BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig13028

Length=679
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CAN65790.1|  hypothetical protein VITISV_042049                     387   1e-129   Vitis vinifera
ref|XP_002270736.1|  PREDICTED: cytochrome P450 77A2                    386   6e-129   Vitis vinifera
ref|XP_008231991.1|  PREDICTED: cytochrome P450 77A3-like               384   3e-128   Prunus mume [ume]
ref|XP_009603326.1|  PREDICTED: cytochrome P450 77A2                    382   1e-127   Nicotiana tomentosiformis
ref|XP_011101640.1|  PREDICTED: cytochrome P450 77A2-like               382   4e-127   Sesamum indicum [beniseed]
ref|XP_007219021.1|  hypothetical protein PRUPE_ppa004373mg             380   9e-127   Prunus persica
gb|AJD25187.1|  cytochrome P450 CYP77A27                                380   1e-126   Salvia miltiorrhiza [Chinese salvia]
ref|XP_009609997.1|  PREDICTED: cytochrome P450 77A1-like               379   2e-126   Nicotiana tomentosiformis
emb|CDO99869.1|  unnamed protein product                                379   5e-126   Coffea canephora [robusta coffee]
gb|EYU38068.1|  hypothetical protein MIMGU_mgv1a004860mg                377   2e-125   Erythranthe guttata [common monkey flower]
ref|XP_010312564.1|  PREDICTED: cytochrome P450 77A1                    376   2e-125   
ref|XP_009760347.1|  PREDICTED: cytochrome P450 77A2                    376   3e-125   Nicotiana sylvestris
ref|XP_004307039.1|  PREDICTED: cytochrome P450 77A3-like               377   3e-125   Fragaria vesca subsp. vesca
ref|XP_006360482.1|  PREDICTED: cytochrome P450 77A1-like               376   3e-125   
ref|XP_009336991.1|  PREDICTED: cytochrome P450 77A3-like               375   9e-125   Pyrus x bretschneideri [bai li]
gb|AGZ83070.1|  CYP77A20                                                375   9e-125   Solanum tuberosum [potatoes]
ref|XP_004239717.1|  PREDICTED: cytochrome P450 77A2                    374   2e-124   
ref|XP_008347045.1|  PREDICTED: LOW QUALITY PROTEIN: cytochrome P...    374   2e-124   
ref|XP_008345522.1|  PREDICTED: cytochrome P450 77A3-like               374   4e-124   
gb|KHN37844.1|  Cytochrome P450 77A3                                    370   6e-124   Glycine soja [wild soybean]
gb|ADJ57933.1|  cytochrome P450                                         373   7e-124   Solanum torvum [berenjena cimarrona]
ref|XP_010032101.1|  PREDICTED: cytochrome P450 77A3-like isoform X2    370   8e-124   
gb|KHN00917.1|  Cytochrome P450 77A3                                    370   1e-123   Glycine soja [wild soybean]
ref|XP_009778849.1|  PREDICTED: cytochrome P450 77A1-like isoform X2    372   1e-123   Nicotiana sylvestris
ref|XP_008375581.1|  PREDICTED: cytochrome P450 77A3-like               372   2e-123   
gb|AGZ83069.1|  CYP77A19                                                372   2e-123   Solanum tuberosum [potatoes]
ref|XP_006345856.1|  PREDICTED: cytochrome P450 77A2-like               372   2e-123   
sp|P37123.1|C77A1_SOLME  RecName: Full=Cytochrome P450 77A1; AltN...    370   7e-123   Solanum melongena [aubergine]
ref|XP_010032100.1|  PREDICTED: cytochrome P450 77A3-like isoform X1    369   2e-122   Eucalyptus grandis [rose gum]
sp|O48928.1|C77A3_SOYBN  RecName: Full=Cytochrome P450 77A3             369   3e-122   Glycine max [soybeans]
sp|P37124.1|C77A2_SOLME  RecName: Full=Cytochrome P450 77A2; AltN...    367   8e-122   Solanum melongena [aubergine]
ref|XP_003536307.2|  PREDICTED: cytochrome P450 77A3-like               368   9e-122   Glycine max [soybeans]
ref|XP_009778848.1|  PREDICTED: cytochrome P450 77A1-like isoform X1    367   1e-121   Nicotiana sylvestris
ref|XP_007143825.1|  hypothetical protein PHAVU_007G104800g             367   1e-121   Phaseolus vulgaris [French bean]
ref|XP_011032810.1|  PREDICTED: cytochrome P450 77A3-like               367   1e-121   Populus euphratica
ref|XP_003556278.2|  PREDICTED: cytochrome P450 77A3-like               370   3e-121   
ref|XP_010278187.1|  PREDICTED: cytochrome P450 77A2-like               365   1e-120   Nelumbo nucifera [Indian lotus]
ref|XP_007010384.1|  Cytochrome P450 77A3                               365   1e-120   
gb|KEH43423.1|  cytochrome P450 family 87 protein                       364   2e-120   Medicago truncatula
ref|XP_002311965.1|  CYP77A3p family protein                            363   4e-120   Populus trichocarpa [western balsam poplar]
ref|XP_010552931.1|  PREDICTED: cytochrome P450 77A4                    362   1e-119   Tarenaya hassleriana [spider flower]
gb|AFK33897.1|  unknown                                                 355   4e-119   Lotus japonicus
ref|XP_009778850.1|  PREDICTED: cytochrome P450 77A1-like               360   6e-119   Nicotiana sylvestris
gb|KDO46108.1|  hypothetical protein CISIN_1g010526mg                   359   1e-118   Citrus sinensis [apfelsine]
ref|XP_006436671.1|  hypothetical protein CICLE_v10031286mg             359   1e-118   Citrus clementina [clementine]
ref|XP_009610308.1|  PREDICTED: cytochrome P450 77A1-like               358   2e-118   Nicotiana tomentosiformis
gb|AJD25188.1|  cytochrome P450 CYP77A28                                356   3e-117   Salvia miltiorrhiza [Chinese salvia]
ref|XP_010248417.1|  PREDICTED: cytochrome P450 77A2-like               350   1e-116   Nelumbo nucifera [Indian lotus]
ref|XP_006407539.1|  hypothetical protein EUTSA_v10020529mg             354   1e-116   Eutrema salsugineum [saltwater cress]
ref|XP_010464733.1|  PREDICTED: cytochrome P450 77A4-like               352   7e-116   Camelina sativa [gold-of-pleasure]
ref|XP_002882683.1|  CYP77A6                                            352   8e-116   
emb|CDY00955.1|  BnaC05g42450D                                          352   9e-116   
ref|XP_010486669.1|  PREDICTED: cytochrome P450 77A4                    352   2e-115   Camelina sativa [gold-of-pleasure]
ref|XP_012089888.1|  PREDICTED: cytochrome P450 77A3-like               351   3e-115   Jatropha curcas
ref|XP_010486076.1|  PREDICTED: cytochrome P450 77A4-like               351   3e-115   Camelina sativa [gold-of-pleasure]
ref|XP_010452364.1|  PREDICTED: cytochrome P450 77A4-like               350   5e-115   Camelina sativa [gold-of-pleasure]
emb|CDY08591.1|  BnaA05g28270D                                          350   6e-115   Brassica napus [oilseed rape]
ref|XP_009146826.1|  PREDICTED: cytochrome P450 77A4                    350   7e-115   Brassica rapa
gb|KJB73379.1|  hypothetical protein B456_011G229800                    350   7e-115   Gossypium raimondii
ref|XP_008456581.1|  PREDICTED: cytochrome P450 77A3-like               350   1e-114   Cucumis melo [Oriental melon]
ref|XP_004496181.1|  PREDICTED: cytochrome P450 77A3-like               349   2e-114   Cicer arietinum [garbanzo]
ref|XP_006297449.1|  hypothetical protein CARUB_v10013470mg             348   2e-114   Capsella rubella
ref|XP_010490980.1|  PREDICTED: cytochrome P450 77A4                    348   2e-114   Camelina sativa [gold-of-pleasure]
gb|KJB49031.1|  hypothetical protein B456_008G098700                    347   1e-113   Gossypium raimondii
ref|NP_187668.1|  cytochrome P450, family 77, subfamily A, polype...    346   2e-113   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010423551.1|  PREDICTED: cytochrome P450 77A4-like               346   4e-113   Camelina sativa [gold-of-pleasure]
gb|AAM66094.1|  cytochrom P450-like protein                             345   5e-113   Arabidopsis thaliana [mouse-ear cress]
ref|NP_196086.1|  cytochrome P450, family 77, subfamily A, polype...    345   6e-113   Arabidopsis thaliana [mouse-ear cress]
gb|AAO42093.1|  putative cytochrome p450                                345   7e-113   Arabidopsis thaliana [mouse-ear cress]
gb|EPS69622.1|  hypothetical protein M569_05145                         343   1e-112   Genlisea aurea
ref|XP_006398921.1|  hypothetical protein EUTSA_v10016078mg             343   2e-112   Eutrema salsugineum [saltwater cress]
ref|XP_002871108.1|  CYP77A4                                            342   7e-112   
gb|EPS63295.1|  hypothetical protein M569_11489                         342   8e-112   Genlisea aurea
ref|XP_004140895.1|  PREDICTED: cytochrome P450 77A3-like               341   2e-111   Cucumis sativus [cucumbers]
gb|KFK38447.1|  hypothetical protein AALP_AA3G114600                    351   3e-110   Arabis alpina [alpine rockcress]
ref|XP_006289766.1|  hypothetical protein CARUB_v10003366mg             335   5e-109   
gb|AFK73721.1|  cytochrome P450                                         330   2e-108   Papaver somniferum
emb|CDX70209.1|  BnaA10g25580D                                          332   5e-108   
ref|XP_009122576.1|  PREDICTED: cytochrome P450 77A4                    332   6e-108   Brassica rapa
ref|XP_009130829.1|  PREDICTED: cytochrome P450 77A4                    331   3e-107   Brassica rapa
emb|CDY11297.1|  BnaA03g01330D                                          329   5e-107   Brassica napus [oilseed rape]
emb|CDX80914.1|  BnaC03g01680D                                          328   1e-106   
ref|XP_010694692.1|  PREDICTED: cytochrome P450 77A2-like               330   2e-106   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002871106.1|  CYP77A9                                            327   3e-106   Arabidopsis lyrata subsp. lyrata
ref|XP_010110167.1|  Cytochrome P450 77A3                               325   4e-105   Morus notabilis
ref|XP_011655840.1|  PREDICTED: cytochrome P450 77A3-like               323   2e-104   Cucumis sativus [cucumbers]
ref|NP_196083.1|  cytochrome P450, family 77, subfamily A, polype...    323   3e-104   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006287416.1|  hypothetical protein CARUB_v10000621mg             324   3e-104   
ref|XP_008446777.1|  PREDICTED: LOW QUALITY PROTEIN: cytochrome P...    318   1e-102   
ref|XP_009414952.1|  PREDICTED: cytochrome P450 77A2-like               315   5e-101   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010940445.1|  PREDICTED: cytochrome P450 77A2                    314   1e-100   Elaeis guineensis
emb|CDY44872.1|  BnaC09g50720D                                          312   3e-100   Brassica napus [oilseed rape]
ref|XP_009392677.1|  PREDICTED: cytochrome P450 77A2-like               311   7e-100   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006407540.1|  hypothetical protein EUTSA_v10022031mg             311   1e-99    Eutrema salsugineum [saltwater cress]
ref|XP_008775191.1|  PREDICTED: cytochrome P450 77A2                    308   3e-98    Phoenix dactylifera
gb|KFK24906.1|  hypothetical protein AALP_AA8G040400                    304   3e-98    Arabis alpina [alpine rockcress]
ref|XP_010490979.1|  PREDICTED: cytochrome P450 77A4-like               305   2e-97    Camelina sativa [gold-of-pleasure]
ref|XP_010423555.1|  PREDICTED: cytochrome P450 77A4-like               300   1e-95    Camelina sativa [gold-of-pleasure]
dbj|BAF02252.1|  putative cytochrome P450                               293   2e-95    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002530881.1|  cytochrome P450, putative                          293   2e-93    
ref|NP_187667.1|  cytochrome P450 protein UNE9                          294   3e-93    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002882682.1|  CYP77A7                                            292   2e-92    
ref|XP_002446399.1|  hypothetical protein SORBIDRAFT_06g015320          286   1e-89    Sorghum bicolor [broomcorn]
gb|AGT16500.1|  hypothetical protein SHCRBa_022_D13_R_80                285   3e-89    Saccharum hybrid cultivar R570
gb|AGT16905.1|  cytochrome P450                                         285   3e-89    Saccharum hybrid cultivar R570
ref|NP_001052719.1|  Os04g0407900                                       275   2e-86    
emb|CAH66495.1|  H0321H01.4                                             276   3e-86    Oryza sativa [red rice]
ref|XP_006652247.1|  PREDICTED: cytochrome P450 77A4-like               274   4e-86    
emb|CAE04891.3|  OSJNBa0042I15.13                                       275   9e-86    Oryza sativa Japonica Group [Japonica rice]
ref|NP_001132177.1|  uncharacterized protein LOC100193602               273   7e-85    
tpg|DAA37962.1|  TPA: putative cytochrome P450 superfamily protein      274   2e-84    
ref|XP_003581190.2|  PREDICTED: cytochrome P450 77A4-like               271   5e-84    Brachypodium distachyon [annual false brome]
gb|ABC68410.1|  cytochrome P450 monooxygenase CYP77A3v2                 244   1e-77    Glycine max [soybeans]
ref|XP_006851629.1|  PREDICTED: cytochrome P450 77A2                    236   5e-71    Amborella trichopoda
gb|EAZ30650.1|  hypothetical protein OsJ_14702                          233   2e-69    Oryza sativa Japonica Group [Japonica rice]
gb|ABR16500.1|  unknown                                                 226   9e-69    Picea sitchensis
ref|XP_007204450.1|  hypothetical protein PRUPE_ppa026370mg             228   1e-67    Prunus persica
ref|XP_008439972.1|  PREDICTED: cytochrome P450 77A1                    228   1e-67    Cucumis melo [Oriental melon]
ref|XP_009803416.1|  PREDICTED: cytochrome P450 77A3                    225   1e-66    Nicotiana sylvestris
ref|XP_009612631.1|  PREDICTED: cytochrome P450 77A1                    225   1e-66    Nicotiana tomentosiformis
ref|XP_004134754.1|  PREDICTED: cytochrome P450 77A1                    224   2e-66    Cucumis sativus [cucumbers]
ref|XP_007153928.1|  hypothetical protein PHAVU_003G076900g             224   3e-66    Phaseolus vulgaris [French bean]
ref|XP_003528678.1|  PREDICTED: cytochrome P450 77A1-like               223   8e-66    Glycine max [soybeans]
ref|XP_010102452.1|  Cytochrome P450 77A3                               223   9e-66    Morus notabilis
ref|XP_006858061.2|  PREDICTED: cytochrome P450 77A4                    223   9e-66    
gb|ERN19528.1|  hypothetical protein AMTR_s00062p00048540               223   1e-65    Amborella trichopoda
ref|XP_004305483.2|  PREDICTED: cytochrome P450 77A4                    222   3e-65    Fragaria vesca subsp. vesca
ref|XP_010276015.1|  PREDICTED: cytochrome P450 77A3                    221   4e-65    Nelumbo nucifera [Indian lotus]
emb|CDP04373.1|  unnamed protein product                                219   2e-64    Coffea canephora [robusta coffee]
gb|EPS68900.1|  hypothetical protein M569_05868                         219   2e-64    Genlisea aurea
ref|XP_006348097.1|  PREDICTED: cytochrome P450 77A3-like               219   2e-64    Solanum tuberosum [potatoes]
ref|XP_010316601.1|  PREDICTED: cytochrome P450 77A1                    218   4e-64    Solanum lycopersicum
ref|XP_011086180.1|  PREDICTED: cytochrome P450 77A3-like               218   8e-64    Sesamum indicum [beniseed]
ref|XP_006468005.1|  PREDICTED: cytochrome P450 77A3-like               218   8e-64    Citrus sinensis [apfelsine]
ref|XP_006449061.1|  hypothetical protein CICLE_v10014970mg             218   9e-64    Citrus clementina [clementine]
gb|KDO75503.1|  hypothetical protein CISIN_1g036686mg                   218   1e-63    Citrus sinensis [apfelsine]
ref|XP_011037689.1|  PREDICTED: cytochrome P450 77A4-like               217   1e-63    Populus euphratica
ref|XP_002305592.1|  cytochrome P450 family protein                     216   3e-63    Populus trichocarpa [western balsam poplar]
emb|CAN68641.1|  hypothetical protein VITISV_030808                     216   3e-63    Vitis vinifera
ref|XP_002265911.1|  PREDICTED: cytochrome P450 77A1                    216   3e-63    Vitis vinifera
ref|XP_002437457.1|  hypothetical protein SORBIDRAFT_10g027430          216   4e-63    Sorghum bicolor [broomcorn]
ref|XP_006657255.1|  PREDICTED: cytochrome P450 77A3-like               216   4e-63    Oryza brachyantha
ref|XP_010553430.1|  PREDICTED: cytochrome P450 77A3                    214   2e-62    Tarenaya hassleriana [spider flower]
ref|XP_002518512.1|  cytochrome P450, putative                          214   2e-62    Ricinus communis
ref|XP_004966222.1|  PREDICTED: cytochrome P450 77A3-like               214   3e-62    Setaria italica
ref|XP_012091382.1|  PREDICTED: cytochrome P450 77A4-like               214   3e-62    Jatropha curcas
ref|XP_003610402.1|  Cytochrome P450                                    213   4e-62    Medicago truncatula
ref|NP_001058373.1|  Os06g0680700                                       214   4e-62    
gb|EEE66224.1|  hypothetical protein OsJ_22376                          214   4e-62    Oryza sativa Japonica Group [Japonica rice]
ref|XP_003549954.2|  PREDICTED: cytochrome P450 77A2-like               213   6e-62    
gb|EYU33905.1|  hypothetical protein MIMGU_mgv1a004759mg                212   2e-61    Erythranthe guttata [common monkey flower]
gb|ACF86457.1|  unknown                                                 211   2e-61    Zea mays [maize]
ref|NP_001141481.1|  uncharacterized protein LOC100273592 precursor     211   2e-61    Zea mays [maize]
ref|XP_008242488.1|  PREDICTED: cytochrome P450 77A3                    211   3e-61    Prunus mume [ume]
ref|XP_010227164.1|  PREDICTED: cytochrome P450 77A1                    211   5e-61    Brachypodium distachyon [annual false brome]
ref|XP_010476093.1|  PREDICTED: cytochrome P450 77A3-like               209   1e-60    Camelina sativa [gold-of-pleasure]
ref|XP_007026022.1|  Cytochrome P450, family 77, subfamily B, pol...    209   1e-60    Theobroma cacao [chocolate]
ref|XP_010458565.1|  PREDICTED: cytochrome P450 77A3-like               209   1e-60    Camelina sativa [gold-of-pleasure]
gb|KJB68589.1|  hypothetical protein B456_010G252700                    209   1e-60    Gossypium raimondii
ref|XP_010493054.1|  PREDICTED: cytochrome P450 77A3-like               209   2e-60    Camelina sativa [gold-of-pleasure]
ref|XP_006417335.1|  hypothetical protein EUTSA_v10007399mg             209   2e-60    Eutrema salsugineum [saltwater cress]
gb|KJB69319.1|  hypothetical protein B456_011G016000                    208   4e-60    Gossypium raimondii
ref|XP_006307273.1|  hypothetical protein CARUB_v10008888mg             207   8e-60    Capsella rubella
gb|KJB67165.1|  hypothetical protein B456_010G178900                    207   8e-60    Gossypium raimondii
ref|XP_002518513.1|  cytochrome P450, putative                          206   1e-59    Ricinus communis
ref|XP_004508228.1|  PREDICTED: uncharacterized protein LOC101501316    212   2e-59    
ref|NP_172626.1|  cytochrome P450, family 77, subfamily B, polype...    205   5e-59    Arabidopsis thaliana [mouse-ear cress]
ref|XP_004148096.2|  PREDICTED: cytochrome P450 89A2-like               205   6e-59    Cucumis sativus [cucumbers]
ref|XP_009118184.1|  PREDICTED: cytochrome P450 77A3                    204   1e-58    Brassica rapa
ref|XP_010931808.1|  PREDICTED: cytochrome P450 77A3                    204   2e-58    Elaeis guineensis
ref|XP_010101456.1|  Cytochrome P450 77A3                               203   3e-58    
ref|XP_002889880.1|  CYP77B1                                            203   4e-58    Arabidopsis lyrata subsp. lyrata
ref|XP_011037690.1|  PREDICTED: cytochrome P450 77A1-like               202   4e-58    Populus euphratica
ref|XP_011086181.1|  PREDICTED: cytochrome P450 77A3-like               202   5e-58    Sesamum indicum [beniseed]
ref|XP_010525140.1|  PREDICTED: cytochrome P450 89A2-like               202   6e-58    Tarenaya hassleriana [spider flower]
ref|XP_009412014.1|  PREDICTED: cytochrome P450 77A3-like               202   8e-58    Musa acuminata subsp. malaccensis [pisang utan]
gb|KDP20777.1|  hypothetical protein JCGZ_21248                         201   1e-57    Jatropha curcas
emb|CDY34640.1|  BnaC08g41990D                                          201   1e-57    Brassica napus [oilseed rape]
ref|XP_012091383.1|  PREDICTED: cytochrome P450 77A1                    201   2e-57    Jatropha curcas
ref|XP_002304925.2|  hypothetical protein POPTR_0004s01860g             200   3e-57    Populus trichocarpa [western balsam poplar]
ref|XP_008812264.1|  PREDICTED: cytochrome P450 77A3-like               200   3e-57    Phoenix dactylifera
ref|XP_009110714.1|  PREDICTED: cytochrome P450 77A3-like               200   4e-57    Brassica rapa
ref|XP_008784547.1|  PREDICTED: cytochrome P450 77A3-like               200   5e-57    Phoenix dactylifera
dbj|BAK06611.1|  predicted protein                                      200   5e-57    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009393330.1|  PREDICTED: cytochrome P450 77A3-like               200   5e-57    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010665549.1|  PREDICTED: cytochrome P450 77A4                    199   7e-57    Beta vulgaris subsp. vulgaris [field beet]
gb|KFK31941.1|  hypothetical protein AALP_AA6G179900                    199   9e-57    Arabis alpina [alpine rockcress]
ref|XP_009363721.1|  PREDICTED: cytochrome P450 77A1-like               199   1e-56    Pyrus x bretschneideri [bai li]
ref|XP_009370410.1|  PREDICTED: cytochrome P450 77A1-like               199   2e-56    Pyrus x bretschneideri [bai li]
ref|XP_010052825.1|  PREDICTED: cytochrome P450 77A2                    199   2e-56    Eucalyptus grandis [rose gum]
ref|XP_009362723.1|  PREDICTED: cytochrome P450 77A3-like               199   2e-56    
emb|CDY64815.1|  BnaA08g31590D                                          198   3e-56    Brassica napus [oilseed rape]
ref|XP_004235319.1|  PREDICTED: cytochrome P450 89A2-like               197   4e-56    Solanum lycopersicum
ref|XP_011086179.1|  PREDICTED: cytochrome P450 77A3-like               197   7e-56    Sesamum indicum [beniseed]
ref|XP_010442231.1|  PREDICTED: cytochrome P450 89A2-like               196   1e-55    Camelina sativa [gold-of-pleasure]
ref|XP_010482059.1|  PREDICTED: cytochrome P450 89A2-like               195   3e-55    Camelina sativa [gold-of-pleasure]
ref|XP_009622536.1|  PREDICTED: cytochrome P450 89A2-like               194   5e-55    Nicotiana tomentosiformis
ref|XP_011650074.1|  PREDICTED: cytochrome P450 89A2-like               194   5e-55    Cucumis sativus [cucumbers]
ref|XP_006347571.1|  PREDICTED: cytochrome P450 89A2-like               194   6e-55    Solanum tuberosum [potatoes]
gb|KGN63395.1|  hypothetical protein Csa_2G437050                       193   8e-55    Cucumis sativus [cucumbers]
ref|NP_176674.1|  cytochrome P450, family 87, subfamily A, polype...    192   3e-54    Arabidopsis thaliana [mouse-ear cress]
ref|XP_011650076.1|  PREDICTED: cytochrome P450 89A2-like               192   3e-54    Cucumis sativus [cucumbers]
ref|XP_010553818.1|  PREDICTED: cytochrome P450 89A2-like               191   1e-53    Tarenaya hassleriana [spider flower]
ref|XP_002970486.1|  hypothetical protein SELMODRAFT_22493              190   1e-53    
ref|XP_009128469.1|  PREDICTED: cytochrome P450 89A2-like               190   2e-53    Brassica rapa
ref|XP_002970487.1|  hypothetical protein SELMODRAFT_93385              190   2e-53    
gb|KFK24754.1|  hypothetical protein AALP_AA8G020600                    186   2e-53    Arabis alpina [alpine rockcress]
ref|XP_008375760.1|  PREDICTED: LOW QUALITY PROTEIN: cytochrome P...    190   3e-53    
ref|XP_002978564.1|  hypothetical protein SELMODRAFT_108700             190   3e-53    
ref|XP_010528671.1|  PREDICTED: cytochrome P450 89A2-like               190   3e-53    Tarenaya hassleriana [spider flower]
ref|XP_002524040.1|  cytochrome P450, putative                          190   4e-53    Ricinus communis
gb|KJB46081.1|  hypothetical protein B456_007G347700                    189   6e-53    Gossypium raimondii
gb|KJB46083.1|  hypothetical protein B456_007G347900                    189   6e-53    Gossypium raimondii
ref|XP_008367238.1|  PREDICTED: LOW QUALITY PROTEIN: cytochrome P...    189   7e-53    
emb|CDY56131.1|  BnaA02g20200D                                          188   9e-53    Brassica napus [oilseed rape]
ref|XP_002886780.1|  CYP89A5                                            188   1e-52    
ref|XP_004148095.1|  PREDICTED: cytochrome P450 89A2-like               188   1e-52    Cucumis sativus [cucumbers]
ref|XP_009782165.1|  PREDICTED: cytochrome P450 89A2-like               188   1e-52    Nicotiana sylvestris
gb|KJB18538.1|  hypothetical protein B456_003G058600                    188   2e-52    Gossypium raimondii
ref|XP_006347570.1|  PREDICTED: cytochrome P450 89A2-like               188   2e-52    Solanum tuberosum [potatoes]
ref|XP_008459160.1|  PREDICTED: cytochrome P450 89A2-like               188   2e-52    Cucumis melo [Oriental melon]
ref|XP_010941087.1|  PREDICTED: cytochrome P450 89A2-like               187   2e-52    Elaeis guineensis
ref|XP_007029515.1|  Cytochrome P450, family 87, subfamily A, pol...    187   2e-52    
ref|NP_178922.1|  putative cytochrome P450                              187   4e-52    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006302157.1|  hypothetical protein CARUB_v10020166mg             186   5e-52    Capsella rubella
ref|XP_003574176.1|  PREDICTED: cytochrome P450 89A2-like               186   7e-52    Brachypodium distachyon [annual false brome]
ref|XP_002268331.1|  PREDICTED: cytochrome P450 89A2                    186   8e-52    Vitis vinifera
gb|EMS64564.1|  Cytochrome P450 89A2                                    184   1e-51    Triticum urartu
gb|KJB46082.1|  hypothetical protein B456_007G347800                    185   2e-51    Gossypium raimondii
ref|XP_006662172.1|  PREDICTED: cytochrome P450 89A2-like               186   2e-51    Oryza brachyantha
ref|XP_006662509.1|  PREDICTED: cytochrome P450 89A2-like               184   2e-51    
ref|NP_001057534.1|  Os06g0328900                                       179   2e-51    
ref|XP_007029747.1|  Cytochrome P450, family 87, subfamily A, pol...    185   3e-51    
gb|EAY79193.1|  hypothetical protein OsI_34305                          185   3e-51    Oryza sativa Indica Group [Indian rice]
gb|KHN42995.1|  Cytochrome P450 89A2                                    181   3e-51    Glycine soja [wild soybean]
ref|XP_002466942.1|  hypothetical protein SORBIDRAFT_01g017160          184   3e-51    Sorghum bicolor [broomcorn]
gb|ADP89483.1|  cytochrome P450 mono-oxygenase superfamily              176   3e-51    Picea mariana [black spruce]
ref|XP_007029748.1|  Cytochrome P450, family 87, subfamily A, pol...    184   5e-51    
emb|CAN77554.1|  hypothetical protein VITISV_039372                     184   5e-51    Vitis vinifera
ref|XP_002266269.2|  PREDICTED: cytochrome P450 89A2-like               184   5e-51    Vitis vinifera
ref|XP_010276939.1|  PREDICTED: cytochrome P450 89A2-like               184   5e-51    Nelumbo nucifera [Indian lotus]
gb|ADP89481.1|  cytochrome P450 mono-oxygenase superfamily              176   6e-51    Picea mariana [black spruce]
ref|XP_008797233.1|  PREDICTED: cytochrome P450 89A2-like               184   6e-51    Phoenix dactylifera
ref|NP_176675.1|  cytochrome P450, family 89, subfamily A, polype...    184   6e-51    Arabidopsis thaliana [mouse-ear cress]
gb|ADP89490.1|  cytochrome P450 mono-oxygenase superfamily              176   6e-51    Picea glauca
gb|AAK96572.1|  At1g64950/F13O11_25                                     184   6e-51    Arabidopsis thaliana [mouse-ear cress]
ref|XP_004151744.2|  PREDICTED: cytochrome P450 89A2-like               184   6e-51    Cucumis sativus [cucumbers]
gb|ADP89478.1|  cytochrome P450 mono-oxygenase superfamily              176   7e-51    Picea abies
ref|XP_002466943.1|  hypothetical protein SORBIDRAFT_01g017170          183   8e-51    Sorghum bicolor [broomcorn]
ref|XP_002524036.1|  cytochrome P450, putative                          183   1e-50    
ref|NP_001065051.1|  Os10g0513900                                       183   1e-50    
ref|XP_009108016.1|  PREDICTED: cytochrome P450 89A2-like               183   1e-50    Brassica rapa
ref|XP_004962930.1|  PREDICTED: cytochrome P450 89A2-like               183   1e-50    Setaria italica
ref|XP_002306325.1|  hypothetical protein POPTR_0005s08140g             183   1e-50    
ref|XP_011005628.1|  PREDICTED: cytochrome P450 89A2-like               183   1e-50    Populus euphratica
ref|XP_006419167.1|  hypothetical protein EUTSA_v10002491mg             183   1e-50    
gb|ACG47544.1|  transposon protein                                      183   1e-50    Zea mays [maize]
ref|XP_008459270.1|  PREDICTED: cytochrome P450 89A2-like               182   1e-50    Cucumis melo [Oriental melon]
ref|XP_010445937.1|  PREDICTED: cytochrome P450 89A2-like               185   1e-50    
ref|XP_002524034.1|  cytochrome P450, putative                          182   1e-50    Ricinus communis
ref|XP_010662054.1|  PREDICTED: cytochrome P450 89A2-like               182   2e-50    Vitis vinifera
gb|ADP89484.1|  cytochrome P450 mono-oxygenase superfamily              175   2e-50    Picea omorika
gb|KFK33248.1|  hypothetical protein AALP_AA6G350000                    182   2e-50    Arabis alpina [alpine rockcress]
ref|XP_011005629.1|  PREDICTED: cytochrome P450 89A2-like               182   2e-50    Populus euphratica
ref|XP_011015670.1|  PREDICTED: cytochrome P450 89A2-like               182   2e-50    Populus euphratica
ref|XP_010439394.1|  PREDICTED: cytochrome P450 89A2-like               182   2e-50    Camelina sativa [gold-of-pleasure]
emb|CAN77555.1|  hypothetical protein VITISV_039373                     182   3e-50    Vitis vinifera
ref|XP_009603616.1|  PREDICTED: cytochrome P450 89A2-like               182   3e-50    Nicotiana tomentosiformis
ref|XP_010276940.1|  PREDICTED: cytochrome P450 89A2-like               182   3e-50    Nelumbo nucifera [Indian lotus]
ref|XP_008459157.1|  PREDICTED: LOW QUALITY PROTEIN: cytochrome P...    182   3e-50    
ref|XP_003529424.1|  PREDICTED: cytochrome P450 89A2-like               181   5e-50    Glycine max [soybeans]
ref|XP_004235317.1|  PREDICTED: cytochrome P450 89A2-like               181   5e-50    Solanum lycopersicum
gb|KJB26702.1|  hypothetical protein B456_004G255300                    181   5e-50    Gossypium raimondii
ref|XP_004148097.1|  PREDICTED: cytochrome P450 89A2-like               181   5e-50    Cucumis sativus [cucumbers]
ref|XP_010934620.1|  PREDICTED: cytochrome P450 89A2-like               181   6e-50    Elaeis guineensis
ref|XP_011016836.1|  PREDICTED: cytochrome P450 89A2-like               177   6e-50    Populus euphratica
ref|XP_004982612.1|  PREDICTED: cytochrome P450 89A2-like               181   6e-50    Setaria italica
ref|XP_008459156.1|  PREDICTED: cytochrome P450 89A2-like               181   6e-50    Cucumis melo [Oriental melon]
ref|XP_007029722.1|  Cytochrome P450, family 87, subfamily A, pol...    181   7e-50    
gb|EMT00202.1|  Cytochrome P450 89A2                                    178   7e-50    
ref|XP_002309993.2|  hypothetical protein POPTR_0007s05960g             181   8e-50    
gb|EAY79198.1|  hypothetical protein OsI_34310                          181   8e-50    
ref|XP_002524041.1|  cytochrome P450, putative                          181   9e-50    
ref|XP_012070270.1|  PREDICTED: cytochrome P450 89A2-like               180   1e-49    
gb|KHN08060.1|  Cytochrome P450 89A2                                    176   1e-49    
gb|ACL53147.1|  unknown                                                 176   1e-49    
ref|XP_002524035.1|  cytochrome P450, putative                          180   2e-49    
ref|XP_008800986.1|  PREDICTED: cytochrome P450 89A2-like               180   2e-49    
ref|XP_011044422.1|  PREDICTED: cytochrome P450 89A2-like               180   2e-49    
ref|XP_011013715.1|  PREDICTED: cytochrome P450 89A2-like               179   2e-49    
ref|XP_006662510.1|  PREDICTED: cytochrome P450 89A2-like               180   2e-49    
ref|XP_012090926.1|  PREDICTED: cytochrome P450 89A2-like               179   2e-49    
gb|ADP89482.1|  cytochrome P450 mono-oxygenase superfamily              172   3e-49    
gb|EAZ36847.1|  hypothetical protein OsJ_21188                          178   3e-49    
ref|XP_010266363.1|  PREDICTED: cytochrome P450 89A2-like               179   3e-49    
ref|XP_006437392.1|  hypothetical protein CICLE_v10033851mg             179   3e-49    
ref|XP_006661955.1|  PREDICTED: cytochrome P450 89A2-like               175   3e-49    
gb|EAZ00761.1|  hypothetical protein OsI_22787                          179   3e-49    
ref|XP_009382325.1|  PREDICTED: cytochrome P450 89A2-like               179   4e-49    
gb|AAG13506.1|AC068924_11  putative cytochrome P450                     179   4e-49    
ref|XP_006659834.1|  PREDICTED: cytochrome P450 89A2-like               176   4e-49    
dbj|BAD33291.1|  putative cytochrome P450                               179   5e-49    
ref|NP_001061003.1|  Os08g0152400                                       179   5e-49    
gb|EAZ05607.1|  hypothetical protein OsI_27825                          179   5e-49    
gb|KDO42607.1|  hypothetical protein CISIN_1g010248mg                   178   6e-49    
gb|KCW45181.1|  hypothetical protein EUGRSUZ_L011822                    172   6e-49    
ref|XP_006484712.1|  PREDICTED: cytochrome P450 89A2-like               178   6e-49    
dbj|BAJ93808.1|  predicted protein                                      178   6e-49    
ref|XP_007029749.1|  Cytochrome P450, family 87, subfamily A, pol...    179   6e-49    
emb|CDY65266.1|  BnaCnng46310D                                          171   6e-49    
gb|KCW44075.1|  hypothetical protein EUGRSUZ_L025191                    178   7e-49    
ref|XP_006380442.1|  hypothetical protein POPTR_0007s059451g            173   7e-49    
ref|XP_006484709.1|  PREDICTED: cytochrome P450 89A2-like               178   8e-49    
dbj|BAJ94552.1|  predicted protein                                      178   8e-49    
emb|CDY66574.1|  BnaCnng51480D                                          178   8e-49    
ref|XP_006437395.1|  hypothetical protein CICLE_v10033803mg             178   9e-49    
ref|XP_010941086.1|  PREDICTED: cytochrome P450 89A2-like               178   9e-49    
gb|KDO39082.1|  hypothetical protein CISIN_1g037361mg                   178   1e-48    
ref|XP_010934624.1|  PREDICTED: cytochrome P450 89A2-like               178   1e-48    
ref|XP_002265797.1|  PREDICTED: cytochrome P450 89A2-like               178   1e-48    
ref|XP_007029752.1|  Cytochrome P450 89A2                               178   1e-48    
ref|XP_006301252.1|  hypothetical protein CARUB_v10021652mg             177   1e-48    
ref|XP_010672161.1|  PREDICTED: cytochrome P450 89A2-like               177   1e-48    
ref|XP_008797231.1|  PREDICTED: cytochrome P450 89A2-like               177   1e-48    
ref|XP_002524037.1|  cytochrome P450, putative                          177   1e-48    
ref|XP_010069931.1|  PREDICTED: cytochrome P450 89A2-like               177   2e-48    
ref|XP_006661954.1|  PREDICTED: cytochrome P450 89A2-like               177   2e-48    
emb|CAN69345.1|  hypothetical protein VITISV_006018                     177   2e-48    
gb|AAY78666.1|  putative cytochrome P450                                177   2e-48    
ref|XP_010662052.1|  PREDICTED: cytochrome P450 89A2                    177   2e-48    
emb|CAN64477.1|  hypothetical protein VITISV_017161                     177   2e-48    
ref|NP_176673.1|  cytochrome P450, family 87, subfamily A, polype...    177   2e-48    
ref|XP_010026130.1|  PREDICTED: cytochrome P450 89A2-like               177   2e-48    
ref|NP_001065059.1|  Os10g0515900                                       177   3e-48    
ref|XP_002456895.1|  hypothetical protein SORBIDRAFT_03g044800          176   3e-48    
ref|XP_002531491.1|  cytochrome P450, putative                          171   4e-48    
ref|XP_006380437.1|  hypothetical protein POPTR_0007s05920g             176   4e-48    
ref|XP_006361087.1|  PREDICTED: cytochrome P450 89A2-like               176   4e-48    
ref|XP_006388469.1|  hypothetical protein POPTR_0177s00210g             176   4e-48    
ref|XP_008379819.1|  PREDICTED: cytochrome P450 89A2-like               176   4e-48    
ref|XP_006302158.1|  hypothetical protein CARUB_v10020167mg             176   4e-48    
gb|EMS57097.1|  Cytochrome P450 89A2                                    176   5e-48    
gb|KJB80554.1|  hypothetical protein B456_013G103400                    176   6e-48    
ref|XP_010934623.1|  PREDICTED: cytochrome P450 89A2-like               176   6e-48    
gb|EEE51265.1|  hypothetical protein OsJ_32150                          175   6e-48    
ref|XP_010934622.1|  PREDICTED: cytochrome P450 89A2-like               176   6e-48    
ref|NP_001146067.1|  uncharacterized protein LOC100279598               176   6e-48    
ref|NP_001147503.1|  transposon protein precursor                       176   7e-48    
gb|AAG13525.1|AC068924_30  putative cytochrome P450                     176   7e-48    
ref|XP_003556183.1|  PREDICTED: cytochrome P450 89A2-like               175   8e-48    
ref|XP_004241332.1|  PREDICTED: cytochrome P450 89A2-like               175   9e-48    
ref|XP_009407856.1|  PREDICTED: cytochrome P450 89A2-like               175   1e-47    
ref|NP_001064139.1|  Os10g0139700                                       175   1e-47    
emb|CDP18187.1|  unnamed protein product                                176   1e-47    
ref|XP_007131475.1|  hypothetical protein PHAVU_011G016700g             175   1e-47    
ref|XP_008644885.1|  PREDICTED: cytochrome P450 89A2-like               175   1e-47    
ref|XP_010026134.1|  PREDICTED: cytochrome P450 89A2-like               174   2e-47    
ref|XP_010040475.1|  PREDICTED: cytochrome P450 89A2-like               174   2e-47    
gb|KCW58465.1|  hypothetical protein EUGRSUZ_H011461                    169   2e-47    
gb|EMS53275.1|  Cytochrome P450 89A2                                    176   2e-47    
gb|EEC66552.1|  hypothetical protein OsI_32710                          174   2e-47    
ref|XP_006388468.1|  hypothetical protein POPTR_0177s00200g             170   3e-47    
gb|EAY79199.1|  hypothetical protein OsI_34311                          174   3e-47    
gb|EEE68050.1|  hypothetical protein OsJ_26050                          174   3e-47    
ref|XP_006851423.1|  PREDICTED: cytochrome P450 89A2                    174   3e-47    
gb|EAY79195.1|  hypothetical protein OsI_34307                          174   3e-47    
ref|XP_010026135.1|  PREDICTED: cytochrome P450 89A2-like               173   3e-47    
gb|EMT18060.1|  Cytochrome P450 89A2                                    169   3e-47    
ref|XP_007029750.1|  Cytochrome P450, family 87, subfamily A, pol...    174   3e-47    
ref|XP_002466944.1|  hypothetical protein SORBIDRAFT_01g017180          174   3e-47    
ref|XP_010026131.1|  PREDICTED: cytochrome P450 89A2-like               174   3e-47    
ref|XP_010919362.1|  PREDICTED: cytochrome P450 89A2-like               173   4e-47    
ref|XP_002319773.2|  Cytochrome P450 89A2 family protein                174   4e-47    
ref|XP_011028246.1|  PREDICTED: cytochrome P450 89A2-like               173   5e-47    
ref|XP_011085115.1|  PREDICTED: cytochrome P450 89A2-like               173   5e-47    
gb|KJB80555.1|  hypothetical protein B456_013G103500                    172   5e-47    
gb|KHN46492.1|  Cytochrome P450 89A2                                    170   5e-47    
dbj|BAC65384.1|  putative cytochrome P450                               172   5e-47    
ref|XP_003571489.1|  PREDICTED: cytochrome P450 89A2                    173   6e-47    
ref|XP_008656896.1|  PREDICTED: cytochrome P450 89A2-like               173   6e-47    
ref|XP_011005627.1|  PREDICTED: cytochrome P450 89A2-like               173   6e-47    
gb|KCW58467.1|  hypothetical protein EUGRSUZ_H01148                     173   7e-47    
ref|XP_004956576.1|  PREDICTED: cytochrome P450 89A2-like               173   8e-47    
ref|XP_010069932.1|  PREDICTED: cytochrome P450 89A2-like               172   9e-47    
gb|KHN11812.1|  Cytochrome P450 89A2                                    170   9e-47    
ref|XP_002464772.1|  hypothetical protein SORBIDRAFT_01g026530          172   1e-46    
dbj|BAB89608.1|  putative cytochrome P450                               172   1e-46    
gb|EAY73941.1|  hypothetical protein OsI_01826                          172   1e-46    
gb|EEC77234.1|  hypothetical protein OsI_15784                          164   1e-46    
gb|EMT17172.1|  Cytochrome P450 89A2                                    171   1e-46    
gb|EMS51260.1|  Cytochrome P450 89A2                                    168   1e-46    
gb|EEC82910.1|  hypothetical protein OsI_27824                          171   1e-46    
ref|XP_004512444.1|  PREDICTED: cytochrome P450 89A2-like               172   1e-46    
ref|XP_010069928.1|  PREDICTED: cytochrome P450 89A2-like               172   2e-46    
ref|XP_010069936.1|  PREDICTED: cytochrome P450 89A2-like               173   2e-46    
gb|KDO42609.1|  hypothetical protein CISIN_1g008732mg                   172   2e-46    
ref|XP_011044421.1|  PREDICTED: cytochrome P450 89A2-like               172   2e-46    
dbj|BAK03964.1|  predicted protein                                      172   2e-46    
ref|XP_010558680.1|  PREDICTED: cytochrome P450 89A9                    171   2e-46    
ref|NP_001065058.2|  Os10g0515400                                       170   2e-46    
ref|XP_002303473.2|  hypothetical protein POPTR_0003s10370g             171   2e-46    
ref|XP_006828882.1|  PREDICTED: cytochrome P450 89A2                    171   2e-46    
ref|XP_008437556.1|  PREDICTED: cytochrome P450 89A2-like               171   3e-46    
ref|XP_010941433.1|  PREDICTED: cytochrome P450 89A2-like               171   3e-46    
ref|XP_009340043.1|  PREDICTED: cytochrome P450 89A2-like               171   3e-46    
gb|ABC68408.1|  cytochrome P450 monooxygenase CYP89H3                   168   3e-46    
ref|XP_010040474.1|  PREDICTED: cytochrome P450 89A2-like               171   3e-46    
ref|XP_007208889.1|  hypothetical protein PRUPE_ppa026664mg             171   3e-46    
ref|XP_003628670.1|  Cytochrome P450                                    171   3e-46    
dbj|BAK07729.1|  predicted protein                                      171   3e-46    
gb|AAB67854.1|  cytochrome P450                                         171   3e-46    
dbj|BAJ91738.1|  predicted protein                                      171   3e-46    
ref|XP_010042755.1|  PREDICTED: cytochrome P450 89A2-like               171   3e-46    
ref|XP_004959779.1|  PREDICTED: cytochrome P450 89A2-like               171   4e-46    
ref|XP_003540011.2|  PREDICTED: cytochrome P450 89A9-like               171   4e-46    
gb|KCW58443.1|  hypothetical protein EUGRSUZ_H01121                     169   4e-46    
ref|XP_010026126.1|  PREDICTED: cytochrome P450 89A2-like               171   4e-46    
ref|XP_006437396.1|  hypothetical protein CICLE_v10031193mg             171   4e-46    
ref|XP_009385971.1|  PREDICTED: cytochrome P450 89A2-like               171   5e-46    
ref|XP_010069927.1|  PREDICTED: cytochrome P450 89A2-like               171   6e-46    
gb|EEE51266.1|  hypothetical protein OsJ_32153                          170   6e-46    
gb|AAP54608.2|  Cytochrome P450 family protein                          169   6e-46    
gb|KCW58461.1|  hypothetical protein EUGRSUZ_H01144                     170   6e-46    
ref|XP_010026125.1|  PREDICTED: cytochrome P450 89A2-like               169   6e-46    
ref|XP_002319775.1|  Cytochrome P450 89A2 family protein                170   7e-46    
dbj|BAK07365.1|  predicted protein                                      170   7e-46    
ref|XP_009340042.1|  PREDICTED: cytochrome P450 89A2-like               170   7e-46    
ref|XP_004300130.1|  PREDICTED: cytochrome P450 89A2-like               170   7e-46    
ref|XP_010069929.1|  PREDICTED: cytochrome P450 89A2-like               170   7e-46    
ref|NP_001065056.1|  Os10g0515200                                       170   7e-46    
ref|XP_010680105.1|  PREDICTED: cytochrome P450 89A2-like               170   7e-46    
gb|EEC67308.1|  hypothetical protein OsI_34309                          169   7e-46    
ref|XP_006433962.1|  hypothetical protein CICLE_v10003406mg             166   7e-46    
ref|NP_001132060.1|  putative cytochrome P450 superfamily protein       170   7e-46    
gb|AAP54612.2|  transposon protein, putative, unclassified              170   8e-46    
ref|XP_003556196.1|  PREDICTED: cytochrome P450 89A2                    170   8e-46    
dbj|BAJ94327.1|  predicted protein                                      170   9e-46    
ref|XP_004986722.1|  PREDICTED: cytochrome P450 89A2-like               170   9e-46    
gb|KCW58445.1|  hypothetical protein EUGRSUZ_H01123                     171   9e-46    
ref|XP_003612570.1|  Cytochrome P450 89A2                               169   1e-45    
gb|EMT23451.1|  Cytochrome P450 89A2                                    169   1e-45    
gb|KHN08058.1|  Cytochrome P450 89A2                                    168   1e-45    
ref|XP_002520014.1|  cytochrome P450, putative                          169   1e-45    
ref|XP_006588311.1|  PREDICTED: cytochrome P450 89A2-like               169   1e-45    
ref|XP_008374073.1|  PREDICTED: cytochrome P450 89A2-like               169   1e-45    
ref|XP_010069933.1|  PREDICTED: cytochrome P450 89A2-like               169   1e-45    
ref|XP_010680926.1|  PREDICTED: cytochrome P450 89A2-like               169   1e-45    
gb|KCW58456.1|  hypothetical protein EUGRSUZ_H01138                     169   2e-45    
ref|XP_010662058.1|  PREDICTED: cytochrome P450 89A2-like               169   2e-45    
gb|KCW58444.1|  hypothetical protein EUGRSUZ_H01122                     169   2e-45    
ref|XP_009411124.1|  PREDICTED: cytochrome P450 89A2-like               169   2e-45    
ref|XP_002466945.1|  hypothetical protein SORBIDRAFT_01g017190          169   2e-45    
ref|XP_010276945.1|  PREDICTED: cytochrome P450 89A2-like               169   2e-45    
gb|AAG13498.1|AC068924_3  putative cytochrome P450                      170   3e-45    
gb|AAG13517.1|AC068924_22  putative cytochrome P450                     169   3e-45    
ref|XP_002447302.1|  hypothetical protein SORBIDRAFT_06g032390          169   3e-45    
ref|XP_009609017.1|  PREDICTED: cytochrome P450 89A2-like               169   3e-45    
emb|CDP14026.1|  unnamed protein product                                169   3e-45    
ref|XP_009340064.1|  PREDICTED: cytochrome P450 89A2-like               168   4e-45    
ref|XP_003556213.1|  PREDICTED: cytochrome P450 89A2-like               168   4e-45    
ref|XP_003579360.1|  PREDICTED: cytochrome P450 89A2-like               168   4e-45    
ref|XP_002266528.2|  PREDICTED: cytochrome P450 89A2-like isoform X2    168   4e-45    
ref|XP_006365724.1|  PREDICTED: cytochrome P450 89A9-like               167   5e-45    
ref|XP_008234459.1|  PREDICTED: cytochrome P450 89A2-like               167   5e-45    
gb|EMT28306.1|  Cytochrome P450 89A2                                    162   5e-45    
ref|XP_004503696.1|  PREDICTED: cytochrome P450 89A2-like               167   6e-45    
ref|XP_007219004.1|  hypothetical protein PRUPE_ppa004199mg             167   6e-45    
ref|XP_004982617.1|  PREDICTED: cytochrome P450 89A2-like               168   6e-45    
gb|EAZ15260.1|  hypothetical protein OsJ_30679                          167   6e-45    
ref|XP_007219018.1|  hypothetical protein PRUPE_ppa004356mg             167   8e-45    
ref|XP_007029732.1|  Cytochrome P450                                    167   1e-44    
ref|XP_006484708.1|  PREDICTED: cytochrome P450 89A2-like               167   1e-44    
ref|XP_003593333.1|  Cytochrome P450 monooxygenase CYP89A28             166   1e-44    
ref|XP_002463066.1|  hypothetical protein SORBIDRAFT_02g037140          166   1e-44    
gb|EAY79200.1|  hypothetical protein OsI_34312                          167   1e-44    
ref|XP_004982618.1|  PREDICTED: cytochrome P450 89A2-like               167   2e-44    
ref|XP_004298097.2|  PREDICTED: cytochrome P450 89A2-like               167   2e-44    
ref|XP_002524042.1|  cytochrome P450, putative                          166   2e-44    
emb|CDY52965.1|  BnaCnng23930D                                          166   2e-44    
gb|ADP89487.1|  cytochrome P450 mono-oxygenase superfamily              159   2e-44    
ref|XP_006361088.1|  PREDICTED: cytochrome P450 89A2-like               166   3e-44    
ref|XP_008234460.1|  PREDICTED: cytochrome P450 89A2-like               162   3e-44    
ref|XP_008679798.1|  PREDICTED: putative cytochrome P450 superfam...    166   4e-44    
ref|XP_004309202.2|  PREDICTED: cytochrome P450 89A2-like isoform X2    165   4e-44    
ref|XP_006388472.1|  hypothetical protein POPTR_0177s002201g            157   4e-44    
ref|XP_010087442.1|  Cytochrome P450 89A2                               166   4e-44    
ref|XP_011470351.1|  PREDICTED: cytochrome P450 89A2-like isoform X1    165   4e-44    
dbj|BAK07236.1|  predicted protein                                      165   4e-44    
gb|AEM43006.1|  cytochrome P450                                         165   5e-44    
ref|XP_008797181.1|  PREDICTED: cytochrome P450 89A2-like               165   5e-44    
gb|KFK23793.1|  hypothetical protein AALP_AAs64732U000200               165   5e-44    
ref|XP_004972841.1|  PREDICTED: cytochrome P450 89A2-like               165   5e-44    
gb|EAY79201.1|  hypothetical protein OsI_34314                          165   6e-44    
ref|XP_012066740.1|  PREDICTED: cytochrome P450 89A2-like               165   6e-44    
ref|XP_004295152.1|  PREDICTED: cytochrome P450 89A2-like               164   6e-44    
gb|KCW58452.1|  hypothetical protein EUGRSUZ_H01131                     165   7e-44    
ref|XP_004972788.1|  PREDICTED: cytochrome P450 89A2-like               165   7e-44    
ref|XP_010069934.1|  PREDICTED: cytochrome P450 89A2-like               165   7e-44    
ref|XP_010069930.1|  PREDICTED: cytochrome P450 89A2-like               165   9e-44    
emb|CAN63607.1|  hypothetical protein VITISV_019131                     162   1e-43    



>emb|CAN65790.1| hypothetical protein VITISV_042049 [Vitis vinifera]
Length=515

 Score =   387 bits (995),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 182/225 (81%), Positives = 201/225 (89%), Gaps = 0/225 (0%)
 Frame = +1

Query  4    LDPRVDDFLPILSPFFSKQRKRVLEVRKQQIETIVPLIERRRRALENPGSDKSAATFSYL  183
            LDPR+DD+LP+LSPFFSKQRK   EVRK+QI+T+VP IERRR ALENPGSDK+AA+FSYL
Sbjct  229  LDPRLDDYLPLLSPFFSKQRKAATEVRKRQIKTVVPFIERRRAALENPGSDKTAASFSYL  288

Query  184  DTLFDLTVEGRKSSPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEI  363
            DT+FDL +EGRKSSPTN ELVTL SEFLNGGTDTT TA+EWAIAR+IENP IQSKLYEEI
Sbjct  289  DTIFDLKIEGRKSSPTNPELVTLCSEFLNGGTDTTGTAVEWAIARMIENPEIQSKLYEEI  348

Query  364  KSVVGDRKVDEKDTDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVE  543
            K+ VGDRKV EKD +KMPYLNAV KELLRKHPPT+F+LTHAVT+P KL GYDIP D  VE
Sbjct  349  KTTVGDRKVQEKDMEKMPYLNAVSKELLRKHPPTYFSLTHAVTEPAKLAGYDIPTDANVE  408

Query  544  FFLPAISDDPTLWSDPEKFDPDRFLSGGEDADITGVTAVKMMPFG  678
            FFLP IS+DP LW +PEKFDPDRFL GGEDADITGVT VKMMPFG
Sbjct  409  FFLPPISEDPKLWKNPEKFDPDRFLLGGEDADITGVTGVKMMPFG  453



>ref|XP_002270736.1| PREDICTED: cytochrome P450 77A2 [Vitis vinifera]
 emb|CBI40213.3| unnamed protein product [Vitis vinifera]
Length=515

 Score =   386 bits (991),  Expect = 6e-129, Method: Compositional matrix adjust.
 Identities = 181/225 (80%), Positives = 200/225 (89%), Gaps = 0/225 (0%)
 Frame = +1

Query  4    LDPRVDDFLPILSPFFSKQRKRVLEVRKQQIETIVPLIERRRRALENPGSDKSAATFSYL  183
            LDPR+DD+LP+LSPFFSKQRK   EVRK+QI+T+VP IERRR ALENPGSDK+AA+FSYL
Sbjct  229  LDPRLDDYLPLLSPFFSKQRKAATEVRKRQIKTVVPFIERRRAALENPGSDKTAASFSYL  288

Query  184  DTLFDLTVEGRKSSPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEI  363
            DT+FDL +EGRKSSPTN ELVTL SEFLNGGTDTT TA+EWAIAR+IENP IQSKLYEEI
Sbjct  289  DTIFDLKIEGRKSSPTNPELVTLCSEFLNGGTDTTGTAVEWAIARMIENPEIQSKLYEEI  348

Query  364  KSVVGDRKVDEKDTDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVE  543
            K+ VGDRKV EKD +KMPYLNAV KELLRKHPPT+F+LTHAVT+P KL GYDIP D  VE
Sbjct  349  KTTVGDRKVQEKDMEKMPYLNAVSKELLRKHPPTYFSLTHAVTEPAKLAGYDIPTDANVE  408

Query  544  FFLPAISDDPTLWSDPEKFDPDRFLSGGEDADITGVTAVKMMPFG  678
            FFLP IS+DP LW +PEKFDPDRF  GGEDADITGVT VKMMPFG
Sbjct  409  FFLPPISEDPKLWKNPEKFDPDRFFLGGEDADITGVTGVKMMPFG  453



>ref|XP_008231991.1| PREDICTED: cytochrome P450 77A3-like [Prunus mume]
Length=514

 Score =   384 bits (987),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 179/226 (79%), Positives = 201/226 (89%), Gaps = 0/226 (0%)
 Frame = +1

Query  1    VLDPRVDDFLPILSPFFSKQRKRVLEVRKQQIETIVPLIERRRRALENPGSDKSAATFSY  180
            VLDPR+DD+LPILSPFFSKQRKR LEVR +QIE IVP IERRRRALENPGSD  A TFSY
Sbjct  227  VLDPRIDDYLPILSPFFSKQRKRALEVRNEQIEYIVPFIERRRRALENPGSDPQATTFSY  286

Query  181  LDTLFDLTVEGRKSSPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEE  360
            LDTLFDL VEGRKS+P++AELV+L SEFLNGGTDTTATAIEW IA+LI+NP +Q KLY E
Sbjct  287  LDTLFDLKVEGRKSAPSHAELVSLCSEFLNGGTDTTATAIEWGIAQLIDNPEVQEKLYRE  346

Query  361  IKSVVGDRKVDEKDTDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGV  540
            +K+ VGDRKVDEKD DKMPYL AVVKELLRKHPPT+F+LTHAVT+PT L GYDIP    V
Sbjct  347  LKASVGDRKVDEKDVDKMPYLQAVVKELLRKHPPTYFSLTHAVTEPTTLAGYDIPTGVNV  406

Query  541  EFFLPAISDDPTLWSDPEKFDPDRFLSGGEDADITGVTAVKMMPFG  678
            E +LPAIS+DP LWSDP+KF+PDRF+SGGE+ADITGVT +KMMPFG
Sbjct  407  ELYLPAISEDPKLWSDPKKFNPDRFVSGGEEADITGVTGIKMMPFG  452



>ref|XP_009603326.1| PREDICTED: cytochrome P450 77A2 [Nicotiana tomentosiformis]
Length=513

 Score =   382 bits (982),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 182/227 (80%), Positives = 202/227 (89%), Gaps = 1/227 (0%)
 Frame = +1

Query  1    VLDPRVDDFLPILSPFFSKQRKRVLEVRKQQIETIVPLIERRRRALENPGSDKSAATFSY  180
            VLDPR+DD+LPILSPFFSKQRKR ++VRKQQIETIVP IE+RR+ L NP SDK+AA+FSY
Sbjct  225  VLDPRLDDYLPILSPFFSKQRKRAMDVRKQQIETIVPFIEKRRKILSNPDSDKTAASFSY  284

Query  181  LDTLFDLTVEGRKSSPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEE  360
            LDTLFDL VEGR S+PTN ELVTL SEFLNGGTDTTATAIEWAIAR+IENP IQS+LYEE
Sbjct  285  LDTLFDLKVEGRNSAPTNPELVTLCSEFLNGGTDTTATAIEWAIARIIENPSIQSRLYEE  344

Query  361  IKSVVGD-RKVDEKDTDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCG  537
            IK+ VGD +KVDEKD +KMPYLNAVVKELLRKHPPT+F+LTHAV +P KLGGYDIP D  
Sbjct  345  IKNTVGDNKKVDEKDIEKMPYLNAVVKELLRKHPPTYFSLTHAVIEPAKLGGYDIPTDAN  404

Query  538  VEFFLPAISDDPTLWSDPEKFDPDRFLSGGEDADITGVTAVKMMPFG  678
            VE FLP ISDDP LWS+PEKFDPDRF  G E+ADITGVT VKM+PFG
Sbjct  405  VEIFLPGISDDPKLWSEPEKFDPDRFFLGKEEADITGVTGVKMIPFG  451



>ref|XP_011101640.1| PREDICTED: cytochrome P450 77A2-like [Sesamum indicum]
Length=531

 Score =   382 bits (981),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 174/226 (77%), Positives = 205/226 (91%), Gaps = 0/226 (0%)
 Frame = +1

Query  1    VLDPRVDDFLPILSPFFSKQRKRVLEVRKQQIETIVPLIERRRRALENPGSDKSAATFSY  180
            VLDPR+DD+LP+LSPFFSKQRKRV EVRK+QIET+VPLIE+RR A++NPGSDK+AA+FSY
Sbjct  244  VLDPRLDDYLPLLSPFFSKQRKRVQEVRKEQIETLVPLIEKRRNAIQNPGSDKTAASFSY  303

Query  181  LDTLFDLTVEGRKSSPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEE  360
            LDTLFDL +EGRKS+P+N E+VTL SEFLNGGTDTTATAIEWA+AR+IENP IQ++LY+E
Sbjct  304  LDTLFDLKIEGRKSAPSNPEIVTLCSEFLNGGTDTTATAIEWAVARMIENPEIQTRLYDE  363

Query  361  IKSVVGDRKVDEKDTDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGV  540
            I+S VG+++VDEKD +KMPYLNAVVKELLRKHPPT+F+LTHAVT+P KL GYDIP    V
Sbjct  364  IRSTVGEKRVDEKDVEKMPYLNAVVKELLRKHPPTYFSLTHAVTEPAKLAGYDIPTGTNV  423

Query  541  EFFLPAISDDPTLWSDPEKFDPDRFLSGGEDADITGVTAVKMMPFG  678
            EFFLP ISDDP +W++PEKFDPDRF +  EDADITGV  VKMMPFG
Sbjct  424  EFFLPGISDDPNIWTNPEKFDPDRFFADREDADITGVKGVKMMPFG  469



