BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig12974

Length=675
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_004231169.2|  PREDICTED: BON1-associated protein 2               196   6e-59   Solanum lycopersicum
ref|XP_009626441.1|  PREDICTED: BON1-associated protein 2-like          194   2e-58   Nicotiana tomentosiformis
ref|XP_006339452.1|  PREDICTED: BON1-associated protein 2-like          194   4e-58   Solanum tuberosum [potatoes]
ref|XP_009771536.1|  PREDICTED: BON1-associated protein 2-like          189   1e-56   Nicotiana sylvestris
ref|XP_009771537.1|  PREDICTED: BON1-associated protein 2-like          182   1e-53   Nicotiana sylvestris
ref|XP_009596379.1|  PREDICTED: BON1-associated protein 2               177   1e-51   Nicotiana tomentosiformis
ref|XP_007219432.1|  hypothetical protein PRUPE_ppa020590mg             171   2e-49   Prunus persica
ref|XP_008232805.1|  PREDICTED: BON1-associated protein 2-like          167   6e-48   Prunus mume [ume]
ref|XP_007220924.1|  hypothetical protein PRUPE_ppa023067mg             165   3e-47   Prunus persica
ref|NP_001238308.1|  uncharacterized protein LOC100527075               162   5e-46   
ref|XP_008232746.1|  PREDICTED: BON1-associated protein 2-like          162   6e-46   Prunus mume [ume]
ref|XP_009340623.1|  PREDICTED: BON1-associated protein 2-like          159   5e-45   Pyrus x bretschneideri [bai li]
ref|XP_007051905.1|  BON association protein 2, putative                159   7e-45   Theobroma cacao [chocolate]
ref|XP_002511806.1|  conserved hypothetical protein                     158   2e-44   
ref|XP_008354303.1|  PREDICTED: BON1-associated protein 2-like          158   2e-44   
emb|CDP08873.1|  unnamed protein product                                156   1e-43   Coffea canephora [robusta coffee]
ref|XP_009376896.1|  PREDICTED: BON1-associated protein 2-like          156   1e-43   Pyrus x bretschneideri [bai li]
emb|CDP22107.1|  unnamed protein product                                155   2e-43   Coffea canephora [robusta coffee]
ref|XP_002271138.1|  PREDICTED: BON1-associated protein 2               154   1e-42   Vitis vinifera
ref|XP_009340618.1|  PREDICTED: BON1-associated protein 2-like          154   1e-42   Pyrus x bretschneideri [bai li]
ref|XP_009340622.1|  PREDICTED: BON1-associated protein 2-like          154   1e-42   Pyrus x bretschneideri [bai li]
gb|AFD97530.1|  BAP1                                                    153   1e-42   Vitis vinifera
emb|CAN72571.1|  hypothetical protein VITISV_017490                     152   2e-42   Vitis vinifera
ref|XP_010092739.1|  BON1-associated protein 2                          153   2e-42   Morus notabilis
ref|XP_008347165.1|  PREDICTED: BON1-associated protein 2-like          154   3e-42   
ref|XP_012083464.1|  PREDICTED: BON1-associated protein 2-like          151   8e-42   Jatropha curcas
ref|XP_012083463.1|  PREDICTED: BON1-associated protein 2               151   9e-42   Jatropha curcas
ref|XP_008355550.1|  PREDICTED: BON1-associated protein 2-like          150   2e-41   Malus domestica [apple tree]
gb|KJB41243.1|  hypothetical protein B456_007G096400                    150   2e-41   Gossypium raimondii
ref|XP_009340617.1|  PREDICTED: BON1-associated protein 2-like          150   2e-41   Pyrus x bretschneideri [bai li]
ref|XP_010092741.1|  BON1-associated protein 2                          149   5e-41   Morus notabilis
ref|XP_011091753.1|  PREDICTED: BON1-associated protein 2-like          149   5e-41   Sesamum indicum [beniseed]
ref|XP_012092683.1|  PREDICTED: BON1-associated protein 2-like          149   8e-41   
gb|KJB49405.1|  hypothetical protein B456_008G117300                    148   1e-40   Gossypium raimondii
ref|XP_006445133.1|  hypothetical protein CICLE_v10022337mg             147   8e-40   Citrus clementina [clementine]
ref|XP_009340619.1|  PREDICTED: BON1-associated protein 2-like          145   2e-39   Pyrus x bretschneideri [bai li]
ref|XP_002511807.1|  conserved hypothetical protein                     145   4e-39   Ricinus communis
gb|EYU32073.1|  hypothetical protein MIMGU_mgv1a025865mg                141   3e-38   Erythranthe guttata [common monkey flower]
gb|AFK45032.1|  unknown                                                 141   5e-38   Lotus japonicus
gb|EYU32072.1|  hypothetical protein MIMGU_mgv1a014964mg                141   6e-38   Erythranthe guttata [common monkey flower]
ref|XP_003528877.2|  PREDICTED: BON1-associated protein 2-like          140   1e-37   Glycine max [soybeans]
gb|KHN04632.1|  BON1-associated protein 2                               140   1e-37   Glycine soja [wild soybean]
ref|XP_004510853.1|  PREDICTED: BON1-associated protein 2-like          139   3e-37   Cicer arietinum [garbanzo]
ref|NP_001236026.1|  uncharacterized protein LOC100500298               139   5e-37   
ref|XP_008438082.1|  PREDICTED: BON1-associated protein 2-like          138   8e-37   Cucumis melo [Oriental melon]
ref|XP_004134336.1|  PREDICTED: BON1-associated protein 2-like          138   1e-36   Cucumis sativus [cucumbers]
gb|KHN27291.1|  BON1-associated protein 2                               137   1e-36   Glycine soja [wild soybean]
ref|XP_002302565.1|  BON association protein 1                          137   2e-36   Populus trichocarpa [western balsam poplar]
gb|KHN34872.1|  BON1-associated protein 2                               137   2e-36   Glycine soja [wild soybean]
ref|XP_008438086.1|  PREDICTED: BON1-associated protein 2-like          137   2e-36   Cucumis melo [Oriental melon]
ref|XP_010040910.1|  PREDICTED: BON1-associated protein 1-like          135   9e-36   Eucalyptus grandis [rose gum]
ref|XP_011023397.1|  PREDICTED: BON1-associated protein 2-like          135   1e-35   Populus euphratica
ref|XP_002320774.1|  BON association protein 1                          135   1e-35   Populus trichocarpa [western balsam poplar]
ref|NP_001237568.1|  uncharacterized protein LOC100527030               133   7e-35   
ref|XP_007156626.1|  hypothetical protein PHAVU_002G004000g             133   1e-34   Phaseolus vulgaris [French bean]
ref|XP_011016831.1|  PREDICTED: BON1-associated protein 2-like          132   2e-34   Populus euphratica
gb|KDO86040.1|  hypothetical protein CISIN_1g036193mg                   132   2e-34   Citrus sinensis [apfelsine]
ref|XP_006445134.1|  hypothetical protein CICLE_v10022449mg             132   3e-34   Citrus clementina [clementine]
ref|XP_004134335.1|  PREDICTED: BON1-associated protein 2-like          131   3e-34   Cucumis sativus [cucumbers]
ref|XP_010255486.1|  PREDICTED: BON1-associated protein 2               131   4e-34   Nelumbo nucifera [Indian lotus]
ref|XP_008439354.1|  PREDICTED: BON1-associated protein 2-like          130   9e-34   Cucumis melo [Oriental melon]
ref|XP_011035593.1|  PREDICTED: BON1-associated protein 2-like          130   1e-33   Populus euphratica
ref|XP_010055220.1|  PREDICTED: BON1-associated protein 2-like          129   4e-33   Eucalyptus grandis [rose gum]
gb|KHN42635.1|  BON1-associated protein 2                               133   6e-33   Glycine soja [wild soybean]
gb|KEH18937.1|  C2 domain protein                                       127   1e-32   Medicago truncatula
gb|KEH18936.1|  BON1-associated-like protein                            127   1e-32   Medicago truncatula
ref|XP_010693564.1|  PREDICTED: BON1-associated protein 2-like          125   2e-32   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_011469060.1|  PREDICTED: BON1-associated protein 2               125   4e-32   Fragaria vesca subsp. vesca
gb|AFK45660.1|  unknown                                                 126   4e-32   Medicago truncatula
gb|KEH18933.1|  BON1-associated-like protein                            126   4e-32   Medicago truncatula
emb|CDP21768.1|  unnamed protein product                                124   7e-32   Coffea canephora [robusta coffee]
ref|XP_004134334.1|  PREDICTED: BON1-associated protein 2-like          125   8e-32   Cucumis sativus [cucumbers]
ref|XP_010523731.1|  PREDICTED: BON1-associated protein 2-like          125   1e-31   Tarenaya hassleriana [spider flower]
ref|XP_004308401.1|  PREDICTED: BON1-associated protein 1               125   1e-31   Fragaria vesca subsp. vesca
ref|XP_010544695.1|  PREDICTED: BON1-associated protein 2-like is...    125   1e-31   Tarenaya hassleriana [spider flower]
ref|XP_010058155.1|  PREDICTED: BON1-associated protein 1-like          124   2e-31   Eucalyptus grandis [rose gum]
ref|XP_002320329.2|  hypothetical protein POPTR_0014s07460g             124   2e-31   
gb|KCW71682.1|  hypothetical protein EUGRSUZ_E00198                     124   2e-31   Eucalyptus grandis [rose gum]
ref|XP_010058153.1|  PREDICTED: BON1-associated protein 1-like          123   7e-31   
ref|XP_002882032.1|  hypothetical protein ARALYDRAFT_483714             122   1e-30   
ref|XP_010910674.1|  PREDICTED: BON1-associated protein 2-like          122   2e-30   Elaeis guineensis
ref|XP_010544696.1|  PREDICTED: BON1-associated protein 2-like is...    121   6e-30   Tarenaya hassleriana [spider flower]
ref|XP_003528878.1|  PREDICTED: BON1-associated protein 2-like          119   1e-29   Glycine max [soybeans]
ref|XP_010040908.1|  PREDICTED: BON1-associated protein 1-like          119   2e-29   Eucalyptus grandis [rose gum]
ref|XP_009133750.1|  PREDICTED: BON1-associated protein 2-like          119   5e-29   Brassica rapa
gb|AFK45603.1|  unknown                                                 117   5e-29   Lotus japonicus
ref|XP_010040911.1|  PREDICTED: BON1-associated protein 2-like          117   8e-29   Eucalyptus grandis [rose gum]
ref|XP_006295550.1|  hypothetical protein CARUB_v10024657mg             117   1e-28   Capsella rubella
ref|XP_006397758.1|  hypothetical protein EUTSA_v10001640mg             117   1e-28   Eutrema salsugineum [saltwater cress]
ref|XP_010508111.1|  PREDICTED: BON1-associated protein 2-like          117   2e-28   Camelina sativa [gold-of-pleasure]
ref|XP_010058154.1|  PREDICTED: BON1-associated protein 1-like          116   2e-28   Eucalyptus grandis [rose gum]
emb|CDY18902.1|  BnaC04g04480D                                          116   4e-28   Brassica napus [oilseed rape]
ref|XP_009143170.1|  PREDICTED: BON1-associated protein 2-like is...    116   5e-28   Brassica rapa
ref|XP_003551648.2|  PREDICTED: BON1-associated protein 2-like          114   8e-28   Glycine max [soybeans]
ref|XP_010058151.1|  PREDICTED: BON1-associated protein 1-like          115   9e-28   
gb|AAP22496.1|  hypothetical protein At2g45760                          114   2e-27   Arabidopsis thaliana [mouse-ear cress]
ref|NP_182100.2|  BON1-associated protein 2                             114   2e-27   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010508112.1|  PREDICTED: BON1-associated protein 2-like is...    114   3e-27   Camelina sativa [gold-of-pleasure]
ref|XP_003521921.1|  PREDICTED: BON1-associated protein 2-like          113   4e-27   Glycine max [soybeans]
gb|AFK46253.1|  unknown                                                 113   4e-27   Lotus japonicus
emb|CDX74764.1|  BnaA05g05100D                                          113   6e-27   
ref|XP_010518213.1|  PREDICTED: BON1-associated protein 2-like          113   7e-27   Camelina sativa [gold-of-pleasure]
gb|KCW71688.1|  hypothetical protein EUGRSUZ_E00205                     110   2e-26   Eucalyptus grandis [rose gum]
gb|KEH18941.1|  BON1-associated-like protein                            111   2e-26   Medicago truncatula
gb|AFK36493.1|  unknown                                                 110   3e-26   Medicago truncatula
gb|KEH18939.1|  BON1-associated-like protein                            109   9e-26   Medicago truncatula
ref|XP_010055222.1|  PREDICTED: BON1-associated protein 2-like          108   1e-25   
ref|XP_010040909.1|  PREDICTED: BON1-associated protein 2-like          108   2e-25   Eucalyptus grandis [rose gum]
ref|XP_004144363.2|  PREDICTED: BON1-associated protein 2-like          108   2e-25   Cucumis sativus [cucumbers]
ref|XP_010055221.1|  PREDICTED: BON1-associated protein 2-like          108   3e-25   Eucalyptus grandis [rose gum]
ref|XP_010506554.1|  PREDICTED: BON1-associated protein 2-like is...    108   3e-25   Camelina sativa [gold-of-pleasure]
ref|XP_010055219.1|  PREDICTED: BON1-associated protein 2-like          107   7e-25   Eucalyptus grandis [rose gum]
emb|CDY27361.1|  BnaC04g50440D                                          107   8e-25   Brassica napus [oilseed rape]
ref|XP_009143172.1|  PREDICTED: BON1-associated protein 2-like is...    106   2e-24   Brassica rapa
ref|XP_006583339.1|  PREDICTED: BON1-associated protein 1-like          105   2e-24   Glycine max [soybeans]
ref|XP_003521920.1|  PREDICTED: BON1-associated protein 2-like          105   3e-24   Glycine max [soybeans]
ref|XP_010508113.1|  PREDICTED: BON1-associated protein 2-like is...    106   3e-24   Camelina sativa [gold-of-pleasure]
emb|CDX95663.1|  BnaC03g25440D                                          105   3e-24   
ref|XP_003623819.1|  hypothetical protein MTR_7g076000                  105   3e-24   Medicago truncatula
ref|XP_007134958.1|  hypothetical protein PHAVU_010G090000g             105   4e-24   Phaseolus vulgaris [French bean]
gb|KCW71689.1|  hypothetical protein EUGRSUZ_E00206                     107   5e-24   Eucalyptus grandis [rose gum]
ref|XP_007134959.1|  hypothetical protein PHAVU_010G090100g             104   8e-24   Phaseolus vulgaris [French bean]
ref|XP_004510855.1|  PREDICTED: BON1-associated protein 2-like          103   1e-23   Cicer arietinum [garbanzo]
gb|AAC28548.1|  hypothetical protein                                    105   1e-23   Arabidopsis thaliana [mouse-ear cress]
