   SE  +H   +   + A +  +         N+VV LE EM DRFYGAGFWRSP
Sbjct  77   ASATAEGSESTVHARLNEEDLTAEIVFEECHVSGGELNDVVRLENEMLDRFYGAGFWRSP  136

Query  826  SQR  834
            SQ+
Sbjct  137  SQK  139



>ref|XP_009412934.1| PREDICTED: uncharacterized protein LOC103994335 [Musa acuminata 
subsp. malaccensis]
Length=167

 Score = 85.5 bits (210),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 48/112 (43%), Positives = 64/112 (57%), Gaps = 17/112 (15%)
 Frame = +1

Query  538  VCCCCPCGLVNLVVLAVYKLPAGICRKAIRSKRRR----KMMKNGMWPVRHCSCPDSELQ  705
            + CCCPCGL NL+  A  KLPAG+ R+A+R KR+        K G++  R  S  D +  
Sbjct  59   IVCCCPCGLANLLFTAAVKLPAGLVRRALRHKRKHGAGFGKRKAGLFRNRVGSLDDDDFG  118

Query  706  IHPISSPSAVAAALESDN---------EVVELEKEMWDRFYGAGFWRSPSQR  834
            I+      ++  ALE++          EV+ LEKEM  RFY AGFWRSPSQ+
Sbjct  119  IY----SGSLLVALEAEEAWPVKVASPEVLALEKEMSKRFYSAGFWRSPSQK  166



>ref|XP_004241363.1| PREDICTED: uncharacterized protein LOC101264331 [Solanum lycopersicum]
Length=147

 Score = 84.7 bits (208),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 50/123 (41%), Positives = 70/123 (57%), Gaps = 7/123 (6%)
 Frame = +1

Query  493  RFAEVAGGTTADIAAVCCCCPCGLVNLVVLAVYKLPAGICRKAIRSKRRRKMMKNGMWPV  672
            R  EVAGGT A+ A VCCCCPC +++L+VLA+YK+P G+CRK  R K+R ++++      
Sbjct  16   RIGEVAGGTAAECAMVCCCCPCTVMHLLVLALYKVPTGLCRKIWRKKKRERLLRKKKKEE  75

Query  673  RHCSCPDSELQIH--PISSPSAVAAALESDN-----EVVELEKEMWDRFYGAGFWRSPSQ  831
                   +   ++              + +N     E  + E EMWDRFYGAGFWR+ SQ
Sbjct  76   DSWKSMKNNKNVYLGAYDEDDGDREKFDGENDDGVREAADFETEMWDRFYGAGFWRTLSQ  135

Query  832  RTE  840
            R E
Sbjct  136  REE  138



>emb|CAA78966.1| pollen preferential protein [Lilium longiflorum]
 emb|CAA78977.1| pollen preferential protein [Lilium longiflorum]
 gb|AAA33399.1| pollen preferential protein [Lilium longiflorum]
Length=182

 Score = 84.0 bits (206),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 64/158 (41%), Positives = 81/158 (51%), Gaps = 25/158 (16%)
 Frame = +1

Query  406  SLRSPGSGREPLLNPARDSSSGPEAVRKARF--AEVAGGTTADIAAVCCCCPCGLVNLVV  579
            ++RSP + +   +   R S   P       F  AEVAGGTTA  AA+ CC PCG+V L+V
Sbjct  32   TIRSPATTKMCKIVSHRSSPRHPTTKANKGFQCAEVAGGTTAGCAALVCC-PCGIVGLLV  90

Query  580  LAVYKLPAGICRKAIRSKRR-------RKMMKNGMWPVRHCSCPDSELQIHPISSPSAVA  738
            LA  KLPAG+CR+A+  KRR         +    M  V      D +  +     PS V 
Sbjct  91   LATVKLPAGLCRRALSQKRRKRVKKRSTTLRSRAMSFVSD----DEDFGV-----PSFVP  141

Query  739  AALES------DNEVVELEKEMWDRFYGAGFWRSPSQR  834
               E+        EV E E+EMW  FY AGFWRSPSQ+
Sbjct  142  RTPETWPSKSPSVEVAEKEEEMWAEFYSAGFWRSPSQK  179



>ref|XP_002309264.1| hypothetical protein POPTR_0006s21440g [Populus trichocarpa]
 gb|EEE92787.1| hypothetical protein POPTR_0006s21440g [Populus trichocarpa]
Length=188

 Score = 83.2 bits (204),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 66/125 (53%), Positives = 86/125 (69%), Gaps = 10/125 (8%)
 Frame = +1

Query  490  ARFAEVAGGTTADIAAVCCCCPCGLVNLVVLAVYKLPAGICRKAIRSKRRRKMMKNGMWP  669
             R  E+AGGTTA+ AA+CCCCPCGLVNL+VL +YK+P GICR+A+R KRR+K++K G+ P
Sbjct  45   GRLGELAGGTTAECAAICCCCPCGLVNLLVLTMYKVPVGICRRALRRKRRKKLIKKGLLP  104

Query  670  --VRHCSC--PDSELQIHPISSPSAVAAALE------SDNEVVELEKEMWDRFYGAGFWR  819
               R CSC    +ELQIHP++         +       +  +V+LEKEMW+ F G GFWR
Sbjct  105  PRTRSCSCDYDGTELQIHPMACVEDSLREFDEEAALKEEEAMVKLEKEMWETFCGTGFWR  164

Query  820  SPSQR  834
            S SQR
Sbjct  165  SSSQR  169



>ref|XP_006289850.1| hypothetical protein CARUB_v10003460mg [Capsella rubella]
 gb|EOA22748.1| hypothetical protein CARUB_v10003460mg [Capsella rubella]
Length=154

 Score = 82.0 bits (201),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 51/118 (43%), Positives = 69/118 (58%), Gaps = 8/118 (7%)
 Frame = +1

Query  499  AEVAGGTTADIAAVCCCCPCGLVNLVVLAVYKLPAGIC------RKAIRSKRRRKMMKNG  660
            AE  GGTTA  AA+C C PC +VNLVVLAVYK+P G+C       +  R  ++ +  ++G
Sbjct  31   AECCGGTTASCAAICLC-PCSVVNLVVLAVYKVPRGLCRRALRRMRRRRLAKKMESSESG  89

Query  661  MWPVRHCSCPDSELQIHPISSPSAVAAALESDNE-VVELEKEMWDRFYGAGFWRSPSQ  831
                +      S+  +HP+ S        E D+E V+ LEKEMW+RFY  GFWRS S+
Sbjct  90   DCEKKLGKVGSSQFAVHPLGSKDEKEEEEEEDDEAVIALEKEMWNRFYSGGFWRSLSR  147



>emb|CDY04987.1| BnaAnng01690D [Brassica napus]
Length=155

 Score = 82.0 bits (201),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 56/121 (46%), Positives = 67/121 (55%), Gaps = 13/121 (11%)
 Frame = +1

Query  499  AEVAGGTTADIAAVCCCCPCGLVNLVVLAVYKLPAGICRKAIRSKRRRKMMKNGMWPVRH  678
            AE  GGTTAD AA+CCC PC +V+LVVLAVYK+P G+ R   R + RR + K G    + 
Sbjct  28   AEFCGGTTADFAALCCCGPCSVVSLVVLAVYKIPRGLFR---RVRGRRGLAKRGNGDSKL  84

Query  679  CSCPDSELQIHPISSP----------SAVAAALESDNEVVELEKEMWDRFYGAGFWRSPS  828
                 S+  +HP+ S                    D EVV LEKEMW RFY  GFWRS S
Sbjct  85   SKVGSSKFAVHPVESREEEDLDKLAMELKEEEEGEDEEVVALEKEMWSRFYSGGFWRSLS  144

Query  829  Q  831
            Q
Sbjct  145  Q  145



>ref|XP_011047139.1| PREDICTED: uncharacterized protein LOC105141580 [Populus euphratica]
Length=190

 Score = 82.0 bits (201),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 66/125 (53%), Positives = 85/125 (68%), Gaps = 10/125 (8%)
 Frame = +1

Query  490  ARFAEVAGGTTADIAAVCCCCPCGLVNLVVLAVYKLPAGICRKAIRSKRRRKMMKNGMWP  669
             R  E+AGGTTA+ AA+CCCCPCGLVNL+VL +YK+P GICR+A+R KRR+K++K G+ P
Sbjct  45   GRLGELAGGTTAECAAICCCCPCGLVNLLVLTLYKVPVGICRRALRRKRRKKLIKKGLSP  104

Query  670  --VRHCSC--PDSELQIHPISSPSAVAAALE------SDNEVVELEKEMWDRFYGAGFWR  819
               R CSC    + LQIHP++         +       +  +VELEKEMW+ F G GFWR
Sbjct  105  PRTRSCSCDYDGTGLQIHPMACVEESLREFDEEAALKEEEAMVELEKEMWETFCGTGFWR  164

Query  820  SPSQR  834
            S SQR
Sbjct  165  SSSQR  169



>ref|XP_009415689.1| PREDICTED: uncharacterized protein LOC103996494 [Musa acuminata 
subsp. malaccensis]
Length=152

 Score = 81.3 bits (199),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 54/127 (43%), Positives = 75/127 (59%), Gaps = 6/127 (5%)
 Frame = +1

Query  472  PEAVRKARFAEVAGGTTADIAAVCCCCPCGLVNLVVLAVYKLPAGICRKAIRSKRRRKMM  651
            P+    +R AE +G T A+ AA+ CCCPCGL  L+V AV KLP G+ RKA+R +R+RK  
Sbjct  25   PKPKPGSRCAEASGETAAECAAIFCCCPCGLAKLLVFAVIKLPEGLVRKALRRRRKRKKK  84

Query  652  KNGMWPVRHCSC-PDSELQIH-----PISSPSAVAAALESDNEVVELEKEMWDRFYGAGF  813
              G+W  ++ +   D +  +H       +       A     E++ELEKEM  +FYGAGF
Sbjct  85   ATGIWRPKYGALDDDDDFSVHGGFLLAAAGAEEAWPAKTPSQELLELEKEMRAKFYGAGF  144

Query  814  WRSPSQR  834
            WRS SQ+
Sbjct  145  WRSGSQK  151



>ref|XP_010423346.1| PREDICTED: uncharacterized protein LOC104708468 [Camelina sativa]
Length=157

 Score = 81.3 bits (199),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 54/120 (45%), Positives = 70/120 (58%), Gaps = 9/120 (8%)
 Frame = +1

Query  499  AEVAGGTTADIAAVCCCCPCGLVNLVVLAVYKLPAGICRKAIRSKRRRKMMKNGMWPV--  672
            AE  GGTTA  AA+C C PC +VNLVVLA YK+P GICR+AIR  RRR++ K  +     
Sbjct  31   AECCGGTTASFAALCLCAPCSVVNLVVLAFYKVPRGICRRAIRRMRRRRLAKKELSESGG  90

Query  673  -----RHCSCPDSELQIHPISSPSAVAAALESDNE--VVELEKEMWDRFYGAGFWRSPSQ  831
                 +      S   +HP+ S          D++  V+ LEKEMW+RF+  GFWRS S+
Sbjct  91   DCDQRKLGKVGSSHFAVHPLESKDDDDDEDGLDDDEAVIALEKEMWNRFHSGGFWRSLSR  150



>ref|XP_012066335.1| PREDICTED: uncharacterized protein LOC105629366 [Jatropha curcas]
Length=174

 Score = 80.5 bits (197),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 55/133 (41%), Positives = 83/133 (62%), Gaps = 5/133 (4%)
 Frame = +1

Query  469  GPEAVRKARFAEVAGGTTADIAAVCCCCPCGLVNLVVLAVYKLPAGICRKAIRSKRRRKM  648
            G ++ +  RF EV GGT A+ AAVCCCCPC L+NL+VL ++K+PA +CRK     R++K 
Sbjct  39   GEKSSKSKRFGEVVGGTAAECAAVCCCCPCTLMNLLVLTIFKMPACLCRKVRNRLRKKKR  98

Query  649  MKNGMWPVRHCSCPDSEL--QIHPISSPSAVAAALESDN---EVVELEKEMWDRFYGAGF  813
             +  + P  + +    EL  ++  ++         ++D+   E ++LEKEMWD+FY +GF
Sbjct  99   REGLLAPTNNNTIRREELERELKAVTEKQKSVDGGDNDDGKTEALDLEKEMWDQFYASGF  158

Query  814  WRSPSQRTEVSQI  852
            WRSPSQR   +Q 
Sbjct  159  WRSPSQRQRQTQT  171



>ref|XP_010090525.1| hypothetical protein L484_017152 [Morus notabilis]
 gb|EXB39674.1| hypothetical protein L484_017152 [Morus notabilis]
Length=162

 Score = 79.7 bits (195),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 61/161 (38%), Positives = 89/161 (55%), Gaps = 16/161 (10%)
 Frame = +1

Query  391  MTKRISLRSPGSGREPLLNPARDSSSGPEAVRKARFAEVAGGTTADIAAVCCCCPCGLVN  570
            M +++ +RSP   R   L P + +++G +   + R  EVAG T A+  AVCCCCPC +VN
Sbjct  1    MNRQVVVRSPPLNRRTPLLPEKSAANGRD---RRRIGEVAGRTAAECTAVCCCCPCTVVN  57

Query  571  LVVLAVYKLPAGICRKAIRSKRRRKMM---KNGMWPVR-------HCSCPDSELQIHPIS  720
            L+VLA+YK+P GICR+A   +R R+ +   +NG+   R         +  + E ++  + 
Sbjct  58   LLVLALYKVPVGICRRAWAKRRMRRQLLAKRNGLLQQRPAGPDACRSTVEELEAELRRVK  117

