BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig13008

Length=818
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009624659.1|  PREDICTED: mechanosensitive ion channel prot...    340   4e-108   
ref|XP_009624658.1|  PREDICTED: mechanosensitive ion channel prot...    340   5e-108   Nicotiana tomentosiformis
ref|XP_009785640.1|  PREDICTED: mechanosensitive ion channel prot...    325   5e-102   Nicotiana sylvestris
ref|XP_009785633.1|  PREDICTED: mechanosensitive ion channel prot...    325   5e-102   Nicotiana sylvestris
ref|XP_009785624.1|  PREDICTED: mechanosensitive ion channel prot...    325   7e-102   Nicotiana sylvestris
ref|XP_002514042.1|  conserved hypothetical protein                     322   6e-101   Ricinus communis
ref|XP_011016936.1|  PREDICTED: mechanosensitive ion channel prot...    306   2e-96    Populus euphratica
ref|XP_006338061.1|  PREDICTED: mechanosensitive ion channel prot...    309   5e-96    Solanum tuberosum [potatoes]
ref|XP_010254531.1|  PREDICTED: mechanosensitive ion channel prot...    309   6e-96    
ref|XP_011016935.1|  PREDICTED: mechanosensitive ion channel prot...    306   6e-95    Populus euphratica
ref|XP_002302344.2|  hypothetical protein POPTR_0002s10610g             305   7e-95    
ref|XP_012068013.1|  PREDICTED: mechanosensitive ion channel prot...    300   1e-94    
ref|XP_010320209.1|  PREDICTED: mechanosensitive ion channel prot...    298   2e-93    Solanum lycopersicum
ref|XP_012068012.1|  PREDICTED: mechanosensitive ion channel prot...    299   6e-93    Jatropha curcas
emb|CDP11503.1|  unnamed protein product                                300   1e-92    Coffea canephora [robusta coffee]
ref|XP_010113430.1|  Mechanosensitive ion channel protein 2             302   1e-92    
ref|XP_012068009.1|  PREDICTED: mechanosensitive ion channel prot...    300   1e-92    Jatropha curcas
ref|XP_010320208.1|  PREDICTED: mechanosensitive ion channel prot...    298   4e-92    
ref|XP_009376225.1|  PREDICTED: mechanosensitive ion channel prot...    298   1e-91    Pyrus x bretschneideri [bai li]
ref|XP_008444925.1|  PREDICTED: mechanosensitive ion channel prot...    297   1e-91    Cucumis melo [Oriental melon]
ref|XP_010692397.1|  PREDICTED: mechanosensitive ion channel prot...    295   1e-91    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009376222.1|  PREDICTED: mechanosensitive ion channel prot...    297   1e-91    Pyrus x bretschneideri [bai li]
ref|XP_010061548.1|  PREDICTED: mechanosensitive ion channel prot...    297   1e-91    Eucalyptus grandis [rose gum]
gb|KHN08998.1|  Mechanosensitive ion channel protein 2, chloropla...    296   2e-91    Glycine soja [wild soybean]
ref|XP_008378589.1|  PREDICTED: mechanosensitive ion channel prot...    295   5e-91    
ref|XP_011099985.1|  PREDICTED: mechanosensitive ion channel prot...    296   7e-91    Sesamum indicum [beniseed]
ref|XP_006581505.1|  PREDICTED: mechanosensitive ion channel prot...    295   8e-91    Glycine max [soybeans]
ref|XP_010646793.1|  PREDICTED: mechanosensitive ion channel prot...    296   1e-90    Vitis vinifera
ref|XP_007018223.1|  MSCS-like 3 isoform 2                              289   1e-90    
ref|XP_008378585.1|  PREDICTED: mechanosensitive ion channel prot...    295   1e-90    
ref|XP_008378588.1|  PREDICTED: mechanosensitive ion channel prot...    295   1e-90    
ref|XP_010277500.1|  PREDICTED: mechanosensitive ion channel prot...    295   2e-90    Nelumbo nucifera [Indian lotus]
ref|XP_008368109.1|  PREDICTED: mechanosensitive ion channel prot...    285   3e-90    
ref|XP_006383812.1|  hypothetical protein POPTR_0005s28410g             288   4e-90    
ref|XP_010942788.1|  PREDICTED: mechanosensitive ion channel prot...    292   6e-90    Elaeis guineensis
gb|KHN08265.1|  Mechanosensitive ion channel protein 2, chloropla...    291   6e-90    Glycine soja [wild soybean]
ref|XP_012081663.1|  PREDICTED: mechanosensitive ion channel prot...    293   2e-89    Jatropha curcas
ref|XP_004299731.1|  PREDICTED: mechanosensitive ion channel prot...    290   2e-89    Fragaria vesca subsp. vesca
ref|XP_004152598.1|  PREDICTED: mechanosensitive ion channel prot...    291   2e-89    Cucumis sativus [cucumbers]
ref|XP_008339021.1|  PREDICTED: mechanosensitive ion channel prot...    286   3e-89    
gb|KJB48897.1|  hypothetical protein B456_008G092700                    291   4e-89    Gossypium raimondii
gb|KDO60564.1|  hypothetical protein CISIN_1g0049741mg                  289   4e-89    Citrus sinensis [apfelsine]
gb|KJB48898.1|  hypothetical protein B456_008G092700                    291   4e-89    Gossypium raimondii
gb|KDO60566.1|  hypothetical protein CISIN_1g0049741mg                  289   4e-89    Citrus sinensis [apfelsine]
ref|XP_003522763.1|  PREDICTED: mechanosensitive ion channel prot...    290   5e-89    Glycine max [soybeans]
ref|XP_006433825.1|  hypothetical protein CICLE_v10000465mg             290   7e-89    
ref|XP_008347792.1|  PREDICTED: mechanosensitive ion channel prot...    286   9e-89    
ref|XP_007136335.1|  hypothetical protein PHAVU_009G036900g             289   1e-88    Phaseolus vulgaris [French bean]
ref|XP_006466311.1|  PREDICTED: mechanosensitive ion channel prot...    288   1e-88    Citrus sinensis [apfelsine]
ref|XP_007018222.1|  MSCS-like 3 isoform 1                              289   2e-88    
ref|XP_007047788.1|  MSCS-like 2                                        290   3e-88    
ref|XP_006426270.1|  hypothetical protein CICLE_v10024979mg             289   4e-88    Citrus clementina [clementine]
ref|XP_008347791.1|  PREDICTED: mechanosensitive ion channel prot...    285   4e-88    
ref|XP_006426271.1|  hypothetical protein CICLE_v10024979mg             288   4e-88    Citrus clementina [clementine]
ref|XP_008219266.1|  PREDICTED: LOW QUALITY PROTEIN: mechanosensi...    288   4e-88    
gb|KHF99185.1|  Mechanosensitive ion channel 3, chloroplastic -li...    288   4e-88    Gossypium arboreum [tree cotton]
ref|XP_008808855.1|  PREDICTED: mechanosensitive ion channel prot...    287   5e-88    
gb|KEH35729.1|  mechanosensitive ion channel-like protein               284   5e-88    Medicago truncatula
ref|XP_006466310.1|  PREDICTED: mechanosensitive ion channel prot...    288   6e-88    
ref|XP_010664408.1|  PREDICTED: mechanosensitive ion channel prot...    287   6e-88    Vitis vinifera
ref|XP_006466309.1|  PREDICTED: mechanosensitive ion channel prot...    288   8e-88    Citrus sinensis [apfelsine]
ref|XP_011097477.1|  PREDICTED: mechanosensitive ion channel prot...    287   9e-88    Sesamum indicum [beniseed]
ref|XP_010664407.1|  PREDICTED: mechanosensitive ion channel prot...    287   9e-88    Vitis vinifera
ref|XP_006466307.1|  PREDICTED: mechanosensitive ion channel prot...    288   1e-87    Citrus sinensis [apfelsine]
gb|KJB64155.1|  hypothetical protein B456_010G034900                    283   1e-87    Gossypium raimondii
ref|XP_010938975.1|  PREDICTED: mechanosensitive ion channel prot...    286   2e-87    Elaeis guineensis
ref|XP_007225517.1|  hypothetical protein PRUPE_ppa002132mg             286   2e-87    Prunus persica
ref|XP_010027956.1|  PREDICTED: mechanosensitive ion channel prot...    286   2e-87    
ref|XP_010027955.1|  PREDICTED: mechanosensitive ion channel prot...    286   3e-87    
gb|KDO60565.1|  hypothetical protein CISIN_1g0049741mg                  284   3e-87    Citrus sinensis [apfelsine]
ref|XP_006573004.1|  PREDICTED: mechanosensitive ion channel prot...    285   3e-87    
ref|XP_006573003.1|  PREDICTED: mechanosensitive ion channel prot...    285   7e-87    Glycine max [soybeans]
gb|KHN38877.1|  Mechanosensitive ion channel protein 2, chloropla...    284   8e-87    Glycine soja [wild soybean]
gb|KHN14509.1|  Mechanosensitive ion channel protein 2, chloropla...    285   8e-87    Glycine soja [wild soybean]
ref|XP_007208164.1|  hypothetical protein PRUPE_ppa003749mg             281   8e-87    
ref|XP_006573000.1|  PREDICTED: mechanosensitive ion channel prot...    285   1e-86    Glycine max [soybeans]
ref|XP_006472464.1|  PREDICTED: mechanosensitive ion channel prot...    284   1e-86    
ref|XP_006472467.1|  PREDICTED: mechanosensitive ion channel prot...    283   2e-86    
ref|XP_008787196.1|  PREDICTED: mechanosensitive ion channel prot...    282   2e-86    Phoenix dactylifera
ref|XP_003533418.1|  PREDICTED: mechanosensitive ion channel prot...    283   3e-86    Glycine max [soybeans]
gb|KDO81178.1|  hypothetical protein CISIN_1g009063mg                   278   3e-86    Citrus sinensis [apfelsine]
ref|XP_003602909.1|  MscS family inner membrane protein ynaI            283   3e-86    Medicago truncatula
gb|KDO81177.1|  hypothetical protein CISIN_1g009063mg                   279   3e-86    Citrus sinensis [apfelsine]
gb|KDO81175.1|  hypothetical protein CISIN_1g009063mg                   279   3e-86    Citrus sinensis [apfelsine]
ref|XP_008787195.1|  PREDICTED: mechanosensitive ion channel prot...    282   3e-86    Phoenix dactylifera
ref|XP_010938976.1|  PREDICTED: mechanosensitive ion channel prot...    279   4e-86    Elaeis guineensis
gb|KJB64153.1|  hypothetical protein B456_010G034900                    282   4e-86    Gossypium raimondii
ref|XP_007047790.1|  MSCS-like 2                                        279   5e-86    
ref|XP_009350348.1|  PREDICTED: mechanosensitive ion channel prot...    283   5e-86    Pyrus x bretschneideri [bai li]
gb|ABJ96380.1|  expressed protein                                       282   5e-86    Prunus persica
ref|XP_009797996.1|  PREDICTED: mechanosensitive ion channel prot...    283   5e-86    Nicotiana sylvestris
ref|XP_009350349.1|  PREDICTED: mechanosensitive ion channel prot...    283   6e-86    Pyrus x bretschneideri [bai li]
ref|XP_009350350.1|  PREDICTED: mechanosensitive ion channel prot...    283   6e-86    Pyrus x bretschneideri [bai li]
ref|XP_006353171.1|  PREDICTED: mechanosensitive ion channel prot...    283   6e-86    
ref|XP_002533682.1|  conserved hypothetical protein                     281   7e-86    
ref|XP_006353168.1|  PREDICTED: mechanosensitive ion channel prot...    283   7e-86    
gb|KJB18176.1|  hypothetical protein B456_003G037900                    281   1e-85    Gossypium raimondii
gb|AES96006.2|  mechanosensitive ion channel-like protein               281   1e-85    Medicago truncatula
ref|XP_007158369.1|  hypothetical protein PHAVU_002G147200g             281   1e-85    Phaseolus vulgaris [French bean]
gb|AGI05086.1|  mechanosensitive channel of small conductance-lik...    281   1e-85    Gossypium aridum
ref|XP_008236146.1|  PREDICTED: mechanosensitive ion channel prot...    282   2e-85    Prunus mume [ume]
ref|XP_010523353.1|  PREDICTED: mechanosensitive ion channel prot...    271   2e-85    Tarenaya hassleriana [spider flower]
emb|CBI19266.3|  unnamed protein product                                276   3e-85    Vitis vinifera
ref|XP_009608143.1|  PREDICTED: mechanosensitive ion channel prot...    281   3e-85    Nicotiana tomentosiformis
emb|CDX97019.1|  BnaC09g46060D                                          280   4e-85    
ref|XP_010523354.1|  PREDICTED: mechanosensitive ion channel prot...    271   5e-85    Tarenaya hassleriana [spider flower]
gb|AAL06497.1|AF412044_1  AT5g10490/F12B17_160                          275   6e-85    Arabidopsis thaliana [mouse-ear cress]
ref|XP_004288512.1|  PREDICTED: mechanosensitive ion channel prot...    280   6e-85    Fragaria vesca subsp. vesca
emb|CDP01563.1|  unnamed protein product                                279   1e-84    Coffea canephora [robusta coffee]
ref|XP_004250148.1|  PREDICTED: mechanosensitive ion channel prot...    280   1e-84    Solanum lycopersicum
ref|XP_010523311.1|  PREDICTED: mechanosensitive ion channel prot...    275   1e-84    Tarenaya hassleriana [spider flower]
ref|XP_010938974.1|  PREDICTED: mechanosensitive ion channel prot...    278   1e-84    Elaeis guineensis
ref|XP_009122047.1|  PREDICTED: mechanosensitive ion channel prot...    277   4e-84    Brassica rapa
ref|XP_010453075.1|  PREDICTED: mechanosensitive ion channel prot...    276   8e-84    Camelina sativa [gold-of-pleasure]
ref|XP_010453078.1|  PREDICTED: mechanosensitive ion channel prot...    276   8e-84    
ref|XP_002873462.1|  hypothetical protein ARALYDRAFT_909005             276   1e-83    Arabidopsis lyrata subsp. lyrata
emb|CAN78779.1|  hypothetical protein VITISV_029753                     276   2e-83    Vitis vinifera
ref|NP_001078567.1|  mechanosensitive ion channel protein 2             274   3e-83    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010422837.1|  PREDICTED: mechanosensitive ion channel prot...    274   5e-83    
ref|XP_010523306.1|  PREDICTED: mechanosensitive ion channel prot...    274   5e-83    Tarenaya hassleriana [spider flower]
ref|NP_568230.2|  mechanosensitive ion channel protein 2                274   5e-83    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010422836.1|  PREDICTED: mechanosensitive ion channel prot...    274   5e-83    Camelina sativa [gold-of-pleasure]
emb|CDX69828.1|  BnaA10g21770D                                          274   5e-83    
ref|XP_010511097.1|  PREDICTED: mechanosensitive ion channel prot...    265   6e-83    
ref|NP_001190278.1|  mechanosensitive ion channel protein 2             274   6e-83    Arabidopsis thaliana [mouse-ear cress]
ref|XP_011021849.1|  PREDICTED: mechanosensitive ion channel prot...    275   6e-83    Populus euphratica
ref|XP_002310309.2|  hypothetical protein POPTR_0007s14270g             275   1e-82    Populus trichocarpa [western balsam poplar]
ref|XP_009414411.1|  PREDICTED: mechanosensitive ion channel prot...    273   1e-82    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010680344.1|  PREDICTED: mechanosensitive ion channel prot...    271   2e-82    
ref|XP_006399547.1|  hypothetical protein EUTSA_v10012873mg             273   2e-82    Eutrema salsugineum [saltwater cress]
gb|ERN14408.1|  hypothetical protein AMTR_s00033p00237950               274   3e-82    Amborella trichopoda
gb|EYU30934.1|  hypothetical protein MIMGU_mgv1a002338mg                271   7e-82    Erythranthe guttata [common monkey flower]
ref|XP_011626432.1|  PREDICTED: mechanosensitive ion channel prot...    273   1e-81    Amborella trichopoda
ref|XP_010491722.1|  PREDICTED: mechanosensitive ion channel prot...    270   1e-81    
ref|XP_010491720.1|  PREDICTED: mechanosensitive ion channel prot...    270   1e-81    Camelina sativa [gold-of-pleasure]
ref|XP_010680343.1|  PREDICTED: mechanosensitive ion channel prot...    271   2e-81    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006289477.1|  hypothetical protein CARUB_v10003006mg             270   2e-81    Capsella rubella
ref|XP_008452178.1|  PREDICTED: mechanosensitive ion channel prot...    268   2e-81    Cucumis melo [Oriental melon]
emb|CBI19267.3|  unnamed protein product                                266   4e-81    Vitis vinifera
emb|CAN78780.1|  hypothetical protein VITISV_029754                     265   1e-80    Vitis vinifera
ref|XP_008452176.1|  PREDICTED: mechanosensitive ion channel prot...    267   2e-80    Cucumis melo [Oriental melon]
ref|XP_006300816.1|  hypothetical protein CARUB_v10019907mg             267   2e-80    
ref|XP_008452177.1|  PREDICTED: mechanosensitive ion channel prot...    266   3e-80    Cucumis melo [Oriental melon]
ref|XP_002888236.1|  hypothetical protein ARALYDRAFT_475431             266   4e-80    
ref|XP_002283834.2|  PREDICTED: mechanosensitive ion channel prot...    263   8e-80    Vitis vinifera
ref|XP_008452175.1|  PREDICTED: mechanosensitive ion channel prot...    266   1e-79    Cucumis melo [Oriental melon]
ref|XP_008452168.1|  PREDICTED: mechanosensitive ion channel prot...    266   2e-79    Cucumis melo [Oriental melon]
emb|CAB89394.1|  putative protein                                       259   2e-79    Arabidopsis thaliana [mouse-ear cress]
ref|XP_011650599.1|  PREDICTED: mechanosensitive ion channel prot...    265   3e-79    Cucumis sativus [cucumbers]
ref|XP_003613048.1|  MscS-Like mechanosensitive ion channel MSCL8       265   4e-79    
ref|XP_010470275.1|  PREDICTED: mechanosensitive ion channel prot...    263   4e-79    
emb|CDY60030.1|  BnaCnng35660D                                          263   6e-79    Brassica napus [oilseed rape]
ref|XP_006392321.1|  hypothetical protein EUTSA_v10023336mg             262   7e-79    
ref|NP_176116.2|  MSCS-like 3                                           263   1e-78    Arabidopsis thaliana [mouse-ear cress]
gb|AAG50956.1|AC073943_6  unknown protein                               262   1e-78    Arabidopsis thaliana [mouse-ear cress]
ref|XP_007136336.1|  hypothetical protein PHAVU_009G037000g             261   2e-78    Phaseolus vulgaris [French bean]
gb|EPS67304.1|  hypothetical protein M569_07470                         254   8e-78    Genlisea aurea
ref|XP_010548858.1|  PREDICTED: mechanosensitive ion channel prot...    256   1e-77    Tarenaya hassleriana [spider flower]
ref|XP_009131165.1|  PREDICTED: mechanosensitive ion channel prot...    259   1e-77    Brassica rapa
ref|XP_009386274.1|  PREDICTED: mechanosensitive ion channel prot...    259   2e-77    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010548853.1|  PREDICTED: mechanosensitive ion channel prot...    256   2e-77    Tarenaya hassleriana [spider flower]
emb|CDY66218.1|  BnaAnng21790D                                          258   4e-77    Brassica napus [oilseed rape]
gb|AAZ66947.1|  117M18_28                                               257   5e-77    Brassica rapa
emb|CDX78385.1|  BnaA03g02970D                                          257   8e-77    
emb|CDY68875.1|  BnaCnng60870D                                          257   8e-77    Brassica napus [oilseed rape]
ref|XP_010548833.1|  PREDICTED: mechanosensitive ion channel prot...    256   8e-77    Tarenaya hassleriana [spider flower]
ref|XP_010548845.1|  PREDICTED: mechanosensitive ion channel prot...    256   9e-77    Tarenaya hassleriana [spider flower]
ref|XP_010544066.1|  PREDICTED: mechanosensitive ion channel prot...    251   2e-76    
ref|XP_009102692.1|  PREDICTED: mechanosensitive ion channel prot...    256   2e-76    Brassica rapa
ref|XP_009102701.1|  PREDICTED: mechanosensitive ion channel prot...    256   3e-76    Brassica rapa
ref|XP_010544067.1|  PREDICTED: mechanosensitive ion channel prot...    250   4e-76    
emb|CDY46875.1|  BnaC01g27790D                                          254   5e-76    Brassica napus [oilseed rape]
ref|XP_006581504.1|  PREDICTED: mechanosensitive ion channel prot...    254   1e-75    Glycine max [soybeans]
ref|XP_010544065.1|  PREDICTED: mechanosensitive ion channel prot...    250   2e-75    Tarenaya hassleriana [spider flower]
gb|AES73164.2|  mechanosensitive ion channel-like protein               249   3e-74    Medicago truncatula
ref|XP_003602913.1|  MscS-Like mechanosensitive ion channel MSCL8       249   6e-74    
gb|KHG03496.1|  Mechanosensitive ion channel 2, chloroplastic -li...    244   2e-71    Gossypium arboreum [tree cotton]
ref|XP_004501642.1|  PREDICTED: mechanosensitive ion channel prot...    238   3e-70    Cicer arietinum [garbanzo]
ref|XP_004501641.1|  PREDICTED: mechanosensitive ion channel prot...    238   4e-70    Cicer arietinum [garbanzo]
gb|EEC75542.1|  hypothetical protein OsI_12168                          230   1e-69    Oryza sativa Indica Group [Indian rice]
ref|XP_001757514.1|  MscS-Like mechanosensitive ion channel MSCL8       231   3e-69    
gb|KJB64154.1|  hypothetical protein B456_010G034900                    236   8e-69    Gossypium raimondii
ref|XP_002465080.1|  hypothetical protein SORBIDRAFT_01g031710          230   1e-68    
ref|XP_001765846.1|  MscS-Like mechanosensitive ion channel MSCL9       229   3e-68    
gb|EEE59315.1|  hypothetical protein OsJ_11375                          230   3e-67    Oryza sativa Japonica Group [Japonica rice]
gb|AAS07290.1|  putative mechanosensitive ion channel protein           229   2e-66    Oryza sativa Japonica Group [Japonica rice]
ref|XP_001763022.1|  MscS-Like mechanosensitive ion channel MSCL10      219   7e-66    
ref|XP_008657401.1|  PREDICTED: mechanosensitive ion channel prot...    227   1e-65    Zea mays [maize]
ref|XP_003562370.1|  PREDICTED: mechanosensitive ion channel prot...    227   3e-65    Brachypodium distachyon [annual false brome]
gb|EMT08062.1|  MscS family inner membrane protein ynaI                 221   3e-65    
ref|XP_004983930.1|  PREDICTED: mechanosensitive ion channel prot...    224   2e-64    Setaria italica
gb|EMS62699.1|  MscS family inner membrane protein ynaI                 219   2e-64    Triticum urartu
ref|XP_004983929.1|  PREDICTED: mechanosensitive ion channel prot...    224   2e-64    Setaria italica
gb|ABF96777.1|  Transposable element protein, putative, MuDR, exp...    228   1e-63    Oryza sativa Japonica Group [Japonica rice]
ref|XP_002980284.1|  hypothetical protein SELMODRAFT_112712             220   2e-63    
ref|XP_006663776.1|  PREDICTED: mechanosensitive ion channel prot...    220   8e-63    
ref|XP_006663175.1|  PREDICTED: mechanosensitive ion channel prot...    220   8e-63    
dbj|BAK02907.1|  predicted protein                                      218   1e-62    Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AAG50758.1|AC079131_3  unknown protein                               219   2e-62    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010227139.1|  PREDICTED: mechanosensitive ion channel prot...    219   2e-62    
ref|XP_002970731.1|  hypothetical protein SELMODRAFT_94155              210   2e-60    
ref|XP_002969394.1|  hypothetical protein SELMODRAFT_170827             206   4e-59    
ref|XP_002963051.1|  hypothetical protein SELMODRAFT_61619              206   2e-58    
ref|XP_006380805.1|  hypothetical protein POPTR_0007s14270g             208   3e-58    
ref|XP_001751467.1|  MscS-Like mechanosensitive ion channel MSCL11      199   3e-58    
gb|KHG22140.1|  Mechanosensitive ion channel 2, chloroplastic -li...    205   2e-57    Gossypium arboreum [tree cotton]
ref|XP_010107673.1|  Mechanosensitive ion channel protein 3             191   1e-53    
gb|EMT29563.1|  MscS family inner membrane protein ynaI                 167   8e-44    
emb|CBI38268.3|  unnamed protein product                                156   2e-40    Vitis vinifera
gb|EYU39301.1|  hypothetical protein MIMGU_mgv1a007350mg                154   3e-40    Erythranthe guttata [common monkey flower]
emb|CAN79156.1|  hypothetical protein VITISV_004652                     142   2e-36    Vitis vinifera
gb|EPS73305.1|  hypothetical protein M569_01452                         142   5e-36    Genlisea aurea
gb|KEH35730.1|  mechanosensitive ion channel-like protein               139   2e-34    Medicago truncatula
gb|EYU39302.1|  hypothetical protein MIMGU_mgv11b010457mg               106   1e-23    Erythranthe guttata [common monkey flower]
ref|XP_010107674.1|  hypothetical protein L484_007692                   104   1e-22    
gb|AAK84478.1|  unknown                                               95.1    2e-18    Solanum lycopersicum
ref|XP_010414765.1|  PREDICTED: mechanosensitive ion channel prot...  84.0    5e-15    Camelina sativa [gold-of-pleasure]
ref|XP_010414763.1|  PREDICTED: mechanosensitive ion channel prot...  84.0    6e-15    Camelina sativa [gold-of-pleasure]
ref|XP_005645721.1|  hypothetical protein COCSUDRAFT_48305            81.3    6e-14    Coccomyxa subellipsoidea C-169
ref|XP_002948588.1|  hypothetical protein VOLCADRAFT_116855           80.9    1e-13    Volvox carteri f. nagariensis
ref|NP_001050432.2|  Os03g0432900                                     75.1    1e-12    
gb|KHN08264.1|  Mechanosensitive ion channel protein 2, chloropla...  74.3    1e-12    Glycine soja [wild soybean]
gb|KIZ07438.1|  hypothetical protein MNEG_0512                        74.3    1e-11    Monoraphidium neglectum
emb|CDP01542.1|  unnamed protein product                              68.9    2e-11    Coffea canephora [robusta coffee]
ref|WP_033315790.1|  mechanosensitive ion channel protein MscS        72.8    2e-11    
ref|XP_001700183.1|  predicted protein                                72.0    7e-11    Chlamydomonas reinhardtii
ref|WP_005164915.1|  MscS family inner membrane protein YnaI          70.1    2e-10    Yersinia enterocolitica
emb|CCV61499.1|  putative inner membrane protein                      69.7    3e-10    Yersinia enterocolitica (type O:2) str. YE3094/96
ref|WP_005170249.1|  MscS family inner membrane protein YnaI          69.3    3e-10    Yersinia enterocolitica
gb|AES73162.2|  transmembrane protein, putative                       68.2    7e-10    Medicago truncatula
gb|EEG85646.1|  transporter, small conductance mechanosensitive i...  66.6    7e-10    Proteus penneri ATCC 35198
ref|XP_005703860.1|  small conductance mechanosensitive ion chann...  68.9    9e-10    Galdieria sulphuraria
ref|WP_019083007.1|  MscS family inner membrane protein YnaI          68.2    1e-09    Yersinia enterocolitica
ref|WP_019079245.1|  MscS family inner membrane protein YnaI          67.8    1e-09    Yersinia enterocolitica
ref|WP_004926073.1|  MscS family inner membrane protein YnaI          67.8    1e-09    Providencia stuartii
ref|WP_018078636.1|  mechanosensitive ion channel protein MscS        67.0    2e-09    Thiobacillus denitrificans
ref|XP_003602911.1|  hypothetical protein MTR_3g100300                67.0    2e-09    
ref|WP_008284617.1|  mechanosensitive ion channel protein MscS        66.2    5e-09    gamma proteobacterium HTCC5015
ref|XP_003602813.1|  MscS-Like mechanosensitive ion channel MSCL9     63.5    5e-09    
ref|WP_009601185.1|  mechanosensitive ion channel protein MscS        65.1    1e-08    Vibrio caribbeanicus
ref|XP_002508793.1|  small conductance mechanosensitive ion chann...  65.1    1e-08    Micromonas commoda
ref|WP_038632473.1|  MULTISPECIES: mechanosensitive ion channel p...  64.3    2e-08    Yersinia
ref|WP_044715856.1|  mechanosensitive ion channel protein MscS        61.6    2e-08    
ref|WP_017009462.1|  mechanosensitive ion channel protein MscS        64.3    2e-08    Enterovibrio norvegicus
ref|WP_017013083.1|  mechanosensitive ion channel protein MscS        64.3    2e-08    Enterovibrio norvegicus
ref|WP_033535597.1|  mechanosensitive ion channel protein MscS        64.3    2e-08    
ref|WP_008316639.1|  MscS family inner membrane protein YnaI          64.3    2e-08    Wohlfahrtiimonas chitiniclastica
ref|WP_038854474.1|  mechanosensitive ion channel protein MscS        64.3    2e-08    
ref|WP_008913805.1|  MscS family inner membrane protein YnaI          64.3    2e-08    Providencia burhodogranariea
emb|CDL40380.1|  Mechanosensitive ion channel                         62.8    3e-08    Escherichia coli ISC11
gb|EUC95421.1|  MscS family inner membrane protein YnaI               63.2    3e-08    Providencia alcalifaciens PAL-2
ref|WP_036237682.1|  mechanosensitive ion channel protein MscS        63.5    3e-08    
ref|WP_023194594.1|  MscS family inner membrane protein YnaI          61.2    3e-08    
emb|CFR12242.1|  putative inner membrane protein                      63.5    4e-08    Yersinia kristensenii
gb|ESO41038.1|  MscS family inner membrane protein YnaI               61.6    5e-08    Salmonella enterica subsp. enterica serovar Agona str. 400095 11
gb|EIE57201.1|  transporter, small conductance mechanosensitive i...  60.8    5e-08    Escherichia coli AI27
ref|WP_041029752.1|  mechanosensitive ion channel protein MscS        60.8    5e-08    
ref|WP_000313279.1|  MscS family inner membrane protein YnaI          60.8    6e-08    Escherichia coli [E. coli]
ref|WP_044325244.1|  mechanosensitive ion channel protein MscS        60.1    6e-08    Escherichia coli [E. coli]
ref|WP_004241219.1|  Mechanosensitive ion channel                     62.8    7e-08    Morganella morganii
gb|KDQ94769.1|  mechanosensitive ion channel protein MscS             60.5    7e-08    
ref|WP_029938204.1|  mechanosensitive ion channel protein MscS        62.8    7e-08    Piscirickettsiaceae
gb|ENE13632.1|  mechanosensitive ion channel family protein           61.2    7e-08    Escherichia coli P0304799.3
ref|WP_042028944.1|  mechanosensitive ion channel protein MscS        60.1    7e-08    
gb|ERL62853.1|  mechanosensitive ion channel family protein           62.8    7e-08    Piscirickettsia salmonis LF-89 = ATCC VR-1361
ref|WP_015422274.1|  MULTISPECIES: Mechanosensitive ion channel       62.4    7e-08    Morganella
gb|KFU18722.1|  mechanosensitive ion channel protein MscS             60.5    8e-08    Salmonella enterica subsp. enterica serovar Bareilly str. CFSAN000195
ref|WP_036818991.1|  mechanosensitive ion channel protein MscS        62.0    8e-08    
ref|WP_032336573.1|  mechanosensitive ion channel protein MscS        60.5    8e-08    Escherichia coli [E. coli]
gb|ESH16745.1|  MscS family inner membrane protein YnaI               60.8    9e-08    Salmonella enterica subsp. enterica serovar Gaminara str. ATCC BAA-711
ref|WP_042027615.1|  mechanosensitive ion channel protein MscS        59.7    9e-08    
ref|WP_041026332.1|  mechanosensitive ion channel protein MscS        60.5    9e-08    
gb|ABB41890.1|  Small conductance mechanosensitive (MscS-family) ...  62.4    9e-08    Hydrogenovibrio crunogenus XCL-2
ref|WP_032126617.1|  mechanosensitive ion channel protein MscS        62.4    9e-08    
emb|CDL26450.1|  Mechanosensitive ion channel                         60.5    1e-07    Escherichia coli ISC7
ref|WP_004392742.1|  MscS family inner membrane protein YnaI          62.0    1e-07    Yersinia kristensenii
gb|EEO26986.2|  hypothetical protein OFAG_00139                       62.0    1e-07    Oxalobacter formigenes HOxBLS
ref|WP_011936827.1|  small mechanosensitive ion channel protein MscS  62.0    1e-07    Synechococcus sp. RCC307
ref|WP_033558786.1|  mechanosensitive ion channel protein MscS        59.3    1e-07    
dbj|BAP13935.1|  putative MscS family transporter                     62.0    1e-07    
ref|WP_002440424.1|  MscS family inner membrane protein YnaI          62.0    1e-07    
gb|KFR54737.1|  mechanosensitive ion channel protein MscS             60.1    1e-07    
gb|AGE94475.1|  hypothetical protein                                  62.0    1e-07    
ref|WP_040721460.1|  mechanosensitive ion channel protein MscS        62.0    1e-07    
ref|WP_045442480.1|  mechanosensitive ion channel protein MscS        62.0    1e-07    
gb|KHE05076.1|  mechanosensitive ion channel protein MscS             62.0    1e-07    
ref|WP_023972673.1|  hypothetical protein                             60.5    1e-07    
ref|WP_035458474.1|  mechanosensitive ion channel protein MscS        62.0    1e-07    
ref|WP_011588303.1|  mechanosensitive ion channel protein MscS        62.0    1e-07    
ref|WP_016153205.1|  MscS family inner membrane protein ynaI          61.6    1e-07    
ref|WP_040724011.1|  mechanosensitive ion channel protein MscS        61.6    2e-07    
ref|WP_025152511.1|  mechanosensitive ion channel protein MscS        61.6    2e-07    
ref|WP_036934697.1|  mechanosensitive ion channel protein MscS        61.6    2e-07    
ref|WP_045137734.1|  mechanosensitive ion channel protein MscS        61.6    2e-07    
ref|WP_016156625.1|  MscS family inner membrane protein ynaI          61.2    2e-07    
ref|XP_005537905.1|  similar to small conductance mechanosensitiv...  61.6    2e-07    
ref|WP_042318817.1|  mechanosensitive ion channel protein MscS        61.2    2e-07    
ref|WP_008175085.1|  mechanosensitive ion channel protein MscS        61.2    2e-07    
ref|WP_004914997.1|  MscS family inner membrane protein YnaI          60.8    2e-07    
ref|WP_005126623.1|  MscS family inner membrane protein YnaI          60.8    3e-07    
ref|WP_006684380.1|  MscS family inner membrane protein YnaI          60.8    3e-07    
ref|WP_004260937.1|  MscS family inner membrane protein YnaI          60.8    3e-07    
ref|WP_004581786.1|  small-conductance mechanosensitive channel       60.8    3e-07    
ref|WP_006658299.1|  MscS family inner membrane protein YnaI          60.5    3e-07    
ref|WP_006815975.1|  MscS family inner membrane protein YnaI          60.5    4e-07    
ref|WP_028025766.1|  mechanosensitive ion channel protein MscS        60.5    4e-07    
ref|WP_023136049.1|  MscS family inner membrane protein YnaI          59.7    4e-07    
ref|WP_001491943.1|  mechanosensitive ion channel family protein      59.3    4e-07    
gb|EHU60419.1|  mechanosensitive ion channel family protein           59.3    4e-07    
ref|WP_004244256.1|  MscS family inner membrane protein YnaI          60.1    5e-07    
ref|WP_020946119.1|  mechanosensitive ion channel protein             60.1    5e-07    
gb|EGI22716.1|  MscS family inner membrane protein YnaI               59.3    5e-07    
gb|EAR17871.1|  small mechanosensitive ion channel, MscS family p...  60.1    5e-07    
ref|WP_007153919.1|  mechanosensitive ion channel protein MscS        60.1    5e-07    
ref|WP_038004617.1|  mechanosensitive ion channel protein MscS        60.1    5e-07    
ref|WP_034855455.1|  mechanosensitive ion channel protein MscS        60.1    5e-07    
ref|WP_000906784.1|  mechanosensitive ion channel protein             59.3    6e-07    
gb|KGP97345.1|  mechanosensitive ion channel protein MscS             60.1    6e-07    
ref|WP_036955051.1|  mechanosensitive ion channel protein MscS        59.7    6e-07    
ref|WP_038640842.1|  mechanosensitive ion channel protein MscS        59.7    7e-07    
ref|WP_036772103.1|  mechanosensitive ion channel protein MscS        59.7    7e-07    
ref|WP_029653984.1|  mechanosensitive ion channel protein MscS        59.7    8e-07    
ref|WP_043016196.1|  mechanosensitive ion channel protein MscS        59.7    8e-07    
ref|WP_020996379.1|  MscS family inner membrane protein ynaI          59.7    8e-07    
ref|WP_007150993.1|  mechanosensitive ion channel protein MscS        59.7    8e-07    
ref|WP_014577578.1|  mechanosensitive ion channel protein MscS        59.7    8e-07    
ref|WP_013639635.1|  mechanosensitive ion channel protein             59.3    9e-07    
ref|WP_042308171.1|  mechanosensitive ion channel protein MscS        59.3    9e-07    
ref|WP_032935616.1|  mechanosensitive ion channel protein MscS        59.3    1e-06    
ref|WP_003843943.1|  MULTISPECIES: MscS family inner membrane pro...  59.3    1e-06    
ref|WP_045722113.1|  mechanosensitive ion channel protein MscS        58.5    1e-06    
ref|WP_044710863.1|  mechanosensitive ion channel protein MscS        59.3    1e-06    
ref|WP_007422658.1|  mechanosensitive ion channel protein             59.3    1e-06    
ref|WP_003833232.1|  MscS family inner membrane protein YnaI          59.3    1e-06    
ref|WP_003020406.1|  MULTISPECIES: MscS family inner membrane pro...  59.3    1e-06    
ref|WP_044700098.1|  mechanosensitive ion channel protein MscS        59.3    1e-06    
ref|WP_034841571.1|  mechanosensitive ion channel protein MscS        59.3    1e-06    
gb|KEQ15053.1|  mechanosensitive ion channel protein MscS             58.9    1e-06    
ref|WP_003840804.1|  MscS family inner membrane protein YnaI          58.9    1e-06    
ref|WP_044699007.1|  mechanosensitive ion channel protein MscS        58.9    1e-06    
ref|XP_003056826.1|  small conductance mechanosensitive ion chann...  59.3    1e-06    
ref|WP_032943577.1|  mechanosensitive ion channel protein MscS        58.9    1e-06    
ref|WP_044386327.1|  mechanosensitive ion channel protein MscS        58.9    1e-06    
ref|WP_023582616.1|  mechanosensitive ion channel protein             58.9    1e-06    
ref|WP_042848870.1|  mechanosensitive ion channel protein MscS        58.9    1e-06    
ref|WP_043564695.1|  mechanosensitive ion channel protein MscS        58.9    1e-06    
ref|WP_008916915.1|  MscS family inner membrane protein YnaI          58.5    2e-06    
ref|WP_011785410.1|  mechanosensitive ion channel protein MscS        58.9    2e-06    
ref|WP_014421076.1|  MULTISPECIES: mechanosensitive ion channel p...  58.9    2e-06    
gb|EXI90075.1|  MscS family inner membrane protein YnaI               58.9    2e-06    
ref|WP_035188221.1|  mechanosensitive ion channel protein             58.5    2e-06    
ref|WP_023010567.1|  mechanosensitive ion channel protein MscS        58.5    2e-06    
ref|WP_046093270.1|  mechanosensitive ion channel protein MscS        58.5    2e-06    
ref|WP_045177945.1|  mechanosensitive ion channel protein MscS        57.8    2e-06    
emb|CDZ83328.1|  small-conductance mechanosensitive channel           58.2    2e-06    
ref|WP_001711357.1|  MscS family inner membrane protein YnaI          57.8    2e-06    
ref|WP_002535456.1|  Small-conductance mechanosensitive channel       58.2    2e-06    
gb|KJT91700.1|  MscS family inner membrane protein YnaI               58.2    2e-06    
ref|WP_000321911.1|  MscS family inner membrane protein YnaI          57.8    2e-06    
ref|WP_011941971.1|  mechanosensitive ion channel protein             58.2    2e-06    
gb|EHN38469.1|  MscS family inner membrane protein YnaI               57.8    2e-06    
gb|KJT83578.1|  MscS family inner membrane protein YnaI               57.8    2e-06    
ref|WP_000559910.1|  MscS family inner membrane protein YnaI          58.2    2e-06    
ref|WP_037071803.1|  mechanosensitive ion channel protein MscS        58.2    3e-06    
ref|WP_001373366.1|  mechanosensitive ion channel family protein      57.8    3e-06    
ref|WP_027832499.1|  mechanosensitive ion channel protein MscS        58.2    3e-06    
ref|WP_032345831.1|  mechanosensitive ion channel protein MscS        57.8    3e-06    
ref|WP_042333306.1|  mechanosensitive ion channel protein MscS        58.2    3e-06    
gb|EXI80053.1|  MscS family inner membrane protein YnaI               58.2    3e-06    
ref|WP_000559909.1|  MscS family inner membrane protein YnaI          57.8    3e-06    
ref|WP_001516470.1|  MULTISPECIES: MscS family inner membrane pro...  57.8    3e-06    
ref|WP_033423203.1|  mechanosensitive ion channel protein MscS        57.8    3e-06    
ref|WP_000632634.1|  MscS family inner membrane protein YnaI          57.8    3e-06    
ref|WP_001502131.1|  mechanosensitive ion channel family protein      57.4    3e-06    
ref|WP_000632635.1|  MscS family inner membrane protein YnaI          57.8    3e-06    
ref|WP_001522779.1|  MscS family inner membrane protein YnaI          57.8    3e-06    
ref|WP_032156220.1|  mechanosensitive ion channel protein MscS        57.4    3e-06    
gb|KDF06763.1|  MscS family inner membrane protein ynaI               57.8    3e-06    
ref|WP_045713719.1|  mechanosensitive ion channel protein MscS        57.8    3e-06    
ref|WP_044257829.1|  MULTISPECIES: mechanosensitive ion channel p...  57.8    3e-06    
ref|WP_043000577.1|  mechanosensitive ion channel protein MscS        57.8    3e-06    
dbj|GAL05654.1|  small-conductance mechanosensitive channel           56.2    3e-06    
gb|ESC71821.1|  MscS family inner membrane protein YnaI               57.4    3e-06    
ref|WP_044326923.1|  mechanosensitive ion channel protein MscS        57.8    4e-06    
ref|WP_032178402.1|  low conductance mechanosensitive channel YnaI    57.4    4e-06    
gb|ESJ14258.1|  MscS family inner membrane protein YnaI               57.4    4e-06    
ref|WP_024155172.1|  mechanosensitive ion channel protein MscS        57.4    4e-06    
gb|ABV12539.1|  hypothetical protein CKO_01403                        57.4    4e-06    
ref|WP_024242661.1|  mechanosensitive ion channel protein MscS        57.4    4e-06    
ref|WP_000493675.1|  MscS family inner membrane protein YnaI          57.4    4e-06    
ref|WP_039519208.1|  mechanosensitive ion channel protein MscS        57.4    5e-06    
ref|WP_033545629.1|  mechanosensitive ion channel protein MscS        57.0    5e-06    
gb|KGY20381.1|  mechanosensitive ion channel protein MscS             57.0    5e-06    
gb|EJE70324.1|  MscS family inner membrane protein YnaI               57.0    5e-06    
ref|WP_014640617.1|  MscS family inner membrane protein YnaI          57.0    5e-06    
ref|WP_000493673.1|  MscS family inner membrane protein YnaI          57.0    6e-06    
emb|CCB91646.1|  MscS family inner membrane protein ynaI              57.0    6e-06    
gb|KFZ91379.1|  Low conductance mechanosensitive channel YnaI         57.0    6e-06    
ref|WP_023209415.1|  MscS family inner membrane protein YnaI          57.0    6e-06    
ref|WP_041771360.1|  mechanosensitive ion channel protein MscS        57.0    7e-06    
ref|WP_000559884.1|  MULTISPECIES: MscS family inner membrane pro...  56.6    7e-06    
ref|WP_000559876.1|  MscS family inner membrane protein YnaI          56.6    7e-06    
gb|AGH80394.1|  small-conductance mechanosensitive channel            56.6    7e-06    
ref|WP_045825477.1|  mechanosensitive ion channel protein MscS        56.6    8e-06    
ref|WP_000493671.1|  MscS family inner membrane protein YnaI          56.6    8e-06    
ref|WP_038086606.1|  mechanosensitive ion channel protein MscS        56.6    8e-06    
ref|WP_035629271.1|  mechanosensitive ion channel protein MscS        56.6    8e-06    
ref|WP_000493662.1|  MscS family inner membrane protein YnaI          56.6    8e-06    
gb|EWM30349.1|  small-conductance mechanosensitive channel            57.0    9e-06    
ref|WP_039045310.1|  mechanosensitive ion channel protein MscS        56.2    9e-06    
ref|WP_001384467.1|  MscS family inner membrane protein YnaI          56.2    9e-06    
gb|KDN95228.1|  mechanosensitive ion channel protein MscS             56.6    9e-06    
ref|WP_023213803.1|  MscS family inner membrane protein YnaI          56.2    9e-06    
ref|WP_000493674.1|  MscS family inner membrane protein YnaI          56.2    9e-06    
ref|WP_023184213.1|  MscS family inner membrane protein YnaI          56.2    9e-06    
ref|WP_000493670.1|  MscS family inner membrane protein YnaI          56.2    9e-06    
gb|AET53843.1|  hypothetical protein SPUL_1483                        56.2    9e-06    
ref|WP_031605288.1|  mechanosensitive ion channel protein MscS        56.2    9e-06    
ref|WP_000493669.1|  MscS family inner membrane protein YnaI          56.2    9e-06    
ref|WP_004030777.1|  low conductance mechanosensitive channel YnaI    56.2    1e-05    
ref|WP_000559880.1|  MULTISPECIES: MscS family inner membrane pro...  56.2    1e-05    
ref|WP_000493664.1|  MscS family inner membrane protein YnaI          56.2    1e-05    
ref|WP_011311974.1|  mechanosensitive ion channel protein MscS        56.2    1e-05    
ref|WP_000559893.1|  MscS family inner membrane protein YnaI          56.2    1e-05    
ref|WP_000559907.1|  MULTISPECIES: MscS family inner membrane pro...  56.2    1e-05    
ref|WP_038391567.1|  mechanosensitive ion channel protein MscS        56.2    1e-05    
ref|WP_000493672.1|  MscS family inner membrane protein YnaI          56.2    1e-05    
ref|WP_036768486.1|  mechanosensitive ion channel protein MscS        56.2    1e-05    
emb|CQW30426.1|  MscS family inner membrane protein YnaI              56.2    1e-05    
ref|WP_042003047.1|  mechanosensitive ion channel protein MscS        56.2    1e-05    
gb|KJT26582.1|  MscS family inner membrane protein YnaI               56.2    1e-05    
ref|WP_000559894.1|  MscS family inner membrane protein YnaI          56.2    1e-05    
ref|WP_023246442.1|  MscS family inner membrane protein YnaI          56.2    1e-05    
ref|WP_011468271.1|  mechanosensitive ion channel protein MscS        56.2    1e-05    
ref|WP_043893756.1|  mechanosensitive ion channel protein MscS        56.2    1e-05    
gb|ACN46202.1|  hypothetical protein SPC_2070                         56.2    1e-05    
ref|WP_024150041.1|  mechanosensitive ion channel protein MscS        55.8    1e-05    
gb|EMV25034.1|  mechanosensitive ion channel family protein           55.8    1e-05    
ref|WP_024181731.1|  mechanosensitive ion channel protein MscS        55.8    1e-05    
ref|WP_023186000.1|  MscS family inner membrane protein YnaI          55.8    1e-05    
ref|WP_002952565.1|  MscS family inner membrane protein ynaI          55.8    1e-05    
ref|WP_001543711.1|  low conductance mechanosensitive channel YnaI    55.8    1e-05    
gb|ESJ53153.1|  MscS family inner membrane protein YnaI               55.8    1e-05    
ref|WP_041030926.1|  mechanosensitive ion channel protein MscS        55.8    1e-05    
gb|EPJ45385.1|  small-conductance mechanosensitive channel            55.8    1e-05    
ref|WP_033572401.1|  mechanosensitive ion channel protein MscS        55.8    1e-05    
ref|WP_021501338.1|  mechanosensitive ion channel family protein      55.8    1e-05    
ref|WP_000559902.1|  MscS family inner membrane protein YnaI          55.8    1e-05    
ref|WP_001686357.1|  mechanosensitive ion channel family protein      55.8    1e-05    
gb|ABX66996.1|  hypothetical protein SPAB_01599                       55.8    1e-05    
ref|XP_005715181.1|  unnamed protein product                          56.2    1e-05    
ref|WP_016247156.1|  low conductance mechanosensitive channel YnaI    55.8    1e-05    
ref|WP_000493676.1|  MscS family inner membrane protein YnaI          55.8    1e-05    
ref|WP_001666503.1|  low conductance mechanosensitive channel YnaI    55.8    1e-05    
ref|WP_000559883.1|  MscS family inner membrane protein YnaI          55.8    1e-05    
gb|EON90467.1|  MscS family inner membrane protein YnaI               55.8    1e-05    
ref|WP_000559908.1|  MscS family inner membrane protein YnaI          55.8    1e-05    
gb|AHT62817.1|  mechanosensitive ion channel protein MscS             55.8    1e-05    
ref|WP_032302955.1|  mechanosensitive ion channel protein MscS        55.8    2e-05    
ref|WP_000559906.1|  MscS family inner membrane protein YnaI          55.8    2e-05    
ref|WP_000559903.1|  MULTISPECIES: MscS family inner membrane pro...  55.8    2e-05    
ref|WP_000559877.1|  MscS family inner membrane protein YnaI          55.8    2e-05    
ref|WP_000559899.1|  low conductance mechanosensitive channel YnaI    55.8    2e-05    
ref|WP_042095355.1|  mechanosensitive ion channel protein MscS        55.5    2e-05    
ref|WP_000559878.1|  MscS family inner membrane protein YnaI          55.5    2e-05    
emb|CCB88569.1|  mscS family inner membrane protein ynaI              55.8    2e-05    
ref|WP_039022467.1|  mechanosensitive ion channel protein MscS        55.5    2e-05    
ref|WP_033548694.1|  mechanosensitive ion channel protein MscS        55.5    2e-05    
ref|WP_025759769.1|  mechanosensitive ion channel protein MscS        55.5    2e-05    
ref|WP_001416268.1|  mechanosensitive ion channel family protein      55.5    2e-05    
ref|WP_001387817.1|  mechanosensitive ion channel family protein      55.5    2e-05    
ref|WP_039356294.1|  hypothetical protein                             53.5    2e-05    
ref|WP_001737989.1|  mechanosensitive ion channel family protein      55.5    2e-05    
ref|WP_000559885.1|  low conductance mechanosensitive channel YnaI    55.5    2e-05    
ref|WP_001578242.1|  low conductance mechanosensitive channel YnaI    55.5    2e-05    
ref|WP_042069019.1|  mechanosensitive ion channel protein MscS        55.5    2e-05    
ref|WP_032176235.1|  mechanosensitive ion channel protein MscS        55.5    2e-05    
ref|WP_000559889.1|  MscS family inner membrane protein YnaI          55.5    2e-05    
ref|WP_021526694.1|  MscS family inner membrane protein ynaI          55.5    2e-05    
ref|WP_001619389.1|  low conductance mechanosensitive channel YnaI    55.5    2e-05    
ref|WP_024705063.1|  mechanosensitive ion channel protein MscS        55.5    2e-05    
gb|AHS44418.1|  mechanosensitive ion channel protein MscS             55.5    2e-05    
ref|WP_000559900.1|  MULTISPECIES: low conductance mechanosensiti...  55.5    2e-05    
gb|ERJ18294.1|  small-conductance mechanosensitive channel protein    55.8    2e-05    
ref|WP_033802237.1|  low conductance mechanosensitive channel YnaI    55.5    2e-05    
ref|WP_000559875.1|  low conductance mechanosensitive channel YnaI    55.5    2e-05    
ref|WP_021517833.1|  MscS family inner membrane protein ynaI          55.5    2e-05    
ref|WP_000559904.1|  MULTISPECIES: MscS family inner membrane pro...  55.5    2e-05    
ref|WP_032202588.1|  mechanosensitive ion channel protein MscS        55.5    2e-05    
ref|WP_032299396.1|  mechanosensitive ion channel protein MscS        55.5    2e-05    
ref|WP_000493665.1|  MscS family inner membrane protein YnaI          55.5    2e-05    
ref|WP_000559881.1|  MscS family inner membrane protein YnaI          55.5    2e-05    
ref|WP_000493539.1|  MscS family inner membrane protein YnaI          55.5    2e-05    
ref|WP_000493666.1|  MscS family inner membrane protein YnaI          55.5    2e-05    
gb|KFU67106.1|  mechanosensitive ion channel protein MscS             55.5    2e-05    
ref|WP_001362090.1|  mechanosensitive ion channel family protein      55.5    2e-05    
ref|WP_024009010.1|  MscS family inner membrane protein ynaI          55.5    2e-05    
ref|WP_000493677.1|  MscS family inner membrane protein YnaI          55.5    2e-05    
ref|WP_032247894.1|  mechanosensitive ion channel protein MscS        55.5    2e-05    
ref|WP_024220188.1|  mechanosensitive ion channel protein MscS        55.5    2e-05    



>ref|XP_009624659.1| PREDICTED: mechanosensitive ion channel protein 2, chloroplastic-like 
isoform X2 [Nicotiana tomentosiformis]
Length=706

 Score =   340 bits (872),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 180/288 (63%), Positives = 217/288 (75%), Gaps = 18/288 (6%)
 Frame = +1

Query  1    AIHIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQVEQQK  180
            AIHIPNHKF+VN+VRNL+QKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQ+EQQ+
Sbjct  335  AIHIPNHKFSVNIVRNLSQKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQIEQQR  394

Query  181  LHRRVFLDNIDRENQALLIMVSCFVKTSHFEEYLRVKEVILLDLLRVISHHRARLATPIR  360
            LHRRVFLDN+D ENQAL+IM+SCFVKTS+FEEY RVKEVILLDLLRVISHHRARLATP+R
Sbjct  395  LHRRVFLDNVDPENQALMIMISCFVKTSYFEEYSRVKEVILLDLLRVISHHRARLATPLR  454

Query  361  TVQKIYKEADVDEVPLADSVMTVNRANHPFLLIEPSYKINNSSEDKTK-AATPPRPNQEK  537
            TVQK Y+E D D+VP ADS+ + +R N PF LIEPSY+INN  +DKTK +A   +P++EK
Sbjct  455  TVQKTYREPDADDVPFADSIFSRDRPNRPFFLIEPSYRINN--DDKTKVSARSVQPDEEK  512

Query  538  DGKSEVQTTASKAVDASPPIVDGNRID-TRgssgssTDTEPGVATSELDGKMPNTGS---  705
            DGK+E  +T+  A D +  +      +  + SS S+ + +  VAT   DGK P  GS   
Sbjct  513  DGKAEAPSTSQAADDTNGLLSKPTEKEVVKVSSASNANVDLKVATLSSDGKTPKQGSISP  572

Query  706  VQSKNERQQVDKV---VPG--------EVDAPSAVSQAKQDGERPTTP  816
            V+S +E+ QV       PG        + D  SA SQA+QD ERP +P
Sbjct  573  VKSNSEKNQVASATGEAPGLTSDINIEKTDVASAASQAQQDAERPISP  620



>ref|XP_009624658.1| PREDICTED: mechanosensitive ion channel protein 3, chloroplastic-like 
isoform X1 [Nicotiana tomentosiformis]
Length=708

 Score =   340 bits (872),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 180/288 (63%), Positives = 217/288 (75%), Gaps = 18/288 (6%)
 Frame = +1

Query  1    AIHIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQVEQQK  180
            AIHIPNHKF+VN+VRNL+QKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQ+EQQ+
Sbjct  337  AIHIPNHKFSVNIVRNLSQKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQIEQQR  396

Query  181  LHRRVFLDNIDRENQALLIMVSCFVKTSHFEEYLRVKEVILLDLLRVISHHRARLATPIR  360
            LHRRVFLDN+D ENQAL+IM+SCFVKTS+FEEY RVKEVILLDLLRVISHHRARLATP+R
Sbjct  397  LHRRVFLDNVDPENQALMIMISCFVKTSYFEEYSRVKEVILLDLLRVISHHRARLATPLR  456

Query  361  TVQKIYKEADVDEVPLADSVMTVNRANHPFLLIEPSYKINNSSEDKTK-AATPPRPNQEK  537
            TVQK Y+E D D+VP ADS+ + +R N PF LIEPSY+INN  +DKTK +A   +P++EK
Sbjct  457  TVQKTYREPDADDVPFADSIFSRDRPNRPFFLIEPSYRINN--DDKTKVSARSVQPDEEK  514

Query  538  DGKSEVQTTASKAVDASPPIVDGNRID-TRgssgssTDTEPGVATSELDGKMPNTGS---  705
            DGK+E  +T+  A D +  +      +  + SS S+ + +  VAT   DGK P  GS   
Sbjct  515  DGKAEAPSTSQAADDTNGLLSKPTEKEVVKVSSASNANVDLKVATLSSDGKTPKQGSISP  574

Query  706  VQSKNERQQVDKV---VPG--------EVDAPSAVSQAKQDGERPTTP  816
            V+S +E+ QV       PG        + D  SA SQA+QD ERP +P
Sbjct  575  VKSNSEKNQVASATGEAPGLTSDINIEKTDVASAASQAQQDAERPISP  622