>ref|XP_007219021.1| hypothetical protein PRUPE_ppa004373mg [Prunus persica]
 gb|EMJ20220.1| hypothetical protein PRUPE_ppa004373mg [Prunus persica]
Length=514

 Score =   380 bits (977),  Expect = 9e-127, Method: Compositional matrix adjust.
 Identities = 177/226 (78%), Positives = 201/226 (89%), Gaps = 0/226 (0%)
 Frame = +1

Query  1    VLDPRVDDFLPILSPFFSKQRKRVLEVRKQQIETIVPLIERRRRALENPGSDKSAATFSY  180
            VLDPR+DD+LPILSPFFSKQRKR LEVR +QI+ IVP IERRRRALENPGSD  A TFSY
Sbjct  227  VLDPRIDDYLPILSPFFSKQRKRALEVRNEQIDYIVPFIERRRRALENPGSDPQATTFSY  286

Query  181  LDTLFDLTVEGRKSSPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEE  360
            LDTLFDL V+GRKS+P++AELV+L SEFLNGGTDTTATAIEW IA+LI+NP +Q KLY E
Sbjct  287  LDTLFDLKVDGRKSAPSHAELVSLCSEFLNGGTDTTATAIEWGIAQLIDNPEVQEKLYRE  346

Query  361  IKSVVGDRKVDEKDTDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGV  540
            +K+ VGDRKVDEKD DKMPYL AVVKELLRKHPPT+F+LTHAVT+PT L GYDIP    V
Sbjct  347  VKASVGDRKVDEKDVDKMPYLQAVVKELLRKHPPTYFSLTHAVTEPTTLAGYDIPTGVNV  406

Query  541  EFFLPAISDDPTLWSDPEKFDPDRFLSGGEDADITGVTAVKMMPFG  678
            E +LPAIS+DP LWSDP+KF+PDRF+SGGE+ADITGVT +KMMPFG
Sbjct  407  ELYLPAISEDPKLWSDPKKFNPDRFVSGGEEADITGVTGIKMMPFG  452



>gb|AJD25187.1| cytochrome P450 CYP77A27 [Salvia miltiorrhiza]
Length=512

 Score =   380 bits (976),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 175/226 (77%), Positives = 205/226 (91%), Gaps = 0/226 (0%)
 Frame = +1

Query  1    VLDPRVDDFLPILSPFFSKQRKRVLEVRKQQIETIVPLIERRRRALENPGSDKSAATFSY  180
            VLDPR+DD+LPILSPFFSKQRKRV EVR +QI+T+VPLIE+RRRA+++PGSD +AA+FSY
Sbjct  225  VLDPRLDDYLPILSPFFSKQRKRVWEVRNEQIQTLVPLIEKRRRAIQSPGSDPTAASFSY  284

Query  181  LDTLFDLTVEGRKSSPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEE  360
            LDTLFDL VEGRKS+P++AE+VTL SEFLNGGTDTTATAIEWA+ R+IENPGIQ+++ +E
Sbjct  285  LDTLFDLKVEGRKSAPSDAEIVTLCSEFLNGGTDTTATAIEWAVGRMIENPGIQTRIRDE  344

Query  361  IKSVVGDRKVDEKDTDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGV  540
            I++ VGDRKVDEKD +KMPYLNAVVKELLRKHPPT+F+LTHAVT+P KL GYDIP D  V
Sbjct  345  IRATVGDRKVDEKDVEKMPYLNAVVKELLRKHPPTYFSLTHAVTEPAKLAGYDIPTDANV  404

Query  541  EFFLPAISDDPTLWSDPEKFDPDRFLSGGEDADITGVTAVKMMPFG  678
            E FLP ISDDP LWSDPEKFDPDRF  G E+ADITGV+ VKM+PFG
Sbjct  405  EIFLPGISDDPKLWSDPEKFDPDRFFLGREEADITGVSGVKMIPFG  450



>ref|XP_009609997.1| PREDICTED: cytochrome P450 77A1-like [Nicotiana tomentosiformis]
Length=501

 Score =   379 bits (973),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 181/226 (80%), Positives = 200/226 (88%), Gaps = 1/226 (0%)
 Frame = +1

Query  4    LDPRVDDFLPILSPFFS-KQRKRVLEVRKQQIETIVPLIERRRRALENPGSDKSAATFSY  180
            L PR+DD+LPILS F   KQRK+V EVRKQQIET+VPLIE+RRRA++NPGSDK+AA+FSY
Sbjct  214  LLPRIDDYLPILSLFVGYKQRKKVQEVRKQQIETLVPLIEKRRRAVQNPGSDKTAASFSY  273

Query  181  LDTLFDLTVEGRKSSPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEE  360
            LDTLF++ VEGRKS PTN ELVTL SEFLNGGTDTTATA+EWAI RLIENP IQ ++YEE
Sbjct  274  LDTLFEVKVEGRKSGPTNPELVTLCSEFLNGGTDTTATALEWAIGRLIENPSIQKRMYEE  333

Query  361  IKSVVGDRKVDEKDTDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGV  540
            I+S VGDRKVDEKD +KMPYLNAVVKELLRKHPPT+F LTHAVT+P KLGGYDIP D  V
Sbjct  334  IRSTVGDRKVDEKDMEKMPYLNAVVKELLRKHPPTYFVLTHAVTEPVKLGGYDIPTDANV  393

Query  541  EFFLPAISDDPTLWSDPEKFDPDRFLSGGEDADITGVTAVKMMPFG  678
            EFF  AIS DP +WSDPEKFDPDRFLSG EDADITGVT VKMMPFG
Sbjct  394  EFFSHAISHDPKIWSDPEKFDPDRFLSGREDADITGVTKVKMMPFG  439



>emb|CDO99869.1| unnamed protein product [Coffea canephora]
Length=513

 Score =   379 bits (972),  Expect = 5e-126, Method: Compositional matrix adjust.
 Identities = 176/226 (78%), Positives = 203/226 (90%), Gaps = 0/226 (0%)
 Frame = +1

Query  1    VLDPRVDDFLPILSPFFSKQRKRVLEVRKQQIETIVPLIERRRRALENPGSDKSAATFSY  180
            VLDPR+DD+LP+LSPFFSKQRKRV EVR++QIE +VP IE+RR A++NPGSDK+AA+FSY
Sbjct  226  VLDPRLDDYLPLLSPFFSKQRKRVQEVRREQIELLVPFIEKRRNAIKNPGSDKTAASFSY  285

Query  181  LDTLFDLTVEGRKSSPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEE  360
            LDTLFDL +EGRKS+P+N ELVTL SEFLNGGTDTT TAIEWAIAR+IENP IQ+KLY+E
Sbjct  286  LDTLFDLKIEGRKSAPSNPELVTLCSEFLNGGTDTTGTAIEWAIARMIENPDIQTKLYKE  345

Query  361  IKSVVGDRKVDEKDTDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGV  540
            IK VVGDRKV+EKD ++MPYLNAV KELLRKHPPT+F+LTHAV +P KLGGYDIP D  V
Sbjct  346  IKGVVGDRKVEEKDMERMPYLNAVGKELLRKHPPTYFSLTHAVIEPAKLGGYDIPTDTNV  405

Query  541  EFFLPAISDDPTLWSDPEKFDPDRFLSGGEDADITGVTAVKMMPFG  678
            E FLP I++DP LWSDP KFDPDRFLSG +DADITGVT VKM+PFG
Sbjct  406  EIFLPTIAEDPKLWSDPAKFDPDRFLSGRDDADITGVTGVKMVPFG  451



>gb|EYU38068.1| hypothetical protein MIMGU_mgv1a004860mg [Erythranthe guttata]
Length=507

 Score =   377 bits (967),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 175/226 (77%), Positives = 202/226 (89%), Gaps = 0/226 (0%)
 Frame = +1

Query  1    VLDPRVDDFLPILSPFFSKQRKRVLEVRKQQIETIVPLIERRRRALENPGSDKSAATFSY  180
            VLDPR+DD+LPILSP FSKQ KRV +VR QQIET+VPLIERRR A++NPGSDKSAA+FSY
Sbjct  220  VLDPRLDDYLPILSPLFSKQWKRVQQVRNQQIETLVPLIERRRSAVQNPGSDKSAASFSY  279

Query  181  LDTLFDLTVEGRKSSPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEE  360
            LDTLFDL +EGRKSSP+NAE+VTL SEFLNGGTDTTATAIEWA AR+IENP IQ++L++E
Sbjct  280  LDTLFDLKIEGRKSSPSNAEIVTLCSEFLNGGTDTTATAIEWAAARMIENPEIQARLHDE  339

Query  361  IKSVVGDRKVDEKDTDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGV  540
            I++ VGD++VDEKD +K+PYLNAVVKELLR+HPPT+F+LTHAVT+P KL GYDIP    V
Sbjct  340  IRTAVGDKRVDEKDVEKLPYLNAVVKELLRRHPPTYFSLTHAVTEPAKLAGYDIPTGANV  399

Query  541  EFFLPAISDDPTLWSDPEKFDPDRFLSGGEDADITGVTAVKMMPFG  678
            EFFLP ISDDP LW+DPEKFDPDRF  G EDADITGV  VKM+PFG
Sbjct  400  EFFLPGISDDPKLWTDPEKFDPDRFFLGREDADITGVREVKMIPFG  445



>ref|XP_010312564.1| PREDICTED: cytochrome P450 77A1 [Solanum lycopersicum]
Length=503

 Score =   376 bits (966),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 178/227 (78%), Positives = 200/227 (88%), Gaps = 1/227 (0%)
 Frame = +1

Query  1    VLDPRVDDFLPILSPFFS-KQRKRVLEVRKQQIETIVPLIERRRRALENPGSDKSAATFS  177
            VLDPR+DDFLPIL  F   KQRKRV +VRK+QIET+VPLIE+RRR L+NPGSDK+A +FS
Sbjct  215  VLDPRIDDFLPILRLFVGYKQRKRVNDVRKRQIETLVPLIEKRRRVLQNPGSDKTATSFS  274

Query  178  YLDTLFDLTVEGRKSSPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYE  357
            YLDTLFD+ +EGRKS PTNAELVTL SEFLNGGTDTTATA+EWAI RLIENP IQ K+Y+
Sbjct  275  YLDTLFDVKIEGRKSGPTNAELVTLCSEFLNGGTDTTATALEWAIGRLIENPSIQEKIYK  334

Query  358  EIKSVVGDRKVDEKDTDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCG  537
            EIK+VVGD+KVDE D +KMPYLNAV+KELLRKHPPT+F LTH VT+P KLGGYDIPMD  
Sbjct  335  EIKTVVGDKKVDENDIEKMPYLNAVIKELLRKHPPTYFTLTHTVTEPVKLGGYDIPMDTN  394

Query  538  VEFFLPAISDDPTLWSDPEKFDPDRFLSGGEDADITGVTAVKMMPFG  678
            VEFF+  IS DP +WSDP+KFDPDRFLSG EDADITGV AVKMMPFG
Sbjct  395  VEFFVHGISHDPNIWSDPDKFDPDRFLSGREDADITGVKAVKMMPFG  441



>ref|XP_009760347.1| PREDICTED: cytochrome P450 77A2 [Nicotiana sylvestris]
Length=513

 Score =   376 bits (966),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 177/227 (78%), Positives = 201/227 (89%), Gaps = 1/227 (0%)
 Frame = +1

Query  1    VLDPRVDDFLPILSPFFSKQRKRVLEVRKQQIETIVPLIERRRRALENPGSDKSAATFSY  180
            VLDPR+DD+LPILSPFFSKQRKR ++VRKQQIETIVP IE+RR+ L NP SD++AA+FSY
Sbjct  225  VLDPRLDDYLPILSPFFSKQRKRAMDVRKQQIETIVPFIEKRRKILSNPESDETAASFSY  284

Query  181  LDTLFDLTVEGRKSSPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEE  360
            LDTLFD+ VEGR S+PTN ELVTL SEFLNGGTDTTATAIEWAIAR+IENP IQS+LYEE
Sbjct  285  LDTLFDVKVEGRNSAPTNPELVTLCSEFLNGGTDTTATAIEWAIARIIENPSIQSRLYEE  344

Query  361  IKSVVGD-RKVDEKDTDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCG  537
            IK+ V D +KVDEKD +KMPYLNAV+KELLRKHPPT+F+LTHAV +P KLGGYDIP D  
Sbjct  345  IKNTVEDNKKVDEKDIEKMPYLNAVIKELLRKHPPTYFSLTHAVIEPAKLGGYDIPTDAN  404

Query  538  VEFFLPAISDDPTLWSDPEKFDPDRFLSGGEDADITGVTAVKMMPFG  678
            VE FLP ISDDP LWS+PEKFDPDRF  G E+ADITGV+ VKM+PFG
Sbjct  405  VEIFLPGISDDPKLWSEPEKFDPDRFFLGKEEADITGVSGVKMIPFG  451



>ref|XP_004307039.1| PREDICTED: cytochrome P450 77A3-like [Fragaria vesca subsp. vesca]
Length=534

 Score =   377 bits (968),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 174/226 (77%), Positives = 199/226 (88%), Gaps = 0/226 (0%)
 Frame = +1

Query  1    VLDPRVDDFLPILSPFFSKQRKRVLEVRKQQIETIVPLIERRRRALENPGSDKSAATFSY  180
            VLDPR+DD+LP+LSPFFSKQRKR LEVRK+Q++ IVP IERRRRA++NPGSD+ A +FSY
Sbjct  247  VLDPRIDDYLPVLSPFFSKQRKRALEVRKEQVDYIVPFIERRRRAIQNPGSDREATSFSY  306

Query  181  LDTLFDLTVEGRKSSPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEE  360
            LDTLFDL VEGRKSSP+N ELVTL SEF+NGGTDTTATA+EW IA+LI NP IQ KLY E
Sbjct  307  LDTLFDLKVEGRKSSPSNEELVTLCSEFINGGTDTTATALEWGIAQLIVNPQIQEKLYAE  366

Query  361  IKSVVGDRKVDEKDTDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGV  540
            +K+ VGDRKVDEKD +KMPYL AVVKELLRKHPPT+F+LTHAVT+PT L GYDIP +  V
Sbjct  367  VKATVGDRKVDEKDVEKMPYLQAVVKELLRKHPPTYFSLTHAVTEPTTLAGYDIPTNANV  426

Query  541  EFFLPAISDDPTLWSDPEKFDPDRFLSGGEDADITGVTAVKMMPFG  678
            E +LP IS+D  LWSDPEKFDPDRF+SG EDADITGVT V+MMPFG
Sbjct  427  EIYLPGISEDHKLWSDPEKFDPDRFISGREDADITGVTGVRMMPFG  472



>ref|XP_006360482.1| PREDICTED: cytochrome P450 77A1-like [Solanum tuberosum]
Length=511

 Score =   376 bits (966),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 180/227 (79%), Positives = 201/227 (89%), Gaps = 1/227 (0%)
 Frame = +1

Query  1    VLDPRVDDFLPILSPFFS-KQRKRVLEVRKQQIETIVPLIERRRRALENPGSDKSAATFS  177
            VLDPR+DDFLPIL  F   KQR+RV +VRK+QIET+VPLIE+RR  ++NPGSDK+AA+FS
Sbjct  223  VLDPRIDDFLPILRLFVGYKQRQRVNDVRKRQIETLVPLIEKRRSVVQNPGSDKTAASFS  282

Query  178  YLDTLFDLTVEGRKSSPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYE  357
            YLDTLFD+ +EGRKS PTN ELVTL SEFLNGGTDTTATA+EWAI RLIENP IQ K+YE
Sbjct  283  YLDTLFDVKIEGRKSGPTNPELVTLCSEFLNGGTDTTATALEWAIGRLIENPSIQEKMYE  342

Query  358  EIKSVVGDRKVDEKDTDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCG  537
            EIK+VVGD+KVDE DT+KMPYLNAVVKELLRKHPPT+F LTHAVT+P KLGGYDIPMD  
Sbjct  343  EIKTVVGDKKVDENDTEKMPYLNAVVKELLRKHPPTYFTLTHAVTEPVKLGGYDIPMDTN  402

Query  538  VEFFLPAISDDPTLWSDPEKFDPDRFLSGGEDADITGVTAVKMMPFG  678
            VEFF+  IS DP +WSDPEKFDPDRFLSG EDADITGV AVKMMPFG
Sbjct  403  VEFFVYGISHDPNIWSDPEKFDPDRFLSGREDADITGVKAVKMMPFG  449



>ref|XP_009336991.1| PREDICTED: cytochrome P450 77A3-like [Pyrus x bretschneideri]
Length=514

 Score =   375 bits (963),  Expect = 9e-125, Method: Compositional matrix adjust.
 Identities = 175/226 (77%), Positives = 198/226 (88%), Gaps = 0/226 (0%)
 Frame = +1

Query  1    VLDPRVDDFLPILSPFFSKQRKRVLEVRKQQIETIVPLIERRRRALENPGSDKSAATFSY  180
            VLDPR+DD+LPILSPFFSKQR R LEVR +QI+ IVP IERRRRALENPGSD  A +FSY
Sbjct  227  VLDPRIDDYLPILSPFFSKQRNRALEVRNKQIQYIVPFIERRRRALENPGSDLKATSFSY  286

Query  181  LDTLFDLTVEGRKSSPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEE  360
            LDTLFDL VEGRKSSP++AELVTL SEFLNGGTDTTATA+EW IA+LI NP +Q KLY+E
Sbjct  287  LDTLFDLKVEGRKSSPSHAELVTLCSEFLNGGTDTTATALEWGIAQLITNPNVQEKLYQE  346

Query  361  IKSVVGDRKVDEKDTDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGV  540
            +K+ VGDRKVDEKD +KMPYL AVVKELLRKHPPT+F+LTHAVT+PT L GYDIP D  V
Sbjct  347  VKATVGDRKVDEKDVEKMPYLQAVVKELLRKHPPTYFSLTHAVTEPTTLAGYDIPTDVNV  406

Query  541  EFFLPAISDDPTLWSDPEKFDPDRFLSGGEDADITGVTAVKMMPFG  678
            E +LP IS+D  +WS+PEKFDPDRF+SG E+ADITGVT VKMMPFG
Sbjct  407  EIYLPGISEDSKIWSNPEKFDPDRFVSGREEADITGVTGVKMMPFG  452



>gb|AGZ83070.1| CYP77A20 [Solanum tuberosum]
Length=503

 Score =   375 bits (962),  Expect = 9e-125, Method: Compositional matrix adjust.
 Identities = 179/227 (79%), Positives = 200/227 (88%), Gaps = 1/227 (0%)
 Frame = +1

Query  1    VLDPRVDDFLPILSPFFS-KQRKRVLEVRKQQIETIVPLIERRRRALENPGSDKSAATFS  177
            VLDPR+DDFLPIL  F   KQR+RV +VRK+QIET+VPLIE+RR  ++NPGSDK+AA+FS
Sbjct  215  VLDPRIDDFLPILRLFVGYKQRQRVNDVRKRQIETLVPLIEKRRSVVQNPGSDKTAASFS  274

Query  178  YLDTLFDLTVEGRKSSPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYE  357
            YLDTLFD+ +EGRKS PTN ELVTL SEFLNGGTDTTATA+EWAI RLIENP IQ K+YE
Sbjct  275  YLDTLFDVKIEGRKSGPTNPELVTLCSEFLNGGTDTTATALEWAIGRLIENPSIQEKMYE  334

Query  358  EIKSVVGDRKVDEKDTDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCG  537
            EIK+VVGD+KVDE DT+KMPYLNAVVKELLRKHPPT+F LTHAVT+P KLGGYDIPMD  
Sbjct  335  EIKTVVGDKKVDENDTEKMPYLNAVVKELLRKHPPTYFTLTHAVTEPVKLGGYDIPMDTN  394

Query  538  VEFFLPAISDDPTLWSDPEKFDPDRFLSGGEDADITGVTAVKMMPFG  678
            VEFF+  IS DP +WSDPEKFDPDRFLSG EDADI GV AVKMMPFG
Sbjct  395  VEFFVYGISHDPNIWSDPEKFDPDRFLSGREDADIMGVKAVKMMPFG  441



>ref|XP_004239717.1| PREDICTED: cytochrome P450 77A2 [Solanum lycopersicum]
Length=511

 Score =   374 bits (961),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 171/225 (76%), Positives = 199/225 (88%), Gaps = 0/225 (0%)
 Frame = +1

Query  4    LDPRVDDFLPILSPFFSKQRKRVLEVRKQQIETIVPLIERRRRALENPGSDKSAATFSYL  183
            LDPR+DD+LPILSPFFSKQRKR ++VRKQQIETIVP IE+R++ LE+P  D++AA+FSYL
Sbjct  226  LDPRLDDYLPILSPFFSKQRKRAMDVRKQQIETIVPFIEKRKKILESPEIDETAASFSYL  285

Query  184  DTLFDLTVEGRKSSPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEI  363
            DTLFDL +EGR S PTN ELVTL SEFLNGGTDTTATAIEWAI R+IENP IQS+LYEEI
Sbjct  286  DTLFDLKIEGRNSVPTNTELVTLCSEFLNGGTDTTATAIEWAIGRMIENPSIQSRLYEEI  345

Query  364  KSVVGDRKVDEKDTDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVE  543
            K+ VG+ K+DEKD +KMPYLNAV+KELLRKHPPT+ +LTHAVT+P KLGGYDIP D  VE
Sbjct  346  KNTVGENKIDEKDIEKMPYLNAVIKELLRKHPPTYMSLTHAVTEPAKLGGYDIPTDVNVE  405

Query  544  FFLPAISDDPTLWSDPEKFDPDRFLSGGEDADITGVTAVKMMPFG  678
             FLP ISDDP LWS+PEKFDPDRF +G E+AD+TGV+ VKM+PFG
Sbjct  406  IFLPGISDDPNLWSEPEKFDPDRFFTGKEEADMTGVSGVKMIPFG  450



>ref|XP_008347045.1| PREDICTED: LOW QUALITY PROTEIN: cytochrome P450 77A3-like [Malus 
domestica]
Length=514

 Score =   374 bits (960),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 174/226 (77%), Positives = 197/226 (87%), Gaps = 0/226 (0%)
 Frame = +1

Query  1    VLDPRVDDFLPILSPFFSKQRKRVLEVRKQQIETIVPLIERRRRALENPGSDKSAATFSY  180
            VLDPR+DD+LPILSPFFSKQR R LEVR +QI+ IVP IERRRRALENPGSD  A +FSY
Sbjct  227  VLDPRIDDYLPILSPFFSKQRNRALEVRNKQIQYIVPFIERRRRALENPGSDLKATSFSY  286

Query  181  LDTLFDLTVEGRKSSPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEE  360
            LDTLFDL VEGRKSSP++AELVTL SEFLNGGTDTTATA+EW IA+LI NP +Q KLY+E
Sbjct  287  LDTLFDLKVEGRKSSPSHAELVTLCSEFLNGGTDTTATALEWGIAQLITNPNVQEKLYQE  346

Query  361  IKSVVGDRKVDEKDTDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGV  540
            +K+ VGDRKVDEKD +KMPYL AVVKELLRKHPPT+F+LTHAVT+PT L GYDIP D  V
Sbjct  347  VKASVGDRKVDEKDVEKMPYLQAVVKELLRKHPPTYFSLTHAVTEPTTLAGYDIPTDVNV  406

Query  541  EFFLPAISDDPTLWSDPEKFDPDRFLSGGEDADITGVTAVKMMPFG  678
            E +LP IS+D  +WS+ EKFDPDRF+SG E+ADITGVT VKMMPFG
Sbjct  407  EIYLPGISEDSKIWSNAEKFDPDRFVSGREEADITGVTGVKMMPFG  452



>ref|XP_008345522.1| PREDICTED: cytochrome P450 77A3-like [Malus domestica]
Length=514

 Score =   374 bits (959),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 177/226 (78%), Positives = 197/226 (87%), Gaps = 0/226 (0%)
 Frame = +1

Query  1    VLDPRVDDFLPILSPFFSKQRKRVLEVRKQQIETIVPLIERRRRALENPGSDKSAATFSY  180
            VLDPR+DD+LPILSPFFSKQRKR LEVR +QI+ IVP IERRRRAL+NPGSD  A +FSY
Sbjct  227  VLDPRMDDYLPILSPFFSKQRKRALEVRNKQIQFIVPFIERRRRALKNPGSDVKATSFSY  286

Query  181  LDTLFDLTVEGRKSSPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEE  360
            LDTLFDL VEG+KSSP++AELVTL SEFLNGGTDTTATA+EW IA+LI NP IQ KLY E
Sbjct  287  LDTLFDLKVEGQKSSPSHAELVTLCSEFLNGGTDTTATALEWGIAQLIANPDIQEKLYSE  346

Query  361  IKSVVGDRKVDEKDTDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGV  540
            IK+ VGDRKVDEKD +KMPYL AVVKELLRKHPPT+F+LTHAVT+PT L GYDIP D  V
Sbjct  347  IKASVGDRKVDEKDVEKMPYLQAVVKELLRKHPPTYFSLTHAVTEPTTLAGYDIPTDVNV  406

Query  541  EFFLPAISDDPTLWSDPEKFDPDRFLSGGEDADITGVTAVKMMPFG  678
            E +LP ISDD  LWS+PEKFDPDRF SG E+ADITGVT +KMMPFG
Sbjct  407  EIYLPGISDDSKLWSNPEKFDPDRFXSGREEADITGVTGIKMMPFG  452



>gb|KHN37844.1| Cytochrome P450 77A3 [Glycine soja]
Length=437

 Score =   370 bits (951),  Expect = 6e-124, Method: Compositional matrix adjust.
 Identities = 169/225 (75%), Positives = 201/225 (89%), Gaps = 0/225 (0%)
 Frame = +1

Query  4    LDPRVDDFLPILSPFFSKQRKRVLEVRKQQIETIVPLIERRRRALENPGSDKSAATFSYL  183
            LDPR+DD+LPILSPFFSKQRK+ LEVR++Q+E +VP+IE+RRRA++NPGSD +A TFSYL
Sbjct  143  LDPRIDDYLPILSPFFSKQRKKALEVRREQVEFLVPIIEQRRRAIQNPGSDHTATTFSYL  202

Query  184  DTLFDLTVEGRKSSPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEI  363
            DTLFDL VEG+KS+P++AELV+L SEFLNGGTDTTATA+EW IA+LI NP +Q KLYEEI
Sbjct  203  DTLFDLKVEGKKSAPSDAELVSLCSEFLNGGTDTTATAVEWGIAQLIANPHVQKKLYEEI  262

Query  364  KSVVGDRKVDEKDTDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVE  543
            K  VG++KVDEKD +KMPYL+AVVKELLRKHPPT F LTHAVT+PT LGGYDIP+D  VE
Sbjct  263  KRTVGEKKVDEKDVEKMPYLHAVVKELLRKHPPTHFVLTHAVTEPTTLGGYDIPIDASVE  322

Query  544  FFLPAISDDPTLWSDPEKFDPDRFLSGGEDADITGVTAVKMMPFG  678
             + PAI+ DP  WS+PEKFDP+RF+SGGE+ADITGVT VKMMPFG
Sbjct  323  VYTPAIAGDPKNWSNPEKFDPERFISGGEEADITGVTGVKMMPFG  367



>gb|ADJ57933.1| cytochrome P450 [Solanum torvum]
Length=511

 Score =   373 bits (957),  Expect = 7e-124, Method: Compositional matrix adjust.
 Identities = 175/226 (77%), Positives = 198/226 (88%), Gaps = 0/226 (0%)
 Frame = +1

Query  1    VLDPRVDDFLPILSPFFSKQRKRVLEVRKQQIETIVPLIERRRRALENPGSDKSAATFSY  180
            VLDPR+DD+LPILSPFFSKQRK  ++VRKQQIETIVP IE+R++ LE+P  DK+AA+FSY
Sbjct  225  VLDPRLDDYLPILSPFFSKQRKHAMDVRKQQIETIVPFIEQRKKILESPEIDKTAASFSY  284

Query  181  LDTLFDLTVEGRKSSPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEE  360
            LDTLFDL VEGR S+PTN ELVTL SEFLNGGTDTTATAIEWAI R+IENP IQS+LYEE
Sbjct  285  LDTLFDLKVEGRNSAPTNPELVTLCSEFLNGGTDTTATAIEWAIGRIIENPNIQSRLYEE  344

Query  361  IKSVVGDRKVDEKDTDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGV  540
            IK+ VG+ KVDEKD +KMPYLNAVVKELLRKHPPT+ +LTHAV +P KLGGYDIP D  V
Sbjct  345  IKNTVGENKVDEKDIEKMPYLNAVVKELLRKHPPTYMSLTHAVIEPVKLGGYDIPTDVNV  404

Query  541  EFFLPAISDDPTLWSDPEKFDPDRFLSGGEDADITGVTAVKMMPFG  678
            E FLP IS+DP LWS+PEKFDPDRF  G EDADITGV+ VKM+PFG
Sbjct  405  EIFLPGISEDPKLWSNPEKFDPDRFYLGKEDADITGVSGVKMIPFG  450



>ref|XP_010032101.1| PREDICTED: cytochrome P450 77A3-like isoform X2 [Eucalyptus grandis]
Length=446

 Score =   370 bits (951),  Expect = 8e-124, Method: Compositional matrix adjust.
 Identities = 172/225 (76%), Positives = 197/225 (88%), Gaps = 0/225 (0%)
 Frame = +1

Query  4    LDPRVDDFLPILSPFFSKQRKRVLEVRKQQIETIVPLIERRRRALENPGSDKSAATFSYL  183
            LDPR+DD+LP LS FFSK+R+R  EVR+ Q++ ++P IE+RR+ALENPGSDKSA +FSYL
Sbjct  160  LDPRIDDYLPALSMFFSKERRRAQEVRQAQLDFVIPFIEKRRKALENPGSDKSATSFSYL  219

Query  184  DTLFDLTVEGRKSSPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEI  363
            DTLFDL VEGRKS PTNAELVTL SEFLNGGTDTTATAIEW IA+LI NP +QSKLYEEI
Sbjct  220  DTLFDLKVEGRKSGPTNAELVTLCSEFLNGGTDTTATAIEWGIAQLIANPHVQSKLYEEI  279

Query  364  KSVVGDRKVDEKDTDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVE  543
            +S VGDRKVDEKD DKM YLNAVVKELLRKHPPT+F+LTHAVT+PTKL GYDIP D  VE
Sbjct  280  RSTVGDRKVDEKDVDKMVYLNAVVKELLRKHPPTYFSLTHAVTEPTKLAGYDIPTDANVE  339

Query  544  FFLPAISDDPTLWSDPEKFDPDRFLSGGEDADITGVTAVKMMPFG  678
             +LPA+ +DP LW +PEKFDPDR++SG EDADITGV  VKM+PFG
Sbjct  340  IYLPAVGEDPKLWKNPEKFDPDRYISGDEDADITGVKGVKMLPFG  384



>gb|KHN00917.1| Cytochrome P450 77A3 [Glycine soja]
Length=435

 Score =   370 bits (949),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 168/225 (75%), Positives = 202/225 (90%), Gaps = 0/225 (0%)
 Frame = +1

Query  4    LDPRVDDFLPILSPFFSKQRKRVLEVRKQQIETIVPLIERRRRALENPGSDKSAATFSYL  183
            LDPR+DD+LPILSPFFSKQRK+ LEVR++Q+E +VP+IE+RRRA++NPGSD +A TFSYL
Sbjct  143  LDPRIDDYLPILSPFFSKQRKKALEVRREQVEFLVPIIEQRRRAIQNPGSDHTATTFSYL  202

Query  184  DTLFDLTVEGRKSSPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEI  363
            DTLFDL VEG+KS+P++AELV+L SEFLNGGTDTTATA+EW IA+LI NP +Q+KLYEEI
Sbjct  203  DTLFDLKVEGKKSAPSDAELVSLCSEFLNGGTDTTATAVEWGIAQLIANPNVQTKLYEEI  262

Query  364  KSVVGDRKVDEKDTDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVE  543
            K  VG++KVDEKD +KMPYL+AVVKELLRKHPPT F LTHAVT+PT LGGYDIP+D  VE
Sbjct  263  KRTVGEKKVDEKDVEKMPYLHAVVKELLRKHPPTHFVLTHAVTEPTTLGGYDIPIDANVE  322

Query  544  FFLPAISDDPTLWSDPEKFDPDRFLSGGEDADITGVTAVKMMPFG  678
             + PAI++DP  W +PEKFDP+RF+SGGE+ADITGVT VKMMPFG
Sbjct  323  VYTPAIAEDPKNWLNPEKFDPERFISGGEEADITGVTGVKMMPFG  367



>ref|XP_009778849.1| PREDICTED: cytochrome P450 77A1-like isoform X2 [Nicotiana sylvestris]
Length=501

 Score =   372 bits (954),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 176/226 (78%), Positives = 198/226 (88%), Gaps = 1/226 (0%)
 Frame = +1

Query  4    LDPRVDDFLPILSPFFS-KQRKRVLEVRKQQIETIVPLIERRRRALENPGSDKSAATFSY  180
            L PR+DD+LPILS F   KQRKRV EVRKQQIET+VPLIE+RRRA++NPGSDK++A+FSY
Sbjct  214  LLPRIDDYLPILSLFVGYKQRKRVQEVRKQQIETLVPLIEKRRRAMQNPGSDKTSASFSY  273

Query  181  LDTLFDLTVEGRKSSPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEE  360
            LDTLFD+ +EG+KS PT+ ELVTL SEFLNGGTDTTATA+EWA+ RLIENP IQ ++YEE
Sbjct  274  LDTLFDVKIEGKKSGPTDPELVTLCSEFLNGGTDTTATALEWAVGRLIENPSIQKRMYEE  333

Query  361  IKSVVGDRKVDEKDTDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGV  540
            I + VGDRKVDEKD +KMPYLNAVVKELLRKHPPT+F LTHAVT+P KLGGYDIP D  V
Sbjct  334  IINTVGDRKVDEKDIEKMPYLNAVVKELLRKHPPTYFVLTHAVTEPVKLGGYDIPTDASV  393

Query  541  EFFLPAISDDPTLWSDPEKFDPDRFLSGGEDADITGVTAVKMMPFG  678
            EFF   IS DP +WSDPEKFDPDRFLSG EDADITGVT VKMMPFG
Sbjct  394  EFFSHGISHDPNIWSDPEKFDPDRFLSGREDADITGVTKVKMMPFG  439



>ref|XP_008375581.1| PREDICTED: cytochrome P450 77A3-like [Malus domestica]
Length=514

 Score =   372 bits (955),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 174/226 (77%), Positives = 197/226 (87%), Gaps = 0/226 (0%)
 Frame = +1

Query  1    VLDPRVDDFLPILSPFFSKQRKRVLEVRKQQIETIVPLIERRRRALENPGSDKSAATFSY  180
            VLDPR+DD+LPILSPFFSKQR R LEVR +QI+ IVP IERRRRALENPGSD  A +FSY
Sbjct  227  VLDPRIDDYLPILSPFFSKQRNRALEVRNKQIQYIVPFIERRRRALENPGSDLKATSFSY  286

Query  181  LDTLFDLTVEGRKSSPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEE  360
            LDTLFDL VEGRKSSP++AELVTL SEFLNGGTDTTATA+EW IA+LI NP +Q KLY+E
Sbjct  287  LDTLFDLKVEGRKSSPSHAELVTLCSEFLNGGTDTTATALEWGIAQLITNPNVQEKLYQE  346

Query  361  IKSVVGDRKVDEKDTDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGV  540
            +K+ VGDRKVDEKD +KMPYL AVVKELLRKHPPT+F+LTHAVT+PT L GYDIP D  V
Sbjct  347  VKASVGDRKVDEKDVEKMPYLQAVVKELLRKHPPTYFSLTHAVTEPTTLAGYDIPTDVNV  406

Query  541  EFFLPAISDDPTLWSDPEKFDPDRFLSGGEDADITGVTAVKMMPFG  678
            E +LP IS+D  +WS+ EKFDPDRF+SG E+ADITGVT VKMMPFG
Sbjct  407  EIYLPGISEDSKIWSNAEKFDPDRFVSGREEADITGVTGVKMMPFG  452



>gb|AGZ83069.1| CYP77A19 [Solanum tuberosum]
Length=511

 Score =   372 bits (955),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 171/225 (76%), Positives = 198/225 (88%), Gaps = 0/225 (0%)
 Frame = +1

Query  4    LDPRVDDFLPILSPFFSKQRKRVLEVRKQQIETIVPLIERRRRALENPGSDKSAATFSYL  183
            LDPR+DD+LPILSPFFSKQRKR ++VRKQQIETIVP IE+R++ LE+P  D++AA+FSYL
Sbjct  226  LDPRLDDYLPILSPFFSKQRKRAMDVRKQQIETIVPFIEKRKKILESPEIDETAASFSYL  285

Query  184  DTLFDLTVEGRKSSPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEI  363
            DTLFDL +EGR S+PT  ELVTL SEFLNGGTDTTATAIEWAI R+IENP IQS+LYEEI
Sbjct  286  DTLFDLKIEGRNSAPTKPELVTLCSEFLNGGTDTTATAIEWAIGRIIENPSIQSRLYEEI  345

Query  364  KSVVGDRKVDEKDTDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVE  543
            K+ VG+ KVDEKD +KMPYLNAV+KELLRKHPPT+ +LTHAVT+P KLGGYDIP D  VE
Sbjct  346  KNTVGENKVDEKDIEKMPYLNAVIKELLRKHPPTYMSLTHAVTEPAKLGGYDIPTDVNVE  405

Query  544  FFLPAISDDPTLWSDPEKFDPDRFLSGGEDADITGVTAVKMMPFG  678
             FLP ISDDP LWS+PEKFDPDRF  G EDAD+TG++ VKM+PFG
Sbjct  406  IFLPGISDDPNLWSEPEKFDPDRFFLGKEDADMTGISGVKMIPFG  450



>ref|XP_006345856.1| PREDICTED: cytochrome P450 77A2-like [Solanum tuberosum]
Length=511

 Score =   372 bits (954),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 171/225 (76%), Positives = 198/225 (88%), Gaps = 0/225 (0%)
 Frame = +1

Query  4    LDPRVDDFLPILSPFFSKQRKRVLEVRKQQIETIVPLIERRRRALENPGSDKSAATFSYL  183
            LDPR+DD+LPILSPFFSKQRKR ++VRKQQIETIVP IE+R++ LE+P  D++AA+FSYL
Sbjct  226  LDPRLDDYLPILSPFFSKQRKRAMDVRKQQIETIVPFIEKRKKILESPEIDETAASFSYL  285

Query  184  DTLFDLTVEGRKSSPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEI  363
            DTLFDL +EGR S+PT  ELVTL SEFLNGGTDTTATAIEWAI R+IENP IQS+LYEEI
Sbjct  286  DTLFDLKIEGRNSAPTKPELVTLCSEFLNGGTDTTATAIEWAIGRIIENPSIQSRLYEEI  345

Query  364  KSVVGDRKVDEKDTDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVE  543
            K+ VG+ KVDEKD +KMPYLNAV+KELLRKHPPT+ +LTHAVT+P KLGGYDIP D  VE
Sbjct  346  KNTVGENKVDEKDIEKMPYLNAVIKELLRKHPPTYMSLTHAVTEPAKLGGYDIPTDVNVE  405

Query  544  FFLPAISDDPTLWSDPEKFDPDRFLSGGEDADITGVTAVKMMPFG  678
             FLP ISDDP LWS+PEKFDPDRF  G EDAD+TG++ VKM+PFG
Sbjct  406  IFLPGISDDPNLWSEPEKFDPDRFFLGKEDADMTGISGVKMIPFG  450



>sp|P37123.1|C77A1_SOLME RecName: Full=Cytochrome P450 77A1; AltName: Full=CYPLXXVIIA1; 
AltName: Full=Cytochrome P-450EG6, partial [Solanum melongena]
 emb|CAA50647.1| P450 hydroxylase [Solanum melongena]
Length=499

 Score =   370 bits (949),  Expect = 7e-123, Method: Compositional matrix adjust.
 Identities = 176/227 (78%), Positives = 199/227 (88%), Gaps = 1/227 (0%)
 Frame = +1

Query  1    VLDPRVDDFLPILSPFFS-KQRKRVLEVRKQQIETIVPLIERRRRALENPGSDKSAATFS  177
            VLDPR+DDFLPIL  F   KQRKRV EVRK+QIET+VPLIE+RR  ++NPGSDK+AA+FS
Sbjct  211  VLDPRIDDFLPILRLFVGYKQRKRVNEVRKRQIETLVPLIEKRRSVVQNPGSDKTAASFS  270

Query  178  YLDTLFDLTVEGRKSSPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYE  357
            YLDTLFD+ VEGRKS PTNAELVTL SEFLNGGTDTTATA+EW I RL+ENP IQ++LY+
Sbjct  271  YLDTLFDVKVEGRKSGPTNAELVTLCSEFLNGGTDTTATALEWGIGRLMENPTIQNQLYQ  330

Query  358  EIKSVVGDRKVDEKDTDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCG  537
            EIK++VGD+KVDE D +KMPYLNAVVKELLRKHPPT+F LTH+VT+P KL GYDIPMD  
Sbjct  331  EIKTIVGDKKVDENDIEKMPYLNAVVKELLRKHPPTYFTLTHSVTEPVKLAGYDIPMDTN  390

Query  538  VEFFLPAISDDPTLWSDPEKFDPDRFLSGGEDADITGVTAVKMMPFG  678
            VEFF+  IS DP +WSDPEKFDPDRFLSG EDADITGV  VKMMPFG
Sbjct  391  VEFFVHGISHDPNVWSDPEKFDPDRFLSGREDADITGVKEVKMMPFG  437



>ref|XP_010032100.1| PREDICTED: cytochrome P450 77A3-like isoform X1 [Eucalyptus grandis]
 gb|KCW51494.1| hypothetical protein EUGRSUZ_J01011 [Eucalyptus grandis]
Length=506

 Score =   369 bits (947),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 172/225 (76%), Positives = 197/225 (88%), Gaps = 0/225 (0%)
 Frame = +1

Query  4    LDPRVDDFLPILSPFFSKQRKRVLEVRKQQIETIVPLIERRRRALENPGSDKSAATFSYL  183
            LDPR+DD+LP LS FFSK+R+R  EVR+ Q++ ++P IE+RR+ALENPGSDKSA +FSYL
Sbjct  220  LDPRIDDYLPALSMFFSKERRRAQEVRQAQLDFVIPFIEKRRKALENPGSDKSATSFSYL  279

Query  184  DTLFDLTVEGRKSSPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEI  363
            DTLFDL VEGRKS PTNAELVTL SEFLNGGTDTTATAIEW IA+LI NP +QSKLYEEI
Sbjct  280  DTLFDLKVEGRKSGPTNAELVTLCSEFLNGGTDTTATAIEWGIAQLIANPHVQSKLYEEI  339

Query  364  KSVVGDRKVDEKDTDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVE  543
            +S VGDRKVDEKD DKM YLNAVVKELLRKHPPT+F+LTHAVT+PTKL GYDIP D  VE
Sbjct  340  RSTVGDRKVDEKDVDKMVYLNAVVKELLRKHPPTYFSLTHAVTEPTKLAGYDIPTDANVE  399

Query  544  FFLPAISDDPTLWSDPEKFDPDRFLSGGEDADITGVTAVKMMPFG  678
             +LPA+ +DP LW +PEKFDPDR++SG EDADITGV  VKM+PFG
Sbjct  400  IYLPAVGEDPKLWKNPEKFDPDRYISGDEDADITGVKGVKMLPFG  444



>sp|O48928.1|C77A3_SOYBN RecName: Full=Cytochrome P450 77A3 [Glycine max]
 gb|AAB94593.1| CYP77A3p [Glycine max]
Length=513

 Score =   369 bits (947),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 168/225 (75%), Positives = 202/225 (90%), Gaps = 0/225 (0%)
 Frame = +1

Query  4    LDPRVDDFLPILSPFFSKQRKRVLEVRKQQIETIVPLIERRRRALENPGSDKSAATFSYL  183
            LDPR+DD+LPILSPFFSKQRK+ LEVR++Q+E +VP+IE+RRRA++NPGSD +A TFSYL
Sbjct  221  LDPRIDDYLPILSPFFSKQRKKALEVRREQVEFLVPIIEQRRRAIQNPGSDHTATTFSYL  280

Query  184  DTLFDLTVEGRKSSPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEI  363
            DTLFDL VEG+KS+P++AELV+L SEFLNGGTDTTATA+EW IA+LI NP +Q+KLYEEI
Sbjct  281  DTLFDLKVEGKKSAPSDAELVSLCSEFLNGGTDTTATAVEWGIAQLIANPNVQTKLYEEI  340

Query  364  KSVVGDRKVDEKDTDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVE  543
            K  VG++KVDEKD +KMPYL+AVVKELLRKHPPT F LTHAVT+PT LGGYDIP+D  VE
Sbjct  341  KRTVGEKKVDEKDVEKMPYLHAVVKELLRKHPPTHFVLTHAVTEPTTLGGYDIPIDANVE  400

Query  544  FFLPAISDDPTLWSDPEKFDPDRFLSGGEDADITGVTAVKMMPFG  678
             + PAI++DP  W +PEKFDP+RF+SGGE+ADITGVT VKMMPFG
Sbjct  401  VYTPAIAEDPKNWLNPEKFDPERFISGGEEADITGVTGVKMMPFG  445



>sp|P37124.1|C77A2_SOLME RecName: Full=Cytochrome P450 77A2; AltName: Full=CYPLXXVIIA2; 
AltName: Full=Cytochrome P-450EG5 [Solanum melongena]
 emb|CAA50646.1| CYP77A2 [Solanum melongena]
Length=511

 Score =   367 bits (943),  Expect = 8e-122, Method: Compositional matrix adjust.
 Identities = 172/225 (76%), Positives = 195/225 (87%), Gaps = 0/225 (0%)
 Frame = +1

Query  4    LDPRVDDFLPILSPFFSKQRKRVLEVRKQQIETIVPLIERRRRALENPGSDKSAATFSYL  183
            LDPR+DD+LPILSPFFSKQRK  ++VRKQQI+TIVP IE+R++ LE+P  DK+AA+FSYL
Sbjct  226  LDPRLDDYLPILSPFFSKQRKHAMDVRKQQIKTIVPFIEQRKKILESPEIDKTAASFSYL  285

Query  184  DTLFDLTVEGRKSSPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEI  363
            DTLFDL +EGR S+PT  ELVTL SEFLNGGTDTTATAIEWAI RLIENP IQS+LYEEI
Sbjct  286  DTLFDLKIEGRNSTPTYPELVTLCSEFLNGGTDTTATAIEWAIGRLIENPNIQSQLYEEI  345

Query  364  KSVVGDRKVDEKDTDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVE  543
            K  VG+ K+DEKD +KMPYLNAVVKELLRKHPPT+ +LTHAVT+P KLGGYDIP    VE
Sbjct  346  KKTVGENKIDEKDIEKMPYLNAVVKELLRKHPPTYMSLTHAVTEPAKLGGYDIPTGVNVE  405

Query  544  FFLPAISDDPTLWSDPEKFDPDRFLSGGEDADITGVTAVKMMPFG  678
             FLP ISDDP LWS+PEKFDPDRF  G EDADITGV+ VKM+PFG
Sbjct  406  IFLPGISDDPNLWSEPEKFDPDRFYLGKEDADITGVSGVKMIPFG  450



>ref|XP_003536307.2| PREDICTED: cytochrome P450 77A3-like [Glycine max]
Length=536

 Score =   368 bits (945),  Expect = 9e-122, Method: Compositional matrix adjust.
 Identities = 169/225 (75%), Positives = 201/225 (89%), Gaps = 0/225 (0%)
 Frame = +1

Query  4    LDPRVDDFLPILSPFFSKQRKRVLEVRKQQIETIVPLIERRRRALENPGSDKSAATFSYL  183
            LDPR+DD+LPILSPFFSKQRK+ LEVR++Q+E +VP+IE+RRRA++NPGSD +A TFSYL
Sbjct  242  LDPRIDDYLPILSPFFSKQRKKALEVRREQVEFLVPIIEQRRRAIQNPGSDHTATTFSYL  301

Query  184  DTLFDLTVEGRKSSPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEI  363
            DTLFDL VEG+KS+P++AELV+L SEFLNGGTDTTATA+EW IA+LI NP +Q KLYEEI
Sbjct  302  DTLFDLKVEGKKSAPSDAELVSLCSEFLNGGTDTTATAVEWGIAQLIANPHVQKKLYEEI  361

Query  364  KSVVGDRKVDEKDTDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVE  543
            K  VG++KVDEKD +KMPYL+AVVKELLRKHPPT F LTHAVT+PT LGGYDIP+D  VE
Sbjct  362  KRTVGEKKVDEKDVEKMPYLHAVVKELLRKHPPTHFVLTHAVTEPTTLGGYDIPIDASVE  421

Query  544  FFLPAISDDPTLWSDPEKFDPDRFLSGGEDADITGVTAVKMMPFG  678
             + PAI+ DP  WS+PEKFDP+RF+SGGE+ADITGVT VKMMPFG
Sbjct  422  VYTPAIAGDPKNWSNPEKFDPERFISGGEEADITGVTGVKMMPFG  466



>ref|XP_009778848.1| PREDICTED: cytochrome P450 77A1-like isoform X1 [Nicotiana sylvestris]
Length=502

 Score =   367 bits (942),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 176/227 (78%), Positives = 198/227 (87%), Gaps = 2/227 (1%)
 Frame = +1

Query  4    LDPRVDDFLPILSPFFS-KQRKRVLEVRKQQIETIVPLIERRRRALENPGSDKSAATFSY  180
            L PR+DD+LPILS F   KQRKRV EVRKQQIET+VPLIE+RRRA++NPGSDK++A+FSY
Sbjct  214  LLPRIDDYLPILSLFVGYKQRKRVQEVRKQQIETLVPLIEKRRRAMQNPGSDKTSASFSY  273

Query  181  LDTLFDLTVE-GRKSSPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYE  357
            LDTLFD+ +E G+KS PT+ ELVTL SEFLNGGTDTTATA+EWA+ RLIENP IQ ++YE
Sbjct  274  LDTLFDVKIEAGKKSGPTDPELVTLCSEFLNGGTDTTATALEWAVGRLIENPSIQKRMYE  333

Query  358  EIKSVVGDRKVDEKDTDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCG  537
            EI + VGDRKVDEKD +KMPYLNAVVKELLRKHPPT+F LTHAVT+P KLGGYDIP D  
Sbjct  334  EIINTVGDRKVDEKDIEKMPYLNAVVKELLRKHPPTYFVLTHAVTEPVKLGGYDIPTDAS  393

Query  538  VEFFLPAISDDPTLWSDPEKFDPDRFLSGGEDADITGVTAVKMMPFG  678
            VEFF   IS DP +WSDPEKFDPDRFLSG EDADITGVT VKMMPFG
Sbjct  394  VEFFSHGISHDPNIWSDPEKFDPDRFLSGREDADITGVTKVKMMPFG  440



>ref|XP_007143825.1| hypothetical protein PHAVU_007G104800g [Phaseolus vulgaris]
 gb|ESW15819.1| hypothetical protein PHAVU_007G104800g [Phaseolus vulgaris]
Length=506

 Score =   367 bits (942),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 167/225 (74%), Positives = 201/225 (89%), Gaps = 0/225 (0%)
 Frame = +1

Query  4    LDPRVDDFLPILSPFFSKQRKRVLEVRKQQIETIVPLIERRRRALENPGSDKSAATFSYL  183
            LDPR+DD+LPILSPFFSKQRKR L+VR++QIE + P+I++RRRA++NPGSD +A TFSYL
Sbjct  216  LDPRMDDYLPILSPFFSKQRKRALKVRREQIEFLAPIIQQRRRAIQNPGSDHTATTFSYL  275

Query  184  DTLFDLTVEGRKSSPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEI  363
            DTLFDL ++G+KS+P++AELVTL SEFLNGGTDTTATA+EW IA+LI NP +Q+KLYEEI
Sbjct  276  DTLFDLKIDGKKSAPSDAELVTLCSEFLNGGTDTTATAVEWGIAQLIANPHVQTKLYEEI  335

Query  364  KSVVGDRKVDEKDTDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVE  543
            K  VG++KVDEKD +KMPYL+AVVKELLRKHPPT F LTHAVT+PT LGGYDIP+D  VE
Sbjct  336  KRTVGEKKVDEKDVEKMPYLHAVVKELLRKHPPTHFVLTHAVTEPTTLGGYDIPIDANVE  395

Query  544  FFLPAISDDPTLWSDPEKFDPDRFLSGGEDADITGVTAVKMMPFG  678
             + PAI +DP  WS+PEKFDPDRF+SGGE+ADITGVT VKM+PFG
Sbjct  396  VYTPAIGEDPKYWSNPEKFDPDRFISGGEEADITGVTGVKMIPFG  440



>ref|XP_011032810.1| PREDICTED: cytochrome P450 77A3-like [Populus euphratica]
Length=517

 Score =   367 bits (942),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 171/226 (76%), Positives = 196/226 (87%), Gaps = 0/226 (0%)
 Frame = +1

Query  1    VLDPRVDDFLPILSPFFSKQRKRVLEVRKQQIETIVPLIERRRRALENPGSDKSAATFSY  180
            VLDPR+DDFLPILSPFFSKQRKR  EVRK Q+  +V  IE+RR A+ NPGSDKSA +FSY
Sbjct  230  VLDPRIDDFLPILSPFFSKQRKRASEVRKAQVNFMVSFIEKRRNAIRNPGSDKSAMSFSY  289

Query  181  LDTLFDLTVEGRKSSPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEE  360
            LDTLFDLTVEGRKS+P+N ELVTL SEFLNGGTDTTATA+EW IA+LI NP +Q+KLY E
Sbjct  290  LDTLFDLTVEGRKSTPSNEELVTLCSEFLNGGTDTTATAVEWGIAQLIANPEVQTKLYNE  349

Query  361  IKSVVGDRKVDEKDTDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGV  540
            IK+ VGDRKVDEKD +KM YL+AVVKELLRKHPPT+F L+HAVT+PT LGGYDIP+D  V
Sbjct  350  IKAAVGDRKVDEKDVEKMEYLHAVVKELLRKHPPTYFVLSHAVTEPTTLGGYDIPLDANV  409

Query  541  EFFLPAISDDPTLWSDPEKFDPDRFLSGGEDADITGVTAVKMMPFG  678
            EFF   I +DP +W++PEKF+PDRF+S GEDADITGVT VKMMPFG
Sbjct  410  EFFSYGIGEDPKVWNNPEKFNPDRFISDGEDADITGVTGVKMMPFG  455



>ref|XP_003556278.2| PREDICTED: cytochrome P450 77A3-like [Glycine max]
Length=622

 Score =   370 bits (949),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 168/225 (75%), Positives = 202/225 (90%), Gaps = 0/225 (0%)
 Frame = +1

Query  4    LDPRVDDFLPILSPFFSKQRKRVLEVRKQQIETIVPLIERRRRALENPGSDKSAATFSYL  183
            LDPR+DD+LPILSPFFSKQRK+ LEVR++Q+E +VP+IE+RRRA++NPGSD +A TFSYL
Sbjct  330  LDPRIDDYLPILSPFFSKQRKKALEVRREQVEFLVPIIEQRRRAIQNPGSDHTATTFSYL  389

Query  184  DTLFDLTVEGRKSSPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEI  363
            DTLFDL VEG+KS+P++AELV+L SEFLNGGTDTTATA+EW IA+LI NP +Q+KLYEEI
Sbjct  390  DTLFDLKVEGKKSAPSDAELVSLCSEFLNGGTDTTATAVEWGIAQLIANPNVQTKLYEEI  449

Query  364  KSVVGDRKVDEKDTDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVE  543
            K  VG++KVDEKD +KMPYL+AVVKELLRKHPPT F LTHAVT+PT LGGYDIP+D  VE
Sbjct  450  KRTVGEKKVDEKDVEKMPYLHAVVKELLRKHPPTHFVLTHAVTEPTTLGGYDIPIDANVE  509

Query  544  FFLPAISDDPTLWSDPEKFDPDRFLSGGEDADITGVTAVKMMPFG  678
             + PAI++DP  W +PEKFDP+RF+SGGE+ADITGVT VKMMPFG
Sbjct  510  VYTPAIAEDPKNWLNPEKFDPERFISGGEEADITGVTGVKMMPFG  554



>ref|XP_010278187.1| PREDICTED: cytochrome P450 77A2-like [Nelumbo nucifera]
Length=520

 Score =   365 bits (936),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 171/225 (76%), Positives = 196/225 (87%), Gaps = 0/225 (0%)
 Frame = +1

Query  4    LDPRVDDFLPILSPFFSKQRKRVLEVRKQQIETIVPLIERRRRALENPGSDKSAATFSYL  183
            LDPR+DDFLPILSPFFSKQRKRV+EVR++QI+T++P IE+RR  L+NPGSD +AA F+YL
Sbjct  234  LDPRLDDFLPILSPFFSKQRKRVMEVRQEQIQTVLPFIEKRRSILKNPGSDMTAAPFAYL  293

Query  184  DTLFDLTVEGRKSSPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEI  363
            DTLFDL VEGRKSSP +AELVTL SE LNGGTDTTATA+EW IARLIENP IQSKLY EI
Sbjct  294  DTLFDLEVEGRKSSPNDAELVTLCSELLNGGTDTTATALEWGIARLIENPDIQSKLYAEI  353

Query  364  KSVVGDRKVDEKDTDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVE  543
            KS VGDRKVDEKD + M YLNAVVKELLR+HPPT+ +LTHAVTQP  LGGYD+P D  VE
Sbjct  354  KSTVGDRKVDEKDIENMVYLNAVVKELLRRHPPTYLSLTHAVTQPATLGGYDVPTDANVE  413

Query  544  FFLPAISDDPTLWSDPEKFDPDRFLSGGEDADITGVTAVKMMPFG  678
             FLP IS+DP LWS+PEKF+PDRF SG E+ADITG+  +KM+PFG
Sbjct  414  IFLPPISEDPNLWSEPEKFNPDRFASGKEEADITGLKGLKMVPFG  458



>ref|XP_007010384.1| Cytochrome P450 77A3 [Theobroma cacao]
 gb|EOY19194.1| Cytochrome P450 77A3 [Theobroma cacao]
Length=516

 Score =   365 bits (936),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 170/225 (76%), Positives = 193/225 (86%), Gaps = 0/225 (0%)
 Frame = +1

Query  4    LDPRVDDFLPILSPFFSKQRKRVLEVRKQQIETIVPLIERRRRALENPGSDKSAATFSYL  183
            LDPR+DD+LPILSPFFSKQRKR L+VRK+Q+E IVP IE+RR AL NPGSDKSA +FSYL
Sbjct  230  LDPRIDDYLPILSPFFSKQRKRALQVRKEQVEYIVPFIEKRREALLNPGSDKSAMSFSYL  289

Query  184  DTLFDLTVEGRKSSPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEI  363
            DTLFDL VEGRKS+P+N+ELVTL SEFLNGGTDTTATA+EW IA+LIENP +QSKLY+EI
Sbjct  290  DTLFDLKVEGRKSAPSNSELVTLCSEFLNGGTDTTATALEWGIAQLIENPDVQSKLYDEI  349

Query  364  KSVVGDRKVDEKDTDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVE  543
            K  VGDRKVDE D DKM YL A VKELLR+HPPT+F+LTHA T+P  LGG+DIP D  +E
Sbjct  350  KWTVGDRKVDEFDVDKMKYLQATVKELLRRHPPTYFSLTHAATEPATLGGFDIPTDANLE  409

Query  544  FFLPAISDDPTLWSDPEKFDPDRFLSGGEDADITGVTAVKMMPFG  678
             FLP IS+DP +WS+PEKFDPDRF S  E ADITGV  VKMMPFG
Sbjct  410  IFLPGISEDPKIWSNPEKFDPDRFFSEKEAADITGVKGVKMMPFG  454



>gb|KEH43423.1| cytochrome P450 family 87 protein [Medicago truncatula]
Length=520

 Score =   364 bits (934),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 169/226 (75%), Positives = 199/226 (88%), Gaps = 1/226 (0%)
 Frame = +1

Query  4    LDPRVDDFLPILSPFFSKQRKRVLEVRKQQIETIVPLIERRRRALENPGSDKSAATFSYL  183
            LDPR+DDFLPILS FFSKQRKR LEVRK+Q+E +VP IE+RRRA +NPGSD++A TFSYL
Sbjct  229  LDPRIDDFLPILSVFFSKQRKRALEVRKEQVEFLVPFIEQRRRAFQNPGSDQTATTFSYL  288

Query  184  DTLFDLTV-EGRKSSPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEE  360
            DTLFD+ V EG+KS+P+N ELV+L+SEFLNGGTDTTATA+EW IA+LI+NP IQ+KLY+E
Sbjct  289  DTLFDIKVHEGKKSTPSNEELVSLISEFLNGGTDTTATAVEWGIAQLIDNPEIQAKLYQE  348

Query  361  IKSVVGDRKVDEKDTDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGV  540
            I S+VGD+KV+EKD +KMPYL AVVKELLRKHPPT F LTHAVT+PT LGGYDIP+D  V
Sbjct  349  INSIVGDKKVEEKDVEKMPYLQAVVKELLRKHPPTHFVLTHAVTEPTTLGGYDIPIDANV  408

Query  541  EFFLPAISDDPTLWSDPEKFDPDRFLSGGEDADITGVTAVKMMPFG  678
            E +   I +DP LWS+PEKFDP+RFLS GE+ADITGVT VKMMPFG
Sbjct  409  EVYTAGIGEDPKLWSNPEKFDPERFLSKGEEADITGVTGVKMMPFG  454



>ref|XP_002311965.1| CYP77A3p family protein [Populus trichocarpa]
 gb|EEE89332.1| CYP77A3p family protein [Populus trichocarpa]
Length=514

 Score =   363 bits (933),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 170/226 (75%), Positives = 194/226 (86%), Gaps = 0/226 (0%)
 Frame = +1

Query  1    VLDPRVDDFLPILSPFFSKQRKRVLEVRKQQIETIVPLIERRRRALENPGSDKSAATFSY  180
            VLDPR+DDFLPILSPFFSKQRKR  EVRK Q+  +V  IE+RR A+ NPGSDKSA +FSY
Sbjct  227  VLDPRIDDFLPILSPFFSKQRKRASEVRKAQVNFMVSFIEKRRNAIRNPGSDKSAMSFSY  286

Query  181  LDTLFDLTVEGRKSSPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEE  360
            LDTLFDLT EGRKS+P+N ELVTL SEFLNGGTDTTATA+EW IA+LI NP +Q+KLY E
Sbjct  287  LDTLFDLTFEGRKSTPSNEELVTLCSEFLNGGTDTTATAVEWGIAQLIANPEVQTKLYNE  346

Query  361  IKSVVGDRKVDEKDTDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGV  540
            IKS VGDRKVDEKD +KM YL+AVVKELLRKHPPT+F L+HAVT+PT L GYDIP+D  V
Sbjct  347  IKSTVGDRKVDEKDVEKMEYLHAVVKELLRKHPPTYFVLSHAVTEPTTLAGYDIPLDASV  406

Query  541  EFFLPAISDDPTLWSDPEKFDPDRFLSGGEDADITGVTAVKMMPFG  678
            EFF   I +DP +W++PEKF+PDRF+S GEDADITGVT VKMMPFG
Sbjct  407  EFFSYGIGEDPKVWNNPEKFNPDRFISDGEDADITGVTGVKMMPFG  452



>ref|XP_010552931.1| PREDICTED: cytochrome P450 77A4 [Tarenaya hassleriana]
Length=526

 Score =   362 bits (930),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 164/225 (73%), Positives = 201/225 (89%), Gaps = 0/225 (0%)
 Frame = +1

Query  4    LDPRVDDFLPILSPFFSKQRKRVLEVRKQQIETIVPLIERRRRALENPGSDKSAATFSYL  183
            +DPR+DD+LPIL+PFFSK+R++ L+VR++Q++ +V  IERRRRA+ENPGSDK+AA+FSYL
Sbjct  240  VDPRIDDYLPILAPFFSKERRKALQVRQEQVDFVVGFIERRRRAIENPGSDKTAASFSYL  299

Query  184  DTLFDLTVEGRKSSPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEI  363
            DTLFDL ++GRK++P+NAELVTL+SEFLNGGTDTT TAIEW IA+LI NP IQS+LY+EI
Sbjct  300  DTLFDLKIDGRKTTPSNAELVTLLSEFLNGGTDTTGTAIEWGIAQLISNPQIQSRLYDEI  359

Query  364  KSVVGDRKVDEKDTDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVE  543
            KS VGDR V+E+D +KM +L AVVKELLRKHPPT+F+LTHA T+PTKL GYDIP    VE
Sbjct  360  KSTVGDRPVEERDVEKMVFLQAVVKELLRKHPPTYFSLTHAATEPTKLAGYDIPTGVNVE  419

Query  544  FFLPAISDDPTLWSDPEKFDPDRFLSGGEDADITGVTAVKMMPFG  678
            F+LP IS+DP LWSDP+KFDPDRFLSG EDAD+TGVT V+MMPFG
Sbjct  420  FYLPGISEDPKLWSDPKKFDPDRFLSGREDADMTGVTGVRMMPFG  464



>gb|AFK33897.1| unknown [Lotus japonicus]
Length=347

 Score =   355 bits (911),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 163/225 (72%), Positives = 199/225 (88%), Gaps = 0/225 (0%)
 Frame = +1

Query  4    LDPRVDDFLPILSPFFSKQRKRVLEVRKQQIETIVPLIERRRRALENPGSDKSAATFSYL  183
            +DPR+DD+LPILSPFFSKQRKRVLEVRK+QIE +VP IE+R+RA+ENPGSD++A TFSYL
Sbjct  61   VDPRIDDYLPILSPFFSKQRKRVLEVRKEQIEFLVPYIEQRKRAIENPGSDQTATTFSYL  120

Query  184  DTLFDLTVEGRKSSPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEI  363
            DTLFD+ VEGRKS+P++ ELV+L+SEFLNGGTDTTATA+EW +A+LI NP IQ +LY EI
Sbjct  121  DTLFDMKVEGRKSTPSDGELVSLISEFLNGGTDTTATAVEWGMAQLIANPDIQKRLYNEI  180

Query  364  KSVVGDRKVDEKDTDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVE  543
            KS VGD+KVDEKD +KM YL AVVKE +R++PPTFFA T+AVT+P  L GYDIP +  VE
Sbjct  181  KSTVGDKKVDEKDVEKMLYLQAVVKEQMRRNPPTFFAPTYAVTEPITLAGYDIPTNANVE  240

Query  544  FFLPAISDDPTLWSDPEKFDPDRFLSGGEDADITGVTAVKMMPFG  678
             ++PAI +DPTLWS+PEKFDP+RF+SGGEDADITGV  V+M+PFG
Sbjct  241  VYIPAIGNDPTLWSNPEKFDPERFISGGEDADITGVKEVRMVPFG  285



>ref|XP_009778850.1| PREDICTED: cytochrome P450 77A1-like [Nicotiana sylvestris]
Length=498

 Score =   360 bits (923),  Expect = 6e-119, Method: Compositional matrix adjust.
 Identities = 179/226 (79%), Positives = 199/226 (88%), Gaps = 1/226 (0%)
 Frame = +1

Query  4    LDPRVDDFLPILSPFFS-KQRKRVLEVRKQQIETIVPLIERRRRALENPGSDKSAATFSY  180
            L PR+DDFLPILS F   KQRKRV EVRK+QIET+VPLIE+RRRA+ NPGSDK+AA+FSY
Sbjct  211  LHPRIDDFLPILSLFVGYKQRKRVREVRKRQIETLVPLIEKRRRAIRNPGSDKTAASFSY  270

Query  181  LDTLFDLTVEGRKSSPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEE  360
            LDTLFD+ +EG+KS PTN ELVTL SEFLNGGTDTTATAIEWAI R+IENP IQ+++YEE
Sbjct  271  LDTLFDVKIEGKKSGPTNPELVTLCSEFLNGGTDTTATAIEWAIGRMIENPSIQNRIYEE  330

Query  361  IKSVVGDRKVDEKDTDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGV  540
            I++ VGDRKVDEKD DKMPYLNAVVKELLRKHPPT+   THAVT+PT LGGYDIP D  V
Sbjct  331  IRNTVGDRKVDEKDMDKMPYLNAVVKELLRKHPPTYVTFTHAVTEPTTLGGYDIPTDANV  390

Query  541  EFFLPAISDDPTLWSDPEKFDPDRFLSGGEDADITGVTAVKMMPFG  678
            EFF+P IS DP +WSDPEKFDPDRFLSG EDADITGVT VKMMPFG
Sbjct  391  EFFVPGISHDPKVWSDPEKFDPDRFLSGREDADITGVTGVKMMPFG  436



>gb|KDO46108.1| hypothetical protein CISIN_1g010526mg [Citrus sinensis]
Length=508

 Score =   359 bits (922),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 169/229 (74%), Positives = 194/229 (85%), Gaps = 3/229 (1%)
 Frame = +1

Query  1    VLDPRVDDFLPILSPFFSKQRKRVLEVRKQQIETIVPLIERRRRALENPGSDKSAATFSY  180
            VLDPR+DD+LPILSPFFSKQRKR  EVRK+Q++ +VP IE RR+ L+NPGSDK+A +FSY
Sbjct  218  VLDPRIDDYLPILSPFFSKQRKRAREVRKEQVDFMVPFIELRRKMLQNPGSDKTAMSFSY  277

Query  181  LDTLFDLTVEGRKSSPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEE  360
            LDTLFDL +EGR S P+N ELVTL SEFLNGGTDTTATA+EW IA+LI NPG+Q K+Y+E
Sbjct  278  LDTLFDLKIEGRTSGPSNEELVTLCSEFLNGGTDTTATAVEWGIAQLIANPGVQEKVYDE  337

Query  361  IKSVVG---DRKVDEKDTDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMD  531
            IK  VG   DRKVDEKD +KMPYL AVVKELLRKHPPT+F+LTHAVT+ T L GYDIP D
Sbjct  338  IKRTVGDNPDRKVDEKDVEKMPYLQAVVKELLRKHPPTYFSLTHAVTEATTLAGYDIPTD  397

Query  532  CGVEFFLPAISDDPTLWSDPEKFDPDRFLSGGEDADITGVTAVKMMPFG  678
              VE FLP I DDP LW+ PE+FDP+RF+SG EDADITGVT VKMMPFG
Sbjct  398  ANVEIFLPGIGDDPKLWAHPERFDPERFVSGREDADITGVTGVKMMPFG  446



>ref|XP_006436671.1| hypothetical protein CICLE_v10031286mg [Citrus clementina]
 ref|XP_006492188.1| PREDICTED: cytochrome P450 77A3-like [Citrus sinensis]
 gb|ESR49911.1| hypothetical protein CICLE_v10031286mg [Citrus clementina]
Length=508

 Score =   359 bits (922),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 169/229 (74%), Positives = 194/229 (85%), Gaps = 3/229 (1%)
 Frame = +1

Query  1    VLDPRVDDFLPILSPFFSKQRKRVLEVRKQQIETIVPLIERRRRALENPGSDKSAATFSY  180
            VLDPR+DD+LPILSPFFSKQRKR  EVRK+Q++ +VP IE RR+ L+NPGSDK+A +FSY
Sbjct  218  VLDPRIDDYLPILSPFFSKQRKRAREVRKEQVDFMVPFIELRRKMLQNPGSDKTAMSFSY  277

Query  181  LDTLFDLTVEGRKSSPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEE  360
            LDTLFDL +EGR S P+N ELVTL SEFLNGGTDTTATA+EW IA+LI NPG+Q K+Y+E
Sbjct  278  LDTLFDLKIEGRTSGPSNEELVTLCSEFLNGGTDTTATAVEWGIAQLIANPGVQEKVYDE  337

Query  361  IKSVVG---DRKVDEKDTDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMD  531
            IK  VG   DRKVDEKD +KMPYL AVVKELLRKHPPT+F+LTHAVT+ T L GYDIP D
Sbjct  338  IKRTVGDDPDRKVDEKDVEKMPYLQAVVKELLRKHPPTYFSLTHAVTEATTLAGYDIPTD  397

Query  532  CGVEFFLPAISDDPTLWSDPEKFDPDRFLSGGEDADITGVTAVKMMPFG  678
              VE FLP I DDP LW+ PE+FDP+RF+SG EDADITGVT VKMMPFG
Sbjct  398  ANVEIFLPGIGDDPKLWAHPERFDPERFVSGREDADITGVTGVKMMPFG  446



>ref|XP_009610308.1| PREDICTED: cytochrome P450 77A1-like [Nicotiana tomentosiformis]
Length=501

 Score =   358 bits (920),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 180/226 (80%), Positives = 198/226 (88%), Gaps = 1/226 (0%)
 Frame = +1

Query  4    LDPRVDDFLPILSPFFS-KQRKRVLEVRKQQIETIVPLIERRRRALENPGSDKSAATFSY  180
            L PR+DDFLPILS F   KQRKRV EVRK+QIET+VPLIE+RRRA++NPGSDK+AA+FSY
Sbjct  211  LHPRIDDFLPILSLFVGYKQRKRVREVRKRQIETLVPLIEKRRRAIQNPGSDKTAASFSY  270

Query  181  LDTLFDLTVEGRKSSPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEE  360
            LDTLFD+ VEG KS PTN ELVTL SEFLNGGTDTTATAIEWAI R+IENP IQ ++YEE
Sbjct  271  LDTLFDVKVEGTKSGPTNPELVTLCSEFLNGGTDTTATAIEWAIGRMIENPSIQKRIYEE  330

Query  361  IKSVVGDRKVDEKDTDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGV  540
            I++ VGDRKVDEKD DKMPYLNAVVKELLRKHPPT+   THAVT+PT LGGYDIP    V
Sbjct  331  IRNTVGDRKVDEKDMDKMPYLNAVVKELLRKHPPTYVTFTHAVTEPTTLGGYDIPTYANV  390

Query  541  EFFLPAISDDPTLWSDPEKFDPDRFLSGGEDADITGVTAVKMMPFG  678
            EFF+P ISDDP +WSDPEKFDPDRFLSG EDADITGVT VKMMPFG
Sbjct  391  EFFVPGISDDPKVWSDPEKFDPDRFLSGREDADITGVTGVKMMPFG  436



>gb|AJD25188.1| cytochrome P450 CYP77A28 [Salvia miltiorrhiza]
Length=505

 Score =   356 bits (913),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 168/226 (74%), Positives = 197/226 (87%), Gaps = 2/226 (1%)
 Frame = +1

Query  1    VLDPRVDDFLPILSPFFSKQRKRVLEVRKQQIETIVPLIERRRRALENPGSDKSAATFSY  180
            VLDPR+DDFLPILSPFFSKQRKRV  VRK+QIET+VPLIE+RR+     GS  ++ +F+Y
Sbjct  220  VLDPRMDDFLPILSPFFSKQRKRVQAVRKKQIETLVPLIEKRRQEWIKHGS--ASNSFAY  277

Query  181  LDTLFDLTVEGRKSSPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEE  360
            LDTLFDL VEGRKS+PTN ELVTL SEFLNGGTDTTATA+EWA+ARLIENP IQ +L +E
Sbjct  278  LDTLFDLKVEGRKSAPTNEELVTLCSEFLNGGTDTTATAVEWAVARLIENPAIQCRLADE  337

Query  361  IKSVVGDRKVDEKDTDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGV  540
            I++ VG++KVDEKD ++MPYLNAVVKELLRKHPPT+FALTHAVT+PT+LGGYDIP    V
Sbjct  338  IRATVGEKKVDEKDVERMPYLNAVVKELLRKHPPTYFALTHAVTEPTRLGGYDIPTSASV  397

Query  541  EFFLPAISDDPTLWSDPEKFDPDRFLSGGEDADITGVTAVKMMPFG  678
            EFF   I++DP +WSDPE+FDPDRF +G E+ADITGVT VKMMPFG
Sbjct  398  EFFSAGIAEDPKVWSDPERFDPDRFFAGREEADITGVTGVKMMPFG  443



>ref|XP_010248417.1| PREDICTED: cytochrome P450 77A2-like [Nelumbo nucifera]
Length=388

 Score =   350 bits (898),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 166/225 (74%), Positives = 192/225 (85%), Gaps = 4/225 (2%)
 Frame = +1

Query  4    LDPRVDDFLPILSPFFSKQRKRVLEVRKQQIETIVPLIERRRRALENPGSDKSAATFSYL  183
            LDPR+DDFLPILSPFFSKQRKR ++VR++QI TI+P IE+RR  L+N        +F+YL
Sbjct  106  LDPRIDDFLPILSPFFSKQRKRSMQVREEQIRTILPFIEKRRSLLKN----NPETSFAYL  161

Query  184  DTLFDLTVEGRKSSPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEI  363
            DTLFDL +EGRKS PT+ ELV+L SEFLNGGTDTTATA+EW IARLIENP IQSKLY EI
Sbjct  162  DTLFDLEIEGRKSRPTDTELVSLCSEFLNGGTDTTATALEWGIARLIENPEIQSKLYTEI  221

Query  364  KSVVGDRKVDEKDTDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVE  543
            KS VGDRKVDEKD ++M YLNAVVKELLRKHPPT+FALTHAVTQP  LGGYD+P D  VE
Sbjct  222  KSKVGDRKVDEKDAEEMVYLNAVVKELLRKHPPTYFALTHAVTQPATLGGYDVPTDANVE  281

Query  544  FFLPAISDDPTLWSDPEKFDPDRFLSGGEDADITGVTAVKMMPFG  678
             FLPAI++DP++WS+PEKF+PDRF +G EDADITGV  VKM+PFG
Sbjct  282  IFLPAIAEDPSIWSEPEKFNPDRFATGKEDADITGVKGVKMLPFG  326



>ref|XP_006407539.1| hypothetical protein EUTSA_v10020529mg [Eutrema salsugineum]
 gb|ESQ48992.1| hypothetical protein EUTSA_v10020529mg [Eutrema salsugineum]
Length=513

 Score =   354 bits (909),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 158/225 (70%), Positives = 196/225 (87%), Gaps = 0/225 (0%)
 Frame = +1

Query  4    LDPRVDDFLPILSPFFSKQRKRVLEVRKQQIETIVPLIERRRRALENPGSDKSAATFSYL  183
            +DPR+DD+LPIL+PF+SKQRKR LEVR++Q++ +V  IERRRRA++NPGSDK+A++FSYL
Sbjct  227  IDPRLDDYLPILAPFYSKQRKRALEVRREQVDLVVGFIERRRRAIQNPGSDKTASSFSYL  286

Query  184  DTLFDLTVEGRKSSPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEI  363
            DTLFDL +EGRK++P+N ELVTL SEFLNGGTDTT TAIEW IA+LI NP IQ +LY+EI
Sbjct  287  DTLFDLKIEGRKTTPSNEELVTLCSEFLNGGTDTTGTAIEWGIAQLIANPEIQCRLYDEI  346

Query  364  KSVVGDRKVDEKDTDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVE  543
            KS VGDR V+EKD DKM +L A VKE+LRKHPPT+F LTH+VT+PT + GYD+P+   VE
Sbjct  347  KSTVGDRSVEEKDVDKMVHLQAFVKEILRKHPPTYFTLTHSVTEPTTVAGYDVPVGINVE  406

Query  544  FFLPAISDDPTLWSDPEKFDPDRFLSGGEDADITGVTAVKMMPFG  678
            F+LP I++DP +WS+P+KFDPDRF+SG EDADITGVT VKMM FG
Sbjct  407  FYLPGINEDPKIWSNPQKFDPDRFISGKEDADITGVTGVKMMTFG  451



>ref|XP_010464733.1| PREDICTED: cytochrome P450 77A4-like [Camelina sativa]
Length=513

 Score =   352 bits (904),  Expect = 7e-116, Method: Compositional matrix adjust.
 Identities = 158/225 (70%), Positives = 199/225 (88%), Gaps = 0/225 (0%)
 Frame = +1

Query  4    LDPRVDDFLPILSPFFSKQRKRVLEVRKQQIETIVPLIERRRRALENPGSDKSAATFSYL  183
            L+PR+DD+LP+L+PF+SK+R R LEVR++Q++ IV  IERRRRA++NPG+DK+A++FSYL
Sbjct  227  LNPRLDDYLPMLAPFYSKERARALEVRREQVDFIVKFIERRRRAIQNPGTDKTASSFSYL  286

Query  184  DTLFDLTVEGRKSSPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEI  363
            DTLFDL +EGRK++P+N ELV+L SEFLNGGTDTT TAIEW IA+LI NP IQS+LY+EI
Sbjct  287  DTLFDLKIEGRKTTPSNEELVSLCSEFLNGGTDTTGTAIEWGIAQLIVNPEIQSRLYDEI  346

Query  364  KSVVGDRKVDEKDTDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVE  543
            KS VGDRKV+EKD DKM +L AVVKE+LRKHPPT+F LTH+VT+ T + GYD+P+   VE
Sbjct  347  KSTVGDRKVEEKDVDKMVFLQAVVKEILRKHPPTYFTLTHSVTEETTVAGYDVPVGINVE  406

Query  544  FFLPAISDDPTLWSDPEKFDPDRFLSGGEDADITGVTAVKMMPFG  678
            F+LPAI++DP LWSDP+KF+PDRF+SG E+ADITGVT VKMMPFG
Sbjct  407  FYLPAINEDPKLWSDPKKFNPDRFISGKEEADITGVTGVKMMPFG  451



>ref|XP_002882683.1| CYP77A6 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH58942.1| CYP77A6 [Arabidopsis lyrata subsp. lyrata]
Length=513

 Score =   352 bits (904),  Expect = 8e-116, Method: Compositional matrix adjust.
 Identities = 158/225 (70%), Positives = 199/225 (88%), Gaps = 0/225 (0%)
 Frame = +1

Query  4    LDPRVDDFLPILSPFFSKQRKRVLEVRKQQIETIVPLIERRRRALENPGSDKSAATFSYL  183
            L+PR+DD+LPIL+PF+SK+R R LEVR++Q++ IV  IERRRRA++NPG+DK+A++FSYL
Sbjct  227  LNPRLDDYLPILAPFYSKERARALEVRREQVDFIVKFIERRRRAIQNPGTDKTASSFSYL  286

Query  184  DTLFDLTVEGRKSSPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEI  363
            DTLFDL  EGRK++P+N ELV+L SEFLNGGTDTT TAIEW IA+LI NP IQS+LY+EI
Sbjct  287  DTLFDLKTEGRKTTPSNEELVSLCSEFLNGGTDTTGTAIEWGIAQLIVNPEIQSRLYDEI  346

Query  364  KSVVGDRKVDEKDTDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVE  543
            KS VGDR+V+EKD DKM +L AVVKE+LRKHPPT+F LTH+VT+PT +GGYD+P+   VE
Sbjct  347  KSTVGDREVEEKDVDKMVFLQAVVKEILRKHPPTYFTLTHSVTEPTTVGGYDVPVGINVE  406

Query  544  FFLPAISDDPTLWSDPEKFDPDRFLSGGEDADITGVTAVKMMPFG  678
            F+LP I++DP LWSDP+KF+PDRF++G E+ADITGVT VKMMPFG
Sbjct  407  FYLPGINEDPKLWSDPKKFNPDRFIAGKEEADITGVTGVKMMPFG  451



>emb|CDY00955.1| BnaC05g42450D [Brassica napus]
Length=516

 Score =   352 bits (904),  Expect = 9e-116, Method: Compositional matrix adjust.
 Identities = 158/225 (70%), Positives = 194/225 (86%), Gaps = 0/225 (0%)
 Frame = +1

Query  4    LDPRVDDFLPILSPFFSKQRKRVLEVRKQQIETIVPLIERRRRALENPGSDKSAATFSYL  183
            +DPR+DD+LPIL+PF+SK+R+R LEVR++Q+E +V  IERRRRAL NPG+DK+A +FSYL
Sbjct  230  IDPRLDDYLPILAPFYSKERRRALEVRREQVELVVGFIERRRRALRNPGTDKTATSFSYL  289

Query  184  DTLFDLTVEGRKSSPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEI  363
            DTLFDL +EGRK++P+N ELVTL SEFLNGGTDTT TAIEW IA+LI NP IQS+LY+EI
Sbjct  290  DTLFDLKIEGRKTTPSNEELVTLCSEFLNGGTDTTGTAIEWGIAQLIANPEIQSRLYDEI  349

Query  364  KSVVGDRKVDEKDTDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVE  543
            KS VGDR V+EKD +KM +L A VKE+LRKHPPT+F LTH VT+PT + GYD+P    VE
Sbjct  350  KSTVGDRAVEEKDVEKMVFLQAFVKEILRKHPPTYFTLTHTVTEPTTVAGYDVPAGINVE  409

Query  544  FFLPAISDDPTLWSDPEKFDPDRFLSGGEDADITGVTAVKMMPFG  678
            F+LP I++DP +WS+P+KFDPDRF+SG EDADITGVT VKMMPFG
Sbjct  410  FYLPGINEDPKIWSNPKKFDPDRFVSGKEDADITGVTGVKMMPFG  454



>ref|XP_010486669.1| PREDICTED: cytochrome P450 77A4 [Camelina sativa]
Length=544

 Score =   352 bits (904),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 157/225 (70%), Positives = 199/225 (88%), Gaps = 0/225 (0%)
 Frame = +1

Query  4    LDPRVDDFLPILSPFFSKQRKRVLEVRKQQIETIVPLIERRRRALENPGSDKSAATFSYL  183
            L+PR+DD+LPIL+PF+SK+R R LEVR++Q++ IV  IERRRRA++NPG+DK+A++FSYL
Sbjct  258  LNPRLDDYLPILAPFYSKERARALEVRREQVDFIVKFIERRRRAIQNPGTDKTASSFSYL  317

Query  184  DTLFDLTVEGRKSSPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEI  363
            DTLFDL +EGRK++P+N ELV+L SEFLNGGTDTT TA+EW IA+LI NP +QS+LY+EI
Sbjct  318  DTLFDLKIEGRKTTPSNEELVSLCSEFLNGGTDTTGTALEWGIAQLIVNPEVQSRLYDEI  377

Query  364  KSVVGDRKVDEKDTDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVE  543
            KS VGDRKV+EKD DKM +L AVVKE+LRKHPPT+F LTH+VT+ T + GYD+P+   VE
Sbjct  378  KSTVGDRKVEEKDVDKMVFLQAVVKEILRKHPPTYFTLTHSVTEETTVAGYDVPVGINVE  437

Query  544  FFLPAISDDPTLWSDPEKFDPDRFLSGGEDADITGVTAVKMMPFG  678
            F+LPAI++DP LWSDP+KF+PDRF+SG E+ADITGVT VKMMPFG
Sbjct  438  FYLPAINEDPKLWSDPKKFNPDRFISGKEEADITGVTGVKMMPFG  482



>ref|XP_012089888.1| PREDICTED: cytochrome P450 77A3-like [Jatropha curcas]
 gb|KDP45018.1| hypothetical protein JCGZ_01518 [Jatropha curcas]
Length=513

 Score =   351 bits (900),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 167/226 (74%), Positives = 192/226 (85%), Gaps = 0/226 (0%)
 Frame = +1

Query  1    VLDPRVDDFLPILSPFFSKQRKRVLEVRKQQIETIVPLIERRRRALENPGSDKSAATFSY  180
            VLDPR+DDFLPILSPFFSKQRKRV +VRK+Q+E +VPLI++RR+ALENP SD  A +FSY
Sbjct  226  VLDPRIDDFLPILSPFFSKQRKRVSQVRKEQVEFMVPLIQKRRKALENPKSDPKAISFSY  285

Query  181  LDTLFDLTVEGRKSSPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEE  360
            LDTLF L +EGRKSSP++ ELVTL SEFLNGGTDTTATA+EW IA+LI+NP +Q+KLY E
Sbjct  286  LDTLFGLKIEGRKSSPSDQELVTLCSEFLNGGTDTTATAVEWGIAQLIDNPDVQNKLYNE  345

Query  361  IKSVVGDRKVDEKDTDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGV  540
            IK VVGD+KV E D +KM YL AVVKELLRKHPPTFF LTHAVT+ T LGGYDIP+D  V
Sbjct  346  IKEVVGDKKVTETDVEKMEYLQAVVKELLRKHPPTFFLLTHAVTEATTLGGYDIPIDANV  405

Query  541  EFFLPAISDDPTLWSDPEKFDPDRFLSGGEDADITGVTAVKMMPFG  678
            E F  AI +DP +WS+PEKF+PDRF SG E ADITGVT VKM PFG
Sbjct  406  EIFSTAIGEDPRIWSNPEKFNPDRFSSGKEQADITGVTGVKMTPFG  451



>ref|XP_010486076.1| PREDICTED: cytochrome P450 77A4-like [Camelina sativa]
Length=513

 Score =   351 bits (900),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 157/225 (70%), Positives = 198/225 (88%), Gaps = 0/225 (0%)
 Frame = +1

Query  4    LDPRVDDFLPILSPFFSKQRKRVLEVRKQQIETIVPLIERRRRALENPGSDKSAATFSYL  183
            L+PR+DD+LPIL+PF+SK+R R LEVR++Q++ IV  IERRRRA++NPG+DK+A++FSYL
Sbjct  227  LNPRLDDYLPILAPFYSKERARALEVRREQVDFIVKFIERRRRAIQNPGTDKTASSFSYL  286

Query  184  DTLFDLTVEGRKSSPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEI  363
            DTLFDL +EGRK++P+N ELV+L SEFLNG TDTT TAIEW IA+LI NP +QS+LY+EI
Sbjct  287  DTLFDLKIEGRKTTPSNEELVSLCSEFLNGSTDTTGTAIEWGIAQLIVNPEVQSRLYDEI  346

Query  364  KSVVGDRKVDEKDTDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVE  543
            KS VGDRKV+EKD DKM +L AVVKE+LRKHPPT+F LTH+VT+ T + GYD+P+   VE
Sbjct  347  KSTVGDRKVEEKDVDKMVFLQAVVKEILRKHPPTYFTLTHSVTEETTVAGYDVPVGINVE  406

Query  544  FFLPAISDDPTLWSDPEKFDPDRFLSGGEDADITGVTAVKMMPFG  678
            F+LPAI++DP LWSDP+KF+PDRF+SG E+ADITGVT VKMMPFG
Sbjct  407  FYLPAINEDPKLWSDPKKFNPDRFISGKEEADITGVTGVKMMPFG  451



>ref|XP_010452364.1| PREDICTED: cytochrome P450 77A4-like [Camelina sativa]
Length=513

 Score =   350 bits (899),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 160/226 (71%), Positives = 198/226 (88%), Gaps = 1/226 (0%)
 Frame = +1

Query  4    LDPRVDDFLPILSPFFSKQRKRVLEVRKQQIETIVPLIERRRRALENPGSDKSAATFSYL  183
            +DPR+DD+LPIL+PFFSK+RKR LEVR++Q++ +V +IERRRRA++NPGSDK+A++FSYL
Sbjct  226  VDPRIDDYLPILAPFFSKERKRALEVRREQVDYVVGVIERRRRAIQNPGSDKTASSFSYL  285

Query  184  DTLFDLTVEGRKSSPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEI  363
            DTLFDLT+EGR+++P+N ELVTL SEFLNGGTDTT TAIEW IA+LI NP IQS+LY+EI
Sbjct  286  DTLFDLTIEGRETTPSNEELVTLCSEFLNGGTDTTGTAIEWGIAQLIANPEIQSRLYDEI  345

Query  364  KSVVG-DRKVDEKDTDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGV  540
            KS VG DR V+EKD DKM YL A VKELLRKHPPT+F+LTHAVT+ T LGGYDIP    V
Sbjct  346  KSTVGDDRSVEEKDVDKMVYLQAFVKELLRKHPPTYFSLTHAVTETTTLGGYDIPAGVNV  405

Query  541  EFFLPAISDDPTLWSDPEKFDPDRFLSGGEDADITGVTAVKMMPFG  678
            E +LP +S+DP +WS+P+KFDPDRF+ G E+ADITG+T VKM+PFG
Sbjct  406  EVYLPGMSEDPRIWSNPKKFDPDRFMLGKENADITGITGVKMIPFG  451



>emb|CDY08591.1| BnaA05g28270D [Brassica napus]
Length=516

 Score =   350 bits (898),  Expect = 6e-115, Method: Compositional matrix adjust.
 Identities = 156/225 (69%), Positives = 194/225 (86%), Gaps = 0/225 (0%)
 Frame = +1

Query  4    LDPRVDDFLPILSPFFSKQRKRVLEVRKQQIETIVPLIERRRRALENPGSDKSAATFSYL  183
            +DPR+DD+LPIL+PF+SK+R+R LEVR++Q++ +V  +ERRRRAL NPG+DK+A +FSYL
Sbjct  230  IDPRLDDYLPILAPFYSKERRRALEVRREQVDLVVGFVERRRRALRNPGTDKTATSFSYL  289

Query  184  DTLFDLTVEGRKSSPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEI  363
            DTLFDL +EGRK++P+N ELVTL SEFLNGGTDTT TAIEW IA+LI NP IQS+LY+EI
Sbjct  290  DTLFDLKIEGRKTTPSNEELVTLCSEFLNGGTDTTGTAIEWGIAQLISNPEIQSRLYDEI  349

Query  364  KSVVGDRKVDEKDTDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVE  543
            KS VGDR V+EKD +KM +L A VKE+LRKHPPT+F LTH VT+PT + GYD+P    VE
Sbjct  350  KSTVGDRAVEEKDVEKMVFLQAFVKEILRKHPPTYFTLTHTVTEPTTVAGYDVPAGINVE  409

Query  544  FFLPAISDDPTLWSDPEKFDPDRFLSGGEDADITGVTAVKMMPFG  678
            F+LP I++DP +WS+P+KFDPDRF+SG EDADITGVT VKMMPFG
Sbjct  410  FYLPGINEDPKIWSNPKKFDPDRFVSGKEDADITGVTGVKMMPFG  454



>ref|XP_009146826.1| PREDICTED: cytochrome P450 77A4 [Brassica rapa]
Length=516

 Score =   350 bits (898),  Expect = 7e-115, Method: Compositional matrix adjust.
 Identities = 156/225 (69%), Positives = 194/225 (86%), Gaps = 0/225 (0%)
 Frame = +1

Query  4    LDPRVDDFLPILSPFFSKQRKRVLEVRKQQIETIVPLIERRRRALENPGSDKSAATFSYL  183
            +DPR+DD+LPIL+PF+SK+R+R LEVR++Q++ +V  +ERRRRAL NPG+DK+A +FSYL
Sbjct  230  IDPRLDDYLPILAPFYSKERRRALEVRREQVDLVVGFVERRRRALRNPGTDKTATSFSYL  289

Query  184  DTLFDLTVEGRKSSPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEI  363
            DTLF+L +EGRK++P+N ELVTL SEFLNGGTDTT TAIEW IA+LI NP IQS+LY+EI
Sbjct  290  DTLFELKIEGRKTTPSNEELVTLCSEFLNGGTDTTGTAIEWGIAQLIANPEIQSRLYDEI  349

Query  364  KSVVGDRKVDEKDTDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVE  543
            KS VGDR V+EKD +KM +L A VKE+LRKHPPT+F LTH VT+PT + GYD+P    VE
Sbjct  350  KSTVGDRAVEEKDVEKMVFLQAFVKEILRKHPPTYFTLTHTVTEPTTVAGYDVPAGINVE  409

Query  544  FFLPAISDDPTLWSDPEKFDPDRFLSGGEDADITGVTAVKMMPFG  678
            F+LP I++DP +WSDP+KFDPDRF+SG EDADITGVT VKMMPFG
Sbjct  410  FYLPGINEDPKIWSDPKKFDPDRFVSGKEDADITGVTGVKMMPFG  454



>gb|KJB73379.1| hypothetical protein B456_011G229800 [Gossypium raimondii]
Length=505

 Score =   350 bits (897),  Expect = 7e-115, Method: Compositional matrix adjust.
 Identities = 165/226 (73%), Positives = 189/226 (84%), Gaps = 1/226 (0%)
 Frame = +1

Query  4    LDPRVDDFLPILSPFFSKQRKRVLEVRKQQIETIVPLIERRRRALENPGSDKSAATFSYL  183
            LDPR+DD+LPILSPFFSKQRK+ L+VRK QI+ IVP IE+RR AL NPGSD+SA +FSYL
Sbjct  216  LDPRIDDYLPILSPFFSKQRKQALQVRKHQIDYIVPFIEKRREALLNPGSDRSAMSFSYL  275

Query  184  DTLFDLTVEGRKSSPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEI  363
            DTLFDL VEGRKS+P+N+ELVTL SEFLNGGTDTTATA+EW IA+LIEN  IQSKL +EI
Sbjct  276  DTLFDLKVEGRKSAPSNSELVTLCSEFLNGGTDTTATALEWGIAQLIENQDIQSKLLDEI  335

Query  364  KSVVGDRKVDEKDTDKMPYLNAVVKELLRKHPPTFFALTHAVT-QPTKLGGYDIPMDCGV  540
            KS VGDR+VDE D +K+ YL AVVKELLR+HPPT+F+LTHA T +   LGGYDIP D  +
Sbjct  336  KSTVGDRRVDETDIEKLKYLQAVVKELLRRHPPTYFSLTHAATEEAATLGGYDIPTDANL  395

Query  541  EFFLPAISDDPTLWSDPEKFDPDRFLSGGEDADITGVTAVKMMPFG  678
            E +LP I DDP +WSDPEKFDPDRF  G ED DI GV  VKMMPFG
Sbjct  396  EIYLPGIGDDPKIWSDPEKFDPDRFYLGKEDGDIMGVKGVKMMPFG  441



>ref|XP_008456581.1| PREDICTED: cytochrome P450 77A3-like [Cucumis melo]
Length=514

 Score =   350 bits (897),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 158/225 (70%), Positives = 193/225 (86%), Gaps = 0/225 (0%)
 Frame = +1

Query  4    LDPRVDDFLPILSPFFSKQRKRVLEVRKQQIETIVPLIERRRRALENPGSDKSAATFSYL  183
            +DPR+DDFLPIL PFF+KQRKR +EVR++QIE +V  I RR++AL+NPGSD +A +FSYL
Sbjct  227  VDPRIDDFLPILRPFFAKQRKRAMEVRREQIEFVVQFINRRKKALQNPGSDINATSFSYL  286

Query  184  DTLFDLTVEGRKSSPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEI  363
            DTLFDL V+GRKS+PT+AELVTL SEFLNGG DTTATAIEW IA LI NP IQ KL+EEI
Sbjct  287  DTLFDLKVDGRKSTPTDAELVTLCSEFLNGGVDTTATAIEWGIAELISNPNIQKKLHEEI  346

Query  364  KSVVGDRKVDEKDTDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVE  543
            K +VGDRKVDE D +K+PYL AVVKELLRKHPPT+F+LTH+V +PTKLGGYDIPM+  VE
Sbjct  347  KQLVGDRKVDESDVEKLPYLQAVVKELLRKHPPTYFSLTHSVIEPTKLGGYDIPMEASVE  406

Query  544  FFLPAISDDPTLWSDPEKFDPDRFLSGGEDADITGVTAVKMMPFG  678
             +L  IS+DP LW +PEKF+P+RF+SG E+ D+TG+  +KM+PFG
Sbjct  407  VYLAGISNDPKLWKNPEKFEPERFISGEEEVDMTGIKGMKMIPFG  451



>ref|XP_004496181.1| PREDICTED: cytochrome P450 77A3-like [Cicer arietinum]
Length=521

 Score =   349 bits (895),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 161/226 (71%), Positives = 197/226 (87%), Gaps = 1/226 (0%)
 Frame = +1

Query  4    LDPRVDDFLPILSPFFSKQRKRVLEVRKQQIETIVPLIERRRRALENPGSDKSAATFSYL  183
            LDPR+DD+LPILS FFSKQRK  L+VRK+Q+E +VP IE+RRRA++NPGSD++A TFSYL
Sbjct  230  LDPRIDDYLPILSMFFSKQRKNALKVRKEQVEFMVPFIEQRRRAIQNPGSDQTATTFSYL  289

Query  184  DTLFDLTVEG-RKSSPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEE  360
            DTLFD+ VEG +KSSP+N ELV+L+SEFLNGGTDTTATA+EW IA+LI+NP IQ+KLY+E
Sbjct  290  DTLFDIKVEGSKKSSPSNEELVSLLSEFLNGGTDTTATAVEWGIAQLIDNPEIQAKLYQE  349

Query  361  IKSVVGDRKVDEKDTDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGV  540
            I ++VGD+KV+EKD +KMPYL AVVKELLRKHPPT F LTHAVT+ T LGGYDIP +  V
Sbjct  350  INAIVGDKKVEEKDVEKMPYLQAVVKELLRKHPPTHFVLTHAVTEDTSLGGYDIPTNTNV  409

Query  541  EFFLPAISDDPTLWSDPEKFDPDRFLSGGEDADITGVTAVKMMPFG  678
            E +   I +DP LW++PEKFDP+RF+S GE+ADITGVT V+MMPFG
Sbjct  410  EVYTAGIGEDPKLWTNPEKFDPERFVSKGEEADITGVTGVRMMPFG  455



>ref|XP_006297449.1| hypothetical protein CARUB_v10013470mg [Capsella rubella]
 gb|EOA30347.1| hypothetical protein CARUB_v10013470mg [Capsella rubella]
Length=515

 Score =   348 bits (894),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 156/225 (69%), Positives = 196/225 (87%), Gaps = 0/225 (0%)
 Frame = +1

Query  4    LDPRVDDFLPILSPFFSKQRKRVLEVRKQQIETIVPLIERRRRALENPGSDKSAATFSYL  183
            L+PR+DD+LPIL+PF+SK+R R LEVR++Q++ IV  IERRRRA++NPG+DK+A++FSYL
Sbjct  229  LNPRLDDYLPILAPFYSKERARALEVRREQVDFIVKFIERRRRAIQNPGTDKTASSFSYL  288

Query  184  DTLFDLTVEGRKSSPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEI  363
            DTLFDL  EGRKS+P+N ELV+L SEFLNGGTDTT TAIEW IA+LI NP +QS+LY+EI
Sbjct  289  DTLFDLKTEGRKSTPSNEELVSLCSEFLNGGTDTTGTAIEWGIAQLIVNPEVQSRLYDEI  348

Query  364  KSVVGDRKVDEKDTDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVE  543
            KS VGDR+V+EKD DKM +L AVVKE+LRKHPPT+F LTH+VT+ T + GYD+P+   +E
Sbjct  349  KSTVGDREVEEKDVDKMVFLQAVVKEILRKHPPTYFTLTHSVTEQTTVAGYDVPVGINIE  408

Query  544  FFLPAISDDPTLWSDPEKFDPDRFLSGGEDADITGVTAVKMMPFG  678
            F+LP I++DP LWSDP+KF PDRF+SG E+ADITGVT VKMMPFG
Sbjct  409  FYLPGINEDPKLWSDPKKFKPDRFISGKEEADITGVTGVKMMPFG  453



>ref|XP_010490980.1| PREDICTED: cytochrome P450 77A4 [Camelina sativa]
Length=512

 Score =   348 bits (894),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 159/226 (70%), Positives = 197/226 (87%), Gaps = 1/226 (0%)
 Frame = +1

Query  4    LDPRVDDFLPILSPFFSKQRKRVLEVRKQQIETIVPLIERRRRALENPGSDKSAATFSYL  183
            +DPR+DD+LPIL+PFFSK+RKR LEVR++Q++ +V +I+RRRRA++NPGSDK+A++FSYL
Sbjct  225  VDPRIDDYLPILAPFFSKERKRALEVRREQVDYVVGVIDRRRRAIQNPGSDKTASSFSYL  284

Query  184  DTLFDLTVEGRKSSPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEI  363
            DTLFDL +EGR+++P+N ELVTL SEFLNGGTDTT TAIEW IA+LI NP IQS+LY+EI
Sbjct  285  DTLFDLKIEGRETTPSNEELVTLCSEFLNGGTDTTGTAIEWGIAQLIANPEIQSRLYDEI  344

Query  364  KSVVG-DRKVDEKDTDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGV  540
            KS VG DR VDEKD DKM YL A VKELLRKHPPT+F+LTHAVT+ T LGGYDIP    V
Sbjct  345  KSTVGDDRSVDEKDVDKMVYLQAFVKELLRKHPPTYFSLTHAVTETTTLGGYDIPAGVNV  404

Query  541  EFFLPAISDDPTLWSDPEKFDPDRFLSGGEDADITGVTAVKMMPFG  678
            E +LP +S+DP +WS+P+KFDPDRF+ G E+ADITG+T VKM+PFG
Sbjct  405  EVYLPGMSEDPRIWSNPKKFDPDRFMLGKENADITGITGVKMIPFG  450



>gb|KJB49031.1| hypothetical protein B456_008G098700 [Gossypium raimondii]
Length=519

 Score =   347 bits (890),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 159/225 (71%), Positives = 188/225 (84%), Gaps = 0/225 (0%)
 Frame = +1

Query  4    LDPRVDDFLPILSPFFSKQRKRVLEVRKQQIETIVPLIERRRRALENPGSDKSAATFSYL  183
            LDPR+DDFLPIL PFF KQRKR L+VRKQQ+E I P I++RR AL NPGS+ SA  FSYL
Sbjct  230  LDPRIDDFLPILRPFFGKQRKRALQVRKQQLENITPFIQQRRVALRNPGSNNSAMRFSYL  289

Query  184  DTLFDLTVEGRKSSPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEI  363
            DTLFDL VEGR S+P+N+ELV+L SEF+NGGTDTTAT +EW IA+LI NP IQSKL++EI
Sbjct  290  DTLFDLKVEGRNSAPSNSELVSLCSEFINGGTDTTATVLEWGIAQLIHNPNIQSKLFDEI  349

Query  364  KSVVGDRKVDEKDTDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVE  543
            KS VGDR V+EKD + M YL A+VKE+LRKHPPT+F LTHA T+ T LGG++IP+D  +E
Sbjct  350  KSTVGDRTVEEKDVENMKYLQAIVKEVLRKHPPTYFLLTHAATEATTLGGFNIPIDANLE  409

Query  544  FFLPAISDDPTLWSDPEKFDPDRFLSGGEDADITGVTAVKMMPFG  678
             FLP IS+DP +WS+PEKFDPDRF  G EDADITGVT VKM+PFG
Sbjct  410  VFLPGISEDPKIWSNPEKFDPDRFYLGKEDADITGVTMVKMIPFG  454



>ref|NP_187668.1| cytochrome P450, family 77, subfamily A, polypeptide 6 [Arabidopsis 
thaliana]
 gb|AAG51390.1|AC011560_22 putative cytochrome P450; 45201-43660 [Arabidopsis thaliana]
 gb|AAF76359.1| cytochrome P450, putative [Arabidopsis thaliana]
 gb|AAV97806.1| At3g10570 [Arabidopsis thaliana]
 gb|AAX12870.1| At3g10570 [Arabidopsis thaliana]
 gb|AEE74926.1| cytochrome P450, family 77, subfamily A, polypeptide 6 [Arabidopsis 
thaliana]
Length=513

 Score =   346 bits (888),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 157/225 (70%), Positives = 196/225 (87%), Gaps = 0/225 (0%)
 Frame = +1

Query  4    LDPRVDDFLPILSPFFSKQRKRVLEVRKQQIETIVPLIERRRRALENPGSDKSAATFSYL  183
            L+PR+DD+LPIL+PF+SK+R R LEVR +Q++ IV LIERRRRA++ PG+DK+A++FSYL
Sbjct  227  LNPRLDDYLPILAPFYSKERARALEVRCEQVDFIVKLIERRRRAIQKPGTDKTASSFSYL  286

Query  184  DTLFDLTVEGRKSSPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEI  363
            DTLFDL  EGR ++P+N ELV+L SEFLNGGTDTT TAIEW IA+LI NP IQS+LY+EI
Sbjct  287  DTLFDLKTEGRITTPSNEELVSLCSEFLNGGTDTTGTAIEWGIAQLIVNPEIQSRLYDEI  346

Query  364  KSVVGDRKVDEKDTDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVE  543
            KS VGDR+V+EKD DKM +L AVVKE+LRKHPPT+F LTH+VT+PT + GYD+P+   VE
Sbjct  347  KSTVGDREVEEKDVDKMVFLQAVVKEILRKHPPTYFTLTHSVTEPTTVAGYDVPVGINVE  406

Query  544  FFLPAISDDPTLWSDPEKFDPDRFLSGGEDADITGVTAVKMMPFG  678
            F+LP I++DP LWSDP+KF+PDRF+SG E+ADITGVT VKMMPFG
Sbjct  407  FYLPGINEDPKLWSDPKKFNPDRFISGKEEADITGVTGVKMMPFG  451



>ref|XP_010423551.1| PREDICTED: cytochrome P450 77A4-like [Camelina sativa]
Length=540

 Score =   346 bits (888),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 157/226 (69%), Positives = 197/226 (87%), Gaps = 1/226 (0%)
 Frame = +1

Query  4    LDPRVDDFLPILSPFFSKQRKRVLEVRKQQIETIVPLIERRRRALENPGSDKSAATFSYL  183
            +DPR+DD+LPIL+PFFSK+RKR LEVR++Q++ +V +IERRRRA++NPGSD++A++FSYL
Sbjct  253  VDPRIDDYLPILAPFFSKERKRALEVRREQVDYVVGVIERRRRAIQNPGSDETASSFSYL  312

Query  184  DTLFDLTVEGRKSSPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEI  363
            DTLFDL +EGR+++P+N ELVTL SEFLNGGTDTT TAIEW IA+LI NP IQS+LY+EI
Sbjct  313  DTLFDLKIEGRETTPSNEELVTLCSEFLNGGTDTTGTAIEWGIAQLIANPEIQSRLYDEI  372

Query  364  KSVVG-DRKVDEKDTDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGV  540
            KS VG DR V+EKD +KM YL A VKELLRKHPPT+F+LTHAVT+ T LGGYDIP    V
Sbjct  373  KSTVGDDRSVEEKDVNKMVYLQAFVKELLRKHPPTYFSLTHAVTETTTLGGYDIPAGVNV  432

Query  541  EFFLPAISDDPTLWSDPEKFDPDRFLSGGEDADITGVTAVKMMPFG  678
            E +LP +S+DP +WS+P+KFDPDRF+ G E+ADITG+T VKM+PFG
Sbjct  433  EVYLPGMSEDPRIWSNPKKFDPDRFMLGKENADITGITGVKMIPFG  478



>gb|AAM66094.1| cytochrom P450-like protein [Arabidopsis thaliana]
Length=512

 Score =   345 bits (885),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 158/226 (70%), Positives = 196/226 (87%), Gaps = 1/226 (0%)
 Frame = +1

Query  4    LDPRVDDFLPILSPFFSKQRKRVLEVRKQQIETIVPLIERRRRALENPGSDKSAATFSYL  183
            +DPR+DD+LPIL+PFFSK+RKR LEVR++Q++ +V +IERRRRA++NPGSDK+A++FSYL
Sbjct  225  VDPRIDDYLPILAPFFSKERKRALEVRREQVDYVVGVIERRRRAIQNPGSDKTASSFSYL  284

Query  184  DTLFDLTVEGRKSSPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEI  363
            DTLFDL +EGRK++P+N ELVTL SEFLNGGTDTT TAIEW IA+LI NP IQS+LY+EI
Sbjct  285  DTLFDLKIEGRKTTPSNEELVTLCSEFLNGGTDTTGTAIEWGIAQLIANPEIQSRLYDEI  344

Query  364  KSVVG-DRKVDEKDTDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGV  540
            KS VG DR+VDEKD DKM +L A VKELLRKHPPT+F+LTHAV + T L GYDIP    V
Sbjct  345  KSTVGDDRRVDEKDVDKMVFLQAFVKELLRKHPPTYFSLTHAVMETTTLAGYDIPAGVNV  404

Query  541  EFFLPAISDDPTLWSDPEKFDPDRFLSGGEDADITGVTAVKMMPFG  678
            E +LP IS+DP +W++P+KFDPDRF+ G EDADITG++ VKM+PFG
Sbjct  405  EVYLPGISEDPRIWNNPKKFDPDRFMLGKEDADITGISGVKMIPFG  450



>ref|NP_196086.1| cytochrome P450, family 77, subfamily A, polypeptide 4 [Arabidopsis 
thaliana]
 sp|Q9LZ31.1|C77A4_ARATH RecName: Full=Cytochrome P450 77A4; AltName: Full=Fatty acid 
epoxidase [Arabidopsis thaliana]
 emb|CAB86008.1| cytochrom P450-like protein [Arabidopsis thaliana]
 gb|AED90769.1| cytochrome P450, family 77, subfamily A, polypeptide 4 [Arabidopsis 
thaliana]
Length=512

 Score =   345 bits (885),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 158/226 (70%), Positives = 196/226 (87%), Gaps = 1/226 (0%)
 Frame = +1

Query  4    LDPRVDDFLPILSPFFSKQRKRVLEVRKQQIETIVPLIERRRRALENPGSDKSAATFSYL  183
            +DPR+DD+LPIL+PFFSK+RKR LEVR++Q++ +V +IERRRRA++NPGSDK+A++FSYL
Sbjct  225  VDPRIDDYLPILAPFFSKERKRALEVRREQVDYVVGVIERRRRAIQNPGSDKTASSFSYL  284

Query  184  DTLFDLTVEGRKSSPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEI  363
            DTLFDL +EGRK++P+N ELVTL SEFLNGGTDTT TAIEW IA+LI NP IQS+LY+EI
Sbjct  285  DTLFDLKIEGRKTTPSNEELVTLCSEFLNGGTDTTGTAIEWGIAQLIANPEIQSRLYDEI  344

Query  364  KSVVG-DRKVDEKDTDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGV  540
            KS VG DR+VDEKD DKM +L A VKELLRKHPPT+F+LTHAV + T L GYDIP    V
Sbjct  345  KSTVGDDRRVDEKDVDKMVFLQAFVKELLRKHPPTYFSLTHAVMETTTLAGYDIPAGVNV  404

Query  541  EFFLPAISDDPTLWSDPEKFDPDRFLSGGEDADITGVTAVKMMPFG  678
            E +LP IS+DP +W++P+KFDPDRF+ G EDADITG++ VKM+PFG
Sbjct  405  EVYLPGISEDPRIWNNPKKFDPDRFMLGKEDADITGISGVKMIPFG  450



>gb|AAO42093.1| putative cytochrome p450 [Arabidopsis thaliana]
Length=513

 Score =   345 bits (884),  Expect = 7e-113, Method: Compositional matrix adjust.
 Identities = 157/225 (70%), Positives = 195/225 (87%), Gaps = 0/225 (0%)
 Frame = +1

Query  4    LDPRVDDFLPILSPFFSKQRKRVLEVRKQQIETIVPLIERRRRALENPGSDKSAATFSYL  183
            L+PR+DD+LPIL+PF+SK+R R LEVR  Q++ IV LIERRRRA++ PG+DK+A++FSYL
Sbjct  227  LNPRLDDYLPILAPFYSKERARALEVRCGQVDFIVKLIERRRRAIQKPGTDKTASSFSYL  286

Query  184  DTLFDLTVEGRKSSPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEI  363
            DTLFDL  EGR ++P+N ELV+L SEFLNGGTDTT TAIEW IA+LI NP IQS+LY+EI
Sbjct  287  DTLFDLKTEGRITTPSNEELVSLCSEFLNGGTDTTGTAIEWGIAQLIVNPEIQSRLYDEI  346

Query  364  KSVVGDRKVDEKDTDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVE  543
            KS VGDR+V+EKD DKM +L AVVKE+LRKHPPT+F LTH+VT+PT + GYD+P+   VE
Sbjct  347  KSTVGDREVEEKDVDKMVFLQAVVKEILRKHPPTYFTLTHSVTEPTTVAGYDVPVGINVE  406

Query  544  FFLPAISDDPTLWSDPEKFDPDRFLSGGEDADITGVTAVKMMPFG  678
            F+LP I++DP LWSDP+KF+PDRF+SG E+ADITGVT VKMMPFG
Sbjct  407  FYLPGINEDPKLWSDPKKFNPDRFISGKEEADITGVTGVKMMPFG  451



>gb|EPS69622.1| hypothetical protein M569_05145, partial [Genlisea aurea]
Length=470

 Score =   343 bits (879),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 159/225 (71%), Positives = 189/225 (84%), Gaps = 0/225 (0%)
 Frame = +1

Query  4    LDPRVDDFLPILSPFFSKQRKRVLEVRKQQIETIVPLIERRRRALENPGSDKSAATFSYL  183
            LD R+DD+LPIL PFFSKQR RV  +R+QQI TI+PLI+RRRRA+ NPGSDKSAA FSYL
Sbjct  189  LDARLDDYLPILGPFFSKQRNRVQAIREQQIRTILPLIQRRRRAVHNPGSDKSAAPFSYL  248

Query  184  DTLFDLTVEGRKSSPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEI  363
            DTLFDL ++GRKSSP++ E+VTL SE LNGGTDTTATA+EWAIARL+  P +Q ++  EI
Sbjct  249  DTLFDLKIDGRKSSPSDPEIVTLCSEILNGGTDTTATAVEWAIARLVAGPDMQDRIRREI  308

Query  364  KSVVGDRKVDEKDTDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVE  543
            +  VGD K+DEKD +K+PYL A VKELLR+HPPTFF+LTHAVT+P KLGGYDIP D  VE
Sbjct  309  RDAVGDAKLDEKDVEKLPYLQAFVKELLRRHPPTFFSLTHAVTEPAKLGGYDIPTDANVE  368

Query  544  FFLPAISDDPTLWSDPEKFDPDRFLSGGEDADITGVTAVKMMPFG  678
             FLP I  DP LWSDP+KFDP+RFLSG  +AD+TGV+ VKM+PFG
Sbjct  369  IFLPEIGLDPNLWSDPDKFDPERFLSGKVEADMTGVSGVKMIPFG  413



>ref|XP_006398921.1| hypothetical protein EUTSA_v10016078mg [Eutrema salsugineum]
 gb|ESQ40374.1| hypothetical protein EUTSA_v10016078mg [Eutrema salsugineum]
Length=510

 Score =   343 bits (881),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 153/225 (68%), Positives = 193/225 (86%), Gaps = 0/225 (0%)
 Frame = +1

Query  4    LDPRVDDFLPILSPFFSKQRKRVLEVRKQQIETIVPLIERRRRALENPGSDKSAATFSYL  183
            +DPR+DD+LPIL+PFFSK+RKR L+VR++Q++ +V  IERRRRA+ NPGSDK+A++FSYL
Sbjct  224  VDPRIDDYLPILAPFFSKERKRALQVRREQVDFVVGFIERRRRAIRNPGSDKTASSFSYL  283

Query  184  DTLFDLTVEGRKSSPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEI  363
            DTLFDL VEGR+++P N ELVTL SEFLNGGTDTT TAIEW IA+LI NP IQS+LY+EI
Sbjct  284  DTLFDLKVEGRETTPCNEELVTLCSEFLNGGTDTTGTAIEWGIAQLIANPEIQSRLYDEI  343

Query  364  KSVVGDRKVDEKDTDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVE  543
            +S  GDR+++EKD +KM +L A VKELLRKHPPT+F+LTHAV + T L GYDIP    VE
Sbjct  344  RSTAGDRRIEEKDVEKMVFLQAFVKELLRKHPPTYFSLTHAVMETTTLAGYDIPAGVNVE  403

Query  544  FFLPAISDDPTLWSDPEKFDPDRFLSGGEDADITGVTAVKMMPFG  678
             +LP IS+DP +W++P+KFDPDRF+SG EDADITG++ VKM+PFG
Sbjct  404  VYLPGISEDPRIWTNPKKFDPDRFISGKEDADITGISGVKMIPFG  448



>ref|XP_002871108.1| CYP77A4 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH47367.1| CYP77A4 [Arabidopsis lyrata subsp. lyrata]
Length=511

 Score =   342 bits (877),  Expect = 7e-112, Method: Compositional matrix adjust.
 Identities = 156/226 (69%), Positives = 195/226 (86%), Gaps = 1/226 (0%)
 Frame = +1

Query  4    LDPRVDDFLPILSPFFSKQRKRVLEVRKQQIETIVPLIERRRRALENPGSDKSAATFSYL  183
            +DPR DD+LPIL+PFFSK+RKR LEVR++Q++ +V +IERRRRA++NPGSDK+A++FSYL
Sbjct  224  VDPRTDDYLPILAPFFSKERKRALEVRREQVDYVVGVIERRRRAIQNPGSDKTASSFSYL  283

Query  184  DTLFDLTVEGRKSSPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEI  363
            DTLFDL +EGRK++P+N ELVTL SEFLNGGTDTT TAIEW IA+LI NP IQS+LY+EI
Sbjct  284  DTLFDLKIEGRKTTPSNEELVTLCSEFLNGGTDTTGTAIEWGIAQLIANPEIQSRLYDEI  343

Query  364  KSVVG-DRKVDEKDTDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGV  540
            +S VG DR+V+EKD DKM +L A VKELLRKHPPT+F+LTHAV + T L GYDIP    V
Sbjct  344  ESTVGDDRRVNEKDVDKMVFLQAFVKELLRKHPPTYFSLTHAVMETTTLAGYDIPAGVNV  403

Query  541  EFFLPAISDDPTLWSDPEKFDPDRFLSGGEDADITGVTAVKMMPFG  678
            E +LP IS+DP +W++P+KFDPDRF+ G EDADITG++ VKM+PFG
Sbjct  404  EIYLPGISEDPRIWNNPKKFDPDRFMLGKEDADITGISGVKMIPFG  449



>gb|EPS63295.1| hypothetical protein M569_11489, partial [Genlisea aurea]
Length=496

 Score =   342 bits (876),  Expect = 8e-112, Method: Compositional matrix adjust.
 Identities = 161/228 (71%), Positives = 195/228 (86%), Gaps = 3/228 (1%)
 Frame = +1

Query  4    LDPRVDDFLPILSPFFSKQRKRVLEVRKQQIETIVPLIERRRRALENPGSD---KSAATF  174
            LDPR+DDFLPILSPFF KQRK+V +VRK+Q+E ++PLIERRR A+ NPGSD    +AA F
Sbjct  213  LDPRIDDFLPILSPFFYKQRKKVRQVRKKQMEILIPLIERRREAIRNPGSDGSSSAAAAF  272

Query  175  SYLDTLFDLTVEGRKSSPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLY  354
            SYLDT+FDL +EGRK+ P++ E+VTL SEFLNGGTDTTATA+EW IARLIENP +QS+LY
Sbjct  273  SYLDTIFDLKIEGRKTYPSDQEIVTLCSEFLNGGTDTTATAVEWGIARLIENPDVQSRLY  332

Query  355  EEIKSVVGDRKVDEKDTDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDC  534
            EEI++ VG RKV++KD +KMPYLNAVVKELLRKHPPT+F L+HAVT+P +LGGY++P   
Sbjct  333  EEIRTTVGSRKVEDKDIEKMPYLNAVVKELLRKHPPTYFVLSHAVTEPARLGGYEVPAGA  392

Query  535  GVEFFLPAISDDPTLWSDPEKFDPDRFLSGGEDADITGVTAVKMMPFG  678
             VEFF  AI++DP +WSDP+KFDPDRF +  EDADITGV  VKMMPFG
Sbjct  393  SVEFFSAAIAEDPKVWSDPQKFDPDRFFADREDADITGVAGVKMMPFG  440



>ref|XP_004140895.1| PREDICTED: cytochrome P450 77A3-like [Cucumis sativus]
 gb|KGN46023.1| Cytochrome P450 77A3 [Cucumis sativus]
Length=513

 Score =   341 bits (875),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 153/225 (68%), Positives = 189/225 (84%), Gaps = 0/225 (0%)
 Frame = +1

Query  4    LDPRVDDFLPILSPFFSKQRKRVLEVRKQQIETIVPLIERRRRALENPGSDKSAATFSYL  183
            +DPR+DDFLPIL PFF+KQRKR +EVR++QIE +V  I RR++AL+NPGSD  A +FSYL
Sbjct  227  VDPRIDDFLPILRPFFAKQRKRAMEVRREQIEFVVQFINRRKKALQNPGSDNKATSFSYL  286

Query  184  DTLFDLTVEGRKSSPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEI  363
            DTLFDL V+GRKS+PT+AELVTL SEFLNGG DTTATAIEW IA LI NP +Q KLYEEI
Sbjct  287  DTLFDLKVDGRKSTPTDAELVTLCSEFLNGGVDTTATAIEWGIAELITNPNVQKKLYEEI  346

Query  364  KSVVGDRKVDEKDTDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVE  543
            K +VGDRKVDE D  K+PYL AVVKELLRKHPPT+F+LTH+  + +KLGGYDIPM+  VE
Sbjct  347  KQLVGDRKVDESDVQKLPYLQAVVKELLRKHPPTYFSLTHSGIEASKLGGYDIPMEASVE  406

Query  544  FFLPAISDDPTLWSDPEKFDPDRFLSGGEDADITGVTAVKMMPFG  678
             +L  +S+DP +W +PEKF+P+RF+SG E+ D+TG+  +KM+PFG
Sbjct  407  VYLAGMSNDPKVWKNPEKFEPERFMSGEEEVDMTGIKGMKMIPFG  451



