BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig13027

Length=1021
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009776913.1|  PREDICTED: caffeoyl-CoA O-methyltransferase 5      468   2e-163   Nicotiana sylvestris
gb|ACF17646.1|  putative caffeoyl-CoA 3-O-methyltransferase             469   2e-163   Capsicum annuum
ref|XP_009600093.1|  PREDICTED: caffeoyl-CoA O-methyltransferase 6      468   3e-163   Nicotiana tomentosiformis
ref|XP_009622008.1|  PREDICTED: caffeoyl-CoA O-methyltransferase 5      468   4e-163   Nicotiana tomentosiformis
dbj|BAK74806.1|  hypothetical protein                                   468   5e-163   Cyclamen persicum x Cyclamen purpurascens
ref|XP_010263488.1|  PREDICTED: caffeoyl-CoA O-methyltransferase        467   1e-162   Nelumbo nucifera [Indian lotus]
gb|AAW55668.1|  caffeoyl CoA 3-O-methyltransferase                      466   2e-162   Betula platyphylla [Asian white birch]
gb|AAT37172.1|  caffeoyl-CoA-O-methyltransferase                        466   2e-162   Broussonetia papyrifera [aka]
sp|O04899.1|CAMT5_TOBAC  RecName: Full=Caffeoyl-CoA O-methyltrans...    466   2e-162   Nicotiana tabacum [American tobacco]
ref|XP_010270267.1|  PREDICTED: caffeoyl-CoA O-methyltransferase-...    466   3e-162   Nelumbo nucifera [Indian lotus]
ref|XP_010548003.1|  PREDICTED: caffeoyl-CoA O-methyltransferase 1      466   4e-162   Tarenaya hassleriana [spider flower]
sp|Q42945.1|CAMT6_TOBAC  RecName: Full=Caffeoyl-CoA O-methyltrans...    465   4e-162   Nicotiana tabacum [American tobacco]
ref|XP_010526962.1|  PREDICTED: caffeoyl-CoA O-methyltransferase 5      465   6e-162   Tarenaya hassleriana [spider flower]
gb|ABE41833.1|  caffeoyl-CoA 3-O-methyltransferase                      465   6e-162   Brassica rapa subsp. pekinensis [bai cai]
gb|AAS91565.1|  caffeoyl-CoA O-methyltransferase                        464   8e-162   Broussonetia papyrifera [aka]
ref|XP_006284297.1|  hypothetical protein CARUB_v10005466mg             466   9e-162   
gb|ACJ38669.1|  caffeoyl-CoA O-methyltransferase                        464   1e-161   Betula luminifera [liang ye hua]
ref|XP_009760383.1|  PREDICTED: caffeoyl-CoA O-methyltransferase 6      464   2e-161   Nicotiana sylvestris
ref|XP_007201237.1|  hypothetical protein PRUPE_ppa010497mg             464   2e-161   Prunus persica
ref|XP_009138259.1|  PREDICTED: caffeoyl-CoA O-methyltransferase 1      464   2e-161   Brassica rapa
ref|XP_008236475.1|  PREDICTED: caffeoyl-CoA O-methyltransferase        463   2e-161   
ref|XP_003529403.2|  PREDICTED: caffeoyl-CoA O-methyltransferase-...    464   3e-161   
gb|ABF74683.1|  caffeoyl-CoA-O-methyltransferase                        463   3e-161   Leucaena leucocephala [cassie]
dbj|BAE48788.1|  caffeoyl-CoA-O-methyltransferase                       462   4e-161   Codonopsis lanceolata
ref|XP_009108759.1|  PREDICTED: caffeoyl-CoA O-methyltransferase ...    463   4e-161   Brassica rapa
gb|EYU37656.1|  hypothetical protein MIMGU_mgv1a012535mg                462   6e-161   Erythranthe guttata [common monkey flower]
ref|XP_004290595.1|  PREDICTED: caffeoyl-CoA O-methyltransferase        462   6e-161   Fragaria vesca subsp. vesca
sp|Q8H9B6.1|CAMT_SOLTU  RecName: Full=Caffeoyl-CoA O-methyltransf...    462   7e-161   Solanum tuberosum [potatoes]
gb|ACF48821.1|  caffeoyl-CoA-O-methyltransferase                        461   1e-160   Gossypium hirsutum [American cotton]
ref|XP_006412281.1|  hypothetical protein EUTSA_v10026028mg             462   1e-160   Eutrema salsugineum [saltwater cress]
ref|XP_010107916.1|  Caffeoyl-CoA O-methyltransferase                   461   1e-160   Morus notabilis
gb|KGN43930.1|  Caffeoyl-CoA O-methyltransferase                        462   1e-160   Cucumis sativus [cucumbers]
gb|AAT75320.2|  caffeoyl-CoA 3-O-methyltransferase                      461   2e-160   Boehmeria nivea [Chinese silk-plant]
gb|KFK30033.1|  hypothetical protein AALP_AA7G208900                    462   2e-160   Arabis alpina [alpine rockcress]
ref|NP_001268047.1|  caffeoyl-CoA O-methyltransferase                   461   2e-160   Vitis vinifera
dbj|BAM05558.1|  caffeoyl-CoA O-methyltransferase                       461   2e-160   Eucalyptus pilularis
ref|XP_002282867.1|  PREDICTED: caffeoyl-CoA O-methyltransferase        461   2e-160   Vitis vinifera
sp|Q9SWB8.1|CAMT2_EUCGL  RecName: Full=Caffeoyl-CoA O-methyltrans...    461   2e-160   Eucalyptus globulus [blue gum]
ref|XP_010447157.1|  PREDICTED: caffeoyl-CoA O-methyltransferase ...    461   2e-160   Camelina sativa [gold-of-pleasure]
gb|AAZ95245.1|  putative caffeoyl-CoA O-methyltransferase protein       461   2e-160   Isatis tinctoria [woad]
ref|XP_009341967.1|  PREDICTED: caffeoyl-CoA O-methyltransferase-...    461   2e-160   Pyrus x bretschneideri [bai li]
gb|KHF99603.1|  Caffeoyl-CoA O-methyltransferase 1                      463   2e-160   Gossypium arboreum [tree cotton]
ref|XP_006487045.1|  PREDICTED: caffeoyl-CoA O-methyltransferase-...    461   2e-160   Citrus sinensis [apfelsine]
ref|XP_006339881.1|  PREDICTED: caffeoyl-CoA O-methyltransferase-...    461   2e-160   
ref|NP_195131.1|  putative caffeoyl-CoA O-methyltransferase             461   2e-160   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008385739.1|  PREDICTED: caffeoyl-CoA O-methyltransferase        461   2e-160   Malus domestica [apple tree]
ref|XP_006339880.1|  PREDICTED: caffeoyl-CoA O-methyltransferase-...    461   2e-160   Solanum tuberosum [potatoes]
gb|ABE60812.1|  caffeoyl coenzyme A 3-O-methyltransferase 2             460   3e-160   Leucaena leucocephala [cassie]
emb|CDX72447.1|  BnaC07g44690D                                          461   3e-160   
emb|CAN72492.1|  hypothetical protein VITISV_037012                     461   3e-160   Vitis vinifera
gb|AFU54611.1|  caffeoyl-CoA O-methyltransferase                        460   3e-160   Pyrus x bretschneideri [bai li]
gb|ACY66929.1|  caffeoyl-CoA O-methyltransferase 2                      460   4e-160   Eucalyptus camaldulensis
gb|ACX37696.1|  caffeoyl-CoA O-methyltransferase 2                      460   4e-160   Eucalyptus camaldulensis
ref|XP_008454948.1|  PREDICTED: caffeoyl-CoA O-methyltransferase 5      460   4e-160   Cucumis melo [Oriental melon]
gb|AFG17073.1|  caffeoyl-CoA O-methyltransferase                        460   4e-160   Paeonia lactiflora [common garden peony]
ref|XP_011088234.1|  PREDICTED: caffeoyl-CoA O-methyltransferase        460   4e-160   Sesamum indicum [beniseed]
ref|XP_006856484.1|  PREDICTED: caffeoyl-CoA O-methyltransferase        460   5e-160   Amborella trichopoda
gb|ACQ59095.1|  caffeoyl CoA O-methyltransferase 1                      460   5e-160   Gossypium hirsutum [American cotton]
ref|XP_004231857.1|  PREDICTED: caffeoyl-CoA O-methyltransferase-...    459   6e-160   Solanum lycopersicum
emb|CDY49272.1|  BnaA03g50850D                                          460   6e-160   Brassica napus [oilseed rape]
ref|XP_010432473.1|  PREDICTED: caffeoyl-CoA O-methyltransferase 1      460   7e-160   Camelina sativa [gold-of-pleasure]
gb|ACZ06244.1|  caffeoyl-CoA O-methyltransferase 1                      460   7e-160   Gossypium hirsutum [American cotton]
ref|XP_010437675.1|  PREDICTED: caffeoyl-CoA O-methyltransferase ...    460   7e-160   Camelina sativa [gold-of-pleasure]
ref|XP_004231856.1|  PREDICTED: caffeoyl-CoA O-methyltransferase        459   8e-160   Solanum lycopersicum
gb|AFZ76980.1|  caffeoyl-CoA O-methyltransferase                        459   1e-159   Eriobotrya japonica [loquat]
ref|XP_011000746.1|  PREDICTED: caffeoyl-CoA O-methyltransferase 1      459   1e-159   Populus euphratica
ref|XP_002313125.1|  caffeoyl-CoA O-methyltransferase family protein    459   1e-159   Populus trichocarpa [western balsam poplar]
ref|XP_009345067.1|  PREDICTED: caffeoyl-CoA O-methyltransferase        459   1e-159   Pyrus x bretschneideri [bai li]
gb|KHG18720.1|  Caffeoyl-CoA O-methyltransferase 1                      459   2e-159   Gossypium arboreum [tree cotton]
sp|Q43095.1|CAMT_POPTM  RecName: Full=Caffeoyl-CoA O-methyltransf...    459   2e-159   Populus tremuloides
emb|CBI32387.3|  unnamed protein product                                458   2e-159   Vitis vinifera
ref|XP_011092559.1|  PREDICTED: caffeoyl-CoA O-methyltransferase-...    458   2e-159   Sesamum indicum [beniseed]
ref|XP_010066009.1|  PREDICTED: caffeoyl-CoA O-methyltransferase 2      458   2e-159   Eucalyptus grandis [rose gum]
ref|XP_003518701.2|  PREDICTED: caffeoyl-CoA O-methyltransferase-...    461   2e-159   Glycine max [soybeans]
gb|KJB77663.1|  hypothetical protein B456_012G149800                    458   2e-159   Gossypium raimondii
gb|KHN05829.1|  Caffeoyl-CoA O-methyltransferase                        458   3e-159   Glycine soja [wild soybean]
gb|AAM66108.1|  caffeoyl-CoA O-methyltransferase-like protein           459   3e-159   Arabidopsis thaliana [mouse-ear cress]
gb|AFY97679.1|  caffeoyl-CoA-O-methyltransferase                        458   3e-159   Camellia sinensis [black tea]
gb|AGR51164.1|  catechol-O-methyltransferase                            457   3e-159   Camellia sinensis [black tea]
gb|ACH47151.1|  caffeoyl-CoA 3-O-methyltransferase                      458   3e-159   Linum usitatissimum
gb|KHN43056.1|  Caffeoyl-CoA O-methyltransferase                        458   4e-159   Glycine soja [wild soybean]
gb|AAT40111.1|  caffeoyl-CoA O-methyltransferase                        457   4e-159   Ammi majus [ameo mayor]
gb|KJB47341.1|  hypothetical protein B456_008G024000                    460   5e-159   Gossypium raimondii
ref|XP_007042461.1|  S-adenosyl-L-methionine-dependent methyltran...    459   5e-159   
gb|KHG16338.1|  Caffeoyl-CoA O-methyltransferase 1                      457   6e-159   Gossypium arboreum [tree cotton]
gb|AFN85667.1|  putative caffeoyl-coenzyme A 3-O-methyltransferase      457   6e-159   Hibiscus cannabinus [bimli-jute]
ref|XP_004136981.1|  PREDICTED: caffeoyl-CoA O-methyltransferase 5      457   8e-159   Cucumis sativus [cucumbers]
gb|AAF44689.1|  caffeoyl-CoA O-methyltransferase                        456   9e-159   Populus tomentosa [Chinese white poplar]
ref|XP_006339879.1|  PREDICTED: caffeoyl-CoA O-methyltransferase-...    456   9e-159   Solanum tuberosum [potatoes]
ref|XP_004231855.1|  PREDICTED: caffeoyl-CoA O-methyltransferase-...    456   1e-158   
ref|XP_012087500.1|  PREDICTED: caffeoyl-CoA O-methyltransferase        456   1e-158   
dbj|BAM05559.1|  caffeoyl-CoA O-methyltransferase                       456   1e-158   Eucalyptus globulus subsp. globulus
gb|AAY89237.1|  caffeoyl-CoA 3-O-methyltransferase                      456   1e-158   Linum usitatissimum
ref|XP_003607927.1|  Caffeoyl-CoA O-methyltransferase                   456   1e-158   Medicago truncatula
gb|AEM45654.1|  caffeoyl-CoA O-methyltransferase 3                      456   1e-158   Gerbera jamesonii [Transvaal daisy]
sp|P28034.1|CAMT_PETCR  RecName: Full=Caffeoyl-CoA O-methyltransf...    456   2e-158   Petroselinum crispum
sp|Q40313.1|CAMT_MEDSA  RecName: Full=Caffeoyl-CoA O-methyltransf...    456   2e-158   Medicago sativa [alfalfa]
gb|ABK94003.1|  unknown                                                 456   2e-158   Populus trichocarpa [western balsam poplar]
ref|XP_004505242.1|  PREDICTED: caffeoyl-CoA O-methyltransferase-...    456   2e-158   
gb|AEK52482.1|  caffeoyl-CoA 3-O-methyltransferase                      456   2e-158   Dimocarpus longan [longan]
ref|XP_004230766.1|  PREDICTED: caffeoyl-CoA O-methyltransferase 6      456   2e-158   Solanum lycopersicum
ref|XP_006346396.1|  PREDICTED: caffeoyl-CoA O-methyltransferase ...    456   2e-158   Solanum tuberosum [potatoes]
gb|AFY97680.1|  caffeoyl-CoA-O-methyltransferase                        456   2e-158   Camellia sinensis [black tea]
ref|XP_011000123.1|  PREDICTED: caffeoyl-CoA O-methyltransferase 2      456   3e-158   Populus euphratica
gb|AFZ15799.1|  caffeoyl-CoA O-methyltransferase                        456   3e-158   Lonicera japonica [Japanese honeysuckle]
dbj|BAG71891.1|  caffeoyl CoA O-methyltransferase                       455   3e-158   Carthamus tinctorius
dbj|BAG71890.1|  caffeoyl CoA O-methyltransferase                       455   4e-158   Carthamus tinctorius
gb|ABO77959.1|  caffeoyl-CoA 3-O methyltransferase                      455   4e-158   Coffea canephora [robusta coffee]
ref|XP_009604110.1|  PREDICTED: caffeoyl-CoA O-methyltransferase 2      454   6e-158   Nicotiana tomentosiformis
gb|ACJ84500.1|  unknown                                                 454   6e-158   Medicago truncatula
gb|ACQ59096.1|  caffeoyl CoA O-methyltransferase 2                      454   7e-158   Gossypium hirsutum [American cotton]
ref|XP_007042462.1|  S-adenosyl-L-methionine-dependent methyltran...    454   8e-158   
gb|ABZ89569.1|  O-methyltransferase 5                                   454   8e-158   Humulus lupulus [common hop]
gb|AEW26089.1|  caffeoyl-CoA 3-o-methyltransferase                      453   1e-157   Medicago sativa subsp. x varia
ref|XP_007047308.1|  Caffeoyl-CoA O-methyltransferase 1                 454   1e-157   Theobroma cacao [chocolate]
gb|AEV93479.1|  cinnamoyl-CoA O-methyltransferase                       454   1e-157   Caragana korshinskii
gb|AFX98065.1|  caffeoyl-CoA O-methyltransferase                        454   1e-157   Cunninghamia lanceolata [China fir]
gb|ADI43381.1|  caffeoyl-CoA O-methyltransferase                        454   2e-157   Eucalyptus camaldulensis
ref|XP_002518739.1|  o-methyltransferase, putative                      454   2e-157   Ricinus communis
gb|KJB79353.1|  hypothetical protein B456_013G045300                    453   2e-157   Gossypium raimondii
ref|NP_001234801.1|  caffeoyl-CoA O-methyltransferase                   453   2e-157   Solanum lycopersicum
gb|AFZ78548.1|  caffeoyl-CoA O-methyltransferase                        453   2e-157   Populus tomentosa [Chinese white poplar]
gb|AFD23679.1|  caffeoyl CoA O-methyltransferase                        453   2e-157   Salvia miltiorrhiza [Chinese salvia]
sp|O24151.1|CAMT4_TOBAC  RecName: Full=Caffeoyl-CoA O-methyltrans...    453   2e-157   Nicotiana tabacum [American tobacco]
sp|O24150.2|CAMT3_TOBAC  RecName: Full=Caffeoyl-CoA O-methyltrans...    453   2e-157   Nicotiana tabacum [American tobacco]
ref|XP_006422984.1|  hypothetical protein CICLE_v10029158mg             453   3e-157   Citrus clementina [clementine]
ref|XP_010028437.1|  PREDICTED: caffeoyl-CoA O-methyltransferase        453   3e-157   Eucalyptus grandis [rose gum]
dbj|BAG71894.1|  caffeoyl CoA O-methyltransferase                       453   3e-157   Carthamus tinctorius
ref|XP_009604111.1|  PREDICTED: caffeoyl-CoA O-methyltransferase 3      452   4e-157   Nicotiana tomentosiformis
sp|O04854.1|CAMT_EUCGU  RecName: Full=Caffeoyl-CoA O-methyltransf...    452   4e-157   Eucalyptus gunnii
sp|O24144.1|CAMT1_TOBAC  RecName: Full=Caffeoyl-CoA O-methyltrans...    452   4e-157   Nicotiana tabacum [American tobacco]
dbj|BAG71892.1|  caffeoyl CoA O-methyltransferase                       452   4e-157   Carthamus tinctorius
dbj|BAG71889.1|  caffeoyl CoA O-methyltransferase                       452   5e-157   Carthamus tinctorius
sp|O81185.1|CAMT1_EUCGL  RecName: Full=Caffeoyl-CoA O-methyltrans...    452   5e-157   Eucalyptus globulus [blue gum]
gb|ABB87184.1|  caffeoyl-CoA O-methyltransferase                        452   5e-157   Taiwania cryptomerioides
gb|ABB89956.1|  caffeoyl-CoA O-methyltransferase                        452   6e-157   Chamaecyparis formosensis [Formosan false cypress]
gb|AEW26114.1|  caffeoyl-CoA 3-o-methyltransferase                      451   7e-157   Medicago falcata [sickle alfalfa]
ref|XP_004248757.1|  PREDICTED: caffeoyl-CoA O-methyltransferase 5      452   7e-157   Solanum lycopersicum
ref|XP_009784105.1|  PREDICTED: caffeoyl-CoA O-methyltransferase ...    451   9e-157   Nicotiana sylvestris
ref|XP_009407208.1|  PREDICTED: caffeoyl-CoA O-methyltransferase        451   9e-157   Musa acuminata subsp. malaccensis [pisang utan]
gb|AEW26126.1|  caffeoyl-CoA 3-o-methyltransferase                      451   1e-156   Medicago falcata [sickle alfalfa]
gb|AEW26132.1|  caffeoyl-CoA 3-o-methyltransferase                      451   1e-156   Medicago sativa subsp. caerulea
ref|XP_009784107.1|  PREDICTED: caffeoyl-CoA O-methyltransferase 1      451   1e-156   Nicotiana sylvestris
ref|XP_002298729.1|  caffeoyl-CoA O-methyltransferase family protein    451   2e-156   Populus trichocarpa [western balsam poplar]
ref|XP_007153585.1|  hypothetical protein PHAVU_003G047900g             451   2e-156   Phaseolus vulgaris [French bean]
gb|AEW26107.1|  caffeoyl-CoA 3-o-methyltransferase                      450   2e-156   Medicago sativa subsp. caerulea
ref|XP_006356576.1|  PREDICTED: caffeoyl-CoA O-methyltransferase ...    450   3e-156   Solanum tuberosum [potatoes]
gb|ACE95173.1|  caffeoyl-CoA-3-O-methyltransferase                      450   5e-156   Populus tomentosa [Chinese white poplar]
gb|AII00961.1|  coffee acyl coenzyme A-3-O-methyl transferase           450   5e-156   Curcuma longa
ref|XP_008799011.1|  PREDICTED: caffeoyl-CoA O-methyltransferase        450   9e-156   Phoenix dactylifera
gb|AAK16714.1|  caffeoyl-CoA 3-O-methyltransferase                      449   1e-155   Populus alba x Populus glandulosa
gb|ABL86148.1|  caffeoyl CoAO-methyltransferase                         449   1e-155   Populus deltoides
dbj|BAM05557.1|  caffeoyl-CoA O-methyltransferase                       448   2e-155   Eucalyptus globulus subsp. globulus
gb|AFK44432.1|  unknown                                                 447   7e-155   Lotus japonicus
ref|XP_010690616.1|  PREDICTED: caffeoyl-CoA O-methyltransferase        447   1e-154   Beta vulgaris subsp. vulgaris [field beet]
sp|Q41720.1|CAMT_ZINVI  RecName: Full=Caffeoyl-CoA O-methyltransf...    446   1e-154   Zinnia elegans [garden zinnia]
ref|XP_008366398.1|  PREDICTED: caffeoyl-CoA O-methyltransferase        446   2e-154   Malus domestica [apple tree]
ref|XP_009413346.1|  PREDICTED: caffeoyl-CoA O-methyltransferase ...    446   2e-154   Musa acuminata subsp. malaccensis [pisang utan]
gb|ABX75853.1|  caffeoyl-CoA-O-methyltransferase                        446   3e-154   Acacia auriculiformis x Acacia mangium
gb|AEM45655.1|  caffeoyl-CoA O-methyltransferase 3                      445   3e-154   Petunia x hybrida [garden petunia]
gb|ABK21526.1|  unknown                                                 446   4e-154   Picea sitchensis
ref|XP_012079255.1|  PREDICTED: caffeoyl-CoA O-methyltransferase ...    446   6e-154   
gb|ACV50428.1|  caffeoyl-CoA O-methyltransferase                        444   1e-153   Jatropha curcas
sp|O65162.1|CAMT_MESCR  RecName: Full=Caffeoyl-CoA O-methyltransf...    443   2e-153   Mesembryanthemum crystallinum
gb|AFL65039.1|  caffeoyl-CoA-O-methyltransferase                        443   3e-153   Pinus pinaster [cluster pine]
gb|AHL67654.1|  caffeoyl-CoA 3-O-methyltransferase                      443   4e-153   Pinus massoniana [Chinese red pine]
gb|AEW26103.1|  caffeoyl-CoA 3-o-methyltransferase                      441   7e-153   Medicago sativa subsp. x varia
emb|CBL95257.2|  caffeoyl CoA O-methyltransferase                       442   9e-153   Pinus pinaster [cluster pine]
ref|XP_002523619.1|  o-methyltransferase, putative                      443   1e-152   
emb|CAK18782.1|  caffeoyl CoA O-methyltransferase                       442   1e-152   Picea abies
gb|AAR91504.1|  caffeoyl-CoA-O-methyltransferase                        440   4e-152   Corchorus capsularis [jute]
gb|ACN40635.1|  unknown                                                 439   1e-151   Picea sitchensis
gb|ABR17605.1|  unknown                                                 439   1e-151   Picea sitchensis
gb|ABB87185.1|  caffeoyl-CoA O-methyltransferase                        439   1e-151   Chamaecyparis obtusa var. formosana [arisan hinoki]
gb|ADV40957.1|  caffeoyl-CoA O-methyltransferase                        438   2e-151   Pinus radiata
gb|ABK22164.1|  unknown                                                 437   8e-151   Picea sitchensis
gb|AFD53035.1|  caffeoyl-CoA O-methyltransferase                        434   8e-150   Bambusa emeiensis
dbj|BAG71893.1|  caffeoyl CoA O-methyltransferase                       433   2e-149   Carthamus tinctorius
gb|ABO26812.1|  caffeoyl-CoA O-methyltransferase                        433   3e-149   Bambusa oldhamii
sp|Q9ZTT5.1|CAMT_PINTA  RecName: Full=Caffeoyl-CoA O-methyltransf...    432   9e-149   Pinus taeda
ref|XP_009413345.1|  PREDICTED: caffeoyl-CoA O-methyltransferase ...    432   1e-148   
dbj|BAK01687.1|  predicted protein                                      430   5e-148   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EPS69718.1|  hypothetical protein M569_05045                         427   4e-147   Genlisea aurea
ref|NP_001056910.1|  Os06g0165800                                       427   7e-147   
sp|Q9SLP8.1|CAMT_CITNA  RecName: Full=Caffeoyl-CoA O-methyltransf...    426   9e-147   Citrus natsudaidai
gb|EAY99818.1|  hypothetical protein OsI_21809                          427   1e-146   Oryza sativa Indica Group [Indian rice]
ref|XP_006655824.1|  PREDICTED: caffeoyl-CoA O-methyltransferase ...    426   1e-146   Oryza brachyantha
gb|AIN39535.1|  caffeoyl-CoA-3-O-methyl transferase                     426   4e-146   Cenchrus purpureus [elephant grass]
gb|ABM79759.1|  caffeoyl-CoA O-methyltransferase                        422   1e-145   Vitis vinifera
gb|ABQ45355.1|  caffeoyl-CoA 3-O-methyltransferase                      419   2e-144   Amorpha fruticosa [bastard indigo]
gb|ACX37697.1|  caffeoyl-CoA O-methyltransferase 1                      417   2e-143   Eucalyptus camaldulensis
gb|AAP37885.1|  caffeoyl CoA 3-O-methyltransferase                      416   3e-142   Zea mays [maize]
gb|AAP37884.1|  caffeoyl CoA 3-O-methyltransferase                      415   4e-142   Zea mays [maize]
sp|Q9XGD5.1|CAMT2_MAIZE  RecName: Full=Caffeoyl-CoA O-methyltrans...    415   6e-142   Zea mays [maize]
gb|EMS59880.1|  Caffeoyl-CoA O-methyltransferase 2                      415   8e-142   Triticum urartu
gb|KHN42093.1|  Caffeoyl-CoA O-methyltransferase 2                      413   1e-141   Glycine soja [wild soybean]
gb|KHN36241.1|  Caffeoyl-CoA O-methyltransferase 2                      413   2e-141   Glycine soja [wild soybean]
gb|AAP37876.1|  caffeoyl CoA 3-O-methyltransferase                      413   2e-141   Zea mays [maize]
gb|AAP37881.1|  caffeoyl CoA 3-O-methyltransferase                      413   2e-141   Zea mays [maize]
gb|AAP37882.1|  caffeoyl CoA 3-O-methyltransferase                      413   3e-141   Zea mays [maize]
gb|AAP37879.1|  caffeoyl CoA 3-O-methyltransferase                      413   3e-141   Zea mays [maize]
gb|AAP37878.1|  caffeoyl CoA 3-O-methyltransferase                      413   3e-141   Zea mays [maize]
gb|ACF79629.1|  unknown                                                 417   5e-141   Zea mays [maize]
ref|XP_007156786.1|  hypothetical protein PHAVU_002G017500g             411   9e-141   Phaseolus vulgaris [French bean]
ref|XP_002523618.1|  o-methyltransferase, putative                      413   1e-140   
ref|XP_003564267.1|  PREDICTED: caffeoyl-CoA O-methyltransferase 1      411   1e-140   Brachypodium distachyon [annual false brome]
dbj|BAO20881.1|  caffeoyl CoA O-methyltransferase 1                     410   2e-140   Panicum virgatum
gb|AAP33129.1|  caffeoyl CoA 3-O-methyltransferase                      410   3e-140   Zea mays [maize]
ref|XP_009764364.1|  PREDICTED: caffeoyl-CoA O-methyltransferase ...    409   3e-140   Nicotiana sylvestris
ref|XP_002436550.1|  hypothetical protein SORBIDRAFT_10g004540          408   2e-139   Sorghum bicolor [broomcorn]
gb|AHX74224.1|  caffeoyl-CoA O-methyltransferase                        408   2e-139   
ref|XP_012079577.1|  PREDICTED: caffeoyl-CoA O-methyltransferase ...    408   3e-139   Jatropha curcas
gb|AFY17068.1|  caffeoyl-coenzymeA O-methyltransferase 1b               407   5e-139   Panicum virgatum
sp|Q9XGD6.1|CAMT1_MAIZE  RecName: Full=Caffeoyl-CoA O-methyltrans...    406   9e-139   Zea mays [maize]
gb|ACG38343.1|  caffeoyl-CoA O-methyltransferase 1                      407   9e-139   Zea mays [maize]
gb|AAQ89900.1|  caffeoyl-CoA 3-O-methyltransferase 1                    406   1e-138   Zea mays [maize]
gb|AEJ83060.1|  caffeoyl CoA 3-O-methyltransferase                      403   1e-137   Miscanthus lutarioriparius
gb|ACY66930.1|  caffeoyl-CoA O-methyltransferase 1                      401   3e-137   Eucalyptus camaldulensis
gb|ABC42571.1|  caffeoyl-CoA 3-O-methyltransferase                      396   1e-135   Leucaena leucocephala [cassie]
ref|XP_009418796.1|  PREDICTED: caffeoyl-CoA O-methyltransferase ...    392   2e-133   Musa acuminata subsp. malaccensis [pisang utan]
gb|ACL54796.1|  unknown                                                 394   2e-133   Zea mays [maize]
gb|ABR16981.1|  unknown                                                 392   3e-133   Picea sitchensis
gb|KJB32361.1|  hypothetical protein B456_005G237100                    391   6e-133   Gossypium raimondii
gb|EMT14560.1|  Caffeoyl-CoA O-methyltransferase 2                      391   8e-133   
ref|XP_009784106.1|  PREDICTED: caffeoyl-CoA O-methyltransferase ...    387   6e-132   Nicotiana sylvestris
ref|XP_002523620.1|  o-methyltransferase, putative                      387   2e-131   
ref|XP_006466586.1|  PREDICTED: caffeoyl-CoA O-methyltransferase-...    384   3e-130   Citrus sinensis [apfelsine]
ref|XP_002963752.1|  hypothetical protein SELMODRAFT_266699             385   1e-129   Selaginella moellendorffii
gb|KDP31955.1|  hypothetical protein JCGZ_12416                         382   1e-129   Jatropha curcas
ref|XP_002974834.1|  hypothetical protein SELMODRAFT_101771             383   3e-129   
ref|XP_002987152.1|  hypothetical protein SELMODRAFT_158563             381   9e-129   Selaginella moellendorffii
ref|XP_002976256.1|  hypothetical protein SELMODRAFT_271191             380   1e-128   Selaginella moellendorffii
gb|ABB04868.1|  caffeoyl-CoA O-methyltransferase                        379   2e-128   Leucaena leucocephala [cassie]
ref|XP_006427260.1|  hypothetical protein CICLE_v10026347mg             379   2e-128   Citrus clementina [clementine]
gb|AEW26101.1|  caffeoyl-CoA 3-o-methyltransferase                      377   5e-128   Medicago falcata [sickle alfalfa]
ref|XP_006465346.1|  PREDICTED: caffeoyl-CoA O-methyltransferase-...    378   1e-127   Citrus sinensis [apfelsine]
ref|XP_006428886.1|  hypothetical protein CICLE_v10012561mg             378   1e-127   Citrus clementina [clementine]
ref|XP_006480587.1|  PREDICTED: caffeoyl-CoA O-methyltransferase-...    377   1e-127   Citrus sinensis [apfelsine]
ref|XP_006425921.1|  hypothetical protein CICLE_v10026344mg             376   6e-127   Citrus clementina [clementine]
ref|XP_010928606.1|  PREDICTED: caffeoyl-CoA O-methyltransferase-...    375   1e-126   Elaeis guineensis
gb|AGV54319.1|  caffeoyl CoA O-methyltransferase                        375   1e-126   Phaseolus vulgaris [French bean]
gb|AAU95084.1|  caffeoyl-CoA 3-0-methyltransferase                      372   5e-126   Apium graveolens Dulce Group [celery]
ref|XP_007155910.1|  hypothetical protein PHAVU_003G242400g             373   8e-126   Phaseolus vulgaris [French bean]
gb|ACJ84250.1|  unknown                                                 372   2e-125   Medicago truncatula
ref|NP_001242163.1|  uncharacterized protein LOC100799303               370   7e-125   
gb|AFK40182.1|  unknown                                                 370   9e-125   Medicago truncatula
ref|NP_001236240.1|  uncharacterized protein LOC100305498               370   2e-124   Glycine max [soybeans]
gb|AAQ89932.1|  caffeoyl-CoA 3-O-methyltransferase 1                    369   3e-124   Zea mays [maize]
gb|AAQ89929.1|  caffeoyl-CoA 3-O-methyltransferase 1                    368   5e-124   Zea mays [maize]
gb|KJB47338.1|  hypothetical protein B456_008G024000                    365   4e-123   Gossypium raimondii
gb|ABK23571.1|  unknown                                                 361   2e-121   Picea sitchensis
ref|XP_008793869.1|  PREDICTED: caffeoyl-CoA O-methyltransferase-...    361   3e-121   Phoenix dactylifera
ref|XP_006422983.1|  hypothetical protein CICLE_v10029158mg             358   6e-121   
emb|CAA04769.1|  caffeoyl-CoA 3-O-methyltransferase                     358   9e-121   Fragaria vesca [alpine strawberry]
ref|XP_006425919.1|  hypothetical protein CICLE_v10026344mg             358   6e-120   
gb|KCW55184.1|  hypothetical protein EUGRSUZ_I01134                     355   1e-119   Eucalyptus grandis [rose gum]
ref|XP_009414015.1|  PREDICTED: caffeoyl-CoA O-methyltransferase-...    354   2e-118   
gb|ADE77434.1|  unknown                                                 354   3e-118   Picea sitchensis
gb|AFS33547.1|  caffeoyl-CoA O-methyltransferase                        350   8e-118   Nicotiana tabacum [American tobacco]
gb|AFW85673.1|  hypothetical protein ZEAMMB73_482080                    351   1e-117   
emb|CAA10217.1|  caffeoyl-CoA 3-O-methyltransferase                     349   2e-117   Populus trichocarpa [western balsam poplar]
gb|ABK23448.1|  unknown                                                 349   1e-116   Picea sitchensis
ref|XP_009413347.1|  PREDICTED: caffeoyl-CoA O-methyltransferase ...    344   4e-115   
gb|AAD50442.1|AF168779_1  caffeoyl-CoA O-methyltransferase              342   1e-114   Eucalyptus globulus [blue gum]
gb|KEH31482.1|  caffeoyl-CoA 3-O-methyltransferase                      342   7e-114   Medicago truncatula
gb|KEH31473.1|  caffeoyl-CoA 3-O-methyltransferase                      339   2e-112   Medicago truncatula
gb|AAD50441.1|AF168778_1  caffeoyl-CoA O-methyltransferase              335   6e-112   Eucalyptus globulus [blue gum]
ref|XP_001755011.1|  predicted protein                                  337   1e-111   
gb|KEH31446.1|  caffeoyl-CoA 3-O-methyltransferase                      331   2e-109   Medicago truncatula
gb|AFK39179.1|  unknown                                                 329   1e-108   Medicago truncatula
gb|AEW26143.1|  caffeoyl-CoA 3-o-methyltransferase                      326   2e-108   Medicago falcata [sickle alfalfa]
gb|AFK31247.1|  caffeoyl-CoA O-methyltransferase                        324   1e-107   Oryza sativa Indica Group [Indian rice]
gb|AEW26090.1|  caffeoyl-CoA 3-o-methyltransferase                      324   1e-107   Medicago sativa subsp. caerulea
gb|AFX98064.1|  caffeoyl-CoA O-methyltransferase                        326   2e-107   Cunninghamia lanceolata [China fir]
ref|XP_009386481.1|  PREDICTED: caffeoyl-CoA O-methyltransferase-...    325   5e-107   Musa acuminata subsp. malaccensis [pisang utan]
gb|AFK31265.1|  caffeoyl-CoA O-methyltransferase                        322   8e-107   Oryza rufipogon [common wild rice]
gb|AFK31263.1|  caffeoyl-CoA O-methyltransferase                        322   1e-106   Oryza sativa Japonica Group [Japonica rice]
gb|AFK31258.1|  caffeoyl-CoA O-methyltransferase                        322   1e-106   Oryza sativa Japonica Group [Japonica rice]
gb|AFK31250.1|  caffeoyl-CoA O-methyltransferase                        320   4e-106   Oryza sativa Indica Group [Indian rice]
gb|AFK31264.1|  caffeoyl-CoA O-methyltransferase                        320   6e-106   
gb|AAV68503.1|  putative caffeoyl-CoA 3-O-methyltransferase             318   2e-105   
gb|ADC84472.1|  caffeoyl CoA O-methyltransferase                        317   7e-105   
gb|KDO55251.1|  hypothetical protein CISIN_1g029536mg                   317   1e-104   
ref|XP_006427259.1|  hypothetical protein CICLE_v10026347mg             317   2e-104   
gb|AAV65754.1|  caffeoyl-CoA O-methyltransferase                        315   3e-104   
ref|XP_009391260.1|  PREDICTED: caffeoyl-CoA O-methyltransferase-...    318   3e-104   
gb|AAV80200.1|  caffeoyl-CoA 3-O-methyltransferase                      314   5e-104   
gb|AAV80203.1|  caffeoyl-CoA 3-O-methyltransferase                      314   6e-104   
gb|ADC84473.1|  caffeoyl CoA O-methyltransferase                        313   1e-103   
gb|AAV80199.1|  caffeoyl-CoA 3-O-methyltransferase                      311   6e-103   
ref|XP_009386482.1|  PREDICTED: caffeoyl-CoA O-methyltransferase-...    314   8e-103   
gb|KDO55250.1|  hypothetical protein CISIN_1g029536mg                   311   2e-102   
ref|XP_006425920.1|  hypothetical protein CICLE_v10026344mg             308   2e-101   
gb|AID69228.1|  caffeoyl CoA O-methyltransferase                        306   8e-101   
ref|XP_006853991.2|  PREDICTED: caffeoyl-CoA O-methyltransferase ...    308   1e-100   
ref|XP_009794693.1|  PREDICTED: caffeoyl-CoA O-methyltransferase ...    305   3e-100   
ref|XP_008780757.1|  PREDICTED: caffeoyl-CoA O-methyltransferase 1      298   2e-97    
ref|XP_011626877.1|  PREDICTED: caffeoyl-CoA O-methyltransferase ...    298   9e-97    
ref|XP_002279936.1|  PREDICTED: probable caffeoyl-CoA O-methyltra...    297   4e-96    
emb|CBI27951.3|  unnamed protein product                                299   4e-96    
ref|XP_004973808.1|  PREDICTED: tricin synthase 1-like                  297   6e-96    
ref|XP_010905196.1|  PREDICTED: caffeoyl-CoA O-methyltransferase-...    296   6e-96    
dbj|BAK74805.1|  hypothetical protein                                   296   1e-95    
ref|XP_006475391.1|  PREDICTED: probable caffeoyl-CoA O-methyltra...    296   1e-95    
emb|CAN62003.1|  hypothetical protein VITISV_007881                     297   2e-95    
ref|XP_002275207.1|  PREDICTED: probable caffeoyl-CoA O-methyltra...    295   2e-95    
emb|CBI21900.3|  unnamed protein product                                297   3e-95    
emb|CAJ43710.1|  caffeoyl-CoA O-methyltransferase                       291   3e-95    
ref|XP_006451397.1|  hypothetical protein CICLE_v10009335mg             294   7e-95    
ref|XP_002514166.1|  o-methyltransferase, putative                      293   7e-95    
gb|KHG02594.1|  hypothetical protein F383_24485                         293   1e-94    
ref|XP_002462549.1|  hypothetical protein SORBIDRAFT_02g027930          293   2e-94    
gb|KJB27192.1|  hypothetical protein B456_004G283700                    292   3e-94    
gb|KDO59273.1|  hypothetical protein CISIN_1g026457mg                   292   3e-94    
ref|XP_008387602.1|  PREDICTED: probable caffeoyl-CoA O-methyltra...    292   4e-94    
ref|XP_010656230.1|  PREDICTED: probable caffeoyl-CoA O-methyltra...    291   7e-94    
ref|XP_011626875.1|  PREDICTED: probable caffeoyl-CoA O-methyltra...    291   7e-94    
ref|XP_008362967.1|  PREDICTED: probable caffeoyl-CoA O-methyltra...    291   8e-94    
ref|XP_002444818.1|  hypothetical protein SORBIDRAFT_07g028530          291   9e-94    
ref|XP_006413213.1|  hypothetical protein EUTSA_v10026121mg             290   1e-93    
dbj|BAO20882.1|  caffeoyl CoA O-methyltransferase 2                     290   2e-93    
ref|XP_011077939.1|  PREDICTED: probable caffeoyl-CoA O-methyltra...    290   2e-93    
ref|XP_008344013.1|  PREDICTED: probable caffeoyl-CoA O-methyltra...    289   3e-93    
ref|XP_012076799.1|  PREDICTED: probable caffeoyl-CoA O-methyltra...    290   3e-93    
ref|XP_011077938.1|  PREDICTED: probable caffeoyl-CoA O-methyltra...    289   6e-93    
ref|XP_009598639.1|  PREDICTED: probable caffeoyl-CoA O-methyltra...    289   6e-93    
ref|XP_010656228.1|  PREDICTED: probable caffeoyl-CoA O-methyltra...    290   6e-93    
ref|XP_011626891.1|  PREDICTED: probable caffeoyl-CoA O-methyltra...    290   7e-93    
ref|XP_010656229.1|  PREDICTED: probable caffeoyl-CoA O-methyltra...    290   7e-93    
ref|XP_009786206.1|  PREDICTED: probable caffeoyl-CoA O-methyltra...    290   8e-93    
ref|XP_004287520.1|  PREDICTED: probable caffeoyl-CoA O-methyltra...    290   9e-93    
gb|KEH31483.1|  caffeoyl-CoA 3-O-methyltransferase                      287   1e-92    
ref|NP_001152511.1|  caffeoyl-CoA O-methyltransferase 1                 288   1e-92    
ref|XP_008337635.1|  PREDICTED: probable caffeoyl-CoA O-methyltra...    288   1e-92    
ref|XP_002869621.1|  hypothetical protein ARALYDRAFT_913940             288   2e-92    
ref|XP_010047610.1|  PREDICTED: probable caffeoyl-CoA O-methyltra...    287   2e-92    
ref|XP_006451395.1|  hypothetical protein CICLE_v10009342mg             287   3e-92    
ref|XP_006660250.1|  PREDICTED: LOW QUALITY PROTEIN: tricin synth...    290   5e-92    
ref|XP_008337636.1|  PREDICTED: probable caffeoyl-CoA O-methyltra...    286   7e-92    
ref|XP_003574709.1|  PREDICTED: tricin synthase 1-like                  286   9e-92    
gb|ABN09208.1|  caffeoyl-CoA 3-O-methyltransferase                      283   9e-92    
ref|XP_008242438.1|  PREDICTED: probable caffeoyl-CoA O-methyltra...    286   1e-91    
ref|XP_004957144.1|  PREDICTED: caffeoyl-CoA O-methyltransferase-...    286   1e-91    
ref|XP_009780390.1|  PREDICTED: probable caffeoyl-CoA O-methyltra...    285   1e-91    
ref|XP_004237700.1|  PREDICTED: probable caffeoyl-CoA O-methyltra...    287   1e-91    
ref|XP_010438785.1|  PREDICTED: probable caffeoyl-CoA O-methyltra...    285   1e-91    
ref|XP_004237699.1|  PREDICTED: probable caffeoyl-CoA O-methyltra...    287   1e-91    
ref|XP_007012915.1|  S-adenosyl-L-methionine-dependent methyltran...    285   2e-91    
ref|XP_008242435.1|  PREDICTED: probable caffeoyl-CoA O-methyltra...    285   2e-91    
ref|XP_004287517.1|  PREDICTED: probable caffeoyl-CoA O-methyltra...    285   2e-91    
ref|XP_008811374.1|  PREDICTED: caffeoyl-CoA O-methyltransferase-...    285   2e-91    
ref|XP_010905194.1|  PREDICTED: caffeoyl-CoA O-methyltransferase-...    285   2e-91    
ref|XP_010536849.1|  PREDICTED: probable caffeoyl-CoA O-methyltra...    285   2e-91    
ref|XP_010047614.1|  PREDICTED: probable caffeoyl-CoA O-methyltra...    285   3e-91    
ref|XP_010536850.1|  PREDICTED: probable caffeoyl-CoA O-methyltra...    284   4e-91    
ref|XP_009142090.1|  PREDICTED: probable caffeoyl-CoA O-methyltra...    285   4e-91    
ref|XP_010047611.1|  PREDICTED: probable caffeoyl-CoA O-methyltra...    284   5e-91    
ref|XP_007202498.1|  hypothetical protein PRUPE_ppa010674mg             283   7e-91    
emb|CDX89352.1|  BnaA01g15410D                                          288   9e-91    
ref|XP_009619045.1|  PREDICTED: probable caffeoyl-CoA O-methyltra...    285   1e-90    
ref|XP_004973810.1|  PREDICTED: tricin synthase 2-like isoform X1       285   1e-90    
ref|XP_009619044.1|  PREDICTED: probable caffeoyl-CoA O-methyltra...    285   2e-90    
emb|CDX94354.1|  BnaC01g18300D                                          283   2e-90    
ref|XP_010448306.1|  PREDICTED: probable caffeoyl-CoA O-methyltra...    282   3e-90    
ref|NP_567739.1|  putative caffeoyl-CoA O-methyltransferase             281   4e-90    
ref|XP_006282704.1|  hypothetical protein CARUB_v10005649mg             281   4e-90    
ref|XP_011459652.1|  PREDICTED: probable caffeoyl-CoA O-methyltra...    283   4e-90    
ref|XP_002514167.1|  o-methyltransferase, putative                      281   4e-90    
emb|CDY60872.1|  BnaC03g77610D                                          281   5e-90    
dbj|BAK74804.1|  anthocyanin O-methyltransferase                        281   7e-90    
ref|XP_007012916.1|  S-adenosyl-L-methionine-dependent methyltran...    280   1e-89    
ref|XP_006343340.1|  PREDICTED: probable caffeoyl-CoA O-methyltra...    280   1e-89    
ref|XP_006371951.1|  hypothetical protein POPTR_0018s06630g             280   1e-89    
gb|ERN15454.1|  hypothetical protein AMTR_s00036p00228690               280   1e-89    
gb|AGQ21571.1|  cation-dependent phenylpropanoid and flavonoid O-...    280   1e-89    
emb|CDP03202.1|  unnamed protein product                                280   2e-89    
ref|XP_004300604.1|  PREDICTED: probable caffeoyl-CoA O-methyltra...    280   2e-89    
gb|AFK39727.1|  unknown                                                 280   2e-89    
ref|XP_006659540.1|  PREDICTED: tricin synthase 1-like                  280   2e-89    
ref|XP_004973812.1|  PREDICTED: tricin synthase 2-like isoform X3       281   2e-89    
ref|XP_009142098.1|  PREDICTED: probable caffeoyl-CoA O-methyltra...    280   3e-89    
gb|AIE77045.1|  anthocyanin methyltransferase                           279   3e-89    
ref|XP_004973811.1|  PREDICTED: tricin synthase 2-like isoform X2       281   3e-89    
ref|NP_001062142.1|  Os08g0498100                                       280   4e-89    
tpg|DAA40360.1|  TPA: caffeoyl-CoA O-methyltransferase 1                281   4e-89    
ref|XP_008387566.1|  PREDICTED: probable caffeoyl-CoA O-methyltra...    279   4e-89    
gb|AIE77044.1|  anthocyanin methyltransferase                           279   5e-89    
pdb|3C3Y|A  Chain A, Crystal Structure Of Pfomt, Phenylpropanoid ...    279   6e-89    
ref|XP_004234518.1|  PREDICTED: probable caffeoyl-CoA O-methyltra...    278   6e-89    
gb|AIL54541.1|  norbelladine 4'-O-methyltransferase                     278   7e-89    
ref|XP_010050460.1|  PREDICTED: probable caffeoyl-CoA O-methyltra...    278   1e-88    
gb|ACG36166.1|  caffeoyl-CoA O-methyltransferase 1                      278   1e-88    
gb|EYU36922.1|  hypothetical protein MIMGU_mgv1a012975mg                278   1e-88    
dbj|BAK74803.1|  hypothetical protein                                   277   2e-88    
gb|AIE77047.1|  anthocyanin methyltransferase                           277   2e-88    
gb|AIE77048.1|  anthocyanin methyltransferase                           277   2e-88    
ref|XP_006660748.1|  PREDICTED: caffeoyl-CoA O-methyltransferase-...    277   2e-88    
ref|NP_001062144.1|  Os08g0498600                                       277   3e-88    
gb|AIE77050.1|  anthocyanin methyltransferase                           277   3e-88    
ref|XP_011008887.1|  PREDICTED: probable caffeoyl-CoA O-methyltra...    277   3e-88    
gb|AIL54542.1|  norbelladine 4'-O-methyltransferase                     277   3e-88    
ref|XP_003532460.1|  PREDICTED: probable caffeoyl-CoA O-methyltra...    276   4e-88    
ref|XP_004503528.1|  PREDICTED: probable caffeoyl-CoA O-methyltra...    276   4e-88    
ref|XP_004509130.1|  PREDICTED: caffeoyl-CoA O-methyltransferase ...    275   4e-88    
emb|CAJ26379.1|  putative caffeoyl-CoA O-methyltransferase              276   5e-88    
ref|XP_004973809.1|  PREDICTED: tricin synthase 1-like                  276   5e-88    
ref|XP_010433534.1|  PREDICTED: probable caffeoyl-CoA O-methyltra...    276   5e-88    
gb|AAM64800.1|  caffeoyl-CoA O-methyltransferase-like protein           276   6e-88    
gb|EYU36932.1|  hypothetical protein MIMGU_mgv1a012974mg                276   7e-88    
gb|AIE77049.1|  anthocyanin methyltransferase                           276   7e-88    
ref|NP_001274974.1|  flavonoid 3',5'-methyltransferase-like             276   8e-88    
gb|AFW65160.1|  caffeoyl-CoA O-methyltransferase 1                      277   8e-88    
gb|AIL54545.1|  norbelladine 4'-O-methyltransferase                     276   8e-88    
gb|EYU42096.1|  hypothetical protein MIMGU_mgv1a012979mg                275   9e-88    
ref|XP_007012912.1|  S-adenosyl-L-methionine-dependent methyltran...    276   1e-87    
ref|XP_006363473.1|  PREDICTED: flavonoid 3',5'-methyltransferase...    275   1e-87    
ref|XP_011077954.1|  PREDICTED: probable caffeoyl-CoA O-methyltra...    275   1e-87    
gb|KEH31472.1|  caffeoyl-CoA 3-O-methyltransferase                      273   1e-87    
gb|AIE77046.1|  anthocyanin methyltransferase                           275   1e-87    
gb|AIL54544.1|  norbelladine 4'-O-methyltransferase                     275   2e-87    
ref|NP_001289828.1|  flavonoid 3',5'-methyltransferase                  275   2e-87    
ref|XP_003574707.1|  PREDICTED: tricin synthase 2-like                  275   2e-87    
ref|NP_001152451.1|  LOC100286091                                       275   2e-87    
gb|KJB47340.1|  hypothetical protein B456_008G024000                    275   3e-87    
gb|AFK47350.1|  unknown                                                 274   4e-87    
ref|XP_011071221.1|  PREDICTED: flavonoid 3',5'-methyltransferase...    274   4e-87    
ref|XP_010317684.1|  PREDICTED: probable caffeoyl-CoA O-methyltra...    273   5e-87    
ref|XP_004288912.1|  PREDICTED: probable caffeoyl-CoA O-methyltra...    273   6e-87    
dbj|BAK01719.1|  predicted protein                                      274   7e-87    
gb|KJB65098.1|  hypothetical protein B456_010G081000                    275   8e-87    
gb|AEW26110.1|  caffeoyl-CoA 3-o-methyltransferase                      269   1e-86    
emb|CAB38951.1|  caffeoyl-CoA O-methyltransferase-like protein          273   1e-86    
ref|XP_011086775.1|  PREDICTED: flavonoid 3',5'-methyltransferase...    272   1e-86    
ref|XP_011086776.1|  PREDICTED: flavonoid 3',5'-methyltransferase...    272   1e-86    
dbj|BAJ99310.1|  predicted protein                                      274   1e-86    
ref|XP_010655817.1|  PREDICTED: flavonoid 3',5'-methyltransferase...    272   2e-86    
gb|ACB45436.1|  caffeoyl-coenzyme A 3-O-methyltransferase               269   2e-86    
gb|ADX42663.1|  caffeoyl-CoA O-methyltransferase 1                      269   2e-86    
dbj|BAJ90386.1|  predicted protein                                      272   2e-86    
ref|XP_007012914.1|  S-adenosyl-L-methionine-dependent methyltran...    273   2e-86    
gb|EYU42680.1|  hypothetical protein MIMGU_mgv1a020383mg                268   3e-86    
gb|AIL54543.1|  norbelladine 4'-O-methyltransferase                     271   3e-86    
gb|EYU18063.1|  hypothetical protein MIMGU_mgv1a022049mg                270   9e-86    
gb|EYU25907.1|  hypothetical protein MIMGU_mgv1a012985mg                270   9e-86    
gb|EYU30663.1|  hypothetical protein MIMGU_mgv1a012878mg                270   1e-85    
ref|NP_001063495.1|  Os09g0481400                                       271   1e-85    
gb|EAZ09516.1|  hypothetical protein OsI_31791                          271   2e-85    
ref|XP_009780087.1|  PREDICTED: probable caffeoyl-CoA O-methyltra...    270   2e-85    
gb|AFY17069.1|  caffeoyl-coenzymeA O-methyltransferase 2b               270   2e-85    
ref|XP_010025314.1|  PREDICTED: flavonoid 3',5'-methyltransferase...    269   2e-85    
gb|KHM99836.1|  Putative caffeoyl-CoA O-methyltransferase               270   3e-85    
gb|ACU23135.1|  unknown                                                 268   4e-85    
gb|KHN16673.1|  Putative caffeoyl-CoA O-methyltransferase               274   4e-85    
ref|NP_001242455.1|  probable caffeoyl-CoA O-methyltransferase At...    269   4e-85    
ref|XP_004287518.1|  PREDICTED: probable caffeoyl-CoA O-methyltra...    268   5e-85    
ref|XP_003607928.1|  Caffeoyl-CoA O-methyltransferase                   265   7e-85    
gb|AAN78178.1|  caffeoyl CoA 3-O-methyltransferase                      264   1e-84    
ref|XP_010682786.1|  PREDICTED: flavonoid 3',5'-methyltransferase...    268   1e-84    
ref|XP_010666836.1|  PREDICTED: caffeoyl-CoA O-methyltransferase-...    268   1e-84    
ref|NP_001062143.1|  Os08g0498400                                       270   1e-84    
gb|EPS69869.1|  hypothetical protein M569_04894                         264   1e-84    
ref|XP_009604811.1|  PREDICTED: probable caffeoyl-CoA O-methyltra...    267   1e-84    
dbj|BAK07710.1|  predicted protein                                      267   2e-84    
ref|XP_003578304.1|  PREDICTED: probable caffeoyl-CoA O-methyltra...    267   2e-84    
ref|XP_010929781.1|  PREDICTED: flavonoid 3',5'-methyltransferase...    266   2e-84    
ref|XP_003530533.1|  PREDICTED: probable caffeoyl-CoA O-methyltra...    266   3e-84    
sp|C7AE94.1|FAOMT_VITVI  RecName: Full=Flavonoid 3',5'-methyltran...    266   3e-84    
gb|ADA72016.1|  anthocyanin-O-methyltransferase                         266   3e-84    
dbj|BAP74301.1|  S-adenosylmethionine: anthocyanin 3'5'-methyltra...    266   4e-84    
sp|Q43161.1|CAMT_STELP  RecName: Full=Caffeoyl-CoA O-methyltransf...    266   6e-84    
dbj|BAD06321.1|  putative caffeoyl CoA O-methyltransferase              266   7e-84    
gb|AFK36713.1|  unknown                                                 263   8e-84    
ref|XP_008344119.1|  PREDICTED: probable caffeoyl-CoA O-methyltra...    269   1e-83    
gb|EMT01826.1|  Putative caffeoyl-CoA O-methyltransferase               266   1e-83    
gb|EPS61348.1|  hypothetical protein M569_13448                         265   1e-83    
ref|XP_003574706.1|  PREDICTED: tricin synthase 1-like                  265   2e-83    
ref|XP_008781889.1|  PREDICTED: caffeoyl-CoA O-methyltransferase-...    265   2e-83    
ref|NP_001290011.1|  flavonoid 3',5'-methyltransferase                  265   2e-83    
ref|XP_004299737.1|  PREDICTED: flavonoid 3',5'-methyltransferase...    265   2e-83    
ref|XP_004310213.1|  PREDICTED: flavonoid 3',5'-methyltransferase...    265   2e-83    
gb|EAZ43214.1|  hypothetical protein OsJ_27813                          265   3e-83    
gb|EMS62351.1|  Caffeoyl-CoA O-methyltransferase 2                      265   3e-83    
gb|EYU25908.1|  hypothetical protein MIMGU_mgv1a012985mg                263   4e-83    
ref|XP_003517937.1|  PREDICTED: probable caffeoyl-CoA O-methyltra...    263   4e-83    
gb|ACU19602.1|  unknown                                                 263   5e-83    
emb|CAJ43712.1|  caffeoyl-CoA O-methyltransferase                       264   6e-83    
ref|XP_007160247.1|  hypothetical protein PHAVU_002G305200g             263   6e-83    
ref|XP_008781890.1|  PREDICTED: caffeoyl-CoA O-methyltransferase-...    263   8e-83    
ref|XP_010027275.1|  PREDICTED: flavonoid 3',5'-methyltransferase...    263   9e-83    
ref|XP_011459662.1|  PREDICTED: probable caffeoyl-CoA O-methyltra...    262   1e-82    
ref|XP_002888647.1|  hypothetical protein ARALYDRAFT_475925             262   2e-82    
ref|XP_010929792.1|  PREDICTED: caffeoyl-CoA O-methyltransferase-...    266   2e-82    
ref|XP_008811373.1|  PREDICTED: caffeoyl-CoA O-methyltransferase-...    261   2e-82    
ref|XP_002278678.2|  PREDICTED: flavonoid 3',5'-methyltransferase...    261   3e-82    
gb|KCW61961.1|  hypothetical protein EUGRSUZ_H04650                     261   3e-82    
ref|NP_564916.2|  caffeoyl-CoA 3-O-methyltransferase                    261   4e-82    
emb|CBI27643.3|  unnamed protein product                                261   4e-82    
ref|XP_006362714.1|  PREDICTED: caffeoyl-CoA O-methyltransferase ...    258   7e-82    
ref|XP_008389853.1|  PREDICTED: flavonoid 3',5'-methyltransferase...    260   9e-82    
emb|CAN75051.1|  hypothetical protein VITISV_020117                     282   1e-81    



>ref|XP_009776913.1| PREDICTED: caffeoyl-CoA O-methyltransferase 5 [Nicotiana sylvestris]
Length=240

 Score =   468 bits (1205),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 223/241 (93%), Positives = 236/241 (98%), Gaps = 1/241 (0%)
 Frame = +3

Query  81   MAENQTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSAD  260
            MAEN   +HQEVGHKSLLQSDALYQYILETSVYPREPE+MKELREVTAKHPWNLMTTSAD
Sbjct  1    MAEN-GIKHQEVGHKSLLQSDALYQYILETSVYPREPESMKELREVTAKHPWNLMTTSAD  59

Query  261  EGQFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEK  440
            EGQFL+MLLKLINAKNTMEIGVYTGYSLLATALA+PDDGKILAMDINRENYE+GLP+IEK
Sbjct  60   EGQFLNMLLKLINAKNTMEIGVYTGYSLLATALAIPDDGKILAMDINRENYEIGLPIIEK  119

Query  441  AGVAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVI  620
            AGVAHKI+FREGPALP+LDQLVED K HGTYDFIFVDADKDNY+NYHKR+IDLVKVGG+I
Sbjct  120  AGVAHKIEFREGPALPVLDQLVEDKKNHGTYDFIFVDADKDNYINYHKRIIDLVKVGGLI  179

Query  621  GYDNTLWNGSVVAPPDAPMRKYIKYYRDFVLELNKALAVDPRIEICMLPVGDGITLCRRI  800
            GYDNTLWNGSVVAPPDAPMRKY++YYRDFVLELNKALAVDPRIEICMLPVGDGITLCRRI
Sbjct  180  GYDNTLWNGSVVAPPDAPMRKYVRYYRDFVLELNKALAVDPRIEICMLPVGDGITLCRRI  239

Query  801  S  803
            S
Sbjct  240  S  240



>gb|ACF17646.1| putative caffeoyl-CoA 3-O-methyltransferase [Capsicum annuum]
Length=247

 Score =   469 bits (1206),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 221/242 (91%), Positives = 233/242 (96%), Gaps = 0/242 (0%)
 Frame = +3

Query  78   AMAENQTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSA  257
            A  ENQ  +HQEVGHKSLLQSDALYQYILETSVYPREPE MKELRE+TAKHPWNLMTTSA
Sbjct  6    AAQENQVAKHQEVGHKSLLQSDALYQYILETSVYPREPEPMKELRELTAKHPWNLMTTSA  65

Query  258  DEGQFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIE  437
            DEGQFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDG+ILAMDINRENYELGLP+I+
Sbjct  66   DEGQFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGQILAMDINRENYELGLPIIQ  125

Query  438  KAGVAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGV  617
            KAGVAHKIDFREGPALP+LD+LVED   HGTYDFIFVDADKDNY+NYHKR+I+LVKVGGV
Sbjct  126  KAGVAHKIDFREGPALPVLDRLVEDKNNHGTYDFIFVDADKDNYINYHKRIIELVKVGGV  185

Query  618  IGYDNTLWNGSVVAPPDAPMRKYIKYYRDFVLELNKALAVDPRIEICMLPVGDGITLCRR  797
            IGYDNTLWNGSVVAPPDAPMRKY++YYRDFVLELNKALA DPRIEICMLPVGDGITLCRR
Sbjct  186  IGYDNTLWNGSVVAPPDAPMRKYVRYYRDFVLELNKALAADPRIEICMLPVGDGITLCRR  245

Query  798  IS  803
            IS
Sbjct  246  IS  247



>ref|XP_009600093.1| PREDICTED: caffeoyl-CoA O-methyltransferase 6 [Nicotiana tomentosiformis]
Length=247

 Score =   468 bits (1205),  Expect = 3e-163, Method: Compositional matrix adjust.
 Identities = 221/242 (91%), Positives = 233/242 (96%), Gaps = 0/242 (0%)
 Frame = +3

Query  78   AMAENQTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSA  257
            A  ENQ T+HQEVGHKSLLQSDALYQYILETSVYPREPE MKELRE+TAKHPWNLMTTSA
Sbjct  6    AAQENQVTKHQEVGHKSLLQSDALYQYILETSVYPREPEPMKELRELTAKHPWNLMTTSA  65

Query  258  DEGQFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIE  437
            DEGQFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDIN+ENYELGLPVI+
Sbjct  66   DEGQFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINKENYELGLPVIQ  125

Query  438  KAGVAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGV  617
            KAGVAHKIDFREGPALP+LD ++ED   HGTYDFIFVDADKDNY+NYHKR+I+LVKVGGV
Sbjct  126  KAGVAHKIDFREGPALPVLDLMIEDKNNHGTYDFIFVDADKDNYINYHKRIIELVKVGGV  185

Query  618  IGYDNTLWNGSVVAPPDAPMRKYIKYYRDFVLELNKALAVDPRIEICMLPVGDGITLCRR  797
            IGYDNTLWNGSVVAPPDAPMRKY++YYRDFVLELNKALA DPRIEICMLPVGDGITLCRR
Sbjct  186  IGYDNTLWNGSVVAPPDAPMRKYVRYYRDFVLELNKALAADPRIEICMLPVGDGITLCRR  245

Query  798  IS  803
            IS
Sbjct  246  IS  247



>ref|XP_009622008.1| PREDICTED: caffeoyl-CoA O-methyltransferase 5 [Nicotiana tomentosiformis]
 gb|AAB80931.1| caffeoyl-CoA 3-O-methyltransferase 5 [Nicotiana tabacum]
Length=240