>ref|XP_009785640.1| PREDICTED: mechanosensitive ion channel protein 3, chloroplastic-like 
isoform X3 [Nicotiana sylvestris]
 ref|XP_009785647.1| PREDICTED: mechanosensitive ion channel protein 3, chloroplastic-like 
isoform X3 [Nicotiana sylvestris]
 ref|XP_009785652.1| PREDICTED: mechanosensitive ion channel protein 3, chloroplastic-like 
isoform X3 [Nicotiana sylvestris]
Length=706

 Score =   325 bits (832),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 167/250 (67%), Positives = 200/250 (80%), Gaps = 7/250 (3%)
 Frame = +1

Query  1    AIHIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQVEQQK  180
            AIHIPNHKF+VN+VRNL+QKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQ+EQQ+
Sbjct  337  AIHIPNHKFSVNIVRNLSQKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQIEQQR  396

Query  181  LHRRVFLDNIDRENQALLIMVSCFVKTSHFEEYLRVKEVILLDLLRVISHHRARLATPIR  360
            LHRRVFLDN+D ENQAL+IM+SCFVKTS+FEEY RVKEVILLDLLRVISHHRARLATP+R
Sbjct  397  LHRRVFLDNVDPENQALMIMISCFVKTSYFEEYSRVKEVILLDLLRVISHHRARLATPLR  456

Query  361  TVQKIYKEADVDEVPLADSVMTVNRANHPFLLIEPSYKINNSSEDKTK-AATPPRPNQEK  537
            TVQK Y+E D D+VP ADS+ + +R N PF LIEPSY+INN  +DKTK +A   +P++EK
Sbjct  457  TVQKTYREPDADDVPFADSIFSRDRPNRPFFLIEPSYRINN--DDKTKVSAGSVQPDEEK  514

Query  538  DGKSEVQTTASKAVDASP-PIVDGNRIDTRgssgssTDTEPGVATSELDGKMPNTGS---  705
            DGK+E  +T+  A D +  P     +   + SS S+ + +  VAT   DGK P  GS   
Sbjct  515  DGKAEAPSTSQAADDTNGLPSKPAEKEVVKVSSASNANVDLKVATLSSDGKTPKQGSSSP  574

Query  706  VQSKNERQQV  735
            V+S +E+ QV
Sbjct  575  VKSNSEKNQV  584



>ref|XP_009785633.1| PREDICTED: mechanosensitive ion channel protein 3, chloroplastic-like 
isoform X2 [Nicotiana sylvestris]
Length=721

 Score =   325 bits (832),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 167/250 (67%), Positives = 200/250 (80%), Gaps = 7/250 (3%)
 Frame = +1

Query  1    AIHIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQVEQQK  180
            AIHIPNHKF+VN+VRNL+QKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQ+EQQ+
Sbjct  352  AIHIPNHKFSVNIVRNLSQKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQIEQQR  411

Query  181  LHRRVFLDNIDRENQALLIMVSCFVKTSHFEEYLRVKEVILLDLLRVISHHRARLATPIR  360
            LHRRVFLDN+D ENQAL+IM+SCFVKTS+FEEY RVKEVILLDLLRVISHHRARLATP+R
Sbjct  412  LHRRVFLDNVDPENQALMIMISCFVKTSYFEEYSRVKEVILLDLLRVISHHRARLATPLR  471

Query  361  TVQKIYKEADVDEVPLADSVMTVNRANHPFLLIEPSYKINNSSEDKTK-AATPPRPNQEK  537
            TVQK Y+E D D+VP ADS+ + +R N PF LIEPSY+INN  +DKTK +A   +P++EK
Sbjct  472  TVQKTYREPDADDVPFADSIFSRDRPNRPFFLIEPSYRINN--DDKTKVSAGSVQPDEEK  529

Query  538  DGKSEVQTTASKAVDASP-PIVDGNRIDTRgssgssTDTEPGVATSELDGKMPNTGS---  705
            DGK+E  +T+  A D +  P     +   + SS S+ + +  VAT   DGK P  GS   
Sbjct  530  DGKAEAPSTSQAADDTNGLPSKPAEKEVVKVSSASNANVDLKVATLSSDGKTPKQGSSSP  589

Query  706  VQSKNERQQV  735
            V+S +E+ QV
Sbjct  590  VKSNSEKNQV  599



>ref|XP_009785624.1| PREDICTED: mechanosensitive ion channel protein 3, chloroplastic-like 
isoform X1 [Nicotiana sylvestris]
Length=723

 Score =   325 bits (832),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 167/250 (67%), Positives = 200/250 (80%), Gaps = 7/250 (3%)
 Frame = +1

Query  1    AIHIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQVEQQK  180
            AIHIPNHKF+VN+VRNL+QKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQ+EQQ+
Sbjct  354  AIHIPNHKFSVNIVRNLSQKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQIEQQR  413

Query  181  LHRRVFLDNIDRENQALLIMVSCFVKTSHFEEYLRVKEVILLDLLRVISHHRARLATPIR  360
            LHRRVFLDN+D ENQAL+IM+SCFVKTS+FEEY RVKEVILLDLLRVISHHRARLATP+R
Sbjct  414  LHRRVFLDNVDPENQALMIMISCFVKTSYFEEYSRVKEVILLDLLRVISHHRARLATPLR  473

Query  361  TVQKIYKEADVDEVPLADSVMTVNRANHPFLLIEPSYKINNSSEDKTK-AATPPRPNQEK  537
            TVQK Y+E D D+VP ADS+ + +R N PF LIEPSY+INN  +DKTK +A   +P++EK
Sbjct  474  TVQKTYREPDADDVPFADSIFSRDRPNRPFFLIEPSYRINN--DDKTKVSAGSVQPDEEK  531

Query  538  DGKSEVQTTASKAVDASP-PIVDGNRIDTRgssgssTDTEPGVATSELDGKMPNTGS---  705
            DGK+E  +T+  A D +  P     +   + SS S+ + +  VAT   DGK P  GS   
Sbjct  532  DGKAEAPSTSQAADDTNGLPSKPAEKEVVKVSSASNANVDLKVATLSSDGKTPKQGSSSP  591

Query  706  VQSKNERQQV  735
            V+S +E+ QV
Sbjct  592  VKSNSEKNQV  601



>ref|XP_002514042.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF48625.1| conserved hypothetical protein [Ricinus communis]
Length=705

 Score =   322 bits (824),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 176/297 (59%), Positives = 213/297 (72%), Gaps = 27/297 (9%)
 Frame = +1

Query  1    AIHIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQVEQQK  180
            A+HIPNHKFTVNVVRNL+QKTHWRIKTHLAISHLDVNK+NNIVADMRKVLAKNPQVEQQ+
Sbjct  337  AVHIPNHKFTVNVVRNLSQKTHWRIKTHLAISHLDVNKVNNIVADMRKVLAKNPQVEQQR  396

Query  181  LHRRVFLDNIDRENQALLIMVSCFVKTSHFEEYLRVKEVILLDLLRVISHHRARLATPIR  360
            LHRRVFLDNI+ ENQAL+I+VSCFVKTSHFEEYL VKE +LLDLLRV+SHHRARLATPIR
Sbjct  397  LHRRVFLDNINPENQALMILVSCFVKTSHFEEYLCVKEAVLLDLLRVLSHHRARLATPIR  456

Query  361  TVQKIYKEADVDEVPLADSVMTVNRA--NHPFLLIEPSYKINNSSEDKTKAATPP-RPNQ  531
            TVQKIY EAD+D VP AD++   +RA  N P LLIEPSYKIN   +DKTKA+T     N+
Sbjct  457  TVQKIYNEADLDNVPFADTIFARSRAATNRPLLLIEPSYKING--DDKTKASTQSVSTNE  514

Query  532  EKDGKSEVQTTASKAVDASPPIVDGNRIDTRgssgssTDTEP-GVATSELDGKMPN----  696
            EKDG  E  +T + A   S PIV+  R     ++ S +   P G AT+  D ++      
Sbjct  515  EKDGNVEAASTLADAKAGSSPIVELKRDKVAATTISDSSITPEGSATTASDSQLGKSEHE  574

Query  697  ------------TGSVQ-SKNERQQVDK--VVPGEVDAP--SAVSQAKQDGERPTTP  816
                        +GS++ S+NE+  ++   +  G   +   SA+SQA++  ER  TP
Sbjct  575  ISVPKNAETQEPSGSMEGSRNEKMGLNSEDLTLGRSTSEEYSAISQAQEAVERSVTP  631



>ref|XP_011016936.1| PREDICTED: mechanosensitive ion channel protein 2, chloroplastic-like 
isoform X2 [Populus euphratica]
Length=579

 Score =   306 bits (785),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 151/210 (72%), Positives = 172/210 (82%), Gaps = 8/210 (4%)
 Frame = +1

Query  1    AIHIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQVEQQK  180
            A+HIPNHKF+V++VRNL+QKTHWRIKTHLAISHLDV KINNIVADMRKVLAKNPQ+EQQ+
Sbjct  203  AVHIPNHKFSVSIVRNLSQKTHWRIKTHLAISHLDVKKINNIVADMRKVLAKNPQIEQQR  262

Query  181  LHRRVFLDNIDRENQALLIMVSCFVKTSHFEEYLRVKEVILLDLLRVISHHRARLATPIR  360
            LHRRVFLDNI+ ENQAL+I+VSCFVKTSHFEEYL VKE +LLDLLRVISHHRARLATPIR
Sbjct  263  LHRRVFLDNINPENQALMILVSCFVKTSHFEEYLCVKEAVLLDLLRVISHHRARLATPIR  322

Query  361  TVQKIYKEADVDEVPLADSVMTVN--RANHPFLLIEPSYKINNSSEDKTKAAT-PPRPNQ  531
            TVQKIY EAD++ VP +DS+ T +   ANHP LL+EPSYKIN  SEDK KA+    R N+
Sbjct  323  TVQKIYSEADLENVPFSDSIFTRSGATANHPLLLVEPSYKIN--SEDKVKASNRSLRANE  380

Query  532  EKDGKSEVQTTASKAVD---ASPPIVDGNR  612
            EKD K E    +    D    S P+VD  R
Sbjct  381  EKDAKVEAALVSELKADTKAGSMPVVDSKR  410



>ref|XP_006338061.1| PREDICTED: mechanosensitive ion channel protein 3, chloroplastic-like 
[Solanum tuberosum]
Length=710

 Score =   309 bits (791),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 175/289 (61%), Positives = 209/289 (72%), Gaps = 22/289 (8%)
 Frame = +1

Query  1    AIHIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQVEQQK  180
            AIHIPNHKF+VN+VRNLTQ+THWRIKTHLAISHLDVNKINNIVADMRKVLAK+P VEQQ+
Sbjct  337  AIHIPNHKFSVNIVRNLTQRTHWRIKTHLAISHLDVNKINNIVADMRKVLAKHPLVEQQR  396

Query  181  LHRRVFLDNIDRENQALLIMVSCFVKTSHFEEYLRVKEVILLDLLRVISHHRARLATPIR  360
            LHRRVFLDN+D ENQAL I++SCFVKT  FEEYLRVKEVILLDLLRVISHHRARLATPIR
Sbjct  397  LHRRVFLDNVDPENQALKILISCFVKTPRFEEYLRVKEVILLDLLRVISHHRARLATPIR  456

Query  361  TVQKIYKEADVDEVPLADSVMTVNRANHPFLLIEPSYKINNSSEDKTKA-ATPPRPNQEK  537
            TVQK  +E DVD+VP ADS+ + NR N   LLIEPSYKI  SS+DK KA A   + ++EK
Sbjct  457  TVQKTSREIDVDDVPFADSIFSRNRPNRQVLLIEPSYKI--SSDDKAKASARSVQSDEEK  514

Query  538  DGKSEVQTTASKAVDAS---PPIVDGNRIDTRgssgssTDTEPGVATSELDGKMPNTGS-  705
            D K E  +T+  A D +     +V+   +    +S ++ D +   ATS  DGK    GS 
Sbjct  515  DQKVEAPSTSRGADDTNDKPSTLVEKEVVKASSASNANGDLK--AATSPSDGKSLKQGSA  572

Query  706  --VQSKNERQQVDKVV---PG--------EVDAPSAVSQAKQDGERPTT  813
              V+S +E+ Q+  V    PG        + D  S+ SQA+QD ERP +
Sbjct  573  SPVKSNSEKNQIASVAGDPPGLTSDTAIEKTDMASSASQAQQDTERPIS  621



>ref|XP_010254531.1| PREDICTED: mechanosensitive ion channel protein 2, chloroplastic-like 
[Nelumbo nucifera]
 ref|XP_010254532.1| PREDICTED: mechanosensitive ion channel protein 2, chloroplastic-like 
[Nelumbo nucifera]
 ref|XP_010254534.1| PREDICTED: mechanosensitive ion channel protein 2, chloroplastic-like 
[Nelumbo nucifera]
 ref|XP_010254535.1| PREDICTED: mechanosensitive ion channel protein 2, chloroplastic-like 
[Nelumbo nucifera]
Length=733

 Score =   309 bits (792),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 167/281 (59%), Positives = 202/281 (72%), Gaps = 12/281 (4%)
 Frame = +1

Query  1    AIHIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQVEQQK  180
            A+HIPNHKFTVNVVRNL+QK+HWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQVEQQ+
Sbjct  335  AVHIPNHKFTVNVVRNLSQKSHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQVEQQR  394

Query  181  LHRRVFLDNIDRENQALLIMVSCFVKTSHFEEYLRVKEVILLDLLRVISHHRARLATPIR  360
            LHRRVFLDN+D ENQALLI++SCFVKTSHFEEYL VKE ILLDLLRVISHHRARLATPIR
Sbjct  395  LHRRVFLDNVDPENQALLILISCFVKTSHFEEYLCVKEAILLDLLRVISHHRARLATPIR  454

Query  361  TVQKIYKEADVDEVPLADSVM--TVNRANHPFLLIEPSYKINNSSEDKTKA-ATPPRPNQ  531
            TVQKIY + D++ VP AD++   T + AN PFLLIEP Y+INN  +DK KA   P R N+
Sbjct  455  TVQKIYSDKDMENVPFADTIFTRTGSAANRPFLLIEPPYRINN--DDKMKAQGRPVRTNE  512

Query  532  EKDGKSEVQTTASKAVDA---SPPIVDGNRIDTRgssgssTDTEPG---VATSELDGKMP  693
            E+D K     T+   VDA   + P  D ++ D +  +   +D++      ATS  D K+ 
Sbjct  513  EQDAKVAGTQTSDSKVDAKVGTGPSSD-SKTDVKVGTTPMSDSKAETMVAATSIPDSKVD  571

Query  694  NTGSVQSKNERQQVDKVVPGEVDAPSAVSQAKQDGERPTTP  816
               ++ S ++ +   KV    V + S +  +  DG   T P
Sbjct  572  GKVAIVSSSDSKADPKVAAMSVSSESKMQSSASDGSPQTNP  612



>ref|XP_011016935.1| PREDICTED: mechanosensitive ion channel protein 3, chloroplastic-like 
isoform X1 [Populus euphratica]
Length=708

 Score =   306 bits (783),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 151/210 (72%), Positives = 172/210 (82%), Gaps = 8/210 (4%)
 Frame = +1

Query  1    AIHIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQVEQQK  180
            A+HIPNHKF+V++VRNL+QKTHWRIKTHLAISHLDV KINNIVADMRKVLAKNPQ+EQQ+
Sbjct  332  AVHIPNHKFSVSIVRNLSQKTHWRIKTHLAISHLDVKKINNIVADMRKVLAKNPQIEQQR  391

Query  181  LHRRVFLDNIDRENQALLIMVSCFVKTSHFEEYLRVKEVILLDLLRVISHHRARLATPIR  360
            LHRRVFLDNI+ ENQAL+I+VSCFVKTSHFEEYL VKE +LLDLLRVISHHRARLATPIR
Sbjct  392  LHRRVFLDNINPENQALMILVSCFVKTSHFEEYLCVKEAVLLDLLRVISHHRARLATPIR  451

Query  361  TVQKIYKEADVDEVPLADSVMTVN--RANHPFLLIEPSYKINNSSEDKTKAAT-PPRPNQ  531
            TVQKIY EAD++ VP +DS+ T +   ANHP LL+EPSYKIN  SEDK KA+    R N+
Sbjct  452  TVQKIYSEADLENVPFSDSIFTRSGATANHPLLLVEPSYKIN--SEDKVKASNRSLRANE  509

Query  532  EKDGKSEVQTTASKAVD---ASPPIVDGNR  612
            EKD K E    +    D    S P+VD  R
Sbjct  510  EKDAKVEAALVSELKADTKAGSMPVVDSKR  539



>ref|XP_002302344.2| hypothetical protein POPTR_0002s10610g [Populus trichocarpa]
 gb|EEE81617.2| hypothetical protein POPTR_0002s10610g [Populus trichocarpa]
Length=671

 Score =   305 bits (781),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 168/284 (59%), Positives = 198/284 (70%), Gaps = 32/284 (11%)
 Frame = +1

Query  1    AIHIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQVEQQK  180
            A+HIPNHKF+V++VRNL+QKTHWRIKTHLAISHLDV KINNIVADMRKVLAKNPQ+EQQ+
Sbjct  332  AVHIPNHKFSVSIVRNLSQKTHWRIKTHLAISHLDVKKINNIVADMRKVLAKNPQIEQQR  391

Query  181  LHRRVFLDNIDRENQALLIMVSCFVKTSHFEEYLRVKEVILLDLLRVISHHRARLATPIR  360
            LHRRVFLDNI+ ENQAL+I+VSCFVKTSHFEEYL VKE +LLDLLRVISHH ARLATPIR
Sbjct  392  LHRRVFLDNINPENQALMILVSCFVKTSHFEEYLCVKEAVLLDLLRVISHHCARLATPIR  451

Query  361  TVQKIYKEADVDEVPLADSVMTVN--RANHPFLLIEPSYKINNSSEDKTKAAT-PPRPNQ  531
            TVQKIY EAD++ VP +DS+ T +   ANHP LLIEPSYKIN  SEDK KA+    R N+
Sbjct  452  TVQKIYSEADLENVPFSDSIFTRSGATANHPLLLIEPSYKIN--SEDKVKASNRSLRANE  509

Query  532  EKDGKSEVQTTASKAVDA---SPPIVDGNR----------IDTRgssgssTDTEPGVATS  672
            EKD K E    +    DA   S P+VD  R            T       + ++P + T+
Sbjct  510  EKDAKVEAALVSELKADAKAGSMPVVDSKRDKVVAKSTSNSSTNSKVSDVSASDPQLITT  569

Query  673  ELDGKMPNTGSVQSKNERQQVDKVVPGEVDAPSAVSQAKQDGER  804
                 + NT SV  + E             +P  +SQ+KQD ER
Sbjct  570  PEGSSVSNTESVGERTE-------------SPD-ISQSKQDIER  599



>ref|XP_012068013.1| PREDICTED: mechanosensitive ion channel protein 2, chloroplastic-like 
isoform X3 [Jatropha curcas]
Length=521

 Score =   300 bits (768),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 170/293 (58%), Positives = 202/293 (69%), Gaps = 31/293 (11%)
 Frame = +1

Query  1    AIHIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQVEQQK  180
            A+HIPNHKFT+NVVRNL+QKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQVEQQK
Sbjct  167  AVHIPNHKFTMNVVRNLSQKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQVEQQK  226

Query  181  LHRRVFLDNIDRENQALLIMVSCFVKTSHFEEYLRVKEVILLDLLRVISHHRARLATPIR  360
            LHRRVFLDNI+ ENQAL++ VSCFVKTSHFEEYL VKE I+LDLLRVISHHRARLATPIR
Sbjct  227  LHRRVFLDNINPENQALMVFVSCFVKTSHFEEYLCVKEAIILDLLRVISHHRARLATPIR  286

Query  361  TVQKIYKEADVDEVPLADSVMTVNR--ANHPFLLIEPSYKINNSSEDKTKAAT-PPRPNQ  531
            TVQKIY EAD+  V  AD+++T +   AN P LLIEPSYKIN   +DKTKA++     N 
Sbjct  287  TVQKIYNEADLANVRSADTILTRSGAVANRPLLLIEPSYKING--DDKTKASSRSVCTNG  344

Query  532  EKDGKSEVQTTASKAVDASPPIVDGNRIDTRgssgssTDTEPGVATSEL-DGKMPNTGSV  708
            EKD K+E  +T+    DA+     G+  +T  S G +T       +  + D  +PN    
Sbjct  345  EKDAKAEAASTSESKADANA----GSTTNTPESKGLATPASDRWQSKMVHDNSVPNNPET  400

Query  709  QSKNERQQ---------------VDKVVPGEV------DAPSAVSQAKQDGER  804
            +  +E  +               + +  P E       + PS +SQAKQD ER
Sbjct  401  KKTSESIEDTWKENMGLNSEDITLGRAAPEEYSESKRSEIPSTISQAKQDVER  453



>ref|XP_010320209.1| PREDICTED: mechanosensitive ion channel protein 2, chloroplastic 
isoform X2 [Solanum lycopersicum]
Length=571

 Score =   298 bits (764),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 165/257 (64%), Positives = 192/257 (75%), Gaps = 9/257 (4%)
 Frame = +1

Query  1    AIHIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQVEQQK  180
            AIHIPNHKF+VN+VRNLTQ+THWRIKTHLAISHLDVNKINNIVADMRKVL+K+P VEQQ+
Sbjct  205  AIHIPNHKFSVNIVRNLTQRTHWRIKTHLAISHLDVNKINNIVADMRKVLSKHPMVEQQR  264

Query  181  LHRRVFLDNIDRENQALLIMVSCFVKTSHFEEYLRVKEVILLDLLRVISHHRARLATPIR  360
            LHRRVFLDN+D ENQAL I++SCFVKT  FEEYLRVKEVILLDLLRVISHHRARLATPIR
Sbjct  265  LHRRVFLDNVDPENQALKILISCFVKTPRFEEYLRVKEVILLDLLRVISHHRARLATPIR  324

Query  361  TVQKIYKEADVDEVPLADSVMTVNRANHPFLLIEPSYKINNSSEDKTKA-ATPPRPNQEK  537
            TVQK  +E D D+VP ADS+ + NR N   LLIEPSYKI  SS+DK KA A   + ++EK
Sbjct  325  TVQKTSREIDADDVPFADSIFSRNRPNRQVLLIEPSYKI--SSDDKAKASARSVQSDEEK  382

Query  538  DGKSEVQTTASKAVD--ASPPIVDGNRIDTRgssgssTDTEPGVATSELDGKMPNTGS--  705
            D K E   T+  A D    P  +    +D + SS S+ + +   ATS  DGK    GS  
Sbjct  383  DQKVEATITSRTADDTNGKPSTLVEKEVD-KASSASNANGDLKAATSPSDGKSLKQGSTS  441

Query  706  -VQSKNERQQVDKVVPG  753
             V+S +E+ QV    PG
Sbjct  442  PVKSNSEKNQVAGDPPG  458



>ref|XP_012068012.1| PREDICTED: mechanosensitive ion channel protein 2, chloroplastic-like 
isoform X2 [Jatropha curcas]
Length=645

 Score =   299 bits (766),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 170/293 (58%), Positives = 202/293 (69%), Gaps = 31/293 (11%)
 Frame = +1

Query  1    AIHIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQVEQQK  180
            A+HIPNHKFT+NVVRNL+QKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQVEQQK
Sbjct  291  AVHIPNHKFTMNVVRNLSQKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQVEQQK  350

Query  181  LHRRVFLDNIDRENQALLIMVSCFVKTSHFEEYLRVKEVILLDLLRVISHHRARLATPIR  360
            LHRRVFLDNI+ ENQAL++ VSCFVKTSHFEEYL VKE I+LDLLRVISHHRARLATPIR
Sbjct  351  LHRRVFLDNINPENQALMVFVSCFVKTSHFEEYLCVKEAIILDLLRVISHHRARLATPIR  410

Query  361  TVQKIYKEADVDEVPLADSVMTVNR--ANHPFLLIEPSYKINNSSEDKTKAAT-PPRPNQ  531
            TVQKIY EAD+  V  AD+++T +   AN P LLIEPSYKIN   +DKTKA++     N 
Sbjct  411  TVQKIYNEADLANVRSADTILTRSGAVANRPLLLIEPSYKING--DDKTKASSRSVCTNG  468

Query  532  EKDGKSEVQTTASKAVDASPPIVDGNRIDTRgssgssTDTEPGVATSEL-DGKMPNTGSV  708
            EKD K+E  +T+    DA+     G+  +T  S G +T       +  + D  +PN    
Sbjct  469  EKDAKAEAASTSESKADANA----GSTTNTPESKGLATPASDRWQSKMVHDNSVPNNPET  524

Query  709  QSKNERQQ---------------VDKVVPGEV------DAPSAVSQAKQDGER  804
            +  +E  +               + +  P E       + PS +SQAKQD ER
Sbjct  525  KKTSESIEDTWKENMGLNSEDITLGRAAPEEYSESKRSEIPSTISQAKQDVER  577



>emb|CDP11503.1| unnamed protein product [Coffea canephora]
Length=706

 Score =   300 bits (768),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 163/285 (57%), Positives = 203/285 (71%), Gaps = 18/285 (6%)
 Frame = +1

Query  1    AIHIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQVEQQK  180
            A+HIP+HKFT+NVVRNL+QKTHWRIK+ LAISHLDVNKINNIV+DMRKVLAKNPQ+EQQK
Sbjct  340  AVHIPSHKFTMNVVRNLSQKTHWRIKSSLAISHLDVNKINNIVSDMRKVLAKNPQIEQQK  399

Query  181  LHRRVFLDNIDRENQALLIMVSCFVKTSHFEEYLRVKEVILLDLLRVISHHRARLATPIR  360
            LHRRVFLD ID ENQAL+IMVSCFVKTS FEEYL VKE IL DLLRVISHHRARLATPIR
Sbjct  400  LHRRVFLDYIDTENQALMIMVSCFVKTSWFEEYLCVKESILQDLLRVISHHRARLATPIR  459

Query  361  TVQKIYKEADVDEVPLADSVMTVNRA--NHPFLLIEPSYKINNSSEDKTKAATPPRPNQE  534
            TVQK+Y E DV+ +P ++++    RA  N PFLL++PSYK+NN ++ +TK  T  +PN+E
Sbjct  460  TVQKVYGETDVETIPFSETIFRRTRAASNRPFLLVDPSYKVNNDNKIRTKGHT-EQPNEE  518

Query  535  KDGKSEVQTTASKAVDAS---PPIVDGNRIDTRgssgssTDT--EPGVATSELDGKMPNT  699
            KD K E  +T+   VDA      IVD +++D  GS+   +D   +  V  +     +P+ 
Sbjct  519  KDEKVEATSTSETKVDAKVGPASIVDDDKVDDEGSTELISDNNQKATVERASTSDALPHM  578

Query  700  GSV---QSKNERQQVDKVVPG-------EVDAPSAVSQAKQDGER  804
            GS+   Q  + +Q+ D+  P             S+ SQA  D ER
Sbjct  579  GSIDPGQRNSVKQRADRARPSVQEFGRDGTAVSSSTSQAMPDVER  623



>ref|XP_010113430.1| Mechanosensitive ion channel protein 2 [Morus notabilis]
 gb|EXC35457.1| Mechanosensitive ion channel protein 2 [Morus notabilis]
Length=797

 Score =   302 bits (773),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 151/211 (72%), Positives = 174/211 (82%), Gaps = 7/211 (3%)
 Frame = +1

Query  1    AIHIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQVEQQK  180
            A+HIPNHKFTVNVVRNL+QKTHWRIKTHLAISHLDV+KINNIVADMRKVLAKNPQVEQQ+
Sbjct  394  AVHIPNHKFTVNVVRNLSQKTHWRIKTHLAISHLDVHKINNIVADMRKVLAKNPQVEQQR  453

Query  181  LHRRVFLDNIDRENQALLIMVSCFVKTSHFEEYLRVKEVILLDLLRVISHHRARLATPIR  360
            LHRRVFL+NI+ ENQALL++VSCFVKTSHFEEYL VKE ILLDLLRVISHHRARLATPIR
Sbjct  454  LHRRVFLENINPENQALLVLVSCFVKTSHFEEYLCVKEAILLDLLRVISHHRARLATPIR  513

Query  361  TVQKIYKEADVDEVPLADSVMTVNR-ANHPFLLIEPSYKINNSSEDKTKAATPPRPNQEK  537
            TVQKIY +AD++ VP ADS+ +    +N P LLIEP YKIN   EDKTK  +  RPN E+
Sbjct  514  TVQKIYSDADLENVPFADSIYSRGGVSNRPLLLIEPLYKING--EDKTKNRS-ARPNGER  570

Query  538  DGKSEVQTTASKAVDAS---PPIVDGNRIDT  621
            DGK+  + ++   +DA    PP +D    +T
Sbjct  571  DGKTTARPSSDNKIDAKVGVPPALDSKTKET  601



>ref|XP_012068009.1| PREDICTED: mechanosensitive ion channel protein 3, chloroplastic-like 
isoform X1 [Jatropha curcas]
 ref|XP_012068010.1| PREDICTED: mechanosensitive ion channel protein 3, chloroplastic-like 
isoform X1 [Jatropha curcas]
 ref|XP_012068011.1| PREDICTED: mechanosensitive ion channel protein 3, chloroplastic-like 
isoform X1 [Jatropha curcas]
 gb|KDP41480.1| hypothetical protein JCGZ_15887 [Jatropha curcas]
Length=691

 Score =   300 bits (767),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 170/293 (58%), Positives = 202/293 (69%), Gaps = 31/293 (11%)
 Frame = +1

Query  1    AIHIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQVEQQK  180
            A+HIPNHKFT+NVVRNL+QKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQVEQQK
Sbjct  337  AVHIPNHKFTMNVVRNLSQKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQVEQQK  396

Query  181  LHRRVFLDNIDRENQALLIMVSCFVKTSHFEEYLRVKEVILLDLLRVISHHRARLATPIR  360
            LHRRVFLDNI+ ENQAL++ VSCFVKTSHFEEYL VKE I+LDLLRVISHHRARLATPIR
Sbjct  397  LHRRVFLDNINPENQALMVFVSCFVKTSHFEEYLCVKEAIILDLLRVISHHRARLATPIR  456

Query  361  TVQKIYKEADVDEVPLADSVMTVNR--ANHPFLLIEPSYKINNSSEDKTKAAT-PPRPNQ  531
            TVQKIY EAD+  V  AD+++T +   AN P LLIEPSYKIN   +DKTKA++     N 
Sbjct  457  TVQKIYNEADLANVRSADTILTRSGAVANRPLLLIEPSYKING--DDKTKASSRSVCTNG  514

Query  532  EKDGKSEVQTTASKAVDASPPIVDGNRIDTRgssgssTDTEPGVATSEL-DGKMPNTGSV  708
            EKD K+E  +T+    DA+     G+  +T  S G +T       +  + D  +PN    
Sbjct  515  EKDAKAEAASTSESKADANA----GSTTNTPESKGLATPASDRWQSKMVHDNSVPNNPET  570

Query  709  QSKNERQQ---------------VDKVVPGEV------DAPSAVSQAKQDGER  804
            +  +E  +               + +  P E       + PS +SQAKQD ER
Sbjct  571  KKTSESIEDTWKENMGLNSEDITLGRAAPEEYSESKRSEIPSTISQAKQDVER  623



>ref|XP_010320208.1| PREDICTED: mechanosensitive ion channel protein 3, chloroplastic 
isoform X1 [Solanum lycopersicum]
Length=675

 Score =   298 bits (762),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 165/257 (64%), Positives = 192/257 (75%), Gaps = 9/257 (4%)
 Frame = +1

Query  1    AIHIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQVEQQK  180
            AIHIPNHKF+VN+VRNLTQ+THWRIKTHLAISHLDVNKINNIVADMRKVL+K+P VEQQ+
Sbjct  309  AIHIPNHKFSVNIVRNLTQRTHWRIKTHLAISHLDVNKINNIVADMRKVLSKHPMVEQQR  368

Query  181  LHRRVFLDNIDRENQALLIMVSCFVKTSHFEEYLRVKEVILLDLLRVISHHRARLATPIR  360
            LHRRVFLDN+D ENQAL I++SCFVKT  FEEYLRVKEVILLDLLRVISHHRARLATPIR
Sbjct  369  LHRRVFLDNVDPENQALKILISCFVKTPRFEEYLRVKEVILLDLLRVISHHRARLATPIR  428

Query  361  TVQKIYKEADVDEVPLADSVMTVNRANHPFLLIEPSYKINNSSEDKTKA-ATPPRPNQEK  537
            TVQK  +E D D+VP ADS+ + NR N   LLIEPSYKI  SS+DK KA A   + ++EK
Sbjct  429  TVQKTSREIDADDVPFADSIFSRNRPNRQVLLIEPSYKI--SSDDKAKASARSVQSDEEK  486

Query  538  DGKSEVQTTASKAVD--ASPPIVDGNRIDTRgssgssTDTEPGVATSELDGKMPNTGS--  705
            D K E   T+  A D    P  +    +D + SS S+ + +   ATS  DGK    GS  
Sbjct  487  DQKVEATITSRTADDTNGKPSTLVEKEVD-KASSASNANGDLKAATSPSDGKSLKQGSTS  545

Query  706  -VQSKNERQQVDKVVPG  753
             V+S +E+ QV    PG
Sbjct  546  PVKSNSEKNQVAGDPPG  562



>ref|XP_009376225.1| PREDICTED: mechanosensitive ion channel protein 3, chloroplastic-like 
isoform X2 [Pyrus x bretschneideri]
Length=708

 Score =   298 bits (762),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 176/314 (56%), Positives = 210/314 (67%), Gaps = 47/314 (15%)
 Frame = +1

Query  1    AIHIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQVEQQK  180
            A+HIPNHKFTVNVVRNL+QKTHWRIKTHLA+SHLDVNKIN IVADMRKVLAKNPQVEQQ+
Sbjct  333  AVHIPNHKFTVNVVRNLSQKTHWRIKTHLAVSHLDVNKINTIVADMRKVLAKNPQVEQQR  392

Query  181  LHRRVFLDNIDRENQALLIMVSCFVKTSHFEEYLRVKEVILLDLLRVISHHRARLATPIR  360
            LHRRVFLDNI+ ENQAL+I+VSCFVKTSH EEYL VKE ILLDLLRVISHH ARLATPIR
Sbjct  393  LHRRVFLDNINPENQALMILVSCFVKTSHIEEYLCVKEAILLDLLRVISHHHARLATPIR  452

Query  361  TVQKIYKEADVDEVPLADSVMTVNRA--NHPFLLIEPSYKINNSSEDKTKAAT-PPRPNQ  531
            TVQK Y EAD++ VP AD++ T +RA  N P+LLIEPSYKI  SS+DK KA+T   R N 
Sbjct  453  TVQKYYSEADLENVPFADTIFTRSRAATNRPYLLIEPSYKI--SSDDKGKASTRTTRTNG  510

Query  532  EKDGKSEVQTTA-SKAVDA-SPPIVDGNRIDTRgssgssTDTEPGVATSELDGKMPNTGS  705
            EK  ++E  + + SK  DA + P V   + D + +  SS+++     TSE+    P T +
Sbjct  511  EKQAQAEAASPSDSKGSDAKAGPAVTHAQTDDKAAVTSSSNSSTTSKTSEMPTPEPQTWN  570

Query  706  -------------VQSKNER------------------QQVDKVVP---------GEVDA  765
                         +QSKNE                   Q+V    P          + D 
Sbjct  571  PASDDSVRNNSEMLQSKNESIKYPGKETTGADSKGVSPQKVTAKKPHVASPETGSEKADV  630

Query  766  PSAVSQAKQDGERP  807
            P  ++Q KQDGE+P
Sbjct  631  PLTITQPKQDGEKP  644



>ref|XP_008444925.1| PREDICTED: mechanosensitive ion channel protein 3, chloroplastic-like 
[Cucumis melo]
Length=703

 Score =   297 bits (761),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 167/300 (56%), Positives = 207/300 (69%), Gaps = 34/300 (11%)
 Frame = +1

Query  1    AIHIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQVEQQK  180
            A+HIPNHKFTV++VRNLTQKTHWRIKTHLAISHLDVNKIN IVADMRKVL+KNPQVEQQ+
Sbjct  335  AVHIPNHKFTVSIVRNLTQKTHWRIKTHLAISHLDVNKINYIVADMRKVLSKNPQVEQQR  394

Query  181  LHRRVFLDNIDRENQALLIMVSCFVKTSHFEEYLRVKEVILLDLLRVISHHRARLATPIR  360
            LHRR+FLDN++ ENQAL+IMVSCFVKTS FEEYL VKE ILLDLLRVISHHRARLATPIR
Sbjct  395  LHRRIFLDNVNPENQALMIMVSCFVKTSRFEEYLCVKEAILLDLLRVISHHRARLATPIR  454

Query  361  TVQKIYKEADVDEVPLADSVMTVNRA-NHPFLLIEPSYKINNSSEDKTKAATPP--RPNQ  531
            TVQKIY EAD++ VP ++++ + + A N P LLIEPSYK+N   +DKTK ++ P     +
Sbjct  455  TVQKIYGEADLENVPFSETMYSRSGATNRPLLLIEPSYKVNG--DDKTKVSSRPTRSSTE  512

Query  532  EKDGKSE-VQTTASKAVDASPPI--VDGNRIDTRgssgssTDTEPG--------------  660
            EK+ K E V T+ +KA D + P   +D    D +  S S T  +P               
Sbjct  513  EKEAKQEAVSTSGTKAPDTTGPTSNLDMKADDKKSISPSGTTPKPSAPNLSTGSPEQSSA  572

Query  661  ---VATSELDGKMPNTGSVQSKNE-------RQQVDKVVPG--EVDAPSAVSQAKQDGER  804
               V ++E+ G+  +   + SK+        ++      PG  + D PS  SQ KQDGE+
Sbjct  573  EKPVTSNEIKGEKKDLLGLNSKDNMPRGTPPKRSPSASSPGSEKADIPSTSSQNKQDGEK  632



>ref|XP_010692397.1| PREDICTED: mechanosensitive ion channel protein 2, chloroplastic-like 
[Beta vulgaris subsp. vulgaris]
 ref|XP_010692398.1| PREDICTED: mechanosensitive ion channel protein 2, chloroplastic-like 
[Beta vulgaris subsp. vulgaris]
Length=633

 Score =   295 bits (756),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 146/197 (74%), Positives = 167/197 (85%), Gaps = 10/197 (5%)
 Frame = +1

Query  1    AIHIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQVEQQK  180
            A++IPNHKFTV+VVRNLTQK HWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQVEQQK
Sbjct  330  AVYIPNHKFTVSVVRNLTQKNHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQVEQQK  389

Query  181  LHRRVFLDNIDRENQALLIMVSCFVKTSHFEEYLRVKEVILLDLLRVISHHRARLATPIR  360
            LHRRVFLDNI+ ENQALLIM+SCFVKTS FEEYL VKE ILLDLLRV+SHHRARLATPIR
Sbjct  390  LHRRVFLDNINHENQALLIMISCFVKTSRFEEYLCVKEAILLDLLRVVSHHRARLATPIR  449

Query  361  TVQKIYKEADVDEVPLADSVMTVNRA--NHPFLLIEPSYKINNSSEDKTKAATPPRPNQE  534
            T++K+Y EAD D +P +++V   + A  NHPFLLIEPSYKIN  S++KTK++T       
Sbjct  450  TIRKVYTEADADNIPFSETVYNGSGAVNNHPFLLIEPSYKIN--SDNKTKSST------R  501

Query  535  KDGKSEVQTTASKAVDA  585
            KD KS+V + +   VDA
Sbjct  502  KDEKSDVTSKSDTKVDA  518



>ref|XP_009376222.1| PREDICTED: mechanosensitive ion channel protein 3, chloroplastic-like 
isoform X1 [Pyrus x bretschneideri]
 ref|XP_009376223.1| PREDICTED: mechanosensitive ion channel protein 3, chloroplastic-like 
isoform X1 [Pyrus x bretschneideri]
 ref|XP_009376224.1| PREDICTED: mechanosensitive ion channel protein 3, chloroplastic-like 
isoform X1 [Pyrus x bretschneideri]
Length=710

 Score =   297 bits (761),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 176/314 (56%), Positives = 210/314 (67%), Gaps = 47/314 (15%)
 Frame = +1

Query  1    AIHIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQVEQQK  180
            A+HIPNHKFTVNVVRNL+QKTHWRIKTHLA+SHLDVNKIN IVADMRKVLAKNPQVEQQ+
Sbjct  335  AVHIPNHKFTVNVVRNLSQKTHWRIKTHLAVSHLDVNKINTIVADMRKVLAKNPQVEQQR  394

Query  181  LHRRVFLDNIDRENQALLIMVSCFVKTSHFEEYLRVKEVILLDLLRVISHHRARLATPIR  360
            LHRRVFLDNI+ ENQAL+I+VSCFVKTSH EEYL VKE ILLDLLRVISHH ARLATPIR
Sbjct  395  LHRRVFLDNINPENQALMILVSCFVKTSHIEEYLCVKEAILLDLLRVISHHHARLATPIR  454

Query  361  TVQKIYKEADVDEVPLADSVMTVNRA--NHPFLLIEPSYKINNSSEDKTKAAT-PPRPNQ  531
            TVQK Y EAD++ VP AD++ T +RA  N P+LLIEPSYKI  SS+DK KA+T   R N 
Sbjct  455  TVQKYYSEADLENVPFADTIFTRSRAATNRPYLLIEPSYKI--SSDDKGKASTRTTRTNG  512

Query  532  EKDGKSEVQTTA-SKAVDA-SPPIVDGNRIDTRgssgssTDTEPGVATSELDGKMPNTGS  705
            EK  ++E  + + SK  DA + P V   + D + +  SS+++     TSE+    P T +
Sbjct  513  EKQAQAEAASPSDSKGSDAKAGPAVTHAQTDDKAAVTSSSNSSTTSKTSEMPTPEPQTWN  572

Query  706  -------------VQSKNER------------------QQVDKVVPG---------EVDA  765
                         +QSKNE                   Q+V    P          + D 
Sbjct  573  PASDDSVRNNSEMLQSKNESIKYPGKETTGADSKGVSPQKVTAKKPHVASPETGSEKADV  632

Query  766  PSAVSQAKQDGERP  807
            P  ++Q KQDGE+P
Sbjct  633  PLTITQPKQDGEKP  646



>ref|XP_010061548.1| PREDICTED: mechanosensitive ion channel protein 3, chloroplastic 
[Eucalyptus grandis]
 ref|XP_010061549.1| PREDICTED: mechanosensitive ion channel protein 3, chloroplastic 
[Eucalyptus grandis]
 ref|XP_010061550.1| PREDICTED: mechanosensitive ion channel protein 3, chloroplastic 
[Eucalyptus grandis]
 gb|KCW68512.1| hypothetical protein EUGRSUZ_F02149 [Eucalyptus grandis]
Length=703

 Score =   297 bits (760),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 146/192 (76%), Positives = 170/192 (89%), Gaps = 5/192 (3%)
 Frame = +1

Query  1    AIHIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQVEQQK  180
            A+HIPNHKFTV+VVRNL+QKTHWRIKTHLA+SHLDV+KINNIVADMRKVLAKNPQVEQQK
Sbjct  336  AVHIPNHKFTVSVVRNLSQKTHWRIKTHLAVSHLDVHKINNIVADMRKVLAKNPQVEQQK  395

Query  181  LHRRVFLDNIDRENQALLIMVSCFVKTSHFEEYLRVKEVILLDLLRVISHHRARLATPIR  360
            LHRRVFL+NI+ ENQAL+I++SCFVKTSHFEEYL VKE ILLDLLRVISHHRARLATPIR
Sbjct  396  LHRRVFLENINPENQALMILISCFVKTSHFEEYLCVKEAILLDLLRVISHHRARLATPIR  455

Query  361  TVQKIYKEADVDEVPLADSVMTVNR--ANHPFLLIEPSYKINNSSEDKTKAAT-PPRPNQ  531
            TVQKIY EAD++ VP AD++ T +R  AN PFLLIEPS KINN  +DK KA+T     ++
Sbjct  456  TVQKIYSEADLENVPFADAIFTRSRAAANRPFLLIEPSDKINN--DDKNKASTKGTHASE  513

Query  532  EKDGKSEVQTTA  567
            +KD K+E+ +T+
Sbjct  514  DKDTKAEMNSTS  525



>gb|KHN08998.1| Mechanosensitive ion channel protein 2, chloroplastic [Glycine 
soja]
Length=664

 Score =   296 bits (757),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 139/184 (76%), Positives = 162/184 (88%), Gaps = 4/184 (2%)
 Frame = +1

Query  1    AIHIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQVEQQK  180
            A+HIPNHKFTVNVVRNL+QK+HWRIK+++AISHLDVNK+NNIVADMRKVL+KNPQVEQQK
Sbjct  318  AVHIPNHKFTVNVVRNLSQKSHWRIKSYIAISHLDVNKVNNIVADMRKVLSKNPQVEQQK  377

Query  181  LHRRVFLDNIDRENQALLIMVSCFVKTSHFEEYLRVKEVILLDLLRVISHHRARLATPIR  360
            LHRRVFL+N++ ENQAL+I++SCFVKTSHFEEYL VKE ILLDLLRV+SHHRARLATPIR
Sbjct  378  LHRRVFLENVNPENQALMILISCFVKTSHFEEYLCVKEAILLDLLRVVSHHRARLATPIR  437

Query  361  TVQKIYKEADVDEVPLADSVMTVNR-ANHPFLLIEPSYKINNSSEDKTKAAT-PPRPNQE  534
            TVQKIY EAD + +P  D++ T +R AN PFLLIEP YK+N   EDK KA+T   R N+E
Sbjct  438  TVQKIYSEADSENIPFGDTIFTRSRAANRPFLLIEPPYKVNG--EDKVKASTRSTRANEE  495

Query  535  KDGK  546
            KD K
Sbjct  496  KDSK  499



>ref|XP_008378589.1| PREDICTED: mechanosensitive ion channel protein 3, chloroplastic-like 
isoform X3 [Malus domestica]
Length=672

 Score =   295 bits (754),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 175/313 (56%), Positives = 210/313 (67%), Gaps = 46/313 (15%)
 Frame = +1

Query  1    AIHIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQVEQQK  180
            A+HIPNHKFTVNVVRNL+QK+HWRIKTHLA+SHLDVNKIN IVADMRKVLAKNPQVEQQ+
Sbjct  298  AVHIPNHKFTVNVVRNLSQKSHWRIKTHLAVSHLDVNKINTIVADMRKVLAKNPQVEQQR  357

Query  181  LHRRVFLDNIDRENQALLIMVSCFVKTSHFEEYLRVKEVILLDLLRVISHHRARLATPIR  360
            LHRRVFLDNI+ ENQAL+I+VSCFVKTSH EEYL VKE ILLDLLRVISHH ARLATPIR
Sbjct  358  LHRRVFLDNINPENQALMILVSCFVKTSHIEEYLCVKEAILLDLLRVISHHHARLATPIR  417

Query  361  TVQKIYKEADVDEVPLADSVMTVNRA--NHPFLLIEPSYKINNSSEDKTKAAT-PPRPNQ  531
            TVQK Y EAD++ VP AD++ T +RA  N P+LLIEPSYKI  SS+DK KA+T   R N 
Sbjct  418  TVQKYYSEADLENVPFADTIFTRSRAATNRPYLLIEPSYKI--SSDDKGKASTRTMRTNG  475

Query  532  EKDGKSEVQTTA-SKAVDA-SPPIVDGNRIDTRgssgssTDTEPGVATSELDGKMPNTGS  705
            EK  ++E  + + SK  DA + P V   + D + ++ SS+++     TSE+    P T +
Sbjct  476  EKQAQAEAASPSDSKGSDAKAGPAVTHAQTDDKVAATSSSNSSTTSKTSEMPTPEPQTWN  535

Query  706  -------------VQSKNER-----------------QQVDKVVP---------GEVDAP  768
                         +QSKNE                  Q+V    P          + D P
Sbjct  536  PTSDDSVXNNSEMLQSKNESIKYPGKETGADSKGVSPQKVTAKKPHVASPETGSEKADVP  595

Query  769  SAVSQAKQDGERP  807
               +Q KQDGE+P
Sbjct  596  LTTTQPKQDGEKP  608



>ref|XP_011099985.1| PREDICTED: mechanosensitive ion channel protein 2, chloroplastic-like 
[Sesamum indicum]
Length=744

 Score =   296 bits (758),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 143/196 (73%), Positives = 168/196 (86%), Gaps = 2/196 (1%)
 Frame = +1

Query  1    AIHIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQVEQQK  180
            A+HIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLDV+KINNIVADMRKVLAKNPQVEQQK
Sbjct  336  AVHIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLDVSKINNIVADMRKVLAKNPQVEQQK  395

Query  181  LHRRVFLDNIDRENQALLIMVSCFVKTSHFEEYLRVKEVILLDLLRVISHHRARLATPIR  360
            LHRRVFLDNI+ ENQAL+I+VSCFVKTSHFEEYL VKE ILLDLLRVI HHRARLATPIR
Sbjct  396  LHRRVFLDNINPENQALMILVSCFVKTSHFEEYLCVKEAILLDLLRVIRHHRARLATPIR  455

Query  361  TVQKIYKEADVDEVPLADSVMTVNR-ANHPFLLIEPSYKINNSSEDKTKAATPPRPNQEK  537
            TVQKI+ +AD+D VP +DS+ +     N P LL+EPSYK+N + + K++A +  R + E+
Sbjct  456  TVQKIFTDADLDGVPFSDSMFSRGAVTNRPLLLVEPSYKVNGADKSKSQARS-ARASGEE  514

Query  538  DGKSEVQTTASKAVDA  585
            + K+ V++T+   VDA
Sbjct  515  ESKATVKSTSDNKVDA  530



>ref|XP_006581505.1| PREDICTED: mechanosensitive ion channel protein 2, chloroplastic-like 
[Glycine max]
Length=681

 Score =   295 bits (754),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 139/184 (76%), Positives = 162/184 (88%), Gaps = 4/184 (2%)
 Frame = +1

Query  1    AIHIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQVEQQK  180
            A+HIPNHKFTVNVVRNL+QK+HWRIK+++AISHLDVNK+NNIVADMRKVL+KNPQVEQQK
Sbjct  335  AVHIPNHKFTVNVVRNLSQKSHWRIKSYIAISHLDVNKVNNIVADMRKVLSKNPQVEQQK  394

Query  181  LHRRVFLDNIDRENQALLIMVSCFVKTSHFEEYLRVKEVILLDLLRVISHHRARLATPIR  360
            LHRRVFL+N++ ENQAL+I++SCFVKTSHFEEYL VKE ILLDLLRV+SHHRARLATPIR
Sbjct  395  LHRRVFLENVNPENQALMILISCFVKTSHFEEYLCVKEAILLDLLRVVSHHRARLATPIR  454

Query  361  TVQKIYKEADVDEVPLADSVMTVNR-ANHPFLLIEPSYKINNSSEDKTKAAT-PPRPNQE  534
            TVQKIY EAD + +P  D++ T +R AN PFLLIEP YK+N   EDK KA+T   R N+E
Sbjct  455  TVQKIYSEADSENIPFGDTIFTRSRAANRPFLLIEPPYKVNG--EDKVKASTRSTRANEE  512

Query  535  KDGK  546
            KD K
Sbjct  513  KDSK  516



>ref|XP_010646793.1| PREDICTED: mechanosensitive ion channel protein 2, chloroplastic 
[Vitis vinifera]
Length=763

 Score =   296 bits (758),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 149/207 (72%), Positives = 165/207 (80%), Gaps = 8/207 (4%)
 Frame = +1

Query  1    AIHIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQVEQQK  180
            A+HIPNHKFTVNVVRNL+QKTHWRIKTHLAISHLDVNKIN+IVADMRKVLAKNPQVEQQ+
Sbjct  335  AVHIPNHKFTVNVVRNLSQKTHWRIKTHLAISHLDVNKINSIVADMRKVLAKNPQVEQQR  394

Query  181  LHRRVFLDNIDRENQALLIMVSCFVKTSHFEEYLRVKEVILLDLLRVISHHRARLATPIR  360
            LHRRVFLDNI+ ENQALLI++SCFVKTSHFEEYL VKE ILLDLLRVISHHRARLATPIR
Sbjct  395  LHRRVFLDNINPENQALLILISCFVKTSHFEEYLCVKEAILLDLLRVISHHRARLATPIR  454

Query  361  TVQKIYKEADVDEVPLADSVMTVNRA--NHPFLLIEPSYKINNSSEDKTKAAT-PPRPNQ  531
            TVQKIY +AD + +P ADS         N P LLIEP Y+IN   EDKTK  T   R N 
Sbjct  455  TVQKIYSDADFENIPFADSAFARGGVAPNRPLLLIEPPYRING--EDKTKTQTRSARTNG  512

Query  532  EKDGKSEVQTTASKAVDA---SPPIVD  603
            E+DGK  ++ T     DA   + P+ D
Sbjct  513  EQDGKVPLRPTTDTKADAKAGATPVTD  539



>ref|XP_007018223.1| MSCS-like 3 isoform 2 [Theobroma cacao]
 ref|XP_007018224.1| MSCS-like 3 isoform 2 [Theobroma cacao]
 gb|EOY15448.1| MSCS-like 3 isoform 2 [Theobroma cacao]
 gb|EOY15449.1| MSCS-like 3 isoform 2 [Theobroma cacao]
Length=487

 Score =   289 bits (739),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 169/300 (56%), Positives = 202/300 (67%), Gaps = 37/300 (12%)
 Frame = +1

Query  1    AIHIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQVEQQK  180
            A+HIPNHKFTVNVVRNL+QKTHWRIK + AISHLDVNKINNIVADMRKVLAKNPQVEQQ+
Sbjct  115  AVHIPNHKFTVNVVRNLSQKTHWRIKNYFAISHLDVNKINNIVADMRKVLAKNPQVEQQR  174

Query  181  LHRRVFLDNIDRENQALLIMVSCFVKTSHFEEYLRVKEVILLDLLRVISHHRARLATPIR  360
            LHRRVFL++I+ ENQAL+I+VSCFVKTSH EEYL V+E ILLDLLRVISHH+ARLATPIR
Sbjct  175  LHRRVFLESINPENQALMILVSCFVKTSHVEEYLCVREAILLDLLRVISHHQARLATPIR  234

Query  361  TVQKIYKEADVDEVPLADSVM--TVNRANHPFLLIEPSYKINNSSEDKTKAATPPRPNQE  534
            TVQK+Y EA+V++VP AD++   +    N P LLIEPSYKI  S +DK KA+T  R N+E
Sbjct  235  TVQKMYSEAEVEDVPFADTIFRRSGVATNRPLLLIEPSYKI--SGDDKVKAST--RANEE  290

Query  535  KDGKSEVQTTA-SKAVDASPP--IVDGNRID--------TRgssgssTDTEPGVATSELD  681
            KD   E  +T+ SKA   S P  I+D +++D           SS   + +E        D
Sbjct  291  KDSMEEATSTSDSKANTLSRPTSIID-SKVDKATSPSLSNSSSSSKVSSSEAQTGNPVPD  349

Query  682  GKMPNTGSVQSKNERQQVDKV-------------------VPGEVDAPSAVSQAKQDGER  804
            G        Q K  R +  KV                   V GE + P A+SQAKQD +R
Sbjct  350  GSAEVNSEKQFKQSRGETWKVSGSGREMITEKSPVANPQSVNGESEIPLAISQAKQDVDR  409



>ref|XP_008378585.1| PREDICTED: mechanosensitive ion channel protein 3, chloroplastic-like 
isoform X1 [Malus domestica]
 ref|XP_008378587.1| PREDICTED: mechanosensitive ion channel protein 3, chloroplastic-like 
isoform X1 [Malus domestica]
Length=709

 Score =   295 bits (754),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 175/313 (56%), Positives = 210/313 (67%), Gaps = 46/313 (15%)
 Frame = +1

Query  1    AIHIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQVEQQK  180
            A+HIPNHKFTVNVVRNL+QK+HWRIKTHLA+SHLDVNKIN IVADMRKVLAKNPQVEQQ+
Sbjct  335  AVHIPNHKFTVNVVRNLSQKSHWRIKTHLAVSHLDVNKINTIVADMRKVLAKNPQVEQQR  394

Query  181  LHRRVFLDNIDRENQALLIMVSCFVKTSHFEEYLRVKEVILLDLLRVISHHRARLATPIR  360
            LHRRVFLDNI+ ENQAL+I+VSCFVKTSH EEYL VKE ILLDLLRVISHH ARLATPIR
Sbjct  395  LHRRVFLDNINPENQALMILVSCFVKTSHIEEYLCVKEAILLDLLRVISHHHARLATPIR  454

Query  361  TVQKIYKEADVDEVPLADSVMTVNRA--NHPFLLIEPSYKINNSSEDKTKAAT-PPRPNQ  531
            TVQK Y EAD++ VP AD++ T +RA  N P+LLIEPSYKI  SS+DK KA+T   R N 
Sbjct  455  TVQKYYSEADLENVPFADTIFTRSRAATNRPYLLIEPSYKI--SSDDKGKASTRTMRTNG  512

Query  532  EKDGKSEVQTTA-SKAVDA-SPPIVDGNRIDTRgssgssTDTEPGVATSELDGKMPNTGS  705
            EK  ++E  + + SK  DA + P V   + D + ++ SS+++     TSE+    P T +
Sbjct  513  EKQAQAEAASPSDSKGSDAKAGPAVTHAQTDDKVAATSSSNSSTTSKTSEMPTPEPQTWN  572

Query  706  -------------VQSKNER-----------------QQVDKVVP---------GEVDAP  768
                         +QSKNE                  Q+V    P          + D P
Sbjct  573  PTSDDSVXNNSEMLQSKNESIKYPGKETGADSKGVSPQKVTAKKPHVASPETGSEKADVP  632

Query  769  SAVSQAKQDGERP  807
               +Q KQDGE+P
Sbjct  633  LTTTQPKQDGEKP  645



>ref|XP_008378588.1| PREDICTED: mechanosensitive ion channel protein 3, chloroplastic-like 
isoform X2 [Malus domestica]
Length=707

