BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig12976

Length=1073
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009783131.1|  PREDICTED: telomere repeat-binding protein 4...    145   4e-35   Nicotiana sylvestris
ref|NP_001233854.1|  telomere binding protein                           140   3e-33   
ref|XP_006345970.1|  PREDICTED: telomere repeat-binding protein 4...    132   2e-30   Solanum tuberosum [potatoes]
ref|XP_009785792.1|  PREDICTED: telomere repeat-binding protein 3...    131   6e-30   Nicotiana sylvestris
emb|CAC19789.1|  MYB-like DNA-binding protein                           131   6e-30   Catharanthus roseus [chatas]
ref|XP_009607614.1|  PREDICTED: telomere repeat-binding protein 4...    130   1e-29   Nicotiana tomentosiformis
ref|XP_009785793.1|  PREDICTED: telomere repeat-binding protein 3...    129   2e-29   Nicotiana sylvestris
ref|XP_009620521.1|  PREDICTED: telomere repeat-binding protein 3...    129   4e-29   Nicotiana tomentosiformis
ref|XP_006346713.1|  PREDICTED: telomere repeat-binding protein 4...    127   1e-28   Solanum tuberosum [potatoes]
ref|XP_004236731.1|  PREDICTED: telomere repeat-binding protein 3       119   8e-26   Solanum lycopersicum
ref|XP_009799099.1|  PREDICTED: telomere repeat-binding protein 4...    112   2e-23   Nicotiana sylvestris
gb|AAN39330.1|  telomere binding protein TBP1                           110   7e-23   Nicotiana glutinosa
ref|XP_009615640.1|  PREDICTED: telomere repeat-binding protein 4...    110   8e-23   Nicotiana tomentosiformis
emb|CDP00111.1|  unnamed protein product                                109   1e-22   Coffea canephora [robusta coffee]
ref|XP_011085026.1|  PREDICTED: telomere repeat-binding protein 4       104   5e-21   Sesamum indicum [beniseed]
ref|XP_008233636.1|  PREDICTED: telomere repeat-binding protein 3...  95.5    4e-18   Prunus mume [ume]
ref|XP_007009230.1|  Telomeric DNA binding protein 1, putative is...  94.0    1e-17   
ref|XP_007009231.1|  Telomeric DNA binding protein 1, putative is...  94.0    1e-17   
ref|XP_007009227.1|  Telomeric DNA binding protein 1, putative is...  93.6    1e-17   
ref|XP_007009228.1|  Telomeric DNA binding protein 1, putative is...  93.6    2e-17   
ref|XP_007009226.1|  Telomeric DNA binding protein 1, putative is...  93.6    2e-17   
ref|XP_010096584.1|  Telomere repeat-binding protein 4                89.7    4e-16   
ref|XP_008371854.1|  PREDICTED: telomere repeat-binding protein 3...  88.2    1e-15   Malus domestica [apple tree]
ref|XP_009357741.1|  PREDICTED: telomere repeat-binding protein 3...  86.7    4e-15   Pyrus x bretschneideri [bai li]
emb|CAA48413.1|  BPF-1                                                86.3    5e-15   Petroselinum crispum
ref|XP_009343592.1|  PREDICTED: telomere repeat-binding protein 3...  83.6    4e-14   Pyrus x bretschneideri [bai li]
ref|XP_008343536.1|  PREDICTED: telomere repeat-binding protein 3...  82.8    6e-14   
ref|XP_007221011.1|  hypothetical protein PRUPE_ppa002374mg           76.6    8e-12   
ref|XP_011077209.1|  PREDICTED: telomere repeat-binding protein 3...  76.3    1e-11   Sesamum indicum [beniseed]
gb|KJB73975.1|  hypothetical protein B456_011G266100                  74.3    2e-11   Gossypium raimondii
gb|EYU19914.1|  hypothetical protein MIMGU_mgv1a002489mg              74.7    3e-11   Erythranthe guttata [common monkey flower]
gb|KJB73977.1|  hypothetical protein B456_011G266100                  73.9    4e-11   Gossypium raimondii
gb|KHG29953.1|  Telomere repeat-binding 3 -like protein               73.9    6e-11   Gossypium arboreum [tree cotton]
gb|KJB73976.1|  hypothetical protein B456_011G266100                  73.6    8e-11   Gossypium raimondii
gb|KJB73978.1|  hypothetical protein B456_011G266100                  73.6    9e-11   Gossypium raimondii
ref|XP_010658554.1|  PREDICTED: telomere repeat-binding protein 4...  73.2    1e-10   Vitis vinifera
emb|CBI31661.3|  unnamed protein product                              71.6    3e-10   Vitis vinifera
ref|XP_006378700.1|  hypothetical protein POPTR_0010s20990g           70.9    6e-10   
ref|XP_006378703.1|  hypothetical protein POPTR_0010s20990g           70.5    8e-10   Populus trichocarpa [western balsam poplar]
ref|XP_002316279.2|  hypothetical protein POPTR_0010s20990g           70.5    8e-10   Populus trichocarpa [western balsam poplar]
ref|XP_006378702.1|  hypothetical protein POPTR_0010s20990g           70.5    9e-10   Populus trichocarpa [western balsam poplar]
ref|XP_010658557.1|  PREDICTED: telomere repeat-binding protein 4...  70.5    9e-10   Vitis vinifera
ref|XP_004307493.1|  PREDICTED: telomere repeat-binding protein 4     69.7    1e-09   Fragaria vesca subsp. vesca
ref|XP_011027692.1|  PREDICTED: telomere repeat-binding protein 3...  68.9    2e-09   Populus euphratica
emb|CAN72738.1|  hypothetical protein VITISV_021864                   68.9    3e-09   Vitis vinifera
gb|ADM64318.1|  putative telomeric protein                            63.2    2e-07   Cestrum parqui [green cestrum]
gb|KHG15516.1|  Telomere repeat-binding 3 -like protein               63.2    2e-07   Gossypium arboreum [tree cotton]
ref|XP_006378701.1|  hypothetical protein POPTR_0010s20990g           61.6    6e-07   
ref|XP_012089031.1|  PREDICTED: telomere repeat-binding protein 4...  60.5    1e-06   Jatropha curcas
ref|XP_012089039.1|  PREDICTED: telomere repeat-binding protein 4...  60.5    1e-06   Jatropha curcas
ref|XP_012089023.1|  PREDICTED: telomere repeat-binding protein 4...  60.1    2e-06   Jatropha curcas
gb|KHF99719.1|  Telomere repeat-binding 4 -like protein               59.7    3e-06   Gossypium arboreum [tree cotton]
gb|EPS64950.1|  hypothetical protein M569_09831                       59.3    3e-06   Genlisea aurea
ref|XP_008784600.1|  PREDICTED: telomere repeat-binding protein 5     59.3    3e-06   Phoenix dactylifera
gb|KJB67624.1|  hypothetical protein B456_010G200900                  57.8    9e-06   Gossypium raimondii
gb|KHN17923.1|  Telomere repeat-binding protein 3                     57.0    2e-05   Glycine soja [wild soybean]
ref|XP_006602000.1|  PREDICTED: telomere repeat-binding protein 3...  57.0    2e-05   Glycine max [soybeans]
ref|XP_003538412.1|  PREDICTED: telomere repeat-binding protein 3...  57.0    2e-05   Glycine max [soybeans]
ref|XP_006591341.1|  PREDICTED: telomere repeat-binding protein 3...  57.0    2e-05   Glycine max [soybeans]
ref|XP_011027219.1|  PREDICTED: telomere repeat-binding protein 3...  55.8    4e-05   Populus euphratica
ref|XP_011027217.1|  PREDICTED: telomere repeat-binding protein 3...  55.8    4e-05   Populus euphratica
ref|XP_002311174.2|  hypothetical protein POPTR_0008s05740g           55.5    5e-05   
ref|XP_010256896.1|  PREDICTED: telomere repeat-binding protein 5...  54.7    8e-05   Nelumbo nucifera [Indian lotus]
ref|XP_007163414.1|  hypothetical protein PHAVU_001G232700g           54.7    9e-05   Phaseolus vulgaris [French bean]
ref|XP_010256898.1|  PREDICTED: telomere repeat-binding protein 5...  54.7    1e-04   Nelumbo nucifera [Indian lotus]
ref|XP_006424854.1|  hypothetical protein CICLE_v10027927mg           54.3    1e-04   Citrus clementina [clementine]
ref|XP_006488345.1|  PREDICTED: telomere repeat-binding protein 5...  54.3    1e-04   Citrus sinensis [apfelsine]
ref|XP_006488343.1|  PREDICTED: telomere repeat-binding protein 5...  54.3    1e-04   Citrus sinensis [apfelsine]
ref|XP_006424849.1|  hypothetical protein CICLE_v10027927mg           53.9    1e-04   
gb|KJB78826.1|  hypothetical protein B456_013G021300                  54.3    1e-04   Gossypium raimondii
gb|KJB78829.1|  hypothetical protein B456_013G021300                  53.9    1e-04   Gossypium raimondii
ref|XP_006424852.1|  hypothetical protein CICLE_v10027927mg           53.9    1e-04   Citrus clementina [clementine]
gb|KDO72832.1|  hypothetical protein CISIN_1g042386mg                 53.9    1e-04   Citrus sinensis [apfelsine]
ref|XP_006602002.1|  PREDICTED: telomere repeat-binding protein 3...  53.1    3e-04   Glycine max [soybeans]
ref|XP_008359724.1|  PREDICTED: telomere repeat-binding protein 5...  52.4    4e-04   
ref|XP_008387775.1|  PREDICTED: telomere repeat-binding protein 5...  52.4    5e-04   
ref|XP_008359723.1|  PREDICTED: telomere repeat-binding protein 5...  52.0    5e-04   
ref|XP_008359725.1|  PREDICTED: telomere repeat-binding protein 2...  52.0    5e-04   
ref|XP_008387772.1|  PREDICTED: telomere repeat-binding protein 5...  52.4    5e-04   
ref|XP_008359721.1|  PREDICTED: telomere repeat-binding protein 5...  52.0    5e-04   
ref|XP_008359718.1|  PREDICTED: telomere repeat-binding protein 5...  52.0    5e-04   
ref|XP_008359722.1|  PREDICTED: telomere repeat-binding protein 5...  51.6    6e-04   
ref|XP_008387777.1|  PREDICTED: telomere repeat-binding protein 5...  52.0    6e-04   
ref|XP_008387776.1|  PREDICTED: telomere repeat-binding protein 5...  52.0    6e-04   
ref|XP_008387778.1|  PREDICTED: telomere repeat-binding protein 5...  52.0    6e-04   
ref|XP_010262528.1|  PREDICTED: telomere repeat-binding protein 5     52.0    6e-04   Nelumbo nucifera [Indian lotus]



>ref|XP_009783131.1| PREDICTED: telomere repeat-binding protein 4-like [Nicotiana 
sylvestris]
Length=688

 Score =   145 bits (367),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 128/253 (51%), Positives = 157/253 (62%), Gaps = 11/253 (4%)
 Frame = +2

Query  329   MVMKKRLEYGFDGYrfpavpraprssrrrHT-GNVDDKQICAFELLAAVAGKlllesess  505
             M  KKRL YGF GY+FP +P+APRS RRRH+  N+D+ QICAFELLAAVAG+LL ESESS
Sbjct  1     MSSKKRLNYGFSGYQFPVIPKAPRSVRRRHSHNNLDNNQICAFELLAAVAGELLQESESS  60

Query  506   assnaaeGKDGPAIQRDVTEELGNFQEGKALKPECLDRGSCVESAILPKGAIQEQKIKHG  685
             A SNAAEGKD  A  R V  +    +E KA+K EC  +GSCVES  +P+ A+ EQ +KH 
Sbjct  61    ACSNAAEGKDELADCR-VGVKCEQLKEDKAVKSECFSQGSCVESTYIPEPAVLEQNLKHS  119

Query  686   ----NGGssysenscvsesTFTEFSGKVYPGVKLESVKNLDAEGNFNSEVEGRPSNLGDL  853
                 N   +   +        ++FS K +   KLE+ K +D  G F++EVEGR SNL + 
Sbjct  120   LDKPNHVENNIFHKHNCSIMNSDFSQKDWSCAKLENCKKVDRGGKFHTEVEGRSSNLENA  179

Query  854   RSVNINNATQKQQLADDGMQTGDITMAGGCSVKDPikisltttnkntlnnsDCSVQLPLY  1033
              +  I   TQK QL DD  QT D+T+A  CSVK P    +   N N   NSD SVQ PLY
Sbjct  180   CNKKIETVTQK-QLDDDRKQTDDLTVANSCSVKGP---IVEHVNNNAAINSDNSVQFPLY  235

Query  1034  RDPVPSASFAKHR  1072
             R  VP  SF K R
Sbjct  236   R-AVPKPSFGKQR  247



>ref|NP_001233854.1| telomere binding protein [Solanum lycopersicum]
 dbj|BAF36749.1| telomere binding protein [Solanum lycopersicum]
Length=689

 Score =   140 bits (354),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 129/251 (51%), Positives = 163/251 (65%), Gaps = 11/251 (4%)
 Frame = +2

Query  329   MVMKKRLEYGFDGYrfpavpraprssrrrHT-GNVDDKQICAFELLAAVAGKlllesess  505
             MV KK+L++GF+G++ P +P+APRS RRR +   +DD QICAFELLAAVAGKLLLESESS
Sbjct  1     MVYKKKLDFGFNGFQVPVIPKAPRSVRRRRSCKKLDDDQICAFELLAAVAGKLLLESESS  60

Query  506   assnaaeGKDGPAIQRD-VTEELGNFQEGKALKPECLDRGSCVESAILPKGAIQEQKIKH  682
              SSNAAEGK+  A  RD +  E    +EGKA+K ECLD+GSCVES  LP  A+Q+Q +KH
Sbjct  61    TSSNAAEGKNEIADGRDGIKSE--QVEEGKAVKSECLDQGSCVESDYLPDTAVQDQNLKH  118

Query  683   GNGGssysenscvsesTFTEFSGKVYPGVKLESVKNLD-AEGNFNSEVEGRPSNLGDLRS  859
             G     ++EN+   E T T         +KLE+ K ++  +G F+ ++EG  S+L D   
Sbjct  119   GFDKPHHAENNYFLEHTSTVIGSDA--DLKLENCKEVNITDGKFHHKIEGGSSSLEDPCD  176

Query  860   VNINNATQKQQLADDGMQTGDITMAGGCSVKDPikisltttnkntlnnsDCSVQLPLYRD  1039
               I   TQK  L DD  Q  D+T+   CSVK+P        N + L NSD SVQLPLYRD
Sbjct  177   SKIRTGTQK-HLDDDSKQIEDVTVTNTCSVKNP---IKECVNNSGLFNSDGSVQLPLYRD  232

Query  1040  PVPSASFAKHR  1072
              VPSASF K R
Sbjct  233   SVPSASFVKQR  243



>ref|XP_006345970.1| PREDICTED: telomere repeat-binding protein 4-like [Solanum tuberosum]
Length=689

 Score =   132 bits (332),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 125/254 (49%), Positives = 161/254 (63%), Gaps = 17/254 (7%)
 Frame = +2

Query  329   MVMKKRLEYGFDGYrfpavpraprssrrrHT-GNVDDKQICAFELLAAVAGKlllesess  505
             MV KK+L++GF+G++ P +P+APRS RRR +   +DD QICAFELLAAVAGKLLLESESS
Sbjct  1     MVYKKKLDFGFNGFQVPVIPKAPRSVRRRRSCKKLDDDQICAFELLAAVAGKLLLESESS  60

Query  506   assnaaeGKDGPAIQRD-VTEELGNFQEGKALKPECLDRGSCVESAILPKGAIQEQKIKH  682
              SSNAAEGK+  A  RD +  E    +EGKA+K E LD+GSCVES  +P+ A Q+Q +KH
Sbjct  61    TSSNAAEGKNEIADGRDGIKSE--QVEEGKAVKSEYLDQGSCVESDYIPETAAQDQNLKH  118

Query  683   GNGGssysenscvsesTFTEFSGKVY---PGVKLESVKNLD-AEGNFNSEVEGRPSNLGD  850
             G     + +      + F E +  V      +KLE+ K ++  +G F+ ++EG  S+L D
Sbjct  119   G-----FDKPHHAENNYFLEHTSIVIGSDADLKLENCKEVNIPDGKFHPKIEGGSSSLED  173

Query  851   LRSVNINNATQKQQLADDGMQTGDITMAGGCSVKDPikisltttnkntlnnsDCSVQLPL  1030
                  I    QK  L DD  Q  D+T+   CSVK+P        N + L NSD SVQLPL
Sbjct  174   PCDGKIRTGIQK-HLDDDSKQIEDVTVTNTCSVKNP---IEECVNNSGLFNSDGSVQLPL  229

Query  1031  YRDPVPSASFAKHR  1072
             YRD VPSASF KHR
Sbjct  230   YRDSVPSASFVKHR  243



>ref|XP_009785792.1| PREDICTED: telomere repeat-binding protein 3-like isoform X1 
[Nicotiana sylvestris]
Length=695

 Score =   131 bits (329),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 122/260 (47%), Positives = 154/260 (59%), Gaps = 24/260 (9%)
 Frame = +2

Query  329   MVMKKRLEYGFDGYrfpavpraprssrrrHTGN-VDDKQICAFELLAAVAGKlllesess  505
             MV KKRL  GF GY+ P +P+APRS+R+R   N +DD QICAFELLAAVAGKLLLESESS
Sbjct  1     MVSKKRLNCGFSGYQIPVIPKAPRSARKRRPCNKLDDDQICAFELLAAVAGKLLLESESS  60

Query  506   assna--aeGKDGPAIQRDVTEELGNFQEGKALKPECLDRGSCVESAILPKGAIQEQKIK  679
             ASSNA    GK   A  RD  +     ++ KA++ ECLD+GSC+ESA +P+ A QEQ  K
Sbjct  61    ASSNAGAPAGKYELANCRDSIKH-EQVEDDKAVRSECLDQGSCIESAYIPEAAEQEQTFK  119

Query  680   HGNGGssysenscvsesTFTEFSGKV---------YPGVKLESVKNLDAEGNFNSEVEGR  832
             +G               +F E +  +         +  VKLES K + A+    ++VEG 
Sbjct  120   NG------LSKPFAENKSFLEHTSTIIGSYSLLKDWSDVKLESCKEVSADAQLQTKVEGG  173

Query  833   PSNLGDLRSVNINNATQKQQLADDGMQTGDITMAGGCSVKDPikisltttnkntlnnsDC  1012
               +L D   + I   T+K QL DD  QT ++T+   CS+K P        N + L NSD 
Sbjct  174   SPDLADPFDIRIVEGTRK-QLDDDSKQT-ELTVVNSCSIKAP---IEKNVNNSVLVNSDS  228

Query  1013  SVQLPLYRDPVPSASFAKHR  1072
             SVQLPLYRDPVP ASF K R
Sbjct  229   SVQLPLYRDPVPCASFVKSR  248



>emb|CAC19789.1| MYB-like DNA-binding protein [Catharanthus roseus]
Length=693

 Score =   131 bits (329),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 127/254 (50%), Positives = 156/254 (61%), Gaps = 11/254 (4%)
 Frame = +2

Query  329   MVMKKRLEYGFDGYrfpavpraprssrrr--HTGNVDDKQICAFELLAAVAGKllleses  502
             MV+K+RLEYGF GY+ P +P+APRS RRR      VDD QICAFELLAAVAGKLL ESES
Sbjct  1     MVLKRRLEYGFSGYQIPVIPKAPRSVRRRGPRKKLVDDHQICAFELLAAVAGKLLQESES  60

Query  503   sassnaaeGKDGPAIQRDVTEELGNFQEGKALKPECLDRGSCVESAILPKGAIQEQKIKH  682
             SASSNA+E KD   I  D  ++    +  K ++ ECLD+GSCVESA +P+ A++E     
Sbjct  61    SASSNASEPKDLLGIHLDGIKQERVEENNKTVRSECLDQGSCVESAFIPELAVKEHNSNP  120

Query  683   GNGGssysenscvsesTFT----EFSGKVYPGVKLESVKNLDAEGNFNSEVEGRPSNLGD  850
               G    +EN   SE T T    +FS KV   +KL  + N   EGN NS+ E     LGD
Sbjct  121   SLGDLPNTENDSFSERTSTLLSSDFSKKVDCELKL-GICNDKTEGNLNSKAEDDTYALGD  179

Query  851   LRSVNINNATQKQQLADDGMQTGDITMAGGCSVKDPikisltttnkntlnnsDCSVQLPL  1030
             L +    N + +Q   D+  Q  D+T A  CSVK+        TN+  L NSD SVQL L
Sbjct  180   LSNSKTGNESVRQS-EDETKQGKDLTAANPCSVKN---TVEKCTNRKPLINSDSSVQLSL  235

Query  1031  YRDPVPSASFAKHR  1072
             YRDP+PSASF KHR
Sbjct  236   YRDPLPSASFPKHR  249



>ref|XP_009607614.1| PREDICTED: telomere repeat-binding protein 4-like [Nicotiana 
tomentosiformis]
 ref|XP_009607681.1| PREDICTED: telomere repeat-binding protein 4-like [Nicotiana 
tomentosiformis]
Length=688

 Score =   130 bits (327),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 122/253 (48%), Positives = 149/253 (59%), Gaps = 11/253 (4%)
 Frame = +2