 Score =   468 bits (1203),  Expect = 4e-163, Method: Compositional matrix adjust.
 Identities = 222/241 (92%), Positives = 236/241 (98%), Gaps = 1/241 (0%)
 Frame = +3

Query  81   MAENQTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSAD  260
            MAEN   +HQEVGHKSLLQSDALYQYILETSVYPREPE+MKELREVTAKHPWNLMTTSAD
Sbjct  1    MAEN-GIKHQEVGHKSLLQSDALYQYILETSVYPREPESMKELREVTAKHPWNLMTTSAD  59

Query  261  EGQFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEK  440
            EGQFL+MLLKLINAKNTMEIGVYTGYSLLATALA+PDDGKILAMDINRENYE+GLP+IEK
Sbjct  60   EGQFLNMLLKLINAKNTMEIGVYTGYSLLATALAIPDDGKILAMDINRENYEIGLPIIEK  119

Query  441  AGVAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVI  620
            AGVAHKI+FREGPALP+LDQLVED K HGTYDFIFVDADKDNY+NYHKR+IDLVKVGG+I
Sbjct  120  AGVAHKIEFREGPALPVLDQLVEDKKNHGTYDFIFVDADKDNYINYHKRIIDLVKVGGLI  179

Query  621  GYDNTLWNGSVVAPPDAPMRKYIKYYRDFVLELNKALAVDPRIEICMLPVGDGITLCRRI  800
            GYDNTLWNGSVVAPPDAPMRKY++YYRDFVLELNKALAVDPRIEICMLPVGDGITLCRRI
Sbjct  180  GYDNTLWNGSVVAPPDAPMRKYVRYYRDFVLELNKALAVDPRIEICMLPVGDGITLCRRI  239

Query  801  S  803
            +
Sbjct  240  T  240



>dbj|BAK74806.1| hypothetical protein [Cyclamen persicum x Cyclamen purpurascens]
Length=245

 Score =   468 bits (1203),  Expect = 5e-163, Method: Compositional matrix adjust.
 Identities = 219/239 (92%), Positives = 234/239 (98%), Gaps = 0/239 (0%)
 Frame = +3

Query  87   ENQTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEG  266
            ENQ+ RHQEVGHKSLLQ+DALYQYILETSVYPREPE+MKELREVTAKHPWN+MTTSADEG
Sbjct  7    ENQSLRHQEVGHKSLLQTDALYQYILETSVYPREPESMKELREVTAKHPWNIMTTSADEG  66

Query  267  QFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAG  446
            QFL+MLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINREN+ELGLP IEKAG
Sbjct  67   QFLNMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENFELGLPSIEKAG  126

Query  447  VAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIGY  626
            VAHKIDFREGPALP+LDQ++ED K HG++DFIFVDADKDNYLNYHKRLI+LVKVGGVIGY
Sbjct  127  VAHKIDFREGPALPVLDQMIEDGKYHGSFDFIFVDADKDNYLNYHKRLIELVKVGGVIGY  186

Query  627  DNTLWNGSVVAPPDAPMRKYIKYYRDFVLELNKALAVDPRIEICMLPVGDGITLCRRIS  803
            DNTLWNGSVVAPPDAPMRKY++YYRDFVLELNKALA DPRIEICMLPVGDGIT+CRRIS
Sbjct  187  DNTLWNGSVVAPPDAPMRKYVRYYRDFVLELNKALAADPRIEICMLPVGDGITVCRRIS  245



>ref|XP_010263488.1| PREDICTED: caffeoyl-CoA O-methyltransferase [Nelumbo nucifera]
Length=248

 Score =   467 bits (1201),  Expect = 1e-162, Method: Compositional matrix adjust.
 Identities = 220/248 (89%), Positives = 237/248 (96%), Gaps = 0/248 (0%)
 Frame = +3

Query  60   LAGKFKAMAENQTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWN  239
            +A K +    NQ  RHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELRE+TAKHPWN
Sbjct  1    MATKQEEQQNNQAGRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELRELTAKHPWN  60

Query  240  LMTTSADEGQFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYEL  419
            +MTTSADEGQFL+MLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYEL
Sbjct  61   IMTTSADEGQFLNMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYEL  120

Query  420  GLPVIEKAGVAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDL  599
            GLPVI+KAGVAHKIDFREGPALP+LDQ++ED K HG++DFIFVDADKDNYLNYHKRLI+L
Sbjct  121  GLPVIQKAGVAHKIDFREGPALPVLDQMIEDGKYHGSFDFIFVDADKDNYLNYHKRLIEL  180

Query  600  VKVGGVIGYDNTLWNGSVVAPPDAPMRKYIKYYRDFVLELNKALAVDPRIEICMLPVGDG  779
            VK+GG+IGYDNTLWNGSVVAPPDAP+RKY++YYRDFVLELNKALAVDPRIEIC LPVGDG
Sbjct  181  VKLGGLIGYDNTLWNGSVVAPPDAPLRKYVRYYRDFVLELNKALAVDPRIEICQLPVGDG  240

Query  780  ITLCRRIS  803
            ITLCRRIS
Sbjct  241  ITLCRRIS  248



>gb|AAW55668.1| caffeoyl CoA 3-O-methyltransferase [Betula platyphylla]
Length=247

 Score =   466 bits (1200),  Expect = 2e-162, Method: Compositional matrix adjust.
 Identities = 220/238 (92%), Positives = 232/238 (97%), Gaps = 0/238 (0%)
 Frame = +3

Query  87   ENQTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEG  266
            +NQ +RHQEVGHKSLLQSDALYQYILETSVYP+EPE MKELREVTAKHPWN+MTTSADEG
Sbjct  9    QNQVSRHQEVGHKSLLQSDALYQYILETSVYPKEPEPMKELREVTAKHPWNIMTTSADEG  68

Query  267  QFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAG  446
            QFL+MLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAG
Sbjct  69   QFLNMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAG  128

Query  447  VAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIGY  626
            VAHKIDFREGPALP+LDQL+ D K HG+YDFIFVDADKDNY+NYHKRLIDLVKVGGVIGY
Sbjct  129  VAHKIDFREGPALPLLDQLIADEKNHGSYDFIFVDADKDNYINYHKRLIDLVKVGGVIGY  188

Query  627  DNTLWNGSVVAPPDAPMRKYIKYYRDFVLELNKALAVDPRIEICMLPVGDGITLCRRI  800
            DNTLWNGSVVAPPDAP+RKY++YYRDFVLELNKALA DPRIEICMLPVGDGITLCRRI
Sbjct  189  DNTLWNGSVVAPPDAPLRKYVRYYRDFVLELNKALAADPRIEICMLPVGDGITLCRRI  246



>gb|AAT37172.1| caffeoyl-CoA-O-methyltransferase [Broussonetia papyrifera]
Length=247

 Score =   466 bits (1199),  Expect = 2e-162, Method: Compositional matrix adjust.
 Identities = 218/239 (91%), Positives = 234/239 (98%), Gaps = 0/239 (0%)
 Frame = +3

Query  87   ENQTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEG  266
            +N+  RHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELRE+TAKHPWN+MTTSADEG
Sbjct  9    QNEAGRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREITAKHPWNIMTTSADEG  68

Query  267  QFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAG  446
            QFL+MLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAG
Sbjct  69   QFLNMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAG  128

Query  447  VAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIGY  626
            VAHKIDFREGPALP+LDQ++ED K HG++DFIFVDADKDNYLNYHKRLI+LVKVGGVIGY
Sbjct  129  VAHKIDFREGPALPVLDQMIEDGKYHGSFDFIFVDADKDNYLNYHKRLIELVKVGGVIGY  188

Query  627  DNTLWNGSVVAPPDAPMRKYIKYYRDFVLELNKALAVDPRIEICMLPVGDGITLCRRIS  803
            DNTLWNGSVVAPPDAP+RKY++YYRDFVLELNKALA DPRIEICMLPVGDGIT+CRR+S
Sbjct  189  DNTLWNGSVVAPPDAPLRKYVRYYRDFVLELNKALAADPRIEICMLPVGDGITVCRRVS  247



>sp|O04899.1|CAMT5_TOBAC RecName: Full=Caffeoyl-CoA O-methyltransferase 5; AltName: Full=Trans-caffeoyl-CoA 
3-O-methyltransferase 5; Short=CCoAMT-5; 
Short=CCoAOMT-5 [Nicotiana tabacum]
 emb|CAB05369.1| caffeoyl-CoA O-methyltransferase 5 [Nicotiana tabacum]
Length=240

 Score =   466 bits (1198),  Expect = 2e-162, Method: Compositional matrix adjust.
 Identities = 221/241 (92%), Positives = 235/241 (98%), Gaps = 1/241 (0%)
 Frame = +3

Query  81   MAENQTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSAD  260
            MAEN   +HQEVGHKSLLQSDALYQYILETSVYPREPE+MKELREVTAKHPWNLMTTSAD
Sbjct  1    MAEN-GIKHQEVGHKSLLQSDALYQYILETSVYPREPESMKELREVTAKHPWNLMTTSAD  59

Query  261  EGQFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEK  440
            EGQFL+MLLKLINAKNTMEIGVYTGYSLLATALA+PDDGKILAMDINRENYE+GLP+IEK
Sbjct  60   EGQFLNMLLKLINAKNTMEIGVYTGYSLLATALAIPDDGKILAMDINRENYEIGLPIIEK  119

Query  441  AGVAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVI  620
            AGVAHKI+FREGPALP+LDQLVED K HGTYDFIFVDADKDNY+NYHKR+IDLVKVGG+I
Sbjct  120  AGVAHKIEFREGPALPVLDQLVEDKKNHGTYDFIFVDADKDNYINYHKRIIDLVKVGGLI  179

Query  621  GYDNTLWNGSVVAPPDAPMRKYIKYYRDFVLELNKALAVDPRIEICMLPVGDGITLCRRI  800
            GYDNTLWNGSVVAPPDAPMRKY++YYRDFVLELNKALA DPRIEICMLPVGDGITLCRRI
Sbjct  180  GYDNTLWNGSVVAPPDAPMRKYVRYYRDFVLELNKALAADPRIEICMLPVGDGITLCRRI  239

Query  801  S  803
            +
Sbjct  240  T  240



>ref|XP_010270267.1| PREDICTED: caffeoyl-CoA O-methyltransferase-like [Nelumbo nucifera]
Length=248

 Score =   466 bits (1198),  Expect = 3e-162, Method: Compositional matrix adjust.
 Identities = 220/248 (89%), Positives = 236/248 (95%), Gaps = 0/248 (0%)
 Frame = +3

Query  60   LAGKFKAMAENQTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWN  239
            +A K +    NQ  RHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELRE+TAKHPWN
Sbjct  1    MATKQEEQQNNQAGRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELRELTAKHPWN  60

Query  240  LMTTSADEGQFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYEL  419
            +MTTSADEGQFL++LLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYEL
Sbjct  61   IMTTSADEGQFLNILLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYEL  120

Query  420  GLPVIEKAGVAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDL  599
            GLPVI+KAGVAHKIDF+EGPALP+LDQ++ED K HGT+DFIFVDADKDNYLNYHKRLI+L
Sbjct  121  GLPVIQKAGVAHKIDFQEGPALPVLDQMIEDGKYHGTFDFIFVDADKDNYLNYHKRLIEL  180

Query  600  VKVGGVIGYDNTLWNGSVVAPPDAPMRKYIKYYRDFVLELNKALAVDPRIEICMLPVGDG  779
            VKVGGVIGYDNTLWNGSVVAPPD P+RKY++YYRDFVLELNKALAVDPRIEIC LPVGDG
Sbjct  181  VKVGGVIGYDNTLWNGSVVAPPDTPLRKYVRYYRDFVLELNKALAVDPRIEICQLPVGDG  240

Query  780  ITLCRRIS  803
            ITLCRRIS
Sbjct  241  ITLCRRIS  248



>ref|XP_010548003.1| PREDICTED: caffeoyl-CoA O-methyltransferase 1 [Tarenaya hassleriana]
Length=270

 Score =   466 bits (1199),  Expect = 4e-162, Method: Compositional matrix adjust.
 Identities = 223/266 (84%), Positives = 241/266 (91%), Gaps = 8/266 (3%)
 Frame = +3

Query  6    TTKSA*KKLRPETSVKGSLAGKFKAMAENQTTRHQEVGHKSLLQSDALYQYILETSVYPR  185
            TT  A KK   ETS  G      +   ++Q  RHQEVGHKSLLQSD LYQYILETSVYPR
Sbjct  13   TTVEATKK---ETSTNGD-----EQQQQSQALRHQEVGHKSLLQSDDLYQYILETSVYPR  64

Query  186  EPEAMKELREVTAKHPWNLMTTSADEGQFLSMLLKLINAKNTMEIGVYTGYSLLATALAL  365
            EPE+MKELREVTAKHPWN+MTTSADEGQFL+ML+KL+NAKNTMEIGVYTGYSLLATALAL
Sbjct  65   EPESMKELREVTAKHPWNIMTTSADEGQFLNMLIKLVNAKNTMEIGVYTGYSLLATALAL  124

Query  366  PDDGKILAMDINRENYELGLPVIEKAGVAHKIDFREGPALPILDQLVEDPKKHGTYDFIF  545
            PDDGKILAMDINRENYELGLP+I+KAGVAHKIDFREGPALP+LDQLV D K  G++DFIF
Sbjct  125  PDDGKILAMDINRENYELGLPIIQKAGVAHKIDFREGPALPVLDQLVADEKNRGSFDFIF  184

Query  546  VDADKDNYLNYHKRLIDLVKVGGVIGYDNTLWNGSVVAPPDAPMRKYIKYYRDFVLELNK  725
            VDADKDNYLNYHKRLIDLVKVGGVIGYDNTLWNGSVVAPPDAPMRKY++YYRDFV+ELNK
Sbjct  185  VDADKDNYLNYHKRLIDLVKVGGVIGYDNTLWNGSVVAPPDAPMRKYVRYYRDFVIELNK  244

Query  726  ALAVDPRIEICMLPVGDGITLCRRIS  803
            ALA DPRIEICMLPVGDGIT+CRRI+
Sbjct  245  ALAADPRIEICMLPVGDGITICRRIN  270



>sp|Q42945.1|CAMT6_TOBAC RecName: Full=Caffeoyl-CoA O-methyltransferase 6; AltName: Full=Trans-caffeoyl-CoA 
3-O-methyltransferase 6; Short=CCoAMT-6; 
Short=CCoAOMT-6 [Nicotiana tabacum]
 emb|CAA91228.1| caffeoyl-CoA O-methyltransferase [Nicotiana tabacum]
Length=247

 Score =   465 bits (1197),  Expect = 4e-162, Method: Compositional matrix adjust.
 Identities = 220/242 (91%), Positives = 232/242 (96%), Gaps = 0/242 (0%)
 Frame = +3

Query  78   AMAENQTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSA  257
            A  ENQ T+HQEVGHKSLLQSDALYQYILETSVYPREPE MKELRE+TAKHPWNLMTTSA
Sbjct  6    AAQENQVTKHQEVGHKSLLQSDALYQYILETSVYPREPEPMKELRELTAKHPWNLMTTSA  65

Query  258  DEGQFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIE  437
            DEGQFLSMLLKLI AKNTMEIGVYTGYSLLATALALPDDGKILAMDIN+ENYELGLPVI+
Sbjct  66   DEGQFLSMLLKLIIAKNTMEIGVYTGYSLLATALALPDDGKILAMDINKENYELGLPVIQ  125

Query  438  KAGVAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGV  617
            KAGVAHKIDFREGPALP+LD ++ED   HGTYDFIFVDADKDNY+NYHKR+I+LVKVGGV
Sbjct  126  KAGVAHKIDFREGPALPVLDLMIEDKNNHGTYDFIFVDADKDNYINYHKRIIELVKVGGV  185

Query  618  IGYDNTLWNGSVVAPPDAPMRKYIKYYRDFVLELNKALAVDPRIEICMLPVGDGITLCRR  797
            IGYDNTLWNGSVVAPPDAPMRKY++YYRDFVLELNKALA DPRIEICMLPVGDGITLCRR
Sbjct  186  IGYDNTLWNGSVVAPPDAPMRKYVRYYRDFVLELNKALAADPRIEICMLPVGDGITLCRR  245

Query  798  IS  803
            IS
Sbjct  246  IS  247



>ref|XP_010526962.1| PREDICTED: caffeoyl-CoA O-methyltransferase 5 [Tarenaya hassleriana]
Length=260

 Score =   465 bits (1197),  Expect = 6e-162, Method: Compositional matrix adjust.
 Identities = 217/239 (91%), Positives = 231/239 (97%), Gaps = 0/239 (0%)
 Frame = +3

Query  87   ENQTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEG  266
            ++Q  RHQEVGHKSLLQSDALYQYILETSVYPREPE+MKELREVTAKHPWN+MTTSADEG
Sbjct  22   QSQALRHQEVGHKSLLQSDALYQYILETSVYPREPESMKELREVTAKHPWNIMTTSADEG  81

Query  267  QFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAG  446
            QFL+ML+KLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLP+I+KAG
Sbjct  82   QFLNMLIKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPIIQKAG  141

Query  447  VAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIGY  626
            VAHKIDFREGPALP LDQLV D K HG+YDFIFVDADKDNY NYHKRLIDLVKVGGVIGY
Sbjct  142  VAHKIDFREGPALPFLDQLVADEKNHGSYDFIFVDADKDNYWNYHKRLIDLVKVGGVIGY  201

Query  627  DNTLWNGSVVAPPDAPMRKYIKYYRDFVLELNKALAVDPRIEICMLPVGDGITLCRRIS  803
            DNTLWNGSVVAPPDAPMRKY++YYRDFV+ELNK+LA DPRIEICMLPVGDGITLCRRI+
Sbjct  202  DNTLWNGSVVAPPDAPMRKYVRYYRDFVIELNKSLAADPRIEICMLPVGDGITLCRRIN  260



>gb|ABE41833.1| caffeoyl-CoA 3-O-methyltransferase [Brassica rapa subsp. pekinensis]
 emb|CDY51954.1| BnaA08g11640D [Brassica napus]
 emb|CDY51865.1| BnaC03g77170D [Brassica napus]
Length=258

 Score =   465 bits (1197),  Expect = 6e-162, Method: Compositional matrix adjust.
 Identities = 217/239 (91%), Positives = 232/239 (97%), Gaps = 0/239 (0%)
 Frame = +3

Query  87   ENQTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEG  266
            ++Q  RHQEVGHKSLLQSD LYQYILETSVYPREPE+MKELREVTAKHPWN+MTTSADEG
Sbjct  20   QSQNLRHQEVGHKSLLQSDDLYQYILETSVYPREPESMKELREVTAKHPWNIMTTSADEG  79

Query  267  QFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAG  446
            QFL+ML+KL+NAKNTMEIGVYTGYSLLATALALP+DGKILAMD+NRENYELGLP+IEKAG
Sbjct  80   QFLNMLIKLVNAKNTMEIGVYTGYSLLATALALPEDGKILAMDVNRENYELGLPIIEKAG  139

Query  447  VAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIGY  626
            VAHKIDFREGPALP+LDQLV D K HGTYDFIFVDADKDNY+NYHKRLIDLVKVGGVIGY
Sbjct  140  VAHKIDFREGPALPVLDQLVADEKNHGTYDFIFVDADKDNYINYHKRLIDLVKVGGVIGY  199

Query  627  DNTLWNGSVVAPPDAPMRKYIKYYRDFVLELNKALAVDPRIEICMLPVGDGITLCRRIS  803
            DNTLWNGSVVAPPDAPMRKY++YYRDFVLELNKALA DPRIEICMLPVGDGIT+CRRIS
Sbjct  200  DNTLWNGSVVAPPDAPMRKYVRYYRDFVLELNKALAADPRIEICMLPVGDGITICRRIS  258



>gb|AAS91565.1| caffeoyl-CoA O-methyltransferase [Broussonetia papyrifera]
Length=247

 Score =   464 bits (1195),  Expect = 8e-162, Method: Compositional matrix adjust.
 Identities = 217/239 (91%), Positives = 233/239 (97%), Gaps = 0/239 (0%)
 Frame = +3

Query  87   ENQTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEG  266
            +N+  RHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELRE+TAKHPWN+MTTSADEG
Sbjct  9    QNEAGRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREITAKHPWNIMTTSADEG  68

Query  267  QFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAG  446
            QFL+MLLKLINAKNTMEIGVYTGYSLLAT LALPDDGKILAMDINRENYELGLPVIEKAG
Sbjct  69   QFLNMLLKLINAKNTMEIGVYTGYSLLATGLALPDDGKILAMDINRENYELGLPVIEKAG  128

Query  447  VAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIGY  626
            VAHKIDFREGPALP+LDQ++ED K HG++DFIFVDADKDNYLNYHKRLI+LVKVGGVIGY
Sbjct  129  VAHKIDFREGPALPVLDQMIEDGKYHGSFDFIFVDADKDNYLNYHKRLIELVKVGGVIGY  188

Query  627  DNTLWNGSVVAPPDAPMRKYIKYYRDFVLELNKALAVDPRIEICMLPVGDGITLCRRIS  803
            DNTLWNGSVVAPPDAP+RKY++YYRDFVLELNKALA DPRIEICMLPVGDGIT+CRR+S
Sbjct  189  DNTLWNGSVVAPPDAPLRKYVRYYRDFVLELNKALAADPRIEICMLPVGDGITVCRRVS  247



>ref|XP_006284297.1| hypothetical protein CARUB_v10005466mg, partial [Capsella rubella]
 gb|EOA17195.1| hypothetical protein CARUB_v10005466mg, partial [Capsella rubella]
Length=276

 Score =   466 bits (1198),  Expect = 9e-162, Method: Compositional matrix adjust.
 Identities = 216/239 (90%), Positives = 231/239 (97%), Gaps = 0/239 (0%)
 Frame = +3

Query  87   ENQTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEG  266
            ++Q  RHQEVGHKSLLQSD LYQYILETSVYPREPE+MKELREVTAKHPWN+MTTSADEG
Sbjct  38   QSQNLRHQEVGHKSLLQSDDLYQYILETSVYPREPESMKELREVTAKHPWNIMTTSADEG  97

Query  267  QFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAG  446
            QFL+ML+KL+NAKNTMEIGVYTGYSLLATALALP+DGKILAMD+NRENYELGLP+IEKAG
Sbjct  98   QFLNMLIKLVNAKNTMEIGVYTGYSLLATALALPEDGKILAMDVNRENYELGLPIIEKAG  157

Query  447  VAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIGY  626
            VAHKIDFREGPALP+LDQLV D K HGTYDFIFVDADKDNY+NYHKRLIDLVKVGGVIGY
Sbjct  158  VAHKIDFREGPALPVLDQLVADEKNHGTYDFIFVDADKDNYINYHKRLIDLVKVGGVIGY  217

Query  627  DNTLWNGSVVAPPDAPMRKYIKYYRDFVLELNKALAVDPRIEICMLPVGDGITLCRRIS  803
            DNTLWNGSVVAP DAPMRKY++YYRDFVLELNKALA DPRIEICMLPVGDGIT+CRRIS
Sbjct  218  DNTLWNGSVVAPADAPMRKYVRYYRDFVLELNKALAADPRIEICMLPVGDGITICRRIS  276



>gb|ACJ38669.1| caffeoyl-CoA O-methyltransferase [Betula luminifera]
Length=247

 Score =   464 bits (1194),  Expect = 1e-161, Method: Compositional matrix adjust.
 Identities = 218/238 (92%), Positives = 232/238 (97%), Gaps = 0/238 (0%)
 Frame = +3

Query  87   ENQTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEG  266
            +NQ +RHQEVGHKSLLQSDALYQYILETSVYP+EPE+MKELREVTAKHPWN+MTTSADEG
Sbjct  9    QNQASRHQEVGHKSLLQSDALYQYILETSVYPKEPESMKELREVTAKHPWNIMTTSADEG  68

Query  267  QFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAG  446
            QFL+MLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAG
Sbjct  69   QFLNMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAG  128

Query  447  VAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIGY  626
            VAHKIDFREGPALP+LD L+ D K HG+YDFIFVDADKDNY+NYHKRLIDLVKVGG+IGY
Sbjct  129  VAHKIDFREGPALPLLDHLIADEKNHGSYDFIFVDADKDNYINYHKRLIDLVKVGGLIGY  188

Query  627  DNTLWNGSVVAPPDAPMRKYIKYYRDFVLELNKALAVDPRIEICMLPVGDGITLCRRI  800
            DNTLWNGSVVAPPDAP+RKY++YYRDFVLELNKALA DPRIEICMLPVGDGITLCRRI
Sbjct  189  DNTLWNGSVVAPPDAPLRKYVRYYRDFVLELNKALAADPRIEICMLPVGDGITLCRRI  246



>ref|XP_009760383.1| PREDICTED: caffeoyl-CoA O-methyltransferase 6 [Nicotiana sylvestris]
Length=247

 Score =   464 bits (1193),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 219/242 (90%), Positives = 230/242 (95%), Gaps = 0/242 (0%)
 Frame = +3

Query  78   AMAENQTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSA  257
            A  ENQ  +HQEVGHKSLLQSDALYQYILETSVYPREPE MKELRE+TAKHPWNLMTTSA
Sbjct  6    AAQENQVAKHQEVGHKSLLQSDALYQYILETSVYPREPEPMKELRELTAKHPWNLMTTSA  65

Query  258  DEGQFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIE  437
            DEGQFLSMLLKLINAKNTMEIGVYTGYSLLATALALP DGKILAMDINRENYE+GLPVI+
Sbjct  66   DEGQFLSMLLKLINAKNTMEIGVYTGYSLLATALALPHDGKILAMDINRENYEIGLPVIQ  125

Query  438  KAGVAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGV  617
            KAGVAHKIDFREGPALP+LD +VED   HGTYDFIFVDADKDNY+NYHKR+I+LVKVGGV
Sbjct  126  KAGVAHKIDFREGPALPVLDLMVEDKNNHGTYDFIFVDADKDNYINYHKRIIELVKVGGV  185

Query  618  IGYDNTLWNGSVVAPPDAPMRKYIKYYRDFVLELNKALAVDPRIEICMLPVGDGITLCRR  797
            IGYDNTLWNGSV APPDAPMRKY++YYRDFVLELNKALA DPRIEICMLPVGDGITLCRR
Sbjct  186  IGYDNTLWNGSVAAPPDAPMRKYVRYYRDFVLELNKALAADPRIEICMLPVGDGITLCRR  245

Query  798  IS  803
            IS
Sbjct  246  IS  247



>ref|XP_007201237.1| hypothetical protein PRUPE_ppa010497mg [Prunus persica]
 gb|EMJ02436.1| hypothetical protein PRUPE_ppa010497mg [Prunus persica]
Length=247

 Score =   464 bits (1193),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 218/241 (90%), Positives = 233/241 (97%), Gaps = 0/241 (0%)
 Frame = +3

Query  78   AMAENQTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSA  257
            A  +NQ  RHQEVGHKSLLQSDALYQYILETSVYPREPE+MKELREVTAKHPWN+MTTSA
Sbjct  6    ADQQNQAGRHQEVGHKSLLQSDALYQYILETSVYPREPESMKELREVTAKHPWNIMTTSA  65

Query  258  DEGQFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIE  437
            DEGQFL+MLLKLINAKNTMEIGV+TGYSLLATALA+PDDGKILAMDINRENY+LG P+IE
Sbjct  66   DEGQFLNMLLKLINAKNTMEIGVFTGYSLLATALAIPDDGKILAMDINRENYDLGRPIIE  125

Query  438  KAGVAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGV  617
            KAGVAHKIDFREGPALP+LDQLVED K HG+YDFIFVDADKDNY+NYHKRLIDLVKVGG+
Sbjct  126  KAGVAHKIDFREGPALPVLDQLVEDEKNHGSYDFIFVDADKDNYINYHKRLIDLVKVGGL  185

Query  618  IGYDNTLWNGSVVAPPDAPMRKYIKYYRDFVLELNKALAVDPRIEICMLPVGDGITLCRR  797
            IGYDNTLWNGSVVAPPDAP+RKY++YYRDFVLELNKALA DPRIEICMLPVGDGITLCRR
Sbjct  186  IGYDNTLWNGSVVAPPDAPLRKYVRYYRDFVLELNKALAADPRIEICMLPVGDGITLCRR  245

Query  798  I  800
            I
Sbjct  246  I  246



>ref|XP_009138259.1| PREDICTED: caffeoyl-CoA O-methyltransferase 1 [Brassica rapa]
Length=258

 Score =   464 bits (1194),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 217/239 (91%), Positives = 232/239 (97%), Gaps = 0/239 (0%)
 Frame = +3

Query  87   ENQTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEG  266
            ++Q  RHQEVGHKSLLQSD LYQYILETSVYPREPE+MKELREVTAKHPWN+MTTSADEG
Sbjct  20   QSQNLRHQEVGHKSLLQSDDLYQYILETSVYPREPESMKELREVTAKHPWNIMTTSADEG  79

Query  267  QFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAG  446
            QFL+ML+KL+NAKNTMEIGVYTGYSLLATALALP+DGKILAMD+NRENYELGLP+IEKAG
Sbjct  80   QFLNMLIKLVNAKNTMEIGVYTGYSLLATALALPEDGKILAMDVNRENYELGLPIIEKAG  139

Query  447  VAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIGY  626
            VAHKIDFREGPALP+LDQLV D K HGTYDFIFVDADKDNY+NYHKRLIDLVKVGGVIGY
Sbjct  140  VAHKIDFREGPALPVLDQLVADEKNHGTYDFIFVDADKDNYINYHKRLIDLVKVGGVIGY  199

Query  627  DNTLWNGSVVAPPDAPMRKYIKYYRDFVLELNKALAVDPRIEICMLPVGDGITLCRRIS  803
            DNTLWNGSVVAPPDAPMRKY++YYRDFVLELNKALA DPRIEICMLPVGDGIT+CRRIS
Sbjct  200  DNTLWNGSVVAPPDAPMRKYVRYYRDFVLELNKALAADPRIEICMLPVGDGITICRRIS  258



>ref|XP_008236475.1| PREDICTED: caffeoyl-CoA O-methyltransferase [Prunus mume]
Length=247

 Score =   463 bits (1192),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 216/238 (91%), Positives = 232/238 (97%), Gaps = 0/238 (0%)
 Frame = +3

Query  87   ENQTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEG  266
            +NQ  RHQEVGHKSLLQSDALYQYILETSVYPREPE+MKELREVTAKHPWN+MTTSADEG
Sbjct  9    QNQAGRHQEVGHKSLLQSDALYQYILETSVYPREPESMKELREVTAKHPWNIMTTSADEG  68

Query  267  QFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAG  446
            QFL+MLLKLINAKNTMEIGV+TGYSLLATALA+PDDGKILAMDINRENY+LG P+IEKAG
Sbjct  69   QFLNMLLKLINAKNTMEIGVFTGYSLLATALAIPDDGKILAMDINRENYDLGRPIIEKAG  128

Query  447  VAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIGY  626
            VAHKIDFREGPALP+LDQL+ED K HG+YDFIFVDADKDNY+NYHKRLIDLVKVGG+IGY
Sbjct  129  VAHKIDFREGPALPVLDQLIEDEKNHGSYDFIFVDADKDNYINYHKRLIDLVKVGGLIGY  188

Query  627  DNTLWNGSVVAPPDAPMRKYIKYYRDFVLELNKALAVDPRIEICMLPVGDGITLCRRI  800
            DNTLWNGSVVAPPDAP+RKY++YYRDFVLELNKALA DPRIEICMLPVGDGITLCRRI
Sbjct  189  DNTLWNGSVVAPPDAPLRKYVRYYRDFVLELNKALAADPRIEICMLPVGDGITLCRRI  246



>ref|XP_003529403.2| PREDICTED: caffeoyl-CoA O-methyltransferase-like [Glycine max]
Length=275

 Score =   464 bits (1194),  Expect = 3e-161, Method: Compositional matrix adjust.
 Identities = 224/271 (83%), Positives = 247/271 (91%), Gaps = 6/271 (2%)
 Frame = +3

Query  6    TTKSA*KKLRPETSVKGSLAGKFKAMAE---NQTT---RHQEVGHKSLLQSDALYQYILE  167
            T+ S+ +  + E   K +      AMAE   NQTT   RHQEVGHKSLLQSDALYQYILE
Sbjct  4    TSSSSNQLFKREKKRKENSQKTIIAMAEQNQNQTTEAGRHQEVGHKSLLQSDALYQYILE  63

Query  168  TSVYPREPEAMKELREVTAKHPWNLMTTSADEGQFLSMLLKLINAKNTMEIGVYTGYSLL  347
            TSVYPREPE+MKELRE+TAKHPWN+MTTSADEGQFL+MLLKLINAKNTMEIGVYTGYSLL
Sbjct  64   TSVYPREPESMKELRELTAKHPWNIMTTSADEGQFLNMLLKLINAKNTMEIGVYTGYSLL  123

Query  348  ATALALPDDGKILAMDINRENYELGLPVIEKAGVAHKIDFREGPALPILDQLVEDPKKHG  527
            ATALALP+DGKILAMDINRENYELGLPVI+KAGV HKI+FREGPALP+LD++++D K HG
Sbjct  124  ATALALPEDGKILAMDINRENYELGLPVIKKAGVDHKIEFREGPALPVLDEMIKDEKNHG  183

Query  528  TYDFIFVDADKDNYLNYHKRLIDLVKVGGVIGYDNTLWNGSVVAPPDAPMRKYIKYYRDF  707
            +YDFIFVDADKDNYLNYHKRLI+LVKVGGVIGYDNTLWNGSVVAPPDAP+RKY++YYRDF
Sbjct  184  SYDFIFVDADKDNYLNYHKRLIELVKVGGVIGYDNTLWNGSVVAPPDAPLRKYVRYYRDF  243

Query  708  VLELNKALAVDPRIEICMLPVGDGITLCRRI  800
            VLELNKALAVDPRIEICMLPVGDGIT+CRRI
Sbjct  244  VLELNKALAVDPRIEICMLPVGDGITICRRI  274



>gb|ABF74683.1| caffeoyl-CoA-O-methyltransferase [Leucaena leucocephala]
 gb|ABE60811.2| caffeoyl coenzyme A 3-O-methyltransferase 1 [Leucaena leucocephala]
Length=244

 Score =   463 bits (1191),  Expect = 3e-161, Method: Compositional matrix adjust.
 Identities = 218/239 (91%), Positives = 234/239 (98%), Gaps = 0/239 (0%)
 Frame = +3

Query  87   ENQTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEG  266
            +++  RHQEVGHKSLLQSDALYQYILETSVYPREPE MKELRE+TAKHPWN+MTTSADEG
Sbjct  6    QSEAGRHQEVGHKSLLQSDALYQYILETSVYPREPEPMKELREITAKHPWNIMTTSADEG  65

Query  267  QFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAG  446
            QFL+MLLKLINAKNTMEIGVYTGYSLLATALALP+DGKILAMDINRENYELGLPVI+KAG
Sbjct  66   QFLNMLLKLINAKNTMEIGVYTGYSLLATALALPEDGKILAMDINRENYELGLPVIQKAG  125

Query  447  VAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIGY  626
            VAHKI+FREGPALP+LD+LV+D K HG+YDFIFVDADKDNYLNYHKRLIDLVKVGGVIGY
Sbjct  126  VAHKIEFREGPALPVLDELVKDEKNHGSYDFIFVDADKDNYLNYHKRLIDLVKVGGVIGY  185

Query  627  DNTLWNGSVVAPPDAPMRKYIKYYRDFVLELNKALAVDPRIEICMLPVGDGITLCRRIS  803
            DNTLWNGSVVAPPDAP+RKY++YYRDFVLELNKALAVDPRIEICMLPVGDGITLCRRIS
Sbjct  186  DNTLWNGSVVAPPDAPLRKYVRYYRDFVLELNKALAVDPRIEICMLPVGDGITLCRRIS  244



>dbj|BAE48788.1| caffeoyl-CoA-O-methyltransferase [Codonopsis lanceolata]
Length=247

 Score =   462 bits (1190),  Expect = 4e-161, Method: Compositional matrix adjust.
 Identities = 214/237 (90%), Positives = 232/237 (98%), Gaps = 0/237 (0%)
 Frame = +3

Query  93   QTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEGQF  272
            QTTRHQEVGHKSLLQSDALYQYILETSVYPREPE+MKELRE TAKHPWN+MTTSADEGQF
Sbjct  11   QTTRHQEVGHKSLLQSDALYQYILETSVYPREPESMKELREATAKHPWNIMTTSADEGQF  70

Query  273  LSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAGVA  452
            L+MLLKLINAKNTMEIGV+TGYSLLATALALPDDGKILAMDINRENY++G P+IEKAGVA
Sbjct  71   LNMLLKLINAKNTMEIGVFTGYSLLATALALPDDGKILAMDINRENYDIGRPIIEKAGVA  130

Query  453  HKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIGYDN  632
            HKIDFREGPALP+LDQ++ED K HGT+DF+FVDADKDNY+NYHKR+IDLVKVGG+IGYDN
Sbjct  131  HKIDFREGPALPVLDQMIEDGKYHGTFDFVFVDADKDNYINYHKRIIDLVKVGGLIGYDN  190

Query  633  TLWNGSVVAPPDAPMRKYIKYYRDFVLELNKALAVDPRIEICMLPVGDGITLCRRIS  803
            TLWNGSVVAPPDAPMRKY++YYRDFVLELNKALA DPRIEICMLPVGDGITLCRR+S
Sbjct  191  TLWNGSVVAPPDAPMRKYVRYYRDFVLELNKALAADPRIEICMLPVGDGITLCRRVS  247



>ref|XP_009108759.1| PREDICTED: caffeoyl-CoA O-methyltransferase 1-like [Brassica 
rapa]
Length=258

 Score =   463 bits (1191),  Expect = 4e-161, Method: Compositional matrix adjust.
 Identities = 216/239 (90%), Positives = 231/239 (97%), Gaps = 0/239 (0%)
 Frame = +3

Query  87   ENQTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEG  266
            ++Q  RHQEVGHKSLLQSD LYQYILETSVYPREPE+MKELREVTAKHPWN+MTTSADEG
Sbjct  20   QSQNLRHQEVGHKSLLQSDDLYQYILETSVYPREPESMKELREVTAKHPWNIMTTSADEG  79

Query  267  QFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAG  446
            QFL+ML+KL+NAKNTMEIGVYTGYSLLATALALP+DGKILAMD+NRENYELGLP+IEKAG
Sbjct  80   QFLNMLIKLVNAKNTMEIGVYTGYSLLATALALPEDGKILAMDVNRENYELGLPIIEKAG  139

Query  447  VAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIGY  626
            VAHKIDFREGPALP+LDQLV D K HGTYDFIFVDADKDNY+NYHKRLIDLVKVGGVIGY
Sbjct  140  VAHKIDFREGPALPVLDQLVADEKNHGTYDFIFVDADKDNYINYHKRLIDLVKVGGVIGY  199

Query  627  DNTLWNGSVVAPPDAPMRKYIKYYRDFVLELNKALAVDPRIEICMLPVGDGITLCRRIS  803
            DNTLWNGSVVAPPDAPMRKY++YYRDFVLELNKALA DPRIEICMLPVGD IT+CRRIS
Sbjct  200  DNTLWNGSVVAPPDAPMRKYVRYYRDFVLELNKALAADPRIEICMLPVGDAITICRRIS  258



>gb|EYU37656.1| hypothetical protein MIMGU_mgv1a012535mg [Erythranthe guttata]
Length=247

 Score =   462 bits (1189),  Expect = 6e-161, Method: Compositional matrix adjust.
 Identities = 217/240 (90%), Positives = 232/240 (97%), Gaps = 0/240 (0%)
 Frame = +3

Query  84   AENQTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADE  263
            AENQ  RHQEVGHKSLLQSDALYQYILETSVYP+EPE+MKELRE+TAKHPWN+MTTSADE
Sbjct  8    AENQAGRHQEVGHKSLLQSDALYQYILETSVYPKEPESMKELREITAKHPWNIMTTSADE  67

Query  264  GQFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKA  443
            GQFL+MLLKLINAKNTMEIGVYTGYSLLATALALP DGKILAMDIN+ENYELGLPVI+KA
Sbjct  68   GQFLNMLLKLINAKNTMEIGVYTGYSLLATALALPHDGKILAMDINKENYELGLPVIQKA  127

Query  444  GVAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIG  623
            GVAHKIDFREGPALP+LDQ++ D K HGT+DFIFVDADKDNY+NYHKRLIDLVKVGGVIG
Sbjct  128  GVAHKIDFREGPALPVLDQMIADGKYHGTFDFIFVDADKDNYINYHKRLIDLVKVGGVIG  187

Query  624  YDNTLWNGSVVAPPDAPMRKYIKYYRDFVLELNKALAVDPRIEICMLPVGDGITLCRRIS  803
            YDNTLWNGSVVAPPDAP+RKY++YYRDFVLELNKALA DPRIEIC LPVGDGITLCRRIS
Sbjct  188  YDNTLWNGSVVAPPDAPLRKYVRYYRDFVLELNKALAADPRIEICQLPVGDGITLCRRIS  247



>ref|XP_004290595.1| PREDICTED: caffeoyl-CoA O-methyltransferase [Fragaria vesca subsp. 
vesca]
Length=244

 Score =   462 bits (1189),  Expect = 6e-161, Method: Compositional matrix adjust.
 Identities = 218/243 (90%), Positives = 235/243 (97%), Gaps = 3/243 (1%)
 Frame = +3

Query  81   MAEN---QTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTT  251
            MAEN   Q +RHQEVGHKSLLQSDALYQYILETSVYPREPE MKELRE+TAKHPWN+MTT
Sbjct  1    MAENGEEQKSRHQEVGHKSLLQSDALYQYILETSVYPREPECMKELRELTAKHPWNIMTT  60

Query  252  SADEGQFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPV  431
            SADEGQFL+MLLKLINAKNTMEIGVYTGYSLLATALA+P+DGKILAMDIN+ENYELGLPV
Sbjct  61   SADEGQFLNMLLKLINAKNTMEIGVYTGYSLLATALAIPEDGKILAMDINKENYELGLPV  120

Query  432  IEKAGVAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVG  611
            IEKAGVAHKIDFREGPALP+LDQ++ED K HG++DFIFVDADKDNY+NYHKRLIDLVKVG
Sbjct  121  IEKAGVAHKIDFREGPALPVLDQMIEDEKNHGSFDFIFVDADKDNYINYHKRLIDLVKVG  180

Query  612  GVIGYDNTLWNGSVVAPPDAPMRKYIKYYRDFVLELNKALAVDPRIEICMLPVGDGITLC  791
            G+IGYDNTLWNGSVVAPPDAP+RKY++YYRDFVLELNKALA DPRIEICMLPVGDGITLC
Sbjct  181  GLIGYDNTLWNGSVVAPPDAPLRKYVRYYRDFVLELNKALAADPRIEICMLPVGDGITLC  240

Query  792  RRI  800
            RRI
Sbjct  241  RRI  243



>sp|Q8H9B6.1|CAMT_SOLTU RecName: Full=Caffeoyl-CoA O-methyltransferase; AltName: Full=Trans-caffeoyl-CoA 
3-O-methyltransferase; Short=CCoAMT; Short=CCoAOMT 
[Solanum tuberosum]
 dbj|BAC23054.1| caffeoyl-CoA O-methyltransferase [Solanum tuberosum]
Length=242

 Score =   462 bits (1188),  Expect = 7e-161, Method: Compositional matrix adjust.
 Identities = 219/242 (90%), Positives = 234/242 (97%), Gaps = 1/242 (0%)
 Frame = +3

Query  81   MAEN-QTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSA  257
            MA N +  RHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELRE+TAKHPWNLMTTSA
Sbjct  1    MASNGENGRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREITAKHPWNLMTTSA  60

Query  258  DEGQFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIE  437
            DEGQFL+MLLKLINAKNTMEIGV+TGYSLLATA+ALPDDGKILAMDINRENYE+GLPVIE
Sbjct  61   DEGQFLNMLLKLINAKNTMEIGVFTGYSLLATAMALPDDGKILAMDINRENYEIGLPVIE  120

Query  438  KAGVAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGV  617
            KAG+AHKIDFREGPALP+LDQ++ED K HG+YDFIFVDADKDNYLNYHKRLIDLVKVGG+
Sbjct  121  KAGLAHKIDFREGPALPVLDQMIEDGKYHGSYDFIFVDADKDNYLNYHKRLIDLVKVGGL  180

Query  618  IGYDNTLWNGSVVAPPDAPMRKYIKYYRDFVLELNKALAVDPRIEICMLPVGDGITLCRR  797
            IGYDNTLWNGSVVAPPDAP+RKY++YYRDFVLELNKALA DPRIEIC LPVGDGITLCRR
Sbjct  181  IGYDNTLWNGSVVAPPDAPLRKYVRYYRDFVLELNKALAADPRIEICQLPVGDGITLCRR  240

Query  798  IS  803
            IS
Sbjct  241  IS  242



>gb|ACF48821.1| caffeoyl-CoA-O-methyltransferase [Gossypium hirsutum]
Length=247

 Score =   461 bits (1187),  Expect = 1e-160, Method: Compositional matrix adjust.
 Identities = 215/238 (90%), Positives = 233/238 (98%), Gaps = 0/238 (0%)
 Frame = +3

Query  87   ENQTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEG  266
            ++Q  RHQEVGHKSLLQSDALYQYILETSVYPREPE MKELRE+TAKHPWNLMTTSADEG
Sbjct  9    QSQAGRHQEVGHKSLLQSDALYQYILETSVYPREPEPMKELRELTAKHPWNLMTTSADEG  68

Query  267  QFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAG  446
            QFL+MLLKLINAKNTMEIGVYTGYSLLATALA+PDDGKILAMD+NRENYELGLPVI+KAG
Sbjct  69   QFLNMLLKLINAKNTMEIGVYTGYSLLATALAIPDDGKILAMDVNRENYELGLPVIQKAG  128

Query  447  VAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIGY  626
            VAHKIDF+EGPALP+LDQLVED K HG++DFIFVDADKDNYLNYHKRLI+LVKVGG+IGY
Sbjct  129  VAHKIDFKEGPALPVLDQLVEDEKNHGSFDFIFVDADKDNYLNYHKRLIELVKVGGLIGY  188

Query  627  DNTLWNGSVVAPPDAPMRKYIKYYRDFVLELNKALAVDPRIEICMLPVGDGITLCRRI  800
            DNTLWNGSVVAPPDAP+RKY++YYRDFV+ELNKALAVDPRIEICMLPVGDGITLCRR+
Sbjct  189  DNTLWNGSVVAPPDAPLRKYVRYYRDFVMELNKALAVDPRIEICMLPVGDGITLCRRL  246



>ref|XP_006412281.1| hypothetical protein EUTSA_v10026028mg [Eutrema salsugineum]
 gb|ESQ53734.1| hypothetical protein EUTSA_v10026028mg [Eutrema salsugineum]
Length=258

 Score =   462 bits (1188),  Expect = 1e-160, Method: Compositional matrix adjust.
 Identities = 215/239 (90%), Positives = 231/239 (97%), Gaps = 0/239 (0%)
 Frame = +3

Query  87   ENQTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEG  266
            ++Q  RHQEVGHKSLLQSD LYQYILETSVYPREPE+MKELREVTAKHPWN+MTTSADEG
Sbjct  20   QSQNLRHQEVGHKSLLQSDDLYQYILETSVYPREPESMKELREVTAKHPWNIMTTSADEG  79

Query  267  QFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAG  446
            QFL+ML+KL+NAKNTMEIGVYTGYSLLATALALP+DGKILAMD+NRENYELGLP+IEKAG
Sbjct  80   QFLNMLIKLVNAKNTMEIGVYTGYSLLATALALPEDGKILAMDVNRENYELGLPIIEKAG  139

Query  447  VAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIGY  626
            VAHKIDFREGPALP+LDQLV D K HGTYDFIFVDADKDNY+NYHKRLIDLVKVGGVIGY
Sbjct  140  VAHKIDFREGPALPVLDQLVADEKNHGTYDFIFVDADKDNYINYHKRLIDLVKVGGVIGY  199

Query  627  DNTLWNGSVVAPPDAPMRKYIKYYRDFVLELNKALAVDPRIEICMLPVGDGITLCRRIS  803
            DNTLWNGSVVA PDAPMRKY++YYRDFVLELNKALA DPRIEICMLPVGDGIT+CRRI+
Sbjct  200  DNTLWNGSVVAAPDAPMRKYVRYYRDFVLELNKALAADPRIEICMLPVGDGITICRRIN  258



>ref|XP_010107916.1| Caffeoyl-CoA O-methyltransferase [Morus notabilis]
 gb|EXC17316.1| Caffeoyl-CoA O-methyltransferase [Morus notabilis]
Length=247

 Score =   461 bits (1187),  Expect = 1e-160, Method: Compositional matrix adjust.
 Identities = 216/239 (90%), Positives = 232/239 (97%), Gaps = 0/239 (0%)
 Frame = +3

Query  87   ENQTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEG  266
            + + +RHQEVGHKSLLQSDALYQYILETSVYPREPE MKELRE+TAKHPWN+MTTSADEG
Sbjct  9    QQEVSRHQEVGHKSLLQSDALYQYILETSVYPREPEPMKELREITAKHPWNIMTTSADEG  68

Query  267  QFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAG  446
            QFL+MLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAG
Sbjct  69   QFLNMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAG  128

Query  447  VAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIGY  626
            VAHKIDFREGPALP+LD ++ED K HGT+DFIFVDADKDNYLNYHKRLI+LVKVGGVIGY
Sbjct  129  VAHKIDFREGPALPVLDHMIEDGKYHGTFDFIFVDADKDNYLNYHKRLIELVKVGGVIGY  188

Query  627  DNTLWNGSVVAPPDAPMRKYIKYYRDFVLELNKALAVDPRIEICMLPVGDGITLCRRIS  803
            DNTLWNGSVVAPPDAP+RKY++YYRDFVLELNKALA DPRIEICMLPVGDGITLCRR++
Sbjct  189  DNTLWNGSVVAPPDAPLRKYVRYYRDFVLELNKALAADPRIEICMLPVGDGITLCRRVN  247



>gb|KGN43930.1| Caffeoyl-CoA O-methyltransferase [Cucumis sativus]
Length=275

 Score =   462 bits (1189),  Expect = 1e-160, Method: Compositional matrix adjust.
 Identities = 220/266 (83%), Positives = 241/266 (91%), Gaps = 3/266 (1%)
 Frame = +3

Query  6    TTKSA*KKLRPETSVKGSLAGKFKAMAENQTTRHQEVGHKSLLQSDALYQYILETSVYPR  185
            T KS  +KL    ++  +  G+     +NQ  RHQEVGHKSLLQSDALYQYILETSVYPR
Sbjct  13   TGKSTKQKLHHSPTMASTTNGQED---QNQAGRHQEVGHKSLLQSDALYQYILETSVYPR  69

Query  186  EPEAMKELREVTAKHPWNLMTTSADEGQFLSMLLKLINAKNTMEIGVYTGYSLLATALAL  365
            EPE+MKELR++TAKHPWN+MTTSADEGQFL+MLLKLINAK TMEIGVYTGYSLLATALAL
Sbjct  70   EPESMKELRDLTAKHPWNIMTTSADEGQFLNMLLKLINAKKTMEIGVYTGYSLLATALAL  129

Query  366  PDDGKILAMDINRENYELGLPVIEKAGVAHKIDFREGPALPILDQLVEDPKKHGTYDFIF  545
            P+DG ILAMDINRENYELGLPVIEKAGVAHKI+F+EGPALP+LD +V D K HG+YDFIF
Sbjct  130  PEDGTILAMDINRENYELGLPVIEKAGVAHKIEFKEGPALPVLDDMVADKKNHGSYDFIF  189

Query  546  VDADKDNYLNYHKRLIDLVKVGGVIGYDNTLWNGSVVAPPDAPMRKYIKYYRDFVLELNK  725
            VDADKDNY+NYHKRLIDLVKVGGVIGYDNTLWNGSVVAPPDAPMRKY++YYRDFVLELNK
Sbjct  190  VDADKDNYINYHKRLIDLVKVGGVIGYDNTLWNGSVVAPPDAPMRKYVRYYRDFVLELNK  249

Query  726  ALAVDPRIEICMLPVGDGITLCRRIS  803
            ALA DPRIEICMLPVGDGITLCRRI+
Sbjct  250  ALAADPRIEICMLPVGDGITLCRRIN  275



>gb|AAT75320.2| caffeoyl-CoA 3-O-methyltransferase [Boehmeria nivea]
Length=247

 Score =   461 bits (1186),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 215/239 (90%), Positives = 233/239 (97%), Gaps = 0/239 (0%)
 Frame = +3

Query  87   ENQTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEG  266
            +N+ +RHQEVGHKSLLQSDALYQYILETSVYPREPE+MKELRE+TAKHPWNLMTTSADEG
Sbjct  9    QNEVSRHQEVGHKSLLQSDALYQYILETSVYPREPESMKELREITAKHPWNLMTTSADEG  68

Query  267  QFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAG  446
            QFLSMLLKLINAKNTMEIGV+TGYSLLATALALP+DGKILAMDINRENYELGLPVIEKAG
Sbjct  69   QFLSMLLKLINAKNTMEIGVFTGYSLLATALALPEDGKILAMDINRENYELGLPVIEKAG  128

Query  447  VAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIGY  626
            +AHKIDFREGPALP LDQ++ED K HG++DFIFVDADKDNYLNYHKRLI+LVKVGGVIGY
Sbjct  129  LAHKIDFREGPALPALDQMIEDGKYHGSFDFIFVDADKDNYLNYHKRLIELVKVGGVIGY  188

Query  627  DNTLWNGSVVAPPDAPMRKYIKYYRDFVLELNKALAVDPRIEICMLPVGDGITLCRRIS  803
            DNTLWNGSVVAPPDAP+RKY++YYRDFVLELNKALA DPRIEICMLPVGDGI +CRR+S
Sbjct  189  DNTLWNGSVVAPPDAPLRKYVRYYRDFVLELNKALAADPRIEICMLPVGDGIPICRRVS  247



>gb|KFK30033.1| hypothetical protein AALP_AA7G208900 [Arabis alpina]
Length=258

 Score =   462 bits (1188),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 214/239 (90%), Positives = 232/239 (97%), Gaps = 0/239 (0%)
 Frame = +3

Query  87   ENQTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEG  266
            ++Q  RHQEVGHKSLLQSD LYQYILETSVYPREPE+MKELREVTAKHPWN+MTTSADEG
Sbjct  20   QSQNLRHQEVGHKSLLQSDDLYQYILETSVYPREPESMKELREVTAKHPWNIMTTSADEG  79

Query  267  QFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAG  446
            QFL+ML+KL+NAKNTMEIGVYTGYSLLATALALP+DGKILAMD+NRENYELGLP+IEKAG
Sbjct  80   QFLNMLIKLVNAKNTMEIGVYTGYSLLATALALPEDGKILAMDVNRENYELGLPIIEKAG  139

Query  447  VAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIGY  626
            VAHKIDFREGPALP+LD+LV D K HGTYDFIFVDADKDNY+NYHKRLIDLVK+GGVIGY
Sbjct  140  VAHKIDFREGPALPVLDELVADEKNHGTYDFIFVDADKDNYINYHKRLIDLVKIGGVIGY  199

Query  627  DNTLWNGSVVAPPDAPMRKYIKYYRDFVLELNKALAVDPRIEICMLPVGDGITLCRRIS  803
            DNTLWNGSVVAPPDAPMRKY++YYRDFV+ELNKALA DPRIEICMLPVGDGIT+CRRIS
Sbjct  200  DNTLWNGSVVAPPDAPMRKYVRYYRDFVIELNKALAADPRIEICMLPVGDGITICRRIS  258



>ref|NP_001268047.1| caffeoyl-CoA O-methyltransferase [Vitis vinifera]
 sp|Q43237.1|CAMT_VITVI RecName: Full=Caffeoyl-CoA O-methyltransferase; AltName: Full=Trans-caffeoyl-CoA 
3-O-methyltransferase; Short=CCOAMT; Short=CCOAOMT 
[Vitis vinifera]
 emb|CAA90969.1| caffeoyl-CoA O-methyltransferase [Vitis vinifera]
 emb|CAN79561.1| hypothetical protein VITISV_021020 [Vitis vinifera]
Length=242

 Score =   461 bits (1186),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 217/242 (90%), Positives = 235/242 (97%), Gaps = 1/242 (0%)
 Frame = +3

Query  81   MAENQTT-RHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSA  257
            MA NQ   RHQEVGHKSLLQSDALYQYILETSVYPREPE+MKELRE+TA+HPWN+MTTSA
Sbjct  1    MATNQEAGRHQEVGHKSLLQSDALYQYILETSVYPREPESMKELRELTAQHPWNIMTTSA  60

Query  258  DEGQFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIE  437
            DEGQFL+MLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDIN+ENYELGLPVI+
Sbjct  61   DEGQFLNMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINKENYELGLPVIQ  120

Query  438  KAGVAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGV  617
            KAGVAHKIDF+EGPALP+LDQ++ED K HG++DFIFVDADKDNYLNYHKRLIDLVKVGG+
Sbjct  121  KAGVAHKIDFKEGPALPVLDQMIEDGKYHGSFDFIFVDADKDNYLNYHKRLIDLVKVGGI  180

Query  618  IGYDNTLWNGSVVAPPDAPMRKYIKYYRDFVLELNKALAVDPRIEICMLPVGDGITLCRR  797
            IGYDNTLWNGSVVAPPDAP+RKY++YYRDFVLELNKALA DPRIEICMLPVGDGITLCRR
Sbjct  181  IGYDNTLWNGSVVAPPDAPLRKYVRYYRDFVLELNKALAADPRIEICMLPVGDGITLCRR  240

Query  798  IS  803
            +S
Sbjct  241  LS  242



>dbj|BAM05558.1| caffeoyl-CoA O-methyltransferase [Eucalyptus pilularis]
 dbj|BAM05560.1| caffeoyl-CoA O-methyltransferase [Eucalyptus pyrocarpa]
Length=246

 Score =   461 bits (1186),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 219/240 (91%), Positives = 233/240 (97%), Gaps = 1/240 (0%)
 Frame = +3

Query  84   AENQTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADE  263
            ++NQ  RHQEVGHKSLLQSDALYQYILETSVYPREPE MKELRE+TAKHPWN+MTTSADE
Sbjct  8    SQNQAGRHQEVGHKSLLQSDALYQYILETSVYPREPEPMKELREITAKHPWNIMTTSADE  67

Query  264  GQFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKA  443
            GQFL+MLLKLINAKNTMEIGV+TGYSLLATALALPDDGKILAMDINRENYELGLPVI+KA
Sbjct  68   GQFLNMLLKLINAKNTMEIGVFTGYSLLATALALPDDGKILAMDINRENYELGLPVIQKA  127

Query  444  GVAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIG  623
            GVAHKIDFREGPALPILDQL+ED  K GT+DFIFVDADKDNYLNYHKRLI+LVKVGG+IG
Sbjct  128  GVAHKIDFREGPALPILDQLIED-GKQGTFDFIFVDADKDNYLNYHKRLIELVKVGGLIG  186

Query  624  YDNTLWNGSVVAPPDAPMRKYIKYYRDFVLELNKALAVDPRIEICMLPVGDGITLCRRIS  803
            YDNTLWNGSVVAPPDAP+RKY++YYRDFVLELNKALA DPRIEICMLPVGDGITLCRRIS
Sbjct  187  YDNTLWNGSVVAPPDAPLRKYVRYYRDFVLELNKALAADPRIEICMLPVGDGITLCRRIS  246



>ref|XP_002282867.1| PREDICTED: caffeoyl-CoA O-methyltransferase [Vitis vinifera]
 emb|CBI21401.3| unnamed protein product [Vitis vinifera]
Length=247

 Score =   461 bits (1186),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 216/239 (90%), Positives = 232/239 (97%), Gaps = 0/239 (0%)
 Frame = +3

Query  87   ENQTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEG  266
            +NQ  RHQEVGHKSLLQSDALYQYILETSVYPREP+ MKELRE+TAKHPWN+MTTSADEG
Sbjct  9    QNQAGRHQEVGHKSLLQSDALYQYILETSVYPREPKPMKELRELTAKHPWNIMTTSADEG  68

Query  267  QFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAG  446
            QFL+MLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLP+IEKAG
Sbjct  69   QFLNMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPIIEKAG  128

Query  447  VAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIGY  626
            +AHKIDFREGPALP+LDQ++ED K HGT+DFIFVDADKDNYLNYHKRLIDLVKVGG+IGY
Sbjct  129  LAHKIDFREGPALPVLDQMIEDGKYHGTFDFIFVDADKDNYLNYHKRLIDLVKVGGLIGY  188

Query  627  DNTLWNGSVVAPPDAPMRKYIKYYRDFVLELNKALAVDPRIEICMLPVGDGITLCRRIS  803
            DNTLWNGSVVAPPDAP+RKY++YY+DFVLELNKALA DPRIEIC LPVGDGITLCRRIS
Sbjct  189  DNTLWNGSVVAPPDAPLRKYVRYYKDFVLELNKALAADPRIEICQLPVGDGITLCRRIS  247



>sp|Q9SWB8.1|CAMT2_EUCGL RecName: Full=Caffeoyl-CoA O-methyltransferase 2; AltName: Full=Trans-caffeoyl-CoA 
3-O-methyltransferase 2; Short=CCoAMT-2; 
Short=CCoAOMT-2 [Eucalyptus globulus]
 gb|AAD50443.1|AF168780_1 caffeoyl-CoA O-methyltransferase [Eucalyptus globulus]
Length=247

 Score =   461 bits (1186),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 215/239 (90%), Positives = 232/239 (97%), Gaps = 0/239 (0%)
 Frame = +3

Query  87   ENQTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEG  266
            + Q  +H EVGHKSLLQSDALYQYILETSVYPREPE+MKELRE+TAKHPWNLMTTSADEG
Sbjct  9    QTQPAKHSEVGHKSLLQSDALYQYILETSVYPREPESMKELREITAKHPWNLMTTSADEG  68

Query  267  QFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAG  446
            QFL+MLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINREN+E+GLPVIEKAG
Sbjct  69   QFLNMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENFEIGLPVIEKAG  128

Query  447  VAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIGY  626
            +AHKIDFREGPALP+LDQLV+D K HGTYDFIFVDADKDNY+NYHKRLIDLVKVGG+IGY
Sbjct  129  LAHKIDFREGPALPLLDQLVQDEKNHGTYDFIFVDADKDNYINYHKRLIDLVKVGGLIGY  188

Query  627  DNTLWNGSVVAPPDAPMRKYIKYYRDFVLELNKALAVDPRIEICMLPVGDGITLCRRIS  803
            DNTLWNGSVVAP DAP+RKY++YYRDFVLELNKALAVDPR+EICMLPVGDGITLCRR+S
Sbjct  189  DNTLWNGSVVAPADAPLRKYVRYYRDFVLELNKALAVDPRVEICMLPVGDGITLCRRVS  247



>ref|XP_010447157.1| PREDICTED: caffeoyl-CoA O-methyltransferase 1-like [Camelina 
sativa]
Length=258

 Score =   461 bits (1187),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 214/239 (90%), Positives = 231/239 (97%), Gaps = 0/239 (0%)
 Frame = +3

Query  87   ENQTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEG  266
            ++Q  RHQEVGHKSLLQSD LYQYILETSVYPREPE+MKELREVTAKHPWN+MTTSADEG
Sbjct  20   QSQNLRHQEVGHKSLLQSDDLYQYILETSVYPREPESMKELREVTAKHPWNIMTTSADEG  79

Query  267  QFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAG  446
            QFL+ML+KL+NAKNTMEIGVYTGYSLLATALALP+DGKILAMD+NRENYELGLP+IEKAG
Sbjct  80   QFLNMLIKLVNAKNTMEIGVYTGYSLLATALALPEDGKILAMDVNRENYELGLPIIEKAG  139

Query  447  VAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIGY  626
            VAHKIDFREGPALP+LD++V D K HGTYDFIFVDADKDNY+NYHKRLIDLVKVGGVIGY
Sbjct  140  VAHKIDFREGPALPVLDEIVADEKNHGTYDFIFVDADKDNYINYHKRLIDLVKVGGVIGY  199

Query  627  DNTLWNGSVVAPPDAPMRKYIKYYRDFVLELNKALAVDPRIEICMLPVGDGITLCRRIS  803
            DNTLWNGSVVAP DAPMRKY++YYRDFVLELNKALA DPRIEICMLPVGDGIT+CRRIS
Sbjct  200  DNTLWNGSVVAPADAPMRKYVRYYRDFVLELNKALAADPRIEICMLPVGDGITICRRIS  258