 Score =   295 bits (754),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 175/313 (56%), Positives = 210/313 (67%), Gaps = 46/313 (15%)
 Frame = +1

Query  1    AIHIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQVEQQK  180
            A+HIPNHKFTVNVVRNL+QK+HWRIKTHLA+SHLDVNKIN IVADMRKVLAKNPQVEQQ+
Sbjct  333  AVHIPNHKFTVNVVRNLSQKSHWRIKTHLAVSHLDVNKINTIVADMRKVLAKNPQVEQQR  392

Query  181  LHRRVFLDNIDRENQALLIMVSCFVKTSHFEEYLRVKEVILLDLLRVISHHRARLATPIR  360
            LHRRVFLDNI+ ENQAL+I+VSCFVKTSH EEYL VKE ILLDLLRVISHH ARLATPIR
Sbjct  393  LHRRVFLDNINPENQALMILVSCFVKTSHIEEYLCVKEAILLDLLRVISHHHARLATPIR  452

Query  361  TVQKIYKEADVDEVPLADSVMTVNRA--NHPFLLIEPSYKINNSSEDKTKAAT-PPRPNQ  531
            TVQK Y EAD++ VP AD++ T +RA  N P+LLIEPSYKI  SS+DK KA+T   R N 
Sbjct  453  TVQKYYSEADLENVPFADTIFTRSRAATNRPYLLIEPSYKI--SSDDKGKASTRTMRTNG  510

Query  532  EKDGKSEVQTTA-SKAVDA-SPPIVDGNRIDTRgssgssTDTEPGVATSELDGKMPNTGS  705
            EK  ++E  + + SK  DA + P V   + D + ++ SS+++     TSE+    P T +
Sbjct  511  EKQAQAEAASPSDSKGSDAKAGPAVTHAQTDDKVAATSSSNSSTTSKTSEMPTPEPQTWN  570

Query  706  -------------VQSKNER-----------------QQVDKVVP---------GEVDAP  768
                         +QSKNE                  Q+V    P          + D P
Sbjct  571  PTSDDSVXNNSEMLQSKNESIKYPGKETGADSKGVSPQKVTAKKPHVASPETGSEKADVP  630

Query  769  SAVSQAKQDGERP  807
               +Q KQDGE+P
Sbjct  631  LTTTQPKQDGEKP  643



>ref|XP_010277500.1| PREDICTED: mechanosensitive ion channel protein 2, chloroplastic-like 
[Nelumbo nucifera]
Length=754

 Score =   295 bits (755),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 147/196 (75%), Positives = 165/196 (84%), Gaps = 6/196 (3%)
 Frame = +1

Query  1    AIHIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQVEQQK  180
            A+HIPNHKFTV+VVRNL+QK+HWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQVEQQ+
Sbjct  334  AVHIPNHKFTVSVVRNLSQKSHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQVEQQR  393

Query  181  LHRRVFLDNIDRENQALLIMVSCFVKTSHFEEYLRVKEVILLDLLRVISHHRARLATPIR  360
            LHRRVFLDNID ENQALLIMVSCFVKTSHFEEYL VKE ILLDLLRV+ HHRARLATPIR
Sbjct  394  LHRRVFLDNIDPENQALLIMVSCFVKTSHFEEYLCVKEAILLDLLRVVRHHRARLATPIR  453

Query  361  TVQKIYKEADVDEVPLADSVMTVNR--ANHPFLLIEPSYKINNSSEDKTK-AATPPRPNQ  531
            TVQK+Y +ADV+ +P AD++ T  R  AN PFLLIEP YKIN   +DK K        N+
Sbjct  454  TVQKVYSDADVENIPFADTIFTRTRPAANRPFLLIEPPYKING--DDKIKPQGRSVHANE  511

Query  532  EKDGK-SEVQTTASKA  576
            E+D K +E QT+ + A
Sbjct  512  EQDAKGTERQTSDTNA  527



>ref|XP_008368109.1| PREDICTED: mechanosensitive ion channel protein 2, chloroplastic-like, 
partial [Malus domestica]
Length=409

 Score =   285 bits (730),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 155/250 (62%), Positives = 185/250 (74%), Gaps = 11/250 (4%)
 Frame = +1

Query  1    AIHIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQVEQQK  180
            A+HIPNHKFTV VVRNL+QKTHWRIKTHLA+SHLDVNKI+ IVADMRKVLAKNPQVEQQ+
Sbjct  155  AVHIPNHKFTVTVVRNLSQKTHWRIKTHLAVSHLDVNKIHTIVADMRKVLAKNPQVEQQR  214

Query  181  LHRRVFLDNIDRENQALLIMVSCFVKTSHFEEYLRVKEVILLDLLRVISHHRARLATPIR  360
            LHRRVFLD+I+ ENQAL+I+VSCFVKTS FEEYL VKE IL+DLLRVISHHRARLATPIR
Sbjct  215  LHRRVFLDDINPENQALMILVSCFVKTSRFEEYLCVKEAILMDLLRVISHHRARLATPIR  274

Query  361  TVQKIYKEADVDEVPLADSVMTVNRA--NHPFLLIEPSYKINNSSEDKTKAAT-PPRPNQ  531
            TVQK Y EAD++ VP AD+V T +RA  N P LLIEPSYKI  SS+DK KA+T     N 
Sbjct  275  TVQKYYSEADLENVPFADTVFTRSRASTNRPHLLIEPSYKI--SSDDKGKASTHTTHTNG  332

Query  532  EKDGKSEVQTTASKAVDASPPIVDGNRIDTRgssgssTDTEPGVATSELDGKMPNT----  699
            EK  ++   + +  +   + P V   + D +    SS+++      SE+    P T    
Sbjct  333  EKQAEAASTSDSKGSNTKAGPAVTHAQTDDKVVVTSSSNSSTTSKASEMPPSEPQTRNSA  392

Query  700  --GSVQSKNE  723
              GSVQ+ +E
Sbjct  393  SDGSVQNNSE  402



>ref|XP_006383812.1| hypothetical protein POPTR_0005s28410g [Populus trichocarpa]
 gb|ERP61609.1| hypothetical protein POPTR_0005s28410g [Populus trichocarpa]
Length=502

 Score =   288 bits (736),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 141/185 (76%), Positives = 158/185 (85%), Gaps = 5/185 (3%)
 Frame = +1

Query  1    AIHIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQVEQQK  180
            A+HIPNHKF V+VVRNL+QKTHWRIKTH AISHLDV KINNIVADMRKVLAKNPQ+EQQ+
Sbjct  205  AVHIPNHKFNVSVVRNLSQKTHWRIKTHFAISHLDVIKINNIVADMRKVLAKNPQIEQQR  264

Query  181  LHRRVFLDNIDRENQALLIMVSCFVKTSHFEEYLRVKEVILLDLLRVISHHRARLATPIR  360
            LHRRVFLDNI+ ENQAL+I+VSCFVKTSHFEEYL VKE +LLDLLRVISHHRARLATPIR
Sbjct  265  LHRRVFLDNINPENQALMILVSCFVKTSHFEEYLCVKEAVLLDLLRVISHHRARLATPIR  324

Query  361  TVQKIYKEADVDEVPLADSVMTVN--RANHPFLLIEPSYKINNSSEDKTKAA-TPPRPNQ  531
            TVQKIY EAD++ VP +DS+ T +   A+ P LLIEP YKIN   EDK KA+  P   N+
Sbjct  325  TVQKIYGEADLENVPFSDSIFTRSGATASRPLLLIEPFYKING--EDKVKASHRPLHANE  382

Query  532  EKDGK  546
            EKD K
Sbjct  383  EKDAK  387



>ref|XP_010942788.1| PREDICTED: mechanosensitive ion channel protein 2, chloroplastic-like 
[Elaeis guineensis]
 ref|XP_010942789.1| PREDICTED: mechanosensitive ion channel protein 2, chloroplastic-like 
[Elaeis guineensis]
Length=674

 Score =   292 bits (747),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 161/275 (59%), Positives = 194/275 (71%), Gaps = 12/275 (4%)
 Frame = +1

Query  1    AIHIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQVEQQK  180
            A+HIPNHKFTVNVVRNL+QKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQ+EQQ+
Sbjct  333  AVHIPNHKFTVNVVRNLSQKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQIEQQR  392

Query  181  LHRRVFLDNIDRENQALLIMVSCFVKTSHFEEYLRVKEVILLDLLRVISHHRARLATPIR  360
            LHRRVFL+NI+ ENQALLI++SCFVKTSHFEEYL VKE ILLDLLRVISHHRARLATPIR
Sbjct  393  LHRRVFLENINPENQALLILISCFVKTSHFEEYLCVKEAILLDLLRVISHHRARLATPIR  452

Query  361  TVQKIYKEADVDEVPLADSVMT--VNRANHPFLLIEPSYKINNSSEDKTKAATPPRPNQE  534
            TVQKIY +AD++ +P ++++ T      N PFLLIE S ++N   +DK K+ T  R N+E
Sbjct  453  TVQKIYGDADLENIPYSETIFTRSATATNRPFLLIESSLRVNG--DDKAKSHTTARTNEE  510

Query  535  KDGK----SEVQTTASKAVDASPPIVDGNRIDTRgssgssT-DTEPGVATSELDGKMPNT  699
               K    SE + T S   D        N  DTR  S  +   T P +++  L+  + + 
Sbjct  511  HKSKAATASESKVTPSDNSDKQQK-KKANSGDTRSKSNMADPATAPSLSSPPLE-SLDSV  568

Query  700  GSVQSKNERQQVDKVVPGEVDAPSAVSQAKQDGER  804
            GS     E+      V  +VD  S +  AK +GER
Sbjct  569  GSTSKAGEKPTSSDAVGEQVDDTSPI-HAKNEGER  602



>gb|KHN08265.1| Mechanosensitive ion channel protein 2, chloroplastic [Glycine 
soja]
Length=625

 Score =   291 bits (744),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 138/184 (75%), Positives = 161/184 (88%), Gaps = 4/184 (2%)
 Frame = +1

Query  1    AIHIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQVEQQK  180
            A+HIPNHKFTVNVVRNL+QK+HWRIK+++AISHLDVNKINNIVADMRKVL+KNPQVEQQK
Sbjct  246  AVHIPNHKFTVNVVRNLSQKSHWRIKSYIAISHLDVNKINNIVADMRKVLSKNPQVEQQK  305

Query  181  LHRRVFLDNIDRENQALLIMVSCFVKTSHFEEYLRVKEVILLDLLRVISHHRARLATPIR  360
            LHRRVFL+N++ ENQAL+I++SCFVKTSHFEEYL VKE ILLDLLRV+SHHRARLATPIR
Sbjct  306  LHRRVFLENVNPENQALMILISCFVKTSHFEEYLCVKEAILLDLLRVVSHHRARLATPIR  365

Query  361  TVQKIYKEADVDEVPLADSVMTVNRA-NHPFLLIEPSYKINNSSEDKTKAAT-PPRPNQE  534
            TVQKIY EAD + +P  D++ T + A N PFLLIEP YK+N   EDKTK +T   R ++E
Sbjct  366  TVQKIYSEADSENIPFGDTIFTRSSAGNRPFLLIEPLYKVNG--EDKTKPSTRSTRASEE  423

Query  535  KDGK  546
            KD K
Sbjct  424  KDFK  427



>ref|XP_012081663.1| PREDICTED: mechanosensitive ion channel protein 2, chloroplastic 
[Jatropha curcas]
 ref|XP_012081664.1| PREDICTED: mechanosensitive ion channel protein 2, chloroplastic 
[Jatropha curcas]
 gb|KDP29764.1| hypothetical protein JCGZ_18699 [Jatropha curcas]
Length=749

 Score =   293 bits (749),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 147/197 (75%), Positives = 162/197 (82%), Gaps = 8/197 (4%)
 Frame = +1

Query  1    AIHIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQVEQQK  180
            A+HIPNHKFTVNVVRNL+QKTHWRIKTHLAISHLD +KINNIVADMRKVLAKNPQVEQQ+
Sbjct  337  AVHIPNHKFTVNVVRNLSQKTHWRIKTHLAISHLDAHKINNIVADMRKVLAKNPQVEQQR  396

Query  181  LHRRVFLDNIDRENQALLIMVSCFVKTSHFEEYLRVKEVILLDLLRVISHHRARLATPIR  360
            LHRRVFLDN++ ENQALLI+VSCFVKTSH EEYL VKE ILLDLLRVISHHRARLATPIR
Sbjct  397  LHRRVFLDNVNPENQALLILVSCFVKTSHHEEYLCVKEAILLDLLRVISHHRARLATPIR  456

Query  361  TVQKIYKEADVDEVPLADSVMTVNR--ANHPFLLIEPSYKINNSSEDKTKAATPPR---P  525
            TVQKIY +AD+D +P ADS+       +N P LLIEPSYKIN   EDKTK+ T P     
Sbjct  457  TVQKIYSDADLDNIPFADSIYNCGGVASNRPLLLIEPSYKING--EDKTKSQTRPGRGAG  514

Query  526  NQEKDGKSEVQTTASKA  576
            +QE  G S   T+ SK 
Sbjct  515  DQENKGMSR-STSESKG  530



>ref|XP_004299731.1| PREDICTED: mechanosensitive ion channel protein 2, chloroplastic-like 
[Fragaria vesca subsp. vesca]
 ref|XP_011464660.1| PREDICTED: mechanosensitive ion channel protein 2, chloroplastic-like 
[Fragaria vesca subsp. vesca]
Length=671

 Score =   290 bits (743),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 158/289 (55%), Positives = 193/289 (67%), Gaps = 29/289 (10%)
 Frame = +1

Query  1    AIHIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQVEQQK  180
            A+HIPNHKFTVNVVRNL+QKTHWRIK ++AISHLDVNKIN IVADMRKVLAKNPQ+EQQ+
Sbjct  334  AVHIPNHKFTVNVVRNLSQKTHWRIKNYIAISHLDVNKINIIVADMRKVLAKNPQIEQQR  393

Query  181  LHRRVFLDNIDRENQALLIMVSCFVKTSHFEEYLRVKEVILLDLLRVISHHRARLATPIR  360
            LHRRVFLDNI+ ENQAL+I+VSCFVKTSH EEYL VKE ILLDLLRV+SHHRARLATP+R
Sbjct  394  LHRRVFLDNINPENQALMILVSCFVKTSHIEEYLCVKEAILLDLLRVVSHHRARLATPLR  453

Query  361  TVQKIYKEADVDEVPLADSVM--TVNRANHPFLLIEPSYKINNSSEDKTKA---------  507
            TVQK+Y +AD++ VP AD++   +  R N P+LLIEPSY+I  SS+DK+KA         
Sbjct  454  TVQKVYGDADLENVPFADTIFGNSTARTNRPYLLIEPSYRI--SSDDKSKASNRSARTNG  511

Query  508  ----ATP---PRPNQEKDGKSEVQTTASKAVDASPPIVDGNRIDTRgssgssTDTEPGVA  666
                A P   P P Q +D  S    +++    +  P               +  TE    
Sbjct  512  DKEEAKPGPIPTPTQTEDKASFTSNSSTSPKTSEMP---------SEPQTQNEKTEYAGK  562

Query  667  TSELDGKMPNTGSVQSKNERQQVDKVVPGEVDAPSAVSQAKQDGERPTT  813
              ++D K  +   V SKN      ++  G+ D P     AKQDGE+P T
Sbjct  563  EKKVDSKYVSPEKVTSKNSPVTSSEMDGGKADIPLTTVHAKQDGEKPVT  611



>ref|XP_004152598.1| PREDICTED: mechanosensitive ion channel protein 3, chloroplastic 
[Cucumis sativus]
 gb|KGN62754.1| hypothetical protein Csa_2G370530 [Cucumis sativus]
Length=704

 Score =   291 bits (745),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 167/300 (56%), Positives = 205/300 (68%), Gaps = 34/300 (11%)
 Frame = +1

Query  1    AIHIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQVEQQK  180
            A+HIPNHKFTV++VRNLTQKTHWRIKTHLAISHLDVNKIN IVADMRKVL+KNPQVEQQ+
Sbjct  335  AVHIPNHKFTVSIVRNLTQKTHWRIKTHLAISHLDVNKINYIVADMRKVLSKNPQVEQQR  394

Query  181  LHRRVFLDNIDRENQALLIMVSCFVKTSHFEEYLRVKEVILLDLLRVISHHRARLATPIR  360
            LHRR+FLDN++ ENQAL+IMVSCFVKTS FEEYL VKE ILLDLLRVISHHRARLATPIR
Sbjct  395  LHRRIFLDNVNPENQALMIMVSCFVKTSRFEEYLCVKEAILLDLLRVISHHRARLATPIR  454

Query  361  TVQKIYKEADVDEVPLADSVMTVNRA-NHPFLLIEPSYKINNSSEDKTKAATPP--RPNQ  531
            TVQKIY EAD++ VP ++++ + + A N P LLIEPSYK+N   +DKTK ++ P     +
Sbjct  455  TVQKIYGEADLENVPFSETMYSRSGATNRPLLLIEPSYKVNG--DDKTKVSSRPTRSSTE  512

Query  532  EKDGKSE-VQTTASKAVD--ASPPIVDGNRIDTRgssgssTDTEPG--------------  660
            EK+ K E V T+ +KA D   S   +D    D +  S S    +P               
Sbjct  513  EKEAKQEAVSTSGTKAPDTTGSTSNLDMKADDKKPISPSGITPKPSAPILSTSSSEQSSA  572

Query  661  ---VATSELDGKMPNTGSVQSKNE--RQQVDKVVPG-------EVDAPSAVSQAKQDGER  804
               V ++E+ G+  +   + SK+   R  + K  P        + D PS  SQ KQDGE+
Sbjct  573  EKPVTSNEIKGEKKDILGLNSKDNMPRATLPKRSPSASSPGSEKADIPSTSSQNKQDGEK  632



>ref|XP_008339021.1| PREDICTED: mechanosensitive ion channel protein 2, chloroplastic-like, 
partial [Malus domestica]
Length=539

 Score =   286 bits (733),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 168/312 (54%), Positives = 201/312 (64%), Gaps = 45/312 (14%)
 Frame = +1

Query  1    AIHIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQVEQQK  180
            A+HIPNHKFTV VVRNL+QKTHWRIKTHLA+SHLDVNKI+ IVADMRKVLAKNPQVEQQ+
Sbjct  166  AVHIPNHKFTVTVVRNLSQKTHWRIKTHLAVSHLDVNKIHTIVADMRKVLAKNPQVEQQR  225

Query  181  LHRRVFLDNIDRENQALLIMVSCFVKTSHFEEYLRVKEVILLDLLRVISHHRARLATPIR  360
            LHRRVFLD+I+ ENQAL+I+VSCFVKTS FEEYL VKE IL+DLLRVISHHRARLATPIR
Sbjct  226  LHRRVFLDDINPENQALMILVSCFVKTSRFEEYLCVKEAILMDLLRVISHHRARLATPIR  285

Query  361  TVQKIYKEADVDEVPLADSVMTVNRA--NHPFLLIEPSYKINNSSEDKTKAAT-PPRPNQ  531
            TVQK Y EAD++ VP AD+V T +RA  N P LLIEPSYKI  SS+DK KA+T     N 
Sbjct  286  TVQKYYSEADLENVPFADTVFTRSRASTNRPHLLIEPSYKI--SSDDKGKASTHTTHTNG  343

Query  532  EKDGKSEVQTTASKAVDASPPIVDGNRIDTRgssgssTD------------TEPGVATSE  675
            EK  ++   + +  +   + P V   + D +    SS++            +EP    S 
Sbjct  344  EKQAEAASTSDSKGSNTKAGPAVTHAQTDDKXVVTSSSNSSTTSKASEMPPSEPQTRNSA  403

Query  676  LDGKMPNTGS-VQSKNER------------------QQVDKVVPG---------EVDAPS  771
             DG + N    V+SKNE                   Q+V    P          +   P 
Sbjct  404  SDGSVQNNSEMVRSKNESTKHAGKDTTGVHSKXASPQKVTSKKPSVASPETGSEKAXIPL  463

Query  772  AVSQAKQDGERP  807
              +Q KQDGE+P
Sbjct  464  TTTQTKQDGEKP  475



>gb|KJB48897.1| hypothetical protein B456_008G092700 [Gossypium raimondii]
Length=739

 Score =   291 bits (746),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 142/191 (74%), Positives = 166/191 (87%), Gaps = 5/191 (3%)
 Frame = +1

Query  1    AIHIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQVEQQK  180
            A+HIPNHKFTVNVVRNL+QKTHWRIKTHLAISH+DV+KI+NIVADMRKVLAKNPQVEQQ+
Sbjct  336  AVHIPNHKFTVNVVRNLSQKTHWRIKTHLAISHMDVHKISNIVADMRKVLAKNPQVEQQR  395

Query  181  LHRRVFLDNIDRENQALLIMVSCFVKTSHFEEYLRVKEVILLDLLRVISHHRARLATPIR  360
            LHRRVFL+NI+ ENQAL+I+VSCFVKTSHFEEYL VKE ILLDLLRVISHH ARLATPIR
Sbjct  396  LHRRVFLENINPENQALMILVSCFVKTSHFEEYLCVKEAILLDLLRVISHHCARLATPIR  455

Query  361  TVQKIYKEADVDEVPLADSVMTVN--RANHPFLLIEPSYKINNSSEDKTKAATPPRPNQE  534
            TVQKIY +AD++ +P ADS+   +  ++N P LLIEPSYKIN   ED+TK  +  RP  E
Sbjct  456  TVQKIYSDADLENIPFADSMYNHDGIQSNRPLLLIEPSYKING--EDRTKGRS-SRPAGE  512

Query  535  KDGKSEVQTTA  567
            +DGK+ V+ +A
Sbjct  513  QDGKTTVRPSA  523



>gb|KDO60564.1| hypothetical protein CISIN_1g0049741mg [Citrus sinensis]
Length=653

 Score =   289 bits (740),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 143/188 (76%), Positives = 162/188 (86%), Gaps = 9/188 (5%)
 Frame = +1

Query  1    AIHIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQVEQQK  180
            A+HIPNHKFTVNVVRNL+QK+HWRIKTHLAISHLDV+KIN+IVADMRKVLAKNPQVEQQ+
Sbjct  246  AVHIPNHKFTVNVVRNLSQKSHWRIKTHLAISHLDVHKINSIVADMRKVLAKNPQVEQQR  305

Query  181  LHRRVFLDNIDRENQALLIMVSCFVKTSHFEEYLRVKEVILLDLLRVISHHRARLATPIR  360
            LHRRVFLDNI+ ENQALLI+VSCFVKTSH EEYL VKE ILLDLLRVISHHRARLATPIR
Sbjct  306  LHRRVFLDNINPENQALLILVSCFVKTSHHEEYLCVKEAILLDLLRVISHHRARLATPIR  365

Query  361  TVQKIYKEADVDEVPLADSVMTVNRA----NHPFLLIEPSYKINNSSEDKTKAAT-PPRP  525
            TVQKI+ +AD++ VP AD++   NR     N P LLIEP Y+IN   EDKTK+ T P R 
Sbjct  366  TVQKIFSDADLENVPFADTIY--NRGGGASNRPLLLIEPPYRING--EDKTKSQTRPSRS  421

Query  526  NQEKDGKS  549
            + E+DGK+
Sbjct  422  SGEQDGKT  429



>gb|KJB48898.1| hypothetical protein B456_008G092700 [Gossypium raimondii]
Length=743

 Score =   291 bits (746),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 142/191 (74%), Positives = 166/191 (87%), Gaps = 5/191 (3%)
 Frame = +1

Query  1    AIHIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQVEQQK  180
            A+HIPNHKFTVNVVRNL+QKTHWRIKTHLAISH+DV+KI+NIVADMRKVLAKNPQVEQQ+
Sbjct  340  AVHIPNHKFTVNVVRNLSQKTHWRIKTHLAISHMDVHKISNIVADMRKVLAKNPQVEQQR  399

Query  181  LHRRVFLDNIDRENQALLIMVSCFVKTSHFEEYLRVKEVILLDLLRVISHHRARLATPIR  360
            LHRRVFL+NI+ ENQAL+I+VSCFVKTSHFEEYL VKE ILLDLLRVISHH ARLATPIR
Sbjct  400  LHRRVFLENINPENQALMILVSCFVKTSHFEEYLCVKEAILLDLLRVISHHCARLATPIR  459

Query  361  TVQKIYKEADVDEVPLADSVMTVN--RANHPFLLIEPSYKINNSSEDKTKAATPPRPNQE  534
            TVQKIY +AD++ +P ADS+   +  ++N P LLIEPSYKIN   ED+TK  +  RP  E
Sbjct  460  TVQKIYSDADLENIPFADSMYNHDGIQSNRPLLLIEPSYKING--EDRTKGRS-SRPAGE  516

Query  535  KDGKSEVQTTA  567
            +DGK+ V+ +A
Sbjct  517  QDGKTTVRPSA  527



>gb|KDO60566.1| hypothetical protein CISIN_1g0049741mg, partial [Citrus sinensis]
 gb|KDO60567.1| hypothetical protein CISIN_1g0049741mg, partial [Citrus sinensis]
Length=643

 Score =   289 bits (740),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 143/188 (76%), Positives = 162/188 (86%), Gaps = 9/188 (5%)
 Frame = +1

Query  1    AIHIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQVEQQK  180
            A+HIPNHKFTVNVVRNL+QK+HWRIKTHLAISHLDV+KIN+IVADMRKVLAKNPQVEQQ+
Sbjct  236  AVHIPNHKFTVNVVRNLSQKSHWRIKTHLAISHLDVHKINSIVADMRKVLAKNPQVEQQR  295

Query  181  LHRRVFLDNIDRENQALLIMVSCFVKTSHFEEYLRVKEVILLDLLRVISHHRARLATPIR  360
            LHRRVFLDNI+ ENQALLI+VSCFVKTSH EEYL VKE ILLDLLRVISHHRARLATPIR
Sbjct  296  LHRRVFLDNINPENQALLILVSCFVKTSHHEEYLCVKEAILLDLLRVISHHRARLATPIR  355

Query  361  TVQKIYKEADVDEVPLADSVMTVNRA----NHPFLLIEPSYKINNSSEDKTKAAT-PPRP  525
            TVQKI+ +AD++ VP AD++   NR     N P LLIEP Y+IN   EDKTK+ T P R 
Sbjct  356  TVQKIFSDADLENVPFADTIY--NRGGGASNRPLLLIEPPYRING--EDKTKSQTRPSRS  411

Query  526  NQEKDGKS  549
            + E+DGK+
Sbjct  412  SGEQDGKT  419



>ref|XP_003522763.1| PREDICTED: mechanosensitive ion channel protein 2, chloroplastic-like 
isoform X1 [Glycine max]
 ref|XP_006578274.1| PREDICTED: mechanosensitive ion channel protein 2, chloroplastic-like 
isoform X2 [Glycine max]
Length=681

 Score =   290 bits (741),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 159/281 (57%), Positives = 205/281 (73%), Gaps = 15/281 (5%)
 Frame = +1

Query  1    AIHIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQVEQQK  180
            A+HIPNHKFTVNVVRNL+QK+HWRIK+++AISHLDVNKINNIVADMRKVL+KNPQVEQQK
Sbjct  335  AVHIPNHKFTVNVVRNLSQKSHWRIKSYIAISHLDVNKINNIVADMRKVLSKNPQVEQQK  394

Query  181  LHRRVFLDNIDRENQALLIMVSCFVKTSHFEEYLRVKEVILLDLLRVISHHRARLATPIR  360
            LHRRVFL+N++ ENQAL+I++SCFVKTSHFEEYL VKE ILLDLLRV+SHHRARLATPIR
Sbjct  395  LHRRVFLENVNPENQALMILISCFVKTSHFEEYLCVKEAILLDLLRVVSHHRARLATPIR  454

Query  361  TVQKIYKEADVDEVPLADSVMTVNRA-NHPFLLIEPSYKINNSSEDKTKAAT-PPRPNQE  534
            TVQKIY EAD + +P  D++ T + A N PFLLIEP YK+N   EDKTK +T   R ++E
Sbjct  455  TVQKIYSEADSENIPFGDTIFTRSSAGNRPFLLIEPLYKVNG--EDKTKPSTRSTRASEE  512

Query  535  KDGKSEVQTTASKAVD---ASPPIVDGNRIDTRgssgssTDTEPGVATSELDGKMPNTGS  705
            KD + + +T AS   +    +  +     ++++  S S ++ +P    +   GK P    
Sbjct  513  KDFRID-ETMASDTKEDENFAATLTSSPDVNSKDKSKSLSEAQPKKENAVDAGKGPTVPV  571

Query  706  VQSKNERQ----QVDKVVPGEVDAPSAVSQAKQDGERPTTP  816
              SKN  Q    +   V   E+++ ++ SQ+KQD E+ + P
Sbjct  572  --SKNLVQSAAPETSPVTSHEINSATS-SQSKQDEEKSSVP  609



>ref|XP_006433825.1| hypothetical protein CICLE_v10000465mg [Citrus clementina]
 gb|ESR47065.1| hypothetical protein CICLE_v10000465mg [Citrus clementina]
Length=697

 Score =   290 bits (741),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 146/215 (68%), Positives = 174/215 (81%), Gaps = 10/215 (5%)
 Frame = +1

Query  1    AIHIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQVEQQK  180
            A+HIPNHKFTVNVVRNL+QKTHWRIKT+LAISHLDV+K+N+IVADMRKVLAKNPQ+EQQ+
Sbjct  333  AVHIPNHKFTVNVVRNLSQKTHWRIKTYLAISHLDVHKVNSIVADMRKVLAKNPQIEQQR  392

Query  181  LHRRVFLDNIDRENQALLIMVSCFVKTSHFEEYLRVKEVILLDLLRVISHHRARLATPIR  360
            LHRRVFL+NI+ ENQ+L I+VSCFVKTS FEEYL VKE ILLDLLRVISHHRARLATPIR
Sbjct  393  LHRRVFLENINPENQSLNILVSCFVKTSRFEEYLCVKEAILLDLLRVISHHRARLATPIR  452

Query  361  TVQKIYKEADVDEVPLADSVMTVNR--ANHPFLLIEPSYKINNSSEDKTKAATPPRPNQE  534
            TVQKIY E D++ +P AD++ T +R  AN PFLLIEPSYKI  SS+DK KA+T    N+E
Sbjct  453  TVQKIYSEPDLENIPFADTIFTHSRAAANRPFLLIEPSYKI--SSDDKIKASTRAARNEE  510

Query  535  KD------GKSEVQTTASKAVDASPPIVDGNRIDT  621
            KD       KS+ +  +   + ++P   +G  I T
Sbjct  511  KDTKVKPTSKSDSEAHSQAGLVSTPDYKEGKAIPT  545



>ref|XP_008347792.1| PREDICTED: mechanosensitive ion channel protein 2, chloroplastic-like 
isoform X2 [Malus domestica]
Length=561

 Score =   286 bits (732),  Expect = 9e-89, Method: Compositional matrix adjust.
 Identities = 136/188 (72%), Positives = 162/188 (86%), Gaps = 6/188 (3%)
 Frame = +1

Query  1    AIHIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQVEQQK  180
            A+HIPNH+FTVNVVRNL+QKTHWRIKTHLAISHLDV+KINNIVADMRKVL+KNPQVEQQ+
Sbjct  167  AVHIPNHQFTVNVVRNLSQKTHWRIKTHLAISHLDVHKINNIVADMRKVLSKNPQVEQQR  226

Query  181  LHRRVFLDNIDRENQALLIMVSCFVKTSHFEEYLRVKEVILLDLLRVISHHRARLATPIR  360
            LHRRVFLDN+  ENQALLI++SCFVKTSH+EEYL VKE I+LDLLRVISHH+ARLATPIR
Sbjct  227  LHRRVFLDNVTPENQALLILISCFVKTSHYEEYLCVKEAIMLDLLRVISHHKARLATPIR  286

Query  361  TVQKIYKEADVDEVPLADSVM--TVNRANHPFLLIEPSYKINNSSEDKTKAATPPRPNQE  534
            TVQK+Y + D+D VP ADS+      R+  PF+LIEPSYKIN   EDK ++ T  + + E
Sbjct  287  TVQKMYSDPDLDSVPFADSMYNHXGARSRRPFILIEPSYKING--EDKKRSRT--QTSGE  342

Query  535  KDGKSEVQ  558
            +DGK+ ++
Sbjct  343  RDGKATMR  350



>ref|XP_007136335.1| hypothetical protein PHAVU_009G036900g [Phaseolus vulgaris]
 gb|ESW08329.1| hypothetical protein PHAVU_009G036900g [Phaseolus vulgaris]
Length=683

 Score =   289 bits (739),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 139/196 (71%), Positives = 164/196 (84%), Gaps = 4/196 (2%)
 Frame = +1

Query  1    AIHIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQVEQQK  180
            A+HIPNHKFTVNVVRNLTQK+HWRIK+++AISHLDVNKINNIVADMRKVL+KNPQVEQQK
Sbjct  336  AVHIPNHKFTVNVVRNLTQKSHWRIKSYIAISHLDVNKINNIVADMRKVLSKNPQVEQQK  395

Query  181  LHRRVFLDNIDRENQALLIMVSCFVKTSHFEEYLRVKEVILLDLLRVISHHRARLATPIR  360
            LHRRVFL+N++ ENQ+L+I++SCFVKTSHFEEYL VKE ILLDLLRV+SHHRARLATPIR
Sbjct  396  LHRRVFLENVNPENQSLMILISCFVKTSHFEEYLCVKEAILLDLLRVVSHHRARLATPIR  455

Query  361  TVQKIYKEADVDEVPLADSVMTVNR-ANHPFLLIEPSYKINNSSEDKTKAAT-PPRPNQE  534
            TVQKIY + D + +P  D++ T +R AN PFLLIEP YK+N   EDK K +T   R N+E
Sbjct  456  TVQKIYSDTDSENIPFGDTIFTRSRAANRPFLLIEPPYKVNG--EDKVKPSTRATRTNEE  513

Query  535  KDGKSEVQTTASKAVD  582
            KD K +    +   VD
Sbjct  514  KDSKIDETMASDSKVD  529



>ref|XP_006466311.1| PREDICTED: mechanosensitive ion channel protein 2, chloroplastic-like 
isoform X5 [Citrus sinensis]
Length=653

 Score =   288 bits (737),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 142/188 (76%), Positives = 162/188 (86%), Gaps = 9/188 (5%)
 Frame = +1

Query  1    AIHIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQVEQQK  180
            A+HIPNHKFT+NVVRNL+QK+HWRIKTHLAISHLDV+KIN+IVADMRKVLAKNPQVEQQ+
Sbjct  246  AVHIPNHKFTMNVVRNLSQKSHWRIKTHLAISHLDVHKINSIVADMRKVLAKNPQVEQQR  305

Query  181  LHRRVFLDNIDRENQALLIMVSCFVKTSHFEEYLRVKEVILLDLLRVISHHRARLATPIR  360
            LHRRVFLDNI+ ENQALLI+VSCFVKTSH EEYL VKE ILLDLLRVISHHRARLATPIR
Sbjct  306  LHRRVFLDNINPENQALLILVSCFVKTSHHEEYLCVKEAILLDLLRVISHHRARLATPIR  365

Query  361  TVQKIYKEADVDEVPLADSVMTVNRA----NHPFLLIEPSYKINNSSEDKTKAAT-PPRP  525
            TVQKI+ +AD++ VP AD++   NR     N P LLIEP Y+IN   EDKTK+ T P R 
Sbjct  366  TVQKIFSDADLENVPFADTIY--NRGGGASNRPLLLIEPPYRING--EDKTKSQTRPSRS  421

Query  526  NQEKDGKS  549
            + E+DGK+
Sbjct  422  SGEQDGKT  429



>ref|XP_007018222.1| MSCS-like 3 isoform 1 [Theobroma cacao]
 gb|EOY15447.1| MSCS-like 3 isoform 1 [Theobroma cacao]
Length=707

 Score =   289 bits (739),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 169/300 (56%), Positives = 202/300 (67%), Gaps = 37/300 (12%)
 Frame = +1

Query  1    AIHIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQVEQQK  180
            A+HIPNHKFTVNVVRNL+QKTHWRIK + AISHLDVNKINNIVADMRKVLAKNPQVEQQ+
Sbjct  335  AVHIPNHKFTVNVVRNLSQKTHWRIKNYFAISHLDVNKINNIVADMRKVLAKNPQVEQQR  394

Query  181  LHRRVFLDNIDRENQALLIMVSCFVKTSHFEEYLRVKEVILLDLLRVISHHRARLATPIR  360
            LHRRVFL++I+ ENQAL+I+VSCFVKTSH EEYL V+E ILLDLLRVISHH+ARLATPIR
Sbjct  395  LHRRVFLESINPENQALMILVSCFVKTSHVEEYLCVREAILLDLLRVISHHQARLATPIR  454

Query  361  TVQKIYKEADVDEVPLADSVM--TVNRANHPFLLIEPSYKINNSSEDKTKAATPPRPNQE  534
            TVQK+Y EA+V++VP AD++   +    N P LLIEPSYKI  S +DK KA+T  R N+E
Sbjct  455  TVQKMYSEAEVEDVPFADTIFRRSGVATNRPLLLIEPSYKI--SGDDKVKAST--RANEE  510

Query  535  KDGKSEVQTTA-SKAVDASPP--IVDGNRID--------TRgssgssTDTEPGVATSELD  681
            KD   E  +T+ SKA   S P  I+D +++D           SS   + +E        D
Sbjct  511  KDSMEEATSTSDSKANTLSRPTSIID-SKVDKATSPSLSNSSSSSKVSSSEAQTGNPVPD  569

Query  682  GKMPNTGSVQSKNERQQVDKV-------------------VPGEVDAPSAVSQAKQDGER  804
            G        Q K  R +  KV                   V GE + P A+SQAKQD +R
Sbjct  570  GSAEVNSEKQFKQSRGETWKVSGSGREMITEKSPVANPQSVNGESEIPLAISQAKQDVDR  629



>ref|XP_007047788.1| MSCS-like 2 [Theobroma cacao]
 gb|EOX91945.1| MSCS-like 2 [Theobroma cacao]
Length=744

 Score =   290 bits (741),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 143/196 (73%), Positives = 162/196 (83%), Gaps = 5/196 (3%)
 Frame = +1

Query  1    AIHIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQVEQQK  180
            A+HIPNHKFTVNVVRNL+QKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQVEQQ+
Sbjct  338  AVHIPNHKFTVNVVRNLSQKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQVEQQR  397

Query  181  LHRRVFLDNIDRENQALLIMVSCFVKTSHFEEYLRVKEVILLDLLRVISHHRARLATPIR  360
            LHRRVFL+N++ ENQALLI+VSCFVKTSH EEYL VKE ILLDLLRVISHHRARLATPIR
Sbjct  398  LHRRVFLENVNPENQALLILVSCFVKTSHLEEYLCVKEAILLDLLRVISHHRARLATPIR  457

Query  361  TVQKIYKEADVDEVPLADSVMTVNR--ANHPFLLIEPSYKINNSSEDKTKAATPPRPNQE  534
            T+QKIY +AD++ +P ADSV +     +N P LLIEPSYKIN   ED+ K  +  RP  E
Sbjct  458  TLQKIYSDADLENIPFADSVYSHGGVPSNRPLLLIEPSYKING--EDRIKGRS-SRPAGE  514

Query  535  KDGKSEVQTTASKAVD  582
            +D K+  +  A    D
Sbjct  515  QDSKTTARPRADTKAD  530



>ref|XP_006426270.1| hypothetical protein CICLE_v10024979mg [Citrus clementina]
 gb|ESR39510.1| hypothetical protein CICLE_v10024979mg [Citrus clementina]
Length=744

 Score =   289 bits (740),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 143/188 (76%), Positives = 162/188 (86%), Gaps = 9/188 (5%)
 Frame = +1

Query  1    AIHIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQVEQQK  180
            A+HIPNHKFTVNVVRNL+QK+HWRIKTHLAISHLDV+KIN+IVADMRKVLAKNPQVEQQ+
Sbjct  337  AVHIPNHKFTVNVVRNLSQKSHWRIKTHLAISHLDVHKINSIVADMRKVLAKNPQVEQQR  396

Query  181  LHRRVFLDNIDRENQALLIMVSCFVKTSHFEEYLRVKEVILLDLLRVISHHRARLATPIR  360
            LHRRVFLDNI+ ENQALLI+VSCFVKTSH EEYL VKE ILLDLLRVISHHRARLATPIR
Sbjct  397  LHRRVFLDNINPENQALLILVSCFVKTSHHEEYLCVKEAILLDLLRVISHHRARLATPIR  456

Query  361  TVQKIYKEADVDEVPLADSVMTVNRA----NHPFLLIEPSYKINNSSEDKTKAAT-PPRP  525
            TVQKI+ +AD++ VP AD++   NR     N P LLIEP Y+IN   EDKTK+ T P R 
Sbjct  457  TVQKIFSDADLENVPFADTIY--NRGGGASNRPLLLIEPPYRING--EDKTKSQTRPSRS  512

Query  526  NQEKDGKS  549
            + E+DGK+
Sbjct  513  SGEQDGKT  520



>ref|XP_008347791.1| PREDICTED: mechanosensitive ion channel protein 2, chloroplastic-like 
isoform X1 [Malus domestica]
Length=598

 Score =   285 bits (730),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 136/188 (72%), Positives = 162/188 (86%), Gaps = 6/188 (3%)
 Frame = +1

Query  1    AIHIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQVEQQK  180
            A+HIPNH+FTVNVVRNL+QKTHWRIKTHLAISHLDV+KINNIVADMRKVL+KNPQVEQQ+
Sbjct  204  AVHIPNHQFTVNVVRNLSQKTHWRIKTHLAISHLDVHKINNIVADMRKVLSKNPQVEQQR  263

Query  181  LHRRVFLDNIDRENQALLIMVSCFVKTSHFEEYLRVKEVILLDLLRVISHHRARLATPIR  360
            LHRRVFLDN+  ENQALLI++SCFVKTSH+EEYL VKE I+LDLLRVISHH+ARLATPIR
Sbjct  264  LHRRVFLDNVTPENQALLILISCFVKTSHYEEYLCVKEAIMLDLLRVISHHKARLATPIR  323

Query  361  TVQKIYKEADVDEVPLADSVM--TVNRANHPFLLIEPSYKINNSSEDKTKAATPPRPNQE  534
            TVQK+Y + D+D VP ADS+      R+  PF+LIEPSYKIN   EDK ++ T  + + E
Sbjct  324  TVQKMYSDPDLDSVPFADSMYNHXGARSRRPFILIEPSYKING--EDKKRSRT--QTSGE  379

Query  535  KDGKSEVQ  558
            +DGK+ ++
Sbjct  380  RDGKATMR  387



>ref|XP_006426271.1| hypothetical protein CICLE_v10024979mg [Citrus clementina]
 gb|ESR39511.1| hypothetical protein CICLE_v10024979mg [Citrus clementina]
Length=724

 Score =   288 bits (738),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 143/188 (76%), Positives = 162/188 (86%), Gaps = 9/188 (5%)
 Frame = +1

Query  1    AIHIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQVEQQK  180
            A+HIPNHKFTVNVVRNL+QK+HWRIKTHLAISHLDV+KIN+IVADMRKVLAKNPQVEQQ+
Sbjct  317  AVHIPNHKFTVNVVRNLSQKSHWRIKTHLAISHLDVHKINSIVADMRKVLAKNPQVEQQR  376

Query  181  LHRRVFLDNIDRENQALLIMVSCFVKTSHFEEYLRVKEVILLDLLRVISHHRARLATPIR  360
            LHRRVFLDNI+ ENQALLI+VSCFVKTSH EEYL VKE ILLDLLRVISHHRARLATPIR
Sbjct  377  LHRRVFLDNINPENQALLILVSCFVKTSHHEEYLCVKEAILLDLLRVISHHRARLATPIR  436

Query  361  TVQKIYKEADVDEVPLADSVMTVNRA----NHPFLLIEPSYKINNSSEDKTKAAT-PPRP  525
            TVQKI+ +AD++ VP AD++   NR     N P LLIEP Y+IN   EDKTK+ T P R 
Sbjct  437  TVQKIFSDADLENVPFADTIY--NRGGGASNRPLLLIEPPYRING--EDKTKSQTRPSRS  492

Query  526  NQEKDGKS  549
            + E+DGK+
Sbjct  493  SGEQDGKT  500



>ref|XP_008219266.1| PREDICTED: LOW QUALITY PROTEIN: mechanosensitive ion channel 
protein 3, chloroplastic-like [Prunus mume]
Length=692

 Score =   288 bits (736),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 168/295 (57%), Positives = 206/295 (70%), Gaps = 28/295 (9%)
 Frame = +1

Query  1    AIHIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQVEQQK  180
            A+HIPNHKFTVNVVRNL+QKTHWRIKTHLAISHLDV KIN IVADMRKVLAKN QVEQQ+
Sbjct  335  AVHIPNHKFTVNVVRNLSQKTHWRIKTHLAISHLDVIKINTIVADMRKVLAKNSQVEQQR  394

Query  181  LHRRVFLDNIDRENQALLIMVSCFVKTSHFEEYLRVKEVILLDLLRVISHHRARLATPIR  360
            LHRRVFLDNI+ +NQAL+I+VSCFVKTSHFEEYL VKE ILLDLLRV+SHHRARLATPIR
Sbjct  395  LHRRVFLDNINPDNQALMILVSCFVKTSHFEEYLCVKEAILLDLLRVVSHHRARLATPIR  454

Query  361  TVQKIYKEADVDEVPLADSVMTVNRA--NHPFLLIEPSYKINNSSEDKTKAATPPRPNQE  534
            TVQK Y EAD++ VP AD++ T +RA  N P+LLIEPSYKI++  +    ++ P   N +
Sbjct  455  TVQKYYSEADLENVPFADTMFTRSRASNNRPYLLIEPSYKISSDDK-SKASSRPTHTNGD  513

Query  535  KDGKSEVQTTA-SKAVDA-SPPIVDGNRIDTRgssgssTDTEPGVATSELDGKMPNT---  699
            K  ++E  +T+ SK  DA +   +   + D + ++ SS+++     TSE+    P T   
Sbjct  514  KQAQAEASSTSDSKGSDAKAGATLTHAQTDNKVAATSSSNSSTNSKTSEMPTSEPQTRNS  573

Query  700  ---GSVQSKNERQQVDKVVPG----------------EVDAPSAVSQAKQDGERP  807
               GSV+SK+E  Q D   P                 + D P A  QAK DGE+P
Sbjct  574  ASDGSVRSKSECFQ-DASPPKVMSKKSLVTSPETGSEKADVPLAPLQAKHDGEKP  627



>gb|KHF99185.1| Mechanosensitive ion channel 3, chloroplastic -like protein [Gossypium 
arboreum]
Length=687

 Score =   288 bits (736),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 159/287 (55%), Positives = 199/287 (69%), Gaps = 34/287 (12%)
 Frame = +1

Query  1    AIHIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQVEQQK  180
            A+HIPNHKFTVNVVRN++QKTHWRIK + AISHLDVNKINN+VADMRKVLAKNPQVEQQ+
Sbjct  335  AVHIPNHKFTVNVVRNISQKTHWRIKNYFAISHLDVNKINNVVADMRKVLAKNPQVEQQR  394

Query  181  LHRRVFLDNIDRENQALLIMVSCFVKTSHFEEYLRVKEVILLDLLRVISHHRARLATPIR  360
            LHRRVFL++ID +NQALLI+VSCFVKTSH EEYL VKEVI+LDLLRVISHHRARLATPIR
Sbjct  395  LHRRVFLESIDPQNQALLILVSCFVKTSHIEEYLCVKEVIMLDLLRVISHHRARLATPIR  454

Query  361  TVQKIYKEADVDEVPLADSVMTVNRA--NHPFLLIEPSYKINNSSEDKTKAATPPRPNQE  534
            TVQKIY E +++++P AD++   + A  N P LLIEP+YKIN  S+DK KA  P R N+E
Sbjct  455  TVQKIYSEPEIEDIPFADTIFRRSGAATNRPLLLIEPAYKIN--SDDKAKA--PTRANEE  510

Query  535  KDGKSEVQTTASKAVDASPPIVDGNRIDTRgssgssTDT-EPGVATSELDGKMPNTGSVQ  711
                     T +   D+      G+ +D++     ++ T   G++++E    +P  GSV+
Sbjct  511  I-------LTPTSTSDSKGNTNSGSALDSKEDKVMASSTNNSGLSSNESGNSVP-VGSVE  562

Query  712  SKNERQQVDKV-------------VPG------EVDAPSAVSQAKQD  795
              +E+Q  +               VP       E + P  VSQAKQD
Sbjct  563  VNSEKQLSESKGETRKTTSSGRVPVPNPQSANEESEIPVGVSQAKQD  609



>ref|XP_008808855.1| PREDICTED: mechanosensitive ion channel protein 2, chloroplastic-like 
[Phoenix dactylifera]
Length=662

 Score =   287 bits (734),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 163/284 (57%), Positives = 200/284 (70%), Gaps = 18/284 (6%)
 Frame = +1

Query  1    AIHIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQVEQQK  180
            A+HIPNHKFTVNVVRNL+QKTHWRIKTHLAISHLDV+KINNIVADMRKVLAKNPQ+EQQ+
Sbjct  308  AVHIPNHKFTVNVVRNLSQKTHWRIKTHLAISHLDVSKINNIVADMRKVLAKNPQIEQQR  367

Query  181  LHRRVFLDNIDRENQALLIMVSCFVKTSHFEEYLRVKEVILLDLLRVISHHRARLATPIR  360
            LHRRVFL+NI+ ENQALLI++SCFVKTSHFEEYL VKE +LLDLLRVISHHRARLATPIR
Sbjct  368  LHRRVFLENINPENQALLILISCFVKTSHFEEYLCVKEAVLLDLLRVISHHRARLATPIR  427

Query  361  TVQKIYKEADVDEVPLADSVMTVNRA--NHPFLLIEPSYKINNSSEDKTKAATPPRPNQE  534
            TVQKIY +AD++ +P +++++T + A  N PFLLIEPS +IN   +DK K  T  R N E
Sbjct  428  TVQKIYGDADMENIPYSETIVTRSAAATNRPFLLIEPSPRING--DDKAKPRT-SRTNGE  484

Query  535  KDGKSEVQTTASKAVDASPPIVDGNRIDTRgssgssTDT-------EPGVA---TSELDG  684
            +  K+    +  K   +S   +  N         SS DT       +P  A   +S+L+G
Sbjct  485  QTSKA-TSASGPKVTPSSEGTILNNSDKQLQKKKSSGDTPSKSNKADPATAPSLSSQLEG  543

Query  685  KMPNTGSVQSKNERQQVDKVVPGEVDAPSAVSQAKQDGER-PTT  813
                  + ++  E     + V  +VD  S V  AK +GER PTT
Sbjct  544  LDSVGSTFKAGGENPMSPEAVSEQVDGTSPV-HAKNEGERVPTT  586



>gb|KEH35729.1| mechanosensitive ion channel-like protein [Medicago truncatula]
Length=553

 Score =   284 bits (726),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 138/185 (75%), Positives = 157/185 (85%), Gaps = 5/185 (3%)
 Frame = +1

Query  1    AIHIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQVEQQK  180
            A+HIPNHKFTVNVVRNLTQK+HWRIK++++ISHLDVNKINNIVADMRKVLAKNPQVEQQK
Sbjct  181  AVHIPNHKFTVNVVRNLTQKSHWRIKSYISISHLDVNKINNIVADMRKVLAKNPQVEQQK  240

Query  181  LHRRVFLDNIDRENQALLIMVSCFVKTSHFEEYLRVKEVILLDLLRVISHHRARLATPIR  360
            LHRRVFL++I+ EN AL I++SCFVKTSHFEEYL VKE ILLDLLRV+SHHRARLATPIR
Sbjct  241  LHRRVFLEDINPENTALKILISCFVKTSHFEEYLCVKEAILLDLLRVVSHHRARLATPIR  300

Query  361  TVQKIYKEADVDEVPLADSVMTVNRA--NHPFLLIEPSYKINNSSEDKTKAAT-PPRPNQ  531
            TVQKIY E   + +P  DS+ T +RA  N PFLLIEP YK+N   EDK K +T   R N+
Sbjct  301  TVQKIYSEPASENIPFGDSIFTRSRAAVNRPFLLIEPPYKVNG--EDKAKPSTRSTRGNE  358

Query  532  EKDGK  546
            EKD K
Sbjct  359  EKDAK  363



>ref|XP_006466310.1| PREDICTED: mechanosensitive ion channel protein 2, chloroplastic-like 
isoform X4 [Citrus sinensis]
Length=716

 Score =   288 bits (736),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 142/188 (76%), Positives = 162/188 (86%), Gaps = 9/188 (5%)
 Frame = +1

Query  1    AIHIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQVEQQK  180
            A+HIPNHKFT+NVVRNL+QK+HWRIKTHLAISHLDV+KIN+IVADMRKVLAKNPQVEQQ+
Sbjct  309  AVHIPNHKFTMNVVRNLSQKSHWRIKTHLAISHLDVHKINSIVADMRKVLAKNPQVEQQR  368

Query  181  LHRRVFLDNIDRENQALLIMVSCFVKTSHFEEYLRVKEVILLDLLRVISHHRARLATPIR  360
            LHRRVFLDNI+ ENQALLI+VSCFVKTSH EEYL VKE ILLDLLRVISHHRARLATPIR
Sbjct  369  LHRRVFLDNINPENQALLILVSCFVKTSHHEEYLCVKEAILLDLLRVISHHRARLATPIR  428

Query  361  TVQKIYKEADVDEVPLADSVMTVNRA----NHPFLLIEPSYKINNSSEDKTKAAT-PPRP  525
            TVQKI+ +AD++ VP AD++   NR     N P LLIEP Y+IN   EDKTK+ T P R 
Sbjct  429  TVQKIFSDADLENVPFADTIY--NRGGGASNRPLLLIEPPYRING--EDKTKSQTRPSRS  484

Query  526  NQEKDGKS  549
            + E+DGK+
Sbjct  485  SGEQDGKT  492



>ref|XP_010664408.1| PREDICTED: mechanosensitive ion channel protein 3, chloroplastic-like 
isoform X2 [Vitis vinifera]
Length=682

 Score =   287 bits (734),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 172/309 (56%), Positives = 200/309 (65%), Gaps = 41/309 (13%)
 Frame = +1

Query  1    AIHIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQVEQQK  180
            A+HIPNHKFTVNVVRNL+QKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQVEQQ+
Sbjct  308  AVHIPNHKFTVNVVRNLSQKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQVEQQR  367

Query  181  LHRRVFLDNIDRENQALLIMVSCFVKTSHFEEYLRVKEVILLDLLRVISHHRARLATPIR  360
            LHRRVFLD ID ENQALLI+VSCFVKT  FEEYL VKE ILLDLLRVISHH+ARLATPIR
Sbjct  368  LHRRVFLDYIDPENQALLILVSCFVKTPRFEEYLCVKEAILLDLLRVISHHQARLATPIR  427

Query  361  TVQKIYKEAD--VDEVPLADSVMTVNR--ANHPFLLIEPSYKINNSSEDKTKAATPPRP-  525
            TVQK Y  AD  ++ +P AD + T +   AN P LLIEPSYK+N   +DKTKA+T     
Sbjct  428  TVQKEYSMADMEMENIPFADPIFTRSSAAANRPLLLIEPSYKMNG--DDKTKASTGSACQ  485

Query  526  NQEKDGKSEVQTTASKAVDA---SPPIVDGNRIDTRgssgssTDTEPG--VATSELDGKM  690
            N+EKD   +  +T+    DA   +  I+D    D   ++  S  +      ATS  D K+
Sbjct  486  NEEKDANIDASSTSESKPDAKAGASSILDSTTDDNVAATSISNSSTNSKVSATSISDPKI  545

Query  691  PNT---GSVQSKNERQQVDKVV-------------------------PGEVDA-PSAVSQ  783
             N    GS Q+  E QQ +  +                          G+ D  PSA   
Sbjct  546  QNMVTDGSTQNNYEEQQSEASMEKVREDINPGGSAFEKPSLNFPESGAGKADGLPSATPL  605

Query  784  AKQDGERPT  810
            AKQDG R +
Sbjct  606  AKQDGNRAS  614



>ref|XP_006466309.1| PREDICTED: mechanosensitive ion channel protein 2, chloroplastic-like 
isoform X3 [Citrus sinensis]
Length=724

 Score =   288 bits (736),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 142/188 (76%), Positives = 162/188 (86%), Gaps = 9/188 (5%)
 Frame = +1

Query  1    AIHIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQVEQQK  180
            A+HIPNHKFT+NVVRNL+QK+HWRIKTHLAISHLDV+KIN+IVADMRKVLAKNPQVEQQ+
Sbjct  317  AVHIPNHKFTMNVVRNLSQKSHWRIKTHLAISHLDVHKINSIVADMRKVLAKNPQVEQQR  376

Query  181  LHRRVFLDNIDRENQALLIMVSCFVKTSHFEEYLRVKEVILLDLLRVISHHRARLATPIR  360
            LHRRVFLDNI+ ENQALLI+VSCFVKTSH EEYL VKE ILLDLLRVISHHRARLATPIR
Sbjct  377  LHRRVFLDNINPENQALLILVSCFVKTSHHEEYLCVKEAILLDLLRVISHHRARLATPIR  436

Query  361  TVQKIYKEADVDEVPLADSVMTVNRA----NHPFLLIEPSYKINNSSEDKTKAAT-PPRP  525
            TVQKI+ +AD++ VP AD++   NR     N P LLIEP Y+IN   EDKTK+ T P R 
Sbjct  437  TVQKIFSDADLENVPFADTIY--NRGGGASNRPLLLIEPPYRING--EDKTKSQTRPSRS  492

Query  526  NQEKDGKS  549
            + E+DGK+
Sbjct  493  SGEQDGKT  500



>ref|XP_011097477.1| PREDICTED: mechanosensitive ion channel protein 2, chloroplastic-like 
[Sesamum indicum]
Length=694