Query  329   MVMKKRLEYGFDGYrfpavpraprssrrrHT-GNVDDKQICAFELLAAVAGKlllesess  505
             M  KKRL YGF G +FP +P+APRS RRRH+  N+D+ QICAFELLAAVAG+LL ESESS
Sbjct  1     MSSKKRLNYGFSGCQFPVIPKAPRSVRRRHSHNNLDNDQICAFELLAAVAGELLQESESS  60

Query  506   assnaaeGKDGPAIQRDVTEELGNFQEGKALKPECLDRGSCVESAILPKGAIQEQKIKHG  685
             A SN AEGK G   +  V  +    +E K +K EC  +GSCVES  +P+ A  EQ  KH 
Sbjct  61    ACSNVAEGK-GELAECRVGVKCEQLKEDKPVKSECFSQGSCVESTYIPEPAALEQNFKHS  119

Query  686   ----NGGssysenscvsesTFTEFSGKVYPGVKLESVKNLDAEGNFNSEVEGRPSNLGDL  853
                 N   +   +        ++FS K +   KLE+ K +D  G F++EVEG  SNL + 
Sbjct  120   LDKPNHVENNIFHRHNCSIMNSDFSQKDWSCAKLENCKKVDRGGKFHTEVEGGSSNLENA  179

Query  854   RSVNINNATQKQQLADDGMQTGDITMAGGCSVKDPikisltttnkntlnnsDCSVQLPLY  1033
              +  I   TQK QL DD  QT D+T+A  CSVK P        N N   NSD SVQ PLY
Sbjct  180   CNKKIETVTQK-QLDDDRKQTDDLTVANSCSVKGP---IEKHVNNNAAINSDNSVQFPLY  235

Query  1034  RDPVPSASFAKHR  1072
             R  VP  SF K R
Sbjct  236   R-VVPKPSFGKQR  247



>ref|XP_009785793.1| PREDICTED: telomere repeat-binding protein 3-like isoform X2 
[Nicotiana sylvestris]
Length=684

 Score =   129 bits (324),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 120/258 (47%), Positives = 152/258 (59%), Gaps = 31/258 (12%)
 Frame = +2

Query  329   MVMKKRLEYGFDGYrfpavpraprssrrrHTGN-VDDKQICAFELLAAVAGKlllesess  505
             MV KKRL  GF GY+ P +P+APRS+R+R   N +DD QICAFELLAAVAGKLLLESESS
Sbjct  1     MVSKKRLNCGFSGYQIPVIPKAPRSARKRRPCNKLDDDQICAFELLAAVAGKLLLESESS  60

Query  506   assnaaeGKDGPAIQRDVTEELGNFQEGKALKPECLDRGSCVESAILPKGAIQEQKIKHG  685
             ASSNA      PA + +  E+       KA++ ECLD+GSC+ESA +P+ A QEQ  K+G
Sbjct  61    ASSNAG----APAGKYEQVED------DKAVRSECLDQGSCIESAYIPEAAEQEQTFKNG  110

Query  686   NGGssysenscvsesTFTEFSGKV---------YPGVKLESVKNLDAEGNFNSEVEGRPS  838
                            +F E +  +         +  VKLES K + A+    ++VEG   
Sbjct  111   ------LSKPFAENKSFLEHTSTIIGSYSLLKDWSDVKLESCKEVSADAQLQTKVEGGSP  164

Query  839   NLGDLRSVNINNATQKQQLADDGMQTGDITMAGGCSVKDPikisltttnkntlnnsDCSV  1018
             +L D   + I   T+K QL DD  QT ++T+   CS+K P        N + L NSD SV
Sbjct  165   DLADPFDIRIVEGTRK-QLDDDSKQT-ELTVVNSCSIKAP---IEKNVNNSVLVNSDSSV  219

Query  1019  QLPLYRDPVPSASFAKHR  1072
             QLPLYRDPVP ASF K R
Sbjct  220   QLPLYRDPVPCASFVKSR  237



>ref|XP_009620521.1| PREDICTED: telomere repeat-binding protein 3-like [Nicotiana 
tomentosiformis]
Length=684

 Score =   129 bits (323),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 121/258 (47%), Positives = 152/258 (59%), Gaps = 31/258 (12%)
 Frame = +2

Query  329   MVMKKRLEYGFDGYrfpavpraprssrrrHTGN-VDDKQICAFELLAAVAGKlllesess  505
             MV KKRL+ GF GY+ P +P+APRS+R+R   N +DD QICAFELLAAVAGKLLLESESS
Sbjct  1     MVSKKRLKCGFSGYQIPVIPKAPRSARKRRPCNKLDDDQICAFELLAAVAGKLLLESESS  60

Query  506   assnaaeGKDGPAIQRDVTEELGNFQEGKALKPECLDRGSCVESAILPKGAIQEQKIKHG  685
             ASSNA      PA + +  E+       KA++ ECLD+GSCVESA +P+ A QEQ  K+G
Sbjct  61    ASSNAG----APAGKYEQVED------DKAVRSECLDQGSCVESAYIPEAAEQEQAFKNG  110

Query  686   NGGssysenscvsesTFTEFSGKV---------YPGVKLESVKNLDAEGNFNSEVEGRPS  838
                             F E +  +         +  VKLES K + A+    ++VEG   
Sbjct  111   ------LSKPFAENKFFLEHTSTIIGSNSLLKDWSDVKLESCKEVSADAQLQTKVEGGSP  164

Query  839   NLGDLRSVNINNATQKQQLADDGMQTGDITMAGGCSVKDPikisltttnkntlnnsDCSV  1018
             +L D   + I   T+K QL DD  QT ++T+A  CS+K P        N + L NSD SV
Sbjct  165   DLADPFDIRIVEGTRK-QLDDDSKQT-ELTVANTCSIKAP---IEKNVNSSALVNSDSSV  219

Query  1019  QLPLYRDPVPSASFAKHR  1072
             Q PLYRDPVP ASF K R
Sbjct  220   QFPLYRDPVPCASFVKSR  237



>ref|XP_006346713.1| PREDICTED: telomere repeat-binding protein 4-like [Solanum tuberosum]
Length=670

 Score =   127 bits (319),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 120/250 (48%), Positives = 144/250 (58%), Gaps = 39/250 (16%)
 Frame = +2

Query  329   MVMKKRLEYGFDGYrfpavpraprssrrrHT-GNVDDKQICAFELLAAVAGKlllesess  505
             M  KKR+ +GF GY FP +P+APRS RRRH+  N+D+ QICAFELLAAVAG+LL ESESS
Sbjct  1     MSSKKRVRHGFSGYEFPVIPKAPRSVRRRHSHNNIDNDQICAFELLAAVAGELLQESESS  60

Query  506   assnaaeGKDGPAIQRDVTEELGNFQEGKALKPECLDRGSCVESAILPKGAIQEQKIKHG  685
             A SNAA GKD  +  R+V +     +E KA+K EC D+GSCVESA LP+ A+QE      
Sbjct  61    ACSNAAVGKDELSDCREVVKR-EQLKEDKAVKSECFDQGSCVESAHLPEPAVQE------  113

Query  686   NGGssysenscvsesTFTEFSGKVYPGVKLESVKNLDAEGN-FNSEVEGRPSNLGDLRSV  862
                                      P +K    K    E N F++EVEG  SNL D+   
Sbjct  114   -------------------------PNLKYSLDKPYHIENNIFHTEVEGGSSNLEDVCDK  148

Query  863   NINNATQKQQLADDGMQTGDITMAGGCSVKDPikisltttnkntlnnsDCSVQLPLYRDP  1042
               +  TQK QL DDG QT D+T+A  CSVK P        N N+  NSD SVQLP YR  
Sbjct  149   RTDTGTQK-QLTDDGKQTEDLTVANSCSVKGP---IEKHVNNNSAINSDSSVQLPWYR-A  203

Query  1043  VPSASFAKHR  1072
             VP  SF K R
Sbjct  204   VPRPSFGKQR  213



>ref|XP_004236731.1| PREDICTED: telomere repeat-binding protein 3 [Solanum lycopersicum]
Length=667

 Score =   119 bits (297),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 114/250 (46%), Positives = 140/250 (56%), Gaps = 39/250 (16%)
 Frame = +2

Query  329   MVMKKRLEYGFDGYrfpavpraprssrrrHTG-NVDDKQICAFELLAAVAGKlllesess  505
             M  KKR+ +GF G+ FP +P+APRS RRRH+  N+++ QICAFELLA VAG+LL ESESS
Sbjct  1     MSSKKRVRHGFSGFEFPVIPKAPRSVRRRHSHKNINNDQICAFELLATVAGELLQESESS  60

Query  506   assnaaeGKDGPAIQRDVTEELGNFQEGKALKPECLDRGSCVESAILPKGAIQEQKIKHG  685
             A S+A  GKD  +  R+V +     +E KA+K EC D+GSCVESA LP+ A+QE      
Sbjct  61    ACSSAVIGKDKLSDCREVVKR-EQLKEDKAVKSECFDQGSCVESAYLPEPAVQE------  113

Query  686   NGGssysenscvsesTFTEFSGKVYPGVKLESVKNLDAEGN-FNSEVEGRPSNLGDLRSV  862
                                      P +K    K    E N F +EVEG  SNL D+   
Sbjct  114   -------------------------PNLKYSLDKPNRIENNIFRTEVEGASSNLEDVYDK  148

Query  863   NINNATQKQQLADDGMQTGDITMAGGCSVKDPikisltttnkntlnnsDCSVQLPLYRDP  1042
               +  TQK QL DDG QT D+T+A   SVK P        N N+  NSD SVQLP YR  
Sbjct  149   RTDTGTQK-QLTDDGKQTEDLTLANSSSVKGP---IEKRVNNNSAINSDSSVQLPWYR-A  203

Query  1043  VPSASFAKHR  1072
             VP  SF K R
Sbjct  204   VPRPSFGKQR  213



>ref|XP_009799099.1| PREDICTED: telomere repeat-binding protein 4-like [Nicotiana 
sylvestris]
Length=677

 Score =   112 bits (279),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 115/249 (46%), Positives = 149/249 (60%), Gaps = 18/249 (7%)
 Frame = +2

Query  329   MVMKKRLEYGFDGYrfpavpraprssrrrHTGNVDDKQICAFELLAAVAGKlllesessa  508
             MV KK+L++GF+G++ P +P+APRS R   +   DD QICAFELLAAVAGKLL ESESS 
Sbjct  1     MVSKKKLDFGFNGFQVPFIPKAPRSRRGS-SKKFDDDQICAFELLAAVAGKLLQESESST  59

Query  509   ssnaaeGKDGPAIQRDVTEELGNFQEGKALKPECLDRGSCVESAILPKGAIQEQKIKHGN  688
             SSN AEGK   +  RD  +     +E KA+K ECLD+GSCVESA +P+ A +EQ +KH  
Sbjct  60    SSNVAEGKYELSDCRDGIK-CEQVEEDKAVKSECLDQGSCVESAYIPEPAAREQNLKHDL  118

Query  689   GGssysenscvsesTFTEFSGKVYPGVKLESVKNLD-AEGNFNSEVEGRPSNLGDLRSVN  865
                 Y+EN+ + E T T         V LE+ K ++ A+GN  ++VE   S +       
Sbjct  119   DKPYYAENNSILEHTSTVIGSD--SDVTLENCKEVNVADGNLPAKVEDFDSKIS------  170

Query  866   INNATQKQQLADDGMQTGDITMAGGCSVKDPikisltttnkntlnnsDCSVQLPLYRDPV  1045
                 TQK QL DD  Q  ++T+   CSVK P        N N L + + SV+L LYRD V
Sbjct  171   ---GTQK-QLDDDSKQIDNLTVTNTCSVKGP---IEKHVNNNALISPENSVELSLYRDLV  223

Query  1046  PSASFAKHR  1072
             P ASF K R
Sbjct  224   PRASFVKQR  232



>gb|AAN39330.1| telomere binding protein TBP1 [Nicotiana glutinosa]
Length=681

 Score =   110 bits (274),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 120/250 (48%), Positives = 153/250 (61%), Gaps = 17/250 (7%)
 Frame = +2

Query  329   MVMKKRLEYGFDGYrfpavpraprssrrrHT-GNVDDKQICAFELLAAVAGKlllesess  505
             MV KK+L++GF+G++ P +P+APRS RRR T    DD QICAFELLAAVAGKLL ESESS
Sbjct  1     MVSKKKLDFGFNGFQVPFIPKAPRSVRRRGTCKKFDDDQICAFELLAAVAGKLLQESESS  60

Query  506   assnaaeGKDGPAIQRDVTEELGNFQEGKALKPECLDRGSCVESAILPKGAIQEQKIKHG  685
              SSNAAEGK   +  RD  +     +E KA+K ECLD+GSCVESA +P+ A++EQ +K  
Sbjct  61    TSSNAAEGKYELSDCRDGIK-CEQVEEDKAVKSECLDQGSCVESAYVPEPAVREQNLKRD  119

Query  686   NGGssysenscvsesTFTEFSGKVYPGVKLESVKNLD-AEGNFNSEVEGRPSNLGDLRSV  862
                  Y+ENS + E   +   G     + LE+ K ++ A+GNF ++VE   S +      
Sbjct  120   LDKPYYAENSSILEQHTSTVIGS-DSDMTLENCKEVNVADGNFPAKVEDFDSKI------  172

Query  863   NINNATQKQQLADDGMQTGDITMAGGCSVKDPikisltttnkntlnnsDCSVQLPLYRDP  1042
                + TQK  L DD  Q  D+T+   C VK P        N N L NS+ SVQL LYRD 
Sbjct  173   ---SGTQK-HLDDDSKQIDDLTVTNACRVKGP---IEKHVNNNALFNSESSVQLSLYRDL  225

Query  1043  VPSASFAKHR  1072
             VP ASF K R
Sbjct  226   VPRASFVKQR  235



>ref|XP_009615640.1| PREDICTED: telomere repeat-binding protein 4-like [Nicotiana 
tomentosiformis]
Length=680

 Score =   110 bits (274),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 117/250 (47%), Positives = 153/250 (61%), Gaps = 18/250 (7%)
 Frame = +2

Query  329   MVMKKRLEYGFDGYrfpavpraprssrrrHT-GNVDDKQICAFELLAAVAGKlllesess  505
             MV KK+L++GF+G++ P +P+APRS RRR +    DD QICAFELLAAVAGKLL ESESS
Sbjct  1     MVSKKKLDFGFNGFQVPFIPKAPRSVRRRGSCKKFDDDQICAFELLAAVAGKLLQESESS  60

Query  506   assnaaeGKDGPAIQRDVTEELGNFQEGKALKPECLDRGSCVESAILPKGAIQEQKIKHG  685
              SSNAAEGK   +  RD  +     +E KA+K ECLD+GSCVESA +P+ A++EQ +KH 
Sbjct  61    TSSNAAEGKYELSDCRDGIK-CEQVEEDKAVKSECLDQGSCVESAYIPEPAVREQNLKHD  119

Query  686   NGGssysenscvsesTFTEFSGKVYPGVKLESVKNLD-AEGNFNSEVEGRPSNLGDLRSV  862
                  Y+EN+ + E T T         + LE+ K ++ A+G F ++VE   + + +    
Sbjct  120   LDKPYYAENNSILEHTSTVIGSD--SDMTLENCKEVNVADGKFPAKVEDFDNKISE----  173

Query  863   NINNATQKQQLADDGMQTGDITMAGGCSVKDPikisltttnkntlnnsDCSVQLPLYRDP  1042
                  TQK  + DD  Q  D+T+   CSVK P        N N L NS+ SVQL LYRD 
Sbjct  174   -----TQK-HIDDDSKQIDDLTVTNTCSVKGP---IEKHVNNNALFNSESSVQLSLYRDL  224

Query  1043  VPSASFAKHR  1072
             VP ASF   R
Sbjct  225   VPRASFVNQR  234



>emb|CDP00111.1| unnamed protein product [Coffea canephora]
Length=692

 Score =   109 bits (272),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 115/254 (45%), Positives = 146/254 (57%), Gaps = 18/254 (7%)
 Frame = +2

Query  329   MVMKKRLEYGFDGYrfpavpraprssrr--rHTGNVDDKQICAFELLAAVAGKllleses  502
             MV+KKRL+YGF GY+ P +PRAPRS RR   H  +V+D QICAFELLAAVAGKLL ESES
Sbjct  1     MVLKKRLDYGFHGYQIPVIPRAPRSVRRRGAHKKSVEDHQICAFELLAAVAGKLLQESES  60

Query  503   sassnaaeGKDGPAIQRDVTEELGNFQEGKALKPECLDRGSCVESAILPKGAIQEQKIKH  682
             SASSNA+E K  P     + +E    +E KA + ECLD+GSCVES  +P+    EQ  K 
Sbjct  61    SASSNASEAKVQPCHMDGIKKERS--EETKAFRTECLDQGSCVESTFIPERVAGEQNFK-  117

Query  683   GNGGssysenscvsesTFTEFSGKVYPGVKLESVKNLDAEGNFNSEVEGRPSNLGDLRSV  862
              +    +      S  T ++FS KV   +KL    N  A+ + +  V G     G   S 
Sbjct  118   -SSVEDHPNLENDSIITSSDFSKKVDCDLKLGICNNKTADEDNHFNVAG-----GSHPSQ  171

Query  863   NINN----ATQKQQLADDGMQTGDITMAGGCSVKDPikisltttnkntlnnsDCSVQLPL  1030
             NI N       K+Q+ D+   + ++T+A   +VK          N  T+ NSD SVQL L
Sbjct  172   NICNGKTETAAKRQVGDETKWSQELTVANSPNVKH---QVGKCMNSKTVINSDSSVQLSL  228

Query  1031  YRDPVPSASFAKHR  1072
             YRDPV S SF KHR
Sbjct  229   YRDPVSSVSFPKHR  242



>ref|XP_011085026.1| PREDICTED: telomere repeat-binding protein 4 [Sesamum indicum]
Length=687

 Score =   104 bits (259),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 102/253 (40%), Positives = 133/253 (53%), Gaps = 21/253 (8%)
 Frame = +2

Query  329   MVMKKRLEYGFDGYrfpa--vpraprssrrrHTGNVDDKQICAFELLAAVAGKllleses  502
             MV KKRL+YGF+GYR P           R  H  +++D ++CAFELLAAVAGKLL ESES
Sbjct  1     MVSKKRLDYGFNGYRAPIIPRAPRSIRRRSPHKNSIEDSKLCAFELLAAVAGKLLQESES  60

Query  503   sassnaaeGKDGPAIQRDVTEELGNFQE----GKALKPECLDRGSCVESAILPKGAIQEQ  670
             SASS+ A GK  P I +      GN +E     KALK E  D GSC ESA +P+ ++ EQ
Sbjct  61    SASSSVANGKFQPGICQG-----GNKKEQSLDDKALKSESFDHGSCAESAFIPEISVPEQ  115

Query  671   KIKHGNGGssysenscvsesTFTEFSGKVYPGVKLESVKNLDAEGNFNSEVEGRPSNLGD  850
                  N     +          ++   KV   +KL + +  +A+GN  S+VEG     GD
Sbjct  116   NQLENNSALEQTSVRAT-----SDIRKKVDCDIKLGTSEVKNADGNTISKVEGSIC-FGD  169

Query  851   LRSVNINNATQKQQLADDGMQTGDITMAGGCSVKDPikisltttnkntlnnsDCSVQLPL  1030
               +  +    +     DD  Q  D ++A   +VKDP        N N L  S+ SVQLPL
Sbjct  170   SLNCKVEGGAE-MHAKDDNNQIIDSSLADTSTVKDP---IEEDVNTNLLIKSEGSVQLPL  225

Query  1031  YRDPVPSASFAKH  1069
             YRDP+P A   KH
Sbjct  226   YRDPIPDALLQKH  238



>ref|XP_008233636.1| PREDICTED: telomere repeat-binding protein 3-like [Prunus mume]
Length=692

 Score = 95.5 bits (236),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 102/256 (40%), Positives = 152/256 (59%), Gaps = 16/256 (6%)
 Frame = +2

Query  329   MVMKKRLEYGFDGYrfpavpraprssrrr--HTGNVDDKQICAFELLAAVAGKl-llese  499
             MV+KKRL++GFDG++ P++PRAPRS+RRR  H  +VD+ QICAFELLA++AGKL      
Sbjct  1     MVLKKRLDFGFDGFQVPSIPRAPRSARRRGPHKKSVDNGQICAFELLASLAGKLLQESES  60

Query  500   ssassnaaeGKDGPAIQRDVTEELGNFQEGKALKPECLDRGSCVESAIL---PKGAIQEQ  670
             SSASSNA+EG   PA  +DV +E  +  E K LK ECLD+GS  ES  L    +   Q+ 
Sbjct  61    SSASSNASEGNSKPAFGKDVKQERQD--EHKPLKEECLDQGSSEESVSLELTSQNIDQKF  118

Query  671   KIKHGNGGssysenscvsesTFTEFSGKVYPGVKLESV--KNLDAEGNFNSEVEGRPSNL  844
              +K      S +     S  T ++ S K   G +++SV   +     +++S+VEG    +
Sbjct  119   ILKEFPHAESDTVLEHTSVITNSDSSAKA--GGRMKSVICSSRPIFQSYSSKVEGGSRGI  176

Query  845   GDLRSVNINNATQKQQLADDGMQTGDITMAGGCSVKDPikisltttnkntlnnsDCSVQL  1024
             G+    N+ N  + Q+   + ++TG +T A  CS K+P ++             D +V+L
Sbjct  177   GESCYGNVANGVEVQK-DSERLETGALTRANPCSSKNPTELHAKYPAMLNG---DNNVKL  232