Query  721  SPSAVAAALESDNEVVEL---EKEMWDRFYGAGFWRSPSQR  834
                       D     +   E+EMWDRFY  GFWRSPSQR
Sbjct  118  EGKIDGGNGGGDAAFGAVDFPEEEMWDRFYNTGFWRSPSQR  158



>ref|XP_007145764.1| hypothetical protein PHAVU_007G265700g [Phaseolus vulgaris]
 gb|ESW17758.1| hypothetical protein PHAVU_007G265700g [Phaseolus vulgaris]
Length=188

 Score = 79.7 bits (195),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 67/172 (39%), Positives = 91/172 (53%), Gaps = 32/172 (19%)
 Frame = +1

Query  388  IMTKRISLRSPGSGREPLLNPARDSSSGPEAVRKARFAEVAGGTTADIAAVCCCCPCGLV  567
            +M+KR+  R   S R   L   R S   P +    R  E  GGT    AAVCCC   GL 
Sbjct  3    VMSKRVVFRPVVSHRRRSL--LRQSGGFPGS--GTRMGEAVGGT----AAVCCCFSFGLA  54

Query  568  NLVVLAVYKLPAGICRKAIRSKRRRKMM--KNGMWP----------VRHCSCP--DSEL-  702
            N+V LA+YKLPA + +K +R KR+R++   K G+            VR C+C   D  + 
Sbjct  55   NMVYLAMYKLPASLYQKMLRRKRQRRLQSKKEGLEAAADADAAASHVRRCTCGCCDDIMG  114

Query  703  --QIHPISSPSAVAAA-------LESDNEVVELEKEMWDRFYGAGFWRSPSQ  831
              +++P+ S   V  A        E D E++ELEK+MW+ FY +GFWRSPSQ
Sbjct  115  AGRVYPLCSDDGVDVAAVRRLSEAEKDPELLELEKKMWEMFYESGFWRSPSQ  166



>emb|CDY14083.1| BnaC02g02000D [Brassica napus]
Length=159

 Score = 79.0 bits (193),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 56/121 (46%), Positives = 71/121 (59%), Gaps = 13/121 (11%)
 Frame = +1

Query  499  AEVAGGTTADIAAVCCCCPCGLVNLVVLAVYKLPAGICRKAIRSKRRRKMMKNGMWPVRH  678
            AE  GGTTAD AA+CCC PC +V+LVVLAVYK+P G+ R+  R +   ++ K G    + 
Sbjct  32   AEFCGGTTADFAALCCCGPCSVVSLVVLAVYKIPRGLFRRVRRRR---RLAKRGNGDSKL  88

Query  679  CSCPDSELQIHPISSP-----SAVAAALES-----DNEVVELEKEMWDRFYGAGFWRSPS  828
                 S+  +HP+ S        +A  L+      D EVV LEKEMW RFY  GFWRS S
Sbjct  89   SKVGSSKFAVHPVESRDEEDLDKLAMELKDGGEGEDEEVVALEKEMWSRFYSGGFWRSLS  148

Query  829  Q  831
            Q
Sbjct  149  Q  149



>ref|XP_004497626.1| PREDICTED: uncharacterized protein LOC101495448 [Cicer arietinum]
Length=199

 Score = 78.2 bits (191),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 61/170 (36%), Positives = 90/170 (53%), Gaps = 31/170 (18%)
 Frame = +1

Query  391  MTKRISLRSPGSG---REPLLNPARDSSSGPEAVRKARFAEVAGGTTADIAAVCCCCPCG  561
            M+ ++ LR  GS    R+PLL  ++  S     +      EV GGT A        CPC 
Sbjct  1    MSNKVVLRPAGSSNHRRQPLLQQSQSLSKAATHI-----GEVVGGTAAVCCC----CPCA  51

Query  562  LVNLVVLAVYKLPAGICRKAIRSKRRRKMMK-----NGMWPV-RHCS---CPDSELQIHP  714
            L N+V LA+YK+PA +C +A++ +++R+  +      G++P  R C+   C D   ++HP
Sbjct  52   LANIVYLAIYKVPATLCIRALKMRKQRRRRRLQTSAEGVFPQKRRCTCGCCDDVGFRVHP  111

Query  715  ISSPSAVAAALES----------DNEVVELEKEMWDRFYGAGFWRSPSQR  834
                  V   ++S          D + +ELEKEMW+RFYG GFWRS SQR
Sbjct  112  TCGDDDVIGGVKSQSMGVEEELEDKDAMELEKEMWERFYGTGFWRSSSQR  161



>ref|XP_006408635.1| hypothetical protein EUTSA_v10002111mg [Eutrema salsugineum]
 gb|ESQ50088.1| hypothetical protein EUTSA_v10002111mg [Eutrema salsugineum]
Length=163

 Score = 76.6 bits (187),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 66/156 (42%), Positives = 92/156 (59%), Gaps = 8/156 (5%)
 Frame = +1

Query  391  MTKRISLRSPGSGREPLLNPARDSSSGPEAVRKARFAEVAGGTTADIAAVCCCCPCGLVN  570
            MT+ + L+SP    E   +P   +++  +   + +  EVAGG  A+ AAV CCCPC +VN
Sbjct  1    MTRHVILKSPLLASEERNSPPTTATAMSKHAERRKVGEVAGGAAAECAAVWCCCPCAVVN  60

Query  571  LVVLAVYKLPAGICRKAIRSKRRRKMMKNGMWPVRHCSCPDSELQIH---PISSPSAVAA  741
            LVVLAVYK+PA +C+KA R  +RR+ M+     +   +   S+  +H       P+A   
Sbjct  61   LVVLAVYKVPAAVCKKAWRRSKRRRFMRKRHGLLASAAAEGSQSTVHARLKEEDPTAEIV  120

Query  742  ALESD-----NEVVELEKEMWDRFYGAGFWRSPSQR  834
              E+      N+VV LE EM +RFYGAGFWRSPSQR
Sbjct  121  FEENTASGELNDVVRLENEMLERFYGAGFWRSPSQR  156



>ref|XP_008230595.1| PREDICTED: uncharacterized protein LOC103329849 [Prunus mume]
Length=144

 Score = 75.9 bits (185),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 45/105 (43%), Positives = 56/105 (53%), Gaps = 9/105 (9%)
 Frame = +1

Query  547  CCPCGLVNLVVLAVYKLPAGICRKA---IRSKRRRKMMKNGMWPVRHCSCPDSELQIHPI  717
            CCPC ++NL++L VYK+P G+CRKA    + KRR    K G+   R        L    +
Sbjct  38   CCPCSVMNLLILTVYKVPKGLCRKAWANTKKKRRCVAQKKGLLQPRPKGLAGGALFRDDM  97

Query  718  SSP-SAVAAALESDNEVVE-----LEKEMWDRFYGAGFWRSPSQR  834
             +   A     E  N+        LEKEMW RFYGAGFWRS SQR
Sbjct  98   DTNRDADDHGDEKQNDAESEGADLLEKEMWARFYGAGFWRSASQR  142



>ref|XP_006592799.1| PREDICTED: uncharacterized protein LOC102667734 [Glycine max]
Length=145

 Score = 75.5 bits (184),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 57/164 (35%), Positives = 78/164 (48%), Gaps = 34/164 (21%)
 Frame = +1

Query  391  MTKRISLRSPGSGREPLLNPARDSSSGPEAVRKARFAEVAGGTTADIAAVCCCCPCGLVN  570
            MT+ + LRSP     P+         G          EVAG  TA+ AAVCCC P  +++
Sbjct  1    MTQMVLLRSP-----PVTRRRGRRGVG----------EVAGSATAECAAVCCCVPLTVMD  45

Query  571  LVVLAVYKLPAGICRKAIR----------SKRRRKMMKNGMWPVRHCSC-PDSELQIHPI  717
            +VVLA YKLPA + +KA+            K+   ++ +G  PV   +  P  +L+ H  
Sbjct  46   MVVLATYKLPACLLKKAMHKRKRRLLQKKKKKTEALLDHG--PVTADNAGPGPKLEDHLA  103

Query  718  SSPSAVAAALESDNEVVELEKEMWDRFYGAGFWRSPSQRTEVSQ  849
               +      E   E   LE EMW +F G GFWRS SQR +  Q
Sbjct  104  KEVA------EEKLEASRLEAEMWAQFNGTGFWRSASQRYQQQQ  141



>ref|XP_009764931.1| PREDICTED: uncharacterized protein LOC104216555 [Nicotiana sylvestris]
Length=159

 Score = 75.1 bits (183),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 66/162 (41%), Positives = 90/162 (56%), Gaps = 16/162 (10%)
 Frame = +1

Query  391  MTKRISLRSPG-SGREPLLNP---ARDSSSGPEAVRKARFAEVAGGTTADIAAVCCCCPC  558
            MT +I + S   SGR+ L      A++        ++ R  EVAGGT A+ A VCCCCPC
Sbjct  1    MTGQIVIESSAASGRQLLRTATAMAKEEEKRISGRQQKRIGEVAGGTAAECAMVCCCCPC  60

Query  559  GLVNLVVLAVYKLPAGICRKAIRS-------KRRRKMMKNGMWPVRHCSCPDSELQIHPI  717
             ++++++LA+YK+PAG+CR+A R+       K+R+KMM N    V +    D E      
Sbjct  61   AVLHILLLALYKIPAGLCRRAWRNKKRKKLLKKRKKMMTNDSLGVYYT---DDEKDSDGG  117

Query  718  SSPSAVAAALESDNEVVELEKEMWDRF-YGAGFWRSPSQRTE  840
                      ES +E  + E EMWDRF YGAGF RS SQR E
Sbjct  118  GDNVGDDHDGES-SETADFETEMWDRFYYGAGFGRSSSQREE  158



>gb|AFK49614.1| unknown [Medicago truncatula]
Length=139

 Score = 74.3 bits (181),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 44/128 (34%), Positives = 70/128 (55%), Gaps = 4/128 (3%)
 Frame = +1

Query  484  RKARFAEVAGGTTADIAAVCCCCPCGLVNLVVLAVYKLPAGICRKAIRSKRRRKMMKNGM  663
            R+    EVAG  TA+ AA+CCC PC +V++V LA YK+PA + +KA  + R+++++K   
Sbjct  10   RRRSVGEVAGNATAECAAICCCVPCAVVDMVALATYKVPASLWKKAAINNRKKRLLKQMK  69

Query  664  WPVRHCSCPDSELQIHPISSPSAVAAALESDNEVVEL-EKEMWDRFYGAGFWR-SPSQRT  837
              +++    + E    P      V   +E      EL E+++W RF   GFWR S SQ+ 
Sbjct  70   KDMKNFL--EHEKPGGPGPETVVVGPTMEELLAQEELPEEDLWARFSVNGFWRSSSSQKH  127

Query  838  EVSQISGA  861
            E  ++   
Sbjct  128  EPDELQAG  135



>gb|AES67187.2| hypothetical protein MTR_2g087830 [Medicago truncatula]
Length=139

 Score = 74.3 bits (181),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 44/126 (35%), Positives = 70/126 (56%), Gaps = 4/126 (3%)
 Frame = +1

Query  484  RKARFAEVAGGTTADIAAVCCCCPCGLVNLVVLAVYKLPAGICRKAIRSKRRRKMMKNGM  663
            R+    EVAG  TA+ AA+CCC PC +V++V LA YK+PA + +KA  + R+++++K   
Sbjct  10   RRRSVGEVAGNATAECAAICCCVPCAVVDMVALATYKVPASLWKKAAINNRKKRLLKQMK  69

Query  664  WPVRHCSCPDSELQIHPISSPSAVAAALESDNEVVEL-EKEMWDRFYGAGFWR-SPSQRT  837
              +++    + E    P      V   +E      EL E+++W RF   GFWR S SQ+ 
Sbjct  70   KDMKNFL--EHEKPGGPGPETVVVGPTMEELLAQEELPEEDLWARFSVNGFWRSSSSQKH  127

Query  838  EVSQIS  855
            E  ++ 
Sbjct  128  EPDELQ  133



>ref|XP_002272763.1| PREDICTED: uncharacterized protein LOC100244371 [Vitis vinifera]
Length=178

 Score = 74.7 bits (182),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 57/130 (44%), Positives = 70/130 (54%), Gaps = 24/130 (18%)
 Frame = +1

Query  475  EAVRKARFAEVAGGTTADIAAVCCCCPCGLVNLVVLAVYKLPAGICRKAIRSKRRRKMMK  654
            E+ +  R  EVAGGT A+ AA+CCCCPCG++NL++LAVYKLP G+CRK            
Sbjct  61   ESEKSKRIGEVAGGTAAECAAICCCCPCGVMNLLILAVYKLPVGLCRK------------  108

Query  655  NGMWPVRHCSCPDSE---LQIHPISSPSA-------VAAALESDNEVVELEKEMWDRFYG  804
              MW  R+          LQ  P + P         V          V+L+ EMW RFYG
Sbjct  109  --MWRRRNLRRKKKRNALLQQRPSAGPPTCSCDEGNVQMIERGGKNGVDLDDEMWARFYG  166

Query  805  AGFWRSPSQR  834
            AGFWRS SQR
Sbjct  167  AGFWRSSSQR  176



>ref|XP_010417870.1| PREDICTED: uncharacterized protein LOC104703541 [Camelina sativa]
Length=166

 Score = 74.3 bits (181),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 71/162 (44%), Positives = 92/162 (57%), Gaps = 16/162 (10%)
 Frame = +1

Query  388  IMTKRISLRSP--GSGREPLLNPARDSSSGPEAV---RKARFAEVAGGTTADIAAVCCCC  552
            +MT+ + L+S    S  E  +   R+SSS P       + +  EVAGG  A+ AAV CCC
Sbjct  1    MMTRHVILKSALLASSEESTM---RNSSSPPSTALGKERRKVGEVAGGAAAECAAVWCCC  57