>gb|AAZ95245.1| putative caffeoyl-CoA O-methyltransferase protein [Isatis tinctoria]
Length=257

 Score =   461 bits (1187),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 216/239 (90%), Positives = 231/239 (97%), Gaps = 0/239 (0%)
 Frame = +3

Query  87   ENQTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEG  266
            ++Q  RHQEVGHKSLLQSD LYQYILETSVYPREPE+MKELREVTAKHPWN+MTTSADEG
Sbjct  19   QSQNLRHQEVGHKSLLQSDDLYQYILETSVYPREPESMKELREVTAKHPWNIMTTSADEG  78

Query  267  QFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAG  446
            QFL+ML+KLINAKNTMEIGVYTGYSLLATALALP+DGKILAMD+NRENYELGLP+IEKAG
Sbjct  79   QFLNMLIKLINAKNTMEIGVYTGYSLLATALALPEDGKILAMDVNRENYELGLPIIEKAG  138

Query  447  VAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIGY  626
            VAHKIDFREGPALP+LDQLV D K HGTYDFIFVDADKDNY+NYHKRLIDLVKVGGVIGY
Sbjct  139  VAHKIDFREGPALPVLDQLVADEKNHGTYDFIFVDADKDNYINYHKRLIDLVKVGGVIGY  198

Query  627  DNTLWNGSVVAPPDAPMRKYIKYYRDFVLELNKALAVDPRIEICMLPVGDGITLCRRIS  803
            DNTLWNGSVVA PDAPMRKY++YYRDFVLELNKALA DPRIEICMLPVGDGIT+CRRI+
Sbjct  199  DNTLWNGSVVAAPDAPMRKYVRYYRDFVLELNKALAADPRIEICMLPVGDGITICRRIN  257



>ref|XP_009341967.1| PREDICTED: caffeoyl-CoA O-methyltransferase-like [Pyrus x bretschneideri]
Length=247

 Score =   461 bits (1186),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 216/238 (91%), Positives = 231/238 (97%), Gaps = 0/238 (0%)
 Frame = +3

Query  87   ENQTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEG  266
            + Q  RHQEVGHKSLLQSDALYQYILETSVYPREPE+MKELREVTAKHPWN+MTTSADEG
Sbjct  9    QTQAGRHQEVGHKSLLQSDALYQYILETSVYPREPESMKELREVTAKHPWNIMTTSADEG  68

Query  267  QFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAG  446
            QFL+MLLKLINAKNTMEIGVYTGYSLLATALA+PDDGKILAMDIN+ENYELGLP+IEKAG
Sbjct  69   QFLNMLLKLINAKNTMEIGVYTGYSLLATALAIPDDGKILAMDINKENYELGLPIIEKAG  128

Query  447  VAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIGY  626
            VAHKIDFREGPALP+LD L+ED K HG+YDFIFVDADKDNY+NYHKRLIDLVKVGG+IGY
Sbjct  129  VAHKIDFREGPALPMLDLLIEDKKNHGSYDFIFVDADKDNYINYHKRLIDLVKVGGLIGY  188

Query  627  DNTLWNGSVVAPPDAPMRKYIKYYRDFVLELNKALAVDPRIEICMLPVGDGITLCRRI  800
            DNTLWNGSVVAPPDAP+RKY++YYRDFVLELNKALA DPRIEICMLPVGDGITLCRRI
Sbjct  189  DNTLWNGSVVAPPDAPLRKYVRYYRDFVLELNKALAADPRIEICMLPVGDGITLCRRI  246



>gb|KHF99603.1| Caffeoyl-CoA O-methyltransferase 1 [Gossypium arboreum]
Length=299

 Score =   463 bits (1191),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 215/238 (90%), Positives = 233/238 (98%), Gaps = 0/238 (0%)
 Frame = +3

Query  87   ENQTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEG  266
            ++Q  RHQEVGHKSLLQSDALYQYILETSVYPREPE MKELRE+TAKHPWNLMTTSADEG
Sbjct  61   QSQAGRHQEVGHKSLLQSDALYQYILETSVYPREPEPMKELRELTAKHPWNLMTTSADEG  120

Query  267  QFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAG  446
            QFL+MLLKLINAKNTMEIGVYTGYSLLATALA+PDDGKILAMD+NRENYELGLPVI+KAG
Sbjct  121  QFLNMLLKLINAKNTMEIGVYTGYSLLATALAIPDDGKILAMDVNRENYELGLPVIQKAG  180

Query  447  VAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIGY  626
            VAHKIDF+EGPALP+LDQLVED K HG++DFIFVDADKDNYLNYHKRLI+LVKVGG+IGY
Sbjct  181  VAHKIDFKEGPALPVLDQLVEDEKNHGSFDFIFVDADKDNYLNYHKRLIELVKVGGLIGY  240

Query  627  DNTLWNGSVVAPPDAPMRKYIKYYRDFVLELNKALAVDPRIEICMLPVGDGITLCRRI  800
            DNTLWNGSVVAPPDAP+RKY++YYRDFV+ELNKALAVDPRIEICMLPVGDGITLCRR+
Sbjct  241  DNTLWNGSVVAPPDAPLRKYVRYYRDFVMELNKALAVDPRIEICMLPVGDGITLCRRV  298



>ref|XP_006487045.1| PREDICTED: caffeoyl-CoA O-methyltransferase-like [Citrus sinensis]
 gb|KDO59750.1| hypothetical protein CISIN_1g025824mg [Citrus sinensis]
Length=247

 Score =   461 bits (1185),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 214/238 (90%), Positives = 232/238 (97%), Gaps = 0/238 (0%)
 Frame = +3

Query  87   ENQTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEG  266
            +NQ  RHQEVGHKSLLQSDALYQYILETSVYPREPE+MKELRE+TAKHPWN+MTTSADEG
Sbjct  9    QNQQGRHQEVGHKSLLQSDALYQYILETSVYPREPESMKELRELTAKHPWNIMTTSADEG  68

Query  267  QFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAG  446
            QFL+MLLKL+NAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVI+KAG
Sbjct  69   QFLNMLLKLVNAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIQKAG  128

Query  447  VAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIGY  626
            VAHKIDFREGPALP+LD L++D K HG++DFIFVDADKDNYLNYHKRLI+LVKVGGVIGY
Sbjct  129  VAHKIDFREGPALPVLDLLIQDEKNHGSFDFIFVDADKDNYLNYHKRLIELVKVGGVIGY  188

Query  627  DNTLWNGSVVAPPDAPMRKYIKYYRDFVLELNKALAVDPRIEICMLPVGDGITLCRRI  800
            DNTLWNGSVVAPPDAP+RKY++YYRDFVLELNKALA DPRIEICMLPVGDG+T+CRRI
Sbjct  189  DNTLWNGSVVAPPDAPLRKYVRYYRDFVLELNKALAADPRIEICMLPVGDGVTICRRI  246



>ref|XP_006339881.1| PREDICTED: caffeoyl-CoA O-methyltransferase-like [Solanum tuberosum]
Length=242

 Score =   461 bits (1185),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 218/242 (90%), Positives = 234/242 (97%), Gaps = 1/242 (0%)
 Frame = +3

Query  81   MAEN-QTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSA  257
            MA N +  RHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELRE+TAKHPWNLMTTSA
Sbjct  1    MASNGENGRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREITAKHPWNLMTTSA  60

Query  258  DEGQFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIE  437
            DEGQFL+MLLKLINAKNTMEIGV+TGYSLLATA+ALPDDGKILAMDINRENYE+GLPVIE
Sbjct  61   DEGQFLNMLLKLINAKNTMEIGVFTGYSLLATAMALPDDGKILAMDINRENYEIGLPVIE  120

Query  438  KAGVAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGV  617
            KAG+AHKI+FREGPALP+LDQ++ED K HG+YDFIFVDADKDNYLNYHKRLIDLVKVGG+
Sbjct  121  KAGLAHKIEFREGPALPVLDQMIEDGKYHGSYDFIFVDADKDNYLNYHKRLIDLVKVGGL  180

Query  618  IGYDNTLWNGSVVAPPDAPMRKYIKYYRDFVLELNKALAVDPRIEICMLPVGDGITLCRR  797
            IGYDNTLWNGSVVAPPDAP+RKY++YYRDFVLELNKALA DPRIEIC LPVGDGITLCRR
Sbjct  181  IGYDNTLWNGSVVAPPDAPLRKYVRYYRDFVLELNKALAADPRIEICQLPVGDGITLCRR  240

Query  798  IS  803
            IS
Sbjct  241  IS  242



>ref|NP_195131.1| putative caffeoyl-CoA O-methyltransferase [Arabidopsis thaliana]
 ref|XP_002869178.1| hypothetical protein ARALYDRAFT_912997 [Arabidopsis lyrata subsp. 
lyrata]
 sp|O49499.1|CAMT4_ARATH RecName: Full=Caffeoyl-CoA O-methyltransferase 1; AltName: Full=Trans-caffeoyl-CoA 
3-O-methyltransferase; Short=CCoAMT; Short=CCoAOMT1 
[Arabidopsis thaliana]
 emb|CAA17567.1| caffeoyl-CoA O-methyltransferase-like protein [Arabidopsis thaliana]
 emb|CAB80122.1| caffeoyl-CoA O-methyltransferase-like protein [Arabidopsis thaliana]
 gb|AAL09793.1| AT4g34050/F28A23_190 [Arabidopsis thaliana]
 gb|AAL32708.1| Phosphoglycerate dehydrogenase - like protein [Arabidopsis thaliana]
 gb|AAM10019.1| phosphoglycerate dehydrogenase-like protein [Arabidopsis thaliana]
 gb|AAN28918.1| At4g34050/F28A23_190 [Arabidopsis thaliana]
 gb|EFH45437.1| hypothetical protein ARALYDRAFT_912997 [Arabidopsis lyrata subsp. 
lyrata]
 gb|AEE86314.1| putative caffeoyl-CoA O-methyltransferase [Arabidopsis thaliana]
Length=259

 Score =   461 bits (1186),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 214/239 (90%), Positives = 232/239 (97%), Gaps = 0/239 (0%)
 Frame = +3

Query  87   ENQTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEG  266
            ++Q  RHQEVGHKSLLQSD LYQYILETSVYPREPE+MKELREVTAKHPWN+MTTSADEG
Sbjct  21   QSQNLRHQEVGHKSLLQSDDLYQYILETSVYPREPESMKELREVTAKHPWNIMTTSADEG  80

Query  267  QFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAG  446
            QFL+ML+KL+NAKNTMEIGVYTGYSLLATALALP+DGKILAMD+NRENYELGLP+IEKAG
Sbjct  81   QFLNMLIKLVNAKNTMEIGVYTGYSLLATALALPEDGKILAMDVNRENYELGLPIIEKAG  140

Query  447  VAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIGY  626
            VAHKIDFREGPALP+LD++V D K HGTYDFIFVDADKDNY+NYHKRLIDLVK+GGVIGY
Sbjct  141  VAHKIDFREGPALPVLDEIVADEKNHGTYDFIFVDADKDNYINYHKRLIDLVKIGGVIGY  200

Query  627  DNTLWNGSVVAPPDAPMRKYIKYYRDFVLELNKALAVDPRIEICMLPVGDGITLCRRIS  803
            DNTLWNGSVVAPPDAPMRKY++YYRDFVLELNKALA DPRIEICMLPVGDGIT+CRRIS
Sbjct  201  DNTLWNGSVVAPPDAPMRKYVRYYRDFVLELNKALAADPRIEICMLPVGDGITICRRIS  259



>ref|XP_008385739.1| PREDICTED: caffeoyl-CoA O-methyltransferase [Malus domestica]
Length=247

 Score =   461 bits (1185),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 216/238 (91%), Positives = 231/238 (97%), Gaps = 0/238 (0%)
 Frame = +3

Query  87   ENQTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEG  266
            + Q  RHQEVGHKSLLQSDALYQYILETSVYPREPE+MKELREVTAKHPWN+MTTSADEG
Sbjct  9    QTQAGRHQEVGHKSLLQSDALYQYILETSVYPREPESMKELREVTAKHPWNIMTTSADEG  68

Query  267  QFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAG  446
            QFL+MLLKLINAKNTMEIGVYTGYSLLATALA+PDDGKILAMDIN+ENYELGLP+IEKAG
Sbjct  69   QFLNMLLKLINAKNTMEIGVYTGYSLLATALAIPDDGKILAMDINKENYELGLPIIEKAG  128

Query  447  VAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIGY  626
            VAHKIDFREGPALP+LD LVED K HG++DFIFVDADKDNY+NYHKRLIDLVKVGG+IGY
Sbjct  129  VAHKIDFREGPALPVLDLLVEDKKNHGSFDFIFVDADKDNYINYHKRLIDLVKVGGLIGY  188

Query  627  DNTLWNGSVVAPPDAPMRKYIKYYRDFVLELNKALAVDPRIEICMLPVGDGITLCRRI  800
            DNTLWNGSVVAPPDAP+RKY++YYRDFVLELNKALA DPRIEICMLPVGDGITLCRRI
Sbjct  189  DNTLWNGSVVAPPDAPLRKYVRYYRDFVLELNKALAADPRIEICMLPVGDGITLCRRI  246



>ref|XP_006339880.1| PREDICTED: caffeoyl-CoA O-methyltransferase-like [Solanum tuberosum]
Length=242

 Score =   461 bits (1185),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 218/242 (90%), Positives = 234/242 (97%), Gaps = 1/242 (0%)
 Frame = +3

Query  81   MAEN-QTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSA  257
            MA N +  RHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELRE+TAKHPWNLMTTSA
Sbjct  1    MASNGENGRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREITAKHPWNLMTTSA  60

Query  258  DEGQFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIE  437
            DEGQFL+MLLKLINAKNTMEIGV+TGYSLLATA+ALPDDGKILAMDINR+NYE+GLPVIE
Sbjct  61   DEGQFLNMLLKLINAKNTMEIGVFTGYSLLATAMALPDDGKILAMDINRDNYEIGLPVIE  120

Query  438  KAGVAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGV  617
            KAG+AHKI+FREGPALP+LDQ++ED K HG+YDFIFVDADKDNYLNYHKRLIDLVKVGGV
Sbjct  121  KAGLAHKIEFREGPALPVLDQMIEDGKYHGSYDFIFVDADKDNYLNYHKRLIDLVKVGGV  180

Query  618  IGYDNTLWNGSVVAPPDAPMRKYIKYYRDFVLELNKALAVDPRIEICMLPVGDGITLCRR  797
            IGYDNTLWNGSVVAPPDAP+RKY++YYRDFVLELNKALA DPRIEIC LPVGDGITLCRR
Sbjct  181  IGYDNTLWNGSVVAPPDAPLRKYVRYYRDFVLELNKALAADPRIEICQLPVGDGITLCRR  240

Query  798  IS  803
            IS
Sbjct  241  IS  242



>gb|ABE60812.1| caffeoyl coenzyme A 3-O-methyltransferase 2 [Leucaena leucocephala]
 gb|ABF74684.1| caffeoyl-CoA-O-methyltransferase [Leucaena leucocephala]
Length=244

 Score =   460 bits (1184),  Expect = 3e-160, Method: Compositional matrix adjust.
 Identities = 216/239 (90%), Positives = 234/239 (98%), Gaps = 0/239 (0%)
 Frame = +3

Query  87   ENQTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEG  266
            +++  RHQEVGHKSLLQSDALYQYILETSVYPREPE MKE+RE+TAKHPWN+MTTSADEG
Sbjct  6    QSEAGRHQEVGHKSLLQSDALYQYILETSVYPREPEPMKEIREITAKHPWNIMTTSADEG  65

Query  267  QFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAG  446
            QFL+MLLKLINAKNTMEIGVYTGYSLLATALALP+DGKILAMDINRENYELGLPVI+KAG
Sbjct  66   QFLNMLLKLINAKNTMEIGVYTGYSLLATALALPEDGKILAMDINRENYELGLPVIQKAG  125

Query  447  VAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIGY  626
            VAHKI+F+EGPALP+LD+LV+D K HG+YDFIFVDADKDNYLNYHKRLIDLVKVGGVIGY
Sbjct  126  VAHKIEFKEGPALPVLDELVKDEKNHGSYDFIFVDADKDNYLNYHKRLIDLVKVGGVIGY  185

Query  627  DNTLWNGSVVAPPDAPMRKYIKYYRDFVLELNKALAVDPRIEICMLPVGDGITLCRRIS  803
            DNTLWNGSVVAPPDAP+RKY++YYRDFVLELNKALAVDPRIEICMLPVGDGITLCRRIS
Sbjct  186  DNTLWNGSVVAPPDAPLRKYVRYYRDFVLELNKALAVDPRIEICMLPVGDGITLCRRIS  244



>emb|CDX72447.1| BnaC07g44690D [Brassica napus]
Length=258

 Score =   461 bits (1186),  Expect = 3e-160, Method: Compositional matrix adjust.
 Identities = 215/239 (90%), Positives = 232/239 (97%), Gaps = 0/239 (0%)
 Frame = +3

Query  87   ENQTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEG  266
            ++Q  RHQEVGHKSLLQSD LYQYILETSVYPREPE+MKELREVTAKHPWN+MTTSADEG
Sbjct  20   QSQNLRHQEVGHKSLLQSDDLYQYILETSVYPREPESMKELREVTAKHPWNIMTTSADEG  79

Query  267  QFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAG  446
            QFL+ML+KL+NAKNTMEIGVYTGYSLLATALALP+DGKILAMD+NRENYELGLP+IEKAG
Sbjct  80   QFLNMLIKLVNAKNTMEIGVYTGYSLLATALALPEDGKILAMDVNRENYELGLPIIEKAG  139

Query  447  VAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIGY  626
            VAHKIDFREGPALP+LD+LV D K HGTYDFIFVDADKDNY+NYHKRLIDLVKVGGVIGY
Sbjct  140  VAHKIDFREGPALPVLDELVADEKNHGTYDFIFVDADKDNYINYHKRLIDLVKVGGVIGY  199

Query  627  DNTLWNGSVVAPPDAPMRKYIKYYRDFVLELNKALAVDPRIEICMLPVGDGITLCRRIS  803
            DNTLWNGSVVAPPDAPMRKY++YYRDFVLELNKALA DPRIEICMLPVGDGIT+CRRI+
Sbjct  200  DNTLWNGSVVAPPDAPMRKYVRYYRDFVLELNKALAADPRIEICMLPVGDGITICRRIN  258



>emb|CAN72492.1| hypothetical protein VITISV_037012 [Vitis vinifera]
Length=247

 Score =   461 bits (1185),  Expect = 3e-160, Method: Compositional matrix adjust.
 Identities = 216/239 (90%), Positives = 232/239 (97%), Gaps = 0/239 (0%)
 Frame = +3

Query  87   ENQTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEG  266
            +NQ  RHQEVGHKSLLQSDALYQYILETSVYPREP+ MKELRE+TAKHPWN+MTTSADEG
Sbjct  9    QNQAGRHQEVGHKSLLQSDALYQYILETSVYPREPKPMKELRELTAKHPWNIMTTSADEG  68

Query  267  QFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAG  446
            QFL+MLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLP+IEKAG
Sbjct  69   QFLNMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPIIEKAG  128

Query  447  VAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIGY  626
            +AHKIDFREGPALP+LDQ++ED K HGT+DFIFVDADKDNYLNYHKRLIDLVKVGG+IGY
Sbjct  129  LAHKIDFREGPALPVLDQMIEDGKYHGTFDFIFVDADKDNYLNYHKRLIDLVKVGGLIGY  188

Query  627  DNTLWNGSVVAPPDAPMRKYIKYYRDFVLELNKALAVDPRIEICMLPVGDGITLCRRIS  803
            DNTLWNGSVVAPPDAP+RKY++YY+DFVLELNKALA DPRIEIC LPVGDGITLCRRIS
Sbjct  189  DNTLWNGSVVAPPDAPLRKYVRYYKDFVLELNKALAADPRIEICQLPVGDGITLCRRIS  247



>gb|AFU54611.1| caffeoyl-CoA O-methyltransferase [Pyrus x bretschneideri]
Length=247

 Score =   460 bits (1184),  Expect = 3e-160, Method: Compositional matrix adjust.
 Identities = 219/244 (90%), Positives = 233/244 (95%), Gaps = 3/244 (1%)
 Frame = +3

Query  78   AMAENQTTR---HQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMT  248
            A  E Q TR   HQEVGHKSLLQSDALYQYILETSVYPREPE+MKELREVTAKHPWN+MT
Sbjct  3    ANGEEQQTRAGRHQEVGHKSLLQSDALYQYILETSVYPREPESMKELREVTAKHPWNIMT  62

Query  249  TSADEGQFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLP  428
            TSADEGQFL+MLLKLINAKNTMEIGVYTGYSLLATALA+PDDGKILAMDIN+ENYELGLP
Sbjct  63   TSADEGQFLNMLLKLINAKNTMEIGVYTGYSLLATALAIPDDGKILAMDINKENYELGLP  122

Query  429  VIEKAGVAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKV  608
            +IEKAGVAHKIDFREGPALP+LD L+ED K HG+YDFIFVDADKDNY+NYHKRLIDLVKV
Sbjct  123  IIEKAGVAHKIDFREGPALPVLDLLIEDKKNHGSYDFIFVDADKDNYINYHKRLIDLVKV  182

Query  609  GGVIGYDNTLWNGSVVAPPDAPMRKYIKYYRDFVLELNKALAVDPRIEICMLPVGDGITL  788
            GG+IGYDNTLWNGSVVAPPDAP+RKY++YYRDFVLELNKALA DPRIEICMLPVGDGITL
Sbjct  183  GGLIGYDNTLWNGSVVAPPDAPLRKYVRYYRDFVLELNKALAADPRIEICMLPVGDGITL  242

Query  789  CRRI  800
            CRRI
Sbjct  243  CRRI  246



>gb|ACY66929.1| caffeoyl-CoA O-methyltransferase 2 [Eucalyptus camaldulensis]
Length=247

 Score =   460 bits (1184),  Expect = 4e-160, Method: Compositional matrix adjust.
 Identities = 215/239 (90%), Positives = 232/239 (97%), Gaps = 0/239 (0%)
 Frame = +3

Query  87   ENQTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEG  266
            + Q  +H EVGHKSLLQSDALYQYILETSVYPREPE+MKELRE+TAKHPWNLMTTSADEG
Sbjct  9    QTQPAKHSEVGHKSLLQSDALYQYILETSVYPREPESMKELREITAKHPWNLMTTSADEG  68

Query  267  QFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAG  446
            QFL+MLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINREN+E+GLPVI+KAG
Sbjct  69   QFLNMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENFEIGLPVIQKAG  128

Query  447  VAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIGY  626
            +AHKIDFREGPALP+LDQLV+D K HGTYDFIFVDADKDNY+NYHKRLIDLVKVGG+IGY
Sbjct  129  LAHKIDFREGPALPLLDQLVQDEKNHGTYDFIFVDADKDNYINYHKRLIDLVKVGGLIGY  188

Query  627  DNTLWNGSVVAPPDAPMRKYIKYYRDFVLELNKALAVDPRIEICMLPVGDGITLCRRIS  803
            DNTLWNGSVVAP DAP+RKY++YYRDFVLELNKALAVDPRIEICMLPVGDGITLCRR+S
Sbjct  189  DNTLWNGSVVAPADAPLRKYVRYYRDFVLELNKALAVDPRIEICMLPVGDGITLCRRVS  247



>gb|ACX37696.1| caffeoyl-CoA O-methyltransferase 2 [Eucalyptus camaldulensis]
Length=247

 Score =   460 bits (1184),  Expect = 4e-160, Method: Compositional matrix adjust.
 Identities = 215/239 (90%), Positives = 232/239 (97%), Gaps = 0/239 (0%)
 Frame = +3

Query  87   ENQTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEG  266
            + Q  +H EVGHKSLLQSDALYQYILETSVYPREPE+MKELRE+TAKHPWNLMTTSADEG
Sbjct  9    QTQPAKHSEVGHKSLLQSDALYQYILETSVYPREPESMKELREITAKHPWNLMTTSADEG  68

Query  267  QFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAG  446
            QFL+MLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINREN+E+GLPVI+KAG
Sbjct  69   QFLNMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENFEIGLPVIQKAG  128

Query  447  VAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIGY  626
            +AHKIDFREGPALP+LDQLV+D K HGTYDFIFVDADKDNY+NYHKRLIDLVKVGG+IGY
Sbjct  129  LAHKIDFREGPALPLLDQLVQDEKNHGTYDFIFVDADKDNYVNYHKRLIDLVKVGGLIGY  188

Query  627  DNTLWNGSVVAPPDAPMRKYIKYYRDFVLELNKALAVDPRIEICMLPVGDGITLCRRIS  803
            DNTLWNGSVVAP DAP+RKY++YYRDFVLELNKALAVDPRIEICMLPVGDGITLCRR+S
Sbjct  189  DNTLWNGSVVAPADAPLRKYVRYYRDFVLELNKALAVDPRIEICMLPVGDGITLCRRVS  247



>ref|XP_008454948.1| PREDICTED: caffeoyl-CoA O-methyltransferase 5 [Cucumis melo]
Length=249

 Score =   460 bits (1184),  Expect = 4e-160, Method: Compositional matrix adjust.
 Identities = 216/239 (90%), Positives = 230/239 (96%), Gaps = 0/239 (0%)
 Frame = +3

Query  87   ENQTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEG  266
            +NQ  RHQEVGHKSLLQSDALYQYILETSVYPREPE+MKELRE+TAKHPWN+MTTSADEG
Sbjct  11   QNQAGRHQEVGHKSLLQSDALYQYILETSVYPREPESMKELRELTAKHPWNIMTTSADEG  70

Query  267  QFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAG  446
            QFL+MLLKLINAK TMEIGVYTGYSLLATALALP+DG ILAMDINRENYELGLPVIEKAG
Sbjct  71   QFLNMLLKLINAKKTMEIGVYTGYSLLATALALPEDGTILAMDINRENYELGLPVIEKAG  130

Query  447  VAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIGY  626
            VAHKI+F+EGPALP+LD +V D K HG+YDFIFVDADKDNY+NYHKRLIDLVKVGGVIGY
Sbjct  131  VAHKIEFKEGPALPVLDDMVADKKNHGSYDFIFVDADKDNYINYHKRLIDLVKVGGVIGY  190

Query  627  DNTLWNGSVVAPPDAPMRKYIKYYRDFVLELNKALAVDPRIEICMLPVGDGITLCRRIS  803
            DNTLWNGSVVAPPDAPMRKY++YYRDFVLELNKALA DPRIEICMLPVGDGITLCRRIS
Sbjct  191  DNTLWNGSVVAPPDAPMRKYVRYYRDFVLELNKALAADPRIEICMLPVGDGITLCRRIS  249



>gb|AFG17073.1| caffeoyl-CoA O-methyltransferase [Paeonia lactiflora]
Length=247

 Score =   460 bits (1183),  Expect = 4e-160, Method: Compositional matrix adjust.
 Identities = 219/247 (89%), Positives = 233/247 (94%), Gaps = 6/247 (2%)
 Frame = +3

Query  81   MAENQTT------RHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNL  242
            MA NQT       RHQEVGHKSLLQSDALYQYILETSVYPREPE MKELREVTAKHPWN+
Sbjct  1    MASNQTEQGSQGGRHQEVGHKSLLQSDALYQYILETSVYPREPEPMKELREVTAKHPWNI  60

Query  243  MTTSADEGQFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELG  422
            MTTSADEGQFL+ML+KLINAKNTMEIGVYTGYSLLATALALPDDGK+LAMDINRENYELG
Sbjct  61   MTTSADEGQFLNMLIKLINAKNTMEIGVYTGYSLLATALALPDDGKVLAMDINRENYELG  120

Query  423  LPVIEKAGVAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLV  602
            LP+IEKAGVAHKIDFREGPALP+LDQ+++D K HGT+DFIFVDADKDNY+NYHKRLIDLV
Sbjct  121  LPIIEKAGVAHKIDFREGPALPVLDQMIQDGKYHGTFDFIFVDADKDNYINYHKRLIDLV  180

Query  603  KVGGVIGYDNTLWNGSVVAPPDAPMRKYIKYYRDFVLELNKALAVDPRIEICMLPVGDGI  782
            KVGGVIGYDNTLWNGSVVAPPDAP+RKY++YYRDFVLELNKALA D RIEIC LPVGDGI
Sbjct  181  KVGGVIGYDNTLWNGSVVAPPDAPLRKYVRYYRDFVLELNKALAADQRIEICQLPVGDGI  240

Query  783  TLCRRIS  803
            TLCRRIS
Sbjct  241  TLCRRIS  247



>ref|XP_011088234.1| PREDICTED: caffeoyl-CoA O-methyltransferase [Sesamum indicum]
Length=244

 Score =   460 bits (1183),  Expect = 4e-160, Method: Compositional matrix adjust.
 Identities = 217/240 (90%), Positives = 230/240 (96%), Gaps = 0/240 (0%)
 Frame = +3

Query  84   AENQTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADE  263
             EN   RHQEVGHKSLLQSDALYQYILETSVYP+EPE MKELRE+TAKHPWN+MTTSADE
Sbjct  5    GENNAGRHQEVGHKSLLQSDALYQYILETSVYPKEPEPMKELREITAKHPWNIMTTSADE  64

Query  264  GQFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKA  443
            GQFL+MLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVI+KA
Sbjct  65   GQFLNMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIKKA  124

Query  444  GVAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIG  623
            GVAHKIDFREGPALP+LDQ++ D K HGT+DFIFVDADKDNYLNYHKRLIDLVK+GGVIG
Sbjct  125  GVAHKIDFREGPALPVLDQMIADGKYHGTFDFIFVDADKDNYLNYHKRLIDLVKIGGVIG  184

Query  624  YDNTLWNGSVVAPPDAPMRKYIKYYRDFVLELNKALAVDPRIEICMLPVGDGITLCRRIS  803
            YDNTLWNGSVVAPPDAPMRKY++YYR+FVLELNKALA DPRIEIC LPVGDGITLCRRIS
Sbjct  185  YDNTLWNGSVVAPPDAPMRKYVRYYREFVLELNKALAADPRIEICQLPVGDGITLCRRIS  244



>ref|XP_006856484.1| PREDICTED: caffeoyl-CoA O-methyltransferase [Amborella trichopoda]
 gb|ERN17951.1| hypothetical protein AMTR_s00046p00069700 [Amborella trichopoda]
Length=246

 Score =   460 bits (1183),  Expect = 5e-160, Method: Compositional matrix adjust.
 Identities = 214/243 (88%), Positives = 233/243 (96%), Gaps = 0/243 (0%)
 Frame = +3

Query  75   KAMAENQTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTS  254
            K   + Q  RHQEVGHKSLLQSD LYQYILETSVYPREPE+MKELRE+TAKHPWN+MTTS
Sbjct  4    KQEEQQQVGRHQEVGHKSLLQSDELYQYILETSVYPREPESMKELREITAKHPWNIMTTS  63

Query  255  ADEGQFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVI  434
            ADEGQFL++LLKLINAKNTMEIGVYTGYSLLATALALPDDGKI+AMDIN+ENYELGLPVI
Sbjct  64   ADEGQFLNLLLKLINAKNTMEIGVYTGYSLLATALALPDDGKIIAMDINKENYELGLPVI  123

Query  435  EKAGVAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGG  614
            EKAGVAHKIDFREGPALP+LDQ++ED K HG++DFIFVDADKDNYLNYHKRLI+LVKVGG
Sbjct  124  EKAGVAHKIDFREGPALPVLDQMLEDEKYHGSFDFIFVDADKDNYLNYHKRLIELVKVGG  183

Query  615  VIGYDNTLWNGSVVAPPDAPMRKYIKYYRDFVLELNKALAVDPRIEICMLPVGDGITLCR  794
            VIGYDNTLWNGSVVAPPDAP+RKY++YYRDFV+ELNKALAVDPRIEIC LPVGDGITLCR
Sbjct  184  VIGYDNTLWNGSVVAPPDAPLRKYVRYYRDFVIELNKALAVDPRIEICQLPVGDGITLCR  243

Query  795  RIS  803
            R+S
Sbjct  244  RVS  246



>gb|ACQ59095.1| caffeoyl CoA O-methyltransferase 1 [Gossypium hirsutum]
Length=250

 Score =   460 bits (1183),  Expect = 5e-160, Method: Compositional matrix adjust.
 Identities = 214/238 (90%), Positives = 233/238 (98%), Gaps = 0/238 (0%)
 Frame = +3

Query  87   ENQTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEG  266
            ++Q  RHQEVGHKSLLQSDALYQYILETSVYPREPE MKELRE+TAKHPWNLMTTSADEG
Sbjct  12   QSQAGRHQEVGHKSLLQSDALYQYILETSVYPREPEPMKELREITAKHPWNLMTTSADEG  71

Query  267  QFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAG  446
            QFL+MLLKLINAKNTMEIGVYTGYSLLATALA+PDDGKILAMDINRENYELGLPVI+KAG
Sbjct  72   QFLNMLLKLINAKNTMEIGVYTGYSLLATALAVPDDGKILAMDINRENYELGLPVIQKAG  131

Query  447  VAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIGY  626
            VAHKIDF+EGPA+P+LD+LV+D K HG++DFIFVDADKDNYLNYHKRLI+LVKVGG+IGY
Sbjct  132  VAHKIDFKEGPAMPVLDELVQDEKNHGSFDFIFVDADKDNYLNYHKRLIELVKVGGLIGY  191

Query  627  DNTLWNGSVVAPPDAPMRKYIKYYRDFVLELNKALAVDPRIEICMLPVGDGITLCRRI  800
            DNTLWNGSVVAPPDAP+RKY++YYRDFVLELNKALAVDPRIEICMLPVGDGITLCRR+
Sbjct  192  DNTLWNGSVVAPPDAPLRKYVRYYRDFVLELNKALAVDPRIEICMLPVGDGITLCRRL  249



>ref|XP_004231857.1| PREDICTED: caffeoyl-CoA O-methyltransferase-like [Solanum lycopersicum]
Length=242

 Score =   459 bits (1182),  Expect = 6e-160, Method: Compositional matrix adjust.
 Identities = 214/241 (89%), Positives = 233/241 (97%), Gaps = 0/241 (0%)
 Frame = +3

Query  81   MAENQTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSAD  260
            M+  + +RHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELRE+TAKHPWNLMTTSAD
Sbjct  2    MSNGENSRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREITAKHPWNLMTTSAD  61

Query  261  EGQFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEK  440
            EGQFL+MLLKLINAKNTMEIGV+TGYSLLATA+ALPDDGKILAMDINR+NYE+GLPVIEK
Sbjct  62   EGQFLNMLLKLINAKNTMEIGVFTGYSLLATAMALPDDGKILAMDINRDNYEIGLPVIEK  121

Query  441  AGVAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVI  620
            AG+AHKI+FREGPALP+LDQ++ED + HG+YDFIFVDADKDNYLNYHKRLIDLVKVGGVI
Sbjct  122  AGLAHKIEFREGPALPVLDQMIEDGQYHGSYDFIFVDADKDNYLNYHKRLIDLVKVGGVI  181

Query  621  GYDNTLWNGSVVAPPDAPMRKYIKYYRDFVLELNKALAVDPRIEICMLPVGDGITLCRRI  800
            GYDNTLWNGSVVAPPDAP+RKY++YYRDFVLELNKALA D RIEIC LPVGDGITLCRRI
Sbjct  182  GYDNTLWNGSVVAPPDAPLRKYVRYYRDFVLELNKALAADSRIEICQLPVGDGITLCRRI  241

Query  801  S  803
            S
Sbjct  242  S  242



>emb|CDY49272.1| BnaA03g50850D [Brassica napus]
Length=258

 Score =   460 bits (1184),  Expect = 6e-160, Method: Compositional matrix adjust.
 Identities = 214/239 (90%), Positives = 232/239 (97%), Gaps = 0/239 (0%)
 Frame = +3

Query  87   ENQTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEG  266
            ++Q  RHQEVGHKSLLQSD LYQYILETSVYPREPE+MKELREVTAKHPWN+MTTSADEG
Sbjct  20   QSQNLRHQEVGHKSLLQSDDLYQYILETSVYPREPESMKELREVTAKHPWNIMTTSADEG  79

Query  267  QFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAG  446
            QFL+ML+KL+NAKNTMEIGVYTGYSLLATALALP+DGKILAMD+NRENYELGLP+IEKAG
Sbjct  80   QFLNMLIKLVNAKNTMEIGVYTGYSLLATALALPEDGKILAMDVNRENYELGLPIIEKAG  139

Query  447  VAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIGY  626
            VAHKIDFREGPALP+LD+LV D K HGTYDFIFVDADKDNY+NYHKRLIDLVKVGGVIGY
Sbjct  140  VAHKIDFREGPALPVLDELVADEKNHGTYDFIFVDADKDNYINYHKRLIDLVKVGGVIGY  199

Query  627  DNTLWNGSVVAPPDAPMRKYIKYYRDFVLELNKALAVDPRIEICMLPVGDGITLCRRIS  803
            DNTLWNGSVVAPPDAPMRKY++YYRDFV+ELNKALA DPRIEICMLPVGDGIT+CRRI+
Sbjct  200  DNTLWNGSVVAPPDAPMRKYVRYYRDFVIELNKALAADPRIEICMLPVGDGITICRRIN  258



>ref|XP_010432473.1| PREDICTED: caffeoyl-CoA O-methyltransferase 1 [Camelina sativa]
Length=258

 Score =   460 bits (1183),  Expect = 7e-160, Method: Compositional matrix adjust.
 Identities = 214/239 (90%), Positives = 231/239 (97%), Gaps = 0/239 (0%)
 Frame = +3

Query  87   ENQTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEG  266
            ++Q  RHQEVGHKSLLQSD LYQYILETSVYPREPE+MKELREVTAKHPWN+MTTSADEG
Sbjct  20   QSQNLRHQEVGHKSLLQSDDLYQYILETSVYPREPESMKELREVTAKHPWNIMTTSADEG  79

Query  267  QFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAG  446
            QFL+ML+KL+NAKNTMEIGVYTGYSLLATALALP+DGKILAMD+NRENYELGLP+IEKAG
Sbjct  80   QFLNMLIKLVNAKNTMEIGVYTGYSLLATALALPEDGKILAMDVNRENYELGLPIIEKAG  139

Query  447  VAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIGY  626
            VAHKIDFREGPALP+LD++V D K HGTYDFIFVDADKDNY+NYHKRLIDLVKVGGVIGY
Sbjct  140  VAHKIDFREGPALPVLDEIVADEKNHGTYDFIFVDADKDNYINYHKRLIDLVKVGGVIGY  199

Query  627  DNTLWNGSVVAPPDAPMRKYIKYYRDFVLELNKALAVDPRIEICMLPVGDGITLCRRIS  803
            DNTLWNGSVVAP DAPMRKY++YYRDFVLELNKALA DPRIEICMLPVGDGIT+CRRIS
Sbjct  200  DNTLWNGSVVAPADAPMRKYVRYYRDFVLELNKALAADPRIEICMLPVGDGITICRRIS  258



>gb|ACZ06244.1| caffeoyl-CoA O-methyltransferase 1 [Gossypium hirsutum]
 gb|KJB79352.1| hypothetical protein B456_013G045300 [Gossypium raimondii]
Length=250

 Score =   460 bits (1183),  Expect = 7e-160, Method: Compositional matrix adjust.
 Identities = 214/238 (90%), Positives = 232/238 (97%), Gaps = 0/238 (0%)
 Frame = +3

Query  87   ENQTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEG  266
            ++Q  RHQEVGHKSLLQSDALYQYILETSVYPREPE MKELRE+TAKHPWNLMTTSADEG
Sbjct  12   QSQAGRHQEVGHKSLLQSDALYQYILETSVYPREPEPMKELREITAKHPWNLMTTSADEG  71

Query  267  QFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAG  446
            QFL+MLLKLINAKNTMEIGVYTGYSLLATALALPDDGKI AMDINRENYELGLPVI+KAG
Sbjct  72   QFLNMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKIFAMDINRENYELGLPVIQKAG  131

Query  447  VAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIGY  626
            VAHKIDF+EGPA+P+LD+LV+D K HG++DFIFVDADKDNYLNYHKRLI+LVKVGG+IGY
Sbjct  132  VAHKIDFKEGPAMPVLDELVQDEKNHGSFDFIFVDADKDNYLNYHKRLIELVKVGGLIGY  191

Query  627  DNTLWNGSVVAPPDAPMRKYIKYYRDFVLELNKALAVDPRIEICMLPVGDGITLCRRI  800
            DNTLWNGSVVAPPDAP+RKY++YYRDFVLELNKALAVDPRIEICMLPVGDGITLCRR+
Sbjct  192  DNTLWNGSVVAPPDAPLRKYVRYYRDFVLELNKALAVDPRIEICMLPVGDGITLCRRL  249



>ref|XP_010437675.1| PREDICTED: caffeoyl-CoA O-methyltransferase 1-like [Camelina 
sativa]
Length=258

 Score =   460 bits (1183),  Expect = 7e-160, Method: Compositional matrix adjust.
 Identities = 214/239 (90%), Positives = 231/239 (97%), Gaps = 0/239 (0%)
 Frame = +3

Query  87   ENQTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEG  266
            ++Q  RHQEVGHKSLLQSD LYQYILETSVYPREPE+MKELREVTAKHPWN+MTTSADEG
Sbjct  20   QSQNLRHQEVGHKSLLQSDDLYQYILETSVYPREPESMKELREVTAKHPWNIMTTSADEG  79

Query  267  QFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAG  446
            QFL+ML+KL+NAKNTMEIGVYTGYSLLATALALP+DGKILAMD+NRENYELGLP+IEKAG
Sbjct  80   QFLNMLIKLVNAKNTMEIGVYTGYSLLATALALPEDGKILAMDVNRENYELGLPIIEKAG  139

Query  447  VAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIGY  626
            VAHKIDFREGPALP+LD++V D K HGTYDFIFVDADKDNY+NYHKRLIDLVKVGGVIGY
Sbjct  140  VAHKIDFREGPALPVLDEIVADEKNHGTYDFIFVDADKDNYINYHKRLIDLVKVGGVIGY  199

Query  627  DNTLWNGSVVAPPDAPMRKYIKYYRDFVLELNKALAVDPRIEICMLPVGDGITLCRRIS  803
            DNTLWNGSVVAP DAPMRKY++YYRDFVLELNKALA DPRIEICMLPVGDGIT+CRRIS
Sbjct  200  DNTLWNGSVVAPADAPMRKYVRYYRDFVLELNKALAADPRIEICMLPVGDGITICRRIS  258



>ref|XP_004231856.1| PREDICTED: caffeoyl-CoA O-methyltransferase [Solanum lycopersicum]
Length=242

 Score =   459 bits (1181),  Expect = 8e-160, Method: Compositional matrix adjust.
 Identities = 217/242 (90%), Positives = 234/242 (97%), Gaps = 1/242 (0%)
 Frame = +3

Query  81   MAEN-QTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSA  257
            MA N +  RHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELRE+TAKHPWNLMTTSA
Sbjct  1    MASNGENGRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREITAKHPWNLMTTSA  60

Query  258  DEGQFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIE  437
            DEGQFL+MLLKLINAKNTMEIGV+TGYSLLATA+ALPDDGKILAMDINR+NYE+GLPVIE
Sbjct  61   DEGQFLNMLLKLINAKNTMEIGVFTGYSLLATAMALPDDGKILAMDINRDNYEIGLPVIE  120

Query  438  KAGVAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGV  617
            KAG+AHKI+FREGPALP+LDQ++ED + HG+YDFIFVDADKDNYLNYHKRLIDLVKVGGV
Sbjct  121  KAGLAHKIEFREGPALPVLDQMIEDGQYHGSYDFIFVDADKDNYLNYHKRLIDLVKVGGV  180

Query  618  IGYDNTLWNGSVVAPPDAPMRKYIKYYRDFVLELNKALAVDPRIEICMLPVGDGITLCRR  797
            IGYDNTLWNGSVVAPPDAP+RKY++YYRDFVLELNKALA DPRIEIC LPVGDGITLCRR
Sbjct  181  IGYDNTLWNGSVVAPPDAPLRKYVRYYRDFVLELNKALAADPRIEICQLPVGDGITLCRR  240

Query  798  IS  803
            IS
Sbjct  241  IS  242



>gb|AFZ76980.1| caffeoyl-CoA O-methyltransferase [Eriobotrya japonica]
Length=247

 Score =   459 bits (1181),  Expect = 1e-159, Method: Compositional matrix adjust.
 Identities = 214/238 (90%), Positives = 231/238 (97%), Gaps = 0/238 (0%)
 Frame = +3

Query  87   ENQTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEG  266
            + Q  RHQEVGHKSLLQSDALYQYILETSVYPREPE+MKELREVTAKHPWN+MTTSADEG
Sbjct  9    QTQAGRHQEVGHKSLLQSDALYQYILETSVYPREPESMKELREVTAKHPWNIMTTSADEG  68

Query  267  QFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAG  446
            QFL+MLLKLINAKNTMEIGVYTGYSLLATALA+PDDGKILAMDIN+ENYELGLP+IEKAG
Sbjct  69   QFLNMLLKLINAKNTMEIGVYTGYSLLATALAIPDDGKILAMDINKENYELGLPIIEKAG  128

Query  447  VAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIGY  626
            VAHKIDFREGPALP+LD LVED K HG++DFIFVDADKDNY+NYHKRLIDLVKVGG+IGY
Sbjct  129  VAHKIDFREGPALPVLDLLVEDKKNHGSFDFIFVDADKDNYINYHKRLIDLVKVGGLIGY  188

Query  627  DNTLWNGSVVAPPDAPMRKYIKYYRDFVLELNKALAVDPRIEICMLPVGDGITLCRRI  800
            DNTLWNGSVVAPPDAP+RKY++YYRDFVLELN+ALA DPR+EICMLPVGDGITLCRRI
Sbjct  189  DNTLWNGSVVAPPDAPLRKYVRYYRDFVLELNRALAADPRVEICMLPVGDGITLCRRI  246



>ref|XP_011000746.1| PREDICTED: caffeoyl-CoA O-methyltransferase 1 [Populus euphratica]
Length=247

 Score =   459 bits (1181),  Expect = 1e-159, Method: Compositional matrix adjust.
 Identities = 213/239 (89%), Positives = 232/239 (97%), Gaps = 0/239 (0%)
 Frame = +3

Query  87   ENQTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEG  266
            +NQ  RHQEVGHKSLLQSDALYQYILETSVYP+EPE MKELREVTAKHPWN+MTTSADEG
Sbjct  9    QNQAGRHQEVGHKSLLQSDALYQYILETSVYPKEPECMKELREVTAKHPWNIMTTSADEG  68

Query  267  QFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAG  446
            QFL+MLLKL+NAKNTMEIGVYTGYSLLATALA+P+DGKILAMDINRENYELGLPVI+KAG
Sbjct  69   QFLNMLLKLVNAKNTMEIGVYTGYSLLATALAIPEDGKILAMDINRENYELGLPVIQKAG  128

Query  447  VAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIGY  626
            VAHKIDF+EGPALP+LDQ++ED K HG++DFIFVDADKDNY+NYHKRLI+LVKVGG+IGY
Sbjct  129  VAHKIDFKEGPALPVLDQMIEDGKCHGSFDFIFVDADKDNYINYHKRLIELVKVGGLIGY  188

Query  627  DNTLWNGSVVAPPDAPMRKYIKYYRDFVLELNKALAVDPRIEICMLPVGDGITLCRRIS  803
            DNTLWNGSVVAPPDAPMRKY++YYRDFVLELNKALA DPRIEICMLPVGDGITLCRRI 
Sbjct  189  DNTLWNGSVVAPPDAPMRKYVRYYRDFVLELNKALAADPRIEICMLPVGDGITLCRRIQ  247



>ref|XP_002313125.1| caffeoyl-CoA O-methyltransferase family protein [Populus trichocarpa]
 sp|O65862.1|CAMT1_POPTR RecName: Full=Caffeoyl-CoA O-methyltransferase 1; AltName: Full=Trans-caffeoyl-CoA 
3-O-methyltransferase 1; Short=CCoAMT-1; 
Short=CCoAOMT-1 [Populus trichocarpa]
 emb|CAA12198.1| caffeoyl-CoA 3-O-methyltransferase [Populus trichocarpa]
 emb|CAA11496.1| caffeoyl CoA 3-O-methyltransferase [Populus trichocarpa]
 gb|ABK93314.1| unknown [Populus trichocarpa]
 gb|ACC63876.1| trans-caffeoyl-CoA 3-O-methyltransferase [Populus trichocarpa]
 gb|EEE87080.1| caffeoyl-CoA O-methyltransferase family protein [Populus trichocarpa]
 gb|AFZ78547.1| caffeoyl-CoA O-methyltransferase [Populus tomentosa]
Length=247

 Score =   459 bits (1180),  Expect = 1e-159, Method: Compositional matrix adjust.
 Identities = 213/239 (89%), Positives = 232/239 (97%), Gaps = 0/239 (0%)
 Frame = +3

Query  87   ENQTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEG  266
            ++Q  RHQEVGHKSLLQSDALYQYILETSVYPREPE MKELREVTAKHPWN+MTTSADEG
Sbjct  9    QSQAGRHQEVGHKSLLQSDALYQYILETSVYPREPECMKELREVTAKHPWNIMTTSADEG  68

Query  267  QFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAG  446
            QFL+MLLKL+NAKNTMEIGVYTGYSLLATALA+P+DGKILAMDINRENYELGLPVI+KAG
Sbjct  69   QFLNMLLKLVNAKNTMEIGVYTGYSLLATALAIPEDGKILAMDINRENYELGLPVIQKAG  128

Query  447  VAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIGY  626
            VAHKIDF+EGPALP+LDQ++ED K HG++DFIFVDADKDNY+NYHKRLI+LVKVGG+IGY
Sbjct  129  VAHKIDFKEGPALPVLDQMIEDGKCHGSFDFIFVDADKDNYINYHKRLIELVKVGGLIGY  188

Query  627  DNTLWNGSVVAPPDAPMRKYIKYYRDFVLELNKALAVDPRIEICMLPVGDGITLCRRIS  803
            DNTLWNGSVVAPPDAPMRKY++YYRDFVLELNKALA DPRIEICMLPVGDGITLCRRI 
Sbjct  189  DNTLWNGSVVAPPDAPMRKYVRYYRDFVLELNKALAADPRIEICMLPVGDGITLCRRIQ  247



>ref|XP_009345067.1| PREDICTED: caffeoyl-CoA O-methyltransferase [Pyrus x bretschneideri]
 ref|XP_009345068.1| PREDICTED: caffeoyl-CoA O-methyltransferase [Pyrus x bretschneideri]
Length=247

 Score =   459 bits (1180),  Expect = 1e-159, Method: Compositional matrix adjust.
 Identities = 215/238 (90%), Positives = 231/238 (97%), Gaps = 0/238 (0%)
 Frame = +3

Query  87   ENQTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEG  266
            + Q  RHQEVGHKSLLQSDALYQYILETSVYPREPE+MKELREVTAKHPWN+MTTSADEG
Sbjct  9    QTQAGRHQEVGHKSLLQSDALYQYILETSVYPREPESMKELREVTAKHPWNIMTTSADEG  68

Query  267  QFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAG  446
            QFL+MLLKLINAKNTMEIGVYTGYSLLATALA+PDDGKILAMDIN+ENYELGLP+IEKAG
Sbjct  69   QFLNMLLKLINAKNTMEIGVYTGYSLLATALAIPDDGKILAMDINKENYELGLPIIEKAG  128

Query  447  VAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIGY  626
            VAHKIDFREGPALP+LD LVED K +G++DFIFVDADKDNY+NYHKRLIDLVKVGG+IGY
Sbjct  129  VAHKIDFREGPALPVLDLLVEDKKNYGSFDFIFVDADKDNYINYHKRLIDLVKVGGLIGY  188

Query  627  DNTLWNGSVVAPPDAPMRKYIKYYRDFVLELNKALAVDPRIEICMLPVGDGITLCRRI  800
            DNTLWNGSVVAPPDAP+RKY++YYRDFVLELNKALA DPRIEICMLPVGDGITLCRRI
Sbjct  189  DNTLWNGSVVAPPDAPLRKYVRYYRDFVLELNKALAADPRIEICMLPVGDGITLCRRI  246



>gb|KHG18720.1| Caffeoyl-CoA O-methyltransferase 1 [Gossypium arboreum]
Length=248

 Score =   459 bits (1180),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 215/238 (90%), Positives = 232/238 (97%), Gaps = 0/238 (0%)
 Frame = +3

Query  87   ENQTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEG  266
            ++   RHQEVGHKSLLQSDALYQYILETSVYPREPE MKELRE+TAKHPWNLMTTSADEG
Sbjct  10   QSAAGRHQEVGHKSLLQSDALYQYILETSVYPREPEPMKELRELTAKHPWNLMTTSADEG  69

Query  267  QFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAG  446
            QFL+MLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVI+KAG
Sbjct  70   QFLNMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIQKAG  129

Query  447  VAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIGY  626
            VAHKI+F+EGPA+P+LD+LVED K HG+YDFIFVDADKDNYLNYHKRLI+LVKVGG+IGY
Sbjct  130  VAHKIEFKEGPAMPVLDKLVEDEKNHGSYDFIFVDADKDNYLNYHKRLIELVKVGGLIGY  189

Query  627  DNTLWNGSVVAPPDAPMRKYIKYYRDFVLELNKALAVDPRIEICMLPVGDGITLCRRI  800
            DNTLWNGSVVAPPDAP+RKY++YYRDFVLELNKALAVDPRIEICMLPVGDGITLCRR+
Sbjct  190  DNTLWNGSVVAPPDAPLRKYVRYYRDFVLELNKALAVDPRIEICMLPVGDGITLCRRV  247



>sp|Q43095.1|CAMT_POPTM RecName: Full=Caffeoyl-CoA O-methyltransferase; AltName: Full=Trans-caffeoyl-CoA 
3-O-methyltransferase; Short=CCoAMT; Short=CCoAOMT 
[Populus tremuloides]
 gb|AAA80651.1| caffeoyl-CoA 3-O-methyltransferase [Populus tremuloides]
Length=247

 Score =   459 bits (1180),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 213/239 (89%), Positives = 232/239 (97%), Gaps = 0/239 (0%)
 Frame = +3

Query  87   ENQTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEG  266
            ++Q  RHQEVGHKSLLQSDALYQYILETSVYPREPE MKELREVTAKHPWN+MTTSADEG
Sbjct  9    QSQAGRHQEVGHKSLLQSDALYQYILETSVYPREPECMKELREVTAKHPWNIMTTSADEG  68

Query  267  QFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAG  446
            QFL+MLLKL+NAKNTMEIGVYTGYSLLATALA+P+DGKILAMDINRENYELGLPVI+KAG
Sbjct  69   QFLNMLLKLVNAKNTMEIGVYTGYSLLATALAIPEDGKILAMDINRENYELGLPVIQKAG  128

Query  447  VAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIGY  626
            VAHKIDF+EGPALP+LDQ++ED K HG++DFIFVDADKDNY+NYHKRLI+LVKVGG+IGY
Sbjct  129  VAHKIDFKEGPALPVLDQMIEDGKYHGSFDFIFVDADKDNYINYHKRLIELVKVGGLIGY  188

Query  627  DNTLWNGSVVAPPDAPMRKYIKYYRDFVLELNKALAVDPRIEICMLPVGDGITLCRRIS  803
            DNTLWNGSVVAPPDAPMRKY++YYRDFVLELNKALA DPRIEICMLPVGDGITLCRRI 
Sbjct  189  DNTLWNGSVVAPPDAPMRKYVRYYRDFVLELNKALAADPRIEICMLPVGDGITLCRRIQ  247



>emb|CBI32387.3| unnamed protein product [Vitis vinifera]
Length=242

 Score =   458 bits (1179),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 213/239 (89%), Positives = 233/239 (97%), Gaps = 0/239 (0%)
 Frame = +3

Query  87   ENQTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEG  266
            + +  RHQEVGHKSLLQSDALYQYILETSVYPREPE+MKELRE+TA+HPWN+MTTSADEG
Sbjct  4    KQEAGRHQEVGHKSLLQSDALYQYILETSVYPREPESMKELRELTAQHPWNIMTTSADEG  63

Query  267  QFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAG  446
            QFL+MLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDIN+ENYELGLPVI+KAG
Sbjct  64   QFLNMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINKENYELGLPVIQKAG  123

Query  447  VAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIGY  626
            VAHKIDF+EGPALP+LDQ++ED K HG++DFIFVDADKDNYLNYHKRLIDLVKVGG+IGY
Sbjct  124  VAHKIDFKEGPALPVLDQMIEDGKYHGSFDFIFVDADKDNYLNYHKRLIDLVKVGGIIGY  183

Query  627  DNTLWNGSVVAPPDAPMRKYIKYYRDFVLELNKALAVDPRIEICMLPVGDGITLCRRIS  803
            DNTLWNGSVVAPPDAP+RKY++YYRDFVLELNKALA DPRIEICMLPVGDGITLCRR+S
Sbjct  184  DNTLWNGSVVAPPDAPLRKYVRYYRDFVLELNKALAADPRIEICMLPVGDGITLCRRLS  242



>ref|XP_011092559.1| PREDICTED: caffeoyl-CoA O-methyltransferase-like [Sesamum indicum]
Length=247

 Score =   458 bits (1179),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 215/239 (90%), Positives = 229/239 (96%), Gaps = 0/239 (0%)
 Frame = +3

Query  87   ENQTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEG  266
            ENQ  RHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELRE+TAKHPWN+MTTSADEG
Sbjct  9    ENQAGRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREITAKHPWNIMTTSADEG  68

Query  267  QFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAG  446
            QFL+MLLKL+NAKNTMEIGVYTGYSLLATALALP D KILAMDINRENYELGLPVI+KAG
Sbjct  69   QFLNMLLKLMNAKNTMEIGVYTGYSLLATALALPHDAKILAMDINRENYELGLPVIQKAG  128

Query  447  VAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIGY  626
            VAHKI F+EGPALP+LDQ+++D K HGT+DFIFVDADKDNYLNYHKRLIDLVK+GGVIGY
Sbjct  129  VAHKIHFKEGPALPLLDQMIQDGKYHGTFDFIFVDADKDNYLNYHKRLIDLVKIGGVIGY  188

Query  627  DNTLWNGSVVAPPDAPMRKYIKYYRDFVLELNKALAVDPRIEICMLPVGDGITLCRRIS  803
            DNTLWNGSVVAPPDAPMRKY++YYRDFVLELNKALA DPRIEIC LPVGDGITLCRR S
Sbjct  189  DNTLWNGSVVAPPDAPMRKYVRYYRDFVLELNKALAADPRIEICQLPVGDGITLCRRAS  247



>ref|XP_010066009.1| PREDICTED: caffeoyl-CoA O-methyltransferase 2 [Eucalyptus grandis]
 gb|AGE09588.1| CCOAMT2-like protein [Eucalyptus cladocalyx]
 gb|KCW63757.1| hypothetical protein EUGRSUZ_G01417 [Eucalyptus grandis]
Length=247

 Score =   458 bits (1179),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 215/239 (90%), Positives = 231/239 (97%), Gaps = 0/239 (0%)
 Frame = +3

Query  87   ENQTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEG  266
            + Q  +H EVGHKSLLQSDALYQYILETSVYPREPE MKELRE+TAKHPWNLMTTSADEG
Sbjct  9    QTQPAKHSEVGHKSLLQSDALYQYILETSVYPREPEPMKELREITAKHPWNLMTTSADEG  68

Query  267  QFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAG  446
            QFL+MLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINREN+E+GLPVI+KAG
Sbjct  69   QFLNMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENFEIGLPVIQKAG  128

Query  447  VAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIGY  626
            +AHKIDFREGPALP+LDQLV+D K HGTYDFIFVDADKDNY+NYHKRLIDLVKVGG+IGY
Sbjct  129  LAHKIDFREGPALPLLDQLVQDEKNHGTYDFIFVDADKDNYINYHKRLIDLVKVGGLIGY  188

Query  627  DNTLWNGSVVAPPDAPMRKYIKYYRDFVLELNKALAVDPRIEICMLPVGDGITLCRRIS  803
            DNTLWNGSVVAP DAP+RKY++YYRDFVLELNKALAVDPRIEICMLPVGDGITLCRR+S
Sbjct  189  DNTLWNGSVVAPADAPLRKYVRYYRDFVLELNKALAVDPRIEICMLPVGDGITLCRRVS  247



>ref|XP_003518701.2| PREDICTED: caffeoyl-CoA O-methyltransferase-like isoform 1 [Glycine 
max]
Length=325

 Score =   461 bits (1187),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 221/247 (89%), Positives = 238/247 (96%), Gaps = 6/247 (2%)
 Frame = +3

Query  78   AMAE---NQTT---RHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWN  239
            AMAE   NQTT   RHQEVGHKSLLQSDALYQYILETSVYPREPE+MKELRE+TAKHPWN
Sbjct  78   AMAEQNQNQTTEAGRHQEVGHKSLLQSDALYQYILETSVYPREPESMKELRELTAKHPWN  137

Query  240  LMTTSADEGQFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYEL  419
            +MTTSADEGQFL+MLLKLINAKNTMEIGVYTGYSLLATALALP+DGKILAMDINRENYEL
Sbjct  138  IMTTSADEGQFLNMLLKLINAKNTMEIGVYTGYSLLATALALPEDGKILAMDINRENYEL  197

Query  420  GLPVIEKAGVAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDL  599
            GLPVI+KAGV HKI+FREGPALP+LD++V+D K HG+YDFIFVDADKDNYLNYHKRLI+L
Sbjct  198  GLPVIKKAGVDHKIEFREGPALPVLDEMVKDEKNHGSYDFIFVDADKDNYLNYHKRLIEL  257

Query  600  VKVGGVIGYDNTLWNGSVVAPPDAPMRKYIKYYRDFVLELNKALAVDPRIEICMLPVGDG  779
            VKVGGVIGYDNTLWNGSVVAPPDAP+RKY++YYRDFVLELNKALAVDPRIEICMLPVGDG
Sbjct  258  VKVGGVIGYDNTLWNGSVVAPPDAPLRKYVRYYRDFVLELNKALAVDPRIEICMLPVGDG  317

Query  780  ITLCRRI  800
            IT+CRRI
Sbjct  318  ITICRRI  324



>gb|KJB77663.1| hypothetical protein B456_012G149800 [Gossypium raimondii]
Length=248

 Score =   458 bits (1179),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 214/238 (90%), Positives = 233/238 (98%), Gaps = 0/238 (0%)
 Frame = +3

Query  87   ENQTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEG  266
            +++  RHQEVGHKSLLQSDALYQY+LETSVYPREPE MKELRE+TAKHPWNLMTTSADEG
Sbjct  10   QSEAGRHQEVGHKSLLQSDALYQYMLETSVYPREPEPMKELRELTAKHPWNLMTTSADEG  69

Query  267  QFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAG  446
            QFL+MLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVI+KAG
Sbjct  70   QFLNMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIQKAG  129

Query  447  VAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIGY  626
            VAHKI+F+EGPA+P+LD+LVED K HG+YDFIFVDADKDNYLNYHKRLI+LVKVGG+IGY
Sbjct  130  VAHKIEFKEGPAMPVLDKLVEDEKNHGSYDFIFVDADKDNYLNYHKRLIELVKVGGLIGY  189

Query  627  DNTLWNGSVVAPPDAPMRKYIKYYRDFVLELNKALAVDPRIEICMLPVGDGITLCRRI  800
            DNTLWNGSVVAPPDAP+RKY++YYRDFVLELNKALAVDPRIEICMLPVGDGITLCRR+
Sbjct  190  DNTLWNGSVVAPPDAPLRKYVRYYRDFVLELNKALAVDPRIEICMLPVGDGITLCRRV  247



>gb|KHN05829.1| Caffeoyl-CoA O-methyltransferase [Glycine soja]
Length=247

 Score =   458 bits (1178),  Expect = 3e-159, Method: Compositional matrix adjust.
 Identities = 217/241 (90%), Positives = 235/241 (98%), Gaps = 3/241 (1%)
 Frame = +3

Query  87   ENQTT---RHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSA  257
            +NQTT   RHQEVGHKSLLQSDALYQYILETSVYPREPE+MKELRE+TAKHPWN+MTTSA
Sbjct  6    QNQTTEAGRHQEVGHKSLLQSDALYQYILETSVYPREPESMKELRELTAKHPWNIMTTSA  65