Query  1025  PLYRDPVPSASFAKHR  1072
              L+RDP+P+ASF++HR
Sbjct  233   SLFRDPIPNASFSRHR  248



>ref|XP_007009230.1| Telomeric DNA binding protein 1, putative isoform 5 [Theobroma 
cacao]
 gb|EOY18040.1| Telomeric DNA binding protein 1, putative isoform 5 [Theobroma 
cacao]
Length=514

 Score = 94.0 bits (232),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 102/253 (40%), Positives = 142/253 (56%), Gaps = 10/253 (4%)
 Frame = +2

Query  329   MVMKKRLEYGFDGYrfpavpraprssrrr--HTGNVDDKQICAFELLAAVAGKllleses  502
             MV KKRL+YGF+ +  P +PRAPRS+RRR      VDD QICAFELLA++AGKLL ESES
Sbjct  1     MVFKKRLDYGFNAFNVPKIPRAPRSTRRRGQSKRTVDDSQICAFELLASLAGKLLQESES  60

Query  503   sassnaaeGKDGPAIQRDVTEELGNFQEGKALKPECLDRGSCVESAILPKGAIQEQ-KIK  679
             SASSNA+EG D  +I +DV ++   + + K LK EC ++GSC  S +      +    +K
Sbjct  61    SASSNASEGHDHVSIGKDVVKQEIQYDD-KPLKTECFEQGSCEASVVASVSTTENSDNLK  119

Query  680   HGNGGssysenscvsesTFTEFSGKVYPGVKLESVKNLDAEGNF--NSEVEGRPSNLGDL  853
                   + +        T   F  ++    K    K   A GNF  N+ V+G   ++G+L
Sbjct  120   EFTHAENDAILERTLIKTQPAFLEQIGGDSKSVICKGNVAYGNFPCNANVDGYSPDIGEL  179

Query  854   RSVNINNATQKQQLADDGMQTGDITMAGGCSVKDPikisltttnkntlnnsDCSVQLPLY  1033
                   N  +++Q A  G++TG + +A  C  KDP      +       NSD  V+LP  
Sbjct  180   CDGKSENGFKQEQDA-RGLETGALHIANTCPSKDP---VELSMTFPPPINSDRDVKLPSR  235

Query  1034  RDPVPSASFAKHR  1072
             RDPVP+ASF++HR
Sbjct  236   RDPVPNASFSRHR  248



>ref|XP_007009231.1| Telomeric DNA binding protein 1, putative isoform 6 [Theobroma 
cacao]
 gb|EOY18041.1| Telomeric DNA binding protein 1, putative isoform 6 [Theobroma 
cacao]
Length=516

 Score = 94.0 bits (232),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 102/253 (40%), Positives = 142/253 (56%), Gaps = 10/253 (4%)
 Frame = +2

Query  329   MVMKKRLEYGFDGYrfpavpraprssrrr--HTGNVDDKQICAFELLAAVAGKllleses  502
             MV KKRL+YGF+ +  P +PRAPRS+RRR      VDD QICAFELLA++AGKLL ESES
Sbjct  1     MVFKKRLDYGFNAFNVPKIPRAPRSTRRRGQSKRTVDDSQICAFELLASLAGKLLQESES  60

Query  503   sassnaaeGKDGPAIQRDVTEELGNFQEGKALKPECLDRGSCVESAILPKGAIQEQ-KIK  679
             SASSNA+EG D  +I +DV ++   + + K LK EC ++GSC  S +      +    +K
Sbjct  61    SASSNASEGHDHVSIGKDVVKQEIQYDD-KPLKTECFEQGSCEASVVASVSTTENSDNLK  119

Query  680   HGNGGssysenscvsesTFTEFSGKVYPGVKLESVKNLDAEGNF--NSEVEGRPSNLGDL  853
                   + +        T   F  ++    K    K   A GNF  N+ V+G   ++G+L
Sbjct  120   EFTHAENDAILERTLIKTQPAFLEQIGGDSKSVICKGNVAYGNFPCNANVDGYSPDIGEL  179

Query  854   RSVNINNATQKQQLADDGMQTGDITMAGGCSVKDPikisltttnkntlnnsDCSVQLPLY  1033
                   N  +++Q A  G++TG + +A  C  KDP      +       NSD  V+LP  
Sbjct  180   CDGKSENGFKQEQDA-RGLETGALHIANTCPSKDP---VELSMTFPPPINSDRDVKLPSR  235

Query  1034  RDPVPSASFAKHR  1072
             RDPVP+ASF++HR
Sbjct  236   RDPVPNASFSRHR  248



>ref|XP_007009227.1| Telomeric DNA binding protein 1, putative isoform 2 [Theobroma 
cacao]
 ref|XP_007009229.1| Telomeric DNA binding protein 1, putative isoform 2 [Theobroma 
cacao]
 ref|XP_007009232.1| Telomeric DNA binding protein 1, putative isoform 2 [Theobroma 
cacao]
 gb|EOY18037.1| Telomeric DNA binding protein 1, putative isoform 2 [Theobroma 
cacao]
 gb|EOY18039.1| Telomeric DNA binding protein 1, putative isoform 2 [Theobroma 
cacao]
 gb|EOY18042.1| Telomeric DNA binding protein 1, putative isoform 2 [Theobroma 
cacao]
Length=507

 Score = 93.6 bits (231),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 102/253 (40%), Positives = 142/253 (56%), Gaps = 10/253 (4%)
 Frame = +2

Query  329   MVMKKRLEYGFDGYrfpavpraprssrrr--HTGNVDDKQICAFELLAAVAGKllleses  502
             MV KKRL+YGF+ +  P +PRAPRS+RRR      VDD QICAFELLA++AGKLL ESES
Sbjct  1     MVFKKRLDYGFNAFNVPKIPRAPRSTRRRGQSKRTVDDSQICAFELLASLAGKLLQESES  60

Query  503   sassnaaeGKDGPAIQRDVTEELGNFQEGKALKPECLDRGSCVESAILPKGAIQEQ-KIK  679
             SASSNA+EG D  +I +DV ++   + + K LK EC ++GSC  S +      +    +K
Sbjct  61    SASSNASEGHDHVSIGKDVVKQEIQYDD-KPLKTECFEQGSCEASVVASVSTTENSDNLK  119

Query  680   HGNGGssysenscvsesTFTEFSGKVYPGVKLESVKNLDAEGNF--NSEVEGRPSNLGDL  853
                   + +        T   F  ++    K    K   A GNF  N+ V+G   ++G+L
Sbjct  120   EFTHAENDAILERTLIKTQPAFLEQIGGDSKSVICKGNVAYGNFPCNANVDGYSPDIGEL  179

Query  854   RSVNINNATQKQQLADDGMQTGDITMAGGCSVKDPikisltttnkntlnnsDCSVQLPLY  1033
                   N  +++Q A  G++TG + +A  C  KDP      +       NSD  V+LP  
Sbjct  180   CDGKSENGFKQEQDA-RGLETGALHIANTCPSKDP---VELSMTFPPPINSDRDVKLPSR  235

Query  1034  RDPVPSASFAKHR  1072
             RDPVP+ASF++HR
Sbjct  236   RDPVPNASFSRHR  248



>ref|XP_007009228.1| Telomeric DNA binding protein 1, putative isoform 3 [Theobroma 
cacao]
 gb|EOY18038.1| Telomeric DNA binding protein 1, putative isoform 3 [Theobroma 
cacao]
Length=657

 Score = 93.6 bits (231),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 103/254 (41%), Positives = 146/254 (57%), Gaps = 12/254 (5%)
 Frame = +2

Query  329   MVMKKRLEYGFDGYrfpavpraprssrrr--HTGNVDDKQICAFELLAAVAGKllleses  502
             MV KKRL+YGF+ +  P +PRAPRS+RRR      VDD QICAFELLA++AGKLL ESES
Sbjct  1     MVFKKRLDYGFNAFNVPKIPRAPRSTRRRGQSKRTVDDSQICAFELLASLAGKLLQESES  60

Query  503   sassnaaeGKDGPAIQRDVTEELGNFQEGKALKPECLDRGSCVESAILPKGAIQEQK--I  676
             SASSNA+EG D  +I +DV ++   + + K LK EC ++GSC E++++   +  E    +
Sbjct  61    SASSNASEGHDHVSIGKDVVKQEIQYDD-KPLKTECFEQGSC-EASVVASVSTTENSDNL  118

Query  677   KHGNGGssysenscvsesTFTEFSGKVYPGVKLESVKNLDAEGNF--NSEVEGRPSNLGD  850
             K      + +        T   F  ++    K    K   A GNF  N+ V+G   ++G+
Sbjct  119   KEFTHAENDAILERTLIKTQPAFLEQIGGDSKSVICKGNVAYGNFPCNANVDGYSPDIGE  178

Query  851   LRSVNINNATQKQQLADDGMQTGDITMAGGCSVKDPikisltttnkntlnnsDCSVQLPL  1030
             L      N  +++Q A  G++TG + +A  C  KDP      +       NSD  V+LP 
Sbjct  179   LCDGKSENGFKQEQDA-RGLETGALHIANTCPSKDP---VELSMTFPPPINSDRDVKLPS  234

Query  1031  YRDPVPSASFAKHR  1072
              RDPVP+ASF++HR
Sbjct  235   RRDPVPNASFSRHR  248



>ref|XP_007009226.1| Telomeric DNA binding protein 1, putative isoform 1 [Theobroma 
cacao]
 gb|EOY18036.1| Telomeric DNA binding protein 1, putative isoform 1 [Theobroma 
cacao]
Length=708

 Score = 93.6 bits (231),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 103/254 (41%), Positives = 146/254 (57%), Gaps = 12/254 (5%)
 Frame = +2

Query  329   MVMKKRLEYGFDGYrfpavpraprssrrr--HTGNVDDKQICAFELLAAVAGKllleses  502
             MV KKRL+YGF+ +  P +PRAPRS+RRR      VDD QICAFELLA++AGKLL ESES
Sbjct  1     MVFKKRLDYGFNAFNVPKIPRAPRSTRRRGQSKRTVDDSQICAFELLASLAGKLLQESES  60

Query  503   sassnaaeGKDGPAIQRDVTEELGNFQEGKALKPECLDRGSCVESAILPKGAIQEQK--I  676
             SASSNA+EG D  +I +DV ++   + + K LK EC ++GSC E++++   +  E    +
Sbjct  61    SASSNASEGHDHVSIGKDVVKQEIQYDD-KPLKTECFEQGSC-EASVVASVSTTENSDNL  118

Query  677   KHGNGGssysenscvsesTFTEFSGKVYPGVKLESVKNLDAEGNF--NSEVEGRPSNLGD  850
             K      + +        T   F  ++    K    K   A GNF  N+ V+G   ++G+
Sbjct  119   KEFTHAENDAILERTLIKTQPAFLEQIGGDSKSVICKGNVAYGNFPCNANVDGYSPDIGE  178

Query  851   LRSVNINNATQKQQLADDGMQTGDITMAGGCSVKDPikisltttnkntlnnsDCSVQLPL  1030
             L      N  +++Q A  G++TG + +A  C  KDP      +       NSD  V+LP 
Sbjct  179   LCDGKSENGFKQEQDA-RGLETGALHIANTCPSKDP---VELSMTFPPPINSDRDVKLPS  234

Query  1031  YRDPVPSASFAKHR  1072
              RDPVP+ASF++HR
Sbjct  235   RRDPVPNASFSRHR  248



>ref|XP_010096584.1| Telomere repeat-binding protein 4 [Morus notabilis]
 gb|EXB65252.1| Telomere repeat-binding protein 4 [Morus notabilis]
Length=693

 Score = 89.7 bits (221),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 102/252 (40%), Positives = 139/252 (55%), Gaps = 12/252 (5%)
 Frame = +2

Query  329   MVMKKRLEYGFDGYrfpavpraprssrr-rHTGNVDDKQICAFELLAAVAGKllle--se  499
             MV+KKRLEYGF+G++ P +PRAPRS+RR  +    DD QICAFELLA++AG+LL E  S 
Sbjct  1     MVLKKRLEYGFNGFQVPTIPRAPRSARRGSNKKKADDSQICAFELLASLAGQLLQECESA  60

Query  500   ssassnaaeGKDGPAIQRDVTEELGNFQEG-KALKPECLDRGSCVESAILPKGAIQEQKI  676
             SSASSNA+EG + PA  +DV  +    Q+G K LK EC ++GS  ESA +    I    I
Sbjct  61    SSASSNASEGNNQPAFGKDVITQ--ERQDGDKLLKEECFEQGSSEESAFV--SEINSPDI  116

Query  677   KHGNGGssysenscvsesTFTEFSGKVYPGVKLESVKNLDAEGNFNSEVEGRPSNLGDLR  856
                              S   +F  KV   VK           N+ S+VEG    + +  
Sbjct  117   DQKFILKESPNAISEHISNKCDFLDKVNGDVKSIICNTKPRFQNYPSKVEGDCPLIEESC  176

Query  857   SVNINNATQKQQLADDGMQTGDITMAGGCSVKDPikisltttnkntlnnsDCSVQLPLYR  1036
               NI    + QQ  ++ ++T  +TMA  CS  DP+++ +           D  V+LPL R
Sbjct  177   DANIGTGIEGQQKGEN-LETAGLTMANKCSSNDPMELQVEFPAVVNS---DNDVKLPLPR  232

Query  1037  DPVPSASFAKHR  1072
             +PVPSASF++HR
Sbjct  233   EPVPSASFSRHR  244



>ref|XP_008371854.1| PREDICTED: telomere repeat-binding protein 3-like [Malus domestica]
Length=674

 Score = 88.2 bits (217),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 105/259 (41%), Positives = 150/259 (58%), Gaps = 24/259 (9%)
 Frame = +2

Query  329   MVMKKRLEYGFDGYrfpavpraprssrr-rHTGNVDDKQICAFELLAAVAGKlllesess  505
             MV+KKRL++GF+G++ P +PRAPRS+RR  H  +V+D Q CAFELLA++AGKLL ESESS
Sbjct  1     MVLKKRLDFGFNGFQVPTIPRAPRSARRGPHRKSVEDGQFCAFELLASLAGKLLQESESS  60

Query  506   assnaaeGKDGPAIQRDVTEELGNFQEGKALKPECLDRGSCVESAIL--------PKGAI  661
             ASSNA+EG   PA   DV +E  +  E K LK EC D+GS  ES  L         KG +
Sbjct  61    ASSNASEGNLQPAFGIDVKQERQD--EHKPLKEECPDQGSSEESVSLGLTSQNVDQKGIL  118

Query  662   QEQKIKHGNGGssysenscvsesTFTEFSGKVYPGVKLESVKNLDAEGNFNSEVEGRPSN  841
             +E  I + +  +     S ++ S  +  +G+    V   S        N++ +VEG   +
Sbjct  119   KE--IPYADSDTVLERTSVITTSDSSAKAGRRAKSVISSSRPTFQ---NYSGKVEG--GS  171

Query  842   LGDLRSV--NINNATQKQQLADDGMQTGDITMAGGCSVKDPikisltttnkntlnnsDCS  1015
             LG + S   NI N  + Q+     ++TG + +A  CS KDP   +        + N D +
Sbjct  172   LGIVESCYGNIANGIEVQE-DSKPLETGALKIANPCSSKDP---TELHAKYPAMLNGDSN  227

Query  1016  VQLPLYRDPVPSASFAKHR  1072
             V+L L+RDPV +ASF++HR
Sbjct  228   VKLSLFRDPVSNASFSRHR  246



>ref|XP_009357741.1| PREDICTED: telomere repeat-binding protein 3-like [Pyrus x bretschneideri]
Length=674

 Score = 86.7 bits (213),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 102/257 (40%), Positives = 148/257 (58%), Gaps = 20/257 (8%)
 Frame = +2

Query  329   MVMKKRLEYGFDGYrfpavpraprssrr-rHTGNVDDKQICAFELLAAVAGKlllesess  505
             MV+KKRL++GF+G++ P++PRAPRS+RR  H  +V+D Q CAFELLA++AGKLL ESESS
Sbjct  1     MVLKKRLDFGFNGFQVPSIPRAPRSARRGPHRKSVEDGQFCAFELLASLAGKLLQESESS  60

Query  506   assnaaeGKDGPAIQRDVTEELGNFQEGKALKPECLDRGSCVESAIL--------PKGAI  661
             ASSNA+EG   PA   DV +E  +  E K LK EC D+GS  ES  L         KG +
Sbjct  61    ASSNASEGNLQPAFGIDVKQERQD--EHKPLKEECPDQGSSEESVSLGLTSQNVGQKGIL  118

Query  662   QEQKIKHGNGGssysenscvsesTFTEFSGKVYPGVKLESVKNLDAEGNFNSEVEGRPSN  841
             +E  I   N  +     S ++ S  +  +G+    V   S        N++ +VEG  S 
Sbjct  119   KE--ILCANSDTVLERTSVITSSDSSAKAGRRAKSVISSSRPTFQ---NYSGKVEGGSSG  173

Query  842   LGDLRSVNINNATQKQQLADDGMQTGDITMAGGCSVKDPikisltttnkntlnnsDCSVQ  1021
             + +     + N  + ++     ++TG + +A  CS KDP   +        + N D +V+
Sbjct  174   IVESCYGTVANGIEVRE-DSKLLETGALKIANPCSSKDP---TELHAKYPAMLNGDSNVK  229

Query  1022  LPLYRDPVPSASFAKHR  1072
             L L+RDPVP+ASF++HR
Sbjct  230   LSLFRDPVPNASFSRHR  246



>emb|CAA48413.1| BPF-1 [Petroselinum crispum]
 emb|CAA44518.1| BPF-1 [Petroselinum crispum]
Length=689

 Score = 86.3 bits (212),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 100/254 (39%), Positives = 131/254 (52%), Gaps = 12/254 (5%)
 Frame = +2

Query  329   MVMKKRLEYGFDGYrfpavpr--aprssrrrHTGNVDDKQICAFELLAAVAGKllleses  502
             MV+KK  EYGF GY+ PA+PR       R      VDD +ICAFELLA VAGKLL ESES
Sbjct  1     MVLKKSQEYGFRGYQVPAIPRGPRSLRRRASFKKPVDDGEICAFELLATVAGKLLQESES  60

Query  503   sassnaaeGKDGPAIQRD-VTEELGNFQEGKALKPECLDRGSCVESAILPKGAIQEQKIK  679
             S SSN AE KD   I +D + +EL    EG  ++ ECLD+GSC+ES ++P  A  E+  K
Sbjct  61    STSSNVAELKDQIRIHKDGIKKELP---EGSGVRSECLDQGSCIESVLVPDFAALERNSK  117

Query  680   HGNGGssysenscvsesTF---TEFSGKVYPGVKLESVKNLDAEGNFNSEVEGRPSNLGD  850
                              +    +EF  K    VK E   + DA G+  S+++G  S+ G 
Sbjct  118   ATVEVPHIESVYVPERVSAVPSSEFLVKGRYNVKPEKRTSDDAAGSLASKLKGTFSSDGP  177

Query  851   LRSVNINNATQKQQLADDGMQTGDITMAGGCSVKDPikisltttnkntlnnsDCSVQLPL  1030
             L   NI     ++Q+     Q G + M    + K+P        N + L NS+ SV LPL
Sbjct  178   LYESNIEKEP-RRQIEVVKKQRGHLDMVKTSASKNP--TEFYVNNTHMLINSENSVDLPL  234

Query  1031  YRDPVPSASFAKHR  1072
             YR   P A   +HR
Sbjct  235   YRAQEPDAPSPRHR  248



>ref|XP_009343592.1| PREDICTED: telomere repeat-binding protein 3-like [Pyrus x bretschneideri]
Length=677

 Score = 83.6 bits (205),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 102/258 (40%), Positives = 146/258 (57%), Gaps = 22/258 (9%)
 Frame = +2

Query  329   MVMKKRLEYGFDGYrfpavpraprssrr-rHTGNVDDKQICAFELLAAVAGKlllesess  505
             M +KKRL++GF+G++ P +PRAPRS+RR  H  +V+D QI AFELLA++AGKLL ESESS
Sbjct  1     MGLKKRLDFGFNGFQVPNIPRAPRSARRGPHRKSVEDGQISAFELLASLAGKLLQESESS  60

Query  506   assnaaeGKDGPAIQRDVTEELGNFQEGKALKPECLDRGSCVESAIL--------PKGAI  661
             ASSNA+EG   PA   DV +E  +  E K LK ECLD+GS  ES  L         KG I
Sbjct  61    ASSNASEGNLQPAFGIDVKQERQD--EHKPLKEECLDQGSSEESVSLGLTSQNINRKGII  118

Query  662   QEQKIKHGNGGssysenscvsesTFTEFSGKVYPGVKLESVKNLDAEGNFNSEVEGRPSN  841
             +E    H +  +     S ++ S  +  +G+    V   S         ++ +VEG   +
Sbjct  119   KE--FPHADSDTVLERTSVITSSDSSAKAGRHAKSVICSSRPTFQ---KYSGKVEG--DS  171

Query  842   LGDLRSVNINNATQKQQLADDG-MQTGDITMAGGCSVKDPikisltttnkntlnnsDCSV  1018
              G + S   N AT  +   D   ++TG + +A  CS KDP ++             D +V
Sbjct  172   PGIVESCYGNVATGIEVQGDSKPLETGSLKIANPCSSKDPTELHANYPAMLNG---DSNV  228

Query  1019  QLPLYRDPVPSASFAKHR  1072
             +L L+RDP+P+ASF++H+
Sbjct  229   KLSLFRDPIPNASFSRHK  246



>ref|XP_008343536.1| PREDICTED: telomere repeat-binding protein 3-like [Malus domestica]
Length=678