Query  553  PCGLVNLVVLAVYKLPAGICRKAIRSKRRRKMMKNGMWPVRHCSCPDSELQIHP---ISS  723
            PC +VNLVVLAVYK+PA +C+KA R  +RR+  +     +   +   SE  +H       
Sbjct  58   PCAVVNLVVLAVYKVPAAVCKKAWRRSKRRRFTRKRHGLLASAAAEGSESTVHARLNEED  117

Query  724  PSAVAAALESD-----NEVVELEKEMWDRFYGAGFWRSPSQR  834
            P+A     E       N+VV LE EM DRFYGAGFWRSPSQR
Sbjct  118  PTAEIVFEECHVTDEVNDVVRLENEMLDRFYGAGFWRSPSQR  159



>ref|XP_002515860.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF46529.1| conserved hypothetical protein [Ricinus communis]
Length=161

 Score = 72.8 bits (177),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 64/155 (41%), Positives = 84/155 (54%), Gaps = 21/155 (14%)
 Frame = +1

Query  418  PGSGREPLLNPARDSSSGPEAVRKARFAEVAGGTTADIAAVCCCCPCGLVNLVVLAVYKL  597
            P    E L         G +  +  R  EVAGGT A+ AAVCCCCPC L+NL+VLA++K+
Sbjct  11   PIKTTEKLAKTTTKGGRGEKHKKTKRVGEVAGGTAAECAAVCCCCPCALMNLLVLAIFKM  70

Query  598  PAGICRKAIRSKRRRKMMKNGMWPVRHCSCPDSELQIHPISSPSAVAAALES--------  753
            PA +C+KA + +  RK  K  +          ++L I  +     V AA+E         
Sbjct  71   PACLCKKAKKRRSLRKKRKQAL----LAPSGSNDLCIEKLERE--VRAAVEKQKGNGGDD  124

Query  754  -------DNEVVELEKEMWDRFYGAGFWRSPSQRT  837
                   +NE V+LEKEMWDRFY  GFWRSPSQR+
Sbjct  125  GDDDHDGENEAVDLEKEMWDRFYATGFWRSPSQRS  159



>emb|CDX83256.1| BnaA03g22500D [Brassica napus]
Length=152

 Score = 72.8 bits (177),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 59/146 (40%), Positives = 84/146 (58%), Gaps = 14/146 (10%)
 Frame = +1

Query  430  REPLLNPARDSSSGPEAVRKA---RFAEVAGGTTADIAAVCCCCPCGLVNLVVLAVYKLP  600
            R  +L     +SS    ++ A   +  EVAGG  A+ AAV CC PC +VNLVVLAVY++P
Sbjct  3    RHVILTSEERNSSPTTMIKHAERRKVGEVAGGAAAECAAVWCCGPCAVVNLVVLAVYRVP  62

Query  601  AGICRKAIRSKRRRKMM--KNGMW------PVRHCSCPDSELQIHPISSPSAVAAALESD  756
            A +C+KA R  +R++ M  ++G+          H    + +     +   + V   L   
Sbjct  63   AAVCKKAWRQTKRQRFMRRRHGLLASAAAESTVHARLKEEDPTAEIVFEENVVNGEL---  119

Query  757  NEVVELEKEMWDRFYGAGFWRSPSQR  834
            N++V LE EM++RFYGAGFWRSPSQR
Sbjct  120  NDIVVLEDEMFERFYGAGFWRSPSQR  145



>ref|XP_009594831.1| PREDICTED: uncharacterized protein LOC104091253 [Nicotiana tomentosiformis]
Length=159

 Score = 72.8 bits (177),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 63/163 (39%), Positives = 90/163 (55%), Gaps = 18/163 (11%)
 Frame = +1

Query  391  MTKRISLRSPG-SGREPLLNP---ARDSSSGPEAVRKARFAEVAGGTTADIAAVCCCCPC  558
            MT +I + S   SGR+ L      A++        ++ R  EVAGGT A+ A VCCCCPC
Sbjct  1    MTGKIVIESSAASGRQLLRTATAMAKEEEKRISGRQQKRIGEVAGGTAAECAMVCCCCPC  60

Query  559  GLVNLVVLAVYKLPAGICRKAIRS-------KRRRKMMKNGMWPVRHCSCP-DSELQIHP  714
             ++++++LA+YK+PAG+CR+A R+       K+ +KMM N    V +     DS+     
Sbjct  61   AVLHILLLALYKIPAGLCRRAWRNKKQKKLLKKSKKMMTNDSLGVYYTDDEKDSDGGRDN  120

Query  715  ISSPSAVAAALESDNEVVELEKEMWDRF-YGAGFWRSPSQRTE  840
            +       ++     E  + E EMWDRF YGAGF RS SQR E
Sbjct  121  VGDDHDGGSS-----ETADFETEMWDRFYYGAGFGRSSSQREE  158



>gb|KEH24288.1| hypothetical protein MTR_7g106820 [Medicago truncatula]
Length=183

 Score = 72.8 bits (177),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 71/161 (44%), Positives = 98/161 (61%), Gaps = 24/161 (15%)
 Frame = +1

Query  391  MTKRISLRSPGS---GREPLLNPARDSSSGPEAVRKARFAEVAGGTTADIAAVCCCCPCG  561
            M+ +I LR   S    R+PLL     SS    AV      EV GGT A+  AVCCCCPCG
Sbjct  1    MSNKIVLRQTASITRRRQPLLEI--QSSKKGCAV-----GEVVGGTAAECVAVCCCCPCG  53

Query  562  LVNLVVLAVYKLPAGICRKAIRSKRRRKMMKNGMW-PVR---HCSCPDSE-----LQIHP  714
            L + ++LAVYK+PAG+CRK +R +RRR+++K+G+  P R   +C C D       +++ P
Sbjct  54   LAHFLLLAVYKIPAGLCRKMLRKRRRRRVIKDGLLQPKRRNCYCGCCDINYVNGVIRVSP  113

Query  715  --ISSPSAVAAALE---SDNEVVELEKEMWDRFYGAGFWRS  822
              ++  S+    LE    D++ + LEKEMW+RFY AGFWRS
Sbjct  114  MCVNDGSSDIKRLEYSSEDDDAIALEKEMWERFYSAGFWRS  154



>ref|XP_009418969.1| PREDICTED: uncharacterized protein LOC103999051 [Musa acuminata 
subsp. malaccensis]
Length=186

 Score = 72.8 bits (177),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 49/120 (41%), Positives = 63/120 (53%), Gaps = 6/120 (5%)
 Frame = +1

Query  490  ARFAEVAGGTTADIAAVCCCCPCGLVNLVVLAVYKLPAGICRKAIRSKRRRKMMKNG---  660
            AR AEVAGGT AD  AVCC  PC +VNL+VL   +LPA  CR+A+R++ +R+        
Sbjct  50   ARCAEVAGGTAADCVAVCCLGPCLVVNLLVLTAVRLPAVACRRALRAREKRRQRARKRKE  109

Query  661  ---MWPVRHCSCPDSELQIHPISSPSAVAAALESDNEVVELEKEMWDRFYGAGFWRSPSQ  831
               + P        S       S+        E+    VELE+EM  +F G GFWRSPS 
Sbjct  110  TALLGPKAGFGGDGSSSDAQEDSNGDVDGLRREAGPSPVELEREMLAQFQGMGFWRSPSN  169



>emb|CDY63609.1| BnaC03g72760D [Brassica napus]
Length=152

 Score = 72.0 bits (175),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 55/124 (44%), Positives = 76/124 (61%), Gaps = 11/124 (9%)
 Frame = +1

Query  487  KARFAEVAGGTTADIAAVCCCCPCGLVNLVVLAVYKLPAGICRKAIRSKRRRKMM--KNG  660
            + +  EVAGG  A+ AAV CC PC +VNLVVLAVY++PA +C+KA R  +R++ M  ++G
Sbjct  25   RRKVGEVAGGAAAECAAVWCCGPCAVVNLVVLAVYRVPAAVCKKAWRQTKRQRFMRRRHG  84

Query  661  MW------PVRHCSCPDSELQIHPISSPSAVAAALESDNEVVELEKEMWDRFYGAGFWRS  822
            +          H    + +     +   + V   L   N+VV LE EM++RFYGAGFWRS
Sbjct  85   LLASAAAESTVHARLKEEDPTAEIVFEENVVNVEL---NDVVVLEDEMFERFYGAGFWRS  141

Query  823  PSQR  834
            PSQR
Sbjct  142  PSQR  145



>ref|XP_010473110.1| PREDICTED: uncharacterized protein LOC104752617 [Camelina sativa]
Length=166

 Score = 71.6 bits (174),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 70/162 (43%), Positives = 91/162 (56%), Gaps = 16/162 (10%)
 Frame = +1

Query  388  IMTKRISLRSP--GSGREPLLNPARDSSSGPEAV---RKARFAEVAGGTTADIAAVCCCC  552
            +MT+ + L+S    S  E  +   R+ SS P       + +  EVAGG  A+ AAV CCC
Sbjct  1    MMTRHVILKSALLASSEESAM---RNYSSPPSTALGKERRKVGEVAGGAAAECAAVWCCC  57

Query  553  PCGLVNLVVLAVYKLPAGICRKAIRSKRRRKMMKNGMWPVRHCSCPDSELQIHP---ISS  723
            PC +VNLVVLAVYK+PA +C+KA R  +RR+  +     +   +   SE  +H       
Sbjct  58   PCAVVNLVVLAVYKVPAAVCKKAWRRSKRRRFTRKRHGLLASAAAEGSESTVHARLNEED  117

Query  724  PSAVAAALESD-----NEVVELEKEMWDRFYGAGFWRSPSQR  834
            P+A     E       N+VV LE EM DRFYGAGFWRSPSQR
Sbjct  118  PTAEIVFEECHVTDEVNDVVRLENEMLDRFYGAGFWRSPSQR  159



>ref|XP_009760948.1| PREDICTED: uncharacterized protein LOC104213201 [Nicotiana sylvestris]
Length=128

 Score = 70.5 bits (171),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 47/130 (36%), Positives = 64/130 (49%), Gaps = 7/130 (5%)
 Frame = +1

Query  460  SSSGPEAVRKARFAEVAGGTTADIAAVCCCCPCGLVNLVVLAVYKLPAGICRKAIRSKRR  639
            ++   E+  + R  EVAG T A+ A VCCC PC + + +VLAVYK+P G+CRK  R K +
Sbjct  2    TTKSIESPHRRRAGEVAGRTAAECATVCCCFPCAVAHFLVLAVYKVPTGLCRKMWRKKNQ  61

Query  640  RKMMKNGMWPVRHCSCPDSELQI---HPISSPSAVAAALESDNEVVELEKEMWDRFYGAG  810
            +K++ N          P     I                     V E E EMW RFY  G
Sbjct  62   KKLLNNNKKKNE----PKGAYDIVANEKNGGGGVGGGGGGGKPVVAESETEMWGRFYEGG  117

Query  811  FWRSPSQRTE  840
            F+RS S++ E
Sbjct  118  FFRSASKKKE  127



>ref|XP_003596936.1| hypothetical protein MTR_2g087830 [Medicago truncatula]
Length=312

 Score = 73.6 bits (179),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 49/129 (38%), Positives = 65/129 (50%), Gaps = 10/129 (8%)
 Frame = +1

Query  484  RKARFAEVAGGTTADIAAVCCCCPCGLVNLVVLAVYKLPAGICRKAI---RSKRRRKMMK  654
            R+    EVAG  TA+ AA+CCC PC +V++V LA YK+PA + +KA    R KR  K MK
Sbjct  10   RRRSVGEVAGNATAECAAICCCVPCAVVDMVALATYKVPASLWKKAAINNRKKRLLKQMK  69

Query  655  NGMWPVRHCSCPDSELQIHPISSPSAVAAALESDNEVVEL-EKEMWDRFYGAGFWR-SPS  828
              M        P       P      V   +E      EL E+++W RF   GFWR S S
Sbjct  70   KDMKNFLEHEKPGG-----PGPETVVVGPTMEELLAQEELPEEDLWARFSVNGFWRSSSS  124

Query  829  QRTEVSQIS  855
            Q+ E  ++ 
Sbjct  125  QKHEPDELQ  133



>ref|XP_008442966.1| PREDICTED: uncharacterized protein LOC103486710 [Cucumis melo]
Length=128

 Score = 70.1 bits (170),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 51/93 (55%), Positives = 69/93 (74%), Gaps = 8/93 (9%)
 Frame = +1

Query  391  MTKRISLRSPGSGR-EPLLNPARDSSSGPEAVRKARFAEVAGGTTADIAAVCCCCPCGLV  567
            M+  I LR P S R +PLL  A  S+SG       RFAEVAGGTTA+ AAVCCCCPC ++
Sbjct  1    MSNTIMLRPPSSNRRQPLL--ASKSASGS-----VRFAEVAGGTTAECAAVCCCCPCVVI  53

Query  568  NLVVLAVYKLPAGICRKAIRSKRRRKMMKNGMW  666
            N +VLA+YK+PAG+CR+A+R+KRR+++ K  ++
Sbjct  54   NFLVLAIYKVPAGLCRRALRTKRRQRLKKKELF  86



>ref|XP_010686148.1| PREDICTED: uncharacterized protein LOC104900431 [Beta vulgaris 
subsp. vulgaris]
Length=176

 Score = 70.9 bits (172),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 59/180 (33%), Positives = 85/180 (47%), Gaps = 38/180 (21%)
 Frame = +1