>gb|KFK38447.1| hypothetical protein AALP_AA3G114600 [Arabis alpina]
Length=1027

 Score =   351 bits (901),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 159/225 (71%), Positives = 196/225 (87%), Gaps = 0/225 (0%)
 Frame = +1

Query  4    LDPRVDDFLPILSPFFSKQRKRVLEVRKQQIETIVPLIERRRRALENPGSDKSAATFSYL  183
            +DPR+DD+LPIL+ F+SK+RK+ LEVR++Q++ +V  IERRRRA+ NPGSDK+A++FSYL
Sbjct  741  IDPRLDDYLPILALFYSKERKKALEVRREQVDFVVKFIERRRRAIANPGSDKTASSFSYL  800

Query  184  DTLFDLTVEGRKSSPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEI  363
            DTLFDL +EGRK+ P+N ELVTL SEFLNGGTDTT TAIEW IA+LI NP IQS+LY+EI
Sbjct  801  DTLFDLKIEGRKTMPSNEELVTLCSEFLNGGTDTTGTAIEWGIAQLIANPEIQSRLYDEI  860

Query  364  KSVVGDRKVDEKDTDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVE  543
            KS VGD  V+EKD DKM YL A VKE+LRKHPPT+F LTH+VT+PTK+GGYD+P+   VE
Sbjct  861  KSTVGDSPVEEKDVDKMVYLQAFVKEILRKHPPTYFTLTHSVTEPTKVGGYDVPVGINVE  920

Query  544  FFLPAISDDPTLWSDPEKFDPDRFLSGGEDADITGVTAVKMMPFG  678
            F+LP I++DP +WS+P+KFDPDRF+SG EDADITGVT VKMMPFG
Sbjct  921  FYLPGINEDPKIWSNPKKFDPDRFVSGKEDADITGVTGVKMMPFG  965


 Score =   268 bits (686),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 131/225 (58%), Positives = 174/225 (77%), Gaps = 8/225 (4%)
 Frame = +1

Query  4    LDPRVDDFLPILSPFFSKQRKRVLEVRKQQIETIVPLIERRRRALENPGSDKSAATFSYL  183
            ++P + D+LP+L+PF  ++R R L++R++ ++ +V  IE+RR A+    S+ S+++FSYL
Sbjct  227  VNPELHDYLPLLTPFNYRERNRALKLRRELVDFVVGFIEKRRTAIR---SESSSSSFSYL  283

Query  184  DTLFDLTVEGRKSSPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEI  363
            DTLFDL     +++P+N +LVTL SEFLN GTDTT  AIEW IA LI NP IQS+LY+EI
Sbjct  284  DTLFDL-----ETTPSNEDLVTLCSEFLNAGTDTTGAAIEWGIAELISNPEIQSRLYDEI  338

Query  364  KSVVGDRKVDEKDTDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVE  543
            KS VGD  V++KD  KM +L  VVKELLR HPPT+F L+H VT+PT L GY+IP+   VE
Sbjct  339  KSTVGDCPVEDKDVGKMVFLQGVVKELLRLHPPTYFTLSHGVTEPTTLSGYNIPVGVNVE  398

Query  544  FFLPAISDDPTLWSDPEKFDPDRFLSGGEDADITGVTAVKMMPFG  678
            F+LP IS+DP +WSDP+KFDPDRF+SG E+AD+TGV  VKMMPFG
Sbjct  399  FYLPGISEDPNIWSDPKKFDPDRFVSGKEEADMTGVAGVKMMPFG  443



>ref|XP_006289766.1| hypothetical protein CARUB_v10003366mg [Capsella rubella]
 gb|EOA22664.1| hypothetical protein CARUB_v10003366mg [Capsella rubella]
Length=511

 Score =   335 bits (858),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 152/226 (67%), Positives = 195/226 (86%), Gaps = 1/226 (0%)
 Frame = +1

Query  4    LDPRVDDFLPILSPFFSKQRKRVLEVRKQQIETIVPLIERRRRALENPGSDKSAATFSYL  183
            +DPR+DD+LPIL+PFFSK+RKR L+VR++Q++ +V  IERRRRA++NPGSD++A++FSYL
Sbjct  224  VDPRIDDYLPILAPFFSKERKRALDVRREQVDYVVGFIERRRRAIKNPGSDETASSFSYL  283

Query  184  DTLFDLTVEGRKSSPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEI  363
            DTLFDL +EGR+++P+N ELVTL SE LNGGTDTT TAIEW +A+LI NP +QS+LY+EI
Sbjct  284  DTLFDLNIEGRETAPSNEELVTLCSELLNGGTDTTGTAIEWGMAQLIANPEMQSRLYDEI  343

Query  364  KSVVG-DRKVDEKDTDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGV  540
            KS VG DR+V+EKD DKM +L A VKELLRKHPPT+F+LTHAVT+ T L GYDIP    V
Sbjct  344  KSTVGDDRRVEEKDMDKMVFLQAFVKELLRKHPPTYFSLTHAVTETTTLAGYDIPAGVNV  403

Query  541  EFFLPAISDDPTLWSDPEKFDPDRFLSGGEDADITGVTAVKMMPFG  678
            E F+P IS+DP +WS+P++FDPDRF+SG E+ADITG + VKM+PFG
Sbjct  404  EIFIPGISEDPRIWSNPKEFDPDRFISGKEEADITGNSGVKMIPFG  449



>gb|AFK73721.1| cytochrome P450 [Papaver somniferum]
Length=429

 Score =   330 bits (847),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 154/223 (69%), Positives = 183/223 (82%), Gaps = 0/223 (0%)
 Frame = +1

Query  10   PRVDDFLPILSPFFSKQRKRVLEVRKQQIETIVPLIERRRRALENPGSDKSAATFSYLDT  189
            PR+DD+LP+LSPF+ KQRK+  +VR+ QI+T+VP IERRR ++ NP  D + A FSYLDT
Sbjct  145  PRLDDYLPLLSPFYLKQRKKAKQVRENQIKTLVPFIERRRSSIANPELDTTEAKFSYLDT  204

Query  190  LFDLTVEGRKSSPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEIKS  369
            LF+L VEGRKSS +NAELVTL SEFLNGGTDTT+TA+EW IARLI+NP IQ KLYE+IKS
Sbjct  205  LFELKVEGRKSSMSNAELVTLCSEFLNGGTDTTSTAVEWGIARLIQNPEIQRKLYEDIKS  264

Query  370  VVGDRKVDEKDTDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVEFF  549
             VGDR VDEKD   + YLNA  KELLRKHPPT+F LTH+V +P KL GYDIP   G+EFF
Sbjct  265  TVGDRVVDEKDIPNLVYLNAFTKELLRKHPPTYFTLTHSVAEPVKLAGYDIPTYVGLEFF  324

Query  550  LPAISDDPTLWSDPEKFDPDRFLSGGEDADITGVTAVKMMPFG  678
            L AI++DP  WSDP +F+PDRFLSG EDAD+TG+  VKMMPFG
Sbjct  325  LTAIAEDPKHWSDPVQFNPDRFLSGKEDADLTGIRGVKMMPFG  367



>emb|CDX70209.1| BnaA10g25580D [Brassica napus]
Length=500

 Score =   332 bits (851),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 146/225 (65%), Positives = 191/225 (85%), Gaps = 0/225 (0%)
 Frame = +1

Query  4    LDPRVDDFLPILSPFFSKQRKRVLEVRKQQIETIVPLIERRRRALENPGSDKSAATFSYL  183
            +DPR+ D+LP+L+PF+SK+RK  LE+R++ +E +V  IE+RR A++NPGSDK+A++F+YL
Sbjct  214  VDPRIHDYLPVLTPFYSKERKLALELRRKLVEFVVGFIEKRRSAIQNPGSDKTASSFAYL  273

Query  184  DTLFDLTVEGRKSSPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEI  363
            DTLF+L ++GR+++P++ +LVTL SEFLN GTDTT TAIEW IA+LI NP IQS+LY+EI
Sbjct  274  DTLFNLKIDGRETTPSDEDLVTLCSEFLNAGTDTTGTAIEWGIAQLITNPKIQSRLYDEI  333

Query  364  KSVVGDRKVDEKDTDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVE  543
            KS VGDR VDEKD DKM +L A VKE+LR+HPPT+F LTH VT+PT L GYDIP+   VE
Sbjct  334  KSTVGDRTVDEKDLDKMVFLKAFVKEILRRHPPTYFTLTHGVTEPTTLSGYDIPVGANVE  393

Query  544  FFLPAISDDPTLWSDPEKFDPDRFLSGGEDADITGVTAVKMMPFG  678
            F+LP +S+DP +WS P+KFDPDRF++GGEDAD+TGV  VKMMPFG
Sbjct  394  FYLPGMSEDPNIWSKPDKFDPDRFITGGEDADLTGVAGVKMMPFG  438



>ref|XP_009122576.1| PREDICTED: cytochrome P450 77A4 [Brassica rapa]
Length=500

 Score =   332 bits (850),  Expect = 6e-108, Method: Compositional matrix adjust.
 Identities = 146/225 (65%), Positives = 191/225 (85%), Gaps = 0/225 (0%)
 Frame = +1

Query  4    LDPRVDDFLPILSPFFSKQRKRVLEVRKQQIETIVPLIERRRRALENPGSDKSAATFSYL  183
            +DPR+ D+LP+L+PF+SK+RK  LE+R++ +E +V  IE+RR A++NPGSDK+A++F+YL
Sbjct  214  VDPRIHDYLPVLTPFYSKERKLALELRRKLVEFVVGFIEKRRSAIQNPGSDKTASSFAYL  273

Query  184  DTLFDLTVEGRKSSPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEI  363
            DTLF+L ++GR+++P++ +LVTL SEFLN GTDTT TAIEW IA+LI NP IQS+LY+EI
Sbjct  274  DTLFNLKIDGRETTPSDEDLVTLCSEFLNAGTDTTGTAIEWGIAQLITNPKIQSRLYDEI  333

Query  364  KSVVGDRKVDEKDTDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVE  543
            KS VGDR VDEKD DKM +L A VKE+LR+HPPT+F LTH VT+PT L GYDIP+   VE
Sbjct  334  KSTVGDRTVDEKDLDKMVFLKAFVKEILRRHPPTYFTLTHGVTEPTTLSGYDIPVGANVE  393

Query  544  FFLPAISDDPTLWSDPEKFDPDRFLSGGEDADITGVTAVKMMPFG  678
            F+LP +S+DP +WS P+KFDPDRF++GGEDAD+TGV  VKMMPFG
Sbjct  394  FYLPGMSEDPNIWSKPDKFDPDRFITGGEDADLTGVAGVKMMPFG  438



>ref|XP_009130829.1| PREDICTED: cytochrome P450 77A4 [Brassica rapa]
Length=533

 Score =   331 bits (849),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 149/225 (66%), Positives = 190/225 (84%), Gaps = 4/225 (2%)
 Frame = +1

Query  4    LDPRVDDFLPILSPFFSKQRKRVLEVRKQQIETIVPLIERRRRALENPGSDKSAATFSYL  183
            +DPR+DD+LPIL+PFFSK+RKR LEVR++Q++ +V LIE+RRRA+ N    K+A +FSYL
Sbjct  251  VDPRIDDYLPILAPFFSKERKRALEVRREQVDLVVSLIEKRRRAIRN----KTAPSFSYL  306

Query  184  DTLFDLTVEGRKSSPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEI  363
            DTLFDL VEGR+++P+N E+VTL SEFLNGGTDTT TAIEW IA+LI NP IQS+LY+EI
Sbjct  307  DTLFDLKVEGRETAPSNEEIVTLCSEFLNGGTDTTGTAIEWGIAQLIANPEIQSRLYDEI  366

Query  364  KSVVGDRKVDEKDTDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVE  543
            +S  GDR+++E D DKM +L A VKELLRKHPPT+F+LTHAV + T LGGYD+P    VE
Sbjct  367  RSTAGDRRIEEGDVDKMVFLQAFVKELLRKHPPTYFSLTHAVMETTSLGGYDVPAGVNVE  426

Query  544  FFLPAISDDPTLWSDPEKFDPDRFLSGGEDADITGVTAVKMMPFG  678
             ++P IS+DP +WS+P+KFDPDRF+SG EDADITG++ VKM+PFG
Sbjct  427  VYIPGISEDPRIWSNPKKFDPDRFISGKEDADITGISGVKMIPFG  471



>emb|CDY11297.1| BnaA03g01330D [Brassica napus]
Length=503

 Score =   329 bits (844),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 148/225 (66%), Positives = 190/225 (84%), Gaps = 4/225 (2%)
 Frame = +1

Query  4    LDPRVDDFLPILSPFFSKQRKRVLEVRKQQIETIVPLIERRRRALENPGSDKSAATFSYL  183
            +DPR+DD+LPIL+PFFSK+R+R LEVR++Q++ +V LIE+RRRA+ N    K+A +FSYL
Sbjct  221  VDPRIDDYLPILAPFFSKERRRALEVRREQVDLVVSLIEKRRRAIRN----KTAPSFSYL  276

Query  184  DTLFDLTVEGRKSSPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEI  363
            DTLFDL VEGR+++P+N E+VTL SEFLNGGTDTT TAIEW IA+LI NP IQS+LY+EI
Sbjct  277  DTLFDLKVEGRETAPSNEEIVTLCSEFLNGGTDTTGTAIEWGIAQLIANPEIQSRLYDEI  336

Query  364  KSVVGDRKVDEKDTDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVE  543
            +S  GDR+++E D DKM +L A VKELLRKHPPT+F+LTHAV + T LGGYD+P    VE
Sbjct  337  RSTAGDRRIEEGDVDKMVFLQAFVKELLRKHPPTYFSLTHAVMETTSLGGYDVPAGVNVE  396

Query  544  FFLPAISDDPTLWSDPEKFDPDRFLSGGEDADITGVTAVKMMPFG  678
             ++P IS+DP +WS+P+KFDPDRF+SG EDADITG++ VKM+PFG
Sbjct  397  VYIPGISEDPRIWSNPKKFDPDRFISGKEDADITGISGVKMIPFG  441



>emb|CDX80914.1| BnaC03g01680D [Brassica napus]
Length=503

 Score =   328 bits (841),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 148/225 (66%), Positives = 189/225 (84%), Gaps = 4/225 (2%)
 Frame = +1

Query  4    LDPRVDDFLPILSPFFSKQRKRVLEVRKQQIETIVPLIERRRRALENPGSDKSAATFSYL  183
            +DPR+DD+LPIL+PFFSK+RKR LEVR++Q++ +V LIE+RRRA+ N    K+A +FSYL
Sbjct  221  VDPRIDDYLPILAPFFSKERKRALEVRREQVDLVVSLIEKRRRAIRN----KTAPSFSYL  276

Query  184  DTLFDLTVEGRKSSPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEI  363
            DTLFDL VEGR+++P+N E+VTL SEFLNGGTDTT TAIEW IA+LI NP IQS+LY+EI
Sbjct  277  DTLFDLKVEGRETAPSNEEIVTLCSEFLNGGTDTTGTAIEWGIAQLIANPEIQSRLYDEI  336

Query  364  KSVVGDRKVDEKDTDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVE  543
            +S  GDR ++E D DKM +L A VKELLRKHPPT+F+LTHAV + T LGGYD+P    VE
Sbjct  337  RSTAGDRSIEEGDVDKMVFLQAFVKELLRKHPPTYFSLTHAVMETTSLGGYDVPAGVNVE  396

Query  544  FFLPAISDDPTLWSDPEKFDPDRFLSGGEDADITGVTAVKMMPFG  678
             ++P IS+DP +WS+P++FDPDRF+SG EDADITG++ VKM+PFG
Sbjct  397  VYIPGISEDPRIWSNPKQFDPDRFISGKEDADITGISGVKMIPFG  441



>ref|XP_010694692.1| PREDICTED: cytochrome P450 77A2-like [Beta vulgaris subsp. vulgaris]
Length=551

 Score =   330 bits (845),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 155/226 (69%), Positives = 186/226 (82%), Gaps = 1/226 (0%)
 Frame = +1

Query  4    LDPRVDDFLPILSPFFSKQRKRVLEVRKQQIETIVPLIERRRRALE-NPGSDKSAATFSY  180
            ++PR+DDFLPILSPFF+KQRK  LEVRK+QIET+ P IE+RR  +     SD +AA FSY
Sbjct  264  VNPRIDDFLPILSPFFTKQRKEALEVRKKQIETLRPFIEQRRAIIRAGLASDPTAAPFSY  323

Query  181  LDTLFDLTVEGRKSSPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEE  360
            LDTLF+L VEGR S PT  E+VTL SEF+NGGTDTTATAIEWA+ARLIENP +Q +L++E
Sbjct  324  LDTLFELQVEGRISGPTEPEIVTLCSEFINGGTDTTATAIEWAMARLIENPAMQERLHDE  383

Query  361  IKSVVGDRKVDEKDTDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGV  540
            I++ VG R V E D D +PYL+A VKELLRKHPPT+F+LTHAVT+PT LG Y+IP  C V
Sbjct  384  IRAAVGSRPVQEGDLDNLPYLHAFVKELLRKHPPTYFSLTHAVTEPTTLGDYNIPTGCNV  443

Query  541  EFFLPAISDDPTLWSDPEKFDPDRFLSGGEDADITGVTAVKMMPFG  678
            E +LP ISDDP +WS+PEKFDP+RFLSG EDAD+TGV  VKM+PFG
Sbjct  444  EIYLPGISDDPKIWSEPEKFDPERFLSGREDADMTGVKGVKMIPFG  489



>ref|XP_002871106.1| CYP77A9 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH47365.1| CYP77A9 [Arabidopsis lyrata subsp. lyrata]
Length=506

 Score =   327 bits (839),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 149/226 (66%), Positives = 187/226 (83%), Gaps = 1/226 (0%)
 Frame = +1

Query  4    LDPRVDDFLPILSPFFSKQRKRVLEVRKQQIETIVPLIERRRRALENPGSDKSAATFSYL  183
            +DPR+ D+LPIL+PF+  +RK+ LE+R++ +E +V  IE+RR A+ NPGSDK+A +F+YL
Sbjct  219  VDPRIHDYLPILTPFYFNERKKALELRRKLVEFVVGFIEKRRSAVRNPGSDKTATSFAYL  278

Query  184  DTLFDLTVEGRKSSPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEI  363
            DTLFDL V+GR+++P++ +LVTL SEFLN GTDTT TAIEW IA LI NP IQS+LY+EI
Sbjct  279  DTLFDLRVDGRETTPSDEDLVTLCSEFLNAGTDTTGTAIEWGIAELISNPEIQSRLYDEI  338

Query  364  KSVVG-DRKVDEKDTDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGV  540
            KS VG DR V+EKD DKM +L A VKELLR+HPPT+F LTH VT+PT L GYDIP+   V
Sbjct  339  KSTVGDDRTVEEKDLDKMVFLQAFVKELLRRHPPTYFTLTHGVTEPTNLSGYDIPVGANV  398

Query  541  EFFLPAISDDPTLWSDPEKFDPDRFLSGGEDADITGVTAVKMMPFG  678
            EF+LP IS+DP +WS PEKFDPDRF++GGEDAD+TGV  VKMMPFG
Sbjct  399  EFYLPGISEDPKIWSKPEKFDPDRFITGGEDADLTGVAGVKMMPFG  444



>ref|XP_010110167.1| Cytochrome P450 77A3 [Morus notabilis]
 gb|EXC25405.1| Cytochrome P450 77A3 [Morus notabilis]
Length=501

 Score =   325 bits (832),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 159/227 (70%), Positives = 184/227 (81%), Gaps = 6/227 (3%)
 Frame = +1

Query  4    LDPRVDDFLPILSPFFSKQRKRVLEVRKQQIETIVPLIERRRRALENPGSDKSAATFSYL  183
            LDPR+DDFLPIL PFF+KQ K+ LEVRK+Q + I P I++R+RALENPGSDK+A +FSYL
Sbjct  217  LDPRIDDFLPILGPFFAKQWKKALEVRKEQTDFIYPFIQQRKRALENPGSDKAATSFSYL  276

Query  184  DTLFDLTVEGRKSSPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEI  363
            DTLFDL +EGR S PT  ELVTL SEFLNGGTDTT TA+EW IA+LI NP +Q KLYEEI
Sbjct  277  DTLFDLKIEGRSSVPTKDELVTLCSEFLNGGTDTTGTAVEWGIAQLIANPEVQRKLYEEI  336

Query  364  KSVVG--DRKVDEKDTDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCG  537
            ++VVG  DRKVDEKD +KMPYL AVVKELLRKHPPT F+LTHAVT+ TKL GYDIP D  
Sbjct  337  QNVVGSSDRKVDEKDVEKMPYLEAVVKELLRKHPPTPFSLTHAVTETTKLAGYDIPTDAN  396

Query  538  VEFFLPAISDDPTLWSDPEKFDPDRFLSGGEDADITGVTAVKMMPFG  678
            V+ FL  ISDDP +WSDPE+FDP+RFL GGE     G   + M+PFG
Sbjct  397  VDIFLSGISDDPNVWSDPERFDPNRFL-GGEQG---GGNDMTMLPFG  439



>ref|XP_011655840.1| PREDICTED: cytochrome P450 77A3-like [Cucumis sativus]
 gb|KGN52206.1| hypothetical protein Csa_5G615280 [Cucumis sativus]
Length=504

 Score =   323 bits (827),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 154/230 (67%), Positives = 182/230 (79%), Gaps = 5/230 (2%)
 Frame = +1

Query  4    LDPRVDDFLPILSPFFSKQRKRVLEVRKQQIETIVPLIERRRRALENPGSDKSAATFSYL  183
            LDPR+DD+ PILSPFFS++R R   VR++Q+E +V LI RRRRALENP SD  A +FSYL
Sbjct  213  LDPRIDDYFPILSPFFSRERNRANLVRRKQVEFVVELINRRRRALENPASDGDATSFSYL  272

Query  184  DTLFDLTV-----EGRKSSPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSK  348
            DTLFD  +     EG+ SS T+ ELVTL SEFLNGGTDTTAT IEW +A LI N  IQ K
Sbjct  273  DTLFDFKIDGRGGEGKSSSATDEELVTLCSEFLNGGTDTTATVIEWGMAELIANEEIQRK  332

Query  349  LYEEIKSVVGDRKVDEKDTDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPM  528
            + EEIK  VG+RKV+E+D +KM YL AVVKE+LRKHPPTFFALTH+VT+ TKL GYDIP 
Sbjct  333  IVEEIKETVGERKVEEEDVEKMVYLQAVVKEVLRKHPPTFFALTHSVTETTKLAGYDIPN  392

Query  529  DCGVEFFLPAISDDPTLWSDPEKFDPDRFLSGGEDADITGVTAVKMMPFG  678
            D  VEFFLPAI  DP LW +P+KF+P+RF SG E+ADITGV+ V+MMPFG
Sbjct  393  DTNVEFFLPAIGRDPKLWKNPDKFEPERFYSGMEEADITGVSGVRMMPFG  442



>ref|NP_196083.1| cytochrome P450, family 77, subfamily A, polypeptide 9 [Arabidopsis 
thaliana]
 emb|CAB85569.1| cytochrome P450-like protein [Arabidopsis thaliana]
 gb|AED90767.1| cytochrome P450, family 77, subfamily A, polypeptide 9 [Arabidopsis 
thaliana]
Length=509

 Score =   323 bits (827),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 148/226 (65%), Positives = 187/226 (83%), Gaps = 1/226 (0%)
 Frame = +1

Query  4    LDPRVDDFLPILSPFFSKQRKRVLEVRKQQIETIVPLIERRRRALENPGSDKSAATFSYL  183
            +DPR+ D+LPIL+PF+ K+RK  LE+R++ ++ +V  IE+RR A+ N GSDK+A++F+YL
Sbjct  222  VDPRIHDYLPILTPFYFKERKNSLELRRKLVQFVVGFIEKRRLAIRNLGSDKTASSFAYL  281

Query  184  DTLFDLTVEGRKSSPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEI  363
            DTLFDL V+GR++SP++ +LVTL SEFLN GTDTT TAIEW IA LI NP IQS+LY+EI
Sbjct  282  DTLFDLRVDGRETSPSDEDLVTLCSEFLNAGTDTTGTAIEWGIAELISNPKIQSRLYDEI  341

Query  364  KSVVG-DRKVDEKDTDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGV  540
            KS VG DR V+EKD +KM +L A VKELLR+HPPT+F LTH VT+PT L GYDIP+   V
Sbjct  342  KSTVGDDRTVEEKDLNKMVFLQAFVKELLRRHPPTYFTLTHGVTEPTNLAGYDIPVGANV  401

Query  541  EFFLPAISDDPTLWSDPEKFDPDRFLSGGEDADITGVTAVKMMPFG  678
            EF+LP IS+DP +WS PEKFDPDRF++GGEDAD+TGV  VKMMPFG
Sbjct  402  EFYLPGISEDPKIWSKPEKFDPDRFITGGEDADLTGVAGVKMMPFG  447



>ref|XP_006287416.1| hypothetical protein CARUB_v10000621mg, partial [Capsella rubella]
 gb|EOA20314.1| hypothetical protein CARUB_v10000621mg, partial [Capsella rubella]
Length=553

 Score =   324 bits (830),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 146/226 (65%), Positives = 188/226 (83%), Gaps = 1/226 (0%)
 Frame = +1

Query  4    LDPRVDDFLPILSPFFSKQRKRVLEVRKQQIETIVPLIERRRRALENPGSDKSAATFSYL  183
            +DP++ D+LPIL+PF+ K+RK+ LE+R++ +E +V  IE+RR A+ NPGSD++A++F+YL
Sbjct  266  VDPQIHDYLPILTPFYFKERKKALELRRELVEFVVGFIEKRRSAIRNPGSDETASSFAYL  325

Query  184  DTLFDLTVEGRKSSPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEI  363
            DTLFDL V+GR+++P++ +LVTL SEFLN GTDTT TAIEW IA LI NP IQS+LY EI
Sbjct  326  DTLFDLRVDGRETTPSDEDLVTLCSEFLNAGTDTTGTAIEWGIAELISNPEIQSRLYNEI  385

Query  364  KSVVG-DRKVDEKDTDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGV  540
            KS VG DR V+E+D D+M +L A VKELLR+HPPT+F LTH VT+PTKL GYDIP+   V
Sbjct  386  KSTVGDDRDVEERDLDRMVFLRAFVKELLRRHPPTYFTLTHGVTEPTKLSGYDIPVGANV  445

Query  541  EFFLPAISDDPTLWSDPEKFDPDRFLSGGEDADITGVTAVKMMPFG  678
            EF+LP IS+DP +WS P KFDPDRF++GGEDAD+TGV  VKMMPFG
Sbjct  446  EFYLPGISEDPKIWSKPGKFDPDRFITGGEDADLTGVAGVKMMPFG  491



>ref|XP_008446777.1| PREDICTED: LOW QUALITY PROTEIN: cytochrome P450 77A3-like [Cucumis 
melo]
Length=503

 Score =   318 bits (815),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 152/229 (66%), Positives = 179/229 (78%), Gaps = 4/229 (2%)
 Frame = +1

Query  4    LDPRVDDFLPILSPFFSKQRKRVLEVRKQQIETIVPLIERRRRALENPGSDKSAATFSYL  183
            LDPR+DD+ PIL+PFF ++R R   VRK+Q+E +V LI RRRRALENP SD  A  FSYL
Sbjct  213  LDPRIDDYFPILTPFFXRERNRATLVRKKQVEFVVELINRRRRALENPASDGDATPFSYL  272

Query  184  DTLFDLTVEGR----KSSPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKL  351
            DTLFD  ++GR     SS T  ELVTL SEFLNGGTDTTAT IEW +A LI N  IQ K+
Sbjct  273  DTLFDFRIDGRSGGGNSSATEEELVTLCSEFLNGGTDTTATVIEWGMAELIANEEIQRKI  332

Query  352  YEEIKSVVGDRKVDEKDTDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMD  531
             EEIK  VG+RKV+E+D +KM YL +VVKE+LRKHPPTFFALTH+VT+ TKL GYDIP D
Sbjct  333  VEEIKETVGERKVEEEDVEKMVYLQSVVKEVLRKHPPTFFALTHSVTEATKLAGYDIPKD  392

Query  532  CGVEFFLPAISDDPTLWSDPEKFDPDRFLSGGEDADITGVTAVKMMPFG  678
              VEFFLPAI  DP LW +P+KF+P+RF SG E+ADITGV+ V+MMPFG
Sbjct  393  TNVEFFLPAIGRDPKLWKNPDKFEPERFYSGMEEADITGVSGVRMMPFG  441



>ref|XP_009414952.1| PREDICTED: cytochrome P450 77A2-like [Musa acuminata subsp. malaccensis]
Length=537

 Score =   315 bits (807),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 141/225 (63%), Positives = 186/225 (83%), Gaps = 0/225 (0%)
 Frame = +1

Query  4    LDPRVDDFLPILSPFFSKQRKRVLEVRKQQIETIVPLIERRRRALENPGSDKSAATFSYL  183
            + PR+DD+LP L PF+++ +K+VLE+RK+Q+ET+V LI RRR  L++P  + +AA FSYL
Sbjct  251  ISPRMDDYLPFLRPFYARHQKKVLEIRKEQVETVVSLINRRRSILKDPSLEPNAAPFSYL  310

Query  184  DTLFDLTVEGRKSSPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEI  363
            D+L DL VEGR ++PT AELVTL SEF+NGGTDTT+TAIEWA+AR+I++P IQ+KLY+EI
Sbjct  311  DSLLDLKVEGRDTAPTEAELVTLCSEFINGGTDTTSTAIEWAMARIIDDPNIQAKLYKEI  370

Query  364  KSVVGDRKVDEKDTDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVE  543
             + VGDR VD+++ +KMPYL A VKELLRKHPPT+F+LTHA  +P KLGGYDIP D  +E
Sbjct  371  VAEVGDRPVDDRNIEKMPYLQAFVKELLRKHPPTYFSLTHAAVEPAKLGGYDIPPDANLE  430

Query  544  FFLPAISDDPTLWSDPEKFDPDRFLSGGEDADITGVTAVKMMPFG  678
             FL  I++DP LWS+P +F+PDRF++GGE ADITG   +KM+PFG
Sbjct  431  LFLLTIAEDPRLWSNPLEFNPDRFITGGETADITGSAGIKMIPFG  475



>ref|XP_010940445.1| PREDICTED: cytochrome P450 77A2 [Elaeis guineensis]
Length=524

 Score =   314 bits (804),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 146/226 (65%), Positives = 184/226 (81%), Gaps = 1/226 (0%)
 Frame = +1

Query  4    LDPRVDDFLPILSPFFSKQRKRVLEVRKQQIETIVPLIERRRRALENPGSDKSAATFSYL  183
            L+PR+DD+LP L   + KQR+  L+VRK+QIETI+PLIE+R+  L++P  D SAA FSYL
Sbjct  237  LNPRIDDYLPFLGFLYYKQRRHALQVRKEQIETILPLIEKRKAILKDPTIDPSAAPFSYL  296

Query  184  DTLFDLTVEGRKSS-PTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEE  360
            D+L DL VEGR ++ P+N ELVTL SEF+NGGTDTTATAIEWAIARLIE+P  Q++++ E
Sbjct  297  DSLLDLKVEGRSAAAPSNEELVTLCSEFINGGTDTTATAIEWAIARLIEDPSRQARIHGE  356

Query  361  IKSVVGDRKVDEKDTDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGV  540
            I +  GDR VDE+DT+KM YL A VKELLRKHPPT+F+LTHA  QP KLGGYDIP +  +
Sbjct  357  IIAECGDRPVDERDTEKMVYLQAFVKELLRKHPPTYFSLTHAAIQPAKLGGYDIPTNANL  416

Query  541  EFFLPAISDDPTLWSDPEKFDPDRFLSGGEDADITGVTAVKMMPFG  678
            E FLP IS+DP  WS+P  F+PDRFL+GGE+AD+TGVT ++M+PFG
Sbjct  417  EIFLPTISEDPRFWSNPTGFNPDRFLTGGENADMTGVTGIRMIPFG  462



>emb|CDY44872.1| BnaC09g50720D [Brassica napus]
Length=496

 Score =   312 bits (799),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 139/225 (62%), Positives = 185/225 (82%), Gaps = 4/225 (2%)
 Frame = +1

Query  4    LDPRVDDFLPILSPFFSKQRKRVLEVRKQQIETIVPLIERRRRALENPGSDKSAATFSYL  183
            +DPR+ D+LP+L+PF+SK+RK  LE+R++ +E +V  IE+RR A++NP    +A++F+YL
Sbjct  214  VDPRIHDYLPVLTPFYSKERKLALELRRKLVEFVVGFIEKRRSAIQNP----TASSFAYL  269

Query  184  DTLFDLTVEGRKSSPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEI  363
            DTLF+L ++GR+++P++ +LVTL SEFLN GTDTT TAIEW IA+LI NP IQS+LY+EI
Sbjct  270  DTLFNLKIDGRETTPSDEDLVTLCSEFLNAGTDTTGTAIEWGIAQLITNPKIQSRLYDEI  329

Query  364  KSVVGDRKVDEKDTDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVE  543
            KS VGDR VDEKD D M +L A VKE+LR+HPPT+F L+H VT+PT L GYDIP+   VE
Sbjct  330  KSTVGDRTVDEKDLDTMVFLKAFVKEILRRHPPTYFTLSHGVTEPTTLSGYDIPVGANVE  389

Query  544  FFLPAISDDPTLWSDPEKFDPDRFLSGGEDADITGVTAVKMMPFG  678
            F+LP +S+DP +W  P+KFDPDRF++GGEDAD+TGV  VKMMPFG
Sbjct  390  FYLPGMSEDPNIWFKPDKFDPDRFITGGEDADLTGVAGVKMMPFG  434



>ref|XP_009392677.1| PREDICTED: cytochrome P450 77A2-like [Musa acuminata subsp. malaccensis]
Length=510

 Score =   311 bits (797),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 139/225 (62%), Positives = 182/225 (81%), Gaps = 0/225 (0%)
 Frame = +1

Query  4    LDPRVDDFLPILSPFFSKQRKRVLEVRKQQIETIVPLIERRRRALENPGSDKSAATFSYL  183
            + PR+DD+LP L P ++K +K+VLE+RK+Q+E +V LI RRR  L++P  + +AA FSYL
Sbjct  224  ISPRMDDYLPFLRPLYAKHQKKVLEIRKEQVEAVVALINRRRAILKDPSLEPNAAPFSYL  283

Query  184  DTLFDLTVEGRKSSPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEI  363
            D+L DL VEGR S+PT  +LVTL SEF+NGGTDTT+TAIEWA+AR+I++P IQ+ LYEEI
Sbjct  284  DSLLDLKVEGRDSAPTETQLVTLCSEFINGGTDTTSTAIEWAMARIIDDPNIQANLYEEI  343

Query  364  KSVVGDRKVDEKDTDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVE  543
             + VGDR VD++D +KMPYL A VKELLRKHPPT+F+LTHA  +P +LGGYDIP D  +E
Sbjct  344  VAEVGDRPVDDRDIEKMPYLQAFVKELLRKHPPTYFSLTHAAVEPARLGGYDIPPDANLE  403

Query  544  FFLPAISDDPTLWSDPEKFDPDRFLSGGEDADITGVTAVKMMPFG  678
             FLP I++DP LWS P +F+PDRF++GGE ADITG   ++M+PFG
Sbjct  404  LFLPTIAEDPRLWSSPLEFNPDRFITGGETADITGSAGIRMIPFG  448



>ref|XP_006407540.1| hypothetical protein EUTSA_v10022031mg [Eutrema salsugineum]
 gb|ESQ48993.1| hypothetical protein EUTSA_v10022031mg [Eutrema salsugineum]
Length=520

 Score =   311 bits (797),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 145/227 (64%), Positives = 186/227 (82%), Gaps = 2/227 (1%)
 Frame = +1

Query  4    LDPRVDDFLPILSPFFSKQRKRVLEVRKQQIETIVPLIERRRRALENP-GSDKSAATFSY  180
            +DP++ D+LPIL+PF +  R R LE+R++ +E +V  IE+R++A+ NP GSD++A++FSY
Sbjct  230  VDPKLHDYLPILTPFNAGGRNRALELRRELVEFVVRFIEKRKKAIWNPEGSDETASSFSY  289

Query  181  LDTLFDL-TVEGRKSSPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYE  357
            LDTLFDL  VEG +++P++ +LVTL SEFLN GTDTT  AIEW IA LI NP IQS+LY+
Sbjct  290  LDTLFDLRVVEGSETTPSDEDLVTLCSEFLNAGTDTTGAAIEWGIAELIANPEIQSRLYD  349

Query  358  EIKSVVGDRKVDEKDTDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCG  537
            EIKS VGDR V+EKD DKM +L AVVKELLR+HPPT+F L+H VT+PT L GY+IP+   
Sbjct  350  EIKSTVGDRAVEEKDVDKMVFLQAVVKELLRRHPPTYFTLSHGVTEPTTLSGYNIPVGVN  409

Query  538  VEFFLPAISDDPTLWSDPEKFDPDRFLSGGEDADITGVTAVKMMPFG  678
            +EF+LP IS+DP +WSDP+KFDPDRF+SG EDADITGV  VKMMPFG
Sbjct  410  IEFYLPGISEDPKIWSDPKKFDPDRFVSGREDADITGVAGVKMMPFG  456



>ref|XP_008775191.1| PREDICTED: cytochrome P450 77A2 [Phoenix dactylifera]
Length=524

 Score =   308 bits (788),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 141/226 (62%), Positives = 184/226 (81%), Gaps = 1/226 (0%)
 Frame = +1

Query  4    LDPRVDDFLPILSPFFSKQRKRVLEVRKQQIETIVPLIERRRRALENPGSDKSAATFSYL  183
            L+PR+DD+LP L   F KQR+  L+VR++QI+T++PLIE+RR  L++P  D SAA FSYL
Sbjct  237  LNPRIDDYLPFLGFLFHKQRRHALQVRREQIDTVLPLIEKRRAILKDPRVDPSAAPFSYL  296

Query  184  DTLFDLTVEGRKSS-PTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEE  360
            D+L DL V+GR ++ P+  ELVTL SEF+NGGTDTTATAIEW IARLIE+P  Q+++++E
Sbjct  297  DSLLDLKVDGRSAAAPSEEELVTLCSEFINGGTDTTATAIEWGIARLIEDPSRQARIHDE  356

Query  361  IKSVVGDRKVDEKDTDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGV  540
            I +V GDR VDE+DT+KM YL A VKELLRKHPPT+F+LTHA  QP KLGGYDIP +  +
Sbjct  357  ILAVCGDRPVDERDTEKMVYLQAFVKELLRKHPPTYFSLTHAAIQPAKLGGYDIPTNANL  416

Query  541  EFFLPAISDDPTLWSDPEKFDPDRFLSGGEDADITGVTAVKMMPFG  678
            + FLP I++DP  WS+P +F+PDRFL+GGE AD+TGVT ++M+PFG
Sbjct  417  DIFLPTIAEDPRFWSNPTEFNPDRFLTGGEIADMTGVTGIRMIPFG  462



>gb|KFK24906.1| hypothetical protein AALP_AA8G040400 [Arabis alpina]
Length=420

 Score =   304 bits (779),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 135/225 (60%), Positives = 181/225 (80%), Gaps = 9/225 (4%)
 Frame = +1

Query  4    LDPRVDDFLPILSPFFSKQRKRVLEVRKQQIETIVPLIERRRRALENPGSDKSAATFSYL  183
            +DPR+DD+LPIL+PFF K+R++ L+VR++QI+ +V +IE+R         +K+   FSYL
Sbjct  143  VDPRIDDYLPILAPFFIKERRKALQVRREQIDYVVGIIEKR---------NKTTTFFSYL  193

Query  184  DTLFDLTVEGRKSSPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEI  363
            DTL DL +EGR+++P+N ELVTL SEFLNGGTDTT TAIEW IA +I NP IQ ++Y+EI
Sbjct  194  DTLLDLKIEGRETTPSNEELVTLCSEFLNGGTDTTGTAIEWGIAEMIANPEIQCRIYDEI  253

Query  364  KSVVGDRKVDEKDTDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVE  543
            +S+VGDR+++E D ++M YL A VKELLRKHPPT+F+LTHAV + T LGGYDIP+   VE
Sbjct  254  RSIVGDRRIEEGDVERMVYLQAFVKELLRKHPPTYFSLTHAVMETTTLGGYDIPVGVNVE  313

Query  544  FFLPAISDDPTLWSDPEKFDPDRFLSGGEDADITGVTAVKMMPFG  678
             F+P I++DP +W +P+KFDPDRF+ G EDADITG++ VKM+PFG
Sbjct  314  VFIPGINEDPKIWVNPKKFDPDRFMLGKEDADITGISGVKMIPFG  358



>ref|XP_010490979.1| PREDICTED: cytochrome P450 77A4-like [Camelina sativa]
Length=508

 Score =   305 bits (780),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 145/226 (64%), Positives = 187/226 (83%), Gaps = 1/226 (0%)
 Frame = +1

Query  4    LDPRVDDFLPILSPFFSKQRKRVLEVRKQQIETIVPLIERRRRALENPGSDKSAATFSYL  183
            +DPR+ D+LPIL+PF+ K+R+R LE+R++ +E +V  IE+RR A+ NPGSD++A++F+YL
Sbjct  221  VDPRIHDYLPILTPFYFKERRRALELRRKLVEFVVRFIEKRRSAILNPGSDETASSFAYL  280

Query  184  DTLFDLTVEGRKSSPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEI  363
            DTLFDL V GR+++P++ +LVTL SEFLN GTDTT TAIEW +A LI NP IQS+LY+EI
Sbjct  281  DTLFDLKVHGRETTPSDEDLVTLCSEFLNAGTDTTGTAIEWGVAELISNPEIQSRLYDEI  340

Query  364  KSVVG-DRKVDEKDTDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGV  540
            KS VG DR V+EKD DK+ +L A VKELLR+HPPT+F LTH VT+PT L GYDIP+   V
Sbjct  341  KSTVGDDRSVEEKDLDKLVFLRAFVKELLRRHPPTYFTLTHGVTEPTNLSGYDIPVGANV  400

Query  541  EFFLPAISDDPTLWSDPEKFDPDRFLSGGEDADITGVTAVKMMPFG  678
            EF+LP IS+DP +W  P+KFDPDRF++GGEDAD+TGV  VKMMPFG
Sbjct  401  EFYLPGISEDPKIWFKPDKFDPDRFITGGEDADLTGVAGVKMMPFG  446



>ref|XP_010423555.1| PREDICTED: cytochrome P450 77A4-like [Camelina sativa]
Length=508

 Score =   300 bits (769),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 143/226 (63%), Positives = 186/226 (82%), Gaps = 1/226 (0%)
 Frame = +1

Query  4    LDPRVDDFLPILSPFFSKQRKRVLEVRKQQIETIVPLIERRRRALENPGSDKSAATFSYL  183
            +DPR+ D+LPIL+PF+ K+R+R LE+R++ +E +V  IE+RR A+ NPGSD++A++F+YL
Sbjct  221  VDPRIHDYLPILTPFYFKERRRALELRRKLVEFVVGFIEKRRSAILNPGSDETASSFAYL  280

Query  184  DTLFDLTVEGRKSSPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEI  363
            DTLFDL V GR+++P++ +LVTL SEFLN GTDTT TAIEW +A LI  P IQ++LY+EI
Sbjct  281  DTLFDLKVHGRETTPSDEDLVTLCSEFLNAGTDTTGTAIEWGVAELISFPEIQTRLYDEI  340

Query  364  KSVVG-DRKVDEKDTDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGV  540
            KS VG DR V+EKD DK+ +L A VKELLR+HPPT+F LTH VT+PT L GYDIP+   V
Sbjct  341  KSTVGDDRNVEEKDLDKLVFLRAFVKELLRRHPPTYFTLTHGVTEPTNLSGYDIPVGANV  400

Query  541  EFFLPAISDDPTLWSDPEKFDPDRFLSGGEDADITGVTAVKMMPFG  678
            EF+LP IS+DP +W  P+KFDPDRF++GGEDAD+TGV  VKMMPFG
Sbjct  401  EFYLPGISEDPKIWFKPDKFDPDRFITGGEDADLTGVAGVKMMPFG  446



>dbj|BAF02252.1| putative cytochrome P450 [Arabidopsis thaliana]
Length=298

 Score =   293 bits (750),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 136/226 (60%), Positives = 178/226 (79%), Gaps = 5/226 (2%)
 Frame = +1

Query  4    LDPRVDDFLPILSPFFSKQRKRVLEVRKQQIETIVPLIERRRRALENPGSDKSAATFSYL  183
            +DP++ D+LPIL+PF   +R R L++R++ ++ +V  IE+RR+A+       + ++FSYL
Sbjct  14   VDPKLHDYLPILTPFNYNERNRALKLRRELVDFVVGFIEKRRKAIRT----ATVSSFSYL  69

Query  184  DTLFDL-TVEGRKSSPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEE  360
            DTLFDL  +EG +++P++ +LVTL SEFLN GTDTT  AIEW IA LI NP IQS+LY+E
Sbjct  70   DTLFDLRIIEGSETTPSDEDLVTLCSEFLNAGTDTTGAAIEWGIAELIANPEIQSRLYDE  129

Query  361  IKSVVGDRKVDEKDTDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGV  540
            IKS VGDR VDE+D DKM  L AVVKE+LR+HPPT+F L+H VT+PT L GY+IP+   +
Sbjct  130  IKSTVGDRAVDERDVDKMVLLQAVVKEILRRHPPTYFTLSHGVTEPTTLSGYNIPVGVNI  189

Query  541  EFFLPAISDDPTLWSDPEKFDPDRFLSGGEDADITGVTAVKMMPFG  678
            EF+LP IS+DP +WS+P+KFDPDRFLSG EDADITGV  VKMMPFG
Sbjct  190  EFYLPGISEDPKIWSEPKKFDPDRFLSGREDADITGVAGVKMMPFG  235



>ref|XP_002530881.1| cytochrome P450, putative [Ricinus communis]
 gb|EEF31487.1| cytochrome P450, putative [Ricinus communis]
Length=482

 Score =   293 bits (751),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 136/188 (72%), Positives = 157/188 (84%), Gaps = 0/188 (0%)
 Frame = +1

Query  115  IERRRRALENPGSDKSAATFSYLDTLFDLTVEGRKSSPTNAELVTLVSEFLNGGTDTTAT  294
            IE+RRRAL+NPGS   A +FSYLDTLFDL +EGRKSSPT+ ELVTL SEFLNGGTDTTAT
Sbjct  233  IEKRRRALQNPGSTSQAMSFSYLDTLFDLQIEGRKSSPTDPELVTLCSEFLNGGTDTTAT  292

Query  295  AIEWAIARLIENPGIQSKLYEEIKSVVGDRKVDEKDTDKMPYLNAVVKELLRKHPPTFFA  474
            A+EW IA+LI+NP +Q KLY EI   VG+RKV+EKD +KM YL AVVKELLRKHPPTFF 
Sbjct  293  AVEWGIAQLIDNPDVQEKLYNEIIKTVGNRKVNEKDVEKMEYLQAVVKELLRKHPPTFFL  352

Query  475  LTHAVTQPTKLGGYDIPMDCGVEFFLPAISDDPTLWSDPEKFDPDRFLSGGEDADITGVT  654
            LTHAV++PT LGGYDIP D  +E F  AI  DP +WS+P+KFDPDRF+SG E+ADITGVT
Sbjct  353  LTHAVSEPTTLGGYDIPTDTNIEIFSQAIGQDPKIWSNPKKFDPDRFISGNEEADITGVT  412

Query  655  AVKMMPFG  678
             +KM PFG
Sbjct  413  GIKMTPFG  420



>ref|NP_187667.1| cytochrome P450 protein UNE9 [Arabidopsis thaliana]
 gb|AAG51393.1|AC011560_25 putative cytochrome P450; 47418-45874 [Arabidopsis thaliana]
 gb|AAF76358.1| cytochrome P450, putative [Arabidopsis thaliana]
 gb|AEE74925.1| cytochrome P450 protein UNE9 [Arabidopsis thaliana]
Length=514

 Score =   294 bits (753),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 136/226 (60%), Positives = 178/226 (79%), Gaps = 5/226 (2%)
 Frame = +1

Query  4    LDPRVDDFLPILSPFFSKQRKRVLEVRKQQIETIVPLIERRRRALENPGSDKSAATFSYL  183
            +DP++ D+LPIL+PF   +R R L++R++ ++ +V  IE+RR+A+       + ++FSYL
Sbjct  230  VDPKLHDYLPILTPFNYNERNRALKLRRELVDFVVGFIEKRRKAIRT----ATVSSFSYL  285

Query  184  DTLFDL-TVEGRKSSPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEE  360
            DTLFDL  +EG +++P++ +LVTL SEFLN GTDTT  AIEW IA LI NP IQS+LY+E
Sbjct  286  DTLFDLRIIEGSETTPSDEDLVTLCSEFLNAGTDTTGAAIEWGIAELIANPEIQSRLYDE  345

Query  361  IKSVVGDRKVDEKDTDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGV  540
            IKS VGDR VDE+D DKM  L AVVKE+LR+HPPT+F L+H VT+PT L GY+IP+   +
Sbjct  346  IKSTVGDRAVDERDVDKMVLLQAVVKEILRRHPPTYFTLSHGVTEPTTLSGYNIPVGVNI  405

Query  541  EFFLPAISDDPTLWSDPEKFDPDRFLSGGEDADITGVTAVKMMPFG  678
            EF+LP IS+DP +WS+P+KFDPDRFLSG EDADITGV  VKMMPFG
Sbjct  406  EFYLPGISEDPKIWSEPKKFDPDRFLSGREDADITGVAGVKMMPFG  451



>ref|XP_002882682.1| CYP77A7 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH58941.1| CYP77A7 [Arabidopsis lyrata subsp. lyrata]
Length=512

 Score =   292 bits (748),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 136/226 (60%), Positives = 179/226 (79%), Gaps = 5/226 (2%)
 Frame = +1

Query  4    LDPRVDDFLPILSPFFSKQRKRVLEVRKQQIETIVPLIERRRRALENPGSDKSAATFSYL  183
            +DP++ D+LPIL+PF   +R R L++R++ ++ +V  IE+RRR +      ++A++FSYL
Sbjct  229  IDPKLHDYLPILTPFNYNERDRALKLRRELVDFVVKFIEKRRRVI----LIETASSFSYL  284

Query  184  DTLFDL-TVEGRKSSPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEE  360
            DTLFDL  VEG +++P++ +LVTL SEFLN GTDTT  AIEW IA LI NP IQS+LY+E
Sbjct  285  DTLFDLRVVEGSETTPSDEDLVTLCSEFLNAGTDTTGAAIEWGIAELIANPEIQSRLYDE  344

Query  361  IKSVVGDRKVDEKDTDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGV  540
            IK  VGDR VDE+D +KM +L AVVKE+LR+HPPT+F L+H VT+PT L GY+IP+   +
Sbjct  345  IKLTVGDRAVDERDVEKMVFLQAVVKEILRRHPPTYFTLSHGVTEPTTLSGYNIPVGVNI  404

Query  541  EFFLPAISDDPTLWSDPEKFDPDRFLSGGEDADITGVTAVKMMPFG  678
            EF+LP IS+DP +WS+P+KFDPDRFLSG EDADITGV  VKMMPFG
Sbjct  405  EFYLPGISEDPKIWSEPKKFDPDRFLSGREDADITGVAGVKMMPFG  450



>ref|XP_002446399.1| hypothetical protein SORBIDRAFT_06g015320 [Sorghum bicolor]
 gb|EES10727.1| hypothetical protein SORBIDRAFT_06g015320 [Sorghum bicolor]
Length=544

 Score =   286 bits (732),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 137/234 (59%), Positives = 176/234 (75%), Gaps = 12/234 (5%)
 Frame = +1

Query  13   RVDDFLPILSPFFSKQRKRVLEVRKQQIETIVPLIERRRRALENPGSDKS----------  162
            R+DD+LP L PFF + ++R L VR++QI+T++PLI RRR  L +     S          
Sbjct  246  RMDDYLPFLRPFFWRHQRRALAVRREQIDTLLPLISRRRAILRDMQQRSSSPSPPPDPNV  305

Query  163  AATFSYLDTLFDLTVEGRKSSPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQ  342
            AA FSYLD++ DL +EGR  +PT+ ELVTL +E +NGGTDTTATAIEW +AR+++NP IQ
Sbjct  306  AAPFSYLDSVLDLHIEGRDGAPTDDELVTLCAELINGGTDTTATAIEWGMARIVDNPSIQ  365

Query  343  SKLYEEIKSVVGD-RKVDEKDTDKMPYLNAVVKELLRKHPPTFFALTHAVTQP-TKLGGY  516
            ++L+EEI   VGD R VD+KDTD MPYL A VKELLRKHPPT+F+LTHA  QP +KL GY
Sbjct  366  ARLHEEIMQQVGDARPVDDKDTDAMPYLQAFVKELLRKHPPTYFSLTHAAVQPGSKLAGY  425

Query  517  DIPMDCGVEFFLPAISDDPTLWSDPEKFDPDRFLSGGEDADITGVTAVKMMPFG  678
            D+P+D  ++ FLPAIS+DP LW  P +FDPDRFLSGGE AD+TG   ++M+PFG
Sbjct  426  DVPVDANLDIFLPAISEDPKLWDRPTEFDPDRFLSGGETADMTGSGGIRMIPFG  479



>gb|AGT16500.1| hypothetical protein SHCRBa_022_D13_R_80 [Saccharum hybrid cultivar 
R570]
Length=542

 Score =   285 bits (729),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 133/229 (58%), Positives = 174/229 (76%), Gaps = 7/229 (3%)
 Frame = +1

Query  13   RVDDFLPILSPFFSKQRKRVLEVRKQQIETIVPLIERRRRALEN-----PGSDKSAATFS  177
            R+DD+LP L PFF + ++R L VR++Q++T++PLI RRR  L +     P     AA FS
Sbjct  250  RMDDYLPFLRPFFWRHQRRALAVRREQVDTLLPLISRRRAILRDMKSSSPPDPNVAAPFS  309

Query  178  YLDTLFDLTVEGRKSSPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYE  357
            YLD++ DL +EGR  +PT+ ELVTL +E +NGGTDTTATAIEW +AR+++NP IQ++L+E
Sbjct  310  YLDSVLDLHIEGRDGAPTDDELVTLCAELINGGTDTTATAIEWGLARIVDNPSIQARLHE  369

Query  358  EIKSVVGD-RKVDEKDTDKMPYLNAVVKELLRKHPPTFFALTHAVTQP-TKLGGYDIPMD  531
            EI   VGD R VD+KDTD MPYL A VKELLRKHPPT+F+LTHA  QP +KL GYD+P+D
Sbjct  370  EIMHQVGDARPVDDKDTDAMPYLQAFVKELLRKHPPTYFSLTHAAVQPGSKLAGYDVPVD  429

Query  532  CGVEFFLPAISDDPTLWSDPEKFDPDRFLSGGEDADITGVTAVKMMPFG  678
              ++ FLP IS+DP LW  P +FDPDRF+SGGE  D+TG   ++M+PFG
Sbjct  430  ANLDIFLPTISEDPKLWDRPTEFDPDRFVSGGEMGDMTGSGGIRMIPFG  478



>gb|AGT16905.1| cytochrome P450 [Saccharum hybrid cultivar R570]
Length=543

 Score =   285 bits (728),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 133/229 (58%), Positives = 174/229 (76%), Gaps = 7/229 (3%)
 Frame = +1

Query  13   RVDDFLPILSPFFSKQRKRVLEVRKQQIETIVPLIERRRRALEN-----PGSDKSAATFS  177
            R+DD+LP L PFF + ++R L VR++Q++T++PLI RRR  L +     P     AA FS
Sbjct  250  RMDDYLPFLRPFFWRHQRRALAVRREQVDTLLPLISRRRAILRDMKSSSPPDPNVAAPFS  309

Query  178  YLDTLFDLTVEGRKSSPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYE  357
            YLD++ DL +EGR  +PT+ ELVTL +E +NGGTDTTATAIEW +AR+++NP IQ++L+E
Sbjct  310  YLDSVLDLHIEGRDGTPTDDELVTLCAELINGGTDTTATAIEWGMARIVDNPSIQARLHE  369

Query  358  EIKSVVGD-RKVDEKDTDKMPYLNAVVKELLRKHPPTFFALTHAVTQP-TKLGGYDIPMD  531
            EI   VGD R VD+KDTD MPYL A VKELLRKHPPT+F+LTHA  QP +KL GYD+P+D
Sbjct  370  EIMQQVGDARPVDDKDTDAMPYLQAFVKELLRKHPPTYFSLTHAAVQPGSKLAGYDVPVD  429

Query  532  CGVEFFLPAISDDPTLWSDPEKFDPDRFLSGGEDADITGVTAVKMMPFG  678
              ++ FLP IS+DP LW  P +FDPDRF+SGGE  D+TG   ++M+PFG
Sbjct  430  ANLDIFLPTISEDPKLWDRPTEFDPDRFVSGGEMGDMTGSGGIRMIPFG  478



>ref|NP_001052719.1| Os04g0407900 [Oryza sativa Japonica Group]
 dbj|BAF14633.1| Os04g0407900, partial [Oryza sativa Japonica Group]
Length=467

 Score =   275 bits (703),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 130/228 (57%), Positives = 173/228 (76%), Gaps = 7/228 (3%)
 Frame = +1

Query  13   RVDDFLPILSPFFSKQRKRVLEVRKQQIETIVPLIERRRRALE-----NPGSDKSAATFS  177
            R+DD+LP L PF  +Q ++ + +R++QI+T++PLI RRR  +      +P     AA +S
Sbjct  174  RIDDYLPFLRPFLWRQHRQAVALRREQIDTVLPLINRRRAIVRGMRAGSPPDPAVAAPYS  233

Query  178  YLDTLFDLTVEGRKSSPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYE  357
            YLD+L DL VEGR + PT+ ELVTL +E +NGGTDTTATAIEWA+AR+++NP IQ++L+ 
Sbjct  234  YLDSLLDLRVEGRDAVPTDEELVTLCAEMINGGTDTTATAIEWAMARVMDNPSIQARLHG  293

Query  358  EIKSVVGD-RKVDEKDTDKMPYLNAVVKELLRKHPPTFFALTHAVTQP-TKLGGYDIPMD  531
            EI   VGD R VD++DT+ MPYL A VKELLRKHPPT+FAL+HA  +P +KL GYD+P+D
Sbjct  294  EIMQRVGDARPVDDRDTEGMPYLKAFVKELLRKHPPTYFALSHAAVEPGSKLAGYDVPVD  353

Query  532  CGVEFFLPAISDDPTLWSDPEKFDPDRFLSGGEDADITGVTAVKMMPF  675
              ++ FLP IS+DP LW  P +FDPDRFL+GGE ADITG   V+M+PF
Sbjct  354  ANLDIFLPTISEDPKLWERPTEFDPDRFLAGGETADITGSAGVRMIPF  401



>emb|CAH66495.1| H0321H01.4 [Oryza sativa Indica Group]
 emb|CAH66519.1| OSIGBa0142C11.7 [Oryza sativa Indica Group]
Length=528

 Score =   276 bits (707),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 131/228 (57%), Positives = 173/228 (76%), Gaps = 7/228 (3%)
 Frame = +1

Query  13   RVDDFLPILSPFFSKQRKRVLEVRKQQIETIVPLIERRRRALE-----NPGSDKSAATFS  177
            R+DD+LP L PF  +Q ++ + +R++QI+T++PLI RRR  +      +P     AA +S
Sbjct  235  RIDDYLPFLRPFLWRQHRQAVALRREQIDTVLPLINRRRAIVRGMRAGSPPDPAVAAPYS  294

Query  178  YLDTLFDLTVEGRKSSPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYE  357
            YLD+L DL VEGR + PT+ ELVTL +E +NGGTDTTATAIEWA+AR+++NP IQ++L+ 
Sbjct  295  YLDSLLDLRVEGRDAVPTDEELVTLCAEMINGGTDTTATAIEWAMARVMDNPSIQARLHG  354

Query  358  EIKSVVGD-RKVDEKDTDKMPYLNAVVKELLRKHPPTFFALTHAVTQP-TKLGGYDIPMD  531
            EI   VGD R VD++DTD MPYL A VKELLRKHPPT+FAL+HA  +P +KL GYD+P+D
Sbjct  355  EIMQRVGDARPVDDRDTDGMPYLQAFVKELLRKHPPTYFALSHAAVEPGSKLAGYDVPVD  414

Query  532  CGVEFFLPAISDDPTLWSDPEKFDPDRFLSGGEDADITGVTAVKMMPF  675
              ++ FLP IS+DP LW  P +FDPDRFL+GGE ADITG   V+M+PF
Sbjct  415  ANLDIFLPTISEDPKLWERPTEFDPDRFLAGGETADITGSAGVRMIPF  462



>ref|XP_006652247.1| PREDICTED: cytochrome P450 77A4-like [Oryza brachyantha]
Length=442

 Score =   274 bits (700),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 129/229 (56%), Positives = 173/229 (76%), Gaps = 7/229 (3%)
 Frame = +1

Query  13   RVDDFLPILSPFFSKQRKRVLEVRKQQIETIVPLIERRRRALEN-----PGSDKSAATFS  177
            R+DD+LP L PF  +Q ++ + +R++QI+T++PLI RRR  + +     P     AA +S
Sbjct  149  RIDDYLPFLRPFLWRQHRQAVALRREQIDTVLPLINRRRAIVRDMKAGSPPDPSVAAPYS  208

Query  178  YLDTLFDLTVEGRKSSPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYE  357
            YLD+L DL VEGR + PT+ ELVTL +E +NGGTDTTAT IEWA+AR+++NP IQ++L++
Sbjct  209  YLDSLLDLRVEGRDAVPTDEELVTLCAEMINGGTDTTATGIEWAMARVMDNPSIQARLHD  268

Query  358  EIKSVVGD-RKVDEKDTDKMPYLNAVVKELLRKHPPTFFALTHAVTQP-TKLGGYDIPMD  531
            EI   VGD R V++KDT+ MPYL A VKELLRKHPPT+FAL+HA  +P +K+ GYDIP+D
Sbjct  269  EIMQHVGDARPVEDKDTEGMPYLQAFVKELLRKHPPTYFALSHAAIEPGSKIAGYDIPVD  328

Query  532  CGVEFFLPAISDDPTLWSDPEKFDPDRFLSGGEDADITGVTAVKMMPFG  678
              ++ FLP IS+DP LW  P +FDPDRFL+GGE ADITG   V+M+PF 
Sbjct  329  ANLDIFLPTISEDPKLWDRPTEFDPDRFLTGGETADITGSAGVRMIPFS  377