Query  258  DEGQFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIE  437
            DEGQFL+MLLKLINAKNTMEIGVYTGYSLLATALALP+DGKILAMDINRENYELGLPVI+
Sbjct  66   DEGQFLNMLLKLINAKNTMEIGVYTGYSLLATALALPEDGKILAMDINRENYELGLPVIK  125

Query  438  KAGVAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGV  617
            KAGV HKI+FREGPALP+LD++V+D K HG+YDFIFVDADKDNYLNYHKRLI+LVKVGGV
Sbjct  126  KAGVDHKIEFREGPALPVLDEMVKDEKNHGSYDFIFVDADKDNYLNYHKRLIELVKVGGV  185

Query  618  IGYDNTLWNGSVVAPPDAPMRKYIKYYRDFVLELNKALAVDPRIEICMLPVGDGITLCRR  797
            IGYDNTLWNGSVVAPPDAP+RKY++YYRDFVLELNKALAVDPRIEICMLPVGDGIT+CRR
Sbjct  186  IGYDNTLWNGSVVAPPDAPLRKYVRYYRDFVLELNKALAVDPRIEICMLPVGDGITICRR  245

Query  798  I  800
            I
Sbjct  246  I  246



>gb|AAM66108.1| caffeoyl-CoA O-methyltransferase-like protein [Arabidopsis thaliana]
Length=259

 Score =   459 bits (1180),  Expect = 3e-159, Method: Compositional matrix adjust.
 Identities = 213/239 (89%), Positives = 231/239 (97%), Gaps = 0/239 (0%)
 Frame = +3

Query  87   ENQTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEG  266
            ++Q  RHQEVGHKSLLQSD LYQYILETSVYPREPE+MKELREVTAKHPWN+MTTSADEG
Sbjct  21   QSQNLRHQEVGHKSLLQSDDLYQYILETSVYPREPESMKELREVTAKHPWNIMTTSADEG  80

Query  267  QFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAG  446
            QFL+ML+KL+NAKNTMEIGVYTGYSLLATALALP+DGKILAMD+NRENYELGLP+IEKAG
Sbjct  81   QFLNMLIKLVNAKNTMEIGVYTGYSLLATALALPEDGKILAMDVNRENYELGLPIIEKAG  140

Query  447  VAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIGY  626
            VAHKIDFREGPALP+LD++V D K HGTYDFIFVDADKD Y+NYHKRLIDLVK+GGVIGY
Sbjct  141  VAHKIDFREGPALPVLDEIVADEKNHGTYDFIFVDADKDXYINYHKRLIDLVKIGGVIGY  200

Query  627  DNTLWNGSVVAPPDAPMRKYIKYYRDFVLELNKALAVDPRIEICMLPVGDGITLCRRIS  803
            DNTLWNGSVVAPPDAPMRKY++YYRDFVLELNKALA DPRIEICMLPVGDGIT+CRRIS
Sbjct  201  DNTLWNGSVVAPPDAPMRKYVRYYRDFVLELNKALAADPRIEICMLPVGDGITICRRIS  259



>gb|AFY97679.1| caffeoyl-CoA-O-methyltransferase [Camellia sinensis]
Length=245

 Score =   458 bits (1178),  Expect = 3e-159, Method: Compositional matrix adjust.
 Identities = 214/237 (90%), Positives = 230/237 (97%), Gaps = 0/237 (0%)
 Frame = +3

Query  93   QTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEGQF  272
            Q  RHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWN+MTTSADEGQF
Sbjct  9    QNLRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNIMTTSADEGQF  68

Query  273  LSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAGVA  452
            L+MLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINR+N+E+GLP+IEKAGVA
Sbjct  69   LNMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRDNFEIGLPIIEKAGVA  128

Query  453  HKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIGYDN  632
            HKIDFREGPALP LDQ+++D K HG++DFIFVDADKDNY+NYHKRLIDLVKVGG+IGYDN
Sbjct  129  HKIDFREGPALPALDQMIKDGKHHGSFDFIFVDADKDNYINYHKRLIDLVKVGGLIGYDN  188

Query  633  TLWNGSVVAPPDAPMRKYIKYYRDFVLELNKALAVDPRIEICMLPVGDGITLCRRIS  803
            TLWNGSVVAPPDAPMRKY++YYRDFVLELNKALA DPRIEICMLPVGDGITLCRR+ 
Sbjct  189  TLWNGSVVAPPDAPMRKYVRYYRDFVLELNKALAADPRIEICMLPVGDGITLCRRVC  245



>gb|AGR51164.1| catechol-O-methyltransferase [Camellia sinensis]
Length=245

 Score =   457 bits (1177),  Expect = 3e-159, Method: Compositional matrix adjust.
 Identities = 214/237 (90%), Positives = 230/237 (97%), Gaps = 0/237 (0%)
 Frame = +3

Query  93   QTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEGQF  272
            Q  RHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWN+MTTSADEGQF
Sbjct  9    QNLRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNIMTTSADEGQF  68

Query  273  LSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAGVA  452
            L+MLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINR+N+E+GLP+IEKAGVA
Sbjct  69   LNMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRDNFEIGLPIIEKAGVA  128

Query  453  HKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIGYDN  632
            HKIDFREGPALP LD+++ED K HG++DFIFVDADKDNY+NYHKRLIDLVKVGG+IGYDN
Sbjct  129  HKIDFREGPALPALDKMIEDGKHHGSFDFIFVDADKDNYINYHKRLIDLVKVGGLIGYDN  188

Query  633  TLWNGSVVAPPDAPMRKYIKYYRDFVLELNKALAVDPRIEICMLPVGDGITLCRRIS  803
            TLWNGSVVAPPDAPMRKY++YYRDFVLELNKALA DPRIEICMLPVGDGITLCRR+ 
Sbjct  189  TLWNGSVVAPPDAPMRKYVRYYRDFVLELNKALAADPRIEICMLPVGDGITLCRRVC  245



>gb|ACH47151.1| caffeoyl-CoA 3-O-methyltransferase [Linum usitatissimum]
Length=247

 Score =   458 bits (1178),  Expect = 3e-159, Method: Compositional matrix adjust.
 Identities = 215/248 (87%), Positives = 236/248 (95%), Gaps = 1/248 (0%)
 Frame = +3

Query  60   LAGKFKAMAENQTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWN  239
            +A + K+ +EN  +RHQEVGHKSLLQSDALYQYILETSVYPREPE+MKELREVTAKHPWN
Sbjct  1    MAEEQKSSSEN-VSRHQEVGHKSLLQSDALYQYILETSVYPREPESMKELREVTAKHPWN  59

Query  240  LMTTSADEGQFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYEL  419
            +MTTSADEGQFL+MLLKL+NAKNTMEIGVYTGYSLLATALA+PDDGK LAMDINRENYE+
Sbjct  60   IMTTSADEGQFLNMLLKLVNAKNTMEIGVYTGYSLLATALAIPDDGKTLAMDINRENYEI  119

Query  420  GLPVIEKAGVAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDL  599
            GLP+IEKAG+AHKI+FREGPALP LD +VE+   HGTYDFIFVDADKDNY+NYHKRLIDL
Sbjct  120  GLPIIEKAGLAHKIEFREGPALPALDLMVENKSLHGTYDFIFVDADKDNYINYHKRLIDL  179

Query  600  VKVGGVIGYDNTLWNGSVVAPPDAPMRKYIKYYRDFVLELNKALAVDPRIEICMLPVGDG  779
            VK+GGVIGYDNTLWNGSVVAPPDAP+RKY++YYRDFVLELNKALA DPRIEICMLPVGDG
Sbjct  180  VKIGGVIGYDNTLWNGSVVAPPDAPLRKYVRYYRDFVLELNKALAADPRIEICMLPVGDG  239

Query  780  ITLCRRIS  803
            ITLCRRIS
Sbjct  240  ITLCRRIS  247



>gb|KHN43056.1| Caffeoyl-CoA O-methyltransferase [Glycine soja]
Length=247

 Score =   458 bits (1178),  Expect = 4e-159, Method: Compositional matrix adjust.
 Identities = 216/241 (90%), Positives = 235/241 (98%), Gaps = 3/241 (1%)
 Frame = +3

Query  87   ENQTT---RHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSA  257
            +NQTT   RHQEVGHKSLLQSDALYQYILETSVYPREPE+MKELRE+TAKHPWN+MTTSA
Sbjct  6    QNQTTEAGRHQEVGHKSLLQSDALYQYILETSVYPREPESMKELRELTAKHPWNIMTTSA  65

Query  258  DEGQFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIE  437
            DEGQFL+MLLKLINAKNTMEIGVYTGYSLLATALALP+DGKILAMDINRENYELGLPVI+
Sbjct  66   DEGQFLNMLLKLINAKNTMEIGVYTGYSLLATALALPEDGKILAMDINRENYELGLPVIK  125

Query  438  KAGVAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGV  617
            KAGV HKI+FREGPALP+LD++++D K HG+YDFIFVDADKDNYLNYHKRLI+LVKVGGV
Sbjct  126  KAGVDHKIEFREGPALPVLDEMIKDEKNHGSYDFIFVDADKDNYLNYHKRLIELVKVGGV  185

Query  618  IGYDNTLWNGSVVAPPDAPMRKYIKYYRDFVLELNKALAVDPRIEICMLPVGDGITLCRR  797
            IGYDNTLWNGSVVAPPDAP+RKY++YYRDFVLELNKALAVDPRIEICMLPVGDGIT+CRR
Sbjct  186  IGYDNTLWNGSVVAPPDAPLRKYVRYYRDFVLELNKALAVDPRIEICMLPVGDGITICRR  245

Query  798  I  800
            I
Sbjct  246  I  246



>gb|AAT40111.1| caffeoyl-CoA O-methyltransferase [Ammi majus]
Length=241

 Score =   457 bits (1177),  Expect = 4e-159, Method: Compositional matrix adjust.
 Identities = 214/241 (89%), Positives = 229/241 (95%), Gaps = 0/241 (0%)
 Frame = +3

Query  81   MAENQTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSAD  260
            MA N  ++H EVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSAD
Sbjct  1    MASNGESKHSEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSAD  60

Query  261  EGQFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEK  440
            EGQFL+MLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYE+GLP+IEK
Sbjct  61   EGQFLNMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYEIGLPIIEK  120

Query  441  AGVAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVI  620
            AGV HKIDFREGPALP+LDQ +ED K HGT+DF+FVDADKDNY+NYHKRLIDLVKVGG+I
Sbjct  121  AGVGHKIDFREGPALPVLDQTLEDGKYHGTFDFVFVDADKDNYINYHKRLIDLVKVGGLI  180

Query  621  GYDNTLWNGSVVAPPDAPMRKYIKYYRDFVLELNKALAVDPRIEICMLPVGDGITLCRRI  800
            GYDNTLWNGSV  P DAPMRKY++YYRDFV+ELNKALA DPRIEICMLPVGDG+TLCRRI
Sbjct  181  GYDNTLWNGSVAQPADAPMRKYVRYYRDFVIELNKALAADPRIEICMLPVGDGVTLCRRI  240

Query  801  S  803
            S
Sbjct  241  S  241



>gb|KJB47341.1| hypothetical protein B456_008G024000 [Gossypium raimondii]
Length=318

 Score =   460 bits (1184),  Expect = 5e-159, Method: Compositional matrix adjust.
 Identities = 214/238 (90%), Positives = 233/238 (98%), Gaps = 0/238 (0%)
 Frame = +3

Query  87   ENQTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEG  266
            ++Q  RHQEVGHKSLLQSDALYQYILETSVYPREPE MKELR++TAKHPWNLMTTSADEG
Sbjct  80   QSQAGRHQEVGHKSLLQSDALYQYILETSVYPREPEPMKELRKLTAKHPWNLMTTSADEG  139

Query  267  QFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAG  446
            QFL+MLLKLINAKNTMEIGVYTGYSLLATALA+PDDGKILAMD+NRENYELGLPVI+KAG
Sbjct  140  QFLNMLLKLINAKNTMEIGVYTGYSLLATALAIPDDGKILAMDVNRENYELGLPVIQKAG  199

Query  447  VAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIGY  626
            VAHKIDF+EGPALP+LDQLVED K HG++DFIFVDADKDNYLNYHKRLI+LVKVGG+IGY
Sbjct  200  VAHKIDFKEGPALPVLDQLVEDEKNHGSFDFIFVDADKDNYLNYHKRLIELVKVGGLIGY  259

Query  627  DNTLWNGSVVAPPDAPMRKYIKYYRDFVLELNKALAVDPRIEICMLPVGDGITLCRRI  800
            DNTLWNGSVVAPPDAP+RKY++YYRDFV+ELNKALAVDPRIEICMLPVGDGITLCRR+
Sbjct  260  DNTLWNGSVVAPPDAPLRKYVRYYRDFVMELNKALAVDPRIEICMLPVGDGITLCRRV  317



>ref|XP_007042461.1| S-adenosyl-L-methionine-dependent methyltransferases superfamily 
protein isoform 1 [Theobroma cacao]
 gb|EOX98292.1| S-adenosyl-L-methionine-dependent methyltransferases superfamily 
protein isoform 1 [Theobroma cacao]
Length=304

 Score =   459 bits (1182),  Expect = 5e-159, Method: Compositional matrix adjust.
 Identities = 220/260 (85%), Positives = 238/260 (92%), Gaps = 6/260 (2%)
 Frame = +3

Query  39   ETSVKGSLAGKFKAMAEN------QTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAM  200
            +T  + S   +F  MA N      Q  RHQEVGHKSLLQSDALYQYILETSVYPREPE M
Sbjct  44   KTEKQQSNLWRFVPMATNTQEQQSQAGRHQEVGHKSLLQSDALYQYILETSVYPREPEPM  103

Query  201  KELREVTAKHPWNLMTTSADEGQFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGK  380
            KELRE+TAKHPWNLMTTSADEGQFL+MLLKLINAKNTMEIGVYTGYSLLATALALPDDGK
Sbjct  104  KELRELTAKHPWNLMTTSADEGQFLNMLLKLINAKNTMEIGVYTGYSLLATALALPDDGK  163

Query  381  ILAMDINRENYELGLPVIEKAGVAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADK  560
            ILAMDINRENYELGLPVI+KAGVAHKIDF+EGPA+P LDQLVED K HG++DF+FVDADK
Sbjct  164  ILAMDINRENYELGLPVIQKAGVAHKIDFKEGPAMPALDQLVEDEKNHGSFDFVFVDADK  223

Query  561  DNYLNYHKRLIDLVKVGGVIGYDNTLWNGSVVAPPDAPMRKYIKYYRDFVLELNKALAVD  740
            DNY+NYHKRLI+LVKVGG+IGYDNTLWNGSVVAPPDAP+RKY++YYRDFVLELNKALA D
Sbjct  224  DNYINYHKRLIELVKVGGLIGYDNTLWNGSVVAPPDAPLRKYVRYYRDFVLELNKALAAD  283

Query  741  PRIEICMLPVGDGITLCRRI  800
            PRIEICMLPVGDGITLCRR+
Sbjct  284  PRIEICMLPVGDGITLCRRV  303



>gb|KHG16338.1| Caffeoyl-CoA O-methyltransferase 1 [Gossypium arboreum]
Length=250

 Score =   457 bits (1177),  Expect = 6e-159, Method: Compositional matrix adjust.
 Identities = 213/238 (89%), Positives = 232/238 (97%), Gaps = 0/238 (0%)
 Frame = +3

Query  87   ENQTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEG  266
            ++Q  RHQEVGHKSLLQSDALYQYILETSVYPREPE MKELRE+TAKHPWNLMTTSADEG
Sbjct  12   QSQAGRHQEVGHKSLLQSDALYQYILETSVYPREPEPMKELREITAKHPWNLMTTSADEG  71

Query  267  QFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAG  446
            QFL+MLLKLINAKNTMEIGVYTGYSLLATALA+PD GKILAMDINRENYELGLPVI+KAG
Sbjct  72   QFLNMLLKLINAKNTMEIGVYTGYSLLATALAVPDHGKILAMDINRENYELGLPVIQKAG  131

Query  447  VAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIGY  626
            VAHKIDF+EGPA+P+LD+LV+D K HG++DFIFVDADKDNYLNYHKRLI+LVKVGG+IGY
Sbjct  132  VAHKIDFKEGPAMPVLDELVQDEKNHGSFDFIFVDADKDNYLNYHKRLIELVKVGGLIGY  191

Query  627  DNTLWNGSVVAPPDAPMRKYIKYYRDFVLELNKALAVDPRIEICMLPVGDGITLCRRI  800
            DNTLWNGSVVAPPDAP+RKY++YYRDFVLELNKALAVDPRIEICMLPVGDGITLCRR+
Sbjct  192  DNTLWNGSVVAPPDAPLRKYVRYYRDFVLELNKALAVDPRIEICMLPVGDGITLCRRL  249



>gb|AFN85667.1| putative caffeoyl-coenzyme A 3-O-methyltransferase [Hibiscus 
cannabinus]
Length=247

 Score =   457 bits (1176),  Expect = 6e-159, Method: Compositional matrix adjust.
 Identities = 213/238 (89%), Positives = 231/238 (97%), Gaps = 0/238 (0%)
 Frame = +3

Query  87   ENQTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEG  266
            ++Q  RHQEVGHKSLLQSDALYQYILETSVYPREPE+MKELRE+TAKHPWNLMTTSADEG
Sbjct  9    QSQAGRHQEVGHKSLLQSDALYQYILETSVYPREPESMKELRELTAKHPWNLMTTSADEG  68

Query  267  QFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAG  446
            QFL+MLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVI+KAG
Sbjct  69   QFLNMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIQKAG  128

Query  447  VAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIGY  626
            VAHKI+F+EGPA+P+LDQLVED K HG+YDFIFVDADKDNY+NYH+RLI LVKVGG+IGY
Sbjct  129  VAHKIEFKEGPAMPVLDQLVEDEKNHGSYDFIFVDADKDNYINYHERLIKLVKVGGLIGY  188

Query  627  DNTLWNGSVVAPPDAPMRKYIKYYRDFVLELNKALAVDPRIEICMLPVGDGITLCRRI  800
            DNTLWNGSVVAPPDAP+RKY++YYRDFVLELNKALA D RIEICMLPVGDGITLCRR+
Sbjct  189  DNTLWNGSVVAPPDAPLRKYVRYYRDFVLELNKALAADTRIEICMLPVGDGITLCRRV  246



>ref|XP_004136981.1| PREDICTED: caffeoyl-CoA O-methyltransferase 5 [Cucumis sativus]
Length=249

 Score =   457 bits (1175),  Expect = 8e-159, Method: Compositional matrix adjust.
 Identities = 214/239 (90%), Positives = 230/239 (96%), Gaps = 0/239 (0%)
 Frame = +3

Query  87   ENQTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEG  266
            +NQ  RHQEVGHKSLLQSDALYQYILETSVYPREPE+MKELR++TAKHPWN+MTTSADEG
Sbjct  11   QNQAGRHQEVGHKSLLQSDALYQYILETSVYPREPESMKELRDLTAKHPWNIMTTSADEG  70

Query  267  QFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAG  446
            QFL+MLLKLINAK TMEIGVYTGYSLLATALALP+DG ILAMDINRENYELGLPVIEKAG
Sbjct  71   QFLNMLLKLINAKKTMEIGVYTGYSLLATALALPEDGTILAMDINRENYELGLPVIEKAG  130

Query  447  VAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIGY  626
            VAHKI+F+EGPALP+LD +V D K HG+YDFIFVDADKDNY+NYHKRLIDLVKVGGVIGY
Sbjct  131  VAHKIEFKEGPALPVLDDMVADKKNHGSYDFIFVDADKDNYINYHKRLIDLVKVGGVIGY  190

Query  627  DNTLWNGSVVAPPDAPMRKYIKYYRDFVLELNKALAVDPRIEICMLPVGDGITLCRRIS  803
            DNTLWNGSVVAPPDAPMRKY++YYRDFVLELNKALA DPRIEICMLPVGDGITLCRRI+
Sbjct  191  DNTLWNGSVVAPPDAPMRKYVRYYRDFVLELNKALAADPRIEICMLPVGDGITLCRRIN  249



>gb|AAF44689.1| caffeoyl-CoA O-methyltransferase [Populus tomentosa]
Length=239

 Score =   456 bits (1174),  Expect = 9e-159, Method: Compositional matrix adjust.
 Identities = 212/239 (89%), Positives = 232/239 (97%), Gaps = 0/239 (0%)
 Frame = +3

Query  87   ENQTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEG  266
            ++Q  RHQEVGHKSLLQSDALYQYILETSVYPREPE MKELREVTAKHPWN+MTTSADEG
Sbjct  1    QSQAGRHQEVGHKSLLQSDALYQYILETSVYPREPECMKELREVTAKHPWNIMTTSADEG  60

Query  267  QFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAG  446
            QFL+MLLKL+NAKNTMEIGVYTGYSLLATALA+P+DGKILAMDINRENYELGLPVI+KAG
Sbjct  61   QFLNMLLKLVNAKNTMEIGVYTGYSLLATALAIPEDGKILAMDINRENYELGLPVIQKAG  120

Query  447  VAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIGY  626
            VAHKIDF+EGPALP+LDQ++ED K HG++DFIFVDADKDNY+NYHKRLI+LVKVGG+IGY
Sbjct  121  VAHKIDFKEGPALPVLDQMIEDGKYHGSFDFIFVDADKDNYINYHKRLIELVKVGGLIGY  180

Query  627  DNTLWNGSVVAPPDAPMRKYIKYYRDFVLELNKALAVDPRIEICMLPVGDGITLCRRIS  803
            D+TLWNGSVVAPPDAPMRKY++YYRDFVLELNKALA DPRIEICMLPVGDGITLCRRI 
Sbjct  181  DSTLWNGSVVAPPDAPMRKYVRYYRDFVLELNKALAADPRIEICMLPVGDGITLCRRIQ  239



>ref|XP_006339879.1| PREDICTED: caffeoyl-CoA O-methyltransferase-like [Solanum tuberosum]
Length=242

 Score =   456 bits (1174),  Expect = 9e-159, Method: Compositional matrix adjust.
 Identities = 212/240 (88%), Positives = 232/240 (97%), Gaps = 0/240 (0%)
 Frame = +3

Query  84   AENQTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADE  263
            +  + +RHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELRE+TAKHPWNLMTTSADE
Sbjct  3    SNGENSRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREITAKHPWNLMTTSADE  62

Query  264  GQFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKA  443
            GQFL+MLLKLINAKNTMEIGV+TGYSLLATA+ALPDDGKILAMDINR+NYE+GLPVIEKA
Sbjct  63   GQFLNMLLKLINAKNTMEIGVFTGYSLLATAMALPDDGKILAMDINRDNYEIGLPVIEKA  122

Query  444  GVAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIG  623
            G+AHKI+FREGPALP+LDQ++ED K HG+YDFIFVDADKDNYLNYHKRLIDLVK+GGVIG
Sbjct  123  GLAHKIEFREGPALPVLDQMIEDGKYHGSYDFIFVDADKDNYLNYHKRLIDLVKIGGVIG  182

Query  624  YDNTLWNGSVVAPPDAPMRKYIKYYRDFVLELNKALAVDPRIEICMLPVGDGITLCRRIS  803
            YDNTLWNGSVVAPPDAP+RKY++YYRDFVLELNKALA D RIEIC LPVGDGITLCRRI+
Sbjct  183  YDNTLWNGSVVAPPDAPLRKYVRYYRDFVLELNKALAADSRIEICQLPVGDGITLCRRIT  242



>ref|XP_004231855.1| PREDICTED: caffeoyl-CoA O-methyltransferase-like [Solanum lycopersicum]
Length=242

 Score =   456 bits (1174),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 215/242 (89%), Positives = 234/242 (97%), Gaps = 1/242 (0%)
 Frame = +3

Query  81   MAEN-QTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSA  257
            MA N +  RHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELRE+TAKHPWNLMTTSA
Sbjct  1    MATNGENGRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREITAKHPWNLMTTSA  60

Query  258  DEGQFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIE  437
            DEGQFL+MLLKLINAKNTMEIGV+TGYSLLATA+ALPDDGKILAMDINR+NYE+GLPVIE
Sbjct  61   DEGQFLNMLLKLINAKNTMEIGVFTGYSLLATAMALPDDGKILAMDINRDNYEIGLPVIE  120

Query  438  KAGVAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGV  617
            KAG+AHKI+FREGPALP+LDQ++ED + HG+YDFIFVDADKDNYLNYHKRLIDLVK+GG+
Sbjct  121  KAGLAHKIEFREGPALPVLDQMIEDGQYHGSYDFIFVDADKDNYLNYHKRLIDLVKIGGL  180

Query  618  IGYDNTLWNGSVVAPPDAPMRKYIKYYRDFVLELNKALAVDPRIEICMLPVGDGITLCRR  797
            IGYDNTLWNGSVVAPPDAP+RKY++YYRDFVLELNKALA DPRIEIC LPVGDGITLCRR
Sbjct  181  IGYDNTLWNGSVVAPPDAPLRKYVRYYRDFVLELNKALAADPRIEICQLPVGDGITLCRR  240

Query  798  IS  803
            IS
Sbjct  241  IS  242



>ref|XP_012087500.1| PREDICTED: caffeoyl-CoA O-methyltransferase [Jatropha curcas]
 gb|KDP25013.1| hypothetical protein JCGZ_23996 [Jatropha curcas]
Length=246

 Score =   456 bits (1174),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 215/239 (90%), Positives = 228/239 (95%), Gaps = 0/239 (0%)
 Frame = +3

Query  87   ENQTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEG  266
            +NQ  RHQEVGHKSLLQSDALYQYILETSVYPREPE MKELRE+TAKHPWN+MTTSADEG
Sbjct  8    QNQAGRHQEVGHKSLLQSDALYQYILETSVYPREPEPMKELRELTAKHPWNIMTTSADEG  67

Query  267  QFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAG  446
            QFL+MLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMD+NRENYELGLP+I+KAG
Sbjct  68   QFLNMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDVNRENYELGLPIIQKAG  127

Query  447  VAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIGY  626
            VAHKIDFREGPALP+LD++V D K HGT+DFIFVDADKDNYLNYHKRLIDLVKVGGVIGY
Sbjct  128  VAHKIDFREGPALPVLDEMVADEKNHGTFDFIFVDADKDNYLNYHKRLIDLVKVGGVIGY  187

Query  627  DNTLWNGSVVAPPDAPMRKYIKYYRDFVLELNKALAVDPRIEICMLPVGDGITLCRRIS  803
            DNTLWNGSVVAP DAP+RKY+KYYRDFV ELNKAL  DPRIEICMLPVGDGITLCRRI 
Sbjct  188  DNTLWNGSVVAPADAPLRKYVKYYRDFVWELNKALPADPRIEICMLPVGDGITLCRRIQ  246



>dbj|BAM05559.1| caffeoyl-CoA O-methyltransferase [Eucalyptus globulus subsp. 
globulus]
Length=246

 Score =   456 bits (1174),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 217/240 (90%), Positives = 232/240 (97%), Gaps = 1/240 (0%)
 Frame = +3

Query  84   AENQTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADE  263
            ++NQ  RHQEVGHKSLLQSDALYQYILETSVYPREPE MKELRE+TAKHPWN+MTTSADE
Sbjct  8    SQNQAGRHQEVGHKSLLQSDALYQYILETSVYPREPEPMKELREITAKHPWNIMTTSADE  67

Query  264  GQFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKA  443
            GQFL+MLLKLINAKNTMEIGV+TGYSLLATALALPDDGKILAMDINRENYELGLPVI+KA
Sbjct  68   GQFLNMLLKLINAKNTMEIGVFTGYSLLATALALPDDGKILAMDINRENYELGLPVIQKA  127

Query  444  GVAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIG  623
            GVA KIDFREGPALPILDQL+ED  K G++DFIFVDADKDNYLNYHKRLI+LVKVGG+IG
Sbjct  128  GVADKIDFREGPALPILDQLIED-GKQGSFDFIFVDADKDNYLNYHKRLIELVKVGGLIG  186

Query  624  YDNTLWNGSVVAPPDAPMRKYIKYYRDFVLELNKALAVDPRIEICMLPVGDGITLCRRIS  803
            YDNTLWNGSVVAPPDAP+RKY++YYRDFVLELNKALA DPRIEICMLPVGDGITLCRRIS
Sbjct  187  YDNTLWNGSVVAPPDAPLRKYVRYYRDFVLELNKALAADPRIEICMLPVGDGITLCRRIS  246



>gb|AAY89237.1| caffeoyl-CoA 3-O-methyltransferase [Linum usitatissimum]
Length=246

 Score =   456 bits (1174),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 216/246 (88%), Positives = 232/246 (94%), Gaps = 5/246 (2%)
 Frame = +3

Query  81   MAENQ-----TTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLM  245
            MAE Q      +RHQEVGHKSLLQSD LYQYILETSVYPREPE+MKELREVTAKHPWN+M
Sbjct  1    MAEQQQSGENVSRHQEVGHKSLLQSDDLYQYILETSVYPREPESMKELREVTAKHPWNIM  60

Query  246  TTSADEGQFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGL  425
            TTSADEGQFL+MLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYE+GL
Sbjct  61   TTSADEGQFLNMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYEIGL  120

Query  426  PVIEKAGVAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVK  605
            P+IEKAG+AHKI+F+EGPALP LD++VED   HG YDFIFVDADKDNY+NYHKRLIDLVK
Sbjct  121  PIIEKAGLAHKIEFKEGPALPALDKMVEDKANHGAYDFIFVDADKDNYINYHKRLIDLVK  180

Query  606  VGGVIGYDNTLWNGSVVAPPDAPMRKYIKYYRDFVLELNKALAVDPRIEICMLPVGDGIT  785
            +GGVIGYDNTLWNGSVVAPPDAP+RKY++YYRDFVLELNKALA DPRIEICMLPVGDGIT
Sbjct  181  IGGVIGYDNTLWNGSVVAPPDAPLRKYVRYYRDFVLELNKALAADPRIEICMLPVGDGIT  240

Query  786  LCRRIS  803
            LCRRIS
Sbjct  241  LCRRIS  246



>ref|XP_003607927.1| Caffeoyl-CoA O-methyltransferase [Medicago truncatula]
 gb|AES90124.1| caffeoyl-CoA 3-O-methyltransferase [Medicago truncatula]
 gb|AFK37143.1| unknown [Medicago truncatula]
Length=247

 Score =   456 bits (1174),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 216/240 (90%), Positives = 233/240 (97%), Gaps = 2/240 (1%)
 Frame = +3

Query  87   ENQTT--RHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSAD  260
            +NQT   RHQEVGHKSLLQSDALYQYILETSV+PRE EAMKELREVTAKHPWN+MTTSAD
Sbjct  7    QNQTESGRHQEVGHKSLLQSDALYQYILETSVFPREHEAMKELREVTAKHPWNIMTTSAD  66

Query  261  EGQFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEK  440
            EGQFLSMLLKLINAKNTMEIGVYTGYSLLATALA+P+DGKILAMDIN+ENYELGLPVI+K
Sbjct  67   EGQFLSMLLKLINAKNTMEIGVYTGYSLLATALAIPEDGKILAMDINKENYELGLPVIKK  126

Query  441  AGVAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVI  620
            AGV HKIDFREGPALP+LD++++D K HG+YDFIFVDADKDNYLNYHKRLIDLVKVGGVI
Sbjct  127  AGVDHKIDFREGPALPVLDEMIKDEKNHGSYDFIFVDADKDNYLNYHKRLIDLVKVGGVI  186

Query  621  GYDNTLWNGSVVAPPDAPMRKYIKYYRDFVLELNKALAVDPRIEICMLPVGDGITLCRRI  800
            GYDNTLWNGSVVAPPDAP+RKY++YYRDFVLELNKALAVDPRIEICMLPVGDGIT+CRRI
Sbjct  187  GYDNTLWNGSVVAPPDAPLRKYVRYYRDFVLELNKALAVDPRIEICMLPVGDGITICRRI  246



>gb|AEM45654.1| caffeoyl-CoA O-methyltransferase 3 [Gerbera jamesonii]
Length=252

 Score =   456 bits (1174),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 215/251 (86%), Positives = 236/251 (94%), Gaps = 2/251 (1%)
 Frame = +3

Query  57   SLAGKFKAMAEN--QTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKH  230
            ++ G+ K  + N  Q +RHQEVGHKSLLQSDALYQYILETSVYPREPE MKELREVTAKH
Sbjct  2    AINGETKTESNNGDQASRHQEVGHKSLLQSDALYQYILETSVYPREPEPMKELREVTAKH  61

Query  231  PWNLMTTSADEGQFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINREN  410
            PWN+MTTSADEGQFL+MLLKL+NAKNTMEIGV+TGYSLLATALALPDDG ILAMDIN++N
Sbjct  62   PWNIMTTSADEGQFLNMLLKLVNAKNTMEIGVFTGYSLLATALALPDDGXILAMDINKDN  121

Query  411  YELGLPVIEKAGVAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRL  590
            YELG P+IEKAGVAHKIDF+EGPALP+LDQ++ D K HGT+DFIFVDADKDNY+NYHKRL
Sbjct  122  YELGRPIIEKAGVAHKIDFKEGPALPVLDQMIADGKYHGTFDFIFVDADKDNYINYHKRL  181

Query  591  IDLVKVGGVIGYDNTLWNGSVVAPPDAPMRKYIKYYRDFVLELNKALAVDPRIEICMLPV  770
            IDLVKVGG+IGYDNTLWNGSVVAPPDAPMRKY+KYYRDFVLELNKALA DPRIEICMLPV
Sbjct  182  IDLVKVGGLIGYDNTLWNGSVVAPPDAPMRKYVKYYRDFVLELNKALAADPRIEICMLPV  241

Query  771  GDGITLCRRIS  803
            GDGITLCRRI+
Sbjct  242  GDGITLCRRIN  252



>sp|P28034.1|CAMT_PETCR RecName: Full=Caffeoyl-CoA O-methyltransferase; AltName: Full=Trans-caffeoyl-CoA 
3-O-methyltransferase; Short=CCoAMT; Short=CCoAOMT 
[Petroselinum crispum]
 gb|AAA33851.1| caffeoyl-CoA 3-O-methyltransferase [Petroselinum crispum]
 emb|CAA83943.1| caffeoyl-CoA 3-O-methyltransferase [Petroselinum crispum]
 emb|CAA90894.1| CCoAOMT [Petroselinum crispum]
Length=241

 Score =   456 bits (1173),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 212/241 (88%), Positives = 229/241 (95%), Gaps = 0/241 (0%)
 Frame = +3

Query  81   MAENQTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSAD  260
            MA N  ++H EVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSAD
Sbjct  1    MASNGESKHSEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSAD  60

Query  261  EGQFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEK  440
            EGQFL+MLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYE+GLP+IEK
Sbjct  61   EGQFLNMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYEIGLPIIEK  120

Query  441  AGVAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVI  620
            AGV HKIDFREGPALP+LD ++ED K HGT+DF+FVDADKDNY+NYHKRLIDLVK+GG+I
Sbjct  121  AGVGHKIDFREGPALPVLDHMLEDGKYHGTFDFVFVDADKDNYINYHKRLIDLVKIGGLI  180

Query  621  GYDNTLWNGSVVAPPDAPMRKYIKYYRDFVLELNKALAVDPRIEICMLPVGDGITLCRRI  800
            GYDNTLWNGSV  P DAPMRKY++YYRDFV+ELNKALA DPRIEICMLPVGDG+TLCRRI
Sbjct  181  GYDNTLWNGSVAQPADAPMRKYVRYYRDFVIELNKALAADPRIEICMLPVGDGVTLCRRI  240

Query  801  S  803
            S
Sbjct  241  S  241



>sp|Q40313.1|CAMT_MEDSA RecName: Full=Caffeoyl-CoA O-methyltransferase; AltName: Full=Trans-caffeoyl-CoA 
3-O-methyltransferase; Short=CCoAMT; Short=CCoAOMT 
[Medicago sativa]
 pdb|1SUI|A Chain A, Alfalfa Caffeoyl Coenzyme A 3-O-Methyltransferase
 pdb|1SUI|B Chain B, Alfalfa Caffeoyl Coenzyme A 3-O-Methyltransferase
 pdb|1SUI|C Chain C, Alfalfa Caffeoyl Coenzyme A 3-O-Methyltransferase
 pdb|1SUI|D Chain D, Alfalfa Caffeoyl Coenzyme A 3-O-Methyltransferase
 pdb|1SUS|A Chain A, Crystal Structure Of Alfalfa Feruoyl Coenzyme A 3-O- 
Methyltransferase
 pdb|1SUS|B Chain B, Crystal Structure Of Alfalfa Feruoyl Coenzyme A 3-O- 
Methyltransferase
 pdb|1SUS|C Chain C, Crystal Structure Of Alfalfa Feruoyl Coenzyme A 3-O- 
Methyltransferase
 pdb|1SUS|D Chain D, Crystal Structure Of Alfalfa Feruoyl Coenzyme A 3-O- 
Methyltransferase
 gb|AAC28973.1| S-adenosyl-L-methionine:trans-caffeoyl-CoA 3-O-methyltransferase 
[Medicago sativa]
Length=247

 Score =   456 bits (1173),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 213/238 (89%), Positives = 232/238 (97%), Gaps = 0/238 (0%)
 Frame = +3

Query  87   ENQTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEG  266
            + ++ RHQEVGHKSLLQSDALYQYILETSV+PRE EAMKELREVTAKHPWN+MTTSADEG
Sbjct  9    QTESGRHQEVGHKSLLQSDALYQYILETSVFPREHEAMKELREVTAKHPWNIMTTSADEG  68

Query  267  QFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAG  446
            QFLSMLLKLINAKNTMEIGVYTGYSLLATALA+P+DGKILAMDIN+ENYELGLPVI+KAG
Sbjct  69   QFLSMLLKLINAKNTMEIGVYTGYSLLATALAIPEDGKILAMDINKENYELGLPVIKKAG  128

Query  447  VAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIGY  626
            V HKIDFREGPALP+LD++++D K HG+YDFIFVDADKDNYLNYHKRLIDLVKVGGVIGY
Sbjct  129  VDHKIDFREGPALPVLDEMIKDEKNHGSYDFIFVDADKDNYLNYHKRLIDLVKVGGVIGY  188

Query  627  DNTLWNGSVVAPPDAPMRKYIKYYRDFVLELNKALAVDPRIEICMLPVGDGITLCRRI  800
            DNTLWNGSVVAPPDAP+RKY++YYRDFVLELNKALAVDPRIEICMLPVGDGIT+CRRI
Sbjct  189  DNTLWNGSVVAPPDAPLRKYVRYYRDFVLELNKALAVDPRIEICMLPVGDGITICRRI  246



>gb|ABK94003.1| unknown [Populus trichocarpa]
Length=247

 Score =   456 bits (1173),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 212/239 (89%), Positives = 232/239 (97%), Gaps = 0/239 (0%)
 Frame = +3

Query  87   ENQTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEG  266
            ++Q  RHQEVG+KSLLQSDALYQYILETSVYPREPE MKELREVTAKHPWN+MTTSADEG
Sbjct  9    QSQAGRHQEVGNKSLLQSDALYQYILETSVYPREPECMKELREVTAKHPWNIMTTSADEG  68

Query  267  QFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAG  446
            QFL+MLLKL+NAKNTMEIGVYTGYSLLATALA+P+DGKILAMDINRENYELGLPVI+KAG
Sbjct  69   QFLNMLLKLVNAKNTMEIGVYTGYSLLATALAIPEDGKILAMDINRENYELGLPVIQKAG  128

Query  447  VAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIGY  626
            VAHKIDF+EGPALP+LDQ++ED K HG++DFIFVDADKDNY+NYHKRLI+LVKVGG+IGY
Sbjct  129  VAHKIDFKEGPALPVLDQMIEDGKCHGSFDFIFVDADKDNYINYHKRLIELVKVGGLIGY  188

Query  627  DNTLWNGSVVAPPDAPMRKYIKYYRDFVLELNKALAVDPRIEICMLPVGDGITLCRRIS  803
            DNTLWNGSVVAPPDAPMRKY++YYRDFVLELNKALA DPRIEICMLPVGDGITLCRRI 
Sbjct  189  DNTLWNGSVVAPPDAPMRKYVRYYRDFVLELNKALAADPRIEICMLPVGDGITLCRRIQ  247



>ref|XP_004505242.1| PREDICTED: caffeoyl-CoA O-methyltransferase-like [Cicer arietinum]
Length=247

 Score =   456 bits (1173),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 213/238 (89%), Positives = 233/238 (98%), Gaps = 0/238 (0%)
 Frame = +3

Query  87   ENQTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEG  266
            + ++ RHQEVGHKSLLQSDALYQYILETSV+PRE EAMKELREVTAKHPWN+MTTSADEG
Sbjct  9    QTESGRHQEVGHKSLLQSDALYQYILETSVFPREHEAMKELREVTAKHPWNIMTTSADEG  68

Query  267  QFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAG  446
            QFL+MLLKLINAKNTMEIGVYTGYSLLATALALP+DGKILAMDIN+ENYELGLPVI+KAG
Sbjct  69   QFLNMLLKLINAKNTMEIGVYTGYSLLATALALPEDGKILAMDINKENYELGLPVIKKAG  128

Query  447  VAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIGY  626
            VAHKIDFREGPALP+LD++V+D K HG+YDFIFVDADKDNY+NYHKRLI+LVKVGGVIGY
Sbjct  129  VAHKIDFREGPALPVLDEMVKDEKNHGSYDFIFVDADKDNYINYHKRLIELVKVGGVIGY  188

Query  627  DNTLWNGSVVAPPDAPMRKYIKYYRDFVLELNKALAVDPRIEICMLPVGDGITLCRRI  800
            DNTLWNGSVVAPPDAP+RKY++YYRDFVLELNKALAVDPRIEICMLPVGDGIT+CRRI
Sbjct  189  DNTLWNGSVVAPPDAPLRKYVRYYRDFVLELNKALAVDPRIEICMLPVGDGITICRRI  246



>gb|AEK52482.1| caffeoyl-CoA 3-O-methyltransferase [Dimocarpus longan]
Length=247

 Score =   456 bits (1173),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 213/238 (89%), Positives = 230/238 (97%), Gaps = 0/238 (0%)
 Frame = +3

Query  87   ENQTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEG  266
            +NQ  RHQEVGHKSLLQSD LYQYILETSVYP EPE+MKELRE+TAKHPWN+MTTSADEG
Sbjct  9    QNQVGRHQEVGHKSLLQSDDLYQYILETSVYPTEPESMKELRELTAKHPWNIMTTSADEG  68

Query  267  QFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAG  446
            QFLSMLLKLINAKNTMEIGVYTGYSLLATALALP+DGKILAMDINRENYELGLPVI+KAG
Sbjct  69   QFLSMLLKLINAKNTMEIGVYTGYSLLATALALPEDGKILAMDINRENYELGLPVIQKAG  128

Query  447  VAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIGY  626
            VAHKIDFREGPA+P+LDQL+ED K HG++DFIFVDADKDNYLNYHKRLI+LVKVGGVIGY
Sbjct  129  VAHKIDFREGPAMPLLDQLIEDEKNHGSFDFIFVDADKDNYLNYHKRLIELVKVGGVIGY  188

Query  627  DNTLWNGSVVAPPDAPMRKYIKYYRDFVLELNKALAVDPRIEICMLPVGDGITLCRRI  800
            DNTLWNG+VVAPPDAP+RKY++YYRDFVLELNKAL  DPRIEICMLPVGDG+TLCRRI
Sbjct  189  DNTLWNGTVVAPPDAPLRKYVRYYRDFVLELNKALPADPRIEICMLPVGDGVTLCRRI  246



>ref|XP_004230766.1| PREDICTED: caffeoyl-CoA O-methyltransferase 6 [Solanum lycopersicum]
Length=248

 Score =   456 bits (1172),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 216/243 (89%), Positives = 232/243 (95%), Gaps = 1/243 (0%)
 Frame = +3

Query  78   AMAENQTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSA  257
            A  ENQ ++HQEVGHKSLLQSDALYQYILETSVYPREPE MKELRE+TAKHPWNLMTTSA
Sbjct  6    ASQENQVSKHQEVGHKSLLQSDALYQYILETSVYPREPEPMKELRELTAKHPWNLMTTSA  65

Query  258  DEGQFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYE-LGLPVI  434
            DEGQFL+MLLKLINAKNTMEIGVYTGYSLLATALALP DGKILAMDIN+ENYE +GLP+I
Sbjct  66   DEGQFLNMLLKLINAKNTMEIGVYTGYSLLATALALPRDGKILAMDINKENYEEIGLPII  125

Query  435  EKAGVAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGG  614
            +KAGVAHKIDFREGPALP+LD LVED   HGTYDFIFVDADKDNY+NYHKR+I+LVKVGG
Sbjct  126  QKAGVAHKIDFREGPALPVLDLLVEDKNNHGTYDFIFVDADKDNYINYHKRIIELVKVGG  185

Query  615  VIGYDNTLWNGSVVAPPDAPMRKYIKYYRDFVLELNKALAVDPRIEICMLPVGDGITLCR  794
            VIGYDNTLWNGSVVAPPDAP+RKY++YYRDFVLELNKALA DPRIEICMLPVGDGITLCR
Sbjct  186  VIGYDNTLWNGSVVAPPDAPLRKYVRYYRDFVLELNKALAADPRIEICMLPVGDGITLCR  245

Query  795  RIS  803
            RI+
Sbjct  246  RIT  248



>ref|XP_006346396.1| PREDICTED: caffeoyl-CoA O-methyltransferase 6-like [Solanum tuberosum]
Length=248

 Score =   456 bits (1172),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 216/243 (89%), Positives = 232/243 (95%), Gaps = 1/243 (0%)
 Frame = +3

Query  78   AMAENQTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSA  257
            A  ENQ ++HQEVGHKSLLQSDALYQYILETSVYPREPE MKELRE+TAKHPWNLMTTSA
Sbjct  6    ASQENQVSKHQEVGHKSLLQSDALYQYILETSVYPREPEPMKELRELTAKHPWNLMTTSA  65

Query  258  DEGQFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYE-LGLPVI  434
            DEGQFL+MLLKLINAKNTMEIGVYTGYSLLATALALP DGKILAMDIN+ENYE +GLP+I
Sbjct  66   DEGQFLNMLLKLINAKNTMEIGVYTGYSLLATALALPHDGKILAMDINKENYEEIGLPII  125

Query  435  EKAGVAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGG  614
            +KAGVAHKIDFREGPALP+LD LVED   HGTYDFIFVDADKDNY+NYHKR+I+LVKVGG
Sbjct  126  QKAGVAHKIDFREGPALPVLDLLVEDKNNHGTYDFIFVDADKDNYINYHKRIIELVKVGG  185

Query  615  VIGYDNTLWNGSVVAPPDAPMRKYIKYYRDFVLELNKALAVDPRIEICMLPVGDGITLCR  794
            VIGYDNTLWNGSVVAPP+AP+RKY++YYRDFVLELNKALA DPRIEICMLPVGDGITLCR
Sbjct  186  VIGYDNTLWNGSVVAPPNAPLRKYVRYYRDFVLELNKALAADPRIEICMLPVGDGITLCR  245

Query  795  RIS  803
            RIS
Sbjct  246  RIS  248



>gb|AFY97680.1| caffeoyl-CoA-O-methyltransferase [Camellia sinensis]
Length=245

 Score =   456 bits (1172),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 214/237 (90%), Positives = 229/237 (97%), Gaps = 0/237 (0%)
 Frame = +3

Query  93   QTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEGQF  272
            Q  RHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWN+MTTSADEGQF
Sbjct  9    QNLRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNIMTTSADEGQF  68

Query  273  LSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAGVA  452
            L+MLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINR+N+E+GLP+IEKAGVA
Sbjct  69   LNMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRDNFEIGLPIIEKAGVA  128

Query  453  HKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIGYDN  632
            HKIDFREGPALP LD+++ED K HG++DFIFVDADKDNY NYHKRLIDLVKVGG+IGYDN
Sbjct  129  HKIDFREGPALPALDKMIEDGKHHGSFDFIFVDADKDNYNNYHKRLIDLVKVGGLIGYDN  188

Query  633  TLWNGSVVAPPDAPMRKYIKYYRDFVLELNKALAVDPRIEICMLPVGDGITLCRRIS  803
            TLWNGSVVAPPDAPMRKY++YYRDFVLELNKALA DPRIEICMLPVGDGITLCRR+ 
Sbjct  189  TLWNGSVVAPPDAPMRKYVRYYRDFVLELNKALAADPRIEICMLPVGDGITLCRRVC  245



>ref|XP_011000123.1| PREDICTED: caffeoyl-CoA O-methyltransferase 2 [Populus euphratica]
Length=247

 Score =   456 bits (1172),  Expect = 3e-158, Method: Compositional matrix adjust.
 Identities = 213/238 (89%), Positives = 230/238 (97%), Gaps = 0/238 (0%)
 Frame = +3

Query  87   ENQTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEG  266
            + Q  RHQEVGHKSLLQSDALYQYILETSVYPREPE MKELRE+TAKHPWN+MTTSADEG
Sbjct  9    QTQAGRHQEVGHKSLLQSDALYQYILETSVYPREPECMKELRELTAKHPWNIMTTSADEG  68

Query  267  QFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAG  446
            QFL+MLLKLINAKNTMEIGVYTGYSLLATALA+P+DGKILAMDINRENYELGLPVI+KAG
Sbjct  69   QFLNMLLKLINAKNTMEIGVYTGYSLLATALAIPEDGKILAMDINRENYELGLPVIQKAG  128

Query  447  VAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIGY  626
            VAHKI+F+EGPALP+LDQ++ED K HGTYDFIFVDADKDNY+NYHKRLI+LVKVGG+IGY
Sbjct  129  VAHKIEFKEGPALPVLDQMIEDGKYHGTYDFIFVDADKDNYINYHKRLIELVKVGGLIGY  188

Query  627  DNTLWNGSVVAPPDAPMRKYIKYYRDFVLELNKALAVDPRIEICMLPVGDGITLCRRI  800
            DNTLWNGSVVAP DAPMRKY++YYRDFVLELNKALA DPRIEICMLPVGDGITLCRRI
Sbjct  189  DNTLWNGSVVAPADAPMRKYVRYYRDFVLELNKALAADPRIEICMLPVGDGITLCRRI  246



>gb|AFZ15799.1| caffeoyl-CoA O-methyltransferase [Lonicera japonica]
Length=247

 Score =   456 bits (1172),  Expect = 3e-158, Method: Compositional matrix adjust.
 Identities = 213/234 (91%), Positives = 229/234 (98%), Gaps = 0/234 (0%)
 Frame = +3

Query  102  RHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEGQFLSM  281
            RHQEVGHKSLLQSDALYQYILETSVYPREPE MKELREVTAKHPWN+MTTSADEGQFL+M
Sbjct  14   RHQEVGHKSLLQSDALYQYILETSVYPREPEPMKELREVTAKHPWNIMTTSADEGQFLNM  73

Query  282  LLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAGVAHKI  461
            LLKLINAKNTMEIGVYTGYSLLATALA+PDDGKILAMDIN+ENYELGLP+IEKAG+AHKI
Sbjct  74   LLKLINAKNTMEIGVYTGYSLLATALAIPDDGKILAMDINKENYELGLPIIEKAGLAHKI  133

Query  462  DFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIGYDNTLW  641
            +FREG ALP+LDQ+++D   HGT+DFIFVDADKDNYLNYHKRLIDLVKVGG+IGYDNTLW
Sbjct  134  EFREGSALPVLDQMIQDENYHGTFDFIFVDADKDNYLNYHKRLIDLVKVGGLIGYDNTLW  193

Query  642  NGSVVAPPDAPMRKYIKYYRDFVLELNKALAVDPRIEICMLPVGDGITLCRRIS  803
            NGSVVAPPDAPMRKY++YYRDFVLELNKALAVDPRIEICMLP+GDGITLCRRIS
Sbjct  194  NGSVVAPPDAPMRKYVRYYRDFVLELNKALAVDPRIEICMLPIGDGITLCRRIS  247



>dbj|BAG71891.1| caffeoyl CoA O-methyltransferase [Carthamus tinctorius]
Length=247

 Score =   455 bits (1171),  Expect = 3e-158, Method: Compositional matrix adjust.
 Identities = 212/240 (88%), Positives = 232/240 (97%), Gaps = 0/240 (0%)
 Frame = +3

Query  84   AENQTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADE  263
            +E+Q  +HQEVGHKSLLQSDALYQYILETSVYPREP  MKELREVTAKHPWNLMTTSADE
Sbjct  8    SESQPAKHQEVGHKSLLQSDALYQYILETSVYPREPAPMKELREVTAKHPWNLMTTSADE  67

Query  264  GQFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKA  443
            GQFL++LLKLINAKNTMEIGVYTGYSLL+TALALPDDGKILA+DINRENYE+GLP+IEKA
Sbjct  68   GQFLNLLLKLINAKNTMEIGVYTGYSLLSTALALPDDGKILALDINRENYEIGLPIIEKA  127

Query  444  GVAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIG  623
            GVAHKIDFREGPALP+LD ++ED K HG++DFIFVDADKDNYLNYHKRLIDLVK+GGVIG
Sbjct  128  GVAHKIDFREGPALPLLDSMIEDKKFHGSFDFIFVDADKDNYLNYHKRLIDLVKIGGVIG  187

Query  624  YDNTLWNGSVVAPPDAPMRKYIKYYRDFVLELNKALAVDPRIEICMLPVGDGITLCRRIS  803
            YDNTLWNGS+VAPPDAP+RKY++YYRDFVLELNKALAVDPR+EIC LPVGDGITLCRRIS
Sbjct  188  YDNTLWNGSLVAPPDAPLRKYVRYYRDFVLELNKALAVDPRVEICQLPVGDGITLCRRIS  247



>dbj|BAG71890.1| caffeoyl CoA O-methyltransferase [Carthamus tinctorius]
Length=244

 Score =   455 bits (1170),  Expect = 4e-158, Method: Compositional matrix adjust.
 Identities = 211/242 (87%), Positives = 232/242 (96%), Gaps = 0/242 (0%)
 Frame = +3

Query  78   AMAENQTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSA  257
            A  E Q  +HQEVGHKSLLQSDALYQYILETSVYPREPE+MKELREVTAKHPWNLMTTSA
Sbjct  3    ATGETQPAKHQEVGHKSLLQSDALYQYILETSVYPREPESMKELREVTAKHPWNLMTTSA  62

Query  258  DEGQFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIE  437
            DEGQFL++LLKLINAKNTMEIGVYTGYSLL+TALALP+DGKILA+DINRENYE+GLP+IE
Sbjct  63   DEGQFLNLLLKLINAKNTMEIGVYTGYSLLSTALALPEDGKILALDINRENYEIGLPIIE  122

Query  438  KAGVAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGV  617
            KAGVAHKIDFREGPALP+LDQ+V+D K HG++DFIFVDADKDNYLNYHKRLIDLVK+GGV
Sbjct  123  KAGVAHKIDFREGPALPLLDQMVDDEKFHGSFDFIFVDADKDNYLNYHKRLIDLVKIGGV  182

Query  618  IGYDNTLWNGSVVAPPDAPMRKYIKYYRDFVLELNKALAVDPRIEICMLPVGDGITLCRR  797
            IGYDNTLWNGS+VAPPDAP+RKY++YYRDFVLELNKALA D R+EIC LPVGDGITLCRR
Sbjct  183  IGYDNTLWNGSLVAPPDAPLRKYVRYYRDFVLELNKALAADSRVEICQLPVGDGITLCRR  242

Query  798  IS  803
            +S
Sbjct  243  VS  244



>gb|ABO77959.1| caffeoyl-CoA 3-O methyltransferase [Coffea canephora]
 emb|CDO97193.1| unnamed protein product [Coffea canephora]
Length=247

 Score =   455 bits (1170),  Expect = 4e-158, Method: Compositional matrix adjust.
 Identities = 211/239 (88%), Positives = 232/239 (97%), Gaps = 0/239 (0%)
 Frame = +3

Query  87   ENQTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEG  266
            ++Q  RHQEVGHKSLLQSDALYQYILETSVYPREPE MKELRE+TAKHPWN+MTTSADEG
Sbjct  9    DSQNLRHQEVGHKSLLQSDALYQYILETSVYPREPEPMKELRELTAKHPWNIMTTSADEG  68

Query  267  QFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAG  446
            QFL+M++KLINAK TMEIGVYTGYSLLATALALP+DGKILAMDINRENYELGLPVIE+AG
Sbjct  69   QFLNMIIKLINAKKTMEIGVYTGYSLLATALALPEDGKILAMDINRENYELGLPVIERAG  128

Query  447  VAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIGY  626
            V+HKIDFREGPALP+LD+L+ED K HG++DFIFVDADKDNYLNYHKR+I+LVKVGG+IGY
Sbjct  129  VSHKIDFREGPALPVLDELIEDDKNHGSFDFIFVDADKDNYLNYHKRIIELVKVGGMIGY  188

Query  627  DNTLWNGSVVAPPDAPMRKYIKYYRDFVLELNKALAVDPRIEICMLPVGDGITLCRRIS  803
            DNTLWNGSVVAPPDAPMRKY++YYRDFVLELNKALA DPRIEICMLPVGDGITLCRR+S
Sbjct  189  DNTLWNGSVVAPPDAPMRKYVRYYRDFVLELNKALAADPRIEICMLPVGDGITLCRRVS  247



>ref|XP_009604110.1| PREDICTED: caffeoyl-CoA O-methyltransferase 2 [Nicotiana tomentosiformis]
 sp|O24149.1|CAMT2_TOBAC RecName: Full=Caffeoyl-CoA O-methyltransferase 2; AltName: Full=Trans-caffeoyl-CoA 
3-O-methyltransferase 2; Short=CCoAMT-2; 
Short=CCoAOMT-2 [Nicotiana tabacum]
 gb|AAC49914.1| caffeoyl-CoA O-methyltransferase 2 [Nicotiana tabacum]
Length=242

 Score =   454 bits (1169),  Expect = 6e-158, Method: Compositional matrix adjust.
 Identities = 216/242 (89%), Positives = 231/242 (95%), Gaps = 1/242 (0%)
 Frame = +3

Query  81   MAEN-QTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSA  257
            MA N +  RHQEVGHKSLLQSDALYQYILETSVYPREPE MKELRE+TAKHPWNLMTTSA
Sbjct  1    MATNGENGRHQEVGHKSLLQSDALYQYILETSVYPREPEPMKELREITAKHPWNLMTTSA  60

Query  258  DEGQFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIE  437
            DEGQFLSMLLKLINAKNTMEIGV+TGYSLLATA+ALPDDGKILAMDINRENYE+GLP+IE
Sbjct  61   DEGQFLSMLLKLINAKNTMEIGVFTGYSLLATAMALPDDGKILAMDINRENYEIGLPIIE  120

Query  438  KAGVAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGV  617
            KAG+AHKI FREGPALP+LDQ++ED K HG+YDFIFVDADKDNYLNYHKRLIDLVKVGG+
Sbjct  121  KAGLAHKIVFREGPALPVLDQMIEDGKYHGSYDFIFVDADKDNYLNYHKRLIDLVKVGGL  180

Query  618  IGYDNTLWNGSVVAPPDAPMRKYIKYYRDFVLELNKALAVDPRIEICMLPVGDGITLCRR  797
            IGYDNTLWNGSVVAPPDAP+RKY++YYRDFVLELNKALA D RIEIC LPVGDGITLCRR
Sbjct  181  IGYDNTLWNGSVVAPPDAPLRKYVRYYRDFVLELNKALAADSRIEICQLPVGDGITLCRR  240

Query  798  IS  803
            IS
Sbjct  241  IS  242



>gb|ACJ84500.1| unknown [Medicago truncatula]
Length=247

 Score =   454 bits (1169),  Expect = 6e-158, Method: Compositional matrix adjust.
 Identities = 215/240 (90%), Positives = 232/240 (97%), Gaps = 2/240 (1%)
 Frame = +3

Query  87   ENQTT--RHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSAD  260
            +NQT   RHQEVGHKSLLQSDALYQYILETSV+PRE EAMKELREVTAKHPWN+MTTSAD
Sbjct  7    QNQTESGRHQEVGHKSLLQSDALYQYILETSVFPREHEAMKELREVTAKHPWNIMTTSAD  66

Query  261  EGQFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEK  440
            EGQFLSMLLKLINAKNTMEIGVYTGYSLLATALA+P+DGKILAMDIN+ENYELGLPVI+K
Sbjct  67   EGQFLSMLLKLINAKNTMEIGVYTGYSLLATALAIPEDGKILAMDINKENYELGLPVIKK  126

Query  441  AGVAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVI  620
            AGV HKIDFREGPALP+LD++++D K HG+YDFIFVDADKDNYLNYHKRLIDLVKVGGVI
Sbjct  127  AGVDHKIDFREGPALPVLDEMIKDEKNHGSYDFIFVDADKDNYLNYHKRLIDLVKVGGVI  186

Query  621  GYDNTLWNGSVVAPPDAPMRKYIKYYRDFVLELNKALAVDPRIEICMLPVGDGITLCRRI  800
            GYDNTLWNGSVV PPDAP+RKY++YYRDFVLELNKALAVDPRIEICMLPVGDGIT+CRRI
Sbjct  187  GYDNTLWNGSVVTPPDAPLRKYVRYYRDFVLELNKALAVDPRIEICMLPVGDGITICRRI  246



>gb|ACQ59096.1| caffeoyl CoA O-methyltransferase 2 [Gossypium hirsutum]
Length=248

 Score =   454 bits (1169),  Expect = 7e-158, Method: Compositional matrix adjust.
 Identities = 218/247 (88%), Positives = 232/247 (94%), Gaps = 7/247 (3%)
 Frame = +3

Query  81   MAENQTT-------RHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWN  239
            MA N T        RHQEVGHKSLLQSDALYQYILETSVYP EPE MKELRE+TAKHPWN
Sbjct  1    MATNTTQEQQPAAGRHQEVGHKSLLQSDALYQYILETSVYPMEPEPMKELRELTAKHPWN  60

Query  240  LMTTSADEGQFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYEL  419
            LMTTSADEGQFL+MLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYEL
Sbjct  61   LMTTSADEGQFLNMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYEL  120

Query  420  GLPVIEKAGVAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDL  599
            GLPVI KAGVAHKI+F+EGPA+P+LD+LVED K HG+YDFIFVDADKDNYLNYHKRLI+L
Sbjct  121  GLPVIRKAGVAHKIEFKEGPAMPVLDKLVEDEKNHGSYDFIFVDADKDNYLNYHKRLIEL  180

Query  600  VKVGGVIGYDNTLWNGSVVAPPDAPMRKYIKYYRDFVLELNKALAVDPRIEICMLPVGDG  779
            VKVGG+IGYDNTLWNGSVVAPPDAP+RKY++YYRDFVLELNKALAVDPRIEICMLPVGDG
Sbjct  181  VKVGGLIGYDNTLWNGSVVAPPDAPLRKYVRYYRDFVLELNKALAVDPRIEICMLPVGDG  240

Query  780  ITLCRRI  800
            ITLCRR+
Sbjct  241  ITLCRRV  247



>ref|XP_007042462.1| S-adenosyl-L-methionine-dependent methyltransferases superfamily 
protein isoform 2 [Theobroma cacao]
 gb|EOX98293.1| S-adenosyl-L-methionine-dependent methyltransferases superfamily 
protein isoform 2 [Theobroma cacao]
Length=248

 Score =   454 bits (1169),  Expect = 8e-158, Method: Compositional matrix adjust.
 Identities = 214/239 (90%), Positives = 231/239 (97%), Gaps = 1/239 (0%)
 Frame = +3

Query  87   ENQTTRHQEVGHKSLLQSDALYQ-YILETSVYPREPEAMKELREVTAKHPWNLMTTSADE  263
            ++Q  RHQEVGHKSLLQSDALYQ YILETSVYPREPE MKELRE+TAKHPWNLMTTSADE
Sbjct  9    QSQAGRHQEVGHKSLLQSDALYQQYILETSVYPREPEPMKELRELTAKHPWNLMTTSADE  68

Query  264  GQFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKA  443
            GQFL+MLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVI+KA
Sbjct  69   GQFLNMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIQKA  128

Query  444  GVAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIG  623
            GVAHKIDF+EGPA+P LDQLVED K HG++DF+FVDADKDNY+NYHKRLI+LVKVGG+IG
Sbjct  129  GVAHKIDFKEGPAMPALDQLVEDEKNHGSFDFVFVDADKDNYINYHKRLIELVKVGGLIG  188

Query  624  YDNTLWNGSVVAPPDAPMRKYIKYYRDFVLELNKALAVDPRIEICMLPVGDGITLCRRI  800
            YDNTLWNGSVVAPPDAP+RKY++YYRDFVLELNKALA DPRIEICMLPVGDGITLCRR+
Sbjct  189  YDNTLWNGSVVAPPDAPLRKYVRYYRDFVLELNKALAADPRIEICMLPVGDGITLCRRV  247