Query  391  MTKRISLRS----------PGSGREPLLNPARDSSSGPEAVRKA--RFAEVAGGTTADIA  534
            MT RI +RS          PG+   P   PAR+       +RK+     EVAGGT A+  
Sbjct  1    MTGRIVIRSSHMALNRRKSPGT-LTPAETPARN-------MRKSCSNVGEVAGGTAANCV  52

Query  535  AVCCCCPCGLVNLVVLAVYKLPAGICRKAIRSKRRR------------------KMMKNG  660
             V CCCPC L+  ++LAVY++P  +CR+ +R K+++                  +  K G
Sbjct  53   VVSCCCPCVLMECLILAVYRVPTILCRRILRRKKQKIMMMNEKKMKNNNKKEVVEYAKEG  112

Query  661  MWPVRHCSCPDSELQIHPISSPSAVAAALESDNEVVELEKEMWDRFYGAGFWRSPSQRTE  840
               V          ++  +         +  D   VEL+K+MWDRF+  GFWRSPSQR +
Sbjct  113  GSSVGEVYNKGYVDEVSDVDLKELEMIKVSIDGSAVELDKQMWDRFHNTGFWRSPSQRYD  172



>ref|XP_002862773.1| hypothetical protein ARALYDRAFT_497300 [Arabidopsis lyrata subsp. 
lyrata]
 ref|XP_002879067.1| hypothetical protein ARALYDRAFT_481606, partial [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH39031.1| hypothetical protein ARALYDRAFT_497300, partial [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH55326.1| hypothetical protein ARALYDRAFT_481606, partial [Arabidopsis 
lyrata subsp. lyrata]
Length=143

 Score = 70.1 bits (170),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 64/137 (47%), Positives = 81/137 (59%), Gaps = 10/137 (7%)
 Frame = +1

Query  454  RDSSSGPEAVRKAR--FAEVAGGTTADIAAVCCCCPCGLVNLVVLAVYKLPAGICRKAIR  627
            R+S     A+ K R    EVAGG  A+ AAV CCCPC +VNLVVLAVYK+PA +C+KA R
Sbjct  2    RNSPPMTTALSKERRKVGEVAGGAAAECAAVWCCCPCAVVNLVVLAVYKVPAAVCKKAWR  61

Query  628  SKRRRKMMKNGMWPVRHCSCPDSELQIHP-ISSPSAVAAALESD-------NEVVELEKE  783
              +RR+  +     +   +   SE  +H  ++     A  +  D       N+VV LE E
Sbjct  62   RSKRRRFTRKRHGLLASATAEGSESTVHARLNGEDLTAEIVFEDCQVNGELNDVVRLENE  121

Query  784  MWDRFYGAGFWRSPSQR  834
            M DRFYGAGFWRSPSQR
Sbjct  122  MLDRFYGAGFWRSPSQR  138



>gb|KJB54161.1| hypothetical protein B456_009G081700 [Gossypium raimondii]
Length=162

 Score = 70.1 bits (170),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 58/164 (35%), Positives = 91/164 (55%), Gaps = 17/164 (10%)
 Frame = +1

Query  391  MTKRISLRSPGSGREPLLNPARDSSSGPEAVRKARFAEVAGGTTADIAAVCCCCPCGLVN  570
            MT+ ++   P   R   L+ ++DS     A +  +  EV G T A+  AVCCCCPC ++ 
Sbjct  1    MTRLLTKAPPVKRRTAALSISKDSKM---AKKGKKCGEVMGVTAAECTAVCCCCPCSIIE  57

Query  571  LVVLAVYKLPAGICRKAIR------SKRRRKMMKNGMWPVRHCSCPDSELQI---HPISS  723
            L+VLA YK+PA +C+K +R       K+++K  ++ + P + C     EL+    H +  
Sbjct  58   LLVLAFYKIPARLCKKVLRWKKRHLMKKKKKNQQDLLGPTK-CRPTGEELEAELDHMMGK  116

Query  724  PSAVAAALESDNE----VVELEKEMWDRFYGAGFWRSPSQRTEV  843
                   +++ ++     V+ E++MWDRF GAGFWRSPSQR E 
Sbjct  117  GEPCDCGVDNHDDSCARAVDFEQKMWDRFRGAGFWRSPSQREET  160



>ref|XP_011005858.1| PREDICTED: uncharacterized protein LOC105112014 [Populus euphratica]
Length=170

 Score = 69.3 bits (168),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 64/156 (41%), Positives = 81/156 (52%), Gaps = 17/156 (11%)
 Frame = +1

Query  388  IMTKRISLRSPGSGREPLLNPARDSSSGPEAVRKARFAEVAGGTTADIAAVCCCCPCGLV  567
            +  K +S   PG  R    NPAR         ++  F EVAGGT A  AAVCCCCPC ++
Sbjct  21   LKEKTVSKMVPGGERRER-NPAR--------AKRQSFGEVAGGTAAGCAAVCCCCPCTVI  71

Query  568  NLVVLAVYKLPAGICRKAIRSKRRRKMMKNGMWPVRHCSCPDS----ELQIHPISSPSAV  735
            NL+VLAVYK+P  +C+KA + +R R+  K      R  S        E +   I      
Sbjct  72   NLLVLAVYKVPVSLCKKAKKRQRLRRKQKERSLLSRASSGLSRDEGWEKEAREIMEKGKC  131

Query  736  AAALESD----NEVVELEKEMWDRFYGAGFWRSPSQ  831
                  D     + V+LEKEMWD+FY  GFWRSPSQ
Sbjct  132  CDQHNHDPNGETDAVDLEKEMWDQFYNTGFWRSPSQ  167



>emb|CDX71471.1| BnaC04g17060D [Brassica napus]
Length=150

 Score = 68.6 bits (166),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 59/148 (40%), Positives = 83/148 (56%), Gaps = 18/148 (12%)
 Frame = +1

Query  436  PLLNPARDSS--SGPEAVRKARFAEVAGGTTADIAAVCCCCPCGLVNLVVLAVYKLPAGI  609
            PLL   + +S  +  +   + +  EVAGG  A+ AAV CCCPC +VNLVVLAVY++PA +
Sbjct  6    PLLASEQRNSLPTMSKHAERRKVGEVAGGAAAECAAVWCCCPCAVVNLVVLAVYRVPAAV  65

Query  610  CRKAIRSKRRRKMMKNGMWPVRHCSCPD-SELQIH---PISSPSAVAAALESD-------  756
            C+KA R  +RR+ M       RH    + S+  +H    +  P+A     E         
Sbjct  66   CKKAWRRSKRRRFMTTK----RHGLLAEGSQSTVHARLKVEDPTAEIIVFEESAVYVNGE  121

Query  757  -NEVVELEKEMWDRFYGAGFWRSPSQRT  837
             N+V+ LE EM +RFYG GFWRS S++ 
Sbjct  122  LNDVMVLEGEMLERFYGTGFWRSLSKKN  149



>ref|XP_009125644.1| PREDICTED: uncharacterized protein LOC103850619 [Brassica rapa]
Length=155

 Score = 68.2 bits (165),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 55/121 (45%), Positives = 65/121 (54%), Gaps = 13/121 (11%)
 Frame = +1

Query  499  AEVAGGTTADIAAVCCCCPCGLVNLVVLAVYKLPAGICRKAIRSKRRRKMMKNGMWPVRH  678
            AE  GGTTAD AA+CCC PC +V+LVVLAVYK+P        R +RRR + K G    + 
Sbjct  28   AEFCGGTTADFAALCCCGPCSVVSLVVLAVYKIPR---GLFRRVRRRRGLAKRGNGDSKL  84

Query  679  CSCPDSELQIHPISS----------PSAVAAALESDNEVVELEKEMWDRFYGAGFWRSPS  828
                 S+  +HP+ S                    D EVV LEKEMW RFY  GFWRS S
Sbjct  85   SKVGSSKFAVHPVESREEEDLDKLAMELKEEEEGEDEEVVALEKEMWSRFYSGGFWRSLS  144

Query  829  Q  831
            Q
Sbjct  145  Q  145



>ref|XP_009103580.1| PREDICTED: uncharacterized protein LOC103829651 [Brassica rapa]
Length=154

 Score = 67.8 bits (164),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 58/148 (39%), Positives = 80/148 (54%), Gaps = 14/148 (9%)
 Frame = +1

Query  436  PLLNPARDSS--SGPEAVRKARFAEVAGGTTADIAAVCCCCPCGLVNLVVLAVYKLPAGI  609
            PLL   + +S  +  +   + +  EVAGG  A+ AAV CCCPC +VNLVVLAVY++PA +
Sbjct  6    PLLASEQRTSLPTMSKHAERRKVGEVAGGAAAECAAVWCCCPCAVVNLVVLAVYRVPAAV  65

Query  610  CRKAIRSKRRRKMMKN--------GMWPVRHCSC----PDSELQIHPISSPSAVAAALES  753
            C+KA R  +RR+ M          G     H       P +E+ +   S+ +        
Sbjct  66   CKKAWRRSKRRRFMTTKRHGLLAEGSQSTVHARLKEEDPTAEIIVFEESAVNVNVNVNGE  125

Query  754  DNEVVELEKEMWDRFYGAGFWRSPSQRT  837
             N+V  LE EM +RFYG GFWRS S+R 
Sbjct  126  LNDVTVLEGEMLERFYGTGFWRSLSKRN  153



>ref|XP_008778376.1| PREDICTED: uncharacterized protein LOC103698166, partial [Phoenix 
dactylifera]
Length=207

 Score = 67.8 bits (164),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 60/124 (48%), Positives = 75/124 (60%), Gaps = 11/124 (9%)
 Frame = +1

Query  490  ARFAEVAGGTTADIAAVCCCCPCGLVNLVVLAVYKLPAGICRKAIRSK-------RRRKM  648
            AR AEVAGGT A  AAVCCCCPCGL+NL+V  V +LPAG+C++A++++       +RRK 
Sbjct  72   ARLAEVAGGTAAGCAAVCCCCPCGLLNLLVFTVVRLPAGLCQRALKARAKRRAVIKRRKA  131

Query  649  MKNGMWPVRHCSCPDSELQIHPISSPSAVAA----ALESDNEVVELEKEMWDRFYGAGFW  816
             K G+            L +H      AVA     A     EV E+EKEMW +FY AGFW
Sbjct  132  GKLGLNSAGGEGEEQEGLGLHGAVVAVAVAGEAWPAKPPSEEVTEMEKEMWAKFYSAGFW  191

Query  817  RSPS  828
            RSPS
Sbjct  192  RSPS  195



>ref|XP_010058753.1| PREDICTED: uncharacterized protein LOC104446615 [Eucalyptus grandis]
 gb|KCW90410.1| hypothetical protein EUGRSUZ_A02549 [Eucalyptus grandis]
Length=195

 Score = 67.4 bits (163),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 36/74 (49%), Positives = 49/74 (66%), Gaps = 4/74 (5%)
 Frame = +1

Query  388  IMTKRISLRS-PGSGREPLLNPARDSSSGPEAVRKARFAEVAGGTTADIAAVCCCCPCGL  564
              + ++ LRS P   RE LL     + SG    R+ARFAEVAGG+ A+ AA+ CCCPC +
Sbjct  12   TTSHQVVLRSAPADRRERLLGTPPPTPSG---ARRARFAEVAGGSAAECAAIWCCCPCAI  68

Query  565  VNLVVLAVYKLPAG  606
             + V+LAVY++PAG
Sbjct  69   ADFVLLAVYRVPAG  82



>gb|EYU45228.1| hypothetical protein MIMGU_mgv1a021343mg, partial [Erythranthe 
guttata]
Length=102

 Score = 65.5 bits (158),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 42/122 (34%), Positives = 62/122 (51%), Gaps = 22/122 (18%)
 Frame = +1

Query  475  EAVRKARFAEVAGGTTADIAAVCCCCPCGLVNLVVLAVYKLPAGICRKAIRSKRRRKMMK  654
            E  R++   E + G   D  AVCCC PCG+++L++L VY LP  + RK    KR      
Sbjct  1    EKRRESGVGEESAGLGGD-PAVCCCFPCGMMHLLILVVYCLPVSMWRK----KR------  49

Query  655  NGMWPVRHCSCPDSELQIHPISSPSAVAAALESDNEVVELEKEMWDRFYGAGFWRSPSQR  834
                  +H S  +++ ++  I S S        +     ++ + WDRFYG GFWRS SQR
Sbjct  50   ------KHSSSEENQQKL--IRSDSTPPMR---NRPKTTIDNKTWDRFYGDGFWRSSSQR  98

Query  835  TE  840
             +
Sbjct  99   ND  100



>emb|CDY71899.1| BnaAnng39210D [Brassica napus]
Length=156

 Score = 66.2 bits (160),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 61/154 (40%), Positives = 82/154 (53%), Gaps = 24/154 (16%)
 Frame = +1

Query  436  PLLNPARDSS--SGPEAVRKARFAEVAGGTTADIAAVCCCCPCGLVNLVVLAVYKLPAGI  609
            PLL   + +S  +  +   + +  EVAGG  A+ AAV CCCPC +VNLVVLAVY++PA +
Sbjct  6    PLLASEQRTSLPTMSKHAERRKVGEVAGGAAAECAAVWCCCPCAVVNLVVLAVYRVPAAV  65

Query  610  CRKAIRSKRRRKMMKNGMWPVRHCSCPD-SELQIH---PISSPSAVAAALESD-------  756
            C+KA R  +RR+ M       RH    + S+  +H       P+A    LE         
Sbjct  66   CKKAWRRSKRRRFMTTK----RHGLLAEGSQSTVHARLKEEDPTAEIIVLEESAVNVNVN  121

Query  757  -------NEVVELEKEMWDRFYGAGFWRSPSQRT  837
                   N+V  LE EM +RFYG GFWRS S+R 
Sbjct  122  VNVNGELNDVTVLEGEMLERFYGTGFWRSLSKRN  155