 Score =   287 bits (734),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 146/218 (67%), Positives = 169/218 (78%), Gaps = 6/218 (3%)
 Frame = +1

Query  1    AIHIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQVEQQK  180
            A+HIPNHKFTVN+VRNL+QKTHWRIKTHLAISHLDV K+NNIVADMRKVLAKNPQVEQQK
Sbjct  336  AVHIPNHKFTVNIVRNLSQKTHWRIKTHLAISHLDVGKVNNIVADMRKVLAKNPQVEQQK  395

Query  181  LHRRVFLDNIDRENQALLIMVSCFVKTSHFEEYLRVKEVILLDLLRVISHHRARLATPIR  360
            LHRRVFLDNID ENQALLI+VSCFVKTS FEEYL VKE ILLDLLRVI+HHRARLATPIR
Sbjct  396  LHRRVFLDNIDPENQALLILVSCFVKTSRFEEYLCVKEAILLDLLRVITHHRARLATPIR  455

Query  361  TVQKIYKEADVDEVPLADSVMTVNR-ANHPFLLIEPSYKINNSSEDKTKAATPPRPNQEK  537
            TVQK++ +AD+D +P +DSV T     + P LLIEPSYKI+   + KT+A    R N ++
Sbjct  456  TVQKVFTDADLDGIPFSDSVFTRGAPLDRPLLLIEPSYKISGDDKIKTQARA-ARANGDE  514

Query  538  DGKSEVQTTASKAVDA-SPPIVDGNRIDTRgssgssTD  648
            + K+  +      VDA   P +    IDT+      TD
Sbjct  515  ENKAPAKPMPYSKVDAEGEPTLS---IDTKSQESELTD  549



>ref|XP_010664407.1| PREDICTED: mechanosensitive ion channel protein 3, chloroplastic-like 
isoform X1 [Vitis vinifera]
Length=709

 Score =   287 bits (735),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 172/309 (56%), Positives = 200/309 (65%), Gaps = 41/309 (13%)
 Frame = +1

Query  1    AIHIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQVEQQK  180
            A+HIPNHKFTVNVVRNL+QKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQVEQQ+
Sbjct  335  AVHIPNHKFTVNVVRNLSQKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQVEQQR  394

Query  181  LHRRVFLDNIDRENQALLIMVSCFVKTSHFEEYLRVKEVILLDLLRVISHHRARLATPIR  360
            LHRRVFLD ID ENQALLI+VSCFVKT  FEEYL VKE ILLDLLRVISHH+ARLATPIR
Sbjct  395  LHRRVFLDYIDPENQALLILVSCFVKTPRFEEYLCVKEAILLDLLRVISHHQARLATPIR  454

Query  361  TVQKIYKEAD--VDEVPLADSVMTVNR--ANHPFLLIEPSYKINNSSEDKTKAATPPRP-  525
            TVQK Y  AD  ++ +P AD + T +   AN P LLIEPSYK+N   +DKTKA+T     
Sbjct  455  TVQKEYSMADMEMENIPFADPIFTRSSAAANRPLLLIEPSYKMNG--DDKTKASTGSACQ  512

Query  526  NQEKDGKSEVQTTASKAVDA---SPPIVDGNRIDTRgssgssTDTEPG--VATSELDGKM  690
            N+EKD   +  +T+    DA   +  I+D    D   ++  S  +      ATS  D K+
Sbjct  513  NEEKDANIDASSTSESKPDAKAGASSILDSTTDDNVAATSISNSSTNSKVSATSISDPKI  572

Query  691  PNT---GSVQSKNERQQVDKVV-------------------------PGEVDA-PSAVSQ  783
             N    GS Q+  E QQ +  +                          G+ D  PSA   
Sbjct  573  QNMVTDGSTQNNYEEQQSEASMEKVREDINPGGSAFEKPSLNFPESGAGKADGLPSATPL  632

Query  784  AKQDGERPT  810
            AKQDG R +
Sbjct  633  AKQDGNRAS  641



>ref|XP_006466307.1| PREDICTED: mechanosensitive ion channel protein 2, chloroplastic-like 
isoform X1 [Citrus sinensis]
 ref|XP_006466308.1| PREDICTED: mechanosensitive ion channel protein 2, chloroplastic-like 
isoform X2 [Citrus sinensis]
Length=744

 Score =   288 bits (736),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 142/188 (76%), Positives = 162/188 (86%), Gaps = 9/188 (5%)
 Frame = +1

Query  1    AIHIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQVEQQK  180
            A+HIPNHKFT+NVVRNL+QK+HWRIKTHLAISHLDV+KIN+IVADMRKVLAKNPQVEQQ+
Sbjct  337  AVHIPNHKFTMNVVRNLSQKSHWRIKTHLAISHLDVHKINSIVADMRKVLAKNPQVEQQR  396

Query  181  LHRRVFLDNIDRENQALLIMVSCFVKTSHFEEYLRVKEVILLDLLRVISHHRARLATPIR  360
            LHRRVFLDNI+ ENQALLI+VSCFVKTSH EEYL VKE ILLDLLRVISHHRARLATPIR
Sbjct  397  LHRRVFLDNINPENQALLILVSCFVKTSHHEEYLCVKEAILLDLLRVISHHRARLATPIR  456

Query  361  TVQKIYKEADVDEVPLADSVMTVNRA----NHPFLLIEPSYKINNSSEDKTKAAT-PPRP  525
            TVQKI+ +AD++ VP AD++   NR     N P LLIEP Y+IN   EDKTK+ T P R 
Sbjct  457  TVQKIFSDADLENVPFADTIY--NRGGGASNRPLLLIEPPYRING--EDKTKSQTRPSRS  512

Query  526  NQEKDGKS  549
            + E+DGK+
Sbjct  513  SGEQDGKT  520



>gb|KJB64155.1| hypothetical protein B456_010G034900 [Gossypium raimondii]
Length=557

 Score =   283 bits (723),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 147/246 (60%), Positives = 184/246 (75%), Gaps = 15/246 (6%)
 Frame = +1

Query  1    AIHIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQVEQQK  180
            A+HIPNHKFTVNVVRN++QKTHWRIK + AISHLDVNKINN+VADMRKVLAKNPQVEQQ+
Sbjct  205  AVHIPNHKFTVNVVRNISQKTHWRIKNYFAISHLDVNKINNVVADMRKVLAKNPQVEQQR  264

Query  181  LHRRVFLDNIDRENQALLIMVSCFVKTSHFEEYLRVKEVILLDLLRVISHHRARLATPIR  360
            LHRRVFL++ID +NQALLI+VSCFVKTSH EEYL VKE I+LDLLRVISHHRARLATPIR
Sbjct  265  LHRRVFLESIDPQNQALLILVSCFVKTSHIEEYLCVKEAIMLDLLRVISHHRARLATPIR  324

Query  361  TVQKIYKEADVDEVPLADSVMTVNRA--NHPFLLIEPSYKINNSSEDKTKAATPPRPNQE  534
            TVQKIY E +++++P AD++   + A  N P LLIEP YKIN  S+DK KA  P R N+E
Sbjct  325  TVQKIYSEPEIEDIPFADTIFRRSGAATNRPLLLIEPDYKIN--SDDKAKA--PTRANEE  380

Query  535  KDGKSEVQTTASKAVDASPPIVDGNRIDTRgssgssTDT-EPGVATSELDGKMPNTGSVQ  711
                     T +   D+      G+ +D++     ++ T   G++++E    +P  GSV+
Sbjct  381  I-------LTPTSTSDSKGNTNSGSALDSKEDKVMASSTNNSGLSSNESGNSVP-VGSVE  432

Query  712  SKNERQ  729
              +E+Q
Sbjct  433  VNSEKQ  438



>ref|XP_010938975.1| PREDICTED: mechanosensitive ion channel protein 3, chloroplastic-like 
isoform X2 [Elaeis guineensis]
Length=686

 Score =   286 bits (732),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 154/283 (54%), Positives = 196/283 (69%), Gaps = 17/283 (6%)
 Frame = +1

Query  1    AIHIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQVEQQK  180
            A+HIPNHKFTVNVVRNL+QKTHWRIKTHLAISHLD++KINNIVADMRKVLAKN Q+EQQ+
Sbjct  333  AVHIPNHKFTVNVVRNLSQKTHWRIKTHLAISHLDISKINNIVADMRKVLAKNSQIEQQR  392

Query  181  LHRRVFLDNIDRENQALLIMVSCFVKTSHFEEYLRVKEVILLDLLRVISHHRARLATPIR  360
            LHRRVFL+NI+ ENQALLI++SCFVKTSHFEEYL VKE +LLDLLRVISHHRARLATPIR
Sbjct  393  LHRRVFLENINPENQALLILISCFVKTSHFEEYLCVKEAVLLDLLRVISHHRARLATPIR  452

Query  361  TVQKIYKEADVDEVPLADSVMT--VNRANHPFLLIEPSYKINNSSEDKTKAATPPRPNQE  534
            TVQKIY +AD++ +P +++++T     AN PFLLIEPS +IN   + K + +   R N+E
Sbjct  453  TVQKIYGDADMENIPYSETILTRSATAANRPFLLIEPSPRINGDDKAKPRGS---RTNEE  509

Query  535  KDGKSEVQTTASKAVDASPPIVDG---------NRIDTRgssgssTDTEPGVATSELDGK  687
            ++ K+   +       +   I++          N  D+R  S  +         S+L+  
Sbjct  510  QNSKATAASGPRATSSSEGAILNNSDKQLQKKKNSGDSRSKSNKADPATAPSLNSQLE-S  568

Query  688  MPNTGSVQSKNERQQVDKVVPGEVDAPSAVSQAKQDGER-PTT  813
            + + GS     E     + V  +VD  S V  AK +GE+ PTT
Sbjct  569  LDSVGSTSKSGENPLSSEAVTEQVDGTSPV-HAKNEGEKVPTT  610



>ref|XP_007225517.1| hypothetical protein PRUPE_ppa002132mg [Prunus persica]
 gb|EMJ26716.1| hypothetical protein PRUPE_ppa002132mg [Prunus persica]
Length=711

 Score =   286 bits (733),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 169/315 (54%), Positives = 207/315 (66%), Gaps = 45/315 (14%)
 Frame = +1

Query  1    AIHIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQVEQQK  180
            A+HIPNHKFTVNVVRNL+QKTHWRIKTHLAISHLDV KIN IVADMRKVLAKN QVEQQ+
Sbjct  335  AVHIPNHKFTVNVVRNLSQKTHWRIKTHLAISHLDVIKINTIVADMRKVLAKNSQVEQQR  394

Query  181  LHRRVFLDNIDRENQALLIMVSCFVKTSHFEEYLRVKEVILLDLLRVISHHRARLATPIR  360
            LHRRVFLDNI+ +NQAL+I+VSCFVKTSHFEEYL VKE ILLDLLRV+SHHRARLATPIR
Sbjct  395  LHRRVFLDNINPDNQALMILVSCFVKTSHFEEYLCVKEAILLDLLRVVSHHRARLATPIR  454

Query  361  TVQKIYKEADVDEVPLADSVMTVNRA--NHPFLLIEPSYKINNSSEDKTKAATPPRPNQE  534
            TVQK Y EAD++ VP AD++ T +RA  N P+LLIEPSYKI +S +    ++ P R N +
Sbjct  455  TVQKYYSEADLENVPFADTIFTHSRASNNRPYLLIEPSYKI-SSDDKSKASSRPTRTNGD  513

Query  535  KDGKSEVQTTA-SKAVDA-SPPIVDGNRIDTRgssgssT------------DTEPGVATS  672
            K  ++E  +T+ SK  DA +   +   + D + ++ SS+             +EP    S
Sbjct  514  KQAQAEASSTSDSKGSDAKAGATLTHAQTDNKVAATSSSNSSTNSKTSEMPTSEPQTRNS  573

Query  673  ELDGKM-PNTGSVQSKNER-QQVDKVVPG--------------------------EVDAP  768
              DG +  N+  +QSKNE  +   K   G                          + D P
Sbjct  574  ASDGSVRSNSEMLQSKNESTKNAGKETTGVDSKDASPPKMTSKKSLVASPETGSEKADVP  633

Query  769  SAVSQAKQDGERPTT  813
             A  QAK DGE+P +
Sbjct  634  LAPLQAKHDGEKPVS  648



>ref|XP_010027956.1| PREDICTED: mechanosensitive ion channel protein 2, chloroplastic-like 
isoform X2 [Eucalyptus grandis]
Length=737

 Score =   286 bits (733),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 142/196 (72%), Positives = 158/196 (81%), Gaps = 4/196 (2%)
 Frame = +1

Query  1    AIHIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQVEQQK  180
            A+HIPNHKFT+NVVRNL+QKTHWRIKTHLAISHLDV+KI+NIVADMRKVLAKNPQVEQQ+
Sbjct  332  AVHIPNHKFTMNVVRNLSQKTHWRIKTHLAISHLDVSKIHNIVADMRKVLAKNPQVEQQR  391

Query  181  LHRRVFLDNIDRENQALLIMVSCFVKTSHFEEYLRVKEVILLDLLRVISHHRARLATPIR  360
            LHRRVFLDNI+ ENQALLI+VSCFVKTSH+EEYL VKE ILLDLLRVISHHRARLATPIR
Sbjct  392  LHRRVFLDNINAENQALLILVSCFVKTSHYEEYLCVKETILLDLLRVISHHRARLATPIR  451

Query  361  TVQKIYKEADVDEVPLADSVMTVNRA--NHPFLLIEPSYKINNSSEDKTKAATPPRPNQE  534
            T+Q+IY + D++ VP +D       A  N PFLLIEP YKIN   EDKTKA     P  E
Sbjct  452  TMQRIYGDNDLENVPFSDVGFPPGGAVSNRPFLLIEPPYKING--EDKTKARATRTPTGE  509

Query  535  KDGKSEVQTTASKAVD  582
            + GK   Q T     D
Sbjct  510  QGGKKSTQPTPDTTAD  525



>ref|XP_010027955.1| PREDICTED: mechanosensitive ion channel protein 2, chloroplastic-like 
isoform X1 [Eucalyptus grandis]
 gb|KCW54612.1| hypothetical protein EUGRSUZ_I00558 [Eucalyptus grandis]
Length=738

 Score =   286 bits (733),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 142/196 (72%), Positives = 158/196 (81%), Gaps = 4/196 (2%)
 Frame = +1

Query  1    AIHIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQVEQQK  180
            A+HIPNHKFT+NVVRNL+QKTHWRIKTHLAISHLDV+KI+NIVADMRKVLAKNPQVEQQ+
Sbjct  333  AVHIPNHKFTMNVVRNLSQKTHWRIKTHLAISHLDVSKIHNIVADMRKVLAKNPQVEQQR  392

Query  181  LHRRVFLDNIDRENQALLIMVSCFVKTSHFEEYLRVKEVILLDLLRVISHHRARLATPIR  360
            LHRRVFLDNI+ ENQALLI+VSCFVKTSH+EEYL VKE ILLDLLRVISHHRARLATPIR
Sbjct  393  LHRRVFLDNINAENQALLILVSCFVKTSHYEEYLCVKETILLDLLRVISHHRARLATPIR  452

Query  361  TVQKIYKEADVDEVPLADSVMTVNRA--NHPFLLIEPSYKINNSSEDKTKAATPPRPNQE  534
            T+Q+IY + D++ VP +D       A  N PFLLIEP YKIN   EDKTKA     P  E
Sbjct  453  TMQRIYGDNDLENVPFSDVGFPPGGAVSNRPFLLIEPPYKING--EDKTKARATRTPTGE  510

Query  535  KDGKSEVQTTASKAVD  582
            + GK   Q T     D
Sbjct  511  QGGKKSTQPTPDTTAD  526



>gb|KDO60565.1| hypothetical protein CISIN_1g0049741mg, partial [Citrus sinensis]
Length=645

 Score =   284 bits (727),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 143/190 (75%), Positives = 162/190 (85%), Gaps = 11/190 (6%)
 Frame = +1

Query  1    AIHIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQVEQQK  180
            A+HIPNHKFTVNVVRNL+QK+HWRIKTHLAISHLDV+KIN+IVADMRKVLAKNPQVEQQ+
Sbjct  236  AVHIPNHKFTVNVVRNLSQKSHWRIKTHLAISHLDVHKINSIVADMRKVLAKNPQVEQQR  295

Query  181  LHRRVFLDNIDRENQALL--IMVSCFVKTSHFEEYLRVKEVILLDLLRVISHHRARLATP  354
            LHRRVFLDNI+ ENQALL  I+VSCFVKTSH EEYL VKE ILLDLLRVISHHRARLATP
Sbjct  296  LHRRVFLDNINPENQALLVSILVSCFVKTSHHEEYLCVKEAILLDLLRVISHHRARLATP  355

Query  355  IRTVQKIYKEADVDEVPLADSVMTVNRA----NHPFLLIEPSYKINNSSEDKTKAAT-PP  519
            IRTVQKI+ +AD++ VP AD++   NR     N P LLIEP Y+IN   EDKTK+ T P 
Sbjct  356  IRTVQKIFSDADLENVPFADTIY--NRGGGASNRPLLLIEPPYRING--EDKTKSQTRPS  411

Query  520  RPNQEKDGKS  549
            R + E+DGK+
Sbjct  412  RSSGEQDGKT  421



>ref|XP_006573004.1| PREDICTED: mechanosensitive ion channel protein 2, chloroplastic-like 
isoform X5 [Glycine max]
Length=673

 Score =   285 bits (729),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 140/190 (74%), Positives = 159/190 (84%), Gaps = 7/190 (4%)
 Frame = +1

Query  1    AIHIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQVEQQK  180
            A+HIPNHKFTVNVVRNL+QKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQVEQQ+
Sbjct  290  AVHIPNHKFTVNVVRNLSQKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQVEQQR  349

Query  181  LHRRVFLDNIDRENQALLIMVSCFVKTSHFEEYLRVKEVILLDLLRVISHHRARLATPIR  360
            LHRRVFLDNI+ ENQALLI+VSCFVKTSHFEEYL VKE ILLDLLRVI HHRARLATP+R
Sbjct  350  LHRRVFLDNINPENQALLILVSCFVKTSHFEEYLCVKEAILLDLLRVIGHHRARLATPVR  409

Query  361  TVQKIYKEADVDEVPLADSVMTVNRA---NHPFLLIEPSYKINNSSEDKTKAATPPRPNQ  531
            T+QKIY +AD++ +P ADS          + P L+IEPSYKI N  + K++AA   RP  
Sbjct  410  TLQKIYSDADLENIPFADSTFGHGAGTVPHRPLLVIEPSYKI-NGDDKKSRAA---RPAV  465

Query  532  EKDGKSEVQT  561
            ++D K+  QT
Sbjct  466  DQDNKTATQT  475



>ref|XP_006573003.1| PREDICTED: mechanosensitive ion channel protein 2, chloroplastic-like 
isoform X4 [Glycine max]
Length=699

 Score =   285 bits (728),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 140/190 (74%), Positives = 159/190 (84%), Gaps = 7/190 (4%)
 Frame = +1

Query  1    AIHIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQVEQQK  180
            A+HIPNHKFTVNVVRNL+QKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQVEQQ+
Sbjct  316  AVHIPNHKFTVNVVRNLSQKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQVEQQR  375

Query  181  LHRRVFLDNIDRENQALLIMVSCFVKTSHFEEYLRVKEVILLDLLRVISHHRARLATPIR  360
            LHRRVFLDNI+ ENQALLI+VSCFVKTSHFEEYL VKE ILLDLLRVI HHRARLATP+R
Sbjct  376  LHRRVFLDNINPENQALLILVSCFVKTSHFEEYLCVKEAILLDLLRVIGHHRARLATPVR  435

Query  361  TVQKIYKEADVDEVPLADSVMTVNRA---NHPFLLIEPSYKINNSSEDKTKAATPPRPNQ  531
            T+QKIY +AD++ +P ADS          + P L+IEPSYKI N  + K++AA   RP  
Sbjct  436  TLQKIYSDADLENIPFADSTFGHGAGTVPHRPLLVIEPSYKI-NGDDKKSRAA---RPAV  491

Query  532  EKDGKSEVQT  561
            ++D K+  QT
Sbjct  492  DQDNKTATQT  501



>gb|KHN38877.1| Mechanosensitive ion channel protein 2, chloroplastic [Glycine 
soja]
Length=673

 Score =   284 bits (726),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 140/192 (73%), Positives = 161/192 (84%), Gaps = 11/192 (6%)
 Frame = +1

Query  1    AIHIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQVEQQK  180
            A+HIPNHKFTVNVVRNL+QKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQVEQQ+
Sbjct  288  AVHIPNHKFTVNVVRNLSQKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQVEQQR  347

Query  181  LHRRVFLDNIDRENQALLIMVSCFVKTSHFEEYLRVKEVILLDLLRVISHHRARLATPIR  360
            LHRRVFLDNI+ ENQALLI+VSCFVKTSHFEEYL VKE +LLDLLRVI HHRARLATP+R
Sbjct  348  LHRRVFLDNINPENQALLILVSCFVKTSHFEEYLCVKEAVLLDLLRVIGHHRARLATPVR  407

Query  361  TVQKIYKEADVDEVPLADSVMTVNRA-----NHPFLLIEPSYKINNSSEDKTKAATPPRP  525
            T+QKIY +AD++ +P ADS  T  R      N P L+IEPSYKI N  + K+++A   RP
Sbjct  408  TLQKIYSDADLENIPFADS--TFGRGAGTVPNRPLLVIEPSYKI-NGDDKKSRSA---RP  461

Query  526  NQEKDGKSEVQT  561
              ++D K+  +T
Sbjct  462  AVDQDNKTATRT  473



>gb|KHN14509.1| Mechanosensitive ion channel protein 2, chloroplastic [Glycine 
soja]
Length=719

 Score =   285 bits (729),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 140/190 (74%), Positives = 159/190 (84%), Gaps = 7/190 (4%)
 Frame = +1

Query  1    AIHIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQVEQQK  180
            A+HIPNHKFTVNVVRNL+QKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQVEQQ+
Sbjct  336  AVHIPNHKFTVNVVRNLSQKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQVEQQR  395

Query  181  LHRRVFLDNIDRENQALLIMVSCFVKTSHFEEYLRVKEVILLDLLRVISHHRARLATPIR  360
            LHRRVFLDNI+ ENQALLI+VSCFVKTSHFEEYL VKE ILLDLLRVI HHRARLATP+R
Sbjct  396  LHRRVFLDNINPENQALLILVSCFVKTSHFEEYLCVKEAILLDLLRVIGHHRARLATPVR  455

Query  361  TVQKIYKEADVDEVPLADSVMTVNRA---NHPFLLIEPSYKINNSSEDKTKAATPPRPNQ  531
            T+QKIY +AD++ +P ADS          + P L+IEPSYKI N  + K++AA   RP  
Sbjct  456  TLQKIYSDADLENIPFADSTFGHGAGTVPHRPLLVIEPSYKI-NGDDKKSRAA---RPAV  511

Query  532  EKDGKSEVQT  561
            ++D K+  QT
Sbjct  512  DQDNKTATQT  521



>ref|XP_007208164.1| hypothetical protein PRUPE_ppa003749mg [Prunus persica]
 gb|EMJ09363.1| hypothetical protein PRUPE_ppa003749mg [Prunus persica]
Length=551

 Score =   281 bits (718),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 146/240 (61%), Positives = 183/240 (76%), Gaps = 14/240 (6%)
 Frame = +1

Query  1    AIHIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQVEQQK  180
            A+HIPNH+FTVNVVRNL+QKTHWRIKTHLAISHLDV+KINNIVADMRKVL+KNPQVEQQ+
Sbjct  241  AVHIPNHQFTVNVVRNLSQKTHWRIKTHLAISHLDVHKINNIVADMRKVLSKNPQVEQQR  300

Query  181  LHRRVFLDNIDRENQALLIMVSCFVKTSHFEEYLRVKEVILLDLLRVISHHRARLATPIR  360
            LHRRVFLDN+  ENQALLI+VSCFVKTSH EEYL VKE ILLDLLRVISHH+ARLATPIR
Sbjct  301  LHRRVFLDNVTPENQALLILVSCFVKTSHHEEYLCVKEAILLDLLRVISHHKARLATPIR  360

Query  361  TVQKIYKEADVDEVPLADSVMTVN--RANHPFLLIEPSYKINNSSEDKTKAATPPRPNQE  534
            TVQK+Y + D+D VP AD++   +   +  P LLIEPSYKIN   EDK ++ T  + + E
Sbjct  361  TVQKMYSDTDLDNVPFADTIYNHSGVTSRRPLLLIEPSYKING--EDKKRSRT--QTSGE  416

Query  535  KDGKSEVQTTASKAVDASPPIVDGNRIDTRgssgssTDT---EPGVATSELD---GKMPN  696
            +DGK+ ++      V  +P  +   + D++  +   +D+   E  ++ ++ D   G+MPN
Sbjct  417  RDGKATMRPAPDSKVRETP--ISDTKADSKVGATPVSDSKTRETPLSDTKADARSGEMPN  474



>ref|XP_006573000.1| PREDICTED: mechanosensitive ion channel protein 2, chloroplastic-like 
isoform X1 [Glycine max]
 ref|XP_006573001.1| PREDICTED: mechanosensitive ion channel protein 2, chloroplastic-like 
isoform X2 [Glycine max]
 ref|XP_006573002.1| PREDICTED: mechanosensitive ion channel protein 2, chloroplastic-like 
isoform X3 [Glycine max]
Length=719

 Score =   285 bits (728),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 140/190 (74%), Positives = 159/190 (84%), Gaps = 7/190 (4%)
 Frame = +1

Query  1    AIHIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQVEQQK  180
            A+HIPNHKFTVNVVRNL+QKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQVEQQ+
Sbjct  336  AVHIPNHKFTVNVVRNLSQKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQVEQQR  395

Query  181  LHRRVFLDNIDRENQALLIMVSCFVKTSHFEEYLRVKEVILLDLLRVISHHRARLATPIR  360
            LHRRVFLDNI+ ENQALLI+VSCFVKTSHFEEYL VKE ILLDLLRVI HHRARLATP+R
Sbjct  396  LHRRVFLDNINPENQALLILVSCFVKTSHFEEYLCVKEAILLDLLRVIGHHRARLATPVR  455

Query  361  TVQKIYKEADVDEVPLADSVMTVNRA---NHPFLLIEPSYKINNSSEDKTKAATPPRPNQ  531
            T+QKIY +AD++ +P ADS          + P L+IEPSYKI N  + K++AA   RP  
Sbjct  456  TLQKIYSDADLENIPFADSTFGHGAGTVPHRPLLVIEPSYKI-NGDDKKSRAA---RPAV  511

Query  532  EKDGKSEVQT  561
            ++D K+  QT
Sbjct  512  DQDNKTATQT  521



>ref|XP_006472464.1| PREDICTED: mechanosensitive ion channel protein 3, chloroplastic-like 
isoform X1 [Citrus sinensis]
 ref|XP_006472465.1| PREDICTED: mechanosensitive ion channel protein 3, chloroplastic-like 
isoform X2 [Citrus sinensis]
 ref|XP_006472466.1| PREDICTED: mechanosensitive ion channel protein 3, chloroplastic-like 
isoform X3 [Citrus sinensis]
Length=699

 Score =   284 bits (726),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 144/215 (67%), Positives = 172/215 (80%), Gaps = 10/215 (5%)
 Frame = +1

Query  1    AIHIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQVEQQK  180
            A+HIPNHKFTVNVVRNL+QKTHWRIKT+LAISHLDV+K+N+IVADMRKVLAKNPQVEQQ+
Sbjct  335  AVHIPNHKFTVNVVRNLSQKTHWRIKTYLAISHLDVHKVNSIVADMRKVLAKNPQVEQQR  394

Query  181  LHRRVFLDNIDRENQALLIMVSCFVKTSHFEEYLRVKEVILLDLLRVISHHRARLATPIR  360
            LHRRVFL+NI+ E+Q+L I+VSCFVKTS FEEYL VKE ILLDLL VISHHRAR+ATPIR
Sbjct  395  LHRRVFLENINPESQSLNILVSCFVKTSRFEEYLCVKEAILLDLLHVISHHRARMATPIR  454

Query  361  TVQKIYKEADVDEVPLADSVMTVNR--ANHPFLLIEPSYKINNSSEDKTKAATPPRPNQE  534
            TVQKIY E D++ +P AD + T +R  AN PFLLIEPSYKI  SS+DK KA+T    N+E
Sbjct  455  TVQKIYSEPDLENIPFADMIFTHSRAAANRPFLLIEPSYKI--SSDDKIKASTRAARNEE  512

Query  535  KD------GKSEVQTTASKAVDASPPIVDGNRIDT  621
            KD       KS+ +  +   + ++P   +G  I T
Sbjct  513  KDTKVKPTSKSDSEAHSQAGLVSTPDYKEGKAILT  547



>ref|XP_006472467.1| PREDICTED: mechanosensitive ion channel protein 3, chloroplastic-like 
isoform X4 [Citrus sinensis]
Length=697

 Score =   283 bits (725),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 144/215 (67%), Positives = 172/215 (80%), Gaps = 10/215 (5%)
 Frame = +1

Query  1    AIHIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQVEQQK  180
            A+HIPNHKFTVNVVRNL+QKTHWRIKT+LAISHLDV+K+N+IVADMRKVLAKNPQVEQQ+
Sbjct  333  AVHIPNHKFTVNVVRNLSQKTHWRIKTYLAISHLDVHKVNSIVADMRKVLAKNPQVEQQR  392

Query  181  LHRRVFLDNIDRENQALLIMVSCFVKTSHFEEYLRVKEVILLDLLRVISHHRARLATPIR  360
            LHRRVFL+NI+ E+Q+L I+VSCFVKTS FEEYL VKE ILLDLL VISHHRAR+ATPIR
Sbjct  393  LHRRVFLENINPESQSLNILVSCFVKTSRFEEYLCVKEAILLDLLHVISHHRARMATPIR  452

Query  361  TVQKIYKEADVDEVPLADSVMTVNR--ANHPFLLIEPSYKINNSSEDKTKAATPPRPNQE  534
            TVQKIY E D++ +P AD + T +R  AN PFLLIEPSYKI  SS+DK KA+T    N+E
Sbjct  453  TVQKIYSEPDLENIPFADMIFTHSRAAANRPFLLIEPSYKI--SSDDKIKASTRAARNEE  510

Query  535  KD------GKSEVQTTASKAVDASPPIVDGNRIDT  621
            KD       KS+ +  +   + ++P   +G  I T
Sbjct  511  KDTKVKPTSKSDSEAHSQAGLVSTPDYKEGKAILT  545



>ref|XP_008787196.1| PREDICTED: mechanosensitive ion channel protein 2, chloroplastic 
isoform X2 [Phoenix dactylifera]
Length=652

 Score =   282 bits (721),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 156/286 (55%), Positives = 193/286 (67%), Gaps = 19/286 (7%)
 Frame = +1

Query  1    AIHIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQVEQQK  180
            A+HIPNHKFTVNVVRNL+QK HWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQ+EQQ+
Sbjct  304  AVHIPNHKFTVNVVRNLSQKAHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQIEQQR  363

Query  181  LHRRVFLDNIDRENQALLIMVSCFVKTSHFEEYLRVKEVILLDLLRVISHHRARLATPIR  360
            LHRRVFL+NI+ ENQALLI +SCFVKTSHFEEYL VKE ILLDLLRVI HHRARLATPIR
Sbjct  364  LHRRVFLENINPENQALLIFISCFVKTSHFEEYLCVKEAILLDLLRVIGHHRARLATPIR  423

Query  361  TVQKIYKEADVDEVPLADSVMT--VNRANHPFLLIEPSYKINNSSEDKTKAATPPRPNQE  534
            TVQKIY +ADV+ +P ++++ T      N PFLLIE S +IN   +DK K  T  R ++E
Sbjct  424  TVQKIYGDADVENIPYSETIFTRSATATNRPFLLIESSPRING--DDKAKPRTTARASEE  481

Query  535  KDGKSEVQTTASKAVDASPPIVDGNRIDTRgssgssTD-----------TEPGVATSELD  681
             + KS    + SK   +S   +  N    +    ++ D           T P  ++  + 
Sbjct  482  HNSKS-TAASESKVTSSSDGTILSNSDKQQLKKANTGDPHSKSNKANPATAPTSSSPPML  540

Query  682  GKMPNTGSV-QSKNERQQVDKVVPGEVDAPSAVSQAKQDGER-PTT  813
              + + GS  ++  E+    +    +VD    +  AK +GER PTT
Sbjct  541  ESLDSVGSTSKAGGEKPPSSEAFGEQVDGTGPI-HAKNEGERVPTT  585



>ref|XP_003533418.1| PREDICTED: mechanosensitive ion channel protein 2, chloroplastic-like 
isoform X1 [Glycine max]
 ref|XP_006587572.1| PREDICTED: mechanosensitive ion channel protein 2, chloroplastic-like 
isoform X2 [Glycine max]
Length=719

 Score =   283 bits (725),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 140/192 (73%), Positives = 161/192 (84%), Gaps = 11/192 (6%)
 Frame = +1

Query  1    AIHIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQVEQQK  180
            A+HIPNHKFTVNVVRNL+QKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQVEQQ+
Sbjct  334  AVHIPNHKFTVNVVRNLSQKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQVEQQR  393

Query  181  LHRRVFLDNIDRENQALLIMVSCFVKTSHFEEYLRVKEVILLDLLRVISHHRARLATPIR  360
            LHRRVFLDNI+ ENQALLI+VSCFVKTSHFEEYL VKE +LLDLLRVI HHRARLATP+R
Sbjct  394  LHRRVFLDNINPENQALLILVSCFVKTSHFEEYLCVKEAVLLDLLRVIGHHRARLATPVR  453

Query  361  TVQKIYKEADVDEVPLADSVMTVNRA-----NHPFLLIEPSYKINNSSEDKTKAATPPRP  525
            T+QKIY +AD++ +P ADS  T  R      N P L+IEPSYKI N  + K+++A   RP
Sbjct  454  TLQKIYSDADLENIPFADS--TFGRGAGTVPNRPLLVIEPSYKI-NGDDKKSRSA---RP  507

Query  526  NQEKDGKSEVQT  561
              ++D K+  +T
Sbjct  508  AVDQDNKTATRT  519



>gb|KDO81178.1| hypothetical protein CISIN_1g009063mg [Citrus sinensis]
Length=502

 Score =   278 bits (711),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 137/181 (76%), Positives = 159/181 (88%), Gaps = 4/181 (2%)
 Frame = +1

Query  1    AIHIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQVEQQK  180
            A+HIPNHKFTVNVVRNL+QKTHWRIKT+LAISHLDV+K+N+IVADMRKVLAKNPQVEQQ+
Sbjct  292  AVHIPNHKFTVNVVRNLSQKTHWRIKTYLAISHLDVHKVNSIVADMRKVLAKNPQVEQQR  351

Query  181  LHRRVFLDNIDRENQALLIMVSCFVKTSHFEEYLRVKEVILLDLLRVISHHRARLATPIR  360
            LHRRVFL+NI+ E+Q+L I+VSCFVKTS FEEYL VKE ILLDLL VISHHRAR+ATPIR
Sbjct  352  LHRRVFLENINPESQSLNILVSCFVKTSRFEEYLCVKEAILLDLLHVISHHRARMATPIR  411

Query  361  TVQKIYKEADVDEVPLADSVMTVNR--ANHPFLLIEPSYKINNSSEDKTKAATPPRPNQE  534
            TVQKIY E D++ +P AD++ T +R  AN PFLLIEPSYKI  SS+DK KA+T    N+E
Sbjct  412  TVQKIYSEPDLENIPFADTIFTHSRAAANRPFLLIEPSYKI--SSDDKIKASTRAARNEE  469

Query  535  K  537
            K
Sbjct  470  K  470



>ref|XP_003602909.1| MscS family inner membrane protein ynaI [Medicago truncatula]
 gb|AES73160.1| mechanosensitive ion channel-like protein [Medicago truncatula]
Length=716

 Score =   283 bits (725),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 138/185 (75%), Positives = 157/185 (85%), Gaps = 5/185 (3%)
 Frame = +1

Query  1    AIHIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQVEQQK  180
            A+HIPNHKFTVNVVRNLTQK+HWRIK++++ISHLDVNKINNIVADMRKVLAKNPQVEQQK
Sbjct  344  AVHIPNHKFTVNVVRNLTQKSHWRIKSYISISHLDVNKINNIVADMRKVLAKNPQVEQQK  403

Query  181  LHRRVFLDNIDRENQALLIMVSCFVKTSHFEEYLRVKEVILLDLLRVISHHRARLATPIR  360
            LHRRVFL++I+ EN AL I++SCFVKTSHFEEYL VKE ILLDLLRV+SHHRARLATPIR
Sbjct  404  LHRRVFLEDINPENTALKILISCFVKTSHFEEYLCVKEAILLDLLRVVSHHRARLATPIR  463

Query  361  TVQKIYKEADVDEVPLADSVMTVNRA--NHPFLLIEPSYKINNSSEDKTKAAT-PPRPNQ  531
            TVQKIY E   + +P  DS+ T +RA  N PFLLIEP YK+N   EDK K +T   R N+
Sbjct  464  TVQKIYSEPASENIPFGDSIFTRSRAAVNRPFLLIEPPYKVNG--EDKAKPSTRSTRGNE  521

Query  532  EKDGK  546
            EKD K
Sbjct  522  EKDAK  526



>gb|KDO81177.1| hypothetical protein CISIN_1g009063mg [Citrus sinensis]
Length=545

 Score =   279 bits (713),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 137/181 (76%), Positives = 159/181 (88%), Gaps = 4/181 (2%)
 Frame = +1

Query  1    AIHIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQVEQQK  180
            A+HIPNHKFTVNVVRNL+QKTHWRIKT+LAISHLDV+K+N+IVADMRKVLAKNPQVEQQ+
Sbjct  335  AVHIPNHKFTVNVVRNLSQKTHWRIKTYLAISHLDVHKVNSIVADMRKVLAKNPQVEQQR  394

Query  181  LHRRVFLDNIDRENQALLIMVSCFVKTSHFEEYLRVKEVILLDLLRVISHHRARLATPIR  360
            LHRRVFL+NI+ E+Q+L I+VSCFVKTS FEEYL VKE ILLDLL VISHHRAR+ATPIR
Sbjct  395  LHRRVFLENINPESQSLNILVSCFVKTSRFEEYLCVKEAILLDLLHVISHHRARMATPIR  454

Query  361  TVQKIYKEADVDEVPLADSVMTVNR--ANHPFLLIEPSYKINNSSEDKTKAATPPRPNQE  534
            TVQKIY E D++ +P AD++ T +R  AN PFLLIEPSYKI  SS+DK KA+T    N+E
Sbjct  455  TVQKIYSEPDLENIPFADTIFTHSRAAANRPFLLIEPSYKI--SSDDKIKASTRAARNEE  512

Query  535  K  537
            K
Sbjct  513  K  513



>gb|KDO81175.1| hypothetical protein CISIN_1g009063mg [Citrus sinensis]
 gb|KDO81176.1| hypothetical protein CISIN_1g009063mg [Citrus sinensis]
Length=543

 Score =   279 bits (713),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 137/181 (76%), Positives = 159/181 (88%), Gaps = 4/181 (2%)
 Frame = +1

Query  1    AIHIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQVEQQK  180
            A+HIPNHKFTVNVVRNL+QKTHWRIKT+LAISHLDV+K+N+IVADMRKVLAKNPQVEQQ+
Sbjct  333  AVHIPNHKFTVNVVRNLSQKTHWRIKTYLAISHLDVHKVNSIVADMRKVLAKNPQVEQQR  392

Query  181  LHRRVFLDNIDRENQALLIMVSCFVKTSHFEEYLRVKEVILLDLLRVISHHRARLATPIR  360
            LHRRVFL+NI+ E+Q+L I+VSCFVKTS FEEYL VKE ILLDLL VISHHRAR+ATPIR
Sbjct  393  LHRRVFLENINPESQSLNILVSCFVKTSRFEEYLCVKEAILLDLLHVISHHRARMATPIR  452

Query  361  TVQKIYKEADVDEVPLADSVMTVNR--ANHPFLLIEPSYKINNSSEDKTKAATPPRPNQE  534
            TVQKIY E D++ +P AD++ T +R  AN PFLLIEPSYKI  SS+DK KA+T    N+E
Sbjct  453  TVQKIYSEPDLENIPFADTIFTHSRAAANRPFLLIEPSYKI--SSDDKIKASTRAARNEE  510

Query  535  K  537
            K
Sbjct  511  K  511



>ref|XP_008787195.1| PREDICTED: mechanosensitive ion channel protein 2, chloroplastic 
isoform X1 [Phoenix dactylifera]
Length=681

 Score =   282 bits (722),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 156/286 (55%), Positives = 193/286 (67%), Gaps = 19/286 (7%)
 Frame = +1

Query  1    AIHIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQVEQQK  180
            A+HIPNHKFTVNVVRNL+QK HWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQ+EQQ+
Sbjct  333  AVHIPNHKFTVNVVRNLSQKAHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQIEQQR  392

Query  181  LHRRVFLDNIDRENQALLIMVSCFVKTSHFEEYLRVKEVILLDLLRVISHHRARLATPIR  360
            LHRRVFL+NI+ ENQALLI +SCFVKTSHFEEYL VKE ILLDLLRVI HHRARLATPIR
Sbjct  393  LHRRVFLENINPENQALLIFISCFVKTSHFEEYLCVKEAILLDLLRVIGHHRARLATPIR  452

Query  361  TVQKIYKEADVDEVPLADSVMT--VNRANHPFLLIEPSYKINNSSEDKTKAATPPRPNQE  534
            TVQKIY +ADV+ +P ++++ T      N PFLLIE S +IN   +DK K  T  R ++E
Sbjct  453  TVQKIYGDADVENIPYSETIFTRSATATNRPFLLIESSPRING--DDKAKPRTTARASEE  510

Query  535  KDGKSEVQTTASKAVDASPPIVDGNRIDTRgssgssTD-----------TEPGVATSELD  681
             + KS    + SK   +S   +  N    +    ++ D           T P  ++  + 
Sbjct  511  HNSKS-TAASESKVTSSSDGTILSNSDKQQLKKANTGDPHSKSNKANPATAPTSSSPPML  569

Query  682  GKMPNTGSV-QSKNERQQVDKVVPGEVDAPSAVSQAKQDGER-PTT  813
              + + GS  ++  E+    +    +VD    +  AK +GER PTT
Sbjct  570  ESLDSVGSTSKAGGEKPPSSEAFGEQVDGTGPI-HAKNEGERVPTT  614



>ref|XP_010938976.1| PREDICTED: mechanosensitive ion channel protein 2, chloroplastic-like 
isoform X3 [Elaeis guineensis]
Length=549

 Score =   279 bits (713),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 154/291 (53%), Positives = 196/291 (67%), Gaps = 25/291 (9%)
 Frame = +1

Query  1    AIHIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLDVNKIN--------NIVADMRKVLAK  156
            A+HIPNHKFTVNVVRNL+QKTHWRIKTHLAISHLD++KIN        NIVADMRKVLAK
Sbjct  188  AVHIPNHKFTVNVVRNLSQKTHWRIKTHLAISHLDISKINPSHAFLEQNIVADMRKVLAK  247

Query  157  NPQVEQQKLHRRVFLDNIDRENQALLIMVSCFVKTSHFEEYLRVKEVILLDLLRVISHHR  336
            N Q+EQQ+LHRRVFL+NI+ ENQALLI++SCFVKTSHFEEYL VKE +LLDLLRVISHHR
Sbjct  248  NSQIEQQRLHRRVFLENINPENQALLILISCFVKTSHFEEYLCVKEAVLLDLLRVISHHR  307

Query  337  ARLATPIRTVQKIYKEADVDEVPLADSVMT--VNRANHPFLLIEPSYKINNSSEDKTKAA  510
            ARLATPIRTVQKIY +AD++ +P +++++T     AN PFLLIEPS +IN   + K + +
Sbjct  308  ARLATPIRTVQKIYGDADMENIPYSETILTRSATAANRPFLLIEPSPRINGDDKAKPRGS  367

Query  511  TPPRPNQEKDGKSEVQTTASKAVDASPPIVDG---------NRIDTRgssgssTDTEPGV  663
               R N+E++ K+   +       +   I++          N  D+R  S  +       
Sbjct  368  ---RTNEEQNSKATAASGPRATSSSEGAILNNSDKQLQKKKNSGDSRSKSNKADPATAPS  424

Query  664  ATSELDGKMPNTGSVQSKNERQQVDKVVPGEVDAPSAVSQAKQDGER-PTT  813
              S+L+  + + GS     E     + V  +VD  S V  AK +GE+ PTT
Sbjct  425  LNSQLE-SLDSVGSTSKSGENPLSSEAVTEQVDGTSPV-HAKNEGEKVPTT  473



>gb|KJB64153.1| hypothetical protein B456_010G034900 [Gossypium raimondii]
Length=687

 Score =   282 bits (722),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 147/246 (60%), Positives = 184/246 (75%), Gaps = 15/246 (6%)
 Frame = +1

Query  1    AIHIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQVEQQK  180
            A+HIPNHKFTVNVVRN++QKTHWRIK + AISHLDVNKINN+VADMRKVLAKNPQVEQQ+
Sbjct  335  AVHIPNHKFTVNVVRNISQKTHWRIKNYFAISHLDVNKINNVVADMRKVLAKNPQVEQQR  394

Query  181  LHRRVFLDNIDRENQALLIMVSCFVKTSHFEEYLRVKEVILLDLLRVISHHRARLATPIR  360
            LHRRVFL++ID +NQALLI+VSCFVKTSH EEYL VKE I+LDLLRVISHHRARLATPIR
Sbjct  395  LHRRVFLESIDPQNQALLILVSCFVKTSHIEEYLCVKEAIMLDLLRVISHHRARLATPIR  454

Query  361  TVQKIYKEADVDEVPLADSVMTVNRA--NHPFLLIEPSYKINNSSEDKTKAATPPRPNQE  534
            TVQKIY E +++++P AD++   + A  N P LLIEP YKIN  S+DK KA  P R N+E
Sbjct  455  TVQKIYSEPEIEDIPFADTIFRRSGAATNRPLLLIEPDYKIN--SDDKAKA--PTRANEE  510

Query  535  KDGKSEVQTTASKAVDASPPIVDGNRIDTRgssgssTDT-EPGVATSELDGKMPNTGSVQ  711
                     T +   D+      G+ +D++     ++ T   G++++E    +P  GSV+
Sbjct  511  I-------LTPTSTSDSKGNTNSGSALDSKEDKVMASSTNNSGLSSNESGNSVP-VGSVE  562

Query  712  SKNERQ  729
              +E+Q
Sbjct  563  VNSEKQ  568



>ref|XP_007047790.1| MSCS-like 2 [Theobroma cacao]
 gb|EOX91947.1| MSCS-like 2 [Theobroma cacao]
Length=566

 Score =   279 bits (714),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 138/196 (70%), Positives = 161/196 (82%), Gaps = 5/196 (3%)
 Frame = +1

Query  1    AIHIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQVEQQK  180
            A+HIPNHK TVNVVRNL+QKTHWRIKTHLAISHLD+NKINNIVADMRKVLAKNPQVEQQ+
Sbjct  270  AVHIPNHKCTVNVVRNLSQKTHWRIKTHLAISHLDINKINNIVADMRKVLAKNPQVEQQR  329

Query  181  LHRRVFLDNIDRENQALLIMVSCFVKTSHFEEYLRVKEVILLDLLRVISHHRARLATPIR  360
            LHRRVFL+N++ ENQALLI+VSCFV+TSH EEYL VKE ILLDLLRVISH RARLAT IR
Sbjct  330  LHRRVFLENVNPENQALLILVSCFVRTSHLEEYLCVKEAILLDLLRVISHQRARLATSIR  389

Query  361  TVQKIYKEADVDEVPLADSVMTVNR--ANHPFLLIEPSYKINNSSEDKTKAATPPRPNQE  534
            T+QKIY +AD++ +P ADSV +     +N P LLIEPSYKIN   E++TK  +  RP  E
Sbjct  390  TLQKIYSDADLENIPFADSVYSRGGVPSNRPLLLIEPSYKING--ENRTKGRS-SRPAGE  446

Query  535  KDGKSEVQTTASKAVD  582
            +D K+  + +A    D
Sbjct  447  QDSKTTARPSADTKAD  462



>ref|XP_009350348.1| PREDICTED: mechanosensitive ion channel protein 2, chloroplastic 
isoform X1 [Pyrus x bretschneideri]
Length=727

 Score =   283 bits (724),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 140/220 (64%), Positives = 176/220 (80%), Gaps = 8/220 (4%)
 Frame = +1

Query  1    AIHIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQVEQQK  180
            A+HIPNH+FTVNVVRNL+QKTHWRIKTHLAISHLDV+KINNIVADMRKVL+KNPQVEQQ+
Sbjct  333  AVHIPNHQFTVNVVRNLSQKTHWRIKTHLAISHLDVHKINNIVADMRKVLSKNPQVEQQR  392

Query  181  LHRRVFLDNIDRENQALLIMVSCFVKTSHFEEYLRVKEVILLDLLRVISHHRARLATPIR  360
            LHRRVFLDN+  ENQALLI++SCFVKTSH+EEYL VKE I+LDLLRVISHH+ARLATPIR
Sbjct  393  LHRRVFLDNVTPENQALLILISCFVKTSHYEEYLCVKEAIMLDLLRVISHHKARLATPIR  452

Query  361  TVQKIYKEADVDEVPLADSVM--TVNRANHPFLLIEPSYKINNSSEDKTKAATPPRPNQE  534
            TVQK+Y + D+D VP ADS+      R+  PF+LI+PSYKIN   EDK ++ T  + + E
Sbjct  453  TVQKMYSDPDLDSVPFADSMYNHAEARSRRPFILIDPSYKING--EDKKRSRT--QTSGE  508

Query  535  KDGKSEVQTTASKAVDASPPIVDGNRIDTRgssgssTDTE  654
            +DGK+ ++ +       +P      + D+R  + S++D++
Sbjct  509  RDGKATMRPSPDSKARETP--TSDTKSDSRTGATSASDSK  546



>gb|ABJ96380.1| expressed protein [Prunus persica]
Length=705

 Score =   282 bits (722),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 169/316 (53%), Positives = 207/316 (66%), Gaps = 46/316 (15%)
 Frame = +1

Query  1    AIHIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQVEQQK  180
            A+HIPNHKFTVNVVRNL+QKTHWRIKTHLAISHLDV KIN IVADMRKVLAKN QVEQQ+
Sbjct  328  AVHIPNHKFTVNVVRNLSQKTHWRIKTHLAISHLDVIKINTIVADMRKVLAKNSQVEQQR  387

Query  181  LHRRVFLDNIDRENQALLIMVSCFVKTSHFEEYLRVK-EVILLDLLRVISHHRARLATPI  357
            LHRRVFLDNI+ +NQAL+I+VSCFVKTSHFEEYL VK E ILLDLLRV+SHHRARLATPI
Sbjct  388  LHRRVFLDNINPDNQALMILVSCFVKTSHFEEYLCVKEEAILLDLLRVVSHHRARLATPI  447

Query  358  RTVQKIYKEADVDEVPLADSVMTVNRA--NHPFLLIEPSYKINNSSEDKTKAATPPRPNQ  531
            RTVQK Y EAD++ VP AD++ T +RA  N P+LLIEPSYKI +S +    ++ P R N 
Sbjct  448  RTVQKYYSEADLENVPFADTIFTHSRASNNRPYLLIEPSYKI-SSDDKSKASSRPTRTNG  506

Query  532  EKDGKSEVQTTA-SKAVDA-SPPIVDGNRIDTRgssgssT------------DTEPGVAT  669
            +K  ++E  +T+ SK  DA +   +   + D + ++ SS+             +EP    
Sbjct  507  DKQAQAEASSTSDSKGSDAKAGATLTHAQTDNKVAATSSSNSSTNSKTSEMPTSEPQTRN  566

Query  670  SELDGKM-PNTGSVQSKNER-QQVDKVVPG--------------------------EVDA  765
            S  DG +  N+  +QSKNE  +   K   G                          + D 
Sbjct  567  SASDGSVRSNSEMLQSKNESTKNAGKETTGVDSKDASPPKMTSKKSLVASPETGSEKADV  626

Query  766  PSAVSQAKQDGERPTT  813
            P A  QAK DGE+P +
Sbjct  627  PLAPLQAKHDGEKPVS  642



>ref|XP_009797996.1| PREDICTED: mechanosensitive ion channel protein 2, chloroplastic 
[Nicotiana sylvestris]
 ref|XP_009797997.1| PREDICTED: mechanosensitive ion channel protein 2, chloroplastic 
[Nicotiana sylvestris]
Length=752

 Score =   283 bits (725),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 139/190 (73%), Positives = 158/190 (83%), Gaps = 3/190 (2%)
 Frame = +1

Query  1    AIHIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQVEQQK  180
            A+HIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLDV+KINNIVADMRKVLAKNPQVEQQ+
Sbjct  338  AVHIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLDVSKINNIVADMRKVLAKNPQVEQQR  397

Query  181  LHRRVFLDNIDRENQALLIMVSCFVKTSHFEEYLRVKEVILLDLLRVISHHRARLATPIR  360
            LHRRVFL+N++ ENQALLI++SCFVKTSHFEEYL VKE ILLDLLRVI HHRARLATPIR
Sbjct  398  LHRRVFLENVNPENQALLILISCFVKTSHFEEYLCVKEAILLDLLRVIRHHRARLATPIR  457

Query  361  TVQKIYKEADVDEVPLADSVMTVNRANHPFLLIEPSYKINNSSEDKTKAATPPRPNQEKD  540
            TVQKIY +AD++ +P   +      +  P LLIEPSYKIN   ED+TK   P R N E+D
Sbjct  458  TVQKIYSDADLENIPYDSAFNRGAASTRPLLLIEPSYKING--EDRTK-GRPIRVNGEED  514

Query  541  GKSEVQTTAS  570
             K +  T ++
Sbjct  515  TKEKATTKSA  524



>ref|XP_009350349.1| PREDICTED: mechanosensitive ion channel protein 2, chloroplastic 
isoform X2 [Pyrus x bretschneideri]
Length=726

 Score =   283 bits (723),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 140/220 (64%), Positives = 176/220 (80%), Gaps = 8/220 (4%)
 Frame = +1

Query  1    AIHIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQVEQQK  180
            A+HIPNH+FTVNVVRNL+QKTHWRIKTHLAISHLDV+KINNIVADMRKVL+KNPQVEQQ+
Sbjct  332  AVHIPNHQFTVNVVRNLSQKTHWRIKTHLAISHLDVHKINNIVADMRKVLSKNPQVEQQR  391

Query  181  LHRRVFLDNIDRENQALLIMVSCFVKTSHFEEYLRVKEVILLDLLRVISHHRARLATPIR  360
            LHRRVFLDN+  ENQALLI++SCFVKTSH+EEYL VKE I+LDLLRVISHH+ARLATPIR
Sbjct  392  LHRRVFLDNVTPENQALLILISCFVKTSHYEEYLCVKEAIMLDLLRVISHHKARLATPIR  451

Query  361  TVQKIYKEADVDEVPLADSVM--TVNRANHPFLLIEPSYKINNSSEDKTKAATPPRPNQE  534
            TVQK+Y + D+D VP ADS+      R+  PF+LI+PSYKIN   EDK ++ T  + + E
Sbjct  452  TVQKMYSDPDLDSVPFADSMYNHAEARSRRPFILIDPSYKING--EDKKRSRT--QTSGE  507

Query  535  KDGKSEVQTTASKAVDASPPIVDGNRIDTRgssgssTDTE  654
            +DGK+ ++ +       +P      + D+R  + S++D++
Sbjct  508  RDGKATMRPSPDSKARETP--TSDTKSDSRTGATSASDSK  545



>ref|XP_009350350.1| PREDICTED: mechanosensitive ion channel protein 2, chloroplastic 
isoform X3 [Pyrus x bretschneideri]
Length=725

 Score =   283 bits (723),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 140/220 (64%), Positives = 176/220 (80%), Gaps = 8/220 (4%)
 Frame = +1

Query  1    AIHIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQVEQQK  180
            A+HIPNH+FTVNVVRNL+QKTHWRIKTHLAISHLDV+KINNIVADMRKVL+KNPQVEQQ+
Sbjct  331  AVHIPNHQFTVNVVRNLSQKTHWRIKTHLAISHLDVHKINNIVADMRKVLSKNPQVEQQR  390

Query  181  LHRRVFLDNIDRENQALLIMVSCFVKTSHFEEYLRVKEVILLDLLRVISHHRARLATPIR  360
            LHRRVFLDN+  ENQALLI++SCFVKTSH+EEYL VKE I+LDLLRVISHH+ARLATPIR
Sbjct  391  LHRRVFLDNVTPENQALLILISCFVKTSHYEEYLCVKEAIMLDLLRVISHHKARLATPIR  450

Query  361  TVQKIYKEADVDEVPLADSVM--TVNRANHPFLLIEPSYKINNSSEDKTKAATPPRPNQE  534
            TVQK+Y + D+D VP ADS+      R+  PF+LI+PSYKIN   EDK ++ T  + + E
Sbjct  451  TVQKMYSDPDLDSVPFADSMYNHAEARSRRPFILIDPSYKING--EDKKRSRT--QTSGE  506

Query  535  KDGKSEVQTTASKAVDASPPIVDGNRIDTRgssgssTDTE  654
            +DGK+ ++ +       +P      + D+R  + S++D++
Sbjct  507  RDGKATMRPSPDSKARETP--TSDTKSDSRTGATSASDSK  544



>ref|XP_006353171.1| PREDICTED: mechanosensitive ion channel protein 2, chloroplastic-like 
isoform X4 [Solanum tuberosum]
Length=756

 Score =   283 bits (725),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 144/204 (71%), Positives = 162/204 (79%), Gaps = 13/204 (6%)
 Frame = +1

Query  1    AIHIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQVEQQK  180
            AIHIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLDV+KINNIVADMRKVLAKNPQVEQQ+
Sbjct  336  AIHIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLDVSKINNIVADMRKVLAKNPQVEQQR  395