>gb|ABZ89569.1| O-methyltransferase 5 [Humulus lupulus]
Length=247

 Score =   454 bits (1168),  Expect = 8e-158, Method: Compositional matrix adjust.
 Identities = 211/239 (88%), Positives = 230/239 (96%), Gaps = 0/239 (0%)
 Frame = +3

Query  87   ENQTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEG  266
            + Q +RHQEVGHKSLLQSDALYQYILETSVYPREPE+MKELREVTAKHPWN+MTTSADEG
Sbjct  9    QXQVSRHQEVGHKSLLQSDALYQYILETSVYPREPESMKELREVTAKHPWNIMTTSADEG  68

Query  267  QFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAG  446
            QFL+MLLKLINAKNTMEIGVYTGYSLLATALA+P+DGKILAMDINRENYELGLP+IEKAG
Sbjct  69   QFLNMLLKLINAKNTMEIGVYTGYSLLATALAIPEDGKILAMDINRENYELGLPIIEKAG  128

Query  447  VAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIGY  626
            VAHKIDFREGPALP+ DQ++ED K HG++DFIFVDADKDNYLNYHKRLIDLVKVGGVIG 
Sbjct  129  VAHKIDFREGPALPVXDQMIEDGKYHGSFDFIFVDADKDNYLNYHKRLIDLVKVGGVIGX  188

Query  627  DNTLWNGSVVAPPDAPMRKYIKYYRDFVLELNKALAVDPRIEICMLPVGDGITLCRRIS  803
            DNTLWNGSVVAPPDAP+RKY++YYRDFV+ELNKALA DPRIEIC LPVGDG+T+C RIS
Sbjct  189  DNTLWNGSVVAPPDAPLRKYVRYYRDFVIELNKALAADPRIEICTLPVGDGVTICHRIS  247



>gb|AEW26089.1| caffeoyl-CoA 3-o-methyltransferase, partial [Medicago sativa 
subsp. x varia]
 gb|AEW26091.1| caffeoyl-CoA 3-o-methyltransferase, partial [Medicago sativa 
subsp. caerulea]
 gb|AEW26092.1| caffeoyl-CoA 3-o-methyltransferase, partial [Medicago sativa 
subsp. x varia]
 gb|AEW26093.1| caffeoyl-CoA 3-o-methyltransferase, partial [Medicago sativa 
subsp. x varia]
 gb|AEW26094.1| caffeoyl-CoA 3-o-methyltransferase, partial [Medicago sativa 
subsp. caerulea]
 gb|AEW26095.1| caffeoyl-CoA 3-o-methyltransferase, partial [Medicago sativa 
subsp. x varia]
 gb|AEW26096.1| caffeoyl-CoA 3-o-methyltransferase, partial [Medicago sativa 
subsp. caerulea]
 gb|AEW26097.1| caffeoyl-CoA 3-o-methyltransferase, partial [Medicago falcata]
 gb|AEW26099.1| caffeoyl-CoA 3-o-methyltransferase, partial [Medicago falcata]
 gb|AEW26100.1| caffeoyl-CoA 3-o-methyltransferase, partial [Medicago sativa 
subsp. caerulea]
 gb|AEW26105.1| caffeoyl-CoA 3-o-methyltransferase, partial [Medicago falcata]
 gb|AEW26106.1| caffeoyl-CoA 3-o-methyltransferase, partial [Medicago falcata]
 gb|AEW26112.1| caffeoyl-CoA 3-o-methyltransferase, partial [Medicago falcata]
 gb|AEW26115.1| caffeoyl-CoA 3-o-methyltransferase, partial [Medicago falcata]
 gb|AEW26116.1| caffeoyl-CoA 3-o-methyltransferase, partial [Medicago falcata]
 gb|AEW26117.1| caffeoyl-CoA 3-o-methyltransferase, partial [Medicago falcata]
 gb|AEW26118.1| caffeoyl-CoA 3-o-methyltransferase, partial [Medicago sativa 
subsp. caerulea]
 gb|AEW26119.1| caffeoyl-CoA 3-o-methyltransferase, partial [Medicago sativa 
subsp. caerulea]
 gb|AEW26120.1| caffeoyl-CoA 3-o-methyltransferase, partial [Medicago sativa 
subsp. caerulea]
 gb|AEW26121.1| caffeoyl-CoA 3-o-methyltransferase, partial [Medicago sativa 
subsp. caerulea]
 gb|AEW26122.1| caffeoyl-CoA 3-o-methyltransferase, partial [Medicago sativa 
subsp. caerulea]
 gb|AEW26123.1| caffeoyl-CoA 3-o-methyltransferase, partial [Medicago sativa 
subsp. x varia]
 gb|AEW26124.1| caffeoyl-CoA 3-o-methyltransferase, partial [Medicago falcata]
 gb|AEW26125.1| caffeoyl-CoA 3-o-methyltransferase, partial [Medicago sativa 
subsp. caerulea]
 gb|AEW26127.1| caffeoyl-CoA 3-o-methyltransferase, partial [Medicago falcata]
 gb|AEW26128.1| caffeoyl-CoA 3-o-methyltransferase, partial [Medicago falcata]
 gb|AEW26129.1| caffeoyl-CoA 3-o-methyltransferase, partial [Medicago falcata]
 gb|AEW26130.1| caffeoyl-CoA 3-o-methyltransferase, partial [Medicago sativa 
subsp. caerulea]
 gb|AEW26133.1| caffeoyl-CoA 3-o-methyltransferase, partial [Medicago sativa 
subsp. caerulea]
 gb|AEW26134.1| caffeoyl-CoA 3-o-methyltransferase, partial [Medicago sativa 
subsp. caerulea]
 gb|AEW26135.1| caffeoyl-CoA 3-o-methyltransferase, partial [Medicago sativa 
subsp. caerulea]
 gb|AEW26137.1| caffeoyl-CoA 3-o-methyltransferase, partial [Medicago falcata]
 gb|AEW26139.1| caffeoyl-CoA 3-o-methyltransferase, partial [Medicago falcata]
 gb|AEW26140.1| caffeoyl-CoA 3-o-methyltransferase, partial [Medicago falcata]
 gb|AEW26141.1| caffeoyl-CoA 3-o-methyltransferase, partial [Medicago falcata]
 gb|AEW26142.1| caffeoyl-CoA 3-o-methyltransferase, partial [Medicago falcata]
 gb|AEW26144.1| caffeoyl-CoA 3-o-methyltransferase, partial [Medicago falcata]
 gb|AEW26145.1| caffeoyl-CoA 3-o-methyltransferase, partial [Medicago falcata]
 gb|AEW26146.1| caffeoyl-CoA 3-o-methyltransferase, partial [Medicago falcata]
 gb|AEW26147.1| caffeoyl-CoA 3-o-methyltransferase, partial [Medicago falcata]
 gb|AEW26148.1| caffeoyl-CoA 3-o-methyltransferase, partial [Medicago falcata]
 gb|AEW26149.1| caffeoyl-CoA 3-o-methyltransferase, partial [Medicago sativa 
subsp. caerulea]
 gb|AEW26150.1| caffeoyl-CoA 3-o-methyltransferase, partial [Medicago sativa 
subsp. caerulea]
 gb|AEW26152.1| caffeoyl-CoA 3-o-methyltransferase, partial [Medicago sativa 
subsp. caerulea]
 gb|AEW26153.1| caffeoyl-CoA 3-o-methyltransferase, partial [Medicago sativa 
subsp. x varia]
 gb|AEW26154.1| caffeoyl-CoA 3-o-methyltransferase, partial [Medicago sativa 
subsp. x varia]
 gb|AEW26155.1| caffeoyl-CoA 3-o-methyltransferase, partial [Medicago sativa 
subsp. caerulea]
 gb|AEW26156.1| caffeoyl-CoA 3-o-methyltransferase, partial [Medicago falcata]
 gb|AEW26157.1| caffeoyl-CoA 3-o-methyltransferase, partial [Medicago sativa 
subsp. caerulea]
 gb|AEW26158.1| caffeoyl-CoA 3-o-methyltransferase, partial [Medicago sativa 
subsp. caerulea]
 gb|AEW26159.1| caffeoyl-CoA 3-o-methyltransferase, partial [Medicago sativa 
subsp. caerulea]
 gb|AEW26160.1| caffeoyl-CoA 3-o-methyltransferase, partial [Medicago falcata]
Length=237

 Score =   453 bits (1166),  Expect = 1e-157, Method: Compositional matrix adjust.
 Identities = 213/236 (90%), Positives = 231/236 (98%), Gaps = 0/236 (0%)
 Frame = +3

Query  93   QTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEGQF  272
            ++ RHQEVGHKSLLQSDALYQYILETSV+PRE EAMKELREVTAKHPWN+MTTSADEGQF
Sbjct  2    ESGRHQEVGHKSLLQSDALYQYILETSVFPREHEAMKELREVTAKHPWNIMTTSADEGQF  61

Query  273  LSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAGVA  452
            LSMLLKLINAKNTMEIGVYTGYSLLATALA+P+DGKILAMDIN+ENYELGLPVI+KAGV 
Sbjct  62   LSMLLKLINAKNTMEIGVYTGYSLLATALAIPEDGKILAMDINKENYELGLPVIKKAGVD  121

Query  453  HKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIGYDN  632
            HKIDFREGPALP+LD++++D K HG+YDFIFVDADKDNYLNYHKRLIDLVKVGGVIGYDN
Sbjct  122  HKIDFREGPALPVLDEMIKDEKNHGSYDFIFVDADKDNYLNYHKRLIDLVKVGGVIGYDN  181

Query  633  TLWNGSVVAPPDAPMRKYIKYYRDFVLELNKALAVDPRIEICMLPVGDGITLCRRI  800
            TLWNGSVVAPPDAP+RKY++YYRDFVLELNKALAVDPRIEICMLPVGDGIT+CRRI
Sbjct  182  TLWNGSVVAPPDAPLRKYVRYYRDFVLELNKALAVDPRIEICMLPVGDGITICRRI  237



>ref|XP_007047308.1| Caffeoyl-CoA O-methyltransferase 1 [Theobroma cacao]
 gb|EOX91465.1| Caffeoyl-CoA O-methyltransferase 1 [Theobroma cacao]
Length=247

 Score =   454 bits (1167),  Expect = 1e-157, Method: Compositional matrix adjust.
 Identities = 214/239 (90%), Positives = 229/239 (96%), Gaps = 0/239 (0%)
 Frame = +3

Query  87   ENQTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEG  266
            +NQ  RHQEVGHKSLLQSD LYQYILETSVYPREPE MKELRE+TAKHPWN+MTTSADEG
Sbjct  9    QNQAGRHQEVGHKSLLQSDNLYQYILETSVYPREPEPMKELRELTAKHPWNIMTTSADEG  68

Query  267  QFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAG  446
            QFL+MLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVI+KAG
Sbjct  69   QFLNMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIQKAG  128

Query  447  VAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIGY  626
            VAHKIDF+EGP+LP+LDQ++E  K HGT+DFIFVDADKDNYLNYHKRLI+LVKVGGVIGY
Sbjct  129  VAHKIDFKEGPSLPVLDQMIEAGKYHGTFDFIFVDADKDNYLNYHKRLIELVKVGGVIGY  188

Query  627  DNTLWNGSVVAPPDAPMRKYIKYYRDFVLELNKALAVDPRIEICMLPVGDGITLCRRIS  803
            DNTLWNGSVVAPPDAP+RKY+ YYRDFVLELN+ALA DPRIEIC LPVGDGITLCRRIS
Sbjct  189  DNTLWNGSVVAPPDAPLRKYVLYYRDFVLELNRALAADPRIEICQLPVGDGITLCRRIS  247



>gb|AEV93479.1| cinnamoyl-CoA O-methyltransferase [Caragana korshinskii]
Length=247

 Score =   454 bits (1167),  Expect = 1e-157, Method: Compositional matrix adjust.
 Identities = 211/238 (89%), Positives = 232/238 (97%), Gaps = 0/238 (0%)
 Frame = +3

Query  87   ENQTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEG  266
            + ++ RHQEVGHKSLLQSDALYQYILETSVYPRE EAMKELRE+TAKHPWN+MTTSADEG
Sbjct  9    QTESGRHQEVGHKSLLQSDALYQYILETSVYPREHEAMKELRELTAKHPWNIMTTSADEG  68

Query  267  QFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAG  446
            QFL+MLLKLINAKNTMEIGVYTGYSLLATALA+P+DGKILAMDIN+ENYELGLPVI+KAG
Sbjct  69   QFLNMLLKLINAKNTMEIGVYTGYSLLATALAIPEDGKILAMDINKENYELGLPVIKKAG  128

Query  447  VAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIGY  626
            VAHKIDFREGPALP+LD++V+D K HG+YDFIFVDADKDNY+NYH+RLIDLVKVGGVIGY
Sbjct  129  VAHKIDFREGPALPVLDEMVKDEKNHGSYDFIFVDADKDNYINYHQRLIDLVKVGGVIGY  188

Query  627  DNTLWNGSVVAPPDAPMRKYIKYYRDFVLELNKALAVDPRIEICMLPVGDGITLCRRI  800
            DNTLWNGSVVAPPDAP+RKY++YYRDFVLELNKALA DPRIEICMLPVGDGIT+CRRI
Sbjct  189  DNTLWNGSVVAPPDAPLRKYVRYYRDFVLELNKALAADPRIEICMLPVGDGITICRRI  246



>gb|AFX98065.1| caffeoyl-CoA O-methyltransferase [Cunninghamia lanceolata]
Length=255

 Score =   454 bits (1168),  Expect = 1e-157, Method: Compositional matrix adjust.
 Identities = 208/240 (87%), Positives = 232/240 (97%), Gaps = 0/240 (0%)
 Frame = +3

Query  84   AENQTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADE  263
            +  Q +RHQEVGHKSLLQSDALYQYILETSVYPREPE+M+ELRE+TAKHPWNLMTTSADE
Sbjct  16   STKQVSRHQEVGHKSLLQSDALYQYILETSVYPREPESMRELREITAKHPWNLMTTSADE  75

Query  264  GQFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKA  443
            GQFL++LLKLINAKNTMEIGVYTGYSLL+TALALPDDGKI+AMDINRENYELGLPVI+KA
Sbjct  76   GQFLNLLLKLINAKNTMEIGVYTGYSLLSTALALPDDGKIIAMDINRENYELGLPVIQKA  135

Query  444  GVAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIG  623
            GVAHKIDFREGPALP+LDQ++E+ + HG++DFIFVDADKDNYLNYHKRLIDLVK+GGVIG
Sbjct  136  GVAHKIDFREGPALPVLDQMLENKEMHGSFDFIFVDADKDNYLNYHKRLIDLVKIGGVIG  195

Query  624  YDNTLWNGSVVAPPDAPMRKYIKYYRDFVLELNKALAVDPRIEICMLPVGDGITLCRRIS  803
            YDNTLWNGSVVAPPDAP+RKY++YYRDFV+ELNKALA DPRIEI  +PVGDGITLCRR+S
Sbjct  196  YDNTLWNGSVVAPPDAPLRKYVRYYRDFVIELNKALAADPRIEISQIPVGDGITLCRRVS  255



>gb|ADI43381.1| caffeoyl-CoA O-methyltransferase [Eucalyptus camaldulensis]
Length=246

 Score =   454 bits (1167),  Expect = 2e-157, Method: Compositional matrix adjust.
 Identities = 216/240 (90%), Positives = 230/240 (96%), Gaps = 1/240 (0%)
 Frame = +3

Query  84   AENQTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADE  263
            ++ Q  RHQEVGHKSLLQSDALYQYILETSVYPREPE MKELRE+TAKHPWN+MTTSADE
Sbjct  8    SQTQAGRHQEVGHKSLLQSDALYQYILETSVYPREPEPMKELREITAKHPWNIMTTSADE  67

Query  264  GQFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKA  443
            GQFL+MLLKLINAKNTMEIGV+TGYSLLATALALPDDGKILAMDINRENYELGLPVI+KA
Sbjct  68   GQFLNMLLKLINAKNTMEIGVFTGYSLLATALALPDDGKILAMDINRENYELGLPVIQKA  127

Query  444  GVAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIG  623
            GVA KIDFREGPALPILDQL+ED  K G +DFIFVDADKDNYLNYHKRLI+LVKVGG+IG
Sbjct  128  GVADKIDFREGPALPILDQLIED-GKQGAFDFIFVDADKDNYLNYHKRLIELVKVGGLIG  186

Query  624  YDNTLWNGSVVAPPDAPMRKYIKYYRDFVLELNKALAVDPRIEICMLPVGDGITLCRRIS  803
            YDNTLWNGSVVAPPDAP+RKY++YYRDFVLELNKALA DPRIEICMLPVGDGITLCRRIS
Sbjct  187  YDNTLWNGSVVAPPDAPLRKYVRYYRDFVLELNKALAADPRIEICMLPVGDGITLCRRIS  246



>ref|XP_002518739.1| o-methyltransferase, putative [Ricinus communis]
 gb|EEF43664.1| o-methyltransferase, putative [Ricinus communis]
Length=248

 Score =   454 bits (1167),  Expect = 2e-157, Method: Compositional matrix adjust.
 Identities = 211/247 (85%), Positives = 232/247 (94%), Gaps = 0/247 (0%)
 Frame = +3

Query  60   LAGKFKAMAENQTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWN  239
            +A   +   +NQ  RHQEVGHKSLLQSDALYQYILETSVYP EPE MKELRE+TAKHPWN
Sbjct  1    MASNNEEQQQNQAGRHQEVGHKSLLQSDALYQYILETSVYPNEPEPMKELRELTAKHPWN  60

Query  240  LMTTSADEGQFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYEL  419
            +MTTSADEGQFL+MLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYEL
Sbjct  61   IMTTSADEGQFLNMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYEL  120

Query  420  GLPVIEKAGVAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDL  599
            GLPVI+KAGVAHKI+FREGPA+P+LD++V D K HG++DFIFVDADKDNYLNYH+RL++L
Sbjct  121  GLPVIQKAGVAHKIEFREGPAMPVLDEMVADEKYHGSFDFIFVDADKDNYLNYHQRLVEL  180

Query  600  VKVGGVIGYDNTLWNGSVVAPPDAPMRKYIKYYRDFVLELNKALAVDPRIEICMLPVGDG  779
            VKVGGVIGYDNTLWNGSVVAPPDAP+RKY++YYRDFVLELNKAL  DPRIEICMLPVGDG
Sbjct  181  VKVGGVIGYDNTLWNGSVVAPPDAPLRKYVRYYRDFVLELNKALPADPRIEICMLPVGDG  240

Query  780  ITLCRRI  800
            ITLCRR+
Sbjct  241  ITLCRRV  247



>gb|KJB79353.1| hypothetical protein B456_013G045300 [Gossypium raimondii]
Length=248

 Score =   453 bits (1166),  Expect = 2e-157, Method: Compositional matrix adjust.
 Identities = 213/238 (89%), Positives = 231/238 (97%), Gaps = 2/238 (1%)
 Frame = +3

Query  87   ENQTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEG  266
            ++Q  RHQEVGHKSLLQSDALYQYILETSVYPREPE MKELRE+TAKHPWNLMTTSADEG
Sbjct  12   QSQAGRHQEVGHKSLLQSDALYQYILETSVYPREPEPMKELREITAKHPWNLMTTSADEG  71

Query  267  QFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAG  446
            QFL+MLLKLINAKNTMEIGVYTGYSLLATALALPDDGKI AMDINRENYELGLPVI+KAG
Sbjct  72   QFLNMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKIFAMDINRENYELGLPVIQKAG  131

Query  447  VAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIGY  626
            VAHKIDF+EGPA+P+LD+LV+D   HG++DFIFVDADKDNYLNYHKRLI+LVKVGG+IGY
Sbjct  132  VAHKIDFKEGPAMPVLDELVQD--NHGSFDFIFVDADKDNYLNYHKRLIELVKVGGLIGY  189

Query  627  DNTLWNGSVVAPPDAPMRKYIKYYRDFVLELNKALAVDPRIEICMLPVGDGITLCRRI  800
            DNTLWNGSVVAPPDAP+RKY++YYRDFVLELNKALAVDPRIEICMLPVGDGITLCRR+
Sbjct  190  DNTLWNGSVVAPPDAPLRKYVRYYRDFVLELNKALAVDPRIEICMLPVGDGITLCRRL  247



>ref|NP_001234801.1| caffeoyl-CoA O-methyltransferase [Solanum lycopersicum]
 gb|ABV90868.1| caffeoyl-CoA O-methyltransferase [Solanum lycopersicum]
Length=242

 Score =   453 bits (1166),  Expect = 2e-157, Method: Compositional matrix adjust.
 Identities = 215/242 (89%), Positives = 231/242 (95%), Gaps = 1/242 (0%)
 Frame = +3

Query  81   MAEN-QTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSA  257
            MA N +  RHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELRE+TAKHPWNLMTTSA
Sbjct  1    MASNGENGRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREITAKHPWNLMTTSA  60

Query  258  DEGQFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIE  437
            DEGQFLSMLLKLINAKNTMEIGV+TGYSLLATA+ALPDDGKILAMDINRENY +GLPVIE
Sbjct  61   DEGQFLSMLLKLINAKNTMEIGVFTGYSLLATAMALPDDGKILAMDINRENYVIGLPVIE  120

Query  438  KAGVAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGV  617
            KAG+AHKI FREGPALP+LDQ+++D K HG+Y+FIFVDADKDNYLNYHKRLIDLV VGG+
Sbjct  121  KAGLAHKIVFREGPALPVLDQMIDDGKYHGSYEFIFVDADKDNYLNYHKRLIDLVNVGGI  180

Query  618  IGYDNTLWNGSVVAPPDAPMRKYIKYYRDFVLELNKALAVDPRIEICMLPVGDGITLCRR  797
            IGYDNTLWNGSVVAPPDAP+RKY++YYRDFVLELNKALA DPRIEIC LPVGDGITLCRR
Sbjct  181  IGYDNTLWNGSVVAPPDAPLRKYVRYYRDFVLELNKALAADPRIEICQLPVGDGITLCRR  240

Query  798  IS  803
            IS
Sbjct  241  IS  242



>gb|AFZ78548.1| caffeoyl-CoA O-methyltransferase [Populus tomentosa]
Length=247

 Score =   453 bits (1166),  Expect = 2e-157, Method: Compositional matrix adjust.
 Identities = 212/238 (89%), Positives = 230/238 (97%), Gaps = 0/238 (0%)
 Frame = +3

Query  87   ENQTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEG  266
            + Q  RHQEVGHKSLLQSDALYQYILETSVYPREPE MKELRE+TAKHPWN+MTTSADEG
Sbjct  9    QTQAGRHQEVGHKSLLQSDALYQYILETSVYPREPECMKELRELTAKHPWNIMTTSADEG  68

Query  267  QFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAG  446
            QFL+MLLKLINAKNTMEIGVYTGYSLLATALA+P+DGKILAMDINRENYELGLPVI+KAG
Sbjct  69   QFLNMLLKLINAKNTMEIGVYTGYSLLATALAIPEDGKILAMDINRENYELGLPVIQKAG  128

Query  447  VAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIGY  626
            VA+KI+F+EGPALP+LDQ++ED K HGTYDFIFVDADKDNY+NYHKRLI+LVKVGG+IGY
Sbjct  129  VANKIEFKEGPALPVLDQMIEDGKYHGTYDFIFVDADKDNYINYHKRLIELVKVGGLIGY  188

Query  627  DNTLWNGSVVAPPDAPMRKYIKYYRDFVLELNKALAVDPRIEICMLPVGDGITLCRRI  800
            DNTLWNGSVVAP DAPMRKY++YYRDFVLELNKALA DPRIEICMLPVGDGITLCRRI
Sbjct  189  DNTLWNGSVVAPADAPMRKYVRYYRDFVLELNKALAADPRIEICMLPVGDGITLCRRI  246



>gb|AFD23679.1| caffeoyl CoA O-methyltransferase [Salvia miltiorrhiza]
Length=247

 Score =   453 bits (1166),  Expect = 2e-157, Method: Compositional matrix adjust.
 Identities = 214/239 (90%), Positives = 228/239 (95%), Gaps = 0/239 (0%)
 Frame = +3

Query  87   ENQTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEG  266
            ENQ  RHQEVGHKSLLQSD LYQYILETSVYPREPE MKELRE+TA HPWN+MTTSADEG
Sbjct  9    ENQAGRHQEVGHKSLLQSDDLYQYILETSVYPREPEPMKELREITANHPWNIMTTSADEG  68

Query  267  QFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAG  446
            QFL+MLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDIN+ENYELGLPVIEKAG
Sbjct  69   QFLNMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINKENYELGLPVIEKAG  128

Query  447  VAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIGY  626
            VAHKI+F+EGPALP+LDQ+V + K HG++DFIFVDADKDNYLNYHKR IDLVKVGGVIGY
Sbjct  129  VAHKIEFKEGPALPVLDQMVAEGKHHGSFDFIFVDADKDNYLNYHKRPIDLVKVGGVIGY  188

Query  627  DNTLWNGSVVAPPDAPMRKYIKYYRDFVLELNKALAVDPRIEICMLPVGDGITLCRRIS  803
            DNTLWNGSVVAPPDAP+RKY++YYRDFVLELNKALA DPRIEIC LPVGDGITLCRRIS
Sbjct  189  DNTLWNGSVVAPPDAPLRKYVRYYRDFVLELNKALAADPRIEICQLPVGDGITLCRRIS  247



>sp|O24151.1|CAMT4_TOBAC RecName: Full=Caffeoyl-CoA O-methyltransferase 4; AltName: Full=Trans-caffeoyl-CoA 
3-O-methyltransferase 4; Short=CCoAMT-4; 
Short=CCoAOMT-4 [Nicotiana tabacum]
 gb|AAC49916.1| caffeoyl-CoA O-methyltransferase 4 [Nicotiana tabacum]
Length=242

 Score =   453 bits (1165),  Expect = 2e-157, Method: Compositional matrix adjust.
 Identities = 211/240 (88%), Positives = 230/240 (96%), Gaps = 0/240 (0%)
 Frame = +3

Query  84   AENQTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADE  263
             + +  RHQEVGHKSLLQSDALYQYILETSVYPREPE MKELRE+TAKHPWNLMTTSADE
Sbjct  3    TDGENGRHQEVGHKSLLQSDALYQYILETSVYPREPEPMKELREITAKHPWNLMTTSADE  62

Query  264  GQFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKA  443
            GQFLSML+KLINAKNTMEIGV+TGYSLLATA+ALPDDGKILAMDINRENYE+GLPVIEKA
Sbjct  63   GQFLSMLIKLINAKNTMEIGVFTGYSLLATAMALPDDGKILAMDINRENYEIGLPVIEKA  122

Query  444  GVAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIG  623
            G+AHKI+F+EGPALP+LDQ++ED K HG+YDFIFVDADKDNYLNYHKRLIDLVK+GG+IG
Sbjct  123  GLAHKIEFKEGPALPVLDQMIEDGKYHGSYDFIFVDADKDNYLNYHKRLIDLVKIGGLIG  182

Query  624  YDNTLWNGSVVAPPDAPMRKYIKYYRDFVLELNKALAVDPRIEICMLPVGDGITLCRRIS  803
            YDNTLWNGSVVAPPDAP+RKY++YYRDFVLELNKALA D RIEIC LPVGDGITLCRRIS
Sbjct  183  YDNTLWNGSVVAPPDAPLRKYVRYYRDFVLELNKALAADSRIEICQLPVGDGITLCRRIS  242



>sp|O24150.2|CAMT3_TOBAC RecName: Full=Caffeoyl-CoA O-methyltransferase 3; AltName: Full=Trans-caffeoyl-CoA 
3-O-methyltransferase 3; Short=CCoAMT-3; 
Short=CCoAOMT-3 [Nicotiana tabacum]
 gb|AAC49915.1| caffeoyl-CoA O-methyltransferase 3 [Nicotiana tabacum]
Length=242

 Score =   453 bits (1165),  Expect = 2e-157, Method: Compositional matrix adjust.
 Identities = 214/242 (88%), Positives = 232/242 (96%), Gaps = 1/242 (0%)
 Frame = +3

Query  81   MAEN-QTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSA  257
            MA N +  RHQEVGHKSLLQSDALYQYILETSVYPREPE MKELRE+TAKHPWN+MTTSA
Sbjct  1    MATNGENGRHQEVGHKSLLQSDALYQYILETSVYPREPEPMKELREITAKHPWNIMTTSA  60

Query  258  DEGQFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIE  437
            DEGQFLSMLLKLINAKNTMEIGV+TGYSLLATA+ALPDDGKILAMDINR+NYE+GLPVIE
Sbjct  61   DEGQFLSMLLKLINAKNTMEIGVFTGYSLLATAMALPDDGKILAMDINRDNYEIGLPVIE  120

Query  438  KAGVAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGV  617
            KAG+AHKI+F+EGPALP+LDQ++ED K HG+YDFIFVDADKDNYLNYHKRLIDLVKVGG+
Sbjct  121  KAGLAHKIEFKEGPALPVLDQMIEDGKYHGSYDFIFVDADKDNYLNYHKRLIDLVKVGGL  180

Query  618  IGYDNTLWNGSVVAPPDAPMRKYIKYYRDFVLELNKALAVDPRIEICMLPVGDGITLCRR  797
            IGYDNTLWNGSVVAPPDAP+RKY++YYRDFVLELNKALA D RIEIC LPVGDGITLCRR
Sbjct  181  IGYDNTLWNGSVVAPPDAPLRKYVRYYRDFVLELNKALAADSRIEICQLPVGDGITLCRR  240

Query  798  IS  803
            IS
Sbjct  241  IS  242



>ref|XP_006422984.1| hypothetical protein CICLE_v10029158mg [Citrus clementina]
 gb|ESR36224.1| hypothetical protein CICLE_v10029158mg [Citrus clementina]
Length=247

 Score =   453 bits (1165),  Expect = 3e-157, Method: Compositional matrix adjust.
 Identities = 210/238 (88%), Positives = 230/238 (97%), Gaps = 0/238 (0%)
 Frame = +3

Query  87   ENQTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEG  266
            +NQ   H+EVGHKSLLQSDALYQYILETSVYPRE E+MKELRE+TAKHPWN+MTTSADEG
Sbjct  9    QNQQGGHKEVGHKSLLQSDALYQYILETSVYPREAESMKELRELTAKHPWNVMTTSADEG  68

Query  267  QFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAG  446
            QFL+MLLKL+NAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVI+KAG
Sbjct  69   QFLNMLLKLVNAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIQKAG  128

Query  447  VAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIGY  626
            VAHKIDFREGPALP+LD L++D K HG++DFIFVDADKDNYLNYHKRL++LVKVGGVIGY
Sbjct  129  VAHKIDFREGPALPVLDLLIQDEKNHGSFDFIFVDADKDNYLNYHKRLVELVKVGGVIGY  188

Query  627  DNTLWNGSVVAPPDAPMRKYIKYYRDFVLELNKALAVDPRIEICMLPVGDGITLCRRI  800
            DNTLWNGSVVAPPDAP+RKY++YYRDFVLELNKALA DPRIEICMLPVGDG+T+CRRI
Sbjct  189  DNTLWNGSVVAPPDAPLRKYVRYYRDFVLELNKALAADPRIEICMLPVGDGVTICRRI  246



>ref|XP_010028437.1| PREDICTED: caffeoyl-CoA O-methyltransferase [Eucalyptus grandis]
 gb|KCW55183.1| hypothetical protein EUGRSUZ_I01134 [Eucalyptus grandis]
Length=246

 Score =   453 bits (1165),  Expect = 3e-157, Method: Compositional matrix adjust.
 Identities = 215/240 (90%), Positives = 231/240 (96%), Gaps = 1/240 (0%)
 Frame = +3

Query  84   AENQTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADE  263
            ++ Q  RHQEVGHKSLLQSDALYQYILETSVYPREPE MKELR++TAKHPWN+MTTSADE
Sbjct  8    SQTQAGRHQEVGHKSLLQSDALYQYILETSVYPREPEPMKELRDITAKHPWNIMTTSADE  67

Query  264  GQFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKA  443
            GQFL+MLLKLINAKNTMEIGV+TGYSLLATALALPDDGKILAMDINRENYELGLPVI+KA
Sbjct  68   GQFLNMLLKLINAKNTMEIGVFTGYSLLATALALPDDGKILAMDINRENYELGLPVIQKA  127

Query  444  GVAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIG  623
            GVA KIDFREGPALPILDQL+ED  K G++DFIFVDADKDNYLNYHKRLI+LVKVGG+IG
Sbjct  128  GVADKIDFREGPALPILDQLIED-GKQGSFDFIFVDADKDNYLNYHKRLIELVKVGGLIG  186

Query  624  YDNTLWNGSVVAPPDAPMRKYIKYYRDFVLELNKALAVDPRIEICMLPVGDGITLCRRIS  803
            YDNTLWNGSVVAPPDAP+RKY++YYRDFVLELNKALA DPRIEICMLPVGDGITLCRRIS
Sbjct  187  YDNTLWNGSVVAPPDAPLRKYVRYYRDFVLELNKALAADPRIEICMLPVGDGITLCRRIS  246



>dbj|BAG71894.1| caffeoyl CoA O-methyltransferase [Carthamus tinctorius]
Length=252

 Score =   453 bits (1165),  Expect = 3e-157, Method: Compositional matrix adjust.
 Identities = 209/245 (85%), Positives = 232/245 (95%), Gaps = 0/245 (0%)
 Frame = +3

Query  69   KFKAMAENQTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMT  248
            K ++  + Q +RHQEVGHKSLLQSDALYQYILETSVYPREPE MKELRE+TAKHPWN+MT
Sbjct  8    KTESNDKEQVSRHQEVGHKSLLQSDALYQYILETSVYPREPEPMKELREITAKHPWNIMT  67

Query  249  TSADEGQFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLP  428
            TSADEGQFL+MLLKL+NAKNTMEIGV+TGYSLLATALALP+DGKILAMDINR+NYELGLP
Sbjct  68   TSADEGQFLNMLLKLVNAKNTMEIGVFTGYSLLATALALPEDGKILAMDINRDNYELGLP  127

Query  429  VIEKAGVAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKV  608
            +IEKAGVAHKIDF+EGPA+P+LD+++ D K HGTYDFIFVDADKDNY+NYHKRLIDLVKV
Sbjct  128  IIEKAGVAHKIDFKEGPAMPVLDEMIADGKYHGTYDFIFVDADKDNYINYHKRLIDLVKV  187

Query  609  GGVIGYDNTLWNGSVVAPPDAPMRKYIKYYRDFVLELNKALAVDPRIEICMLPVGDGITL  788
            GG+IGYDNTLWNG+VVAPPDAPMRKY++YYRDFVLE NK L  DPRIEICMLPVGDGITL
Sbjct  188  GGLIGYDNTLWNGTVVAPPDAPMRKYVRYYRDFVLEFNKVLGADPRIEICMLPVGDGITL  247

Query  789  CRRIS  803
            CRRIS
Sbjct  248  CRRIS  252



>ref|XP_009604111.1| PREDICTED: caffeoyl-CoA O-methyltransferase 3 [Nicotiana tomentosiformis]
Length=242

 Score =   452 bits (1164),  Expect = 4e-157, Method: Compositional matrix adjust.
 Identities = 214/242 (88%), Positives = 232/242 (96%), Gaps = 1/242 (0%)
 Frame = +3

Query  81   MAEN-QTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSA  257
            MA N +  RHQEVGHKSLLQSDALYQYILETSVYPREPE MKELRE+TAKHPWN+MTTSA
Sbjct  1    MATNGENGRHQEVGHKSLLQSDALYQYILETSVYPREPEPMKELREITAKHPWNIMTTSA  60

Query  258  DEGQFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIE  437
            DEGQFLSMLLKLINAKNTMEIGV+TGYSLLATA+ALPDDGKILAMDINR+NYE+GLPVIE
Sbjct  61   DEGQFLSMLLKLINAKNTMEIGVFTGYSLLATAMALPDDGKILAMDINRDNYEIGLPVIE  120

Query  438  KAGVAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGV  617
            KAG+AHKI+F+EGPALP+LDQ++ED K HG+YDFIFVDADKDNYLNYHKRLIDLVKVGG+
Sbjct  121  KAGLAHKIEFKEGPALPVLDQMIEDGKYHGSYDFIFVDADKDNYLNYHKRLIDLVKVGGL  180

Query  618  IGYDNTLWNGSVVAPPDAPMRKYIKYYRDFVLELNKALAVDPRIEICMLPVGDGITLCRR  797
            IGYDNTLWNGSVVAPPDAP+RKY++YYRDFVLELNKALA D RIEIC LPVGDGITLCRR
Sbjct  181  IGYDNTLWNGSVVAPPDAPLRKYVRYYRDFVLELNKALAADQRIEICQLPVGDGITLCRR  240

Query  798  IS  803
            IS
Sbjct  241  IS  242



>sp|O04854.1|CAMT_EUCGU RecName: Full=Caffeoyl-CoA O-methyltransferase; AltName: Full=Trans-caffeoyl-CoA 
3-O-methyltransferase; Short=CCoAMT; Short=CCoAOMT 
[Eucalyptus gunnii]
 emb|CAA72911.1| caffeoyl-CoA O-methyltransferase [Eucalyptus gunnii]
Length=249

 Score =   452 bits (1164),  Expect = 4e-157, Method: Compositional matrix adjust.
 Identities = 216/242 (89%), Positives = 231/242 (95%), Gaps = 1/242 (0%)
 Frame = +3

Query  84   AENQTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADE  263
            ++ Q  RHQEVGHKSLLQSDALYQYILETSVYPREPE MKELRE+TAKHPWN+MTTSADE
Sbjct  8    SQTQAGRHQEVGHKSLLQSDALYQYILETSVYPREPEPMKELREITAKHPWNIMTTSADE  67

Query  264  GQFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKA  443
            GQFL+MLLKLINAKNTMEIGV+TGYSLLATALALPDDGKILAMDINRENYELGLPVI+KA
Sbjct  68   GQFLNMLLKLINAKNTMEIGVFTGYSLLATALALPDDGKILAMDINRENYELGLPVIQKA  127

Query  444  GVAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIG  623
            GVA KIDFREGPALPILDQL+ED  K G++DFIFVDADKDNYLNYHKRLI+LVKVGG+IG
Sbjct  128  GVADKIDFREGPALPILDQLIED-GKQGSFDFIFVDADKDNYLNYHKRLIELVKVGGLIG  186

Query  624  YDNTLWNGSVVAPPDAPMRKYIKYYRDFVLELNKALAVDPRIEICMLPVGDGITLCRRIS  803
            YDNTLWNGSVVAPPDAP+RKY++YYRDFVLELNKALA DPRIEICMLPVGDGITLCRRI 
Sbjct  187  YDNTLWNGSVVAPPDAPLRKYVRYYRDFVLELNKALAADPRIEICMLPVGDGITLCRRIQ  246

Query  804  *S  809
             S
Sbjct  247  LS  248



>sp|O24144.1|CAMT1_TOBAC RecName: Full=Caffeoyl-CoA O-methyltransferase 1; AltName: Full=Trans-caffeoyl-CoA 
3-O-methyltransferase 1; Short=CCoAMT-1; 
Short=CCoAOMT-1 [Nicotiana tabacum]
 gb|AAC49913.1| caffeoyl-coenzymeA O-methyltransferase [Nicotiana tabacum]
Length=239

 Score =   452 bits (1163),  Expect = 4e-157, Method: Compositional matrix adjust.
 Identities = 214/241 (89%), Positives = 231/241 (96%), Gaps = 2/241 (1%)
 Frame = +3

Query  81   MAENQTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSAD  260
            MA N   RHQEVGHKSLLQSDALYQYILETSVYPREPE MKELRE+TAKHPWNLMTTSAD
Sbjct  1    MATN--GRHQEVGHKSLLQSDALYQYILETSVYPREPEPMKELREITAKHPWNLMTTSAD  58

Query  261  EGQFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEK  440
            EGQFLSML+KLINAKNTMEIGV+TGYSLLATA+ALPDDGKILAMDINRENYE+GLPVIEK
Sbjct  59   EGQFLSMLIKLINAKNTMEIGVFTGYSLLATAMALPDDGKILAMDINRENYEIGLPVIEK  118

Query  441  AGVAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVI  620
            AG+AHKI+F+EGPALP+LDQ++ED K HG+YDFIFVDADKDNYLNYHKRLIDLVK+GG+I
Sbjct  119  AGLAHKIEFKEGPALPVLDQMIEDGKYHGSYDFIFVDADKDNYLNYHKRLIDLVKIGGLI  178

Query  621  GYDNTLWNGSVVAPPDAPMRKYIKYYRDFVLELNKALAVDPRIEICMLPVGDGITLCRRI  800
            GYDNTLWNGSVVAPPDAP+RKY++YYRDFVLELNKALA D RIEIC LPVGDGITLCRRI
Sbjct  179  GYDNTLWNGSVVAPPDAPLRKYVRYYRDFVLELNKALAADSRIEICQLPVGDGITLCRRI  238

Query  801  S  803
            S
Sbjct  239  S  239



>dbj|BAG71892.1| caffeoyl CoA O-methyltransferase [Carthamus tinctorius]
Length=247

 Score =   452 bits (1164),  Expect = 4e-157, Method: Compositional matrix adjust.
 Identities = 210/240 (88%), Positives = 231/240 (96%), Gaps = 0/240 (0%)
 Frame = +3

Query  84   AENQTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADE  263
            +E+Q  +HQEVGHKS LQSDALYQYILETSVYPREP +MKELREVTAKHPWNLMTTSADE
Sbjct  8    SESQPAKHQEVGHKSFLQSDALYQYILETSVYPREPASMKELREVTAKHPWNLMTTSADE  67

Query  264  GQFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKA  443
            GQFLS+LLKLINAKNTMEIGVYTGYSLL+TALALPDDGKILA+DINRENYE+GLP+IEKA
Sbjct  68   GQFLSLLLKLINAKNTMEIGVYTGYSLLSTALALPDDGKILALDINRENYEIGLPIIEKA  127

Query  444  GVAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIG  623
             VAHKIDFREGPALP+LDQ++ D K HG++DFIFVDADKDNYLNYHKRLIDLVK+GGVIG
Sbjct  128  RVAHKIDFREGPALPLLDQMINDEKFHGSFDFIFVDADKDNYLNYHKRLIDLVKIGGVIG  187

Query  624  YDNTLWNGSVVAPPDAPMRKYIKYYRDFVLELNKALAVDPRIEICMLPVGDGITLCRRIS  803
            YDNTLWNGS+VAPPDAP+RKY++YYRDFVLELNKALA+DPRIEIC LPVGDGITLCRRI+
Sbjct  188  YDNTLWNGSLVAPPDAPLRKYVRYYRDFVLELNKALAIDPRIEICQLPVGDGITLCRRIN  247



>dbj|BAG71889.1| caffeoyl CoA O-methyltransferase [Carthamus tinctorius]
Length=244

 Score =   452 bits (1163),  Expect = 5e-157, Method: Compositional matrix adjust.
 Identities = 210/242 (87%), Positives = 231/242 (95%), Gaps = 0/242 (0%)
 Frame = +3

Query  78   AMAENQTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSA  257
            A  E Q  +HQEVGHKSLLQSDALYQYILETSVYPREPE+MKELREVTAKHPWNLMTTSA
Sbjct  3    ATGETQPAKHQEVGHKSLLQSDALYQYILETSVYPREPESMKELREVTAKHPWNLMTTSA  62

Query  258  DEGQFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIE  437
            DEGQFL++LLKLINAKNTMEIGVYTGYSLL+TALALP+DGKILA+DINRENYE+GLP+IE
Sbjct  63   DEGQFLNLLLKLINAKNTMEIGVYTGYSLLSTALALPEDGKILALDINRENYEIGLPIIE  122

Query  438  KAGVAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGV  617
            KAGVAHKIDFREGPALP+LD+++ D K HG++DFIFVDADKDNYLNYHKRLIDLVK+GGV
Sbjct  123  KAGVAHKIDFREGPALPLLDEMIGDEKFHGSFDFIFVDADKDNYLNYHKRLIDLVKIGGV  182

Query  618  IGYDNTLWNGSVVAPPDAPMRKYIKYYRDFVLELNKALAVDPRIEICMLPVGDGITLCRR  797
            IGYDNTLWNGS+VAPPDAP+RKY++YYRDFVLELNKALA D R+EIC LPVGDGITLCRR
Sbjct  183  IGYDNTLWNGSLVAPPDAPLRKYVRYYRDFVLELNKALAADSRVEICQLPVGDGITLCRR  242

Query  798  IS  803
            IS
Sbjct  243  IS  244



>sp|O81185.1|CAMT1_EUCGL RecName: Full=Caffeoyl-CoA O-methyltransferase 1; AltName: Full=Trans-caffeoyl-CoA 
3-O-methyltransferase 1; Short=CCoAMT-1; 
Short=CCoAOMT-1 [Eucalyptus globulus]
 gb|AAC26191.1| caffeoyl-CoA 3-O-methyltransferase [Eucalyptus globulus]
Length=246

 Score =   452 bits (1164),  Expect = 5e-157, Method: Compositional matrix adjust.
 Identities = 215/240 (90%), Positives = 231/240 (96%), Gaps = 1/240 (0%)
 Frame = +3

Query  84   AENQTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADE  263
            ++ Q  RHQEVGHKSLLQSDALYQ+ILETSVYPREPE MKELRE+TAKHPWN+MTTSADE
Sbjct  8    SQTQAGRHQEVGHKSLLQSDALYQHILETSVYPREPEPMKELREITAKHPWNIMTTSADE  67

Query  264  GQFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKA  443
            GQFL+MLLKLINAKNTMEIGV+TGYSLLATALALPDDGKILAMDINRENYELGLPVI+KA
Sbjct  68   GQFLNMLLKLINAKNTMEIGVFTGYSLLATALALPDDGKILAMDINRENYELGLPVIQKA  127

Query  444  GVAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIG  623
            GVA KIDFREGPALPILDQL+ED  K G++DFIFVDADKDNYLNYHKRLI+LVKVGG+IG
Sbjct  128  GVADKIDFREGPALPILDQLIED-GKQGSFDFIFVDADKDNYLNYHKRLIELVKVGGLIG  186

Query  624  YDNTLWNGSVVAPPDAPMRKYIKYYRDFVLELNKALAVDPRIEICMLPVGDGITLCRRIS  803
            YDNTLWNGSVVAPPDAP+RKY++YYRDFVLELNKALA DPRIEICMLPVGDGITLCRRIS
Sbjct  187  YDNTLWNGSVVAPPDAPLRKYVRYYRDFVLELNKALAADPRIEICMLPVGDGITLCRRIS  246



>gb|ABB87184.1| caffeoyl-CoA O-methyltransferase [Taiwania cryptomerioides]
Length=249

 Score =   452 bits (1163),  Expect = 5e-157, Method: Compositional matrix adjust.
 Identities = 209/240 (87%), Positives = 231/240 (96%), Gaps = 0/240 (0%)
 Frame = +3

Query  84   AENQTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADE  263
            +  Q +RHQEVGHKSLLQSDALYQYILETSVYPREPE+M+ELRE+TAKHPWNLMTTSADE
Sbjct  10   STQQVSRHQEVGHKSLLQSDALYQYILETSVYPREPESMRELREITAKHPWNLMTTSADE  69

Query  264  GQFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKA  443
            GQFL +LLKLINAKNTMEIGVYTGYSLL+TALALPDDGKILAMDINRENYELGLPVI+KA
Sbjct  70   GQFLHLLLKLINAKNTMEIGVYTGYSLLSTALALPDDGKILAMDINRENYELGLPVIQKA  129

Query  444  GVAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIG  623
            GVAHKIDFREGPALP+LDQ++E+ + HG++DFIFVDADKD+YLNYHKRLIDLVK+GGVIG
Sbjct  130  GVAHKIDFREGPALPVLDQMLENKEMHGSFDFIFVDADKDDYLNYHKRLIDLVKIGGVIG  189

Query  624  YDNTLWNGSVVAPPDAPMRKYIKYYRDFVLELNKALAVDPRIEICMLPVGDGITLCRRIS  803
            YDNTLWNGSVVAPPDAP+RKY++YYRDFV+ELNKALA DPRIEI  +PVGDGITLCRRIS
Sbjct  190  YDNTLWNGSVVAPPDAPLRKYVRYYRDFVIELNKALAADPRIEISQIPVGDGITLCRRIS  249



>gb|ABB89956.1| caffeoyl-CoA O-methyltransferase [Chamaecyparis formosensis]
Length=249

 Score =   452 bits (1163),  Expect = 6e-157, Method: Compositional matrix adjust.
 Identities = 210/239 (88%), Positives = 229/239 (96%), Gaps = 0/239 (0%)
 Frame = +3

Query  84   AENQTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADE  263
            +  Q +RHQEVGHKSLLQSDALYQYILETSVYPREPE M+ELRE+TAKHPWNLMTTSADE
Sbjct  10   STQQVSRHQEVGHKSLLQSDALYQYILETSVYPREPEPMRELREITAKHPWNLMTTSADE  69

Query  264  GQFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKA  443
            GQFL +LLKLINAKNTMEIGVYTGYSLL+TALALPDDGKILAMDINRENYELGLPVI+KA
Sbjct  70   GQFLHLLLKLINAKNTMEIGVYTGYSLLSTALALPDDGKILAMDINRENYELGLPVIQKA  129

Query  444  GVAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIG  623
            GVAHKIDFREGPALP+LDQ++E+ + HG++DFIFVDADKDNYLNYHKRLIDLVK+GGVIG
Sbjct  130  GVAHKIDFREGPALPVLDQMLENKEMHGSFDFIFVDADKDNYLNYHKRLIDLVKIGGVIG  189

Query  624  YDNTLWNGSVVAPPDAPMRKYIKYYRDFVLELNKALAVDPRIEICMLPVGDGITLCRRI  800
            YDNTLWNGSVVAPPDAPMRKY++YYRDFV+ELNKALA DPRIEI  +PVGDGITLCRRI
Sbjct  190  YDNTLWNGSVVAPPDAPMRKYVRYYRDFVIELNKALAADPRIEISQIPVGDGITLCRRI  248



>gb|AEW26114.1| caffeoyl-CoA 3-o-methyltransferase, partial [Medicago falcata]
Length=237

 Score =   451 bits (1161),  Expect = 7e-157, Method: Compositional matrix adjust.
 Identities = 212/236 (90%), Positives = 230/236 (97%), Gaps = 0/236 (0%)
 Frame = +3

Query  93   QTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEGQF  272
            ++ RHQEVGHKSLLQSDALYQYILETSV+PRE EAMKELR VTAKHPWN+MTTSADEGQF
Sbjct  2    ESGRHQEVGHKSLLQSDALYQYILETSVFPREHEAMKELRXVTAKHPWNIMTTSADEGQF  61

Query  273  LSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAGVA  452
            LSMLLKLINAKNTMEIGVYTGYSLLATALA+P+DGKILAMDIN+ENYELGLPVI+KAGV 
Sbjct  62   LSMLLKLINAKNTMEIGVYTGYSLLATALAIPEDGKILAMDINKENYELGLPVIKKAGVD  121

Query  453  HKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIGYDN  632
            HKIDFREGPALP+LD++++D K HG+YDFIFVDADKDNYLNYHKRLIDLVKVGGVIGYDN
Sbjct  122  HKIDFREGPALPVLDEMIKDEKNHGSYDFIFVDADKDNYLNYHKRLIDLVKVGGVIGYDN  181

Query  633  TLWNGSVVAPPDAPMRKYIKYYRDFVLELNKALAVDPRIEICMLPVGDGITLCRRI  800
            TLWNGSVVAPPDAP+RKY++YYRDFVLELNKALAVDPRIEICMLPVGDGIT+CRRI
Sbjct  182  TLWNGSVVAPPDAPLRKYVRYYRDFVLELNKALAVDPRIEICMLPVGDGITICRRI  237



>ref|XP_004248757.1| PREDICTED: caffeoyl-CoA O-methyltransferase 5 [Solanum lycopersicum]
Length=245

 Score =   452 bits (1162),  Expect = 7e-157, Method: Compositional matrix adjust.
 Identities = 211/239 (88%), Positives = 228/239 (95%), Gaps = 0/239 (0%)
 Frame = +3

Query  84   AENQTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADE  263
             E Q  +HQEVGHKSLLQSDALYQYILETSVYPREPE+MKELREVTAKHPWNLMTTSADE
Sbjct  6    GEVQEIKHQEVGHKSLLQSDALYQYILETSVYPREPESMKELREVTAKHPWNLMTTSADE  65

Query  264  GQFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKA  443
            GQFL+MLLKLINAKNTMEIGVYTGYSLLATALA+P+DGKILAMDINRENYE+GLP+IEKA
Sbjct  66   GQFLNMLLKLINAKNTMEIGVYTGYSLLATALAIPEDGKILAMDINRENYEIGLPIIEKA  125

Query  444  GVAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIG  623
            GV+HKIDFREGPALP+LDQL+ED   HGTYDFIFVDADKDNY+NYHKR+I+LVKVGGVIG
Sbjct  126  GVSHKIDFREGPALPLLDQLLEDKNNHGTYDFIFVDADKDNYINYHKRIIELVKVGGVIG  185

Query  624  YDNTLWNGSVVAPPDAPMRKYIKYYRDFVLELNKALAVDPRIEICMLPVGDGITLCRRI  800
            YDNTLWNGSV AP DAPMRKY++YYRDFVLELNKALA D R+EICMLP+GDGITLCRRI
Sbjct  186  YDNTLWNGSVAAPADAPMRKYVRYYRDFVLELNKALAEDQRVEICMLPIGDGITLCRRI  244



>ref|XP_009784105.1| PREDICTED: caffeoyl-CoA O-methyltransferase 4 isoform X1 [Nicotiana 
sylvestris]
Length=242

 Score =   451 bits (1161),  Expect = 9e-157, Method: Compositional matrix adjust.
 Identities = 210/240 (88%), Positives = 230/240 (96%), Gaps = 0/240 (0%)
 Frame = +3

Query  84   AENQTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADE  263
             + +  RHQEVGHKSLLQSDALYQYILETSVYPREPE MKELRE+TAKHPWNLMTTSADE
Sbjct  3    TDGENGRHQEVGHKSLLQSDALYQYILETSVYPREPEPMKELREITAKHPWNLMTTSADE  62

Query  264  GQFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKA  443
            GQFLSML+KLINAKNTMEIGV+TGYSLLATA+ALPDDGKILAMDINRENYE+GLPVIEKA
Sbjct  63   GQFLSMLIKLINAKNTMEIGVFTGYSLLATAMALPDDGKILAMDINRENYEIGLPVIEKA  122

Query  444  GVAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIG  623
            G+AHKI+F+EGPALP+LDQ++E+ K HG+YDFIFVDADKDNYLNYHKRLIDLVK+GG+IG
Sbjct  123  GLAHKIEFKEGPALPVLDQMIENGKYHGSYDFIFVDADKDNYLNYHKRLIDLVKIGGLIG  182

Query  624  YDNTLWNGSVVAPPDAPMRKYIKYYRDFVLELNKALAVDPRIEICMLPVGDGITLCRRIS  803
            YDNTLWNGSVVAPPDAP+RKY++YYRDFVLELNKALA D RIEIC LPVGDGITLCRRIS
Sbjct  183  YDNTLWNGSVVAPPDAPLRKYVRYYRDFVLELNKALAADSRIEICQLPVGDGITLCRRIS  242



>ref|XP_009407208.1| PREDICTED: caffeoyl-CoA O-methyltransferase [Musa acuminata subsp. 
malaccensis]
Length=244

 Score =   451 bits (1161),  Expect = 9e-157, Method: Compositional matrix adjust.
 Identities = 211/241 (88%), Positives = 230/241 (95%), Gaps = 2/241 (1%)
 Frame = +3

Query  84   AENQT--TRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSA  257
            +ENQ    RHQEVGHKSLLQSD LYQYILET+VYPREPEAMKELRE+TAKHPWNLMTTSA
Sbjct  3    SENQNGDRRHQEVGHKSLLQSDELYQYILETTVYPREPEAMKELREITAKHPWNLMTTSA  62

Query  258  DEGQFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIE  437
            DEGQFL+MLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYE+GLPVI+
Sbjct  63   DEGQFLNMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYEIGLPVIQ  122

Query  438  KAGVAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGV  617
            KAGVAHKIDFREGPALP+LDQ++ED K HG++DF+FVDADKDNY+NYHKRL++LV+VGGV
Sbjct  123  KAGVAHKIDFREGPALPVLDQMIEDEKNHGSFDFVFVDADKDNYINYHKRLLELVRVGGV  182

Query  618  IGYDNTLWNGSVVAPPDAPMRKYIKYYRDFVLELNKALAVDPRIEICMLPVGDGITLCRR  797
            I YDNTLW+GSVVAPPDAPMRKYI+YYRDFVLELN ALA DPRIEIC LPVGDG+TLCRR
Sbjct  183  IAYDNTLWSGSVVAPPDAPMRKYIRYYRDFVLELNNALAADPRIEICQLPVGDGVTLCRR  242

Query  798  I  800
            I
Sbjct  243  I  243



>gb|AEW26126.1| caffeoyl-CoA 3-o-methyltransferase, partial [Medicago falcata]
Length=237

 Score =   451 bits (1160),  Expect = 1e-156, Method: Compositional matrix adjust.
 Identities = 212/236 (90%), Positives = 230/236 (97%), Gaps = 0/236 (0%)
 Frame = +3

Query  93   QTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEGQF  272
            ++ RHQEVGHKSLLQSDALYQYILETSV+PRE EAMKELREVTAKHPWN+MTTSADEGQF
Sbjct  2    ESGRHQEVGHKSLLQSDALYQYILETSVFPREHEAMKELREVTAKHPWNIMTTSADEGQF  61

Query  273  LSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAGVA  452
            LSMLLKLINAKNTMEIGVYTGYSLLATALA+P+DGKILAMDIN+ENYELGLPVI+KAGV 
Sbjct  62   LSMLLKLINAKNTMEIGVYTGYSLLATALAIPEDGKILAMDINKENYELGLPVIKKAGVD  121

Query  453  HKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIGYDN  632
            HKIDFREGPALP+LD++++D K  G+YDFIFVDADKDNYLNYHKRLIDLVKVGGVIGYDN
Sbjct  122  HKIDFREGPALPVLDEMIKDEKNRGSYDFIFVDADKDNYLNYHKRLIDLVKVGGVIGYDN  181

Query  633  TLWNGSVVAPPDAPMRKYIKYYRDFVLELNKALAVDPRIEICMLPVGDGITLCRRI  800
            TLWNGSVVAPPDAP+RKY++YYRDFVLELNKALAVDPRIEICMLPVGDGIT+CRRI
Sbjct  182  TLWNGSVVAPPDAPLRKYVRYYRDFVLELNKALAVDPRIEICMLPVGDGITICRRI  237



>gb|AEW26132.1| caffeoyl-CoA 3-o-methyltransferase, partial [Medicago sativa 
subsp. caerulea]
Length=237

 Score =   451 bits (1160),  Expect = 1e-156, Method: Compositional matrix adjust.
 Identities = 212/236 (90%), Positives = 230/236 (97%), Gaps = 0/236 (0%)
 Frame = +3

Query  93   QTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEGQF  272
            ++ RHQEVGHKSLLQSDALYQYILETSV+PRE EAMKELREVTAKHPWN+MTTSADEGQF
Sbjct  2    ESGRHQEVGHKSLLQSDALYQYILETSVFPREHEAMKELREVTAKHPWNIMTTSADEGQF  61

Query  273  LSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAGVA  452
            LSMLLKLINAKNTMEIGVYTGYSLLATALA+P+DGKILAMDIN+ENYELGLPVI+KAGV 
Sbjct  62   LSMLLKLINAKNTMEIGVYTGYSLLATALAIPEDGKILAMDINKENYELGLPVIKKAGVD  121

Query  453  HKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIGYDN  632
            HKIDFREGPALP+LD++++D K HG+YDFIFVDADKDNYLNYHKRLIDLVKVGGVIGYDN
Sbjct  122  HKIDFREGPALPVLDEMIKDEKNHGSYDFIFVDADKDNYLNYHKRLIDLVKVGGVIGYDN  181

Query  633  TLWNGSVVAPPDAPMRKYIKYYRDFVLELNKALAVDPRIEICMLPVGDGITLCRRI  800
            TLWNGSVVAPPDAP+RKY++YYRDFVLELNKALAVDPRIEIC LPVGDGIT+CRRI
Sbjct  182  TLWNGSVVAPPDAPLRKYVRYYRDFVLELNKALAVDPRIEICXLPVGDGITICRRI  237



>ref|XP_009784107.1| PREDICTED: caffeoyl-CoA O-methyltransferase 1 [Nicotiana sylvestris]
Length=239

 Score =   451 bits (1160),  Expect = 1e-156, Method: Compositional matrix adjust.
 Identities = 213/241 (88%), Positives = 231/241 (96%), Gaps = 2/241 (1%)
 Frame = +3

Query  81   MAENQTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSAD  260
            MA N   RHQEVGHKSLLQSDALYQYILETSVYPREPE MKELRE+TAKHPWNLMTTSAD
Sbjct  1    MATN--GRHQEVGHKSLLQSDALYQYILETSVYPREPEPMKELREITAKHPWNLMTTSAD  58

Query  261  EGQFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEK  440
            EGQFLSML+KLINAKNTMEIGV+TGYSLLATA+ALPDDGKILAMDINRENYE+GLPVIEK
Sbjct  59   EGQFLSMLIKLINAKNTMEIGVFTGYSLLATAMALPDDGKILAMDINRENYEIGLPVIEK  118

Query  441  AGVAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVI  620
            AG+AHKI+F+EGPALP+LDQ++E+ K HG+YDFIFVDADKDNYLNYHKRLIDLVK+GG+I
Sbjct  119  AGLAHKIEFKEGPALPVLDQMIENGKYHGSYDFIFVDADKDNYLNYHKRLIDLVKIGGLI  178

Query  621  GYDNTLWNGSVVAPPDAPMRKYIKYYRDFVLELNKALAVDPRIEICMLPVGDGITLCRRI  800
            GYDNTLWNGSVVAPPDAP+RKY++YYRDFVLELNKALA D RIEIC LPVGDGITLCRRI
Sbjct  179  GYDNTLWNGSVVAPPDAPLRKYVRYYRDFVLELNKALAADSRIEICQLPVGDGITLCRRI  238

Query  801  S  803
            S
Sbjct  239  S  239



>ref|XP_002298729.1| caffeoyl-CoA O-methyltransferase family protein [Populus trichocarpa]
 sp|O65922.1|CAMT2_POPTR RecName: Full=Caffeoyl-CoA O-methyltransferase 2; AltName: Full=Trans-caffeoyl-CoA 
3-O-methyltransferase 2; Short=CCoAMT-2; 
Short=CCoAOMT-2 [Populus trichocarpa]
 emb|CAA12199.1| caffeoyl-CoA 3-O-methyltransferase [Populus trichocarpa]
 emb|CAA12200.1| caffeoyl-CoA 3-O-methyltransferase [Populus trichocarpa]
 emb|CAA11495.1| caffeoyl CoA 3-O-methyltransferase [Populus trichocarpa]
 gb|ABK94944.1| unknown [Populus trichocarpa]
 gb|ACC63878.1| trans-caffeoyl-CoA 3-O-methyltransferase [Populus trichocarpa]
 gb|EEE83534.1| caffeoyl-CoA O-methyltransferase family protein [Populus trichocarpa]
Length=247

 Score =   451 bits (1160),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 210/238 (88%), Positives = 229/238 (96%), Gaps = 0/238 (0%)
 Frame = +3

Query  87   ENQTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEG  266
            + Q  RHQEVGHKSLLQSDALYQYILETSVYPREPE MKELRE+TAKHPWN+MTTSADEG
Sbjct  9    QTQAGRHQEVGHKSLLQSDALYQYILETSVYPREPECMKELRELTAKHPWNIMTTSADEG  68

Query  267  QFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAG  446
            QFL+MLLKLINAKNTMEIGV+TGYSLLATALA+P+DGKILAMDINRENYELGLPVI+KAG
Sbjct  69   QFLNMLLKLINAKNTMEIGVFTGYSLLATALAIPEDGKILAMDINRENYELGLPVIQKAG  128

Query  447  VAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIGY  626
            + HKI+F+EGPALP+LDQ++ED K HGTYDFIFVDADKDNY+NYHKRLI+LVKVGG+IGY
Sbjct  129  LEHKIEFKEGPALPVLDQMIEDGKYHGTYDFIFVDADKDNYINYHKRLIELVKVGGLIGY  188