>emb|CAE04891.3| OSJNBa0042I15.13 [Oryza sativa Japonica Group]
Length=520

 Score =   275 bits (703),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 130/228 (57%), Positives = 173/228 (76%), Gaps = 7/228 (3%)
 Frame = +1

Query  13   RVDDFLPILSPFFSKQRKRVLEVRKQQIETIVPLIERRRRALE-----NPGSDKSAATFS  177
            R+DD+LP L PF  +Q ++ + +R++QI+T++PLI RRR  +      +P     AA +S
Sbjct  227  RIDDYLPFLRPFLWRQHRQAVALRREQIDTVLPLINRRRAIVRGMRAGSPPDPAVAAPYS  286

Query  178  YLDTLFDLTVEGRKSSPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYE  357
            YLD+L DL VEGR + PT+ ELVTL +E +NGGTDTTATAIEWA+AR+++NP IQ++L+ 
Sbjct  287  YLDSLLDLRVEGRDAVPTDEELVTLCAEMINGGTDTTATAIEWAMARVMDNPSIQARLHG  346

Query  358  EIKSVVGD-RKVDEKDTDKMPYLNAVVKELLRKHPPTFFALTHAVTQP-TKLGGYDIPMD  531
            EI   VGD R VD++DT+ MPYL A VKELLRKHPPT+FAL+HA  +P +KL GYD+P+D
Sbjct  347  EIMQRVGDARPVDDRDTEGMPYLKAFVKELLRKHPPTYFALSHAAVEPGSKLAGYDVPVD  406

Query  532  CGVEFFLPAISDDPTLWSDPEKFDPDRFLSGGEDADITGVTAVKMMPF  675
              ++ FLP IS+DP LW  P +FDPDRFL+GGE ADITG   V+M+PF
Sbjct  407  ANLDIFLPTISEDPKLWERPTEFDPDRFLAGGETADITGSAGVRMIPF  454



>ref|NP_001132177.1| uncharacterized protein LOC100193602 [Zea mays]
 gb|ACF80918.1| unknown [Zea mays]
Length=545

 Score =   273 bits (699),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 132/234 (56%), Positives = 173/234 (74%), Gaps = 12/234 (5%)
 Frame = +1

Query  13   RVDDFLPILSPFFSKQRKRVLEVRKQQIETIVPLIERRRRALENPGSDKS---------A  165
            R+DD+LP L PFF + ++R L VR++QI+T++PLI RRR  L +    +S         A
Sbjct  247  RMDDYLPFLRPFFWRHQRRALAVRREQIDTLLPLINRRRAMLRDMQQRQSSSPPPDPSVA  306

Query  166  ATFSYLDTLFDLTVEGRK-SSPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQ  342
            A FSYLD++ DL +EGR   + T+ ELVTL +E LNGGTDTTATAIEW +AR++++P IQ
Sbjct  307  APFSYLDSVLDLRIEGRDDGALTDDELVTLCAELLNGGTDTTATAIEWGMARIVDSPSIQ  366

Query  343  SKLYEEIKSVVGD-RKVDEKDTDKMPYLNAVVKELLRKHPPTFFALTHAVTQP-TKLGGY  516
            ++L+EE+   VGD R VD+KDTD MPYL   VKELLRKHPPT+F+LTHA  QP  KL GY
Sbjct  367  ARLHEEVMQQVGDARPVDDKDTDAMPYLQTFVKELLRKHPPTYFSLTHAAVQPGCKLAGY  426

Query  517  DIPMDCGVEFFLPAISDDPTLWSDPEKFDPDRFLSGGEDADITGVTAVKMMPFG  678
            D+P+D  ++ FLP IS+DP LW  P +FDPDRF+SGGE AD+TG   ++M+PFG
Sbjct  427  DVPVDANLDIFLPTISEDPKLWDRPTEFDPDRFVSGGETADMTGSAGIRMIPFG  480



>tpg|DAA37962.1| TPA: putative cytochrome P450 superfamily protein [Zea mays]
Length=612

 Score =   274 bits (701),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 133/234 (57%), Positives = 174/234 (74%), Gaps = 12/234 (5%)
 Frame = +1

Query  13   RVDDFLPILSPFFSKQRKRVLEVRKQQIETIVPLIERRRRALENPGSDKS---------A  165
            R+DD+LP L PFF + ++R L VR++QI+T++PLI RRR  L +    +S         A
Sbjct  314  RMDDYLPFLRPFFWRHQRRALAVRREQIDTLLPLINRRRAMLRDMQQRQSSSPPPDPSVA  373

Query  166  ATFSYLDTLFDLTVEGRK-SSPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQ  342
            A FSYLD++ DL +EGR   + T+ ELVTL +E LNGGTDTTATAIEW +AR++++P IQ
Sbjct  374  APFSYLDSVLDLRIEGRDDGALTDDELVTLCAELLNGGTDTTATAIEWGMARIVDSPSIQ  433

Query  343  SKLYEEIKSVVGD-RKVDEKDTDKMPYLNAVVKELLRKHPPTFFALTHAVTQP-TKLGGY  516
            ++L+EE+   VGD R VD+KDTD MPYL A VKELLRKHPPT+F+LTHA  QP  KL GY
Sbjct  434  ARLHEEVMQQVGDARPVDDKDTDAMPYLQAFVKELLRKHPPTYFSLTHAAVQPGCKLAGY  493

Query  517  DIPMDCGVEFFLPAISDDPTLWSDPEKFDPDRFLSGGEDADITGVTAVKMMPFG  678
            D+P+D  ++ FLP IS+DP LW  P +FDPDRF+SGGE AD+TG   ++M+PFG
Sbjct  494  DVPVDANLDIFLPTISEDPKLWDRPTEFDPDRFVSGGETADMTGSAGIRMIPFG  547



>ref|XP_003581190.2| PREDICTED: cytochrome P450 77A4-like [Brachypodium distachyon]
Length=523

 Score =   271 bits (692),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 136/228 (60%), Positives = 175/228 (77%), Gaps = 6/228 (3%)
 Frame = +1

Query  13   RVDDFLPILSPFFSKQRKRVLEVRKQQIETIVPLIERRRRALEN----PGSDKSAATFSY  180
            R+DD+LP L PFF +Q++R L+VR++Q++T++PLI RRR  L +    P     AA FSY
Sbjct  231  RMDDYLPFLRPFFRRQQRRALDVRREQVDTLLPLINRRRAILRDRDTRPADPDVAAPFSY  290

Query  181  LDTLFDLTVEGRKSSPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEE  360
            LD+L DL +EGR    ++ ELVTL +E +NGGTDTTATAIEWA+AR+++NP IQ++L+EE
Sbjct  291  LDSLLDLRIEGRDGVASDDELVTLCAELINGGTDTTATAIEWAMARIVDNPSIQARLHEE  350

Query  361  IKSVVGD-RKVDEKDTDKMPYLNAVVKELLRKHPPTFFALTHAVTQP-TKLGGYDIPMDC  534
            I   VGD R VDEKDTD MPYL A VKELLRKHPPT+F+LTHA  +P +KL GYD+P D 
Sbjct  351  IMQQVGDTRPVDEKDTDGMPYLQAFVKELLRKHPPTYFSLTHAAVKPGSKLAGYDVPADA  410

Query  535  GVEFFLPAISDDPTLWSDPEKFDPDRFLSGGEDADITGVTAVKMMPFG  678
             ++ FLP IS+DP LW  P +FDPDRFLSGGE AD+TG   ++M+PFG
Sbjct  411  NLDIFLPGISEDPKLWDRPAEFDPDRFLSGGETADMTGSAGIRMIPFG  458



>gb|ABC68410.1| cytochrome P450 monooxygenase CYP77A3v2 [Glycine max]
Length=219

 Score =   244 bits (624),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 113/149 (76%), Positives = 130/149 (87%), Gaps = 0/149 (0%)
 Frame = +1

Query  232  NAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEIKSVVGDRKVDEKDTDK  411
            +AELV+L SEFLNGGTDTTATA+EW IA+LI NP +Q KLYEEIK  VG++KVDEKD +K
Sbjct  1    DAELVSLCSEFLNGGTDTTATAVEWGIAQLIANPHVQKKLYEEIKRTVGEKKVDEKDVEK  60

Query  412  MPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVEFFLPAISDDPTLWSDP  591
            MPYL+AVVKELLRKHPPT F LTHAVT+PT LGGYDIP+D  VE + PAI+ DP  WS+P
Sbjct  61   MPYLHAVVKELLRKHPPTHFVLTHAVTEPTTLGGYDIPIDASVEVYTPAIAGDPKNWSNP  120

Query  592  EKFDPDRFLSGGEDADITGVTAVKMMPFG  678
            EKFDP+RF+SGGE+ADITGVT VKMMPFG
Sbjct  121  EKFDPERFISGGEEADITGVTGVKMMPFG  149



>ref|XP_006851629.1| PREDICTED: cytochrome P450 77A2 [Amborella trichopoda]
 gb|ERN13159.1| hypothetical protein AMTR_s00040p00200250 [Amborella trichopoda]
Length=496

 Score =   236 bits (602),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 122/228 (54%), Positives = 163/228 (71%), Gaps = 9/228 (4%)
 Frame = +1

Query  4    LDPRVDDFLPILSPFFSKQRKRVLEVRKQQIETIVPLIERRRRALENPGSDKSAATFSYL  183
            L+PR+DDFLPIL   F K+      VRK+Q+ET++PLI  R++ ++N  S + A    Y+
Sbjct  212  LEPRIDDFLPILQAIFVKKVAHAKHVRKEQLETLLPLIRSRKKTIQNAMSAEPA----YI  267

Query  184  DTLFDLTVEGRKSSPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEI  363
            D+LFDL +   +  P+   LVTL +EFLNGGTDTTATA+EWA+A L+ +  IQ+++  EI
Sbjct  268  DSLFDLDMG--QGPPSEDMLVTLCAEFLNGGTDTTATAVEWAMAHLVADSEIQTRVRAEI  325

Query  364  KSVVGDRKVDEKDTDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVE  543
              V  D +V+++D +KM YL A VKE LRKHPPT+F LTHAVT+ + LGGYDIP    V+
Sbjct  326  DRVSPDHRVNDEDVEKMEYLQAFVKETLRKHPPTYFLLTHAVTEKSTLGGYDIPEGVNVD  385

Query  544  FFLPAISDDPTLWSDPEKFDPDRFL---SGGEDADITGVTAVKMMPFG  678
            F+ P+ISDDP LW DPE+F P+RF+    G +DAD+TGV  VKMMPFG
Sbjct  386  FYTPSISDDPKLWGDPERFRPERFVDKMDGDDDADLTGVKGVKMMPFG  433



>gb|EAZ30650.1| hypothetical protein OsJ_14702 [Oryza sativa Japonica Group]
Length=521

 Score =   233 bits (594),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 109/174 (63%), Positives = 138/174 (79%), Gaps = 2/174 (1%)
 Frame = +1

Query  160  SAATFSYLDTLFDLTVEGRKSSPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGI  339
            S   +SYLD+L DL VEGR + PT+ ELVTL +E +NGGTDTTATAIEWA+AR+++NP I
Sbjct  282  SRRQYSYLDSLLDLRVEGRDAVPTDEELVTLCAEMINGGTDTTATAIEWAMARVMDNPSI  341

Query  340  QSKLYEEIKSVVGD-RKVDEKDTDKMPYLNAVVKELLRKHPPTFFALTHAVTQP-TKLGG  513
            Q++L+ EI   VGD R VD++DT+ MPYL A VKELLRKHPPT+FAL+HA  +P +KL G
Sbjct  342  QARLHGEIMQRVGDARPVDDRDTEGMPYLKAFVKELLRKHPPTYFALSHAAVEPGSKLAG  401

Query  514  YDIPMDCGVEFFLPAISDDPTLWSDPEKFDPDRFLSGGEDADITGVTAVKMMPF  675
            YD+P+D  ++ FLP IS+DP LW  P +FDPDRFL+GGE ADITG   V+M+PF
Sbjct  402  YDVPVDANLDIFLPTISEDPKLWERPTEFDPDRFLAGGETADITGSAGVRMIPF  455



>gb|ABR16500.1| unknown [Picea sitchensis]
Length=327

 Score =   226 bits (575),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 108/215 (50%), Positives = 147/215 (68%), Gaps = 3/215 (1%)
 Frame = +1

Query  43   PFFSKQRKRVLEVRKQQIETIVPLIERRRRALENPGSDKSAA---TFSYLDTLFDLTVEG  213
            PFF++Q KR+ E+R+ Q+++I+PL+  RR  L+     ++ +     +Y+D+L +L +  
Sbjct  44   PFFARQWKRIKELRRIQMDSILPLVNTRRAVLKAGAHTQAGSPDGAHAYIDSLMNLELPE  103

Query  214  RKSSPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEIKSVVGDRKVD  393
             +  PT+ ELVTL SE L  GTDTT+TA+EWA+ R++ +  IQ  LY+EI  VVGDRKV+
Sbjct  104  GRGKPTDEELVTLCSELLTAGTDTTSTALEWAMLRMVMHQDIQETLYQEICDVVGDRKVE  163

Query  394  EKDTDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVEFFLPAISDDP  573
             KD + +PYLNAVVKE LR+HPP  F L+HAVTQ  +L GYDIP    VEF+   +S DP
Sbjct  164  GKDIENLPYLNAVVKETLRRHPPGHFVLSHAVTQDCQLRGYDIPYKANVEFYTAWMSFDP  223

Query  574  TLWSDPEKFDPDRFLSGGEDADITGVTAVKMMPFG  678
             +W DP  F+P RFL  G + DITG   VKMMPFG
Sbjct  224  KIWPDPMTFNPRRFLDPGNEVDITGNKQVKMMPFG  258



>ref|XP_007204450.1| hypothetical protein PRUPE_ppa026370mg [Prunus persica]
 gb|EMJ05649.1| hypothetical protein PRUPE_ppa026370mg [Prunus persica]
Length=516

 Score =   228 bits (581),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 110/228 (48%), Positives = 151/228 (66%), Gaps = 5/228 (2%)
 Frame = +1

Query  10   PRVDDFLPILSPFFSKQRKRVLEVRKQQIETIVPLIERRRRALE-NPGSDKSAAT---FS  177
            P++ DFLP+L+P F +Q +   E+R++Q+E +VPLI  R+  ++ N  SD +  +    +
Sbjct  222  PKLPDFLPVLTPLFRRQVREAKELRRRQMECLVPLIRNRKTFVQANQSSDGNMVSPKGAA  281

Query  178  YLDTLFDLTVEGRKSSPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYE  357
            Y+D+LF+L V GR       ELVTL SE +N GTDT+AT +EWA+  L+ N  IQ KLY 
Sbjct  282  YIDSLFELEVPGRAQRLGEEELVTLCSEVINAGTDTSATTLEWALLHLVMNQEIQQKLYN  341

Query  358  EIKSVVGDRKVDEKDTDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCG  537
            EI   VG  +V E D +KM YL+AVVKE  R+HPP+ F L+HA  + T LGGY +P D  
Sbjct  342  EIVDCVGKEEVTESDVEKMSYLSAVVKETFRRHPPSHFVLSHAAVKETVLGGYTVPADAS  401

Query  538  VEFFLPAISDDPTLWSDPEKFDPDRFLSG-GEDADITGVTAVKMMPFG  678
            VEF+   +++DP LW DP +F P+RFL G G D D+TG   VKM+PFG
Sbjct  402  VEFYTAWVTEDPNLWEDPGEFRPERFLEGDGVDVDVTGTKGVKMVPFG  449



>ref|XP_008439972.1| PREDICTED: cytochrome P450 77A1 [Cucumis melo]
Length=513

 Score =   228 bits (580),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 115/234 (49%), Positives = 155/234 (66%), Gaps = 12/234 (5%)
 Frame = +1

Query  10   PRVDDFLPILSPFFSKQRKRVLEVRKQQIETIVPLIERRRRALENPGSDK---------S  162
            P++ DFLPIL+P F +Q K+  E+R++Q+E ++PLI +RR  +E  G +          S
Sbjct  218  PKLPDFLPILTPLFRRQLKQAKELRRKQLECLIPLIRKRRMFVERNGDESVREELPEMVS  277

Query  163  AATFSYLDTLFDLTVEGRKSSPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQ  342
                +YLD+LF+L   GR       ELVTL SE +N GTDT+ATA+EWA+  L+++  +Q
Sbjct  278  PIGAAYLDSLFELETPGR-GRLGEEELVTLCSEVINAGTDTSATALEWALLHLVQDQDVQ  336

Query  343  SKLYEEIKSVVG-DRKVDEKDTDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYD  519
             +LY EI +VVG D ++ E D +KMPYL AVVKE  R+HPP+ F L+HA T+ T+LGGY 
Sbjct  337  ERLYNEIINVVGKDGRITEGDIEKMPYLGAVVKETFRRHPPSHFLLSHAATKETELGGYT  396

Query  520  IPMDCGVEFFLPAISDDPTLWSDPEKFDPDRFLSG-GEDADITGVTAVKMMPFG  678
            IP D  VEF+   +SDDP  W +P  F PDRFL G G   D+TG  AVKM+PFG
Sbjct  397  IPADASVEFYTAHLSDDPNTWEEPGSFRPDRFLEGDGVGVDVTGTKAVKMVPFG  450



>ref|XP_009803416.1| PREDICTED: cytochrome P450 77A3 [Nicotiana sylvestris]
Length=510

 Score =   225 bits (574),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 110/232 (47%), Positives = 160/232 (69%), Gaps = 11/232 (5%)
 Frame = +1

Query  10   PRVDDFLPILSPFFSKQRKRVLEVRKQQIETIVPLIERRRRALENPGSDKSAAT------  171
            P++ DFLP+ +P F  Q K+  ++R+ Q+E +VPL+  R+  +E+ G+ KS+++      
Sbjct  218  PQLPDFLPVFTPLFRSQVKQAKKLRQTQLEYLVPLVRDRKAFVESNGNPKSSSSEMVSPI  277

Query  172  -FSYLDTLFDLTVEGRKSSPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSK  348
              +Y+D+LF L + GRK     AE++TLVSE +  GTDT+ATA+EWA+  L+ +  IQ K
Sbjct  278  GAAYVDSLFSLEIPGRKLG--EAEIITLVSETIGAGTDTSATALEWALLHLVMDQEIQEK  335

Query  349  LYEEIKSVVGDRK-VDEKDTDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIP  525
            LY+EI   VG    + E D +KMPYL A+VKE  R+HPP+ F L+H+VT  T+LGGY+IP
Sbjct  336  LYKEIVDCVGKHGDISESDVEKMPYLGAIVKETFRRHPPSHFVLSHSVTNDTQLGGYNIP  395

Query  526  MDCGVEFFLPAISDDPTLWSDPEKFDPDRFLSG-GEDADITGVTAVKMMPFG  678
             D  VEF+   +++DP+LW DP +F P+RFL+G G D DITG+  VKM+PFG
Sbjct  396  SDAYVEFYTAWVTEDPSLWKDPGEFRPERFLTGDGVDVDITGMRGVKMLPFG  447



>ref|XP_009612631.1| PREDICTED: cytochrome P450 77A1 [Nicotiana tomentosiformis]
Length=510

 Score =   225 bits (574),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 110/232 (47%), Positives = 161/232 (69%), Gaps = 11/232 (5%)
 Frame = +1

Query  10   PRVDDFLPILSPFFSKQRKRVLEVRKQQIETIVPLIERRRRALENPGSDKSAAT------  171
            P++ DFLP+ +P F +Q K+  ++R+ Q+E +VPL+  R+  +E+ G+ KS+++      
Sbjct  218  PQLPDFLPVFTPLFRRQVKQAKKLRQTQLEYLVPLVRDRKAFVESNGNPKSSSSEMVSPV  277

Query  172  -FSYLDTLFDLTVEGRKSSPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSK  348
              +Y+D+LF L + GRK     AE++TLVSE +  GTDT+ATA+EWA+  L+ +  IQ K
Sbjct  278  GAAYVDSLFSLELPGRKLG--EAEIITLVSETIGAGTDTSATALEWALLHLVMDQEIQEK  335

Query  349  LYEEIKSVVGDRK-VDEKDTDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIP  525
            LY+EI   VG    + E D +KMPYL A+VKE  R+HPP+ F L+H+VT  T+LGGY+IP
Sbjct  336  LYKEIVDCVGKHGDISESDVEKMPYLGAIVKETFRRHPPSHFVLSHSVTNDTQLGGYNIP  395

Query  526  MDCGVEFFLPAISDDPTLWSDPEKFDPDRFLSG-GEDADITGVTAVKMMPFG  678
             D  VEF+   +++DP+LW DP +F P+RFL+G G D DITG+  VKM+PFG
Sbjct  396  SDAYVEFYTAWVTEDPSLWKDPGEFRPERFLTGDGVDVDITGMRGVKMLPFG  447



>ref|XP_004134754.1| PREDICTED: cytochrome P450 77A1 [Cucumis sativus]
 gb|KGN49124.1| hypothetical protein Csa_6G514850 [Cucumis sativus]
Length=513

 Score =   224 bits (572),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 113/234 (48%), Positives = 154/234 (66%), Gaps = 12/234 (5%)
 Frame = +1

Query  10   PRVDDFLPILSPFFSKQRKRVLEVRKQQIETIVPLIERRRRALENPGSDK---------S  162
            P++ DFLPIL+P F +Q K+  E+R++Q+E ++PLI +RR  +E  G +          S
Sbjct  218  PKLPDFLPILTPLFGRQLKQAKELRRKQLECLIPLIRKRRMFMERNGDESVRKELPEMVS  277

Query  163  AATFSYLDTLFDLTVEGRKSSPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQ  342
                +YLD+LF+L   GR       ELVTL SE +N GTDT+ATA+EWA+  L+++  +Q
Sbjct  278  PMGAAYLDSLFELETPGR-GRLGEEELVTLCSEVINAGTDTSATALEWALLHLVQDQDVQ  336

Query  343  SKLYEEIKSVVG-DRKVDEKDTDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYD  519
             +LY EI +VVG D  + E D +KMPYL AVVKE  R+HPP+ F L+HA T+ T+LGGY 
Sbjct  337  ERLYNEIINVVGKDGLITEGDIEKMPYLGAVVKETFRRHPPSHFLLSHAATKETELGGYT  396

Query  520  IPMDCGVEFFLPAISDDPTLWSDPEKFDPDRFLSG-GEDADITGVTAVKMMPFG  678
            IP D  VEF+   +++DP  W +P  F PDRFL G G   D+TG  AVKM+PFG
Sbjct  397  IPADASVEFYTAHLTEDPNTWEEPGSFRPDRFLEGDGVGVDVTGTKAVKMVPFG  450



>ref|XP_007153928.1| hypothetical protein PHAVU_003G076900g [Phaseolus vulgaris]
 gb|ESW25922.1| hypothetical protein PHAVU_003G076900g [Phaseolus vulgaris]
Length=510

 Score =   224 bits (571),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 111/228 (49%), Positives = 153/228 (67%), Gaps = 6/228 (3%)
 Frame = +1

Query  10   PRVDDFLPILSPFFSKQRKRVLEVRKQQIETIVPLIERRRRALENPGSDKSAAT---FSY  180
            P++ DFLP+ +P F +Q K   E+RK+Q+E + PLI  R+  +E   S    A+    +Y
Sbjct  222  PKLPDFLPVFTPLFRRQVKEARELRKRQVELLAPLIRSRKAYVEGSFSGSEMASPVGAAY  281

Query  181  LDTLFDLTVEGRKSSPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEE  360
            +D+LF+L V GR       ELVTLVSE ++ GTDT+ATA+EWA+  L+ +  IQ +LY+E
Sbjct  282  VDSLFELEVPGR-GRLGEEELVTLVSEIISAGTDTSATAVEWALFHLVTDQEIQERLYKE  340

Query  361  IKSVVGDRKV-DEKDTDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCG  537
            I   VG   V  E D ++MPYL+AVVKE  R+HPP+ F L+HA T+ TKLGGY +P +  
Sbjct  341  IVECVGKEGVVKESDVERMPYLSAVVKETFRRHPPSHFVLSHAATEDTKLGGYTVPKNAS  400

Query  538  VEFFLPAISDDPTLWSDPEKFDPDRFLSG-GEDADITGVTAVKMMPFG  678
            VEF+   +S+DP +W DP +F P+RFLSG G D D+TG   V+MMPFG
Sbjct  401  VEFYTAWLSEDPNMWEDPNEFRPERFLSGDGVDVDVTGTKGVRMMPFG  448



>ref|XP_003528678.1| PREDICTED: cytochrome P450 77A1-like [Glycine max]
Length=504

 Score =   223 bits (568),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 110/226 (49%), Positives = 152/226 (67%), Gaps = 4/226 (2%)
 Frame = +1

Query  10   PRVDDFLPILSPFFSKQRKRVLEVRKQQIETIVPLIERRRRALENPGSD-KSAATFSYLD  186
            P++ DFLP+ +P F +Q K   E+R++Q+E + PLI  R+  +E   SD  S    +Y+D
Sbjct  218  PKLPDFLPVFTPLFRRQVKEAEELRRRQVELLAPLIRSRKAYVEGNNSDMASPVGAAYVD  277

Query  187  TLFDLTVEGRKSSPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEIK  366
            +LF L V GR       ELVTLVSE ++ GTDT+ATA+EWA+  L+ +  IQ +LY EI 
Sbjct  278  SLFGLEVPGR-GRLGEEELVTLVSEIISAGTDTSATALEWALLHLVMDQEIQERLYREIV  336

Query  367  SVVG-DRKVDEKDTDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVE  543
              VG D  V E   +KMPYL+AVVKE  R+HPP+ F L+HA T+ TKLGGY +P +  VE
Sbjct  337  GCVGKDGVVTESHVEKMPYLSAVVKETFRRHPPSHFVLSHAATEETKLGGYTVPKEASVE  396

Query  544  FFLPAISDDPTLWSDPEKFDPDRFLSG-GEDADITGVTAVKMMPFG  678
            F+   +++DP++W DP +F P+RF+SG G D D+TG   V+MMPFG
Sbjct  397  FYTAWLTEDPSMWEDPNEFRPERFMSGDGVDVDVTGTKGVRMMPFG  442



>ref|XP_010102452.1| Cytochrome P450 77A3 [Morus notabilis]
 gb|EXB93488.1| Cytochrome P450 77A3 [Morus notabilis]
Length=506

 Score =   223 bits (568),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 114/234 (49%), Positives = 153/234 (65%), Gaps = 12/234 (5%)
 Frame = +1

Query  10   PRVDDFLPILSPFFSKQRKRVLEVRKQQIETIVPLIERRRRALENPGSDK---------S  162
            P++ DFLP+L+P F +Q +   EVRK+Q+E + PL+  R+  LEN G +K         S
Sbjct  214  PKLPDFLPVLTPLFRRQLREAREVRKRQLECLAPLLRDRKAFLENGGGNKADQNNYKMVS  273

Query  163  AATFSYLDTLFDLTVEGRKSSPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQ  342
             A  +Y+D+LF+L V  R     + ELVTL SE +NGGTDTTATA+EWA+  L++N  IQ
Sbjct  274  PAGAAYIDSLFELDVPNRGRLGED-ELVTLCSEAINGGTDTTATAVEWAMFNLVKNQKIQ  332

Query  343  SKLYEEIKSVVGDRKV-DEKDTDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYD  519
              +Y+EI   VG+  V  E D +KM YL AVVKE  R+HPPT F L+H+  + T+LGGY 
Sbjct  333  ETIYKEIVETVGENGVVTENDVEKMTYLGAVVKETFRRHPPTHFMLSHSAVEETELGGYT  392

Query  520  IPMDCGVEFFLPAISDDPTLWSDPEKFDPDRFLS-GGEDADITGVTAVKMMPFG  678
            IP D  VEF+   +++DP LW DP +F P+RFL   G D D+TG  AV M+PFG
Sbjct  393  IPADASVEFYTAWVAEDPGLWKDPGEFRPERFLERNGADVDVTGTRAVTMVPFG  446



>ref|XP_006858061.2| PREDICTED: cytochrome P450 77A4 [Amborella trichopoda]
Length=516

 Score =   223 bits (568),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 117/228 (51%), Positives = 150/228 (66%), Gaps = 7/228 (3%)
 Frame = +1

Query  10   PRVDDFLPILSPFFSKQRKRVLEVRKQQIETIVPLIERRRRALENPGSDK---SAATFSY  180
            P++ DFLPI +P F  Q K   E+RK Q+E +VPLIERR+ A  N G D    S    +Y
Sbjct  231  PKLPDFLPIFTPLFRGQLKFARELRKTQMECLVPLIERRQ-AFLNGGEDSDMVSPKGAAY  289

Query  181  LDTLFDLTVEGRKSSPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEE  360
            +D+LFDL VEGR     + ELV+LVSE +N GTDT+AT IEWA   L+ +  +Q KLY E
Sbjct  290  IDSLFDLEVEGR-GKLGHEELVSLVSEIINAGTDTSATTIEWATLHLVLDQKLQEKLYRE  348

Query  361  IKSVVG-DRKVDEKDTDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCG  537
            I  VVG D  + E   +KM YL A+VKE  R+HPP+ F L+HA  + T L GY +P D  
Sbjct  349  IIEVVGKDGAITESGVEKMVYLGAIVKETFRRHPPSHFVLSHAAIKDTTLAGYRVPSDAS  408

Query  538  VEFFLPAISDDPTLWSDPEKFDPDRFLSG-GEDADITGVTAVKMMPFG  678
            VEF+   +S+DP +W DP++F P+RFL G G+D DITG   VKMMPFG
Sbjct  409  VEFYTAWLSEDPNMWEDPKEFRPERFLVGDGKDVDITGSRHVKMMPFG  456



>gb|ERN19528.1| hypothetical protein AMTR_s00062p00048540 [Amborella trichopoda]
Length=518

 Score =   223 bits (568),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 117/228 (51%), Positives = 150/228 (66%), Gaps = 7/228 (3%)
 Frame = +1

Query  10   PRVDDFLPILSPFFSKQRKRVLEVRKQQIETIVPLIERRRRALENPGSDK---SAATFSY  180
            P++ DFLPI +P F  Q K   E+RK Q+E +VPLIERR+ A  N G D    S    +Y
Sbjct  233  PKLPDFLPIFTPLFRGQLKFARELRKTQMECLVPLIERRQ-AFLNGGEDSDMVSPKGAAY  291

Query  181  LDTLFDLTVEGRKSSPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEE  360
            +D+LFDL VEGR     + ELV+LVSE +N GTDT+AT IEWA   L+ +  +Q KLY E
Sbjct  292  IDSLFDLEVEGR-GKLGHEELVSLVSEIINAGTDTSATTIEWATLHLVLDQKLQEKLYRE  350

Query  361  IKSVVG-DRKVDEKDTDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCG  537
            I  VVG D  + E   +KM YL A+VKE  R+HPP+ F L+HA  + T L GY +P D  
Sbjct  351  IIEVVGKDGAITESGVEKMVYLGAIVKETFRRHPPSHFVLSHAAIKDTTLAGYRVPSDAS  410

Query  538  VEFFLPAISDDPTLWSDPEKFDPDRFLSG-GEDADITGVTAVKMMPFG  678
            VEF+   +S+DP +W DP++F P+RFL G G+D DITG   VKMMPFG
Sbjct  411  VEFYTAWLSEDPNMWEDPKEFRPERFLVGDGKDVDITGSRHVKMMPFG  458



>ref|XP_004305483.2| PREDICTED: cytochrome P450 77A4 [Fragaria vesca subsp. vesca]
Length=511

 Score =   222 bits (565),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 114/229 (50%), Positives = 151/229 (66%), Gaps = 7/229 (3%)
 Frame = +1

Query  10   PRVDDFLPILSPFFSKQRKRVLEVRKQQIETIVPLIERRRRALENPGSDK----SAATFS  177
            P++ DFLP+L+P F +Q K  +++RK+Q+E +VPLI  R+  L+  G       S +  +
Sbjct  220  PKLPDFLPMLTPLFRRQVKEAVKLRKKQLECLVPLIRNRKAFLDGGGVVNEEMVSPSGAA  279

Query  178  YLDTLFDLTVEGRKSSPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYE  357
            Y+D+LF+L V GR       ELVTLVSE +N GTDT+AT  EWA+  L+ N  IQ KLY+
Sbjct  280  YIDSLFELDVPGR-GKLGEEELVTLVSEIVNAGTDTSATTTEWALLHLVMNQEIQDKLYK  338

Query  358  EIKSVVG-DRKVDEKDTDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDC  534
            EI   VG D  V E D +KM YL AVVKE  R+HPP+ F L+HA  + T+LGGY IP D 
Sbjct  339  EIVDCVGKDGAVTESDVEKMTYLTAVVKETFRRHPPSHFLLSHAAVKETQLGGYTIPADA  398

Query  535  GVEFFLPAISDDPTLWSDPEKFDPDRFLSG-GEDADITGVTAVKMMPFG  678
             VEF+   +++DP +W DP +F P+RFL G G D DITG   VKM+PFG
Sbjct  399  SVEFYTAWVTEDPGMWKDPGEFRPERFLDGDGVDVDITGTKGVKMVPFG  447



>ref|XP_010276015.1| PREDICTED: cytochrome P450 77A3 [Nelumbo nucifera]
Length=512

 Score =   221 bits (564),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 112/236 (47%), Positives = 152/236 (64%), Gaps = 14/236 (6%)
 Frame = +1

Query  10   PRVDDFLPILSPFFSKQRKRVLEVRKQQIETIVPLIERRRRALE---NPGSDKSAAT---  171
            P++ DFLP+ +PFF +Q K   ++R++Q+E +VPL+  RR  +E   NP  D +      
Sbjct  218  PKLPDFLPVFTPFFRRQLKEAKKLRRKQVECLVPLVRSRRAFVECEGNPTGDAAGWNEDI  277

Query  172  -----FSYLDTLFDLTVEGRKSSPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPG  336
                  +Y+D+LF L   GR       ELVTL SE +N GTDT+ATA+EWA+  L+ +  
Sbjct  278  VSPIGAAYIDSLFKLEPSGR-GKLGEEELVTLCSEVMNAGTDTSATAVEWALLHLVMDQD  336

Query  337  IQSKLYEEIKSVVG-DRKVDEKDTDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGG  513
            IQ KLYEEI   VG D K+ E+D +KM YL A+VKE  R+HPP+ F L+HA T  T+LGG
Sbjct  337  IQQKLYEEIVDSVGKDGKITEEDVEKMRYLGAIVKETFRRHPPSHFVLSHAATHETELGG  396

Query  514  YDIPMDCGVEFFLPAISDDPTLWSDPEKFDPDRFLSG-GEDADITGVTAVKMMPFG  678
            Y IP D  VEF+   +++DP++W +P  F P+RFL G G D D+TG   VKMMPFG
Sbjct  397  YTIPADANVEFYTAWVTEDPSVWKEPGAFRPERFLDGDGVDVDVTGSRGVKMMPFG  452



>emb|CDP04373.1| unnamed protein product [Coffea canephora]
Length=512

 Score =   219 bits (558),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 112/236 (47%), Positives = 156/236 (66%), Gaps = 11/236 (5%)
 Frame = +1

Query  1    VLDPRVDDFLPILSPFFSKQRKRVLEVRKQQIETIVPLIERRRRALENPGSDKSA-----  165
            +  P++ DFLP+L+P F  Q +   E+R++Q++++VPLI  RR  +E+ GS  S+     
Sbjct  215  ITSPKLPDFLPLLTPLFRGQVQAAKELRRRQLDSLVPLIRDRRAFVESGGSKNSSPRSEM  274

Query  166  ---ATFSYLDTLFDLTVEGRKSSPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPG  336
                  +Y+D+LF L   GR       E+VTL SE ++ GTDT+AT +EWA+ RL+ N  
Sbjct  275  VSDIGAAYVDSLFQLAPPGR-GKLGEEEIVTLCSETISAGTDTSATTVEWAMHRLVTNQE  333

Query  337  IQSKLYEEIKSVVG-DRKVDEKDTDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGG  513
            IQ KLY+EI  +VG + ++ EKD + MPYL A+VKE  R+HPP+ F L+HA T+ T+LGG
Sbjct  334  IQEKLYKEIVDLVGKNGEITEKDVENMPYLVAIVKETFRRHPPSHFVLSHASTKETELGG  393

Query  514  YDIPMDCGVEFFLPAISDDPTLWSDPEKFDPDRFLSG-GEDADITGVTAVKMMPFG  678
            Y IP D  VEF+   I+ DP+LW DP +F P+RFL G G D DITGV   KM+PFG
Sbjct  394  YTIPADASVEFYTEWITKDPSLWEDPNEFRPERFLIGDGVDVDITGVKGAKMLPFG  449



>gb|EPS68900.1| hypothetical protein M569_05868, partial [Genlisea aurea]
Length=504

 Score =   219 bits (558),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 106/230 (46%), Positives = 156/230 (68%), Gaps = 8/230 (3%)
 Frame = +1

Query  10   PRVDDFLPILSPFFSKQRKRVLEVRKQQIETIVPLIERRRRALENPGSDKSAAT---FSY  180
            P++ DF+P+L+PFF +      E+R++Q++ +VPL+ +R+  ++  G+ +  A+    +Y
Sbjct  215  PKLPDFMPVLTPFFRRHVAAAKELRRRQLDCLVPLLRKRKDFVDGVGAREEMASPLGAAY  274

Query  181  LDTLFDLTVEGRKSSPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEE  360
            +D+LF L V GR       E+V+L SE +NGGTDT+A  +EWA+  L++N  IQ KL+ E
Sbjct  275  IDSLFGLQVPGR-GKLGEEEMVSLCSEAINGGTDTSAATLEWALFHLVQNQDIQEKLFGE  333

Query  361  IKSVVG---DRKVDEKDTDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMD  531
            I SV G   D  + E + ++MPYL AVVKE LRKHPP +F L+HA TQ  +LGGY IP D
Sbjct  334  IVSVAGKNNDGVITETEVERMPYLEAVVKETLRKHPPIYFLLSHAATQEMELGGYTIPAD  393

Query  532  CGVEFFLPAISDDPTLWSDPEKFDPDRFLSG-GEDADITGVTAVKMMPFG  678
              VEF+   IS+DP +W +P +F P+RFL+G G + DITG+  V+M+PFG
Sbjct  394  VNVEFYTGGISEDPEMWDNPTEFRPERFLTGDGVEVDITGMRGVRMLPFG  443



>ref|XP_006348097.1| PREDICTED: cytochrome P450 77A3-like [Solanum tuberosum]
Length=508

 Score =   219 bits (558),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 108/232 (47%), Positives = 160/232 (69%), Gaps = 11/232 (5%)
 Frame = +1

Query  10   PRVDDFLPILSPFFSKQRKRVLEVRKQQIETIVPLIERRRRALENPGSDKSAAT------  171
            P++ DFLP+L+P F  Q K+  ++R+ Q+E ++PL+  R+  +++ G  KS+ +      
Sbjct  218  PQLPDFLPLLTPLFRSQVKQAKKLRQTQLEYLIPLVRDRKAFVDSNGDPKSSESEMVSPI  277

Query  172  -FSYLDTLFDLTVEGRKSSPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSK  348
              +Y+D+LF L   GRK     AE++TLVSE +  GTDT+ATA+EWA+ +L+ N  IQ K
Sbjct  278  GAAYVDSLFSLEPPGRKLG--EAEIITLVSETIGAGTDTSATALEWALLQLVMNQEIQEK  335

Query  349  LYEEIKSVVG-DRKVDEKDTDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIP  525
            LY+EI   VG +  + E D +K+PYL A+VKE  R+HPP+ F L+H+VT  T+LGGY+IP
Sbjct  336  LYKEIVDCVGKNGSISESDVEKLPYLGAIVKETFRRHPPSHFILSHSVTNDTQLGGYNIP  395

Query  526  MDCGVEFFLPAISDDPTLWSDPEKFDPDRFLSG-GEDADITGVTAVKMMPFG  678
             D  VEF+   +++DP+LW DP +F P+RFL+G G D D+TG+  VKM+PFG
Sbjct  396  SDAYVEFYTAWLTEDPSLWKDPGEFRPERFLTGDGVDVDLTGMRGVKMLPFG  447



>ref|XP_010316601.1| PREDICTED: cytochrome P450 77A1 [Solanum lycopersicum]
Length=508

 Score =   218 bits (556),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 108/232 (47%), Positives = 157/232 (68%), Gaps = 11/232 (5%)
 Frame = +1

Query  10   PRVDDFLPILSPFFSKQRKRVLEVRKQQIETIVPLIERRRRALENPGSDKSAAT------  171
            P++ DFLP+L+P F  Q K+  ++R+ Q+E + PL+  R+  +++ G   S+ +      
Sbjct  218  PQLPDFLPVLTPLFRSQVKQAKKLRQTQLEYLTPLVRDRKAFVDSNGDPNSSESEMVSPI  277

Query  172  -FSYLDTLFDLTVEGRKSSPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSK  348
              +Y+D+LF L   GRK     AE++TLVSE +  GTDT+ATA+EWA+  L+ N  IQ K
Sbjct  278  GAAYVDSLFSLEPPGRKLG--EAEIITLVSETIGAGTDTSATALEWALLHLVMNQEIQEK  335

Query  349  LYEEIKSVVG-DRKVDEKDTDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIP  525
            LYEEI   VG +  + E D +K+PYL A+VKE  R+HPP+ F L+H+VT  T+LGGY+IP
Sbjct  336  LYEEIVDCVGKNGSISESDVEKLPYLGAIVKETFRRHPPSHFVLSHSVTNDTQLGGYNIP  395

Query  526  MDCGVEFFLPAISDDPTLWSDPEKFDPDRFLSG-GEDADITGVTAVKMMPFG  678
             D  VEF+   +++DP+LW DP +F P+RFL+G G D D+TG+  VKM+PFG
Sbjct  396  SDAYVEFYTAWLTEDPSLWKDPTEFRPERFLTGDGVDVDLTGMRGVKMLPFG  447



>ref|XP_011086180.1| PREDICTED: cytochrome P450 77A3-like [Sesamum indicum]
Length=511

 Score =   218 bits (555),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 107/232 (46%), Positives = 155/232 (67%), Gaps = 10/232 (4%)
 Frame = +1

Query  10   PRVDDFLPILSPFFSKQRKRVLEVRKQQIETIVPLIERRRRALENPGSDKSAAT------  171
            P++ DFLP+L+P F +Q K   E+R++Q+E +VPLI  R+  +E+ G+ K+  +      
Sbjct  218  PKLPDFLPVLTPLFRRQVKAAKELRRKQLECLVPLIRNRKAFVESGGNPKATTSEMASPL  277

Query  172  -FSYLDTLFDLTVEGRKSSPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSK  348
              +Y+D+LF L   G K      E+VTL SE +N GTDT+ATA+EWA+  L+++  IQ K
Sbjct  278  GAAYIDSLFGLEPPG-KGKLGEEEMVTLCSEAINAGTDTSATALEWALLHLVQDQEIQEK  336

Query  349  LYEEIKSVVGDRKV-DEKDTDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIP  525
            LY+EI  +VG   V  E D +KMPYL A+VKE  R+HPP+ F L+HA T+  +LGGY IP
Sbjct  337  LYKEIVGIVGKNGVIAESDVEKMPYLGAIVKETFRRHPPSHFLLSHAATKEIELGGYTIP  396

Query  526  MDCGVEFFLPAISDDPTLWSDPEKFDPDRFLSG-GEDADITGVTAVKMMPFG  678
             D  VE +   +++DP +W +P +F P+RFL+G G + DITG+  VKM+PFG
Sbjct  397  ADVNVEIYTAWLTEDPEMWENPSEFRPERFLTGDGVEVDITGMRGVKMLPFG  448



>ref|XP_006468005.1| PREDICTED: cytochrome P450 77A3-like [Citrus sinensis]
Length=508

 Score =   218 bits (554),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 113/234 (48%), Positives = 155/234 (66%), Gaps = 9/234 (4%)
 Frame = +1

Query  1    VLDPRVDDFLPILSPFFSKQRKRVLEVRKQQIETIVPLIERRRRALE---NPGSDKSAAT  171
            +  P++ DFLPIL+P F +Q +   E+RK+Q+E +VPLI  R+  +E   NP S+    +
Sbjct  216  ITSPQLPDFLPILTPLFRRQMREAKELRKRQMECLVPLIRNRKAFVEKGQNPNSESEMVS  275

Query  172  ---FSYLDTLFDLTVEGRKSSPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQ  342
                +Y+D+LF L   GR+      E+VTL SE ++ GTDT+AT  EWA+  L+ N  IQ
Sbjct  276  PIGAAYVDSLFGLEPTGREQL-GEQEIVTLCSEVISAGTDTSATTAEWAMHHLVLNQEIQ  334

Query  343  SKLYEEIKSVVG-DRKVDEKDTDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYD  519
             KLY+EI + VG D  V E+D +KMPYL+AVVKE LR+HPP  F L+HA  + T+LGGY 
Sbjct  335  EKLYKEIVAAVGKDGLVKEEDVEKMPYLDAVVKETLRRHPPGHFLLSHAAIKDTELGGYS  394

Query  520  IPMDCGVEFFLPAISDDPTLWSDPEKFDPDRFLSG-GEDADITGVTAVKMMPFG  678
            IP    VEF+   +++DP +WSDP +F P+RFL G G D D+TG   VKM+PFG
Sbjct  395  IPAGVHVEFYTAWLTEDPDMWSDPGEFRPERFLEGDGVDVDVTGTRGVKMVPFG  448



>ref|XP_006449061.1| hypothetical protein CICLE_v10014970mg [Citrus clementina]
 gb|ESR62301.1| hypothetical protein CICLE_v10014970mg [Citrus clementina]
Length=508

 Score =   218 bits (554),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 113/234 (48%), Positives = 155/234 (66%), Gaps = 9/234 (4%)
 Frame = +1

Query  1    VLDPRVDDFLPILSPFFSKQRKRVLEVRKQQIETIVPLIERRRRALE---NPGSDKSAAT  171
            +  P++ DFLPIL+P F +Q +   E+RK+Q+E +VPLI  R+  +E   NP S+    +
Sbjct  216  ITSPQLPDFLPILTPLFRRQMREAKELRKRQMECLVPLIRNRKAFVEKGQNPNSESEMVS  275

Query  172  ---FSYLDTLFDLTVEGRKSSPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQ  342
                +Y+D+LF L   GR+      E+VTL SE ++ GTDT+AT  EWA+  L+ N  IQ
Sbjct  276  PIGAAYVDSLFGLEPTGREQL-GEQEIVTLCSEVISAGTDTSATTAEWAMHHLVLNQEIQ  334

Query  343  SKLYEEIKSVVG-DRKVDEKDTDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYD  519
             KLY+EI + VG D  V E+D +KMPYL+AVVKE LR+HPP  F L+HA  + T+LGGY 
Sbjct  335  EKLYKEIVAAVGKDGLVKEEDVEKMPYLDAVVKETLRRHPPGHFLLSHAAIKDTELGGYS  394

Query  520  IPMDCGVEFFLPAISDDPTLWSDPEKFDPDRFLSG-GEDADITGVTAVKMMPFG  678
            IP    VEF+   +++DP +WSDP +F P+RFL G G D D+TG   VKM+PFG
Sbjct  395  IPAGVHVEFYTAWLTEDPDMWSDPGEFRPERFLEGDGVDVDVTGTRGVKMVPFG  448



>gb|KDO75503.1| hypothetical protein CISIN_1g036686mg [Citrus sinensis]
Length=508

 Score =   218 bits (554),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 113/234 (48%), Positives = 155/234 (66%), Gaps = 9/234 (4%)
 Frame = +1

Query  1    VLDPRVDDFLPILSPFFSKQRKRVLEVRKQQIETIVPLIERRRRALE---NPGSDKSAAT  171
            +  P++ DFLPIL+P F +Q +   E+RK+Q+E +VPLI  R+  +E   NP S+    +
Sbjct  216  ITSPQLPDFLPILTPLFRRQMREAKELRKRQMECLVPLIRNRKAFVEKGQNPNSESEMVS  275

Query  172  ---FSYLDTLFDLTVEGRKSSPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQ  342
                +Y+D+LF L   GR+      E+VTL SE ++ GTDT+AT  EWA+  L+ N  IQ
Sbjct  276  PIGAAYVDSLFGLEPTGREQL-GEQEIVTLCSEVISAGTDTSATTAEWAMHHLVLNQEIQ  334

Query  343  SKLYEEIKSVVG-DRKVDEKDTDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYD  519
             KLY+EI + VG D  V E+D +KMPYL+AVVKE LR+HPP  F L+HA  + T+LGGY 
Sbjct  335  EKLYKEIVAAVGKDGLVKEEDVEKMPYLDAVVKETLRRHPPGHFLLSHAAIKDTELGGYS  394

Query  520  IPMDCGVEFFLPAISDDPTLWSDPEKFDPDRFLSG-GEDADITGVTAVKMMPFG  678
            IP    VEF+   +++DP +WSDP +F P+RFL G G D D+TG   VKM+PFG
Sbjct  395  IPAGVHVEFYTAWLTEDPDMWSDPGEFRPERFLEGDGVDVDVTGTRGVKMVPFG  448



>ref|XP_011037689.1| PREDICTED: cytochrome P450 77A4-like [Populus euphratica]
Length=505

 Score =   217 bits (553),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 112/230 (49%), Positives = 149/230 (65%), Gaps = 9/230 (4%)
 Frame = +1

Query  10   PRVDDFLPILSPFFSKQRKRVLEVRKQQIETIVPLIERRRRALENPGSD-----KSAATF  174
            P++ DFLPIL+P F K+     E+R++Q++ +VPLI R RRA    G D      S    
Sbjct  218  PKLPDFLPILAPLFRKKMDEAKELRRKQMDCLVPLI-RNRRAFVEKGEDPDLEMASPVGA  276

Query  175  SYLDTLFDLTVEGRKSSPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLY  354
            +Y+D+LFD+    R       E VTL SE ++ GTDT+AT IEWA+  L++N  IQ KLY
Sbjct  277  AYIDSLFDMKPVNR-GPLGEQEFVTLCSEVISAGTDTSATTIEWALLNLVQNQEIQEKLY  335

Query  355  EEIKSVVGDRKV-DEKDTDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMD  531
            +E+   VG+  V  E+DT+KMPYL A+VKE  R+HPP+ F L+HA T  T+L GY IP D
Sbjct  336  QEVIGCVGEHGVVTEEDTEKMPYLGAIVKETFRRHPPSHFVLSHAATNETQLAGYTIPAD  395

Query  532  CGVEFFLPAISDDPTLWSDPEKFDPDRFLSG-GEDADITGVTAVKMMPFG  678
              VEF+   +++DP LW DP +F P+RFL G G D D+TG   VKMMPFG
Sbjct  396  VNVEFYTAWLTEDPDLWKDPGEFRPERFLEGDGVDVDMTGTRGVKMMPFG  445



>ref|XP_002305592.1| cytochrome P450 family protein [Populus trichocarpa]
 gb|EEE86103.1| cytochrome P450 family protein [Populus trichocarpa]
Length=505

 Score =   216 bits (550),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 114/230 (50%), Positives = 150/230 (65%), Gaps = 9/230 (4%)
 Frame = +1

Query  10   PRVDDFLPILSPFFSKQRKRVLEVRKQQIETIVPLIERRRRAL----ENPGSD-KSAATF  174
            P++ DFLPIL+P F K+ +   E+R++Q+E +VPLI R RRA     ENP  +  S    
Sbjct  218  PKLPDFLPILAPLFRKKMEEAKELRRKQMECLVPLI-RNRRAFVEKGENPDLEMASPVGA  276

Query  175  SYLDTLFDLTVEGRKSSPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLY  354
            +Y+D+LF +    R       E VTL SE ++ GTDT+AT IEWA+  L++N  IQ KLY
Sbjct  277  AYIDSLFAMKPVNR-GPLGEQEFVTLCSEVISAGTDTSATTIEWALLNLVQNQEIQEKLY  335

Query  355  EEIKSVVGDRKV-DEKDTDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMD  531
            +EI   VG   V  E+DT+KMPYL A+VKE  R+HPP+ F L+HA T  T+L GY IP D
Sbjct  336  QEIIGCVGKHGVVKEEDTEKMPYLGAIVKETFRRHPPSHFVLSHAATNETQLAGYTIPAD  395

Query  532  CGVEFFLPAISDDPTLWSDPEKFDPDRFLSG-GEDADITGVTAVKMMPFG  678
              VEF+   +++DP LW DP +F P+RFL G G D D+TG   VKMMPFG
Sbjct  396  VNVEFYTAWLTEDPDLWKDPGEFRPERFLEGDGVDVDMTGTRGVKMMPFG  445



>emb|CAN68641.1| hypothetical protein VITISV_030808 [Vitis vinifera]
Length=484

 Score =   216 bits (549),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 107/232 (46%), Positives = 150/232 (65%), Gaps = 10/232 (4%)
 Frame = +1

Query  10   PRVDDFLPILSPFFSKQRKRVLEVRKQQIETIVPLIERRRRALENPGSDKSAAT------  171
            P++ DFLP+L+P   +Q +   E+RK+Q+E +VPL+  RR  +E+ G+   +++      
Sbjct  194  PKLPDFLPVLTPLLRRQLREAKELRKKQMECMVPLVRSRRAFVESKGAPGRSSSEMVSPI  253

Query  172  -FSYLDTLFDLTVEGRKSSPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSK  348
              +Y+D+LF L     +      ELVTL SE +N GTDT+AT +EWA+  L+ N  IQ K
Sbjct  254  GAAYIDSLFGLE-PAERGRLGEEELVTLCSEIINAGTDTSATTVEWALLHLVMNQDIQQK  312

Query  349  LYEEIKSVVGDRKV-DEKDTDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIP  525
            LY+EI   VG   V  E D +KMPYL A+VKE  R+HPP+ F L+HA T+ T+LGGY IP
Sbjct  313  LYKEIIDCVGKNGVVTEGDVEKMPYLGAIVKETFRRHPPSHFVLSHAATKDTELGGYTIP  372

Query  526  MDCGVEFFLPAISDDPTLWSDPEKFDPDRFLSG-GEDADITGVTAVKMMPFG  678
             D  VEF+   +++DP LW DP +F P+RFL G G + D+TG   VKM+PFG
Sbjct  373  ADVNVEFYTAWVTEDPDLWQDPAEFRPERFLQGDGVNVDVTGTRGVKMVPFG  424



>ref|XP_002265911.1| PREDICTED: cytochrome P450 77A1 [Vitis vinifera]
 emb|CBI23188.3| unnamed protein product [Vitis vinifera]
Length=508

 Score =   216 bits (550),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 107/232 (46%), Positives = 150/232 (65%), Gaps = 10/232 (4%)
 Frame = +1

Query  10   PRVDDFLPILSPFFSKQRKRVLEVRKQQIETIVPLIERRRRALENPGSDKSAAT------  171
            P++ DFLP+L+P   +Q +   E+RK+Q+E +VPL+  RR  +E+ G+   +++      
Sbjct  218  PKLPDFLPVLTPLLRRQLREAKELRKKQMECMVPLVRSRRAFVESKGAPGRSSSEMVSPI  277

Query  172  -FSYLDTLFDLTVEGRKSSPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSK  348
              +Y+D+LF L     +      ELVTL SE +N GTDT+AT +EWA+  L+ N  IQ K
Sbjct  278  GAAYIDSLFGLE-PAERGRLGEEELVTLCSEIINAGTDTSATTVEWALLHLVMNQDIQQK  336

Query  349  LYEEIKSVVGDRKV-DEKDTDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIP  525
            LY+EI   VG   V  E D +KMPYL A+VKE  R+HPP+ F L+HA T+ T+LGGY IP
Sbjct  337  LYKEIIDCVGKNGVVTEGDVEKMPYLGAIVKETFRRHPPSHFVLSHAATKDTELGGYTIP  396

Query  526  MDCGVEFFLPAISDDPTLWSDPEKFDPDRFLSG-GEDADITGVTAVKMMPFG  678
             D  VEF+   +++DP LW DP +F P+RFL G G + D+TG   VKM+PFG
Sbjct  397  ADVNVEFYTAWVTEDPDLWQDPAEFRPERFLQGDGVNVDVTGTRGVKMVPFG  448



>ref|XP_002437457.1| hypothetical protein SORBIDRAFT_10g027430 [Sorghum bicolor]
 gb|EER88824.1| hypothetical protein SORBIDRAFT_10g027430 [Sorghum bicolor]
Length=521

 Score =   216 bits (550),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 108/237 (46%), Positives = 153/237 (65%), Gaps = 14/237 (6%)
 Frame = +1

Query  10   PRVDDFLPILSPFFSKQRKRVLEVRKQQIETIVPLIERRRRAL-ENPGSDKSAATF----  174
            P++ DFLP+L+P F KQ      +R++Q++ + PL+  RR  L +  GS ++AA      
Sbjct  217  PKLPDFLPLLTPLFRKQLSEARALRRRQLDCLAPLVRARRDFLRDGAGSQEAAAKGGVEM  276

Query  175  ------SYLDTLFDLTVEGRKSSPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPG  336
                  +Y+D+LFDL   GR       ELVTL SE ++ GTDT+ATA+EWA+  LI +P 
Sbjct  277  MSGPGEAYVDSLFDLEPPGRGKRLGEEELVTLCSEVMSAGTDTSATALEWAMLHLILDPA  336

Query  337  IQSKLYEEIKSVVGD-RKVDEKDTDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGG  513
             Q +LY+E+ + VG   ++ E D + MPYL AVVKE  R+HPP+ F L+HA T+ T+LGG
Sbjct  337  AQERLYDEVVAKVGKTARITEADVEAMPYLQAVVKETFRRHPPSHFVLSHAATRDTELGG  396

Query  514  YDIPMDCGVEFFLPAISDDPTLWSDPEKFDPDRFLSGGE--DADITGVTAVKMMPFG  678
            Y +P D  VEF+   ++++P  W DPE + P+RFL GGE  D DITG  A++MMPFG
Sbjct  397  YRVPADASVEFYTAWVTENPATWPDPETWRPERFLEGGEGFDTDITGTRALRMMPFG  453



>ref|XP_006657255.1| PREDICTED: cytochrome P450 77A3-like [Oryza brachyantha]
Length=529

 Score =   216 bits (551),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 108/239 (45%), Positives = 151/239 (63%), Gaps = 16/239 (7%)
 Frame = +1

Query  10   PRVDDFLPILSPFFSKQRKRVLEVRKQQIETIVPLIERRRRALENPGSDK----------  159
            P++ DFLP+L+P F KQ      +R++Q+  + PL+  RR  L++ G+            
Sbjct  218  PKLPDFLPLLTPLFRKQLTEARNLRRRQLGCLAPLVRARREFLKDGGAKNADGNTVVGGV  277

Query  160  ---SAATFSYLDTLFDLTVEGRKSSPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIEN  330
               SA   +Y+D+LFDL   GR       ELVTL SE ++ GTDT+ATA+EWA+  L+ +
Sbjct  278  EMMSAPGEAYVDSLFDLEPPGRGKRLGEDELVTLCSEVMSAGTDTSATALEWAMMHLVLD  337

Query  331  PGIQSKLYEEIKSVVGD-RKVDEKDTDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKL  507
            P +Q KLY E+ S VG   ++ E D + MPYL AVVKE  R+HPP+ F L+HA T+ T+L
Sbjct  338  PAVQEKLYGEVVSKVGTTARITEADVETMPYLQAVVKETFRRHPPSHFVLSHAATRDTEL  397

Query  508  GGYDIPMDCGVEFFLPAISDDPTLWSDPEKFDPDRFLSGGE--DADITGVTAVKMMPFG  678
            GGY +P D  VEF+   ++++P  W DPE + P+RFL GGE  D DITG  A++MMPFG
Sbjct  398  GGYRVPADASVEFYTAWVTENPETWPDPETWRPERFLEGGEGFDTDITGTRALRMMPFG  456



>ref|XP_010553430.1| PREDICTED: cytochrome P450 77A3 [Tarenaya hassleriana]
Length=504

 Score =   214 bits (545),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 108/233 (46%), Positives = 157/233 (67%), Gaps = 9/233 (4%)
 Frame = +1

Query  1    VLDPRVDDFLPILSPFFSKQRKRVLEVRKQQIETIVPLIERRR---RALENPGSDK-SAA  168
            +  P++ DFLP+L+P F +Q K+  E+RK+Q++ +VPLI +RR   +  ENP ++  S  
Sbjct  213  ITSPQLPDFLPMLTPLFRRQVKQAKELRKRQLDCLVPLIRKRRLFVKKRENPNAEMVSPI  272

Query  169  TFSYLDTLFDLTVEGRKSSPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSK  348
              +Y+D+LFDL    R+    + E VTL SE ++ GTDT+AT +EWA+  L+ +  +Q K
Sbjct  273  GAAYVDSLFDLKCGERELG--DEEYVTLCSEIVSAGTDTSATTVEWALLHLVTDETVQQK  330

Query  349  LYEEIKSVVGDRKV-DEKDTDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIP  525
            LY+EI SVVG   V +E D +KMPYL AVVKE LR+HPP  F L+HA  + T+LGGY+IP
Sbjct  331  LYDEIDSVVGKNSVVEEDDVEKMPYLEAVVKETLRRHPPGHFLLSHATVKDTELGGYEIP  390

Query  526  MDCGVEFFLPAISDDPTLWSDPEKFDPDRFLSGGE--DADITGVTAVKMMPFG  678
                +EF+   ++++P +W DP  F P+RFL+GGE  ++D TG   V M+PFG
Sbjct  391  AGAYLEFYTAWVTENPEIWPDPGNFRPERFLTGGEGFNSDWTGTRGVTMLPFG  443



>ref|XP_002518512.1| cytochrome P450, putative [Ricinus communis]
 gb|EEF43899.1| cytochrome P450, putative [Ricinus communis]
Length=505

 Score =   214 bits (544),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 111/230 (48%), Positives = 152/230 (66%), Gaps = 9/230 (4%)
 Frame = +1

Query  10   PRVDDFLPILSPFFSKQRKRVLEVRKQQIETIVPLIERRRRAL----ENPGSDK-SAATF  174
            P++ DF+P+L+PFF +Q K   E+RK+Q+E +VPLI R RRA     ENP S+  S    
Sbjct  218  PKLPDFMPVLAPFFRRQMKVAKELRKKQMECLVPLI-RNRRAFVEKGENPNSEMVSPVGA  276

Query  175  SYLDTLFDLTVEGRKSSPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLY  354
            +Y+D+LF+L     +      E VTL SE ++ GTDT+AT IEWA+  L+ N  IQ  LY
Sbjct  277  AYIDSLFELK-PAERGPLGEQEFVTLCSEVVSAGTDTSATTIEWALLHLVLNQEIQENLY  335