Query  181  LHRRVFLDNIDRENQALLIMVSCFVKTSHFEEYLRVKEVILLDLLRVISHHRARLATPIR  360
            LHRRVFL+N++ ENQALLI++SCFVKTSHFEEYL VKE ILLDLLRVI HHRARLATPIR
Sbjct  396  LHRRVFLENVNPENQALLILISCFVKTSHFEEYLCVKEAILLDLLRVIRHHRARLATPIR  455

Query  361  TVQKIYKEADVDEVPLADSVMTVNRANHPFLLIEPSYKINNSSEDKTKAATPPRPNQEKD  540
            TVQKIY +AD+D +P   +      +  P LLIEPSYK+N   ED+TK   P R N E+D
Sbjct  456  TVQKIYSDADLDNMPYDSAFSRGAASTRPLLLIEPSYKVNG--EDRTK-GRPIRVNGEED  512

Query  541  GK----------SEVQTTASKAVD  582
             K          S+V+T +  A D
Sbjct  513  TKEKSTMKPAPDSKVETKSGPASD  536



>ref|XP_002533682.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF28698.1| conserved hypothetical protein [Ricinus communis]
Length=654

 Score =   281 bits (719),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 136/175 (78%), Positives = 153/175 (87%), Gaps = 8/175 (5%)
 Frame = +1

Query  1    AIHIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQVEQQK  180
            A+HIPNHKFTVNVVRNL+QKTHWRIKTHLAISHLDV+KI+NIVADMRKVLAKNPQVEQQ+
Sbjct  241  AVHIPNHKFTVNVVRNLSQKTHWRIKTHLAISHLDVHKIHNIVADMRKVLAKNPQVEQQR  300

Query  181  LHRRVFLDNIDRENQALLIMVSCFVKTSHFEEYLRVKEVILLDLLRVISHHRARLATPIR  360
            LHRRVFL+NI+ ENQALLI++SCFVKTSH EEYL VKE ILLDLLRVISHHRARLATPIR
Sbjct  301  LHRRVFLENINPENQALLILISCFVKTSHHEEYLCVKEAILLDLLRVISHHRARLATPIR  360

Query  361  TVQKIYKEADVDEVPLADSVMTVNRA----NHPFLLIEPSYKINNSSEDKTKAAT  513
            TVQKIY +AD++ +P ADS+   NR     N P LLIEPSY+IN   +DK K+ T
Sbjct  361  TVQKIYSDADLENIPFADSIY--NRGGSASNRPLLLIEPSYRING--DDKAKSQT  411



>ref|XP_006353168.1| PREDICTED: mechanosensitive ion channel protein 2, chloroplastic-like 
isoform X1 [Solanum tuberosum]
 ref|XP_006353169.1| PREDICTED: mechanosensitive ion channel protein 2, chloroplastic-like 
isoform X2 [Solanum tuberosum]
 ref|XP_006353170.1| PREDICTED: mechanosensitive ion channel protein 2, chloroplastic-like 
isoform X3 [Solanum tuberosum]
Length=757

 Score =   283 bits (725),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 144/204 (71%), Positives = 162/204 (79%), Gaps = 13/204 (6%)
 Frame = +1

Query  1    AIHIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQVEQQK  180
            AIHIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLDV+KINNIVADMRKVLAKNPQVEQQ+
Sbjct  337  AIHIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLDVSKINNIVADMRKVLAKNPQVEQQR  396

Query  181  LHRRVFLDNIDRENQALLIMVSCFVKTSHFEEYLRVKEVILLDLLRVISHHRARLATPIR  360
            LHRRVFL+N++ ENQALLI++SCFVKTSHFEEYL VKE ILLDLLRVI HHRARLATPIR
Sbjct  397  LHRRVFLENVNPENQALLILISCFVKTSHFEEYLCVKEAILLDLLRVIRHHRARLATPIR  456

Query  361  TVQKIYKEADVDEVPLADSVMTVNRANHPFLLIEPSYKINNSSEDKTKAATPPRPNQEKD  540
            TVQKIY +AD+D +P   +      +  P LLIEPSYK+N   ED+TK   P R N E+D
Sbjct  457  TVQKIYSDADLDNMPYDSAFSRGAASTRPLLLIEPSYKVNG--EDRTK-GRPIRVNGEED  513

Query  541  GK----------SEVQTTASKAVD  582
             K          S+V+T +  A D
Sbjct  514  TKEKSTMKPAPDSKVETKSGPASD  537



>gb|KJB18176.1| hypothetical protein B456_003G037900 [Gossypium raimondii]
Length=707

 Score =   281 bits (720),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 143/227 (63%), Positives = 174/227 (77%), Gaps = 5/227 (2%)
 Frame = +1

Query  1    AIHIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQVEQQK  180
            A+HIPNHKFTVNVVRNL+QKTHWRIKTHLAISHLDV+KINNIVADMRKVLAKNPQVEQQ+
Sbjct  337  AVHIPNHKFTVNVVRNLSQKTHWRIKTHLAISHLDVHKINNIVADMRKVLAKNPQVEQQR  396

Query  181  LHRRVFLDNIDRENQALLIMVSCFVKTSHFEEYLRVKEVILLDLLRVISHHRARLATPIR  360
            LHRRVFL+N+  ENQALLI+VSCFVKTSH EEYL VKE ILLDLLRVISHHRARLATPIR
Sbjct  397  LHRRVFLENVSPENQALLILVSCFVKTSHLEEYLCVKEAILLDLLRVISHHRARLATPIR  456

Query  361  TVQKIYKEADVDEVPLADSVMTVN--RANHPFLLIEPSYKINNSSEDKTKAATPPRPNQE  534
            TVQK+  +++++ VP ADS+       +N P LLIEP+YK   S ED+TK  +  +P  E
Sbjct  457  TVQKVVGDSELENVPFADSIYNHGGVSSNRPLLLIEPAYK--TSGEDRTKGRS-AQPAGE  513

Query  535  KDGKSEVQTTASKAVDASPPIVDGNRIDTRgssgssTDTEPGVATSE  675
            +D K+ V+  A     A+P     ++ D +     +++T+   A+ E
Sbjct  514  QDSKTTVRPAADNKAGATPKPDSKSKADAKVVESPNSETKASNASFE  560



>gb|AES96006.2| mechanosensitive ion channel-like protein [Medicago truncatula]
Length=705

 Score =   281 bits (720),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 145/205 (71%), Positives = 168/205 (82%), Gaps = 11/205 (5%)
 Frame = +1

Query  1    AIHIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQVEQQK  180
            A+HIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQVEQQ+
Sbjct  332  AVHIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQVEQQR  391

Query  181  LHRRVFLDNIDRENQALLIMVSCFVKTSHFEEYLRVKEVILLDLLRVISHHRARLATPIR  360
            LHRRVFLDNI+ ENQAL+I++SCFVKTSHFEEYL VKE ILLDLLRVISHHRARLATP+R
Sbjct  392  LHRRVFLDNINPENQALMILISCFVKTSHFEEYLCVKETILLDLLRVISHHRARLATPVR  451

Query  361  TVQKIYKEADVDEVPLADSVMTVNRA-----NHPFLLIEPSYKINNSSEDKTKAATPPRP  525
            T+QKIY +AD+D +P AD+  T N A     N P L+I+  YK  N+++DKTK+ +  R 
Sbjct  452  TLQKIYADADLDNIPYADT--TFNGAGPVVSNRPLLVIDSPYK--NNADDKTKSRS-TRA  506

Query  526  NQEKDGKSEVQTTA-SKAVDASPPI  597
              ++D K+ V+T   SK  D   PI
Sbjct  507  TVDQDDKTTVRTKLDSKTEDKVEPI  531



>ref|XP_007158369.1| hypothetical protein PHAVU_002G147200g [Phaseolus vulgaris]
 gb|ESW30363.1| hypothetical protein PHAVU_002G147200g [Phaseolus vulgaris]
Length=697

 Score =   281 bits (719),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 136/187 (73%), Positives = 157/187 (84%), Gaps = 7/187 (4%)
 Frame = +1

Query  1    AIHIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQVEQQK  180
            A+HIPNHKFTVNVVRNL+QKTHWRIKTHLAI+HLDVNKINNIVADMRKVLAKNPQVEQQ+
Sbjct  335  AVHIPNHKFTVNVVRNLSQKTHWRIKTHLAITHLDVNKINNIVADMRKVLAKNPQVEQQR  394

Query  181  LHRRVFLDNIDRENQALLIMVSCFVKTSHFEEYLRVKEVILLDLLRVISHHRARLATPIR  360
            LHRRVFLDNI+ E+QALLI+VSCFVKTSHFEEYL VKE ILLDLLRVI HHRARLATP+R
Sbjct  395  LHRRVFLDNINPESQALLILVSCFVKTSHFEEYLCVKEAILLDLLRVIGHHRARLATPVR  454

Query  361  TVQKIYKEADVDEVPLADSVMTVNRA----NHPFLLIEPSYKINNSSEDKTKAATPPRPN  528
            T+QK+Y +AD++ +P ADS      A    N P L+IEPSYKIN   + K ++A   RP 
Sbjct  455  TLQKVYSDADLENIPFADSTFGGGGAGTVPNRPLLVIEPSYKINADDKMKNRSA---RPV  511

Query  529  QEKDGKS  549
             ++D K+
Sbjct  512  VDQDNKT  518



>gb|AGI05086.1| mechanosensitive channel of small conductance-like protein [Gossypium 
aridum]
Length=707

 Score =   281 bits (720),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 143/227 (63%), Positives = 174/227 (77%), Gaps = 5/227 (2%)
 Frame = +1

Query  1    AIHIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQVEQQK  180
            A+HIPNHKFTVNVVRNL+QKTHWRIKTHLAISHLDV+KINNIVADMRKVLAKNPQVEQQ+
Sbjct  337  AVHIPNHKFTVNVVRNLSQKTHWRIKTHLAISHLDVHKINNIVADMRKVLAKNPQVEQQR  396

Query  181  LHRRVFLDNIDRENQALLIMVSCFVKTSHFEEYLRVKEVILLDLLRVISHHRARLATPIR  360
            LHRRVFL+N+  ENQALLI+VSCFVKTSH EEYL VKE ILLDLLRVISHHRARLATPIR
Sbjct  397  LHRRVFLENVSPENQALLILVSCFVKTSHLEEYLCVKEAILLDLLRVISHHRARLATPIR  456

Query  361  TVQKIYKEADVDEVPLADSVMTVN--RANHPFLLIEPSYKINNSSEDKTKAATPPRPNQE  534
            TVQK+  +++++ VP ADS+       +N P LLIEP+YK   S ED+TK  +  +P  E
Sbjct  457  TVQKVVGDSELENVPFADSIYNHGGVSSNRPLLLIEPAYK--TSGEDRTKGRS-AQPAGE  513

Query  535  KDGKSEVQTTASKAVDASPPIVDGNRIDTRgssgssTDTEPGVATSE  675
            +D K+ V+  A     A+P     ++ D +     +++T+   A+ E
Sbjct  514  QDSKTTVRPAADNKAGATPKPDSKSKADAKVVESPNSETKASNASFE  560



>ref|XP_008236146.1| PREDICTED: mechanosensitive ion channel protein 2, chloroplastic 
[Prunus mume]
Length=757

 Score =   282 bits (721),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 147/240 (61%), Positives = 182/240 (76%), Gaps = 14/240 (6%)
 Frame = +1

Query  1    AIHIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQVEQQK  180
            A+HIPNH+FTVNVVRNL+QKTHWRIKTHLAISHLDV+KINNIVADMRKVL+KNPQVEQQ+
Sbjct  335  AVHIPNHQFTVNVVRNLSQKTHWRIKTHLAISHLDVHKINNIVADMRKVLSKNPQVEQQR  394

Query  181  LHRRVFLDNIDRENQALLIMVSCFVKTSHFEEYLRVKEVILLDLLRVISHHRARLATPIR  360
            LHRRVFLDN+  ENQALLI+VSCFVKTSH EEYL VKE ILLDLLRVISHH+ARLATPIR
Sbjct  395  LHRRVFLDNVTPENQALLILVSCFVKTSHHEEYLCVKEAILLDLLRVISHHKARLATPIR  454

Query  361  TVQKIYKEADVDEVPLADSVMTVNR--ANHPFLLIEPSYKINNSSEDKTKAATPPRPNQE  534
            TVQK+Y + D+D VP AD++   +   +  P LLIEPSYKIN   EDK ++ T  + + E
Sbjct  455  TVQKMYSDTDLDNVPFADTIYNHSGVTSRRPLLLIEPSYKING--EDKKRSRT--QTSGE  510

Query  535  KDGKSEVQTTASKAVDASPPIVDGNRIDTRgssgssTDT---EPGVATSELD---GKMPN  696
            +DGK+ ++      V  +P      R D++  +   +D+   E  ++ ++ D   G+MPN
Sbjct  511  RDGKATMRPAPDSKVRETP--TSDTRADSKVGATPVSDSKTRETPLSDTKADARSGEMPN  568



>ref|XP_010523353.1| PREDICTED: mechanosensitive ion channel protein 2, chloroplastic-like 
[Tarenaya hassleriana]
Length=363

 Score =   271 bits (693),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 130/171 (76%), Positives = 149/171 (87%), Gaps = 4/171 (2%)
 Frame = +1

Query  1    AIHIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQVEQQK  180
            A+HIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLDV+KINNIVADMRKVLAKNPQVEQQ+
Sbjct  187  AVHIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLDVSKINNIVADMRKVLAKNPQVEQQR  246

Query  181  LHRRVFLDNIDRENQALLIMVSCFVKTSHFEEYLRVKEVILLDLLRVISHHRARLATPIR  360
            LHRRVFLDN+D ENQALLI++SCFVKTSH EEYL VKE I+LDLLRVISHHRARLATPIR
Sbjct  247  LHRRVFLDNVDPENQALLILISCFVKTSHHEEYLCVKEAIMLDLLRVISHHRARLATPIR  306

Query  361  TVQKIYKEADVDEVPLADSVMTVN--RANHPFLLIEPSYKINNSSEDKTKA  507
            T++K+Y ++D++  P  DS+       +  P LLIEPSYKIN   ED++K+
Sbjct  307  TIRKMYSDSDLENPPFGDSIYNQGGVSSRRPLLLIEPSYKING--EDRSKS  355



>emb|CBI19266.3| unnamed protein product [Vitis vinifera]
Length=514

 Score =   276 bits (705),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 138/175 (79%), Positives = 151/175 (86%), Gaps = 6/175 (3%)
 Frame = +1

Query  1    AIHIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQVEQQK  180
            A+HIPNHKFTVNVVRNL+QKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQVEQQ+
Sbjct  335  AVHIPNHKFTVNVVRNLSQKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQVEQQR  394

Query  181  LHRRVFLDNIDRENQALLIMVSCFVKTSHFEEYLRVKEVILLDLLRVISHHRARLATPIR  360
            LHRRVFLD ID ENQALLI+VSCFVKT  FEEYL VKE ILLDLLRVISHH+ARLATPIR
Sbjct  395  LHRRVFLDYIDPENQALLILVSCFVKTPRFEEYLCVKEAILLDLLRVISHHQARLATPIR  454

Query  361  TVQKIYKEAD--VDEVPLADSVMTVNR--ANHPFLLIEPSYKINNSSEDKTKAAT  513
            TVQK Y  AD  ++ +P AD + T +   AN P LLIEPSYK+N   +DKTKA+T
Sbjct  455  TVQKEYSMADMEMENIPFADPIFTRSSAAANRPLLLIEPSYKMNG--DDKTKAST  507



>ref|XP_009608143.1| PREDICTED: mechanosensitive ion channel protein 2, chloroplastic 
[Nicotiana tomentosiformis]
 ref|XP_009608144.1| PREDICTED: mechanosensitive ion channel protein 2, chloroplastic 
[Nicotiana tomentosiformis]
 ref|XP_009608145.1| PREDICTED: mechanosensitive ion channel protein 2, chloroplastic 
[Nicotiana tomentosiformis]
Length=752

 Score =   281 bits (720),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 143/204 (70%), Positives = 162/204 (79%), Gaps = 13/204 (6%)
 Frame = +1

Query  1    AIHIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQVEQQK  180
            A+HIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLDV+KINNIVADMRKVLAKNPQVEQQ+
Sbjct  338  AVHIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLDVSKINNIVADMRKVLAKNPQVEQQR  397

Query  181  LHRRVFLDNIDRENQALLIMVSCFVKTSHFEEYLRVKEVILLDLLRVISHHRARLATPIR  360
            LHRRVFL+N++ ENQALLI++SCFVKTSHFEEYL VKE ILLDLLRVI HHRARLATPIR
Sbjct  398  LHRRVFLENVNPENQALLILISCFVKTSHFEEYLCVKEAILLDLLRVIRHHRARLATPIR  457

Query  361  TVQKIYKEADVDEVPLADSVMTVNRANHPFLLIEPSYKINNSSEDKTKAATPPRPNQEKD  540
            TVQKIY +AD++ +P   +      +  P LLIEPSYKIN   ED+TK   P R N E+D
Sbjct  458  TVQKIYSDADLENIPYDSAFNRGAASTRPLLLIEPSYKING--EDRTK-GRPIRVNGEED  514

Query  541  GK----------SEVQTTASKAVD  582
             K          S+V+T +  A D
Sbjct  515  TKEKATMKSAPDSKVETKSGPASD  538



>emb|CDX97019.1| BnaC09g46060D [Brassica napus]
Length=679

 Score =   280 bits (715),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 149/257 (58%), Positives = 176/257 (68%), Gaps = 15/257 (6%)
 Frame = +1

Query  1    AIHIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQVEQQK  180
            AIHIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQVEQQ+
Sbjct  335  AIHIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQVEQQR  394

Query  181  LHRRVFLDNIDRENQALLIMVSCFVKTSHFEEYLRVKEVILLDLLRVISHHRARLATPIR  360
            LHRR+FL+N++ ENQAL+I++SCFVKTSHFEEYL VKE ILLDLLRVISHHRARLATPIR
Sbjct  395  LHRRIFLENVNPENQALVILISCFVKTSHFEEYLCVKEAILLDLLRVISHHRARLATPIR  454

Query  361  TVQKIYKEADVDEVPLADSVMTVN--RANHPFLLIEPSYKINNSSEDKTK----AATPPR  522
            T++K+Y +AD++  P  +S+       +  P +LIEPSYKIN   EDK+K    A+ P  
Sbjct  455  TIRKMYTDADMENAPFGESMYGPGGVASRRPLMLIEPSYKING--EDKSKSQNRASKPTT  512

Query  523  PNQEKDGKSEVQTTASKAVDASPPIVDGNRIDTRgssgssTDTEP-------GVATSELD  681
              QE    S  +T  +         V     DT         T+P          T+E  
Sbjct  513  AEQENKAPSSPKTKETPTSPDPKANVKAGESDTNKVPDDKPGTKPVSKPATIAKDTTEAS  572

Query  682  GKMPNTGSVQSKNERQQ  732
            GK   +G    KN+ Q+
Sbjct  573  GKAKRSGGATPKNDTQK  589



>ref|XP_010523354.1| PREDICTED: mechanosensitive ion channel protein 2, chloroplastic 
[Tarenaya hassleriana]
 ref|XP_010523355.1| PREDICTED: mechanosensitive ion channel protein 2, chloroplastic 
[Tarenaya hassleriana]
 ref|XP_010523356.1| PREDICTED: mechanosensitive ion channel protein 2, chloroplastic 
[Tarenaya hassleriana]
Length=388

 Score =   271 bits (693),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 130/171 (76%), Positives = 149/171 (87%), Gaps = 4/171 (2%)
 Frame = +1

Query  1    AIHIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQVEQQK  180
            A+HIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLDV+KINNIVADMRKVLAKNPQVEQQ+
Sbjct  212  AVHIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLDVSKINNIVADMRKVLAKNPQVEQQR  271

Query  181  LHRRVFLDNIDRENQALLIMVSCFVKTSHFEEYLRVKEVILLDLLRVISHHRARLATPIR  360
            LHRRVFLDN+D ENQALLI++SCFVKTSH EEYL VKE I+LDLLRVISHHRARLATPIR
Sbjct  272  LHRRVFLDNVDPENQALLILISCFVKTSHHEEYLCVKEAIMLDLLRVISHHRARLATPIR  331

Query  361  TVQKIYKEADVDEVPLADSVMTVN--RANHPFLLIEPSYKINNSSEDKTKA  507
            T++K+Y ++D++  P  DS+       +  P LLIEPSYKIN   ED++K+
Sbjct  332  TIRKMYSDSDLENPPFGDSIYNQGGVSSRRPLLLIEPSYKIN--GEDRSKS  380



>gb|AAL06497.1|AF412044_1 AT5g10490/F12B17_160 [Arabidopsis thaliana]
 gb|AAN46772.1| At5g10490/F12B17_160 [Arabidopsis thaliana]
Length=519

 Score =   275 bits (703),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 134/184 (73%), Positives = 150/184 (82%), Gaps = 5/184 (3%)
 Frame = +1

Query  1    AIHIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQVEQQK  180
            AIHIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNP VEQQ+
Sbjct  181  AIHIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPMVEQQR  240

Query  181  LHRRVFLDNIDRENQALLIMVSCFVKTSHFEEYLRVKEVILLDLLRVISHHRARLATPIR  360
            LHRRVFL+N+  ENQAL I++SCFVKTSH EEYL VKE ILLDLLRVISHHRARLATPIR
Sbjct  241  LHRRVFLENVIPENQALSILISCFVKTSHHEEYLGVKEAILLDLLRVISHHRARLATPIR  300

Query  361  TVQKIYKEADVDEVPLADSVMTVNRANHPFLLIEPSYKINNSSEDKTKA---ATPPRPNQ  531
            T++K+Y E DV+  P  +S+     +  P +LIEP+YKIN   EDK+K+   A  P   Q
Sbjct  301  TIRKMYTETDVENTPFGESMYGGVTSRRPLMLIEPAYKING--EDKSKSQNRAAKPTAEQ  358

Query  532  EKDG  543
            E  G
Sbjct  359  ENKG  362



>ref|XP_004288512.1| PREDICTED: mechanosensitive ion channel protein 2, chloroplastic 
[Fragaria vesca subsp. vesca]
 ref|XP_011468595.1| PREDICTED: mechanosensitive ion channel protein 2, chloroplastic 
[Fragaria vesca subsp. vesca]
 ref|XP_011468597.1| PREDICTED: mechanosensitive ion channel protein 2, chloroplastic 
[Fragaria vesca subsp. vesca]
Length=739

 Score =   280 bits (717),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 134/197 (68%), Positives = 163/197 (83%), Gaps = 5/197 (3%)
 Frame = +1

Query  1    AIHIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQVEQQK  180
            A+HIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLDV+KINNIVADMRKVL+KNPQVEQQ+
Sbjct  337  AVHIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLDVHKINNIVADMRKVLSKNPQVEQQR  396

Query  181  LHRRVFLDNIDRENQALLIMVSCFVKTSHFEEYLRVKEVILLDLLRVISHHRARLATPIR  360
            LHRRVFL+N+  ENQAL+I++SCFVKTSH EEYL VKE IL+DLLRVISHH+ARLATPIR
Sbjct  397  LHRRVFLENVTPENQALMILISCFVKTSHHEEYLCVKEAILMDLLRVISHHKARLATPIR  456

Query  361  TVQKIYKEADVDEVPLADSVMTVNRAN--HPFLLIEPSYKINNSSEDKTKAATPPRPNQE  534
            TVQK+Y + D+D +P ADS+ +    +   P LLIEPSYKIN   + ++++    + + E
Sbjct  457  TVQKMYNDTDLDSMPFADSMYSHGGVSPRRPLLLIEPSYKINGEDKKRSRSG---QTSGE  513

Query  535  KDGKSEVQTTASKAVDA  585
            +DGK+ V+ +    VDA
Sbjct  514  RDGKATVRPSPDPKVDA  530



>emb|CDP01563.1| unnamed protein product [Coffea canephora]
Length=706

 Score =   279 bits (714),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 134/187 (72%), Positives = 150/187 (80%), Gaps = 1/187 (1%)
 Frame = +1

Query  1    AIHIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQVEQQK  180
            A+HIPNHKFTVNVVRNL+QKTHWRIKTHL ISHLDVNK+N+IVADMRKVLAKNPQVEQQK
Sbjct  335  AVHIPNHKFTVNVVRNLSQKTHWRIKTHLGISHLDVNKVNSIVADMRKVLAKNPQVEQQK  394

Query  181  LHRRVFLDNIDRENQALLIMVSCFVKTSHFEEYLRVKEVILLDLLRVISHHRARLATPIR  360
            LHRRVFL+NI+ ENQALLI VSCFVKTSHFEEYL VKE I+LDLL+VI HHRARLATPIR
Sbjct  395  LHRRVFLENINPENQALLIFVSCFVKTSHFEEYLCVKETIMLDLLKVIRHHRARLATPIR  454

Query  361  TVQKIYKEADVDEVPLADSVMTVNRA-NHPFLLIEPSYKINNSSEDKTKAATPPRPNQEK  537
            TVQKIY +AD++ +P  DS      A   P L IEP YKI N  E K       R +  +
Sbjct  455  TVQKIYNDADMENIPYGDSFFDTGTAPKRPLLFIEPPYKIINGEERKKTDGRSVRGSGGE  514

Query  538  DGKSEVQ  558
            DGK+ V+
Sbjct  515  DGKATVR  521



>ref|XP_004250148.1| PREDICTED: mechanosensitive ion channel protein 2, chloroplastic-like 
[Solanum lycopersicum]
Length=754

 Score =   280 bits (716),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 138/182 (76%), Positives = 153/182 (84%), Gaps = 3/182 (2%)
 Frame = +1

Query  1    AIHIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQVEQQK  180
            AIHIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLDV+KINNIVADMRKVLAKNPQVEQQ+
Sbjct  337  AIHIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLDVSKINNIVADMRKVLAKNPQVEQQR  396

Query  181  LHRRVFLDNIDRENQALLIMVSCFVKTSHFEEYLRVKEVILLDLLRVISHHRARLATPIR  360
            LHRRVFL+N++ ENQALLI++SCFVKTSHFEEYL VKE ILLDLLRVI HHRARLATPIR
Sbjct  397  LHRRVFLENVNPENQALLILISCFVKTSHFEEYLCVKEAILLDLLRVIRHHRARLATPIR  456

Query  361  TVQKIYKEADVDEVPLADSVMTVNRANHPFLLIEPSYKINNSSEDKTKAATPPRPNQEKD  540
            TVQKIY +AD+D +    +      +  P LLIEPSYK+N   ED+TK   P R N E+D
Sbjct  457  TVQKIYSDADLDNMTYDSAFSRGAASTRPLLLIEPSYKVNG--EDRTK-GRPIRVNGEED  513

Query  541  GK  546
             K
Sbjct  514  TK  515



>ref|XP_010523311.1| PREDICTED: mechanosensitive ion channel protein 2, chloroplastic-like 
[Tarenaya hassleriana]
Length=544

 Score =   275 bits (702),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 130/171 (76%), Positives = 149/171 (87%), Gaps = 4/171 (2%)
 Frame = +1

Query  1    AIHIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQVEQQK  180
            A+HIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLDV+KINNIVADMRKVLAKNPQVEQQ+
Sbjct  212  AVHIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLDVSKINNIVADMRKVLAKNPQVEQQR  271

Query  181  LHRRVFLDNIDRENQALLIMVSCFVKTSHFEEYLRVKEVILLDLLRVISHHRARLATPIR  360
            LHRRVFLDN+D ENQALLI++SCFVKTSH EEYL VKE I+LDLLRVISHHRARLATPIR
Sbjct  272  LHRRVFLDNVDPENQALLILISCFVKTSHHEEYLCVKEAIMLDLLRVISHHRARLATPIR  331

Query  361  TVQKIYKEADVDEVPLADSVMTVN--RANHPFLLIEPSYKINNSSEDKTKA  507
            T++K+Y ++D++  P  DS+       +  P LLIEPSYKIN   ED++K+
Sbjct  332  TIRKMYSDSDLENPPFGDSIYNQGGVSSRRPLLLIEPSYKING--EDRSKS  380



>ref|XP_010938974.1| PREDICTED: mechanosensitive ion channel protein 3, chloroplastic-like 
isoform X1 [Elaeis guineensis]
Length=694

 Score =   278 bits (712),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 154/291 (53%), Positives = 196/291 (67%), Gaps = 25/291 (9%)
 Frame = +1

Query  1    AIHIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLDVNKIN--------NIVADMRKVLAK  156
            A+HIPNHKFTVNVVRNL+QKTHWRIKTHLAISHLD++KIN        NIVADMRKVLAK
Sbjct  333  AVHIPNHKFTVNVVRNLSQKTHWRIKTHLAISHLDISKINPSHAFLEQNIVADMRKVLAK  392

Query  157  NPQVEQQKLHRRVFLDNIDRENQALLIMVSCFVKTSHFEEYLRVKEVILLDLLRVISHHR  336
            N Q+EQQ+LHRRVFL+NI+ ENQALLI++SCFVKTSHFEEYL VKE +LLDLLRVISHHR
Sbjct  393  NSQIEQQRLHRRVFLENINPENQALLILISCFVKTSHFEEYLCVKEAVLLDLLRVISHHR  452

Query  337  ARLATPIRTVQKIYKEADVDEVPLADSVMT--VNRANHPFLLIEPSYKINNSSEDKTKAA  510
            ARLATPIRTVQKIY +AD++ +P +++++T     AN PFLLIEPS +IN   + K + +
Sbjct  453  ARLATPIRTVQKIYGDADMENIPYSETILTRSATAANRPFLLIEPSPRINGDDKAKPRGS  512

Query  511  TPPRPNQEKDGKSEVQTTASKAVDASPPIVDG---------NRIDTRgssgssTDTEPGV  663
               R N+E++ K+   +       +   I++          N  D+R  S  +       
Sbjct  513  ---RTNEEQNSKATAASGPRATSSSEGAILNNSDKQLQKKKNSGDSRSKSNKADPATAPS  569

Query  664  ATSELDGKMPNTGSVQSKNERQQVDKVVPGEVDAPSAVSQAKQDGER-PTT  813
              S+L+  + + GS     E     + V  +VD  S V  AK +GE+ PTT
Sbjct  570  LNSQLE-SLDSVGSTSKSGENPLSSEAVTEQVDGTSPV-HAKNEGEKVPTT  618



>ref|XP_009122047.1| PREDICTED: mechanosensitive ion channel protein 2, chloroplastic 
[Brassica rapa]
 ref|XP_009122048.1| PREDICTED: mechanosensitive ion channel protein 2, chloroplastic 
[Brassica rapa]
Length=679

 Score =   277 bits (708),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 150/257 (58%), Positives = 180/257 (70%), Gaps = 16/257 (6%)
 Frame = +1

Query  1    AIHIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQVEQQK  180
            AIHIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQVEQQ+
Sbjct  334  AIHIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQVEQQR  393

Query  181  LHRRVFLDNIDRENQALLIMVSCFVKTSHFEEYLRVKEVILLDLLRVISHHRARLATPIR  360
            LHRR+FL+N++ ENQAL+I++SCFVKTSHFEEYL VKE ILLDLLRVISHHRARLATPIR
Sbjct  394  LHRRIFLENVNPENQALVILISCFVKTSHFEEYLCVKEAILLDLLRVISHHRARLATPIR  453

Query  361  TVQKIYKEADVDEVPLADSVMTVNR--ANHPFLLIEPSYKINNSSEDKTK----AATPPR  522
            T++K+Y +AD++  P  +S+       +  P +LIEPSYKI  S EDK+K    A+ P  
Sbjct  454  TIRKMYTDADMENAPFGESMYGPGGVASRRPLMLIEPSYKI--SGEDKSKSQNRASKPTT  511

Query  523  PNQEKDGKSEVQTTASKAVDASPPIVDGNRIDTRgssgssTDTEP-----GVA--TSELD  681
              QE    S  ++  +   D    +  G   DT  +      T+P      VA   +E  
Sbjct  512  AEQENKAPSSPKSKETPTPDPKENVKAGES-DTNKTPDEKPGTKPVSKPATVANDATEAS  570

Query  682  GKMPNTGSVQSKNERQQ  732
            GK   +G    KN+ Q+
Sbjct  571  GKAKRSGGTTPKNDTQK  587



>ref|XP_010453075.1| PREDICTED: mechanosensitive ion channel protein 2, chloroplastic 
isoform X1 [Camelina sativa]
 ref|XP_010453076.1| PREDICTED: mechanosensitive ion channel protein 2, chloroplastic 
isoform X1 [Camelina sativa]
Length=677

 Score =   276 bits (706),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 140/203 (69%), Positives = 157/203 (77%), Gaps = 13/203 (6%)
 Frame = +1

Query  1    AIHIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQVEQQK  180
            AIHIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNP VEQQ+
Sbjct  336  AIHIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPMVEQQR  395

Query  181  LHRRVFLDNIDRENQALLIMVSCFVKTSHFEEYLRVKEVILLDLLRVISHHRARLATPIR  360
            LHRRVFL+N+  ENQAL I++SCFVKT H EEYL VKE ILLDLLRVISHHRARLATPIR
Sbjct  396  LHRRVFLENVIPENQALSILISCFVKTCHHEEYLGVKEAILLDLLRVISHHRARLATPIR  455

Query  361  TVQKIYKEADVDEVPLADSVMTVNRAN--HPFLLIEPSYKINNSSEDKTKA---ATPPRP  525
            T++K+Y EADV+  P  +S+          P +LIEPSYKIN   EDK+K+   A+ P  
Sbjct  456  TIRKMYTEADVENAPFGESMYGPGGVGSRRPLMLIEPSYKING--EDKSKSQNRASKPTA  513

Query  526  NQEKDGKSEVQTTASKAVDASPP  594
             QE  G S       K+ + SPP
Sbjct  514  EQENKGSSP------KSKETSPP  530



>ref|XP_010453078.1| PREDICTED: mechanosensitive ion channel protein 2, chloroplastic 
isoform X2 [Camelina sativa]
Length=676

 Score =   276 bits (706),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 140/203 (69%), Positives = 157/203 (77%), Gaps = 13/203 (6%)
 Frame = +1

Query  1    AIHIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQVEQQK  180
            AIHIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNP VEQQ+
Sbjct  335  AIHIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPMVEQQR  394

Query  181  LHRRVFLDNIDRENQALLIMVSCFVKTSHFEEYLRVKEVILLDLLRVISHHRARLATPIR  360
            LHRRVFL+N+  ENQAL I++SCFVKT H EEYL VKE ILLDLLRVISHHRARLATPIR
Sbjct  395  LHRRVFLENVIPENQALSILISCFVKTCHHEEYLGVKEAILLDLLRVISHHRARLATPIR  454

Query  361  TVQKIYKEADVDEVPLADSVMTVNRAN--HPFLLIEPSYKINNSSEDKTKA---ATPPRP  525
            T++K+Y EADV+  P  +S+          P +LIEPSYKIN   EDK+K+   A+ P  
Sbjct  455  TIRKMYTEADVENAPFGESMYGPGGVGSRRPLMLIEPSYKING--EDKSKSQNRASKPTA  512

Query  526  NQEKDGKSEVQTTASKAVDASPP  594
             QE  G S       K+ + SPP
Sbjct  513  EQENKGSSP------KSKETSPP  529



>ref|XP_002873462.1| hypothetical protein ARALYDRAFT_909005 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH49721.1| hypothetical protein ARALYDRAFT_909005 [Arabidopsis lyrata subsp. 
lyrata]
Length=673

 Score =   276 bits (705),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 134/186 (72%), Positives = 153/186 (82%), Gaps = 5/186 (3%)
 Frame = +1

Query  1    AIHIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQVEQQK  180
            AIHIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNP VEQQ+
Sbjct  335  AIHIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPMVEQQR  394

Query  181  LHRRVFLDNIDRENQALLIMVSCFVKTSHFEEYLRVKEVILLDLLRVISHHRARLATPIR  360
            LHRRVFL+N+  ENQAL I++SCFVKTSH EEYL VKE ILLDLLRVISHHRARLATPIR
Sbjct  395  LHRRVFLENVIPENQALSILISCFVKTSHHEEYLGVKEAILLDLLRVISHHRARLATPIR  454

Query  361  TVQKIYKEADVDEVPLADSVMTVNRANHPFLLIEPSYKINNSSEDKTKA---ATPPRPNQ  531
            T++K+Y +AD++  P  +S+     +  P +LIEP+YKIN   EDK+K+   A+ P   Q
Sbjct  455  TIRKMYTDADMENAPFGESMYGGVTSRRPLMLIEPAYKING--EDKSKSQNRASKPTSEQ  512

Query  532  EKDGKS  549
            E  G S
Sbjct  513  ENKGSS  518



>emb|CAN78779.1| hypothetical protein VITISV_029753 [Vitis vinifera]
Length=738

 Score =   276 bits (707),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 172/324 (53%), Positives = 200/324 (62%), Gaps = 56/324 (17%)
 Frame = +1

Query  1    AIHIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQVEQQK  180
            A+HIPNHKFTVNVVRNL+QKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQVEQQ+
Sbjct  349  AVHIPNHKFTVNVVRNLSQKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQVEQQR  408

Query  181  LHRRVFLDNIDRENQALLIMVSCFVKTSHFEEYLRVK---------------EVILLDLL  315
            LHRRVFLD ID ENQALLI+VSCFVKT  FEEYL VK               E ILLDLL
Sbjct  409  LHRRVFLDYIDPENQALLILVSCFVKTPRFEEYLCVKYLERLRKINQCLMNQEAILLDLL  468

Query  316  RVISHHRARLATPIRTVQKIYKEAD--VDEVPLADSVMTVNR--ANHPFLLIEPSYKINN  483
            RVISHH+ARLATPIRTVQK Y  AD  ++ +P AD + T +   AN P LLIEPSYK+N 
Sbjct  469  RVISHHQARLATPIRTVQKEYSMADMEMENIPFADPIFTRSSAAANRPLLLIEPSYKMNG  528

Query  484  SSEDKTKAATPPRP-NQEKDGKSEVQTTASKAVDA---SPPIVDGNRIDTRgssgssTDT  651
              +DKTKA+T     N+EKD   +  +T+    DA   +  I+D    D   ++  S  +
Sbjct  529  --DDKTKASTGSACQNEEKDANIDASSTSESKPDAKAGASSILDSTTDDNVAATSISNSS  586

Query  652  EPG--VATSELDGKMPNT---GSVQSKNERQQVDKVV-----------------------  747
                  ATS  D K+ N    GS Q+  E QQ +  +                       
Sbjct  587  TNSKVSATSISDPKIQNMVTDGSTQNNYEEQQSEASMEKVREDINPGGSAFEKPSLNFPE  646

Query  748  --PGEVDA-PSAVSQAKQDGERPT  810
               G+ D  PSA   AKQDG R +
Sbjct  647  SGAGKADGLPSATPLAKQDGNRAS  670



>ref|NP_001078567.1| mechanosensitive ion channel protein 2 [Arabidopsis thaliana]
 dbj|BAH20174.1| AT5G10490 [Arabidopsis thaliana]
 gb|AED91552.1| mechanosensitive ion channel protein 2 [Arabidopsis thaliana]
Length=645

 Score =   274 bits (700),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 134/184 (73%), Positives = 150/184 (82%), Gaps = 5/184 (3%)
 Frame = +1

Query  1    AIHIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQVEQQK  180
            AIHIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNP VEQQ+
Sbjct  307  AIHIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPMVEQQR  366

Query  181  LHRRVFLDNIDRENQALLIMVSCFVKTSHFEEYLRVKEVILLDLLRVISHHRARLATPIR  360
            LHRRVFL+N+  ENQAL I++SCFVKTSH EEYL VKE ILLDLLRVISHHRARLATPIR
Sbjct  367  LHRRVFLENVIPENQALSILISCFVKTSHHEEYLGVKEAILLDLLRVISHHRARLATPIR  426

Query  361  TVQKIYKEADVDEVPLADSVMTVNRANHPFLLIEPSYKINNSSEDKTKA---ATPPRPNQ  531
            T++K+Y E DV+  P  +S+     +  P +LIEP+YKIN   EDK+K+   A  P   Q
Sbjct  427  TIRKMYTETDVENTPFGESMYGGVTSRRPLMLIEPAYKING--EDKSKSQNRAAKPTAEQ  484

Query  532  EKDG  543
            E  G
Sbjct  485  ENKG  488



>ref|XP_010422837.1| PREDICTED: mechanosensitive ion channel protein 2, chloroplastic-like 
isoform X2 [Camelina sativa]
Length=676

 Score =   274 bits (700),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 139/203 (68%), Positives = 157/203 (77%), Gaps = 13/203 (6%)
 Frame = +1

Query  1    AIHIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQVEQQK  180
            AIHIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNP VEQQ+
Sbjct  335  AIHIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPMVEQQR  394

Query  181  LHRRVFLDNIDRENQALLIMVSCFVKTSHFEEYLRVKEVILLDLLRVISHHRARLATPIR  360
            LHRRVFL+N+  ENQAL I++SCFVKT H EEYL VKE ILLDLLRVISHHRARLATPIR
Sbjct  395  LHRRVFLENVIPENQALSILISCFVKTCHHEEYLGVKEAILLDLLRVISHHRARLATPIR  454

Query  361  TVQKIYKEADVDEVPLADSVMTVNRAN--HPFLLIEPSYKINNSSEDKTKA---ATPPRP  525
            T++K+Y +ADV+  P  +S+          P +LIEPSYKIN   EDK+K+   A+ P  
Sbjct  455  TIRKMYTDADVENAPFGESMYGPGGVGSRRPLMLIEPSYKING--EDKSKSQNRASKPTA  512

Query  526  NQEKDGKSEVQTTASKAVDASPP  594
             QE  G S       K+ + SPP
Sbjct  513  EQENKGSS------PKSKETSPP  529



>ref|XP_010523306.1| PREDICTED: mechanosensitive ion channel protein 2, chloroplastic-like 
[Tarenaya hassleriana]
 ref|XP_010523307.1| PREDICTED: mechanosensitive ion channel protein 2, chloroplastic-like 
[Tarenaya hassleriana]
Length=675

 Score =   274 bits (700),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 130/171 (76%), Positives = 149/171 (87%), Gaps = 4/171 (2%)
 Frame = +1

Query  1    AIHIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQVEQQK  180
            A+HIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLDV+KINNIVADMRKVLAKNPQVEQQ+
Sbjct  343  AVHIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLDVSKINNIVADMRKVLAKNPQVEQQR  402

Query  181  LHRRVFLDNIDRENQALLIMVSCFVKTSHFEEYLRVKEVILLDLLRVISHHRARLATPIR  360
            LHRRVFLDN+D ENQALLI++SCFVKTSH EEYL VKE I+LDLLRVISHHRARLATPIR
Sbjct  403  LHRRVFLDNVDPENQALLILISCFVKTSHHEEYLCVKEAIMLDLLRVISHHRARLATPIR  462

Query  361  TVQKIYKEADVDEVPLADSVMTVN--RANHPFLLIEPSYKINNSSEDKTKA  507
            T++K+Y ++D++  P  DS+       +  P LLIEPSYKIN   ED++K+
Sbjct  463  TIRKMYSDSDLENPPFGDSIYNQGGVSSRRPLLLIEPSYKING--EDRSKS  511



>ref|NP_568230.2| mechanosensitive ion channel protein 2 [Arabidopsis thaliana]
 sp|Q56X46.1|MSL2_ARATH RecName: Full=Mechanosensitive ion channel protein 2, chloroplastic; 
AltName: Full=Mechanosensitive channel of small conductance-like 
2; AltName: Full=MscS-Like protein 2; Flags: Precursor 
[Arabidopsis thaliana]
 dbj|BAD94053.1| hypothetical protein [Arabidopsis thaliana]
 dbj|BAF01838.1| hypothetical protein [Arabidopsis thaliana]
 gb|AED91551.1| mechanosensitive ion channel protein 2 [Arabidopsis thaliana]
Length=673

 Score =   274 bits (700),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 134/184 (73%), Positives = 150/184 (82%), Gaps = 5/184 (3%)
 Frame = +1

Query  1    AIHIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQVEQQK  180
            AIHIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNP VEQQ+
Sbjct  335  AIHIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPMVEQQR  394

Query  181  LHRRVFLDNIDRENQALLIMVSCFVKTSHFEEYLRVKEVILLDLLRVISHHRARLATPIR  360
            LHRRVFL+N+  ENQAL I++SCFVKTSH EEYL VKE ILLDLLRVISHHRARLATPIR
Sbjct  395  LHRRVFLENVIPENQALSILISCFVKTSHHEEYLGVKEAILLDLLRVISHHRARLATPIR  454

Query  361  TVQKIYKEADVDEVPLADSVMTVNRANHPFLLIEPSYKINNSSEDKTKA---ATPPRPNQ  531
            T++K+Y E DV+  P  +S+     +  P +LIEP+YKIN   EDK+K+   A  P   Q
Sbjct  455  TIRKMYTETDVENTPFGESMYGGVTSRRPLMLIEPAYKING--EDKSKSQNRAAKPTAEQ  512

Query  532  EKDG  543
            E  G
Sbjct  513  ENKG  516



>ref|XP_010422836.1| PREDICTED: mechanosensitive ion channel protein 2, chloroplastic-like 
isoform X1 [Camelina sativa]
Length=677

 Score =   274 bits (700),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 139/203 (68%), Positives = 157/203 (77%), Gaps = 13/203 (6%)
 Frame = +1

Query  1    AIHIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQVEQQK  180
            AIHIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNP VEQQ+
Sbjct  336  AIHIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPMVEQQR  395

Query  181  LHRRVFLDNIDRENQALLIMVSCFVKTSHFEEYLRVKEVILLDLLRVISHHRARLATPIR  360
            LHRRVFL+N+  ENQAL I++SCFVKT H EEYL VKE ILLDLLRVISHHRARLATPIR
Sbjct  396  LHRRVFLENVIPENQALSILISCFVKTCHHEEYLGVKEAILLDLLRVISHHRARLATPIR  455

Query  361  TVQKIYKEADVDEVPLADSVMTVNRAN--HPFLLIEPSYKINNSSEDKTKA---ATPPRP  525
            T++K+Y +ADV+  P  +S+          P +LIEPSYKIN   EDK+K+   A+ P  
Sbjct  456  TIRKMYTDADVENAPFGESMYGPGGVGSRRPLMLIEPSYKING--EDKSKSQNRASKPTA  513

Query  526  NQEKDGKSEVQTTASKAVDASPP  594
             QE  G S       K+ + SPP
Sbjct  514  EQENKGSS------PKSKETSPP  530



>emb|CDX69828.1| BnaA10g21770D [Brassica napus]
Length=678

 Score =   274 bits (700),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 151/258 (59%), Positives = 181/258 (70%), Gaps = 18/258 (7%)
 Frame = +1

Query  1    AIHIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQVEQQK  180
            AIHIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQVEQQ+
Sbjct  334  AIHIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQVEQQR  393

Query  181  LHRRVFLDNIDRENQALLIMVSCFVKTSHFEEYLRVKEVILLDLLRVISHHRARLATPIR  360
            LHRR+FL+N++ ENQAL+I++SCFVKTSHFEEYL VKE ILLDLLRVISHHRARLATPIR
Sbjct  394  LHRRIFLENVNPENQALVILISCFVKTSHFEEYLCVKEAILLDLLRVISHHRARLATPIR  453

Query  361  TVQKIYKEADVDEVPLADSVM---TVNRANHPFLLIEPSYKINNSSEDKTK----AATPP  519
            T++K+Y +AD++  P  +S+     V    H  +LIEPSYKIN   EDK+K    A+ P 
Sbjct  454  TIRKMYTDADMENAPFGESMYGPGGVASRRH-LMLIEPSYKING--EDKSKSQNRASKPT  510

Query  520  RPNQEKDGKSEVQTTASKAVDASPPIVDGNRIDTRgssgssTDTEP-----GVA--TSEL  678
               QE    S  ++  +   D    +  G   DT  +      T+P      VA  ++E 
Sbjct  511  TAEQENKAPSTPKSKETPTPDPKENVKAGES-DTNKTPDEKPGTKPVSKPATVANDSTEA  569

Query  679  DGKMPNTGSVQSKNERQQ  732
             GK   +G    KN+ Q+
Sbjct  570  SGKAKRSGGTTPKNDTQK  587



>ref|XP_010511097.1| PREDICTED: mechanosensitive ion channel protein 3, chloroplastic-like 
[Camelina sativa]
Length=372

 Score =   265 bits (678),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 129/187 (69%), Positives = 154/187 (82%), Gaps = 6/187 (3%)
 Frame = +1

Query  1    AIHIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQVEQQK  180
            A+HIPNH+F+VN+VRNLTQKTHWRIKTHLAISHLDV+KINNIVADMRKVL+KNPQ+EQQK
Sbjct  45   AVHIPNHQFSVNIVRNLTQKTHWRIKTHLAISHLDVSKINNIVADMRKVLSKNPQIEQQK  104

Query  181  LHRRVFLDNIDRENQALLIMVSCFVKTSHFEEYLRVKEVILLDLLRVISHHRARLATPIR  360
            +HRRVFLDNID ENQAL I++SCFVKTS FEEYL VKE +LLDLL VI HH ARLATPIR
Sbjct  105  IHRRVFLDNIDPENQALRILISCFVKTSRFEEYLCVKEAVLLDLLTVIRHHGARLATPIR  164

Query  361  TVQKIYKEADVDEVPLADSVMTVNRANHPFLLIEPSYKINNSSEDKTKAATP---PRPNQ  531
            TVQ++  EA+VD    +D +      N   +LIEPSYKIN  S+D TK+++P   P+ ++
Sbjct  165  TVQRMRNEAEVDSAGFSDIIFNQAAMNRRLMLIEPSYKIN--SDDNTKSSSPNSMPK-SE  221

Query  532  EKDGKSE  552
            EKD + E
Sbjct  222  EKDLQEE  228



>ref|NP_001190278.1| mechanosensitive ion channel protein 2 [Arabidopsis thaliana]
 gb|AED91553.1| mechanosensitive ion channel protein 2 [Arabidopsis thaliana]
Length=671

 Score =   274 bits (700),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 140/214 (65%), Positives = 165/214 (77%), Gaps = 11/214 (5%)
 Frame = +1

Query  1    AIHIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQVEQQK  180
            AIHIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNP VEQQ+
Sbjct  333  AIHIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPMVEQQR  392

Query  181  LHRRVFLDNIDRENQALLIMVSCFVKTSHFEEYLRVKEVILLDLLRVISHHRARLATPIR  360
            LHRRVFL+N+  ENQAL I++SCFVKTSH EEYL VKE ILLDLLRVISHHRARLATPIR
Sbjct  393  LHRRVFLENVIPENQALSILISCFVKTSHHEEYLGVKEAILLDLLRVISHHRARLATPIR  452

Query  361  TVQKIYKEADVDEVPLADSVMTVNRANHPFLLIEPSYKINNSSEDKTKA---ATPPRPNQ  531
            T++K+Y E DV+  P  +S+     +  P +LIEP+YKIN   EDK+K+   A  P   Q
Sbjct  453  TIRKMYTETDVENTPFGESMYGGVTSRRPLMLIEPAYKING--EDKSKSQNRAAKPTAEQ  510

Query  532  EKDGKS-EVQTTASKAVDAS-----PPIVDGNRI  615
            E  G + + + T+S  + A+      P+ D N++
Sbjct  511  ENKGSNPKSKETSSPDLKANVKVGESPVSDTNKV  544



>ref|XP_011021849.1| PREDICTED: mechanosensitive ion channel protein 2, chloroplastic 
[Populus euphratica]
Length=753

 Score =   275 bits (704),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 148/239 (62%), Positives = 174/239 (73%), Gaps = 18/239 (8%)
 Frame = +1

Query  1    AIHIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQVEQQK  180
            A+HIPNHKFTVNVVRNL+QKTHWRIKTHLAISHLD +KINNIVADMRKVLAKNPQVEQQ+
Sbjct  338  AVHIPNHKFTVNVVRNLSQKTHWRIKTHLAISHLDAHKINNIVADMRKVLAKNPQVEQQR  397

Query  181  LHRRVFLDNIDRENQALLIMVSCFVKTSHFEEYLRVKEVILLDLLRVISHHRARLATPIR  360
            LHRR+FLDNI+ ENQALLI+VSCFVKTSH EEYL VKE +LLDLLRVISHHRARLATPIR
Sbjct  398  LHRRIFLDNINPENQALLILVSCFVKTSHHEEYLCVKEAVLLDLLRVISHHRARLATPIR  457

Query  361  TVQKIY---KEADVDEVPLADSVMTVN--RANHPFLLIEPSYKINNSSEDKTKA-ATPPR  522
            T+QKIY    + D++ VP  DS+       +  P LLIEPSY+IN   EDK K+ A   R
Sbjct  458  TIQKIYSDTSDTDMENVPFTDSIYNHGGVASKRPLLLIEPSYRING--EDKAKSQARSGR  515

Query  523  PNQEKDGKSEVQTTASKAVDASPPIVDGNRIDTRgssgssTDTEPGVATSELDGKMPNT  699
               EKD K+  + T+      +       + DTR      +D++ G A S   G+ PN+
Sbjct  516  VTGEKDSKTTSRLTSDTKAGTN------TKSDTRAKETPKSDSK-GDANS---GETPNS  564



>ref|XP_002310309.2| hypothetical protein POPTR_0007s14270g [Populus trichocarpa]
 gb|EEE90759.2| hypothetical protein POPTR_0007s14270g [Populus trichocarpa]
Length=749

 Score =   275 bits (702),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 137/189 (72%), Positives = 154/189 (81%), Gaps = 8/189 (4%)
 Frame = +1

Query  1    AIHIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQVEQQK  180
            A+HIPNHKFTVNVVRNL+QKTHWRIKTHLAISHLD +KINNIVADMRKVLAKNPQVEQQ+
Sbjct  338  AVHIPNHKFTVNVVRNLSQKTHWRIKTHLAISHLDAHKINNIVADMRKVLAKNPQVEQQR  397

Query  181  LHRRVFLDNIDRENQALLIMVSCFVKTSHFEEYLRVKEVILLDLLRVISHHRARLATPIR  360
            LHRR+FLDNI+ ENQALLI+VSCFVKTSH EEYL VKE IL+DLLRVISHHRARLATPIR
Sbjct  398  LHRRIFLDNINPENQALLILVSCFVKTSHHEEYLCVKEAILMDLLRVISHHRARLATPIR  457

Query  361  TVQKIY---KEADVDEVPLADSVMTVN--RANHPFLLIEPSYKINNSSEDKTKA-ATPPR  522
            T+QKIY    + D++ VP  DS+       +  P LLIEPSY+IN   EDK K+ A   R
Sbjct  458  TIQKIYSDTSDTDIENVPFTDSIYNHGGVASKRPLLLIEPSYRING--EDKAKSQARSGR  515

Query  523  PNQEKDGKS  549
               EKD K+
Sbjct  516  VTGEKDSKT  524



>ref|XP_009414411.1| PREDICTED: mechanosensitive ion channel protein 3, chloroplastic-like 
[Musa acuminata subsp. malaccensis]
Length=683

 Score =   273 bits (698),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 137/196 (70%), Positives = 158/196 (81%), Gaps = 15/196 (8%)
 Frame = +1

Query  1    AIHIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQVEQQK  180
            A+HIPNHKFTV+VVRNL+QKTHWRIKTHLAISHLDVNKI+NIVADMRKVLAKNPQ+EQQ+
Sbjct  333  AVHIPNHKFTVSVVRNLSQKTHWRIKTHLAISHLDVNKISNIVADMRKVLAKNPQIEQQR  392

Query  181  LHRRVFLDNIDRENQALLIMVSCFVKTSHFEEYLRVKEVILLDLLRVISHHRARLATPIR  360
            LHRRVFLDNID ENQALLI+VSCFVKTSHFEEYL VKE ++LDLLRVISHHRARLATPIR
Sbjct  393  LHRRVFLDNIDPENQALLILVSCFVKTSHFEEYLCVKESVMLDLLRVISHHRARLATPIR  452

Query  361  TVQKIYKEADVDEVPLADSVMTVN-RANHPFLLIEPSYKINNS-----------SEDKT-  501
            TVQKIY + D++ VP A+S+   +  A+ PFLL++   +IN             SED+T 
Sbjct  453  TVQKIYGDPDIENVPFAESIFRHSAAASRPFLLLDSQSRINGDEKTKPRQTPHVSEDQTN  512

Query  502  KAATP--PRPNQEKDG  543
            K+AT   P P    DG
Sbjct  513  KSATTVDPNPTSSSDG  528



>ref|XP_010680344.1| PREDICTED: mechanosensitive ion channel protein 2, chloroplastic 
isoform X2 [Beta vulgaris subsp. vulgaris]
Length=621

 Score =   271 bits (693),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 140/199 (70%), Positives = 159/199 (80%), Gaps = 5/199 (3%)
 Frame = +1

Query  1    AIHIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQVEQQK  180
            A+HIPNHKFTVNVVRNLTQK+HWRIKTHLAISHLDV+KINNIVADMRKVLAKNPQVEQQK
Sbjct  246  AVHIPNHKFTVNVVRNLTQKSHWRIKTHLAISHLDVSKINNIVADMRKVLAKNPQVEQQK  305

Query  181  LHRRVFLDNIDRENQALLIMVSCFVKTSHFEEYLRVKEVILLDLLRVISHHRARLATPIR  360
            LHRRVFL+NID ENQAL+I++SCFVKTS  EEYL VKE ILLDLLRVISHHRARLATPIR
Sbjct  306  LHRRVFLENIDPENQALMILISCFVKTSRHEEYLCVKEAILLDLLRVISHHRARLATPIR  365

Query  361  TVQKIYKEADVDEVPLADSVMTVN--RANHPFLLIEPSYKINNSSEDKTKA-ATPPRPNQ  531
            T+QK Y E D+D +  + S  T     +  P LLIEP YKIN   EDK+K+ A   RP+ 
Sbjct  366  TIQKFYNEPDLDSMSFSSSFFTRGGPASKRPMLLIEPPYKING--EDKSKSQARAVRPSA  423