emb|CDY37063.1|  BnaA04g26410D                                          103   2e-23   Brassica napus [oilseed rape]
ref|XP_009142364.1|  PREDICTED: BON1-associated protein 2               103   2e-23   Brassica rapa
ref|XP_002878369.1|  hypothetical protein ARALYDRAFT_486595             102   3e-23   
gb|KEH18942.1|  BON1-associated-like protein                            102   3e-23   Medicago truncatula
ref|XP_007139959.1|  hypothetical protein PHAVU_008G073100g             102   5e-23   Phaseolus vulgaris [French bean]
gb|AES70909.2|  BON1-associated-like protein                            103   7e-23   Medicago truncatula
ref|XP_003521254.1|  PREDICTED: uncharacterized protein LOC100802552    101   1e-22   Glycine max [soybeans]
ref|XP_004510906.1|  PREDICTED: BON1-associated protein 2-like          101   2e-22   Cicer arietinum [garbanzo]
ref|XP_010506555.1|  PREDICTED: BON1-associated protein 2-like is...    101   2e-22   Camelina sativa [gold-of-pleasure]
emb|CDX71760.1|  BnaC08g31140D                                          101   2e-22   
ref|XP_006402510.1|  hypothetical protein EUTSA_v10006244mg             100   3e-22   Eutrema salsugineum [saltwater cress]
ref|XP_006576358.1|  PREDICTED: BON1-associated protein 2-like        99.8    3e-22   Glycine max [soybeans]
ref|XP_003600658.1|  hypothetical protein MTR_3g064780                  103   5e-22   
gb|KEH18945.1|  BON1-associated-like protein                          99.4    6e-22   Medicago truncatula
gb|KFK35317.1|  hypothetical protein AALP_AA5G268700                  99.0    8e-22   Arabis alpina [alpine rockcress]
ref|XP_009116781.1|  PREDICTED: BON1-associated protein 1             99.4    1e-21   Brassica rapa
gb|AAM64568.1|  unknown                                               98.2    2e-21   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001190150.1|  BON association protein 1                        98.2    2e-21   
gb|KHN04629.1|  BON1-associated protein 2                             98.2    2e-21   Glycine soja [wild soybean]
ref|NP_567111.1|  BON association protein 1                           98.2    2e-21   Arabidopsis thaliana [mouse-ear cress]
emb|CDY51153.1|  BnaA09g51880D                                        97.1    4e-21   Brassica napus [oilseed rape]
ref|XP_009415833.1|  PREDICTED: LOW QUALITY PROTEIN: BON1-associa...  95.9    1e-20   
ref|XP_010671765.1|  PREDICTED: BON1-associated protein 1-like        94.4    6e-20   Beta vulgaris subsp. vulgaris [field beet]
emb|CDY42491.1|  BnaC04g21900D                                        92.8    1e-19   Brassica napus [oilseed rape]
gb|KHN27288.1|  BON1-associated protein 2                             92.8    2e-19   Glycine soja [wild soybean]
emb|CDX89102.1|  BnaA04g00840D                                        92.0    3e-19   
gb|ACU19695.1|  unknown                                               92.4    3e-19   Glycine max [soybeans]
ref|XP_009138789.1|  PREDICTED: BON1-associated protein 1-like        92.0    3e-19   Brassica rapa
gb|KEH18944.1|  C2 domain protein                                     89.7    2e-18   Medicago truncatula
ref|XP_003551649.2|  PREDICTED: BON1-associated protein 2-like        88.6    6e-18   Glycine max [soybeans]
gb|KHN24278.1|  BON1-associated protein 1                             88.2    7e-18   Glycine soja [wild soybean]
ref|XP_006396251.1|  hypothetical protein EUTSA_v10029351mg           86.7    1e-17   
ref|XP_010512453.1|  PREDICTED: BON1-associated protein 1-like        85.9    4e-17   Camelina sativa [gold-of-pleasure]
ref|XP_007158774.1|  hypothetical protein PHAVU_002G180900g           85.5    7e-17   Phaseolus vulgaris [French bean]
ref|XP_006292593.1|  hypothetical protein CARUB_v10018832mg           85.9    7e-17   Capsella rubella
ref|XP_007135000.1|  hypothetical protein PHAVU_010G093500g           85.1    9e-17   Phaseolus vulgaris [French bean]
ref|XP_007158773.1|  hypothetical protein PHAVU_002G180800g           85.1    1e-16   Phaseolus vulgaris [French bean]
ref|XP_010424040.1|  PREDICTED: BON1-associated protein 2-like        84.0    1e-16   Camelina sativa [gold-of-pleasure]
ref|XP_002872946.1|  hypothetical protein ARALYDRAFT_912190           84.3    1e-16   
gb|KHN04631.1|  BON1-associated protein 1                             83.2    1e-16   Glycine soja [wild soybean]
ref|XP_006289418.1|  hypothetical protein CARUB_v10002917mg           84.0    2e-16   Capsella rubella
gb|KHN04630.1|  hypothetical protein glysoja_021929                   84.0    2e-16   Glycine soja [wild soybean]
ref|XP_009128620.1|  PREDICTED: BON1-associated protein 2-like        83.6    4e-16   Brassica rapa
ref|XP_006576357.1|  PREDICTED: BON1-associated protein 1-like        83.2    4e-16   Glycine max [soybeans]
ref|XP_010469043.1|  PREDICTED: BON1-associated protein 1-like        83.6    5e-16   Camelina sativa [gold-of-pleasure]
emb|CDY01978.1|  BnaC02g27490D                                        82.8    6e-16   
ref|XP_007134957.1|  hypothetical protein PHAVU_010G089900g           80.5    4e-15   Phaseolus vulgaris [French bean]
ref|XP_007134999.1|  hypothetical protein PHAVU_010G093400g           80.1    5e-15   Phaseolus vulgaris [French bean]
ref|XP_006282258.1|  hypothetical protein CARUB_v10028535mg           76.6    5e-14   
ref|XP_007209531.1|  hypothetical protein PRUPE_ppa010653mg           77.4    8e-14   
gb|KGN54699.1|  hypothetical protein Csa_4G429320                     73.6    3e-13   Cucumis sativus [cucumbers]
emb|CAN82266.1|  hypothetical protein VITISV_009284                   72.8    4e-12   Vitis vinifera
ref|XP_003631424.1|  PREDICTED: BON1-associated protein 2-like        72.4    4e-12   Vitis vinifera
emb|CDP09792.1|  unnamed protein product                              71.2    9e-12   Coffea canephora [robusta coffee]
gb|KHN27290.1|  BON1-associated protein 2                             70.5    1e-11   Glycine soja [wild soybean]
ref|XP_002509742.1|  conserved hypothetical protein                   70.5    2e-11   
gb|KHN04628.1|  hypothetical protein glysoja_021927                   69.3    2e-11   Glycine soja [wild soybean]
ref|XP_008355606.1|  PREDICTED: BON1-associated protein 1-like        66.2    4e-10   
ref|XP_006440566.1|  hypothetical protein CICLE_v10022388mg           65.1    1e-09   
ref|XP_011029373.1|  PREDICTED: BON1-associated protein 2-like        64.7    1e-09   Populus euphratica
ref|XP_002462702.1|  hypothetical protein SORBIDRAFT_02g030480        64.3    2e-09   
ref|XP_009770722.1|  PREDICTED: BON1-associated protein 2-like        63.9    2e-09   Nicotiana sylvestris
gb|KJB47079.1|  hypothetical protein B456_008G010000                  65.5    2e-09   Gossypium raimondii
ref|XP_010278593.1|  PREDICTED: BON1-associated protein 2             64.7    3e-09   Nelumbo nucifera [Indian lotus]
ref|XP_002512696.1|  conserved hypothetical protein                   63.9    4e-09   
ref|XP_009369028.1|  PREDICTED: uncharacterized protein LOC103958488  63.5    5e-09   
ref|XP_010112552.1|  hypothetical protein L484_010557                 62.8    7e-09   
ref|XP_012088683.1|  PREDICTED: uncharacterized protein LOC105647276  62.0    2e-08   Jatropha curcas
gb|KDP23239.1|  hypothetical protein JCGZ_23072                       62.0    3e-08   Jatropha curcas
tpg|DAA62422.1|  TPA: BAP2                                            60.5    4e-08   
gb|KJB20714.1|  hypothetical protein B456_003G160700                  59.7    7e-08   Gossypium raimondii
ref|NP_001175951.1|  Os09g0526500                                     59.7    8e-08   
ref|XP_012087217.1|  PREDICTED: BON1-associated protein 2-like        58.9    1e-07   
ref|XP_010090794.1|  16 kDa phloem protein 2                          60.1    2e-07   Morus notabilis
gb|ABG73463.1|  unknown protein                                       57.8    3e-07   Oryza brachyantha
ref|XP_002298055.1|  hypothetical protein POPTR_0001s08960g           57.8    4e-07   
ref|XP_002297893.1|  hypothetical protein POPTR_0001s12710g           58.9    7e-07   Populus trichocarpa [western balsam poplar]
ref|XP_002272904.1|  PREDICTED: cytokinesis protein sepA-like         57.0    2e-06   Vitis vinifera
gb|KJB46046.1|  hypothetical protein B456_007G345600                  56.6    3e-06   Gossypium raimondii
ref|XP_002304627.1|  hypothetical protein POPTR_0003s15870g           55.8    6e-06   Populus trichocarpa [western balsam poplar]
ref|XP_011020919.1|  PREDICTED: uncharacterized protein LOC105123120  55.8    7e-06   Populus euphratica
gb|EAY99500.1|  hypothetical protein OsI_21469                        55.1    7e-06   Oryza sativa Indica Group [Indian rice]
emb|CDP19532.1|  unnamed protein product                              55.1    1e-05   Coffea canephora [robusta coffee]
ref|XP_009588589.1|  PREDICTED: pollen-specific leucine-rich repe...  55.1    1e-05   Nicotiana tomentosiformis
gb|KJB75514.1|  hypothetical protein B456_012G044800                  54.7    1e-05   Gossypium raimondii
ref|XP_007035560.1|  Soybean gene regulated by cold-2, putative       54.7    1e-05   
gb|ABU98655.1|  SRC2 protein                                          54.7    2e-05   Taiwania cryptomerioides
ref|XP_011004332.1|  PREDICTED: uncharacterized protein LOC105110855  54.3    3e-05   Populus euphratica
gb|EPS59428.1|  hypothetical protein M569_15381                       53.9    3e-05   Genlisea aurea
dbj|BAK04679.1|  predicted protein                                    53.9    3e-05   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002268514.1|  PREDICTED: uncharacterized protein LOC100245456  53.5    3e-05   Vitis vinifera
emb|CDM86357.1|  unnamed protein product                              51.6    5e-05   Triticum aestivum [Canadian hard winter wheat]
ref|XP_009387361.1|  PREDICTED: uncharacterized protein LOC103974297  53.1    5e-05   Musa acuminata subsp. malaccensis [pisang utan]
emb|CBI29284.3|  unnamed protein product                              53.1    6e-05   Vitis vinifera
ref|XP_010269468.1|  PREDICTED: abl interactor homolog                52.8    6e-05   Nelumbo nucifera [Indian lotus]
ref|XP_011087410.1|  PREDICTED: uncharacterized protein LOC105168911  52.8    7e-05   
gb|EYU29829.1|  hypothetical protein MIMGU_mgv1a021847mg              51.2    8e-05   Erythranthe guttata [common monkey flower]
ref|XP_009359909.1|  PREDICTED: uncharacterized protein LOC103950433  52.4    9e-05   Pyrus x bretschneideri [bai li]
ref|XP_010249359.1|  PREDICTED: uncharacterized protein LOC104591911  52.4    1e-04   Nelumbo nucifera [Indian lotus]
gb|EYU20982.1|  hypothetical protein MIMGU_mgv1a011603mg              52.0    1e-04   Erythranthe guttata [common monkey flower]
ref|XP_009383915.1|  PREDICTED: BON1-associated protein 2-like        52.0    1e-04   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010259736.1|  PREDICTED: uncharacterized protein LOC104599071  51.6    1e-04   Nelumbo nucifera [Indian lotus]
ref|XP_008369595.1|  PREDICTED: uncharacterized protein LOC103433141  52.0    1e-04   Malus domestica [apple tree]
ref|XP_002965668.1|  hypothetical protein SELMODRAFT_407234           52.0    1e-04   
ref|XP_010682216.1|  PREDICTED: optomotor-blind protein-like          52.0    2e-04   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002315561.1|  shock protein SRC2                               51.6    2e-04   Populus trichocarpa [western balsam poplar]
ref|XP_007218347.1|  hypothetical protein PRUPE_ppa008681mg           51.6    2e-04   
ref|XP_007050005.1|  Calcium-dependent lipid-binding family prote...  51.6    2e-04   Theobroma cacao [chocolate]
ref|XP_002970540.1|  hypothetical protein SELMODRAFT_441151           51.2    2e-04   Selaginella moellendorffii
ref|XP_010054786.1|  PREDICTED: uncharacterized protein LOC104443136  50.4    2e-04   
ref|XP_011044520.1|  PREDICTED: actin cytoskeleton-regulatory com...  50.8    3e-04   Populus euphratica
ref|XP_002978619.1|  hypothetical protein SELMODRAFT_443918           50.8    4e-04   
ref|XP_011012859.1|  PREDICTED: formin-like protein 18                50.4    4e-04   Populus euphratica
ref|XP_006844679.2|  PREDICTED: splicing factor 3B subunit 4          50.4    4e-04   Amborella trichopoda
ref|XP_003576757.1|  PREDICTED: BON1-associated protein 2-like        50.1    5e-04   Brachypodium distachyon [annual false brome]
ref|XP_010684409.1|  PREDICTED: splicing factor 3B subunit 4-like     50.4    5e-04   Beta vulgaris subsp. vulgaris [field beet]
emb|CDY31113.1|  BnaA08g26630D                                        50.1    5e-04   Brassica napus [oilseed rape]
ref|XP_009110855.1|  PREDICTED: small nuclear ribonucleoprotein-a...  50.1    5e-04   Brassica rapa
ref|XP_006446875.1|  hypothetical protein CICLE_v10017662mg           50.1    6e-04   
ref|XP_002971671.1|  hypothetical protein SELMODRAFT_412188           50.1    6e-04   
ref|XP_009353538.1|  PREDICTED: uncharacterized protein LOC103944799  50.4    6e-04   
gb|ERN06354.1|  hypothetical protein AMTR_s00016p00243850             50.1    6e-04   Amborella trichopoda
ref|XP_009409984.1|  PREDICTED: wiskott-Aldrich syndrome protein ...  50.1    7e-04   Musa acuminata subsp. malaccensis [pisang utan]
emb|CAN74734.1|  hypothetical protein VITISV_044234                   49.7    7e-04   Vitis vinifera
ref|XP_010660769.1|  PREDICTED: uncharacterized protein LOC100244618  50.1    8e-04   Vitis vinifera
gb|EMT21195.1|  hypothetical protein F775_15531                       49.3    9e-04   
ref|XP_010103360.1|  hypothetical protein L484_002544                 49.3    9e-04   
ref|XP_009401591.1|  PREDICTED: uncharacterized protein LOC103985575  49.3    9e-04   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006646653.1|  PREDICTED: C2 domain-containing protein At1g...  49.3    9e-04   