Query  355  EEIKSVVG-DRKVDEKDTDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMD  531
            +EI   VG D  V E+  +KMPYL A+VKE  R+HPP+ F L+HA T+ T+LGGY IP  
Sbjct  336  KEIVDFVGKDGLVKEEHVEKMPYLGAIVKETFRRHPPSHFLLSHAATKETQLGGYTIPAG  395

Query  532  CGVEFFLPAISDDPTLWSDPEKFDPDRFLSG-GEDADITGVTAVKMMPFG  678
              VE +   +++DP +W DP++F P+RFL+G G D D+TG   VKM+PFG
Sbjct  396  VNVELYTAWVTEDPDVWKDPDEFRPERFLNGDGVDVDVTGTRGVKMVPFG  445



>ref|XP_004966222.1| PREDICTED: cytochrome P450 77A3-like [Setaria italica]
Length=513

 Score =   214 bits (544),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 107/235 (46%), Positives = 150/235 (64%), Gaps = 13/235 (6%)
 Frame = +1

Query  10   PRVDDFLPILSPFFSKQRKRVLEVRKQQIETIVPLIERRRRALENPGSDK---------S  162
            P++ DFLP+L+P F KQ      +R++Q+  +VPL+  RR  L + G+ K         S
Sbjct  217  PKLPDFLPLLTPLFRKQLTEARNLRRRQLACLVPLVRARREFLRD-GNKKAVDGGVEMMS  275

Query  163  AATFSYLDTLFDLTVEGRKSSPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQ  342
                +Y+D+LFDL   GR       ELVTL SE ++ GTDT+ATA+EWA+  L+ +P  Q
Sbjct  276  GPGEAYVDSLFDLEPPGRGKRLGEDELVTLCSEVMSAGTDTSATALEWAMMHLVLDPAAQ  335

Query  343  SKLYEEIKSVVGD-RKVDEKDTDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYD  519
             +LY+E+   VG   ++ E D + MPYL AVVKE  R+HPP+ F L+HA T+ T+LGGY 
Sbjct  336  ERLYDEVVGKVGKTARITEADVEAMPYLQAVVKETFRRHPPSHFVLSHAATRDTELGGYR  395

Query  520  IPMDCGVEFFLPAISDDPTLWSDPEKFDPDRFLSGGE--DADITGVTAVKMMPFG  678
            +P D  VEF+   ++++P  W DPE + P+RFL GGE  D DITG  A++MMPFG
Sbjct  396  VPADASVEFYTAWVTENPATWPDPEAWRPERFLEGGEGFDTDITGTRALRMMPFG  450



>ref|XP_012091382.1| PREDICTED: cytochrome P450 77A4-like [Jatropha curcas]
 gb|KDP20776.1| hypothetical protein JCGZ_21247 [Jatropha curcas]
Length=506

 Score =   214 bits (544),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 108/229 (47%), Positives = 148/229 (65%), Gaps = 7/229 (3%)
 Frame = +1

Query  10   PRVDDFLPILSPFFSKQRKRVLEVRKQQIETIVPLIERRRRALENPGSDK----SAATFS  177
            P++ DFLP+L+P F +Q K   E+R++Q+E + PLI  RR  +E  G+      S    +
Sbjct  218  PKLPDFLPVLAPLFRRQMKEAKELRRKQMECLFPLIRNRRAFIEKGGNPNEEMASPVGAA  277

Query  178  YLDTLFDLTVEGRKSSPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYE  357
            Y+D+LF+L    R       E VTL SE ++ GTDT+AT IEWA+  L++N  IQ KLY+
Sbjct  278  YIDSLFELKPANR-GQLGEEEFVTLCSEVISAGTDTSATTIEWALLHLVQNQEIQEKLYK  336

Query  358  EIKSVVG-DRKVDEKDTDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDC  534
            EI   VG D  V E+D +KM YL AVVKE LR+HPP+ F L+HA T+ T+LGGY IP   
Sbjct  337  EIVECVGKDGVVKEEDVEKMRYLGAVVKETLRRHPPSHFLLSHAATKETELGGYTIPAGV  396

Query  535  GVEFFLPAISDDPTLWSDPEKFDPDRFLSG-GEDADITGVTAVKMMPFG  678
             VE +   +++DP +W DP +F P+RFL G G D D+TG   +KM+PFG
Sbjct  397  NVELYTAWVTEDPEMWEDPREFRPERFLKGDGVDVDLTGTRGLKMVPFG  445



>ref|XP_003610402.1| Cytochrome P450 [Medicago truncatula]
 gb|AES92599.1| cytochrome P450 family 87 protein [Medicago truncatula]
Length=508

 Score =   213 bits (543),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 112/230 (49%), Positives = 150/230 (65%), Gaps = 8/230 (3%)
 Frame = +1

Query  10   PRVDDFLPILSPFFSKQRKRVLEVRKQQIETIVPLIERRRRALENPGSDK-----SAATF  174
            P++ DFLP+L+P F    K   ++RK+Q+E I PLI +R+  +E+ G        SA   
Sbjct  218  PKLPDFLPVLTPLFRGHVKEAKKLRKKQLELIAPLIRKRKVYVESDGKCGDPEMVSAIGA  277

Query  175  SYLDTLFDLTVEGRKSSPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLY  354
            +Y+D+LF L V  R     + ELVTLVSE ++ GTDT+ATAIEWA+  L+ +  IQ +LY
Sbjct  278  AYVDSLFGLEVPSR-GILGDEELVTLVSEIISAGTDTSATAIEWALLHLVMDQEIQERLY  336

Query  355  EEIKSVVGDRK-VDEKDTDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMD  531
             EI   VG    V + D +KMPYL A+VKE  R+HPP+ F L+HA T+ TKLGGY IP D
Sbjct  337  REIVDCVGKCGIVMDSDVEKMPYLCAIVKETFRRHPPSHFVLSHAATEETKLGGYTIPAD  396

Query  532  CGVEFFLPAISDDPTLWSDPEKFDPDRFLSG-GEDADITGVTAVKMMPFG  678
              VEF+   +S++P  W DP+ F P+RFL+G G D DITG   +KMMPFG
Sbjct  397  ASVEFYTAWLSENPNTWKDPDVFRPERFLNGDGVDVDITGTKEMKMMPFG  446



>ref|NP_001058373.1| Os06g0680700 [Oryza sativa Japonica Group]
 dbj|BAD45490.1| putative cytochrome P450 [Oryza sativa Japonica Group]
 dbj|BAD45883.1| putative cytochrome P450 [Oryza sativa Japonica Group]
 dbj|BAF20287.1| Os06g0680700 [Oryza sativa Japonica Group]
 gb|EEC81184.1| hypothetical protein OsI_24186 [Oryza sativa Indica Group]
Length=535

 Score =   214 bits (545),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 107/239 (45%), Positives = 149/239 (62%), Gaps = 16/239 (7%)
 Frame = +1

Query  10   PRVDDFLPILSPFFSKQRKRVLEVRKQQIETIVPLIERRRRALENPGSDK----------  159
            P++ DFLP+L+P F+KQ     E+R++Q+  + PL+  RR  +   G             
Sbjct  218  PKLPDFLPLLTPLFTKQLAAARELRRRQLGCLAPLVRARREFIRGGGERNADGNTVVGGV  277

Query  160  ---SAATFSYLDTLFDLTVEGRKSSPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIEN  330
               SA   +Y+D+LFDL   GR       ELVTL SE ++ GTDT+ATA+EWA+  L+ +
Sbjct  278  EMVSAPGEAYVDSLFDLEPPGRGKRLGEDELVTLCSEVMSAGTDTSATALEWAMMHLVLD  337

Query  331  PGIQSKLYEEIKSVVGD-RKVDEKDTDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKL  507
             G+Q KLY E+ S VG   ++ E D + MPYL AVVKE  R+HPP+ F L+HA T+ T+L
Sbjct  338  AGVQDKLYGEVVSKVGTTARITEADVEAMPYLQAVVKETFRRHPPSHFVLSHAATRDTEL  397

Query  508  GGYDIPMDCGVEFFLPAISDDPTLWSDPEKFDPDRFLSGGE--DADITGVTAVKMMPFG  678
            GGY +P D  VEF+   ++++P  W DPE + P+RFL GGE  D DIT   A++MMPFG
Sbjct  398  GGYRVPADASVEFYTAWVTENPATWPDPEAWRPERFLEGGEGFDTDITATRALRMMPFG  456



>gb|EEE66224.1| hypothetical protein OsJ_22376 [Oryza sativa Japonica Group]
Length=535

 Score =   214 bits (544),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 107/239 (45%), Positives = 149/239 (62%), Gaps = 16/239 (7%)
 Frame = +1

Query  10   PRVDDFLPILSPFFSKQRKRVLEVRKQQIETIVPLIERRRRALENPGSDK----------  159
            P++ DFLP+L+P F+KQ     E+R++Q+  + PL+  RR  +   G             
Sbjct  218  PKLPDFLPLLTPLFTKQLAAARELRRRQLGCLAPLVRARREFIRGGGERNADGNTVVGGV  277

Query  160  ---SAATFSYLDTLFDLTVEGRKSSPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIEN  330
               SA   +Y+D+LFDL   GR       ELVTL SE ++ GTDT+ATA+EWA+  L+ +
Sbjct  278  EMVSAPGEAYVDSLFDLEPPGRGKRLGEDELVTLCSEVMSAGTDTSATALEWAMMHLVLD  337

Query  331  PGIQSKLYEEIKSVVGD-RKVDEKDTDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKL  507
             G+Q KLY E+ S VG   ++ E D + MPYL AVVKE  R+HPP+ F L+HA T+ T+L
Sbjct  338  AGVQDKLYGEVVSKVGTTARITEADVEAMPYLQAVVKETFRRHPPSHFVLSHAATRDTEL  397

Query  508  GGYDIPMDCGVEFFLPAISDDPTLWSDPEKFDPDRFLSGGE--DADITGVTAVKMMPFG  678
            GGY +P D  VEF+   ++++P  W DPE + P+RFL GGE  D DIT   A++MMPFG
Sbjct  398  GGYRVPADASVEFYTAWVTENPATWPDPEAWRPERFLEGGEGFDTDITATRALRMMPFG  456



>ref|XP_003549954.2| PREDICTED: cytochrome P450 77A2-like [Glycine max]
Length=523

 Score =   213 bits (542),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 106/232 (46%), Positives = 152/232 (66%), Gaps = 10/232 (4%)
 Frame = +1

Query  10   PRVDDFLPILSPFFSKQRKRVLEVRKQQIETIVPLIERRRRALE-------NPGSDKSAA  168
            P++ DFLP+ +P F +Q K   E+R++Q+E + PLI  R+  +E       N     S  
Sbjct  231  PKLPDFLPVFTPLFRRQVKEAKELRRRQVELLAPLIRSRKAFVEGNLLELGNHYDMASPV  290

Query  169  TFSYLDTLFDLTVEGRKSSPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSK  348
              +Y+D+LF+L V GR       ELVTLVSE ++ GTDT+ATA+EWA+  L+ +  IQ +
Sbjct  291  GAAYVDSLFNLEVPGR-GRLGEEELVTLVSEIISAGTDTSATAVEWALLHLVMDQDIQER  349

Query  349  LYEEIKSVVG-DRKVDEKDTDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIP  525
            LY+EI   VG D  V E   +KMPYL+AVVKE  R+HPP+ F L+HA T+ T+LGGY +P
Sbjct  350  LYKEIVECVGKDGVVTESHVEKMPYLSAVVKETFRRHPPSHFVLSHAATEETELGGYTVP  409

Query  526  MDCGVEFFLPAISDDPTLWSDPEKFDPDRFLSG-GEDADITGVTAVKMMPFG  678
             +  VEF+   ++++P +W DP +F P+RF+SG G + D+TG   V+MMPFG
Sbjct  410  KEASVEFYTAWLTENPDMWEDPNEFRPERFMSGDGVEVDVTGTKGVRMMPFG  461



>gb|EYU33905.1| hypothetical protein MIMGU_mgv1a004759mg [Erythranthe guttata]
Length=511

 Score =   212 bits (539),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 106/232 (46%), Positives = 150/232 (65%), Gaps = 10/232 (4%)
 Frame = +1

Query  10   PRVDDFLPILSPFFSKQRKRVLEVRKQQIETIVPLIERRRRALENPGSDKSAAT------  171
            P++ DFLP+L+P F +Q K   E+R++Q++ +VPL+  RR  +E+ G   S A       
Sbjct  218  PKLPDFLPVLTPLFRRQVKEARELRRRQLDCLVPLLRDRRAFVESGGDASSTAAEMASPF  277

Query  172  -FSYLDTLFDLTVEGRKSSPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSK  348
              +Y+D+LF L   GR       E++TL SE +N GTDT+AT +EWA+  L+ N  IQ K
Sbjct  278  GAAYIDSLFGLEPPGR-GKLGEEEIITLCSETINAGTDTSATTLEWALLHLVLNQEIQEK  336

Query  349  LYEEIKSVVG-DRKVDEKDTDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIP  525
            LY E+   VG D  V E D +KM YL AVVKE  R+HPP+ F L+HA T+  +LGGY IP
Sbjct  337  LYNEVVDCVGKDGPVTESDVEKMTYLGAVVKETFRRHPPSHFLLSHAATEEIELGGYKIP  396

Query  526  MDCGVEFFLPAISDDPTLWSDPEKFDPDRFLSG-GEDADITGVTAVKMMPFG  678
             D  VEF+   ++++P +W +P +F P+RFL+G G + DITG+  VKM+PFG
Sbjct  397  ADVNVEFYTAWLTENPEMWENPSEFRPERFLTGDGVEVDITGMRGVKMLPFG  448



>gb|ACF86457.1| unknown [Zea mays]
Length=519

 Score =   211 bits (538),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 105/234 (45%), Positives = 151/234 (65%), Gaps = 12/234 (5%)
 Frame = +1

Query  10   PRVDDFLPILSPFFSKQRKRVLEVRKQQIETIVPLIERRRRALENPGSDKSAATF-----  174
            P++ DFLP+L+P F KQ      +R++Q+  +VPL+  RR  L + G+  +A        
Sbjct  217  PKLPDFLPLLTPLFRKQLTEARGLRRRQLNCLVPLVRARRDFLRD-GTAAAADGVEMMSG  275

Query  175  ---SYLDTLFDLTVEGRKSSPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQS  345
               +Y+D+LFDL   GR       ELVTL SE ++ GTDT+ATA+EWA+  L+ +P  Q 
Sbjct  276  PGEAYVDSLFDLEPPGRGKRLGEEELVTLCSEVMSAGTDTSATALEWAMMHLVLDPAAQE  335

Query  346  KLYEEIKSVVGD-RKVDEKDTDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDI  522
            +LY+E+ + VG   ++ E D + MPYL AVVKE  R+HPP+ F L+HA T+ T+LGGY +
Sbjct  336  RLYDEVVAKVGKTARITEADVEAMPYLQAVVKETFRRHPPSHFVLSHAATRDTELGGYRV  395

Query  523  PMDCGVEFFLPAISDDPTLWSDPEKFDPDRFLSGGE--DADITGVTAVKMMPFG  678
            P D  VEF+   ++++P  W DP+ + P+RFL GGE  D DITG  A++MMPFG
Sbjct  396  PADASVEFYTAWVTENPATWPDPDAWRPERFLEGGEGFDTDITGTRALRMMPFG  449



>ref|NP_001141481.1| uncharacterized protein LOC100273592 precursor [Zea mays]
 gb|ACN34097.1| unknown [Zea mays]
 gb|AFW69072.1| putative cytochrome P450 superfamily protein [Zea mays]
Length=519

 Score =   211 bits (538),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 105/234 (45%), Positives = 151/234 (65%), Gaps = 12/234 (5%)
 Frame = +1

Query  10   PRVDDFLPILSPFFSKQRKRVLEVRKQQIETIVPLIERRRRALENPGSDKSAATF-----  174
            P++ DFLP+L+P F KQ      +R++Q+  +VPL+  RR  L + G+  +A        
Sbjct  217  PKLPDFLPLLTPLFRKQLTEARGLRRRQLNCLVPLVRARRDFLRD-GTAAAADGVEMMSG  275

Query  175  ---SYLDTLFDLTVEGRKSSPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQS  345
               +Y+D+LFDL   GR       ELVTL SE ++ GTDT+ATA+EWA+  L+ +P  Q 
Sbjct  276  PGEAYVDSLFDLEPPGRGKRLGEEELVTLCSEVMSAGTDTSATALEWAMMHLVLDPAAQE  335

Query  346  KLYEEIKSVVGD-RKVDEKDTDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDI  522
            +LY+E+ + VG   ++ E D + MPYL AVVKE  R+HPP+ F L+HA T+ T+LGGY +
Sbjct  336  RLYDEVVAKVGKTARITEADVEAMPYLQAVVKETFRRHPPSHFVLSHAATRDTELGGYRV  395

Query  523  PMDCGVEFFLPAISDDPTLWSDPEKFDPDRFLSGGE--DADITGVTAVKMMPFG  678
            P D  VEF+   ++++P  W DP+ + P+RFL GGE  D DITG  A++MMPFG
Sbjct  396  PADASVEFYTAWVTENPATWPDPDAWRPERFLEGGEGFDTDITGTRALRMMPFG  449



>ref|XP_008242488.1| PREDICTED: cytochrome P450 77A3 [Prunus mume]
Length=517

 Score =   211 bits (538),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 105/229 (46%), Positives = 148/229 (65%), Gaps = 6/229 (3%)
 Frame = +1

Query  10   PRVDDFLPILSPFFSKQRKRVLEVRKQQIETIVPLIERRRRALE-NPGSDKSAAT---FS  177
            P++ DFLP+L+P F +Q +   E+R++Q+E +VPLI  R+  ++ N  SD +  +    +
Sbjct  222  PKLPDFLPVLTPLFRRQVREAKELRRRQLECLVPLIRNRKTFVQANQSSDGNMVSPKGAA  281

Query  178  YLDTLFDLTVEGRKSSPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYE  357
            Y+D+LF+L V GR       ELVTL SE +N GTDT+AT +EWA+  L+ N  IQ KL  
Sbjct  282  YIDSLFELEVPGRAQRLGEEELVTLCSEVINAGTDTSATTLEWALLHLVMNQEIQQKLXX  341

Query  358  EIKSVVGDRK-VDEKDTDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDC  534
                    ++ V E D +KM YL+AVVKE  R+HPP+ F L+HA  + T+LGGY +P D 
Sbjct  342  XXXXXXXXKEEVTESDVEKMSYLSAVVKETFRRHPPSHFVLSHAAVKETELGGYTVPADA  401

Query  535  GVEFFLPAISDDPTLWSDPEKFDPDRFLSG-GEDADITGVTAVKMMPFG  678
             VEF+   +++DP LW DP +F P+RFL G G D D+TG   VKM+PFG
Sbjct  402  SVEFYTAWVTEDPDLWEDPGEFRPERFLEGDGVDVDVTGTKGVKMVPFG  450



>ref|XP_010227164.1| PREDICTED: cytochrome P450 77A1 [Brachypodium distachyon]
Length=522

 Score =   211 bits (536),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 105/235 (45%), Positives = 148/235 (63%), Gaps = 12/235 (5%)
 Frame = +1

Query  10   PRVDDFLPILSPFFSKQRKRVLEVRKQQIETIVPLIERRRRALENPGSD---------KS  162
            P++ DFLP+L+P F KQ      +RK+Q+  + PL+  RR  L+N G            S
Sbjct  217  PKLPDFLPLLTPLFRKQLGEARALRKRQLGCLAPLVRARREFLQNGGKTGEIIGGVEMMS  276

Query  163  AATFSYLDTLFDLTVEGRKSSPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQ  342
             +  +Y+D+LFDL   GR       ELVTL SE ++ GTDT+ATA+EWA+  LI +P  Q
Sbjct  277  PSGEAYVDSLFDLEPPGRGKRLGEEELVTLCSEVMSAGTDTSATALEWAMMHLILDPKAQ  336

Query  343  SKLYEEIKSVVGD-RKVDEKDTDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYD  519
             ++Y+E+ +  G   ++ E D + MPYL AVVKE  R+HPP+ F L+HA T+ T+LGGY 
Sbjct  337  ERVYDEVVAKAGKTARITEADVEDMPYLQAVVKETFRRHPPSHFVLSHAATRDTELGGYR  396

Query  520  IPMDCGVEFFLPAISDDPTLWSDPEKFDPDRFLSGGE--DADITGVTAVKMMPFG  678
            +P    VEF+   I+++P  W DP+ + P+RFL GGE  D DITG  A++MMPFG
Sbjct  397  VPATASVEFYTAWITENPATWPDPDAWRPERFLEGGEGHDTDITGTRALRMMPFG  451



>ref|XP_010476093.1| PREDICTED: cytochrome P450 77A3-like [Camelina sativa]
Length=511

 Score =   209 bits (533),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 110/233 (47%), Positives = 152/233 (65%), Gaps = 7/233 (3%)
 Frame = +1

Query  1    VLDPRVDDFLPILSPFFSKQRKRVLEVRKQQIETIVPLIERRRR---ALENPGSDK-SAA  168
            +  P + DFLP+ +P F +Q +   E+RK Q+E +VPLI  RR+   A E+P  +  S  
Sbjct  217  ITSPTLPDFLPVFTPLFRRQVREARELRKTQLECLVPLIRNRRKFVEAKESPNEEMVSPI  276

Query  169  TFSYLDTLFDLTVEGRKSSPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSK  348
              +Y+D+LF L +  R     + E+VTL SE ++ GTDT+AT +EWA+  L+ +  IQ K
Sbjct  277  GAAYVDSLFGLNLVERGGELRDEEIVTLCSEIVSAGTDTSATTLEWALCHLVSDQNIQQK  336

Query  349  LYEEIKSVVGDRKV-DEKDTDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIP  525
            LY+E+  VVG   V +E D  KMPYL A+VKE LR+HPP  F L+HA  + T+LGGYDIP
Sbjct  337  LYDEVVGVVGKNGVVEEDDVSKMPYLEAIVKETLRRHPPGHFLLSHAAVKDTELGGYDIP  396

Query  526  MDCGVEFFLPAISDDPTLWSDPEKFDPDRFLSGGE--DADITGVTAVKMMPFG  678
                VEF+   ++++P +WSDP KF PDRFL+GG+  DAD TG   V M+PFG
Sbjct  397  AGAYVEFYTAWVTENPEIWSDPAKFRPDRFLTGGDGVDADWTGTRGVTMLPFG  449



>ref|XP_007026022.1| Cytochrome P450, family 77, subfamily B, polypeptide 1 [Theobroma 
cacao]
 gb|EOY28644.1| Cytochrome P450, family 77, subfamily B, polypeptide 1 [Theobroma 
cacao]
Length=505

 Score =   209 bits (533),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 111/232 (48%), Positives = 152/232 (66%), Gaps = 7/232 (3%)
 Frame = +1

Query  1    VLDPRVDDFLPILSPFFSKQRKRVLEVRKQQIETIVPLIERRRRALE---NPGSDK-SAA  168
            +  P++ DFLPIL+P F +Q K    +RK+Q+E +VPLI+ RR  +E   NP  +  S  
Sbjct  215  ITSPQLPDFLPILTPLFRRQMKEAKALRKRQLECLVPLIKNRRAFVEKGENPNQEMVSPI  274

Query  169  TFSYLDTLFDLTVEGRKSSPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSK  348
              +Y+D+LF L    R       E VTL SE ++ GTDT+AT +EWA+  L+    IQ K
Sbjct  275  GAAYIDSLFGLEPATR-GPLGEEEYVTLCSEVISAGTDTSATTVEWAMLHLVTKQEIQDK  333

Query  349  LYEEIKSVVG-DRKVDEKDTDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIP  525
            LY+EI +VVG +  + E+D +KMPYL+AVVKE LR+HPP  F L+HA  + T+LGGY IP
Sbjct  334  LYQEIVAVVGKNGDIQEEDVEKMPYLDAVVKETLRRHPPGHFLLSHAAIKDTELGGYTIP  393

Query  526  MDCGVEFFLPAISDDPTLWSDPEKFDPDRFLSG-GEDADITGVTAVKMMPFG  678
                VEF+   I+++P +WSDP +F P+RFL G G   D+TG  AVKM+PFG
Sbjct  394  EGVFVEFYTAWITENPDIWSDPGEFQPERFLHGDGVGVDVTGTRAVKMVPFG  445



>ref|XP_010458565.1| PREDICTED: cytochrome P450 77A3-like [Camelina sativa]
Length=510

 Score =   209 bits (533),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 110/233 (47%), Positives = 152/233 (65%), Gaps = 7/233 (3%)
 Frame = +1

Query  1    VLDPRVDDFLPILSPFFSKQRKRVLEVRKQQIETIVPLIERRRR---ALENPGSDK-SAA  168
            +  P + DFLP+ +P F +Q +   E+RK Q+E +VPLI  RR+   A E+P  +  S  
Sbjct  217  ITSPTLPDFLPVFTPLFRRQVREARELRKTQLECLVPLIRNRRKFVEAKESPNEEMVSPI  276

Query  169  TFSYLDTLFDLTVEGRKSSPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSK  348
              +Y+D+LF L +  R     + E+VTL SE ++ GTDT+AT +EWA+  L+ +  IQ K
Sbjct  277  GAAYVDSLFGLNLVERSGELRDEEIVTLCSEIVSAGTDTSATTLEWALCHLVSDQNIQEK  336

Query  349  LYEEIKSVVGDRKV-DEKDTDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIP  525
            LY+E+  VVG   V +E D  KMPYL A+VKE LR+HPP  F L+HA  + T+LGGYDIP
Sbjct  337  LYDEVVGVVGKNGVVEEDDVAKMPYLEAIVKETLRRHPPGHFLLSHAAVKDTELGGYDIP  396

Query  526  MDCGVEFFLPAISDDPTLWSDPEKFDPDRFLSGGE--DADITGVTAVKMMPFG  678
                VEF+   ++++P +WSDP KF PDRFL+GG+  DAD TG   V M+PFG
Sbjct  397  AGAYVEFYTAWVTENPEIWSDPAKFRPDRFLTGGDGVDADWTGTRGVTMLPFG  449



>gb|KJB68589.1| hypothetical protein B456_010G252700 [Gossypium raimondii]
Length=506

 Score =   209 bits (532),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 107/232 (46%), Positives = 150/232 (65%), Gaps = 6/232 (3%)
 Frame = +1

Query  1    VLDPRVDDFLPILSPFFSKQRKRVLEVRKQQIETIVPLIERRRRALE---NPGSDK-SAA  168
            +  P++ DFLP+L+P F +Q K+   +RK+Q+E +VPLI+ RR  +E   NP  +  S  
Sbjct  215  ITSPQLPDFLPVLTPLFHRQMKKAKALRKKQLECLVPLIKARRAFVEKGENPNQEMVSPL  274

Query  169  TFSYLDTLFDLTVEGRKSSPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSK  348
              +Y+D+LF L  +  +      E VTL SE ++ GTDT+AT +EWA+  L+ N  IQ K
Sbjct  275  GAAYIDSLFGLEPDKTRDPLGEEEYVTLCSEVISAGTDTSATTVEWAMLHLVMNQDIQDK  334

Query  349  LYEEIKSVVG-DRKVDEKDTDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIP  525
            LY EI   VG +  + E+D +KM YL +VVKE  R+HPP+ F L+HA  + T+LGGY IP
Sbjct  335  LYHEIVECVGKNGDIKEEDVEKMAYLESVVKETFRRHPPSHFLLSHAAIKDTELGGYTIP  394

Query  526  MDCGVEFFLPAISDDPTLWSDPEKFDPDRFLSG-GEDADITGVTAVKMMPFG  678
                VEF+   I++DP +WSDP +F PDRFL G G   D+TG  +VKM+PFG
Sbjct  395  EGVHVEFYTAWITEDPDIWSDPGEFRPDRFLRGDGVGVDVTGTRSVKMLPFG  446



>ref|XP_010493054.1| PREDICTED: cytochrome P450 77A3-like [Camelina sativa]
Length=511

 Score =   209 bits (531),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 110/233 (47%), Positives = 152/233 (65%), Gaps = 7/233 (3%)
 Frame = +1

Query  1    VLDPRVDDFLPILSPFFSKQRKRVLEVRKQQIETIVPLIERRRR---ALENPGSDK-SAA  168
            +  P + DFLP+ +P F +Q +   E+RK Q+E +VPLI  RR+   A E+P  +  S  
Sbjct  217  ITSPTLPDFLPVFTPLFRRQVREARELRKTQLECLVPLIRNRRKFVEAKESPNEEMVSPI  276

Query  169  TFSYLDTLFDLTVEGRKSSPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSK  348
              +Y+D+LF L +  R     + E+VTL SE ++ GTDT+AT +EWA+  L+ +  IQ K
Sbjct  277  GAAYVDSLFGLNLVERGGELRDEEIVTLCSEIVSAGTDTSATTLEWALCHLVSDQNIQEK  336

Query  349  LYEEIKSVVGDRKV-DEKDTDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIP  525
            LY+E+  VVG   V +E D  KMPYL A+VKE LR+HPP  F L+HA  + T+LGGYDIP
Sbjct  337  LYDEVVGVVGKNGVVEEDDVAKMPYLEAIVKETLRRHPPGHFLLSHAAVKDTELGGYDIP  396

Query  526  MDCGVEFFLPAISDDPTLWSDPEKFDPDRFLSGGE--DADITGVTAVKMMPFG  678
                VEF+   ++++P +WSDP KF PDRFL+GG+  DAD TG   V M+PFG
Sbjct  397  AGAYVEFYTAWVTENPEIWSDPAKFRPDRFLTGGDGVDADWTGTRGVTMLPFG  449



>ref|XP_006417335.1| hypothetical protein EUTSA_v10007399mg [Eutrema salsugineum]
 gb|ESQ35688.1| hypothetical protein EUTSA_v10007399mg [Eutrema salsugineum]
Length=510

 Score =   209 bits (531),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 106/230 (46%), Positives = 147/230 (64%), Gaps = 7/230 (3%)
 Frame = +1

Query  10   PRVDDFLPILSPFFSKQRKRVLEVRKQQIETIVPLIERRRRALENPGSDK----SAATFS  177
            P + DFLP+ +P F +Q +   E+RK Q+E +VPLI  RR  ++   S      S    +
Sbjct  220  PTLPDFLPVFTPLFRRQVREARELRKTQLECLVPLIRNRRAFVDAKASPNEEMVSPIGAA  279

Query  178  YLDTLFDLTVEGRKSSPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYE  357
            Y+D+LF L    R     + E+VTL SE ++ GTDT+AT +EWA+  L+ +  IQ KLYE
Sbjct  280  YVDSLFGLKPIERGGELGDEEIVTLCSEIVSAGTDTSATTLEWALLHLVTDQNIQEKLYE  339

Query  358  EIKSVVGDRKV-DEKDTDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDC  534
            E+  VVG   V +E D  K+PYL A+VKE LR+HPP  F L+HA  + T+LGGYDIP   
Sbjct  340  EVVQVVGKNGVVEEDDVAKIPYLEAIVKETLRRHPPGHFLLSHAAVKDTELGGYDIPAGA  399

Query  535  GVEFFLPAISDDPTLWSDPEKFDPDRFLSGGE--DADITGVTAVKMMPFG  678
             VEF+   ++++P +WSDP KF P+RFL+GG+  +AD TG   V M+PFG
Sbjct  400  YVEFYTAWVTENPEIWSDPGKFRPERFLTGGDGVNADWTGTRGVTMLPFG  449



>gb|KJB69319.1| hypothetical protein B456_011G016000 [Gossypium raimondii]
Length=506

 Score =   208 bits (529),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 109/232 (47%), Positives = 150/232 (65%), Gaps = 7/232 (3%)
 Frame = +1

Query  1    VLDPRVDDFLPILSPFFSKQRKRVLEVRKQQIETIVPLIERRRRALE---NPGSDK-SAA  168
            +  P++ DFLP+L+P F +Q K    +RK+Q+E +VPLI+ RR  +E   NP  +  S  
Sbjct  215  ITSPQLPDFLPVLTPLFRRQMKEAKALRKKQLECLVPLIKNRRAFVEKGENPNQEMVSPI  274

Query  169  TFSYLDTLFDLTVEGRKSSPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSK  348
              +Y+D+LF L    R     + E VTL SE ++ GTDT+AT +EWA+  L+ N  IQ K
Sbjct  275  GAAYVDSLFGLEPPTR-GPLGDEEYVTLCSEAISAGTDTSATTVEWAMLHLVMNQEIQEK  333

Query  349  LYEEIKSVVG-DRKVDEKDTDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIP  525
            LY+EI   VG D ++ E+D +KMPYL A+VKE  R+HPP  F L+HA T+ T+L GY IP
Sbjct  334  LYQEIIDCVGKDGEIKEEDVEKMPYLEAIVKETFRRHPPGHFLLSHAATKDTELAGYTIP  393

Query  526  MDCGVEFFLPAISDDPTLWSDPEKFDPDRFLSG-GEDADITGVTAVKMMPFG  678
                VE +   I++DP +WSDP +F P+RFL G G   D+TG  AVKM+PFG
Sbjct  394  AGVYVEIYTAWITEDPDIWSDPSEFRPERFLHGDGVGVDVTGTRAVKMLPFG  445



>ref|XP_006307273.1| hypothetical protein CARUB_v10008888mg [Capsella rubella]
 gb|EOA40171.1| hypothetical protein CARUB_v10008888mg [Capsella rubella]
Length=510

 Score =   207 bits (527),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 109/233 (47%), Positives = 152/233 (65%), Gaps = 7/233 (3%)
 Frame = +1

Query  1    VLDPRVDDFLPILSPFFSKQRKRVLEVRKQQIETIVPLIERRRR---ALENPGSDK-SAA  168
            +  P + DFLP+ +P F +Q +   E+RK Q++ +VPLI  RR+   A E+P  +  S  
Sbjct  217  ITSPTLPDFLPVFTPLFRRQVREARELRKTQLDCLVPLIRNRRKFVLAKESPNEEMVSPI  276

Query  169  TFSYLDTLFDLTVEGRKSSPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSK  348
              +Y+D+LF L +  R     + E+VTL SE ++ GTDT+AT +EWA+  L+ +  IQ K
Sbjct  277  GAAYVDSLFGLNLVERGGELRDEEIVTLCSEIVSAGTDTSATTLEWALCHLVSDQNIQEK  336

Query  349  LYEEIKSVVGDRKV-DEKDTDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIP  525
            LYEE+  VVG   V +E D  KMPYL A+VKE LR+HPP  F L+HA  + T+LGGYDIP
Sbjct  337  LYEEVVGVVGKNGVVEEDDVAKMPYLEAIVKETLRRHPPGHFLLSHAAVKDTELGGYDIP  396

Query  526  MDCGVEFFLPAISDDPTLWSDPEKFDPDRFLSGGE--DADITGVTAVKMMPFG  678
                VEF+   ++++P +WSDP KF P+RFL+GG+  DAD TG   V M+PFG
Sbjct  397  AGAYVEFYTAWVTENPEIWSDPGKFRPERFLTGGDGVDADWTGTRGVTMLPFG  449



>gb|KJB67165.1| hypothetical protein B456_010G178900 [Gossypium raimondii]
Length=505

 Score =   207 bits (527),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 111/232 (48%), Positives = 148/232 (64%), Gaps = 7/232 (3%)
 Frame = +1

Query  1    VLDPRVDDFLPILSPFFSKQRKRVLEVRKQQIETIVPLIERRRRALE---NPGSDK-SAA  168
            V  P++ DFLPIL+P F +Q K    +RK+Q+E + PLI+ RR  +E   NP  +  S  
Sbjct  215  VTSPQLPDFLPILTPLFRRQMKEAKALRKRQLECLAPLIKNRRAFVEKGENPNQEMVSPI  274

Query  169  TFSYLDTLFDLTVEGRKSSPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSK  348
              +Y+D+LF L    R       E VTL SE ++ GTDT+ T +EWA+  L+ N  IQ K
Sbjct  275  GAAYIDSLFGLEPPTR-GPLGEEEYVTLCSEVISAGTDTSTTTVEWAMLNLVMNQDIQEK  333

Query  349  LYEEIKSVVG-DRKVDEKDTDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIP  525
            LY+EI   VG D  + E+D +KMPYL AVVKE LR+HPP  F L+HA  + T+LGGY IP
Sbjct  334  LYQEIVDCVGKDGDIKEEDIEKMPYLEAVVKETLRRHPPGHFLLSHAAIKDTELGGYTIP  393

Query  526  MDCGVEFFLPAISDDPTLWSDPEKFDPDRFLSG-GEDADITGVTAVKMMPFG  678
                VEF+   I+++P +WSDP +F P+RFL G G   D+TG  AVKM+PFG
Sbjct  394  AGVHVEFYTAWITENPDIWSDPGEFRPERFLQGDGVGVDVTGTRAVKMVPFG  445



>ref|XP_002518513.1| cytochrome P450, putative [Ricinus communis]
 gb|EEF43900.1| cytochrome P450, putative [Ricinus communis]
Length=505

 Score =   206 bits (525),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 112/233 (48%), Positives = 144/233 (62%), Gaps = 8/233 (3%)
 Frame = +1

Query  1    VLDPRVDDFLPILSPFFSKQRKRVLEVRKQQIETIVPLIERRRRALE---NPGSDK-SAA  168
            +  P++ DFLPI +P F +Q KR  E+RK+Q+E + PLI  RR  +E   NPGS   SA 
Sbjct  214  ITSPQLPDFLPIFTPLFRRQMKRAKELRKRQMECLSPLIRNRRAYVEKGENPGSSMVSAV  273

Query  169  TFSYLDTLFDLTVEGRKSSPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSK  348
              +Y+D+LF L   GR       ELVTL SE    G DT+ + ++W    L+ N  IQ K
Sbjct  274  GAAYVDSLFGLEAPGR-GRLGEEELVTLCSELFVAGIDTSTSVLQWVFLELVLNQDIQEK  332

Query  349  LYEEIKSVVGDRKVDEKDT-DKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIP  525
            LYEEI   VG      +DT +KMPYLNAVVKE LR H P  F L HA T+ T+LGGY IP
Sbjct  333  LYEEIVDGVGKNGAITEDTVEKMPYLNAVVKETLRVHSPAHFTLAHAATEETELGGYKIP  392

Query  526  MDCGVEFFLPAISDDPTLWSDPEKFDPDRFLSG-GEDADITGVTA-VKMMPFG  678
             +  VEF++  +++DP +W DP  F P+RFL G G D D+TG    VKM+PFG
Sbjct  393  TNVNVEFYIEWMTEDPQMWKDPGVFRPERFLEGDGVDVDLTGTKGTVKMLPFG  445



>ref|XP_004508228.1| PREDICTED: uncharacterized protein LOC101501316 [Cicer arietinum]
Length=1078

 Score =   212 bits (540),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 108/230 (47%), Positives = 148/230 (64%), Gaps = 8/230 (3%)
 Frame = +1

Query  10    PRVDDFLPILSPFFSKQRKRVLEVRKQQIETIVPLIERRRRALENPGSDK-----SAATF  174
             P++ DFLP+L+P F    K   ++RK Q+E + PLI +R+  +E+ G        S    
Sbjct  788   PKLPDFLPVLTPLFRGHVKEARKLRKIQVELLAPLIRKRKAYVESDGKCGDPEMVSPVGA  847

Query  175   SYLDTLFDLTVEGRKSSPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLY  354
             +Y+D+LF L V GR       ELVTLVSE ++ GTDT+ATA+EWA+  L+ +  IQ +LY
Sbjct  848   AYVDSLFALEVPGR-GKLGEEELVTLVSEIMSAGTDTSATAVEWALLHLVMDQEIQERLY  906

Query  355   EEIKSVVGDRKVD-EKDTDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMD  531
              EI   VG   V  E D +KM YL A+VKE  R+HPP+ F L+HA T+ T+LGGY +P D
Sbjct  907   REIVDCVGKCGVILESDVEKMHYLGAIVKETFRRHPPSHFVLSHAATEETELGGYTVPAD  966

Query  532   CGVEFFLPAISDDPTLWSDPEKFDPDRFLSG-GEDADITGVTAVKMMPFG  678
               VEF+   +++DP +W DP +F P+RFL+G G D D+TG   VKMMPFG
Sbjct  967   ASVEFYTAWLTEDPNMWEDPNEFRPERFLNGDGVDVDVTGTKEVKMMPFG  1016



>ref|NP_172626.1| cytochrome P450, family 77, subfamily B, polypeptide 1 [Arabidopsis 
thaliana]
 gb|AAD30263.1|AC007296_24 Strong similarity to gb|U61231 cytochrome P450 from Arabidopsis 
thaliana and is a member of the PF|00067 Cytochrome P450 
family. ESTs gb|Z30775 and gb|Z30776 come from this gene [Arabidopsis 
thaliana]
 gb|AAM61354.1| putative cytochrome P450 [Arabidopsis thaliana]
 dbj|BAF01194.1| cytochrome P450 like protein [Arabidopsis thaliana]
 gb|AEE28758.1| cytochrome P450, family 77, subfamily B, polypeptide 1 [Arabidopsis 
thaliana]
Length=510

 Score =   205 bits (522),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 110/233 (47%), Positives = 151/233 (65%), Gaps = 7/233 (3%)
 Frame = +1

Query  1    VLDPRVDDFLPILSPFFSKQRKRVLEVRKQQIETIVPLIERRRR---ALENPGSDK-SAA  168
            +  P + DFLP+ +P F +Q +   E+RK Q+E +VPLI  RR+   A ENP  +  S  
Sbjct  217  ITSPTLPDFLPVFTPLFRRQVREARELRKTQLECLVPLIRNRRKFVDAKENPNEEMVSPI  276

Query  169  TFSYLDTLFDLTVEGRKSSPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSK  348
              +Y+D+LF L +  R     + E+VTL SE ++ GTDT+AT +EWA+  L+ +  IQ K
Sbjct  277  GAAYVDSLFRLNLIERGGELGDEEIVTLCSEIVSAGTDTSATTLEWALFHLVTDQNIQEK  336

Query  349  LYEEIKSVVGDRKV-DEKDTDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIP  525
            LYEE+  VVG   V +E D  KMPYL A+VKE LR+HPP  F L+HA  + T+LGGYDIP
Sbjct  337  LYEEVVGVVGKNGVVEEDDVAKMPYLEAIVKETLRRHPPGHFLLSHAAVKDTELGGYDIP  396

Query  526  MDCGVEFFLPAISDDPTLWSDPEKFDPDRFLSGGE--DADITGVTAVKMMPFG  678
                VE +   ++++P +WSDP KF P+RFL+GG+  DAD TG   V M+PFG
Sbjct  397  AGAYVEIYTAWVTENPDIWSDPGKFRPERFLTGGDGVDADWTGTRGVTMLPFG  449



>ref|XP_004148096.2| PREDICTED: cytochrome P450 89A2-like [Cucumis sativus]
 gb|KGN63389.1| hypothetical protein Csa_2G435520 [Cucumis sativus]
Length=512

 Score =   205 bits (521),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 112/233 (48%), Positives = 150/233 (64%), Gaps = 14/233 (6%)
 Frame = +1

Query  22   DFLPILSP-FFSKQRKRVLEVRKQQIETIVPLIERRRRALENPGS-----DKSAATFSYL  183
            D LP LS  FF K+ +  LE+R++Q + ++PLIE RR A++N  S     DK    FSY+
Sbjct  220  DLLPKLSKIFFRKRWEAFLEIRRKQDKVVIPLIESRRTAIQNRASSAKNEDKEGFVFSYV  279

Query  184  DTLFDLTV-EGRKSSPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEE  360
            DTL DL + E      T+ E+VTL SEFL+GGTDTTATA++W +A L++NP IQ+KL  E
Sbjct  280  DTLLDLKLPEEDNRKLTDEEMVTLCSEFLSGGTDTTATALQWIMANLVKNPEIQNKLLSE  339

Query  361  IKSVVGD---RKVDEKDTDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMD  531
            +K V+GD    +V E+D +K+PYL A++ E LR+HPP  F L HAV + T L  Y IP +
Sbjct  340  MKGVMGDGSREEVKEEDLEKLPYLKAMILEGLRRHPPGHFLLPHAVKEDTILENYVIPKN  399

Query  532  CGVEFFLPAISDDPTLWSDPEKFDPDRFLSGGE----DADITGVTAVKMMPFG  678
              V F +  I  DP +W DP  F P+RF+ G E    + DITG   +KMMPFG
Sbjct  400  GIVNFMVAEIGWDPKVWEDPMAFKPERFMKGNEGEGVEFDITGSKEIKMMPFG  452



>ref|XP_009118184.1| PREDICTED: cytochrome P450 77A3 [Brassica rapa]
Length=510

 Score =   204 bits (519),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 110/233 (47%), Positives = 153/233 (66%), Gaps = 7/233 (3%)
 Frame = +1

Query  1    VLDPRVDDFLPILSPFFSKQRKRVLEVRKQQIETIVPLIERRRR---ALENPGSDK-SAA  168
            +  P++ DFLP+ +P F +Q +   E+RK Q+E +VPLI+ RR    A E+P  +  S  
Sbjct  217  ITSPKLPDFLPVFTPLFRRQVREARELRKTQLECLVPLIKNRRAFVDAKESPNEEMVSPI  276

Query  169  TFSYLDTLFDLTVEGRKSSPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSK  348
              +Y+D+LF L    R     + E+VTL SE ++ GTDT+AT +EWA+  L+ +  IQ K
Sbjct  277  GAAYVDSLFSLKPVERGGELRDEEIVTLCSEIVSAGTDTSATTLEWALLHLVTDQNIQEK  336

Query  349  LYEEIKSVVGDRKV-DEKDTDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIP  525
            LYEE+  VVG R V +E D  KMPYL A+VKE LR+HPP  F L+HA  + T+LGGYDIP
Sbjct  337  LYEEVVGVVGKRGVVEEDDVAKMPYLEAIVKETLRRHPPGHFLLSHAAVKDTELGGYDIP  396

Query  526  MDCGVEFFLPAISDDPTLWSDPEKFDPDRFLSGGE--DADITGVTAVKMMPFG  678
                VEF+   ++++P +WSDP KF P+RFL+GG+  +AD TG   V M+PFG
Sbjct  397  AGAYVEFYTAWVTENPEIWSDPGKFRPERFLAGGDGVNADWTGTRGVTMLPFG  449



>ref|XP_010931808.1| PREDICTED: cytochrome P450 77A3 [Elaeis guineensis]
Length=518

 Score =   204 bits (518),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 105/237 (44%), Positives = 150/237 (63%), Gaps = 16/237 (7%)
 Frame = +1

Query  10   PRVDDFLPILSPFFSKQRKRVLEVRKQQIETIVPLIERRRRALENPGSDK---------S  162
            P++ DFLPI +P F  Q     ++RK+Q++ ++PL+ R RRA    G +K         S
Sbjct  220  PKLPDFLPIFTPLFRGQLSEAKKLRKRQMDCLLPLV-RARRAFVKSGGEKDVNSPWEMVS  278

Query  163  AATFSYLDTLFDLTVEGRKSSPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQ  342
                +Y+D+LF L   GR       ELVTL SE ++ GTDT+ATA+EWA+  L+ + G Q
Sbjct  279  PVGDAYIDSLFGLDPAGR-GRLGEGELVTLCSEVMSAGTDTSATALEWALLHLVLDQGAQ  337

Query  343  SKLYEEIKSVVG---DRKVDEKDTDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGG  513
             +LY+EI   VG   +RK+ E D + M YL AVVKE LR+HPP+ F L+HA T+ T+LGG
Sbjct  338  ERLYKEIVGNVGTEKERKITESDVEGMGYLQAVVKETLRRHPPSHFVLSHAATRETELGG  397

Query  514  YDIPMDCGVEFFLPAISDDPTLWSDPEKFDPDRFLSGGE--DADITGVTAVKMMPFG  678
            Y IP +  VEF+   +++DP++W   E++ P+RF  GGE  + D+TG   V+MMPFG
Sbjct  398  YRIPAEASVEFYTAWVAEDPSVWDKAEEWRPERFEEGGEGWETDVTGTRGVRMMPFG  454



>ref|XP_010101456.1| Cytochrome P450 77A3 [Morus notabilis]
 gb|EXB88439.1| Cytochrome P450 77A3 [Morus notabilis]
Length=498

 Score =   203 bits (516),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 107/232 (46%), Positives = 146/232 (63%), Gaps = 15/232 (6%)
 Frame = +1

Query  1    VLDPRVDDFLPILSPFFSKQRKRVLEVRKQQIETIVPLIERRRRALENPGSDK----SAA  168
            +  P++ DFLP+L+P F +Q +   E+R++Q+E +VPLI  RR+ +E+ G       S  
Sbjct  215  ITTPKLPDFLPVLTPLFRRQVRAAKELRRKQLECLVPLIRNRRKFIESGGKVDEEMVSPV  274

Query  169  TFSYLDTLFDLTVEGRKSSPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSK  348
              +Y+D+LFDL   GR       ELVTL SE +N GTDT+ATA EWA+  L+ +  +Q K
Sbjct  275  GAAYIDSLFDLEAPGR-GRLGEEELVTLCSEIINAGTDTSATAAEWALFHLVTDHSVQEK  333

Query  349  LYEEIKSVVG-DRKVDEKDTDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIP  525
            LY+EI   VG D  V E D +KM YL AVVKE  R+HPP+ F         TKLGGY +P
Sbjct  334  LYKEIVVTVGKDGVVLESDVEKMAYLGAVVKETFRRHPPSHF--------DTKLGGYTVP  385

Query  526  MDCGVEFFLPAISDDPTLWSDPEKFDPDRFLSG-GEDADITGVTAVKMMPFG  678
             D  VEF+   +++DP +W DP +F P+RFL G G D D+TG   V+M+PFG
Sbjct  386  ADASVEFYTAWLTEDPDMWKDPMEFRPERFLDGDGVDVDVTGTKGVRMVPFG  437



>ref|XP_002889880.1| CYP77B1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH66139.1| CYP77B1 [Arabidopsis lyrata subsp. lyrata]
Length=510

 Score =   203 bits (516),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 108/233 (46%), Positives = 151/233 (65%), Gaps = 7/233 (3%)
 Frame = +1

Query  1    VLDPRVDDFLPILSPFFSKQRKRVLEVRKQQIETIVPLIERRRR---ALENPGSDK-SAA  168
            +  P + DFLP+ +P F +Q +   E+RK Q+E +VPLI  RR+   A ++P  +  S  
Sbjct  217  ITSPTLPDFLPVFTPLFRRQVREARELRKTQLECLVPLIRNRRKFVDAKDSPNEEMVSPI  276

Query  169  TFSYLDTLFDLTVEGRKSSPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSK  348
              +Y+D+LF L +  R     + E+VTL SE ++ GTDT+AT +EWA+  L+ +  IQ K
Sbjct  277  GAAYVDSLFGLNLIERGGELGDEEIVTLCSEIVSAGTDTSATTLEWALLHLVTDQSIQEK  336

Query  349  LYEEIKSVVGDRKV-DEKDTDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIP  525
            LYEE+  VVG   V +E D  KMPYL A+VKE LR+HPP  F L+HA  + T+LGGYDIP
Sbjct  337  LYEEVVGVVGKNGVVEEDDVAKMPYLEAIVKETLRRHPPGHFLLSHAAVKDTELGGYDIP  396

Query  526  MDCGVEFFLPAISDDPTLWSDPEKFDPDRFLSGGE--DADITGVTAVKMMPFG  678
                VE +   ++++P +WSDP KF P+RFL+GG+  DAD TG   V M+PFG
Sbjct  397  AGAYVEIYTAWVTENPEIWSDPGKFRPERFLTGGDGVDADWTGTRGVTMLPFG  449



>ref|XP_011037690.1| PREDICTED: cytochrome P450 77A1-like [Populus euphratica]
Length=507

 Score =   202 bits (515),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 111/231 (48%), Positives = 147/231 (64%), Gaps = 10/231 (4%)
 Frame = +1

Query  10   PRVDDFLPILSPFFSKQRKRVLEVRKQQIETIVPLIERRRRAL----ENPGSDK-SAATF  174
            P++ DFLPIL+P F KQ K+  ++RK QIE +VPLI R RRA     ENP  +  S    
Sbjct  219  PQLPDFLPILTPLFRKQMKKAKDLRKAQIECLVPLI-RNRRAFVEKGENPKMEMLSPVGA  277

Query  175  SYLDTLFDLTVEGRKSSPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLY  354
            +Y+D+LF L   GR       ELVT+ SE    G DT+ + ++W    L+ N  IQ KLY
Sbjct  278  AYVDSLFTLNAPGR-GLLGEEELVTVCSELFVAGIDTSTSVLQWVFLELVLNQDIQEKLY  336

Query  355  EEIKSVVG-DRKVDEKDTDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMD  531
             EI   VG DR ++E+D +KM YLNAVVKE LR H P  F L+HA T+ T+LGGY IP +
Sbjct  337  REIVESVGKDRVINEEDVEKMNYLNAVVKETLRVHSPAHFTLSHATTEETELGGYKIPSN  396

Query  532  CGVEFFLPAISDDPTLWSDPEKFDPDRFLSG-GEDADITGVTA-VKMMPFG  678
              VEF++  +++DP+LW DP  F P+RF+ G G + D+TG    VKM+PFG
Sbjct  397  VNVEFYIEWMTEDPSLWKDPGIFRPERFIDGDGVNVDMTGTKGRVKMLPFG  447



>ref|XP_011086181.1| PREDICTED: cytochrome P450 77A3-like [Sesamum indicum]
Length=511

 Score =   202 bits (515),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 102/233 (44%), Positives = 150/233 (64%), Gaps = 12/233 (5%)
 Frame = +1

Query  10   PRVDDFLPILSPFFSKQRKRVLEVRKQQIETIVPLIERRRRALENPGSDKSAAT------  171
            P++ DFLP+L+P F  Q K   E+R++Q+E +VPLI R R+A    G   +A T      
Sbjct  219  PKLLDFLPVLTPLFRHQVKAAKELRRKQMECLVPLI-RNRKAFVESGGHPNATTSEMASP  277

Query  172  --FSYLDTLFDLTVEGRKSSPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQS  345
               +Y+D+LF +    R       E++TL +E +  GTDT+ATA+EWA+  L+++  +Q 
Sbjct  278  LGAAYVDSLFKIEPPSR-GRLGEEEILTLCTEAIVAGTDTSATALEWALLHLVQDQEMQE  336

Query  346  KLYEEIKSVVG-DRKVDEKDTDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDI  522
             LY+EI   VG +  + E D +KMPYL A+VKE  R+HPP++F L+HA T+ T+LGGY I
Sbjct  337  ILYKEIVECVGKNGAITESDVEKMPYLGAIVKETFRRHPPSYFLLSHAATKETELGGYTI  396

Query  523  PMDCGVEFFLPAISDDPTLWSDPEKFDPDRFLSG-GEDADITGVTAVKMMPFG  678
            P    VE +   +++DP +W +P +F P+RFL+G G D DITG+  VKM+PFG
Sbjct  397  PAGVNVEIYTKWLTEDPEMWQNPSEFRPERFLTGDGVDVDITGLRGVKMLPFG  449



>ref|XP_010525140.1| PREDICTED: cytochrome P450 89A2-like [Tarenaya hassleriana]
 gb|ABD96947.1| hypothetical protein [Cleome spinosa]
Length=505

 Score =   202 bits (514),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 106/228 (46%), Positives = 144/228 (63%), Gaps = 9/228 (4%)
 Frame = +1

Query  22   DFLPILSPF-FSKQRKRVLEVRKQQIETIVPLIERRRRALE---NPG---SDKSAATFSY  180
            D  P ++ F F K+ + VL++R+ Q   ++PLI  RR+ +E    PG   SD      SY
Sbjct  216  DVCPKITKFLFRKRWEEVLQLRRDQEALLLPLIRARRKIVEENARPGISDSDNKDYVVSY  275

Query  181  LDTLFDLTVEGRKSSPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEE  360
            +DTL DL +   K      E+VTL SEFLNGGTD+TATA++W +A L++ P +Q +L+EE
Sbjct  276  VDTLLDLELPDEKRKLDEGEMVTLCSEFLNGGTDSTATALQWIMANLVKYPEVQKRLHEE  335

Query  361  IKSVVGDR--KVDEKDTDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDC  534
            IKSV G+   +V E D  KMPYL AVV E LR+HPP   AL H VT  T LGGY +P + 
Sbjct  336  IKSVTGETGGEVKEDDLQKMPYLKAVVLEGLRRHPPGHLALPHRVTDETDLGGYSVPKNG  395

Query  535  GVEFFLPAISDDPTLWSDPEKFDPDRFLSGGEDADITGVTAVKMMPFG  678
             + F +  +  DP +W DP  F P+RF++GG+  DITG   +KM+PFG
Sbjct  396  TINFMIADMGRDPEVWEDPMAFKPERFVNGGDPIDITGSRGIKMIPFG  443



>ref|XP_009412014.1| PREDICTED: cytochrome P450 77A3-like [Musa acuminata subsp. malaccensis]
Length=510

 Score =   202 bits (514),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 100/236 (42%), Positives = 149/236 (63%), Gaps = 14/236 (6%)
 Frame = +1

Query  10   PRVDDFLPILSPFFSKQRKRVLEVRKQQIETIVPLIERRRRALENPGSDKSAATF-----  174
            P++ DFLPI +PFF  Q     ++RK+Q++ +VPL+  RR  +E+ G    ++ +     
Sbjct  215  PKLPDFLPIFTPFFRGQLTEARKLRKRQMDCLVPLVRARRAFVESGGKMDPSSAWEMVSP  274

Query  175  ---SYLDTLFDLTVEGRKSSPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQS  345
               +Y+D+L+ +   G K      ELVTL SE ++ GTDT+AT +EWA+  L+ +   Q 
Sbjct  275  VGEAYIDSLYGMEPSG-KGRLGEDELVTLCSEVMSAGTDTSATMLEWAMLHLVLDQSAQE  333

Query  346  KLYEEIKSVVG---DRKVDEKDTDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGY  516
            +LYEEI   VG    RK+ E D + M YL AVVKE +R+HPP+ F L+HA T+ T+LGGY
Sbjct  334  RLYEEIVGKVGRDKGRKITESDVEGMGYLQAVVKETMRRHPPSHFVLSHAATRETELGGY  393

Query  517  DIPMDCGVEFFLPAISDDPTLWSDPEKFDPDRFLSGGE--DADITGVTAVKMMPFG  678
             IP D  VEF+   ++++P+ W DP ++ P+RF  GGE  + D+TG   ++MMPFG
Sbjct  394  RIPADASVEFYTAWVTENPSTWKDPGEWRPERFEEGGEGWETDVTGTRGIRMMPFG  449



>gb|KDP20777.1| hypothetical protein JCGZ_21248 [Jatropha curcas]
Length=505

 Score =   201 bits (512),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 110/233 (47%), Positives = 145/233 (62%), Gaps = 8/233 (3%)
 Frame = +1

Query  1    VLDPRVDDFLPILSPFFSKQRKRVLEVRKQQIETIVPLIERRRRALE---NPGSDK-SAA  168
            +  P++ DFLPI +P F +Q KR  E+RK Q+E +VPLI  RR  +E   NPGS   S  
Sbjct  214  ITTPQLPDFLPIFTPLFRRQMKRAKELRKTQMECLVPLIRNRRAYVEKGDNPGSLMVSPV  273

Query  169  TFSYLDTLFDLTVEGRKSSPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSK  348
              +Y+D+LF L   GR       ELVTL SE    G DT+ + ++WA   L+ +  IQ K
Sbjct  274  GAAYVDSLFGLEAPGR-GRLGEEELVTLCSELFVAGIDTSTSVLQWAFLELVLHQDIQEK  332

Query  349  LYEEIKSVVGDRK-VDEKDTDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIP  525
            LY+EI   VG    + E + +KM YLNAVVKE LR H P  F L+HA T+ T+LGGY IP
Sbjct  333  LYKEIVDSVGKNGLITEDNVEKMTYLNAVVKETLRVHSPAHFTLSHATTEETELGGYKIP  392

Query  526  MDCGVEFFLPAISDDPTLWSDPEKFDPDRFLSG-GEDADITGVTA-VKMMPFG  678
             +  VEF++  +++DP LW DP+ F P+RFL G G D D+TG    VKM+PFG
Sbjct  393  TNVYVEFYIEWMTEDPNLWKDPDVFRPERFLEGDGVDVDLTGTKGTVKMLPFG  445



>emb|CDY34640.1| BnaC08g41990D [Brassica napus]
Length=510

 Score =   201 bits (512),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 107/233 (46%), Positives = 151/233 (65%), Gaps = 7/233 (3%)
 Frame = +1

Query  1    VLDPRVDDFLPILSPFFSKQRKRVLEVRKQQIETIVPLIERRRR---ALENPGSDK-SAA  168
            +  P++ DFLP+ +P F +Q +   E+RK Q+E +VP+I+ RR    A E+P  +  S  
Sbjct  217  ITSPKLPDFLPVFTPLFRRQVREARELRKTQLECLVPMIKNRRAFVDAKESPNEEMVSPI  276

Query  169  TFSYLDTLFDLTVEGRKSSPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSK  348
              +Y+D+LF L    R     + E+VTL SE ++ GTDT+AT +EWA+  L+ +  IQ K
Sbjct  277  GAAYVDSLFTLKPVERGGELRDEEIVTLCSEIVSAGTDTSATTLEWALHHLVTDQNIQEK  336

Query  349  LYEEIKSVVGDRKV-DEKDTDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIP  525
            LYEE+  VVG   V +E D  KMPYL A+VKE LR+HPP  F L+HA  + T+LGGYDIP
Sbjct  337  LYEEVVGVVGKNGVVEEDDVAKMPYLEAIVKETLRRHPPGHFLLSHAAVKNTELGGYDIP  396

Query  526  MDCGVEFFLPAISDDPTLWSDPEKFDPDRFLSGGE--DADITGVTAVKMMPFG  678
                VEF+   ++++P +WSDP  F P+RFL+GG+  +AD TG   V M+PFG
Sbjct  397  AGAYVEFYTAWVTENPEIWSDPGMFRPERFLAGGDGVNADWTGTRGVTMLPFG  449



>ref|XP_012091383.1| PREDICTED: cytochrome P450 77A1 [Jatropha curcas]
 ref|XP_012091385.1| PREDICTED: cytochrome P450 77A1 [Jatropha curcas]
Length=520

 Score =   201 bits (512),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 110/233 (47%), Positives = 145/233 (62%), Gaps = 8/233 (3%)
 Frame = +1