Query  627  DNTLWNGSVVAPPDAPMRKYIKYYRDFVLELNKALAVDPRIEICMLPVGDGITLCRRI  800
            DNTLWNGSVVAP DAPMRKY++YYRDFVLELNKALA DPRIEICMLPVGDGITLCRRI
Sbjct  189  DNTLWNGSVVAPADAPMRKYVRYYRDFVLELNKALAADPRIEICMLPVGDGITLCRRI  246



>ref|XP_007153585.1| hypothetical protein PHAVU_003G047900g [Phaseolus vulgaris]
 gb|ESW25579.1| hypothetical protein PHAVU_003G047900g [Phaseolus vulgaris]
Length=247

 Score =   451 bits (1159),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 212/240 (88%), Positives = 233/240 (97%), Gaps = 2/240 (1%)
 Frame = +3

Query  87   ENQTT--RHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSAD  260
            +NQT   RHQEVGHKSLLQSDALYQYILETSVYPREP++MKELRE+TAKHPWN+MTTSAD
Sbjct  7    QNQTEAGRHQEVGHKSLLQSDALYQYILETSVYPREPDSMKELRELTAKHPWNIMTTSAD  66

Query  261  EGQFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEK  440
            EGQFL+MLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVI+K
Sbjct  67   EGQFLNMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIKK  126

Query  441  AGVAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVI  620
            AGV HKI+FREGPALP+LD+++ D K HG+YDFIFVDADKDNY+NYHKRLI+LVKVGG+I
Sbjct  127  AGVDHKIEFREGPALPVLDEMITDEKNHGSYDFIFVDADKDNYINYHKRLIELVKVGGLI  186

Query  621  GYDNTLWNGSVVAPPDAPMRKYIKYYRDFVLELNKALAVDPRIEICMLPVGDGITLCRRI  800
            GYDNTLWNGSVVAPPDAP+RKY++YYRDFVLELNK+LA+DPRIEICMLPVGDGITLCRRI
Sbjct  187  GYDNTLWNGSVVAPPDAPLRKYVRYYRDFVLELNKSLALDPRIEICMLPVGDGITLCRRI  246



>gb|AEW26107.1| caffeoyl-CoA 3-o-methyltransferase, partial [Medicago sativa 
subsp. caerulea]
Length=235

 Score =   450 bits (1158),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 211/234 (90%), Positives = 229/234 (98%), Gaps = 0/234 (0%)
 Frame = +3

Query  93   QTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEGQF  272
            ++ RHQEVGHKSLLQSDALYQYILETSV+PRE EAMKELREVTAKHPWN+MTTSADEGQF
Sbjct  2    ESGRHQEVGHKSLLQSDALYQYILETSVFPREHEAMKELREVTAKHPWNIMTTSADEGQF  61

Query  273  LSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAGVA  452
            LSMLLKLINAKNTMEIGVYTGYSLLATALA+P+DGKILAMDIN+ENYELGLPVI+KAGV 
Sbjct  62   LSMLLKLINAKNTMEIGVYTGYSLLATALAIPEDGKILAMDINKENYELGLPVIKKAGVD  121

Query  453  HKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIGYDN  632
            HKIDFREGPALP+LD++++D K HG+YDFIFVDADKDNYLNYHKRLIDLVKVGGVIGYDN
Sbjct  122  HKIDFREGPALPVLDEMIKDEKNHGSYDFIFVDADKDNYLNYHKRLIDLVKVGGVIGYDN  181

Query  633  TLWNGSVVAPPDAPMRKYIKYYRDFVLELNKALAVDPRIEICMLPVGDGITLCR  794
            TLWNGSVVAPPDAP+RKY++YYRDFVLELNKALAVDPRIEICMLPVGDGIT+CR
Sbjct  182  TLWNGSVVAPPDAPLRKYVRYYRDFVLELNKALAVDPRIEICMLPVGDGITICR  235



>ref|XP_006356576.1| PREDICTED: caffeoyl-CoA O-methyltransferase 5-like [Solanum tuberosum]
Length=245

 Score =   450 bits (1158),  Expect = 3e-156, Method: Compositional matrix adjust.
 Identities = 210/239 (88%), Positives = 228/239 (95%), Gaps = 0/239 (0%)
 Frame = +3

Query  84   AENQTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADE  263
             E Q  +HQEVGHKSLLQSDALYQYILETSVYPREPE+MKELREVTAKHPWNLMTTSADE
Sbjct  6    GEVQEIKHQEVGHKSLLQSDALYQYILETSVYPREPESMKELREVTAKHPWNLMTTSADE  65

Query  264  GQFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKA  443
            GQFL+MLLKLINAKNTMEIGVYTGYSLLATALA+P+DGKILAMDINRENYE+GLP+IEKA
Sbjct  66   GQFLNMLLKLINAKNTMEIGVYTGYSLLATALAIPEDGKILAMDINRENYEIGLPIIEKA  125

Query  444  GVAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIG  623
            GV+HKIDFREGPALP+LDQL+ED   HGTYDFIFVDADKDNY+NYHKR+I+LVKVGG+IG
Sbjct  126  GVSHKIDFREGPALPLLDQLLEDKNNHGTYDFIFVDADKDNYINYHKRIIELVKVGGLIG  185

Query  624  YDNTLWNGSVVAPPDAPMRKYIKYYRDFVLELNKALAVDPRIEICMLPVGDGITLCRRI  800
            YDNTLWNGSV AP DAPMRKY++YYRDFVLELNKALA D R+EICMLP+GDGITLCRRI
Sbjct  186  YDNTLWNGSVAAPADAPMRKYVRYYRDFVLELNKALAEDQRVEICMLPIGDGITLCRRI  244



>gb|ACE95173.1| caffeoyl-CoA-3-O-methyltransferase [Populus tomentosa]
Length=247

 Score =   450 bits (1157),  Expect = 5e-156, Method: Compositional matrix adjust.
 Identities = 211/239 (88%), Positives = 229/239 (96%), Gaps = 0/239 (0%)
 Frame = +3

Query  87   ENQTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEG  266
            + Q  RHQEVGHKSLLQSDALYQYILETSVYPREPE MKELRE+TAKHPWN+MTTSADEG
Sbjct  9    QTQAGRHQEVGHKSLLQSDALYQYILETSVYPREPECMKELRELTAKHPWNIMTTSADEG  68

Query  267  QFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAG  446
            QFL+MLLKLINAKNTMEIGVYTGYSLLATALA+P+DGKILAMDINRENYELG PVIEKAG
Sbjct  69   QFLNMLLKLINAKNTMEIGVYTGYSLLATALAIPEDGKILAMDINRENYELGPPVIEKAG  128

Query  447  VAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIGY  626
            VA+KI+F+EGPALP+LDQ++ED K HG+YDFIFVDADKDNY+NYHKRLI+LVKVGG+IGY
Sbjct  129  VANKIEFKEGPALPVLDQMIEDGKYHGSYDFIFVDADKDNYINYHKRLIELVKVGGLIGY  188

Query  627  DNTLWNGSVVAPPDAPMRKYIKYYRDFVLELNKALAVDPRIEICMLPVGDGITLCRRIS  803
            DNTLWNGSVVAP DAPMRKY++YYRDFVLELNKALA DPRIEICMLPVGDGITLCRRI 
Sbjct  189  DNTLWNGSVVAPADAPMRKYVRYYRDFVLELNKALAADPRIEICMLPVGDGITLCRRIQ  247



>gb|AII00961.1| coffee acyl coenzyme A-3-O-methyl transferase [Curcuma longa]
Length=245

 Score =   450 bits (1157),  Expect = 5e-156, Method: Compositional matrix adjust.
 Identities = 209/233 (90%), Positives = 226/233 (97%), Gaps = 0/233 (0%)
 Frame = +3

Query  102  RHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEGQFLSM  281
            RHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELR++TAKHPWNLMTTSADEGQFL +
Sbjct  12   RHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELRDITAKHPWNLMTTSADEGQFLGL  71

Query  282  LLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAGVAHKI  461
            LLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYE+GLPVI+KAGVAHKI
Sbjct  72   LLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYEIGLPVIQKAGVAHKI  131

Query  462  DFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIGYDNTLW  641
            DFREGPALP+LDQL+ED K HG++DF+FVDADKDNY+NYHKRL++LVKVGGVI YDNTLW
Sbjct  132  DFREGPALPVLDQLLEDAKNHGSFDFVFVDADKDNYINYHKRLLELVKVGGVIAYDNTLW  191

Query  642  NGSVVAPPDAPMRKYIKYYRDFVLELNKALAVDPRIEICMLPVGDGITLCRRI  800
            NGSVVAPPDAPMRKYI+YYRDFVLELNKALA D RIEIC LPVGDG+T+CRR+
Sbjct  192  NGSVVAPPDAPMRKYIRYYRDFVLELNKALAADDRIEICQLPVGDGVTICRRV  244



>ref|XP_008799011.1| PREDICTED: caffeoyl-CoA O-methyltransferase [Phoenix dactylifera]
Length=278

 Score =   450 bits (1158),  Expect = 9e-156, Method: Compositional matrix adjust.
 Identities = 211/245 (86%), Positives = 230/245 (94%), Gaps = 1/245 (0%)
 Frame = +3

Query  69   KFKAMAEN-QTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLM  245
            K ++ ++N Q  RHQEVGHKSLLQSDALYQYILETSVYPREPE MKELRE+TAKHPWN+M
Sbjct  33   KSQSQSQNGQVGRHQEVGHKSLLQSDALYQYILETSVYPREPECMKELREITAKHPWNIM  92

Query  246  TTSADEGQFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGL  425
            TTSADEGQFL+MLLKL+NAK TMEIGVYTGYSLLATALALPDDG+ILAMDINRENYELGL
Sbjct  93   TTSADEGQFLNMLLKLVNAKKTMEIGVYTGYSLLATALALPDDGQILAMDINRENYELGL  152

Query  426  PVIEKAGVAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVK  605
            PVIEKAGVAHKIDFR GPALP+LD LVED K HG++DFIFVDADKDNYLNYHKRL+DLVK
Sbjct  153  PVIEKAGVAHKIDFRVGPALPLLDGLVEDEKNHGSFDFIFVDADKDNYLNYHKRLLDLVK  212

Query  606  VGGVIGYDNTLWNGSVVAPPDAPMRKYIKYYRDFVLELNKALAVDPRIEICMLPVGDGIT  785
             GG+I YDNTLWNG+VVAPPDAP+RKY++YYRDFVLELNKALA DPRIEIC LPVGDG+T
Sbjct  213  PGGIIAYDNTLWNGTVVAPPDAPLRKYVRYYRDFVLELNKALAADPRIEICQLPVGDGVT  272

Query  786  LCRRI  800
            LCRRI
Sbjct  273  LCRRI  277



>gb|AAK16714.1| caffeoyl-CoA 3-O-methyltransferase [Populus alba x Populus glandulosa]
Length=247

 Score =   449 bits (1154),  Expect = 1e-155, Method: Compositional matrix adjust.
 Identities = 209/239 (87%), Positives = 229/239 (96%), Gaps = 0/239 (0%)
 Frame = +3

Query  87   ENQTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEG  266
            ++Q  RHQEVGHKSLLQSDALYQYILETSVYPREPE MKELREVTAKHPWN+MTTSADEG
Sbjct  9    QSQAGRHQEVGHKSLLQSDALYQYILETSVYPREPECMKELREVTAKHPWNIMTTSADEG  68

Query  267  QFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAG  446
            QFL+MLLKL+NAKNTMEIGVYTGYSLLATALA+P+DG+ILAMDINRENYELGLPVIEKAG
Sbjct  69   QFLNMLLKLVNAKNTMEIGVYTGYSLLATALAIPEDGEILAMDINRENYELGLPVIEKAG  128

Query  447  VAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIGY  626
            V +KI+F+EGPALP+LDQ++ED K HG+YDFIFVDADK NY+NYHKRLI+LVKVGG+IGY
Sbjct  129  VXNKIEFKEGPALPVLDQMIEDGKYHGSYDFIFVDADKKNYINYHKRLIELVKVGGLIGY  188

Query  627  DNTLWNGSVVAPPDAPMRKYIKYYRDFVLELNKALAVDPRIEICMLPVGDGITLCRRIS  803
            DNTLWNGSVVAPPDAPMRKY++YYRDFVLELNKALA D RIEICMLPVGDGITLCRRI 
Sbjct  189  DNTLWNGSVVAPPDAPMRKYVRYYRDFVLELNKALAADSRIEICMLPVGDGITLCRRIQ  247



>gb|ABL86148.1| caffeoyl CoAO-methyltransferase [Populus deltoides]
Length=247

 Score =   449 bits (1154),  Expect = 1e-155, Method: Compositional matrix adjust.
 Identities = 208/239 (87%), Positives = 228/239 (95%), Gaps = 0/239 (0%)
 Frame = +3

Query  87   ENQTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEG  266
            + Q  RHQEVGHKSLLQSDALYQYILETSVYPREPE MKELRE+TAKHPWN+MTTSADEG
Sbjct  9    QTQAGRHQEVGHKSLLQSDALYQYILETSVYPREPECMKELRELTAKHPWNIMTTSADEG  68

Query  267  QFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAG  446
            QFL+MLLKLINAKNTMEIGV+TGYSLLATALA+P+DGKILAMDINRENYELGLPVI+KAG
Sbjct  69   QFLNMLLKLINAKNTMEIGVFTGYSLLATALAIPEDGKILAMDINRENYELGLPVIQKAG  128

Query  447  VAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIGY  626
            + HKI+F+EGPALP+LDQ++ED K HGTYDFIFVDADKDNY+NYHKRL +LVKVGG+IGY
Sbjct  129  LEHKIEFKEGPALPVLDQMIEDGKYHGTYDFIFVDADKDNYINYHKRLFELVKVGGLIGY  188

Query  627  DNTLWNGSVVAPPDAPMRKYIKYYRDFVLELNKALAVDPRIEICMLPVGDGITLCRRIS  803
            DNTLWNGSVVAP DAPMRKY++YYRDFVLELNKALA DPRIEICMLPVGDGITLCRR+ 
Sbjct  189  DNTLWNGSVVAPADAPMRKYVRYYRDFVLELNKALAADPRIEICMLPVGDGITLCRRMQ  247



>dbj|BAM05557.1| caffeoyl-CoA O-methyltransferase [Eucalyptus globulus subsp. 
globulus]
Length=247

 Score =   448 bits (1153),  Expect = 2e-155, Method: Compositional matrix adjust.
 Identities = 215/241 (89%), Positives = 231/241 (96%), Gaps = 2/241 (1%)
 Frame = +3

Query  84   AENQTTRHQEVGHKSL-LQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSAD  260
            ++ Q  RHQEVGHKSL +QSDALYQYILETSVYPREPE MKELRE+TAKHPWN+MTTSAD
Sbjct  8    SQTQAGRHQEVGHKSLHIQSDALYQYILETSVYPREPEPMKELREITAKHPWNIMTTSAD  67

Query  261  EGQFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEK  440
            EGQFL+MLLKLINAKNTMEIGV+TGYSLLATALALPDDGKILAMDINRENYELGLPVI+K
Sbjct  68   EGQFLNMLLKLINAKNTMEIGVFTGYSLLATALALPDDGKILAMDINRENYELGLPVIQK  127

Query  441  AGVAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVI  620
            AGVA KIDFREGPALPILDQL+ED  K G++DFIFVDADKDNYLNYHKRLI+LVKVGG+I
Sbjct  128  AGVADKIDFREGPALPILDQLIED-GKQGSFDFIFVDADKDNYLNYHKRLIELVKVGGLI  186

Query  621  GYDNTLWNGSVVAPPDAPMRKYIKYYRDFVLELNKALAVDPRIEICMLPVGDGITLCRRI  800
            GYDNTLWNGSVVAPPDAP+RKY++YYRDFVLELNKALA DPRIEICMLPVGDGITLCRRI
Sbjct  187  GYDNTLWNGSVVAPPDAPLRKYVRYYRDFVLELNKALAADPRIEICMLPVGDGITLCRRI  246

Query  801  S  803
            S
Sbjct  247  S  247



>gb|AFK44432.1| unknown [Lotus japonicus]
Length=247

 Score =   447 bits (1149),  Expect = 7e-155, Method: Compositional matrix adjust.
 Identities = 209/238 (88%), Positives = 229/238 (96%), Gaps = 0/238 (0%)
 Frame = +3

Query  87   ENQTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEG  266
            + +  RHQEVGHKSLLQSDALYQYILETSVYPRE EAMKELR++TAKHPWN+MTTSADEG
Sbjct  9    QTEAGRHQEVGHKSLLQSDALYQYILETSVYPREHEAMKELRDLTAKHPWNIMTTSADEG  68

Query  267  QFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAG  446
            QFL+ML KLINAKNTMEIGVYTGYS LATALA+PDDGKILAMD+N+ENYELGLPVI+KAG
Sbjct  69   QFLNMLFKLINAKNTMEIGVYTGYSPLATALAIPDDGKILAMDVNKENYELGLPVIKKAG  128

Query  447  VAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIGY  626
            VAHKIDFREGPALP+LD++V+  K HG+YDFIFVDADKDNYLNYHKRLI+LVKVGGVIGY
Sbjct  129  VAHKIDFREGPALPVLDEMVKAEKNHGSYDFIFVDADKDNYLNYHKRLIELVKVGGVIGY  188

Query  627  DNTLWNGSVVAPPDAPMRKYIKYYRDFVLELNKALAVDPRIEICMLPVGDGITLCRRI  800
            DNTLWNGSVVAPPDAP+RKY++YYRDFVLELNKALAVDPRIEICMLPVGDGIT+CRRI
Sbjct  189  DNTLWNGSVVAPPDAPLRKYVRYYRDFVLELNKALAVDPRIEICMLPVGDGITICRRI  246



>ref|XP_010690616.1| PREDICTED: caffeoyl-CoA O-methyltransferase [Beta vulgaris subsp. 
vulgaris]
Length=258

 Score =   447 bits (1149),  Expect = 1e-154, Method: Compositional matrix adjust.
 Identities = 207/239 (87%), Positives = 226/239 (95%), Gaps = 0/239 (0%)
 Frame = +3

Query  87   ENQTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEG  266
            +++  +H EVGHKSLLQSDAL+QYILETSVYPREPE MKELRE+TA HPWNLMTTSADEG
Sbjct  20   QSKEIKHSEVGHKSLLQSDALFQYILETSVYPREPEPMKELREITANHPWNLMTTSADEG  79

Query  267  QFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAG  446
            QFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDIN+ENYELGLPVIEKAG
Sbjct  80   QFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINKENYELGLPVIEKAG  139

Query  447  VAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIGY  626
            VAHKIDFREGPALP+LD L+EDPK HG++DF+FVDADKDNY NYHKRLIDLVKVGGVIGY
Sbjct  140  VAHKIDFREGPALPVLDLLLEDPKNHGSFDFVFVDADKDNYWNYHKRLIDLVKVGGVIGY  199

Query  627  DNTLWNGSVVAPPDAPMRKYIKYYRDFVLELNKALAVDPRIEICMLPVGDGITLCRRIS  803
            DNTLWNGSVVAP DAPMRKY++YYRDFVLE NK++A D R+EIC LPVGDG+TLCRR+S
Sbjct  200  DNTLWNGSVVAPADAPMRKYVRYYRDFVLEFNKSIAADLRVEICQLPVGDGVTLCRRVS  258



>sp|Q41720.1|CAMT_ZINVI RecName: Full=Caffeoyl-CoA O-methyltransferase; AltName: Full=Trans-caffeoyl-CoA 
3-O-methyltransferase; Short=CCoAMT; Short=CCoAOMT 
[Zinnia violacea]
 gb|AAA59389.1| S-adenosyl-L-methionine:trans-caffeoyl-CoA 3-O-methyltransferase 
[Zinnia violacea]
Length=245

 Score =   446 bits (1148),  Expect = 1e-154, Method: Compositional matrix adjust.
 Identities = 207/240 (86%), Positives = 229/240 (95%), Gaps = 0/240 (0%)
 Frame = +3

Query  84   AENQTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADE  263
             E Q  +HQEVGHKSLLQSDALYQYILETSVYPREP+ MKELR +TAKHPWNLMTTSADE
Sbjct  6    GETQPAKHQEVGHKSLLQSDALYQYILETSVYPREPQPMKELRRITAKHPWNLMTTSADE  65

Query  264  GQFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKA  443
            GQFL++LLKLINAKNTMEIGVYTGYSLL+TALALP+DGKILA+DINRENYE+GLP+I+KA
Sbjct  66   GQFLNLLLKLINAKNTMEIGVYTGYSLLSTALALPEDGKILALDINRENYEIGLPIIQKA  125

Query  444  GVAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIG  623
            GVAHKIDFREGPALP+LDQ+++D K HG++DFIFVDADKDNYLNYHKRLIDLVK GGVIG
Sbjct  126  GVAHKIDFREGPALPLLDQMLQDEKCHGSFDFIFVDADKDNYLNYHKRLIDLVKFGGVIG  185

Query  624  YDNTLWNGSVVAPPDAPMRKYIKYYRDFVLELNKALAVDPRIEICMLPVGDGITLCRRIS  803
            YDNTLWNGS+VAP DAP+RKY++YYRDFVLELNKALAVDPR+EIC LPVGDGITLCRRIS
Sbjct  186  YDNTLWNGSLVAPADAPLRKYVRYYRDFVLELNKALAVDPRVEICQLPVGDGITLCRRIS  245



>ref|XP_008366398.1| PREDICTED: caffeoyl-CoA O-methyltransferase [Malus domestica]
Length=243

 Score =   446 bits (1147),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 211/238 (89%), Positives = 227/238 (95%), Gaps = 4/238 (2%)
 Frame = +3

Query  87   ENQTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEG  266
            + Q  RHQEVGHKSLLQSDALYQ    TSVYPREPE+MKELREVTAKHPWN+MTTSADEG
Sbjct  9    QTQAGRHQEVGHKSLLQSDALYQ----TSVYPREPESMKELREVTAKHPWNIMTTSADEG  64

Query  267  QFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAG  446
            QFL+MLLKLINAKNTMEIGVYTGYSLLATALA+PDDGKILAMDIN+ENYELGLP+IEKAG
Sbjct  65   QFLNMLLKLINAKNTMEIGVYTGYSLLATALAIPDDGKILAMDINKENYELGLPIIEKAG  124

Query  447  VAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIGY  626
            VAHKIDFREGPALP+LD L+E+ K HG+YDFIFVDADKDNY+NYHKRLIDLVKVGG+IGY
Sbjct  125  VAHKIDFREGPALPMLDLLIENKKNHGSYDFIFVDADKDNYINYHKRLIDLVKVGGLIGY  184

Query  627  DNTLWNGSVVAPPDAPMRKYIKYYRDFVLELNKALAVDPRIEICMLPVGDGITLCRRI  800
            DNTLWNGSVVAPPDAP+RKY++YYRDFVLELNKALA DPRIEICMLPVGDGITLCRRI
Sbjct  185  DNTLWNGSVVAPPDAPLRKYVRYYRDFVLELNKALAADPRIEICMLPVGDGITLCRRI  242



>ref|XP_009413346.1| PREDICTED: caffeoyl-CoA O-methyltransferase isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=246

 Score =   446 bits (1146),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 208/237 (88%), Positives = 225/237 (95%), Gaps = 0/237 (0%)
 Frame = +3

Query  93   QTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEGQF  272
            Q  RHQEVGHKSLLQSDALYQY+LET+VYPREPE MKELRE+TA HPWN+MTTSADEGQF
Sbjct  10   QQGRHQEVGHKSLLQSDALYQYMLETTVYPREPECMKELREITANHPWNIMTTSADEGQF  69

Query  273  LSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAGVA  452
            L+MLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAGVA
Sbjct  70   LNMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAGVA  129

Query  453  HKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIGYDN  632
            HKIDFREGPALP+LD L+ED KK G++DF+FVDADKDNYLNYHKRL++LVKVGGVI YDN
Sbjct  130  HKIDFREGPALPVLDLLLEDEKKQGSFDFVFVDADKDNYLNYHKRLLELVKVGGVIAYDN  189

Query  633  TLWNGSVVAPPDAPMRKYIKYYRDFVLELNKALAVDPRIEICMLPVGDGITLCRRIS  803
            TLWNGSVVAPPDAP+RKY++YYRDFVL LN+ALA DPRIEIC LPVGDG+TLCRRI 
Sbjct  190  TLWNGSVVAPPDAPLRKYVRYYRDFVLHLNRALAADPRIEICQLPVGDGVTLCRRIK  246



>gb|ABX75853.1| caffeoyl-CoA-O-methyltransferase [Acacia auriculiformis x Acacia 
mangium]
 gb|AEV43321.1| caffeoyl-CoA O-methyltransferase [Acacia auriculiformis x Acacia 
mangium]
Length=249

 Score =   446 bits (1146),  Expect = 3e-154, Method: Compositional matrix adjust.
 Identities = 209/238 (88%), Positives = 227/238 (95%), Gaps = 0/238 (0%)
 Frame = +3

Query  87   ENQTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEG  266
            +++  RHQEVGHKSLLQSDALYQYILETSVYPREPE MKELRE+TAKHPWN+MTTSADEG
Sbjct  11   QSEAGRHQEVGHKSLLQSDALYQYILETSVYPREPEPMKELREITAKHPWNIMTTSADEG  70

Query  267  QFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAG  446
            QFL+MLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELG P +EKAG
Sbjct  71   QFLNMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGRPTLEKAG  130

Query  447  VAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIGY  626
            VAHK+DFREGPALP LD+LV+D K HG++DFIFVDADKDNYLNYH+RL+ LVKVGGVIGY
Sbjct  131  VAHKVDFREGPALPFLDELVKDEKNHGSFDFIFVDADKDNYLNYHERLLQLVKVGGVIGY  190

Query  627  DNTLWNGSVVAPPDAPMRKYIKYYRDFVLELNKALAVDPRIEICMLPVGDGITLCRRI  800
            DNTLWNGSVVAP DAP+RKY+ YYR+FVL+LNKALAVDPRIEICMLPVGDGITLCRRI
Sbjct  191  DNTLWNGSVVAPDDAPLRKYVMYYREFVLKLNKALAVDPRIEICMLPVGDGITLCRRI  248



>gb|AEM45655.1| caffeoyl-CoA O-methyltransferase 3 [Petunia x hybrida]
Length=242

 Score =   445 bits (1145),  Expect = 3e-154, Method: Compositional matrix adjust.
 Identities = 212/242 (88%), Positives = 230/242 (95%), Gaps = 1/242 (0%)
 Frame = +3

Query  81   MAEN-QTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSA  257
            MA N +  RHQEVG KSLLQSDALYQYILETSVYPREPE MKELRE+TAKHPWNLMTTSA
Sbjct  1    MATNGENGRHQEVGRKSLLQSDALYQYILETSVYPREPEPMKELREITAKHPWNLMTTSA  60

Query  258  DEGQFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIE  437
            DEGQFLSML+KLINAKNTMEIGV+TGYSLLATA+ALPDD KILAMDINRENYE+GLPVIE
Sbjct  61   DEGQFLSMLIKLINAKNTMEIGVFTGYSLLATAMALPDDDKILAMDINRENYEIGLPVIE  120

Query  438  KAGVAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGV  617
            KAG+AHKI+F+EGPALP+LDQ++ED K HG+YDFIFVDADKDNYLNYHKRLIDLVKVGG+
Sbjct  121  KAGLAHKIEFKEGPALPVLDQMIEDGKYHGSYDFIFVDADKDNYLNYHKRLIDLVKVGGL  180

Query  618  IGYDNTLWNGSVVAPPDAPMRKYIKYYRDFVLELNKALAVDPRIEICMLPVGDGITLCRR  797
            IGYDN+LWNGSVVAPPDAP+RKY++YYRDFVLELNKALA DPRIEI  LPVGDGITLCRR
Sbjct  181  IGYDNSLWNGSVVAPPDAPLRKYVRYYRDFVLELNKALAADPRIEIGQLPVGDGITLCRR  240

Query  798  IS  803
            IS
Sbjct  241  IS  242



>gb|ABK21526.1| unknown [Picea sitchensis]
 gb|ACN40568.1| unknown [Picea sitchensis]
Length=259

 Score =   446 bits (1146),  Expect = 4e-154, Method: Compositional matrix adjust.
 Identities = 207/242 (86%), Positives = 228/242 (94%), Gaps = 0/242 (0%)
 Frame = +3

Query  75   KAMAENQTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTS  254
            KA    +  RHQEVGHKSLLQSDALYQYILETSVYPREPE +KELREVTAKHPWNLMTTS
Sbjct  17   KAEEPAKVARHQEVGHKSLLQSDALYQYILETSVYPREPEPLKELREVTAKHPWNLMTTS  76

Query  255  ADEGQFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVI  434
            ADEGQFL +LLKLINAKNTMEIGVYTGYSLL+TALALPDDGKILAMDINRENY+LGLP+I
Sbjct  77   ADEGQFLGLLLKLINAKNTMEIGVYTGYSLLSTALALPDDGKILAMDINRENYDLGLPMI  136

Query  435  EKAGVAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGG  614
            EKAGVAHKIDFREGPALP+LDQ++++ + HG++DF+FVDADKDNYLNYHKRLIDLVKVGG
Sbjct  137  EKAGVAHKIDFREGPALPLLDQMIQNEELHGSFDFVFVDADKDNYLNYHKRLIDLVKVGG  196

Query  615  VIGYDNTLWNGSVVAPPDAPMRKYIKYYRDFVLELNKALAVDPRIEICMLPVGDGITLCR  794
            VI YDNTLWNGSVVAPPDAP+RKY++YYRDFVLELNKALA DPRIEI  +PVGDG+TLCR
Sbjct  197  VIAYDNTLWNGSVVAPPDAPLRKYVRYYRDFVLELNKALAADPRIEISQIPVGDGVTLCR  256

Query  795  RI  800
            R+
Sbjct  257  RV  258



>ref|XP_012079255.1| PREDICTED: caffeoyl-CoA O-methyltransferase 1-like [Jatropha 
curcas]
 gb|KDP31954.1| hypothetical protein JCGZ_12415 [Jatropha curcas]
Length=281

 Score =   446 bits (1147),  Expect = 6e-154, Method: Compositional matrix adjust.
 Identities = 206/239 (86%), Positives = 226/239 (95%), Gaps = 0/239 (0%)
 Frame = +3

Query  87   ENQTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEG  266
            +N   RHQE+GHKSLLQSDALYQYILETSVYPREPE +KELRE+TA HPWN+MTTSADEG
Sbjct  43   QNLVGRHQEIGHKSLLQSDALYQYILETSVYPREPEPLKELRELTANHPWNIMTTSADEG  102

Query  267  QFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAG  446
            QFLSML+KLINAKNTMEIGVYTGYSLLATALALP DGKILAMDINRENYELGLPVIEKAG
Sbjct  103  QFLSMLIKLINAKNTMEIGVYTGYSLLATALALPHDGKILAMDINRENYELGLPVIEKAG  162

Query  447  VAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIGY  626
            +AHKIDFREGPALP+LDQLV+D K HG++DFIFVDADKDNY+NYHKR I+LVKVGG+IGY
Sbjct  163  LAHKIDFREGPALPVLDQLVQDEKNHGSFDFIFVDADKDNYINYHKRTIELVKVGGIIGY  222

Query  627  DNTLWNGSVVAPPDAPMRKYIKYYRDFVLELNKALAVDPRIEICMLPVGDGITLCRRIS  803
            DNTLWNGSV APPDAP+RKY+++YRD+VLE NKA+A DPRIEIC LPVGDGITLCRRIS
Sbjct  223  DNTLWNGSVAAPPDAPLRKYVRFYRDYVLEFNKAMAADPRIEICQLPVGDGITLCRRIS  281



>gb|ACV50428.1| caffeoyl-CoA O-methyltransferase [Jatropha curcas]
Length=246

 Score =   444 bits (1141),  Expect = 1e-153, Method: Compositional matrix adjust.
 Identities = 209/239 (87%), Positives = 224/239 (94%), Gaps = 0/239 (0%)
 Frame = +3

Query  87   ENQTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEG  266
            +NQ  RHQEVGHKSLL+SDALYQYILETSVYPREPE MKELRE+TAKHPWN+MTTSADEG
Sbjct  8    QNQAGRHQEVGHKSLLRSDALYQYILETSVYPREPEPMKELRELTAKHPWNIMTTSADEG  67

Query  267  QFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAG  446
            QFL+MLLK  NAKNTME+GVYTGYSLLATALALPDD KILAMD+NRENYELGLP+I+KAG
Sbjct  68   QFLNMLLKPNNAKNTMEMGVYTGYSLLATALALPDDEKILAMDVNRENYELGLPIIQKAG  127

Query  447  VAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIGY  626
            VAHKIDFREGPALP+LD++V D K HGT+DFIFVDADKDNYLNYHKRLIDLVKVGGVIGY
Sbjct  128  VAHKIDFREGPALPVLDEMVADEKNHGTFDFIFVDADKDNYLNYHKRLIDLVKVGGVIGY  187

Query  627  DNTLWNGSVVAPPDAPMRKYIKYYRDFVLELNKALAVDPRIEICMLPVGDGITLCRRIS  803
            DNTLWNGSVVAP DAP+RKY+KYYRDFV ELNKAL  DPRIEICMLPVGDGIT CRRI 
Sbjct  188  DNTLWNGSVVAPADAPLRKYVKYYRDFVWELNKALPADPRIEICMLPVGDGITFCRRIQ  246



>sp|O65162.1|CAMT_MESCR RecName: Full=Caffeoyl-CoA O-methyltransferase; AltName: Full=Trans-caffeoyl-CoA 
3-O-methyltransferase; Short=CCoAMT; Short=CCoAOMT 
[Mesembryanthemum crystallinum]
 gb|AAC08395.1| caffeoyl-CoA O-methyltransferase [Mesembryanthemum crystallinum]
Length=254

 Score =   443 bits (1140),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 205/234 (88%), Positives = 223/234 (95%), Gaps = 0/234 (0%)
 Frame = +3

Query  102  RHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEGQFLSM  281
            +HQEVGHKSLLQSDAL+QYILETSVYPREPE MKELR++TAKHPWNLMTTSADEGQFL+M
Sbjct  21   KHQEVGHKSLLQSDALFQYILETSVYPREPEPMKELRDITAKHPWNLMTTSADEGQFLNM  80

Query  282  LLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAGVAHKI  461
            LLKLINAKNT+EIGVYTGYSLLA+ALALPDDGKILAMDINRENYELGLPVI+KAGVAHKI
Sbjct  81   LLKLINAKNTIEIGVYTGYSLLASALALPDDGKILAMDINRENYELGLPVIQKAGVAHKI  140

Query  462  DFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIGYDNTLW  641
            DFREGPALP+LD L+ED K HG++DF FVDADKDNY NYHKRLIDLVK+GGVIGYDNTLW
Sbjct  141  DFREGPALPVLDLLIEDAKNHGSFDFAFVDADKDNYGNYHKRLIDLVKIGGVIGYDNTLW  200

Query  642  NGSVVAPPDAPMRKYIKYYRDFVLELNKALAVDPRIEICMLPVGDGITLCRRIS  803
            NGSV AP DAPMRKY++YYRDFV+E NKA+A DPR+EIC LPVGDGITLCRRIS
Sbjct  201  NGSVAAPADAPMRKYVRYYRDFVMEFNKAIAADPRVEICQLPVGDGITLCRRIS  254



>gb|AFL65039.1| caffeoyl-CoA-O-methyltransferase [Pinus pinaster]
Length=259

 Score =   443 bits (1140),  Expect = 3e-153, Method: Compositional matrix adjust.
 Identities = 204/236 (86%), Positives = 226/236 (96%), Gaps = 0/236 (0%)
 Frame = +3

Query  93   QTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEGQF  272
            +  RHQEVGHKSLLQSDALYQYILETSVYPREPE MKELREVTAKHPWNLMTTSADEGQF
Sbjct  23   KVVRHQEVGHKSLLQSDALYQYILETSVYPREPEPMKELREVTAKHPWNLMTTSADEGQF  82

Query  273  LSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAGVA  452
            L +LLKLINAKNTMEIGVYTGYSLL+TALALPDDGKILAMDINRENY++GLP+IEKAGVA
Sbjct  83   LGLLLKLINAKNTMEIGVYTGYSLLSTALALPDDGKILAMDINRENYDIGLPIIEKAGVA  142

Query  453  HKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIGYDN  632
            HKIDFREGPALP+LD++V++   HG++DF+FVDADKDNYLNYHKRLIDLVKVGG+I YDN
Sbjct  143  HKIDFREGPALPVLDEMVKNEDMHGSFDFVFVDADKDNYLNYHKRLIDLVKVGGLIAYDN  202

Query  633  TLWNGSVVAPPDAPMRKYIKYYRDFVLELNKALAVDPRIEICMLPVGDGITLCRRI  800
            TLWNGSVVAPPDAP+RKY++YYRDFV+ELNKALAVDPRIEI  +PVGDG+TLCRR+
Sbjct  203  TLWNGSVVAPPDAPLRKYVRYYRDFVMELNKALAVDPRIEISQIPVGDGVTLCRRV  258



>gb|AHL67654.1| caffeoyl-CoA 3-O-methyltransferase [Pinus massoniana]
Length=259

 Score =   443 bits (1139),  Expect = 4e-153, Method: Compositional matrix adjust.
 Identities = 204/236 (86%), Positives = 226/236 (96%), Gaps = 0/236 (0%)
 Frame = +3

Query  93   QTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEGQF  272
            +  RHQEVGHKSLLQSDALYQYILETSVYPREPE MKELREVTAKHPWNLMTTSADEGQF
Sbjct  23   KVVRHQEVGHKSLLQSDALYQYILETSVYPREPEPMKELREVTAKHPWNLMTTSADEGQF  82

Query  273  LSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAGVA  452
            L +LLKLINAKNTMEIGVYTGYSLL+TALALPDDGKILAMDINRENY++GLP+IEKAGVA
Sbjct  83   LGLLLKLINAKNTMEIGVYTGYSLLSTALALPDDGKILAMDINRENYDIGLPIIEKAGVA  142

Query  453  HKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIGYDN  632
            HKIDFREGPALP+LD++V++   HG++DF+FVDADKDNYLNYHKRLIDLVKVGG+I YDN
Sbjct  143  HKIDFREGPALPVLDEMVKNEDMHGSFDFVFVDADKDNYLNYHKRLIDLVKVGGLIAYDN  202

Query  633  TLWNGSVVAPPDAPMRKYIKYYRDFVLELNKALAVDPRIEICMLPVGDGITLCRRI  800
            TLWNGSVVAPPDAP+RKY++YYRDFV+ELNKALAVDPRIEI  +PVGDG+TLCRR+
Sbjct  203  TLWNGSVVAPPDAPLRKYVRYYRDFVMELNKALAVDPRIEISQIPVGDGVTLCRRV  258



>gb|AEW26103.1| caffeoyl-CoA 3-o-methyltransferase, partial [Medicago sativa 
subsp. x varia]
Length=231

 Score =   441 bits (1134),  Expect = 7e-153, Method: Compositional matrix adjust.
 Identities = 208/230 (90%), Positives = 225/230 (98%), Gaps = 0/230 (0%)
 Frame = +3

Query  93   QTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEGQF  272
            ++ RHQEVGHKSLLQSDALYQYILETSV+PRE EAMKELREVTAKHPWN+MTTSADEGQF
Sbjct  2    ESGRHQEVGHKSLLQSDALYQYILETSVFPREHEAMKELREVTAKHPWNIMTTSADEGQF  61

Query  273  LSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAGVA  452
            LSMLLKLINAKNTMEIGVYTGYSLLATALA+P+DGKILAMDIN+ENYELGLPVI+KAGV 
Sbjct  62   LSMLLKLINAKNTMEIGVYTGYSLLATALAIPEDGKILAMDINKENYELGLPVIKKAGVD  121

Query  453  HKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIGYDN  632
            HKIDFREGPALP+LD++++D K HG+YDFIFVDADKDNYLNYHKRLIDLVKVGGVIGYDN
Sbjct  122  HKIDFREGPALPVLDEMIKDEKNHGSYDFIFVDADKDNYLNYHKRLIDLVKVGGVIGYDN  181

Query  633  TLWNGSVVAPPDAPMRKYIKYYRDFVLELNKALAVDPRIEICMLPVGDGI  782
            TLWNGSVVAPPDAP+RKY++YYRDFVLELNKALAVDPRIEICMLPVGDGI
Sbjct  182  TLWNGSVVAPPDAPLRKYVRYYRDFVLELNKALAVDPRIEICMLPVGDGI  231



>emb|CBL95257.2| caffeoyl CoA O-methyltransferase [Pinus pinaster]
Length=259

 Score =   442 bits (1137),  Expect = 9e-153, Method: Compositional matrix adjust.
 Identities = 204/235 (87%), Positives = 225/235 (96%), Gaps = 0/235 (0%)
 Frame = +3

Query  93   QTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEGQF  272
            +  RHQEVGHKSLLQSDALYQYILETSVYPREPE MKELREVTAKHPWNLMTTSADEGQF
Sbjct  23   KVVRHQEVGHKSLLQSDALYQYILETSVYPREPEPMKELREVTAKHPWNLMTTSADEGQF  82

Query  273  LSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAGVA  452
            L +LLKLINAKNTMEIGVYTGYSLL+TALALPDDGKILAMDINRENY++GLP+IEKAGVA
Sbjct  83   LGLLLKLINAKNTMEIGVYTGYSLLSTALALPDDGKILAMDINRENYDIGLPIIEKAGVA  142

Query  453  HKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIGYDN  632
            HKIDFREGPALP+LD++V++   HG++DF+FVDADKDNYLNYHKRLIDLVKVGG+I YDN
Sbjct  143  HKIDFREGPALPVLDEMVKNEDMHGSFDFVFVDADKDNYLNYHKRLIDLVKVGGLIAYDN  202

Query  633  TLWNGSVVAPPDAPMRKYIKYYRDFVLELNKALAVDPRIEICMLPVGDGITLCRR  797
            TLWNGSVVAPPDAP+RKY++YYRDFV+ELNKALAVDPRIEI  +PVGDG+TLCRR
Sbjct  203  TLWNGSVVAPPDAPLRKYVRYYRDFVMELNKALAVDPRIEISQIPVGDGVTLCRR  257



>ref|XP_002523619.1| o-methyltransferase, putative [Ricinus communis]
 gb|EEF38814.1| o-methyltransferase, putative [Ricinus communis]
Length=292

 Score =   443 bits (1140),  Expect = 1e-152, Method: Compositional matrix adjust.
 Identities = 204/239 (85%), Positives = 224/239 (94%), Gaps = 0/239 (0%)
 Frame = +3

Query  87   ENQTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEG  266
            ENQ  RHQE+GHKSLLQSDALYQYILETSVYP EPE MKELRE+TA H WN+MTTSADEG
Sbjct  54   ENQAGRHQEIGHKSLLQSDALYQYILETSVYPGEPEPMKELRELTATHKWNIMTTSADEG  113

Query  267  QFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAG  446
            QFLSMLLKLINAKNTMEIGVYTGYSLLATALALP+DGKILAMDINRENYELGLP+I+KAG
Sbjct  114  QFLSMLLKLINAKNTMEIGVYTGYSLLATALALPEDGKILAMDINRENYELGLPIIKKAG  173

Query  447  VAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIGY  626
            VAHKIDFREGPALP+LDQL++D K HGT+DFIFVDADKDNYLNYHKR + L KVGGVIGY
Sbjct  174  VAHKIDFREGPALPVLDQLIQDGKHHGTFDFIFVDADKDNYLNYHKRTVQLAKVGGVIGY  233

Query  627  DNTLWNGSVVAPPDAPMRKYIKYYRDFVLELNKALAVDPRIEICMLPVGDGITLCRRIS  803
            DNTLWNGSVVA PDAP+RKY+++YRD+V+E NKA+A DPR+EIC LP+GDGITLCRRIS
Sbjct  234  DNTLWNGSVVASPDAPLRKYVRFYRDYVMEFNKAIAADPRVEICQLPIGDGITLCRRIS  292



>emb|CAK18782.1| caffeoyl CoA O-methyltransferase [Picea abies]
Length=259

 Score =   442 bits (1136),  Expect = 1e-152, Method: Compositional matrix adjust.
 Identities = 204/235 (87%), Positives = 226/235 (96%), Gaps = 0/235 (0%)
 Frame = +3

Query  93   QTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEGQF  272
            + TRHQEVGHKSLLQSDALYQYILETSVYPREPE +KELREVTAKHPWNLMTTSADEGQF
Sbjct  23   KVTRHQEVGHKSLLQSDALYQYILETSVYPREPEPLKELREVTAKHPWNLMTTSADEGQF  82

Query  273  LSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAGVA  452
            L +LLKLINAKNTMEIGVYTGYSLL+TALALPDDGKILAMDINRENY+LGLP+IEKAGVA
Sbjct  83   LGLLLKLINAKNTMEIGVYTGYSLLSTALALPDDGKILAMDINRENYDLGLPMIEKAGVA  142

Query  453  HKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIGYDN  632
            HKIDFREGPALP+LD++V++ + HG++DF+FVDADKDNYLNYH+RLIDLVKVGGVI YDN
Sbjct  143  HKIDFREGPALPLLDEMVKNEEMHGSFDFVFVDADKDNYLNYHRRLIDLVKVGGVIAYDN  202

Query  633  TLWNGSVVAPPDAPMRKYIKYYRDFVLELNKALAVDPRIEICMLPVGDGITLCRR  797
            TLWNGSVVAPPDAP+RKY++YYRDFV+ELNKALA DPRIEI  +PVGDG+TLCRR
Sbjct  203  TLWNGSVVAPPDAPLRKYVRYYRDFVMELNKALAADPRIEISQIPVGDGVTLCRR  257



>gb|AAR91504.1| caffeoyl-CoA-O-methyltransferase [Corchorus capsularis]
Length=250

 Score =   440 bits (1131),  Expect = 4e-152, Method: Compositional matrix adjust.
 Identities = 210/242 (87%), Positives = 227/242 (94%), Gaps = 3/242 (1%)
 Frame = +3

Query  87   ENQTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEG  266
            ++Q  RHQEV HKS+LQSDALYQYILETSVYPREPE MKELRE+TAKHPWNLMTTSADE 
Sbjct  9    QSQAGRHQEVEHKSVLQSDALYQYILETSVYPREPEPMKELRELTAKHPWNLMTTSADEW  68

Query  267  QFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAG  446
            QFL+MLLKLINAKNTMEIGVYTGYSLLATALALPDD KILAMDINRENYELGLPVI+KAG
Sbjct  69   QFLNMLLKLINAKNTMEIGVYTGYSLLATALALPDDAKILAMDINRENYELGLPVIQKAG  128

Query  447  VAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKD---NYLNYHKRLIDLVKVGGV  617
            VAHKI+F+EGPALP+LD+LVED K H +YDFIFVDADKD   NY+NYHKRLIDLVKVGG+
Sbjct  129  VAHKIEFKEGPALPVLDKLVEDEKNHESYDFIFVDADKDNYINYINYHKRLIDLVKVGGL  188

Query  618  IGYDNTLWNGSVVAPPDAPMRKYIKYYRDFVLELNKALAVDPRIEICMLPVGDGITLCRR  797
            IGYDNTLWNGSVVAPPDAPMRKY++YYRDFVLE+NKALA DPRIEICMLPV DGIT+CRR
Sbjct  189  IGYDNTLWNGSVVAPPDAPMRKYVRYYRDFVLEINKALAADPRIEICMLPVEDGITVCRR  248

Query  798  IS  803
            I 
Sbjct  249  IQ  250



>gb|ACN40635.1| unknown [Picea sitchensis]
Length=258

 Score =   439 bits (1129),  Expect = 1e-151, Method: Compositional matrix adjust.
 Identities = 203/235 (86%), Positives = 225/235 (96%), Gaps = 0/235 (0%)
 Frame = +3

Query  93   QTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEGQF  272
            + TRHQEVGHKSLLQSDALYQYILETSVYPREPE +KELREVTAKHPWNLMTTSADEGQF
Sbjct  22   KVTRHQEVGHKSLLQSDALYQYILETSVYPREPEPLKELREVTAKHPWNLMTTSADEGQF  81

Query  273  LSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAGVA  452
            L +LLKLINAKNTMEIGVYTGYSLL+TALALPDDGKILAMDINRENY+LGLP+IEKAGVA
Sbjct  82   LGLLLKLINAKNTMEIGVYTGYSLLSTALALPDDGKILAMDINRENYDLGLPMIEKAGVA  141

Query  453  HKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIGYDN  632
            HKIDFREGPALP+LD++V++ +  G++DF+FVDADKDNYLNYH+RLIDLVKVGGVI YDN
Sbjct  142  HKIDFREGPALPLLDEMVKNEEMQGSFDFVFVDADKDNYLNYHRRLIDLVKVGGVIAYDN  201

Query  633  TLWNGSVVAPPDAPMRKYIKYYRDFVLELNKALAVDPRIEICMLPVGDGITLCRR  797
            TLWNGSVVAPPDAP+RKY++YYRDFV+ELNKALA DPRIEI  +PVGDG+TLCRR
Sbjct  202  TLWNGSVVAPPDAPLRKYVRYYRDFVMELNKALAADPRIEISQIPVGDGVTLCRR  256



>gb|ABR17605.1| unknown [Picea sitchensis]
 gb|ACN40076.1| unknown [Picea sitchensis]
Length=259

 Score =   439 bits (1129),  Expect = 1e-151, Method: Compositional matrix adjust.
 Identities = 203/235 (86%), Positives = 225/235 (96%), Gaps = 0/235 (0%)
 Frame = +3

Query  93   QTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEGQF  272
            + TRHQEVGHKSLLQSDALYQYILETSVYPREPE +KELREVTAKHPWNLMTTSADEGQF
Sbjct  23   KVTRHQEVGHKSLLQSDALYQYILETSVYPREPEPLKELREVTAKHPWNLMTTSADEGQF  82

Query  273  LSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAGVA  452
            L +LLKLINAKNTMEIGVYTGYSLL+TALALPDDGKILAMDINRENY+LGLP+IEKAGVA
Sbjct  83   LGLLLKLINAKNTMEIGVYTGYSLLSTALALPDDGKILAMDINRENYDLGLPMIEKAGVA  142

Query  453  HKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIGYDN  632
            HKIDFREGPALP+LD++V++ +  G++DF+FVDADKDNYLNYH+RLIDLVKVGGVI YDN
Sbjct  143  HKIDFREGPALPLLDEMVKNEEMQGSFDFVFVDADKDNYLNYHRRLIDLVKVGGVIAYDN  202

Query  633  TLWNGSVVAPPDAPMRKYIKYYRDFVLELNKALAVDPRIEICMLPVGDGITLCRR  797
            TLWNGSVVAPPDAP+RKY++YYRDFV+ELNKALA DPRIEI  +PVGDG+TLCRR
Sbjct  203  TLWNGSVVAPPDAPLRKYVRYYRDFVMELNKALAADPRIEISQIPVGDGVTLCRR  257



>gb|ABB87185.1| caffeoyl-CoA O-methyltransferase [Chamaecyparis obtusa var. formosana]
Length=278

 Score =   439 bits (1130),  Expect = 1e-151, Method: Compositional matrix adjust.
 Identities = 209/268 (78%), Positives = 231/268 (86%), Gaps = 29/268 (11%)
 Frame = +3

Query  84   AENQTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVT--------------  221
            +  Q +RHQEVGHKSLLQSDALYQYILETSVYPREPE+M+ELRE+T              
Sbjct  10   STQQVSRHQEVGHKSLLQSDALYQYILETSVYPREPESMRELREITQSDALYQYILETSV  69

Query  222  ---------------AKHPWNLMTTSADEGQFLSMLLKLINAKNTMEIGVYTGYSLLATA  356
                           AKHPWNLMTTSADEGQFL++LLKLINAKNTMEIGVYTGYSLL+TA
Sbjct  70   YPREPESMRELREITAKHPWNLMTTSADEGQFLNLLLKLINAKNTMEIGVYTGYSLLSTA  129

Query  357  LALPDDGKILAMDINRENYELGLPVIEKAGVAHKIDFREGPALPILDQLVEDPKKHGTYD  536
            LALPDDGKILAMDINRENYELGLPVI+KAGVAHKIDFREGPALP+LDQ++E+ + HG++D
Sbjct  130  LALPDDGKILAMDINRENYELGLPVIQKAGVAHKIDFREGPALPVLDQMLENKEMHGSFD  189

Query  537  FIFVDADKDNYLNYHKRLIDLVKVGGVIGYDNTLWNGSVVAPPDAPMRKYIKYYRDFVLE  716
            FIFVDADKDNYLNYHKRLIDLVK+GGVIGYDNTLWNGSVVAPPDAPMRKY++YYRDFV+E
Sbjct  190  FIFVDADKDNYLNYHKRLIDLVKIGGVIGYDNTLWNGSVVAPPDAPMRKYVRYYRDFVIE  249

Query  717  LNKALAVDPRIEICMLPVGDGITLCRRI  800
            LNKALA DPRIEI  +PVGDGITLCRR+
Sbjct  250  LNKALAADPRIEISQIPVGDGITLCRRV  277



>gb|ADV40957.1| caffeoyl-CoA O-methyltransferase [Pinus radiata]
Length=259

 Score =   438 bits (1127),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 207/255 (81%), Positives = 231/255 (91%), Gaps = 2/255 (1%)
 Frame = +3

Query  42   TSVKGSLAGKFKAMAEN--QTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELRE  215
            TSV  +        AE   +  RHQEVGHKSLLQSDALYQYILETSVYPREPE MKELRE
Sbjct  4    TSVAAAEVKAQTTQAEEPVKVVRHQEVGHKSLLQSDALYQYILETSVYPREPEPMKELRE  63

Query  216  VTAKHPWNLMTTSADEGQFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMD  395
            VTAKHPWNLMTTSADEGQFL +LLKLINAKNTMEIGVYTGYSLL+TALALPDDGKILAMD
Sbjct  64   VTAKHPWNLMTTSADEGQFLGLLLKLINAKNTMEIGVYTGYSLLSTALALPDDGKILAMD  123

Query  396  INRENYELGLPVIEKAGVAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLN  575
            INRENY++GLP+IEKAGVAHKIDFREGPALP+ D+L+++   HG++DF+FVDADKDNYLN
Sbjct  124  INRENYDIGLPIIEKAGVAHKIDFREGPALPVPDELLKNEDMHGSFDFVFVDADKDNYLN  183

Query  576  YHKRLIDLVKVGGVIGYDNTLWNGSVVAPPDAPMRKYIKYYRDFVLELNKALAVDPRIEI  755
            YHKRLIDLVKVGG+I YDNTLW+GSVVAPPDAP+RKY++YYRDFV+ELNKALAVDPRIEI
Sbjct  184  YHKRLIDLVKVGGLIAYDNTLWDGSVVAPPDAPLRKYVRYYRDFVMELNKALAVDPRIEI  243

Query  756  CMLPVGDGITLCRRI  800
              +PVGDG+TLCRR+
Sbjct  244  SQIPVGDGVTLCRRV  258



>gb|ABK22164.1| unknown [Picea sitchensis]
Length=259

 Score =   437 bits (1124),  Expect = 8e-151, Method: Compositional matrix adjust.
 Identities = 202/235 (86%), Positives = 224/235 (95%), Gaps = 0/235 (0%)
 Frame = +3

Query  93   QTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEGQF  272
            + TRHQEVGHKSLLQSDALYQYILETSVYPREPE +KELREVTAKHPWNLMTTS DEGQF
Sbjct  23   KVTRHQEVGHKSLLQSDALYQYILETSVYPREPEPLKELREVTAKHPWNLMTTSEDEGQF  82

Query  273  LSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAGVA  452
            L +LLKLINAKNTMEIGVYTGYSLL+TALALPDDGKILAMDINRENY+LGLP+IEKAGVA
Sbjct  83   LGLLLKLINAKNTMEIGVYTGYSLLSTALALPDDGKILAMDINRENYDLGLPMIEKAGVA  142

Query  453  HKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIGYDN  632
            HKIDFREGPALP+LD++V++ +  G++DF+FVDADKDNYLNYH+RLIDLVKVGGVI YDN
Sbjct  143  HKIDFREGPALPLLDEMVKNEEMQGSFDFVFVDADKDNYLNYHRRLIDLVKVGGVIAYDN  202

Query  633  TLWNGSVVAPPDAPMRKYIKYYRDFVLELNKALAVDPRIEICMLPVGDGITLCRR  797
            TLWNGSVVAPPDAP+RKY++YYRDFV+ELNKALA DPRIEI  +PVGDG+TLCRR
Sbjct  203  TLWNGSVVAPPDAPLRKYVRYYRDFVMELNKALAADPRIEISQIPVGDGVTLCRR  257



>gb|AFD53035.1| caffeoyl-CoA O-methyltransferase [Bambusa emeiensis]
Length=258

 Score =   434 bits (1117),  Expect = 8e-150, Method: Compositional matrix adjust.
 Identities = 204/235 (87%), Positives = 218/235 (93%), Gaps = 0/235 (0%)
 Frame = +3

Query  93   QTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEGQF  272
            Q TRH EVGHKSLLQSDALYQYILETSVYPRE E MKELREVTAKHPWNLMTTSADEGQF
Sbjct  22   QKTRHSEVGHKSLLQSDALYQYILETSVYPREHECMKELREVTAKHPWNLMTTSADEGQF  81

Query  273  LSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAGVA  452
            L+MLLKLI AK TMEIGVYTGYSLLATALA+P+DG ILAMDINRENYELGLP IEKAGVA
Sbjct  82   LNMLLKLIGAKKTMEIGVYTGYSLLATALAIPEDGTILAMDINRENYELGLPCIEKAGVA  141

Query  453  HKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIGYDN  632
            HKIDFREGPALP+LDQL+ED   HG++DF+FVDADKDNYLNYH+RL+ LVKVGG++GYDN
Sbjct  142  HKIDFREGPALPVLDQLLEDESNHGSFDFVFVDADKDNYLNYHERLMKLVKVGGLVGYDN  201

Query  633  TLWNGSVVAPPDAPMRKYIKYYRDFVLELNKALAVDPRIEICMLPVGDGITLCRR  797
            TLWNGSVV P DAPMRKYI+YYRDFVLELNKALA D R+EIC LPVGDGITLCRR
Sbjct  202  TLWNGSVVLPADAPMRKYIRYYRDFVLELNKALAADERVEICQLPVGDGITLCRR  256



>dbj|BAG71893.1| caffeoyl CoA O-methyltransferase [Carthamus tinctorius]
Length=252

 Score =   433 bits (1114),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 202/245 (82%), Positives = 224/245 (91%), Gaps = 0/245 (0%)
 Frame = +3

Query  69   KFKAMAENQTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMT  248
            K  +  E Q + HQEVGHKSLLQSDALYQYILETSVYPREP  MKELRE+TAKHP N+M 
Sbjct  8    KIDSNNEEQASGHQEVGHKSLLQSDALYQYILETSVYPREPTPMKELREITAKHPMNVMA  67

Query  249  TSADEGQFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLP  428
            TSADEGQFL+MLLKL+NAKNTMEIGV+TGYSLLATALALP+DGKILAMDINR++YELG P
Sbjct  68   TSADEGQFLNMLLKLVNAKNTMEIGVFTGYSLLATALALPEDGKILAMDINRDDYELGRP  127

Query  429  VIEKAGVAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKV  608
            +IEKAGVAHKIDF+EGPA+P+LD+++ D K HGTYDFIFVDADKDNY+NYHKRL+DLVKV
Sbjct  128  IIEKAGVAHKIDFKEGPAMPVLDEMIVDGKYHGTYDFIFVDADKDNYINYHKRLVDLVKV  187

Query  609  GGVIGYDNTLWNGSVVAPPDAPMRKYIKYYRDFVLELNKALAVDPRIEICMLPVGDGITL  788
            GG+IGYDNTLWNG V APPDAPM KY+ YYRDFVLE NKALA DPRIEICMLPVGDGITL
Sbjct  188  GGLIGYDNTLWNGPVAAPPDAPMAKYVSYYRDFVLEFNKALAADPRIEICMLPVGDGITL  247

Query  789  CRRIS  803
            CRRI+
Sbjct  248  CRRIN  252



>gb|ABO26812.1| caffeoyl-CoA O-methyltransferase [Bambusa oldhamii]
Length=259

 Score =   433 bits (1113),  Expect = 3e-149, Method: Compositional matrix adjust.
 Identities = 204/235 (87%), Positives = 217/235 (92%), Gaps = 0/235 (0%)
 Frame = +3

Query  93   QTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEGQF  272
            Q TRH EVGHKSLLQSDALYQYILETSVYPRE E MKELREVTAKHPWNLMTTSADEGQF
Sbjct  23   QKTRHSEVGHKSLLQSDALYQYILETSVYPREHECMKELREVTAKHPWNLMTTSADEGQF  82

Query  273  LSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAGVA  452
            L+MLLKLI AK TMEIGVYTGYSLLATALA+P+DG ILAMDINRENYELGLP IEKAGVA
Sbjct  83   LNMLLKLIGAKKTMEIGVYTGYSLLATALAIPEDGTILAMDINRENYELGLPCIEKAGVA  142

Query  453  HKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIGYDN  632
            HKIDFREGPALP+LDQL+ED   HG++DF+FVDADKDNYLNYH RL+ LVKVGG++GYDN
Sbjct  143  HKIDFREGPALPVLDQLLEDEANHGSFDFVFVDADKDNYLNYHDRLMKLVKVGGLVGYDN  202

Query  633  TLWNGSVVAPPDAPMRKYIKYYRDFVLELNKALAVDPRIEICMLPVGDGITLCRR  797
            TLWNGSVV P DAPMRKYI+YYRDFVLELNKALA D R+EIC LPVGDGITLCRR
Sbjct  203  TLWNGSVVLPADAPMRKYIRYYRDFVLELNKALAADERVEICQLPVGDGITLCRR  257



>sp|Q9ZTT5.1|CAMT_PINTA RecName: Full=Caffeoyl-CoA O-methyltransferase; AltName: Full=Trans-caffeoyl-CoA 
3-O-methyltransferase; Short=CCoAMT; Short=CCoAOMT 
[Pinus taeda]
 gb|AAD02050.1| caffeoyl-CoA O-methyltransferase [Pinus taeda]
Length=259

 Score =   432 bits (1110),  Expect = 9e-149, Method: Compositional matrix adjust.
 Identities = 205/255 (80%), Positives = 228/255 (89%), Gaps = 2/255 (1%)
 Frame = +3

Query  42   TSVKGSLAGKFKAMAEN--QTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELRE  215
            TSV  +        AE   +  RHQEVGHKSLLQSDALYQYILETSVYPREPE MKEL  
Sbjct  4    TSVAAAEVKAQTTQAEEPVKVVRHQEVGHKSLLQSDALYQYILETSVYPREPEPMKELPR  63

Query  216  VTAKHPWNLMTTSADEGQFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMD  395
            VTAKHPWNLMTTSADEGQFL +LLKLINAKNTMEIGVYTGYSLL+TALALPDDGKILAMD
Sbjct  64   VTAKHPWNLMTTSADEGQFLGLLLKLINAKNTMEIGVYTGYSLLSTALALPDDGKILAMD  123

Query  396  INRENYELGLPVIEKAGVAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLN  575
            INRENY++GLP+IEKAGVAHKIDFREGPALP+LD+L+++   HG++DF+FVD DKDNYLN
Sbjct  124  INRENYDIGLPIIEKAGVAHKIDFREGPALPVLDELLKNEDMHGSFDFVFVDRDKDNYLN  183

Query  576  YHKRLIDLVKVGGVIGYDNTLWNGSVVAPPDAPMRKYIKYYRDFVLELNKALAVDPRIEI  755
            YHKRLIDLVKVGG+I YDNTLWNGSVVAPPDAP+RKY++YYRDFV+ELNKALAVDPRIEI
Sbjct  184  YHKRLIDLVKVGGLIAYDNTLWNGSVVAPPDAPLRKYVRYYRDFVMELNKALAVDPRIEI  243

Query  756  CMLPVGDGITLCRRI  800
              +PV DG+TLCRR+
Sbjct  244  SQIPVLDGVTLCRRV  258



>ref|XP_009413345.1| PREDICTED: caffeoyl-CoA O-methyltransferase isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=271

 Score =   432 bits (1110),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 208/261 (80%), Positives = 225/261 (86%), Gaps = 25/261 (10%)
 Frame = +3