>ref|XP_004231169.2| PREDICTED: BON1-associated protein 2 [Solanum lycopersicum]
Length=190

 Score =   196 bits (497),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 96/176 (55%), Positives = 128/176 (73%), Gaps = 8/176 (5%)
 Frame = +1

Query  88   METSSRDLEITVISGEGL-----RVGKKNVFVTVKSE-FSCNVKATGVDKGGGSFPAWNE  249
            + +SSR LEITV+SGE L     R  KKN FV +K+E +SCN++ T +DK GG FP WNE
Sbjct  4    LSSSSRLLEITVMSGENLLDNRNRPVKKNAFVNIKTESYSCNLQTTKLDKEGGGFPKWNE  63

Query  250  KLVVDLPMHARYLTLQVQCKTFSGVKVVGEAKVPAKDFVGGFVPESYVRFLSYRLKDRKG  429
            KL+VDLPMHAR+LT++VQCK  SG+K VG AKVP  DF+GG +PE Y+ FLSYRL++ KG
Sbjct  64   KLIVDLPMHARHLTVEVQCKNSSGIKTVGIAKVPTSDFIGGILPEDYLHFLSYRLRNEKG  123

Query  430  EKNGIINISVRVKNSAAENAAVASCSSQYSRRpwtglppptgnptnAAVVTGIPVW  597
            EKNGIIN SVRVKN+AA + + A C++ Y++     +   +    +  +VTG+PV+
Sbjct  124  EKNGIINFSVRVKNAAAPSQSAAGCAAAYTK--AAPVDMGSSYNGSCGIVTGLPVY  177



>ref|XP_009626441.1| PREDICTED: BON1-associated protein 2-like [Nicotiana tomentosiformis]
Length=177

 Score =   194 bits (492),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 101/177 (57%), Positives = 130/177 (73%), Gaps = 8/177 (5%)
 Frame = +1

Query  88   METSSRDLEITVISGEGLRVG-----KKNVFVTVKSEFSCNVKATGVDKGGGSFPAWNEK  252
            M+  SR LEITVISGE LR       KKNVFV +K+E S N++ T +DK GGSFP WNEK
Sbjct  1    MKPLSRALEITVISGENLRESRTQWVKKNVFVNIKTESSSNIQTTRMDKEGGSFPVWNEK  60

Query  253  LVVDLPMHARYLTLQVQCKTFSGVKVVGEAKVPAKDFVGGFVPESYVRFLSYRLKDRKGE  432
            L+VD+PMHARYLT++VQCKT SG+K +G A+VP  DF+GG++PE+Y+  LSYRL+D KGE
Sbjct  61   LIVDMPMHARYLTVEVQCKTSSGIKTIGIARVPTSDFIGGYLPENYLHLLSYRLRDEKGE  120

Query  433  KNGIINISVRVKNSAAENAAVASCSSQYSRRpwtglppptgnptnAAVVTGIPVWCS  603
            KNGIIN SV+VKN   +  +   C++ YS++ WT  P   G+  +  VVTGIPV+ S
Sbjct  121  KNGIINFSVKVKN--VQPYSSTGCATAYSQQ-WTAAPVAMGSNASGGVVTGIPVYPS  174



>ref|XP_006339452.1| PREDICTED: BON1-associated protein 2-like [Solanum tuberosum]
Length=193

 Score =   194 bits (492),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 96/177 (54%), Positives = 127/177 (72%), Gaps = 7/177 (4%)
 Frame = +1

Query  88   METSSRDLEITVISGEGL-----RVGKKNVFVTVKSE-FSCNVKATGVDKGGGSFPAWNE  249
            + +SSR LE+TVISGE L     +  KKN FV +KSE +SCN++ T +DK GG FP WNE
Sbjct  4    LSSSSRLLEVTVISGENLLDNRKQPVKKNAFVNIKSESYSCNLQTTKMDKEGGGFPKWNE  63

Query  250  KLVVDLPMHARYLTLQVQCKTFSGVKVVGEAKVPAKDFVGGFVPESYVRFLSYRLKDRKG  429
            KL+VDLPMHAR+LT++VQCK  SG+K VG AKVP  DF+GG +PE Y+ FLSYRL++ KG
Sbjct  64   KLIVDLPMHARHLTVEVQCKNSSGIKTVGIAKVPTSDFIGGILPEDYLHFLSYRLRNEKG  123

Query  430  EKNGIINISVRVKNSAAENAAVASCSSQYSRR-pwtglppptgnptnAAVVTGIPVW  597
            EKNGIIN SVRVKN+A  + + A C++ Y+++     +        +  VVTG+PV+
Sbjct  124  EKNGIINFSVRVKNAAPPSQSAAGCAAAYTQQWTAAPIDMGISYNGSCGVVTGVPVY  180



>ref|XP_009771536.1| PREDICTED: BON1-associated protein 2-like [Nicotiana sylvestris]
Length=178

 Score =   189 bits (480),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 96/171 (56%), Positives = 125/171 (73%), Gaps = 9/171 (5%)
 Frame = +1

Query  100  SRDLEITVISGEGLRVG-----KKNVFVTVKSEFSCNVKATGVDKGGGSFPAWNEKLVVD  264
            SR LEITVISGE LR       KKN FV +K++ S N++ T +DK GG+FP WNEKL+V+
Sbjct  8    SRALEITVISGENLRQNRTQWVKKNAFVNIKTDSSSNIQTTRMDKEGGNFPMWNEKLIVN  67

Query  265  LPMHARYLTLQVQCKTFSGVKVVGEAKVPAKDFVGGFVPESYVRFLSYRLKDRKGEKNGI  444
            +PMHARYLT++VQCKT SG+K +G A+VP  DF+GGF+PE Y+  LSYRL+D KGEKNGI
Sbjct  68   MPMHARYLTVEVQCKTSSGIKTIGIARVPTSDFIGGFLPEDYLHLLSYRLRDEKGEKNGI  127

Query  445  INISVRVKNSAAENAAVASCSSQYSRRpwtglppptgnptnAAVVTGIPVW  597
            IN SV+VKN+    +  A C++ YS++ W   P   G+  +  VVTGIPV+
Sbjct  128  INFSVKVKNA---QSYTAGCATAYSQQ-WMATPVAMGSNASGGVVTGIPVY  174



>ref|XP_009771537.1| PREDICTED: BON1-associated protein 2-like [Nicotiana sylvestris]
Length=177

 Score =   182 bits (461),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 99/175 (57%), Positives = 125/175 (71%), Gaps = 10/175 (6%)
 Frame = +1

Query  97   SSRDLEITVISGEGLRVGKK-----NVFVTVKSEFSCNVKATGVDKGGGSFPAWNEKLVV  261
            +SR LEITVISGE LR  KK     N FV +++  S NV+ T +DK GGS+P WNEKL+V
Sbjct  8    TSRVLEITVISGENLRESKKQWVKKNAFVNIRTTDS-NVQTTKMDKDGGSYPVWNEKLIV  66

Query  262  DLPMHARYLTLQVQCKTFSGVKVVGEAKVPAKDFVGGFVPESYVRFLSYRLKDRKGEKNG  441
            DLPMHA  LT++VQCKT  G+K +G A+VP  DF+GGF+PE Y+ FLSYRL+D KGEKNG
Sbjct  67   DLPMHAINLTVEVQCKTSYGIKPIGIARVPTSDFIGGFLPEDYLHFLSYRLRDEKGEKNG  126

Query  442  IINISVRVKNSAAENAAVASCSSQYSRRpwtglppptgnptnAAVVTGIPVWCSY  606
            IIN SV+VKN+  +      C+S YS++ WT  P    + T+  VVTGIPV+ SY
Sbjct  127  IINFSVKVKNAPPQTTG---CASAYSQQ-WTVAPAAMRSNTSGVVVTGIPVYPSY  177



>ref|XP_009596379.1| PREDICTED: BON1-associated protein 2 [Nicotiana tomentosiformis]
Length=177

 Score =   177 bits (448),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 97/175 (55%), Positives = 121/175 (69%), Gaps = 10/175 (6%)
 Frame = +1

Query  97   SSRDLEITVISGEGLRVG-----KKNVFVTVKSEFSCNVKATGVDKGGGSFPAWNEKLVV  261
            +SR LEITVISGE LR       KKN FV +++  SCN K T +DK GGS+P WNEKL+V
Sbjct  8    ASRVLEITVISGENLRESRKQWVKKNAFVNIRTTDSCN-KTTKMDKDGGSYPVWNEKLIV  66

Query  262  DLPMHARYLTLQVQCKTFSGVKVVGEAKVPAKDFVGGFVPESYVRFLSYRLKDRKGEKNG  441
            DLPMHA  LT++VQCKT  G+K +G A+V   DF+GGF+PE Y+ FLSYRL+D KGEKNG
Sbjct  67   DLPMHAINLTVEVQCKTSYGIKTIGIARVLTSDFIGGFLPEDYLHFLSYRLRDEKGEKNG  126

Query  442  IINISVRVKNSAAENAAVASCSSQYSRRpwtglppptgnptnAAVVTGIPVWCSY  606
            IIN SV+VKN+         C+S YS++ WT  P    +  +  VVTGIP + SY
Sbjct  127  IINFSVKVKNAPPHTTG---CASAYSQQ-WTAAPVAVRSKGSCEVVTGIPFYPSY  177



>ref|XP_007219432.1| hypothetical protein PRUPE_ppa020590mg [Prunus persica]
 gb|EMJ20631.1| hypothetical protein PRUPE_ppa020590mg [Prunus persica]
Length=176

 Score =   171 bits (433),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 92/175 (53%), Positives = 114/175 (65%), Gaps = 10/175 (6%)
 Frame = +1

Query  88   METSSRDLEITVISGEGLRVG----KKNVFVTVKSEFSCNVKATGVDKGGGSFPAWNEKL  255
            M  +SR LEITVIS E L++     KKN   TV++E       T  D  GG++P WNEKL
Sbjct  1    MAATSRKLEITVISAENLQLDRKPIKKNASATVRAENDSQFLTTDTDTEGGAYPKWNEKL  60