Query  532  EKDGKSEVQTTASKAVDAS  588
            E++ +   Q TA K  + S
Sbjct  424  EQESRVTGQPTADKKTNDS  442



>ref|XP_006399547.1| hypothetical protein EUTSA_v10012873mg [Eutrema salsugineum]
 gb|ESQ41000.1| hypothetical protein EUTSA_v10012873mg [Eutrema salsugineum]
Length=678

 Score =   273 bits (697),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 132/188 (70%), Positives = 153/188 (81%), Gaps = 7/188 (4%)
 Frame = +1

Query  1    AIHIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQVEQQK  180
            AIHIPNHKFTVNVVRNLTQKTHWRIKTHLA+SHLDVNKINNIVADMRKVLAKNP VEQQ+
Sbjct  335  AIHIPNHKFTVNVVRNLTQKTHWRIKTHLAVSHLDVNKINNIVADMRKVLAKNPHVEQQR  394

Query  181  LHRRVFLDNIDRENQALLIMVSCFVKTSHFEEYLRVKEVILLDLLRVISHHRARLATPIR  360
            LHRR+FL+N++ ENQAL+I++SCFVKTSHFEEYL VKE ILLDLLRVISHHRARLATPIR
Sbjct  395  LHRRIFLENVNPENQALVILISCFVKTSHFEEYLCVKEAILLDLLRVISHHRARLATPIR  454

Query  361  TVQKIYKEADVDEVPLADSVMTVNR--ANHPFLLIEPSYKINNSSEDKTKA---ATPPRP  525
            T++K+Y +AD++  P  +S+       +    +LIEPSYKIN   EDK K+   A+    
Sbjct  455  TIRKMYTDADMENAPFGESMYGPGGVASRRSLMLIEPSYKING--EDKWKSQNRASKTTA  512

Query  526  NQEKDGKS  549
             QE  G S
Sbjct  513  EQENKGSS  520



>gb|ERN14408.1| hypothetical protein AMTR_s00033p00237950 [Amborella trichopoda]
Length=778

 Score =   274 bits (700),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 145/215 (67%), Positives = 166/215 (77%), Gaps = 20/215 (9%)
 Frame = +1

Query  1    AIHIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQVEQQK  180
            A+HIPNHKFTVNVVRNL+QKTHWRIKTHLAISHLDVNKI+NIVADMRKVLAK+PQVEQQ+
Sbjct  313  ALHIPNHKFTVNVVRNLSQKTHWRIKTHLAISHLDVNKISNIVADMRKVLAKSPQVEQQR  372

Query  181  LHRRVFLDNIDRENQALLIMVSCFVKTSHFEEYLRVKEVILLDLLRVISHHRARLATPIR  360
            LHRR+FLDNID ENQALLIMVSCFVKTSHFEEYL VKE ILLDLLRVISHHRARLATPIR
Sbjct  373  LHRRIFLDNIDPENQALLIMVSCFVKTSHFEEYLCVKEAILLDLLRVISHHRARLATPIR  432

Query  361  TVQKIYKEADVDEVPLADSVMTVNRA---NHPFLLIEPSY-------------KINNSSE  492
            TVQK Y +AD++ VP ++SV   NR    + PFLL+EPS              K+++S+ 
Sbjct  433  TVQKYYGDADLENVPFSESVF--NRGGVHSRPFLLLEPSKPKSSSSAGSTDPNKVSSSAA  490

Query  493  --DKTKAATPPRPNQEKDGKSEVQTTASKAVDASP  591
              D +KA++    +  K   S V   ASKA   SP
Sbjct  491  PIDASKASSAGPIDASKASPSVVPMDASKASSVSP  525



>gb|EYU30934.1| hypothetical protein MIMGU_mgv1a002338mg [Erythranthe guttata]
Length=686

 Score =   271 bits (693),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 142/194 (73%), Positives = 154/194 (79%), Gaps = 20/194 (10%)
 Frame = +1

Query  1    AIHIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQVEQQK  180
            A+HIPNHKFT+NVVRNLTQKTHWRIKTHLAISHLDV+KINNIVADMRKVLAKNPQVEQQK
Sbjct  334  AVHIPNHKFTMNVVRNLTQKTHWRIKTHLAISHLDVSKINNIVADMRKVLAKNPQVEQQK  393

Query  181  LHRRVFLDNIDRENQALLIMVSCFVKTSHFEEYLRVKEVILLDLLRVISHHRARLATPIR  360
            LHRRVFLDNI+ ENQAL+I+VSCFVKTSHFEEYL VKE ILLDLLRVI HHRARLATPIR
Sbjct  394  LHRRVFLDNINPENQALMILVSCFVKTSHFEEYLCVKETILLDLLRVIRHHRARLATPIR  453

Query  361  TVQKIYKEADVDEVPLA-DSVMTVNR----ANHPFLLIEPSYKINNSSEDKTKAAT-PPR  522
            T          D VP + DS+   NR    +N P LLIEPSYKIN   EDKTK  + PPR
Sbjct  454  T----------DNVPFSPDSIF--NRGGPVSNRPLLLIEPSYKIN--GEDKTKTQSRPPR  499

Query  523  PNQEKDGKSEVQTT  564
             N E+D      +T
Sbjct  500  ANGEEDSNKATTST  513



>ref|XP_011626432.1| PREDICTED: mechanosensitive ion channel protein 2, chloroplastic 
[Amborella trichopoda]
Length=817

 Score =   273 bits (698),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 145/215 (67%), Positives = 166/215 (77%), Gaps = 20/215 (9%)
 Frame = +1

Query  1    AIHIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQVEQQK  180
            A+HIPNHKFTVNVVRNL+QKTHWRIKTHLAISHLDVNKI+NIVADMRKVLAK+PQVEQQ+
Sbjct  352  ALHIPNHKFTVNVVRNLSQKTHWRIKTHLAISHLDVNKISNIVADMRKVLAKSPQVEQQR  411

Query  181  LHRRVFLDNIDRENQALLIMVSCFVKTSHFEEYLRVKEVILLDLLRVISHHRARLATPIR  360
            LHRR+FLDNID ENQALLIMVSCFVKTSHFEEYL VKE ILLDLLRVISHHRARLATPIR
Sbjct  412  LHRRIFLDNIDPENQALLIMVSCFVKTSHFEEYLCVKEAILLDLLRVISHHRARLATPIR  471

Query  361  TVQKIYKEADVDEVPLADSVMTVNRA---NHPFLLIEPSY-------------KINNSSE  492
            TVQK Y +AD++ VP ++SV   NR    + PFLL+EPS              K+++S+ 
Sbjct  472  TVQKYYGDADLENVPFSESVF--NRGGVHSRPFLLLEPSKPKSSSSAGSTDPNKVSSSAA  529

Query  493  --DKTKAATPPRPNQEKDGKSEVQTTASKAVDASP  591
              D +KA++    +  K   S V   ASKA   SP
Sbjct  530  PIDASKASSAGPIDASKASPSVVPMDASKASSVSP  564



>ref|XP_010491722.1| PREDICTED: mechanosensitive ion channel protein 2, chloroplastic-like 
isoform X2 [Camelina sativa]
Length=678

 Score =   270 bits (691),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 133/188 (71%), Positives = 150/188 (80%), Gaps = 7/188 (4%)
 Frame = +1

Query  1    AIHIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQVEQQK  180
            AIHIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNP VEQQ+
Sbjct  335  AIHIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPMVEQQR  394

Query  181  LHRRVFLDNIDRENQALLIMVSCFVKTSHFEEYLRVKEVILLDLLRVISHHRARLATPIR  360
            LHRRVFL+N+  ENQAL I++SCFVKT H EEYL VKE ILLDLLRVISHHRARLATP+R
Sbjct  395  LHRRVFLENVIPENQALSILISCFVKTCHHEEYLGVKEAILLDLLRVISHHRARLATPLR  454

Query  361  TVQKIYKEADVDEVPLADSVMTVNRAN--HPFLLIEPSYKINNSSEDKTKA---ATPPRP  525
            T++++Y +ADV+  P  +S+          P +LIEPSYKIN   EDK K+   A+ P  
Sbjct  455  TIRRMYTDADVENAPFGESMYGPGGVGSRRPLMLIEPSYKING--EDKPKSQNRASKPTA  512

Query  526  NQEKDGKS  549
             QE  G S
Sbjct  513  EQENKGSS  520



>ref|XP_010491720.1| PREDICTED: mechanosensitive ion channel protein 2, chloroplastic-like 
isoform X1 [Camelina sativa]
 ref|XP_010491721.1| PREDICTED: mechanosensitive ion channel protein 2, chloroplastic-like 
isoform X1 [Camelina sativa]
Length=679

 Score =   270 bits (691),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 133/188 (71%), Positives = 150/188 (80%), Gaps = 7/188 (4%)
 Frame = +1

Query  1    AIHIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQVEQQK  180
            AIHIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNP VEQQ+
Sbjct  336  AIHIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPMVEQQR  395

Query  181  LHRRVFLDNIDRENQALLIMVSCFVKTSHFEEYLRVKEVILLDLLRVISHHRARLATPIR  360
            LHRRVFL+N+  ENQAL I++SCFVKT H EEYL VKE ILLDLLRVISHHRARLATP+R
Sbjct  396  LHRRVFLENVIPENQALSILISCFVKTCHHEEYLGVKEAILLDLLRVISHHRARLATPLR  455

Query  361  TVQKIYKEADVDEVPLADSVMTVNRAN--HPFLLIEPSYKINNSSEDKTKA---ATPPRP  525
            T++++Y +ADV+  P  +S+          P +LIEPSYKIN   EDK K+   A+ P  
Sbjct  456  TIRRMYTDADVENAPFGESMYGPGGVGSRRPLMLIEPSYKING--EDKPKSQNRASKPTA  513

Query  526  NQEKDGKS  549
             QE  G S
Sbjct  514  EQENKGSS  521



>ref|XP_010680343.1| PREDICTED: mechanosensitive ion channel protein 2, chloroplastic 
isoform X1 [Beta vulgaris subsp. vulgaris]
Length=710

 Score =   271 bits (692),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 140/199 (70%), Positives = 159/199 (80%), Gaps = 5/199 (3%)
 Frame = +1

Query  1    AIHIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQVEQQK  180
            A+HIPNHKFTVNVVRNLTQK+HWRIKTHLAISHLDV+KINNIVADMRKVLAKNPQVEQQK
Sbjct  335  AVHIPNHKFTVNVVRNLTQKSHWRIKTHLAISHLDVSKINNIVADMRKVLAKNPQVEQQK  394

Query  181  LHRRVFLDNIDRENQALLIMVSCFVKTSHFEEYLRVKEVILLDLLRVISHHRARLATPIR  360
            LHRRVFL+NID ENQAL+I++SCFVKTS  EEYL VKE ILLDLLRVISHHRARLATPIR
Sbjct  395  LHRRVFLENIDPENQALMILISCFVKTSRHEEYLCVKEAILLDLLRVISHHRARLATPIR  454

Query  361  TVQKIYKEADVDEVPLADSVMTVN--RANHPFLLIEPSYKINNSSEDKTKA-ATPPRPNQ  531
            T+QK Y E D+D +  + S  T     +  P LLIEP YKIN   EDK+K+ A   RP+ 
Sbjct  455  TIQKFYNEPDLDSMSFSSSFFTRGGPASKRPMLLIEPPYKING--EDKSKSQARAVRPSA  512

Query  532  EKDGKSEVQTTASKAVDAS  588
            E++ +   Q TA K  + S
Sbjct  513  EQESRVTGQPTADKKTNDS  531



>ref|XP_006289477.1| hypothetical protein CARUB_v10003006mg [Capsella rubella]
 gb|EOA22375.1| hypothetical protein CARUB_v10003006mg [Capsella rubella]
Length=676

 Score =   270 bits (690),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 136/216 (63%), Positives = 164/216 (76%), Gaps = 13/216 (6%)
 Frame = +1

Query  1    AIHIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQVEQQK  180
            AIHIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNP VEQQ+
Sbjct  336  AIHIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPMVEQQR  395

Query  181  LHRRVFLDNIDRENQALLIMVSCFVKTSHFEEYLRVKEVILLDLLRVISHHRARLATPIR  360
            LHRRVFL+N+  ENQAL I++SCFVKTSH EEYL VKE IL+DLLRVISHHRARLATPIR
Sbjct  396  LHRRVFLENVIPENQALSILISCFVKTSHHEEYLGVKEAILMDLLRVISHHRARLATPIR  455

Query  361  TVQKIYKEADVDEVPLADSVMTVNRAN--HPFLLIEPSYKINNSSEDKT--KAATPPRPN  528
            T++K+Y +AD++  P  +S+          P +LIEPSYKIN   + K+  +A+ P    
Sbjct  456  TIRKMYTDADLENAPFGESMYGPGGVGSRRPLMLIEPSYKINGEEKSKSQNRASKPTAEQ  515

Query  529  QEKDGKSEVQTTA-------SKAVDASPPIVDGNRI  615
            + KD   + + T+       +KAV+   P+ D N++
Sbjct  516  ENKDSGPKSKETSPPDLKENAKAVEL--PVSDTNKV  549



>ref|XP_008452178.1| PREDICTED: mechanosensitive ion channel protein 2, chloroplastic-like 
isoform X5 [Cucumis melo]
Length=588

 Score =   268 bits (684),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 126/184 (68%), Positives = 153/184 (83%), Gaps = 3/184 (2%)
 Frame = +1

Query  1    AIHIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQVEQQK  180
            A+HIPNH+FT+NVVRNL+QKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQVEQQ+
Sbjct  198  AVHIPNHQFTMNVVRNLSQKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQVEQQR  257

Query  181  LHRRVFLDNIDRENQALLIMVSCFVKTSHFEEYLRVKEVILLDLLRVISHHRARLATPIR  360
            LHRRVFL+N+D ENQALLI++SCFVKTSHFEEYL VKE I+LDLLRVI HH ARLATPIR
Sbjct  258  LHRRVFLENVDSENQALLILISCFVKTSHFEEYLCVKEAIILDLLRVIRHHGARLATPIR  317

Query  361  TVQKIYKEADVDEVPLADSVMTVNRA--NHPFLLIEPSYKINNSSEDKTKAATPPRPNQE  534
            T+QK++ ++D++ VP +DS+     A  N   L+IEP YK++     ++ + T  R   E
Sbjct  318  TMQKMHSDSDLESVPFSDSIFGHRGATLNRRMLMIEPPYKVHGEDRKQSHSRT-SRTTGE  376

Query  535  KDGK  546
            ++GK
Sbjct  377  QNGK  380



>emb|CBI19267.3| unnamed protein product [Vitis vinifera]
Length=565

 Score =   266 bits (681),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 134/192 (70%), Positives = 158/192 (82%), Gaps = 7/192 (4%)
 Frame = +1

Query  1    AIHIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQVEQQK  180
            A+H+PN+KFTVNVVRNL+Q+THWRIKT LAISHLDV+KINN+VADMRKVL+KNPQ+EQQ+
Sbjct  334  AVHVPNNKFTVNVVRNLSQRTHWRIKTQLAISHLDVDKINNVVADMRKVLSKNPQIEQQR  393

Query  181  LHRRVFLDNIDRENQALLIMVSCFVKTSHFEEYLRVKEVILLDLLRVISHHRARLATPIR  360
            LHRRVFLD ID ENQALLI+VSCFVKTS  EEYL VKE ILLDLLRV+SHH+ARLATPIR
Sbjct  394  LHRRVFLDYIDPENQALLILVSCFVKTSRIEEYLCVKEAILLDLLRVVSHHQARLATPIR  453

Query  361  TVQKIYKEAD--VDEVPLADSVMTVNR--ANHPFLLIEPSYKINNSSEDKTKAAT-PPRP  525
            TVQK Y  AD  ++ +P AD + T ++  AN P L IEPSYK+N   +DK KA+T   R 
Sbjct  454  TVQKEYGVADMEMENIPFADPIFTRSQAAANRPLLQIEPSYKMNG--DDKMKASTGSARR  511

Query  526  NQEKDGKSEVQT  561
            N+EKD K +  T
Sbjct  512  NKEKDAKIKANT  523



>emb|CAN78780.1| hypothetical protein VITISV_029754 [Vitis vinifera]
Length=560

 Score =   265 bits (677),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 158/311 (51%), Positives = 202/311 (65%), Gaps = 51/311 (16%)
 Frame = +1

Query  1    AIHIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQVEQQK  180
            A+H+PN+KFTVNVVRNL+Q+THWRIKT LAISHLDV+KINN+VADMRKVL+KNPQ+EQQ+
Sbjct  239  AVHVPNNKFTVNVVRNLSQRTHWRIKTQLAISHLDVDKINNVVADMRKVLSKNPQIEQQR  298

Query  181  LHRRVFLDNIDRENQALLIMVSCFVKTSHFEEYLRVKEVILLDLLRVISHHRARLATPIR  360
            LHRRVFLD ID ENQALLI+VSCFVKTS  EEYL VKE ILLDLLRV+SHH+ARLATPIR
Sbjct  299  LHRRVFLDYIDPENQALLILVSCFVKTSRIEEYLCVKEAILLDLLRVVSHHQARLATPIR  358

Query  361  TVQKIYKEADVD--EVPLADSVMTVNRA--NHPFLLIEPSYKINNSSEDKTKAAT-PPRP  525
            TVQK Y  AD++   +P AD + T ++A  N P L IEPSYK+N   +DK KA+T   R 
Sbjct  359  TVQKEYXVADMEMENIPFADPIFTRSQAAANRPLLQIEPSYKMNG--DDKMKASTGSARR  416

Query  526  NQEKDGKSEVQTTA-----SKAVDASPPIVDGNRIDTRgssgssTDTEPGVATSE-----  675
            N+EK  K E +  +     SKA  +S  I++    D +  + + +D++P  + S+     
Sbjct  417  NKEKVAKIEARPKSDLKPGSKAGASS--ILEK---DAKIKANTKSDSKPETSISDKIENM  471

Query  676  -LDGKMPNT-----GSVQSKNERQQVDKVVPGEVD-----------------------AP  768
              DG  PN        V  +  R++   ++P + +                        P
Sbjct  472  VTDGSTPNNYEKXRSEVGMEKVREETVGLIPEDKNQGGSAFENPSLNFPESGTRKADILP  531

Query  769  SAVSQAKQDGE  801
            SA S AKQDG+
Sbjct  532  SATSLAKQDGD  542



>ref|XP_008452176.1| PREDICTED: mechanosensitive ion channel protein 2, chloroplastic-like 
isoform X3 [Cucumis melo]
Length=677

 Score =   267 bits (683),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 126/184 (68%), Positives = 153/184 (83%), Gaps = 3/184 (2%)
 Frame = +1

Query  1    AIHIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQVEQQK  180
            A+HIPNH+FT+NVVRNL+QKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQVEQQ+
Sbjct  287  AVHIPNHQFTMNVVRNLSQKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQVEQQR  346

Query  181  LHRRVFLDNIDRENQALLIMVSCFVKTSHFEEYLRVKEVILLDLLRVISHHRARLATPIR  360
            LHRRVFL+N+D ENQALLI++SCFVKTSHFEEYL VKE I+LDLLRVI HH ARLATPIR
Sbjct  347  LHRRVFLENVDSENQALLILISCFVKTSHFEEYLCVKEAIILDLLRVIRHHGARLATPIR  406

Query  361  TVQKIYKEADVDEVPLADSVMTVNRA--NHPFLLIEPSYKINNSSEDKTKAATPPRPNQE  534
            T+QK++ ++D++ VP +DS+     A  N   L+IEP YK++     ++ + T  R   E
Sbjct  407  TMQKMHSDSDLESVPFSDSIFGHRGATLNRRMLMIEPPYKVHGEDRKQSHSRT-SRTTGE  465

Query  535  KDGK  546
            ++GK
Sbjct  466  QNGK  469



>ref|XP_006300816.1| hypothetical protein CARUB_v10019907mg [Capsella rubella]
 gb|EOA33714.1| hypothetical protein CARUB_v10019907mg [Capsella rubella]
Length=672

 Score =   267 bits (682),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 128/190 (67%), Positives = 156/190 (82%), Gaps = 4/190 (2%)
 Frame = +1

Query  1    AIHIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQVEQQK  180
            A+HIPNH+F+VN+VRNLTQKTHWRIKTHLAISHLDV+KINNIVADMRKVL+KNPQ+EQQK
Sbjct  338  AVHIPNHQFSVNIVRNLTQKTHWRIKTHLAISHLDVSKINNIVADMRKVLSKNPQIEQQK  397

Query  181  LHRRVFLDNIDRENQALLIMVSCFVKTSHFEEYLRVKEVILLDLLRVISHHRARLATPIR  360
            +HRRVFL++ID ENQAL I++SCFVKTS FEEYL VKE +LLDLLRVI HH ARLATPIR
Sbjct  398  IHRRVFLEDIDPENQALRILISCFVKTSRFEEYLCVKEAVLLDLLRVIRHHGARLATPIR  457

Query  361  TVQKIYKEADVDEVPLADSVMTVNRANHPFLLIEPSYKINNSSEDKTKAATPP--RPNQE  534
            TVQ++  EA+VD    +D V      N  ++LIEPSYKIN   +D TK++TP   + +++
Sbjct  458  TVQRMRNEAEVDSAGFSDIVFNQAAMNRRYMLIEPSYKING--DDTTKSSTPSSVQKSED  515

Query  535  KDGKSEVQTT  564
            KD + E+  T
Sbjct  516  KDLQEELLET  525



>ref|XP_008452177.1| PREDICTED: mechanosensitive ion channel protein 2, chloroplastic-like 
isoform X4 [Cucumis melo]
Length=662

 Score =   266 bits (680),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 126/184 (68%), Positives = 153/184 (83%), Gaps = 3/184 (2%)
 Frame = +1

Query  1    AIHIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQVEQQK  180
            A+HIPNH+FT+NVVRNL+QKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQVEQQ+
Sbjct  272  AVHIPNHQFTMNVVRNLSQKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQVEQQR  331

Query  181  LHRRVFLDNIDRENQALLIMVSCFVKTSHFEEYLRVKEVILLDLLRVISHHRARLATPIR  360
            LHRRVFL+N+D ENQALLI++SCFVKTSHFEEYL VKE I+LDLLRVI HH ARLATPIR
Sbjct  332  LHRRVFLENVDSENQALLILISCFVKTSHFEEYLCVKEAIILDLLRVIRHHGARLATPIR  391

Query  361  TVQKIYKEADVDEVPLADSVMTVNRA--NHPFLLIEPSYKINNSSEDKTKAATPPRPNQE  534
            T+QK++ ++D++ VP +DS+     A  N   L+IEP YK++     ++ + T  R   E
Sbjct  392  TMQKMHSDSDLESVPFSDSIFGHRGATLNRRMLMIEPPYKVHGEDRKQSHSRT-SRTTGE  450

Query  535  KDGK  546
            ++GK
Sbjct  451  QNGK  454



>ref|XP_002888236.1| hypothetical protein ARALYDRAFT_475431 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH64495.1| hypothetical protein ARALYDRAFT_475431 [Arabidopsis lyrata subsp. 
lyrata]
Length=671

 Score =   266 bits (680),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 123/184 (67%), Positives = 151/184 (82%), Gaps = 0/184 (0%)
 Frame = +1

Query  1    AIHIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQVEQQK  180
            A+HIPNH+F+VN+VRNLTQKTHWRIKTHLAISHLDV+KINNIVADMRKVL+KNPQ+EQQK
Sbjct  335  AVHIPNHQFSVNIVRNLTQKTHWRIKTHLAISHLDVSKINNIVADMRKVLSKNPQIEQQK  394

Query  181  LHRRVFLDNIDRENQALLIMVSCFVKTSHFEEYLRVKEVILLDLLRVISHHRARLATPIR  360
            +HRRVFL++ID ENQAL I++SCFVKTS FEEYL VKE +LLDLL VI HH ARLATPIR
Sbjct  395  IHRRVFLEDIDPENQALRILISCFVKTSRFEEYLCVKEAVLLDLLTVIRHHGARLATPIR  454

Query  361  TVQKIYKEADVDEVPLADSVMTVNRANHPFLLIEPSYKINNSSEDKTKAATPPRPNQEKD  540
            TVQ++  EA+VD    +D +      N  F+LIEPSYKIN+    K+ + +P + ++E+D
Sbjct  455  TVQRMRNEAEVDSAGFSDIIFNQAAMNRRFMLIEPSYKINSDDNSKSPSPSPGQKSEERD  514

Query  541  GKSE  552
             + E
Sbjct  515  LQEE  518



>ref|XP_002283834.2| PREDICTED: mechanosensitive ion channel protein 3, chloroplastic-like 
[Vitis vinifera]
Length=591

 Score =   263 bits (673),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 133/191 (70%), Positives = 157/191 (82%), Gaps = 7/191 (4%)
 Frame = +1

Query  1    AIHIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQVEQQK  180
            A+H+PN+KFTVNVVRNL+Q+THWRIKT LAISHLDV+KINN+VADMRKVL+KNPQ+EQQ+
Sbjct  334  AVHVPNNKFTVNVVRNLSQRTHWRIKTQLAISHLDVDKINNVVADMRKVLSKNPQIEQQR  393

Query  181  LHRRVFLDNIDRENQALLIMVSCFVKTSHFEEYLRVKEVILLDLLRVISHHRARLATPIR  360
            LHRRVFLD ID ENQALLI+VSCFVKTS  EEYL VKE ILLDLLRV+SHH+ARLATPIR
Sbjct  394  LHRRVFLDYIDPENQALLILVSCFVKTSRIEEYLCVKEAILLDLLRVVSHHQARLATPIR  453

Query  361  TVQKIYKEAD--VDEVPLADSVMTVNR--ANHPFLLIEPSYKINNSSEDKTKAAT-PPRP  525
            TVQK Y  AD  ++ +P AD + T ++  AN P L IEPSYK+N   +DK KA+T   R 
Sbjct  454  TVQKEYGVADMEMENIPFADPIFTRSQAAANRPLLQIEPSYKMNG--DDKMKASTGSARR  511

Query  526  NQEKDGKSEVQ  558
            N+EK  K E +
Sbjct  512  NKEKVAKIEAR  522



>ref|XP_008452175.1| PREDICTED: mechanosensitive ion channel protein 2, chloroplastic-like 
isoform X2 [Cucumis melo]
Length=725

 Score =   266 bits (680),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 126/184 (68%), Positives = 153/184 (83%), Gaps = 3/184 (2%)
 Frame = +1

Query  1    AIHIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQVEQQK  180
            A+HIPNH+FT+NVVRNL+QKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQVEQQ+
Sbjct  335  AVHIPNHQFTMNVVRNLSQKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQVEQQR  394

Query  181  LHRRVFLDNIDRENQALLIMVSCFVKTSHFEEYLRVKEVILLDLLRVISHHRARLATPIR  360
            LHRRVFL+N+D ENQALLI++SCFVKTSHFEEYL VKE I+LDLLRVI HH ARLATPIR
Sbjct  395  LHRRVFLENVDSENQALLILISCFVKTSHFEEYLCVKEAIILDLLRVIRHHGARLATPIR  454

Query  361  TVQKIYKEADVDEVPLADSVMTVNRA--NHPFLLIEPSYKINNSSEDKTKAATPPRPNQE  534
            T+QK++ ++D++ VP +DS+     A  N   L+IEP YK++     ++ + T  R   E
Sbjct  455  TMQKMHSDSDLESVPFSDSIFGHRGATLNRRMLMIEPPYKVHGEDRKQSHSRT-SRTTGE  513

Query  535  KDGK  546
            ++GK
Sbjct  514  QNGK  517



>ref|XP_008452168.1| PREDICTED: mechanosensitive ion channel protein 2, chloroplastic-like 
isoform X1 [Cucumis melo]
 ref|XP_008452169.1| PREDICTED: mechanosensitive ion channel protein 2, chloroplastic-like 
isoform X1 [Cucumis melo]
 ref|XP_008452170.1| PREDICTED: mechanosensitive ion channel protein 2, chloroplastic-like 
isoform X1 [Cucumis melo]
 ref|XP_008452171.1| PREDICTED: mechanosensitive ion channel protein 2, chloroplastic-like 
isoform X1 [Cucumis melo]
 ref|XP_008452172.1| PREDICTED: mechanosensitive ion channel protein 2, chloroplastic-like 
isoform X1 [Cucumis melo]
 ref|XP_008452173.1| PREDICTED: mechanosensitive ion channel protein 2, chloroplastic-like 
isoform X1 [Cucumis melo]
Length=742

 Score =   266 bits (680),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 126/184 (68%), Positives = 153/184 (83%), Gaps = 3/184 (2%)
 Frame = +1

Query  1    AIHIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQVEQQK  180
            A+HIPNH+FT+NVVRNL+QKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQVEQQ+
Sbjct  352  AVHIPNHQFTMNVVRNLSQKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQVEQQR  411

Query  181  LHRRVFLDNIDRENQALLIMVSCFVKTSHFEEYLRVKEVILLDLLRVISHHRARLATPIR  360
            LHRRVFL+N+D ENQALLI++SCFVKTSHFEEYL VKE I+LDLLRVI HH ARLATPIR
Sbjct  412  LHRRVFLENVDSENQALLILISCFVKTSHFEEYLCVKEAIILDLLRVIRHHGARLATPIR  471

Query  361  TVQKIYKEADVDEVPLADSVMTVNRA--NHPFLLIEPSYKINNSSEDKTKAATPPRPNQE  534
            T+QK++ ++D++ VP +DS+     A  N   L+IEP YK++     ++ + T  R   E
Sbjct  472  TMQKMHSDSDLESVPFSDSIFGHRGATLNRRMLMIEPPYKVHGEDRKQSHSRT-SRTTGE  530

Query  535  KDGK  546
            ++GK
Sbjct  531  QNGK  534



>emb|CAB89394.1| putative protein [Arabidopsis thaliana]
Length=447

 Score =   259 bits (661),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 129/189 (68%), Positives = 147/189 (78%), Gaps = 10/189 (5%)
 Frame = +1

Query  1    AIHIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLDVNKI-----NNIVADMRKVLAKNPQ  165
            AIHIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLD+  +      NIVADMRKVLAKNP 
Sbjct  104  AIHIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLDLILVWNFLKQNIVADMRKVLAKNPM  163

Query  166  VEQQKLHRRVFLDNIDRENQALLIMVSCFVKTSHFEEYLRVKEVILLDLLRVISHHRARL  345
            VEQQ+LHRRVFL+N+  ENQAL I++SCFVKTSH EEYL VKE ILLDLLRVISHHRARL
Sbjct  164  VEQQRLHRRVFLENVIPENQALSILISCFVKTSHHEEYLGVKEAILLDLLRVISHHRARL  223

Query  346  ATPIRTVQKIYKEADVDEVPLADSVMTVNRANHPFLLIEPSYKINNSSEDKTKA---ATP  516
            ATPIRT++K+Y E DV+  P  +S+     +  P +LIEP+YKIN   EDK+K+   A  
Sbjct  224  ATPIRTIRKMYTETDVENTPFGESMYGGVTSRRPLMLIEPAYKING--EDKSKSQNRAAK  281

Query  517  PRPNQEKDG  543
            P   QE  G
Sbjct  282  PTAEQENKG  290



>ref|XP_011650599.1| PREDICTED: mechanosensitive ion channel protein 2, chloroplastic 
[Cucumis sativus]
 gb|KGN56304.1| hypothetical protein Csa_3G114440 [Cucumis sativus]
Length=724

 Score =   265 bits (677),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 126/184 (68%), Positives = 152/184 (83%), Gaps = 3/184 (2%)
 Frame = +1

Query  1    AIHIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQVEQQK  180
            A+HIPNH+FT+NVVRNL+QKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQVEQQ+
Sbjct  335  AVHIPNHQFTMNVVRNLSQKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQVEQQR  394

Query  181  LHRRVFLDNIDRENQALLIMVSCFVKTSHFEEYLRVKEVILLDLLRVISHHRARLATPIR  360
            LHRRVFL+N+D ENQALLI++SCFVKTSHFEEYL VKE I+LDLLRVI HH ARLATPIR
Sbjct  395  LHRRVFLENVDSENQALLILISCFVKTSHFEEYLCVKEAIILDLLRVIRHHGARLATPIR  454

Query  361  TVQKIYKEADVDEVPLADSVMTVNRA--NHPFLLIEPSYKINNSSEDKTKAATPPRPNQE  534
            T+QK++ ++D++ VP +DS+     A  N   L+IEP YK+      ++ + T  R   E
Sbjct  455  TMQKMHSDSDLENVPFSDSIFGHRGATLNRRMLMIEPPYKVYGEDRKQSHSRT-SRTTGE  513

Query  535  KDGK  546
            ++GK
Sbjct  514  QNGK  517



>ref|XP_003613048.1| MscS-Like mechanosensitive ion channel MSCL8 [Medicago truncatula]
Length=735

 Score =   265 bits (677),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 145/235 (62%), Positives = 168/235 (71%), Gaps = 41/235 (17%)
 Frame = +1

Query  1    AIHIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQVEQQK  180
            A+HIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQVEQQ+
Sbjct  332  AVHIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQVEQQR  391

Query  181  LHRRVFLDNIDRENQALL------------------------------IMVSCFVKTSHF  270
            LHRRVFLDNI+ ENQAL+                              I++SCFVKTSHF
Sbjct  392  LHRRVFLDNINPENQALMDPFPDPAYAGALVHRATLRLHCNCHGQILGILISCFVKTSHF  451

Query  271  EEYLRVKEVILLDLLRVISHHRARLATPIRTVQKIYKEADVDEVPLADSVMTVNRA----  438
            EEYL VKE ILLDLLRVISHHRARLATP+RT+QKIY +AD+D +P AD+  T N A    
Sbjct  452  EEYLCVKETILLDLLRVISHHRARLATPVRTLQKIYADADLDNIPYADT--TFNGAGPVV  509

Query  439  -NHPFLLIEPSYKINNSSEDKTKAATPPRPNQEKDGKSEVQTTA-SKAVDASPPI  597
             N P L+I+  YK  N+++DKTK+ +  R   ++D K+ V+T   SK  D   PI
Sbjct  510  SNRPLLVIDSPYK--NNADDKTKSRS-TRATVDQDDKTTVRTKLDSKTEDKVEPI  561



>ref|XP_010470275.1| PREDICTED: mechanosensitive ion channel protein 3, chloroplastic 
[Camelina sativa]
Length=644

 Score =   263 bits (672),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 128/187 (68%), Positives = 153/187 (82%), Gaps = 6/187 (3%)
 Frame = +1

Query  1    AIHIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQVEQQK  180
            A+HIPNH+F+VN+VRNLTQKTHWRIKTHLAISHLDV+KINNIVADMRKVL+KNPQ+EQQK
Sbjct  317  AVHIPNHQFSVNIVRNLTQKTHWRIKTHLAISHLDVSKINNIVADMRKVLSKNPQIEQQK  376

Query  181  LHRRVFLDNIDRENQALLIMVSCFVKTSHFEEYLRVKEVILLDLLRVISHHRARLATPIR  360
            +HRRVFLDNID ENQAL I++SCFVKTS FEEYL VKE +LLDLL VI HH ARLATPIR
Sbjct  377  IHRRVFLDNIDPENQALRILISCFVKTSRFEEYLCVKEAVLLDLLTVIRHHGARLATPIR  436

Query  361  TVQKIYKEADVDEVPLADSVMTVNRANHPFLLIEPSYKINNSSEDKTKAATP---PRPNQ  531
            TVQ++  E +VD    +D +      N   +LIEPSYKIN  S+D TK+++P   P+ ++
Sbjct  437  TVQRMRNETEVDSAGFSDIIFNQAAMNRRLMLIEPSYKIN--SDDNTKSSSPNSMPK-SE  493

Query  532  EKDGKSE  552
            EKD + E
Sbjct  494  EKDLQEE  500



>emb|CDY60030.1| BnaCnng35660D [Brassica napus]
Length=669

 Score =   263 bits (672),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 128/203 (63%), Positives = 159/203 (78%), Gaps = 4/203 (2%)
 Frame = +1

Query  1    AIHIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQVEQQK  180
            A+HIPNH+F+VN+VRNLTQKTHWRIKTHLAISHLDV+KINNIVADMRKVL+KNPQ+EQQK
Sbjct  333  AVHIPNHQFSVNIVRNLTQKTHWRIKTHLAISHLDVSKINNIVADMRKVLSKNPQIEQQK  392

Query  181  LHRRVFLDNIDRENQALLIMVSCFVKTSHFEEYLRVKEVILLDLLRVISHHRARLATPIR  360
            +HRRVFL+ ID ENQAL I++SCFVKTS FEEYL VKE ++LDLLRVI HH ARLATP+R
Sbjct  393  IHRRVFLEEIDPENQALRILISCFVKTSRFEEYLCVKEAVILDLLRVIRHHGARLATPLR  452

Query  361  TVQKIYKEADVDEVPLADSVMTVNRANHPFLLIEPSYKINNSSEDKTKAATPP--RPNQE  534
            TVQ++  EA+VD    +D V      N  ++LIEPSYKIN  S+D  K++ P   + ++E
Sbjct  453  TVQRMRNEAEVDSAAFSDIVFNQAAMNRRYMLIEPSYKIN--SDDNAKSSLPNSVQKSEE  510

Query  535  KDGKSEVQTTASKAVDASPPIVD  603
            KD + E   + ++A D    +V 
Sbjct  511  KDPEGEPSESNTEAKDYGSVLVS  533



>ref|XP_006392321.1| hypothetical protein EUTSA_v10023336mg [Eutrema salsugineum]
 gb|ESQ29607.1| hypothetical protein EUTSA_v10023336mg [Eutrema salsugineum]
Length=651

 Score =   262 bits (670),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 122/167 (73%), Positives = 142/167 (85%), Gaps = 0/167 (0%)
 Frame = +1

Query  1    AIHIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQVEQQK  180
            A+HIPNH+F+VN+VRNLTQKTHWRIKTHL+ISHLDV+KINNIVADMRKVL+KNPQ+EQQK
Sbjct  317  AVHIPNHQFSVNIVRNLTQKTHWRIKTHLSISHLDVSKINNIVADMRKVLSKNPQIEQQK  376

Query  181  LHRRVFLDNIDRENQALLIMVSCFVKTSHFEEYLRVKEVILLDLLRVISHHRARLATPIR  360
            +HRRVFL++ID ENQAL I++SCFVKTS FEEYL VKE +LLDLLRVISHH ARLATPIR
Sbjct  377  IHRRVFLEDIDPENQALRILISCFVKTSRFEEYLCVKEAVLLDLLRVISHHGARLATPIR  436

Query  361  TVQKIYKEADVDEVPLADSVMTVNRANHPFLLIEPSYKINNSSEDKT  501
            TVQ++  EA+VD    +D V      N  F+LIEPSYKINN    K+
Sbjct  437  TVQRMRHEAEVDSAAFSDIVYNQAAMNRRFMLIEPSYKINNDDNGKS  483



>ref|NP_176116.2| MSCS-like 3 [Arabidopsis thaliana]
 ref|NP_974046.1| MSCS-like 3 [Arabidopsis thaliana]
 sp|Q8L7W1.1|MSL3_ARATH RecName: Full=Mechanosensitive ion channel protein 3, chloroplastic; 
AltName: Full=Mechanosensitive channel of small conductance-like 
3; AltName: Full=MscS-Like protein 3; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAM78096.1| At1g58200/F16M22_2 [Arabidopsis thaliana]
 gb|AAO11636.1| At1g58200/F16M22_2 [Arabidopsis thaliana]
 gb|AEE33512.1| MSCS-like 3 [Arabidopsis thaliana]
 gb|AEE33513.1| MSCS-like 3 [Arabidopsis thaliana]
Length=678

 Score =   263 bits (671),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 139/238 (58%), Positives = 176/238 (74%), Gaps = 13/238 (5%)
 Frame = +1

Query  1    AIHIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQVEQQK  180
            A+HIPNH+F+VN+VRNLTQKTHWRIKTHLAISHLDV+KINNIVADMRKVL+KNPQ+EQQK
Sbjct  337  AVHIPNHQFSVNIVRNLTQKTHWRIKTHLAISHLDVSKINNIVADMRKVLSKNPQIEQQK  396

Query  181  LHRRVFLDNIDRENQALLIMVSCFVKTSHFEEYLRVKEVILLDLLRVISHHRARLATPIR  360
            +HRRVFL++ID ENQAL I++SCFVKTS FEEYL VKE +LLDLL VI HH ARLATPIR
Sbjct  397  IHRRVFLEDIDPENQALRILISCFVKTSRFEEYLCVKEAVLLDLLTVIRHHGARLATPIR  456

Query  361  TVQKIYKEADVDEVPLADSVMTVNRANHPFLLIEPSYKINNSSEDKTKAATP------PR  522
            TVQ++  EA+VD    +D V      N  ++LIEPSYKIN  S+D +K+ +P      P 
Sbjct  457  TVQRMRNEAEVDTAGFSDIVFNQAAMNRRYMLIEPSYKIN--SDDNSKSPSPSPGQKSPS  514

Query  523  PNQ---EKDGKSE-VQTTASKAVDASPPIVDGNRIDTRgssgssTDTEP-GVATSELD  681
            P Q   E+D + E  +T A    + S P+ +  + + + + GS+++T   G +TS  D
Sbjct  515  PGQKSEERDLQEEPSETKAETENNGSVPVSNAKKENQKAALGSNSNTGTKGSSTSTSD  572



>gb|AAG50956.1|AC073943_6 unknown protein [Arabidopsis thaliana]
Length=676

 Score =   262 bits (670),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 139/238 (58%), Positives = 176/238 (74%), Gaps = 13/238 (5%)
 Frame = +1

Query  1    AIHIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQVEQQK  180
            A+HIPNH+F+VN+VRNLTQKTHWRIKTHLAISHLDV+KINNIVADMRKVL+KNPQ+EQQK
Sbjct  335  AVHIPNHQFSVNIVRNLTQKTHWRIKTHLAISHLDVSKINNIVADMRKVLSKNPQIEQQK  394

Query  181  LHRRVFLDNIDRENQALLIMVSCFVKTSHFEEYLRVKEVILLDLLRVISHHRARLATPIR  360
            +HRRVFL++ID ENQAL I++SCFVKTS FEEYL VKE +LLDLL VI HH ARLATPIR
Sbjct  395  IHRRVFLEDIDPENQALRILISCFVKTSRFEEYLCVKEAVLLDLLTVIRHHGARLATPIR  454

Query  361  TVQKIYKEADVDEVPLADSVMTVNRANHPFLLIEPSYKINNSSEDKTKAATP------PR  522
            TVQ++  EA+VD    +D V      N  ++LIEPSYKIN  S+D +K+ +P      P 
Sbjct  455  TVQRMRNEAEVDTAGFSDIVFNQAAMNRRYMLIEPSYKIN--SDDNSKSPSPSPGQKSPS  512

Query  523  PNQ---EKDGKSE-VQTTASKAVDASPPIVDGNRIDTRgssgssTDTEP-GVATSELD  681
            P Q   E+D + E  +T A    + S P+ +  + + + + GS+++T   G +TS  D
Sbjct  513  PGQKSEERDLQEEPSETKAETENNGSVPVSNAKKENQKAALGSNSNTGTKGSSTSTSD  570



>ref|XP_007136336.1| hypothetical protein PHAVU_009G037000g [Phaseolus vulgaris]
 gb|ESW08330.1| hypothetical protein PHAVU_009G037000g [Phaseolus vulgaris]
Length=631

 Score =   261 bits (667),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 129/185 (70%), Positives = 152/185 (82%), Gaps = 11/185 (6%)
 Frame = +1

Query  1    AIHIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQVEQQK  180
            AIHIPNH  +VNVVRNL++K+HWRIKT LAISHLDVNKIN+I+ADMRKVLAKNPQVEQ+K
Sbjct  321  AIHIPNHNLSVNVVRNLSKKSHWRIKTRLAISHLDVNKINSIIADMRKVLAKNPQVEQRK  380

Query  181  LHRRVFLDNIDRENQALLIMVSCFVKTSHFEEYLRVKEVILLDLLRVISHHRARLATPIR  360
            LHRRVFL+NID ENQAL+I+VSCFVKTS  EEYLRVKE ILLDLLRVISHHRARLATPIR
Sbjct  381  LHRRVFLENIDPENQALMILVSCFVKTSRSEEYLRVKEAILLDLLRVISHHRARLATPIR  440

Query  361  TVQKIYKEADVDEVPLADSVMTVNRA--NHPFLLIEPSYKINNSSEDKTKAATPPR-PNQ  531
            TVQK+Y + D D  P  D++ T +R+  N PF LI+P YK+        K++TP    N+
Sbjct  441  TVQKMYSDTDFDIDPFDDTISTRSRSKKNRPFTLIDPPYKV--------KSSTPSTITNE  492

Query  532  EKDGK  546
            ++DGK
Sbjct  493  DRDGK  497



>gb|EPS67304.1| hypothetical protein M569_07470, partial [Genlisea aurea]
Length=459

 Score =   254 bits (650),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 130/187 (70%), Positives = 147/187 (79%), Gaps = 13/187 (7%)
 Frame = +1

Query  1    AIHIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQVEQQK  180
            A+HIPNHKFTVNVVRNL+QKTHWRIKTHLAISHLDV+KIN+IVADMRKVLAKNPQVEQQK
Sbjct  240  AVHIPNHKFTVNVVRNLSQKTHWRIKTHLAISHLDVSKINSIVADMRKVLAKNPQVEQQK  299

Query  181  LHRRVFLDNIDRENQALLIMVSCFVKTSHFEEYLRVKEVILLDLLRVISHHRARLATPIR  360
            LHRRVFLDNI+ ENQAL+I+VSCFVKTSHFEEYL VKE ILLDLLRVI H+RARLA+PIR
Sbjct  300  LHRRVFLDNINPENQALMILVSCFVKTSHFEEYLCVKEAILLDLLRVIRHYRARLASPIR  359

Query  361  TVQKIYKEADVDEVPLADSVMT-VNRANHPFLLIEPSYKINNSSED---KTKAATPPRPN  528
             +QK+Y E D+D    +DS+      +N PFLLI        S ED   K   A   R N
Sbjct  360  MIQKVYSEPDIDNS--SDSMFGRTTVSNGPFLLIA-------SGEDRAAKAPQARSSRAN  410

Query  529  QEKDGKS  549
             + D +S
Sbjct  411  SDADAES  417



>ref|XP_010548858.1| PREDICTED: mechanosensitive ion channel protein 3, chloroplastic-like 
isoform X4 [Tarenaya hassleriana]
Length=537

 Score =   256 bits (655),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 129/182 (71%), Positives = 149/182 (82%), Gaps = 8/182 (4%)
 Frame = +1

Query  1    AIHIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQVEQQK  180
            A+HIPNHKFTV+VVRNL+QKTHWRIKTHL ISHLDV+KINNIVADMRKVLAKNPQVEQQK
Sbjct  256  AVHIPNHKFTVSVVRNLSQKTHWRIKTHLCISHLDVSKINNIVADMRKVLAKNPQVEQQK  315

Query  181  LHRRVFLDNIDRENQALLIMVSCFVKTSHFEEYLRVKEVILLDLLRVISHHRARLATPIR  360
            +HRRVFL+++D ENQAL I++SCFVKTS FEEYL VKE +LLDLLRVI HH ARLATPIR
Sbjct  316  IHRRVFLEDVDPENQALKILISCFVKTSRFEEYLCVKEAVLLDLLRVIRHHGARLATPIR  375

Query  361  TVQKIYKEADVDEVPLADSVMT--VNRANH-PFLLIEPSYKINNSSEDKTKAATPPRPNQ  531
            TVQ++  EA+VD    +D V T   +  NH   +LIEPSYKI NSS++K K    P PN 
Sbjct  376  TVQRMRNEAEVDSAAFSDIVFTHASSSINHRRLMLIEPSYKI-NSSDEKAK----PSPNS  430

Query  532  EK  537
             +
Sbjct  431  AQ  432



>ref|XP_009131165.1| PREDICTED: mechanosensitive ion channel protein 2, chloroplastic-like 
[Brassica rapa]
 ref|XP_009131166.1| PREDICTED: mechanosensitive ion channel protein 2, chloroplastic-like 
[Brassica rapa]
Length=644

 Score =   259 bits (662),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 124/171 (73%), Positives = 147/171 (86%), Gaps = 4/171 (2%)
 Frame = +1

Query  1    AIHIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQVEQQK  180
            AIHIPNHKFTVNVVRN+TQKTHWRIKTHLAIS+LDVNKINNIVADMRKVLAKNPQVEQQK
Sbjct  336  AIHIPNHKFTVNVVRNITQKTHWRIKTHLAISYLDVNKINNIVADMRKVLAKNPQVEQQK  395

Query  181  LHRRVFLDNIDRENQALLIMVSCFVKTSHFEEYLRVKEVILLDLLRVISHHRARLATPIR  360
            LHRR+FL++++ ENQ+L+I++SCFVKTSH EEYL VKE ILLDLLRVISHHRARLATPIR
Sbjct  396  LHRRIFLEDVNPENQSLVILISCFVKTSHREEYLSVKEAILLDLLRVISHHRARLATPIR  455

Query  361  TVQKIYKEADVDEVPLADSVMTVN--RANHPFLLIEPSYKINNSSEDKTKA  507
            T+QK++  AD++  P  +S+       +  P ++IEPSYKI    EDK+K+
Sbjct  456  TIQKMHTAADMENAPFGESMYGPGGVGSKRPSVVIEPSYKIYG--EDKSKS  504



>ref|XP_009386274.1| PREDICTED: mechanosensitive ion channel protein 2, chloroplastic-like 
[Musa acuminata subsp. malaccensis]
 ref|XP_009386275.1| PREDICTED: mechanosensitive ion channel protein 2, chloroplastic-like 
[Musa acuminata subsp. malaccensis]
Length=691

 Score =   259 bits (662),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 126/184 (68%), Positives = 155/184 (84%), Gaps = 3/184 (2%)
 Frame = +1

Query  1    AIHIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQVEQQK  180
            A++IPNHKFTV+VVRNL++KTHWRIKTHLAISHLDVNKI+NIVADMRKVLAKNPQ+EQQK
Sbjct  344  AVYIPNHKFTVSVVRNLSKKTHWRIKTHLAISHLDVNKISNIVADMRKVLAKNPQIEQQK  403

Query  181  LHRRVFLDNIDRENQALLIMVSCFVKTSHFEEYLRVKEVILLDLLRVISHHRARLATPIR  360
            LHRRVFLDNID ENQALLI+VSCFVKTS+ EEYL VKE ++LDLL+VISHHRARLATPIR
Sbjct  404  LHRRVFLDNIDPENQALLILVSCFVKTSYHEEYLCVKEAVMLDLLKVISHHRARLATPIR  463

Query  361  TVQKIYKEADVDEVPLADSVMTVNRA-NHPFLLIEPSYKINNSSEDKTKAATPPRPNQEK  537
            TVQK+Y + D++    A+SV   + A + PFLL++   +IN+  +DK K+ +  R N+ +
Sbjct  464  TVQKMYGDPDIENSLFAESVFRHSAASSRPFLLVDSQSRIND--DDKVKSRSTSRANENQ  521

Query  538  DGKS  549
              K+
Sbjct  522  TSKT  525



>ref|XP_010548853.1| PREDICTED: mechanosensitive ion channel protein 3, chloroplastic-like 
isoform X3 [Tarenaya hassleriana]
Length=545

 Score =   256 bits (653),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 129/182 (71%), Positives = 149/182 (82%), Gaps = 8/182 (4%)
 Frame = +1

Query  1    AIHIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQVEQQK  180
            A+HIPNHKFTV+VVRNL+QKTHWRIKTHL ISHLDV+KINNIVADMRKVLAKNPQVEQQK
Sbjct  264  AVHIPNHKFTVSVVRNLSQKTHWRIKTHLCISHLDVSKINNIVADMRKVLAKNPQVEQQK  323

Query  181  LHRRVFLDNIDRENQALLIMVSCFVKTSHFEEYLRVKEVILLDLLRVISHHRARLATPIR  360
            +HRRVFL+++D ENQAL I++SCFVKTS FEEYL VKE +LLDLLRVI HH ARLATPIR
Sbjct  324  IHRRVFLEDVDPENQALKILISCFVKTSRFEEYLCVKEAVLLDLLRVIRHHGARLATPIR  383

Query  361  TVQKIYKEADVDEVPLADSVMT--VNRANH-PFLLIEPSYKINNSSEDKTKAATPPRPNQ  531
            TVQ++  EA+VD    +D V T   +  NH   +LIEPSYKI NSS++K K    P PN 
Sbjct  384  TVQRMRNEAEVDSAAFSDIVFTHASSSINHRRLMLIEPSYKI-NSSDEKAK----PSPNS  438

Query  532  EK  537
             +
Sbjct  439  AQ  440



>emb|CDY66218.1| BnaAnng21790D [Brassica napus]
Length=653

 Score =   258 bits (659),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 125/193 (65%), Positives = 152/193 (79%), Gaps = 3/193 (2%)
 Frame = +1

Query  1    AIHIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQVEQQK  180
            A+HIPNH+F+VN+VRNLTQ+THWRIKTHLAISHLDV+KIN+IVADMRKVL+KNPQ+EQQK
Sbjct  332  AVHIPNHQFSVNIVRNLTQRTHWRIKTHLAISHLDVSKINSIVADMRKVLSKNPQIEQQK  391

Query  181  LHRRVFLDNIDRENQALLIMVSCFVKTSHFEEYLRVKEVILLDLLRVISHHRARLATPIR  360
            +HRRVFL+++D ENQAL I++SCFVKTS FEEYL VKE +LLDLLRVI HH ARLATPIR
Sbjct  392  IHRRVFLEDVDPENQALRILISCFVKTSRFEEYLCVKEEVLLDLLRVIRHHGARLATPIR  451

Query  361  TVQKIYKEADVDEVPLADSVMTVNRANHPFLLIEPSYKINNSSEDKTKAATPPRPNQEKD  540
            TVQ++  E + D    +D V      N   +LIEPSYKIN   +D  K++ P    Q+ +
Sbjct  452  TVQRMRNETEADSAAFSDIVFNQAAMNRRLMLIEPSYKING--DDNAKSSRPKSSEQKGE  509

Query  541  GK-SEVQTTASKA  576
             K SE + T SKA
Sbjct  510  EKDSEGEATDSKA  522



>gb|AAZ66947.1| 117M18_28 [Brassica rapa]
Length=644

 Score =   257 bits (657),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 123/171 (72%), Positives = 147/171 (86%), Gaps = 4/171 (2%)
 Frame = +1

Query  1    AIHIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQVEQQK  180
            AIHIPNHKFTVNVVRN+TQKTHWRIKTHLAIS+LDVNKINNIVADMRKVLAKNPQVEQQK
Sbjct  336  AIHIPNHKFTVNVVRNITQKTHWRIKTHLAISYLDVNKINNIVADMRKVLAKNPQVEQQK  395

Query  181  LHRRVFLDNIDRENQALLIMVSCFVKTSHFEEYLRVKEVILLDLLRVISHHRARLATPIR  360
            LHRR+FL++++ ENQ+L+I++SCFVKTSH EEYL VKE ILLDLLRVISHHRARLATPIR
Sbjct  396  LHRRIFLEDVNPENQSLVILISCFVKTSHREEYLSVKEAILLDLLRVISHHRARLATPIR  455

Query  361  TVQKIYKEADVDEVPLADSVMTVN--RANHPFLLIEPSYKINNSSEDKTKA  507
            T++K++  AD++  P  +S+       +  P ++IEPSYKI    EDK+K+
Sbjct  456  TIRKMHTAADMENAPFGESMYGPGGVGSKRPSVVIEPSYKIYG--EDKSKS  504



>emb|CDX78385.1| BnaA03g02970D [Brassica napus]
Length=644

 Score =   257 bits (656),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 123/171 (72%), Positives = 147/171 (86%), Gaps = 4/171 (2%)
 Frame = +1

Query  1    AIHIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQVEQQK  180
            AIHIPNHKFTVNVVRN+TQKTHWRIKTHLAIS+LDVNKINNIVADMRKVLAKNPQVEQQK
Sbjct  336  AIHIPNHKFTVNVVRNITQKTHWRIKTHLAISYLDVNKINNIVADMRKVLAKNPQVEQQK  395

Query  181  LHRRVFLDNIDRENQALLIMVSCFVKTSHFEEYLRVKEVILLDLLRVISHHRARLATPIR  360
            LHRR+FL++++ ENQ+L+I++SCFVKTSH EEYL VKE ILLDLLRVISHHRARLATPIR
Sbjct  396  LHRRIFLEDVNPENQSLVILISCFVKTSHREEYLSVKEAILLDLLRVISHHRARLATPIR  455

Query  361  TVQKIYKEADVDEVPLADSVMTVN--RANHPFLLIEPSYKINNSSEDKTKA  507
            T++K++  AD++  P  +S+       +  P ++IEPSYKI    EDK+K+
Sbjct  456  TIRKMHTAADMENAPFGESMYGPGGVGSKRPSVVIEPSYKIYG--EDKSKS  504



>emb|CDY68875.1| BnaCnng60870D [Brassica napus]
Length=644

 Score =   257 bits (656),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 124/171 (73%), Positives = 146/171 (85%), Gaps = 4/171 (2%)
 Frame = +1

Query  1    AIHIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQVEQQK  180
            AIHIPNHKFTVNVVRN+TQKTHWRIKTHLAIS+LDVNKINNIVADMRKVLAKNPQVEQQK
Sbjct  336  AIHIPNHKFTVNVVRNITQKTHWRIKTHLAISYLDVNKINNIVADMRKVLAKNPQVEQQK  395

Query  181  LHRRVFLDNIDRENQALLIMVSCFVKTSHFEEYLRVKEVILLDLLRVISHHRARLATPIR  360
            LHRR+FL+++D ENQAL+I++SCFVKTSH EEYL VKE ILLDLLRVISHHRARLATPIR
Sbjct  396  LHRRIFLEDVDPENQALVILISCFVKTSHREEYLSVKEAILLDLLRVISHHRARLATPIR  455