Query  93   QTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEGQF  272
            Q  RHQEVGHKSLLQSDALYQY+LET+VYPREPE MKELRE+TA HPWN+MTTSADEGQF
Sbjct  10   QQGRHQEVGHKSLLQSDALYQYMLETTVYPREPECMKELREITANHPWNIMTTSADEGQF  69

Query  273  LSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAGVA  452
            L+MLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAGVA
Sbjct  70   LNMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAGVA  129

Query  453  HKIDFREGPALPILDQLVED-------------------------PKKHGTYDFIFVDAD  557
            HKIDFREGPALP+LD L+ED                          KK G++DF+FVDAD
Sbjct  130  HKIDFREGPALPVLDLLLEDVRIECIFQPLLLVSADKCCRRGWSQEKKQGSFDFVFVDAD  189

Query  558  KDNYLNYHKRLIDLVKVGGVIGYDNTLWNGSVVAPPDAPMRKYIKYYRDFVLELNKALAV  737
            KDNYLNYHKRL++LVKVGGVI YDNTLWNGSVVAPPDAP+RKY++YYRDFVL LN+ALA 
Sbjct  190  KDNYLNYHKRLLELVKVGGVIAYDNTLWNGSVVAPPDAPLRKYVRYYRDFVLHLNRALAA  249

Query  738  DPRIEICMLPVGDGITLCRRI  800
            DPRIEIC LPVGDG+TLCRRI
Sbjct  250  DPRIEICQLPVGDGVTLCRRI  270



>dbj|BAK01687.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=266

 Score =   430 bits (1106),  Expect = 5e-148, Method: Compositional matrix adjust.
 Identities = 202/235 (86%), Positives = 216/235 (92%), Gaps = 0/235 (0%)
 Frame = +3

Query  93   QTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEGQF  272
            Q TRH EVGHKSLLQSDALYQYILETSVYPRE E MKELRE+TA HPWNLMTTSADEGQF
Sbjct  30   QVTRHSEVGHKSLLQSDALYQYILETSVYPREHECMKELREITANHPWNLMTTSADEGQF  89

Query  273  LSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAGVA  452
            L+MLLKLI AK TMEIGVYTGYSLLATALA+PDDG ILAMDINRENYELGLP IEKAGVA
Sbjct  90   LNMLLKLIGAKKTMEIGVYTGYSLLATALAIPDDGTILAMDINRENYELGLPCIEKAGVA  149

Query  453  HKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIGYDN  632
            HKIDFREGPALP+LD L+ED   HGT+DF+FVDADKDNYLNYH+RL+ LVKVGG++GYDN
Sbjct  150  HKIDFREGPALPVLDALLEDEANHGTFDFVFVDADKDNYLNYHERLMKLVKVGGLLGYDN  209

Query  633  TLWNGSVVAPPDAPMRKYIKYYRDFVLELNKALAVDPRIEICMLPVGDGITLCRR  797
            TLWNGSVV P DAPMRKYI+YYRDFVL+LNKALA D R+EIC LPVGDGITLCRR
Sbjct  210  TLWNGSVVLPADAPMRKYIRYYRDFVLDLNKALAADQRVEICQLPVGDGITLCRR  264



>gb|EPS69718.1| hypothetical protein M569_05045, partial [Genlisea aurea]
Length=246

 Score =   427 bits (1098),  Expect = 4e-147, Method: Compositional matrix adjust.
 Identities = 199/233 (85%), Positives = 220/233 (94%), Gaps = 0/233 (0%)
 Frame = +3

Query  105  HQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEGQFLSML  284
            H+EVGHKSLL+SDALYQYILETSVYPREPE+MKELRE+TAKHPWN+MTTSADEGQFL+ML
Sbjct  14   HREVGHKSLLKSDALYQYILETSVYPREPESMKELREITAKHPWNMMTTSADEGQFLNML  73

Query  285  LKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAGVAHKID  464
            LKLINAK TMEIGVYTGYSLLATALALP DGKILAMDINRENYELGLPVI+KAGVA KID
Sbjct  74   LKLINAKKTMEIGVYTGYSLLATALALPPDGKILAMDINRENYELGLPVIQKAGVADKID  133

Query  465  FREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIGYDNTLWN  644
            FREGPALP+LD+L+ D K HG +DFIFVDADKDNYLNYHKRLI+LVKVGGVIGYDNTLWN
Sbjct  134  FREGPALPVLDELILDEKNHGAFDFIFVDADKDNYLNYHKRLIELVKVGGVIGYDNTLWN  193

Query  645  GSVVAPPDAPMRKYIKYYRDFVLELNKALAVDPRIEICMLPVGDGITLCRRIS  803
            GS+VAPPDAP+RKY++YYRDFV+E NK +  D R+EIC LPVGDGITLCRR++
Sbjct  194  GSMVAPPDAPLRKYVRYYRDFVVEFNKVIGDDVRVEICQLPVGDGITLCRRVT  246



>ref|NP_001056910.1| Os06g0165800 [Oryza sativa Japonica Group]
 dbj|BAA78733.1| putative caffeoyl-CoA O-methyltransferase [Oryza sativa Japonica 
Group]
 gb|AAT68022.1| caffeoyl-CoA O-methyltransferase [Oryza sativa Japonica Group]
 dbj|BAD67858.1| putative caffeoyl-CoA O-methyltransferase [Oryza sativa Japonica 
Group]
 dbj|BAF18824.1| Os06g0165800 [Oryza sativa Japonica Group]
 gb|EAZ35945.1| hypothetical protein OsJ_20249 [Oryza sativa Japonica Group]
Length=260

 Score =   427 bits (1098),  Expect = 7e-147, Method: Compositional matrix adjust.
 Identities = 201/236 (85%), Positives = 217/236 (92%), Gaps = 0/236 (0%)
 Frame = +3

Query  93   QTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEGQF  272
            Q TRH EVGHKSLL+SD LYQYILETSVYPRE E MKELREVTA HPWNLMTTSADEGQF
Sbjct  24   QKTRHSEVGHKSLLKSDDLYQYILETSVYPREHECMKELREVTANHPWNLMTTSADEGQF  83

Query  273  LSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAGVA  452
            L++LLKLI AK TMEIGVYTGYSLLATALA+PDDG ILAMDINRENYELGLP IEKAGVA
Sbjct  84   LNLLLKLIGAKKTMEIGVYTGYSLLATALAIPDDGTILAMDINRENYELGLPSIEKAGVA  143

Query  453  HKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIGYDN  632
            HKIDFREGPALP+LDQLVE+   HG++DF+FVDADKDNYLNYH+RL+ LVKVGG++GYDN
Sbjct  144  HKIDFREGPALPVLDQLVEEEGNHGSFDFVFVDADKDNYLNYHERLMKLVKVGGLVGYDN  203

Query  633  TLWNGSVVAPPDAPMRKYIKYYRDFVLELNKALAVDPRIEICMLPVGDGITLCRRI  800
            TLWNGSVV P DAPMRKYI+YYRDFVLELNKALA D R+EIC LPVGDGITLCRR+
Sbjct  204  TLWNGSVVLPADAPMRKYIRYYRDFVLELNKALAADHRVEICQLPVGDGITLCRRV  259



>sp|Q9SLP8.1|CAMT_CITNA RecName: Full=Caffeoyl-CoA O-methyltransferase; AltName: Full=Trans-caffeoyl-CoA 
3-O-methyltransferase; Short=CCoAMT; Short=CCoAOMT 
[Citrus natsudaidai]
 dbj|BAA88234.1| caffeoyl-CoA 3-O-methyltransferase [Citrus natsudaidai]
Length=232

 Score =   426 bits (1094),  Expect = 9e-147, Method: Compositional matrix adjust.
 Identities = 204/229 (89%), Positives = 216/229 (94%), Gaps = 0/229 (0%)
 Frame = +3

Query  117  GHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEGQFLSMLLKLI  296
            GHKS LQSDAL QYILETSVYPREPE+MKELREVTAKHPWNLM TSADEGQFL+M LKLI
Sbjct  4    GHKSKLQSDALRQYILETSVYPREPESMKELREVTAKHPWNLMRTSADEGQFLNMSLKLI  63

Query  297  NAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAGVAHKIDFREG  476
            NAKNTMEIGVYT YSLLATALA+PDDGKILAMDINRENYE+GLP IEKAGVAH+I FREG
Sbjct  64   NAKNTMEIGVYTDYSLLATALAIPDDGKILAMDINRENYEIGLPKIEKAGVAHRIQFREG  123

Query  477  PALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIGYDNTLWNGSVV  656
            PALP+LDQLVED K HGTYDFIFVDADKDNY+NYHKR+IDLVKVGG+IGYDNTLWNGSVV
Sbjct  124  PALPVLDQLVEDKKNHGTYDFIFVDADKDNYINYHKRIIDLVKVGGLIGYDNTLWNGSVV  183

Query  657  APPDAPMRKYIKYYRDFVLELNKALAVDPRIEICMLPVGDGITLCRRIS  803
             PPDAPMRKY++Y RDFVLEL KALAVDPRIEICMLPVGDGITL RRI+
Sbjct  184  GPPDAPMRKYLRYCRDFVLELIKALAVDPRIEICMLPVGDGITLSRRIT  232



>gb|EAY99818.1| hypothetical protein OsI_21809 [Oryza sativa Indica Group]
Length=260

 Score =   427 bits (1097),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 201/236 (85%), Positives = 217/236 (92%), Gaps = 0/236 (0%)
 Frame = +3

Query  93   QTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEGQF  272
            Q TRH EVGHKSLL+SD LYQYILETSVYPRE E MKELREVTA HPWNLMTTSADEGQF
Sbjct  24   QKTRHSEVGHKSLLKSDDLYQYILETSVYPREHECMKELREVTANHPWNLMTTSADEGQF  83

Query  273  LSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAGVA  452
            L++LLKLI AK TMEIGVYTGYSLLATALA+PDDG ILAMDINRENYELGLP IEKAGVA
Sbjct  84   LNLLLKLIGAKKTMEIGVYTGYSLLATALAIPDDGTILAMDINRENYELGLPSIEKAGVA  143

Query  453  HKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIGYDN  632
            HKIDFREGPALP+LDQLVE+   HG++DF+FVDADKDNYLNYH+RL+ LVKVGG++GYDN
Sbjct  144  HKIDFREGPALPVLDQLVEEEGNHGSFDFVFVDADKDNYLNYHERLMKLVKVGGLVGYDN  203

Query  633  TLWNGSVVAPPDAPMRKYIKYYRDFVLELNKALAVDPRIEICMLPVGDGITLCRRI  800
            TLWNGSVV P DAPMRKYI+YYRDFVLELNKALA D R+EIC LPVGDGITLCRR+
Sbjct  204  TLWNGSVVLPADAPMRKYIRYYRDFVLELNKALAADHRVEICQLPVGDGITLCRRV  259



>ref|XP_006655824.1| PREDICTED: caffeoyl-CoA O-methyltransferase 1-like [Oryza brachyantha]
Length=257

 Score =   426 bits (1095),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 201/236 (85%), Positives = 217/236 (92%), Gaps = 0/236 (0%)
 Frame = +3

Query  93   QTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEGQF  272
            Q TRH EVGHKSLL+SD LYQYILETSVYPRE E MKELREVTAKHPWNLMTTSADEGQF
Sbjct  21   QKTRHSEVGHKSLLKSDDLYQYILETSVYPREHECMKELREVTAKHPWNLMTTSADEGQF  80

Query  273  LSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAGVA  452
            L++LLKLI AK TMEIGVYTGYSLLATALA+PDDG ILAMDINRENYELGLP IEKAGVA
Sbjct  81   LNLLLKLIGAKKTMEIGVYTGYSLLATALAIPDDGTILAMDINRENYELGLPSIEKAGVA  140

Query  453  HKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIGYDN  632
            HKIDFREGPALP+LDQL+E+   HG +DF+FVDADKDNYLNYH+RL+ LVKVGG++GYDN
Sbjct  141  HKIDFREGPALPLLDQLLEEDANHGAFDFVFVDADKDNYLNYHERLLRLVKVGGLVGYDN  200

Query  633  TLWNGSVVAPPDAPMRKYIKYYRDFVLELNKALAVDPRIEICMLPVGDGITLCRRI  800
            TLWNGSVV P DAPMRKYI+YYRDFVLELNKALA D R+EIC LPVGDGITLCRR+
Sbjct  201  TLWNGSVVLPADAPMRKYIRYYRDFVLELNKALAADHRVEICQLPVGDGITLCRRV  256



>gb|AIN39535.1| caffeoyl-CoA-3-O-methyl transferase [Cenchrus purpureus]
Length=266

 Score =   426 bits (1094),  Expect = 4e-146, Method: Compositional matrix adjust.
 Identities = 199/236 (84%), Positives = 218/236 (92%), Gaps = 0/236 (0%)
 Frame = +3

Query  93   QTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEGQF  272
            Q TRH EVGHKSLL+SD LYQYIL+TSVYPREPE+MKELREVTAKHPWNLMTTSADEGQF
Sbjct  30   QKTRHSEVGHKSLLKSDDLYQYILDTSVYPREPESMKELREVTAKHPWNLMTTSADEGQF  89

Query  273  LSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAGVA  452
            L+ML+KLI AK TMEIGVYTGYSLLATALALP+DG ILAMDINRENYELGLP IEKAGVA
Sbjct  90   LNMLIKLIGAKKTMEIGVYTGYSLLATALALPEDGTILAMDINRENYELGLPCIEKAGVA  149

Query  453  HKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIGYDN  632
            HKIDFREGPALP+LD L+ D K HG++DF+FVDADKDNYLNYH+RL+ LVK+GG+IGYDN
Sbjct  150  HKIDFREGPALPVLDDLIADEKNHGSFDFVFVDADKDNYLNYHERLLKLVKMGGLIGYDN  209

Query  633  TLWNGSVVAPPDAPMRKYIKYYRDFVLELNKALAVDPRIEICMLPVGDGITLCRRI  800
            TLWNGSVV P DAPMRKYI+YYRDFVL LNKALA D R+EIC LPVGDG+TLCRR+
Sbjct  210  TLWNGSVVLPDDAPMRKYIRYYRDFVLVLNKALAADERVEICQLPVGDGVTLCRRV  265



>gb|ABM79759.1| caffeoyl-CoA O-methyltransferase [Vitis vinifera]
Length=218

 Score =   422 bits (1085),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 198/218 (91%), Positives = 215/218 (99%), Gaps = 0/218 (0%)
 Frame = +3

Query  132  LQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEGQFLSMLLKLINAKNT  311
            LQSDALYQYILETSVYPREPE+MKELRE+TA+HPWN+MTTSADEGQFL+MLLKLINAKNT
Sbjct  1    LQSDALYQYILETSVYPREPESMKELRELTAQHPWNIMTTSADEGQFLNMLLKLINAKNT  60

Query  312  MEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAGVAHKIDFREGPALPI  491
            MEIGVYTGYSLLATALALPDDGKILAMDIN+ENYELGLPVI+KAGVAHKIDF+EGPALP+
Sbjct  61   MEIGVYTGYSLLATALALPDDGKILAMDINKENYELGLPVIQKAGVAHKIDFKEGPALPV  120

Query  492  LDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIGYDNTLWNGSVVAPPDA  671
            LDQ++ED K HG++DFIFVDADKDNYLNYHKRLIDLVKVGG+IGYDNTLWNGSVVAPPDA
Sbjct  121  LDQMIEDGKYHGSFDFIFVDADKDNYLNYHKRLIDLVKVGGIIGYDNTLWNGSVVAPPDA  180

Query  672  PMRKYIKYYRDFVLELNKALAVDPRIEICMLPVGDGIT  785
            P+RKY++YYRDFVLELNKALA DPRIEICMLPVGDGIT
Sbjct  181  PLRKYVRYYRDFVLELNKALAADPRIEICMLPVGDGIT  218



>gb|ABQ45355.1| caffeoyl-CoA 3-O-methyltransferase [Amorpha fruticosa]
Length=223

 Score =   419 bits (1078),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 198/223 (89%), Positives = 215/223 (96%), Gaps = 0/223 (0%)
 Frame = +3

Query  135  QSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEGQFLSMLLKLINAKNTM  314
            QSDALYQYILE SVYPRE EAMKELRE+TAKHPWN+MTTSADEGQFL+ML+KLINAKNTM
Sbjct  1    QSDALYQYILEASVYPREHEAMKELRELTAKHPWNIMTTSADEGQFLNMLIKLINAKNTM  60

Query  315  EIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAGVAHKIDFREGPALPIL  494
            EIGVYTGYSLLATALALP+DGKILAMDINRENYELGLPVI+KAG+ HKI+FREGPALP+L
Sbjct  61   EIGVYTGYSLLATALALPEDGKILAMDINRENYELGLPVIKKAGLEHKIEFREGPALPVL  120

Query  495  DQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIGYDNTLWNGSVVAPPDAP  674
            D+LV+D K HG++DFIFVDADKDNYLNYHKRLIDLVKVGG+IGYDNTLWNGSVVAP DAP
Sbjct  121  DELVKDEKNHGSFDFIFVDADKDNYLNYHKRLIDLVKVGGLIGYDNTLWNGSVVAPHDAP  180

Query  675  MRKYIKYYRDFVLELNKALAVDPRIEICMLPVGDGITLCRRIS  803
            +RKY++YYRDFVLELNKAL VDPRIEICMLPVGDGITLCRRI 
Sbjct  181  LRKYVRYYRDFVLELNKALGVDPRIEICMLPVGDGITLCRRIK  223



>gb|ACX37697.1| caffeoyl-CoA O-methyltransferase 1 [Eucalyptus camaldulensis]
Length=232

 Score =   417 bits (1072),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 200/230 (87%), Positives = 215/230 (93%), Gaps = 1/230 (0%)
 Frame = +3

Query  114  VGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEGQFLSMLLKL  293
             G +S  Q+    +YILETSVYPREPE MKELRE+TAKHPWN+MTTSADEGQFL+MLLKL
Sbjct  4    AGEESQTQAGRHQEYILETSVYPREPEPMKELREITAKHPWNIMTTSADEGQFLNMLLKL  63

Query  294  INAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAGVAHKIDFRE  473
            INAKNTMEIGV+TGYSLLATALALPDDGKILAMDINRENYELGLPVI+KAGVA KIDFRE
Sbjct  64   INAKNTMEIGVFTGYSLLATALALPDDGKILAMDINRENYELGLPVIQKAGVADKIDFRE  123

Query  474  GPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIGYDNTLWNGSV  653
            GPALPILDQL+ED  K G +DFIFVDADKDNYLNYHKRLI+LVKVGG+IGYDNTLWNGSV
Sbjct  124  GPALPILDQLIED-GKQGAFDFIFVDADKDNYLNYHKRLIELVKVGGLIGYDNTLWNGSV  182

Query  654  VAPPDAPMRKYIKYYRDFVLELNKALAVDPRIEICMLPVGDGITLCRRIS  803
            VAPPDAP+RKY++YYRDFVLELNKALA DPRIEICMLPVGDGITLCRRIS
Sbjct  183  VAPPDAPLRKYVRYYRDFVLELNKALAADPRIEICMLPVGDGITLCRRIS  232



>gb|AAP37885.1| caffeoyl CoA 3-O-methyltransferase [Zea mays]
 gb|AAP37886.1| caffeoyl CoA 3-O-methyltransferase [Zea mays]
Length=266

 Score =   416 bits (1068),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 193/236 (82%), Positives = 216/236 (92%), Gaps = 0/236 (0%)
 Frame = +3

Query  93   QTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEGQF  272
            Q TRH EVGHKSLL+SD LYQYIL+TSVYPREPE+MKELRE+TAKHPWNLMTTSADEGQF
Sbjct  30   QKTRHSEVGHKSLLKSDDLYQYILDTSVYPREPESMKELREITAKHPWNLMTTSADEGQF  89

Query  273  LSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAGVA  452
            L+ML+KLI AK TMEIGVYTGYSLLATALALP+DG ILAMDINRENYELGLP I+KAGVA
Sbjct  90   LNMLIKLIGAKKTMEIGVYTGYSLLATALALPEDGTILAMDINRENYELGLPCIDKAGVA  149

Query  453  HKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIGYDN  632
            HKIDFREGPALP+LD LV D ++HG++DF FVDADKDNYL+YH+RL+ LV+ GG+IGYDN
Sbjct  150  HKIDFREGPALPVLDDLVADKEQHGSFDFAFVDADKDNYLSYHERLLKLVRPGGLIGYDN  209

Query  633  TLWNGSVVAPPDAPMRKYIKYYRDFVLELNKALAVDPRIEICMLPVGDGITLCRRI  800
            TLWNGSVV P DAPMRKYI++YRDFVL LN ALA D R+EIC LPVGDG+TLCRR+
Sbjct  210  TLWNGSVVLPDDAPMRKYIRFYRDFVLALNSALAADDRVEICQLPVGDGVTLCRRV  265



>gb|AAP37884.1| caffeoyl CoA 3-O-methyltransferase [Zea mays]
Length=266

 Score =   415 bits (1067),  Expect = 4e-142, Method: Compositional matrix adjust.
 Identities = 193/236 (82%), Positives = 215/236 (91%), Gaps = 0/236 (0%)
 Frame = +3

Query  93   QTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEGQF  272
            Q TRH EVGHKSLL+SD LYQYIL+TSVYPREPE+MKELRE+TAKHPWNLMTTSADEGQF
Sbjct  30   QKTRHSEVGHKSLLKSDDLYQYILDTSVYPREPESMKELREITAKHPWNLMTTSADEGQF  89

Query  273  LSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAGVA  452
            L+ML+KLI AK TMEIGVYTGYSLLATALALP+DG ILAMDINRENYELGLP I KAGVA
Sbjct  90   LNMLIKLIGAKKTMEIGVYTGYSLLATALALPEDGTILAMDINRENYELGLPCINKAGVA  149

Query  453  HKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIGYDN  632
            HKIDFREGPALP+LD LV D ++HG++DF FVDADKDNYL+YH+RL+ LV+ GG+IGYDN
Sbjct  150  HKIDFREGPALPVLDDLVADKEQHGSFDFAFVDADKDNYLSYHERLLKLVRPGGLIGYDN  209

Query  633  TLWNGSVVAPPDAPMRKYIKYYRDFVLELNKALAVDPRIEICMLPVGDGITLCRRI  800
            TLWNGSVV P DAPMRKYI++YRDFVL LN ALA D R+EIC LPVGDG+TLCRR+
Sbjct  210  TLWNGSVVLPDDAPMRKYIRFYRDFVLALNSALAADDRVEICQLPVGDGVTLCRRV  265



>sp|Q9XGD5.1|CAMT2_MAIZE RecName: Full=Caffeoyl-CoA O-methyltransferase 2; AltName: Full=Trans-caffeoyl-CoA 
3-O-methyltransferase 2; Short=CCoAMT-2; 
Short=CCoAOMT-2 [Zea mays]
 emb|CAB45150.1| Caffeoyl CoA O-methyltransferase [Zea mays]
 gb|AAP33130.1| caffeoyl CoA 3-O-methyltransferase [Zea mays]
 gb|AAP37894.1| caffeoyl CoA 3-O-methyltransferase [Zea mays]
 gb|AAP37896.1| caffeoyl CoA 3-O-methyltransferase [Zea mays]
 gb|AAP37904.1| caffeoyl CoA 3-O-methyltransferase [Zea mays]
Length=264

 Score =   415 bits (1066),  Expect = 6e-142, Method: Compositional matrix adjust.
 Identities = 193/236 (82%), Positives = 214/236 (91%), Gaps = 0/236 (0%)
 Frame = +3

Query  93   QTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEGQF  272
            Q TRH EVGHKSLL+SD LYQYIL+TSVYPREPE+MKELRE+TAKHPWNLMTTSADEGQF
Sbjct  28   QKTRHSEVGHKSLLKSDDLYQYILDTSVYPREPESMKELREITAKHPWNLMTTSADEGQF  87

Query  273  LSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAGVA  452
            L+ML+KLI AK TMEIGVYTGYSLLATALALP+DG ILAMDINRENYELGLP I KAGV 
Sbjct  88   LNMLIKLIGAKKTMEIGVYTGYSLLATALALPEDGTILAMDINRENYELGLPCINKAGVG  147

Query  453  HKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIGYDN  632
            HKIDFREGPALP+LD LV D ++HG++DF FVDADKDNYLNYH+RL+ LV+ GG+IGYDN
Sbjct  148  HKIDFREGPALPVLDDLVADKEQHGSFDFAFVDADKDNYLNYHERLLKLVRPGGLIGYDN  207

Query  633  TLWNGSVVAPPDAPMRKYIKYYRDFVLELNKALAVDPRIEICMLPVGDGITLCRRI  800
            TLWNGSVV P DAPMRKYI++YRDFVL LN ALA D R+EIC LPVGDG+TLCRR+
Sbjct  208  TLWNGSVVLPDDAPMRKYIRFYRDFVLALNSALAADDRVEICQLPVGDGVTLCRRV  263



>gb|EMS59880.1| Caffeoyl-CoA O-methyltransferase 2 [Triticum urartu]
Length=284

 Score =   415 bits (1067),  Expect = 8e-142, Method: Compositional matrix adjust.
 Identities = 202/265 (76%), Positives = 218/265 (82%), Gaps = 25/265 (9%)
 Frame = +3

Query  78   AMAENQTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSA  257
            A    Q TRH EVGHKSLLQSDALYQYILETSVYPRE E MKELRE+TA HPWNLMTTSA
Sbjct  18   ANGSEQVTRHSEVGHKSLLQSDALYQYILETSVYPREHECMKELREITANHPWNLMTTSA  77

Query  258  DEGQFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDG--------------------  377
            DEGQFL+MLLKLI AK TMEIGVYTGYSLLATALA+PDDG                    
Sbjct  78   DEGQFLNMLLKLIGAKKTMEIGVYTGYSLLATALAIPDDGTVSSLTSPLPDPPLPIHQET  137

Query  378  -----KILAMDINRENYELGLPVIEKAGVAHKIDFREGPALPILDQLVEDPKKHGTYDFI  542
                 +ILAMDINRENYELGLP IEKAGVAHKIDFREGPALP+LD L+ED   HGT+DF+
Sbjct  138  ETGMKQILAMDINRENYELGLPCIEKAGVAHKIDFREGPALPVLDALLEDEANHGTFDFV  197

Query  543  FVDADKDNYLNYHKRLIDLVKVGGVIGYDNTLWNGSVVAPPDAPMRKYIKYYRDFVLELN  722
            FVDADKDNYLNYH+RL+ LVK+GG++GYDNTLWNGSVV P DAPMRKYI+YYRDFVL+LN
Sbjct  198  FVDADKDNYLNYHERLMKLVKLGGLLGYDNTLWNGSVVLPADAPMRKYIRYYRDFVLDLN  257

Query  723  KALAVDPRIEICMLPVGDGITLCRR  797
            KALA D R+EIC LPVGDGITLCRR
Sbjct  258  KALAADQRVEICQLPVGDGITLCRR  282



>gb|KHN42093.1| Caffeoyl-CoA O-methyltransferase 2 [Glycine soja]
Length=249

 Score =   413 bits (1062),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 193/237 (81%), Positives = 216/237 (91%), Gaps = 0/237 (0%)
 Frame = +3

Query  90   NQTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEGQ  269
            NQ   H+E+ HKSLLQSDALYQYILETSVYPRE E++KELRE+T KHPWNLM T  DEGQ
Sbjct  12   NQIAGHKELAHKSLLQSDALYQYILETSVYPREHESLKELRELTEKHPWNLMATPPDEGQ  71

Query  270  FLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAGV  449
             L MLLKLINAKNTMEIGV+TGYSLL+TALALP DGKILAMD+NRE YELGLPVI+KAGV
Sbjct  72   LLGMLLKLINAKNTMEIGVFTGYSLLSTALALPSDGKILAMDVNREYYELGLPVIQKAGV  131

Query  450  AHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIGYD  629
            AHKIDFREGPALP+LDQL++D K  G +DFI+VDADKDNYLNYHKR+I+LVKVGG++GYD
Sbjct  132  AHKIDFREGPALPLLDQLIKDEKNKGAFDFIYVDADKDNYLNYHKRVIELVKVGGLVGYD  191

Query  630  NTLWNGSVVAPPDAPMRKYIKYYRDFVLELNKALAVDPRIEICMLPVGDGITLCRRI  800
            NTLWNGSVVAPPDAP+  Y+KYYRDFV+ELNKALA+D R+EIC LPVGDGITLCRRI
Sbjct  192  NTLWNGSVVAPPDAPLMDYVKYYRDFVMELNKALALDSRVEICQLPVGDGITLCRRI  248



>gb|KHN36241.1| Caffeoyl-CoA O-methyltransferase 2 [Glycine soja]
Length=248

 Score =   413 bits (1061),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 194/237 (82%), Positives = 216/237 (91%), Gaps = 0/237 (0%)
 Frame = +3

Query  90   NQTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEGQ  269
            NQ   H+E+GHKSLLQSDALYQYILETSVYPRE E++KELRE+T KHPWNLM T  DEGQ
Sbjct  11   NQIAGHKELGHKSLLQSDALYQYILETSVYPREHESLKELRELTEKHPWNLMATPPDEGQ  70

Query  270  FLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAGV  449
             L MLLKLINAKNTMEIGV+TGYSLL+TALALP DGKILAMD+NRE YELGLPVIEKAGV
Sbjct  71   LLGMLLKLINAKNTMEIGVFTGYSLLSTALALPSDGKILAMDVNREYYELGLPVIEKAGV  130

Query  450  AHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIGYD  629
            AHKIDFREGPALP+LD L++D K  G +DFI+VDADKDNYLNYHKR+I+LVK+GG+IGYD
Sbjct  131  AHKIDFREGPALPLLDVLIKDEKNKGAFDFIYVDADKDNYLNYHKRVIELVKLGGLIGYD  190

Query  630  NTLWNGSVVAPPDAPMRKYIKYYRDFVLELNKALAVDPRIEICMLPVGDGITLCRRI  800
            NTLWNGSVVAPPDAP+  Y+KYYRDFV+ELNKALA+D R+EIC LPVGDGITLCRRI
Sbjct  191  NTLWNGSVVAPPDAPLMDYVKYYRDFVMELNKALALDSRVEICQLPVGDGITLCRRI  247



>gb|AAP37876.1| caffeoyl CoA 3-O-methyltransferase [Zea mays]
 gb|AAP37877.1| caffeoyl CoA 3-O-methyltransferase [Zea mays]
 gb|AAP37887.1| caffeoyl CoA 3-O-methyltransferase [Zea mays]
 gb|AAP37888.1| caffeoyl CoA 3-O-methyltransferase [Zea mays]
 gb|AAP37889.1| caffeoyl CoA 3-O-methyltransferase [Zea mays]
 gb|AAP37890.1| caffeoyl CoA 3-O-methyltransferase [Zea mays]
 gb|AAP37892.1| caffeoyl CoA 3-O-methyltransferase [Zea mays]
 gb|AAP37895.1| caffeoyl CoA 3-O-methyltransferase [Zea mays]
 gb|AAP37897.1| caffeoyl CoA 3-O-methyltransferase [Zea mays]
 gb|ACF79475.1| unknown [Zea mays]
 gb|ACF85778.1| unknown [Zea mays]
 gb|AFW85676.1| caffeoyl-CoA O-methyltransferase 2 [Zea mays]
Length=263

 Score =   413 bits (1062),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 192/236 (81%), Positives = 214/236 (91%), Gaps = 0/236 (0%)
 Frame = +3

Query  93   QTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEGQF  272
            Q TRH EVGHKSLL+SD LYQYIL+TSVYPREPE+MKELRE+TAKHPWNLMTTSADEGQF
Sbjct  27   QKTRHSEVGHKSLLKSDDLYQYILDTSVYPREPESMKELREITAKHPWNLMTTSADEGQF  86

Query  273  LSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAGVA  452
            L+ML+KLI AK TMEIGVYTGYSLLATALALP+DG ILAMDINRENYELGLP I KAGV 
Sbjct  87   LNMLIKLIGAKKTMEIGVYTGYSLLATALALPEDGTILAMDINRENYELGLPCINKAGVG  146

Query  453  HKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIGYDN  632
            HKIDFREGPALP+LD LV D ++HG++DF FVDADKDNYL+YH+RL+ LV+ GG+IGYDN
Sbjct  147  HKIDFREGPALPVLDDLVADKEQHGSFDFAFVDADKDNYLSYHERLLKLVRPGGLIGYDN  206

Query  633  TLWNGSVVAPPDAPMRKYIKYYRDFVLELNKALAVDPRIEICMLPVGDGITLCRRI  800
            TLWNGSVV P DAPMRKYI++YRDFVL LN ALA D R+EIC LPVGDG+TLCRR+
Sbjct  207  TLWNGSVVLPDDAPMRKYIRFYRDFVLALNSALAADDRVEICQLPVGDGVTLCRRV  262



>gb|AAP37881.1| caffeoyl CoA 3-O-methyltransferase [Zea mays]
 gb|AAP37891.1| caffeoyl CoA 3-O-methyltransferase [Zea mays]
Length=264

 Score =   413 bits (1062),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 192/236 (81%), Positives = 214/236 (91%), Gaps = 0/236 (0%)
 Frame = +3

Query  93   QTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEGQF  272
            Q TRH EVGHKSLL+SD LYQYIL+TSVYPREPE+MKELRE+TAKHPWNLMTTSADEGQF
Sbjct  28   QKTRHSEVGHKSLLKSDDLYQYILDTSVYPREPESMKELREITAKHPWNLMTTSADEGQF  87

Query  273  LSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAGVA  452
            L+ML+KLI AK TMEIGVYTGYSLLATALALP+DG ILAMDINRENYELGLP I KAGV 
Sbjct  88   LNMLIKLIGAKKTMEIGVYTGYSLLATALALPEDGTILAMDINRENYELGLPCINKAGVG  147

Query  453  HKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIGYDN  632
            HKIDFREGPALP+LD LV D ++HG++DF FVDADKDNYL+YH+RL+ LV+ GG+IGYDN
Sbjct  148  HKIDFREGPALPVLDDLVADKEQHGSFDFAFVDADKDNYLSYHERLLKLVRPGGLIGYDN  207

Query  633  TLWNGSVVAPPDAPMRKYIKYYRDFVLELNKALAVDPRIEICMLPVGDGITLCRRI  800
            TLWNGSVV P DAPMRKYI++YRDFVL LN ALA D R+EIC LPVGDG+TLCRR+
Sbjct  208  TLWNGSVVLPDDAPMRKYIRFYRDFVLALNSALAADDRVEICQLPVGDGVTLCRRV  263



>gb|AAP37882.1| caffeoyl CoA 3-O-methyltransferase [Zea mays]
 gb|AAP37883.1| caffeoyl CoA 3-O-methyltransferase [Zea mays]
 gb|AAP37893.1| caffeoyl CoA 3-O-methyltransferase [Zea mays]
 gb|AAP37898.1| caffeoyl CoA 3-O-methyltransferase [Zea mays]
 gb|AAP37899.1| caffeoyl CoA 3-O-methyltransferase [Zea mays]
 gb|AAP37900.1| caffeoyl CoA 3-O-methyltransferase [Zea mays]
 gb|AAP37901.1| caffeoyl CoA 3-O-methyltransferase [Zea mays]
 gb|AAP37902.1| caffeoyl CoA 3-O-methyltransferase [Zea mays]
 gb|AAP37903.1| caffeoyl CoA 3-O-methyltransferase [Zea mays]
 gb|AAP37905.1| caffeoyl CoA 3-O-methyltransferase [Zea mays]
Length=266

 Score =   413 bits (1062),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 192/236 (81%), Positives = 214/236 (91%), Gaps = 0/236 (0%)
 Frame = +3

Query  93   QTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEGQF  272
            Q TRH EVGHKSLL+SD LYQYIL+TSVYPREPE+MKELRE+TAKHPWNLMTTSADEGQF
Sbjct  30   QKTRHSEVGHKSLLKSDDLYQYILDTSVYPREPESMKELREITAKHPWNLMTTSADEGQF  89

Query  273  LSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAGVA  452
            L+ML+KLI AK TMEIGVYTGYSLLATALALP+DG ILAMDINRENYELGLP I KAGV 
Sbjct  90   LNMLIKLIGAKKTMEIGVYTGYSLLATALALPEDGTILAMDINRENYELGLPCINKAGVG  149

Query  453  HKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIGYDN  632
            HKIDFREGPALP+LD LV D ++HG++DF FVDADKDNYL+YH+RL+ LV+ GG+IGYDN
Sbjct  150  HKIDFREGPALPVLDDLVADKEQHGSFDFAFVDADKDNYLSYHERLLKLVRPGGLIGYDN  209

Query  633  TLWNGSVVAPPDAPMRKYIKYYRDFVLELNKALAVDPRIEICMLPVGDGITLCRRI  800
            TLWNGSVV P DAPMRKYI++YRDFVL LN ALA D R+EIC LPVGDG+TLCRR+
Sbjct  210  TLWNGSVVLPDDAPMRKYIRFYRDFVLALNSALAADDRVEICQLPVGDGVTLCRRV  265



>gb|AAP37879.1| caffeoyl CoA 3-O-methyltransferase [Zea mays]
Length=267

 Score =   413 bits (1062),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 192/236 (81%), Positives = 214/236 (91%), Gaps = 0/236 (0%)
 Frame = +3

Query  93   QTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEGQF  272
            Q TRH EVGHKSLL+SD LYQYIL+TSVYPREPE+MKELRE+TAKHPWNLMTTSADEGQF
Sbjct  31   QKTRHSEVGHKSLLKSDDLYQYILDTSVYPREPESMKELREITAKHPWNLMTTSADEGQF  90

Query  273  LSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAGVA  452
            L+ML+KLI AK TMEIGVYTGYSLLATALALP+DG ILAMDINRENYELGLP I KAGV 
Sbjct  91   LNMLIKLIGAKKTMEIGVYTGYSLLATALALPEDGTILAMDINRENYELGLPCINKAGVG  150

Query  453  HKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIGYDN  632
            HKIDFREGPALP+LD LV D ++HG++DF FVDADKDNYL+YH+RL+ LV+ GG+IGYDN
Sbjct  151  HKIDFREGPALPVLDDLVADKEQHGSFDFAFVDADKDNYLSYHERLLKLVRPGGLIGYDN  210

Query  633  TLWNGSVVAPPDAPMRKYIKYYRDFVLELNKALAVDPRIEICMLPVGDGITLCRRI  800
            TLWNGSVV P DAPMRKYI++YRDFVL LN ALA D R+EIC LPVGDG+TLCRR+
Sbjct  211  TLWNGSVVLPDDAPMRKYIRFYRDFVLALNSALAADDRVEICQLPVGDGVTLCRRV  266



>gb|AAP37878.1| caffeoyl CoA 3-O-methyltransferase [Zea mays]
 gb|AAP37880.1| caffeoyl CoA 3-O-methyltransferase [Zea mays]
Length=266

 Score =   413 bits (1061),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 192/236 (81%), Positives = 214/236 (91%), Gaps = 0/236 (0%)
 Frame = +3

Query  93   QTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEGQF  272
            Q TRH EVGHKSLL+SD LYQYIL+TSVYPREPE+MKELRE+TAKHPWNLMTTSADEGQF
Sbjct  30   QKTRHSEVGHKSLLKSDDLYQYILDTSVYPREPESMKELREITAKHPWNLMTTSADEGQF  89

Query  273  LSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAGVA  452
            L+ML+KLI AK TMEIGVYTGYSLLATALALP+DG ILAMDINRENYELGLP I KAGV 
Sbjct  90   LNMLIKLIGAKKTMEIGVYTGYSLLATALALPEDGTILAMDINRENYELGLPCINKAGVG  149

Query  453  HKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIGYDN  632
            HKIDFREGPALP+LD LV D ++HG++DF FVDADKDNYL+YH+RL+ LV+ GG+IGYDN
Sbjct  150  HKIDFREGPALPVLDDLVADKEQHGSFDFAFVDADKDNYLSYHERLLKLVRPGGLIGYDN  209

Query  633  TLWNGSVVAPPDAPMRKYIKYYRDFVLELNKALAVDPRIEICMLPVGDGITLCRRI  800
            TLWNGSVV P DAPMRKYI++YRDFVL LN ALA D R+EIC LPVGDG+TLCRR+
Sbjct  210  TLWNGSVVLPDDAPMRKYIRFYRDFVLALNSALAADDRVEICQLPVGDGVTLCRRV  265



>gb|ACF79629.1| unknown [Zea mays]
Length=402

 Score =   417 bits (1073),  Expect = 5e-141, Method: Compositional matrix adjust.
 Identities = 192/236 (81%), Positives = 214/236 (91%), Gaps = 0/236 (0%)
 Frame = +3

Query  93   QTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEGQF  272
            Q TRH EVGHKSLL+SD LYQYIL+TSVYPREPE+MKELRE+TAKHPWNLMTTSADEGQF
Sbjct  166  QKTRHSEVGHKSLLKSDDLYQYILDTSVYPREPESMKELREITAKHPWNLMTTSADEGQF  225

Query  273  LSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAGVA  452
            L+ML+KLI AK TMEIGVYTGYSLLATALALP+DG ILAMDINRENYELGLP I KAGV 
Sbjct  226  LNMLIKLIGAKKTMEIGVYTGYSLLATALALPEDGTILAMDINRENYELGLPCINKAGVG  285

Query  453  HKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIGYDN  632
            HKIDFREGPALP+LD LV D ++HG++DF FVDADKDNYL+YH+RL+ LV+ GG+IGYDN
Sbjct  286  HKIDFREGPALPVLDDLVADKEQHGSFDFAFVDADKDNYLSYHERLLKLVRPGGLIGYDN  345

Query  633  TLWNGSVVAPPDAPMRKYIKYYRDFVLELNKALAVDPRIEICMLPVGDGITLCRRI  800
            TLWNGSVV P DAPMRKYI++YRDFVL LN ALA D R+EIC LPVGDG+TLCRR+
Sbjct  346  TLWNGSVVLPDDAPMRKYIRFYRDFVLALNSALAADDRVEICQLPVGDGVTLCRRV  401



>ref|XP_007156786.1| hypothetical protein PHAVU_002G017500g [Phaseolus vulgaris]
 gb|ESW28780.1| hypothetical protein PHAVU_002G017500g [Phaseolus vulgaris]
Length=248

 Score =   411 bits (1056),  Expect = 9e-141, Method: Compositional matrix adjust.
 Identities = 194/238 (82%), Positives = 216/238 (91%), Gaps = 0/238 (0%)
 Frame = +3

Query  87   ENQTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEG  266
            +NQ   H+++ HKSLLQSDALYQYILETSVYPRE E++KELRE+T KHPWNL+ T  DEG
Sbjct  10   QNQMAGHKQLRHKSLLQSDALYQYILETSVYPREHESLKELRELTEKHPWNLLATPPDEG  69

Query  267  QFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAG  446
            Q L MLLKLINAKNTMEIGVYTGYSLL+TALALP DGKILA+DINRE YELGLPVIEKAG
Sbjct  70   QLLGMLLKLINAKNTMEIGVYTGYSLLSTALALPSDGKILALDINREYYELGLPVIEKAG  129

Query  447  VAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIGY  626
            VAHKIDFREGPALP+LDQL+++ K  GT+DFIFVDADKDNYLNYH R+I+LVKVGG+I Y
Sbjct  130  VAHKIDFREGPALPLLDQLIKEEKNKGTFDFIFVDADKDNYLNYHNRVIELVKVGGMIAY  189

Query  627  DNTLWNGSVVAPPDAPMRKYIKYYRDFVLELNKALAVDPRIEICMLPVGDGITLCRRI  800
            DNTLWNGSVVAPPDAP+  YIKYYRDFV+ELN+ALAVD R+EIC LPVGDGITLCRRI
Sbjct  190  DNTLWNGSVVAPPDAPLLDYIKYYRDFVIELNQALAVDSRVEICQLPVGDGITLCRRI  247



>ref|XP_002523618.1| o-methyltransferase, putative [Ricinus communis]
 gb|EEF38813.1| o-methyltransferase, putative [Ricinus communis]
Length=309

 Score =   413 bits (1061),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 192/245 (78%), Positives = 221/245 (90%), Gaps = 1/245 (0%)
 Frame = +3

Query  69   KFKAMAENQTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMT  248
            K +++ ++++ + + V  K L  +   Y+YIL+TSVYP EPE MKELRE+TA H WN+MT
Sbjct  66   KLRSLNQHKSKKTKLVDIKKL-DTRVFYRYILQTSVYPGEPEPMKELRELTATHKWNIMT  124

Query  249  TSADEGQFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLP  428
            TSADEGQFLSMLLKLINAKNTMEIGVYTGYSLLATALALP+DGKILAMDINRENYELGLP
Sbjct  125  TSADEGQFLSMLLKLINAKNTMEIGVYTGYSLLATALALPEDGKILAMDINRENYELGLP  184

Query  429  VIEKAGVAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKV  608
            VI+KAGVAHKIDFREGPALP+LDQL++D K HGT+DFIFVDADKDNYLNYHKR I+LVKV
Sbjct  185  VIKKAGVAHKIDFREGPALPVLDQLIQDGKHHGTFDFIFVDADKDNYLNYHKRTIELVKV  244

Query  609  GGVIGYDNTLWNGSVVAPPDAPMRKYIKYYRDFVLELNKALAVDPRIEICMLPVGDGITL  788
            GGVIGYDNTLWNGSV APPDAPMRKY+++YRD+V+E NKA+A DPR+EIC LP+GDGITL
Sbjct  245  GGVIGYDNTLWNGSVAAPPDAPMRKYVRFYRDYVMEFNKAIAADPRVEICQLPIGDGITL  304

Query  789  CRRIS  803
            CRRIS
Sbjct  305  CRRIS  309



>ref|XP_003564267.1| PREDICTED: caffeoyl-CoA O-methyltransferase 1 [Brachypodium distachyon]
Length=262

 Score =   411 bits (1056),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 203/236 (86%), Positives = 217/236 (92%), Gaps = 0/236 (0%)
 Frame = +3

Query  93   QTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEGQF  272
            Q TRH EVGHKSLLQSDALYQYILETSVYPRE E MKELREVTA HPWNLMTTSADEGQF
Sbjct  26   QKTRHSEVGHKSLLQSDALYQYILETSVYPREHECMKELREVTANHPWNLMTTSADEGQF  85

Query  273  LSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAGVA  452
            L+MLLKLI AK TMEIGVYTGYSLLATALALP DG ILAMDINRENYELGLP IEKAGVA
Sbjct  86   LNMLLKLIGAKKTMEIGVYTGYSLLATALALPADGTILAMDINRENYELGLPCIEKAGVA  145

Query  453  HKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIGYDN  632
            HKIDFREGPALP+LD L+ED + HG++DF+FVDADKDNYLNYH+RL+ LVKVGG++GYDN
Sbjct  146  HKIDFREGPALPVLDALLEDERNHGSFDFVFVDADKDNYLNYHERLMRLVKVGGLLGYDN  205

Query  633  TLWNGSVVAPPDAPMRKYIKYYRDFVLELNKALAVDPRIEICMLPVGDGITLCRRI  800
            TLWNGSVV P DAPMRKYI+YYRDFVLELNKALA D R+EIC LPVGDGITLCRR+
Sbjct  206  TLWNGSVVLPADAPMRKYIRYYRDFVLELNKALAADLRVEICQLPVGDGITLCRRV  261



>dbj|BAO20881.1| caffeoyl CoA O-methyltransferase 1 [Panicum virgatum]
Length=257

 Score =   410 bits (1055),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 199/236 (84%), Positives = 218/236 (92%), Gaps = 0/236 (0%)
 Frame = +3

Query  93   QTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEGQF  272
            Q TRH EVGHKSLL+SD LYQYIL+TSVYPREPE+MKELRE+TAKHPWNLMTTSADEGQF
Sbjct  21   QKTRHSEVGHKSLLKSDDLYQYILDTSVYPREPESMKELREITAKHPWNLMTTSADEGQF  80

Query  273  LSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAGVA  452
            L+ML+KLI AK TMEIGVYTGYSLLATALALP+DG ILAMDINRENYELGLP IEKAGVA
Sbjct  81   LNMLIKLIGAKKTMEIGVYTGYSLLATALALPEDGTILAMDINRENYELGLPCIEKAGVA  140

Query  453  HKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIGYDN  632
            HKIDFREGPALP+LD L+ D K HGT+DF+FVDADKDNYLNYH+RL+ LVK+GG+IGYDN
Sbjct  141  HKIDFREGPALPVLDDLIADEKNHGTFDFVFVDADKDNYLNYHERLLKLVKLGGLIGYDN  200

Query  633  TLWNGSVVAPPDAPMRKYIKYYRDFVLELNKALAVDPRIEICMLPVGDGITLCRRI  800
            TLWNGSVV P DAPMRKYI+YYRDFVL LNKALA D R+EIC LPVGDG+TLCRR+
Sbjct  201  TLWNGSVVLPDDAPMRKYIRYYRDFVLVLNKALAADERVEICQLPVGDGVTLCRRV  256



>gb|AAP33129.1| caffeoyl CoA 3-O-methyltransferase [Zea mays]
Length=267

 Score =   410 bits (1055),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 191/236 (81%), Positives = 213/236 (90%), Gaps = 0/236 (0%)
 Frame = +3

Query  93   QTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEGQF  272
            Q TRH EVG KSLL+SD LYQYIL+TSVYPREPE+MKELRE+TAKHPWNLMTTSADEGQF
Sbjct  31   QKTRHSEVGRKSLLKSDDLYQYILDTSVYPREPESMKELREITAKHPWNLMTTSADEGQF  90

Query  273  LSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAGVA  452
            L+ML+KLI AK TMEIGVYTGYSLLATALALP+DG ILAMDINRENYELGLP I KAGV 
Sbjct  91   LNMLIKLIGAKKTMEIGVYTGYSLLATALALPEDGTILAMDINRENYELGLPCINKAGVG  150

Query  453  HKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIGYDN  632
            HKIDFREGPALP+LD LV D ++HG++DF FVDADKDNYL+YH+RL+ LV+ GG+IGYDN
Sbjct  151  HKIDFREGPALPVLDDLVADKEQHGSFDFAFVDADKDNYLSYHERLLKLVRPGGLIGYDN  210

Query  633  TLWNGSVVAPPDAPMRKYIKYYRDFVLELNKALAVDPRIEICMLPVGDGITLCRRI  800
            TLWNGSVV P DAPMRKYI++YRDFVL LN ALA D R+EIC LPVGDG+TLCRR+
Sbjct  211  TLWNGSVVLPDDAPMRKYIRFYRDFVLALNSALAADDRVEICQLPVGDGVTLCRRV  266



>ref|XP_009764364.1| PREDICTED: caffeoyl-CoA O-methyltransferase 3-like [Nicotiana 
sylvestris]
Length=244

 Score =   409 bits (1052),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 192/240 (80%), Positives = 214/240 (89%), Gaps = 0/240 (0%)
 Frame = +3

Query  84   AENQTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADE  263
             ENQ  RHQEVGHKSLLQSDALYQYIL+TSVYP+EPE MKELRE+TAKHPWN+MTTSADE
Sbjct  5    GENQNGRHQEVGHKSLLQSDALYQYILDTSVYPKEPEPMKELREITAKHPWNIMTTSADE  64

Query  264  GQFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKA  443
            GQFLSMLLKLINAKNTMEIGV+ GY LLAT +ALPDDGKILAM+INRENYE+GLPVIEK 
Sbjct  65   GQFLSMLLKLINAKNTMEIGVFIGYYLLATTMALPDDGKILAMNINRENYEIGLPVIEKV  124

Query  444  GVAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIG  623
            G+AHKI+F+EG ALP+LDQ++ED K H TYDFIFVDA K+NYLNYHK LIDLVK+GG+IG
Sbjct  125  GLAHKIEFKEGHALPVLDQMLEDGKYHETYDFIFVDAGKENYLNYHKILIDLVKIGGLIG  184

Query  624  YDNTLWNGSVVAPPDAPMRKYIKYYRDFVLELNKALAVDPRIEICMLPVGDGITLCRRIS  803
            Y+NTLWNGSVVAP   P+RKY++YYRDF+LE NKAL  DPRIEIC L VGDGIT C  I 
Sbjct  185  YNNTLWNGSVVAPSYVPLRKYVRYYRDFLLEPNKALVADPRIEICQLSVGDGITFCHHIG  244



>ref|XP_002436550.1| hypothetical protein SORBIDRAFT_10g004540 [Sorghum bicolor]
 gb|EER87917.1| hypothetical protein SORBIDRAFT_10g004540 [Sorghum bicolor]
Length=261

 Score =   408 bits (1049),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 197/236 (83%), Positives = 217/236 (92%), Gaps = 0/236 (0%)
 Frame = +3

Query  93   QTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEGQF  272
            Q TRH EVGHKSLL+SD LYQYIL+TSVYPREPE+MKELRE+TAKHPWNLMTTSADEGQF
Sbjct  25   QKTRHSEVGHKSLLKSDDLYQYILDTSVYPREPESMKELREITAKHPWNLMTTSADEGQF  84

Query  273  LSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAGVA  452
            L+ML+KLI AK TMEIGVYTGYSLLATALALP+DG ILAMDINRENYELGLP IEKAGVA
Sbjct  85   LNMLIKLIGAKKTMEIGVYTGYSLLATALALPEDGTILAMDINRENYELGLPCIEKAGVA  144

Query  453  HKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIGYDN  632
            HKIDFREGPALP+LD L+ D K HG++DF+FVDADKDNYLNYH RL+ LVK+GG+IGYDN
Sbjct  145  HKIDFREGPALPVLDDLIADEKNHGSFDFVFVDADKDNYLNYHDRLLKLVKLGGLIGYDN  204

Query  633  TLWNGSVVAPPDAPMRKYIKYYRDFVLELNKALAVDPRIEICMLPVGDGITLCRRI  800
            TLWNGSVV P DAPMRKYI++YRDFVL LNKALA D R+EIC LPVGDG+TLCRR+
Sbjct  205  TLWNGSVVLPDDAPMRKYIRFYRDFVLVLNKALAADERVEICQLPVGDGVTLCRRV  260



>gb|AHX74224.1| caffeoyl-CoA O-methyltransferase [Pinus taeda]
Length=261

 Score =   408 bits (1049),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 191/243 (79%), Positives = 217/243 (89%), Gaps = 2/243 (1%)
 Frame = +3

Query  72   FKAMAENQTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTT  251
            FK MA       +     +  Q++   +YILETSVYPREPE MKELREVTAKHPWNLMTT
Sbjct  20   FKEMAGTSVAAAEVKAQTT--QAEEPVKYILETSVYPREPEPMKELREVTAKHPWNLMTT  77

Query  252  SADEGQFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPV  431
            SADEGQFL +LLKLINAKNTMEIGVYTGYSLL+TALALPDDGKILAMDINRENY++GLP+
Sbjct  78   SADEGQFLGLLLKLINAKNTMEIGVYTGYSLLSTALALPDDGKILAMDINRENYDIGLPI  137

Query  432  IEKAGVAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVG  611
            IEKAGVAHKIDFREGPA+P+LD+LV++   HG++DF+FVDADKDNYLNYHKRLIDLVKVG
Sbjct  138  IEKAGVAHKIDFREGPAMPVLDELVKNEDMHGSFDFVFVDADKDNYLNYHKRLIDLVKVG  197

Query  612  GVIGYDNTLWNGSVVAPPDAPMRKYIKYYRDFVLELNKALAVDPRIEICMLPVGDGITLC  791
            G+I YDNTLWNGSVVAPPDAP+RKY++YYRDFV+ELNKALAVDPRIEI  +PVGDG+TLC
Sbjct  198  GLIAYDNTLWNGSVVAPPDAPLRKYVRYYRDFVMELNKALAVDPRIEISQIPVGDGVTLC  257

Query  792  RRI  800
            RR+
Sbjct  258  RRV  260



>ref|XP_012079577.1| PREDICTED: caffeoyl-CoA O-methyltransferase 1-like [Jatropha 
curcas]
Length=271

 Score =   408 bits (1048),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 195/249 (78%), Positives = 218/249 (88%), Gaps = 0/249 (0%)
 Frame = +3

Query  57   SLAGKFKAMAENQTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPW  236
            SLA        N+    Q+VGH+SLLQSD LYQYIL+TSVYP+EP  +KELRE+TA HPW
Sbjct  23   SLAIYKDIFENNEPEPDQDVGHRSLLQSDDLYQYILDTSVYPKEPAPLKELRELTANHPW  82

Query  237  NLMTTSADEGQFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYE  416
            ++MTTSAD GQFLS+LLK++NAKNTMEIGVYTGYSLLATALALP DGKILAMDINRENYE
Sbjct  83   SIMTTSADGGQFLSILLKIMNAKNTMEIGVYTGYSLLATALALPYDGKILAMDINRENYE  142

Query  417  LGLPVIEKAGVAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLID  596
            LGLPVIEKAGVAHKIDFREGPALP+LDQLV+D K HG +DFIFVDADKDNYLNYHKR I+
Sbjct  143  LGLPVIEKAGVAHKIDFREGPALPVLDQLVQDEKNHGKFDFIFVDADKDNYLNYHKRNIE  202

Query  597  LVKVGGVIGYDNTLWNGSVVAPPDAPMRKYIKYYRDFVLELNKALAVDPRIEICMLPVGD  776
            LVKVG +IGYDNTLW GSV A PDAP+RK+I+YYRD+VLE NK +A D RIEIC LP+GD
Sbjct  203  LVKVGAIIGYDNTLWRGSVAALPDAPLRKHIRYYRDYVLEFNKVIAADQRIEICQLPIGD  262

Query  777  GITLCRRIS  803
            GITLCRRIS
Sbjct  263  GITLCRRIS  271



>gb|AFY17068.1| caffeoyl-coenzymeA O-methyltransferase 1b [Panicum virgatum]
Length=258

 Score =   407 bits (1046),  Expect = 5e-139, Method: Compositional matrix adjust.
 Identities = 199/236 (84%), Positives = 217/236 (92%), Gaps = 0/236 (0%)
 Frame = +3

Query  93   QTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEGQF  272
            Q TRH EVGHKSLL+SD LYQYIL+TSVYPREPE+MKELRE+TAKHPWNLMTTSADEGQF
Sbjct  22   QKTRHSEVGHKSLLKSDDLYQYILDTSVYPREPESMKELREITAKHPWNLMTTSADEGQF  81

Query  273  LSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAGVA  452
            L+ML+KLI AK TMEIGVYTGYSLLATALALP+DG ILAMDINRENYELGLP IEKAGVA
Sbjct  82   LNMLIKLIGAKKTMEIGVYTGYSLLATALALPEDGTILAMDINRENYELGLPCIEKAGVA  141

Query  453  HKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIGYDN  632
            HKIDFREGPALP+LD L+ D K HGT+DF FVDADKDNYLNYH+RL+ LVK+GG+IGYDN
Sbjct  142  HKIDFREGPALPVLDDLIADEKNHGTFDFAFVDADKDNYLNYHERLLKLVKLGGLIGYDN  201

Query  633  TLWNGSVVAPPDAPMRKYIKYYRDFVLELNKALAVDPRIEICMLPVGDGITLCRRI  800
            TLWNGSVV P DAPMRKYI+YYRDFVL LNKALA D R+EIC LPVGDG+TLCRR+
Sbjct  202  TLWNGSVVLPDDAPMRKYIRYYRDFVLVLNKALAADERVEICQLPVGDGVTLCRRV  257



>sp|Q9XGD6.1|CAMT1_MAIZE RecName: Full=Caffeoyl-CoA O-methyltransferase 1; AltName: Full=Trans-caffeoyl-CoA 
3-O-methyltransferase 1; Short=CCoAMT-1; 
Short=CCoAOMT-1 [Zea mays]
 emb|CAB45149.1| Caffeoyl CoA O-methyltransferase [Zea mays]
 gb|AAQ89899.1| caffeoyl-CoA 3-O-methyltransferase 1 [Zea mays]
 gb|AAQ89901.1| caffeoyl-CoA 3-O-methyltransferase 1 [Zea mays]
 gb|AAQ89907.1| caffeoyl-CoA 3-O-methyltransferase 1 [Zea mays]
 gb|AAQ89910.1| caffeoyl-CoA 3-O-methyltransferase 1 [Zea mays]
 gb|AAQ89913.1| caffeoyl-CoA 3-O-methyltransferase 1 [Zea mays]
 gb|AAQ89918.1| caffeoyl-CoA 3-O-methyltransferase 1 [Zea mays]
 gb|AAQ89923.1| caffeoyl-CoA 3-O-methyltransferase 1 [Zea mays]
 gb|AAQ89925.1| caffeoyl-CoA 3-O-methyltransferase 1 [Zea mays]
 gb|AAQ89928.1| caffeoyl-CoA 3-O-methyltransferase 1 [Zea mays]
 gb|AAQ89931.1| caffeoyl-CoA 3-O-methyltransferase 1 [Zea mays]
 gb|ACG24581.1| caffeoyl-CoA O-methyltransferase 1 [Zea mays]
 gb|ACG43034.1| caffeoyl-CoA O-methyltransferase 1 [Zea mays]
Length=258

 Score =   406 bits (1044),  Expect = 9e-139, Method: Compositional matrix adjust.
 Identities = 197/236 (83%), Positives = 218/236 (92%), Gaps = 0/236 (0%)
 Frame = +3

Query  93   QTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEGQF  272
            Q TRH EVGHKSLL+SD LYQYIL+TSVYPREPE+MKELREVTAKHPWNLMTTSADEGQF
Sbjct  22   QKTRHSEVGHKSLLKSDDLYQYILDTSVYPREPESMKELREVTAKHPWNLMTTSADEGQF  81

Query  273  LSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAGVA  452
            L+ML+KLI AK TMEIGVYTGYSLLATALALP+DG ILAMDINRENYELGLP IEKAGVA
Sbjct  82   LNMLIKLIGAKKTMEIGVYTGYSLLATALALPEDGTILAMDINRENYELGLPCIEKAGVA  141

Query  453  HKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIGYDN  632
            HKIDFREGPALP+LD L+ + K HG++DF+FVDADKDNYLNYH+RL+ LVK+GG+IGYDN
Sbjct  142  HKIDFREGPALPVLDDLIAEEKNHGSFDFVFVDADKDNYLNYHERLLKLVKLGGLIGYDN  201

Query  633  TLWNGSVVAPPDAPMRKYIKYYRDFVLELNKALAVDPRIEICMLPVGDGITLCRRI  800
            TLWNGSVV P DAPMRKYI++YRDFVL LNKALA D R+EIC LPVGDG+TLCRR+
Sbjct  202  TLWNGSVVLPDDAPMRKYIRFYRDFVLVLNKALAADDRVEICQLPVGDGVTLCRRV  257



>gb|ACG38343.1| caffeoyl-CoA O-methyltransferase 1 [Zea mays]
 gb|ACG40539.1| caffeoyl-CoA O-methyltransferase 1 [Zea mays]
Length=265

 Score =   407 bits (1045),  Expect = 9e-139, Method: Compositional matrix adjust.
 Identities = 192/240 (80%), Positives = 214/240 (89%), Gaps = 4/240 (2%)
 Frame = +3

Query  93   QTTRHQEVGHKSLLQSDALYQ----YILETSVYPREPEAMKELREVTAKHPWNLMTTSAD  260
            Q TRH EVGHKSLL+SD LYQ    YIL+TSVYPREPE+MKELRE+TAKHPWNLMTTSAD
Sbjct  25   QKTRHSEVGHKSLLKSDDLYQNDPQYILDTSVYPREPESMKELREITAKHPWNLMTTSAD  84

Query  261  EGQFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEK  440
            EGQFL+ML+KLI AK TMEIGVYTGYSLLATALALP+DG ILAMDINRENYELGLP I K
Sbjct  85   EGQFLNMLIKLIGAKKTMEIGVYTGYSLLATALALPEDGTILAMDINRENYELGLPCINK  144

Query  441  AGVAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVI  620
            AGV HKIDFREGPALP+LD LV D ++HG++DF FVDADKDNYL+YH+RL+ LV+ GG+I
Sbjct  145  AGVGHKIDFREGPALPVLDDLVADKEQHGSFDFAFVDADKDNYLSYHERLLKLVRPGGLI  204

Query  621  GYDNTLWNGSVVAPPDAPMRKYIKYYRDFVLELNKALAVDPRIEICMLPVGDGITLCRRI  800
            GYDNTLWNGSVV P DAPMRKYI++YRDFVL LN ALA D R+EIC LPVGDG+TLCRR+
Sbjct  205  GYDNTLWNGSVVLPDDAPMRKYIRFYRDFVLALNSALAADDRVEICQLPVGDGVTLCRRV  264