Query  256  VVDLPMHARYLTLQVQCKTFSGVKVVGEAKVPAKDFVGGFVPESYVRFLSYRLKDRKGEK  435
            V+DLPM AR LT++VQCKT  G++ +G AK+P  DFVGGFVPE Y+ FLSYRL+DR+GE+
Sbjct  61   VLDLPMQARSLTVEVQCKTSYGLRTIGTAKIPVSDFVGGFVPEGYLHFLSYRLRDRRGER  120

Query  436  NGIINISVRVKNSAAENAAVASCSSQYSRRpwtglppptgnptnAAVVTGIPVWC  600
            NGI+NISVR+K    E  A A+ SS  S     G P    +     V TGIPVWC
Sbjct  121  NGIVNISVRMK--VPELKACATTSSHSS----VGFPVGDSSFGVGGVATGIPVWC  169



>ref|XP_008232805.1| PREDICTED: BON1-associated protein 2-like [Prunus mume]
Length=176

 Score =   167 bits (423),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 89/179 (50%), Positives = 118/179 (66%), Gaps = 11/179 (6%)
 Frame = +1

Query  88   METSSRDLEITVISGEGLRVG----KKNVFVTVKSEFSCNVKATGVDKGGGSFPAWNEKL  255
            M T+SR LEI VIS E L++     KKN F TV++E     + T +D  GG++P WNEKL
Sbjct  1    MATTSRKLEIRVISAENLQLDRKPIKKNAFATVRAEKDSQFRTTDMDTEGGAYPKWNEKL  60

Query  256  VVDLPMHARYLTLQVQCKTFSGVKVVGEAKVPAKDFVGGFVPESYVRFLSYRLKDRKGEK  435
            V+DLP HAR  T+++QCKT  GV+ +G AK+P  DF+GGFVPE Y+ FLSYRL+D +GE+
Sbjct  61   VLDLPFHARSFTVEIQCKTSYGVRKIGTAKIPVSDFMGGFVPEGYLHFLSYRLRDNRGER  120

Query  436  NGIINISVRVKNSAAENAAVASCSSQYSRRpwtglppptgnptnAAVVTGIPVWC-SYQ  609
            NGI+NISVR++    E  A A+ SS  S     G P    +    +V TG+PVW  +YQ
Sbjct  121  NGIVNISVRMQ--VPELKACAATSSHSS----MGFPVGDSSFGGGSVATGVPVWYGAYQ  173



>ref|XP_007220924.1| hypothetical protein PRUPE_ppa023067mg [Prunus persica]
 gb|EMJ22123.1| hypothetical protein PRUPE_ppa023067mg [Prunus persica]
Length=176

 Score =   165 bits (418),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 89/179 (50%), Positives = 117/179 (65%), Gaps = 11/179 (6%)
 Frame = +1

Query  88   METSSRDLEITVISGEGLRVG----KKNVFVTVKSEFSCNVKATGVDKGGGSFPAWNEKL  255
            M T+SR LEI VIS E L++     KKN   TV++E     + T +D  GG++P WNEKL
Sbjct  1    MATTSRKLEIRVISAENLQLDRKPIKKNASATVRAEKDSQFRTTYMDTEGGAYPKWNEKL  60

Query  256  VVDLPMHARYLTLQVQCKTFSGVKVVGEAKVPAKDFVGGFVPESYVRFLSYRLKDRKGEK  435
            V+DLP+HAR  T+++QCKT  GV+ +G AK+P  DFVGGFVPE Y+ FLSYRL+D +GE+
Sbjct  61   VLDLPLHARSFTVEIQCKTSYGVRTIGTAKIPVSDFVGGFVPEGYLHFLSYRLRDNRGER  120

Query  436  NGIINISVRVKNSAAENAAVASCSSQYSRRpwtglppptgnptnAAVVTGIPVWC-SYQ  609
            NGI+NISVR++    E  A A+ SS  S     G P    +     V TG+PVW  +YQ
Sbjct  121  NGIVNISVRMQ--VPELKACATTSSHSS----MGFPVGDSSFGGGGVATGVPVWYGAYQ  173



>ref|NP_001238308.1| uncharacterized protein LOC100527075 [Glycine max]
 gb|ACU16116.1| unknown [Glycine max]
Length=179

 Score =   162 bits (410),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 85/176 (48%), Positives = 117/176 (66%), Gaps = 6/176 (3%)
 Frame = +1

Query  100  SRDLEITVISGEGLRVGKK----NVFVTVKSEFSCNVKATGVDKGGGSFPAWNEKLVVDL  267
            SR +EITV+S E L++ KK    N FVTV+S+ S +  AT VD  GGS+P+WNEKLV+D+
Sbjct  2    SRTVEITVLSAENLQMNKKPIRGNAFVTVQSDASNDTSATTVDSEGGSYPSWNEKLVMDV  61

Query  268  PMHARYLTLQVQCKTFS-GVKVVGEAKVPAKDFVGGFVPESYVRFLSYRLKDRKGEKNGI  444
            P+HAR++T++V+CKT S G   +G A++P  DFVGG+VPE+ + FLSYRL D K  +NG+
Sbjct  62   PLHARFITVEVKCKTSSAGSNSIGVARIPVSDFVGGYVPENQLHFLSYRLWDGKVRRNGV  121

Query  445  INISVRVKNSAAENAAVASCSSQYSRRpwtglppptgnptnAAVVTGIP-VWCSYQ  609
            +NISVRVK +  +     SC+S            P     +  VVTGIP +W +YQ
Sbjct  122  VNISVRVKVAQQQQQQQHSCNSNSMSLSSAVTGVPVAGNGSTGVVTGIPAIWLNYQ  177



>ref|XP_008232746.1| PREDICTED: BON1-associated protein 2-like [Prunus mume]
Length=176

 Score =   162 bits (409),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 87/175 (50%), Positives = 114/175 (65%), Gaps = 10/175 (6%)
 Frame = +1

Query  88   METSSRDLEITVISGEGLRVG----KKNVFVTVKSEFSCNVKATGVDKGGGSFPAWNEKL  255
            M  +SR LEITVIS E L++     KKN   TV+++     + T +D  GG++P WNEKL
Sbjct  1    MAATSRKLEITVISAENLQLDRKPIKKNASATVRAQNESQFRTTDMDTEGGAYPKWNEKL  60

Query  256  VVDLPMHARYLTLQVQCKTFSGVKVVGEAKVPAKDFVGGFVPESYVRFLSYRLKDRKGEK  435
            V+DLPM AR LT++VQCKT  GV+ +G AK+P  DF+G +VPE Y+ FLSYRL+DR+GE+
Sbjct  61   VLDLPMQARSLTVEVQCKTSYGVRTIGTAKIPVSDFMGDYVPEGYLHFLSYRLRDRRGER  120

Query  436  NGIINISVRVKNSAAENAAVASCSSQYSRRpwtglppptgnptnAAVVTGIPVWC  600
            NGI+NISVR+K    E  A A+  S  S     G P    +   + V TGIPV C
Sbjct  121  NGIVNISVRMK--VPELKACATTLSHSS----MGFPVGDSSFGGSGVATGIPVRC  169



>ref|XP_009340623.1| PREDICTED: BON1-associated protein 2-like [Pyrus x bretschneideri]
Length=178

 Score =   159 bits (403),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 83/174 (48%), Positives = 114/174 (66%), Gaps = 8/174 (5%)
 Frame = +1

Query  88   METSSRDLEITVISGEGLRVG----KKNVFVTVKSEFSCNVKATGVDKGGGSFPAWNEKL  255
            M  +SR LEI VIS E L++     KKN  VTV+++ +   + T +D  GG++P WNE L
Sbjct  1    MAANSRTLEIKVISAENLQLDRKPIKKNASVTVRTDTNGQFRTTEMDTEGGAYPRWNETL  60

Query  256  VVDLPMHARYLTLQVQCKTFSGVKVVGEAKVPAKDFVGGFVPESYVRFLSYRLKDRKGEK  435
            V+DLP H++ +T++VQCKT S V+ +G A +PA DFVGG+VPE Y+ FLSYRL+D KGE+
Sbjct  61   VLDLPTHSKSITVEVQCKTSSSVRTIGTATIPASDFVGGYVPEGYLHFLSYRLRDHKGER  120

Query  436  NGIINISVRVKNSAAENAAVASCSSQYSRRpwtglppptgnptnAAVVTGIPVW  597
            NGIINISV +K   A+     + S+ +S     G P        + VVTG+PVW
Sbjct  121  NGIINISVSMK---AQKMYAYASSTTWS-HSTMGFPATGNKSFGSGVVTGVPVW  170



>ref|XP_007051905.1| BON association protein 2, putative [Theobroma cacao]
 gb|EOX96062.1| BON association protein 2, putative [Theobroma cacao]
Length=173

 Score =   159 bits (402),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 90/178 (51%), Positives = 118/178 (66%), Gaps = 17/178 (10%)
 Frame = +1

Query  88   METSSRDLEITVISGEGLRVG----KKNVFVTVKSE-FSCNVKATGVDKGGGSFPAWNEK  252
            ME+ SR LEIT++SGE LR+     KKN FV V  + F+C  K T +D  GGS P+WN+K
Sbjct  1    MESKSRTLEITILSGEDLRIDNKSVKKNAFVDVSIDPFNC--KTTKMDGEGGSNPSWNDK  58

Query  253  LVVDLPMHARYLTLQVQCKTFSGVKVVGEAKVPAKDFVGGFVPESYVRFLSYRLKDRKGE  432
            LV+D+PM  R++TL V+CK  SG K VG A++P  DF+GG+ PE+ ++FLSYRL+D KG 
Sbjct  59   LVMDMPMQTRFITLAVKCKASSGEKTVGLARIPVTDFIGGYSPETCLQFLSYRLRDPKGL  118

Query  433  KNGIINISVRVKNSAAENAAVASCSSQYSRRpwtglppptgnptnAAVVTGIPVWCSY  606
            KNGIIN+SVRVK        + +CSSQ +     GL  P     +  VVTGIP+W  Y
Sbjct  119  KNGIINVSVRVKE------PLHACSSQAA----AGLGIPIDGRNDFGVVTGIPIWSGY  166



>ref|XP_002511806.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF50475.1| conserved hypothetical protein [Ricinus communis]
Length=179

 Score =   158 bits (399),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 79/182 (43%), Positives = 118/182 (65%), Gaps = 20/182 (11%)
 Frame = +1

Query  88   METSSRDLEITVISGEGLRVG----KKNVFVTVKSEFSCNVKATGVDKGGGSFPAWNEKL  255
            M+++SR LEIT+ S E LR+     K N +V V+++   N  AT +D  GGS+P+WNEKL
Sbjct  1    MQSTSRTLEITIFSCEDLRIDRRSVKNNTYVVVRTDH-LNSTATKIDTQGGSYPSWNEKL  59

Query  256  VVDLPMHARYLTLQVQCKTFSGVKVVGEAKVPAKDFVGGFVPESYVRFLSYRLKDRKGEK  435
            +VD+P+H R++TL+ +CKT S  +++  A++P  DF+GG++P++Y+  LSYRL+D +GE+
Sbjct  60   IVDMPLHERFITLEARCKTASADRIIASARMPVTDFMGGYLPDNYLNILSYRLRDTRGER  119

Query  436  NGIINISVRVKNSAAENAAVA--------SCSSQYSRRpwtglppptgnptnAAVVTGIP  591
            NGIIN+S++VK +AA+             +CSS Y            G   N  VVTGIP
Sbjct  120  NGIINLSLKVKAAAADYYLSTRKKRLPGNTCSSGYP-------IQNNGGEKNLDVVTGIP  172

Query  592  VW  597
            VW
Sbjct  173  VW  174



>ref|XP_008354303.1| PREDICTED: BON1-associated protein 2-like [Malus domestica]
Length=178

 Score =   158 bits (399),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 74/131 (56%), Positives = 97/131 (74%), Gaps = 4/131 (3%)
 Frame = +1

Query  88   METSSRDLEITVISGEGLRVG----KKNVFVTVKSEFSCNVKATGVDKGGGSFPAWNEKL  255
            M  SSR LEITVIS E L++     KKN  VTV+++ +   + T +D  GGS+P WNEKL
Sbjct  1    MTPSSRTLEITVISAENLKLDRKPIKKNASVTVRTDTNSQFRTTEMDTEGGSYPRWNEKL  60

Query  256  VVDLPMHARYLTLQVQCKTFSGVKVVGEAKVPAKDFVGGFVPESYVRFLSYRLKDRKGEK  435
            V+D+P H+R +T++VQCKT  GV+ +  A +PA DFVGG+VPE Y+ FLSYRL+D  GE+
Sbjct  61   VLDMPTHSRSITVEVQCKTSYGVRTIXTASIPASDFVGGYVPEGYLHFLSYRLRDHMGER  120

Query  436  NGIINISVRVK  468
            NGIINISVR+K
Sbjct  121  NGIINISVRMK  131



>emb|CDP08873.1| unnamed protein product [Coffea canephora]
Length=181

 Score =   156 bits (394),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 84/174 (48%), Positives = 110/174 (63%), Gaps = 10/174 (6%)
 Frame = +1