Query  361  TVQKIYKEADVDEVPLADSVMTVN--RANHPFLLIEPSYKINNSSEDKTKA  507
            T++K++  AD++  P  +S+       +    ++IEPSYKI    EDK+K+
Sbjct  456  TIRKMHTAADMENAPFGESMYGPGGVASRRSSVVIEPSYKIYG--EDKSKS  504



>ref|XP_010548833.1| PREDICTED: mechanosensitive ion channel protein 3, chloroplastic-like 
isoform X1 [Tarenaya hassleriana]
 ref|XP_010548839.1| PREDICTED: mechanosensitive ion channel protein 3, chloroplastic-like 
isoform X1 [Tarenaya hassleriana]
Length=616

 Score =   256 bits (654),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 129/182 (71%), Positives = 149/182 (82%), Gaps = 8/182 (4%)
 Frame = +1

Query  1    AIHIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQVEQQK  180
            A+HIPNHKFTV+VVRNL+QKTHWRIKTHL ISHLDV+KINNIVADMRKVLAKNPQVEQQK
Sbjct  335  AVHIPNHKFTVSVVRNLSQKTHWRIKTHLCISHLDVSKINNIVADMRKVLAKNPQVEQQK  394

Query  181  LHRRVFLDNIDRENQALLIMVSCFVKTSHFEEYLRVKEVILLDLLRVISHHRARLATPIR  360
            +HRRVFL+++D ENQAL I++SCFVKTS FEEYL VKE +LLDLLRVI HH ARLATPIR
Sbjct  395  IHRRVFLEDVDPENQALKILISCFVKTSRFEEYLCVKEAVLLDLLRVIRHHGARLATPIR  454

Query  361  TVQKIYKEADVDEVPLADSVMT--VNRANH-PFLLIEPSYKINNSSEDKTKAATPPRPNQ  531
            TVQ++  EA+VD    +D V T   +  NH   +LIEPSYKI NSS++K K    P PN 
Sbjct  455  TVQRMRNEAEVDSAAFSDIVFTHASSSINHRRLMLIEPSYKI-NSSDEKAK----PSPNS  509

Query  532  EK  537
             +
Sbjct  510  AQ  511



>ref|XP_010548845.1| PREDICTED: mechanosensitive ion channel protein 3, chloroplastic-like 
isoform X2 [Tarenaya hassleriana]
Length=615

 Score =   256 bits (654),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 129/182 (71%), Positives = 149/182 (82%), Gaps = 8/182 (4%)
 Frame = +1

Query  1    AIHIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQVEQQK  180
            A+HIPNHKFTV+VVRNL+QKTHWRIKTHL ISHLDV+KINNIVADMRKVLAKNPQVEQQK
Sbjct  334  AVHIPNHKFTVSVVRNLSQKTHWRIKTHLCISHLDVSKINNIVADMRKVLAKNPQVEQQK  393

Query  181  LHRRVFLDNIDRENQALLIMVSCFVKTSHFEEYLRVKEVILLDLLRVISHHRARLATPIR  360
            +HRRVFL+++D ENQAL I++SCFVKTS FEEYL VKE +LLDLLRVI HH ARLATPIR
Sbjct  394  IHRRVFLEDVDPENQALKILISCFVKTSRFEEYLCVKEAVLLDLLRVIRHHGARLATPIR  453

Query  361  TVQKIYKEADVDEVPLADSVMT--VNRANH-PFLLIEPSYKINNSSEDKTKAATPPRPNQ  531
            TVQ++  EA+VD    +D V T   +  NH   +LIEPSYKI NSS++K K    P PN 
Sbjct  454  TVQRMRNEAEVDSAAFSDIVFTHASSSINHRRLMLIEPSYKI-NSSDEKAK----PSPNS  508

Query  532  EK  537
             +
Sbjct  509  AQ  510



>ref|XP_010544066.1| PREDICTED: mechanosensitive ion channel protein 3, chloroplastic 
isoform X2 [Tarenaya hassleriana]
Length=464

 Score =   251 bits (641),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 121/172 (70%), Positives = 144/172 (84%), Gaps = 4/172 (2%)
 Frame = +1

Query  1    AIHIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQVEQQK  180
            A+HIPNHKFTV++VRNL+QKTHWRIKTHL ISHLD+ KINNIVADMRKVLAKNPQVEQQK
Sbjct  265  AVHIPNHKFTVSIVRNLSQKTHWRIKTHLCISHLDIGKINNIVADMRKVLAKNPQVEQQK  324

Query  181  LHRRVFLDNIDRENQALLIMVSCFVKTSHFEEYLRVKEVILLDLLRVISHHRARLATPIR  360
            +HRRVFL++ID ENQAL I++SCFVKTS FEEYL VKE +LLDLLRVI HH A LATPIR
Sbjct  325  IHRRVFLEDIDPENQALKILISCFVKTSRFEEYLCVKEAVLLDLLRVIRHHGAHLATPIR  384

Query  361  TVQKIYKEADVDEVPLADSVMT---VNRANHPFLLIEPSYKINNSSEDKTKA  507
            TVQ++  E +VD+   +D V T    + AN   +L+EPSYKI NS ++K+K+
Sbjct  385  TVQRMRNETEVDKSAFSDIVFTQASSSAANRRLMLVEPSYKI-NSGDNKSKS  435



>ref|XP_009102692.1| PREDICTED: mechanosensitive ion channel protein 3, chloroplastic 
isoform X1 [Brassica rapa]
Length=654

 Score =   256 bits (653),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 124/193 (64%), Positives = 151/193 (78%), Gaps = 3/193 (2%)
 Frame = +1

Query  1    AIHIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQVEQQK  180
            A+HIPNH+F+VN+VRNLTQ+THWRIKTHLAISHLDV+KIN+IVADMRKVL+KNPQ+EQQK
Sbjct  333  AVHIPNHQFSVNIVRNLTQRTHWRIKTHLAISHLDVSKINSIVADMRKVLSKNPQIEQQK  392

Query  181  LHRRVFLDNIDRENQALLIMVSCFVKTSHFEEYLRVKEVILLDLLRVISHHRARLATPIR  360
            +HRRVFL+++D ENQAL I++SCFVKTS FEEYL VKE +LLDLLRVI HH ARLATPIR
Sbjct  393  IHRRVFLEDVDPENQALRILISCFVKTSRFEEYLCVKEEVLLDLLRVIRHHGARLATPIR  452

Query  361  TVQKIYKEADVDEVPLADSVMTVNRANHPFLLIEPSYKINNSSEDKTKAATPPRPNQEKD  540
            TVQ++  E + D    +D V      N   +LIEPSYKIN   +D  K++ P    Q+ +
Sbjct  453  TVQRMRNETEADSAAFSDIVFNQAAMNRRLMLIEPSYKING--DDNAKSSRPKSSEQKGE  510

Query  541  GKS-EVQTTASKA  576
             K  E + T SKA
Sbjct  511  EKDPEGEATDSKA  523



>ref|XP_009102701.1| PREDICTED: mechanosensitive ion channel protein 3, chloroplastic 
isoform X2 [Brassica rapa]
Length=653

 Score =   256 bits (653),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 124/193 (64%), Positives = 151/193 (78%), Gaps = 3/193 (2%)
 Frame = +1

Query  1    AIHIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQVEQQK  180
            A+HIPNH+F+VN+VRNLTQ+THWRIKTHLAISHLDV+KIN+IVADMRKVL+KNPQ+EQQK
Sbjct  332  AVHIPNHQFSVNIVRNLTQRTHWRIKTHLAISHLDVSKINSIVADMRKVLSKNPQIEQQK  391

Query  181  LHRRVFLDNIDRENQALLIMVSCFVKTSHFEEYLRVKEVILLDLLRVISHHRARLATPIR  360
            +HRRVFL+++D ENQAL I++SCFVKTS FEEYL VKE +LLDLLRVI HH ARLATPIR
Sbjct  392  IHRRVFLEDVDPENQALRILISCFVKTSRFEEYLCVKEEVLLDLLRVIRHHGARLATPIR  451

Query  361  TVQKIYKEADVDEVPLADSVMTVNRANHPFLLIEPSYKINNSSEDKTKAATPPRPNQEKD  540
            TVQ++  E + D    +D V      N   +LIEPSYKIN   +D  K++ P    Q+ +
Sbjct  452  TVQRMRNETEADSAAFSDIVFNQAAMNRRLMLIEPSYKING--DDNAKSSRPKSSEQKGE  509

Query  541  GKS-EVQTTASKA  576
             K  E + T SKA
Sbjct  510  EKDPEGEATDSKA  522



>ref|XP_010544067.1| PREDICTED: mechanosensitive ion channel protein 3, chloroplastic 
isoform X3 [Tarenaya hassleriana]
Length=463

 Score =   250 bits (639),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 121/172 (70%), Positives = 144/172 (84%), Gaps = 4/172 (2%)
 Frame = +1

Query  1    AIHIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQVEQQK  180
            A+HIPNHKFTV++VRNL+QKTHWRIKTHL ISHLD+ KINNIVADMRKVLAKNPQVEQQK
Sbjct  264  AVHIPNHKFTVSIVRNLSQKTHWRIKTHLCISHLDIGKINNIVADMRKVLAKNPQVEQQK  323

Query  181  LHRRVFLDNIDRENQALLIMVSCFVKTSHFEEYLRVKEVILLDLLRVISHHRARLATPIR  360
            +HRRVFL++ID ENQAL I++SCFVKTS FEEYL VKE +LLDLLRVI HH A LATPIR
Sbjct  324  IHRRVFLEDIDPENQALKILISCFVKTSRFEEYLCVKEAVLLDLLRVIRHHGAHLATPIR  383

Query  361  TVQKIYKEADVDEVPLADSVMT---VNRANHPFLLIEPSYKINNSSEDKTKA  507
            TVQ++  E +VD+   +D V T    + AN   +L+EPSYKI NS ++K+K+
Sbjct  384  TVQRMRNETEVDKSAFSDIVFTQASSSAANRRLMLVEPSYKI-NSGDNKSKS  434



>emb|CDY46875.1| BnaC01g27790D [Brassica napus]
Length=631

 Score =   254 bits (650),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 124/193 (64%), Positives = 152/193 (79%), Gaps = 3/193 (2%)
 Frame = +1

Query  1    AIHIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQVEQQK  180
            A+HIPNH+F+VN+VRNLTQ+THWRIKTHLAISHLDV+KIN+IVADMRKVL+KNPQ+EQQK
Sbjct  339  AVHIPNHQFSVNIVRNLTQRTHWRIKTHLAISHLDVSKINSIVADMRKVLSKNPQIEQQK  398

Query  181  LHRRVFLDNIDRENQALLIMVSCFVKTSHFEEYLRVKEVILLDLLRVISHHRARLATPIR  360
            +HRRVFL+++D ENQAL I++SCFVKTS FE+YL VKE +LLDLLRVI HH ARLATPIR
Sbjct  399  IHRRVFLEDVDPENQALRILISCFVKTSRFEDYLCVKEEVLLDLLRVIRHHGARLATPIR  458

Query  361  TVQKIYKEADVDEVPLADSVMTVNRANHPFLLIEPSYKINNSSEDKTKAATPPRPNQEKD  540
            TVQ++  E +VD    +D V      N   +LIEPSYKIN   +D  K++ P    Q+ +
Sbjct  459  TVQRMRNETEVDSAGFSDIVFNQAAMNRRLMLIEPSYKING--DDNAKSSRPKSSEQKGE  516

Query  541  GKS-EVQTTASKA  576
             K  E + T SKA
Sbjct  517  EKDPEGEATDSKA  529



>ref|XP_006581504.1| PREDICTED: mechanosensitive ion channel protein 2, chloroplastic-like 
[Glycine max]
 gb|KHN08999.1| Mechanosensitive ion channel protein 3, chloroplastic [Glycine 
soja]
Length=660

 Score =   254 bits (648),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 129/195 (66%), Positives = 153/195 (78%), Gaps = 5/195 (3%)
 Frame = +1

Query  1    AIHIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQVEQQK  180
            A+HIPNH  +VNVVRNL++K+HWRIKTHLAISHLDVNKIN+I+ADMRKVLAKNPQVEQ+K
Sbjct  341  AVHIPNHNLSVNVVRNLSKKSHWRIKTHLAISHLDVNKINSIIADMRKVLAKNPQVEQKK  400

Query  181  LHRRVFLDNIDRENQALLIMVSCFVKTSHFEEYLRVKEVILLDLLRVISHHRARLATPIR  360
            LHRRVFL+NID ENQAL+I+VSCFVKT H EEYLRVKE ILLDLLRVISHHRARLATPIR
Sbjct  401  LHRRVFLENIDPENQALMILVSCFVKTRHSEEYLRVKEAILLDLLRVISHHRARLATPIR  460

Query  361  TVQKIYKEADVDEVPLADSVMTVNRA--NHPFLLIEPSYKINNSS---EDKTKAATPPRP  525
            TVQK+  + D+D  P  D++ T +R+  N PF LI P YK+  S+   EDK        P
Sbjct  461  TVQKMCSDTDLDVDPFDDTIPTRSRSKNNRPFPLINPPYKVKPSTTTNEDKDTKIDETLP  520

Query  526  NQEKDGKSEVQTTAS  570
            +  K  + +   T+S
Sbjct  521  SDFKVERDKFAATSS  535



>ref|XP_010544065.1| PREDICTED: mechanosensitive ion channel protein 3, chloroplastic 
isoform X1 [Tarenaya hassleriana]
Length=534

 Score =   250 bits (639),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 121/172 (70%), Positives = 144/172 (84%), Gaps = 4/172 (2%)
 Frame = +1

Query  1    AIHIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQVEQQK  180
            A+HIPNHKFTV++VRNL+QKTHWRIKTHL ISHLD+ KINNIVADMRKVLAKNPQVEQQK
Sbjct  335  AVHIPNHKFTVSIVRNLSQKTHWRIKTHLCISHLDIGKINNIVADMRKVLAKNPQVEQQK  394

Query  181  LHRRVFLDNIDRENQALLIMVSCFVKTSHFEEYLRVKEVILLDLLRVISHHRARLATPIR  360
            +HRRVFL++ID ENQAL I++SCFVKTS FEEYL VKE +LLDLLRVI HH A LATPIR
Sbjct  395  IHRRVFLEDIDPENQALKILISCFVKTSRFEEYLCVKEAVLLDLLRVIRHHGAHLATPIR  454

Query  361  TVQKIYKEADVDEVPLADSVMT---VNRANHPFLLIEPSYKINNSSEDKTKA  507
            TVQ++  E +VD+   +D V T    + AN   +L+EPSYKI NS ++K+K+
Sbjct  455  TVQRMRNETEVDKSAFSDIVFTQASSSAANRRLMLVEPSYKI-NSGDNKSKS  505



>gb|AES73164.2| mechanosensitive ion channel-like protein [Medicago truncatula]
Length=591

 Score =   249 bits (635),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 123/184 (67%), Positives = 147/184 (80%), Gaps = 9/184 (5%)
 Frame = +1

Query  1    AIHIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQVEQQK  180
            A+HIPNHK +VNVVRNL++KTHWRIKTHLAISHLDVNKI+ I+ADMRKVLAKNP VEQ+K
Sbjct  335  AVHIPNHKLSVNVVRNLSKKTHWRIKTHLAISHLDVNKIDTIIADMRKVLAKNPLVEQKK  394

Query  181  LHRRVFLDNIDRENQALLIMVSCFVKTSHFEEYLRVKEVILLDLLRVISHHRARLATPIR  360
            LHRRVFL++++ ENQAL+I+VSCFVKTSH EEYLRVKE ILLDLLRVISHH ARLATPIR
Sbjct  395  LHRRVFLEDVNPENQALMILVSCFVKTSHSEEYLRVKEAILLDLLRVISHHGARLATPIR  454

Query  361  TVQKIYKEADVDEVPLADSVMTVNRA--NHPFLLIEPSYKINNSSEDKTKAATPPRPNQE  534
            T+QK+Y ++D++  P  D++ T +RA  NHPF      YK   S++  T        N E
Sbjct  455  TIQKMYSDSDLEIDPFDDAIFTRSRAKGNHPFPFTNSPYKAKPSTQSTT-------VNDE  507

Query  535  KDGK  546
            KD K
Sbjct  508  KDVK  511



>ref|XP_003602913.1| MscS-Like mechanosensitive ion channel MSCL8 [Medicago truncatula]
Length=618

 Score =   249 bits (635),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 123/184 (67%), Positives = 147/184 (80%), Gaps = 9/184 (5%)
 Frame = +1

Query  1    AIHIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQVEQQK  180
            A+HIPNHK +VNVVRNL++KTHWRIKTHLAISHLDVNKI+ I+ADMRKVLAKNP VEQ+K
Sbjct  362  AVHIPNHKLSVNVVRNLSKKTHWRIKTHLAISHLDVNKIDTIIADMRKVLAKNPLVEQKK  421

Query  181  LHRRVFLDNIDRENQALLIMVSCFVKTSHFEEYLRVKEVILLDLLRVISHHRARLATPIR  360
            LHRRVFL++++ ENQAL+I+VSCFVKTSH EEYLRVKE ILLDLLRVISHH ARLATPIR
Sbjct  422  LHRRVFLEDVNPENQALMILVSCFVKTSHSEEYLRVKEAILLDLLRVISHHGARLATPIR  481

Query  361  TVQKIYKEADVDEVPLADSVMTVNRA--NHPFLLIEPSYKINNSSEDKTKAATPPRPNQE  534
            T+QK+Y ++D++  P  D++ T +RA  NHPF      YK   S++  T        N E
Sbjct  482  TIQKMYSDSDLEIDPFDDAIFTRSRAKGNHPFPFTNSPYKAKPSTQSTT-------VNDE  534

Query  535  KDGK  546
            KD K
Sbjct  535  KDVK  538



>gb|KHG03496.1| Mechanosensitive ion channel 2, chloroplastic -like protein [Gossypium 
arboreum]
Length=723

 Score =   244 bits (623),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 125/191 (65%), Positives = 148/191 (77%), Gaps = 24/191 (13%)
 Frame = +1

Query  1    AIHIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQVEQQK  180
            A+HIPNHKFTVNVVRNL+QKTHWRIKTHLAISH+DV+KI+NIVADMRKVLAKNPQVEQQ+
Sbjct  340  AVHIPNHKFTVNVVRNLSQKTHWRIKTHLAISHMDVHKISNIVADMRKVLAKNPQVEQQR  399

Query  181  LHRRVFLDNIDRENQALLIMVSCFVKTSHFEEYLRVKEVILLDLLRVISHHRARLATPIR  360
            LHRRVFL+NI+ ENQAL+                   E ILLDLLRVISHHRARLATPIR
Sbjct  400  LHRRVFLENINPENQALM-------------------EAILLDLLRVISHHRARLATPIR  440

Query  361  TVQKIYKEADVDEVPLADSVMTVN--RANHPFLLIEPSYKINNSSEDKTKAATPPRPNQE  534
            TVQK+Y +AD++ +P ADS    +  ++N P LLIEPSYKIN  SED+TK  +  RP  E
Sbjct  441  TVQKVYSDADLENIPFADSTYNHDGVQSNRPLLLIEPSYKIN--SEDRTKGRS-SRPAGE  497

Query  535  KDGKSEVQTTA  567
            + GK+ V+ +A
Sbjct  498  QGGKTAVRPSA  508



>ref|XP_004501642.1| PREDICTED: mechanosensitive ion channel protein 3, chloroplastic-like 
isoform X2 [Cicer arietinum]
Length=567

 Score =   238 bits (607),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 124/206 (60%), Positives = 153/206 (74%), Gaps = 16/206 (8%)
 Frame = +1

Query  1    AIHIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQVEQQK  180
            A+HIPNH  +VNVVRNL++K+HWRIKTHLAISH D NKIN+IVADMRKVLAKNP VEQ+K
Sbjct  314  AVHIPNHNLSVNVVRNLSKKSHWRIKTHLAISHFDANKINSIVADMRKVLAKNPLVEQRK  373

Query  181  LHRRVFLDNIDRENQALLIMVSCFVKTSHFEEYLRVKEVILLDLLRVISHHRARLATPIR  360
            LHRRVFL++I+ ENQAL+I+VSCFVKTSH EEYLRVKE ILLDLLRVISHH ARLATPIR
Sbjct  374  LHRRVFLEDINPENQALMILVSCFVKTSHSEEYLRVKEAILLDLLRVISHHGARLATPIR  433

Query  361  TVQKIYKEADVDEVPLADSVMTVNRA--NHPFLLIEPSYKINNSSEDKTKAATPPRPNQE  534
            T+QK+Y ++D++  P  D++   + A  N  F +I+  YK+  S++           N E
Sbjct  434  TIQKMYSDSDLEIDPFDDAIFARSAAKRNLSFPVIDLPYKVKPSTQSTI-------VNDE  486

Query  535  KDGK------SEVQTTASK-AVDASP  591
            KD K      SE++    K AV  +P
Sbjct  487  KDAKIHETLVSEIKVDGEKVAVTWTP  512



>ref|XP_004501641.1| PREDICTED: mechanosensitive ion channel protein 3, chloroplastic-like 
isoform X1 [Cicer arietinum]
Length=580

 Score =   238 bits (607),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 139/273 (51%), Positives = 182/273 (67%), Gaps = 24/273 (9%)
 Frame = +1

Query  1    AIHIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQVEQQK  180
            A+HIPNH  +VNVVRNL++K+HWRIKTHLAISH D NKIN+IVADMRKVLAKNP VEQ+K
Sbjct  327  AVHIPNHNLSVNVVRNLSKKSHWRIKTHLAISHFDANKINSIVADMRKVLAKNPLVEQRK  386

Query  181  LHRRVFLDNIDRENQALLIMVSCFVKTSHFEEYLRVKEVILLDLLRVISHHRARLATPIR  360
            LHRRVFL++I+ ENQAL+I+VSCFVKTSH EEYLRVKE ILLDLLRVISHH ARLATPIR
Sbjct  387  LHRRVFLEDINPENQALMILVSCFVKTSHSEEYLRVKEAILLDLLRVISHHGARLATPIR  446

Query  361  TVQKIYKEADVDEVPLADSVMTVNRA--NHPFLLIEPSYKINNSSEDKTKAATPPRPNQE  534
            T+QK+Y ++D++  P  D++   + A  N  F +I+  YK+  S++           N E
Sbjct  447  TIQKMYSDSDLEIDPFDDAIFARSAAKRNLSFPVIDLPYKVKPSTQSTI-------VNDE  499

Query  535  KDGKSEVQTTASKAVDASPPIVDGNRIDTRgssgssTDTEPGV-ATSELDGKMPNTGSVQ  711
            KD K  +  T    +      VDG ++    +  SS  ++  + +TSE       T +V 
Sbjct  500  KDAK--IHETLVSEIK-----VDGEKVAVTWTPSSSVKSQDKLKSTSE-----AKTKNVD  547

Query  712  SKNERQQVDK--VVPGEVDAPSAVSQAKQDGER  804
            S N  Q+  K   +P  + + +  S +KQD E+
Sbjct  548  SDNSVQKGSKSATIPQTLLSSNESSPSKQDEEK  580



>gb|EEC75542.1| hypothetical protein OsI_12168 [Oryza sativa Indica Group]
Length=356

 Score =   230 bits (587),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 113/189 (60%), Positives = 144/189 (76%), Gaps = 9/189 (5%)
 Frame = +1

Query  1    AIHIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQVEQQK  180
            AI+IPNHKFTV+++RN TQ+THWRIKT+LA+SH+D  KI  IVADMRKVLAKNP +EQQ+
Sbjct  26   AIYIPNHKFTVSILRNNTQRTHWRIKTYLALSHMDAAKIGIIVADMRKVLAKNPHIEQQR  85

Query  181  LHRRVFLDNIDRENQALLIMVSCFVKTSHFEEYLRVKEVILLDLLRVISHHRARLATPIR  360
            LHRRVF + ID + QAL+I +SCFVKTSHFEEYL V+E ++LDLLR++ HHRARLAT IR
Sbjct  86   LHRRVFFEKIDPKTQALMIYISCFVKTSHFEEYLNVQEAVMLDLLRIVGHHRARLATQIR  145

Query  361  TVQKIYKEADVDEVPLADSVMTVNRANHPFLLIEPSYKINNSSEDKTKAATPPRPNQEKD  540
            TVQK Y  AD+D +P  + + +  R   P LLI+ S +I   S+DK+K    PRP   +D
Sbjct  146  TVQKSYGNADIDNIPFGEEMYSRVRG-RP-LLIDTSARI---SDDKSK----PRPASRED  196

Query  541  GKSEVQTTA  567
             K +  T+A
Sbjct  197  HKVKTVTSA  205



>ref|XP_001757514.1| MscS-Like mechanosensitive ion channel MSCL8 [Physcomitrella 
patens]
 gb|EDQ77571.1| MscS-Like mechanosensitive ion channel MSCL8, partial [Physcomitrella 
patens]
Length=404

 Score =   231 bits (588),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 111/162 (69%), Positives = 133/162 (82%), Gaps = 1/162 (1%)
 Frame = +1

Query  1    AIHIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQVEQQK  180
            A+HIPNHKF+V+VVRNL+QKTHWRIKTHL ISHLDVNK+  IVADMRKVLAK+PQVEQQ+
Sbjct  242  AVHIPNHKFSVSVVRNLSQKTHWRIKTHLGISHLDVNKMTPIVADMRKVLAKHPQVEQQR  301

Query  181  LHRRVFLDNIDRENQALLIMVSCFVKTSHFEEYLRVKEVILLDLLRVISHHRARLATPIR  360
            LHRRVF D+ID ENQALLI++SCFVKTSHFEEYLRVKE+ILLDLL+VISHH ARLATPIR
Sbjct  302  LHRRVFFDSIDPENQALLILISCFVKTSHFEEYLRVKEIILLDLLKVISHHNARLATPIR  361

Query  361  TVQKIYKEADVDEVPLADSVMTVNRANHPFLLIEPSYKINNS  486
            +VQ++  E +       D + + N+A     L+  S  ++ S
Sbjct  362  SVQRVLDETESRSAGFRD-MRSANQAQRRTFLLLGSQAVSAS  402



>gb|KJB64154.1| hypothetical protein B456_010G034900 [Gossypium raimondii]
Length=668

 Score =   236 bits (602),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 131/246 (53%), Positives = 167/246 (68%), Gaps = 34/246 (14%)
 Frame = +1

Query  1    AIHIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQVEQQK  180
            A+HIPNHKFTVNVVRN++QKTHWRIK + AISHLDVNKINN+VADMRKVLAKNPQVEQQ+
Sbjct  335  AVHIPNHKFTVNVVRNISQKTHWRIKNYFAISHLDVNKINNVVADMRKVLAKNPQVEQQR  394

Query  181  LHRRVFLDNIDRENQALLIMVSCFVKTSHFEEYLRVKEVILLDLLRVISHHRARLATPIR  360
            LHRRVFL++ID +NQALL                   E I+LDLLRVISHHRARLATPIR
Sbjct  395  LHRRVFLESIDPQNQALL-------------------EAIMLDLLRVISHHRARLATPIR  435

Query  361  TVQKIYKEADVDEVPLADSVMTVNRA--NHPFLLIEPSYKINNSSEDKTKAATPPRPNQE  534
            TVQKIY E +++++P AD++   + A  N P LLIEP YKIN  S+DK KA  P R N+E
Sbjct  436  TVQKIYSEPEIEDIPFADTIFRRSGAATNRPLLLIEPDYKIN--SDDKAKA--PTRANEE  491

Query  535  KDGKSEVQTTASKAVDASPPIVDGNRIDTRgssgssTDT-EPGVATSELDGKMPNTGSVQ  711
                     T +   D+      G+ +D++     ++ T   G++++E    +P  GSV+
Sbjct  492  I-------LTPTSTSDSKGNTNSGSALDSKEDKVMASSTNNSGLSSNESGNSVP-VGSVE  543

Query  712  SKNERQ  729
              +E+Q
Sbjct  544  VNSEKQ  549



>ref|XP_002465080.1| hypothetical protein SORBIDRAFT_01g031710 [Sorghum bicolor]
 gb|EER92078.1| hypothetical protein SORBIDRAFT_01g031710 [Sorghum bicolor]
Length=422

 Score =   230 bits (586),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 113/198 (57%), Positives = 148/198 (75%), Gaps = 10/198 (5%)
 Frame = +1

Query  1    AIHIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQVEQQK  180
            AI++PNHKFTV+++RN TQ+THWRIKT+LAISH+D  KI  IVADMRKVLAKNP +EQQK
Sbjct  104  AIYVPNHKFTVSILRNNTQRTHWRIKTYLAISHMDAGKIGTIVADMRKVLAKNPHIEQQK  163

Query  181  LHRRVFLDNIDRENQALLIMVSCFVKTSHFEEYLRVKEVILLDLLRVISHHRARLATPIR  360
            LHRRVF + ID +NQAL+I+VSCFVKTSHFEE+L V+E ++LDLLR++ HH+ARLAT IR
Sbjct  164  LHRRVFFEKIDPKNQALMILVSCFVKTSHFEEFLNVQEAVMLDLLRIVGHHKARLATQIR  223

Query  361  TVQKIYKEADVDEVPLADSVMTVNRANHPFLLIEPSYKINNSSEDKTKAATPPRPNQEKD  540
            TVQK Y  AD D +P  + + +  R     LLI+ S +I   S+DK K    PRP   ++
Sbjct  224  TVQKSYGNADFDNIPFGEDMYSRVRGRP--LLIDTSARI---SDDKPK----PRPVSSRE  274

Query  541  GKSEVQTTASKAVDASPP  594
             + +V+T  S  + ++ P
Sbjct  275  -EHKVKTNGSVEIKSASP  291



>ref|XP_001765846.1| MscS-Like mechanosensitive ion channel MSCL9 [Physcomitrella 
patens]
 gb|EDQ69437.1| MscS-Like mechanosensitive ion channel MSCL9, partial [Physcomitrella 
patens]
Length=410

 Score =   229 bits (583),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 108/155 (70%), Positives = 126/155 (81%), Gaps = 0/155 (0%)
 Frame = +1

Query  1    AIHIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQVEQQK  180
            A+HIPNHKF+V+VVRNL+QKTHWRIK HL ISHLDV+K+  IV DMRKVLAK+PQVEQ +
Sbjct  242  AVHIPNHKFSVSVVRNLSQKTHWRIKMHLGISHLDVSKLAPIVTDMRKVLAKHPQVEQHR  301

Query  181  LHRRVFLDNIDRENQALLIMVSCFVKTSHFEEYLRVKEVILLDLLRVISHHRARLATPIR  360
            LHRRVF D ID ENQAL+I+VSCFVKTSHFEEYLRVKEVI+LDLL+VI HH ARLATPIR
Sbjct  302  LHRRVFFDQIDPENQALMILVSCFVKTSHFEEYLRVKEVIILDLLKVIGHHSARLATPIR  361

Query  361  TVQKIYKEADVDEVPLADSVMTVNRANHPFLLIEP  465
            +VQ++  E++    P  D   T      PFLL+ P
Sbjct  362  SVQRVIDESEARSSPFRDMRNTNQNQRRPFLLVNP  396



>gb|EEE59315.1| hypothetical protein OsJ_11375 [Oryza sativa Japonica Group]
Length=574

 Score =   230 bits (586),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 113/189 (60%), Positives = 144/189 (76%), Gaps = 9/189 (5%)
 Frame = +1

Query  1    AIHIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQVEQQK  180
            AI+IPNHKFTV+++RN TQ+THWRIKT+LA+SH+D  KI  IVADMRKVLAKNP +EQQ+
Sbjct  244  AIYIPNHKFTVSILRNNTQRTHWRIKTYLALSHMDAAKIGIIVADMRKVLAKNPHIEQQR  303

Query  181  LHRRVFLDNIDRENQALLIMVSCFVKTSHFEEYLRVKEVILLDLLRVISHHRARLATPIR  360
            LHRRVF + ID + QAL+I +SCFVKTSHFEEYL V+E ++LDLLR++ HHRARLAT IR
Sbjct  304  LHRRVFFEKIDPKTQALMIYISCFVKTSHFEEYLNVQEAVMLDLLRIVGHHRARLATQIR  363

Query  361  TVQKIYKEADVDEVPLADSVMTVNRANHPFLLIEPSYKINNSSEDKTKAATPPRPNQEKD  540
            TVQK Y  AD+D +P  + + +  R   P LLI+ S +I   S+DK+K    PRP   +D
Sbjct  364  TVQKSYGNADIDNIPFGEEMYSRVRG-RP-LLIDTSARI---SDDKSK----PRPASRED  414

Query  541  GKSEVQTTA  567
             K +  T+A
Sbjct  415  HKVKTVTSA  423



>gb|AAS07290.1| putative mechanosensitive ion channel protein [Oryza sativa Japonica 
Group]
Length=661

 Score =   229 bits (585),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 112/189 (59%), Positives = 143/189 (76%), Gaps = 9/189 (5%)
 Frame = +1

Query  1    AIHIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQVEQQK  180
            AI+IPNHKFTV+++RN TQ+THWRIKT+LA+SH+D  KI  IVADMRKVLAKNP +EQQ+
Sbjct  331  AIYIPNHKFTVSILRNNTQRTHWRIKTYLALSHMDAAKIGIIVADMRKVLAKNPHIEQQR  390

Query  181  LHRRVFLDNIDRENQALLIMVSCFVKTSHFEEYLRVKEVILLDLLRVISHHRARLATPIR  360
            LHRRVF + ID + QAL+I +SCFVKTSHFEEYL V+E ++LDLLR++ HHRARLAT IR
Sbjct  391  LHRRVFFEKIDPKTQALMIYISCFVKTSHFEEYLNVQEAVMLDLLRIVGHHRARLATQIR  450

Query  361  TVQKIYKEADVDEVPLADSVMTVNRANHPFLLIEPSYKINNSSEDKTKAATPPRPNQEKD  540
            TVQK Y  AD+D +P  + + +  R     LLI+ S +I   S+DK+K    PRP   +D
Sbjct  451  TVQKSYGNADIDNIPFGEEMYSRVRGRP--LLIDTSARI---SDDKSK----PRPASRED  501

Query  541  GKSEVQTTA  567
             K +  T+A
Sbjct  502  HKVKTVTSA  510



>ref|XP_001763022.1| MscS-Like mechanosensitive ion channel MSCL10 [Physcomitrella 
patens]
 gb|EDQ72227.1| MscS-Like mechanosensitive ion channel MSCL10, partial [Physcomitrella 
patens]
Length=318

 Score =   219 bits (559),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 105/155 (68%), Positives = 122/155 (79%), Gaps = 0/155 (0%)
 Frame = +1

Query  1    AIHIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQVEQQK  180
            A+HIPNHKF+V+VVRNL+QK+HWRIKTHL I HLDV K+  IVADMRKVLAK+PQVEQ +
Sbjct  164  AVHIPNHKFSVSVVRNLSQKSHWRIKTHLGIRHLDVGKMTLIVADMRKVLAKHPQVEQHR  223

Query  181  LHRRVFLDNIDRENQALLIMVSCFVKTSHFEEYLRVKEVILLDLLRVISHHRARLATPIR  360
            LHRRVF D ID ENQALLI+VSCFVKTSH EEYLRVKE+ILLDLL+V+SHH ARLATPIR
Sbjct  224  LHRRVFFDQIDPENQALLILVSCFVKTSHIEEYLRVKELILLDLLKVVSHHSARLATPIR  283

Query  361  TVQKIYKEADVDEVPLADSVMTVNRANHPFLLIEP  465
            +VQ++  E +    P  D            LL+ P
Sbjct  284  SVQRVVDENEAKSSPFRDMRNVNQNQQRSLLLLNP  318



>ref|XP_008657401.1| PREDICTED: mechanosensitive ion channel protein 2, chloroplastic-like 
[Zea mays]
 ref|XP_008657405.1| PREDICTED: mechanosensitive ion channel protein 2, chloroplastic-like 
[Zea mays]
 tpg|DAA45912.1| TPA: hypothetical protein ZEAMMB73_580044 [Zea mays]
 tpg|DAA45913.1| TPA: hypothetical protein ZEAMMB73_580044 [Zea mays]
Length=651

 Score =   227 bits (579),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 112/190 (59%), Positives = 143/190 (75%), Gaps = 10/190 (5%)
 Frame = +1

Query  1    AIHIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQVEQQK  180
            AI+IPNHKFTV+++RN TQ+THWRIKT+LAISH+D  KI  IVADMRKVLAKNP +EQQK
Sbjct  333  AIYIPNHKFTVSILRNNTQRTHWRIKTYLAISHMDAGKIGTIVADMRKVLAKNPHIEQQK  392

Query  181  LHRRVFLDNIDRENQALLIMVSCFVKTSHFEEYLRVKEVILLDLLRVISHHRARLATPIR  360
            LHRRVF + ID +NQAL+I +SCFVKTSHFEEYL V+E ++LDLLR++ HH+ARLAT IR
Sbjct  393  LHRRVFFEKIDPKNQALMIFISCFVKTSHFEEYLNVQEAVMLDLLRIVGHHKARLATQIR  452

Query  361  TVQKIYKEADVDEVPLADSVMTVNRANHPFLLIEPSYKINNSSEDKTKAATPPRPNQEKD  540
            TVQK Y  AD D +P  + + +  R     LLI+ S +I   S+DK +    PRP   ++
Sbjct  453  TVQKSYGNADFDNIPFGEDMYSRVRGRP--LLIDTSARI---SDDKPR----PRPVSSRE  503

Query  541  GKSEVQTTAS  570
             + +V+T  S
Sbjct  504  -EQKVKTNGS  512



>ref|XP_003562370.1| PREDICTED: mechanosensitive ion channel protein 2, chloroplastic-like 
[Brachypodium distachyon]
 ref|XP_010233310.1| PREDICTED: mechanosensitive ion channel protein 2, chloroplastic-like 
[Brachypodium distachyon]
Length=673

 Score =   227 bits (578),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 115/205 (56%), Positives = 150/205 (73%), Gaps = 12/205 (6%)
 Frame = +1

Query  1    AIHIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQVEQQK  180
            AI+IPNHKFT++++RN T+++HWRIKT+LAISH+D  KI  IVADMRKVLAKN Q+EQQK
Sbjct  338  AIYIPNHKFTMSILRNNTRRSHWRIKTYLAISHMDAGKIGTIVADMRKVLAKNHQIEQQK  397

Query  181  LHRRVFLDNIDRENQALLIMVSCFVKTSHFEEYLRVKEVILLDLLRVISHHRARLATPIR  360
            LHRRVF + ID + QAL+I +SCFVKTSHFEEYL V+E ++LDLL ++ HHRARLAT IR
Sbjct  398  LHRRVFFEKIDPKTQALMIYISCFVKTSHFEEYLNVQETVMLDLLTIVGHHRARLATQIR  457

Query  361  TVQKIYKEADVDEVPLADSVMTVNRANHPFLLIEPSYKINNSSEDKTKAATPPRPNQEKD  540
            TVQK Y  AD+D +P  + + +  R     LLI+ S +I  SS+DK+K    PRP   +D
Sbjct  458  TVQKSYGNADIDNIPFGEDIYSRVRGRP--LLIDTSARI--SSDDKSK----PRPVSRED  509

Query  541  GKSEVQTTASKAVDASPPIVDGNRI  615
             K  V+T+ S    ++ P  DG  +
Sbjct  510  QK--VKTSVSVETKSASP--DGASV  530



>gb|EMT08062.1| MscS family inner membrane protein ynaI [Aegilops tauschii]
Length=429

 Score =   221 bits (564),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 113/207 (55%), Positives = 148/207 (71%), Gaps = 11/207 (5%)
 Frame = +1

Query  1    AIHIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQVEQQK  180
            AI+IPNHKFT++++RN T++ HWRIKT+LAISH+D  KI  IVADMRKVLAKN  +EQQK
Sbjct  104  AIYIPNHKFTMSILRNNTRRNHWRIKTYLAISHMDAGKIGIIVADMRKVLAKNHHIEQQK  163

Query  181  LHRRVFLDNIDRENQALLIMVSCFVKTSHFEEYLRVKEVILLDLLRVISHHRARLATPIR  360
            LHRRVF + ID + QAL+I +SCFVKTSHFEEYL V+E ++LDLL ++ HHRARLAT IR
Sbjct  164  LHRRVFFEKIDPKTQALMIYISCFVKTSHFEEYLNVQEAVMLDLLTIVGHHRARLATQIR  223

Query  361  TVQKIYKEADVDEVPLADSVMTVNRANHPFLLIEPSYKINNSSEDKTKAATPPRPN-QEK  537
            TVQK Y  AD+D +P  +   +      P LLI+ S +I   S+DK     PPRP    +
Sbjct  224  TVQKSYGNADIDNIPFGEDTYSPRARGRP-LLIDTSARI---SDDK----KPPRPAVARE  275

Query  538  DGKSEVQTTASKAVDASPPIVDGNRID  618
            D K++V + +  AV+A     DG+ ++
Sbjct  276  DQKAKVASVS--AVEAKSDAPDGSSLN  300



>ref|XP_004983930.1| PREDICTED: mechanosensitive ion channel protein 2, chloroplastic-like 
isoform X2 [Setaria italica]
Length=623

 Score =   224 bits (570),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 111/198 (56%), Positives = 146/198 (74%), Gaps = 10/198 (5%)
 Frame = +1

Query  1    AIHIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQVEQQK  180
            AI+IPNHKFTV+++RN +Q+THWRIKT+LAISH+D  KI  IVADMRKVLAKNP +EQQK
Sbjct  293  AIYIPNHKFTVSILRNNSQRTHWRIKTYLAISHMDAGKIGIIVADMRKVLAKNPHIEQQK  352

Query  181  LHRRVFLDNIDRENQALLIMVSCFVKTSHFEEYLRVKEVILLDLLRVISHHRARLATPIR  360
            LHRRVF + ID +NQAL+I +SCFVKTS FEEYL V+E ++LDLLR++ HH+ARLAT IR
Sbjct  353  LHRRVFFEKIDPKNQALMIYISCFVKTSRFEEYLNVQEAVMLDLLRIVGHHKARLATQIR  412

Query  361  TVQKIYKEADVDEVPLADSVMTVNRANHPFLLIEPSYKINNSSEDKTKAATPPRPNQEKD  540
            TVQK Y  AD D +P  + + +  R     LLI+ S ++   S+DK K    PRP    +
Sbjct  413  TVQKSYGNADFDNIPFGEDMYSRVRGRP--LLIDTSARV---SDDKAK----PRPVSSHE  463

Query  541  GKSEVQTTASKAVDASPP  594
             + +V+T  S  ++++ P
Sbjct  464  -EQKVKTNGSVEINSASP  480



>gb|EMS62699.1| MscS family inner membrane protein ynaI [Triticum urartu]
Length=429

 Score =   219 bits (558),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 111/207 (54%), Positives = 147/207 (71%), Gaps = 11/207 (5%)
 Frame = +1

Query  1    AIHIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQVEQQK  180
            AI+IPNHKFT++++RN T++ HWRIKT+LAISH+D  KI  IVADMRKVLAKN  +EQQK
Sbjct  104  AIYIPNHKFTMSILRNNTRRNHWRIKTYLAISHMDAGKIGIIVADMRKVLAKNHHIEQQK  163

Query  181  LHRRVFLDNIDRENQALLIMVSCFVKTSHFEEYLRVKEVILLDLLRVISHHRARLATPIR  360
            LHRRVF + ID + QAL+I +SCFVKTSHFEEYL V+E ++LDLL ++ HHRARLAT IR
Sbjct  164  LHRRVFFEKIDPKTQALMIYISCFVKTSHFEEYLNVQEAVMLDLLTIVGHHRARLATQIR  223

Query  361  TVQKIYKEADVDEVPLADSVMTVNRANHPFLLIEPSYKINNSSEDKTKAATPPRP-NQEK  537
            TVQK Y  AD+D +P  +   +      P LLI+ S +I   S+DK     PPRP    +
Sbjct  224  TVQKSYGNADIDNIPFGEDTYSPRARGRP-LLIDTSARI---SDDK----KPPRPVVARE  275

Query  538  DGKSEVQTTASKAVDASPPIVDGNRID  618
            D K++V + ++    +  P  DG+ ++
Sbjct  276  DQKAKVASVSAVETKSDAP--DGSSLN  300



>ref|XP_004983929.1| PREDICTED: mechanosensitive ion channel protein 2, chloroplastic-like 
isoform X1 [Setaria italica]
Length=663

 Score =   224 bits (571),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 111/198 (56%), Positives = 146/198 (74%), Gaps = 10/198 (5%)
 Frame = +1

Query  1    AIHIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQVEQQK  180
            AI+IPNHKFTV+++RN +Q+THWRIKT+LAISH+D  KI  IVADMRKVLAKNP +EQQK
Sbjct  333  AIYIPNHKFTVSILRNNSQRTHWRIKTYLAISHMDAGKIGIIVADMRKVLAKNPHIEQQK  392

Query  181  LHRRVFLDNIDRENQALLIMVSCFVKTSHFEEYLRVKEVILLDLLRVISHHRARLATPIR  360
            LHRRVF + ID +NQAL+I +SCFVKTS FEEYL V+E ++LDLLR++ HH+ARLAT IR
Sbjct  393  LHRRVFFEKIDPKNQALMIYISCFVKTSRFEEYLNVQEAVMLDLLRIVGHHKARLATQIR  452

Query  361  TVQKIYKEADVDEVPLADSVMTVNRANHPFLLIEPSYKINNSSEDKTKAATPPRPNQEKD  540
            TVQK Y  AD D +P  + + +  R     LLI+ S ++   S+DK K    PRP    +
Sbjct  453  TVQKSYGNADFDNIPFGEDMYSRVRGRP--LLIDTSARV---SDDKAK----PRPVSSHE  503

Query  541  GKSEVQTTASKAVDASPP  594
             + +V+T  S  ++++ P
Sbjct  504  -EQKVKTNGSVEINSASP  520



>gb|ABF96777.1| Transposable element protein, putative, MuDR, expressed [Oryza 
sativa Japonica Group]
Length=1837

 Score =   228 bits (581),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 113/189 (60%), Positives = 144/189 (76%), Gaps = 9/189 (5%)
 Frame = +1

Query  1    AIHIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQVEQQK  180
            AI+IPNHKFTV+++RN TQ+THWRIKT+LA+SH+D  KI  IVADMRKVLAKNP +EQQ+
Sbjct  104  AIYIPNHKFTVSILRNNTQRTHWRIKTYLALSHMDAAKIGIIVADMRKVLAKNPHIEQQR  163

Query  181  LHRRVFLDNIDRENQALLIMVSCFVKTSHFEEYLRVKEVILLDLLRVISHHRARLATPIR  360
            LHRRVF + ID + QAL+I +SCFVKTSHFEEYL V+E ++LDLLR++ HHRARLAT IR
Sbjct  164  LHRRVFFEKIDPKTQALMIYISCFVKTSHFEEYLNVQEAVMLDLLRIVGHHRARLATQIR  223

Query  361  TVQKIYKEADVDEVPLADSVMTVNRANHPFLLIEPSYKINNSSEDKTKAATPPRPNQEKD  540
            TVQK Y  AD+D +P  + + +  R   P LLI+ S +I   S+DK+K    PRP   +D
Sbjct  224  TVQKSYGNADIDNIPFGEEMYSRVRGR-P-LLIDTSARI---SDDKSK----PRPASRED  274

Query  541  GKSEVQTTA  567
             K +  T+A
Sbjct  275  HKVKTVTSA  283



>ref|XP_002980284.1| hypothetical protein SELMODRAFT_112712 [Selaginella moellendorffii]
 gb|EFJ18544.1| hypothetical protein SELMODRAFT_112712 [Selaginella moellendorffii]
Length=566

 Score =   220 bits (560),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 95/141 (67%), Positives = 125/141 (89%), Gaps = 0/141 (0%)
 Frame = +1

Query  1    AIHIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQVEQQK  180
            A+HIPNHKFT++VVRNL+QKTHWR+KT++ +SHLD +KI+ IVADMRKVL+K+PQVE ++
Sbjct  246  AVHIPNHKFTMSVVRNLSQKTHWRVKTYIGLSHLDASKIHVIVADMRKVLSKHPQVEHRR  305

Query  181  LHRRVFLDNIDRENQALLIMVSCFVKTSHFEEYLRVKEVILLDLLRVISHHRARLATPIR  360
            LHRRVF DNID  NQ+L+IM+SCFVKTSH+EEYL VKE+ILL+LL+VISHH ARLATPIR
Sbjct  306  LHRRVFFDNIDPSNQSLMIMISCFVKTSHYEEYLSVKEIILLNLLKVISHHNARLATPIR  365

Query  361  TVQKIYKEADVDEVPLADSVM  423
            ++Q++Y EA+  + P  + ++
Sbjct  366  SIQRVYDEAETRQSPYRNVLL  386



>ref|XP_006663776.1| PREDICTED: mechanosensitive ion channel protein 2, chloroplastic-like 
[Oryza brachyantha]
Length=655

 Score =   220 bits (560),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 110/198 (56%), Positives = 144/198 (73%), Gaps = 11/198 (6%)
 Frame = +1

Query  1    AIHIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQVEQQK  180
            AI+IPNHKFTV+++RN TQ+THWRIKT+LA+SH+D  K+  IVADMRKVLAKNP +EQQ+
Sbjct  328  AIYIPNHKFTVSILRNNTQRTHWRIKTYLALSHMDAAKVGIIVADMRKVLAKNPNIEQQR  387

Query  181  LHRRVFLDNIDRENQALLIMVSCFVKTSHFEEYLRVKEVILLDLLRVISHHRARLATPIR  360
            LHRRVF + ID + QAL+I +SCFVKTS FEEYL V+E ++LDLLR++ HH+ARLAT IR
Sbjct  388  LHRRVFFEKIDPKTQALMIYISCFVKTSRFEEYLNVQEAVMLDLLRIVGHHKARLATQIR  447

Query  361  TVQKIYKEADVDEVPLADSVMTVNRANHPFLLIEPSYKINNSSEDKTKAATPPRPNQEKD  540
            TVQK Y  AD+D +P  + + +  R     LLI+ S +I   S+DK+K    P P   ++
Sbjct  448  TVQKSYGNADIDNIPFGEEMYSRVRGRP--LLIDTSARI---SDDKSK----PHPASREE  498

Query  541  GKSEVQTTASKAVDASPP  594
             K  V+T AS     + P
Sbjct  499  HK--VKTVASTETKPASP  514



>ref|XP_006663175.1| PREDICTED: mechanosensitive ion channel protein 2, chloroplastic-like 
[Oryza brachyantha]
Length=657

 Score =   220 bits (560),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 110/198 (56%), Positives = 144/198 (73%), Gaps = 11/198 (6%)
 Frame = +1

Query  1    AIHIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQVEQQK  180
            AI+IPNHKFTV+++RN TQ+THWRIKT+LA+SH+D  K+  IVADMRKVLAKNP +EQQ+
Sbjct  333  AIYIPNHKFTVSILRNNTQRTHWRIKTYLALSHMDAAKVGIIVADMRKVLAKNPNIEQQR  392

Query  181  LHRRVFLDNIDRENQALLIMVSCFVKTSHFEEYLRVKEVILLDLLRVISHHRARLATPIR  360
            LHRRVF + ID + QAL+I +SCFVKTS FEEYL V+E ++LDLLR++ HH+ARLAT IR
Sbjct  393  LHRRVFFEKIDPKTQALMIYISCFVKTSRFEEYLNVQEAVMLDLLRIVGHHKARLATQIR  452

Query  361  TVQKIYKEADVDEVPLADSVMTVNRANHPFLLIEPSYKINNSSEDKTKAATPPRPNQEKD  540
            TVQK Y  AD+D +P  + + +  R     LLI+ S +I   S+DK+K    P P   ++
Sbjct  453  TVQKSYGNADIDNIPFGEEMYSRVRGRP--LLIDTSARI---SDDKSK----PHPASREE  503

Query  541  GKSEVQTTASKAVDASPP  594
             K  V+T AS     + P
Sbjct  504  HK--VKTVASTETKPASP  519



>dbj|BAK02907.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=550

 Score =   218 bits (554),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 111/204 (54%), Positives = 144/204 (71%), Gaps = 11/204 (5%)
 Frame = +1

Query  1    AIHIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQVEQQK  180
            AI+IPNHKFT++++RN T++ HWRIKT+LAISH+D  KI  IVA MRKVLAKN  +EQQK
Sbjct  337  AIYIPNHKFTMSILRNNTRRNHWRIKTYLAISHMDAGKIGIIVAGMRKVLAKNHNIEQQK  396

Query  181  LHRRVFLDNIDRENQALLIMVSCFVKTSHFEEYLRVKEVILLDLLRVISHHRARLATPIR  360
            LHRRVF + ID + QAL+I +SCFVKTSHFEEYL V+E ++LDLL ++ HHRARLAT IR
Sbjct  397  LHRRVFFEKIDPKTQALMIYISCFVKTSHFEEYLNVQEAVMLDLLTIVGHHRARLATQIR  456

Query  361  TVQKIYKEADVDEVPLADSVMTVNRANHPFLLIEPSYKINNSSEDKTKAATPPRPN-QEK  537
            TVQK Y  AD+D +P  +   +      P LLI+ S +I   S+DK     PPRP    +
Sbjct  457  TVQKSYGNADIDNIPFGEDTYSPRARGRP-LLIDTSARI---SDDK----KPPRPAVARE  508

Query  538  DGKSEVQTTASKAVDASPPIVDGN  609
            D K++V + +S    +  P  DG+
Sbjct  509  DQKAKVASVSSAETKSDAP--DGS  530



>gb|AAG50758.1|AC079131_3 unknown protein [Arabidopsis thaliana]
Length=657

 Score =   219 bits (557),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 124/238 (52%), Positives = 160/238 (67%), Gaps = 32/238 (13%)
 Frame = +1

Query  1    AIHIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQVEQQK  180
            A+HIPNH+F+VN+VRNLTQKTHWRIKTHLAISHLDV+KINNIVADMRKVL+KNPQ+EQQK
Sbjct  335  AVHIPNHQFSVNIVRNLTQKTHWRIKTHLAISHLDVSKINNIVADMRKVLSKNPQIEQQK  394

Query  181  LHRRVFLDNIDRENQALLIMVSCFVKTSHFEEYLRVKEVILLDLLRVISHHRARLATPIR  360
            +HRRVFL++ID ENQAL                   +E +LLDLL VI HH ARLATPIR
Sbjct  395  IHRRVFLEDIDPENQAL-------------------REAVLLDLLTVIRHHGARLATPIR  435

Query  361  TVQKIYKEADVDEVPLADSVMTVNRANHPFLLIEPSYKINNSSEDKTKAATP------PR  522
            TVQ++  EA+VD    +D V      N  ++LIEPSYKIN  S+D +K+ +P      P 
Sbjct  436  TVQRMRNEAEVDTAGFSDIVFNQAAMNRRYMLIEPSYKIN--SDDNSKSPSPSPGQKSPS  493

Query  523  PNQ---EKDGKSE-VQTTASKAVDASPPIVDGNRIDTRgssgssTDTEP-GVATSELD  681
            P Q   E+D + E  +T A    + S P+ +  + + + + GS+++T   G +TS  D
Sbjct  494  PGQKSEERDLQEEPSETKAETENNGSVPVSNAKKENQKAALGSNSNTGTKGSSTSTSD  551



>ref|XP_010227139.1| PREDICTED: mechanosensitive ion channel protein 2, chloroplastic-like 
[Brachypodium distachyon]
Length=654

 Score =   219 bits (557),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 108/190 (57%), Positives = 139/190 (73%), Gaps = 5/190 (3%)
 Frame = +1

Query  1    AIHIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQVEQQK  180
            AI+IPNHKFTV+++RN T+++HWRIKT+LAISH+D  KI  IVADMRKVLAKN Q+EQQK
Sbjct  333  AIYIPNHKFTVSILRNNTRRSHWRIKTYLAISHMDAGKIGVIVADMRKVLAKNHQIEQQK  392

Query  181  LHRRVFLDNIDRENQALLIMVSCFVKTSHFEEYLRVKEVILLDLLRVISHHRARLATPIR  360
            LHRRVF + ID + QAL+I VSCFVKT+H EEYL V+E +LLD LR++ HHRARLAT  R
Sbjct  393  LHRRVFFEQIDPKTQALMIFVSCFVKTTHLEEYLNVQEDVLLDFLRIVGHHRARLATQTR  452

Query  361  TVQKIYKEADVDEVPLADSVMTVNRANHPFLLIEPSYKINNSSEDKTKAATPPRPNQEKD  540
            TVQK Y  AD+D +P  + +   NR     LLI+ S KI   SE K+K+ +  R   +  
Sbjct  453  TVQKSYGNADIDNIPFGEEMY--NRVRGRPLLIDTSAKI---SEGKSKSRSASREEHKFK  507

Query  541  GKSEVQTTAS  570
              + V+T ++
Sbjct  508  TSASVETKSA  517



>ref|XP_002970731.1| hypothetical protein SELMODRAFT_94155, partial [Selaginella moellendorffii]
 gb|EFJ28057.1| hypothetical protein SELMODRAFT_94155, partial [Selaginella moellendorffii]
Length=481

 Score =   210 bits (534),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 103/156 (66%), Positives = 123/156 (79%), Gaps = 6/156 (4%)
 Frame = +1

Query  1    AIHIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQVEQQK  180
            A+HIPNHKFTV+VVRNL+QKTHWRIKTHLAISHLD  KI  IVADMRKVLAK+ QVE ++
Sbjct  180  AVHIPNHKFTVSVVRNLSQKTHWRIKTHLAISHLDAGKIALIVADMRKVLAKHSQVEHKR  239

Query  181  LHRRVFLDNIDRENQALLIMVSCFVKTSHFEEYLRVKEVILLDLLRVISHHRARLATPIR  360
            LHRRVFLD +  E+QAL ++VSCFVKTSHFEEYLRVKE ILLD+L+VISHH ARLATPIR
Sbjct  240  LHRRVFLDYVHPESQALHVLVSCFVKTSHFEEYLRVKETILLDILKVISHHNARLATPIR  299

Query  361  TVQKIYKE------ADVDEVPLADSVMTVNRANHPF  450
            ++ ++  +      A   + PL  S  +V  + HP 
Sbjct  300  SIHRVSADEPQQAPASKYDRPLLISESSVLSSEHPL  335