Query  1    VLDPRVDDFLPILSPFFSKQRKRVLEVRKQQIETIVPLIERRRRALE---NPGSDK-SAA  168
            +  P++ DFLPI +P F +Q KR  E+RK Q+E +VPLI  RR  +E   NPGS   S  
Sbjct  229  ITTPQLPDFLPIFTPLFRRQMKRAKELRKTQMECLVPLIRNRRAYVEKGDNPGSLMVSPV  288

Query  169  TFSYLDTLFDLTVEGRKSSPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSK  348
              +Y+D+LF L   GR       ELVTL SE    G DT+ + ++WA   L+ +  IQ K
Sbjct  289  GAAYVDSLFGLEAPGR-GRLGEEELVTLCSELFVAGIDTSTSVLQWAFLELVLHQDIQEK  347

Query  349  LYEEIKSVVGDRK-VDEKDTDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIP  525
            LY+EI   VG    + E + +KM YLNAVVKE LR H P  F L+HA T+ T+LGGY IP
Sbjct  348  LYKEIVDSVGKNGLITEDNVEKMTYLNAVVKETLRVHSPAHFTLSHATTEETELGGYKIP  407

Query  526  MDCGVEFFLPAISDDPTLWSDPEKFDPDRFLSG-GEDADITGVTA-VKMMPFG  678
             +  VEF++  +++DP LW DP+ F P+RFL G G D D+TG    VKM+PFG
Sbjct  408  TNVYVEFYIEWMTEDPNLWKDPDVFRPERFLEGDGVDVDLTGTKGTVKMLPFG  460



>ref|XP_002304925.2| hypothetical protein POPTR_0004s01860g [Populus trichocarpa]
 gb|EEE85436.2| hypothetical protein POPTR_0004s01860g [Populus trichocarpa]
Length=507

 Score =   200 bits (509),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 111/231 (48%), Positives = 146/231 (63%), Gaps = 10/231 (4%)
 Frame = +1

Query  10   PRVDDFLPILSPFFSKQRKRVLEVRKQQIETIVPLIERRRRAL----ENPGSDK-SAATF  174
            P++ DFLPIL+P F KQ KR  ++RK QIE +VPLI R RRA     ENP  +  S    
Sbjct  219  PQLPDFLPILTPLFRKQMKRAKDLRKTQIECLVPLI-RNRRAFVEKGENPKMEMLSPVGA  277

Query  175  SYLDTLFDLTVEGRKSSPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLY  354
            +Y+D+LF L   GR       ELVT+ SE    G DT+ + ++W    L+ N  IQ KLY
Sbjct  278  AYVDSLFTLKAPGR-GLLGEEELVTVCSELFVAGIDTSTSVLQWVFLELVLNQDIQEKLY  336

Query  355  EEIKSVVG-DRKVDEKDTDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMD  531
             EI   VG D  ++E+D +KM YLNAVVKE LR H P  F L+HA T+ T+LGGY IP +
Sbjct  337  REIVESVGKDGVINEEDVEKMNYLNAVVKETLRVHSPAHFTLSHATTEETELGGYKIPSN  396

Query  532  CGVEFFLPAISDDPTLWSDPEKFDPDRFLSG-GEDADITGVTA-VKMMPFG  678
              VEF++  +++DP+LW DP  F P+RF+ G G + D+TG    VKM+PFG
Sbjct  397  VNVEFYIEWMTEDPSLWKDPGIFRPERFIDGDGVNVDMTGTKGKVKMLPFG  447



>ref|XP_008812264.1| PREDICTED: cytochrome P450 77A3-like [Phoenix dactylifera]
Length=516

 Score =   200 bits (509),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 101/236 (43%), Positives = 149/236 (63%), Gaps = 14/236 (6%)
 Frame = +1

Query  10   PRVDDFLPILSPFFSKQRKRVLEVRKQQIETIVPLIERRRRALENPGSDKSAATF-----  174
            P++ DFLP+L+P F  Q     ++RK+Q++ ++PL   RR  +E+ G    + ++     
Sbjct  220  PKLPDFLPMLTPLFRGQLTEARKLRKRQMDCLLPLARARRAFVESGGEKDVSCSWEMVSP  279

Query  175  ---SYLDTLFDLTVEGRKSSPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQS  345
               +Y+D+LF L   GR       EL+TL SE ++ GTDT+ATA+EWA+  LI N   Q 
Sbjct  280  IGEAYVDSLFGLEPAGR-GRLGEEELMTLCSEVMSAGTDTSATALEWALLHLILNQAAQE  338

Query  346  KLYEEIKSVVGDRK---VDEKDTDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGY  516
            +LY+EI   VG  K   + E D + M YL A+VKE LR+HPP+ F L+HA T+ T+LGG+
Sbjct  339  RLYKEILRKVGTEKGMKITEDDVEGMGYLQAMVKETLRRHPPSHFVLSHAATRETQLGGF  398

Query  517  DIPMDCGVEFFLPAISDDPTLWSDPEKFDPDRFLSGGE--DADITGVTAVKMMPFG  678
             IP D  VEF+   +++DP++W  PE++ P+RF  GGE  D D+TG   ++MMPFG
Sbjct  399  RIPTDANVEFYTAWMTEDPSVWDKPEEWRPERFEEGGEGWDTDVTGTRGLRMMPFG  454



>ref|XP_009110714.1| PREDICTED: cytochrome P450 77A3-like [Brassica rapa]
Length=510

 Score =   200 bits (508),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 109/233 (47%), Positives = 151/233 (65%), Gaps = 7/233 (3%)
 Frame = +1

Query  1    VLDPRVDDFLPILSPFFSKQRKRVLEVRKQQIETIVPLIERRR---RALENPGSDK-SAA  168
            +  P + DFLP+L+P F +Q +   E+RK Q+E++VPLI+ RR    A E+P  +  S  
Sbjct  217  ITSPTLPDFLPVLTPLFRRQVREARELRKTQLESLVPLIKNRRAFVEAKESPNEEMVSPI  276

Query  169  TFSYLDTLFDLTVEGRKSSPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSK  348
              +Y+D+LF L    R     + E+VTL SE ++ GTDT+AT +EWA+  L  +  IQ K
Sbjct  277  GAAYVDSLFALKPVERGGELKDEEIVTLCSEIVSAGTDTSATTLEWALLHLATDQNIQEK  336

Query  349  LYEEIKSVVGDRKV-DEKDTDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIP  525
            LYEE+  VVG   V +E D  KMPYL A+VKE LR+HPP  F L+HA  + T+LGGYDIP
Sbjct  337  LYEEVVGVVGKNGVVEEDDVAKMPYLEAIVKETLRRHPPGHFLLSHAAVKDTELGGYDIP  396

Query  526  MDCGVEFFLPAISDDPTLWSDPEKFDPDRFLSGGE--DADITGVTAVKMMPFG  678
                VEF+   ++++P +WSDP +F P+RFL GG+  +AD TG   V M+PFG
Sbjct  397  SGAYVEFYTAWVTENPEIWSDPGEFRPERFLPGGDGVNADWTGTRGVTMLPFG  449



>ref|XP_008784547.1| PREDICTED: cytochrome P450 77A3-like [Phoenix dactylifera]
Length=515

 Score =   200 bits (508),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 102/237 (43%), Positives = 151/237 (64%), Gaps = 16/237 (7%)
 Frame = +1

Query  10   PRVDDFLPILSPFFSKQRKRVLEVRKQQIETIVPLIERRRRALENPGSDKSAAT------  171
            P++ DFLP+L+P F  Q     ++RK+Q++ ++PL+ R RRA    G +K A +      
Sbjct  220  PKLPDFLPMLTPLFRGQLSEAKKLRKRQMDCLLPLV-RARRAFVKSGGEKDANSPWEMVS  278

Query  172  ---FSYLDTLFDLTVEGRKSSPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQ  342
                +Y+D+LF L   GR       ELVTL SE ++ GTDT+ATA+EWA+  L+ +   Q
Sbjct  279  LVGEAYIDSLFALEPAGR-GRLGEEELVTLCSEVMSAGTDTSATALEWALLHLVLDQAAQ  337

Query  343  SKLYEEIKSVVGD---RKVDEKDTDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGG  513
             +L++EI   VG    +K+ E D + M YL AVVKE LR+HPP+ F L+HA T+ T+L G
Sbjct  338  ERLHKEIVGKVGSEKGKKITETDVEGMGYLQAVVKETLRRHPPSHFVLSHAATRETELAG  397

Query  514  YDIPMDCGVEFFLPAISDDPTLWSDPEKFDPDRFLSGGE--DADITGVTAVKMMPFG  678
            Y IP D  VEF+   +++DP++W +PE++ P+RF  GG+  + D+TG   V+MMPFG
Sbjct  398  YRIPADASVEFYTAWVTEDPSVWENPEEWRPERFEEGGDGRETDVTGTRGVRMMPFG  454



>dbj|BAK06611.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=528

 Score =   200 bits (509),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 98/242 (40%), Positives = 146/242 (60%), Gaps = 19/242 (8%)
 Frame = +1

Query  10   PRVDDFLPILSPFFSKQRKRVLEVRKQQIETIVPLIERRRRALENPGSDKSAATF-----  174
            P++ DFLP+L+P F ++      +R++Q+  ++PL+  RR  L   G+   AA       
Sbjct  217  PKLPDFLPLLTPLFRRELAEAKNLRRRQLNCLLPLVRARREFLRTGGNACKAAGEGNRVI  276

Query  175  -----------SYLDTLFDLTVEGRKSSPTNAELVTLVSEFLNGGTDTTATAIEWAIARL  321
                       +Y+D+LFDL   GR       ELVTL SE ++ GTDT+ATA+EW +  L
Sbjct  277  GGVEMMSPPGEAYVDSLFDLEPPGRGKRLGEEELVTLCSEVMSAGTDTSATALEWVMMHL  336

Query  322  IENPGIQSKLYEEIKSVVGD-RKVDEKDTDKMPYLNAVVKELLRKHPPTFFALTHAVTQP  498
            I +P  Q ++Y+E+ +  G   ++ E D + +PYL AVVKE  R+HPP+ F L+HA T+ 
Sbjct  337  ILDPAAQERVYDEVVAKAGKTARITEADVESLPYLQAVVKETFRRHPPSHFVLSHAATRD  396

Query  499  TKLGGYDIPMDCGVEFFLPAISDDPTLWSDPEKFDPDRFLSGGE--DADITGVTAVKMMP  672
             +LGGY +P +  VEF+   ++++P  W DP  + P+RFL GGE  D DITG  A++MMP
Sbjct  397  AELGGYRVPANASVEFYTAWVTENPETWPDPGAWRPERFLEGGEGHDTDITGTRALRMMP  456

Query  673  FG  678
            FG
Sbjct  457  FG  458



>ref|XP_009393330.1| PREDICTED: cytochrome P450 77A3-like [Musa acuminata subsp. malaccensis]
Length=510

 Score =   200 bits (508),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 101/236 (43%), Positives = 149/236 (63%), Gaps = 14/236 (6%)
 Frame = +1

Query  10   PRVDDFLPILSPFFSKQRKRVLEVRKQQIETIVPLIERRRRALENPGSDKSAATF-----  174
            P++ DFLP+ +PFF  Q     ++RK+Q++ +VPL+  RR  +E+ G    ++ +     
Sbjct  215  PKLPDFLPVFTPFFRGQLTEARKLRKRQMDCLVPLLRARRAFVESGGKCDPSSPWEMVSP  274

Query  175  ---SYLDTLFDLTVEGRKSSPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQS  345
               +YLD+L  L   G K    + ELVTL SE ++ GTDT+AT +EWA+  L+ +   Q 
Sbjct  275  VGEAYLDSLLCLEPTG-KGRLRDEELVTLCSEVMSAGTDTSATMLEWAMLHLVLDQSAQD  333

Query  346  KLYEEIKSVVG---DRKVDEKDTDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGY  516
            +LYEEI   VG     K+ E D + M YL AVVKE +R+HPP+ F L+HA T+ T+LGGY
Sbjct  334  QLYEEIVEKVGRDKGMKITESDVEGMSYLQAVVKETMRRHPPSHFVLSHAATRETELGGY  393

Query  517  DIPMDCGVEFFLPAISDDPTLWSDPEKFDPDRFLSGGE--DADITGVTAVKMMPFG  678
             IP D  VEF+   ++++P+ W DP ++ P+RF+ GGE  + DITG   ++MMPFG
Sbjct  394  RIPADASVEFYTAWVTENPSTWKDPGEWRPERFMKGGEGWETDITGTRGIRMMPFG  449



>ref|XP_010665549.1| PREDICTED: cytochrome P450 77A4 [Beta vulgaris subsp. vulgaris]
Length=512

 Score =   199 bits (507),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 106/234 (45%), Positives = 146/234 (62%), Gaps = 11/234 (5%)
 Frame = +1

Query  10   PRVDDFLPILSPFFSK-QRKRVLEVRKQQIETIVPLIERRRRALENPGSDKSAATF----  174
            P++ DFLP+L+   ++ Q +R  E+RK+Q+E + PL+  R+  +E+ G   S+       
Sbjct  218  PKLPDFLPVLTTLVARGQLRRAKELRKRQMEILGPLVRARKAFVESGGRADSSPLHMASP  277

Query  175  ---SYLDTLFDLTVEGRKSSPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQS  345
               +Y+D+L  L   GR       ELVTL SE +N GTDT+ATAIEWA+  L+ +  +Q 
Sbjct  278  VGAAYVDSLMGLDPPGRPGGLGEEELVTLCSEVINAGTDTSATAIEWALLHLVVDQRVQQ  337

Query  346  KLYEEIKSVVGDRKV-DEKDTDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDI  522
            KLYEEI  VVG   + +E D +KM YL A++KE LR+HPP+ F L+HA T  T LGGY I
Sbjct  338  KLYEEIVDVVGKNGIINEDDLEKMVYLKAIIKETLRRHPPSHFLLSHAATDDTVLGGYTI  397

Query  523  PMDCGVEFFLPAISDDPTLWSDPEKFDPDRFLSG--GEDADITGVTAVKMMPFG  678
            P D  +E +   ++ DPTLW DPE F P+RFL G  G + D TG   V M+PFG
Sbjct  398  PKDINLEIYTAWLTQDPTLWPDPEAFRPERFLPGEEGYEVDWTGNRGVNMLPFG  451



>gb|KFK31941.1| hypothetical protein AALP_AA6G179900 [Arabis alpina]
Length=510

 Score =   199 bits (506),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 109/233 (47%), Positives = 149/233 (64%), Gaps = 7/233 (3%)
 Frame = +1

Query  1    VLDPRVDDFLPILSPFFSKQRKRVLEVRKQQIETIVPLIERRRR---ALENPGSDK-SAA  168
            +  P + DFLP+ +P F +Q +   E+RK Q+E +VPLI  RR+   A E+P  +  S  
Sbjct  217  ITSPTLPDFLPVFTPLFRRQVREARELRKTQLECLVPLIRNRRKFVDANESPNEEMVSPI  276

Query  169  TFSYLDTLFDLTVEGRKSSPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSK  348
              +Y+D+LF L    R       E+VTL SE ++ GTDT+AT +EWA+  L+ +  IQ K
Sbjct  277  GAAYVDSLFSLNPVERGGELGEEEIVTLCSEIVSAGTDTSATTLEWALLHLVTDHNIQEK  336

Query  349  LYEEIKSVVGDRKV-DEKDTDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIP  525
            LYEE+  VVG   V +E D  KMPYL A+VKE LR+HPP  F L+HA  + T+LGGYDIP
Sbjct  337  LYEEVVGVVGKNGVVEEDDVAKMPYLEAIVKETLRRHPPGHFLLSHAAVKDTELGGYDIP  396

Query  526  MDCGVEFFLPAISDDPTLWSDPEKFDPDRFLSGGE--DADITGVTAVKMMPFG  678
                VE +   ++++P +WSDP  F P+RFL+GG+  DAD TG   VKM+PFG
Sbjct  397  AGAYVEIYTAWVTENPEIWSDPGTFRPERFLTGGDGVDADWTGTRGVKMLPFG  449



>ref|XP_009363721.1| PREDICTED: cytochrome P450 77A1-like [Pyrus x bretschneideri]
Length=537

 Score =   199 bits (507),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 113/258 (44%), Positives = 158/258 (61%), Gaps = 35/258 (14%)
 Frame = +1

Query  1    VLDPRVDDFLPILSPFFSKQRKRVLEVRKQQIETIVPLI-ERRRRALENPG---------  150
            V  P++ DFLP+L+P F +Q     E+R++Q+E +VPL+ +R+   LE+           
Sbjct  215  VTTPKLPDFLPVLTPLFRRQVGEAKELRRRQLECLVPLVRDRKAFVLESDNVEDENVRKI  274

Query  151  --SDKSAATFSYLDTLFDLTVEGRKSSPT-----NAELVTLVSEFLNGGTDTTATAIEWA  309
              S K AA   Y+D+LF+L V GR            ELVTLVSE +N GTDT+ATA+EWA
Sbjct  275  MVSPKGAA---YIDSLFELEVPGRGKDGGRRRLEEEELVTLVSEVINAGTDTSATALEWA  331

Query  310  IARLIENPGIQSKLYEEIKSVVG-DRK------------VDEKDTDKMPYLNAVVKELLR  450
            +  L+ +  IQ KLY+EI   VG DR             + E D +KM YL+AVVKE  R
Sbjct  332  LFHLVMDQKIQEKLYKEIVDCVGTDRSPYADQQKPQEEVITESDVEKMSYLSAVVKETFR  391

Query  451  KHPPTFFALTHAVTQPTKLGGYDIPMDCGVEFFLPAISDDPTLWSDPEKFDPDRFLSGGE  630
            +HPP+ F L+HA  + T+LGGY +P D  VEF+   +++DP +W DP +F P+RF++GG+
Sbjct  392  RHPPSHFVLSHAAVKDTELGGYTVPADASVEFYTAWLTEDPEMWEDPGEFRPERFMAGGD  451

Query  631  --DADITGVTAVKMMPFG  678
              D D+TG   VKM+PFG
Sbjct  452  GVDVDVTGTKGVKMVPFG  469



>ref|XP_009370410.1| PREDICTED: cytochrome P450 77A1-like [Pyrus x bretschneideri]
Length=537

 Score =   199 bits (506),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 113/258 (44%), Positives = 158/258 (61%), Gaps = 35/258 (14%)
 Frame = +1

Query  1    VLDPRVDDFLPILSPFFSKQRKRVLEVRKQQIETIVPLI-ERRRRALENPG---------  150
            V  P++ DFLP+L+P F +Q     E+R++Q+E +VPL+ +R+   LE+           
Sbjct  215  VTTPKLPDFLPVLTPLFRRQVGEAKELRRRQLECLVPLVRDRKAFVLESDNVEDENVRKI  274

Query  151  --SDKSAATFSYLDTLFDLTVEGRKSSPT-----NAELVTLVSEFLNGGTDTTATAIEWA  309
              S K AA   Y+D+LF+L V GR            ELVTLVSE +N GTDT+ATA+EWA
Sbjct  275  MVSPKGAA---YIDSLFELEVPGRGKDGGRRRLEEEELVTLVSEVINAGTDTSATALEWA  331

Query  310  IARLIENPGIQSKLYEEIKSVVG-DRK------------VDEKDTDKMPYLNAVVKELLR  450
            +  L+ +  IQ KLY+EI   VG DR             + E D +KM YL+AVVKE  R
Sbjct  332  LFHLVMDQKIQEKLYKEIVDCVGTDRSPYTDQQKPQEEVITESDVEKMSYLSAVVKETFR  391

Query  451  KHPPTFFALTHAVTQPTKLGGYDIPMDCGVEFFLPAISDDPTLWSDPEKFDPDRFLSGGE  630
            +HPP+ F L+HA  + T+LGGY +P D  VEF+   +++DP +W DP +F P+RF++GG+
Sbjct  392  RHPPSHFVLSHAAVKDTELGGYTVPADASVEFYTAWLTEDPEMWEDPGEFRPERFMAGGD  451

Query  631  --DADITGVTAVKMMPFG  678
              D D+TG   VKM+PFG
Sbjct  452  GVDVDVTGTKGVKMVPFG  469



>ref|XP_010052825.1| PREDICTED: cytochrome P450 77A2 [Eucalyptus grandis]
 gb|KCW76940.1| hypothetical protein EUGRSUZ_D01302 [Eucalyptus grandis]
Length=533

 Score =   199 bits (506),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 107/242 (44%), Positives = 149/242 (62%), Gaps = 21/242 (9%)
 Frame = +1

Query  10   PRVDDFLPILSPFFSKQRKRVLEVRKQQIETIVPLIERRRRALENPGSDK----------  159
            P++ DFLP+L+P F +Q K   E+R++Q+E +VPLI  R+  +E  G             
Sbjct  223  PKLPDFLPVLTPLFRRQLKAARELRRRQMECLVPLIRERKAFVEGGGGGGGAGRNGGSGN  282

Query  160  -------SAATFSYLDTLFDLTVEGRKSSPTNAELVTLVSEFLNGGTDTTATAIEWAIAR  318
                   S    +Y+D+L  L   GR+    + ELVTL SE ++ GTDT+AT +EWA+  
Sbjct  283  EPRFEMLSPVGAAYVDSLLGLEPAGRELG--DEELVTLCSEVISAGTDTSATTVEWALLH  340

Query  319  LIENPGIQSKLYEEIKSVVG-DRKVDEKDTDKMPYLNAVVKELLRKHPPTFFALTHAVTQ  495
            L+++  +Q K+Y+EI   VG D  VDE D +KM YL AVVKE LR+HPP+ F L+HA T+
Sbjct  341  LVQDQDMQQKVYDEIVQHVGKDGLVDENDVEKMTYLGAVVKETLRRHPPSHFLLSHAPTE  400

Query  496  PTKLGGYDIPMDCGVEFFLPAISDDPTLWSDPEKFDPDRFLSG-GEDADITGVTAVKMMP  672
             T+LGGY IP    VEF+   ++ DP LW+DP+ F P RFL G G   D+TG   V+M+P
Sbjct  401  ETELGGYVIPAQATVEFYTAWVTQDPDLWADPDDFRPGRFLDGDGIGVDVTGTKGVRMVP  460

Query  673  FG  678
            FG
Sbjct  461  FG  462



>ref|XP_009362723.1| PREDICTED: cytochrome P450 77A3-like [Pyrus x bretschneideri]
Length=538

 Score =   199 bits (505),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 110/252 (44%), Positives = 156/252 (62%), Gaps = 29/252 (12%)
 Frame = +1

Query  10   PRVDDFLPILSPFFSKQRKRVLEVRKQQIETIVPLIERRRR------ALENPGSDK---S  162
            P++ DFLP+L+P F +Q +   E+R++Q+E +VPL+  R+        +E+   +K   S
Sbjct  219  PKLPDFLPVLTPLFRRQVREAKELRRRQLECLVPLVRERKAFVLQSDNVEDEKVNKIMVS  278

Query  163  AATFSYLDTLFDLTVEGR-----KSSPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIE  327
                +Y+D+LF+L V  R     +      ELVTLVSE +N GTDT+ATAIEWA+  L+ 
Sbjct  279  PKGAAYIDSLFELEVPVRGKDRVRRRLEEEELVTLVSEVINAGTDTSATAIEWALLHLVM  338

Query  328  NPGIQSKLYEEIKSVVG-DRK------------VDEKDTDKMPYLNAVVKELLRKHPPTF  468
            +  IQ KLY+EI   VG DR             + E D +KM YL+AVVKE  R+HPP+ 
Sbjct  339  DQKIQEKLYKEIVDCVGTDRSPYTNEQKPHEEVITESDVEKMSYLSAVVKETFRRHPPSH  398

Query  469  FALTHAVTQPTKLGGYDIPMDCGVEFFLPAISDDPTLWSDPEKFDPDRFLSGGE--DADI  642
            F L+HA  + T+LGGY +P D  VEF+   +++DP +W DP +F P+RFL GG+  D D+
Sbjct  399  FVLSHAALENTELGGYTVPADASVEFYTAWVTEDPDMWEDPGEFRPERFLEGGDGVDVDV  458

Query  643  TGVTAVKMMPFG  678
            TG   VKM+PFG
Sbjct  459  TGTKGVKMVPFG  470



>emb|CDY64815.1| BnaA08g31590D [Brassica napus]
Length=510

 Score =   198 bits (503),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 108/233 (46%), Positives = 150/233 (64%), Gaps = 7/233 (3%)
 Frame = +1

Query  1    VLDPRVDDFLPILSPFFSKQRKRVLEVRKQQIETIVPLIERRR---RALENPGSDK-SAA  168
            +  P + DFLP+L+P F +Q +   E+RK Q+E++VPLI+ RR    A E+P  +  S  
Sbjct  217  ITSPTLPDFLPVLTPLFRRQVREARELRKTQLESLVPLIKNRRAFVEAKESPNEEMVSPI  276

Query  169  TFSYLDTLFDLTVEGRKSSPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSK  348
              +Y+D+LF L    R     + E+VTL SE ++ GTDT+AT +EWA+  L  +  IQ K
Sbjct  277  GAAYVDSLFALKPVERGGELKDEEIVTLCSEIVSAGTDTSATTLEWALLHLATDQNIQEK  336

Query  349  LYEEIKSVVGDRKV-DEKDTDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIP  525
            LYEE+  VVG   V +E D  KMPYL A+VKE LR+HPP  F L+HA  + T+LGGYDIP
Sbjct  337  LYEEVVGVVGKNGVVEEDDVAKMPYLEAIVKETLRRHPPGHFLLSHAAVKDTELGGYDIP  396

Query  526  MDCGVEFFLPAISDDPTLWSDPEKFDPDRFLSGGE--DADITGVTAVKMMPFG  678
                VEF+   ++++P +WSDP +F P+RFL  G+  +AD TG   V M+PFG
Sbjct  397  SGAYVEFYTAWVTENPEIWSDPGEFRPERFLPAGDGVNADWTGTRGVTMLPFG  449



>ref|XP_004235319.1| PREDICTED: cytochrome P450 89A2-like [Solanum lycopersicum]
Length=517

 Score =   197 bits (502),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 100/221 (45%), Positives = 137/221 (62%), Gaps = 11/221 (5%)
 Frame = +1

Query  49   FSKQRKRVLEVRKQQIETIVPLIERRRRALENPGSDKSAATFSYLDTLFDLTVEGRKSSP  228
            F  + K ++E+R++Q   I+PLIE R RA E           +Y+DTL +L     K + 
Sbjct  233  FRNRWKELIELRQEQESIIIPLIEARSRAREQRTEHGDEFVVAYVDTLLNLEFPEEKRNL  292

Query  229  TNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEIKSVVGDRK-------  387
             + E+VTL SEFL+ GTDTT+TA++W +A L++NP IQ KLY+EI +VVG+++       
Sbjct  293  NHGEIVTLCSEFLSAGTDTTSTALQWIMANLVKNPSIQEKLYQEIATVVGEKQSKLTDEE  352

Query  388  -VDEKDTDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVEFFLPAIS  564
             V E+D  KMPYL AV+ E LR+HPP  F L H VT+  +L GY IP D  + F +  + 
Sbjct  353  VVKEEDLQKMPYLKAVILEGLRRHPPGHFVLPHTVTEEVELNGYVIPKDVTINFMVAEMG  412

Query  565  DDPTLWSDPEKFDPDRFLSGGEDA---DITGVTAVKMMPFG  678
             DP +W DP +F P+RFL  G D    DITG   +KMMPFG
Sbjct  413  LDPKVWEDPLEFRPERFLVEGSDNEGFDITGSREIKMMPFG  453



>ref|XP_011086179.1| PREDICTED: cytochrome P450 77A3-like [Sesamum indicum]
Length=510

 Score =   197 bits (500),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 102/233 (44%), Positives = 149/233 (64%), Gaps = 13/233 (6%)
 Frame = +1

Query  10   PRVDDFLPILSPFFSKQRKRVLEVRKQQIETIVPLIERRRRALENPGSDKSAAT------  171
            P++ DFLP+L+P F  Q K   E+R++Q+E +VPLI R R+A    G   +A T      
Sbjct  219  PKLLDFLPVLTPLFRHQVKAAKELRRKQMECLVPLI-RNRKAFVESGGHPNATTSEMASP  277

Query  172  --FSYLDTLFDLTVEGRKSSPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQS  345
               +Y+D+LF++    R       E++TL +E +  GTDT+ATA+EWA+  L+++  +Q 
Sbjct  278  LGAAYVDSLFNIEPPSR-GRLGEEEILTLCTEAIIAGTDTSATALEWALLHLVQDQEMQE  336

Query  346  KLYEEIKSVVG-DRKVDEKDTDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDI  522
             LY+EI   VG +  + E D +KMPYL  +VKE  R+HPP++F L+HA T+ T+LGGY I
Sbjct  337  ILYKEIVECVGKNGAITESDVEKMPYLGDIVKETFRRHPPSYFLLSHAATKETELGGYTI  396

Query  523  PMDCGVEFFLPAISDDPTLWSDPEKFDPDRFLSG-GEDADITGVTAVKMMPFG  678
            P    VE +   +++DP +W +P KF P+RFL+G G D DITG   VKM+PFG
Sbjct  397  PAGVNVEIYTKWLTEDPEMWQNPSKFRPERFLTGDGVDVDITG-RGVKMLPFG  448



>ref|XP_010442231.1| PREDICTED: cytochrome P450 89A2-like [Camelina sativa]
Length=513

 Score =   196 bits (498),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 104/229 (45%), Positives = 145/229 (63%), Gaps = 15/229 (7%)
 Frame = +1

Query  37   LSPFFSKQ--RKR---VLEVRKQQIETIVPLIERRRRALENPGSDKSAA------TFSYL  183
            L P F+K   RKR     +++++Q + ++PLI  RR+ +E      S          SY+
Sbjct  222  LWPKFTKLILRKRWEEFFQMKREQQDVLLPLIRARRKIVEERKKRSSEEDNNKEYVQSYV  281

Query  184  DTLFDLTVEGRKSSPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEI  363
            DTL D+ +   K      E+V+L SEFLN GTDTTATA++W +A L++NP IQ +LYEEI
Sbjct  282  DTLLDVELPDEKRKLNEDEIVSLCSEFLNAGTDTTATALQWIMANLVKNPNIQKRLYEEI  341

Query  364  KSVVGD---RKVDEKDTDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDC  534
            KSVVG+   ++V+E+D  KMPYL AVV E LR+HPP  F L H+VT+ T LGGY +P   
Sbjct  342  KSVVGEDQAKEVEEEDAQKMPYLKAVVLEGLRRHPPGHFVLPHSVTEDTVLGGYKVPKKG  401

Query  535  GVEFFLPAISDDPTLWSDPEKFDPDRFLSGGEDA-DITGVTAVKMMPFG  678
             + F +  I  DP +W +P  F+P+RF+   E++ DITG   +KMMPFG
Sbjct  402  TINFMVAEIGRDPKVWEEPMAFNPERFIGAQEESVDITGSRGIKMMPFG  450



>ref|XP_010482059.1| PREDICTED: cytochrome P450 89A2-like [Camelina sativa]
Length=513

 Score =   195 bits (496),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 104/229 (45%), Positives = 144/229 (63%), Gaps = 15/229 (7%)
 Frame = +1

Query  37   LSPFFSKQ--RKR---VLEVRKQQIETIVPLIERRRRALENPGSDKSAA------TFSYL  183
            L P F+K   RKR     +++++Q + ++PLI  RR+ +E      S          SY+
Sbjct  222  LWPKFTKLILRKRWEEFFQMKREQQDVLLPLIRARRKIVEERKKRSSEEDNNKEYVQSYV  281

Query  184  DTLFDLTVEGRKSSPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEI  363
            DTL D+ +   K      E+V+L SEFLN GTDTTATA++W +A L++NP IQ +LYEEI
Sbjct  282  DTLLDVELPDEKRKLNEDEIVSLCSEFLNAGTDTTATALQWIMANLVKNPNIQKRLYEEI  341

Query  364  KSVVGD---RKVDEKDTDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDC  534
            KSVVG+   ++V+E+D  KMPYL AVV E LR+HPP  F L H+VT+ T LGGY +P   
Sbjct  342  KSVVGEDQAKEVEEEDAQKMPYLKAVVLEGLRRHPPGHFVLPHSVTEDTVLGGYKVPKKG  401

Query  535  GVEFFLPAISDDPTLWSDPEKFDPDRFLSGGEDA-DITGVTAVKMMPFG  678
             + F +  I  DP +W +P  F P+RF+   E++ DITG   +KMMPFG
Sbjct  402  TINFMVAEIGRDPKVWEEPMAFKPERFIGAQEESVDITGSRGIKMMPFG  450



>ref|XP_009622536.1| PREDICTED: cytochrome P450 89A2-like [Nicotiana tomentosiformis]
Length=517

 Score =   194 bits (494),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 103/231 (45%), Positives = 143/231 (62%), Gaps = 15/231 (6%)
 Frame = +1

Query  22   DFLPILSPFFSKQR-KRVLEVRKQQIETIVPLIERRR-RALENPGSDKSAATFSYLDTLF  195
            +FLP +     + R K ++E+R++Q +  +PLIE R  RA E    ++  A   Y+DTL 
Sbjct  226  NFLPRVGKIIFRNRWKELIELRQEQEKIFIPLIEARSIRAKEQKPEEEVVA---YVDTLL  282

Query  196  DLTVEGRKSSPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEIKSVV  375
            +L + G   S    E+V+L SEFLN GTDTT+TA++W +A L++NP IQ KLY+EI SVV
Sbjct  283  NLELPGENRSLNYGEMVSLCSEFLNAGTDTTSTALQWVMANLVKNPSIQGKLYQEIASVV  342

Query  376  GDRK-------VDEKDTDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDC  534
            G+++       V E D  KMPYL AV+ E LR+HPP  F L H VT+  +L GY +P + 
Sbjct  343  GEKQSKLTEEVVKEDDLHKMPYLRAVILEGLRRHPPGHFVLPHTVTEEVELNGYVVPKNA  402

Query  535  GVEFFLPAISDDPTLWSDPEKFDPDRFLSGGEDA---DITGVTAVKMMPFG  678
             + F +  +  DP +W DP +F P+RFL  G D    DITG   +KMMPFG
Sbjct  403  TINFMVADMGLDPKVWEDPLEFKPERFLMEGSDKEGFDITGSREIKMMPFG  453



>ref|XP_011650074.1| PREDICTED: cytochrome P450 89A2-like [Cucumis sativus]
 gb|KGN63391.1| hypothetical protein Csa_2G435540 [Cucumis sativus]
Length=510

 Score =   194 bits (494),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 100/229 (44%), Positives = 143/229 (62%), Gaps = 10/229 (4%)
 Frame = +1

Query  22   DFLPILSPFFSKQR-KRVLEVRKQQIETIVPLIERRRRAL---ENPGSDKSAATFSYLDT  189
            +  P L+    ++R +  L++R+ Q E I+P IE RR+     EN   +K     SY+DT
Sbjct  221  NLFPKLTKILLRKRWEEFLQLRRNQEEVIIPFIEARRKIQQNKENRDENKEEIVVSYVDT  280

Query  190  LFDLTVEGRKSSPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEIKS  369
            L +L +   K   T+ E+VT+ SEF+NGG+DTT+TA++W +A L++ P IQ+KL  E+K 
Sbjct  281  LLELELPDEKRKLTDTEMVTIASEFINGGSDTTSTALQWIMANLVKYPEIQNKLLVEMKG  340

Query  370  VVGD---RKVDEKDTDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGV  540
            V+GD    +V E+D  K+PYL AV+ E LR+HPP  F L HAV + TKLG Y IP +   
Sbjct  341  VMGDGSEEEVKEEDLGKLPYLKAVILEGLRRHPPAHFLLPHAVKEETKLGNYVIPKNGTT  400

Query  541  EFFLPAISDDPTLWSDPEKFDPDRFLSGGEDA---DITGVTAVKMMPFG  678
             + +  +  DP +W DP  F P+RF+ GGE+    DITG   +KMMPFG
Sbjct  401  NYMVAEMGRDPKVWEDPMAFKPERFMKGGEEGIEFDITGSKEIKMMPFG  449



>ref|XP_006347571.1| PREDICTED: cytochrome P450 89A2-like [Solanum tuberosum]
Length=513

 Score =   194 bits (494),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 100/231 (43%), Positives = 140/231 (61%), Gaps = 12/231 (5%)
 Frame = +1

Query  22   DFLPILSPFFSKQR-KRVLEVRKQQIETIVPLIERRRRALENPGSDKSAATFSYLDTLFD  198
            +F P +     + R K ++E+R++Q   I+PLIE R R  E           +Y+DTL +
Sbjct  219  NFFPRVGKIIFRNRWKELIELRQEQESIIIPLIEARSRTKEQKIEHGDEFVVAYVDTLLN  278

Query  199  LTVEGRKSSPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEIKSVVG  378
            L +   K +  + E+VTL SEFL+ GTDTT+TA++W +A L++NP IQ KLY+EI  VVG
Sbjct  279  LELPEEKRNLNHGEIVTLCSEFLSAGTDTTSTALQWVMANLVKNPSIQEKLYQEIARVVG  338

Query  379  DRK--------VDEKDTDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDC  534
            +++        V E+D  K+PYL AV+ E LR+HPP  F L H VT+  +L GY IP D 
Sbjct  339  EKQSKLADEEVVKEEDLQKIPYLKAVILEGLRRHPPGHFVLPHTVTEEVELNGYVIPKDV  398

Query  535  GVEFFLPAISDDPTLWSDPEKFDPDRFLSGGEDA---DITGVTAVKMMPFG  678
             + F +  +  DP +W DP +F P+RFL  G D    DITG   +KMMPFG
Sbjct  399  TINFMVAEMGLDPKVWEDPLEFRPERFLVEGSDNEGFDITGSREIKMMPFG  449



>gb|KGN63395.1| hypothetical protein Csa_2G437050 [Cucumis sativus]
Length=460

 Score =   193 bits (490),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 105/232 (45%), Positives = 144/232 (62%), Gaps = 13/232 (6%)
 Frame = +1

Query  22   DFLPILSPFFSKQR-KRVLEVRKQQIETIVPLIERRRRALENPGSDKSA---ATFSYLDT  189
            +F P L+  F ++R +  L+ +K + E ++PLIE RR+A EN G ++        SY+DT
Sbjct  168  NFWPKLTKIFLRKRWETFLKFKKNRDEVLIPLIEARRKAKENRGGEEKQDEEFVVSYVDT  227

Query  190  LFDLTVEGRKSSPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEIKS  369
            L DL     K   T  E+V + SEFLN GTDTT+TA++W +A L++NP IQ+KLY EIK 
Sbjct  228  LLDLDHPEEKRKLTEEEIVAIASEFLNAGTDTTSTALQWIMANLVKNPEIQNKLYAEIKG  287

Query  370  VVGD---RKVDEKDTDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGV  540
            V+GD    +V E++  K+PYL AVV E LR+HPP  F L HAV + T+L  Y IP +  V
Sbjct  288  VMGDGSREEVMEEELGKLPYLKAVVLEGLRRHPPGHFVLPHAVKEDTELENYVIPKNGSV  347

Query  541  EFFLPAISDDPTLWSDPEKFDPDRFLSGGE------DADITGVTAVKMMPFG  678
             F +  +  DP +W DP +F P+RF+ GG       + DITG    KMMPFG
Sbjct  348  NFMVAEMGWDPKVWEDPMEFKPERFMKGGAGEEGVVEFDITGSKERKMMPFG  399



>ref|NP_176674.1| cytochrome P450, family 87, subfamily A, polypeptide 6 [Arabidopsis 
thaliana]
 gb|AAD38268.1|AC006193_24 Putative cytochrome P450 [Arabidopsis thaliana]
 gb|AEE34307.1| cytochrome P450, family 87, subfamily A, polypeptide 6 [Arabidopsis 
thaliana]
Length=511

 Score =   192 bits (489),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 98/220 (45%), Positives = 140/220 (64%), Gaps = 13/220 (6%)
 Frame = +1

Query  49   FSKQRKRVLEVRKQQIETIVPLI--------ERRRRALENPGSDKSAATFSYLDTLFDLT  204
            + K+ +   +++ +Q + ++PLI        ER++R+ E    +K     SY+DTL D+ 
Sbjct  232  YRKRWEEFFQMQSEQQDVLLPLIRARRKIVDERKKRSSEEEKDNKEYVQ-SYVDTLLDVE  290

Query  205  VEGRKSSPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEIKSVVGD-  381
            +   K      E+V+L SEFLN GTDTTATA++W +A L++NP IQ +LYEEIKS+VG+ 
Sbjct  291  LPDEKRKLNEDEIVSLCSEFLNAGTDTTATALQWIMANLVKNPEIQRRLYEEIKSIVGEE  350

Query  382  -RKVDEKDTDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVEFFLPA  558
             ++V+E+D  KMPYL AVV E LR+HPP  F L H+VT+ T LGGY +P    + F +  
Sbjct  351  AKEVEEQDAQKMPYLKAVVMEGLRRHPPGHFVLPHSVTEDTVLGGYKVPKKGTINFMVAE  410

Query  559  ISDDPTLWSDPEKFDPDRFLSGGEDADITGVTAVKMMPFG  678
            I  DP +W +P  F P+RF+   E  DITG   +KMMPFG
Sbjct  411  IGRDPKVWEEPMAFKPERFME--EAVDITGSRGIKMMPFG  448



>ref|XP_011650076.1| PREDICTED: cytochrome P450 89A2-like [Cucumis sativus]
Length=512

 Score =   192 bits (489),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 105/232 (45%), Positives = 144/232 (62%), Gaps = 13/232 (6%)
 Frame = +1

Query  22   DFLPILSPFFSKQR-KRVLEVRKQQIETIVPLIERRRRALENPGSDKSA---ATFSYLDT  189
            +F P L+  F ++R +  L+ +K + E ++PLIE RR+A EN G ++        SY+DT
Sbjct  220  NFWPKLTKIFLRKRWETFLKFKKNRDEVLIPLIEARRKAKENRGGEEKQDEEFVVSYVDT  279

Query  190  LFDLTVEGRKSSPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEIKS  369
            L DL     K   T  E+V + SEFLN GTDTT+TA++W +A L++NP IQ+KLY EIK 
Sbjct  280  LLDLDHPEEKRKLTEEEIVAIASEFLNAGTDTTSTALQWIMANLVKNPEIQNKLYAEIKG  339

Query  370  VVGD---RKVDEKDTDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGV  540
            V+GD    +V E++  K+PYL AVV E LR+HPP  F L HAV + T+L  Y IP +  V
Sbjct  340  VMGDGSREEVMEEELGKLPYLKAVVLEGLRRHPPGHFVLPHAVKEDTELENYVIPKNGSV  399

Query  541  EFFLPAISDDPTLWSDPEKFDPDRFLSGGE------DADITGVTAVKMMPFG  678
             F +  +  DP +W DP +F P+RF+ GG       + DITG    KMMPFG
Sbjct  400  NFMVAEMGWDPKVWEDPMEFKPERFMKGGAGEEGVVEFDITGSKERKMMPFG  451



>ref|XP_010553818.1| PREDICTED: cytochrome P450 89A2-like [Tarenaya hassleriana]
Length=516

 Score =   191 bits (485),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 98/231 (42%), Positives = 138/231 (60%), Gaps = 12/231 (5%)
 Frame = +1

Query  22   DFLPILSPF-FSKQRKRVLEVRKQQIETIVPLIERRRRALE---NPGSDKSAATFSYLDT  189
            +  P L+ F F K+ +  L++R++Q   ++PLI  RR+ ++     G        SY+DT
Sbjct  217  NLWPKLTKFIFWKKWEEFLQLRREQEAVLLPLICARRKIVDEKTKSGLSHKDYVLSYVDT  276

Query  190  LFDLTVEGRKSSPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEIKS  369
            L DL +   K      E+++L SEFLN GTDTTATA++W +A L++ P IQ++LYEEIK 
Sbjct  277  LLDLELPDEKRKLNENEMISLCSEFLNAGTDTTATALQWIMANLVKYPEIQNRLYEEIKG  336

Query  370  VVGDRKVDEK--------DTDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIP  525
            VV   + +          D  KMPYL AVV E LR+HPP    L H+VT  T L GY +P
Sbjct  337  VVSRNRGESGEEGEISEEDVQKMPYLKAVVLEGLRRHPPGHTVLPHSVTDETVLAGYSVP  396

Query  526  MDCGVEFFLPAISDDPTLWSDPEKFDPDRFLSGGEDADITGVTAVKMMPFG  678
             +C + F +  +  DP +W DP  F+P+RF++G E  DITG   +KMMPFG
Sbjct  397  KNCTINFMVAEMGWDPQVWDDPMAFNPERFINGEEAVDITGSRGIKMMPFG  447



>ref|XP_002970486.1| hypothetical protein SELMODRAFT_22493, partial [Selaginella moellendorffii]
 gb|EFJ28616.1| hypothetical protein SELMODRAFT_22493, partial [Selaginella moellendorffii]
Length=477

 Score =   190 bits (483),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 102/226 (45%), Positives = 147/226 (65%), Gaps = 8/226 (4%)
 Frame = +1

Query  13   RVDDFLPILSPFFSKQRK-RVLEVRKQQIETIVPLIERRRRALENPGSDKSAATFSYLDT  189
            R+ DF+P+L       R  ++ E+  ++ E ++PLI+R +        D++    SYL +
Sbjct  195  RMSDFVPLLKIVQRSPRDLKLEELVGERRELLLPLIQRAKLLAAEDKLDQN----SYLSS  250

Query  190  LFDLT-VEGRKSSPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEIK  366
            LF L   E  +   T+ +L+ L SEFLN G DTTA  +EW++A +I++P +Q KL EEI 
Sbjct  251  LFSLQRQEDHQLKLTDEDLIVLCSEFLNAGADTTANTLEWSLANVIKHPAVQKKLLEEIH  310

Query  367  SVVGDRKVDEKDTDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVEF  546
            S VGD+ V EKD DK+ YL AVVKE LRKHPP +  L HAVT+P KLGGYDIP+   + F
Sbjct  311  SSVGDKPVTEKDIDKLVYLKAVVKETLRKHPPGYTTLPHAVTEPCKLGGYDIPVHATLLF  370

Query  547  FLPAISDDPTLWSDPEKFDPDRFLSG-GEDADITGVT-AVKMMPFG  678
             + AI++DP LW++P+++ P+RFL G G  AD T  + A+ ++PFG
Sbjct  371  NIYAINNDPELWTNPDEYKPERFLEGPGASADFTASSGALNLIPFG  416



>ref|XP_009128469.1| PREDICTED: cytochrome P450 89A2-like [Brassica rapa]
Length=507

 Score =   190 bits (483),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 98/214 (46%), Positives = 132/214 (62%), Gaps = 3/214 (1%)
 Frame = +1

Query  46   FFSKQRKRVLEVRKQQIETIVPLIERRRRALENPGSDKSAATFSYLDTLFDLTVEGRKSS  225
             F  + +   ++R++Q + ++PLI  RR+ +E    +      SY+DTL DL +   K  
Sbjct  232  MFRSRWEEFHQMRREQGDVLLPLIRARRKIVEERMKNNKDYVQSYVDTLLDLELPEEKRK  291

Query  226  PTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEIKSVVGDRKVDEKD-  402
                E+V+L SEFLNGGTDTTATA++W +A L++ P IQ +LYEEIKSVV   +  E + 
Sbjct  292  LNEEEIVSLCSEFLNGGTDTTATALQWIMANLVKKPEIQERLYEEIKSVVAGEEGKEIEE  351

Query  403  --TDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVEFFLPAISDDPT  576
                KMPYL AVV E LR+HPP  F L H+VT+ T LGGY +P    V F +  I  DP 
Sbjct  352  EEAHKMPYLKAVVLEGLRRHPPGHFVLPHSVTEDTVLGGYKVPKRGTVNFMVAEIGRDPA  411

Query  577  LWSDPEKFDPDRFLSGGEDADITGVTAVKMMPFG  678
            +W DP +F P+RF+   E  DITG   +KMMPFG
Sbjct  412  VWDDPMEFKPERFIGEEEPVDITGSRGIKMMPFG  445



>ref|XP_002970487.1| hypothetical protein SELMODRAFT_93385 [Selaginella moellendorffii]
 gb|EFJ28617.1| hypothetical protein SELMODRAFT_93385 [Selaginella moellendorffii]
Length=503

 Score =   190 bits (483),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 102/226 (45%), Positives = 147/226 (65%), Gaps = 8/226 (4%)
 Frame = +1

Query  13   RVDDFLPILSPFFSKQRK-RVLEVRKQQIETIVPLIERRRRALENPGSDKSAATFSYLDT  189
            R+ DF+P+L       R  ++ E+  ++ E ++PLI+R +        D++    SYL +
Sbjct  219  RMSDFVPLLKIVQRSPRDLKLEELVGERRELLLPLIQRAKLLAAEDKLDQN----SYLSS  274

Query  190  LFDLT-VEGRKSSPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEIK  366
            LF L   E  +   T+ +L+ L SEFLN G DTTA  +EW++A +I++P +Q KL EEI 
Sbjct  275  LFSLQRQEDHQLKLTDEDLIVLCSEFLNAGADTTANTLEWSLANVIKHPAVQKKLLEEIH  334

Query  367  SVVGDRKVDEKDTDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVEF  546
            S VGD+ V EKD DK+ YL AVVKE LRKHPP +  L HAVT+P KLGGYDIP+   + F
Sbjct  335  SSVGDKPVTEKDIDKLVYLKAVVKETLRKHPPGYTTLPHAVTEPCKLGGYDIPVHATLLF  394

Query  547  FLPAISDDPTLWSDPEKFDPDRFLSG-GEDADITGVT-AVKMMPFG  678
             + AI++DP LW++P+++ P+RFL G G  AD T  + A+ ++PFG
Sbjct  395  NIYAINNDPELWTNPDEYKPERFLEGPGASADFTASSGALNLIPFG  440



>gb|KFK24754.1| hypothetical protein AALP_AA8G020600 [Arabis alpina]
Length=316

 Score =   186 bits (471),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 97/224 (43%), Positives = 136/224 (61%), Gaps = 13/224 (6%)
 Frame = +1

Query  22   DFLPILSPFFSKQR-KRVLEVRKQQIETIVPLIERRRRALENPGSDKSAATF----SYLD  186
            +  P L+    ++R +   ++R++Q E ++PLI  R+R +E               SY+D
Sbjct  40   NLWPKLTRLVMRKRWEEFFQIRREQHEVLLPLILARKRMVEERKKKMEEEEEEYVQSYVD  99

Query  187  TLFDLTVEGRKSSPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEIK  366
            TL DL +   K      E+V+L SEFLNGGTDTTATA++W +A L++NP IQ +LYEE+K
Sbjct  100  TLLDLELPEEKRKLNEDEIVSLCSEFLNGGTDTTATALQWIMANLVKNPEIQERLYEEVK  159

Query  367  SVVGDRKVDEKDTDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVEF  546
                    +E + +KMPYL AVV E LR+HPP  F L H+VT+ T LGGY +P    + F
Sbjct  160  GA------EEIEVEKMPYLKAVVLEGLRRHPPGHFVLPHSVTEDTVLGGYKVPKKGTINF  213

Query  547  FLPAISDDPTLWSDPEKFDPDRFLSGGEDADITGVTAVKMMPFG  678
             +  I  DP +W +P  F P+RF+  GE+ DITG   +KMMPFG
Sbjct  214  MVAEIGRDPEVWKEPMAFKPERFM--GEEVDITGSRGIKMMPFG  255



>ref|XP_008375760.1| PREDICTED: LOW QUALITY PROTEIN: cytochrome P450 77A3 [Malus domestica]
Length=535

 Score =   190 bits (483),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 110/255 (43%), Positives = 155/255 (61%), Gaps = 35/255 (14%)
 Frame = +1

Query  10   PRVDDFLPILSPFFSKQRKRVLEVRKQQIETIVPLI-ERRRRALENPG-----------S  153
            P++ DFLP+L+P F +Q     E+R++Q+E +VPL+ +R+   LE+             S
Sbjct  216  PKLPDFLPVLTPLFRRQVGEAKELRRRQLECLVPLVRDRKAFVLESDNVEDENVRKIMVS  275

Query  154  DKSAATFSYLDTLFDLTVEGRKSSPT-----NAELVTLVSEFLNGGTDTTATAIEWAIAR  318
             K AA   Y+D+LF+L V GR            ELVTLVSE +N GTDT+ATA+E  +  
Sbjct  276  PKGAA---YIDSLFELEVPGRGKDGGRRRLEEEELVTLVSEVINAGTDTSATALEGLLFH  332

Query  319  LIENPGIQSKLYEEIKSVVG-DRK------------VDEKDTDKMPYLNAVVKELLRKHP  459
            L+ +  IQ KLY+EI   VG DR             + E D +KM YL+AVVKE  R+HP
Sbjct  333  LVMDQKIQEKLYKEIVDCVGTDRSPYTDQQKPHEEVITESDVEKMSYLSAVVKETFRRHP  392

Query  460  PTFFALTHAVTQPTKLGGYDIPMDCGVEFFLPAISDDPTLWSDPEKFDPDRFLSGGE--D  633
            P+ F L+HA  + T+LGGY +P D  VEF+   +++DP +W DP +F P+RF++GG+  D
Sbjct  393  PSHFVLSHAAVKDTELGGYTVPADASVEFYTAWVTEDPEMWVDPGEFLPERFMAGGDGVD  452

Query  634  ADITGVTAVKMMPFG  678
             D+TG   VKM+PFG
Sbjct  453  VDVTGTKGVKMVPFG  467



>ref|XP_002978564.1| hypothetical protein SELMODRAFT_108700 [Selaginella moellendorffii]
 gb|EFJ20550.1| hypothetical protein SELMODRAFT_108700 [Selaginella moellendorffii]
Length=502

 Score =   190 bits (482),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 102/226 (45%), Positives = 146/226 (65%), Gaps = 8/226 (4%)
 Frame = +1

Query  13   RVDDFLPILSPFFSKQRK-RVLEVRKQQIETIVPLIERRRRALENPGSDKSAATFSYLDT  189
            R+ DF+P+L       R  ++ E+  ++ E ++PLI+R +        D++    SYL +
Sbjct  218  RMSDFVPLLKIVQRSPRDLKLEELVGERRELLLPLIQRAKLLAAEDKLDQN----SYLSS  273

Query  190  LFDLT-VEGRKSSPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEIK  366
            LF L   E  +   T+ +L+ L SEFLN G DTTA  +EW++A +I++P +Q KL EEI 
Sbjct  274  LFSLQRQEDHQLKLTDEDLIVLCSEFLNAGADTTANTLEWSLANVIKHPAVQKKLLEEIH  333

Query  367  SVVGDRKVDEKDTDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVEF  546
            S VGD+ V EKD DK+ YL AVVKE LRKHPP +  L HAVT+P KLGGYDIP+   + F
Sbjct  334  SSVGDKPVTEKDIDKLVYLKAVVKETLRKHPPGYTTLPHAVTEPCKLGGYDIPVHATLLF  393

Query  547  FLPAISDDPTLWSDPEKFDPDRFLSG-GEDADITGVTAV-KMMPFG  678
             + AI++DP LW++P+++ P+RFL G G  AD T  + V  ++PFG
Sbjct  394  NIYAINNDPELWTNPDEYKPERFLEGPGASADFTASSGVLNLIPFG  439



>ref|XP_010528671.1| PREDICTED: cytochrome P450 89A2-like [Tarenaya hassleriana]
Length=509

 Score =   190 bits (482),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 97/228 (43%), Positives = 140/228 (61%), Gaps = 9/228 (4%)
 Frame = +1

Query  22   DFLPILSPFFSKQR-KRVLEVRKQQIETIVPLIERRRRALENPG------SDKSAATFSY  180
            +  P ++ F  ++R +  L++R+ Q   ++PLI  RR+ ++         SD      SY
Sbjct  220  NVWPKITKFLLRKRWEDFLQLRRDQEAVLLPLIRARRKIVDENAKSGISDSDNKDYVLSY  279

Query  181  LDTLFDLTVEGRKSSPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEE  360
            +DTL DL +   K      E+V+L SEFLN GTDTTATA++W +A L++ P IQ++L+EE
Sbjct  280  VDTLLDLELPDEKRKLDEGEMVSLCSEFLNAGTDTTATALQWIMANLVKYPEIQNRLHEE  339

Query  361  IKSVVG--DRKVDEKDTDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDC  534
            IK V G  + ++ E+D  KMPYL AVV E LR+HPP    L H+VT  T LGGY +P + 
Sbjct  340  IKGVTGGTEGEIKEEDLQKMPYLKAVVLEGLRRHPPGHLVLPHSVTDDTDLGGYSVPKNG  399

Query  535  GVEFFLPAISDDPTLWSDPEKFDPDRFLSGGEDADITGVTAVKMMPFG  678
             + F +  +  DP +W DP  F P+RF++G +  DITG   +KMMPFG
Sbjct  400  TINFMVADMGWDPEVWEDPMAFKPERFVNGEDSVDITGSRGIKMMPFG  447



>ref|XP_002524040.1| cytochrome P450, putative [Ricinus communis]
 gb|EEF38408.1| cytochrome P450, putative [Ricinus communis]
Length=516

 Score =   190 bits (482),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 101/227 (44%), Positives = 139/227 (61%), Gaps = 8/227 (4%)
 Frame = +1

Query  22   DFLPILSPF-FSKQRKRVLEVRKQQIETIVPLIERRRRALENPGSDKSAATF--SYLDTL  192
            +F+P L+   F K+    L+++K + E ++PLI  R++  E   S      F  SY+DTL
Sbjct  222  NFMPRLTKIVFRKRWSEFLQLQKDREEVLIPLIRARKKVNEEIKSKNCNNEFVLSYVDTL  281

Query  193  FDLTVEGRKSSPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEIKSV  372
            FDL +   K      E+V L +EFLN GTDTT+TA++W +A L++ P IQ KL+ EIKSV
Sbjct  282  FDLQLPDEKRKLREKEMVALCNEFLNAGTDTTSTALQWVMANLVKYPYIQEKLFMEIKSV  341

Query  373  V--GDRKVDEKDTDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVEF  546
            V  G+ +V E D  KM YL AV+ E LR+HPPT F L HAVT+   LG Y +P +  + F
Sbjct  342  VADGEEEVKEDDLQKMSYLKAVILEGLRRHPPTHFVLPHAVTEDVVLGKYLVPKNANINF  401

Query  547  FLPAISDDPTLWSDPEKFDPDRFL---SGGEDADITGVTAVKMMPFG  678
             +  +  DP +W +P  F P+RF+   S GE  DITG   +KMMPFG
Sbjct  402  MVAEMGWDPEVWEEPMAFKPERFMGSDSNGEVFDITGSREIKMMPFG  448



>gb|KJB46081.1| hypothetical protein B456_007G347700 [Gossypium raimondii]
Length=513

 Score =   189 bits (480),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 98/220 (45%), Positives = 139/220 (63%), Gaps = 11/220 (5%)
 Frame = +1

Query  46   FFSKQRKRVLEVRKQQIETIVPLIERRRRA----LENPGSDKSAATFSYLDTLFDLTVEG  213
               K+  ++ ++RK+  + ++PLI  R++     L N GSD      +Y+DTL DL +  
Sbjct  234  LLRKRWDQLFQLRKELDDALIPLIRERKKVKDERLSNKGSDDY--ELAYVDTLLDLELPE  291

Query  214  RKSSPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEIKSVVGD--RK  387
             K     AE+VTL SEF+N GTDTT+TA++W +A L++ P IQ +L+ EIK VVGD   +
Sbjct  292  EKRKLDEAEMVTLASEFINAGTDTTSTALQWIMANLVKYPYIQDRLFLEIKGVVGDYVEE  351

Query  388  VDEKDTDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVEFFLPAISD  567
            ++E+D  KMPYL AV+ E LR+HPP  F + H VT+ T LGGY IP +  + F +  +  
Sbjct  352  IEEEDLQKMPYLKAVILEGLRRHPPAHFVVPHCVTEDTVLGGYLIPKNGMINFMVADMGW  411

Query  568  DPTLWSDPEKFDPDRFLS---GGEDADITGVTAVKMMPFG  678
            DP +W DP  F P+RF++   GGE  DITG   +KMMPFG
Sbjct  412  DPKVWEDPMAFKPERFINNAGGGEVFDITGSREIKMMPFG  451



>gb|KJB46083.1| hypothetical protein B456_007G347900 [Gossypium raimondii]
Length=512

 Score =   189 bits (480),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 102/232 (44%), Positives = 144/232 (62%), Gaps = 13/232 (6%)
 Frame = +1

Query  4    LDPRVDDFLPILSPFFSKQRKRVLEVRKQQIETIVPLIERRRRALENPGSDKSAATF--S  177
            L PRV   L        K+  ++ ++RK   ++ +PLI  R++A +   S+K +A +  +
Sbjct  225  LWPRVTKIL------LRKKWDQLFKLRKDLEDSYIPLIRARKKAKDERLSNKGSADYVLA  278

Query  178  YLDTLFDLTVEGRKSSPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYE  357
            Y+DTL DL +   K     AE+VTL SEF+N GTDTT+TA++W +A L++ P IQ +L  
Sbjct  279  YVDTLLDLELPEEKRKLDEAEMVTLASEFINAGTDTTSTALQWVMANLVKYPHIQDRLLV  338

Query  358  EIKSVVGD--RKVDEKDTDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMD  531
            EIK VVGD   ++ E+D  KMPYL AV+ E LR+HPP  F + H VT+ T LGGY IP +
Sbjct  339  EIKGVVGDSVEEIKEEDLQKMPYLRAVILEGLRRHPPAHFVVPHCVTEDTVLGGYLIPKN  398

Query  532  CGVEFFLPAISDDPTLWSDPEKFDPDRFLS---GGEDADITGVTAVKMMPFG  678
              + F +  +  DP +W DP  F P+RF++   GGE  DITG   +KMMPFG
Sbjct  399  STINFMVADMGWDPKVWEDPMAFKPERFINNAGGGEVFDITGSREIKMMPFG  450



>ref|XP_008367238.1| PREDICTED: LOW QUALITY PROTEIN: cytochrome P450 77A1-like [Malus 
domestica]
Length=537

 Score =   189 bits (481),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 108/255 (42%), Positives = 153/255 (60%), Gaps = 35/255 (14%)
 Frame = +1

Query  10   PRVDDFLPILSPFFSKQRKRVLEVRKQQIETIVPLI-ERRRRALENPG-----------S  153
            P++ DFLP+L+P F +Q +   E+R++Q+E +VPL+ +R+   LE+             S
Sbjct  218  PKLPDFLPVLTPLFRRQVREAKELRRRQLECLVPLVRDRKAFVLESDNVKDENVKKIMVS  277