>ref|XP_009417076.1| PREDICTED: uncharacterized protein LOC103997547 [Musa acuminata 
subsp. malaccensis]
Length=184

 Score = 66.6 bits (161),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 57/130 (44%), Positives = 73/130 (56%), Gaps = 16/130 (12%)
 Frame = +1

Query  487  KARFAEVAGGTTADIAAVCCCCPCGLVNLVVLAVYKLPAGICRKAIRSKRRRKMM-----  651
            +AR AE+AGGT AD  AVCCC P  LVNL+V+A  +LPAG+CR+A R++ RRK       
Sbjct  51   RARCAEMAGGTAADCLAVCCCPPLALVNLLVVASVRLPAGLCRRAARARARRKERIRRRK  110

Query  652  -------KNGMWPVRHCSCPDSELQIHPIS---SPSAVAAALESDNEVVELEKEMWDRFY  801
                   K G    R  S   +E + +      S SA AA   S  EV E++  MW +F 
Sbjct  111  EAALLAHKAGRGEERASSATTAEGEANGEGFRGSASASAAGGPSREEVAEMDN-MWTQFS  169

Query  802  GAGFWRSPSQ  831
              GFWRSPS+
Sbjct  170  NMGFWRSPSE  179



>gb|EPS68681.1| hypothetical protein M569_06090 [Genlisea aurea]
Length=135

 Score = 65.1 bits (157),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 53/144 (37%), Positives = 71/144 (49%), Gaps = 20/144 (14%)
 Frame = +1

Query  403  ISLRSPGSGREPLL--NPARDSSSGPEAVRKARFAEVAGGTTADIAAVCCCCPCGLVNLV  576
            ++ RS    R P L  NPA D    P   R     E+AG T AD  A+CCC PC + N +
Sbjct  1    MTTRSQAPDRPPTLLNNPAIDV---PRLRRTPE--ELAGQTAADCVAICCCVPCCIFNAI  55

Query  577  VLAVYKLPAGICRKAIRSKRRRKMMKNGMWPVRHCSCPDSELQIHPISSPSAVAAALESD  756
             LAVYK+P G+ RK    +RRR++ +        C   D +         ++V    E  
Sbjct  56   ALAVYKIPVGLARKVRTVRRRRRLRER------KCVSDDEQ-------GGASVEKLPELS  102

Query  757  NEVVELEKEMWDRFYGAGFWRSPS  828
             E  EL+ EM ++F G GFWR PS
Sbjct  103  QEAAELDNEMREKFKGGGFWRRPS  126



>ref|XP_011461807.1| PREDICTED: uncharacterized protein LOC105350703 [Fragaria vesca 
subsp. vesca]
Length=145

 Score = 65.1 bits (157),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 56/131 (43%), Positives = 77/131 (59%), Gaps = 11/131 (8%)
 Frame = +1

Query  466  SGPEAVR-KARFAEVAGGTTADIAAVCCCCPCGLVNLVVLAVYKLPAGICRKA---IRSK  633
            S P   R K R  EVAGG  A+ AAVCCCCPC ++NL++LAVYK+P G+CRKA    ++K
Sbjct  9    SSPSTTRSKRRVGEVAGGAAAECAAVCCCCPCSMMNLLILAVYKVPRGLCRKAWAMTKTK  68

Query  634  RRRKMMKNGMWPVRHCSCPDSELQIHPISSPSAVAAAL------ESDNEVVELEKEMWDR  795
              ++  K G    R     + +L+   +S        +      ++++E    EKEMWDR
Sbjct  69   SNKQSCKKGSLLPRPTGLGNGDLR-KTVSGGEDDDLMMKKNKEDDAESEDAAFEKEMWDR  127

Query  796  FYGAGFWRSPS  828
            FYGAGFWRS +
Sbjct  128  FYGAGFWRSST  138



>ref|XP_006384687.1| hypothetical protein POPTR_0004s20180g [Populus trichocarpa]
 gb|ERP62484.1| hypothetical protein POPTR_0004s20180g [Populus trichocarpa]
Length=142

 Score = 64.3 bits (155),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 55/120 (46%), Positives = 67/120 (56%), Gaps = 8/120 (7%)
 Frame = +1

Query  496  FAEVAGGTTADIAAVCCCCPCGLVNLVVLAVYKLPAGICRKAIRSKRRRKMMKNGMWPVR  675
            F EVAGGT A  AAVCCCCPC ++NL+VLAVYK+P  +CRKA + +R R+  K      R
Sbjct  20   FGEVAGGTAAGCAAVCCCCPCTVINLLVLAVYKVPVSLCRKAKKRQRLRRKQKERSLLSR  79

Query  676  HCSCPDS----ELQIHPISSPSAVAAALESD----NEVVELEKEMWDRFYGAGFWRSPSQ  831
              S        E +   I            D     + V+LEKEMWD+F   GFWRSPSQ
Sbjct  80   ASSGLSRDEGWEKEAREIMEKGKCCDQHNHDPNGETDAVDLEKEMWDQFNNTGFWRSPSQ  139



>ref|XP_006847831.1| PREDICTED: uncharacterized protein LOC18437561 [Amborella trichopoda]
 gb|ERN09412.1| hypothetical protein AMTR_s00029p00052430 [Amborella trichopoda]
Length=145

 Score = 64.3 bits (155),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 70/152 (46%), Positives = 87/152 (57%), Gaps = 26/152 (17%)
 Frame = +1

Query  418  PGSGR-EPLLNPARDSSSGPEAVRKARFAEVAGGTTADIAAVCCCCPCGLVNLVVLAVYK  594
            P SGR +PLL        G E    +RFAE AGGT A  AAVCCCCPCGLVNL+VLA+ K
Sbjct  9    PDSGRRQPLL--------GKETSSASRFAETAGGTMASCAAVCCCCPCGLVNLLVLAMVK  60

Query  595  LPAGIC-RKAIRSKRRRKMMKNGMWPVRHCSCPDSELQIHPI--------SSPSAVAAAL  747
            LPAG+C R   R KR +K  K+ + P R      SELQ+HP+        +SP       
Sbjct  61   LPAGLCKRALRRKKREKKRRKDVLIPNR------SELQVHPVRPAPTRPENSPEIAGNWP  114

Query  748  E-SDNEVVELEKEMWDRFYGAGFWRSPSQRTE  840
            E S  + VE    MW++ +  GFWRS S+R +
Sbjct  115  EKSPEKQVEEMDAMWEKMH-TGFWRSISEREQ  145



>ref|XP_009804871.1| PREDICTED: uncharacterized protein LOC104250040 [Nicotiana sylvestris]
Length=138

 Score = 64.3 bits (155),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 48/121 (40%), Positives = 64/121 (53%), Gaps = 5/121 (4%)
 Frame = +1

Query  493  RFAEVAGGTTADIAAVCCCCPCGLVNLVVLAVYKLPAGIC-----RKAIRSKRRRKMMKN  657
            R  EV GGT A+ A VCCCCPC +++ +VLAVYK+P G+C     +K  +   R K  + 
Sbjct  17   RIGEVVGGTAAECAMVCCCCPCAVMHFLVLAVYKVPTGLCRKMWRKKKRKRLLRNKKKEE  76

Query  658  GMWPVRHCSCPDSELQIHPISSPSAVAAALESDNEVVELEKEMWDRFYGAGFWRSPSQRT  837
              W     +  D     +            +   E  + E EMWDRFYGAGFWR+PSQ+ 
Sbjct  77   DSWKAMKKNKSDLLGVYNEEEFDGEDDGDYDGVREAADFETEMWDRFYGAGFWRTPSQKE  136

Query  838  E  840
            E
Sbjct  137  E  137



>emb|CDX98918.1| BnaC09g49170D [Brassica napus]
Length=167

 Score = 63.5 bits (153),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 54/127 (43%), Positives = 72/127 (57%), Gaps = 17/127 (13%)
 Frame = +1

Query  499  AEVAGGTTADIAAVCCCCPCGLVNLVVLAVYKLPAGICRKAIRSKR-------RRKMMKN  657
            AE  GGTTA  AA+CCC PC +V+LVV AVYK P  ICR AIR  R       ++++ +N
Sbjct  33   AEFCGGTTAGCAALCCCAPCSVVSLVVFAVYKAPRRICRGAIRRVRRRRRGMSKKEVSEN  92

Query  658  GMWPVRHCSCPDSELQIHPISSP-----SAVAAALE-----SDNEVVELEKEMWDRFYGA  807
            G    + C    S+  +HP+ S        +A  L       D+EV+ LEKEMW+RF   
Sbjct  93   GDCEKKLCKAGSSQFAVHPLESKEDGDLDKLAMYLSDDEEEDDDEVIALEKEMWNRFNSG  152

Query  808  GFWRSPS  828
            GFWR+ +
Sbjct  153  GFWRAET  159



>ref|XP_009140772.1| PREDICTED: uncharacterized protein LOC103864759 [Brassica rapa]
Length=160

 Score = 62.8 bits (151),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 49/103 (48%), Positives = 62/103 (60%), Gaps = 10/103 (10%)
 Frame = +1

Query  556  CGLVNLVVLAVYKLPAGICRKA-IRSKRRRKMMKNGMWPVRHCSCPDSELQIH------P  714
            C +VNLVVLAVYK+PA +C+KA  RSKRRR MMK             SE  +H       
Sbjct  51   CAVVNLVVLAVYKVPAAVCKKAWKRSKRRRFMMKRHGLLASSAGAKGSESTVHARLKEED  110

Query  715  ISSPSAVAAALESD---NEVVELEKEMWDRFYGAGFWRSPSQR  834
            +++   V    E++   N+V+ LE EM + FYGAGFWRSPSQR
Sbjct  111  LTAEIVVIEENEANCQPNDVIMLEDEMLEHFYGAGFWRSPSQR  153



>gb|KEH41815.1| hypothetical protein MTR_1g054990 [Medicago truncatula]
Length=187

 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 56/175 (32%), Positives = 83/175 (47%), Gaps = 32/175 (18%)
 Frame = +1

Query  391  MTKRISLRSPGSG--REPLLNPARDSSSGPEAVRKARFAEVAGGTTADIAAVCCCCPCGL  564
            M+ ++ LR   S   R+PLL   + S          R  E  GGT A         PC +
Sbjct  1    MSSKVVLRQVQSSNRRQPLLQQNKSSLKA-----GTRLGEAVGGTAAVCCCA----PCAV  51

Query  565  VNLVVLAVYKLPAGICRKAIRSKRRR-----KMMKNGMWPVRH---CSCPDSEL--QIHP  714
             N+V LA+YK+PA +C +A+R +++      +     M+P +    C C D  +  ++HP
Sbjct  52   ANIVYLAIYKVPATLCIRALRKRKQHHRRRIQASAETMFPAKRRCTCGCCDDIVGARVHP  111

Query  715  I-SSPSAVAAALESDNEVVE----------LEKEMWDRFYGAGFWRSPSQRTEVS  846
              S        ++SD+  V+          LEKEMW+ FY  GFWRS SQR + S
Sbjct  112  TCSDDDETYRGVKSDSLGVQEEEEDKDVVELEKEMWNTFYETGFWRSSSQRNKDS  166



>ref|XP_008378262.1| PREDICTED: uncharacterized protein LOC103441365 [Malus domestica]
 ref|XP_008347703.1| PREDICTED: uncharacterized protein LOC103410817 [Malus domestica]
Length=152

 Score = 62.0 bits (149),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 46/113 (41%), Positives = 64/113 (57%), Gaps = 15/113 (13%)
 Frame = +1

Query  541  CCCCPCGLVNLVVLAVYKLPAGICRKAI---RSKRR------RKMMK---NGMWPVRHCS  684
            CCCCP  ++NL++L VYK+P GICR+A+   ++KRR      + +++   NG+      S
Sbjct  38   CCCCPFSVMNLLILTVYKVPKGICRRALAHRKNKRRCLAAQKKALLQPRPNGLAGGGLYS  97

Query  685  CPDSELQIHPISSPSAVAAALESDNEVVE---LEKEMWDRFYGAGFWRSPSQR  834
              D   +     S   V     S++E      LEKEMWDRF GAGFWRS S+R
Sbjct  98   DDDEFFRRASSYSDGDVDDRKGSEDETEGADLLEKEMWDRFDGAGFWRSASRR  150



>ref|XP_004251435.1| PREDICTED: uncharacterized protein LOC101260996 [Solanum lycopersicum]
Length=168

 Score = 61.6 bits (148),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 50/125 (40%), Positives = 67/125 (54%), Gaps = 4/125 (3%)
 Frame = +1

Query  457  DSSSGPEAVRKARFAEVAGGTTADIAAVCCCCPCGLVNLVVLAVYKLPAGICRKAIRSKR  636
            D   G    +  R  EVAGGT A+ A VCCCCPC +++ ++LA+YK+P G+CRKA RSK+
Sbjct  34   DEKRGGGGNQHKRIGEVAGGTAAECAMVCCCCPCTVLHFLLLALYKVPTGLCRKAWRSKK  93

Query  637  RRKMMKNGMWPVRHCSCPDSELQIHPISSPSAVAAALESDNEVVELEKEMWDRFY-GAGF  813
            ++K++K         + P                      +E  E E EMW RFY GAGF
Sbjct  94   QKKVLKK---KNSTNNSPGVYYTDDDKDYFDGGGNVNRGSSETAEFETEMWHRFYDGAGF  150

Query  814  WRSPS  828
             RS S
Sbjct  151  GRSSS  155



>ref|XP_006582800.1| PREDICTED: uncharacterized protein LOC100796231 [Glycine max]
Length=146

 Score = 61.2 bits (147),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 56/137 (41%), Positives = 66/137 (48%), Gaps = 23/137 (17%)
 Frame = +1