Query  103  RDLEITVISGEGLRVGKK-----NVFVTVKSEFSCNVKATGVDKGGGSFPAWNEKLVVDL  267
            R LEITVISGE LR+ +K     N FVT+K++ SC  + T +DK GG +PAW+EK V+D+
Sbjct  8    RVLEITVISGEDLRINRKQPVKNNAFVTIKTD-SCKEQTTKMDKDGGGYPAWDEKFVMDM  66

Query  268  PMHARYLTLQVQCKTFSGVKVVGEAKVPAKDFVGGFVPESYVRFLSYRLKDRKGEKNGII  447
             MHARY T +V+CKT +G ++VG A +PA DF+G +VPE+Y+ FLSYRL D  GE+NGI+
Sbjct  67   TMHARYFTAEVRCKTAAGSRIVGTAVIPASDFLGDYVPENYLHFLSYRLWDSHGERNGIL  126

Query  448  NI-SVRVKNSAAENAAVASCSSQY---SRRpwtglppptgnptnAAVVTGIPVW  597
            N+      +S+  NA    CSS     SR                 VVTGIPVW
Sbjct  127  NLSVRVKSSSSVRNAYGGGCSSHSAGCSRPWSGIAVGGQQVSNGEGVVTGIPVW  180



>ref|XP_009376896.1| PREDICTED: BON1-associated protein 2-like [Pyrus x bretschneideri]
Length=179

 Score =   156 bits (394),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 90/179 (50%), Positives = 117/179 (65%), Gaps = 9/179 (5%)
 Frame = +1

Query  88   METSSRDLEITVISGEGLRVG----KKNVFVTVKSEFSCNVKATGVDKGGGSFPAWNEKL  255
            M  +SR LEITVIS E L++     KKN  VTV+ + +     T +D  GG++P WNEKL
Sbjct  1    MAANSRTLEITVISAENLKLDRKPIKKNSSVTVRPDTNSQFCTTEMDTEGGAYPRWNEKL  60

Query  256  VVDLPMHARYLTLQVQCKTFSGVKVVGEAKVPAKDFVGGFVPESYVRFLSYRLKDRKGEK  435
            V+DLP H+R +T++VQCKT  GV+ VG A +PA DFVGG+VP+ Y+ FLSYRL+D +GE+
Sbjct  61   VLDLPAHSRSITVEVQCKTSYGVRTVGTATIPASDFVGGYVPDGYLHFLSYRLRDNRGER  120

Query  436  NGIINISVRVKNSAAENAAVASCSSQYSRRpwtglppptgnptnAAVVTGIPVWC-SYQ  609
            NGIINISVR+K    E  A +S ++    R   G P    N     V TG+PVW  SYQ
Sbjct  121  NGIINISVRMK--VPEIYACSSSTTSSHSR--MGFPVAENNNFGGGVATGVPVWYGSYQ  175



>emb|CDP22107.1| unnamed protein product [Coffea canephora]
Length=181

 Score =   155 bits (393),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 85/174 (49%), Positives = 110/174 (63%), Gaps = 10/174 (6%)
 Frame = +1

Query  103  RDLEITVISGEGLRVG-----KKNVFVTVKSEFSCNVKATGVDKGGGSFPAWNEKLVVDL  267
            R LEITVISGE LR+      KKN FVT+K++ S   + T +DK GG +PAW+EK V+D+
Sbjct  8    RVLEITVISGEDLRINRKQPVKKNAFVTIKTD-SFKEQTTKMDKDGGGYPAWDEKFVMDM  66

Query  268  PMHARYLTLQVQCKTFSGVKVVGEAKVPAKDFVGGFVPESYVRFLSYRLKDRKGEKNGII  447
            PMHARY T +V+CKT +G ++VG A +PA DF+G +VPE+Y+ FLSYRL D  GE+NGI+
Sbjct  67   PMHARYFTAEVRCKTAAGSRIVGTAVIPASDFLGDYVPENYLHFLSYRLWDSHGERNGIL  126

Query  448  NI-SVRVKNSAAENAAVASCSSQY---SRRpwtglppptgnptnAAVVTGIPVW  597
            N+      +S+  NA    CSS     SR                 VVTGIPVW
Sbjct  127  NLSVRVKSSSSVRNAYGGGCSSHSAGCSRPWSGIAVGGQQVSNGEGVVTGIPVW  180



>ref|XP_002271138.1| PREDICTED: BON1-associated protein 2 [Vitis vinifera]
Length=176

 Score =   154 bits (388),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 77/132 (58%), Positives = 98/132 (74%), Gaps = 6/132 (5%)
 Frame = +1

Query  88   METSSRDLEITVISGEGLRVG-----KKNVFVTVKSEFSCNVKATGVDKGGGSFPAWNEK  252
            ME +S  +EITVISGE LRV      KKN F  V+++ S N + T VD  GGS+  WNEK
Sbjct  1    MEAASGVVEITVISGEDLRVNSRRPVKKNAFAVVRTD-SKNYQMTRVDTEGGSYSTWNEK  59

Query  253  LVVDLPMHARYLTLQVQCKTFSGVKVVGEAKVPAKDFVGGFVPESYVRFLSYRLKDRKGE  432
            LV++LP HAR+LT++V CKT SG +V+G A+VP  DF GG  PESY+ FLSYRL+D KGE
Sbjct  60   LVMNLPAHARFLTVEVHCKTSSGDRVIGTARVPVSDFSGGSTPESYLHFLSYRLRDDKGE  119

Query  433  KNGIINISVRVK  468
            +NGI+N+SVR+K
Sbjct  120  RNGIVNLSVRMK  131



>ref|XP_009340618.1| PREDICTED: BON1-associated protein 2-like [Pyrus x bretschneideri]
Length=179

 Score =   154 bits (388),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 70/131 (53%), Positives = 97/131 (74%), Gaps = 4/131 (3%)
 Frame = +1

Query  88   METSSRDLEITVISGEGLRVGKK----NVFVTVKSEFSCNVKATGVDKGGGSFPAWNEKL  255
            M  + R LEITVIS E L++ +K    N  VTV+++ +   + T +D  GG++P WNEKL
Sbjct  1    MAANFRTLEITVISAENLQLNRKPISKNTSVTVRTDNNSQFRTTDMDTEGGAYPRWNEKL  60

Query  256  VVDLPMHARYLTLQVQCKTFSGVKVVGEAKVPAKDFVGGFVPESYVRFLSYRLKDRKGEK  435
            V+DLP H++ +T++VQC+T  GV+  G A +PA DF+GG+VPE Y+ FLSYRL+D KGE+
Sbjct  61   VLDLPTHSKSITVEVQCQTSYGVRTFGTATIPASDFIGGYVPEGYLHFLSYRLRDYKGER  120

Query  436  NGIINISVRVK  468
            NGIINISVR+K
Sbjct  121  NGIINISVRMK  131



>ref|XP_009340622.1| PREDICTED: BON1-associated protein 2-like [Pyrus x bretschneideri]
Length=178

 Score =   154 bits (388),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 85/179 (47%), Positives = 114/179 (64%), Gaps = 9/179 (5%)
 Frame = +1

Query  88   METSSRDLEITVISGEGLRVGKK----NVFVTVKSEFSCNVKATGVDKGGGSFPAWNEKL  255
            M  + R LEITVIS E L++ +K    N  VTV+++ +   + T  D  GG++P WNEKL
Sbjct  1    MAANFRTLEITVISAENLQLDRKPIKTNASVTVRTDTNSQFRTTERDTEGGAYPRWNEKL  60

Query  256  VVDLPMHARYLTLQVQCKTFSGVKVVGEAKVPAKDFVGGFVPESYVRFLSYRLKDRKGEK  435
            V+DLP H++ +T++VQCKT  GV+  G A VPA DFVG +VPE Y  FLSYRL+D KGE+
Sbjct  61   VLDLPTHSKSITVEVQCKTAYGVRTFGTATVPASDFVGAYVPEGYPHFLSYRLRDYKGER  120

Query  436  NGIINISVRVKNSAAENAAVASCSSQYSRRpwtglppptgnptnAAVVTGIPVWC-SYQ  609
            NG+INISVR+K      A  +S +S +SR    G P    +     V  G+PVW  +YQ
Sbjct  121  NGVINISVRMK-VPEMYACASSTTSSHSR---MGFPAAGNHSFGGGVAIGVPVWYGAYQ  175



>gb|AFD97530.1| BAP1 [Vitis vinifera]
Length=176

 Score =   153 bits (387),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 77/132 (58%), Positives = 98/132 (74%), Gaps = 6/132 (5%)
 Frame = +1

Query  88   METSSRDLEITVISGEGLRVG-----KKNVFVTVKSEFSCNVKATGVDKGGGSFPAWNEK  252
            ME +S  +EITVISGE LRV      KKN F  V+++ S N + T VD  GGS+  WNEK
Sbjct  1    MEAASGVVEITVISGEDLRVNSRRPVKKNAFAVVRTD-SKNYQMTRVDTEGGSYSTWNEK  59

Query  253  LVVDLPMHARYLTLQVQCKTFSGVKVVGEAKVPAKDFVGGFVPESYVRFLSYRLKDRKGE  432
            LV++LP HAR+LT++V CKT SG +V+G A+VP  DF GG  PESY+ FLSYRL+D KGE
Sbjct  60   LVMNLPAHARFLTVEVHCKTSSGDRVIGTARVPVSDFSGGSTPESYLHFLSYRLRDDKGE  119

Query  433  KNGIINISVRVK  468
            +NGI+N+SVR+K
Sbjct  120  RNGIVNLSVRMK  131



>emb|CAN72571.1| hypothetical protein VITISV_017490 [Vitis vinifera]
Length=176

 Score =   152 bits (385),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 77/132 (58%), Positives = 97/132 (73%), Gaps = 6/132 (5%)
 Frame = +1

Query  88   METSSRDLEITVISGEGLRVG-----KKNVFVTVKSEFSCNVKATGVDKGGGSFPAWNEK  252
            ME +S  +EITVISGE LRV      KKN F  V+++ S N + T VD  GGS+  WNEK
Sbjct  1    MEAASGVVEITVISGEDLRVNSRRPVKKNAFAVVRTD-SKNYQMTRVDTEGGSYSTWNEK  59

Query  253  LVVDLPMHARYLTLQVQCKTFSGVKVVGEAKVPAKDFVGGFVPESYVRFLSYRLKDRKGE  432
            LV++LP HAR+LT++V CKT SG +V+G A+VP  DF GG  PESY  FLSYRL+D KGE
Sbjct  60   LVMNLPAHARFLTVEVHCKTSSGDRVIGTARVPVSDFSGGSTPESYXHFLSYRLRDDKGE  119

Query  433  KNGIINISVRVK  468
            +NGI+N+SVR+K
Sbjct  120  RNGIVNLSVRMK  131



>ref|XP_010092739.1| BON1-associated protein 2 [Morus notabilis]
 gb|EXB52084.1| BON1-associated protein 2 [Morus notabilis]
Length=183

 Score =   153 bits (386),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 74/131 (56%), Positives = 99/131 (76%), Gaps = 5/131 (4%)
 Frame = +1

Query  100  SRDLEITVISGEGLRVGK----KNVFVTVKSEFSCNVKATGVDKGGGSFPAWNEKLVVDL  267
            SR +EIT++SGE LR+ +    KN FV V+ + + N + T +D  GGS+P WNE+L++DL
Sbjct  9    SRTVEITILSGEDLRIDRRSIQKNAFVVVRCDAN-NFRTTEMDGEGGSYPKWNERLILDL  67

Query  268  PMHARYLTLQVQCKTFSGVKVVGEAKVPAKDFVGGFVPESYVRFLSYRLKDRKGEKNGII  447
            P HA+ +TL+V CKT  G KVVG A VP  DFVGG+VPESY+ FLSYRL+D +G +NGII
Sbjct  68   PAHAQAVTLEVHCKTAFGNKVVGTASVPVSDFVGGYVPESYLHFLSYRLRDSRGVRNGII  127

Query  448  NISVRVKNSAA  480
            NISV++K+ AA
Sbjct  128  NISVKMKDPAA  138



>ref|XP_008347165.1| PREDICTED: BON1-associated protein 2-like [Malus domestica]
Length=215

 Score =   154 bits (388),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 71/126 (56%), Positives = 94/126 (75%), Gaps = 4/126 (3%)
 Frame = +1

Query  103  RDLEITVISGEGLRVG----KKNVFVTVKSEFSCNVKATGVDKGGGSFPAWNEKLVVDLP  270
            R LEITVIS E L++     KKN  VTV+++ +   + T +D  GGS+P WNEKLV+D+P
Sbjct  43   RTLEITVISAENLKLDRKPIKKNASVTVRTDTNSQFRTTEMDTEGGSYPRWNEKLVLDMP  102

Query  271  MHARYLTLQVQCKTFSGVKVVGEAKVPAKDFVGGFVPESYVRFLSYRLKDRKGEKNGIIN  450
             H+R +T++VQCKT  GV+ +  A +PA DFVGG+VPE Y+ FLSYRL+D  GE+NGIIN
Sbjct  103  THSRSITVEVQCKTSYGVRTIXTASIPASDFVGGYVPEGYLHFLSYRLRDHMGERNGIIN  162

Query  451  ISVRVK  468
            ISVR+K
Sbjct  163  ISVRMK  168



>ref|XP_012083464.1| PREDICTED: BON1-associated protein 2-like [Jatropha curcas]
 gb|KDP28677.1| hypothetical protein JCGZ_14448 [Jatropha curcas]
Length=181