 Score = 82.8 bits (203),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 103/258 (40%), Positives = 144/258 (56%), Gaps = 22/258 (9%)
 Frame = +2

Query  329   MVMKKRLEYGFDGYrfpavpraprssrr-rHTGNVDDKQICAFELLAAVAGKlllesess  505
             M +KKRL++GF+G++ P +PRAPRS+RR  H  +V D QI AFELLA++AGKLL ESESS
Sbjct  1     MGLKKRLDFGFNGFQVPNIPRAPRSARRGPHRKSVKDGQISAFELLASLAGKLLQESESS  60

Query  506   assnaaeGKDGPAIQRDVTEELGNFQEGKALKPECLDRGSCVESAIL--------PKGAI  661
             ASSNA+EG   PA   DV  +L    E K LK ECLD+GS  ES  L         KG I
Sbjct  61    ASSNASEGNLQPAFGIDV--KLERQDEHKPLKEECLDQGSSEESVSLGLTSQNINRKGII  118

Query  662   QEQKIKHGNGGssysenscvsesTFTEFSGKVYPGVKLESVKNLDAEGNFNSEVEGRPSN  841
             +E    H +  +     S ++ S  +  +G+    V   S         ++ +VEG   +
Sbjct  119   KE--FPHADSDTVLERTSVITSSDSSAKAGRHAKSVICSSRPTFQ---KYSGKVEG--DS  171

Query  842   LGDLRSVNINNATQKQQLADDG-MQTGDITMAGGCSVKDPikisltttnkntlnnsDCSV  1018
              G + S   N AT  +   D   ++TG + +A  CS KDP ++             D +V
Sbjct  172   PGIVESCYGNVATGIEVQGDSKPLETGSLKIANPCSSKDPTELHANYPAMLNG---DSNV  228

Query  1019  QLPLYRDPVPSASFAKHR  1072
             +L L+RDP+P+ASF++HR
Sbjct  229   KLSLFRDPIPNASFSRHR  246



>ref|XP_007221011.1| hypothetical protein PRUPE_ppa002374mg [Prunus persica]
 gb|EMJ22210.1| hypothetical protein PRUPE_ppa002374mg [Prunus persica]
Length=680

 Score = 76.6 bits (187),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 81/224 (36%), Positives = 122/224 (54%), Gaps = 12/224 (5%)
 Frame = +2

Query  416   HTGNVDDKQICAFELLAAVAGKl-llesessassnaaeGKDGPAIQRDVTEELGNFQEG-  589
             H  +VD+ QICAFELLA++AGKL    + SSASSNA+EG   PA  +DV +E    Q+G 
Sbjct  20    HKKSVDNGQICAFELLASLAGKLLQESASSSASSNASEGNSKPAFGKDVKQER---QDGH  76

Query  590   KALKPECLDRGSCVESAILPKGAIQEQK---IKHGNGGssysenscvsesTFTEFSGKVY  760
             K LK ECLD+GS  ES  L   +    +   +K      S +     S  T ++ S K  
Sbjct  77    KPLKEECLDQGSSEESVSLELTSQNINRKFILKEFPHAESDTVLEHTSVITNSDSSAKAG  136

Query  761   PGVKLESVKNLDAEGNFNSEVEGRPSNLGDLRSVNINNATQKQQLADDGMQTGDITMAGG  940
               +K     +     +++S+VEG    +G+    N+ N  + Q+   + ++TG +T A  
Sbjct  137   GHMKSVICSSRPIFQSYSSKVEGGFQGIGESCYGNVANGAEVQK-DSERLETGALTRANP  195

Query  941   CSVKDPikisltttnkntlnnsDCSVQLPLYRDPVPSASFAKHR  1072
             CS K+PI++             D +V+L L+RDP+P+ASF++HR
Sbjct  196   CSSKNPIELRAKYPAMLNG---DNNVKLSLFRDPIPNASFSRHR  236



>ref|XP_011077209.1| PREDICTED: telomere repeat-binding protein 3-like [Sesamum indicum]
 ref|XP_011077212.1| PREDICTED: telomere repeat-binding protein 3-like [Sesamum indicum]
 ref|XP_011077213.1| PREDICTED: telomere repeat-binding protein 3-like [Sesamum indicum]
Length=695

 Score = 76.3 bits (186),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 111/267 (42%), Positives = 141/267 (53%), Gaps = 40/267 (15%)
 Frame = +2

Query  329   MVMKKRLEYGFDGYrfpavpraprssrrr--HTGNVDDKQICAFELLAAVAGKllleses  502
             MV KKRL+  F+GYR P VPRAPRS RRR      V+D ++CAFELLAAVAGKLL ESES
Sbjct  1     MVSKKRLDCRFNGYRAPIVPRAPRSIRRRGPRKKLVEDSKLCAFELLAAVAGKLLEESES  60

Query  503   sassnaaeGKDGPAIQRDVTEELGNFQEGKALKPECLDRGSCVESAILPKGAIQEQKIKH  682
             SASSN AEGK       D  E++   ++  ALK E LDRGS  ESA +P+  +QE K+  
Sbjct  61    SASSNIAEGKVKVGACLDGDEKV-QPKDDTALKSESLDRGSSAESAFVPEICVQEHKLLS  119

Query  683   GNGGssysenscvsesTFTEFS----GKVYPGVKLESVKNLDAEGN--------------  808
                    +EN  V +      S     K+   +KL   +  +++GN              
Sbjct  120   NFKALPQAENDYVVDHISVHASPDRVKKIDCDIKLGICEEKNSDGNTTCKIGGSACFDDS  179

Query  809   FNSEVEGRPSNLGDLRSVNINNATQKQQLADDGMQTGDITMAGGCSVKDPikisltttnk  988
             FN +VE  P                + Q  D+  Q GD++MA   +VKD         N 
Sbjct  180   FNHKVESEP----------------EVQPEDEKNQIGDLSMANRSTVKD---SIGECVNN  220

Query  989   ntlnnsDCSVQLPLYRDPVPSASFAKH  1069
             + LNNS+ SVQLPLYR+PV  A F KH
Sbjct  221   DVLNNSESSVQLPLYREPVAGAFFQKH  247



>gb|KJB73975.1| hypothetical protein B456_011G266100, partial [Gossypium raimondii]
Length=338

 Score = 74.3 bits (181),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 101/259 (39%), Positives = 143/259 (55%), Gaps = 24/259 (9%)
 Frame = +2

Query  329   MVMKKRLEYGFDGYrfpavpraprssrrrHTGN--VDDKQICAFELLAAVAGKllleses  502
             MV KKRL+YGF+ +  P VPRAPRS RRR      V+D QICAFELLA++AGKLL ESES
Sbjct  1     MVFKKRLDYGFNTFNVPDVPRAPRSIRRRCRSKRVVEDSQICAFELLASLAGKLLQESES  60

Query  503   sassnaaeGKDGPAIQRDV-TEELGNFQEGKALKPECLDRGSCVESAILPKGAIQEQKIK  679
             SASSNA+EG D  +I +DV  +E+    + K LK EC+++GSC  SA+  +         
Sbjct  61    SASSNASEGHDHVSIGKDVLKQEIQYNDDEKPLKVECVEQGSCDASAVASEST-------  113

Query  680   HGNGGssysenscvsesTFTEFSGKVYPGVK------LESV--KNLDAEGNFNSEVEGRP  835
               N  S   +    ++S     S K  P         L+SV  K   A GNF+ + +   
Sbjct  114   --NENSDDLKEFKPADSILDRASIKTRPACSEQMSGDLKSVIRKGNVAYGNFHDDGDLCS  171

Query  836   SNLGDLRSVNINNATQKQQLADDGMQTGDITMAGGCSVKDPikisltttnkntlnnsDCS  1015
              +LG+L      N  + ++ A  G++TG  ++A  C  KDP+ + +T +           
Sbjct  172   PDLGELCDGKSENGFKLERDAK-GLETGKSSIANTCPSKDPVALPMTYSAPINSKR---D  227

Query  1016  VQLPLYRDPVPSASFAKHR  1072
             V+LP   D +P+ASF++HR
Sbjct  228   VKLPSRGDRIPNASFSRHR  246



>gb|EYU19914.1| hypothetical protein MIMGU_mgv1a002489mg [Erythranthe guttata]
Length=667

 Score = 74.7 bits (182),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 101/251 (40%), Positives = 131/251 (52%), Gaps = 25/251 (10%)
 Frame = +2

Query  329   MVMKKRLEYGFDGYrfpavpraprssrrr---HTGNVDDKQICAFELLAAVAGKlllese  499
             MV KKRL+ G DGYR P +P+APRS RRR       V+  ++CAFELLAAVAGKLL ESE
Sbjct  1     MVSKKRLDTGLDGYRAPFIPKAPRSIRRRGPLKKLVVEHGELCAFELLAAVAGKLLQESE  60

Query  500   ssassnaaeGKDGPAIQRDVTEELGNFQEGKALKPECLDRGSCVESAILPKGAIQEQKIK  679
             SSASSN AEGK    I  D  E +   ++ KALK E  D GS  ESA +P+ ++QE  + 
Sbjct  61    SSASSNIAEGKSPLDIFPDENERVQPKEDNKALKSESFDHGSFAESAFVPEVSVQEHNLL  120

Query  680   HGNGGssysenscvsesTFTEFSGKVYPGVKLESVKNLDAEGNFNSEVEGRPSNLGDLRS  859
                 G     N  V E T                  N+ A  +F  +++     LG    
Sbjct  121   SNFKGLPQEVNDYVVEHT------------------NVHASSDFLEKIDCD-IKLGICED  161

Query  860   VNINNATQKQQLADDGMQTGDITMAGGCSVKDPikisltttnkntlnnsDCSVQLPLYRD  1039
               I+    + QL D+  +   ++MA   +V DP  +       N L NS+ SV+LPLYRD
Sbjct  162   -KISENGSEMQLKDEKNEISYLSMANISTVNDP--VGECVNTNNVLINSEGSVKLPLYRD  218

Query  1040  PVPSASFAKHR  1072
             P+  A   KHR
Sbjct  219   PISGALLRKHR  229



>gb|KJB73977.1| hypothetical protein B456_011G266100 [Gossypium raimondii]
Length=483

 Score = 73.9 bits (180),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 101/259 (39%), Positives = 143/259 (55%), Gaps = 24/259 (9%)
 Frame = +2

Query  329   MVMKKRLEYGFDGYrfpavpraprssrrrHTGN--VDDKQICAFELLAAVAGKllleses  502
             MV KKRL+YGF+ +  P VPRAPRS RRR      V+D QICAFELLA++AGKLL ESES
Sbjct  1     MVFKKRLDYGFNTFNVPDVPRAPRSIRRRCRSKRVVEDSQICAFELLASLAGKLLQESES  60

Query  503   sassnaaeGKDGPAIQRDVT-EELGNFQEGKALKPECLDRGSCVESAILPKGAIQEQKIK  679
             SASSNA+EG D  +I +DV  +E+    + K LK EC+++GSC  SA+  +         
Sbjct  61    SASSNASEGHDHVSIGKDVLKQEIQYNDDEKPLKVECVEQGSCDASAVASEST-------  113

Query  680   HGNGGssysenscvsesTFTEFSGKVYPGVK------LESV--KNLDAEGNFNSEVEGRP  835
               N  S   +    ++S     S K  P         L+SV  K   A GNF+ + +   
Sbjct  114   --NENSDDLKEFKPADSILDRASIKTRPACSEQMSGDLKSVIRKGNVAYGNFHDDGDLCS  171

Query  836   SNLGDLRSVNINNATQKQQLADDGMQTGDITMAGGCSVKDPikisltttnkntlnnsDCS  1015
              +LG+L      N  + ++ A  G++TG  ++A  C  KDP+ + +T +           
Sbjct  172   PDLGELCDGKSENGFKLERDAK-GLETGKSSIANTCPSKDPVALPMTYSAPINSKR---D  227

Query  1016  VQLPLYRDPVPSASFAKHR  1072
             V+LP   D +P+ASF++HR
Sbjct  228   VKLPSRGDRIPNASFSRHR  246



>gb|KHG29953.1| Telomere repeat-binding 3 -like protein [Gossypium arboreum]
Length=707

 Score = 73.9 bits (180),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 95/255 (37%), Positives = 143/255 (56%), Gaps = 16/255 (6%)
 Frame = +2

Query  329   MVMKKRLEYGFDGYrfpavpraprssrrrHTGN--VDDKQICAFELLAAVAGKllleses  502
             MV KKRL+YGF+ +  P VPRAPRS RRR      V+D QICAFELLA++AGKLL ESES
Sbjct  1     MVFKKRLDYGFNTFNVPDVPRAPRSIRRRCRSKRVVEDSQICAFELLASLAGKLLQESES  60

Query  503   sassnaaeGKDGPAIQRDVT-EELGNFQEGKALKPECLDRGSCVESAILPKGAIQE----  667
             SASSNA+EG D  +I +DV  +E+    + K LK EC ++GSC  SA+  +   +     
Sbjct  61    SASSNASEGHDRVSIGKDVVKQEIQYDDDEKPLKVECFEQGSCDTSAVASESTNENSDDL  120

Query  668   QKIKHGNGGssysenscvsesTFTEFSGKVYPGVKLESVKNLDAEGNFNSEVEGRPSNLG  847
             ++ K  +       +     +   + SG +   ++  +V    A GNF+ + +    +LG
Sbjct  121   KEFKPADS-VLDRASIKTRPACLEQMSGDLKSVIRKGNV----AYGNFHDDGDLCSPDLG  175

Query  848   DLRSVNINNATQKQQLADDGMQTGDITMAGGCSVKDPikisltttnkntlnnsDCSVQLP  1027
             +L      N  + ++ A  G++TG  ++A  C  KDP+ + +T +           V+LP
Sbjct  176   ELCDGKSENGFKLERDAK-GLETGKSSIANTCPSKDPVALPMTYSAPVNSKR---DVKLP  231

Query  1028  LYRDPVPSASFAKHR  1072
                D +P+ASF++HR
Sbjct  232   SRGDRIPNASFSRHR  246



>gb|KJB73976.1| hypothetical protein B456_011G266100 [Gossypium raimondii]
Length=603

 Score = 73.6 bits (179),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 101/259 (39%), Positives = 143/259 (55%), Gaps = 24/259 (9%)
 Frame = +2

Query  329   MVMKKRLEYGFDGYrfpavpraprssrrrHTGN--VDDKQICAFELLAAVAGKllleses  502
             MV KKRL+YGF+ +  P VPRAPRS RRR      V+D QICAFELLA++AGKLL ESES
Sbjct  1     MVFKKRLDYGFNTFNVPDVPRAPRSIRRRCRSKRVVEDSQICAFELLASLAGKLLQESES  60

Query  503   sassnaaeGKDGPAIQRDVT-EELGNFQEGKALKPECLDRGSCVESAILPKGAIQEQKIK  679
             SASSNA+EG D  +I +DV  +E+    + K LK EC+++GSC  SA+  +         
Sbjct  61    SASSNASEGHDHVSIGKDVLKQEIQYNDDEKPLKVECVEQGSCDASAVASEST-------  113

Query  680   HGNGGssysenscvsesTFTEFSGKVYPGVK------LESV--KNLDAEGNFNSEVEGRP  835
               N  S   +    ++S     S K  P         L+SV  K   A GNF+ + +   
Sbjct  114   --NENSDDLKEFKPADSILDRASIKTRPACSEQMSGDLKSVIRKGNVAYGNFHDDGDLCS  171

Query  836   SNLGDLRSVNINNATQKQQLADDGMQTGDITMAGGCSVKDPikisltttnkntlnnsDCS  1015
              +LG+L      N  + ++ A  G++TG  ++A  C  KDP+ + +T +           
Sbjct  172   PDLGELCDGKSENGFKLERDAK-GLETGKSSIANTCPSKDPVALPMTYSAPINSKR---D  227

Query  1016  VQLPLYRDPVPSASFAKHR  1072
             V+LP   D +P+ASF++HR
Sbjct  228   VKLPSRGDRIPNASFSRHR  246



>gb|KJB73978.1| hypothetical protein B456_011G266100 [Gossypium raimondii]
Length=683

 Score = 73.6 bits (179),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 101/259 (39%), Positives = 143/259 (55%), Gaps = 24/259 (9%)
 Frame = +2

Query  329   MVMKKRLEYGFDGYrfpavpraprssrrrHTGN--VDDKQICAFELLAAVAGKllleses  502
             MV KKRL+YGF+ +  P VPRAPRS RRR      V+D QICAFELLA++AGKLL ESES
Sbjct  1     MVFKKRLDYGFNTFNVPDVPRAPRSIRRRCRSKRVVEDSQICAFELLASLAGKLLQESES  60

Query  503   sassnaaeGKDGPAIQRDVT-EELGNFQEGKALKPECLDRGSCVESAILPKGAIQEQKIK  679
             SASSNA+EG D  +I +DV  +E+    + K LK EC+++GSC  SA+  +         
Sbjct  61    SASSNASEGHDHVSIGKDVLKQEIQYNDDEKPLKVECVEQGSCDASAVASEST-------  113

Query  680   HGNGGssysenscvsesTFTEFSGKVYPGVK------LESV--KNLDAEGNFNSEVEGRP  835
               N  S   +    ++S     S K  P         L+SV  K   A GNF+ + +   
Sbjct  114   --NENSDDLKEFKPADSILDRASIKTRPACSEQMSGDLKSVIRKGNVAYGNFHDDGDLCS  171

Query  836   SNLGDLRSVNINNATQKQQLADDGMQTGDITMAGGCSVKDPikisltttnkntlnnsDCS  1015
              +LG+L      N  + ++ A  G++TG  ++A  C  KDP+ + +T +           
Sbjct  172   PDLGELCDGKSENGFKLERDAK-GLETGKSSIANTCPSKDPVALPMTYSAPINSKR---D  227

Query  1016  VQLPLYRDPVPSASFAKHR  1072
             V+LP   D +P+ASF++HR
Sbjct  228   VKLPSRGDRIPNASFSRHR  246



>ref|XP_010658554.1| PREDICTED: telomere repeat-binding protein 4 isoform X1 [Vitis 
vinifera]
 ref|XP_010658555.1| PREDICTED: telomere repeat-binding protein 4 isoform X1 [Vitis 
vinifera]
 ref|XP_010658556.1| PREDICTED: telomere repeat-binding protein 4 isoform X1 [Vitis 
vinifera]
Length=706

 Score = 73.2 bits (178),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 98/261 (38%), Positives = 137/261 (52%), Gaps = 24/261 (9%)
 Frame = +2

Query  329   MVMKKRLEYGFDGYrfpavpraprssrrrHTGN----VDDKQICAFELLAAVAGKl-lle  493
             MV+KK+ +YGF+G+    +PRAPRS R +  G+    V+D QICA +LLA +AGKL    
Sbjct  1     MVLKKKQDYGFNGFHVSTIPRAPRSIRFQRRGSIKKPVEDSQICAIDLLATLAGKLLQES  60

Query  494   sessassnaaeGKDGPAIQRD-VTEELGNFQEGKALKPECLDRGSCVESAILPKGAIQEQ  670
               SSASSN A GKD   I +D + +EL +  + K LK ECLD+GSC     + K A Q+ 
Sbjct  61    ESSSASSNVAAGKDRLNISKDGIKQELQD--DDKPLKGECLDQGSCEGIVFVSKLASQDL  118

Query  671   KIKHGNGGssysenscvsesTFTEFSGKVYPGV---KLESVKNLDAEGNFNSEVE-GRP-  835
               K+      ++ +  V + T T  S      V    + + K+ +  G    +VE G P 
Sbjct  119   SPKYTVKQFPHAVHDAVLDCTSTVASPDYLDKVGCDVMVTCKSKNIFGKVPCKVERGSPD  178

Query  836   --SNLGDLRSVNINNATQKQQLADDGMQTGDITMAGGCSVKDPikisltttnkntlnnsD  1009
                  GDL      N  + +Q A+ G ++G +TMA  CS KD               NSD
Sbjct  179   CGETCGDL-----ENGAEIRQDAE-GEESGGLTMANRCSSKD---SVELCMKNPAQINSD  229

Query  1010  CSVQLPLYRDPVPSASFAKHR  1072
              +V+L L RD +P+ASF KHR
Sbjct  230   SNVKLSLNRDSIPNASFPKHR  250



>emb|CBI31661.3| unnamed protein product [Vitis vinifera]
Length=681

 Score = 71.6 bits (174),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 95/255 (37%), Positives = 130/255 (51%), Gaps = 37/255 (15%)
 Frame = +2

Query  329   MVMKKRLEYGFDGYrfpavpraprssrrrHT--GNVDDKQICAFELLAAVAGKl-llese  499
             MV+KK+ +YGF+G+    +PRAPRS RRR +    V+D QICA +LLA +AGKL      
Sbjct  1     MVLKKKQDYGFNGFHVSTIPRAPRSIRRRGSIKKPVEDSQICAIDLLATLAGKLLQESES  60

Query  500   ssassnaaeGKDGPAIQRD-VTEELGNFQEGKALKPECLDRGSCVESAILPKGAIQEQKI  676
             SSASSN A GKD   I +D + +EL +  + K LK ECLD+GSC     + K A Q+   
Sbjct  61    SSASSNVAAGKDRLNISKDGIKQELQD--DDKPLKGECLDQGSCEGIVFVSKLASQDLSP  118

Query  677   KHGNGGssysenscvsesTFTEFSGKVYPGVKLESVKNLDAEGNFNSEVEGRP---SNLG  847
             K+                T  +F   V+  V L+    + +    +    G P      G
Sbjct  119   KY----------------TVKQFPHAVHDAV-LDCTSTVASPDYLDKR--GSPDCGETCG  159