Query  484  RKARFAEVAGGTTADIAAVCCCCPCGLVNLVVLAVYKLPAGICRKAIRSKRRRKMMKNGM  663
            R+    EVAG   AD  AVCCCCPC +VNLVVLAVYKLP G+  KA   +RRR   KN  
Sbjct  11   RRRGVGEVAGSAAADCTAVCCCCPCTVVNLVVLAVYKLPKGLVEKAAHKRRRRMPKKNNT  70

Query  664  WPVRHCSCPDSELQIHPISSPSAVAAALESDNEVVELEKE--------------------  783
              V++       LQ    SS   +  A+        ++KE                    
Sbjct  71   GDVKNGVVL---LQAQRSSSVETLDIAVGPTRLEEFMKKEWEDEEKGKCEKEEEEGLEKE  127

Query  784  MWDRFYGAGFWRSPSQR  834
            MW RF G GFWRS SQR
Sbjct  128  MWARFAGTGFWRSESQR  144



>gb|AFW68128.1| hypothetical protein ZEAMMB73_262336 [Zea mays]
Length=158

 Score = 61.2 bits (147),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 39/101 (39%), Positives = 52/101 (51%), Gaps = 7/101 (7%)
 Frame = +1

Query  550  CPCGLVNLVVLAVYKLPAGICRKAIRSKR--RRKMMKNGMWPVRHCSCPDSELQIHPISS  723
             PC +V +VVLA  + PA +CRKA R  +  RR+    G     +    D+   +  + +
Sbjct  52   FPCVMVEVVVLATVRAPAALCRKAARVSKGGRRRSASVGQATEIYELPVDNAGVVVKVDA  111

Query  724  PSAVAAALESD-----NEVVELEKEMWDRFYGAGFWRSPSQ  831
             +  A AL         E  ELEKE+W RFYG GFWRS SQ
Sbjct  112  SAVEAVALPVKPALQLEETGELEKEVWARFYGTGFWRSVSQ  152



>ref|XP_010909500.1| PREDICTED: uncharacterized protein LOC105035598 [Elaeis guineensis]
Length=177

 Score = 61.6 bits (148),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 55/131 (42%), Positives = 78/131 (60%), Gaps = 14/131 (11%)
 Frame = +1

Query  490  ARFAEVAGGTTADIAAVCCCCPCGLVNLVVLAVYKLPAGICRKAIRSKRRRKMM----KN  657
            AR AEVAGGT A  AAVCCCCPCGL NL+VL V +LPA +C++A++++ +R+ +    K+
Sbjct  42   ARLAEVAGGTAAGCAAVCCCCPCGLANLLVLMVVRLPAVLCQRALKARTKRRAVIKKPKD  101

Query  658  GMWPVRHCSC-------PDSELQIHPISSPSAVAAALESD---NEVVELEKEMWDRFYGA  807
            G +  +            +  + +H   + +    A  +     E  E+EKEMW +F  A
Sbjct  102  GRFGSKQDGSGGRVRAGNEEGVGLHGAVAVAVAGEAWPAKPPPAEATEMEKEMWAKFCAA  161

Query  808  GFWRSPSQRTE  840
            GFWRSPSQR E
Sbjct  162  GFWRSPSQREE  172



>emb|CDY57481.1| BnaAnng14620D [Brassica napus]
Length=142

 Score = 60.8 bits (146),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 50/104 (48%), Positives = 66/104 (63%), Gaps = 13/104 (13%)
 Frame = +1

Query  556  CGLVNLVVLAVYKLPAGICRKA-IRSKRRRKMMK-NGMWPVRHCSCPDSELQIH------  711
            C +VNLVVLAVYK+PA +C+KA  RSKRRR MMK +G+  +       SE  +H      
Sbjct  34   CAVVNLVVLAVYKVPAAVCKKAWKRSKRRRFMMKRHGL--LASAGAKGSESTVHARLKEE  91

Query  712  PISSPSAVAAALESD---NEVVELEKEMWDRFYGAGFWRSPSQR  834
             +++   V    E++   N+V+ LE EM + FYGAGFWRSPSQR
Sbjct  92   DLTAEIVVIEENEANCQPNDVIMLEDEMLEHFYGAGFWRSPSQR  135



>ref|XP_009363700.1| PREDICTED: uncharacterized protein LOC103953653 [Pyrus x bretschneideri]
 ref|XP_009368032.1| PREDICTED: uncharacterized protein LOC103957578 [Pyrus x bretschneideri]
Length=150

 Score = 60.8 bits (146),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 48/111 (43%), Positives = 66/111 (59%), Gaps = 17/111 (15%)
 Frame = +1

Query  544  CCCPCGLVNLVVLAVYKLPAGICRKAI---RSKRR------RKMMK---NGMWPVRHCSC  687
            CCCPC ++NL++L VYK+P GICRKA+   ++KRR      + +++   NG+        
Sbjct  39   CCCPCSVMNLLILTVYKVPKGICRKALAHRKNKRRCLAAQKKALLQPRPNGL-AGGGLYS  97

Query  688  PDSELQIHPISSPSAVAAALESDNE---VVELEKEMWDRFYGAGFWRSPSQ  831
             D EL     SS S V     S++E      LEKE+WDRF+GAGFWRS S+
Sbjct  98   DDDEL-FRRASSYSDVDDGKGSEDESDAADLLEKEIWDRFHGAGFWRSASR  147



>ref|XP_004487434.1| PREDICTED: uncharacterized protein LOC101515047 [Cicer arietinum]
Length=151

 Score = 60.8 bits (146),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 53/137 (39%), Positives = 69/137 (50%), Gaps = 31/137 (23%)
 Frame = +1

Query  484  RKARFAEVAGGTTADIAAVCCCCPCGLVNLVVLAVYKLPAGICRKAIRSKR---------  636
            ++ R  EVAG  TA+ AAVCCC PC ++++V LAVYK+PAG+ +KA+++KR         
Sbjct  11   QRRRAGEVAGNATAECAAVCCCVPCAVMDMVALAVYKVPAGLFQKAMKNKRKKRLQQKKS  70

Query  637  -----------RRKMMKNGMWPVRHCSCPDSELQIHPISSPSAVAAALESDNEVVELEKE  783
                       R   + +G  P      P  E  +    SP           EVV LE E
Sbjct  71   NKKKNETGLLDRNSSIGSGPGPDTFIVGPTLEEHLAKEESP-----------EVVNLEDE  119

Query  784  MWDRFYGAGFWRSPSQR  834
            MW RF   GFWRS SQR
Sbjct  120  MWARFSVTGFWRSDSQR  136



>ref|XP_008780325.1| PREDICTED: uncharacterized protein LOC103700136, partial [Phoenix 
dactylifera]
Length=185

 Score = 60.8 bits (146),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 63/140 (45%), Positives = 75/140 (54%), Gaps = 36/140 (26%)
 Frame = +1

Query  493  RFAEVAGGTTADIAAVCCCCPCGLVNLVVLAVYKLPAGICRKAIRSKR---------RRK  645
            RFAE AG T A+ AA+CCCCPCGL+NLVVLA  K PAG+ R+A+R +R         R+K
Sbjct  59   RFAEAAGATAAECAAICCCCPCGLLNLVVLAAVKFPAGLLRQAVRRRRKRSAIVGAARKK  118

Query  646  MMKNGMWPVRHCSCPDSELQIH--------------PISSPSAVAAALESDNEVVELEKE  783
               N +  +      D +  IH              P  SPS          E+ ELEKE
Sbjct  119  AGPNKVGAMDD----DDDFSIHGGRLLVLASGDDAWPRRSPSP---------ELSELEKE  165

Query  784  MWDRFYGAGFWRSPSQRTEV  843
            M   FY AGFWRSPSQR EV
Sbjct  166  MRALFYSAGFWRSPSQREEV  185



>ref|XP_009391465.1| PREDICTED: uncharacterized protein LOC103977621 [Musa acuminata 
subsp. malaccensis]
Length=170

 Score = 60.8 bits (146),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 60/122 (49%), Positives = 78/122 (64%), Gaps = 5/122 (4%)
 Frame = +1

Query  484  RKARFAEVAGGTTADIAAVCCCCPCGLVNLVVLAVYKLPAGICRKAIRSKRRRKMMKNGM  663
            R+ARFAE+AG T A+ AAVCCCCPCGLVNL+V+ V KLPAG+ RKA+R  R R   K  +
Sbjct  37   RRARFAEMAGETAAECAAVCCCCPCGLVNLLVVVVVKLPAGLVRKALRRIRNRSRKKAAV  96

Query  664  W--PVRHCSCPDSELQIHPISSPSAVAAALESDN---EVVELEKEMWDRFYGAGFWRSPS  828
                V   +  D  ++   + + +    A  + +   E++ELEK M   FYGAGFWRSPS
Sbjct  97   SRPKVGALNHDDDSIRRAALLATAGNKEAWPTKSPSEEILELEKVMLANFYGAGFWRSPS  156

Query  829  QR  834
            QR
Sbjct  157  QR  158



>ref|XP_008365866.1| PREDICTED: uncharacterized protein LOC103429499 [Malus domestica]
Length=138

 Score = 59.7 bits (143),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 62/146 (42%), Positives = 79/146 (54%), Gaps = 23/146 (16%)
 Frame = +1

Query  430  REPLLNPARDSSSGPEAVRKARFAEVAGGTTADIAAVCCCCPCGLVNLVVLAVYKLPAGI  609
            R+PL    + +   P   R  R  EVAGG  A+ AAVCCCCPC ++NL++LAVYK P G+
Sbjct  3    RDPLFQSPKLTRPPPREKR--RVGEVAGGAAAECAAVCCCCPCSVMNLLILAVYKAPKGL  60

Query  610  CRKA---IRSKRRRKMMKNGMWPV--------RHCSCPDSELQIHPISSPSAVAAALESD  756
            C KA    + KRR  + K G            R  SC + + +    S+     A L   
Sbjct  61   CMKAWAHTKKKRRCAVQKKGRLGGGGDDDDGKRASSCTEGDGEKK--SNAETEGADL---  115

Query  757  NEVVELEKEMWDRFYGAGFWRSPSQR  834
                 LEKEMWDRF+GAGFWRS S+R
Sbjct  116  -----LEKEMWDRFHGAGFWRSASRR  136



>ref|XP_010544320.1| PREDICTED: uncharacterized protein LOC104816969 [Tarenaya hassleriana]
Length=175

 Score = 60.1 bits (144),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 70/174 (40%), Positives = 93/174 (53%), Gaps = 27/174 (16%)
 Frame = +1

Query  391  MTKRISLRSPG-SGREPLLNPARDSSSGPEAV-----------------RKARFAEVAGG  516
            MT+ + LRSP  + REPLL       + P  +                 R+ + AEVAGG
Sbjct  1    MTRHVILRSPAVNKREPLLASESKEPATPPIIKSPGRIVKASAMVVTGERRKKAAEVAGG  60

Query  517  TTADIAAVCCCCPCGLVNLVVLAVYKLPAGIC--RKAIRSKRRRKMMKNGMWPVRHCSCP  690
            + A+ AAVCCCCPC +VNLVVLAVYK+PA +C      + +RR    + G+      S  
Sbjct  61   SAAECAAVCCCCPCAVVNLVVLAVYKVPAAMCKKALRRKKRRRFSGKRQGLLSAAEGSEV  120

Query  691  DSELQIHPISSPSAVAAALESD------NEVVELEKEMWDRFYGAGFWRSPSQR  834
               L+ +    P+A     E +      N+ VEL+ EMWD F+GAGFWRSPSQR
Sbjct  121  SGRLRFNG-EDPTAETKFEERENTGGEQNDDVELDNEMWDHFHGAGFWRSPSQR  173



>ref|NP_001168992.1| uncharacterized protein LOC100382821 [Zea mays]
 gb|ACN31341.1| unknown [Zea mays]
Length=211

 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 39/101 (39%), Positives = 52/101 (51%), Gaps = 7/101 (7%)
 Frame = +1

Query  550  CPCGLVNLVVLAVYKLPAGICRKAIRSKR--RRKMMKNGMWPVRHCSCPDSELQIHPISS  723
             PC +V +VVLA  + PA +CRKA R  +  RR+    G     +    D+   +  + +
Sbjct  105  FPCVMVEVVVLATVRAPAALCRKAARVSKGGRRRSASVGQATEIYELPVDNAGVVVKVDA  164

Query  724  PSAVAAALESD-----NEVVELEKEMWDRFYGAGFWRSPSQ  831
             +  A AL         E  ELEKE+W RFYG GFWRS SQ
Sbjct  165  SAVEAVALPVKPALQLEETGELEKEVWARFYGTGFWRSVSQ  205



>ref|XP_007149998.1| hypothetical protein PHAVU_005G117300g [Phaseolus vulgaris]
 gb|ESW21992.1| hypothetical protein PHAVU_005G117300g [Phaseolus vulgaris]
Length=162

 Score = 59.7 bits (143),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 40/108 (37%), Positives = 57/108 (53%), Gaps = 16/108 (15%)
 Frame = +1

Query  550  CPCGLVNLVVLAVYKLPAGICRKAIRSKRRRKMMKNGMWPVRHCSCPDSELQIHP--ISS  723
             PC ++++VVLA YK+PAG+ RKA+  ++RR + K            ++ L   P  +S 
Sbjct  54   VPCSVMDVVVLAAYKVPAGLVRKAMHKRKRRLLQKKN-------KKTEALLDHGPADVSG  106

Query  724  PSAVA-------AALESDNEVVELEKEMWDRFYGAGFWRSPSQRTEVS  846
            P   A        A +      +LE+EMW +F G GFWRS SQR E S
Sbjct  107  PRPCAEEHLSKDVAEDKSEATTKLEEEMWAQFNGTGFWRSDSQRLEQS  154