Query  154  DKSAATFSYLDTLFDLTVEGR-----KSSPTNAELVTLVSEFLNGGTDTTATAIEWAIAR  318
             K AA   Y+D+LF+L V  R     +      ELVTLVSE +N GTDT+ATA+EWA+  
Sbjct  278  PKGAA---YIDSLFELEVPVRGKDRGRRRLEEEELVTLVSEVINAGTDTSATALEWALLH  334

Query  319  LIENPGIQSKLYEEIKSVVG-DRK------------VDEKDTDKMPYLNAVVKELLRKHP  459
            L+ +  IQ KLY EI   VG DR             + E D +KM YL+AVVKE  R+HP
Sbjct  335  LVMDQKIQEKLYREIVDCVGTDRSPYTNEQKPHEEVIIESDVEKMSYLSAVVKETFRRHP  394

Query  460  PTFFALTHAVTQPTKLGGYDIPMDCGVEFFLPAISDDPTLWSDPEKFDPDRFLSGGE--D  633
            P+ F L+HA  + T+LG Y +P +  V  +   +++DP +W DP +F P+RFL GG+  D
Sbjct  395  PSHFVLSHAALENTELGXYTVPABASVXXYTAWVTEDPDMWEDPGEFRPERFLEGGDGVD  454

Query  634  ADITGVTAVKMMPFG  678
             D+TG   VKM+PFG
Sbjct  455  VDVTGTKGVKMVPFG  469



>emb|CDY56131.1| BnaA02g20200D [Brassica napus]
Length=491

 Score =   188 bits (478),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 96/210 (46%), Positives = 128/210 (61%), Gaps = 13/210 (6%)
 Frame = +1

Query  49   FSKQRKRVLEVRKQQIETIVPLIERRRRALENPGSDKSAATFSYLDTLFDLTVEGRKSSP  228
            F  + +   ++R++Q + ++PLI  RR+ +E    +      SY+DTL DL +   K   
Sbjct  233  FRSRWEEFHQMRREQGDVLLPLIRARRKIVEERMKNSKDYVQSYVDTLLDLELPEEKRKL  292

Query  229  TNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEIKSVVGDRKVDEKDTD  408
               E+V+L SEFLNGGTDTTATA++W +A L++NP IQ +LYEEIKSV            
Sbjct  293  NEEEIVSLCSEFLNGGTDTTATALQWIMANLVKNPEIQERLYEEIKSV------------  340

Query  409  KMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVEFFLPAISDDPTLWSD  588
             MPYL AVV E LR+HPP  F L H+VT+ T LGGY +P    V F +  I  DP +W D
Sbjct  341  -MPYLKAVVLEGLRRHPPGHFVLPHSVTEDTVLGGYKVPKRGTVNFMVAEIGRDPAVWDD  399

Query  589  PEKFDPDRFLSGGEDADITGVTAVKMMPFG  678
            P +F P+RF+   E  DITG   +KMMPFG
Sbjct  400  PMEFKPERFIGEEEPVDITGSRGIKMMPFG  429



>ref|XP_002886780.1| CYP89A5 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH63039.1| CYP89A5 [Arabidopsis lyrata subsp. lyrata]
Length=513

 Score =   188 bits (478),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 102/229 (45%), Positives = 139/229 (61%), Gaps = 10/229 (4%)
 Frame = +1

Query  22   DFLPILSPF-FSKQRKRVLEVRKQQIETIVPLIERRRRALE-------NPGSDKSAATFS  177
            +  P L+ F F K+ +   ++R++Q + ++PLI  RR+ +E           D      S
Sbjct  222  NLWPKLTKFIFRKRWEEFFQMRREQHDVLLPLIRARRKIVEERKNRSSKEAEDNKEYVQS  281

Query  178  YLDTLFDLTVEGRKSSPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYE  357
            Y+DTL DL +   K      E+V+L SEFLNGGTDTTATA++W +A L++NP IQ +LYE
Sbjct  282  YVDTLLDLELPDEKRKLNEDEIVSLCSEFLNGGTDTTATALQWIMANLVKNPEIQRRLYE  341

Query  358  EIKSVVGDRKVDEK--DTDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMD  531
            EIKSVVG+   + +  D  KMPYL AVV E LR+HPP  F L H+VT+ T LGGY +P  
Sbjct  342  EIKSVVGEEAKEVEEEDAQKMPYLKAVVMEGLRRHPPGHFVLPHSVTEDTVLGGYKVPKK  401

Query  532  CGVEFFLPAISDDPTLWSDPEKFDPDRFLSGGEDADITGVTAVKMMPFG  678
              + F +  I  DP +W +P  F P+RF+   E  DITG   + MMPFG
Sbjct  402  GTINFMVAEIGRDPKVWEEPMAFKPERFMGEEEPVDITGSRGITMMPFG  450



>ref|XP_004148095.1| PREDICTED: cytochrome P450 89A2-like [Cucumis sativus]
 gb|KGN63388.1| hypothetical protein Csa_2G435510 [Cucumis sativus]
Length=515

 Score =   188 bits (478),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 100/231 (43%), Positives = 143/231 (62%), Gaps = 12/231 (5%)
 Frame = +1

Query  22   DFLP-ILSPFFSKQRKRVLEVRKQQIETIVPLIERRRRALENPG-SDKSAATFSYLDTLF  195
            +F P +    F K+ +   ++RK Q + +  LI+ RR+A EN   +++     SY+DTL 
Sbjct  220  NFWPKVTKILFRKRWEAFFQLRKNQEKVLTRLIDARRKANENRAQNEEEEIVVSYVDTLL  279

Query  196  DLTVEGRKSSPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEIKSVV  375
            +L +   K    + ELVTL SEFLN GTDTT+TA++W +A L++ P IQ+KL+ E+K V+
Sbjct  280  ELELPDEKRKLNDDELVTLCSEFLNAGTDTTSTALQWIMANLVKYPEIQNKLFVEMKGVM  339

Query  376  GD---RKVDEKDTDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVEF  546
            G+    +V E+   K+PYL AVV E LRKHPP  F L HAV + T+LG Y IP +  V F
Sbjct  340  GNGSREEVKEEVLGKLPYLKAVVLEGLRKHPPAHFVLPHAVKEDTELGNYVIPKNASVNF  399

Query  547  FLPAISDDPTLWSDPEKFDPDRFLSGGEDA-------DITGVTAVKMMPFG  678
             +  +  DP +W DP  F+P+RF+ GG++        DITG   +KMMPFG
Sbjct  400  MVAEMGRDPKVWEDPTAFNPERFMKGGKEKEEQVAEFDITGSKEIKMMPFG  450



>ref|XP_009782165.1| PREDICTED: cytochrome P450 89A2-like [Nicotiana sylvestris]
Length=517

 Score =   188 bits (478),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 99/231 (43%), Positives = 143/231 (62%), Gaps = 15/231 (6%)
 Frame = +1

Query  22   DFLPILSPFFSKQR-KRVLEVRKQQIETIVPLIE-RRRRALENPGSDKSAATFSYLDTLF  195
            +F P +     + R K ++E+R++Q +  +PLIE R  RA E    ++  A   Y+DTL 
Sbjct  226  NFFPRIGKIIFRNRWKELIELRQEQEKIFIPLIEARSSRAKEQKPDEEVVA---YVDTLL  282

Query  196  DLTVEGRKSSPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEIKSVV  375
            +L +     +    E+V+L SEFL+ GTDTT+TA++W +A L++NP IQ KLY+EI SVV
Sbjct  283  NLELPEENRNLNYGEMVSLCSEFLSAGTDTTSTALQWVMANLVKNPSIQEKLYQEIASVV  342

Query  376  GDRK-------VDEKDTDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDC  534
            G+++       V+E+D  KMPYL AV+ E LR+HPP  F L H VT+  +L GY +P + 
Sbjct  343  GEKQSKLTEEVVNEEDLHKMPYLKAVILEGLRRHPPGHFVLPHTVTEEAELNGYVVPKNA  402

Query  535  GVEFFLPAISDDPTLWSDPEKFDPDRFLSGGEDA---DITGVTAVKMMPFG  678
             + F +  +  DP +W DP +F P+RFL  G D    DITG   +KMMPFG
Sbjct  403  TINFMVADMGLDPKVWEDPLEFKPERFLMEGSDKEGFDITGSREIKMMPFG  453



>gb|KJB18538.1| hypothetical protein B456_003G058600 [Gossypium raimondii]
Length=512

 Score =   188 bits (477),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 97/223 (43%), Positives = 137/223 (61%), Gaps = 4/223 (2%)
 Frame = +1

Query  22   DFLPILSPFFSKQR-KRVLEVRKQQIETIVPLIERRRRALENPGSDKSA--ATFSYLDTL  192
            +F P ++    ++R +   + RK Q + ++PLI  R++A E   SDK +     +Y+DTL
Sbjct  225  NFWPKVTKVLLRKRWQEFFQRRKDQEDVLIPLIRARKKAKEEKLSDKKSDDYVLAYVDTL  284

Query  193  FDLTVEGRKSSPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEIKSV  372
             DL +   K   T  E+ +L SEFLN GTDTT+TA++W +A L++ P IQ KL+ EIK V
Sbjct  285  LDLELPEEKRKLTEGEIFSLASEFLNAGTDTTSTALQWVMANLVKYPHIQDKLFLEIKGV  344

Query  373  VGD-RKVDEKDTDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVEFF  549
            VGD  ++ E D  KMPYL AV+ E LR+HPP  F L H VT+ T LG Y +P +  + F 
Sbjct  345  VGDGEEIKEDDLQKMPYLKAVILEGLRRHPPGHFVLPHCVTEDTVLGDYLVPKNGTINFM  404

Query  550  LPAISDDPTLWSDPEKFDPDRFLSGGEDADITGVTAVKMMPFG  678
            +  +  DP +W DP  F P+RF+   +  DITG   +KMMPFG
Sbjct  405  VAEMGWDPKVWEDPMAFKPERFMRNEQVFDITGSREIKMMPFG  447



>ref|XP_006347570.1| PREDICTED: cytochrome P450 89A2-like [Solanum tuberosum]
Length=520

 Score =   188 bits (477),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 97/233 (42%), Positives = 136/233 (58%), Gaps = 14/233 (6%)
 Frame = +1

Query  22   DFLPILSPFFSKQR-KRVLEVRKQQIETIVPLIERRRRALENPGSDKSAATFSYLDTLFD  198
            +F P L     + R K ++E+R++Q   I+PLIE R R  E           +Y+DTL +
Sbjct  224  NFFPRLGKIIFRNRWKELVELRREQESIIIPLIEARNRNKEQKKEQSDEFVVAYVDTLLN  283

Query  199  LTVEGRKSSPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEIKSVVG  378
            L +     +    E+VTL  EFL+ GTDTT+TA++W +A L++NP IQ KLY EI SVVG
Sbjct  284  LELPEENRNLNLGEMVTLCREFLSAGTDTTSTALQWIMANLVKNPSIQEKLYREIASVVG  343

Query  379  DRK---------VDEKDTDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMD  531
            +++         V E+D  KMPYL AV+ E LR+HPP+     H VT+  +L GY +P +
Sbjct  344  EKQSKLSTDEEVVKEEDFQKMPYLKAVILEGLRRHPPSHVLFPHTVTEEVELNGYTVPKN  403

Query  532  CGVEFFLPAISDDPTLWSDPEKFDPDRFLSGGEDA----DITGVTAVKMMPFG  678
              + F +  +  DP +W DP +F P+RFL  G D     DITG   +KMMPFG
Sbjct  404  GTINFMVADMGLDPNVWEDPMEFRPERFLVEGSDKGVDFDITGSKEIKMMPFG  456



>ref|XP_008459160.1| PREDICTED: cytochrome P450 89A2-like [Cucumis melo]
Length=531

 Score =   188 bits (477),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 107/236 (45%), Positives = 147/236 (62%), Gaps = 15/236 (6%)
 Frame = +1

Query  16   VDDFLPILSPFFSKQR-KRVLEVRKQQIETIVPLIERRRRALENPGS---DKSAATF--S  177
            V +F PIL+    ++R +  L+++  + E ++PLIE RR+A EN G    +K    F  S
Sbjct  235  VLNFWPILTKILLRKRWETFLKLKNNRDEVLIPLIEARRKAKENRGGGEEEKQDEEFVVS  294

Query  178  YLDTLFDLTVEGRKSSPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYE  357
            Y+DTL DL     K   T+ E+V + SEFLN GTDTT+TA++W +A L++NP IQ+KLY 
Sbjct  295  YVDTLLDLEHPEEKRKLTDEEIVAIASEFLNAGTDTTSTALQWIMANLVKNPEIQNKLYA  354

Query  358  EIKSVVGD---RKVDEKDTDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPM  528
            EIK V+GD    +V E++  K+PYL AVV E LR+HPP  F L HAV + T+L  Y IP 
Sbjct  355  EIKGVMGDGSREEVKEEELGKLPYLKAVVLEGLRRHPPGHFVLPHAVKEDTELENYVIPK  414

Query  529  DCGVEFFLPAISDDPTLWSDPEKFDPDRFLSGGEDA------DITGVTAVKMMPFG  678
            +  V F +  +  DP +W DP +F P+RF+ GG         DITG   +KMMPFG
Sbjct  415  NGSVNFMVAEMGWDPKVWEDPMEFKPERFMKGGAGEEGGVEFDITGSKEIKMMPFG  470



>ref|XP_010941087.1| PREDICTED: cytochrome P450 89A2-like [Elaeis guineensis]
Length=516

 Score =   187 bits (476),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 99/228 (43%), Positives = 147/228 (64%), Gaps = 12/228 (5%)
 Frame = +1

Query  25   FLPILSPF-FSKQRKRVLEVRKQQIETIVPLIERRRRALENP--GSDKSAATFSYLDTLF  195
            F P +S + F  + K  L++R+ QIE  VPLI+ R+    +P   +++    +SY+D+L 
Sbjct  223  FAPRISRYIFWNRIKTALQMRQAQIELFVPLIKARKEYKNHPQHKNEEERYVYSYVDSLL  282

Query  196  DLTV---EGRKSSPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEIK  366
            D+ +    GRK   T  E+V+L SEFL  GTDTT+TA++W +A L+++ GIQ+KL EEI+
Sbjct  283  DMEIPEEGGRKL--TEEEMVSLCSEFLTAGTDTTSTALQWIMANLVKHQGIQAKLLEEIE  340

Query  367  SVVG--DRKVDEKDTDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGV  540
             VVG  ++++ E+D  +MPYL AV+ E LR+HPP  F + H VT+   L GY IP +  +
Sbjct  341  RVVGKDEKEIKEEDLQRMPYLKAVILEGLRRHPPAHFVVPHKVTEDVTLDGYLIPRNASI  400

Query  541  EFFLPAISDDPTLWSDPEKFDPDRFLSG--GEDADITGVTAVKMMPFG  678
             F +  +S D  +W +P +F P+RFL+G  GE  DITG   +KMMPFG
Sbjct  401  NFMVAEMSWDGKVWEEPMEFKPERFLAGGSGEGVDITGSREIKMMPFG  448



>ref|XP_007029515.1| Cytochrome P450, family 87, subfamily A, polypeptide 6, putative 
[Theobroma cacao]
 gb|EOY10017.1| Cytochrome P450, family 87, subfamily A, polypeptide 6, putative 
[Theobroma cacao]
Length=511

 Score =   187 bits (476),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 101/215 (47%), Positives = 140/215 (65%), Gaps = 6/215 (3%)
 Frame = +1

Query  46   FFSKQRKRVLEVRKQQIETIVPLIERRRRALENPGSDKSAATFSYLDTLFDLTVEGRKSS  225
            FF +  K +L +RK Q ET+VPLI R RRAL++    + +    Y+DTLFDL +  +K  
Sbjct  235  FFHQSWKELLTLRKDQEETLVPLI-RARRALKDKNICQESF-LPYVDTLFDLNLPEQKRK  292

Query  226  PTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEIKSVVGDRKVDEKDT  405
                E+VTL SEF  GGTDTTAT+++W +A L++   IQ KL+EEIK V+GD +V+ K+ 
Sbjct  293  LEEKEIVTLCSEFFTGGTDTTATSLQWIMANLVKYQHIQDKLFEEIKGVIGDGEVEIKED  352

Query  406  D--KMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVEFFLPAISDDPTL  579
            D  KMPYL AV+ E LR+HPP+ F + H+VT+   L G+ +P D  V   +  +  DP +
Sbjct  353  DLRKMPYLRAVILEGLRRHPPSLFLVPHSVTKDVLLHGFLVPKDSVVTLTVGEMGRDPKV  412

Query  580  WSDPEKFDPDRFLSG--GEDADITGVTAVKMMPFG  678
            W +P +F P+RFL+G  GE  D TG   +KMMPFG
Sbjct  413  WENPMEFKPERFLNGDDGEAFDFTGRKEIKMMPFG  447



>ref|NP_178922.1| putative cytochrome P450 [Arabidopsis thaliana]
 gb|AAM15091.1| putative cytochrome p450 [Arabidopsis thaliana]
 gb|AAM15354.1| putative cytochrome p450 [Arabidopsis thaliana]
 gb|AEC06192.1| putative cytochrome P450 [Arabidopsis thaliana]
Length=512

 Score =   187 bits (474),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 106/228 (46%), Positives = 141/228 (62%), Gaps = 14/228 (6%)
 Frame = +1

Query  37   LSPFFSKQ--RKR---VLEVRKQQIETIVPLIERRRRALE---NPGS----DKSAATFSY  180
            L P F+K   RKR     ++R++Q + ++PLI  RR+ +E   N  S    D      SY
Sbjct  222  LWPKFTKLILRKRWEEFFQMRREQHDVLLPLIRARRKIVEERKNRSSEEEEDNKVYVQSY  281

Query  181  LDTLFDLTVEGRKSSPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEE  360
            +DTL +L +   K      E+V+L SEFLNGGTDTTATA++W +A L++NP IQ +LYEE
Sbjct  282  VDTLLELELPDEKRKLNEDEIVSLCSEFLNGGTDTTATALQWIMANLVKNPEIQKRLYEE  341

Query  361  IKSVVGDRKVDEK--DTDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDC  534
            IKSVVG+   + +  D  KMPYL AVV E LR+HPP  F L H+VT+ T LGGY +P   
Sbjct  342  IKSVVGEEAKEVEEEDAQKMPYLKAVVMEGLRRHPPGHFVLPHSVTEDTVLGGYKVPKKG  401

Query  535  GVEFFLPAISDDPTLWSDPEKFDPDRFLSGGEDADITGVTAVKMMPFG  678
             + F +  I  DP +W +P  F P+RF+   E  DITG   +KMMPFG
Sbjct  402  TINFMVAEIGRDPMVWEEPMAFKPERFMGEEEAVDITGSRGIKMMPFG  449



>ref|XP_006302157.1| hypothetical protein CARUB_v10020166mg [Capsella rubella]
 gb|EOA35055.1| hypothetical protein CARUB_v10020166mg [Capsella rubella]
Length=509

 Score =   186 bits (473),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 103/232 (44%), Positives = 143/232 (62%), Gaps = 14/232 (6%)
 Frame = +1

Query  16   VDDFLPILSPFFSKQR-KRVLEVRKQQIETIVPLI--------ERRRRALENPGSDKSAA  168
            V +  P L+    ++R +   ++RK+Q E ++PLI        ER++R+LE    DK   
Sbjct  218  VLNIWPKLTKLICRKRWEEFFQMRKEQHEVLLPLIRARRKIVEERKKRSLE---EDKKEY  274

Query  169  TFSYLDTLFDLTVEGRKSSPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSK  348
              SY+DTL D+ +   K      E+V+L SEFLN GTDTTATA++W +A L++NP IQ +
Sbjct  275  VQSYVDTLLDVELPDEKRKLNEDEIVSLCSEFLNAGTDTTATALQWIMANLVKNPDIQKR  334

Query  349  LYEEIKSVVGDRKVDEK--DTDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDI  522
            L+EEI SVVG+   + +  D  KMPYL AVV E LR+HPP  F L H+VT+ T LGGY +
Sbjct  335  LHEEITSVVGEEAKEVEEEDAQKMPYLKAVVLEGLRRHPPGHFVLPHSVTEDTVLGGYKV  394

Query  523  PMDCGVEFFLPAISDDPTLWSDPEKFDPDRFLSGGEDADITGVTAVKMMPFG  678
            P    + F +  I  DP +W +P +F P+RF+   E  DITG   +KMMPFG
Sbjct  395  PKKGTINFMVAEIGRDPKVWEEPMEFKPERFIGEEESVDITGSRGIKMMPFG  446



>ref|XP_003574176.1| PREDICTED: cytochrome P450 89A2-like [Brachypodium distachyon]
Length=512

 Score =   186 bits (472),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 105/232 (45%), Positives = 139/232 (60%), Gaps = 15/232 (6%)
 Frame = +1

Query  25   FLPILSPFFSKQRKRVLE-VRKQQIETIVPLIE-----RRRRALENPGSDKSAATF--SY  180
            FLP ++    + R R  E +R++Q E  VPLI      R RRA E  G  ++  TF  SY
Sbjct  220  FLPSITKLIFRDRIRTAEAMRQRQKELFVPLINARREYRNRRAAEAEGEPRTVTTFEHSY  279

Query  181  LDTLFDLTV--EGRKSSPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLY  354
            +D L D+ +  EG ++  T+ E+V L SEFLN GTDTT+T ++W +A L++NP IQ KLY
Sbjct  280  VDALLDIKLPDEGDRAL-TDGEMVNLCSEFLNAGTDTTSTGLQWIMAELVKNPSIQQKLY  338

Query  355  EEIKSVVGDRK--VDEKDTDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPM  528
            EEI++  GD K  V E+D  KMPYL AVV E LRKHPP  F L H   +  ++G Y IP 
Sbjct  339  EEIRATTGDDKEEVSEEDVHKMPYLKAVVLEGLRKHPPGHFVLPHRAAEDMEVGEYLIPK  398

Query  529  DCGVEFFLPAISDDPTLWSDPEKFDPDRFLSG--GEDADITGVTAVKMMPFG  678
               V F +  +  D   W  P +F P+RFL G  GE  D+TG   ++MMPFG
Sbjct  399  GATVNFMIAEMGRDEQEWEKPMEFSPERFLPGGAGEGVDVTGNREIRMMPFG  450



>ref|XP_002268331.1| PREDICTED: cytochrome P450 89A2 [Vitis vinifera]
 ref|XP_010662053.1| PREDICTED: cytochrome P450 89A2 [Vitis vinifera]
Length=516

 Score =   186 bits (472),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 99/232 (43%), Positives = 140/232 (60%), Gaps = 13/232 (6%)
 Frame = +1

Query  22   DFLPILSP-FFSKQRKRVLEVRKQQIETIVPLIERRRRALENPGSDK--------SAATF  174
            +F P +    F K+ ++ L++RK Q   ++PLI  R R  E   S +        S+   
Sbjct  220  NFWPTIGKILFRKRWEKFLQLRKHQENVLIPLIRARERLKEELQSKQQEDSDNEDSSRIT  279

Query  175  SYLDTLFDLTVEGRKSSPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLY  354
             Y+DTL DL +   K    ++ELV+L SEFLN GT TT T+++W +A L++ P IQ+K++
Sbjct  280  VYVDTLLDLQLPDEKRKLNDSELVSLCSEFLNAGTHTTYTSLQWIMANLVKYPHIQAKVF  339

Query  355  EEIKSVVGDRK--VDEKDTDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPM  528
            EEI  V G R+  V ++D  KMPYL AV+ E LR+HPP  F L HAV Q   LGGY IP 
Sbjct  340  EEISGVKGTREDEVKQEDLQKMPYLKAVILEGLRRHPPGHFGLPHAVDQDVNLGGYTIPQ  399

Query  529  DCGVEFFLPAISDDPTLWSDPEKFDPDRFLSGG--EDADITGVTAVKMMPFG  678
            +  + F +  I+ +P +W DP +F P+RFL+G   E  D+TG   +KMMPFG
Sbjct  400  NANIFFMVAEIAWNPEVWEDPLEFKPERFLTGDGVEAFDVTGSKEIKMMPFG  451



>gb|EMS64564.1| Cytochrome P450 89A2 [Triticum urartu]
Length=454

 Score =   184 bits (467),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 103/226 (46%), Positives = 131/226 (58%), Gaps = 8/226 (4%)
 Frame = +1

Query  25   FLPILSPFFSKQRKRVLE-VRKQQIETIVPLIERRRRALENPGSDKSAATF--SYLDTLF  195
            F P L+    + R R    +R++Q E +VPLI  RR    + G  +   TF  SY+DTL 
Sbjct  167  FFPSLTKHLFRDRLRTAHAMRRRQKELLVPLINARREYKSSGGEPRKETTFEHSYVDTLL  226

Query  196  DLTVEGRKSSP-TNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEIKSV  372
            D+ +      P T+ ELV L SEFLN GTDTT+T ++W +A L++NP IQ KLYEEIK+ 
Sbjct  227  DIKLPEEGDRPLTDNELVILCSEFLNAGTDTTSTGLQWIMAELVKNPAIQEKLYEEIKAT  286

Query  373  VGD--RKVDEKDTDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVEF  546
             GD   +V   D  KMPYL AVV E LRKHPP  F L H   +  ++G Y IP    V F
Sbjct  287  TGDDQEEVSGDDIHKMPYLKAVVLEGLRKHPPGHFVLPHKAAEDMEIGDYLIPKGATVNF  346

Query  547  FLPAISDDPTLWSDPEKFDPDRFLSG--GEDADITGVTAVKMMPFG  678
             +  +  D   W  P +F PDRFL G  GE  D+TG   +KMMPFG
Sbjct  347  MVAEMGRDEREWEKPLEFSPDRFLPGGAGEGVDVTGNREIKMMPFG  392



>gb|KJB46082.1| hypothetical protein B456_007G347800 [Gossypium raimondii]
Length=509

 Score =   185 bits (470),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 95/226 (42%), Positives = 143/226 (63%), Gaps = 6/226 (3%)
 Frame = +1

Query  16   VDDFLPILSPFFSKQR-KRVLEVRKQQIETIVPLIERRRRALENPGSDKSA--ATFSYLD  186
            V +F P ++    ++R  ++ ++RK++ + ++PL+  R++  +   S+K +     +Y+D
Sbjct  223  VLNFWPRVTKILLRKRWDQLFQLRKEREDVLIPLLRARKKGKDERLSNKESDDYVLAYVD  282

Query  187  TLFDLTVEGRKSSPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEIK  366
            TL DL +   K     AE+VTL SEF+N GTDTT+TA++W +A L++ P IQ +L +EIK
Sbjct  283  TLLDLELPEEKRKLDEAEMVTLASEFINAGTDTTSTALQWVMANLVKYPHIQERLLDEIK  342

Query  367  SVVGD--RKVDEKDTDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGV  540
             VVGD    + E+D  KMP+L AV+ E LR+HPP  F + H VT+ T LGGY IP +  +
Sbjct  343  QVVGDGVEDIKEEDLQKMPHLKAVILEGLRRHPPAHFVVPHCVTEDTILGGYLIPKNSNI  402

Query  541  EFFLPAISDDPTLWSDPEKFDPDRFLSGGEDADITGVTAVKMMPFG  678
             F +  +  DP +W DP  F P+RF+ G E  DITG   +KMMPFG
Sbjct  403  NFMVADMGWDPKVWEDPMAFKPERFI-GEEVFDITGSREIKMMPFG  447



>ref|XP_006662172.1| PREDICTED: cytochrome P450 89A2-like [Oryza brachyantha]
Length=538

 Score =   186 bits (471),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 109/241 (45%), Positives = 147/241 (61%), Gaps = 19/241 (8%)
 Frame = +1

Query  13   RVDDFLP-ILSPFFSKQRKRVLEVRKQQIETIVPLIE-RRRRALENPGSDKSAATF--SY  180
            RV  FLP + +  F+ + K +L +R +     +PLI+ RR+R    P   + A T   SY
Sbjct  228  RVFAFLPAVTTRLFAGRMKAMLAMRLRLKAMFMPLIDARRQRKNNTPPRQEKATTLPHSY  287

Query  181  LDTLFDLTV----EGRKSSPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSK  348
            +DTL  L++    +G + + T+ E+V L SEFLNGGTDTT+TA++W +A L++NPGIQ K
Sbjct  288  VDTLLGLSINDGGKGGERALTDDEMVALCSEFLNGGTDTTSTALQWIMAELVKNPGIQDK  347

Query  349  LYEEIKSVV----GD-----RKVDEKDTDKMPYLNAVVKELLRKHPPTFFALTHAVTQPT  501
            L++EIK+V     GD     R+V E D  +MPYL AVV E LR+HPP  F L HA  +  
Sbjct  348  LHDEIKAVTAADSGDGGSRRRQVSEDDVHRMPYLKAVVLEGLRRHPPGHFVLPHAPAEDM  407

Query  502  KLGGYDIPMDCGVEFFLPAISDDPTLWSDPEKFDPDRFLSG--GEDADITGVTAVKMMPF  675
            +LGGY IP    V F +  IS D   W  P +F P+RF+ G  GE  DITG   +KMMPF
Sbjct  408  ELGGYTIPKGTLVNFTVADISMDEKTWERPREFVPERFMPGGDGEGVDITGTREIKMMPF  467

Query  676  G  678
            G
Sbjct  468  G  468



>ref|XP_006662509.1| PREDICTED: cytochrome P450 89A2-like [Oryza brachyantha]
Length=460

 Score =   184 bits (467),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 101/225 (45%), Positives = 134/225 (60%), Gaps = 7/225 (3%)
 Frame = +1

Query  25   FLPILSPFFSKQRKRVLEVRKQQIETIVPLIERRRRALENPGSDKSAATF--SYLDTLFD  198
            F  I    F  + K+   +R++Q +  VPLI  RR   ++ G  +  +TF  SY DTL D
Sbjct  174  FPAITKHVFRGRLKKAHALRQRQKDLFVPLINSRREYKKHGGEPRKESTFEHSYADTLLD  233

Query  199  LTV-EGRKSSPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEIKSVV  375
            + + E    + T+ E+V L SEFLN GTDTT+TA++W +A L++NP IQSKLYEEIKS  
Sbjct  234  IKLPEDGNRALTDDEMVNLCSEFLNAGTDTTSTALQWIMAELVKNPSIQSKLYEEIKSKT  293

Query  376  GD--RKVDEKDTDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVEFF  549
            GD  R+V E+D   MPYL  VV E LRKHPP    L H   +  ++GGY IP    V F 
Sbjct  294  GDGQREVSEEDVHGMPYLKVVVLEGLRKHPPGHMVLPHKAAEDMEIGGYLIPKGATVNFM  353

Query  550  LPAISDDPTLWSDPEKFDPDRFLSG--GEDADITGVTAVKMMPFG  678
            +  +  D   W  P +F P+RFL G  GE  D+TG   ++MMPFG
Sbjct  354  VAEMGRDEKEWEKPMEFIPERFLPGGDGEGVDVTGTREIRMMPFG  398



>ref|NP_001057534.1| Os06g0328900 [Oryza sativa Japonica Group]
 dbj|BAF19448.1| Os06g0328900, partial [Oryza sativa Japonica Group]
Length=290

 Score =   179 bits (455),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 97/219 (44%), Positives = 133/219 (61%), Gaps = 11/219 (5%)
 Frame = +1

Query  31   PILSPFFSKQRKRVLEVRKQQIETIVPLIERRRRALENPGSDKSAATFSYLDTLFDLTV-  207
            PI    F ++  +++ +R++Q E   PLI  RR A    G D       Y+D+L  LT+ 
Sbjct  6    PITRLVFRRRWNKLVSLRRRQEELFAPLIRARREA--GAGGD------CYVDSLVKLTIP  57

Query  208  EGRKSSPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEIKSVVGDRK  387
            E      T+ E+V+L SEF++ GTDTTATA++W +A L++NP +Q KL EEI +   D +
Sbjct  58   EDGGRGLTDVEIVSLCSEFMSAGTDTTATALQWILANLVKNPAMQDKLREEITAAAVDGE  117

Query  388  VDEKDTDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVEFFLPAISD  567
            V E+D   MPYL AVV E LR+HPP  F L H V + T L GY +P +  V F +  I  
Sbjct  118  VREEDLQAMPYLKAVVLEGLRRHPPDHFLLPHTVEEETTLDGYRVPANTPVNFAVGEIGL  177

Query  568  DPTLWSDPEKFDPDRFLSG--GEDADITGVTAVKMMPFG  678
            D  +W+ PE F P+RFL+G  GED D+TG   +KMMPFG
Sbjct  178  DSEVWTSPEVFRPERFLAGGEGEDVDLTGSKEIKMMPFG  216



>ref|XP_007029747.1| Cytochrome P450, family 87, subfamily A, polypeptide 6 [Theobroma 
cacao]
 gb|EOY10249.1| Cytochrome P450, family 87, subfamily A, polypeptide 6 [Theobroma 
cacao]
Length=513

 Score =   185 bits (469),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 102/231 (44%), Positives = 140/231 (61%), Gaps = 14/231 (6%)
 Frame = +1

Query  10   PRVDDFLPILSPFFSKQRKRVLEVRKQQIETIVPLIERRRRALENPGSDKSA--ATFSYL  183
            PRV   L        K+ +++ ++RK Q + ++PLI  R++A E   + K +     +Y+
Sbjct  227  PRVTKVL------LRKKWEQLYQLRKDQEDLLIPLIRARKKAKEENLNKKESDDYVLAYV  280

Query  184  DTLFDLTVEGRKSSPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEI  363
            DTL DL +   K      E+VTL SEFLN GTDTT+TA++W +A L++ P +Q KL  EI
Sbjct  281  DTLLDLELPEDKRKLEEGEIVTLASEFLNAGTDTTSTALQWIMANLVKYPYVQDKLLLEI  340

Query  364  KSVVGD--RKVDEKDTDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCG  537
            K VVGD   ++ E D  KMPYL AV+ E LR+HPP  F L H VT+ T LGG+ +P +  
Sbjct  341  KGVVGDGAEEIQEDDLQKMPYLKAVILEGLRRHPPGHFVLPHCVTEDTVLGGFLVPKNGT  400

Query  538  VEFFLPAISDDPTLWSDPEKFDPDRFL----SGGEDADITGVTAVKMMPFG  678
            V F +  ++ DP +W DP  F P+RFL    S GE  DITG   +KMMPFG
Sbjct  401  VNFMVADMAWDPKVWEDPMAFKPERFLRSDDSSGEVFDITGSREIKMMPFG  451



>gb|EAY79193.1| hypothetical protein OsI_34305 [Oryza sativa Indica Group]
Length=522

 Score =   185 bits (469),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 103/232 (44%), Positives = 145/232 (63%), Gaps = 15/232 (6%)
 Frame = +1

Query  25   FLPILSPFFSKQRKRV-LEVRKQQIETIVPLIERRR---RALENPGS-----DKSAATFS  177
            F P ++    ++R ++ L +R+QQ E  VPLI+ RR     ++  GS      ++    S
Sbjct  229  FYPAVTKHIFRRRLQMGLALRRQQKELFVPLIDARRARKNHIQQSGSPPVPEKETTFEHS  288

Query  178  YLDTLFDLTV---EGRKSSPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSK  348
            Y+DTL D+++   +G ++  T+ ELV L SEFLN GTDTTATA++W +A L++NP IQSK
Sbjct  289  YVDTLLDISLPDTDGDRAL-TDDELVMLCSEFLNAGTDTTATALQWIMAELVKNPSIQSK  347

Query  349  LYEEIKSVVGDRKVDEKDTDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPM  528
            L++EIKS   D ++ E+DT  MPYL AV+ E LRKHPPT F L H   +  ++GGY IP 
Sbjct  348  LHDEIKSKTSDDEITEEDTHDMPYLKAVILEGLRKHPPTHFVLPHKAAEDVEVGGYLIPK  407

Query  529  DCGVEFFLPAISDDPTLWSDPEKFDPDRFLSG--GEDADITGVTAVKMMPFG  678
               V F +  +  D   W  P +F P+RFL+G  GE  D+TG   V+MMPFG
Sbjct  408  GATVNFMVAEMGRDEREWEKPMEFIPERFLAGGDGEGVDVTGSREVRMMPFG  459



>gb|KHN42995.1| Cytochrome P450 89A2 [Glycine soja]
Length=364

 Score =   181 bits (460),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 93/213 (44%), Positives = 131/213 (62%), Gaps = 5/213 (2%)
 Frame = +1

Query  46   FFSKQRKRVLEVRKQQIETIVPLIERRRRALENPGSDKSAATFSYLDTLFDLTVEGRKSS  225
             F K+ K  L  RK+Q +  VPLI  R++  +  G D      SY+DTL DL +   K  
Sbjct  94   LFRKRWKEFLRFRKEQKDVFVPLIRARKQKRDKKGCD--GFVVSYVDTLLDLELPEEKRK  151

Query  226  PTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEIKSVVGD--RKVDEK  399
             +  E+V+L SEF+N GTDTT+TA++W  A L++ P +Q ++ EEI++V+G+  R+V E+
Sbjct  152  LSEEEMVSLCSEFMNAGTDTTSTALQWITANLVKYPHVQERVVEEIRNVLGESVREVKEE  211

Query  400  DTDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVEFFLPAISDDPTL  579
            D  K+PYL AV+ E LR+HPP  F L HAVT+      Y +P +  V F +  +  DP +
Sbjct  212  DLQKLPYLKAVILEGLRRHPPGHFVLPHAVTEDVVFNDYLVPKNGTVNFMVAEMGWDPKV  271

Query  580  WSDPEKFDPDRFLSGGEDADITGVTAVKMMPFG  678
            W DP  F P+RFL+  E  DITG   +KMMPFG
Sbjct  272  WEDPMAFKPERFLN-DEGFDITGSKEIKMMPFG  303



>ref|XP_002466942.1| hypothetical protein SORBIDRAFT_01g017160 [Sorghum bicolor]
 gb|EER93940.1| hypothetical protein SORBIDRAFT_01g017160 [Sorghum bicolor]
Length=521

 Score =   184 bits (468),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 100/230 (43%), Positives = 136/230 (59%), Gaps = 8/230 (3%)
 Frame = +1

Query  13   RVDDFLPILSPFFSKQR-KRVLEVRKQQIETIVPLIERRRRALENPGSDKSAATF--SYL  183
            +V  FLP ++    + R  +  E+R++  E  VPLI  RR   +  G  K   TF  SYL
Sbjct  227  QVFSFLPAVTKHLFRARLDKARELRRRVKELFVPLINARREYKKRGGEPKGETTFEHSYL  286

Query  184  DTLFDLTVEGRKSSP-TNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEE  360
            DTL D+ +      P T+ E+  L SEFL+ GTDTT+T ++W +A L++NP IQ KLY E
Sbjct  287  DTLLDIKLHEDGDRPLTDDEICILCSEFLDAGTDTTSTGLQWIMAELVKNPAIQEKLYNE  346

Query  361  IKSVVGDRK--VDEKDTDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDC  534
            +K+   + K  V E+D  KMPYL AV+ E LRKHPP  F L H   +  ++GGY IP   
Sbjct  347  VKAAADNDKEGVSEEDVHKMPYLKAVILEALRKHPPAHFVLPHKAAEDMEIGGYLIPKGT  406

Query  535  GVEFFLPAISDDPTLWSDPEKFDPDRFLSG--GEDADITGVTAVKMMPFG  678
             V F +  +S D   W +P +F P+RFL G  GE  D+TG  A++MMPFG
Sbjct  407  TVNFMVAEMSRDEQEWKNPMEFSPERFLPGGDGEGVDVTGTKAIRMMPFG  456



>gb|ADP89483.1| cytochrome P450 mono-oxygenase superfamily, partial [Picea mariana]
Length=210

 Score =   176 bits (447),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 83/141 (59%), Positives = 100/141 (71%), Gaps = 0/141 (0%)
 Frame = +1

Query  256  SEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEIKSVVGDRKVDEKDTDKMPYLNAVV  435
            SE L  GTDTT+TA+EWA+ R++ +  IQ  LY+EI  VVGDRKV+ KD + +PYLNAVV
Sbjct  1    SELLTAGTDTTSTALEWAMLRMVMHQDIQEALYQEICDVVGDRKVEGKDIENLPYLNAVV  60

Query  436  KELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVEFFLPAISDDPTLWSDPEKFDPDRF  615
            KE LR+HPP  F L+HAVTQ  KL GYDIP    VEF+   +S DP +W DP  F+P RF
Sbjct  61   KETLRRHPPGHFVLSHAVTQDCKLRGYDIPYKANVEFYTAWMSFDPNIWPDPMTFNPRRF  120

Query  616  LSGGEDADITGVTAVKMMPFG  678
            L  G + DITG   VKMMPFG
Sbjct  121  LDPGNEVDITGNKQVKMMPFG  141



>ref|XP_007029748.1| Cytochrome P450, family 87, subfamily A, polypeptide 6 [Theobroma 
cacao]
 gb|EOY10250.1| Cytochrome P450, family 87, subfamily A, polypeptide 6 [Theobroma 
cacao]
Length=513

 Score =   184 bits (467),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 99/228 (43%), Positives = 140/228 (61%), Gaps = 9/228 (4%)
 Frame = +1

Query  22   DFLPILSPFFSKQR-KRVLEVRKQQIETIVPLIERRRRALENPGSDKSA--ATFSYLDTL  192
            +F P ++    ++R ++  ++RK Q + ++PLI  R++A E   + K++     +Y+DTL
Sbjct  224  NFWPRVTKVLLRKRWEQFYQLRKDQEDLLIPLIRARKKAKEENLTKKASDDYVLAYVDTL  283

Query  193  FDLTVEGRKSSPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEIKSV  372
             DL +   K      E+V+L SEFLNGGTDTT+TA++W +A L++ P +Q KL  EIK V
Sbjct  284  LDLELPEEKRKLEEGEIVSLASEFLNGGTDTTSTALQWIMANLVKYPHVQDKLLLEIKGV  343

Query  373  VGD--RKVDEKDTDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVEF  546
            VGD   ++ E D  KMPYL AVV E LR+HPP  F L H  T+ T LGG+ +P +  V F
Sbjct  344  VGDGAEEIKEDDLQKMPYLKAVVLEGLRRHPPGHFVLPHCATEDTVLGGFLVPKNGTVNF  403

Query  547  FLPAISDDPTLWSDPEKFDPDRFL----SGGEDADITGVTAVKMMPFG  678
             +  +  DP +W DP  F P+RFL      GE  DITG   +KMMPFG
Sbjct  404  MVADMGWDPKVWEDPMAFKPERFLRSDDGSGEVFDITGSREIKMMPFG  451



>emb|CAN77554.1| hypothetical protein VITISV_039372 [Vitis vinifera]
Length=516

 Score =   184 bits (467),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 102/239 (43%), Positives = 143/239 (60%), Gaps = 20/239 (8%)
 Frame = +1

Query  22   DFLPILSP-FFSKQRKRVLEVRKQQIETIVPLI----------ERRRRALENPGSDKSAA  168
            +F P++    F K+ +  L++ K + E ++PLI          +R+++   N  S  S  
Sbjct  217  NFWPMVGKILFRKRWREFLQICKDEEEVLIPLIRGRQRXNHDMQRKQKQDSNDLSSSSKD  276

Query  169  TF-SYLDTLFDLTVEGRKSSPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQS  345
             F SY+DTL DL +   K      E+V+L SEFL  GTDTT+TA++W +A L++ P IQ 
Sbjct  277  YFISYVDTLLDLQLPDEKRKLNEGEIVSLCSEFLGAGTDTTSTALQWIMANLVQYPHIQV  336

Query  346  KLYEEIKSVVG--DRKVDEKDTDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYD  519
            KL+EEI  VVG  +++V E+D  KMPYL AV+ E LR+HPP  F   H+VTQ   L GY 
Sbjct  337  KLFEEIMGVVGVGEKEVKEEDLQKMPYLKAVILEGLRRHPPGHFVSPHSVTQDVVLDGYI  396

Query  520  IPMDCGVEFFLPAISDDPTLWSDPEKFDPDRFLS------GGEDADITGVTAVKMMPFG  678
            IP +  V F +  I  +P +W DP +F P+RFL+      GGE  DITG + +KMMPFG
Sbjct  397  IPKNTIVNFMVAEIGRNPNVWEDPMEFKPERFLNKNGDGDGGEVFDITGSSEIKMMPFG  455



>ref|XP_002266269.2| PREDICTED: cytochrome P450 89A2-like [Vitis vinifera]
Length=537

 Score =   184 bits (468),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 102/239 (43%), Positives = 143/239 (60%), Gaps = 20/239 (8%)
 Frame = +1

Query  22   DFLPILSP-FFSKQRKRVLEVRKQQIETIVPLI----------ERRRRALENPGSDKSAA  168
            +F P++    F K+ +  L++ K + E ++PLI          +R+++   N  S  S  
Sbjct  238  NFWPMVGKILFRKRWREFLQICKDEEEVLIPLIRGRQRLNHDMQRKQKQDSNDLSSSSKD  297

Query  169  TF-SYLDTLFDLTVEGRKSSPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQS  345
             F SY+DTL DL +   K      E+V+L SEFL  GTDTT+TA++W +A L++ P IQ 
Sbjct  298  YFISYVDTLLDLQLPDEKRKLNEGEIVSLCSEFLGAGTDTTSTALQWIMANLVQYPHIQV  357

Query  346  KLYEEIKSVVG--DRKVDEKDTDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYD  519
            KL+EEI  VVG  +++V E+D  KMPYL AV+ E LR+HPP  F   H+VTQ   L GY 
Sbjct  358  KLFEEIMGVVGVGEKEVKEEDLQKMPYLKAVILEGLRRHPPGHFVSPHSVTQDVVLDGYI  417

Query  520  IPMDCGVEFFLPAISDDPTLWSDPEKFDPDRFLS------GGEDADITGVTAVKMMPFG  678
            IP +  V F +  I  +P +W DP +F P+RFL+      GGE  DITG + +KMMPFG
Sbjct  418  IPKNTIVNFMVAEIGRNPNVWEDPMEFKPERFLNKNGDGDGGEVFDITGSSEIKMMPFG  476



>ref|XP_010276939.1| PREDICTED: cytochrome P450 89A2-like [Nelumbo nucifera]
Length=510

 Score =   184 bits (466),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 105/227 (46%), Positives = 141/227 (62%), Gaps = 12/227 (5%)
 Frame = +1

Query  25   FLPILSPF-FSKQRKRVLEVRKQQIETIVPLIERRRRALENPGSDKSAAT---FSYLDTL  192
            FLP L    F K+     E+R+ Q   + PLI R RR  E   S++  +T     Y+DTL
Sbjct  225  FLPKLGKIIFRKKWNEFYEMRRSQESVLFPLI-RARREQEKKQSEEGKSTEMVVCYVDTL  283

Query  193  FDLTV-EGRKSSPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEIKS  369
             +L + +GRK   T  E+++L SEFLN GTDTT TA++W +A L+++P IQ KL  EI+ 
Sbjct  284  LNLRLPDGRKL--TEEEIMSLCSEFLNAGTDTTFTALQWIMANLVKHPHIQEKLVSEIEG  341

Query  370  VVGD-RKVDEKDTDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVEF  546
            VVG   ++ E+D  KMPYL AVV E LR+HPP  F L HAVT+   L GY +P +  V F
Sbjct  342  VVGSGEEIKEEDLQKMPYLKAVVLEGLRRHPPGHFVLPHAVTEDITLDGYLVPENATVNF  401

Query  547  FLPAISDDPTLWSDPEKFDPDRFL---SGGEDADITGVTAVKMMPFG  678
             +  +  DP +W DP +F P+RFL   +GGE+ DITG   +KMMPFG
Sbjct  402  MVAEMGWDPKVWEDPMEFMPERFLPRGNGGEEFDITGTREIKMMPFG  448



>gb|ADP89481.1| cytochrome P450 mono-oxygenase superfamily, partial [Picea mariana]
 gb|ADP89485.1| cytochrome P450 mono-oxygenase superfamily, partial [Picea omorika]
 gb|ADP89486.1| cytochrome P450 mono-oxygenase superfamily, partial [Picea omorika]
Length=210

 Score =   176 bits (446),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 83/141 (59%), Positives = 100/141 (71%), Gaps = 0/141 (0%)
 Frame = +1

Query  256  SEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEIKSVVGDRKVDEKDTDKMPYLNAVV  435
            SE L  GTDTT+TA+EWA+ R++ +  IQ  LY+EI  VVGDRKV+ KD + +PYLNAVV
Sbjct  1    SELLTAGTDTTSTALEWAMLRMVMHQDIQETLYQEICDVVGDRKVEGKDIENLPYLNAVV  60

Query  436  KELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVEFFLPAISDDPTLWSDPEKFDPDRF  615
            KE LR+HPP  F L+HAVTQ  KL GYDIP    VEF+   +S DP +W DP  F+P RF
Sbjct  61   KETLRRHPPGHFVLSHAVTQDCKLRGYDIPYKANVEFYTAWMSFDPKIWPDPMTFNPRRF  120

Query  616  LSGGEDADITGVTAVKMMPFG  678
            L  G + DITG   VKMMPFG
Sbjct  121  LDPGNEVDITGNKQVKMMPFG  141



>ref|XP_008797233.1| PREDICTED: cytochrome P450 89A2-like, partial [Phoenix dactylifera]
Length=510

 Score =   184 bits (466),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 102/229 (45%), Positives = 140/229 (61%), Gaps = 13/229 (6%)
 Frame = +1

Query  25   FLPILSPFFSKQR-KRVLEVRKQQIETIVPLIERRRRALENPGSDKSAA---TFSYLDTL  192
            F P +S +  + R   VL++R++Q E  VPLI  R+   E     KS      +SY+D+L
Sbjct  222  FAPRISRYVFRDRINTVLQMRQRQEELFVPLIRARKEFKEQQQRQKSEEERFVYSYVDSL  281

Query  193  FDLTVE---GRKSSPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEI  363
             D+ +    GR+   T  E+V L SEFLN GTDTT+TA++W +A L+++  IQSKL EEI
Sbjct  282  LDIELSEEGGRRL--TEREIVALCSEFLNAGTDTTSTALQWIMANLVKHQDIQSKLREEI  339

Query  364  KSVVGD--RKVDEKDTDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCG  537
            +  VG   +++ E+D  KMPYL AV+KE LR+HPP  F L H VT+   L GY IP    
Sbjct  340  EGAVGSDAQEIKEEDLQKMPYLKAVIKEGLRRHPPGHFVLPHTVTEDVVLDGYLIPRGAS  399

Query  538  VEFFLPAISDDPTLWSDPEKFDPDRFLSG--GEDADITGVTAVKMMPFG  678
            + F +  I  D  +W +P +F P+RFL+G  GE  DITG   +KMMPFG
Sbjct  400  INFMVAEIGWDGKVWEEPMEFKPERFLAGGSGEGVDITGSKEIKMMPFG  448



>ref|NP_176675.1| cytochrome P450, family 89, subfamily A, polypeptide 5 [Arabidopsis 
thaliana]
 gb|AAD38269.1|AC006193_25 Putative cytochrome P450 [Arabidopsis thaliana]
 gb|AAK59583.1| putative cytochrome p450 protein [Arabidopsis thaliana]
 gb|AAK93709.1| putative cytochrome p450 protein [Arabidopsis thaliana]
 gb|AEE34308.1| cytochrome P450, family 89, subfamily A, polypeptide 5 [Arabidopsis 
thaliana]
Length=510

 Score =   184 bits (466),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 105/228 (46%), Positives = 141/228 (62%), Gaps = 16/228 (7%)
 Frame = +1

Query  37   LSPFFSKQ--RKR---VLEVRKQQIETIVPLIERRRRALE---NPGS----DKSAATFSY  180
            L P F+K   RKR     ++R++Q + ++PLI  RR+ +E   N  S    D      SY
Sbjct  222  LWPKFTKLILRKRWEEFFQMRREQHDVLLPLIRARRKIVEERKNRSSEEEEDNKEYVQSY  281

Query  181  LDTLFDLTVEGRKSSPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEE  360
            +DTL +L +   K      E+V+L SEFLNGGTDTTATA++W +A L++NP IQ +LYEE
Sbjct  282  VDTLLELELPDEKRKLNEDEIVSLCSEFLNGGTDTTATALQWIMANLVKNPDIQKRLYEE  341

Query  361  IKS--VVGDRKVDEKDTDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDC  534
            IKS       +V+E+D  KMPYL AVV E LR+HPP  F L H+VT+ T LGGY +P + 
Sbjct  342  IKSVVGEEANEVEEEDAQKMPYLEAVVMEGLRRHPPGHFVLPHSVTEDTVLGGYKVPKNG  401

Query  535  GVEFFLPAISDDPTLWSDPEKFDPDRFLSGGEDADITGVTAVKMMPFG  678
             + F +  I  DP +W +P  F P+RF+   E  DITG   +KMMPFG
Sbjct  402  TINFMVAEIGRDPKVWEEPMAFKPERFME--EAVDITGSRGIKMMPFG  447



>gb|ADP89490.1| cytochrome P450 mono-oxygenase superfamily, partial [Picea glauca]
 gb|ADP89491.1| cytochrome P450 mono-oxygenase superfamily, partial [Picea glauca]
 gb|ADP89492.1| cytochrome P450 mono-oxygenase superfamily, partial [Picea glauca]
Length=210

 Score =   176 bits (446),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 83/141 (59%), Positives = 100/141 (71%), Gaps = 0/141 (0%)
 Frame = +1

Query  256  SEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEIKSVVGDRKVDEKDTDKMPYLNAVV  435
            SE L  GTDTT+TA+EWA+ R++ +  IQ  LY+EI  VVGDRKV+ KD + +PYLNAVV
Sbjct  1    SELLTAGTDTTSTALEWAMLRMVMHQDIQETLYQEICDVVGDRKVEGKDIENLPYLNAVV  60

Query  436  KELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVEFFLPAISDDPTLWSDPEKFDPDRF  615
            KE LR+HPP  F L+HAVTQ  KL GYDIP    VEF+   +S DP +W DP  F+P RF
Sbjct  61   KETLRRHPPGHFVLSHAVTQDCKLRGYDIPYKANVEFYTAWMSFDPKIWPDPMTFNPRRF  120

Query  616  LSGGEDADITGVTAVKMMPFG  678
            L  G + DITG   VKMMPFG
Sbjct  121  LDPGNEVDITGNKQVKMMPFG  141



>gb|AAK96572.1| At1g64950/F13O11_25 [Arabidopsis thaliana]
Length=510

 Score =   184 bits (466),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 105/228 (46%), Positives = 141/228 (62%), Gaps = 16/228 (7%)
 Frame = +1

Query  37   LSPFFSKQ--RKR---VLEVRKQQIETIVPLIERRRRALE---NPGS----DKSAATFSY  180
            L P F+K   RKR     ++R++Q + ++PLI  RR+ +E   N  S    D      SY
Sbjct  222  LWPKFTKLILRKRWEEFFQMRREQHDVLLPLIRARRKIVEERKNRSSEEEEDNKEYVQSY  281

Query  181  LDTLFDLTVEGRKSSPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEE  360
            +DTL +L +   K      E+V+L SEFLNGGTDTTATA++W +A L++NP IQ +LYEE
Sbjct  282  VDTLLELELPDEKRKLNEDEIVSLCSEFLNGGTDTTATALQWIMANLVKNPDIQKRLYEE  341

Query  361  IKS--VVGDRKVDEKDTDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDC  534
            IKS       +V+E+D  KMPYL AVV E LR+HPP  F L H+VT+ T LGGY +P + 
Sbjct  342  IKSVVGEEANEVEEEDAQKMPYLEAVVMEGLRRHPPGHFVLPHSVTEDTVLGGYKVPKNG  401

Query  535  GVEFFLPAISDDPTLWSDPEKFDPDRFLSGGEDADITGVTAVKMMPFG  678
             + F +  I  DP +W +P  F P+RF+   E  DITG   +KMMPFG
Sbjct  402  TINFMVAEIGRDPKVWEEPMAFKPERFME--EAVDITGSRGIKMMPFG  447



>ref|XP_004151744.2| PREDICTED: cytochrome P450 89A2-like [Cucumis sativus]
 gb|KGN63392.1| hypothetical protein Csa_2G436040 [Cucumis sativus]
Length=512

 Score =   184 bits (466),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 98/234 (42%), Positives = 146/234 (62%), Gaps = 13/234 (6%)
 Frame = +1

Query  16   VDDFLPILSP-FFSKQRKRVLEVRKQQIETIVPLIERRRRALEN-----PGSDKSAATFS  177
            + +F P L+   F K+ + ++++R+ Q + ++PLIE RR+  +N        ++     S
Sbjct  219  ILNFWPKLTKILFRKRWEMLIQLRRNQEKVLIPLIEARRKVNQNRVNRAHTEEEEEFAIS  278

Query  178  YLDTLFDLTVEGRKSSP-TNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLY  354
            Y+DTL DL +    +   TN E+VT+ SEFL GGTDTT TA++W +A +++NP IQ KL+
Sbjct  279  YVDTLLDLELSHEDNRKLTNEEIVTICSEFLVGGTDTTCTALQWTMANIVKNPEIQHKLF  338

Query  355  EEIKSVVGD---RKVDEKDTDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIP  525
             E+K V+GD   ++V E+D +K+PYL AVV E LR+HPP  F L H VT+ T L  Y IP
Sbjct  339  SEMKEVMGDGPGKEVKEEDLEKIPYLKAVVLEGLRRHPPGHFVLPHTVTEDTVLENYVIP  398

Query  526  MDCGVEFFLPAISDDPTLWSDPEKFDPDRFLSGGE---DADITGVTAVKMMPFG  678
             +  V F +  +  +  +W DP +F P+RF+ GG    + DITG   +KMMPFG
Sbjct  399  KNGTVNFMVAEMGWNSKVWEDPMEFKPERFMKGGGGGVEFDITGSKEIKMMPFG  452



>gb|ADP89478.1| cytochrome P450 mono-oxygenase superfamily, partial [Picea abies]
 gb|ADP89479.1| cytochrome P450 mono-oxygenase superfamily, partial [Picea abies]
 gb|ADP89480.1| cytochrome P450 mono-oxygenase superfamily, partial [Picea abies]
Length=210

 Score =   176 bits (445),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 83/141 (59%), Positives = 100/141 (71%), Gaps = 0/141 (0%)
 Frame = +1

Query  256  SEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEIKSVVGDRKVDEKDTDKMPYLNAVV  435
            SE L  GTDTT+TA+EWA+ R++ +  IQ  LY+EI  VVGDRKV+ KD + +PYLNAVV
Sbjct  1    SELLTAGTDTTSTALEWAMLRMVMHQDIQETLYQEICDVVGDRKVEGKDIENLPYLNAVV  60

Query  436  KELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVEFFLPAISDDPTLWSDPEKFDPDRF  615
            KE LR+HPP  F L+HAVTQ  KL GYDIP    VEF+   +S DP +W DP  F+P RF
Sbjct  61   KETLRRHPPGHFVLSHAVTQDCKLRGYDIPYKANVEFYTAWMSFDPKIWPDPMTFNPRRF  120

Query  616  LSGGEDADITGVTAVKMMPFG  678
            L  G + DITG   VKMMPFG
Sbjct  121  LDPGNEVDITGNKQVKMMPFG  141



>ref|XP_002466943.1| hypothetical protein SORBIDRAFT_01g017170 [Sorghum bicolor]
 gb|EER93941.1| hypothetical protein SORBIDRAFT_01g017170 [Sorghum bicolor]
Length=517

 Score =   183 bits (465),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 98/234 (42%), Positives = 140/234 (60%), Gaps = 12/234 (5%)
 Frame = +1

Query  13   RVDDFLPILSPFFSKQR-KRVLEVRKQQIETIVPLIERRRRALENPGSD----KSAATFS  177
            +V  FLP ++    + R  + L +R++  E  +PLI+ RR   + PG +    ++    S
Sbjct  218  QVFSFLPAVTKHLFRARLDKALAMRRRIKELFLPLIDARREYKKRPGGEPPKGETTLEHS  277

Query  178  YLDTLFDLTVE--GRKSSPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKL  351
            Y+DTL D+ +E  G +   T+ E++ L SEFLN GTDTT+T ++W +A L++NP IQ KL
Sbjct  278  YVDTLLDMKIEEDGAQRPLTDDEIIRLCSEFLNAGTDTTSTGLQWIMAELVKNPAIQEKL  337

Query  352  YEEIKSVVGDRK---VDEKDTDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDI  522
            Y EI +   + K   V E+D  KMPYL AV+ E LRKHPP  F L H   +  ++GGY I
Sbjct  338  YNEIMAATDEDKQEGVAEEDVHKMPYLKAVILEALRKHPPAHFVLPHKAAEDMEIGGYLI  397

Query  523  PMDCGVEFFLPAISDDPTLWSDPEKFDPDRFLSG--GEDADITGVTAVKMMPFG  678
            P    V F +  +S D   W +P +F P+RFL G  GE  D+TG  A++MMPFG
Sbjct  398  PKGTTVNFMVAEMSRDEQEWKNPMEFSPERFLPGGDGEGVDVTGTKAIRMMPFG  451



>ref|XP_002524036.1| cytochrome P450, putative [Ricinus communis]
 gb|EEF38404.1| cytochrome P450, putative [Ricinus communis]
Length=524

 Score =   183 bits (465),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 100/238 (42%), Positives = 138/238 (58%), Gaps = 19/238 (8%)
 Frame = +1

Query  22   DFLPILSP-FFSKQRKRVLEVRKQQIETIVPLIERRRRALENPGSDKSAA------TFSY  180
            +F+P L+   F K     L+++K + + ++PLI  R++  E   S KS +        SY
Sbjct  222  NFMPRLTKILFRKDWSEFLQLQKDREDVLIPLIRARKKVNEERQSKKSNSKKDDEYVLSY  281

Query  181  LDTLFDLTVEGRKSSPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEE  360
            LDTLFDL +   K   T  E+++L +EFLN GTDTT+T ++W +A L++ P IQ KL+ E
Sbjct  282  LDTLFDLQLPDEKRKLTEKEILSLCNEFLNAGTDTTSTTLQWIMANLVKYPYIQEKLFME  341

Query  361  IKSVV--GDRKVDEKDTDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDC  534
            IKSVV  G+ +V E    KMPYL AV+ E LR+HPP  F L HAV +   LG Y +P   
Sbjct  342  IKSVVADGEEEVKEDHLQKMPYLKAVILEGLRRHPPAHFLLPHAVIEDVVLGKYLVPKTA  401

Query  535  GVEFFLPAISDDPTLWSDPEKFDPDRFL----------SGGEDADITGVTAVKMMPFG  678
             + F +  +  DP +W DP  F P+RF+           GGE  DITG   +KMMPFG
Sbjct  402  NINFMVAEMGLDPEVWEDPMAFKPERFMGSSDNSSSEGGGGEVFDITGSREIKMMPFG  459



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1147404787994