>gb|AAQ89900.1| caffeoyl-CoA 3-O-methyltransferase 1 [Zea mays]
 gb|AAQ89902.1| caffeoyl-CoA 3-O-methyltransferase 1 [Zea mays]
 gb|AAQ89903.1| caffeoyl-CoA 3-O-methyltransferase 1 [Zea mays]
 gb|AAQ89904.1| caffeoyl-CoA 3-O-methyltransferase 1 [Zea mays]
 gb|AAQ89905.1| caffeoyl-CoA 3-O-methyltransferase 1 [Zea mays]
 gb|AAQ89906.1| caffeoyl-CoA 3-O-methyltransferase 1 [Zea mays]
 gb|AAQ89908.1| caffeoyl-CoA 3-O-methyltransferase 1 [Zea mays]
 gb|AAQ89909.1| caffeoyl-CoA 3-O-methyltransferase 1 [Zea mays]
 gb|AAQ89911.1| caffeoyl-CoA 3-O-methyltransferase 1 [Zea mays]
 gb|AAQ89912.1| caffeoyl-CoA 3-O-methyltransferase 1 [Zea mays]
 gb|AAQ89914.1| caffeoyl-CoA 3-O-methyltransferase 1 [Zea mays]
 gb|AAQ89915.1| caffeoyl-CoA 3-O-methyltransferase 1 [Zea mays]
 gb|AAQ89916.1| caffeoyl-CoA 3-O-methyltransferase 1 [Zea mays]
 gb|AAQ89917.1| caffeoyl-CoA 3-O-methyltransferase 1 [Zea mays]
 gb|AAQ89919.1| caffeoyl-CoA 3-O-methyltransferase 1 [Zea mays]
 gb|AAQ89920.1| caffeoyl-CoA 3-O-methyltransferase 1 [Zea mays]
 gb|AAQ89921.1| caffeoyl-CoA 3-O-methyltransferase 1 [Zea mays]
 gb|AAQ89922.1| caffeoyl-CoA 3-O-methyltransferase 1 [Zea mays]
 gb|AAQ89924.1| caffeoyl-CoA 3-O-methyltransferase 1 [Zea mays]
 gb|AAQ89926.1| caffeoyl-CoA 3-O-methyltransferase 1 [Zea mays]
 gb|AAQ89927.1| caffeoyl-CoA 3-O-methyltransferase 1 [Zea mays]
 gb|AAQ89930.1| caffeoyl-CoA 3-O-methyltransferase 1 [Zea mays]
 gb|AFW75630.1| caffeoyl-CoA O-methyltransferase 1 [Zea mays]
Length=258

 Score =   406 bits (1043),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 196/236 (83%), Positives = 218/236 (92%), Gaps = 0/236 (0%)
 Frame = +3

Query  93   QTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEGQF  272
            Q TRH EVGHKSLL+SD LYQYIL+TSVYPREPE+MKELRE+TAKHPWNLMTTSADEGQF
Sbjct  22   QKTRHSEVGHKSLLKSDDLYQYILDTSVYPREPESMKELREITAKHPWNLMTTSADEGQF  81

Query  273  LSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAGVA  452
            L+ML+KLI AK TMEIGVYTGYSLLATALALP+DG ILAMDINRENYELGLP IEKAGVA
Sbjct  82   LNMLIKLIGAKKTMEIGVYTGYSLLATALALPEDGTILAMDINRENYELGLPCIEKAGVA  141

Query  453  HKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIGYDN  632
            HKIDFREGPALP+LD L+ + K HG++DF+FVDADKDNYLNYH+RL+ LVK+GG+IGYDN
Sbjct  142  HKIDFREGPALPVLDDLIAEEKNHGSFDFVFVDADKDNYLNYHERLLKLVKLGGLIGYDN  201

Query  633  TLWNGSVVAPPDAPMRKYIKYYRDFVLELNKALAVDPRIEICMLPVGDGITLCRRI  800
            TLWNGSVV P DAPMRKYI++YRDFVL LNKALA D R+EIC LPVGDG+TLCRR+
Sbjct  202  TLWNGSVVLPDDAPMRKYIRFYRDFVLVLNKALAADDRVEICQLPVGDGVTLCRRV  257



>gb|AEJ83060.1| caffeoyl CoA 3-O-methyltransferase [Triarrhena lutarioriparia 
var. lutarioriparia]
Length=261

 Score =   403 bits (1036),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 189/236 (80%), Positives = 210/236 (89%), Gaps = 0/236 (0%)
 Frame = +3

Query  93   QTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEGQF  272
            Q TRH EVGHKSLL+SD LYQYIL+TSVYPREPE+MKELRE+TAKHPWNLMTT+ADEGQ 
Sbjct  25   QKTRHSEVGHKSLLKSDDLYQYILDTSVYPREPESMKELREITAKHPWNLMTTTADEGQT  84

Query  273  LSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAGVA  452
            L+ L  LI AK T + G  TGYSLLATALALP+DG ILAMDINRENYELGLP IEKAGVA
Sbjct  85   LNKLNNLIGAKKTRKTGEDTGYSLLATALALPEDGTILAMDINRENYELGLPCIEKAGVA  144

Query  453  HKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIGYDN  632
            HKIDFREGPALP+LD LV D K HG++DF+FVDADKDNYLNYH+RL+ LV+VGG+IGYDN
Sbjct  145  HKIDFREGPALPVLDDLVADEKNHGSFDFVFVDADKDNYLNYHERLMQLVRVGGLIGYDN  204

Query  633  TLWNGSVVAPPDAPMRKYIKYYRDFVLELNKALAVDPRIEICMLPVGDGITLCRRI  800
            TLWNGSVV P DAPMRKYI++YRDFVL LNKALA D R+EIC LPVGDG+TLCRR+
Sbjct  205  TLWNGSVVLPDDAPMRKYIRFYRDFVLVLNKALAADERVEICQLPVGDGVTLCRRV  260



>gb|ACY66930.1| caffeoyl-CoA O-methyltransferase 1 [Eucalyptus camaldulensis]
Length=232

 Score =   401 bits (1031),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 199/230 (87%), Positives = 215/230 (93%), Gaps = 1/230 (0%)
 Frame = +3

Query  114  VGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEGQFLSMLLKL  293
             G +S  Q+    +YILETSVYPREPE MKELRE+TAKHPWN+MTTSADEGQFL+MLLKL
Sbjct  4    AGEESQTQAGRHQEYILETSVYPREPEPMKELREITAKHPWNIMTTSADEGQFLNMLLKL  63

Query  294  INAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAGVAHKIDFRE  473
            INAKNTMEIGV+TGYSLLA ALALPDDGKILAMDINRENYELGLPVI+KAGVA KIDFRE
Sbjct  64   INAKNTMEIGVFTGYSLLAAALALPDDGKILAMDINRENYELGLPVIQKAGVADKIDFRE  123

Query  474  GPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIGYDNTLWNGSV  653
            GPALPILDQL+ED  K G++DFIFVDADKDNYLNYHKRLI+LVKVGG+IGYDNTLWNGSV
Sbjct  124  GPALPILDQLIED-GKQGSFDFIFVDADKDNYLNYHKRLIELVKVGGLIGYDNTLWNGSV  182

Query  654  VAPPDAPMRKYIKYYRDFVLELNKALAVDPRIEICMLPVGDGITLCRRIS  803
            VAPPDAP+RKY++YYRDFVLELNKALA DPRIEICMLPVGDGITLCRRIS
Sbjct  183  VAPPDAPLRKYVRYYRDFVLELNKALAADPRIEICMLPVGDGITLCRRIS  232



>gb|ABC42571.1| caffeoyl-CoA 3-O-methyltransferase [Leucaena leucocephala]
 gb|ABC42572.1| caffeoyl-CoA 3-O-methyltransferase [Leucaena leucocephala]
Length=204

 Score =   396 bits (1018),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 186/204 (91%), Positives = 201/204 (99%), Gaps = 0/204 (0%)
 Frame = +3

Query  192  EAMKELREVTAKHPWNLMTTSADEGQFLSMLLKLINAKNTMEIGVYTGYSLLATALALPD  371
            E MKELRE+TAKHPWN+MTTSADEGQFL+MLLKLINAKNTMEIGVYTGYSLLATALALP+
Sbjct  1    EPMKELREITAKHPWNIMTTSADEGQFLNMLLKLINAKNTMEIGVYTGYSLLATALALPE  60

Query  372  DGKILAMDINRENYELGLPVIEKAGVAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVD  551
            DGKILAMDINRENYELGLPVI+KAGVAHKI+F+EGPALP+LD+LV+D K HG+YDFIFVD
Sbjct  61   DGKILAMDINRENYELGLPVIQKAGVAHKIEFKEGPALPVLDELVKDEKNHGSYDFIFVD  120

Query  552  ADKDNYLNYHKRLIDLVKVGGVIGYDNTLWNGSVVAPPDAPMRKYIKYYRDFVLELNKAL  731
            ADKDNYLNYHKRLIDLVKVGGVIGYDNTLWNGSVVAPPDAP+RKY++YYRDFVLELNKAL
Sbjct  121  ADKDNYLNYHKRLIDLVKVGGVIGYDNTLWNGSVVAPPDAPLRKYVRYYRDFVLELNKAL  180

Query  732  AVDPRIEICMLPVGDGITLCRRIS  803
            AVDPRIEICMLP+GDGITLCRRIS
Sbjct  181  AVDPRIEICMLPIGDGITLCRRIS  204



>ref|XP_009418796.1| PREDICTED: caffeoyl-CoA O-methyltransferase 5-like [Musa acuminata 
subsp. malaccensis]
Length=243

 Score =   392 bits (1007),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 181/241 (75%), Positives = 209/241 (87%), Gaps = 0/241 (0%)
 Frame = +3

Query  78   AMAENQTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSA  257
            A    Q   HQEVGHKSLLQSDALYQYIL+TSV PREPE MKELR++TA HP N+M+ S 
Sbjct  2    ASQNGQQRPHQEVGHKSLLQSDALYQYILDTSVLPREPECMKELRQITANHPMNIMSISV  61

Query  258  DEGQFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIE  437
            DEGQFL+MLLKL  AK TMEIGVYTGYSLLATALALPDDGKILAMD NR+ YE+GLP I+
Sbjct  62   DEGQFLNMLLKLTRAKKTMEIGVYTGYSLLATALALPDDGKILAMDTNRKYYEVGLPTIQ  121

Query  438  KAGVAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGV  617
            KA VAHKIDFREGPALP+LDQL++D   HG++DF+FVDADK+NY+NYH+RL+DLVKVGG+
Sbjct  122  KAAVAHKIDFREGPALPVLDQLLQDETNHGSFDFVFVDADKENYVNYHRRLLDLVKVGGL  181

Query  618  IGYDNTLWNGSVVAPPDAPMRKYIKYYRDFVLELNKALAVDPRIEICMLPVGDGITLCRR  797
            I YDNTLW G+V APPDAP+  Y+++Y DFVL+LN+ LA DPRIEIC LPVGDG+TLCRR
Sbjct  182  IAYDNTLWGGAVAAPPDAPLPGYLRHYLDFVLQLNQELAADPRIEICQLPVGDGVTLCRR  241

Query  798  I  800
            I
Sbjct  242  I  242



>gb|ACL54796.1| unknown [Zea mays]
 gb|AFW85675.1| hypothetical protein ZEAMMB73_482080 [Zea mays]
Length=299

 Score =   394 bits (1012),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 192/272 (71%), Positives = 214/272 (79%), Gaps = 36/272 (13%)
 Frame = +3

Query  93   QTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPW------------  236
            Q TRH EVGHKSLL+SD LYQYIL+TSVYPREPE+MKELRE+TAKHPW            
Sbjct  27   QKTRHSEVGHKSLLKSDDLYQYILDTSVYPREPESMKELREITAKHPWYVPLAFRPVVRG  86

Query  237  ------------------------NLMTTSADEGQFLSMLLKLINAKNTMEIGVYTGYSL  344
                                    NLMTTSADEGQFL+ML+KLI AK TMEIGVYTGYSL
Sbjct  87   GFECVGLLDVDRPRSENERGVACRNLMTTSADEGQFLNMLIKLIGAKKTMEIGVYTGYSL  146

Query  345  LATALALPDDGKILAMDINRENYELGLPVIEKAGVAHKIDFREGPALPILDQLVEDPKKH  524
            LATALALP+DG ILAMDINRENYELGLP I KAGV HKIDFREGPALP+LD LV D ++H
Sbjct  147  LATALALPEDGTILAMDINRENYELGLPCINKAGVGHKIDFREGPALPVLDDLVADKEQH  206

Query  525  GTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIGYDNTLWNGSVVAPPDAPMRKYIKYYRD  704
            G++DF FVDADKDNYL+YH+RL+ LV+ GG+IGYDNTLWNGSVV P DAPMRKYI++YRD
Sbjct  207  GSFDFAFVDADKDNYLSYHERLLKLVRPGGLIGYDNTLWNGSVVLPDDAPMRKYIRFYRD  266

Query  705  FVLELNKALAVDPRIEICMLPVGDGITLCRRI  800
            FVL LN ALA D R+EIC LPVGDG+TLCRR+
Sbjct  267  FVLALNSALAADDRVEICQLPVGDGVTLCRRV  298



>gb|ABR16981.1| unknown [Picea sitchensis]
Length=240

 Score =   392 bits (1006),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 186/235 (79%), Positives = 208/235 (89%), Gaps = 18/235 (8%)
 Frame = +3

Query  93   QTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEGQF  272
            + TRHQEVGHKSLLQSDALYQYILETSVYPREPE +KELREVTAKHPWNLMTTSADEGQF
Sbjct  22   KVTRHQEVGHKSLLQSDALYQYILETSVYPREPEPLKELREVTAKHPWNLMTTSADEGQF  81

Query  273  LSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAGVA  452
            L +LLKLINAKNTMEIGVYTGYSLL+TALALPDDGKILAMDINRENY+LGLP+IEKAGVA
Sbjct  82   LGLLLKLINAKNTMEIGVYTGYSLLSTALALPDDGKILAMDINRENYDLGLPMIEKAGVA  141

Query  453  HKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIGYDN  632
            HKIDFREGPALP+LD++V++ +  G++DF+FVDADKDNYLNYH+RLIDL           
Sbjct  142  HKIDFREGPALPLLDEMVKNEEMQGSFDFVFVDADKDNYLNYHRRLIDL-----------  190

Query  633  TLWNGSVVAPPDAPMRKYIKYYRDFVLELNKALAVDPRIEICMLPVGDGITLCRR  797
                   VAPPDAP+RKY++YYRDFV+ELNKALA DPRIEI  +PVGDG+TLCRR
Sbjct  191  -------VAPPDAPLRKYVRYYRDFVMELNKALAADPRIEISQIPVGDGVTLCRR  238



>gb|KJB32361.1| hypothetical protein B456_005G237100 [Gossypium raimondii]
Length=240

 Score =   391 bits (1004),  Expect = 6e-133, Method: Compositional matrix adjust.
 Identities = 189/248 (76%), Positives = 211/248 (85%), Gaps = 27/248 (11%)
 Frame = +3

Query  87   ENQTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEG  266
            ++Q  RHQEVGHKSLLQ+D LYQYILETSVYPREPE MKELRE+TAKHPW          
Sbjct  9    QSQAGRHQEVGHKSLLQTDDLYQYILETSVYPREPEPMKELRELTAKHPW----------  58

Query  267  QFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAG  446
                    LINAKNTMEIGVYTGYSLLATALALP DGKILAMDINRENYELGLPVI+KAG
Sbjct  59   -------LLINAKNTMEIGVYTGYSLLATALALPHDGKILAMDINRENYELGLPVIQKAG  111

Query  447  VAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLV--------  602
            VAHKI+F+E PA+P+LD+L++D K HG+YDFIFVDADKDNYLNYH+RLI+LV        
Sbjct  112  VAHKIEFKESPAMPVLDELLQDEKNHGSYDFIFVDADKDNYLNYHRRLIELVKVDKRSIE  171

Query  603  --KVGGVIGYDNTLWNGSVVAPPDAPMRKYIKYYRDFVLELNKALAVDPRIEICMLPVGD  776
              KVGG+IGYDNTLWNGSVVAP DAP+RK+++YYRDFV+ELNKALAVDPRIEICMLPVGD
Sbjct  172  LAKVGGLIGYDNTLWNGSVVAPADAPLRKFVRYYRDFVMELNKALAVDPRIEICMLPVGD  231

Query  777  GITLCRRI  800
            GITLCRR+
Sbjct  232  GITLCRRL  239



>gb|EMT14560.1| Caffeoyl-CoA O-methyltransferase 2 [Aegilops tauschii]
Length=261

 Score =   391 bits (1005),  Expect = 8e-133, Method: Compositional matrix adjust.
 Identities = 188/238 (79%), Positives = 206/238 (87%), Gaps = 5/238 (2%)
 Frame = +3

Query  93   QTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEGQF  272
            Q TRH EVGHKSLLQSDALYQYILETSVYPRE E MKELRE+TA HPWNLMTTSADEGQF
Sbjct  24   QVTRHSEVGHKSLLQSDALYQYILETSVYPREHECMKELREITANHPWNLMTTSADEGQF  83

Query  273  LSMLLKLINAKNTMEIGVYTGYSLLATALALPDDG---KILAMDINRENYELGLPVIEKA  443
            L+MLLKLI AK TMEIG+Y  +S     L   ++    +ILAMDINRENYELGLP IEKA
Sbjct  84   LNMLLKLIGAKKTMEIGIY--HSQFTKKLKKNENETEMQILAMDINRENYELGLPCIEKA  141

Query  444  GVAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIG  623
            GVAHKIDFREGPALP+LD L+ED   HGT+DF+FVDADKDNYLNYH+RL+ LVKVGG++G
Sbjct  142  GVAHKIDFREGPALPVLDALLEDEANHGTFDFVFVDADKDNYLNYHERLMKLVKVGGLLG  201

Query  624  YDNTLWNGSVVAPPDAPMRKYIKYYRDFVLELNKALAVDPRIEICMLPVGDGITLCRR  797
            YDNTLWNGSVV P DAPMRKYI+YYRDFVL+LNKALA D R+EIC LPVGDGITLCRR
Sbjct  202  YDNTLWNGSVVLPADAPMRKYIRYYRDFVLDLNKALAADQRVEICQLPVGDGITLCRR  259



>ref|XP_009784106.1| PREDICTED: caffeoyl-CoA O-methyltransferase 1 isoform X2 [Nicotiana 
sylvestris]
Length=202

 Score =   387 bits (993),  Expect = 6e-132, Method: Compositional matrix adjust.
 Identities = 179/202 (89%), Positives = 197/202 (98%), Gaps = 0/202 (0%)
 Frame = +3

Query  198  MKELREVTAKHPWNLMTTSADEGQFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDG  377
            MKELRE+TAKHPWNLMTTSADEGQFLSML+KLINAKNTMEIGV+TGYSLLATA+ALPDDG
Sbjct  1    MKELREITAKHPWNLMTTSADEGQFLSMLIKLINAKNTMEIGVFTGYSLLATAMALPDDG  60

Query  378  KILAMDINRENYELGLPVIEKAGVAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDAD  557
            KILAMDINRENYE+GLPVIEKAG+AHKI+F+EGPALP+LDQ++E+ K HG+YDFIFVDAD
Sbjct  61   KILAMDINRENYEIGLPVIEKAGLAHKIEFKEGPALPVLDQMIENGKYHGSYDFIFVDAD  120

Query  558  KDNYLNYHKRLIDLVKVGGVIGYDNTLWNGSVVAPPDAPMRKYIKYYRDFVLELNKALAV  737
            KDNYLNYHKRLIDLVK+GG+IGYDNTLWNGSVVAPPDAP+RKY++YYRDFVLELNKALA 
Sbjct  121  KDNYLNYHKRLIDLVKIGGLIGYDNTLWNGSVVAPPDAPLRKYVRYYRDFVLELNKALAA  180

Query  738  DPRIEICMLPVGDGITLCRRIS  803
            D RIEIC LPVGDGITLCRRIS
Sbjct  181  DSRIEICQLPVGDGITLCRRIS  202



>ref|XP_002523620.1| o-methyltransferase, putative [Ricinus communis]
 gb|EEF38815.1| o-methyltransferase, putative [Ricinus communis]
Length=226

 Score =   387 bits (993),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 178/216 (82%), Positives = 203/216 (94%), Gaps = 0/216 (0%)
 Frame = +3

Query  156  YILETSVYPREPEAMKELREVTAKHPWNLMTTSADEGQFLSMLLKLINAKNTMEIGVYTG  335
            YILETSVYPREP  MKELRE+TA H WN+MTTSADEGQFLSML+KLI+AKNTMEIGVYTG
Sbjct  11   YILETSVYPREPRPMKELRELTATHKWNVMTTSADEGQFLSMLVKLIHAKNTMEIGVYTG  70

Query  336  YSLLATALALPDDGKILAMDINRENYELGLPVIEKAGVAHKIDFREGPALPILDQLVEDP  515
            YSLLATALALP+DGK+LA+DINRENYELGLP+I+KAGVAHKIDF+E PALP+LDQL++D 
Sbjct  71   YSLLATALALPEDGKVLAIDINRENYELGLPIIKKAGVAHKIDFKEEPALPVLDQLIQDG  130

Query  516  KKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIGYDNTLWNGSVVAPPDAPMRKYIKY  695
            K HGT+DFIFVDADKDNYLNYHKR I+LVKVGG+IGYDNTLWNGSVVAPPDAP++  I++
Sbjct  131  KHHGTFDFIFVDADKDNYLNYHKRTIELVKVGGIIGYDNTLWNGSVVAPPDAPLKDIIRF  190

Query  696  YRDFVLELNKALAVDPRIEICMLPVGDGITLCRRIS  803
            Y+++VLE NKA+A DPR+EIC LPVGDGITLCRRIS
Sbjct  191  YKEYVLEFNKAIAADPRVEICQLPVGDGITLCRRIS  226



>ref|XP_006466586.1| PREDICTED: caffeoyl-CoA O-methyltransferase-like [Citrus sinensis]
Length=249

 Score =   384 bits (987),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 178/229 (78%), Positives = 208/229 (91%), Gaps = 0/229 (0%)
 Frame = +3

Query  117  GHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEGQFLSMLLKLI  296
            G+K+LLQS+ LY+YILETSVYPREP+ +KE+RE+T KHPW++M TS DE QFLSMLLKLI
Sbjct  21   GNKTLLQSEKLYEYILETSVYPREPQCLKEIRELTDKHPWSVMMTSPDEAQFLSMLLKLI  80

Query  297  NAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAGVAHKIDFREG  476
            NAKNTMEIGV+TGYSLLATALA+PDDGKILA+DI +E+YE GLP+I+KAGVAHKIDFREG
Sbjct  81   NAKNTMEIGVFTGYSLLATALAIPDDGKILALDITKEHYEKGLPIIQKAGVAHKIDFREG  140

Query  477  PALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIGYDNTLWNGSVV  656
            PALP+LDQL++D K HGT+DF+FVDADK+NY+NYHKRLI+LVKVGGVIGYDNTLW GSVV
Sbjct  141  PALPLLDQLIQDEKYHGTFDFVFVDADKNNYINYHKRLIELVKVGGVIGYDNTLWGGSVV  200

Query  657  APPDAPMRKYIKYYRDFVLELNKALAVDPRIEICMLPVGDGITLCRRIS  803
            A PDA + ++I Y RDFV ELNKALAVDPRIEIC L + DG+TLCRRI 
Sbjct  201  AQPDAELDEHILYLRDFVQELNKALAVDPRIEICQLSIADGVTLCRRIG  249



>ref|XP_002963752.1| hypothetical protein SELMODRAFT_266699 [Selaginella moellendorffii]
 gb|EFJ35623.1| hypothetical protein SELMODRAFT_266699 [Selaginella moellendorffii]
Length=291

 Score =   385 bits (988),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 170/239 (71%), Positives = 213/239 (89%), Gaps = 0/239 (0%)
 Frame = +3

Query  84   AENQTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADE  263
            A+ + ++HQ +GHKSLL+SDALYQY+LETSVYPREP +++ LRE+TAKHPWN+MTTS DE
Sbjct  52   AKEEASKHQTLGHKSLLKSDALYQYLLETSVYPREPASLRGLRELTAKHPWNIMTTSPDE  111

Query  264  GQFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKA  443
            GQFLSML+K++NAKNT+EIGV+TGYSLL+TALALP+DGKI+AMDI+R NY+LG P +++A
Sbjct  112  GQFLSMLVKIMNAKNTIEIGVFTGYSLLSTALALPEDGKIIAMDIDRSNYDLGFPFLQEA  171

Query  444  GVAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIG  623
            GV HKIDFREGPAL  LD+LV++ K HG +DFIF+DADK+NYLNYH+R++ LVK+GG+IG
Sbjct  172  GVDHKIDFREGPALATLDELVQNNKNHGFFDFIFIDADKNNYLNYHERVMQLVKIGGIIG  231

Query  624  YDNTLWNGSVVAPPDAPMRKYIKYYRDFVLELNKALAVDPRIEICMLPVGDGITLCRRI  800
            YDNTLWNG+VVA  D PMRKY+++Y+DFV ELNK LA DPRIEI  + + DGITLCRRI
Sbjct  232  YDNTLWNGAVVASDDEPMRKYVRFYKDFVKELNKVLAADPRIEISHISISDGITLCRRI  290



>gb|KDP31955.1| hypothetical protein JCGZ_12416 [Jatropha curcas]
Length=232

 Score =   382 bits (981),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 179/231 (77%), Positives = 204/231 (88%), Gaps = 0/231 (0%)
 Frame = +3

Query  111  EVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEGQFLSMLLK  290
             +    +L ++   +YIL+TSVYP+EP  +KELRE+TA HPW++MTTSAD GQFLS+LLK
Sbjct  2    SLNQTRMLATEVSCRYILDTSVYPKEPAPLKELRELTANHPWSIMTTSADGGQFLSILLK  61

Query  291  LINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAGVAHKIDFR  470
            ++NAKNTMEIGVYTGYSLLATALALP DGKILAMDINRENYELGLPVIEKAGVAHKIDFR
Sbjct  62   IMNAKNTMEIGVYTGYSLLATALALPYDGKILAMDINRENYELGLPVIEKAGVAHKIDFR  121

Query  471  EGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIGYDNTLWNGS  650
            EGPALP+LDQLV+D K HG +DFIFVDADKDNYLNYHKR I+LVKVG +IGYDNTLW GS
Sbjct  122  EGPALPVLDQLVQDEKNHGKFDFIFVDADKDNYLNYHKRNIELVKVGAIIGYDNTLWRGS  181

Query  651  VVAPPDAPMRKYIKYYRDFVLELNKALAVDPRIEICMLPVGDGITLCRRIS  803
            V A PDAP+RK+I+YYRD+VLE NK +A D RIEIC LP+GDGITLCRRIS
Sbjct  182  VAALPDAPLRKHIRYYRDYVLEFNKVIAADQRIEICQLPIGDGITLCRRIS  232



>ref|XP_002974834.1| hypothetical protein SELMODRAFT_101771 [Selaginella moellendorffii]
 gb|EFJ24354.1| hypothetical protein SELMODRAFT_101771 [Selaginella moellendorffii]
Length=278

 Score =   383 bits (984),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 169/239 (71%), Positives = 214/239 (90%), Gaps = 0/239 (0%)
 Frame = +3

Query  84   AENQTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADE  263
            A+++ ++HQ +GHKSLL+SDALYQY+LETSVYPREP +++ LRE+TAKHPWN+MTTS DE
Sbjct  39   AKDEASKHQTLGHKSLLKSDALYQYLLETSVYPREPASLRGLRELTAKHPWNIMTTSPDE  98

Query  264  GQFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKA  443
            GQFLS+L+K++NAKNT+EIGV+TGYSLL+TALALP+DGKI+AMDI+R NY+LG P +++A
Sbjct  99   GQFLSLLVKIMNAKNTIEIGVFTGYSLLSTALALPEDGKIIAMDIDRSNYDLGFPFLQEA  158

Query  444  GVAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIG  623
            GV HKIDFREGPAL  LD+LV++ K HG +DFIF+DADK+NYLNYH+R++ LVK+GG+IG
Sbjct  159  GVDHKIDFREGPALATLDELVQNDKNHGFFDFIFIDADKNNYLNYHERVMQLVKIGGIIG  218

Query  624  YDNTLWNGSVVAPPDAPMRKYIKYYRDFVLELNKALAVDPRIEICMLPVGDGITLCRRI  800
            YDNTLWNG+VVA  D PMRKY+++Y+DFV ELNK LA DPRIEI  + + DGITLCRRI
Sbjct  219  YDNTLWNGAVVASDDEPMRKYVRFYKDFVKELNKVLAADPRIEISHISISDGITLCRRI  277



>ref|XP_002987152.1| hypothetical protein SELMODRAFT_158563 [Selaginella moellendorffii]
 gb|EFJ11728.1| hypothetical protein SELMODRAFT_158563 [Selaginella moellendorffii]
Length=258

 Score =   381 bits (978),  Expect = 9e-129, Method: Compositional matrix adjust.
 Identities = 176/238 (74%), Positives = 206/238 (87%), Gaps = 0/238 (0%)
 Frame = +3

Query  90   NQTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEGQ  269
            N+  +H +VGHKS+L+SD LYQYIL+TSVYPREP  +K LRE+TA HPWNLMTTS DEGQ
Sbjct  21   NKAGKHSQVGHKSVLKSDKLYQYILDTSVYPREPAPLKGLREMTAHHPWNLMTTSPDEGQ  80

Query  270  FLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAGV  449
            FL  LLK++NAK TMEIGVYTGYSLL+TALALP+DG +LAMDINR+N+ELG P + +AGV
Sbjct  81   FLMFLLKMMNAKKTMEIGVYTGYSLLSTALALPEDGTVLAMDINRKNFELGYPYMVEAGV  140

Query  450  AHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIGYD  629
            AHKIDFREGPAL  LD++++D   HG +DFIFVDADKDNYLNYHKRLI LVKVGGVIGYD
Sbjct  141  AHKIDFREGPALAALDEMLKDEANHGAFDFIFVDADKDNYLNYHKRLISLVKVGGVIGYD  200

Query  630  NTLWNGSVVAPPDAPMRKYIKYYRDFVLELNKALAVDPRIEICMLPVGDGITLCRRIS  803
            NTLWNGSVVA  D PM KY+KYY+DFV+E+NKALA D RIEI  +P+ DGITLCRR++
Sbjct  201  NTLWNGSVVAEEDEPMPKYVKYYKDFVIEVNKALAADSRIEITQVPISDGITLCRRVN  258



>ref|XP_002976256.1| hypothetical protein SELMODRAFT_271191 [Selaginella moellendorffii]
 gb|EFJ22516.1| hypothetical protein SELMODRAFT_271191 [Selaginella moellendorffii]
Length=258

 Score =   380 bits (977),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 176/238 (74%), Positives = 206/238 (87%), Gaps = 0/238 (0%)
 Frame = +3

Query  90   NQTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEGQ  269
            N+  +H +VGHKS+L+SD LYQYIL+TSVYPREP  +K LRE+TA HPWNLMTTS DEGQ
Sbjct  21   NKAGKHSQVGHKSVLKSDKLYQYILDTSVYPREPAPLKGLREMTAHHPWNLMTTSPDEGQ  80

Query  270  FLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAGV  449
            FL  LLK++NAK TMEIGVYTGYSLL+TALALP+DG +LAMDINR+N+ELG P + +AGV
Sbjct  81   FLMFLLKMMNAKKTMEIGVYTGYSLLSTALALPEDGTVLAMDINRKNFELGYPYMVEAGV  140

Query  450  AHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIGYD  629
            AHKIDFREGPAL  LD++++D   HG +DFIFVDADKDNYLNYHKRLI LVKVGGVIGYD
Sbjct  141  AHKIDFREGPALAALDEMLKDEANHGAFDFIFVDADKDNYLNYHKRLISLVKVGGVIGYD  200

Query  630  NTLWNGSVVAPPDAPMRKYIKYYRDFVLELNKALAVDPRIEICMLPVGDGITLCRRIS  803
            NTLWNGSVVA  D PM KY+KYY+DFV+E+NKALA D RIEI  +P+ DGITLCRR++
Sbjct  201  NTLWNGSVVAEEDEPMPKYVKYYKDFVIEVNKALAADSRIEITQVPISDGITLCRRLN  258



>gb|ABB04868.1| caffeoyl-CoA O-methyltransferase [Leucaena leucocephala]
 gb|ABB04871.1| caffeoyl-CoA O-methyltransferase [Leucaena leucocephala]
Length=212

 Score =   379 bits (972),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 178/212 (84%), Positives = 195/212 (92%), Gaps = 0/212 (0%)
 Frame = +3

Query  168  TSVYPREPEAMKELREVTAKHPWNLMTTSADEGQFLSMLLKLINAKNTMEIGVYTGYSLL  347
            TSVYPREPE MKELRE+TAKHPWN+MTTSADEGQFL+MLLKLINAKNTMEIGVYTGYSLL
Sbjct  1    TSVYPREPEPMKELREITAKHPWNIMTTSADEGQFLNMLLKLINAKNTMEIGVYTGYSLL  60

Query  348  ATALALPDDGKILAMDINRENYELGLPVIEKAGVAHKIDFREGPALPILDQLVEDPKKHG  527
            ATALALP+DGKILAMDINRENYELGLPVI+KAGVAHKI+F+EGPALP+LD L+ D K  G
Sbjct  61   ATALALPEDGKILAMDINRENYELGLPVIQKAGVAHKIEFKEGPALPVLDHLLTDEKNKG  120

Query  528  TYDFIFVDADKDNYLNYHKRLIDLVKVGGVIGYDNTLWNGSVVAPPDAPMRKYIKYYRDF  707
             +DFIFVDADK+NYLNYHKR I+LVKVGG+IGYDNTLWNGSV  PP+ P   YIKYYR F
Sbjct  121  AFDFIFVDADKNNYLNYHKRAIELVKVGGLIGYDNTLWNGSVADPPEVPQLDYIKYYRGF  180

Query  708  VLELNKALAVDPRIEICMLPVGDGITLCRRIS  803
            VLELNKALA+D R+EIC LP+GDGITLCRRIS
Sbjct  181  VLELNKALALDSRVEICQLPIGDGITLCRRIS  212



>ref|XP_006427260.1| hypothetical protein CICLE_v10026347mg [Citrus clementina]
 gb|ESR40500.1| hypothetical protein CICLE_v10026347mg [Citrus clementina]
Length=248

 Score =   379 bits (974),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 178/227 (78%), Positives = 203/227 (89%), Gaps = 0/227 (0%)
 Frame = +3

Query  123  KSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEGQFLSMLLKLINA  302
            K+LLQSD LYQYILETSVYPRE E +KELRE+T KHP N M ++ DE QFLSMLLKLINA
Sbjct  22   KNLLQSDELYQYILETSVYPREHECLKELRELTKKHPRNHMLSTPDEAQFLSMLLKLINA  81

Query  303  KNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAGVAHKIDFREGPA  482
            KNTMEIGVYTGYSLL TALA+PDDGKILAMDINRE YELGLP+IEKAGVAHKIDFREGPA
Sbjct  82   KNTMEIGVYTGYSLLYTALAIPDDGKILAMDINREYYELGLPIIEKAGVAHKIDFREGPA  141

Query  483  LPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIGYDNTLWNGSVVAP  662
            LP+LDQ+++D K HGT+DFIFVDADK+NY+NYH+R+I LVKVGGVIGYDNTLW GSV  P
Sbjct  142  LPLLDQMIQDEKYHGTFDFIFVDADKNNYINYHERIIALVKVGGVIGYDNTLWCGSVAVP  201

Query  663  PDAPMRKYIKYYRDFVLELNKALAVDPRIEICMLPVGDGITLCRRIS  803
            PD+ M + ++Y+RDFVLE NKA+A+DPRIEIC L + DG+TLCRRIS
Sbjct  202  PDSIMDERLRYFRDFVLEFNKAVALDPRIEICQLSIADGVTLCRRIS  248



>gb|AEW26101.1| caffeoyl-CoA 3-o-methyltransferase, partial [Medicago falcata]
 gb|AEW26104.1| caffeoyl-CoA 3-o-methyltransferase, partial [Medicago falcata]
 gb|AEW26109.1| caffeoyl-CoA 3-o-methyltransferase, partial [Medicago falcata]
 gb|AEW26131.1| caffeoyl-CoA 3-o-methyltransferase, partial [Medicago falcata]
 gb|AEW26136.1| caffeoyl-CoA 3-o-methyltransferase, partial [Medicago falcata]
 gb|AEW26151.1| caffeoyl-CoA 3-o-methyltransferase, partial [Medicago sativa 
subsp. caerulea]
Length=194

 Score =   377 bits (967),  Expect = 5e-128, Method: Compositional matrix adjust.
 Identities = 176/194 (91%), Positives = 191/194 (98%), Gaps = 0/194 (0%)
 Frame = +3

Query  219  TAKHPWNLMTTSADEGQFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDI  398
            TAKHPWN+MTTSADEGQFLSMLLKLINAKNTMEIGVYTGYSLLATALA+P+DGKILAMDI
Sbjct  1    TAKHPWNIMTTSADEGQFLSMLLKLINAKNTMEIGVYTGYSLLATALAIPEDGKILAMDI  60

Query  399  NRENYELGLPVIEKAGVAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNY  578
            N+ENYELGLPVI+KAGV HKIDFREGPALP+LD++++D K HG+YDFIFVDADKDNYLNY
Sbjct  61   NKENYELGLPVIKKAGVDHKIDFREGPALPVLDEMIKDEKNHGSYDFIFVDADKDNYLNY  120

Query  579  HKRLIDLVKVGGVIGYDNTLWNGSVVAPPDAPMRKYIKYYRDFVLELNKALAVDPRIEIC  758
            HKRLIDLVKVGGVIGYDNTLWNGSVVAPPDAP+RKY++YYRDFVLELNKALAVDPRIEIC
Sbjct  121  HKRLIDLVKVGGVIGYDNTLWNGSVVAPPDAPLRKYVRYYRDFVLELNKALAVDPRIEIC  180

Query  759  MLPVGDGITLCRRI  800
            MLPVGDGIT+CRRI
Sbjct  181  MLPVGDGITICRRI  194



>ref|XP_006465346.1| PREDICTED: caffeoyl-CoA O-methyltransferase-like [Citrus sinensis]
Length=248

 Score =   378 bits (970),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 180/248 (73%), Positives = 209/248 (84%), Gaps = 7/248 (3%)
 Frame = +3

Query  81   MAENQTTRHQEVGH-------KSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWN  239
            MA NQ  +  +          K+LLQSD LYQYILETSVYPRE E +KELRE+T KHP N
Sbjct  1    MAANQEGQENKAADLLQLSKTKNLLQSDELYQYILETSVYPREHECLKELRELTKKHPRN  60

Query  240  LMTTSADEGQFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYEL  419
             M ++ DE QFLSMLLKLINAKNTMEIGVYTGYSLL TALA+PDDGKILAMDINRE YEL
Sbjct  61   HMLSTPDEAQFLSMLLKLINAKNTMEIGVYTGYSLLYTALAIPDDGKILAMDINREYYEL  120

Query  420  GLPVIEKAGVAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDL  599
            GLP+IEKAGVAHKIDFREGPALP+LDQ+++D K HGT+DFIFVDADK+N +NYHKR+I+L
Sbjct  121  GLPIIEKAGVAHKIDFREGPALPLLDQMIQDEKYHGTFDFIFVDADKNNNINYHKRIIEL  180

Query  600  VKVGGVIGYDNTLWNGSVVAPPDAPMRKYIKYYRDFVLELNKALAVDPRIEICMLPVGDG  779
            VKVGGVIGYDNTLW GSV  PPD+ M + ++Y+RDF++E NKA+A+DPRIEIC L + DG
Sbjct  181  VKVGGVIGYDNTLWCGSVAVPPDSIMDERLRYFRDFMMEFNKAVALDPRIEICQLSIADG  240

Query  780  ITLCRRIS  803
            +TLCRRIS
Sbjct  241  VTLCRRIS  248



>ref|XP_006428886.1| hypothetical protein CICLE_v10012561mg [Citrus clementina]
 gb|ESR42126.1| hypothetical protein CICLE_v10012561mg [Citrus clementina]
Length=249

 Score =   378 bits (970),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 180/249 (72%), Positives = 212/249 (85%), Gaps = 1/249 (0%)
 Frame = +3

Query  60   LAGKFKAMAENQTTRHQEV-GHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPW  236
            +A   +   EN+    + V G+K+ LQS+ LY+YILETSVYPREP+ +KE+RE+T KHP 
Sbjct  1    MAANREGQEENKDRYFKAVHGNKTFLQSEKLYEYILETSVYPREPQCLKEIRELTYKHPL  60

Query  237  NLMTTSADEGQFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYE  416
            + M TS DE QF SMLLKLINAKNTMEIGV+TGYSLLATALA+PDDGKILA+DI +E+YE
Sbjct  61   SPMMTSPDEAQFFSMLLKLINAKNTMEIGVFTGYSLLATALAIPDDGKILALDITKEHYE  120

Query  417  LGLPVIEKAGVAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLID  596
             GLP+I+KAGVAHKIDFREGPALP+LDQL++  K HGT+DF+FVDADKDNY+NYHKRLI+
Sbjct  121  KGLPIIQKAGVAHKIDFREGPALPLLDQLIQHEKYHGTFDFVFVDADKDNYVNYHKRLIE  180

Query  597  LVKVGGVIGYDNTLWNGSVVAPPDAPMRKYIKYYRDFVLELNKALAVDPRIEICMLPVGD  776
            LVKVGGVIGYDNTLW GSVVAPPDA + ++I Y RDFV ELNKALAVDPRIEIC L + D
Sbjct  181  LVKVGGVIGYDNTLWGGSVVAPPDADLDEHILYLRDFVQELNKALAVDPRIEICQLSIAD  240

Query  777  GITLCRRIS  803
            G+TLCRRI 
Sbjct  241  GVTLCRRIG  249



>ref|XP_006480587.1| PREDICTED: caffeoyl-CoA O-methyltransferase-like [Citrus sinensis]
Length=249

 Score =   377 bits (969),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 181/249 (73%), Positives = 213/249 (86%), Gaps = 1/249 (0%)
 Frame = +3

Query  60   LAGKFKAMAENQTTRHQEV-GHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPW  236
            +A   +   EN+    + V G+K+LLQS+ LY+YILETSVYPREP+ +KE+RE+T KHP 
Sbjct  1    MAANREDQEENKDRYFKAVHGNKTLLQSEKLYEYILETSVYPREPQCLKEIRELTYKHPL  60

Query  237  NLMTTSADEGQFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYE  416
            + M TS DE QF SMLLKLINAKNTMEIGV+TGYSLLATALA+PDDGKILA+DI +E+YE
Sbjct  61   SPMMTSPDEAQFFSMLLKLINAKNTMEIGVFTGYSLLATALAIPDDGKILALDITKEHYE  120

Query  417  LGLPVIEKAGVAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLID  596
             GLP+I+KAGVAHKIDFREGPALP+LDQL++  K HGT+DF+FVDADKDNY+NYHKRLI+
Sbjct  121  KGLPIIQKAGVAHKIDFREGPALPLLDQLIQHEKYHGTFDFVFVDADKDNYVNYHKRLIE  180

Query  597  LVKVGGVIGYDNTLWNGSVVAPPDAPMRKYIKYYRDFVLELNKALAVDPRIEICMLPVGD  776
            LVKVGGVIGYDNTLW GSVVAPPDA + ++I Y RDFV ELNKALAVDPRIEIC L + D
Sbjct  181  LVKVGGVIGYDNTLWGGSVVAPPDADLDEHILYLRDFVQELNKALAVDPRIEICQLSIAD  240

Query  777  GITLCRRIS  803
            G+TLCRRI 
Sbjct  241  GVTLCRRIG  249



>ref|XP_006425921.1| hypothetical protein CICLE_v10026344mg [Citrus clementina]
 gb|ESR39161.1| hypothetical protein CICLE_v10026344mg [Citrus clementina]
Length=249

 Score =   376 bits (965),  Expect = 6e-127, Method: Compositional matrix adjust.
 Identities = 178/249 (71%), Positives = 214/249 (86%), Gaps = 1/249 (0%)
 Frame = +3

Query  60   LAGKFKAMAENQTTRHQEV-GHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPW  236
            +A   +   EN+   ++ + G+K+LLQS+ LY+YILETSVYPREP+ +KE+RE+T KHPW
Sbjct  1    MAANREGQEENKDRYYKTLHGNKTLLQSEKLYEYILETSVYPREPQCLKEIRELTDKHPW  60

Query  237  NLMTTSADEGQFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYE  416
            + M T+ DE QFLSMLLKLINAKNTMEIGV+TGYSLLATALA+PDDGKILA+DI +E+YE
Sbjct  61   SAMMTAPDEAQFLSMLLKLINAKNTMEIGVFTGYSLLATALAIPDDGKILALDITKEHYE  120

Query  417  LGLPVIEKAGVAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLID  596
             GLP+I+KAGVAHKIDFREGPALP+LDQL++D K HGT+DF+FVDADK+NY+NYHKRLI+
Sbjct  121  KGLPIIQKAGVAHKIDFREGPALPLLDQLIQDEKYHGTFDFVFVDADKNNYINYHKRLIE  180

Query  597  LVKVGGVIGYDNTLWNGSVVAPPDAPMRKYIKYYRDFVLELNKALAVDPRIEICMLPVGD  776
            LVKVGGVIGYDNTLW GSVVA PDA + + I  +RD V ELNKALAVDPRIEIC L + D
Sbjct  181  LVKVGGVIGYDNTLWGGSVVAQPDADLDELILGWRDSVQELNKALAVDPRIEICQLSIAD  240

Query  777  GITLCRRIS  803
            G+TLCRRI 
Sbjct  241  GVTLCRRIG  249



>ref|XP_010928606.1| PREDICTED: caffeoyl-CoA O-methyltransferase-like [Elaeis guineensis]
Length=247

 Score =   375 bits (963),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 180/246 (73%), Positives = 207/246 (84%), Gaps = 4/246 (2%)
 Frame = +3

Query  78   AMAENQTTRHQEV----GHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLM  245
            A A    +R QE       KSLL+SDALYQYILETSVYPREPE MKELR VTAKHPWN M
Sbjct  2    ANAPEDESREQENPTDHAQKSLLKSDALYQYILETSVYPREPECMKELRLVTAKHPWNGM  61

Query  246  TTSADEGQFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGL  425
              +ADE QFL MLLK++NAKNTMEIGVYTGYSLLATALALPDDGKILA DINRENYELGL
Sbjct  62   AAAADEVQFLGMLLKVLNAKNTMEIGVYTGYSLLATALALPDDGKILAFDINRENYELGL  121

Query  426  PVIEKAGVAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVK  605
            PV++KAGVAHKIDF EGPALP+LDQ+V D K  G+ DF+FVDADK+NYLNYHKR+++LV+
Sbjct  122  PVLKKAGVAHKIDFHEGPALPVLDQMVHDEKHKGSLDFVFVDADKENYLNYHKRVLELVR  181

Query  606  VGGVIGYDNTLWNGSVVAPPDAPMRKYIKYYRDFVLELNKALAVDPRIEICMLPVGDGIT  785
            VGGVIGYDNTLWNGSV APP+AP+  +++  R  +LELNK +A DPR+EIC L + DG+T
Sbjct  182  VGGVIGYDNTLWNGSVAAPPEAPLPDHVRRLRGPILELNKYVAADPRVEICQLSIADGLT  241

Query  786  LCRRIS  803
            LCRR+S
Sbjct  242  LCRRLS  247



>gb|AGV54319.1| caffeoyl CoA O-methyltransferase [Phaseolus vulgaris]
 gb|AGV54717.1| caffeoyl CoA O-methyltransferase [Phaseolus vulgaris]
Length=246

 Score =   375 bits (962),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 181/238 (76%), Positives = 205/238 (86%), Gaps = 0/238 (0%)
 Frame = +3

Query  87   ENQTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEG  266
            +N     +++ HK+LLQSDALYQYILETSVYPRE E +KELRE+T KHP NLM T  DEG
Sbjct  8    KNHVFGVKDLSHKTLLQSDALYQYILETSVYPREHECLKELREMTEKHPRNLMATPPDEG  67

Query  267  QFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAG  446
            Q LSML+KLINAKNT+EIGVYTGYSLL+TALALP DGKILA+D+NRE YELGLP+IEKAG
Sbjct  68   QLLSMLIKLINAKNTLEIGVYTGYSLLSTALALPPDGKILALDVNREYYELGLPIIEKAG  127

Query  447  VAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIGY  626
            VAHKIDF+EGPALP LD+L++D  K GT+DF+FVDADK+NYLNYHKR+IDLVKVGG+IGY
Sbjct  128  VAHKIDFKEGPALPFLDELLKDENKKGTFDFVFVDADKNNYLNYHKRVIDLVKVGGLIGY  187

Query  627  DNTLWNGSVVAPPDAPMRKYIKYYRDFVLELNKALAVDPRIEICMLPVGDGITLCRRI  800
            DNTLW GSV A PDAP   YIK  R +V+ELNK LA D RIEIC LPVGDGITLCRRI
Sbjct  188  DNTLWAGSVAASPDAPFMDYIKPLRGYVMELNKYLAQDSRIEICQLPVGDGITLCRRI  245



>gb|AAU95084.1| caffeoyl-CoA 3-0-methyltransferase [Apium graveolens Dulce Group]
Length=197

 Score =   372 bits (954),  Expect = 5e-126, Method: Compositional matrix adjust.
 Identities = 173/197 (88%), Positives = 191/197 (97%), Gaps = 0/197 (0%)
 Frame = +3

Query  186  EPEAMKELREVTAKHPWNLMTTSADEGQFLSMLLKLINAKNTMEIGVYTGYSLLATALAL  365
            +PEAMKELREVTAKHPWNLMTTSADEGQFL+MLLKLINAKNTMEIGVYTGYSLLATALAL
Sbjct  1    DPEAMKELREVTAKHPWNLMTTSADEGQFLNMLLKLINAKNTMEIGVYTGYSLLATALAL  60

Query  366  PDDGKILAMDINRENYELGLPVIEKAGVAHKIDFREGPALPILDQLVEDPKKHGTYDFIF  545
            P+DGKILAMDINRENYE+GLP+IEKAGV HKIDFREGPALP+LDQ+++D K HGT+DFIF
Sbjct  61   PEDGKILAMDINRENYEIGLPIIEKAGVGHKIDFREGPALPVLDQMIQDGKYHGTFDFIF  120

Query  546  VDADKDNYLNYHKRLIDLVKVGGVIGYDNTLWNGSVVAPPDAPMRKYIKYYRDFVLELNK  725
            VDAD+DNY+NYHKRLIDLVKVGG+IGYD+TLWNGSV  P DAPMRKY++YYRDFV+ELNK
Sbjct  121  VDADEDNYINYHKRLIDLVKVGGLIGYDSTLWNGSVAEPADAPMRKYVRYYRDFVMELNK  180

Query  726  ALAVDPRIEICMLPVGD  776
            ALAVDPRIEICMLPVG+
Sbjct  181  ALAVDPRIEICMLPVGE  197



>ref|XP_007155910.1| hypothetical protein PHAVU_003G242400g [Phaseolus vulgaris]
 gb|ESW27904.1| hypothetical protein PHAVU_003G242400g [Phaseolus vulgaris]
Length=246

 Score =   373 bits (957),  Expect = 8e-126, Method: Compositional matrix adjust.
 Identities = 180/238 (76%), Positives = 205/238 (86%), Gaps = 0/238 (0%)
 Frame = +3

Query  87   ENQTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEG  266
            +N     +++ HK+LLQSDALYQYIL+TSVYPRE E +KELRE+T KHP NLM T  DEG
Sbjct  8    KNHVFGIKDLSHKTLLQSDALYQYILDTSVYPREHECLKELREMTEKHPRNLMATPPDEG  67

Query  267  QFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAG  446
            Q LSML+KLINAKNT+EIGVYTGYSLL+TALALP DGKILA+D+NRE YELGLP+IEKAG
Sbjct  68   QLLSMLIKLINAKNTLEIGVYTGYSLLSTALALPPDGKILALDVNREYYELGLPIIEKAG  127

Query  447  VAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIGY  626
            VAHKIDF+EGPALP LD+L++D  K GT+DF+FVDADK+NYLNYHKR+IDLVKVGG+IGY
Sbjct  128  VAHKIDFKEGPALPFLDELLKDENKKGTFDFVFVDADKNNYLNYHKRVIDLVKVGGLIGY  187

Query  627  DNTLWNGSVVAPPDAPMRKYIKYYRDFVLELNKALAVDPRIEICMLPVGDGITLCRRI  800
            DNTLW GSV A PDAP   YIK  R +V+ELNK LA D RIEIC LPVGDGITLCRRI
Sbjct  188  DNTLWAGSVAASPDAPFMDYIKPLRGYVMELNKYLAQDSRIEICQLPVGDGITLCRRI  245



>gb|ACJ84250.1| unknown [Medicago truncatula]
 gb|KEH31447.1| caffeoyl-CoA 3-O-methyltransferase [Medicago truncatula]
Length=248

 Score =   372 bits (955),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 174/239 (73%), Positives = 203/239 (85%), Gaps = 0/239 (0%)
 Frame = +3

Query  87   ENQTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEG  266
            +NQ   H ++ HK+LLQSDALYQYIL+TSV+P E   +KELRE+T KHP NLM T ADEG
Sbjct  10   QNQIIGHTDLAHKTLLQSDALYQYILDTSVFPNEHPCLKELREMTEKHPRNLMATPADEG  69

Query  267  QFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAG  446
            Q + ML+KLINAKNTMEIGVYTGYSLL+TALALP DGK+LA+D++RE YELGLP+IEKAG
Sbjct  70   QLIRMLIKLINAKNTMEIGVYTGYSLLSTALALPSDGKVLALDVSREYYELGLPIIEKAG  129

Query  447  VAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIGY  626
            +AHKIDFREGPALP+LDQL++D    G +DF+FVDADKDNYLNYH+R+IDLVKVGG+IGY
Sbjct  130  IAHKIDFREGPALPLLDQLIQDENNKGAFDFVFVDADKDNYLNYHERIIDLVKVGGLIGY  189

Query  627  DNTLWNGSVVAPPDAPMRKYIKYYRDFVLELNKALAVDPRIEICMLPVGDGITLCRRIS  803
            DNTLW GSV  P DAPM  ++K  R  V+ELNK LA D R+EIC LPVGDGITLCRRIS
Sbjct  190  DNTLWFGSVAVPDDAPMLDFVKRLRGHVIELNKYLAKDSRVEICQLPVGDGITLCRRIS  248



>ref|NP_001242163.1| uncharacterized protein LOC100799303 [Glycine max]
 gb|ACU20512.1| unknown [Glycine max]
Length=247

 Score =   370 bits (951),  Expect = 7e-125, Method: Compositional matrix adjust.
 Identities = 179/237 (76%), Positives = 202/237 (85%), Gaps = 1/237 (0%)
 Frame = +3

Query  90   NQTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEGQ  269
            NQ   H+E+GHKSLLQSDALYQYILETSVYPRE E++KELRE+T KHPWNLM T  DEGQ
Sbjct  11   NQIAGHKELGHKSLLQSDALYQYILETSVYPREHESLKELRELTEKHPWNLMATPPDEGQ  70

Query  270  FLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAGV  449
             L MLLKLINAKNTMEIGV+TGYSLL+TALALP DGKILAMD+NRE YELGLPVIEKAGV
Sbjct  71   LLGMLLKLINAKNTMEIGVFTGYSLLSTALALPSDGKILAMDVNREYYELGLPVIEKAGV  130

Query  450  AHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIGYD  629
            AHKIDFREGPALP+LD L+++ K  G +DFI+VDADKDNYLNYHKR+I+LVK+GG+IGYD
Sbjct  131  AHKIDFREGPALPLLDVLIKNEKNKGAFDFIYVDADKDNYLNYHKRVIELVKLGGLIGYD  190

Query  630  NTLWNGSVVAPPDAPMRKYIKYYRDFVLELNKALAVDPRIEICMLPVGDGITLCRRI  800
            NTLWNGSVVAPPDAP+  Y+KYYRDFV+EL K L +         P+  G  LCRRI
Sbjct  191  NTLWNGSVVAPPDAPLMDYVKYYRDFVMELTKLLHLIQGSRFASFPLVMGY-LCRRI  246



>gb|AFK40182.1| unknown [Medicago truncatula]
Length=248

 Score =   370 bits (951),  Expect = 9e-125, Method: Compositional matrix adjust.
 Identities = 173/239 (72%), Positives = 202/239 (85%), Gaps = 0/239 (0%)
 Frame = +3

Query  87   ENQTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEG  266
            +NQ   H ++ HK+LLQSDALYQYIL+TSV+P E   +KELRE+T KHP NLM T ADEG
Sbjct  10   QNQIIGHTDLAHKTLLQSDALYQYILDTSVFPNEHPCLKELREMTEKHPRNLMATPADEG  69

Query  267  QFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAG  446
            Q + ML+KLINAKNTMEIGVYTGYSLL+T LALP DGK+LA+D++RE YELGLP+IEKAG
Sbjct  70   QLIRMLIKLINAKNTMEIGVYTGYSLLSTTLALPSDGKVLALDVSREYYELGLPIIEKAG  129

Query  447  VAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIGY  626
            +AHKIDFREGPALP+LDQL++D    G +DF+FVDADKDNYLNYH+R+IDLVKVGG+IGY
Sbjct  130  IAHKIDFREGPALPLLDQLIQDENNKGAFDFVFVDADKDNYLNYHERIIDLVKVGGLIGY  189

Query  627  DNTLWNGSVVAPPDAPMRKYIKYYRDFVLELNKALAVDPRIEICMLPVGDGITLCRRIS  803
            DNTLW GSV  P DAPM  ++K  R  V+ELNK LA D R+EIC LPVGDGITLCRRIS
Sbjct  190  DNTLWFGSVAVPDDAPMLDFVKRLRGHVIELNKYLAKDSRVEICQLPVGDGITLCRRIS  248



>ref|NP_001236240.1| uncharacterized protein LOC100305498 [Glycine max]
 gb|ACU13197.1| unknown [Glycine max]
 gb|KHN15625.1| Caffeoyl-CoA O-methyltransferase [Glycine soja]
Length=246

 Score =   370 bits (949),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 173/231 (75%), Positives = 204/231 (88%), Gaps = 0/231 (0%)
 Frame = +3

Query  108  QEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEGQFLSMLL  287
            +++GHK+LLQSDALYQYILETSVYPRE E +KE+R++TAKHP N+M T ADEGQ LSML+
Sbjct  15   KDLGHKTLLQSDALYQYILETSVYPREHECLKEIRKMTAKHPLNIMATPADEGQLLSMLV  74

Query  288  KLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAGVAHKIDF  467
            KL N+KN +EIGV+TGYSLL+TALALP DGKILA+D+NRE YELGLP+I+KAGVAHKIDF
Sbjct  75   KLTNSKNALEIGVFTGYSLLSTALALPPDGKILALDVNREYYELGLPIIQKAGVAHKIDF  134

Query  468  REGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIGYDNTLWNG  647
            REGPALP LD++++D  K G+ DF+FVDADKDNYLNYHKR+++LVK+GG+IGYDNTLW G
Sbjct  135  REGPALPFLDEMLKDENKKGSLDFVFVDADKDNYLNYHKRVLELVKIGGLIGYDNTLWAG  194

Query  648  SVVAPPDAPMRKYIKYYRDFVLELNKALAVDPRIEICMLPVGDGITLCRRI  800
            SV APPDAP+  YIK  R  V+ELNK LA D RIEIC LPVGDGITLCRRI
Sbjct  195  SVAAPPDAPLMDYIKPLRGHVMELNKYLAQDSRIEICQLPVGDGITLCRRI  245



>gb|AAQ89932.1| caffeoyl-CoA 3-O-methyltransferase 1 [Zea mays]
Length=242

 Score =   369 bits (947),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 186/236 (79%), Positives = 204/236 (86%), Gaps = 16/236 (7%)
 Frame = +3

Query  93   QTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEGQF  272
            Q TRH EVGHKSLL+SD LYQYIL+TSVYPREPE+MKELREVTAKHPWNLMTTSADEGQF
Sbjct  22   QKTRHSEVGHKSLLKSDDLYQYILDTSVYPREPESMKELREVTAKHPWNLMTTSADEGQF  81

Query  273  LSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAGVA  452
            L+ML+KLI AK TMEIGVYTGYSLLATALALP+DG ILAMDINRENYELGLP IEKAGVA
Sbjct  82   LNMLIKLIGAKKTMEIGVYTGYSLLATALALPEDGTILAMDINRENYELGLPCIEKAGVA  141

Query  453  HKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIGYDN  632
            HKIDFREGPALP+LD L+ +                DNYLNYH+RL+ LVK+GG+IGYDN
Sbjct  142  HKIDFREGPALPVLDDLIAE----------------DNYLNYHERLLKLVKLGGLIGYDN  185

Query  633  TLWNGSVVAPPDAPMRKYIKYYRDFVLELNKALAVDPRIEICMLPVGDGITLCRRI  800
            TLWNGSVV P DAPMRKYI++YRDFVL LNKALA D R+EIC LPVGDG+TLCRR+
Sbjct  186  TLWNGSVVLPDDAPMRKYIRFYRDFVLVLNKALAADDRVEICQLPVGDGVTLCRRV  241



>gb|AAQ89929.1| caffeoyl-CoA 3-O-methyltransferase 1 [Zea mays]
 gb|AFW75631.1| caffeoyl-CoA 3-O-methyltransferase 1 [Zea mays]
Length=242

 Score =   368 bits (945),  Expect = 5e-124, Method: Compositional matrix adjust.
 Identities = 185/236 (78%), Positives = 204/236 (86%), Gaps = 16/236 (7%)
 Frame = +3

Query  93   QTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEGQF  272
            Q TRH EVGHKSLL+SD LYQYIL+TSVYPREPE+MKELRE+TAKHPWNLMTTSADEGQF
Sbjct  22   QKTRHSEVGHKSLLKSDDLYQYILDTSVYPREPESMKELREITAKHPWNLMTTSADEGQF  81

Query  273  LSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAGVA  452
            L+ML+KLI AK TMEIGVYTGYSLLATALALP+DG ILAMDINRENYELGLP IEKAGVA
Sbjct  82   LNMLIKLIGAKKTMEIGVYTGYSLLATALALPEDGTILAMDINRENYELGLPCIEKAGVA  141

Query  453  HKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIGYDN  632
            HKIDFREGPALP+LD L+ +                DNYLNYH+RL+ LVK+GG+IGYDN
Sbjct  142  HKIDFREGPALPVLDDLIAE----------------DNYLNYHERLLKLVKLGGLIGYDN  185

Query  633  TLWNGSVVAPPDAPMRKYIKYYRDFVLELNKALAVDPRIEICMLPVGDGITLCRRI  800
            TLWNGSVV P DAPMRKYI++YRDFVL LNKALA D R+EIC LPVGDG+TLCRR+
Sbjct  186  TLWNGSVVLPDDAPMRKYIRFYRDFVLVLNKALAADDRVEICQLPVGDGVTLCRRV  241



>gb|KJB47338.1| hypothetical protein B456_008G024000 [Gossypium raimondii]
 gb|KJB47339.1| hypothetical protein B456_008G024000 [Gossypium raimondii]
Length=224

 Score =   365 bits (938),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 171/188 (91%), Positives = 186/188 (99%), Gaps = 0/188 (0%)
 Frame = +3

Query  237  NLMTTSADEGQFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYE  416
            NLMTTSADEGQFL+MLLKLINAKNTMEIGVYTGYSLLATALA+PDDGKILAMD+NRENYE
Sbjct  36   NLMTTSADEGQFLNMLLKLINAKNTMEIGVYTGYSLLATALAIPDDGKILAMDVNRENYE  95

Query  417  LGLPVIEKAGVAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLID  596
            LGLPVI+KAGVAHKIDF+EGPALP+LDQLVED K HG++DFIFVDADKDNYLNYHKRLI+
Sbjct  96   LGLPVIQKAGVAHKIDFKEGPALPVLDQLVEDEKNHGSFDFIFVDADKDNYLNYHKRLIE  155

Query  597  LVKVGGVIGYDNTLWNGSVVAPPDAPMRKYIKYYRDFVLELNKALAVDPRIEICMLPVGD  776
            LVKVGG+IGYDNTLWNGSVVAPPDAP+RKY++YYRDFV+ELNKALAVDPRIEICMLPVGD
Sbjct  156  LVKVGGLIGYDNTLWNGSVVAPPDAPLRKYVRYYRDFVMELNKALAVDPRIEICMLPVGD  215

Query  777  GITLCRRI  800
            GITLCRR+
Sbjct  216  GITLCRRV  223



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2584178199290