 Score =   151 bits (382),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 78/177 (44%), Positives = 118/177 (67%), Gaps = 8/177 (5%)
 Frame = +1

Query  88   METSSRDLEITVISGEGLRVG----KKNVFVTVKSEFSCNVKATGVDKGGGSFPAWNEKL  255
            M +SSR LEITV+S E LR+     KKN +V V+++   N + T +D  GGS+P+WN+ L
Sbjct  1    MASSSRTLEITVLSCEDLRIDGKSVKKNTYVVVRTDH-LNYRTTKIDTEGGSYPSWNQNL  59

Query  256  VVDLPMHARYLTLQVQCKTFSGVKVVGEAKVPAKDFVGGFVPESYVRFLSYRLKDRKGEK  435
            ++D+P+H R++TL+V CK  S  +++G A++P  DF+GG++P++Y+ FLSYRL+D +G +
Sbjct  60   LIDMPLHERFVTLEVNCKMASSDRIIGTARIPVTDFMGGYLPDNYLNFLSYRLRDSRGVR  119

Query  436  NGIINISVRVKNS---AAENAAVASCSSQYSRRpwtglppptgnptnAAVVTGIPVW  597
            NGI+NISV+VK     +++N    + +S  S      L  P G   N  VV GIPVW
Sbjct  120  NGIVNISVKVKLPEYLSSKNNKKVTENSACSTASKPPLKMPIGGEKNFGVVAGIPVW  176



>ref|XP_012083463.1| PREDICTED: BON1-associated protein 2 [Jatropha curcas]
 gb|KDP28676.1| hypothetical protein JCGZ_14447 [Jatropha curcas]
Length=188

 Score =   151 bits (382),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 81/185 (44%), Positives = 114/185 (62%), Gaps = 15/185 (8%)
 Frame = +1

Query  88   METSSRDLEITVISGEGLRVG----KKNVFVTVKSEFSCNVKATGVDKGGGSFPAWNEKL  255
            M++   +LEITV+S E L +     KK+ FV +K +   N ++T  D  GG  P+WN+KL
Sbjct  1    MDSLVHNLEITVLSAENLNLDGKSVKKDTFVVIKVD-PLNSQSTRADYEGGRNPSWNQKL  59

Query  256  VVDLPMHARYLTLQVQCKTFSGVKVVGEAKVPAKDFVGGFVPESYVRFLSYRLKDRKGEK  435
             + +PMHAR++TL+VQCK  SG KV+G   VP  DF+GG++PE+Y+ FLSYRL+D +GEK
Sbjct  60   EIGMPMHARFITLEVQCKIGSGNKVIGTTNVPVSDFMGGYIPENYLNFLSYRLRDVRGEK  119

Query  436  NGIINISVRVKNSAA----------ENAAVASCSSQYSRRpwtglppptgnptnAAVVTG  585
            NGI+NIS++VK+SAA           +    S  S   +  W           +  VVTG
Sbjct  120  NGIVNISLKVKSSAACATLGMRKNLPSYTWQSSPSPQMQPTWGVPAGQKNCLGHGGVVTG  179

Query  586  IPVWC  600
            +PVWC
Sbjct  180  VPVWC  184



>ref|XP_008355550.1| PREDICTED: BON1-associated protein 2-like [Malus domestica]
Length=179

 Score =   150 bits (380),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 70/131 (53%), Positives = 95/131 (73%), Gaps = 4/131 (3%)
 Frame = +1

Query  88   METSSRDLEITVISGEGLRVGKK----NVFVTVKSEFSCNVKATGVDKGGGSFPAWNEKL  255
            M  + R LEITVIS   L++ +K    N  VTV+++ +   + T +D  GG++P WNEKL
Sbjct  1    MAANFRTLEITVISAGNLQLNRKPISKNTSVTVRTDTNSQFRTTDMDTEGGAYPQWNEKL  60

Query  256  VVDLPMHARYLTLQVQCKTFSGVKVVGEAKVPAKDFVGGFVPESYVRFLSYRLKDRKGEK  435
            V+DLP H++ +T++VQC+T  GV+    A +PA DFVGG+VPE Y+ FLSYRL+D KGEK
Sbjct  61   VLDLPTHSKSITVEVQCQTSYGVRTFATASIPASDFVGGYVPEGYLHFLSYRLRDYKGEK  120

Query  436  NGIINISVRVK  468
            NGIINISVR+K
Sbjct  121  NGIINISVRMK  131



>gb|KJB41243.1| hypothetical protein B456_007G096400 [Gossypium raimondii]
Length=175

 Score =   150 bits (379),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 85/178 (48%), Positives = 118/178 (66%), Gaps = 15/178 (8%)
 Frame = +1

Query  88   METSSRDLEITVISGEGLRVG----KKNVFVTVKSEFSCNVKATGVDKGGGSFPAWNEKL  255
            MET SR LEIT++S E LR+     KKN FV V+++ S N K T ++  GGS P+WN+KL
Sbjct  1    METKSRTLEITILSAEDLRIHNKSVKKNAFVVVQTD-SFNSKTTKMNGKGGSSPSWNDKL  59

Query  256  VVDLPMHARYLTLQVQCKTFSGV-KVVGEAKVPAKDFVGGFVPESYVRFLSYRLKDRKGE  432
            V+D+PMH R++TLQV+CK+  G  K VG  ++P  DF+GG+ PE+ ++FLSYRL+D KG 
Sbjct  60   VMDMPMHTRFVTLQVKCKSSGGRDKTVGLVRIPVTDFIGGYSPETCLQFLSYRLRDPKGL  119

Query  433  KNGIINISVRVKNSAAENAAVASCSSQYSRRpwtglppptgnptnAAVVTGIPVWCSY  606
            KNGI+N+S+R+K        + +CSSQ      +GL  P     +  VVTGIP+   Y
Sbjct  120  KNGILNVSIRLKE------PLQACSSQA---VASGLGIPINGLNDFGVVTGIPICSGY  168



>ref|XP_009340617.1| PREDICTED: BON1-associated protein 2-like [Pyrus x bretschneideri]
Length=178

 Score =   150 bits (378),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 83/179 (46%), Positives = 115/179 (64%), Gaps = 9/179 (5%)
 Frame = +1

Query  88   METSSRDLEITVISGEGLRVGKK----NVFVTVKSEFSCNVKATGVDKGGGSFPAWNEKL  255
            M  + R LEITVIS E L++ +K    N  VTV+++ +   + T  D  GG++P WNEKL
Sbjct  1    MAANFRTLEITVISAENLQLDRKPIKTNASVTVRTDTNSQFRTTERDTEGGAYPRWNEKL  60

Query  256  VVDLPMHARYLTLQVQCKTFSGVKVVGEAKVPAKDFVGGFVPESYVRFLSYRLKDRKGEK  435
            V+DLP H++ +T++VQCKT  GV++ G A V A DFVG +VPE Y  FLSYRL+D KG++
Sbjct  61   VLDLPTHSKSITVEVQCKTAYGVRMFGTATVLASDFVGAYVPEGYPHFLSYRLRDYKGQR  120

Query  436  NGIINISVRVKNSAAENAAVASCSSQYSRRpwtglppptgnptnAAVVTGIPVWC-SYQ  609
            NG+INISVR+ N     A  +S +S +SR+   G P    +     V  G+PVW  +YQ
Sbjct  121  NGVINISVRM-NVPEMYACASSTTSSHSRK---GFPAAGNHSFGGGVAIGVPVWYGAYQ  175



>ref|XP_010092741.1| BON1-associated protein 2 [Morus notabilis]
 gb|EXB52086.1| BON1-associated protein 2 [Morus notabilis]
Length=185

 Score =   149 bits (377),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 88/182 (48%), Positives = 115/182 (63%), Gaps = 11/182 (6%)
 Frame = +1

Query  82   FDMETSSRDLEITVISGEGLRVG----KKNVFVTVKSEFSCNVKATGVDKG-GGSFPAWN  246
            +D   SSR +E+TV+SGE LR+     KKN FV V+S+ S N + T +D G  GS P WN
Sbjct  5    YDNYYSSRTVEMTVLSGEDLRLARKSVKKNTFVVVRSDGS-NFRTTEMDGGESGSRPNWN  63

Query  247  EKLVVDLPMHARYLTLQVQCKTFSGVKVVGEAKVPAKDFVGGFVPES-YVRFLSYRLKDR  423
            EKLV+DLP HA+ +TL+V CKT  G K+VG   VP  DF GG++ ES Y+ FLSYRL+D 
Sbjct  64   EKLVLDLPAHAQAVTLEVHCKTAFGDKIVGTVSVPVADFSGGYLSESGYLHFLSYRLRDS  123

Query  424  KGEKNGIINISVRVKNSAAENAAVASCSSQYSRRpwtglppptgnptnAAVVTGIPVWCS  603
            +GEKNGIIN+SVR++    E     +CS+         +  P G      VVTG+PV C+
Sbjct  124  RGEKNGIINVSVRMEVPIPE----YTCSASVLAPEQMTVGVPVGKSNFGGVVTGVPVLCA  179

Query  604  YQ  609
            Y 
Sbjct  180  YN  181



>ref|XP_011091753.1| PREDICTED: BON1-associated protein 2-like [Sesamum indicum]
Length=165

 Score =   149 bits (375),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 83/174 (48%), Positives = 113/174 (65%), Gaps = 17/174 (10%)
 Frame = +1

Query  97   SSRDLEITVISGEGL----RVGKKNVFVTVKSEFSCNVKATGVDKGGGSFPAWNEKLVVD  264
            SS+++E+TVISGEGL    R  KKNV VTVK++   N ++TGVD  GGS+PAWNEKLV++
Sbjct  5    SSKEIEVTVISGEGLLLSRRPVKKNVSVTVKTD-PFNSRSTGVDPEGGSYPAWNEKLVME  63

Query  265  LPMHARYLTLQVQCKTFSGVKVVGEAKVPAKDFVGGFVPESYVRFLSYRLKDRKGEKNGI  444
            LP+HA ++T++       G +++G A +P  DF GG++PE+Y+ FLSYRL+D  GEKNGI
Sbjct  64   LPLHAHFITVEAHA----GSRLIGVANIPVSDFSGGYLPENYLSFLSYRLRDSNGEKNGI  119

Query  445  INISVRVKNSAAENAAVASCSSQYSRRpwtglppptgnptnAAVVTGIPVWCSY  606
            IN+SV+VK S   N   A  S  +         P      +  +VTGIPV   Y
Sbjct  120  INLSVKVKGSG--NMGYAGSSRPW------MGVPTADAKVSDGIVTGIPVSYRY  165



>ref|XP_012092683.1| PREDICTED: BON1-associated protein 2-like [Jatropha curcas]
 gb|KDP20267.1| hypothetical protein JCGZ_06853 [Jatropha curcas]
Length=188

 Score =   149 bits (376),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 80/185 (43%), Positives = 114/185 (62%), Gaps = 15/185 (8%)
 Frame = +1

Query  88   METSSRDLEITVISGEGLRVG----KKNVFVTVKSEFSCNVKATGVDKGGGSFPAWNEKL  255
            M++   +LEITV+S E L++     KK+ FV +K +   N ++T  D  GG  P+WN+KL
Sbjct  1    MDSLHHNLEITVLSAENLKLAGKSVKKDTFVVIKVD-PLNSQSTRADYEGGRNPSWNQKL  59

Query  256  VVDLPMHARYLTLQVQCKTFSGVKVVGEAKVPAKDFVGGFVPESYVRFLSYRLKDRKGEK  435
             + +PMHAR++TL+VQCK  SG +VVG A VP  DF+  ++PE+Y+ FLSYRL+D +GEK
Sbjct  60   EIGMPMHARFITLEVQCKIGSGNRVVGTANVPVSDFMSCYIPENYLNFLSYRLRDVRGEK  119

Query  436  NGIINISVRVKNSAA----------ENAAVASCSSQYSRRpwtglppptgnptnAAVVTG  585
            NGI+NIS++VK+ AA           + +  S  S   R  W           +  VVTG
Sbjct  120  NGIVNISLKVKSPAACATPGMRKNLPSYSWQSSPSPQMRPTWGVPAGQKNCLGHGGVVTG  179

Query  586  IPVWC  600
            +PVWC
Sbjct  180  VPVWC  184



>gb|KJB49405.1| hypothetical protein B456_008G117300 [Gossypium raimondii]
Length=181

 Score =   148 bits (374),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 83/182 (46%), Positives = 110/182 (60%), Gaps = 16/182 (9%)
 Frame = +1

Query  88   METSSRDLEITVISGEGLRVG----KKNVFVTVKSEFSCNVKATGVDKGGGSFPAWNEKL  255
            MET SR LEITV+S E LR+     KKN +V V  +   N KAT VD  GGS+P+WN+KL
Sbjct  1    METKSRTLEITVLSAEDLRIDNKPVKKNAYVVVSVD-PFNNKATKVDGEGGSYPSWNDKL  59

Query  256  VVDLPMHARYLTLQVQCKTFSGVKVVGEAKVPAKDFVGGFVPESYVRFLSYRLKDRKGEK  435
            V+++P+  R++TL V+CK   G K VG A++P  DFVGG+ P + ++FLSYRL+D KG K
Sbjct  60   VMEMPLQTRFVTLLVKCKGSRGEKTVGLARIPVMDFVGGYSPATCLQFLSYRLRDPKGLK  119