Query  848   DLRSVNINNATQKQQLADDGMQTGDITMAGGCSVKDPikisltttnkntlnnsDCSVQLP  1027
             DL      N  + +Q A+ G ++G +TMA  CS KD               NSD +V+L 
Sbjct  160   DL-----ENGAEIRQDAE-GEESGGLTMANRCSSKD---SVELCMKNPAQINSDSNVKLS  210

Query  1028  LYRDPVPSASFAKHR  1072
             L RD +P+ASF KHR
Sbjct  211   LNRDSIPNASFPKHR  225



>ref|XP_006378700.1| hypothetical protein POPTR_0010s20990g [Populus trichocarpa]
 ref|XP_006378704.1| hypothetical protein POPTR_0010s20990g [Populus trichocarpa]
 gb|ERP56497.1| hypothetical protein POPTR_0010s20990g [Populus trichocarpa]
 gb|ERP56501.1| hypothetical protein POPTR_0010s20990g [Populus trichocarpa]
Length=625

 Score = 70.9 bits (172),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 101/254 (40%), Positives = 136/254 (54%), Gaps = 15/254 (6%)
 Frame = +2

Query  329   MVMKKRLEYGFDGYrfpavpraprssrrr--HTGNVDDKQICAFELLAAVAGKllleses  502
             MV+KKR  YGF+G+  P VPRAPRS+R R  +   V+D QICAFELLA++AGKLL ESES
Sbjct  1     MVVKKRQYYGFNGFHMPPVPRAPRSARGRGLNKMKVEDSQICAFELLASLAGKLLQESES  60

Query  503   sassnaaeGKDGPAIQRDVTEELGNFQEGKALKPECLDRGSCVESAILPKGAI--QEQKI  676
             SASSNA+E  D P I   V  E     + + LK ECLD GSC ESA+  + +    +QK 
Sbjct  61    SASSNASEANDQPIIGGGVKFEQ---DDDRPLKAECLDHGSCGESALFTRFSSPNSDQKC  117

Query  677   KHGNGGssysenscvsesTFTEFSGKVYPGVKLESV--KNLDAEGNFNSEVEGRPSNLGD  850
                    + S       S  T  +     G  L+SV  K+  A  N   +VEG   +   
Sbjct  118   LLNEFPHAESNLFLERSSMITNSNSSKNGGADLKSVICKSKSACENIPGKVEGSSDSRVS  177

Query  851   LRSVNINNATQKQQLADDGMQTGDITMAGGCSVKDPikisltttnkntlnnsDCSVQLPL  1030
                  ++N   +Q+   DG+ T  + +   CS  DP+++ +         N   +V+LP 
Sbjct  178   CDGY-VDNGLSRQKRC-DGLDTRGL-IVDPCSSNDPMEMCMKFPALINSVN---NVELPS  231

Query  1031  YRDPVPSASFAKHR  1072
              RDPVPSAS  +HR
Sbjct  232   CRDPVPSASIPRHR  245



>ref|XP_006378703.1| hypothetical protein POPTR_0010s20990g [Populus trichocarpa]
 gb|ERP56500.1| hypothetical protein POPTR_0010s20990g [Populus trichocarpa]
Length=707

 Score = 70.5 bits (171),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 103/257 (40%), Positives = 137/257 (53%), Gaps = 21/257 (8%)
 Frame = +2

Query  329   MVMKKRLEYGFDGYrfpavpraprssrrr--HTGNVDDKQICAFELLAAVAGKllleses  502
             MV+KKR  YGF+G+  P VPRAPRS+R R  +   V+D QICAFELLA++AGKLL ESES
Sbjct  1     MVVKKRQYYGFNGFHMPPVPRAPRSARGRGLNKMKVEDSQICAFELLASLAGKLLQESES  60

Query  503   sassnaaeGKDGPAIQRDVTEELGNFQEGKALKPECLDRGSCVESAILPKGAI--QEQKI  676
             SASSNA+E  D P I   V  E     + + LK ECLD GSC ESA+  + +    +QK 
Sbjct  61    SASSNASEANDQPIIGGGVKFEQ---DDDRPLKAECLDHGSCGESALFTRFSSPNSDQKC  117

Query  677   KHGNGGssysenscvsesTFTEFSGKVYPGVKLESV--KNLDAEGNFNSEVEGRPSNLGD  850
                    + S       S  T  +     G  L+SV  K+  A  N   +VEG      D
Sbjct  118   LLNEFPHAESNLFLERSSMITNSNSSKNGGADLKSVICKSKSACENIPGKVEGS----SD  173

Query  851   LRSV---NINNATQKQQLADDGMQTGDITMAGGCSVKDPikisltttnkntlnnsDCSVQ  1021
              R      ++N   +Q+   DG+ T  + +   CS  DP+++ +         N   +V+
Sbjct  174   SRVSCDGYVDNGLSRQKRC-DGLDTRGL-IVDPCSSNDPMEMCMKFPALINSVN---NVE  228

Query  1022  LPLYRDPVPSASFAKHR  1072
             LP  RDPVPSAS  +HR
Sbjct  229   LPSCRDPVPSASIPRHR  245



>ref|XP_002316279.2| hypothetical protein POPTR_0010s20990g [Populus trichocarpa]
 gb|EEF02450.2| hypothetical protein POPTR_0010s20990g [Populus trichocarpa]
Length=696

 Score = 70.5 bits (171),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 103/257 (40%), Positives = 137/257 (53%), Gaps = 21/257 (8%)
 Frame = +2

Query  329   MVMKKRLEYGFDGYrfpavpraprssrrr--HTGNVDDKQICAFELLAAVAGKllleses  502
             MV+KKR  YGF+G+  P VPRAPRS+R R  +   V+D QICAFELLA++AGKLL ESES
Sbjct  1     MVVKKRQYYGFNGFHMPPVPRAPRSARGRGLNKMKVEDSQICAFELLASLAGKLLQESES  60

Query  503   sassnaaeGKDGPAIQRDVTEELGNFQEGKALKPECLDRGSCVESAILPKGAI--QEQKI  676
             SASSNA+E  D P I   V  E     + + LK ECLD GSC ESA+  + +    +QK 
Sbjct  61    SASSNASEANDQPIIGGGVKFEQ---DDDRPLKAECLDHGSCGESALFTRFSSPNSDQKC  117

Query  677   KHGNGGssysenscvsesTFTEFSGKVYPGVKLESV--KNLDAEGNFNSEVEGRPSNLGD  850
                    + S       S  T  +     G  L+SV  K+  A  N   +VEG      D
Sbjct  118   LLNEFPHAESNLFLERSSMITNSNSSKNGGADLKSVICKSKSACENIPGKVEGS----SD  173

Query  851   LRSV---NINNATQKQQLADDGMQTGDITMAGGCSVKDPikisltttnkntlnnsDCSVQ  1021
              R      ++N   +Q+   DG+ T  + +   CS  DP+++ +         N   +V+
Sbjct  174   SRVSCDGYVDNGLSRQKRC-DGLDTRGL-IVDPCSSNDPMEMCMKFPALINSVN---NVE  228

Query  1022  LPLYRDPVPSASFAKHR  1072
             LP  RDPVPSAS  +HR
Sbjct  229   LPSCRDPVPSASIPRHR  245



>ref|XP_006378702.1| hypothetical protein POPTR_0010s20990g [Populus trichocarpa]
 gb|ERP56499.1| hypothetical protein POPTR_0010s20990g [Populus trichocarpa]
Length=705

 Score = 70.5 bits (171),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 103/257 (40%), Positives = 137/257 (53%), Gaps = 21/257 (8%)
 Frame = +2

Query  329   MVMKKRLEYGFDGYrfpavpraprssrrr--HTGNVDDKQICAFELLAAVAGKllleses  502
             MV+KKR  YGF+G+  P VPRAPRS+R R  +   V+D QICAFELLA++AGKLL ESES
Sbjct  1     MVVKKRQYYGFNGFHMPPVPRAPRSARGRGLNKMKVEDSQICAFELLASLAGKLLQESES  60

Query  503   sassnaaeGKDGPAIQRDVTEELGNFQEGKALKPECLDRGSCVESAILPKGAI--QEQKI  676
             SASSNA+E  D P I   V  E     + + LK ECLD GSC ESA+  + +    +QK 
Sbjct  61    SASSNASEANDQPIIGGGVKFEQ---DDDRPLKAECLDHGSCGESALFTRFSSPNSDQKC  117

Query  677   KHGNGGssysenscvsesTFTEFSGKVYPGVKLESV--KNLDAEGNFNSEVEGRPSNLGD  850
                    + S       S  T  +     G  L+SV  K+  A  N   +VEG      D
Sbjct  118   LLNEFPHAESNLFLERSSMITNSNSSKNGGADLKSVICKSKSACENIPGKVEGS----SD  173

Query  851   LRSV---NINNATQKQQLADDGMQTGDITMAGGCSVKDPikisltttnkntlnnsDCSVQ  1021
              R      ++N   +Q+   DG+ T  + +   CS  DP+++ +         N   +V+
Sbjct  174   SRVSCDGYVDNGLSRQKRC-DGLDTRGL-IVDPCSSNDPMEMCMKFPALINSVN---NVE  228

Query  1022  LPLYRDPVPSASFAKHR  1072
             LP  RDPVPSAS  +HR
Sbjct  229   LPSCRDPVPSASIPRHR  245



>ref|XP_010658557.1| PREDICTED: telomere repeat-binding protein 4 isoform X2 [Vitis 
vinifera]
Length=704

 Score = 70.5 bits (171),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 99/259 (38%), Positives = 137/259 (53%), Gaps = 22/259 (8%)
 Frame = +2

Query  329   MVMKKRLEYGFDGYrfpavpraprssrrrHTGN--VDDKQICAFELLAAVAGKl-llese  499
             MV+KK+ +YGF+G+    +PRAPRS RRR +    V+D QICA +LLA +AGKL      
Sbjct  1     MVLKKKQDYGFNGFHVSTIPRAPRSIRRRGSIKKPVEDSQICAIDLLATLAGKLLQESES  60

Query  500   ssassnaaeGKDGPAIQRD-VTEELGNFQEGKALKPECLDRGSCVESAILPKGAIQEQKI  676
             SSASSN A GKD   I +D + +EL +  + K LK ECLD+GSC     + K A Q+   
Sbjct  61    SSASSNVAAGKDRLNISKDGIKQELQD--DDKPLKGECLDQGSCEGIVFVSKLASQDLSP  118

Query  677   KHGNGGssysenscvsesTFTEFSGKVYPGV---KLESVKNLDAEGNFNSEVE-GRP---  835
             K+      ++ +  V + T T  S      V    + + K+ +  G    +VE G P   
Sbjct  119   KYTVKQFPHAVHDAVLDCTSTVASPDYLDKVGCDVMVTCKSKNIFGKVPCKVERGSPDCG  178

Query  836   SNLGDLRSVNINNATQKQQLADDGMQTGDITMAGGCSVKDPikisltttnkntlnnsDCS  1015
                GDL      N  + +Q A+ G ++G +TMA  CS KD               NSD +
Sbjct  179   ETCGDL-----ENGAEIRQDAE-GEESGGLTMANRCSSKD---SVELCMKNPAQINSDSN  229

Query  1016  VQLPLYRDPVPSASFAKHR  1072
             V+L L RD +P+ASF KHR
Sbjct  230   VKLSLNRDSIPNASFPKHR  248



>ref|XP_004307493.1| PREDICTED: telomere repeat-binding protein 4 [Fragaria vesca 
subsp. vesca]
Length=697

 Score = 69.7 bits (169),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 95/263 (36%), Positives = 146/263 (56%), Gaps = 34/263 (13%)
 Frame = +2

Query  329   MVMKKRLEYGFDGYrfpavpraprssrrr--HTGNVDDKQICAFELLAAVAGK-lllese  499
             MV+KKRL++GF+G++ P +P+APRS+RRR      V+D+QICAFELLA++AGK L     
Sbjct  1     MVLKKRLDFGFNGFQVPTIPKAPRSARRRGPQKKPVEDEQICAFELLASIAGKLLQESES  60

Query  500   ssassnaaeGKDGPAIQRDVTEELGNFQEGKALKPECLDRGSCVESAIL---PKGAIQEQ  670
             SSASSNA++G+  PA  ++V +E+ +  E K LK ECL +G   ES  L    K   ++ 
Sbjct  61    SSASSNASQGESQPAFGKEVKQEIQD--EHKLLKDECLYQGCSEESVSLELTSKSIDRKC  118

Query  671   KIK---HGNGGssysenscvsesTFTE-FSGKVYPGVKLESVKNLDAEGNFNSEV-EGRP  835
              +K   H    ++    S ++ S  +E  +G+  P ++  S   L    N++S++  G P
Sbjct  119   TLKEFLHAESDTALEHASIITSSHSSENLAGQTKPVIR-SSKPTLH---NYSSKLGRGSP  174

Query  836   ----SNLGDLRSVNINNATQKQQLADDGMQTGDITMAGGCSVKDPikisltttnkntlnn  1003
                 S+ G+L        T K     +G++TG    A  CS KDP              +
Sbjct  175   GIGESSFGNL-------GTPK---GSEGLETGGCNRANTCSSKDP---MELHAEYPATVD  221

Query  1004  sDCSVQLPLYRDPVPSASFAKHR  1072
              D +V+L LYR+ +P+ASF++ R
Sbjct  222   GDNNVKLSLYRNLIPNASFSRRR  244



>ref|XP_011027692.1| PREDICTED: telomere repeat-binding protein 3-like [Populus euphratica]
Length=618

 Score = 68.9 bits (167),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 101/260 (39%), Positives = 136/260 (52%), Gaps = 23/260 (9%)
 Frame = +2

Query  329   MVMKKRLEYGFDGYrfpavpraprssr----rrHTGNVDDKQICAFELLAAVAGKllles  496
             MV+KKR  YGF+G+  P VPRAPRS+R      +   V+D Q+CAFELLA++AGKLL ES
Sbjct  1     MVVKKRQYYGFNGFHMPPVPRAPRSARQRGLSLNKKKVEDSQLCAFELLASLAGKLLQES  60

Query  497   essassnaaeGKDGPAIQRDVTEELGNFQEGKALKPECLDRGSCVESAIL-----PKGAI  661
             ESSASSNA+E  + P I     +      E + LK ECLD GSC ESA +     P G  
Sbjct  61    ESSASSNASEANNQPIIGGGGVK--CEQAEDRPLKAECLDHGSCRESAFVTGFSSPNGD-  117

Query  662   QEQKIKHGNGGssysenscvsesTFTEFSGKVYPGVKLESVKNLDAEGNFNSEVEGRPSN  841
             Q+  +       SYS     S  + +  S KV   +K    K+     NF  +VE    +
Sbjct  118   QKSLLNDFRHAESYSILERSSMISNSNSSEKVGADLKTVICKSKSVCENFTGKVE----D  173

Query  842   LGDLRSV---NINNATQKQQLADDGMQTGDITMAGGCSVKDPikisltttnkntlnnsDC  1012
               D +      ++N  ++ Q+  DG+ TG +T    CS+KDP           TL   D 
Sbjct  174   SFDSKVACDGYVDNGFRRHQVG-DGLDTGGLTAENACSLKDP---MEMCMKFPTLIKPDS  229

Query  1013  SVQLPLYRDPVPSASFAKHR  1072
              V+LPL R+PVP+ S  + R
Sbjct  230   DVELPLRREPVPNTSIPRRR  249



>emb|CAN72738.1| hypothetical protein VITISV_021864 [Vitis vinifera]
Length=672

 Score = 68.9 bits (167),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 92/252 (37%), Positives = 135/252 (54%), Gaps = 19/252 (8%)
 Frame = +2

Query  329   MVMKKRLEYGFDGYrfpavpraprssrrrHTGN--VDDKQICAFELLAAVAGKl-llese  499
             MV+KK+ +YGF+G+    +PRAPRS RRR +    V+D QICA +LLA +AGKL      
Sbjct  1     MVLKKKQDYGFNGFHVSTIPRAPRSIRRRGSIKKPVEDSQICAIDLLATLAGKLLQESES  60

Query  500   ssassnaaeGKDGPAIQRD-VTEELGNFQEGKALKPECLDRGSCVESAILPKGAIQEQKI  676
             SSASSN A GKD   I +D + +EL +  + K LK ECLD+GSC     + + A Q+   
Sbjct  61    SSASSNVAAGKDRLNISKDGIKQELQD--DDKPLKGECLDQGSCEGIVFVSELASQDLSP  118

Query  677   KHGNGGssysenscvsesTFTEFSGKVYPGVKLESVKNLDAEGNFNSEVEGRPSNLGDLR  856
             K+       +  +  +     ++  KV   V + + K  +  G    +VE    + G+  
Sbjct  119   KY-------TVEAISTCFASXDYLDKVGCDV-MVTCKXKNIFGKVPCKVERGSXDCGET-  169

Query  857   SVNINNATQKQQLADDGMQTGDITMAGGCSVKDPikisltttnkntlnnsDCSVQLPLYR  1036
               ++ N  + +Q A+ G ++G +TMA  CS KD               NSD +V+L L R
Sbjct  170   CGDLENGAEIRQXAE-GEESGGLTMANRCSSKD---SVELCMKNPAQINSDSNVKLSLNR  225

Query  1037  DPVPSASFAKHR  1072
             D +P+ASF KHR
Sbjct  226   DSIPNASFPKHR  237



>gb|ADM64318.1| putative telomeric protein [Cestrum parqui]
Length=610

 Score = 63.2 bits (152),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 66/104 (63%), Positives = 83/104 (80%), Gaps = 4/104 (4%)
 Frame = +2

Query  329  MVMKKRLEYGFDGYrfpavpraprssrrrHTGN-VDDKQICAFELLAAVAGKlllesess  505
            MV KK+L++GF+G++ P +P+APRS RRR + N ++D +ICAFELLAAVAGKLL ESESS
Sbjct  1    MVSKKKLDWGFNGFQVPFIPKAPRSVRRRRSCNKLNDGEICAFELLAAVAGKLLEESESS  60

Query  506  assnaaeGKDGPAIQRDVTE-ELGNFQEGKALKPECLDRGSCVE  634
            ASSNAAEGK   +  RD ++ EL   +E KALK ECLD+GSCVE
Sbjct  61   ASSNAAEGKYELSDCRDGSKREL--VEEDKALKSECLDQGSCVE  102



>gb|KHG15516.1| Telomere repeat-binding 3 -like protein [Gossypium arboreum]
Length=660

 Score = 63.2 bits (152),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 86/250 (34%), Positives = 124/250 (50%), Gaps = 25/250 (10%)
 Frame = +2

Query  329   MVMKKRLEYGFDGYrfpavpraprssrrrHTG--NVDDKQICAFELLAAVAGKllleses  502
             MV KKRL+YGF+ +    VPRAPRS RRR      V++ Q CAFE+LA++AGKLL ESES
Sbjct  1     MVFKKRLDYGFNAFNVHDVPRAPRSMRRRSQSKCTVEESQFCAFEMLASLAGKLLQESES  60

Query  503   sassnaaeGKDGPAIQRDVTEELGNFQEGKALKPECLDRGSCVESAILPKGAIQEQKIKH  682
             SAS NA+EG +  +I ++  ++   + E K LKP+C ++G C       + ++   ++  
Sbjct  61    SASGNASEGHECDSIGKNCFKQEIQY-EDKPLKPKCFEQGRC-------EASVAASELTT  112

Query  683   GNGGssysenscvsesTFTEFSGKVYPGVKLESVKNLDAEGNFNSEVEGRPSNLGDLRSV  862
              NG  S       + +       K  P    E   +L   G+F   V+G     G+  + 
Sbjct  113   ENGDDSKDFRCAKNNAILECTLTKTDPACSEEINGDLKY-GSFPGNVDGHSPYFGESYNG  171

Query  863   NINNATQKQQLADDGMQTGDITMAGGCSVKDPikisltttnkntlnnsDCSVQLPLYRDP  1042
                NA  KQ+    G++T  + +A     KDP              N D  V+L   RDP
Sbjct  172   KTENAF-KQERDPTGLETQALNIANKGPPKDP-------------VNFDRVVKLLSRRDP  217

Query  1043  VPSASFAKHR  1072
             VPS  F + R
Sbjct  218   VPSVPFTRRR  227



>ref|XP_006378701.1| hypothetical protein POPTR_0010s20990g [Populus trichocarpa]
 gb|ERP56498.1| hypothetical protein POPTR_0010s20990g [Populus trichocarpa]
Length=689

 Score = 61.6 bits (148),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 84/222 (38%), Positives = 113/222 (51%), Gaps = 19/222 (9%)
 Frame = +2

Query  428   VDDKQICAFELLAAVAGKlllesessassnaaeGKDGPAIQRDVTEELGNFQEGKALKPE  607
             V+D QICAFELLA++AGKLL ESESSASSNA+E  D P I   V  E     + + LK E
Sbjct  29    VEDSQICAFELLASLAGKLLQESESSASSNASEANDQPIIGGGVKFEQ---DDDRPLKAE  85

Query  608   CLDRGSCVESAILPKGAI--QEQKIKHGNGGssysenscvsesTFTEFSGKVYPGVKLES  781
             CLD GSC ESA+  + +    +QK        + S       S  T  +     G  L+S
Sbjct  86    CLDHGSCGESALFTRFSSPNSDQKCLLNEFPHAESNLFLERSSMITNSNSSKNGGADLKS  145