>ref|XP_009378608.1| PREDICTED: uncharacterized protein LOC103967087 [Pyrus x bretschneideri]
Length=140

 Score = 59.3 bits (142),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 55/138 (40%), Positives = 76/138 (55%), Gaps = 5/138 (4%)
 Frame = +1

Query  430  REPLLNPARDSSSGPEAVRKARFAEVAGGTTADIAAVCCCCPCGLVNLVVLAVYKLPAGI  609
            R+PL    + +   P   R  R  EVAGG  A+ AAVCCCCPC ++NL++LAVYK+P G+
Sbjct  3    RDPLFQSPKLTRPPPREKR--RVGEVAGGAAAECAAVCCCCPCSVMNLLILAVYKVPKGL  60

Query  610  CRKAIRSKRRRK---MMKNGMWPVRHCSCPDSELQIHPISSPSAVAAALESDNEVVELEK  780
            C KA   ++R++   + K G          D   +    +  +    +         LEK
Sbjct  61   CMKAWAHRKRKRRCAVQKKGRLGGGGDDDDDDGKRASSCTEGNGEKKSNAETEGADLLEK  120

Query  781  EMWDRFYGAGFWRSPSQR  834
            EMWDRF+GAGFWRS S+R
Sbjct  121  EMWDRFHGAGFWRSASRR  138



>ref|XP_008337098.1| PREDICTED: uncharacterized protein LOC103400217 [Malus domestica]
Length=152

 Score = 58.9 bits (141),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 40/105 (38%), Positives = 59/105 (56%), Gaps = 15/105 (14%)
 Frame = +1

Query  562  LVNLVVLAVYKLPAGICRKAI---RSKR------RRKMMK---NGMWPVRHCSCPDSELQ  705
            ++NL++L VYK+P GIC KA+   ++KR      R+ +++   NG+      S  D   +
Sbjct  45   VMNLLILTVYKVPKGICMKALAHRKNKRQCLAAHRKALLQPRPNGLAGGGLYSDDDDFFR  104

Query  706  IHPISSPSAVAAALES--DNEVVEL-EKEMWDRFYGAGFWRSPSQ  831
                 S   V     S  ++E  EL EKE+WDRF+GAGFWRS S+
Sbjct  105  KASSYSDGDVDDGKGSXDESEAAELLEKEIWDRFHGAGFWRSASR  149



>ref|XP_010917914.1| PREDICTED: uncharacterized protein LOC105042416 [Elaeis guineensis]
Length=188

 Score = 58.2 bits (139),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 63/148 (43%), Positives = 78/148 (53%), Gaps = 40/148 (27%)
 Frame = +1

Query  475  EAVRKA-RFAEVAGGTTADIAAVCCCCPCGLVNLVVLAVYKLPAGICRK----------A  621
            E V+ A RFAE AG T A+ AA+CCCCPCG++NLVV+A  KLPAG+ R+          +
Sbjct  52   EPVKPADRFAEAAGATAAECAAICCCCPCGILNLVVVATLKLPAGLLRRALSRRRKRGVS  111

Query  622  IRSKRRRKMMKNGMWPVRHCSCPDSELQIH--------------PISSPSAVAAALESDN  759
            + + R++   K G          D +  IH              P  SPS          
Sbjct  112  VGAARKKAGPKVG------AMDDDDDFSIHGGHLLLLARGDDAWPSRSPSP---------  156

Query  760  EVVELEKEMWDRFYGAGFWRSPSQRTEV  843
            E+ ELEKEMW  FY AGFWRSPSQR EV
Sbjct  157  ELSELEKEMWALFYSAGFWRSPSQREEV  184



>ref|XP_009378628.1| PREDICTED: uncharacterized protein LOC103967106, partial [Pyrus 
x bretschneideri]
Length=129

 Score = 57.0 bits (136),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 55/123 (45%), Positives = 72/123 (59%), Gaps = 11/123 (9%)
 Frame = +1

Query  487  KARFAEVAGGTTADIAAVCCCCPCGLVNLVVLAVYKLPAGICRKAIRSKRRRK---MMKN  657
            K R  EVAGG  A+ AAVCCCCPC ++NL++LAVYK+P G+C KA   ++R++   + K 
Sbjct  9    KRRVGEVAGGAAAECAAVCCCCPCSVMNLLILAVYKVPKGLCMKAWAHRKRKRRCAVQKK  68

Query  658  GMWPVRHCSCPDSELQIHPISSPSAVAAALESDNEVVE----LEKEMWDRFYGAGFWRSP  825
            G    R     D +      +S        +  N   E    LEKEMWDRF+GAGFWRS 
Sbjct  69   G----RLGGGGDDDDDDGKRASGCTEGDGEKKSNAETEGADLLEKEMWDRFHGAGFWRSA  124

Query  826  SQR  834
            S+R
Sbjct  125  SRR  127



>ref|XP_004506249.1| PREDICTED: uncharacterized protein LOC101514172 [Cicer arietinum]
Length=143

 Score = 57.0 bits (136),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 50/122 (41%), Positives = 72/122 (59%), Gaps = 11/122 (9%)
 Frame = +1

Query  499  AEVAGGTTADIAAVCCCCPCGLVNLVVLAVYKLPAGICRKAIRSKRRRKMMKNGMWPVRH  678
             E+AG   A+ AAVCCCCPC + ++VVLAVY +PAG+  + +  +RRR++MKNG+   ++
Sbjct  21   GEMAGSGAAECAAVCCCCPCAVFHVVVLAVYSVPAGLF-RKVVRRRRRRLMKNGVKVEKN  79

Query  679  ----------CSCPDSELQIHPISSPSAVAAALESDNEVVELEKEMWDRFYGAGFWRSPS  828
                       S  D+ +++  +        A +  +E V LE EMW RF G GFWRS S
Sbjct  80   DVVLLQRQMSSSVADNVMRVDSLEDHFMKDRAADEKSEEVALETEMWSRFAGTGFWRSDS  139

Query  829  QR  834
            QR
Sbjct  140  QR  141



>gb|EAY83943.1| hypothetical protein OsI_39163 [Oryza sativa Indica Group]
Length=187

 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 54/132 (41%), Positives = 72/132 (55%), Gaps = 23/132 (17%)
 Frame = +1

Query  484  RKARFAEVAGGTTADIAAVCCCCPCGLVNLVVLAVYKLPAGICRKAIRSKRRRKMMKNGM  663
            ++ R  EVAGGT A+ AAV CC P  +V LVVLA  + PA +CR+A+R  RRR++     
Sbjct  64   QQPRCGEVAGGTAAECAAVFCCFPFAVVELVVLAAVRAPAALCRRAVRGGRRRRVR----  119

Query  664  WPVRHCSCPDSELQIHPISSPSAVAA-------------ALESDNEVVELEKEMWDRFYG  804
                  S    E     I+SP ++AA             A      +V++EKE+W  FYG
Sbjct  120  ------STKPKETGAMDIASPRSLAAAAAKARKVDADFPATPKAEHLVDMEKEVWASFYG  173

Query  805  AGFWRSPSQRTE  840
             GFWRSPSQR +
Sbjct  174  GGFWRSPSQRED  185



>ref|XP_002464157.1| hypothetical protein SORBIDRAFT_01g013260 [Sorghum bicolor]
 gb|EER91155.1| hypothetical protein SORBIDRAFT_01g013260 [Sorghum bicolor]
Length=272

 Score = 58.9 bits (141),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 40/104 (38%), Positives = 52/104 (50%), Gaps = 11/104 (11%)
 Frame = +1

Query  550  CPCGLVNLVVLAVYKLPAGICRKAIRSK---RRRKMMKNGMWPVRHCSCPDSEL------  702
             PC +V +VVLA  + PA +CRKA R +   RRR         +      D+ +      
Sbjct  161  FPCVMVEVVVLATVRAPAALCRKAARVRKAGRRRSASAGQATEIYELLVDDAAVVEVDAT  220

Query  703  -QIHPISSPSAVAAALESDNEVVELEKEMWDRFYGAGFWRSPSQ  831
                   +   V  ALE ++   ELEKE+W RFYG GFWRSPSQ
Sbjct  221  GAADAAVALPVVKPALELED-TGELEKEVWARFYGTGFWRSPSQ  263



>ref|XP_011089214.1| PREDICTED: uncharacterized protein LOC105170241 [Sesamum indicum]
Length=161

 Score = 56.6 bits (135),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 58/178 (33%), Positives = 83/178 (47%), Gaps = 47/178 (26%)
 Frame = +1

Query  391  MTKRISLRSPGSG--REPLLNPARDSSS----------GPEAVRKARFAEVAGGTTADIA  534
            M+ +I+L SPGS   R  LL     SS+          G  + R +R  E A       A
Sbjct  1    MSGKIALESPGSTVTRRRLLTTDLTSSTVKDHPVDAKDGGGSRRGSRIGEAA----GGCA  56

Query  535  AVCCCCPCGLVNLVVLAVYKLPAGI----------------CRKAIRSKRRRKMMKNGMW  666
            AVCCCCPC ++N+++LAVY+LP G+                  + + ++R+      G  
Sbjct  57   AVCCCCPCAMMNILILAVYRLPRGLWRKKKRKRLLRKKRKSSSEEMENQRKTNSSGGGGK  116

Query  667  PVRHCSCPDSELQIHPISSPSAVAAALESDNEVVELEKEMWDRFYGAGFWRSPSQRTE  840
              R  S  D EL+                +N+VV+ + EMW RF GAGFWRS S+R +
Sbjct  117  EERESSTDDEELR---------------GENDVVDWDNEMWGRFNGAGFWRSASRRKD  159



>ref|XP_009122239.1| PREDICTED: uncharacterized protein LOC103846973 [Brassica rapa]
Length=167

 Score = 56.2 bits (134),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 50/129 (39%), Positives = 71/129 (55%), Gaps = 19/129 (15%)
 Frame = +1

Query  499  AEVAGGTTADIAAVCCCCPCGLVNLVVLAVYKLP--------AGICRKAIRSKRRRKMMK  654
            AE  GGTTA  AA+CCC PC +V+LVV AVYK P          + R+  R  +++++++
Sbjct  32   AEFCGGTTAGCAALCCCAPCSVVSLVVFAVYKAPRRICRRAIRRVRRRRRRISKKKEVLE  91

Query  655  NGMWPVRHCSCPDSELQIHPISSP-----SAVAAALE------SDNEVVELEKEMWDRFY  801
            NG    + C    S+  +HP+ S        VA  L        D+EV+ LEKEMW+RF 
Sbjct  92   NGDCEKKLCKVGSSQFAVHPLESKDDGDLDKVAMYLSEDEEEEEDDEVIALEKEMWNRFN  151

Query  802  GAGFWRSPS  828
              GFWR+ +
Sbjct  152  SGGFWRAET  160



>ref|NP_001067301.2| Os12g0621400 [Oryza sativa Japonica Group]
 gb|ABA99907.2| expressed protein [Oryza sativa Japonica Group]
 dbj|BAF30320.2| Os12g0621400 [Oryza sativa Japonica Group]
Length=225

 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 54/132 (41%), Positives = 72/132 (55%), Gaps = 23/132 (17%)
 Frame = +1

Query  484  RKARFAEVAGGTTADIAAVCCCCPCGLVNLVVLAVYKLPAGICRKAIRSKRRRKMMKNGM  663
            ++ R  EVAGGT A+ AAV CC P  +V LVVLA  + PA +CR+A+R  RRR++     
Sbjct  64   QQPRCGEVAGGTAAECAAVFCCFPFAVVELVVLAAVRAPAALCRRAVRGGRRRRVR----  119

Query  664  WPVRHCSCPDSELQIHPISSPSAVAA-------------ALESDNEVVELEKEMWDRFYG  804
                  S    E     I+SP ++AA             A      +V++EKE+W  FYG
Sbjct  120  ------STKPKETGAMDIASPRSLAAAAAKARKVDADFPATPKAEHLVDMEKEVWASFYG  173

Query  805  AGFWRSPSQRTE  840
             GFWRSPSQR +
Sbjct  174  GGFWRSPSQRED  185



>dbj|BAK06956.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=207

 Score = 56.2 bits (134),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 43/132 (33%), Positives = 64/132 (48%), Gaps = 9/132 (7%)
 Frame = +1

Query  463  SSGPEAVRKARFAEVAGGTTADIAAVCCCCPCGLVNLVVLAVYKLPAGICRKAIRSKRRR  642
            S G  A ++    ++ G T   +A   C  PC +V+   LA  + P  +CR+A+R  R R
Sbjct  81   SEGEPASKQPGCKQLTGETMGGLATASCLLPCAVVDFAFLATVRAPVALCRRAVRGSRHR  140

Query  643  KMMKNG---MWPVRHCSCPDSELQIHPISSPSAVAAALESDNEVVELEKEMWDRFYGAGF  813
            +    G   M  +R  +  DS L+     + SA  A   +D E  ELEK++W  F  AGF
Sbjct  141  RSASVGEAEMAKLREEA--DSVLKF--GRTASAWPAMTPADGE-EELEKKVWASFNDAGF  195

Query  814  WR-SPSQRTEVS  846
             R SP    ++S
Sbjct  196  GRTSPHLDNDIS  207



>ref|XP_003540827.1| PREDICTED: uncharacterized protein LOC100792178 [Glycine max]
Length=153

 Score = 54.3 bits (129),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 58/136 (43%), Positives = 68/136 (50%), Gaps = 19/136 (14%)
 Frame = +1

Query  484  RKARFAEVAGGTTADIAAVCCCCPCGLVNLVVLAVYKLPAGICRKAIRSKRRRKMMKNG-  660
            R+    EVAGG  AD AAVCCCCPC +VNLVVLAVYKLP  + +KA   +RRR   KN  
Sbjct  16   RRRGVGEVAGGVAADCAAVCCCCPCTVVNLVVLAVYKLPKRLVKKAANKRRRRLPKKNST  75