Query  436  NGIINISVRVKNSAAENAAVASCSSQYSRRpwtglppptgnptnA-----AVVTGIPVWC  600
            NGIIN+S+RVK        +  CSSQ +                       +VTGIP+W 
Sbjct  120  NGIINVSLRVKE------PLQDCSSQAAAAGGGNAATIGLGIPIDGRRDYGMVTGIPIWT  173

Query  601  SY  606
             Y
Sbjct  174  GY  175



>ref|XP_006445133.1| hypothetical protein CICLE_v10022337mg [Citrus clementina]
 ref|XP_006491026.1| PREDICTED: BON1-associated protein 2-like [Citrus sinensis]
 gb|ESR58373.1| hypothetical protein CICLE_v10022337mg [Citrus clementina]
 gb|KDO86041.1| hypothetical protein CISIN_1g040360mg [Citrus sinensis]
Length=198

 Score =   147 bits (370),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 76/153 (50%), Positives = 106/153 (69%), Gaps = 15/153 (10%)
 Frame = +1

Query  88   METSS---RDLEITVISGEGLRVG----KKNVFVTVKSEFSCNVKATGVDKGGGSFPAWN  246
            +E SS   R +E+TV+SGE LR+     KKN F  V+++ S +   T VD+ GGS P+WN
Sbjct  2    LEKSSSGYRTIELTVLSGEDLRIDRRLIKKNAFAIVQTDTSFDYCTTKVDESGGSHPSWN  61

Query  247  EKLVVDLPMHARYLTLQVQCKTFSGVK--------VVGEAKVPAKDFVGGFVPESYVRFL  402
            EKLV++LPMHAR++T+QVQCK+ S           +VG A++P  DF+GG+ PE+Y+ FL
Sbjct  62   EKLVIELPMHARFITVQVQCKSKSSSSGNNNNHNKIVGFARIPVSDFIGGYAPENYLHFL  121

Query  403  SYRLKDRKGEKNGIINISVRVKNSAAENAAVAS  501
            SYRL++ KG+KNGIIN+SVR    AA+  A +S
Sbjct  122  SYRLRNAKGDKNGIINVSVRSLKVAADQHASSS  154



>ref|XP_009340619.1| PREDICTED: BON1-associated protein 2-like [Pyrus x bretschneideri]
Length=178

 Score =   145 bits (366),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 68/131 (52%), Positives = 93/131 (71%), Gaps = 4/131 (3%)
 Frame = +1

Query  88   METSSRDLEITVISGEGLRVG----KKNVFVTVKSEFSCNVKATGVDKGGGSFPAWNEKL  255
            M  +S+ LEI VIS E L++     KKN  VTV+++ +     T +D  GG++P WNEKL
Sbjct  1    MAANSQTLEIKVISAENLKLDRKSIKKNASVTVRTDTNSQFCTTDIDTEGGAYPRWNEKL  60

Query  256  VVDLPMHARYLTLQVQCKTFSGVKVVGEAKVPAKDFVGGFVPESYVRFLSYRLKDRKGEK  435
            V+DLP H++ + ++V CKT SGV+ +G A VP  DFVG +VPE Y+ FLSYRL++ KG +
Sbjct  61   VLDLPTHSKSIIVEVHCKTSSGVRTIGTATVPTSDFVGEYVPEGYLHFLSYRLRNHKGVR  120

Query  436  NGIINISVRVK  468
            NGIINISVR+K
Sbjct  121  NGIINISVRMK  131



>ref|XP_002511807.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF50476.1| conserved hypothetical protein [Ricinus communis]
Length=196

 Score =   145 bits (365),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 70/129 (54%), Positives = 94/129 (73%), Gaps = 5/129 (4%)
 Frame = +1

Query  103  RDLEITVISGEGLRVG----KKNVFVTVKSEFSCNVKATGVDKGGGSFPAWNEKLVVDLP  270
            R LEI V+S E LR+     KK+ FV V+ +   N K+T  D  GGS P+WNEKL +D+ 
Sbjct  8    RSLEIDVLSAEKLRLDGKSVKKDTFVVVRVD-PVNYKSTKADHQGGSNPSWNEKLEIDMS  66

Query  271  MHARYLTLQVQCKTFSGVKVVGEAKVPAKDFVGGFVPESYVRFLSYRLKDRKGEKNGIIN  450
            MHA ++TL+VQCK  SG +V+G A +P  DF+GG+ PE+Y+ FLSYRL+D +GEKNGIIN
Sbjct  67   MHAHFITLEVQCKVGSGNRVIGIASIPVSDFMGGYAPENYLHFLSYRLRDLRGEKNGIIN  126

Query  451  ISVRVKNSA  477
            +SV+VK +A
Sbjct  127  VSVKVKGAA  135



>gb|EYU32073.1| hypothetical protein MIMGU_mgv1a025865mg [Erythranthe guttata]
Length=161

 Score =   141 bits (356),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 72/130 (55%), Positives = 95/130 (73%), Gaps = 10/130 (8%)
 Frame = +1

Query  109  LEITVISGEGLRVGKK-----NVFVTVKSEFSCNVKATGVDKGGGSFPAWNEKLVVDLPM  273
            +E+TVISGEGL V KK     N FV V+S+   N ++TG D  GGS+PAWNEKLV+DLP 
Sbjct  3    IEVTVISGEGLLVRKKQPVKRNAFVVVRSD-PFNHQSTGTDTYGGSYPAWNEKLVLDLPA  61

Query  274  HARYLTLQVQCKTFSGVKVVGEAKVPAKDFVGGFVPESYVRFLSYRLKDRKGEKNGIINI  453
             ARY+T++      SG +++G + +P  DF GGF+PE+Y+ FLSYRL+D  GEKNGIINI
Sbjct  62   RARYITVEAH----SGSRLIGISNIPVSDFAGGFLPENYLSFLSYRLRDANGEKNGIINI  117

Query  454  SVRVKNSAAE  483
            SV+VK +A +
Sbjct  118  SVKVKGAAGK  127



>gb|AFK45032.1| unknown [Lotus japonicus]
Length=171

 Score =   141 bits (356),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 79/176 (45%), Positives = 112/176 (64%), Gaps = 15/176 (9%)
 Frame = +1

Query  100  SRDLEITVISGEGLRVGKKNV----FVTVKSEFSCNVKATGVDKGGGSFPAWNEKLVVDL  267
            SR +EIT++S E L+V +K++    FV V+S+ S  V  T VD   GS+P+WNEK+V+D+
Sbjct  2    SRTIEITILSAEDLQVNRKHIKGKAFVEVQSDASSEVGTTKVDSNNGSYPSWNEKIVMDV  61

Query  268  PMHARYLTLQVQCKTFS-GVKVVGEAKVPAKDFVGGFVPESYVRFLSYRLKDRKGEKNGI  444
            P+H+R++T+ V+C+T S     +G A++P  +FVGG+VPE+ ++FLSYRL D K  +NG+
Sbjct  62   PLHSRFITIDVRCRTSSTASNSIGMARIPVCEFVGGYVPENQLQFLSYRLWDSKVRRNGV  121

Query  445  INISVRVKNSAAENAAVASCSSQYSRRpwtglppptgnptnAAVVTGIP-VWCSYQ  609
            INISVRVK S        SCS        +    P        VVTGIP VW +YQ
Sbjct  122  INISVRVKVSH------HSCSGSIP---LSATGVPVAGNGTTGVVTGIPAVWLNYQ  168



>gb|EYU32072.1| hypothetical protein MIMGU_mgv1a014964mg [Erythranthe guttata]
Length=172

 Score =   141 bits (355),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 83/181 (46%), Positives = 115/181 (64%), Gaps = 15/181 (8%)
 Frame = +1

Query  82   FDMETSSRDLEITVISGEGLRVGKK-----NVFVTVKSEFSCNVKATG-VDKGGGSFPAW  243
             +   +S+ +EITVIS EGL V +K     NV VTVK++   N ++TG VD  GGS PAW
Sbjct  1    MEKAAASKAMEITVISAEGLLVNRKQTVRKNVSVTVKTD-PLNSRSTGRVDPEGGSSPAW  59

Query  244  NEKLVVDLPMHARYLTLQVQCKTFSGVKVVGEAKVPAKDFVGGFVPESYVRFLSYRLKDR  423
             EKLV+DLP+HAR++T++V     SG ++VG A +P  DF GG++PE+++ FLSYRL+D 
Sbjct  60   KEKLVMDLPVHARFITVEVH----SGSRIVGAANIPVTDFSGGYLPENHLSFLSYRLRDG  115

Query  424  KGEKNGIINISVRVKNSAAENAAVASCSSQYSRRpwtglppptgnptnAAVVTGIPVWCS  603
             G++NGI+N+SV+V+  A      ASCS  +         P  G    A +VTGIPV   
Sbjct  116  NGDRNGIVNLSVKVR-GAGNTGCAASCSRPW---IGVPGLPAVGEKAPAGIVTGIPVPYK  171

Query  604  Y  606
            Y
Sbjct  172  Y  172



>ref|XP_003528877.2| PREDICTED: BON1-associated protein 2-like [Glycine max]
Length=179

 Score =   140 bits (354),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 80/176 (45%), Positives = 110/176 (63%), Gaps = 8/176 (5%)
 Frame = +1

Query  100  SRDLEITVISGEGLRVGKK----NVFVTVKSEFSCNVKATGVDKGGGSFPAWNEKLVVDL  267
            SR +EIT++S E L++ KK    N FVTV+S+ S +  AT VD  GGS+P+WNEKLV+D 
Sbjct  4    SRTVEITILSAENLQMNKKPIRGNTFVTVQSDASSDTSATKVDSEGGSYPSWNEKLVMDA  63

Query  268  PMHARYLTLQVQCKTFS-GVKVVGEAKVPAKDFVGGFVPESYVRFLSYRLKDRKGEKNGI  444
            P+HAR++T++V+CKT S G K VG A++P  DFVGG+VPE+ + FLSYRL D K  +NG+
Sbjct  64   PLHARFITVEVKCKTSSTGSKSVGVARIPVSDFVGGYVPENQLHFLSYRLWDGKVRRNGV  123

Query  445  INISVRVKNSAAENAAVASCSSQYSRRpwtglppptgnptnAAVVTGIP-VWCSYQ  609
            +         A +      C+S  S         P     +  VVTGIP +W +YQ
Sbjct  124  V-NVSVRVKVAQQQPQQHLCNSN-STSLSAVTGVPVAGNRSTGVVTGIPAIWLNYQ  177



>gb|KHN04632.1| BON1-associated protein 2 [Glycine soja]
Length=177

 Score =   140 bits (354),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 80/176 (45%), Positives = 110/176 (63%), Gaps = 8/176 (5%)
 Frame = +1

Query  100  SRDLEITVISGEGLRVGKK----NVFVTVKSEFSCNVKATGVDKGGGSFPAWNEKLVVDL  267
            SR +EIT++S E L++ KK    N FVTV+S+ S +  AT VD  GGS+P+WNEKLV+D 
Sbjct  2    SRTVEITILSAENLQMNKKPIRGNTFVTVQSDASSDTSATKVDSEGGSYPSWNEKLVMDA  61

Query  268  PMHARYLTLQVQCKTFS-GVKVVGEAKVPAKDFVGGFVPESYVRFLSYRLKDRKGEKNGI  444
            P+HAR++T++V+CKT S G K VG A++P  DFVGG+VPE+ + FLSYRL D K  +NG+
Sbjct  62   PLHARFITVEVKCKTSSTGSKSVGVARIPVSDFVGGYVPENQLHFLSYRLWDGKVRRNGV  121

Query  445  INISVRVKNSAAENAAVASCSSQYSRRpwtglppptgnptnAAVVTGIP-VWCSYQ  609
            +         A +      C+S  S         P     +  VVTGIP +W +YQ
Sbjct  122  V-NVSVRVKVAQQQPQQHLCNSN-STSLSAVTGVPVAGNRSTGVVTGIPAIWLNYQ  175



>ref|XP_004510853.1| PREDICTED: BON1-associated protein 2-like [Cicer arietinum]
Length=178

 Score =   139 bits (351),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 80/179 (45%), Positives = 113/179 (63%), Gaps = 14/179 (8%)
 Frame = +1

Query  100  SRDLEITVISGEGLRVGKK----NVFVTVKSEFSCN-VKATGVDKGGGSFPAWNEKLVVD  264
            SR +EIT+IS E L+  KK    N FVTV+ + + + +  T VD  GGS+P+WNEKLV+D
Sbjct  2    SRSIEITIISSENLQENKKALKGNTFVTVQCDGNRDEMSTTKVDSEGGSYPSWNEKLVMD  61

Query  265  LPMHARYLTLQVQCKTF-SGVKVVGEAKVPAKDFVGGFVPESYVRFLSYRLKDRKGEKNG  441
            +P+HAR++T++V+CKT  +    +G A++P  DF+GG+VPE+ ++FLSYRL D K  +NG
Sbjct  62   VPLHARFITIEVKCKTRGNSSSSIGMARIPVSDFIGGYVPENQLQFLSYRLWDNKVSRNG  121

Query  442  IINISVRVKNSAAENAAVASCSSQYSRRpwtglppptgnptnAA--VVTGIP-VWCSYQ  609
            I+NIS+RVK S         CS+  S               N +  VVTGIP  W +YQ
Sbjct  122  IVNISIRVKVSQNN-----YCSNSMSSAVNGVPVTGVPVAGNGSTRVVTGIPAAWLNYQ  175