Query  782   V--KNLDAEGNFNSEVEGRPSNLGDLRSV---NINNATQKQQLADDGMQTGDITMAGGCS  946
             V  K+  A  N   +VEG      D R      ++N   +Q+   DG+ T  + +   CS
Sbjct  146   VICKSKSACENIPGKVEGS----SDSRVSCDGYVDNGLSRQKRC-DGLDTRGL-IVDPCS  199

Query  947   VKDPikisltttnkntlnnsDCSVQLPLYRDPVPSASFAKHR  1072
               DP+++ +         N   +V+LP  RDPVPSAS  +HR
Sbjct  200   SNDPMEMCMKFPALINSVN---NVELPSCRDPVPSASIPRHR  238



>ref|XP_012089031.1| PREDICTED: telomere repeat-binding protein 4 isoform X2 [Jatropha 
curcas]
Length=712

 Score = 60.5 bits (145),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 100/253 (40%), Positives = 141/253 (56%), Gaps = 13/253 (5%)
 Frame = +2

Query  329   MVMKKRLEYGFDGYrfpavpraprssrr-rHTGNVDDKQICAFELLAAVAGKlllesess  505
             MV+KKR +YGF+G+  P +PRAPRS+RR      V+D QICAFELLAA+AGKLL ESESS
Sbjct  1     MVLKKRQDYGFNGFHVPFIPRAPRSARRGLQKKKVEDSQICAFELLAALAGKLLQESESS  60

Query  506   assnaaeGKDGPAIQRDVTEELGNFQEGKALKPECLDRGSCVESAILPK----GAIQEQK  673
             ASS+A+E  D PAI  +  +E    ++ K LK ECLD+GSC ES  +P+     + ++  
Sbjct  61    ASSSASETNDQPAIGDNGIKE----EQDKPLKIECLDQGSCEESVFIPEFTAPSSDKKFL  116

Query  674   IKHGNGGssysenscvsesTFTEFSGKVYPGVKLESVKNLDAEGNFNSEVEGRPSNLGDL  853
             +K      S S     S  T ++ S K    VK    K+     +   ++EG   + G+ 
Sbjct  117   LKECPRADSDSILERSSIITNSDSSEKASSDVKSAICKSKSPCDDLPCKIEGGSPDSGEY  176

Query  854   RSVNINNATQKQQLADDGMQTGDITMAGGCSVKDPikisltttnkntlnnsDCSVQLPLY  1033
                 + N   +QQ A DG+ TG +T+    S+KDP            L NS+ +V+L   
Sbjct  177   GDGYVENGFSQQQEA-DGLGTGGLTIDNTSSLKDP---MELCMKFPALVNSENNVKLTSC  232

Query  1034  RDPVPSASFAKHR  1072
             R+ VP+AS  + R
Sbjct  233   RNSVPNASSLRLR  245



>ref|XP_012089039.1| PREDICTED: telomere repeat-binding protein 4 isoform X3 [Jatropha 
curcas]
 gb|KDP44939.1| hypothetical protein JCGZ_01439 [Jatropha curcas]
Length=709

 Score = 60.5 bits (145),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 100/254 (39%), Positives = 142/254 (56%), Gaps = 14/254 (6%)
 Frame = +2

Query  329   MVMKKRLEYGFDGYrfpavpraprssrrr--HTGNVDDKQICAFELLAAVAGKllleses  502
             MV+KKR +YGF+G+  P +PRAPRS+R+R      V+D QICAFELLAA+AGKLL ESES
Sbjct  1     MVLKKRQDYGFNGFHVPFIPRAPRSARQRGLQKKKVEDSQICAFELLAALAGKLLQESES  60

Query  503   sassnaaeGKDGPAIQRDVTEELGNFQEGKALKPECLDRGSCVESAILPK----GAIQEQ  670
             SASS+A+E  D PAI  +  +E    ++ K LK ECLD+GSC ES  +P+     + ++ 
Sbjct  61    SASSSASETNDQPAIGDNGIKE----EQDKPLKIECLDQGSCEESVFIPEFTAPSSDKKF  116

Query  671   KIKHGNGGssysenscvsesTFTEFSGKVYPGVKLESVKNLDAEGNFNSEVEGRPSNLGD  850
              +K      S S     S  T ++ S K    VK    K+     +   ++EG   + G+
Sbjct  117   LLKECPRADSDSILERSSIITNSDSSEKASSDVKSAICKSKSPCDDLPCKIEGGSPDSGE  176

Query  851   LRSVNINNATQKQQLADDGMQTGDITMAGGCSVKDPikisltttnkntlnnsDCSVQLPL  1030
                  + N   +QQ A DG+ TG +T+    S+KDP            L NS+ +V+L  
Sbjct  177   YGDGYVENGFSQQQEA-DGLGTGGLTIDNTSSLKDP---MELCMKFPALVNSENNVKLTS  232

Query  1031  YRDPVPSASFAKHR  1072
              R+ VP+AS  + R
Sbjct  233   CRNSVPNASSLRLR  246



>ref|XP_012089023.1| PREDICTED: telomere repeat-binding protein 4 isoform X1 [Jatropha 
curcas]
Length=713

 Score = 60.1 bits (144),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 100/254 (39%), Positives = 142/254 (56%), Gaps = 14/254 (6%)
 Frame = +2

Query  329   MVMKKRLEYGFDGYrfpavpraprssrrr--HTGNVDDKQICAFELLAAVAGKllleses  502
             MV+KKR +YGF+G+  P +PRAPRS+R+R      V+D QICAFELLAA+AGKLL ESES
Sbjct  1     MVLKKRQDYGFNGFHVPFIPRAPRSARQRGLQKKKVEDSQICAFELLAALAGKLLQESES  60

Query  503   sassnaaeGKDGPAIQRDVTEELGNFQEGKALKPECLDRGSCVESAILPK----GAIQEQ  670
             SASS+A+E  D PAI  +  +E    ++ K LK ECLD+GSC ES  +P+     + ++ 
Sbjct  61    SASSSASETNDQPAIGDNGIKE----EQDKPLKIECLDQGSCEESVFIPEFTAPSSDKKF  116

Query  671   KIKHGNGGssysenscvsesTFTEFSGKVYPGVKLESVKNLDAEGNFNSEVEGRPSNLGD  850
              +K      S S     S  T ++ S K    VK    K+     +   ++EG   + G+
Sbjct  117   LLKECPRADSDSILERSSIITNSDSSEKASSDVKSAICKSKSPCDDLPCKIEGGSPDSGE  176

Query  851   LRSVNINNATQKQQLADDGMQTGDITMAGGCSVKDPikisltttnkntlnnsDCSVQLPL  1030
                  + N   +QQ A DG+ TG +T+    S+KDP            L NS+ +V+L  
Sbjct  177   YGDGYVENGFSQQQEA-DGLGTGGLTIDNTSSLKDP---MELCMKFPALVNSENNVKLTS  232

Query  1031  YRDPVPSASFAKHR  1072
              R+ VP+AS  + R
Sbjct  233   CRNSVPNASSLRLR  246



>gb|KHF99719.1| Telomere repeat-binding 4 -like protein [Gossypium arboreum]
Length=676

 Score = 59.7 bits (143),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 82/254 (32%), Positives = 121/254 (48%), Gaps = 26/254 (10%)
 Frame = +2

Query  329   MVMKKRLEYGFDGYrfpavpraprssrrrHTGN--VDDKQICAFELLAAVAGKllleses  502
             MV KKRL+YGF+ +    VPRAPRS R+R      V+D +ICAFELLA++AGKLL   ES
Sbjct  1     MVFKKRLDYGFNAFSVSNVPRAPRSIRKRDRTKRVVEDSRICAFELLASLAGKLLEAGES  60

Query  503   sassnaaeGKDGPAIQRDVTEELGNFQEGKALKPECLDRGSCVESAILPKGAIQ----EQ  670
              ASSNA+ G D  ++ +DV  +L    + K LK EC++  SC  S +      +     +
Sbjct  61    FASSNASAGHDHVSVVKDV--KLETQYDDKPLKTECVEHVSCDASVVTSDWTTENSDNSK  118

Query  671   KIKHGNGGssysenscvsesTFTEFSGKVYPGVKLESVKNLDAEGNFNSEVEGRPSNLGD  850
             + KH    +        +    +E   K+   +     K     G+F   ++G   + GD
Sbjct  119   EPKHSENNAILEPTLTKALPACSE---KINDDLMYTIRKCNVGYGSFTGNLDGCSPDFGD  175

Query  851   LRSVNINNATQKQQLADDGMQTGDITMAGGCSVKDPikisltttnkntlnnsDCSVQLPL  1030
             L      N  +++              A  C   DP      +    +  NSD  V+L  
Sbjct  176   LCDDISENGVKRE------------IEANNCLTMDP---LELSMTFPSPINSDRDVKLLS  220

Query  1031  YRDPVPSASFAKHR  1072
             + D VP+ASF++HR
Sbjct  221   HSDSVPNASFSRHR  234



>gb|EPS64950.1| hypothetical protein M569_09831, partial [Genlisea aurea]
Length=659

 Score = 59.3 bits (142),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 87/256 (34%), Positives = 128/256 (50%), Gaps = 20/256 (8%)
 Frame = +2

Query  329   MVMKKRLEYGFDG----YrfpavpraprssrrrHTGNVDDKQICAFELLAAVAGKllles  496
             MV+K+RL++ F G                 +      ++++ +C+FELLAAVAGKLL ES
Sbjct  1     MVLKRRLDFRFSGNGNEAATIPRAPRSIRKKPPRKKILEEENLCSFELLAAVAGKLLEES  60

Query  497   essassnaaeGKDGPAIQRDVTEELGNFQEGKALKPECLDRGSCVESAILPKGAIQEQKI  676
             E SAS +AAEGK+   +++   +EL    EG ALK E  DRGSC ESA L + +IQE  +
Sbjct  61    EGSASCSAAEGKN--QLRQGNEKELPK-DEG-ALKFEIFDRGSCAESAFLREISIQEHNL  116

Query  677   KHGNGGssysenscvsesTFTEFSGKVYPG-----VKLESVKNLDAEGNFNSEVEGRPSN  841
                  G      S    S+    SG   P      +KL    +  +E N NS  +  PS+
Sbjct  117   ISNFKG---LLESDTDRSSLHMTSGAPKPKKLDWDMKLGICADKSSENN-NSCNKNDPSS  172

Query  842   LGDLRSVNINNATQKQQLADDGMQTGDITMAGGCSVKDPikisltttnkntlnnsDCSVQ  1021
              G+  ++ + + ++     D   +  D ++A   S+KD         N N+L NS+ SV+
Sbjct  173   AGESLNLKVEDGSEVVYSRDKKDKIVDSSVANVSSIKD---QIGGCVNTNSLVNSESSVK  229

Query  1022  LPLYRDPVPSASFAKH  1069
             L LYR  +P A   KH
Sbjct  230   LSLYRKSIPRALLQKH  245



>ref|XP_008784600.1| PREDICTED: telomere repeat-binding protein 5 [Phoenix dactylifera]
 ref|XP_008784601.1| PREDICTED: telomere repeat-binding protein 5 [Phoenix dactylifera]
Length=704

 Score = 59.3 bits (142),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 48/116 (41%), Positives = 72/116 (62%), Gaps = 3/116 (3%)
 Frame = +2

Query  329  MVMKKRLEYGFDGYrfpavpraprssrrrHT--GNVDDKQICAFELLAAVAGKllleses  502
            MV++KRL+YG  GY+ PA+P  PRS+R + +    V+D ++CAF+LLA VAG+LL E ++
Sbjct  1    MVLQKRLDYGSSGYQVPAMPHVPRSARGKRSVRKKVEDNRMCAFDLLATVAGRLLSERQN  60

Query  503  sassnaaeGKDGPAIQRDVTEELGNFQEGKALKPECLDRGSCVESAILPKGAIQEQ  670
            S +     G   P   +D+ ++   F+  K LK E  D+GSC ESA+  +   Q Q
Sbjct  61   SPTPCNITGTSNPTAGKDIIKQ-EQFENEKPLKAEAFDQGSCDESALGSEIVFQRQ  115



>gb|KJB67624.1| hypothetical protein B456_010G200900 [Gossypium raimondii]
Length=662

 Score = 57.8 bits (138),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 75/250 (30%), Positives = 115/250 (46%), Gaps = 25/250 (10%)
 Frame = +2

Query  329   MVMKKRLEYGFDGYrfpa--vpraprssrrrHTGNVDDKQICAFELLAAVAGKllleses  502
             MV KKRL+YGF+ +              R +    V + Q CAFE+LA++AGKLL ESES
Sbjct  1     MVFKKRLDYGFNAFNVHDVPRAARSMRRRSQSKWTVQESQFCAFEMLASLAGKLLQESES  60

Query  503   sassnaaeGKDGPAIQRDVTEELGNFQEGKALKPECLDRGSCVESAILPKGAIQEQKIKH  682
             SASSNA+EG +  +I ++  ++   + + K LKP+C ++G C       + ++   ++  
Sbjct  61    SASSNASEGHECDSIGKNCFKQEIQYDD-KPLKPKCFEQGRC-------EASVAASELTT  112

Query  683   GNGGssysenscvsesTFTEFSGKVYPGVKLESVKNLDAEGNFNSEVEGRPSNLGDLRSV  862
              NG  S       + +       K  P    E   +L+  G+F   V+      G+  + 
Sbjct  113   ENGDDSKDFRCAENNAILECTLTKTDPACSEEINGDLNY-GSFPGNVDDHSPYFGESYNG  171

Query  863   NINNATQKQQLADDGMQTGDITMAGGCSVKDPikisltttnkntlnnsDCSVQLPLYRDP  1042
                NA  KQ+    G++T  + +A     KDP                D  V+L   RDP
Sbjct  172   KTENAF-KQERDPTGLETQALNIANNGPSKDP-------------VKFDRVVKLLSCRDP  217

Query  1043  VPSASFAKHR  1072
             VPS  F + R
Sbjct  218   VPSVPFTRRR  227



>gb|KHN17923.1| Telomere repeat-binding protein 3 [Glycine soja]
Length=676

 Score = 57.0 bits (136),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 83/252 (33%), Positives = 123/252 (49%), Gaps = 20/252 (8%)
 Frame = +2

Query  329   MVMKKRLEYGFDGYrfpa--vpraprssrrrHTGNVDDKQICAFELLAAVAGKllleses  502
             MV+KKR+++GFDG R P           R      V+D Q+CA ELLA++AG+LL ESE 
Sbjct  1     MVLKKRVDHGFDGLRVPVIPKAPRSARRRIAFKKAVEDGQVCAIELLASLAGQLLQESEG  60

Query  503   sassnaaeGKDGPAIQRDVTEELGNFQEG-KALKPECLDRGSCVESAILPKGAIQ---EQ  670
             SASSNA+EG   P   + V E+  + Q+G K LK E + +GSCVES    + A Q   ++
Sbjct  61    SASSNASEGNHHPPFSQGVIEQ--DIQDGVKPLKKEEIHQGSCVESTFKTEVASQNSSQK  118

Query  671   KIKHGNGGssysenscvsesTFTEFSGKVYPGVKLESVKNLDAEGNFNSEVEGRPSNLGD  850
              + H   G     NS       ++   KV   VK E  +  +  GN+++ +     N   
Sbjct  119   PLSHTKTGHVSVNNS-------SDCCEKVEADVKSEIFEWDNKFGNYSNRLVETRENFRK  171

Query  851   LRSVNINNATQKQQLADDGMQTGDITMAGGCSVKDPikisltttnkntlnnsDCSVQLPL  1030
                  I N  +++Q A      G   +A  CS++      L       L +S  + + P 
Sbjct  172   SSDGKIKNGFKREQEAGSSCIRGS-NLADKCSLE----GHLELYVSPALIDSKSNKKSPF  226

Query  1031  YRDPVPSASFAK  1066
             +R   PSASF++
Sbjct  227   HRKSFPSASFSR  238



>ref|XP_006602000.1| PREDICTED: telomere repeat-binding protein 3-like isoform X1 
[Glycine max]
 ref|XP_006602001.1| PREDICTED: telomere repeat-binding protein 3-like isoform X2 
[Glycine max]
 gb|KHN07566.1| Telomere repeat-binding protein 3 [Glycine soja]
Length=674

 Score = 57.0 bits (136),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 91/253 (36%), Positives = 136/253 (54%), Gaps = 20/253 (8%)
 Frame = +2

Query  329   MVMKKRLEYGFDGYrfpavpraprssrrrHTGN--VDDKQICAFELLAAVAGKllleses  502
             MV+KKR++YGF+G+R P +P+APRS+RRR   N  V+D Q+CA ELLA++AG+LL ESES
Sbjct  1     MVLKKRVDYGFNGFRVPVIPKAPRSARRRVAFNKAVEDGQVCAIELLASLAGQLLQESES  60

Query  503   sassnaaeGKDGPAIQRDVTEELGNFQ-EGKALKPECLDRGSCVESAILPKGAIQ---EQ  670
             SASSNA+EG   PA  + V E+  + Q E K LK E + +G+C ES    + A Q   ++
Sbjct  61    SASSNASEGNHQPAFSQGVIEQ--DIQDEVKPLKMEEIHQGNCAESTFKTEVASQKSSQK  118

Query  671   KIKHGNGGssysenscvsesTFTEFSGKVYPGVKLESVKNLDAEGNFNSEVEGRPSNLGD  850
              + H   G     NS       ++   K    VK E  +  +  GN+++ +         
Sbjct  119   PLSHTKTGHVSVNNS-------SDCCEKAEADVKSEIFEWDNKFGNYSNRLVETREKFRV  171

Query  851   LRSVNINNATQKQQLADDGMQTGDITMAGGCSVKDPikisltttnkntlnnsDCSVQLPL  1030
                 NI N  + +Q A      G   +A  CS++D     L       L +S  +++ P 
Sbjct  172   STHGNIKNGFKWEQEAGSSCIRGS-NLADKCSLED----HLELYVSPALIDSKSNIKSPF  226

Query  1031  YRDPVPSASFAKH  1069
             +R   PSASF+++
Sbjct  227   HRKFFPSASFSRY  239



>ref|XP_003538412.1| PREDICTED: telomere repeat-binding protein 3-like isoform X1 
[Glycine max]
Length=679

 Score = 57.0 bits (136),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 83/252 (33%), Positives = 123/252 (49%), Gaps = 20/252 (8%)
 Frame = +2

Query  329   MVMKKRLEYGFDGYrfpa--vpraprssrrrHTGNVDDKQICAFELLAAVAGKllleses  502
             MV+KKR+++GFDG R P           R      V+D Q+CA ELLA++AG+LL ESE 
Sbjct  1     MVLKKRVDHGFDGLRVPVIPKAPRSARRRIAFKKAVEDGQVCAIELLASLAGQLLQESEG  60

Query  503   sassnaaeGKDGPAIQRDVTEELGNFQEG-KALKPECLDRGSCVESAILPKGAIQ---EQ  670
             SASSNA+EG   P   + V E+  + Q+G K LK E + +GSCVES    + A Q   ++
Sbjct  61    SASSNASEGNHHPPFSQGVIEQ--DIQDGVKPLKKEEIHQGSCVESTFKTEVASQNSSQK  118

Query  671   KIKHGNGGssysenscvsesTFTEFSGKVYPGVKLESVKNLDAEGNFNSEVEGRPSNLGD  850
              + H   G     NS       ++   KV   VK E  +  +  GN+++ +     N   
Sbjct  119   PLSHTKTGHVSVNNS-------SDCCEKVEADVKSEIFEWDNKFGNYSNRLVETRENFRK  171

Query  851   LRSVNINNATQKQQLADDGMQTGDITMAGGCSVKDPikisltttnkntlnnsDCSVQLPL  1030
                  I N  +++Q A      G   +A  CS++      L       L +S  + + P 
Sbjct  172   SSDGKIKNGFKREQEAGSSCIRGS-NLADKCSLE----GHLELYVSPALIDSKSNKKSPF  226

Query  1031  YRDPVPSASFAK  1066
             +R   PSASF++
Sbjct  227   HRKSFPSASFSR  238



>ref|XP_006591341.1| PREDICTED: telomere repeat-binding protein 3-like isoform X2 
[Glycine max]
Length=676

 Score = 57.0 bits (136),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 83/252 (33%), Positives = 123/252 (49%), Gaps = 20/252 (8%)
 Frame = +2

Query  329   MVMKKRLEYGFDGYrfpa--vpraprssrrrHTGNVDDKQICAFELLAAVAGKllleses  502
             MV+KKR+++GFDG R P           R      V+D Q+CA ELLA++AG+LL ESE 
Sbjct  1     MVLKKRVDHGFDGLRVPVIPKAPRSARRRIAFKKAVEDGQVCAIELLASLAGQLLQESEG  60

Query  503   sassnaaeGKDGPAIQRDVTEELGNFQEG-KALKPECLDRGSCVESAILPKGAIQ---EQ  670
             SASSNA+EG   P   + V E+  + Q+G K LK E + +GSCVES    + A Q   ++
Sbjct  61    SASSNASEGNHHPPFSQGVIEQ--DIQDGVKPLKKEEIHQGSCVESTFKTEVASQNSSQK  118

Query  671   KIKHGNGGssysenscvsesTFTEFSGKVYPGVKLESVKNLDAEGNFNSEVEGRPSNLGD  850
              + H   G     NS       ++   KV   VK E  +  +  GN+++ +     N   
Sbjct  119   PLSHTKTGHVSVNNS-------SDCCEKVEADVKSEIFEWDNKFGNYSNRLVETRENFRK  171