>ref|XP_002969394.1| hypothetical protein SELMODRAFT_170827 [Selaginella moellendorffii]
 gb|EFJ29482.1| hypothetical protein SELMODRAFT_170827 [Selaginella moellendorffii]
Length=486

 Score =   206 bits (525),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 102/156 (65%), Positives = 122/156 (78%), Gaps = 6/156 (4%)
 Frame = +1

Query  1    AIHIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQVEQQK  180
            A+HIPNHKFTV+VVRNL+QKTHWRIKTHLAISHLD  KI  IVADMRKVLAK+ QVE ++
Sbjct  214  AVHIPNHKFTVSVVRNLSQKTHWRIKTHLAISHLDAGKIALIVADMRKVLAKHSQVEHKR  273

Query  181  LHRRVFLDNIDRENQALLIMVSCFVKTSHFEEYLRVKEVILLDLLRVISHHRARLATPIR  360
            LHRRVFLD +  E+QAL ++VSCFVKTS FEEYLRVKE ILLD+L+VISHH ARLATPIR
Sbjct  274  LHRRVFLDYVHPESQALHVLVSCFVKTSRFEEYLRVKETILLDILKVISHHNARLATPIR  333

Query  361  TVQKIYKE------ADVDEVPLADSVMTVNRANHPF  450
            ++ ++  +      A   + PL  S  +V  + HP 
Sbjct  334  SIHRVSADEPQQAPASKYDRPLLISETSVLSSEHPL  369



>ref|XP_002963051.1| hypothetical protein SELMODRAFT_61619, partial [Selaginella moellendorffii]
 gb|EFJ36514.1| hypothetical protein SELMODRAFT_61619, partial [Selaginella moellendorffii]
Length=530

 Score =   206 bits (524),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 90/141 (64%), Positives = 122/141 (87%), Gaps = 3/141 (2%)
 Frame = +1

Query  1    AIHIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQVEQQK  180
            A+HIPNHKFT++VVRNL+QKTHWR+KT++ +SHLD +KI+ IVADMRKVL+K+PQVE ++
Sbjct  228  AVHIPNHKFTMSVVRNLSQKTHWRVKTYIGLSHLDASKIHVIVADMRKVLSKHPQVEHRR  287

Query  181  LHRRVFLDNIDRENQALLIMVSCFVKTSHFEEYLRVKEVILLDLLRVISHHRARLATPIR  360
            LHRRVF DNID  NQ+L+IM+SCFVKTSH+E+   + E+ILL+LL+VISHH ARLATPIR
Sbjct  288  LHRRVFFDNIDPSNQSLMIMISCFVKTSHYED---ISEIILLNLLKVISHHNARLATPIR  344

Query  361  TVQKIYKEADVDEVPLADSVM  423
            ++Q++Y EA+  + P  + ++
Sbjct  345  SIQRVYDEAETRQSPYRNVLL  365



>ref|XP_006380805.1| hypothetical protein POPTR_0007s14270g [Populus trichocarpa]
 gb|ERP58602.1| hypothetical protein POPTR_0007s14270g [Populus trichocarpa]
Length=722

 Score =   208 bits (530),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 113/189 (60%), Positives = 128/189 (68%), Gaps = 35/189 (19%)
 Frame = +1

Query  1    AIHIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQVEQQK  180
            A+HIPNHKFTVNV                           NIVADMRKVLAKNPQVEQQ+
Sbjct  338  AVHIPNHKFTVNV---------------------------NIVADMRKVLAKNPQVEQQR  370

Query  181  LHRRVFLDNIDRENQALLIMVSCFVKTSHFEEYLRVKEVILLDLLRVISHHRARLATPIR  360
            LHRR+FLDNI+ ENQALLI+VSCFVKTSH EEYL VKE IL+DLLRVISHHRARLATPIR
Sbjct  371  LHRRIFLDNINPENQALLILVSCFVKTSHHEEYLCVKEAILMDLLRVISHHRARLATPIR  430

Query  361  TVQKIY---KEADVDEVPLADSVMTVN--RANHPFLLIEPSYKINNSSEDKTKA-ATPPR  522
            T+QKIY    + D++ VP  DS+       +  P LLIEPSY+IN   EDK K+ A   R
Sbjct  431  TIQKIYSDTSDTDIENVPFTDSIYNHGGVASKRPLLLIEPSYRING--EDKAKSQARSGR  488

Query  523  PNQEKDGKS  549
               EKD K+
Sbjct  489  VTGEKDSKT  497



>ref|XP_001751467.1| MscS-Like mechanosensitive ion channel MSCL11 [Physcomitrella 
patens]
 gb|EDQ83784.1| MscS-Like mechanosensitive ion channel MSCL11, partial [Physcomitrella 
patens]
Length=311

 Score =   199 bits (507),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 88/124 (71%), Positives = 112/124 (90%), Gaps = 0/124 (0%)
 Frame = +1

Query  1    AIHIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQVEQQK  180
            A+ +PNHKF+V+VVRN TQKTHWRIKTH+ I+H DV KI+NIVADMRKVLA +P++EQ++
Sbjct  179  AVLVPNHKFSVSVVRNFTQKTHWRIKTHIGINHRDVQKISNIVADMRKVLANHPEIEQKR  238

Query  181  LHRRVFLDNIDRENQALLIMVSCFVKTSHFEEYLRVKEVILLDLLRVISHHRARLATPIR  360
            LHRRVF D+I+ +N AL+I+VSCFVKTS FEEYLRVKEVILLDLL+V++HH  RLATP+R
Sbjct  239  LHRRVFFDHINSQNLALMIIVSCFVKTSRFEEYLRVKEVILLDLLKVVAHHGGRLATPLR  298

Query  361  TVQK  372
            ++Q+
Sbjct  299  SMQR  302



>gb|KHG22140.1| Mechanosensitive ion channel 2, chloroplastic -like protein [Gossypium 
arboreum]
Length=651

 Score =   205 bits (522),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 107/189 (57%), Positives = 136/189 (72%), Gaps = 5/189 (3%)
 Frame = +1

Query  115  INNIVADMRKVLAKNPQVEQQKLHRRVFLDNIDRENQALLIMVSCFVKTSHFEEYLRVKE  294
            + NIVADMRKVLAKNPQVEQQ+LHRRVFL+N+  ENQALLI+VSCFVKTSH EEYL VKE
Sbjct  319  VENIVADMRKVLAKNPQVEQQRLHRRVFLENVSPENQALLILVSCFVKTSHLEEYLCVKE  378

Query  295  VILLDLLRVISHHRARLATPIRTVQKIYKEADVDEVPLADSVMTVN--RANHPFLLIEPS  468
             ILLDLLRVISHHRARLATPIRTVQK+  +++++ VP ADS+       +N P LLIEP+
Sbjct  379  AILLDLLRVISHHRARLATPIRTVQKVVGDSELENVPFADSIYNHGGVSSNRPLLLIEPA  438

Query  469  YKINNSSEDKTKAATPPRPNQEKDGKSEVQTTASKAVDASPPIVDGNRIDTRgssgssTD  648
            YKIN   ED+TK  +  +P  E+D K+ V+  A     A+P     ++ D +     +++
Sbjct  439  YKING--EDRTKGRS-AQPTGEQDSKTTVRPAADNKAGATPKPDSKSKADAKVGESPNSE  495

Query  649  TEPGVATSE  675
            T+   A+ E
Sbjct  496  TKASNASFE  504



>ref|XP_010107673.1| Mechanosensitive ion channel protein 3 [Morus notabilis]
 gb|EXC16646.1| Mechanosensitive ion channel protein 3 [Morus notabilis]
Length=422

 Score =   191 bits (484),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 89/103 (86%), Positives = 96/103 (93%), Gaps = 0/103 (0%)
 Frame = +1

Query  1    AIHIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQVEQQK  180
            A+HIPNHKFTVNVVRNL+QKTHWRIKTH+AISHLDVNKINNIVADMRKVLAKNPQVEQQK
Sbjct  305  AVHIPNHKFTVNVVRNLSQKTHWRIKTHVAISHLDVNKINNIVADMRKVLAKNPQVEQQK  364

Query  181  LHRRVFLDNIDRENQALLIMVSCFVKTSHFEEYLRVKEVILLD  309
            LHRRVFL++I +ENQAL I+VSCFVKT HFEEYL VKE  L D
Sbjct  365  LHRRVFLEDISQENQALRILVSCFVKTPHFEEYLCVKECSLSD  407



>gb|EMT29563.1| MscS family inner membrane protein ynaI [Aegilops tauschii]
Length=554

 Score =   167 bits (422),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 94/198 (47%), Positives = 116/198 (59%), Gaps = 38/198 (19%)
 Frame = +1

Query  1    AIHIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQVEQQK  180
            AI+IPNHKFTV+++                           IVADMRKVLAKN  +EQQ+
Sbjct  273  AIYIPNHKFTVSII---------------------------IVADMRKVLAKNQNIEQQR  305

Query  181  LHRRVFLDNIDRENQALLIMVSCFVKTSHFEEYLRVKEVILLDLLRVISHHRARLATPIR  360
            LHRRVF + ID   QAL+I VSCFVKTSH EEYL V+E +LLD LR+I HHRARLAT  R
Sbjct  306  LHRRVFFEKIDETTQALMIYVSCFVKTSHLEEYLNVQEEVLLDFLRIIGHHRARLATQTR  365

Query  361  TVQKIYKEADVDEVPLADSVMTVNRANHPFLLIEPSYKINNSSEDKTKAATPPRPNQEKD  540
            TVQK Y  AD+D +P  + + T  R     LLI+ S K+   SE K K+ +  R +Q   
Sbjct  366  TVQKSYGNADIDNIPFGEEMYTRVRGRP--LLIDTSAKV---SEGKPKSRSTSREDQ---  417

Query  541  GKSEVQTTASKAVDASPP  594
                V+T+AS       P
Sbjct  418  ---RVKTSASAETRVGSP  432



>emb|CBI38268.3| unnamed protein product [Vitis vinifera]
Length=462

 Score =   156 bits (395),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 72/79 (91%), Positives = 78/79 (99%), Gaps = 0/79 (0%)
 Frame = +1

Query  1    AIHIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQVEQQK  180
            A+HIPNHKFTVNVVRNL+QKTHWRIKTHLAISHLDVNKIN+IVADMRKVLAKNPQVEQQ+
Sbjct  335  AVHIPNHKFTVNVVRNLSQKTHWRIKTHLAISHLDVNKINSIVADMRKVLAKNPQVEQQR  394

Query  181  LHRRVFLDNIDRENQALLI  237
            LHRRVFLDNI+ ENQALL+
Sbjct  395  LHRRVFLDNINPENQALLV  413



>gb|EYU39301.1| hypothetical protein MIMGU_mgv1a007350mg [Erythranthe guttata]
Length=410

 Score =   154 bits (390),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 73/79 (92%), Positives = 76/79 (96%), Gaps = 0/79 (0%)
 Frame = +1

Query  1    AIHIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQVEQQK  180
            AIHIPNHKF+VNVVRNL+QKTHWRIKTHLAISHLDV KINNIVADMRKVLAKN QVEQQK
Sbjct  313  AIHIPNHKFSVNVVRNLSQKTHWRIKTHLAISHLDVGKINNIVADMRKVLAKNHQVEQQK  372

Query  181  LHRRVFLDNIDRENQALLI  237
            LHRRVFLDNID ENQALL+
Sbjct  373  LHRRVFLDNIDPENQALLV  391



>emb|CAN79156.1| hypothetical protein VITISV_004652 [Vitis vinifera]
Length=298

 Score =   142 bits (357),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 76/141 (54%), Positives = 87/141 (62%), Gaps = 38/141 (27%)
 Frame = +1

Query  1    AIHIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQVEQQK  180
             +HIP HKFTVNVVRNL+QKTHW IKTH AI HLDVNKINNI+ADM KVLAKNPQVEQQ 
Sbjct  100  VVHIPKHKFTVNVVRNLSQKTHWHIKTHFAIGHLDVNKINNIIADMHKVLAKNPQVEQQG  159

Query  181  LHRRVFLDNIDRENQALLIMVSCFVKTSHFEEYLRVKEVILLDLLRVISHHRARLATPIR  360
            L                                    + ILLDLLRV++HH+A LA PIR
Sbjct  160  L------------------------------------KAILLDLLRVVNHHQACLAIPIR  183

Query  361  TVQKIYKEAD--VDEVPLADS  417
            TVQK Y  AD  ++ +P  D+
Sbjct  184  TVQKEYNMADMEMENIPFVDN  204



>gb|EPS73305.1| hypothetical protein M569_01452, partial [Genlisea aurea]
Length=353

 Score =   142 bits (359),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 65/79 (82%), Positives = 74/79 (94%), Gaps = 0/79 (0%)
 Frame = +1

Query  1    AIHIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQVEQQK  180
            AI+IPNHKFTV VVRNL+QKTHWR+KTHLAISHLDV KIN+IVADMRKVLAKN  VEQQK
Sbjct  267  AIYIPNHKFTVTVVRNLSQKTHWRVKTHLAISHLDVGKINSIVADMRKVLAKNSLVEQQK  326

Query  181  LHRRVFLDNIDRENQALLI  237
            LHRRVFLD+++ ENQAL++
Sbjct  327  LHRRVFLDDVNPENQALMV  345



>gb|KEH35730.1| mechanosensitive ion channel-like protein [Medicago truncatula]
Length=430

 Score =   139 bits (350),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 62/79 (78%), Positives = 75/79 (95%), Gaps = 0/79 (0%)
 Frame = +1

Query  1    AIHIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQVEQQK  180
            A+HIPNHK +VNVVRNL++KTHWRIKTHLAISHLDVNKI+ I+ADMRKVLAKNP VEQ+K
Sbjct  347  AVHIPNHKLSVNVVRNLSKKTHWRIKTHLAISHLDVNKIDTIIADMRKVLAKNPLVEQKK  406

Query  181  LHRRVFLDNIDRENQALLI  237
            LHRRVFL++++ ENQAL++
Sbjct  407  LHRRVFLEDVNPENQALMV  425



>gb|EYU39302.1| hypothetical protein MIMGU_mgv11b010457mg [Erythranthe guttata]
Length=247

 Score =   106 bits (265),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 68/153 (44%), Positives = 83/153 (54%), Gaps = 46/153 (30%)
 Frame = +1

Query  238  MVSCFVKTSHFEEYLRVK------------------------------EVILLDLLRVIS  327
            MVSCFVKTS FEEY+ VK                              E IL DLLRVI+
Sbjct  1    MVSCFVKTSRFEEYMCVKVNMLFFSFSRIYLFAYLFCCHLWVEEKKKQEAILHDLLRVIT  60

Query  328  HHRARLATPIRTVQKIYKEADVDEVPLADSVMT--------VNRANHPFLLIEPSYKI--  477
            HHRARLATPIRT+QK Y++ADVD VP  DS+ +         NRA    LLIEPSYKI  
Sbjct  61   HHRARLATPIRTIQKTYRDADVDTVPFPDSIFSWGAAAASSSNRA----LLIEPSYKIED  116

Query  478  -NNSSEDKTKAATPPRPNQEK-DGKSEVQTTAS  570
                 +DKTK+   P+ ++   + K+E  T A+
Sbjct  117  EEEEEQDKTKSHARPKSDESATESKAENNTAAA  149



>ref|XP_010107674.1| hypothetical protein L484_007692 [Morus notabilis]
 gb|EXC16647.1| hypothetical protein L484_007692 [Morus notabilis]
Length=283

 Score =   104 bits (259),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 83/212 (39%), Positives = 114/212 (54%), Gaps = 43/212 (20%)
 Frame = +1

Query  289  KEVILLDLLRVISHHRARLATPIRTVQKIYKEADVDEVPLADSVMTVNR--ANHPFLLIE  462
            +E IL+DLLRV+SHHRARLATPIRTVQ I+ EA+++ VP ADS+ + +R  AN P+LLIE
Sbjct  6    QEAILMDLLRVVSHHRARLATPIRTVQNIHSEAELENVPFADSIFSRSRGTANRPYLLIE  65

Query  463  PSYKINNSSEDKTKAAT-PPRPNQEKDGKSEVQTTASKAVDA----SPPIVDGNRIDTRg  627
            PSYKIN   +D+TK ++     N++K+ ++E + T     DA    S  I  G++ D + 
Sbjct  66   PSYKING--DDRTKTSSRSALTNEDKEAQTEAELTFGSKADAKARSSSSI--GSKNDDQV  121

Query  628  ssgssTDT------------EPGVATSELDGKMPNTGSVQ----------SKNERQQVD-  738
               S +++            EP +     DG  P   S +          SK+    VD 
Sbjct  122  KVTSDSNSSIESKNSEVPTSEPQIRNLSSDGLSPQHKSTEYAGKETVMSNSKDASLPVDT  181

Query  739  -KVVP--------GEVDAPSAVSQAKQDGERP  807
             K  P        G+ DAP A  QAKQ  ERP
Sbjct  182  PKNSPSTSAESDSGKTDAPLANLQAKQYVERP  213



>gb|AAK84478.1| unknown [Solanum lycopersicum]
Length=621

 Score = 95.1 bits (235),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 53/97 (55%), Positives = 63/97 (65%), Gaps = 3/97 (3%)
 Frame = +1

Query  256  KTSHFEEYLRVKEVILLDLLRVISHHRARLATPIRTVQKIYKEADVDEVPLADSVMTVNR  435
            K   +E    V+E ILLDLLRVI HHRARLATPIRTVQKIY +AD+D +    +      
Sbjct  289  KIEGYEVSGTVEEAILLDLLRVIRHHRARLATPIRTVQKIYSDADLDNMTYDSAFSRGAA  348

Query  436  ANHPFLLIEPSYKINNSSEDKTKAATPPRPNQEKDGK  546
            +  P LLIEPSYK+N   ED+TK   P R N E+D K
Sbjct  349  STRPLLLIEPSYKVNG--EDRTK-GRPIRVNGEEDTK  382



>ref|XP_010414765.1| PREDICTED: mechanosensitive ion channel protein 3, chloroplastic-like 
isoform X2 [Camelina sativa]
Length=461

 Score = 84.0 bits (206),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 46/90 (51%), Positives = 61/90 (68%), Gaps = 6/90 (7%)
 Frame = +1

Query  292  EVILLDLLRVISHHRARLATPIRTVQKIYKEADVDEVPLADSVMTVNRANHPFLLIEPSY  471
            E +LLDLL VI HH ARLATPIRTVQ++  EA+VD    +D +      N   +LIEPSY
Sbjct  231  EAVLLDLLTVIRHHGARLATPIRTVQRMRNEAEVDSAGFSDIIFNQAAMNRRLMLIEPSY  290

Query  472  KINNSSEDKTKAATP---PRPNQEKDGKSE  552
            KIN  S+D TK+++P   P+ ++EKD + E
Sbjct  291  KIN--SDDNTKSSSPNSMPK-SEEKDLQEE  317



>ref|XP_010414763.1| PREDICTED: mechanosensitive ion channel protein 3, chloroplastic-like 
isoform X1 [Camelina sativa]
 ref|XP_010414764.1| PREDICTED: mechanosensitive ion channel protein 3, chloroplastic-like 
isoform X1 [Camelina sativa]
Length=462

 Score = 84.0 bits (206),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 46/90 (51%), Positives = 61/90 (68%), Gaps = 6/90 (7%)
 Frame = +1

Query  292  EVILLDLLRVISHHRARLATPIRTVQKIYKEADVDEVPLADSVMTVNRANHPFLLIEPSY  471
            E +LLDLL VI HH ARLATPIRTVQ++  EA+VD    +D +      N   +LIEPSY
Sbjct  232  EAVLLDLLTVIRHHGARLATPIRTVQRMRNEAEVDSAGFSDIIFNQAAMNRRLMLIEPSY  291

Query  472  KINNSSEDKTKAATP---PRPNQEKDGKSE  552
            KIN  S+D TK+++P   P+ ++EKD + E
Sbjct  292  KIN--SDDNTKSSSPNSMPK-SEEKDLQEE  318



>ref|XP_005645721.1| hypothetical protein COCSUDRAFT_48305 [Coccomyxa subellipsoidea 
C-169]
 gb|EIE21177.1| hypothetical protein COCSUDRAFT_48305 [Coccomyxa subellipsoidea 
C-169]
Length=634

 Score = 81.3 bits (199),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 43/116 (37%), Positives = 73/116 (63%), Gaps = 4/116 (3%)
 Frame = +1

Query  4    IHIPNHKFTVNVVRNLTQKT-HWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQVEQQK  180
             +IPN  F+ NVV N+T+K   WR    + +   DV K + +VADMRK++ ++P++  QK
Sbjct  404  FNIPNSVFSRNVVLNITRKQREWRFYEFIGLRVDDVGKASAVVADMRKIIRQDPRI-IQK  462

Query  181  LHRRVFLDNIDRENQALLIMVSCFVKTSHFEEYLRVKEVILLDLLRVISHHRARLA  348
            LHRRVF D + RE   + I VS +V+ ++ + ++ +K+ +LL  +  +  + A+LA
Sbjct  463  LHRRVFFDKLTREQ--VTIYVSFYVEAANRDAFMSIKQDLLLAFIDCVDRNGAKLA  516



>ref|XP_002948588.1| hypothetical protein VOLCADRAFT_116855 [Volvox carteri f. nagariensis]
 gb|EFJ50463.1| hypothetical protein VOLCADRAFT_116855 [Volvox carteri f. nagariensis]
Length=1244

 Score = 80.9 bits (198),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 45/121 (37%), Positives = 73/121 (60%), Gaps = 4/121 (3%)
 Frame = +1

Query  10   IPNHKFTVNVVRNLTQKT-HWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQVEQQKLH  186
            IPN  F+ N+V N+T+K   WR    + +   DV+K+N I+ D+R+++ +N Q    KLH
Sbjct  722  IPNAVFSKNIVLNITRKNREWRFFEMICVRVQDVHKVNTIIQDIRRIV-RNDQRIITKLH  780

Query  187  RRVFLDNIDRENQALLIMVSCFVKTSHFEEYLRVKEVILLDLLRVISHHRARLATPIRTV  366
            RR+FLD +  E+    I VS +V+  + E ++ VK+ +LL  +  +  + A+LA P  TV
Sbjct  781  RRIFLDKLTHED--CRIYVSFYVEAQNRESFMAVKQDLLLAFVDCVERNGAKLAVPRTTV  838

Query  367  Q  369
            Q
Sbjct  839  Q  839



>ref|NP_001050432.2| Os03g0432900 [Oryza sativa Japonica Group]
 dbj|BAF12346.2| Os03g0432900, partial [Oryza sativa Japonica Group]
Length=253

 Score = 75.1 bits (183),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 42/93 (45%), Positives = 59/93 (63%), Gaps = 9/93 (10%)
 Frame = +1

Query  289  KEVILLDLLRVISHHRARLATPIRTVQKIYKEADVDEVPLADSVMTVNRANHPFLLIEPS  468
            +E ++LDLLR++ HHRARLAT IRTVQK Y  AD+D +P  + + +  R     LLI+ S
Sbjct  19   QEAVMLDLLRIVGHHRARLATQIRTVQKSYGNADIDNIPFGEEMYS--RVRGRPLLIDTS  76

Query  469  YKINNSSEDKTKAATPPRPNQEKDGKSEVQTTA  567
             +I   S+DK+K    PRP   +D K +  T+A
Sbjct  77   ARI---SDDKSK----PRPASREDHKVKTVTSA  102



>gb|KHN08264.1| Mechanosensitive ion channel protein 2, chloroplastic [Glycine 
soja]
Length=205

 Score = 74.3 bits (181),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 32/40 (80%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = +1

Query  1    AIHIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLDVNKIN  120
            A+HIPNH  +VNVVRNL++K+HW IKTHLAISHLDVNKIN
Sbjct  147  AVHIPNHNLSVNVVRNLSKKSHWGIKTHLAISHLDVNKIN  186



>gb|KIZ07438.1| hypothetical protein MNEG_0512 [Monoraphidium neglectum]
Length=825

 Score = 74.3 bits (181),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 41/116 (35%), Positives = 72/116 (62%), Gaps = 4/116 (3%)
 Frame = +1

Query  10   IPNHKFTVNVVRNLTQKT-HWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQVEQQKLH  186
            IPN  F+ N V N+T+K   WR    L +   DV+K+N I+ D+R+++  + ++   KLH
Sbjct  397  IPNAVFSKNTVLNVTRKMREWRFYEFLCVRVQDVHKVNAIIQDIRRIVKNDARI-INKLH  455

Query  187  RRVFLDNIDRENQALLIMVSCFVKTSHFEEYLRVKEVILLDLLRVISHHRARLATP  354
            RRVF+D I  ++  + I +S +V+ S+ + ++ VK+ +LL  +  +  + A+LATP
Sbjct  456  RRVFMDKITHDD--VKIYLSFYVEASNRDAFMAVKQDLLLAFVDCVERNGAKLATP  509



>emb|CDP01542.1| unnamed protein product [Coffea canephora]
Length=107

 Score = 68.9 bits (167),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 30/39 (77%), Positives = 36/39 (92%), Gaps = 0/39 (0%)
 Frame = +1

Query  79   THLAISHLDVNKINNIVADMRKVLAKNPQVEQQKLHRRV  195
            T ++ISHLDVNKI++IVADMRKVLAKNPQVEQQ+ HR +
Sbjct  65   TAISISHLDVNKISSIVADMRKVLAKNPQVEQQRWHRSI  103



>ref|WP_033315790.1| mechanosensitive ion channel protein MscS, partial [Pseudochrobactrum 
sp. AO18b]
Length=332

 Score = 72.8 bits (177),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 37/121 (31%), Positives = 76/121 (63%), Gaps = 3/121 (2%)
 Frame = +1

Query  4    IHIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQVEQQKL  183
            +++PN  F+   V N ++ T+ RI T + + + D +K+++++ D+RK+L  N +++Q + 
Sbjct  209  LYVPNALFSTISVENPSRMTNRRISTTIGLRYEDADKVSDVIDDIRKMLKNNKKIDQNQ-  267

Query  184  HRRVFLDNIDRENQALLIMVSCFVKTSHFEEYLRVKEVILLDLLRVISHHRARLATPIRT  363
               VF +     + +L IMV CF KT+H+ E+L +++ I L +++++  H+A  A P +T
Sbjct  268  DLLVFFNTF--ADSSLNIMVYCFTKTTHWAEWLDIQQDIYLQIIKIVQAHKADFAYPTQT  325

Query  364  V  366
            +
Sbjct  326  L  326



>ref|XP_001700183.1| predicted protein [Chlamydomonas reinhardtii]
 gb|EDO98298.1| predicted protein [Chlamydomonas reinhardtii]
Length=607

 Score = 72.0 bits (175),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 43/120 (36%), Positives = 71/120 (59%), Gaps = 4/120 (3%)
 Frame = +1

Query  10   IPNHKFTVNVVRNLTQKTH-WRIKTHLAISHLDVNKINNIVADMRKVLAKNPQVEQQKLH  186
            IPN  F+ N+V N+T+K   WR    + I   DV+K N I+ D+R+++ +N Q    KLH
Sbjct  409  IPNAVFSKNIVLNITRKNREWRFFEQICIRVQDVHKANAIIQDIRRIV-RNDQRIITKLH  467

Query  187  RRVFLDNIDRENQALLIMVSCFVKTSHFEEYLRVKEVILLDLLRVISHHRARLATPIRTV  366
            RR+FLD +  ++    I VS +V+ ++ E ++  K+ +LL  +  +  + A+LA P  TV
Sbjct  468  RRIFLDKVTHDD--CRIYVSFYVEAANRESFMAAKQDLLLAFVDCVERNGAKLAVPRTTV  525



>ref|WP_005164915.1| MscS family inner membrane protein YnaI [Yersinia enterocolitica]
 emb|CBY27463.1| mechanosensitive ion channel [Yersinia enterocolitica subsp. 
palearctica Y11]
 gb|ADZ42428.1| putative inner membrane protein [Yersinia enterocolitica subsp. 
palearctica 105.5R(r)]
 emb|CBX71684.1| MscS family inner membrane protein ynaI [Yersinia enterocolitica 
W22703]
 gb|EHB19712.1| MscS family inner membrane protein YnaI [Yersinia enterocolitica 
subsp. palearctica PhRBD_Ye1]
 emb|CCO68878.1| Mechanosensitive ion channel [Yersinia enterocolitica IP 10393]
 emb|CCV38496.1| putative inner membrane protein [Yersinia enterocolitica (type 
O:9) str. YE56/03]
 gb|EOR69209.1| MscS family inner membrane protein YnaI [Yersinia enterocolitica 
subsp. palearctica YE-149]
 gb|EOR79903.1| MscS family inner membrane protein YnaI [Yersinia enterocolitica 
subsp. palearctica YE-P1]
 gb|EOR80370.1| MscS family inner membrane protein YnaI [Yersinia enterocolitica 
subsp. palearctica YE-150]
 gb|EOR83294.1| MscS family inner membrane protein YnaI [Yersinia enterocolitica 
subsp. palearctica YE-P4]
 emb|CCV30017.1| putative inner membrane protein [Yersinia enterocolitica (type 
O:9) str. YE212/02]
 emb|CCV53290.1| putative inner membrane protein [Yersinia enterocolitica (type 
O:3) str. YE12/03]
 emb|CCV46468.1| putative inner membrane protein [Yersinia enterocolitica (type 
O:5,27) str. YE149/02]
 gb|KGA67467.1| mechanosensitive ion channel family protein [Yersinia enterocolitica]
 gb|KGA68535.1| mechanosensitive ion channel family protein [Yersinia enterocolitica]
 gb|AJJ26521.1| mechanosensitive ion channel family protein [Yersinia enterocolitica]
 emb|CFQ22268.1| putative inner membrane protein [Yersinia enterocolitica]
 emb|CFQ62812.1| putative inner membrane protein [Yersinia enterocolitica]
 emb|CFW67908.1| putative inner membrane protein [Yersinia enterocolitica]
Length=346

 Score = 70.1 bits (170),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 43/121 (36%), Positives = 66/121 (55%), Gaps = 3/121 (2%)
 Frame = +1

Query  4    IHIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQVEQQKL  183
            +++PN  FT   V N  + T+ RIKT LA+ + D +KI  IV +M K LA N  ++ Q+ 
Sbjct  214  LYVPNSAFTDTSVENPGRMTNRRIKTTLALRYEDADKIGTIVDEMHKFLANNNDIDHQQ-  272

Query  184  HRRVFLDNIDRENQALLIMVSCFVKTSHFEEYLRVKEVILLDLLRVISHHRARLATPIRT  363
               V+ +       +L IMV CF KT  + E+L V++   L  + ++  H A  A P RT
Sbjct  273  TLLVYFNGFGES--SLNIMVYCFTKTRVWAEWLAVQQACYLKFIDIVHQHGADFAFPSRT  330

Query  364  V  366
            +
Sbjct  331  L  331



>emb|CCV61499.1| putative inner membrane protein [Yersinia enterocolitica (type 
O:2) str. YE3094/96]
 emb|CFV33189.1| putative inner membrane protein [Yersinia enterocolitica]
Length=346

 Score = 69.7 bits (169),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 43/121 (36%), Positives = 66/121 (55%), Gaps = 3/121 (2%)
 Frame = +1

Query  4    IHIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQVEQQKL  183
            +++PN  FT   V N  + T+ RIKT LA+ + D +KI  IV +M K LA N  ++ Q+ 
Sbjct  214  LYVPNSAFTDTSVENPGRMTNRRIKTTLALRYEDADKIGTIVDEMHKFLANNDDIDHQQ-  272

Query  184  HRRVFLDNIDRENQALLIMVSCFVKTSHFEEYLRVKEVILLDLLRVISHHRARLATPIRT  363
               V+ +       +L IMV CF KT  + E+L V++   L  + ++  H A  A P RT
Sbjct  273  TLLVYFNGFGES--SLNIMVYCFTKTIVWAEWLAVQQTCYLKFIDIVHQHGADFAFPSRT  330

Query  364  V  366
            +
Sbjct  331  L  331



>ref|WP_005170249.1| MscS family inner membrane protein YnaI [Yersinia enterocolitica]
 ref|YP_001006111.1| inner membrane protein [Yersinia enterocolitica subsp. enterocolitica 
8081]
 emb|CAL11928.1| putative inner membrane protein [Yersinia enterocolitica subsp. 
enterocolitica 8081]
 gb|EKA27628.1| MscS family inner membrane protein YnaI [Yersinia enterocolitica 
subsp. enterocolitica WA-314]
 gb|KGA71449.1| mechanosensitive ion channel family protein [Yersinia enterocolitica]
 gb|KGA77838.1| mechanosensitive ion channel family protein [Yersinia enterocolitica]
 gb|AJI84858.1| mechanosensitive ion channel family protein [Yersinia enterocolitica]
 gb|AJJ21661.1| mechanosensitive ion channel family protein [Yersinia enterocolitica]
 emb|CFQ19230.1| putative inner membrane protein [Yersinia enterocolitica]
Length=346

 Score = 69.3 bits (168),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 43/121 (36%), Positives = 66/121 (55%), Gaps = 3/121 (2%)
 Frame = +1

Query  4    IHIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQVEQQKL  183
            +++PN  FT   V N  + T+ RIKT LA+ + D +KI  IV +M K LA N  ++ Q+ 
Sbjct  214  LYVPNSAFTDTSVENPGRMTNRRIKTTLALRYEDADKIGAIVDEMHKFLANNDDIDHQQ-  272

Query  184  HRRVFLDNIDRENQALLIMVSCFVKTSHFEEYLRVKEVILLDLLRVISHHRARLATPIRT  363
               V+ +       +L IMV CF KT  + E+L V++   L  + ++  H A  A P RT
Sbjct  273  TLLVYFNGFGES--SLNIMVYCFTKTRVWAEWLAVQQTCYLKFIDIVHQHGADFAFPSRT  330

Query  364  V  366
            +
Sbjct  331  L  331



>gb|AES73162.2| transmembrane protein, putative [Medicago truncatula]
Length=321

 Score = 68.2 bits (165),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 52/124 (42%), Positives = 61/124 (49%), Gaps = 27/124 (22%)
 Frame = +1

Query  1    AIHIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQVEQQK  180
            A+HIPNHKF  NVVRN T+   W ++ + AI     N IN I     + L K PQVEQQ 
Sbjct  169  AVHIPNHKFADNVVRNPTKI--WNLRRYFAIRSF--NDINIIKLIAVRFLLKKPQVEQQT  224

Query  181  LHRRVFLDNIDRENQALLIMVSCFVKTSHFEEYLRVKEVILLDLLRVISHHRARLATPIR  360
                V L  I    Q                     KE IL DL  V+SHHR  LATPIR
Sbjct  225  ----VVLKAISPGKQTR-------------------KEAILSDLRSVVSHHRDPLATPIR  261

Query  361  TVQK  372
            TV++
Sbjct  262  TVEE  265



>gb|EEG85646.1| transporter, small conductance mechanosensitive ion channel MscS 
family protein [Proteus penneri ATCC 35198]
Length=202

 Score = 66.6 bits (161),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 38/121 (31%), Positives = 68/121 (56%), Gaps = 3/121 (2%)
 Frame = +1

Query  4    IHIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQVEQQKL  183
            ++IPN  F+   V N  + T+ RI+T L + + D +KI  IV D+R +L +N +++ Q+ 
Sbjct  75   LYIPNSIFSSISVENPGRMTNRRIETELGLRYEDSDKIGVIVEDIRTMLMQNDKIDTQQT  134

Query  184  HRRVFLDNIDRENQALLIMVSCFVKTSHFEEYLRVKEVILLDLLRVISHHRARLATPIRT  363
                F    D    +L IMV CF KT+ + ++L  ++ + L ++ ++  H A  A P +T
Sbjct  135  LLVYFNQFAD---SSLNIMVYCFTKTTVWAQWLEAQQEVYLKMIEIVHKHGADFAFPSQT  191

Query  364  V  366
            +
Sbjct  192  I  192



>ref|XP_005703860.1| small conductance mechanosensitive ion channel, MscS family [Galdieria 
sulphuraria]
 gb|EME27340.1| small conductance mechanosensitive ion channel, MscS family [Galdieria 
sulphuraria]
Length=817

 Score = 68.9 bits (167),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 36/118 (31%), Positives = 70/118 (59%), Gaps = 3/118 (3%)
 Frame = +1

Query  4    IHIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQVEQQKL  183
            ++IPN +F+  V+ N ++ T+ RIK  + ++  D+  I +I+ D++ +L ++P+++ ++ 
Sbjct  557  LYIPNSRFSTLVMENPSRMTNRRIKHTIGLAMEDMCVIKDIIQDIQNLLDQHPELDPKQ-  615

Query  184  HRRVFLDNIDRENQALLIMVSCFVKTSHFEEYLRVKEVILLDLLRVISHHRARLATPI  357
            HR V+ D     +  L +  SC+ KT    EY RV++ IL  +  +I  H  RLA+ +
Sbjct  616  HRMVWFDGFGEYSVNLWL--SCYTKTVFLSEYRRVQQEILFAVYDIIRSHHGRLASSL  671



>ref|WP_019083007.1| MscS family inner membrane protein YnaI [Yersinia enterocolitica]
Length=346

 Score = 68.2 bits (165),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 41/121 (34%), Positives = 66/121 (55%), Gaps = 3/121 (2%)
 Frame = +1

Query  4    IHIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQVEQQKL  183
            +++PN  FT   V N  + T+ RIKT LA+ + D +K+  IV +M + LA N  ++ Q+ 
Sbjct  214  LYVPNSAFTDTSVENPGRMTNRRIKTTLALRYEDADKVGAIVEEMHQFLANNDDIDHQQ-  272

Query  184  HRRVFLDNIDRENQALLIMVSCFVKTSHFEEYLRVKEVILLDLLRVISHHRARLATPIRT  363
               V+ +       +L IMV CF KT  + E+L V++   L  + ++  H A  A P RT
Sbjct  273  TLLVYFNGFGES--SLNIMVYCFTKTRVWAEWLAVQQTCYLKFIDIVHQHGADFAFPSRT  330

Query  364  V  366
            +
Sbjct  331  L  331



>ref|WP_019079245.1| MscS family inner membrane protein YnaI [Yersinia enterocolitica]
 emb|CCQ40805.1| putative inner membrane protein [Yersinia enterocolitica (type 
O:5) str. YE53/03]
 emb|CFB66718.1| putative inner membrane protein [Yersinia enterocolitica]
 emb|CFQ81235.1| putative inner membrane protein [Yersinia enterocolitica]
 emb|CRE86925.1| putative inner membrane protein [Yersinia enterocolitica]
Length=346

 Score = 67.8 bits (164),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 41/121 (34%), Positives = 66/121 (55%), Gaps = 3/121 (2%)
 Frame = +1

Query  4    IHIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQVEQQKL  183
            +++PN  FT   V N  + T+ RIKT LA+ + D +K+  IV +M + LA N  ++ Q+ 
Sbjct  214  LYVPNSAFTDTSVENPGRMTNRRIKTTLALRYEDADKVGAIVEEMHQFLANNDDIDHQQ-  272

Query  184  HRRVFLDNIDRENQALLIMVSCFVKTSHFEEYLRVKEVILLDLLRVISHHRARLATPIRT  363
               V+ +       +L IMV CF KT  + E+L V++   L  + ++  H A  A P RT
Sbjct  273  TLLVYFNGFGES--SLNIMVYCFTKTRVWAEWLAVQQTCYLKFIDIVHQHGADFAFPSRT  330

Query  364  V  366
            +
Sbjct  331  L  331



>ref|WP_004926073.1| MscS family inner membrane protein YnaI [Providencia stuartii]
 gb|EDU58062.1| transporter, small conductance mechanosensitive ion channel MscS 
family protein [Providencia stuartii ATCC 25827]
 gb|AFH93465.1| MscS family inner membrane protein YnaI [Providencia stuartii 
MRSN 2154]
 gb|AIN65793.1| mechanosensitive ion channel family protein [Providencia stuartii]
 gb|KGY22326.1| mechanosensitive ion channel protein MscS [Providencia stuartii]
Length=339

 Score = 67.8 bits (164),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 41/127 (32%), Positives = 71/127 (56%), Gaps = 6/127 (5%)
 Frame = +1

Query  4    IHIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQVEQQKL  183
            ++IPN  F+   V N  + T+ RIKT L + + D +KI  IV+D+R +L + P ++  + 
Sbjct  216  LYIPNSLFSSISVENPGRMTNRRIKTSLGLRYEDADKIGAIVSDIRTMLQQEPSIDTGQ-  274

Query  184  HRRVFLDNIDRENQALLIMVSCFVKTSHFEEYLRVKEVILLDLLRVISHHRARLATPIRT  363
               V+ D  +  + +L IMV CF KT+ + E+L  ++ + L ++ ++  H A  A P   
Sbjct  275  TLLVYFD--EFADSSLNIMVYCFTKTTVWAEWLAAQQEVYLKIIAIVKQHGADFAYP---  329

Query  364  VQKIYKE  384
             Q +Y E
Sbjct  330  TQTLYME  336



>ref|WP_018078636.1| mechanosensitive ion channel protein MscS [Thiobacillus denitrificans]
Length=365

 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 43/133 (32%), Positives = 72/133 (54%), Gaps = 8/133 (6%)
 Frame = +1

Query  4    IHIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQVEQQKL  183
            I++PN  FT  VV N T+ TH RIK  + I + D++K+  IVAD++ +L  +P+++    
Sbjct  235  IYVPNALFTTIVVENPTRMTHRRIKETIGIRYTDLDKMAAIVADVKAMLQAHPEIDTDA-  293

Query  184  HRRVFLDNIDRENQALL-IMVSCFVKTSHFEEYLRVKEVILLDLLRVISHHRARLATPIR  360
                 + N ++   + L   +  F +T  +  Y  VK+ +LL +  +I  H A +A P R
Sbjct  294  ---TLIVNFNQFGVSSLDFFIYTFTRTVQWVHYHEVKQDVLLKVAAIIQSHGAEIAFPTR  350

Query  361  TVQKIYKEADVDE  399
            T   +Y E+D  E
Sbjct  351  T---LYIESDAAE  360



>ref|XP_003602911.1| hypothetical protein MTR_3g100300 [Medicago truncatula]
Length=386

 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 53/129 (41%), Positives = 64/129 (50%), Gaps = 30/129 (23%)
 Frame = +1

Query  1    AIHIPNHKFTVNVVRNLTQKTHWRIKTHLAI-SHLDVNKINNIVADMR----KVLAKNPQ  165
            A+HIPNHKF  NVVRN T+   W ++ + AI S  D+N I   +   R    + L K PQ
Sbjct  169  AVHIPNHKFADNVVRNPTKI--WNLRRYFAIRSFNDINIIKVSIVGSRLIAVRFLLKKPQ  226

Query  166  VEQQKLHRRVFLDNIDRENQALLIMVSCFVKTSHFEEYLRVKEVILLDLLRVISHHRARL  345
            VEQQ     V L  I    Q                     KE IL DL  V+SHHR  L
Sbjct  227  VEQQT----VVLKAISPGKQTR-------------------KEAILSDLRSVVSHHRDPL  263

Query  346  ATPIRTVQK  372
            ATPIRTV++
Sbjct  264  ATPIRTVEE  272



>ref|WP_008284617.1| mechanosensitive ion channel protein MscS [gamma proteobacterium 
HTCC5015]
 gb|EDY86413.1| small-conductance mechanosensitive channel [gamma proteobacterium 
HTCC5015]
Length=384

 Score = 66.2 bits (160),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 38/123 (31%), Positives = 73/123 (59%), Gaps = 5/123 (4%)
 Frame = +1

Query  4    IHIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQVEQQKL  183
            +++PN  FT  VV N ++  + RI   + + + D++ + NIVAD+R +L  +  ++Q++ 
Sbjct  241  LYVPNAIFTNIVVENPSRMFNRRISESIGVRYDDLSHVKNIVADIRSMLENHEDIDQEE-  299

Query  184  HRRVFLDNIDRENQALL-IMVSCFVKTSHFEEYLRVKEVILLDLLRVISHHRARLATPIR  360
                 + N D+ N + L IM+  F KT+++ EY +V++ +LL +  +I  + A +A P R
Sbjct  300  ---TLIVNFDKFNSSSLDIMLYTFTKTTNWVEYHKVRQAVLLAIADIIEEYGAEIAFPTR  356

Query  361  TVQ  369
            T+ 
Sbjct  357  TLH  359



>ref|XP_003602813.1| MscS-Like mechanosensitive ion channel MSCL9 [Medicago truncatula]
 gb|AES73064.1| hypothetical protein MTR_3g099260 [Medicago truncatula]
Length=161

 Score = 63.5 bits (153),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 30/85 (35%), Positives = 52/85 (61%), Gaps = 3/85 (4%)
 Frame = +1

Query  4    IHIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQVEQQKL  183
            + IP H FT N+VRN T   +  I  ++ +  L++ K+  I+  M  VL+K+  VEQ+K 
Sbjct  80   VMIPTHNFTTNIVRNHTHDGYLNI--YIPVERLNITKLKIILTKMCDVLSKSSYVEQEKF  137

Query  184  HRRVFLDNIDRENQALLIMVSCFVK  258
            HRRV+ D++  +   + I++ C++K
Sbjct  138  HRRVYFDDVPGKG-TVRILIDCYLK  161



>ref|WP_009601185.1| mechanosensitive ion channel protein MscS [Vibrio caribbeanicus]
 gb|EFP96753.1| Small-conductance mechanosensitive channel [Vibrio caribbeanicus 
ATCC BAA-2122]
Length=361

 Score = 65.1 bits (157),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 38/123 (31%), Positives = 77/123 (63%), Gaps = 5/123 (4%)
 Frame = +1

Query  4    IHIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQVEQQKL  183
            +++PN  F+  VV N ++  + RIK ++ + + D  K++ IV+++R +L++NP+++Q   
Sbjct  230  LYVPNSVFSSIVVENPSRMHNRRIKENIGLRYEDERKVDRIVSEIRDMLSQNPEIDQ---  286

Query  184  HRRVFLDNIDREN-QALLIMVSCFVKTSHFEEYLRVKEVILLDLLRVISHHRARLATPIR  360
             R+  + N D     +L +++  F KT+++ +Y  VK+ +LLD+ ++I  H A +A P  
Sbjct  287  -RQTLIVNFDGYAPSSLTLLIYTFTKTTNWIKYHEVKQNVLLDIGKIIHSHGAEIALPTH  345

Query  361  TVQ  369
            +VQ
Sbjct  346  SVQ  348



>ref|XP_002508793.1| small conductance mechanosensitive ion channel family [Micromonas 
sp. RCC299]
 gb|ACO70051.1| small conductance mechanosensitive ion channel family [Micromonas 
sp. RCC299]
Length=656

 Score = 65.1 bits (157),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 41/133 (31%), Positives = 72/133 (54%), Gaps = 7/133 (5%)
 Frame = +1

Query  7    HIPNHKFTVNVVRNLTQKT-HWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQVEQQKL  183
            ++PN  F+  VV N+T+K   WRIK  + I H D  ++   ++  R +L  + +V  Q+L
Sbjct  449  YVPNSLFSSLVVLNITRKGKQWRIKQDILIRHSDSARVAAALSAYRSLLKSDGRV-VQRL  507

Query  184  HRRVFLDNIDRENQALLIMVSCFVKTSHFEEYLRVKEVILLDLLRVISHHRARLATPIRT  363
            HRRVFL  +  E   L+  +S +V+  + +++  + +  L   L  +  +  RLA P+R 
Sbjct  508  HRRVFLSEVTPEG--LMCRISFYVEAKNKDQFSGINQDFLSAFLETLRKNDVRLAVPMRG  565

Query  364  VQKIYKEADVDEV  402
            V ++    D DE+
Sbjct  566  VMQM---QDSDEI  575



>ref|WP_038632473.1| MULTISPECIES: mechanosensitive ion channel protein MscS [Yersinia]
 gb|AIN20447.1| mechanosensitive ion channel family protein [Yersinia kristensenii]
 gb|AJI85271.1| mechanosensitive ion channel family protein [Yersinia frederiksenii 
Y225]
 gb|AJJ37262.1| mechanosensitive ion channel family protein [Yersinia kristensenii]
Length=349

 Score = 64.3 bits (155),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 43/121 (36%), Positives = 66/121 (55%), Gaps = 3/121 (2%)
 Frame = +1

Query  4    IHIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQVEQQKL  183
            +++PN  FT   V N  + T+ RIKT LA+ + D +KI  IV +M   LA N  ++QQ+ 
Sbjct  214  LYVPNSIFTDISVENPGRMTNRRIKTTLALRYEDADKIGIIVDEMHNFLANNDDIDQQQ-  272

Query  184  HRRVFLDNIDRENQALLIMVSCFVKTSHFEEYLRVKEVILLDLLRVISHHRARLATPIRT  363
               V+ +       +L IMV CF KT  + E+L V++   L  + ++  H A  A P RT
Sbjct  273  TLLVYFNGFGES--SLNIMVYCFTKTKVWAEWLAVQQNCYLKFIDIVHQHGADFAFPSRT  330

Query  364  V  366
            +
Sbjct  331  L  331



>ref|WP_044715856.1| mechanosensitive ion channel protein MscS, partial [Escherichia 
coli]
Length=135

 Score = 61.6 bits (148),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 35/121 (29%), Positives = 66/121 (55%), Gaps = 3/121 (2%)
 Frame = +1

Query  4    IHIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQVEQQKL  183
            +++PN  F+   V N  + T+ RI T + + + D  K+  IV  +R++L  +P ++Q++ 
Sbjct  6    LYVPNSLFSSISVENPGRMTNRRITTTIGLRYQDAAKVGEIVEAVREMLKNHPAIDQRQT  65

Query  184  HRRVFLDNIDRENQALLIMVSCFVKTSHFEEYLRVKEVILLDLLRVISHHRARLATPIRT  363
                F    D    +L IMV CF KT+ + E+L  ++ + L ++ ++  H A  A P +T
Sbjct  66   LLVYFNQFAD---SSLNIMVYCFTKTTVWAEWLAAQQDVYLKIIDIVQSHGADFAFPSQT  122

Query  364  V  366
            +
Sbjct  123  L  123



>ref|WP_017009462.1| mechanosensitive ion channel protein MscS [Enterovibrio calviensis]
Length=374

 Score = 64.3 bits (155),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 42/138 (30%), Positives = 74/138 (54%), Gaps = 9/138 (7%)
 Frame = +1

Query  4    IHIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQVEQQKL  183
            I++PN  F+  VV+N ++  H RI     + + D +K+  +VAD++K+L  +P +EQ   
Sbjct  232  IYVPNSVFSSIVVQNPSRMQHRRINETFGLRYKDADKMAVVVADVKKMLEAHPDIEQ---  288

Query  184  HRRVFLDNIDR-ENQALLIMVSCFVKTSHFEEYLRVKEVILLDLLRVISHHRARLATPIR  360
             R   + N D     +L   +  F KT ++ +Y  VK+ ++L ++ ++  H A  A P R
Sbjct  289  -RATMMVNFDAFAGSSLNFFIYTFTKTVNWAKYHEVKQDVMLKIVEIVHGHGADFAFPTR  347

Query  361  TVQKIYKEADVDE--VPL  408
            TV   +   D+ E  +PL
Sbjct  348  TVS--FDNGDMAEANIPL  363



>ref|WP_017013083.1| mechanosensitive ion channel protein MscS [Enterovibrio calviensis]
Length=374

 Score = 64.3 bits (155),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 42/138 (30%), Positives = 74/138 (54%), Gaps = 9/138 (7%)
 Frame = +1

Query  4    IHIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQVEQQKL  183
            I++PN  F+  VV+N ++  H RI     + + D +K+  +VAD++K+L  +P +EQ   
Sbjct  232  IYVPNSVFSSIVVQNPSRMQHRRINETFGLRYKDADKMAVVVADVKKMLEAHPDIEQ---  288

Query  184  HRRVFLDNIDR-ENQALLIMVSCFVKTSHFEEYLRVKEVILLDLLRVISHHRARLATPIR  360
             R   + N D     +L   +  F KT ++ +Y  VK+ ++L ++ ++  H A  A P R
Sbjct  289  -RATMMVNFDAFAGSSLNFFIYTFTKTVNWAKYHEVKQDVMLKIVEIVHGHGADFAFPTR  347

Query  361  TVQKIYKEADVDE--VPL  408
            TV   +   D+ E  +PL
Sbjct  348  TVS--FDNGDMAEANIPL  363



>ref|WP_033535597.1| mechanosensitive ion channel protein MscS, partial [Bordetella 
trematum]
Length=336

 Score = 64.3 bits (155),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 38/121 (31%), Positives = 69/121 (57%), Gaps = 3/121 (2%)
 Frame = +1

Query  4    IHIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQVEQQKL  183
            +++PN  FT   V N ++ T+ RI T L + + D +KI  I+ D+RK+L  N +++Q + 
Sbjct  216  LYVPNSLFTSISVENPSRMTNRRISTTLGLRYEDADKIGPIIEDVRKMLQGNDKIDQTQ-  274

Query  184  HRRVFLDNIDRENQALLIMVSCFVKTSHFEEYLRVKEVILLDLLRVISHHRARLATPIRT  363
               V+ +       +L IMV CF KT+ +  +L+ ++ + L L+ ++  H A  A P +T
Sbjct  275  DLLVYFNAFGES--SLNIMVYCFTKTTGWAAWLQAQQEVYLKLIEIVHGHGADFAFPSQT  332

Query  364  V  366
            +
Sbjct  333  L  333



>ref|WP_008316639.1| MscS family inner membrane protein YnaI [Wohlfahrtiimonas chitiniclastica]
 gb|ELV07380.1| MscS family inner membrane protein YnaI [Wohlfahrtiimonas chitiniclastica 
SH04]
Length=338

 Score = 64.3 bits (155),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 36/121 (30%), Positives = 71/121 (59%), Gaps = 3/121 (2%)
 Frame = +1

Query  4    IHIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQVEQQKL  183
            +++PN  F+   V N  + T+ RIKT L + + D +K+ +IV D+R +L ++P+++  + 
Sbjct  215  LYVPNAVFSAISVENPGRMTNRRIKTELGLRYDDADKVGDIVNDIRTMLQQHPKIDATQT  274

Query  184  HRRVFLDNIDRENQALLIMVSCFVKTSHFEEYLRVKEVILLDLLRVISHHRARLATPIRT  363
                F +  D    +L IM+ CF KT+ + E+L  ++ + L+++ ++  H A  A P +T
Sbjct  275  LLVYFNEFAD---SSLNIMIYCFTKTTVWAEWLEAQQEVYLEMISIVHKHGADFAFPTQT  331

Query  364  V  366
            +
Sbjct  332  L  332



>ref|WP_038854474.1| mechanosensitive ion channel protein MscS, partial [Bordetella 
trematum]
Length=336

 Score = 64.3 bits (155),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 38/121 (31%), Positives = 69/121 (57%), Gaps = 3/121 (2%)
 Frame = +1

Query  4    IHIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQVEQQKL  183
            +++PN  FT   V N ++ T+ RI T L + + D +KI  I+ D+RK+L  N +++Q + 
Sbjct  216  LYVPNSLFTSISVENPSRMTNRRISTTLGLRYEDADKIGPIIEDVRKMLQGNDKIDQTQ-  274

Query  184  HRRVFLDNIDRENQALLIMVSCFVKTSHFEEYLRVKEVILLDLLRVISHHRARLATPIRT  363
               V+ +       +L IMV CF KT+ +  +L+ ++ + L L+ ++  H A  A P +T
Sbjct  275  DLLVYFNAFGES--SLNIMVYCFTKTTGWAAWLQAQQEVYLKLIEIVHGHGADFAFPSQT  332

Query  364  V  366
            +
Sbjct  333  L  333



>ref|WP_008913805.1| MscS family inner membrane protein YnaI [Providencia burhodogranariea]
 gb|EKT53032.1| MscS family inner membrane protein YnaI [Providencia burhodogranariea 
DSM 19968]
Length=341

 Score = 64.3 bits (155),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 39/121 (32%), Positives = 69/121 (57%), Gaps = 3/121 (2%)
 Frame = +1

Query  4    IHIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQVEQQKL  183
            ++IPN  F+   V N  + T+ RIKT L + + D +KI +IV D+R +L ++  ++  + 
Sbjct  218  LYIPNSLFSSISVENPGRMTNRRIKTELGLRYEDADKIGDIVNDIRTMLQQDESIDTGQ-  276

Query  184  HRRVFLDNIDRENQALLIMVSCFVKTSHFEEYLRVKEVILLDLLRVISHHRARLATPIRT  363
               V+ D     + +L IMV CF KT+ + E+L  ++ I L ++ ++  H A  A P +T
Sbjct  277  TLLVYFDAF--ADSSLNIMVYCFTKTTVWAEWLAAQQEIYLKIIEIVKRHGADFAYPTQT  334

Query  364  V  366
            +
Sbjct  335  L  335



>emb|CDL40380.1| Mechanosensitive ion channel [Escherichia coli ISC11]
Length=243

 Score = 62.8 bits (151),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 35/121 (29%), Positives = 71/121 (59%), Gaps = 3/121 (2%)
 Frame = +1

Query  4    IHIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLDVNKINNIVADMRKVLAKNPQVEQQKL  183
            +++PN  F+   V N  + T+ RIKT + + + D +K+  +V  +R++L  +P ++Q++ 
Sbjct  114  LYVPNSIFSSISVENPGRMTNRRIKTVIGLRYEDADKVGAVVESVREMLQNHPGIDQKQT  173

Query  184  HRRVFLDNIDRENQALLIMVSCFVKTSHFEEYLRVKEVILLDLLRVISHHRARLATPIRT  363
                F +  D    +L IMV CF KT+ ++E+L V++ + L ++ ++  + A  A P +T
Sbjct  174  LLVYFNEFAD---SSLNIMVYCFTKTTVWKEWLAVQQDVYLKIITIVQANGADFAFPSQT  230

Query  364  V  366
            +
Sbjct  231  L  231



Lambda      K        H        a         alpha
   0.314    0.129    0.361    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1724604950500