Query  661  ----MWPVRHCSCPDSELQIHPI--------------SSPSAVAAALESDNEVVELEKEM  786
                + P R  S    +  + P+                        E + E   LE EM
Sbjct  76   DVVLLQPQRSSSVDALDFAVGPMFFEEFLKNEKESENEKGKEEEEEEEEEEEEEGLEMEM  135

Query  787  WDRFYGAGFWRSPSQR  834
            W RF G GFWRS SQR
Sbjct  136  WARFAGTGFWRSESQR  151



>ref|XP_009407080.1| PREDICTED: uncharacterized protein LOC103989859 [Musa acuminata 
subsp. malaccensis]
Length=167

 Score = 54.7 bits (130),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 49/117 (42%), Positives = 67/117 (57%), Gaps = 5/117 (4%)
 Frame = +1

Query  493  RFAEVAGGTTADIAAVCCCCPCGLVNLVVLAVYKLPAGICRKAIRSKRRRKMMKNGMWPV  672
            R AE+AG T AD AAVCCC PC +VNLVVL   KLPA +CR+ + + R ++  +      
Sbjct  41   RCAELAGVTAADCAAVCCCGPCMVVNLVVLTAVKLPARVCRRVLHA-RDKRKERARKRKE  99

Query  673  RHCSCPDSELQIHPISSPSA--VAAALE--SDNEVVELEKEMWDRFYGAGFWRSPSQ  831
                 P S+     +S+ +   +   +E  S  EV E+EKE+  RF   GFWRSPS+
Sbjct  100  ARLLGPRSDAGGDRLSTVTTEDLNGDVEGPSPAEVAEVEKEILARFQRTGFWRSPSR  156



>emb|CDY57988.1| BnaA10g30350D [Brassica napus]
Length=165

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 48/126 (38%), Positives = 67/126 (53%), Gaps = 16/126 (13%)
 Frame = +1

Query  499  AEVAGGTTADIAAVCCCCPCGLVNLVVLAVYKLP-------AGICRKAIRSKRRRKMMKN  657
            AE  GGTTA  AA+CCC PC +V+LVV AVYK P           R+  R   ++++  N
Sbjct  32   AEFCGGTTAGCAALCCCAPCSVVSLVVFAVYKAPRRICRRAIRRVRRRRRRISKKEVSDN  91

Query  658  GMWPVRHCSCPDSELQIHPISSPSA---------VAAALESDNEVVELEKEMWDRFYGAG  810
            G    + C    S+  +HP+ S            ++   E D+EV+ LEKEMW+RF   G
Sbjct  92   GDCEKKLCKVGSSQFAVHPLESKDNEDMDKLAMYLSEEEEEDDEVIALEKEMWNRFNSGG  151

Query  811  FWRSPS  828
            FWR+ +
Sbjct  152  FWRAET  157



>gb|ABF97913.1| expressed protein [Oryza sativa Japonica Group]
Length=220

 Score = 53.9 bits (128),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 59/133 (44%), Positives = 76/133 (57%), Gaps = 11/133 (8%)
 Frame = +1

Query  475  EAVRKARFAEVAGGTTADIAAVCCCCPCGLVNLVVLAVYKLPAGICRKAIRSKRRRKMMK  654
            E VR+ R  EVAGGT A  AAVCCC PC +V +VVLA  + PA +CR+A+R +R  +  +
Sbjct  85   EQVRQPRCGEVAGGTAAGCAAVCCCLPCAVVEVVVLATVRAPAALCRRAVRGRRGGRGTR  144

Query  655  NGM----------WPVRHCSCPDSELQIHPISSP-SAVAAALESDNEVVELEKEMWDRFY  801
                           V      DS  +  P+  P +A+ AA     E  ELEKE+W RFY
Sbjct  145  RSASAGQAGEIYELLVDEGGAVDSGEKKAPVVWPVAAITAAAVPSEEAGELEKEVWARFY  204

Query  802  GAGFWRSPSQRTE  840
            GAGFWRSPSQ ++
Sbjct  205  GAGFWRSPSQLSD  217



>ref|NP_001159142.1| uncharacterized protein LOC100304221 [Zea mays]
 gb|ACN25200.1| unknown [Zea mays]
 tpg|DAA50681.1| TPA: hypothetical protein ZEAMMB73_981814 [Zea mays]
Length=224

 Score = 52.8 bits (125),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 39/99 (39%), Positives = 52/99 (53%), Gaps = 5/99 (5%)
 Frame = +1

Query  550  CPCGLVNLVVLAVYKLPAGICRKA--IRSKRRRKMMKNGMWPVRHCSCPDSELQIHPISS  723
             PC +V + VLA  + PA +CRKA  +R  RRR         +      D+ +      +
Sbjct  119  FPCVMVEVAVLATVRAPAALCRKAARVRKGRRRSASAGQATEIYELLVDDTGVVEVDAGA  178

Query  724  PSAVAAALE---SDNEVVELEKEMWDRFYGAGFWRSPSQ  831
             +AVA  ++      E  ELEKE+W RFYG GFWRSPSQ
Sbjct  179  ANAVALPVKPALQLEEKGELEKEVWARFYGTGFWRSPSQ  217



>gb|AGO59364.1| hypothetical protein OG_BBa0035M03.12 [Oryza glaberrima]
Length=187

 Score = 52.0 bits (123),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 27/51 (53%), Positives = 34/51 (67%), Gaps = 1/51 (2%)
 Frame = +1

Query  691  DSELQIHPISSP-SAVAAALESDNEVVELEKEMWDRFYGAGFWRSPSQRTE  840
            DS  +  P+  P +A+ AA     E  ELEKE+W RFYGAGFWRSPSQ ++
Sbjct  134  DSGEKKAPVVWPVAAITAAAVPSEEAGELEKEVWARFYGAGFWRSPSQLSD  184



>ref|XP_007132517.1| hypothetical protein PHAVU_011G101000g [Phaseolus vulgaris]
 gb|ESW04511.1| hypothetical protein PHAVU_011G101000g [Phaseolus vulgaris]
Length=151

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 44/114 (39%), Positives = 55/114 (48%), Gaps = 17/114 (15%)
 Frame = +1

Query  544  CCCPCGLVNLVVLAVYKLPAGICRKAIRSKRRRKMMKNGMWPVRHCSCPDSELQIHPISS  723
            CC PC +++L VLAVYK+P  +  KA R +RRR M       V   +  D  + +HP  +
Sbjct  36   CCFPCVVIHLAVLAVYKVPKRLVVKAARKRRRRLMRNKNNGNVVVGNKADDIVVLHPHRA  95

Query  724  PSAVAAAL-----------------ESDNEVVELEKEMWDRFYGAGFWRSPSQR  834
             S                       E+D E   LEKEMW RF G GFWRS SQR
Sbjct  96   SSVEGWDYDVGTTRLDEFLKQIPENETDEEEQGLEKEMWARFAGTGFWRSESQR  149



>ref|XP_009394273.1| PREDICTED: uncharacterized protein LOC103979785 [Musa acuminata 
subsp. malaccensis]
Length=161

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 55/151 (36%), Positives = 76/151 (50%), Gaps = 24/151 (16%)
 Frame = +1

Query  445  NPARDSSSGPEAVRKA-----------RFAEVAGGTTADIAAVCCCCPCGLVNLVVLAVY  591
             PA  +++ PE  R+            R AEVAG T A  AA+CCC  CGL NL+V+   
Sbjct  16   TPALPAATFPETRRRTLIIKEPQKPGPRLAEVAGSTAAGCAAICCCP-CGLANLIVV---  71

Query  592  KLPAGICRKAIRSKRRRKMMKNGMW--PVRHCSCPDSELQIHPISSPSAVAAALES----  753
             +PAG+ R+  +   R    K+ +W   V      D +L ++    P A + + E     
Sbjct  72   -VPAGLVRRWRKRWPRGAKTKSSIWRPEVDAFDDDDDDLSLYLGGFPLASSGSEERWLAK  130

Query  754  --DNEVVELEKEMWDRFYGAGFWRSPSQRTE  840
                E  ELEKEM  +FYG GFWRS SQR++
Sbjct  131  SLSPEFAELEKEMVAKFYGTGFWRSLSQRSQ  161



>gb|AGO59345.1| hypothetical protein OB_ABa0085D15.10 [Oryza barthii]
Length=216

 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 27/51 (53%), Positives = 34/51 (67%), Gaps = 1/51 (2%)
 Frame = +1

Query  691  DSELQIHPISSP-SAVAAALESDNEVVELEKEMWDRFYGAGFWRSPSQRTE  840
            DS  +  P+  P +A+ AA     E  ELEKE+W RFYGAGFWRSPSQ ++
Sbjct  163  DSGEKKAPVVWPVAAITAAAVPSEEAGELEKEVWARFYGAGFWRSPSQLSD  213



>gb|EMT21933.1| hypothetical protein F775_52541 [Aegilops tauschii]
Length=224

 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 37/120 (31%), Positives = 55/120 (46%), Gaps = 8/120 (7%)
 Frame = +1

Query  472  PEAVRKARFAEVAGGTTADIAAVCCCCPCGLVNLVVLAVYKLPAGICRKAIRSKRRRKMM  651
            P   R+    ++ G T   +A   C  PC +V+   LA  + P  +CR+A+R  R R+  
Sbjct  101  PTKHRQPGCKQLTGETMGGLATASCLLPCAVVDFAFLATVRAPVALCRRAVRGSRFRRSP  160

Query  652  KNG---MWPVRHCSCPDSELQIHPISSPSAVAAALESDNEVVELEKEMWDRFYGAGFWRS  822
              G   M  +R  +  DS L+    +S     A  E   E  ELE ++W  F  AGF R+
Sbjct  161  SVGEAEMAKLREEA--DSVLKFGRTASAWPAMAPAE---EEKELENQVWASFRDAGFGRT  215



>ref|XP_006826414.1| PREDICTED: uncharacterized protein LOC18421609 [Amborella trichopoda]
 gb|ERM93651.1| hypothetical protein AMTR_s00004p00157920 [Amborella trichopoda]
Length=159

 Score = 50.1 bits (118),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 60/172 (35%), Positives = 86/172 (50%), Gaps = 40/172 (23%)
 Frame = +1

Query  400  RISLRSPGSGR-EPLLNPARDSSSGPEAVRKARFAEVAGGTTADIAAVCCCCPCGLVNLV  576
            R  +  P SGR +PL       SS        RFAEVAG T A+ AAV CCCPCGL+NL+
Sbjct  3    RQPVSRPDSGRRKPLKKETHTGSS-------FRFAEVAGATAAECAAVFCCCPCGLLNLL  55

Query  577  VLAVYKLPAGICRK---------------AIRSKRRRKMMK------NGMWPVRHCSCPD  693
            +LA  +LPAG+  +               ++ +  R + ++        +WP +  S   
Sbjct  56   ILAAIRLPAGLFHRALKKRRRRSRAKRACSLTTPERHQQVELPSPVVAEIWPEK--SLEK  113

Query  694  SEL---QIHPISSPSAVAAALESDNEVVELEKEMWDRFYGAGFWRSPSQRTE  840
            SE+    +H  +SP  + A   SD E VE+   MW + +  GFWR+PS R +
Sbjct  114  SEVVAPAMHEATSPEKLGAL--SDMEEVEM---MWGKLH-TGFWRTPSDREQ  159



>gb|AGT16534.1| hypothetical protein SHCRBa_224_D04_R_290 [Saccharum hybrid cultivar 
R570]
Length=218

 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 40/100 (40%), Positives = 53/100 (53%), Gaps = 6/100 (6%)
 Frame = +1

Query  550  CPCGLVNLVVLAVYKLPAGICRKAI---RSKRRRKMMKNGMWPVRHCSCPDSELQIHPIS  720
             PC +V +VVLA  + PA +CRKA    ++ RRR         +      D+ +     S
Sbjct  112  FPCVMVEVVVLATVRAPAALCRKAALVRKAGRRRSASAGQATEIYELLVDDAGVVEVDAS  171

Query  721  SPSAVAAALE---SDNEVVELEKEMWDRFYGAGFWRSPSQ  831
            +  AVA  ++      E  ELEKE+W RFYG GFWRSPSQ
Sbjct  172  AAEAVALPVKPALELEETGELEKEVWARFYGTGFWRSPSQ  211



>ref|XP_008798689.1| PREDICTED: uncharacterized protein LOC103713512 [Phoenix dactylifera]
Length=163

 Score = 48.5 bits (114),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 63/127 (50%), Positives = 81/127 (64%), Gaps = 11/127 (9%)
 Frame = +1

Query  490  ARFAEVAGGTTADIAAVCCCCPCGLVNLVVLAVYKLPAGICRKAIRSKRRRKMM----KN  657
            AR AEVAGGT A  AAVCCCCPCGLVNL+VL V +LPA +C++A++++ +R+ +    K 
Sbjct  34   ARLAEVAGGTAAGCAAVCCCCPCGLVNLLVLTVVRLPAVLCQRALKARTKRRAVIKKPKE  93

Query  658  GMWPV-----RHCSCPDSE-LQIHPISSPSAVAAALESDNEVVELEKEMWDRFYGAGFWR  819
            G++       R     D E + +H      AVA    S  EV E+EKEMW +F  AGFWR
Sbjct  94   GLFGPKQGGGRESGEGDEEGVSLHGAVVAVAVAKEA-SPAEVTEMEKEMWAKFCSAGFWR  152

Query  820  SPSQRTE  840
            SPSQR E
Sbjct  153  SPSQREE  159



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1908683925587