Query  851   LRSVNINNATQKQQLADDGMQTGDITMAGGCSVKDPikisltttnkntlnnsDCSVQLPL  1030
                  I N  +++Q A      G   +A  CS++      L       L +S  + + P 
Sbjct  172   SSDGKIKNGFKREQEAGSSCIRGS-NLADKCSLE----GHLELYVSPALIDSKSNKKSPF  226

Query  1031  YRDPVPSASFAK  1066
             +R   PSASF++
Sbjct  227   HRKSFPSASFSR  238



>ref|XP_011027219.1| PREDICTED: telomere repeat-binding protein 3-like isoform X3 
[Populus euphratica]
Length=701

 Score = 55.8 bits (133),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 95/260 (37%), Positives = 126/260 (48%), Gaps = 31/260 (12%)
 Frame = +2

Query  329   MVMKKRLEYGFDGYrfpavpraprssrrr--HTGNVDDKQICAFELLAAVAGKllleses  502
             MV+KKR  YGF+G+  P VPRAPRS+R R  +   V+D QICAFELLA++AGKLL ESES
Sbjct  1     MVVKKRQYYGFNGFHMPPVPRAPRSARGRGLNKTKVEDSQICAFELLASLAGKLLQESES  60

Query  503   sassnaaeGKDGPAI--------QRDVTEELGNFQEGKALKPECLDRGSCVESAILPKGA  658
             SASSNA+E  D P I        ++D         + + L+ ECLD GSC ESA   + +
Sbjct  61    SASSNASEANDQPVIGGGGGVKFEQD---------DDRPLRAECLDHGSCGESAFFTRFS  111

Query  659   I--QEQKIKHGNGGssysenscvsesTFTEFSGKVYPGVKLESVKNLDAEGNFNSEVEGR  832
                 +QK        + S       S     +     G  L+SV      G      + R
Sbjct  112   SPNNDQKCLLNEFPHAESNLFLERSSMIMNSNSSKNGGADLKSVICKSIPGKVEGSSDSR  171

Query  833   PSNLGDLRSVNINNATQKQQLADDGMQTGDITMAGGCSVKDPikisltttnkntlnnsDC  1012
              S  G      ++N   +Q+  D     G I     CS  DP++  +         N   
Sbjct  172   VSCDG-----YVDNGLSRQKRCDRLDTRGLI--GDPCSSNDPMEKCMKFPVLINSVN---  221

Query  1013  SVQLPLYRDPVPSASFAKHR  1072
             +V+LP  RDPV SAS  +HR
Sbjct  222   NVELPSCRDPVTSASIPRHR  241



>ref|XP_011027217.1| PREDICTED: telomere repeat-binding protein 3-like isoform X1 
[Populus euphratica]
Length=703

 Score = 55.8 bits (133),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 95/260 (37%), Positives = 126/260 (48%), Gaps = 31/260 (12%)
 Frame = +2

Query  329   MVMKKRLEYGFDGYrfpavpraprssrrr--HTGNVDDKQICAFELLAAVAGKllleses  502
             MV+KKR  YGF+G+  P VPRAPRS+R R  +   V+D QICAFELLA++AGKLL ESES
Sbjct  1     MVVKKRQYYGFNGFHMPPVPRAPRSARGRGLNKTKVEDSQICAFELLASLAGKLLQESES  60

Query  503   sassnaaeGKDGPAI--------QRDVTEELGNFQEGKALKPECLDRGSCVESAILPKGA  658
             SASSNA+E  D P I        ++D         + + L+ ECLD GSC ESA   + +
Sbjct  61    SASSNASEANDQPVIGGGGGVKFEQD---------DDRPLRAECLDHGSCGESAFFTRFS  111

Query  659   I--QEQKIKHGNGGssysenscvsesTFTEFSGKVYPGVKLESVKNLDAEGNFNSEVEGR  832
                 +QK        + S       S     +     G  L+SV      G      + R
Sbjct  112   SPNNDQKCLLNEFPHAESNLFLERSSMIMNSNSSKNGGADLKSVICKSIPGKVEGSSDSR  171

Query  833   PSNLGDLRSVNINNATQKQQLADDGMQTGDITMAGGCSVKDPikisltttnkntlnnsDC  1012
              S  G      ++N   +Q+  D     G I     CS  DP++  +         N   
Sbjct  172   VSCDG-----YVDNGLSRQKRCDRLDTRGLI--GDPCSSNDPMEKCMKFPVLINSVN---  221

Query  1013  SVQLPLYRDPVPSASFAKHR  1072
             +V+LP  RDPV SAS  +HR
Sbjct  222   NVELPSCRDPVTSASIPRHR  241



>ref|XP_002311174.2| hypothetical protein POPTR_0008s05740g [Populus trichocarpa]
 gb|EEE88541.2| hypothetical protein POPTR_0008s05740g [Populus trichocarpa]
Length=707

 Score = 55.5 bits (132),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 105/266 (39%), Positives = 142/266 (53%), Gaps = 36/266 (14%)
 Frame = +2

Query  329   MVMKKRLEYGFDGYrfpavpraprssrrrHTGN---VDDKQICAFELLAAVAGKlllese  499
             MV+KKR  YGF+G+  P VPRAPRS+RR  + N   V+D Q+CAF+LLA++AGKLL ESE
Sbjct  1     MVVKKRQYYGFNGFHMPPVPRAPRSARRGLSLNKKKVEDSQLCAFDLLASLAGKLLQESE  60

Query  500   ssassnaaeGKDGPAI-----QRDVTEELGNFQEGKALKPECLDRGSCVESAILP--KGA  658
             SSASSNA+E  D P I     + +  EE       + LK ECLD GSC ESA +      
Sbjct  61    SSASSNASEANDQPIIGGGGVKCEQAEE-------RPLKAECLDHGSCGESAFVTGFTSP  113

Query  659   IQEQK-----IKHGNGGssysenscvsesTFTEFSGKVYPGVKLESVKNLDAEGNFNSEV  823
               +QK       H    S    +S +S S  +E   KV   +K    K+     NF  +V
Sbjct  114   NSDQKCLLNAFPHAESCSILERSSMISNSNSSE---KVGADLKTVICKSKSVCENFTGKV  170

Query  824   EGRPSNLGDLRSV---NINNATQKQQLADDGMQTGDITMAGGCSVKDPikisltttnknt  994
             EG      D R      ++N  ++QQ   DG+ TG +T    CS+KDP+++ +       
Sbjct  171   EGS----FDSRVPCDGYVDNGFRRQQ-GGDGLDTGGLTAENACSLKDPMEMCMKFPALIK  225

Query  995   lnnsDCSVQLPLYRDPVPSASFAKHR  1072
               N    V+LP  R+PVP+AS  + R
Sbjct  226   PAN---DVELPSRREPVPNASIPRRR  248



>ref|XP_010256896.1| PREDICTED: telomere repeat-binding protein 5-like isoform X1 
[Nelumbo nucifera]
 ref|XP_010256897.1| PREDICTED: telomere repeat-binding protein 5-like isoform X1 
[Nelumbo nucifera]
Length=686

 Score = 54.7 bits (130),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 72/246 (29%), Positives = 115/246 (47%), Gaps = 14/246 (6%)
 Frame = +2

Query  329   MVMKKRLEYGFDGYrfpavpraprssrrrHTGNVDDKQICAFELLAAVAGKlllesessa  508
             MV++KRLEYGF+GY+ P   R+ R         V D  +CAF+LLA VAGKLL E ESS 
Sbjct  1     MVLQKRLEYGFNGYQVPRASRSARGRGSVRK-KVHDNPMCAFDLLATVAGKLLQEGESSP  59

Query  509   ssnaaeGKD--GPAIQRDVTEELGNFQEGKALKPECLDRGSCVESAILP----KGAIQEQ  670
             +   A  ++   P ++ ++  E  +  E + LK E  D+GSC ES ++     +G  +  
Sbjct  60    APAKASARNDQNPLVKHNLEAEQQD--EERTLKVEPFDQGSCNESVLVSGLGSEGHNRTH  117

Query  671   KIKHGNGGssysenscvsesTFTEFSGKVYPGVKLESVKNLDAEGNFNS-EVEGRPSNLG  847
              +K      +         +    +S K     K    K+ +  G   S E +G PS  G
Sbjct  118   FLKENPQVQNAVALRQTPATRNLNYSEKFTCAEKFIKGKSRNEFGCIPSKERKGSPS-YG  176

Query  848   DLRSVNINNATQKQQLADDGMQTGDITMAGGCSVKDPikisltttnkntlnnsDCSVQLP  1027
             +     + + T +++         + T+   CS +DP+++        +    D SV +P
Sbjct  177   ESYGGKVEDGTVRERETQKIGSVINGTLPDSCSSEDPMEVDRKPPALISS---DSSVDIP  233

Query  1028  LYRDPV  1045
             L RDP+
Sbjct  234   LCRDPI  239



>ref|XP_007163414.1| hypothetical protein PHAVU_001G232700g [Phaseolus vulgaris]
 gb|ESW35408.1| hypothetical protein PHAVU_001G232700g [Phaseolus vulgaris]
Length=680

 Score = 54.7 bits (130),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 88/249 (35%), Positives = 131/249 (53%), Gaps = 8/249 (3%)
 Frame = +2

Query  329   MVMKKRLEYGFDGYrfpavpraprssrrrHTGN--VDDKQICAFELLAAVAGKllleses  502
             MV+KKR++YGF+G+R P +P+APRS RRR   N   +D ++CA ELLA++AG+LL ESES
Sbjct  1     MVLKKRIDYGFNGFRVPIIPKAPRSVRRRGPFNKATEDGRVCAIELLASLAGQLLQESES  60

Query  503   sassnaaeGKDGPAIQRDVTEELGNFQEGKALKPECLDRGSCVESAILPKGAIQEQKIKH  682
             SASSNA+EG   PA  + V E+     E K LK E + +GSC ES    +   Q    K 
Sbjct  61    SASSNASEGNRQPAFSQGVIEQ-DRQGEVKPLKKEEIHQGSCAESTFKTEVGSQNSSQKP  119

Query  683   GNGGssysenscvsesTFTEFSGKVYPGVKLESVKNLDAEGNFNSEVEGRPSNLGDLRSV  862
                  +      VS +  ++   KV   VK E  K  +  GN+++ +        +    
Sbjct  120   LPHAKTDFSQGHVSVNNDSDIWEKVQADVKSEIFKWDNKFGNYSNRLVEPSEKFRESSDG  179

Query  863   NINNATQKQQLADDGMQTGDITMAGGCSVKDPikisltttnkntlnnsDCSVQLPLYRDP  1042
              +    ++++ A      G   +A  CS+KD     +      TL NS  +++ P +R  
Sbjct  180   KMKIGFKQEKKAGSSCFRGS-NLADKCSLKD----HIELYVSPTLINSKSNIKSPFHRKS  234

Query  1043  VPSASFAKH  1069
              PSASF++H
Sbjct  235   SPSASFSRH  243



>ref|XP_010256898.1| PREDICTED: telomere repeat-binding protein 5-like isoform X2 
[Nelumbo nucifera]
Length=680

 Score = 54.7 bits (130),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 72/246 (29%), Positives = 115/246 (47%), Gaps = 14/246 (6%)
 Frame = +2

Query  329   MVMKKRLEYGFDGYrfpavpraprssrrrHTGNVDDKQICAFELLAAVAGKlllesessa  508
             MV++KRLEYGF+GY+ P   R+ R         V D  +CAF+LLA VAGKLL E ESS 
Sbjct  1     MVLQKRLEYGFNGYQVPRASRSARGRGSVRK-KVHDNPMCAFDLLATVAGKLLQEGESSP  59

Query  509   ssnaaeGKD--GPAIQRDVTEELGNFQEGKALKPECLDRGSCVESAILP----KGAIQEQ  670
             +   A  ++   P ++ ++  E  +  E + LK E  D+GSC ES ++     +G  +  
Sbjct  60    APAKASARNDQNPLVKHNLEAEQQD--EERTLKVEPFDQGSCNESVLVSGLGSEGHNRTH  117

Query  671   KIKHGNGGssysenscvsesTFTEFSGKVYPGVKLESVKNLDAEGNFNS-EVEGRPSNLG  847
              +K      +         +    +S K     K    K+ +  G   S E +G PS  G
Sbjct  118   FLKENPQVQNAVALRQTPATRNLNYSEKFTCAEKFIKGKSRNEFGCIPSKERKGSPS-YG  176

Query  848   DLRSVNINNATQKQQLADDGMQTGDITMAGGCSVKDPikisltttnkntlnnsDCSVQLP  1027
             +     + + T +++         + T+   CS +DP+++        +    D SV +P
Sbjct  177   ESYGGKVEDGTVRERETQKIGSVINGTLPDSCSSEDPMEVDRKPPALISS---DSSVDIP  233

Query  1028  LYRDPV  1045
             L RDP+
Sbjct  234   LCRDPI  239



>ref|XP_006424854.1| hypothetical protein CICLE_v10027927mg [Citrus clementina]
 ref|XP_006488347.1| PREDICTED: telomere repeat-binding protein 5-like isoform X5 
[Citrus sinensis]
 gb|ESR38094.1| hypothetical protein CICLE_v10027927mg [Citrus clementina]
Length=694

 Score = 54.3 bits (129),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 85/254 (33%), Positives = 129/254 (51%), Gaps = 17/254 (7%)
 Frame = +2

Query  329   MVMKKRLEYGFDGYrfpavpraprssrr--rHTGNVDDKQICAFELLAAVAGKlllese-  499
             MV++KRL+YGF+GY+ P  PRA RS+R+        +D Q+CAF+LLA VAGKLLLE + 
Sbjct  1     MVLQKRLDYGFNGYQVPYTPRATRSARKRCSFKKRAEDNQMCAFDLLATVAGKLLLEKQC  60

Query  500   ssassnaaeGKDGPAIQRDVTEELGNFQEGKALKPECLDRGSC----VESAILPKGAIQE  667
             + +SSN    +D  A+ +++ E+     E K LK E  D+GSC      S ++ +   Q+
Sbjct  61    TPSSSNTPSDEDQSAVAKEI-EQKAMQDENKQLKVETCDQGSCDRGFFVSDLVSQAHDQK  119

Query  668   QKIKHGNGGssysenscvsesTFTEFSGKVYPGVKLESVKNLDAEGNFNSEVEGRPSNLG  847
               +K  +   + +     S  T ++ S + +   KL + K  +  G   S+VE  PS   
Sbjct  120   CSLKPPSCQQADAHPGFASVITTSDCS-EGFGDQKLVNGKPKNEMGTLASKVEVGPSGYM  178

Query  848   DLRSVNINNATQKQQLADDGMQTGDI---TMAGGCSVKDPikisltttnkntlnnsDCSV  1018
                +  +   T K  + D+  +T  +   T A GCS +DP    L    K    +SD S 
Sbjct  179   GYGNCKVEAETNK-FMKDESHKTAKVQLGTRADGCSFEDP----LVWDGKPPAVSSDSSA  233

Query  1019  QLPLYRDPVPSASF  1060
             + PL  D  P  SF
Sbjct  234   KAPLCGDHSPHISF  247



>ref|XP_006488345.1| PREDICTED: telomere repeat-binding protein 5-like isoform X3 
[Citrus sinensis]
Length=701

 Score = 54.3 bits (129),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 84/254 (33%), Positives = 128/254 (50%), Gaps = 17/254 (7%)
 Frame = +2

Query  329   MVMKKRLEYGFDGYrfpavpraprssrr--rHTGNVDDKQICAFELLAAVAGKllleses  502
             MV++KRL+YGF+GY+ P  PRA RS+R+        +D Q+CAF+LLA VAGKLLLE + 
Sbjct  1     MVLQKRLDYGFNGYQVPYTPRATRSARKRCSFKKRAEDNQMCAFDLLATVAGKLLLEKQC  60

Query  503   sassnaaeG-KDGPAIQRDVTEELGNFQEGKALKPECLDRGSC----VESAILPKGAIQE  667
             + SS+     +D  A+ +++ E+     E K LK E  D+GSC      S ++ +   Q+
Sbjct  61    TPSSSNTPSDEDQSAVAKEI-EQKAMQDENKQLKVETCDQGSCDRGFFVSDLVSQAHDQK  119

Query  668   QKIKHGNGGssysenscvsesTFTEFSGKVYPGVKLESVKNLDAEGNFNSEVEGRPSNLG  847
               +K  +   + +     S  T ++ S + +   KL + K  +  G   S+VE  PS   
Sbjct  120   CSLKPPSCQQADAHPGFASVITTSDCS-EGFGDQKLVNGKPKNEMGTLASKVEVGPSGYM  178

Query  848   DLRSVNINNATQKQQLADDGMQTGDI---TMAGGCSVKDPikisltttnkntlnnsDCSV  1018
                +  +   T K  + D+  +T  +   T A GCS +DP    L    K    +SD S 
Sbjct  179   GYGNCKVEAETNK-FMKDESHKTAKVQLGTRADGCSFEDP----LVWDGKPPAVSSDSSA  233

Query  1019  QLPLYRDPVPSASF  1060
             + PL  D  P  SF
Sbjct  234   KAPLCGDHSPHISF  247



>ref|XP_006488343.1| PREDICTED: telomere repeat-binding protein 5-like isoform X1 
[Citrus sinensis]
 ref|XP_006488344.1| PREDICTED: telomere repeat-binding protein 5-like isoform X2 
[Citrus sinensis]
Length=706

 Score = 54.3 bits (129),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 85/254 (33%), Positives = 129/254 (51%), Gaps = 17/254 (7%)
 Frame = +2

Query  329   MVMKKRLEYGFDGYrfpavpraprssrr--rHTGNVDDKQICAFELLAAVAGKlllese-  499
             MV++KRL+YGF+GY+ P  PRA RS+R+        +D Q+CAF+LLA VAGKLLLE + 
Sbjct  1     MVLQKRLDYGFNGYQVPYTPRATRSARKRCSFKKRAEDNQMCAFDLLATVAGKLLLEKQC  60

Query  500   ssassnaaeGKDGPAIQRDVTEELGNFQEGKALKPECLDRGSC----VESAILPKGAIQE  667
             + +SSN    +D  A+ +++ E+     E K LK E  D+GSC      S ++ +   Q+
Sbjct  61    TPSSSNTPSDEDQSAVAKEI-EQKAMQDENKQLKVETCDQGSCDRGFFVSDLVSQAHDQK  119

Query  668   QKIKHGNGGssysenscvsesTFTEFSGKVYPGVKLESVKNLDAEGNFNSEVEGRPSNLG  847
               +K  +   + +     S  T ++ S + +   KL + K  +  G   S+VE  PS   
Sbjct  120   CSLKPPSCQQADAHPGFASVITTSDCS-EGFGDQKLVNGKPKNEMGTLASKVEVGPSGYM  178

Query  848   DLRSVNINNATQKQQLADDGMQTGDI---TMAGGCSVKDPikisltttnkntlnnsDCSV  1018
                +  +   T K  + D+  +T  +   T A GCS +DP    L    K    +SD S 
Sbjct  179   GYGNCKVEAETNK-FMKDESHKTAKVQLGTRADGCSFEDP----LVWDGKPPAVSSDSSA  233

Query  1019  QLPLYRDPVPSASF  1060
             + PL  D  P  SF
Sbjct  234   KAPLCGDHSPHISF  247



>ref|XP_006424849.1| hypothetical protein CICLE_v10027927mg [Citrus clementina]
 gb|ESR38089.1| hypothetical protein CICLE_v10027927mg [Citrus clementina]
Length=631

 Score = 53.9 bits (128),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 84/254 (33%), Positives = 128/254 (50%), Gaps = 17/254 (7%)
 Frame = +2

Query  329   MVMKKRLEYGFDGYrfpavpraprssrr--rHTGNVDDKQICAFELLAAVAGKllleses  502
             MV++KRL+YGF+GY+ P  PRA RS+R+        +D Q+CAF+LLA VAGKLLLE + 
Sbjct  1     MVLQKRLDYGFNGYQVPYTPRATRSARKRCSFKKRAEDNQMCAFDLLATVAGKLLLEKQC  60

Query  503   sassnaaeG-KDGPAIQRDVTEELGNFQEGKALKPECLDRGSC----VESAILPKGAIQE  667
             + SS+     +D  A+ +++ E+     E K LK E  D+GSC      S ++ +   Q+
Sbjct  61    TPSSSNTPSDEDQSAVAKEI-EQKAMQDENKQLKVETCDQGSCDRGFFVSDLVSQAHDQK  119

Query  668   QKIKHGNGGssysenscvsesTFTEFSGKVYPGVKLESVKNLDAEGNFNSEVEGRPSNLG  847
               +K  +   + +     S  T ++ S + +   KL + K  +  G   S+VE  PS   
Sbjct  120   CSLKPPSCQQADAHPGFASVITTSDCS-EGFGDQKLVNGKPKNEMGTLASKVEVGPSGYM  178

Query  848   DLRSVNINNATQKQQLADDGMQTGDI---TMAGGCSVKDPikisltttnkntlnnsDCSV  1018
                +  +   T K  + D+  +T  +   T A GCS +DP    L    K    +SD S 
Sbjct  179   GYGNCKVEAETNK-FMKDESHKTAKVQLGTRADGCSFEDP----LVWDGKPPAVSSDSSA  233

Query  1019  QLPLYRDPVPSASF  1060
             + PL  D  P  SF
Sbjct  234   KAPLCGDHSPHISF  247



>gb|KJB78826.1| hypothetical protein B456_013G021300 [Gossypium raimondii]
 gb|KJB78827.1| hypothetical protein B456_013G021300 [Gossypium raimondii]
 gb|KJB78828.1| hypothetical protein B456_013G021300 [Gossypium raimondii]
Length=697

 Score = 54.3 bits (129),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 56/107 (52%), Positives = 71/107 (66%), Gaps = 4/107 (4%)
 Frame = +2

Query  329  MVMKKRLEYGFDGYrfpavpraprssrrrHTGN--VDDKQICAFELLAAVAGKllleses  502
            MV KKRL+YGF+ +    VPRAPRS R+R      V+D +ICAFELLA++AGKLL E ES
Sbjct  1    MVFKKRLDYGFNAFSVSNVPRAPRSIRKRDRTKRVVEDSRICAFELLASLAGKLLEEGES  60

Query  503  sassnaaeGKDGPAIQRDVTEELGNFQEGKALKPECLDRGSCVESAI  643
            SASSNA+ G D  +I +DV  +L    + K LK EC+   SC  S +
Sbjct  61   SASSNASAGHDHVSIGKDV--KLETRYDDKPLKTECVGHVSCDASVV  105



>gb|KJB78829.1| hypothetical protein B456_013G021300 [Gossypium raimondii]
Length=620

 Score = 53.9 bits (128),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 56/107 (52%), Positives = 71/107 (66%), Gaps = 4/107 (4%)
 Frame = +2

Query  329  MVMKKRLEYGFDGYrfpavpraprssrrrHTGN--VDDKQICAFELLAAVAGKllleses  502
            MV KKRL+YGF+ +    VPRAPRS R+R      V+D +ICAFELLA++AGKLL E ES
Sbjct  1    MVFKKRLDYGFNAFSVSNVPRAPRSIRKRDRTKRVVEDSRICAFELLASLAGKLLEEGES  60

Query  503  sassnaaeGKDGPAIQRDVTEELGNFQEGKALKPECLDRGSCVESAI  643
            SASSNA+ G D  +I +DV  +L    + K LK EC+   SC  S +
Sbjct  61   SASSNASAGHDHVSIGKDV--KLETRYDDKPLKTECVGHVSCDASVV  105



>ref|XP_006424852.1| hypothetical protein CICLE_v10027927mg [Citrus clementina]
 ref|XP_006424853.1| hypothetical protein CICLE_v10027927mg [Citrus clementina]
 ref|XP_006488346.1| PREDICTED: telomere repeat-binding protein 5-like isoform X4 
[Citrus sinensis]
 gb|ESR38092.1| hypothetical protein CICLE_v10027927mg [Citrus clementina]
 gb|ESR38093.1| hypothetical protein CICLE_v10027927mg [Citrus clementina]
Length=699

 Score = 53.9 bits (128),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 85/254 (33%), Positives = 129/254 (51%), Gaps = 17/254 (7%)
 Frame = +2

Query  329   MVMKKRLEYGFDGYrfpavpraprssrr--rHTGNVDDKQICAFELLAAVAGKlllese-  499
             MV++KRL+YGF+GY+ P  PRA RS+R+        +D Q+CAF+LLA VAGKLLLE + 
Sbjct  1     MVLQKRLDYGFNGYQVPYTPRATRSARKRCSFKKRAEDNQMCAFDLLATVAGKLLLEKQC  60

Query  500   ssassnaaeGKDGPAIQRDVTEELGNFQEGKALKPECLDRGSC----VESAILPKGAIQE  667
             + +SSN    +D  A+ +++ E+     E K LK E  D+GSC      S ++ +   Q+
Sbjct  61    TPSSSNTPSDEDQSAVAKEI-EQKAMQDENKQLKVETCDQGSCDRGFFVSDLVSQAHDQK  119

Query  668   QKIKHGNGGssysenscvsesTFTEFSGKVYPGVKLESVKNLDAEGNFNSEVEGRPSNLG  847
               +K  +   + +     S  T ++ S + +   KL + K  +  G   S+VE  PS   
Sbjct  120   CSLKPPSCQQADAHPGFASVITTSDCS-EGFGDQKLVNGKPKNEMGTLASKVEVGPSGYM  178

Query  848   DLRSVNINNATQKQQLADDGMQTGDI---TMAGGCSVKDPikisltttnkntlnnsDCSV  1018
                +  +   T K  + D+  +T  +   T A GCS +DP    L    K    +SD S 
Sbjct  179   GYGNCKVEAETNK-FMKDESHKTAKVQLGTRADGCSFEDP----LVWDGKPPAVSSDSSA  233

Query  1019  QLPLYRDPVPSASF  1060
             + PL  D  P  SF
Sbjct  234   KAPLCGDHSPHISF  247



>gb|KDO72832.1| hypothetical protein CISIN_1g042386mg [Citrus sinensis]
Length=699

 Score = 53.9 bits (128),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 85/254 (33%), Positives = 129/254 (51%), Gaps = 17/254 (7%)
 Frame = +2

Query  329   MVMKKRLEYGFDGYrfpavpraprssrr--rHTGNVDDKQICAFELLAAVAGKlllese-  499
             MV++KRL+YGF+GY+ P  PRA RS+R+        +D Q+CAF+LLA VAGKLLLE + 
Sbjct  1     MVLQKRLDYGFNGYQVPYTPRATRSARKRCSFKKRAEDNQMCAFDLLATVAGKLLLEKQC  60

Query  500   ssassnaaeGKDGPAIQRDVTEELGNFQEGKALKPECLDRGSC----VESAILPKGAIQE  667
             + +SSN    +D  A+ +++ E+     E K LK E  D+GSC      S ++ +   Q+
Sbjct  61    TPSSSNTPSDEDQSAVAKEI-EQKAMQDENKQLKVETCDQGSCDRGFFVSDLVSQAHDQK  119

Query  668   QKIKHGNGGssysenscvsesTFTEFSGKVYPGVKLESVKNLDAEGNFNSEVEGRPSNLG  847
               +K  +   + +     S  T ++ S + +   KL + K  +  G   S+VE  PS   
Sbjct  120   CSLKPPSCQQADAHPGFASVITTSDCS-EGFGDQKLVNGKPKNEMGTLASKVEVGPSGYM  178

Query  848   DLRSVNINNATQKQQLADDGMQTGDI---TMAGGCSVKDPikisltttnkntlnnsDCSV  1018
                +  +   T K  + D+  +T  +   T A GCS +DP    L    K    +SD S 
Sbjct  179   GYGNCKVEAETNK-FMKDESHKTAKVQLGTRADGCSFEDP----LVWDGKPPAVSSDSSA  233

Query  1019  QLPLYRDPVPSASF  1060
             + PL  D  P  SF
Sbjct  234   KAPLCGDHSPHISF  247



>ref|XP_006602002.1| PREDICTED: telomere repeat-binding protein 3-like isoform X3 
[Glycine max]
Length=650

 Score = 53.1 bits (126),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 62/120 (52%), Positives = 84/120 (70%), Gaps = 5/120 (4%)
 Frame = +2

Query  329  MVMKKRLEYGFDGYrfpavpraprssrrrHTGN--VDDKQICAFELLAAVAGKllleses  502
            MV+KKR++YGF+G+R P +P+APRS+RRR   N  V+D Q+CA ELLA++AG+LL ESES
Sbjct  1    MVLKKRVDYGFNGFRVPVIPKAPRSARRRVAFNKAVEDGQVCAIELLASLAGQLLQESES  60

Query  503  sassnaaeGKDGPAIQRDVTEELGNFQ-EGKALKPECLDRGSCVESAILPKGAIQEQKIK  679
            SASSNA+EG   PA  + V E+  + Q E K LK E + +G+C ES    + A Q+   K
Sbjct  61   SASSNASEGNHQPAFSQGVIEQ--DIQDEVKPLKMEEIHQGNCAESTFKTEVASQKSSQK  118



>ref|XP_008359724.1| PREDICTED: telomere repeat-binding protein 5-like isoform X5 
[Malus domestica]
Length=360

 Score = 52.4 bits (124),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 53/117 (45%), Positives = 71/117 (61%), Gaps = 3/117 (3%)
 Frame = +2

Query  329  MVMKKRLEYGFDGYrfpavpraprssrrr--HTGNVDDKQICAFELLAAVAGKllleses  502
            MV+++RLEYGF+GYR P VPRA RS+R R      ++  QI AFE LA+VAGKLL ES+ 
Sbjct  1    MVLQRRLEYGFNGYRMPEVPRASRSARGRGPIRSKLEANQIXAFESLASVAGKLLQESKD  60

Query  503  sassnaaeGKDGPAIQRDVTEELGNFQEGKALKPECLDRGSCVESAILPKGAIQEQK  673
               +N + GKD P  + DV  +     +G  LK E  + GSC E   L    +QE++
Sbjct  61   PLPTNDSCGKD-PHFKFDVITKSEQXDKGNLLKEEPCELGSCDEETFLYVHGLQERR  116



>ref|XP_008387775.1| PREDICTED: telomere repeat-binding protein 5-like isoform X2 
[Malus domestica]
Length=648

 Score = 52.4 bits (124),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 53/117 (45%), Positives = 71/117 (61%), Gaps = 3/117 (3%)
 Frame = +2

Query  329  MVMKKRLEYGFDGYrfpavpraprssrrr--HTGNVDDKQICAFELLAAVAGKllleses  502
            MV+++RLEYGF+GYR P VPRA RS+R R      ++  QI AFE LA+VAGKLL ES+ 
Sbjct  1    MVLQRRLEYGFNGYRMPEVPRASRSARGRGPIRSKLEANQIXAFESLASVAGKLLQESKD  60

Query  503  sassnaaeGKDGPAIQRDVTEELGNFQEGKALKPECLDRGSCVESAILPKGAIQEQK  673
               +N + GKD P  + DV  +     +G  LK E  + GSC E   L    +QE++
Sbjct  61   PLPTNDSCGKD-PHFKFDVITKSEQXDKGNLLKEEPCELGSCDEETFLYVHGLQERR  116



>ref|XP_008359723.1| PREDICTED: telomere repeat-binding protein 5-like isoform X4 
[Malus domestica]
Length=369

 Score = 52.0 bits (123),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 53/117 (45%), Positives = 71/117 (61%), Gaps = 3/117 (3%)
 Frame = +2

Query  329  MVMKKRLEYGFDGYrfpavpraprssrrr--HTGNVDDKQICAFELLAAVAGKllleses  502
            MV+++RLEYGF+GYR P VPRA RS+R R      ++  QI AFE LA+VAGKLL ES+ 
Sbjct  1    MVLQRRLEYGFNGYRMPEVPRASRSARGRGPIRSKLEANQIXAFESLASVAGKLLQESKD  60

Query  503  sassnaaeGKDGPAIQRDVTEELGNFQEGKALKPECLDRGSCVESAILPKGAIQEQK  673
               +N + GKD P  + DV  +     +G  LK E  + GSC E   L    +QE++
Sbjct  61   PLPTNDSCGKD-PHFKFDVITKSEQXDKGNLLKEEPCELGSCDEETFLYVHGLQERR  116



>ref|XP_008359725.1| PREDICTED: telomere repeat-binding protein 2-like isoform X6 
[Malus domestica]
Length=358

 Score = 52.0 bits (123),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 53/117 (45%), Positives = 71/117 (61%), Gaps = 3/117 (3%)
 Frame = +2

Query  329  MVMKKRLEYGFDGYrfpavpraprssrrr--HTGNVDDKQICAFELLAAVAGKllleses  502
            MV+++RLEYGF+GYR P VPRA RS+R R      ++  QI AFE LA+VAGKLL ES+ 
Sbjct  1    MVLQRRLEYGFNGYRMPEVPRASRSARGRGPIRSKLEANQIXAFESLASVAGKLLQESKD  60

Query  503  sassnaaeGKDGPAIQRDVTEELGNFQEGKALKPECLDRGSCVESAILPKGAIQEQK  673
               +N + GKD P  + DV  +     +G  LK E  + GSC E   L    +QE++
Sbjct  61   PLPTNDSCGKD-PHFKFDVITKSEQXDKGNLLKEEPCELGSCDEETFLYVHGLQERR  116



>ref|XP_008387772.1| PREDICTED: telomere repeat-binding protein 5-like isoform X1 
[Malus domestica]
 ref|XP_008387773.1| PREDICTED: telomere repeat-binding protein 5-like isoform X1 
[Malus domestica]
 ref|XP_008387774.1| PREDICTED: telomere repeat-binding protein 5-like isoform X1 
[Malus domestica]
Length=649

 Score = 52.4 bits (124),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 53/117 (45%), Positives = 71/117 (61%), Gaps = 3/117 (3%)
 Frame = +2

Query  329  MVMKKRLEYGFDGYrfpavpraprssrrr--HTGNVDDKQICAFELLAAVAGKllleses  502
            MV+++RLEYGF+GYR P VPRA RS+R R      ++  QI AFE LA+VAGKLL ES+ 
Sbjct  1    MVLQRRLEYGFNGYRMPEVPRASRSARGRGPIRSKLEANQIXAFESLASVAGKLLQESKD  60

Query  503  sassnaaeGKDGPAIQRDVTEELGNFQEGKALKPECLDRGSCVESAILPKGAIQEQK  673
               +N + GKD P  + DV  +     +G  LK E  + GSC E   L    +QE++
Sbjct  61   PLPTNDSCGKD-PHFKFDVITKSEQXDKGNLLKEEPCELGSCDEETFLYVHGLQERR  116



>ref|XP_008359721.1| PREDICTED: telomere repeat-binding protein 5-like isoform X2 
[Malus domestica]
Length=389

 Score = 52.0 bits (123),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 53/117 (45%), Positives = 71/117 (61%), Gaps = 3/117 (3%)
 Frame = +2

Query  329  MVMKKRLEYGFDGYrfpavpraprssrrr--HTGNVDDKQICAFELLAAVAGKllleses  502
            MV+++RLEYGF+GYR P VPRA RS+R R      ++  QI AFE LA+VAGKLL ES+ 
Sbjct  1    MVLQRRLEYGFNGYRMPEVPRASRSARGRGPIRSKLEANQIXAFESLASVAGKLLQESKD  60

Query  503  sassnaaeGKDGPAIQRDVTEELGNFQEGKALKPECLDRGSCVESAILPKGAIQEQK  673
               +N + GKD P  + DV  +     +G  LK E  + GSC E   L    +QE++
Sbjct  61   PLPTNDSCGKD-PHFKFDVITKSEQXDKGNLLKEEPCELGSCDEETFLYVHGLQERR  116



>ref|XP_008359718.1| PREDICTED: telomere repeat-binding protein 5-like isoform X1 
[Malus domestica]
 ref|XP_008359719.1| PREDICTED: telomere repeat-binding protein 5-like isoform X1 
[Malus domestica]
 ref|XP_008359720.1| PREDICTED: telomere repeat-binding protein 5-like isoform X1 
[Malus domestica]
Length=390

 Score = 52.0 bits (123),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 53/117 (45%), Positives = 71/117 (61%), Gaps = 3/117 (3%)
 Frame = +2

Query  329  MVMKKRLEYGFDGYrfpavpraprssrrr--HTGNVDDKQICAFELLAAVAGKllleses  502
            MV+++RLEYGF+GYR P VPRA RS+R R      ++  QI AFE LA+VAGKLL ES+ 
Sbjct  1    MVLQRRLEYGFNGYRMPEVPRASRSARGRGPIRSKLEANQIXAFESLASVAGKLLQESKD  60

Query  503  sassnaaeGKDGPAIQRDVTEELGNFQEGKALKPECLDRGSCVESAILPKGAIQEQK  673
               +N + GKD P  + DV  +     +G  LK E  + GSC E   L    +QE++
Sbjct  61   PLPTNDSCGKD-PHFKFDVITKSEQXDKGNLLKEEPCELGSCDEETFLYVHGLQERR  116



>ref|XP_008359722.1| PREDICTED: telomere repeat-binding protein 5-like isoform X3 
[Malus domestica]
Length=372

 Score = 51.6 bits (122),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 53/117 (45%), Positives = 71/117 (61%), Gaps = 3/117 (3%)
 Frame = +2

Query  329  MVMKKRLEYGFDGYrfpavpraprssrrr--HTGNVDDKQICAFELLAAVAGKllleses  502
            MV+++RLEYGF+GYR P VPRA RS+R R      ++  QI AFE LA+VAGKLL ES+ 
Sbjct  1    MVLQRRLEYGFNGYRMPEVPRASRSARGRGPIRSKLEANQIXAFESLASVAGKLLQESKD  60

Query  503  sassnaaeGKDGPAIQRDVTEELGNFQEGKALKPECLDRGSCVESAILPKGAIQEQK  673
               +N + GKD P  + DV  +     +G  LK E  + GSC E   L    +QE++
Sbjct  61   PLPTNDSCGKD-PHFKFDVITKSEQXDKGNLLKEEPCELGSCDEETFLYVHGLQERR  116



>ref|XP_008387777.1| PREDICTED: telomere repeat-binding protein 5-like isoform X4 
[Malus domestica]
Length=617

 Score = 52.0 bits (123),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 53/117 (45%), Positives = 71/117 (61%), Gaps = 3/117 (3%)
 Frame = +2

Query  329  MVMKKRLEYGFDGYrfpavpraprssrrr--HTGNVDDKQICAFELLAAVAGKllleses  502
            MV+++RLEYGF+GYR P VPRA RS+R R      ++  QI AFE LA+VAGKLL ES+ 
Sbjct  1    MVLQRRLEYGFNGYRMPEVPRASRSARGRGPIRSKLEANQIXAFESLASVAGKLLQESKD  60

Query  503  sassnaaeGKDGPAIQRDVTEELGNFQEGKALKPECLDRGSCVESAILPKGAIQEQK  673
               +N + GKD P  + DV  +     +G  LK E  + GSC E   L    +QE++
Sbjct  61   PLPTNDSCGKD-PHFKFDVITKSEQXDKGNLLKEEPCELGSCDEETFLYVHGLQERR  116



>ref|XP_008387776.1| PREDICTED: telomere repeat-binding protein 5-like isoform X3 
[Malus domestica]
Length=631

 Score = 52.0 bits (123),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 53/117 (45%), Positives = 71/117 (61%), Gaps = 3/117 (3%)
 Frame = +2

Query  329  MVMKKRLEYGFDGYrfpavpraprssrrr--HTGNVDDKQICAFELLAAVAGKllleses  502
            MV+++RLEYGF+GYR P VPRA RS+R R      ++  QI AFE LA+VAGKLL ES+ 
Sbjct  1    MVLQRRLEYGFNGYRMPEVPRASRSARGRGPIRSKLEANQIXAFESLASVAGKLLQESKD  60

Query  503  sassnaaeGKDGPAIQRDVTEELGNFQEGKALKPECLDRGSCVESAILPKGAIQEQK  673
               +N + GKD P  + DV  +     +G  LK E  + GSC E   L    +QE++
Sbjct  61   PLPTNDSCGKD-PHFKFDVITKSEQXDKGNLLKEEPCELGSCDEETFLYVHGLQERR  116



>ref|XP_008387778.1| PREDICTED: telomere repeat-binding protein 5-like isoform X5 
[Malus domestica]
Length=604

 Score = 52.0 bits (123),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 53/117 (45%), Positives = 71/117 (61%), Gaps = 3/117 (3%)
 Frame = +2

Query  329  MVMKKRLEYGFDGYrfpavpraprssrrr--HTGNVDDKQICAFELLAAVAGKllleses  502
            MV+++RLEYGF+GYR P VPRA RS+R R      ++  QI AFE LA+VAGKLL ES+ 
Sbjct  1    MVLQRRLEYGFNGYRMPEVPRASRSARGRGPIRSKLEANQIXAFESLASVAGKLLQESKD  60

Query  503  sassnaaeGKDGPAIQRDVTEELGNFQEGKALKPECLDRGSCVESAILPKGAIQEQK  673
               +N + GKD P  + DV  +     +G  LK E  + GSC E   L    +QE++
Sbjct  61   PLPTNDSCGKD-PHFKFDVITKSEQXDKGNLLKEEPCELGSCDEETFLYVHGLQERR  116



>ref|XP_010262528.1| PREDICTED: telomere repeat-binding protein 5 [Nelumbo nucifera]
 ref|XP_010262529.1| PREDICTED: telomere repeat-binding protein 5 [Nelumbo nucifera]
 ref|XP_010262530.1| PREDICTED: telomere repeat-binding protein 5 [Nelumbo nucifera]
 ref|XP_010262531.1| PREDICTED: telomere repeat-binding protein 5 [Nelumbo nucifera]
 ref|XP_010262532.1| PREDICTED: telomere repeat-binding protein 5 [Nelumbo nucifera]
 ref|XP_010262533.1| PREDICTED: telomere repeat-binding protein 5 [Nelumbo nucifera]
 ref|XP_010262534.1| PREDICTED: telomere repeat-binding protein 5 [Nelumbo nucifera]
Length=684

 Score = 52.0 bits (123),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 45/103 (44%), Positives = 59/103 (57%), Gaps = 3/103 (3%)
 Frame = +2

Query  329  MVMKKRLEYGFDGYrfpavpraprssrrrHTGNVDDKQICAFELLAAVAGKlllesess-  505
            MV++KR +YGF+GY  P   R+ R         V+D  +CAFELLA VAGKLL E E+S 
Sbjct  1    MVLQKRFDYGFNGYHVPRASRSARGRGSVKK-KVEDNSMCAFELLATVAGKLLQEKETSP  59

Query  506  assnaaeGKDGPAIQRDVTEELGNFQEGKALKPECLDRGSCVE  634
              + A  G D   I + + +E  +  E K LK E  D+GSC E
Sbjct  60   IHAKALAGNDRTTIVKHIVKE-EHQDEVKILKSEPFDQGSCNE  101



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2788341287920