>ref|NP_001236026.1| uncharacterized protein LOC100500298 [Glycine max]
 gb|ACU15336.1| unknown [Glycine max]
Length=175

 Score =   139 bits (349),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 80/177 (45%), Positives = 116/177 (66%), Gaps = 13/177 (7%)
 Frame = +1

Query  100  SRDLEITVISGEGLRVGKKNV----FVTVKSEFSCNVKA-TGVDKGGGSFPAWNEKLVVD  264
            SR +E+T++S E L++ +K++    FVTV+S+ S +  A T VD  GGS+P+WNEK+V+D
Sbjct  2    SRTVEMTILSAENLQMNRKSIRGSTFVTVQSDTSSDTSAATKVDSEGGSYPSWNEKVVMD  61

Query  265  LPMHARYLTLQVQCKTFSGVKVVGE-AKVPAKDFVGGFVPESYVRFLSYRLKDRKGEKNG  441
            +P+HAR++T++V+CKT S        A++P  DF+GG++PE+ + FLSYRL D K  +NG
Sbjct  62   VPLHARFITVEVKCKTSSSGSSSVGVAQIPVSDFIGGYMPENQLHFLSYRLWDGKVRRNG  121

Query  442  IINISVRVKNSAAENAAVASCSSQYSRRpwtglppptgnptnAAVVTGIP-VWCSYQ  609
            +INISVRVK   AE+   +SC+   S         P        VVTGIP VW +YQ
Sbjct  122  VINISVRVK--VAEH---SSCNLN-SMSLSAVTGVPVAGNGPTGVVTGIPAVWLNYQ  172



>ref|XP_008438082.1| PREDICTED: BON1-associated protein 2-like [Cucumis melo]
Length=182

 Score =   138 bits (348),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 76/178 (43%), Positives = 111/178 (62%), Gaps = 10/178 (6%)
 Frame = +1

Query  94   TSSRDLEITVISGEGLRVGKKNV----FVTVK---SEFSCNVKATGVDKGGGSFPAWNEK  252
            TS R +EITV+SGE LR+ +K V    FVTVK     F     +T +D+ GGS+P WNEK
Sbjct  4    TSFRSIEITVVSGEDLRIDRKPVSRKTFVTVKFARQSFGGGGGSTEIDERGGSYPFWNEK  63

Query  253  LVVDLPMHARYLTLQVQCKTFSGVKVVGEAKVPAKDFVGGFVPESYVRFLSYRLKDRKGE  432
            + +++P+   +LT++V C + S  ++VG A VP  DF+G + PESY+  LSYRL+D  GE
Sbjct  64   MALEIPVDTVFLTIEVHCGSNSRNRIVGTANVPVSDFLGRYRPESYLHLLSYRLRDGNGE  123

Query  433  KNGIINISVRVKNSAAENAAVASCSSQYSRRpwtglppptgnptnAAVVTGIPVWCSY  606
            +NGI+NISVRVK    E+ +  + +S+ + R            ++  VV G+P+W SY
Sbjct  124  RNGIVNISVRVKE--LESDSEPAITSRATVR-VPVAETAALCRSSGGVVIGVPIWSSY  178



>ref|XP_004134336.1| PREDICTED: BON1-associated protein 2-like [Cucumis sativus]
 gb|KGN56545.1| hypothetical protein Csa_3G123180 [Cucumis sativus]
Length=177

 Score =   138 bits (347),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 70/133 (53%), Positives = 99/133 (74%), Gaps = 10/133 (8%)
 Frame = +1

Query  97   SSRDLEITVISGEGLRVG----KKNVFVTVKSEFSCNVKA--TGVDKGGGSFPAWNEKLV  258
            +SR +EITVISGE L++     K ++FVTV+S+      +  T +D+ G  FP WNEKLV
Sbjct  2    ASRTVEITVISGENLQIRGKPIKSDLFVTVRSDLQSENGSVNTKIDRDGDGFPRWNEKLV  61

Query  259  VDLPMHARYLTLQVQCKTFSG---VKVVGEAKVPAKDFVGGFVPESYVRFLSYRLKDRKG  429
            +DLPMHA ++ ++V C++ S    VK+VG+++VP  DFV G +PES+++FLSYRL+D KG
Sbjct  62   IDLPMHAAFVVVEV-CRSASSGRKVKIVGKSRVPVADFVAGHLPESHLQFLSYRLRDEKG  120

Query  430  EKNGIINISVRVK  468
            E+NGIIN+SVRVK
Sbjct  121  ERNGIINLSVRVK  133



>gb|KHN27291.1| BON1-associated protein 2 [Glycine soja]
Length=158

 Score =   137 bits (345),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 74/155 (48%), Positives = 101/155 (65%), Gaps = 7/155 (5%)
 Frame = +1

Query  151  KKNVFVTVKSEFSCNVKATGVDKGGGSFPAWNEKLVVDLPMHARYLTLQVQCKTFS-GVK  327
            + N FVTV+S+ S +  AT VD  GGS+P+WNEKLV+D+P+HAR++T++V+CKT S G  
Sbjct  7    RGNAFVTVQSDASNDTSATKVDSEGGSYPSWNEKLVMDVPLHARFITVEVKCKTSSAGSN  66

Query  328  VVGEAKVPAKDFVGGFVPESYVRFLSYRLKDRKGEKNGIINISVRVKNSAAENAAVASCS  507
             +G A++P  DFVGG+VPE+ + FLSYRL D K  +NG++NISVRVK      A      
Sbjct  67   SIGVARIPVSDFVGGYVPENQLHFLSYRLWDGKVRRNGVVNISVRVK-----VAQQQQQQ  121

Query  508  SQYSRRpwtglppptgnptnAAVVTGIP-VWCSYQ  609
             Q+S         P     +  VVTGIP +W +YQ
Sbjct  122  QQHSCNLSAVTGVPVAGNGSTGVVTGIPAIWLNYQ  156



>ref|XP_002302565.1| BON association protein 1 [Populus trichocarpa]
 gb|EEE81838.1| BON association protein 1 [Populus trichocarpa]
Length=183

 Score =   137 bits (346),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 77/178 (43%), Positives = 108/178 (61%), Gaps = 13/178 (7%)
 Frame = +1

Query  97   SSRDLEITVISGEGLRVG----KKNVFVTVKSEFSCNVKATGVDKGGGSFPAWNEKLVVD  264
            +SR +EIT++S E L +     KKN +V  + +   N  +T  D  GG  P+WNEKL +D
Sbjct  7    ASRTIEITILSAENLSLDRKSVKKNAYVIARID-PINYGSTKADFEGGCNPSWNEKLTLD  65

Query  265  LPMHARYLTLQVQCKTFSGVKVVGEAKVPAKDFVGGFVPESYVRFLSYRLKDRKGEKNGI  444
            +P   R++TL+V+CKT SG +VVG A +P  D  G + PES++ FLSYRL+D +GEKNGI
Sbjct  66   MPFQTRFITLEVKCKTSSGDRVVGTASLPISDISGDYTPESHLHFLSYRLRDSRGEKNGI  125

Query  445  INISVRVK-------NSAAENAAVASCSSQYSRRpwtglppptgnptnAAVVTGIPVW  597
            IN+S RVK        +  +N     CSS + ++P  G+P          VVTG+PVW
Sbjct  126  INVSARVKVQVESMSPAVTKNPMRNGCSSSW-QQPTLGVPAGHQKRYYGGVVTGVPVW  182



>gb|KHN34872.1| BON1-associated protein 2 [Glycine soja]
Length=176

 Score =   137 bits (345),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 80/178 (45%), Positives = 118/178 (66%), Gaps = 14/178 (8%)
 Frame = +1

Query  100  SRDLEITVISGEGLRVGKKNV----FVTVKSEFSCN--VKATGVDKGGGSFPAWNEKLVV  261
            SR +E+T++S E L++ +K++    FVTV+S+ S +    AT VD  GGS+P+WNEK+V+
Sbjct  2    SRTVEMTILSAENLQMNRKSIRGSTFVTVQSDASSDDTSAATKVDLEGGSYPSWNEKVVM  61

Query  262  DLPMHARYLTLQVQCKTFSGVKVVGE-AKVPAKDFVGGFVPESYVRFLSYRLKDRKGEKN  438
            D+P+HAR++T++V+CKT S        A++P  DF+GG++PE+ + FLSYRL D K  +N
Sbjct  62   DVPLHARFITVEVKCKTSSSGSNSVGVAQIPVSDFIGGYMPENQLHFLSYRLWDGKVRRN  121

Query  439  GIINISVRVKNSAAENAAVASCSSQYSRRpwtglppptgnptnAAVVTGIP-VWCSYQ  609
            G+INISVRVK   AE+   +SC+   S         P     ++ VVTGIP VW +YQ
Sbjct  122  GVINISVRVK--VAEH---SSCNLN-SMSLSAVTGVPVAGDGSSGVVTGIPAVWVNYQ  173



>ref|XP_008438086.1| PREDICTED: BON1-associated protein 2-like [Cucumis melo]
Length=176

 Score =   137 bits (345),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 70/133 (53%), Positives = 97/133 (73%), Gaps = 10/133 (8%)
 Frame = +1

Query  97   SSRDLEITVISGEGLRVG----KKNVFVTVKSEFSCNVKA--TGVDKGGGSFPAWNEKLV  258
            +SR LEITVISGE +++     K  +FVTV+ E      +  T +D+ G  FP WNEKLV
Sbjct  2    ASRTLEITVISGENIQIRGKPIKSGLFVTVRPELQSENGSVNTKIDRDGDGFPRWNEKLV  61

Query  259  VDLPMHARYLTLQVQCKTFSG---VKVVGEAKVPAKDFVGGFVPESYVRFLSYRLKDRKG  429
            VDLPMHA ++ ++V C++ S    VK+VG ++VP  DFV G++PES+++FLSYRL+D +G
Sbjct  62   VDLPMHAAFVVVEV-CRSASSGRKVKIVGTSRVPVADFVAGYLPESHLQFLSYRLRDERG  120

Query  430  EKNGIINISVRVK  468
            E+NGIIN+SVRVK
Sbjct  121  ERNGIINLSVRVK  133



>ref|XP_010040910.1| PREDICTED: BON1-associated protein 1-like [Eucalyptus grandis]
 gb|KCW44795.1| hypothetical protein EUGRSUZ_L01643 [Eucalyptus grandis]
Length=183

 Score =   135 bits (341),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 79/180 (44%), Positives = 111/180 (62%), Gaps = 11/180 (6%)
 Frame = +1

Query  94   TSSRDLEITVISGEGLRVG----KKNVFVTVKSEFSCNV---KATGVDKGGGSFPAWNEK  252
            T +R LE+T+ISGE LR+     K N FVTVK++  C+     +T  D  G S+P W+EK
Sbjct  4    THNRSLEVTIISGEDLRINDRPIKNNAFVTVKADSCCSPSSQDSTKPDAQGESYPYWDEK  63

Query  253  LVVDLPMHARYLTLQVQCKTFS-GVKVVGEAKVPAKDFVGGFVPESYVRFLSYRLKDRKG  429
            L V+LP  +RY+ ++V  ++FS G K+VG A +P  DF+G + PE+Y+ FLSYRL+D KG
Sbjct  64   LRVELPAGSRYIVVEVCRRSFSTGDKLVGTAWIPVSDFIGDYTPENYLHFLSYRLRDAKG  123

Query  430  EKNGIINISVRVKNSAAENAAVASCSSQYSRRpwtglppptgnptnAAVVTGIPVWCSYQ  609
             +NGIINISVRV +S+ +    +SCSS+           P     +   VTG+P W   Q
Sbjct  124  LRNGIINISVRVVSSSYK--GTSSCSSR-PPPLVPWFRMPADRENHGGTVTGVPAWYPNQ  180



>ref|XP_011023397.1| PREDICTED: BON1-associated protein 2-like [Populus euphratica]
Length=183

 Score =   135 bits (341),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 76/178 (43%), Positives = 106/178 (60%), Gaps = 13/178 (7%)
 Frame = +1

Query  97   SSRDLEITVISGEGLRVG----KKNVFVTVKSEFSCNVKATGVDKGGGSFPAWNEKLVVD  264
            +SR LEIT++S E L +     KKN +V  + +   N  +T  D  GG  P+WNEKL +D
Sbjct  7    ASRTLEITILSAENLSLDRKSVKKNAYVIARID-PINYGSTKADFEGGCNPSWNEKLTLD  65

Query  265  LPMHARYLTLQVQCKTFSGVKVVGEAKVPAKDFVGGFVPESYVRFLSYRLKDRKGEKNGI  444
            +P    ++TL+V+CKT SG +VVG A +P  D    + PESY+ FLSYRL+D +GEKNGI
Sbjct  66   MPFQTHFITLEVKCKTSSGDRVVGTASLPISDISSDYTPESYLHFLSYRLRDSRGEKNGI  125

Query  445  INISVRVK-------NSAAENAAVASCSSQYSRRpwtglppptgnptnAAVVTGIPVW  597
            IN+S RVK        +  +N     CSS + ++P  G+P          VVTG+P+W
Sbjct  126  INVSARVKVQVESMSLAVTKNPMRNGCSSSW-QQPTLGVPAGHQKSYYGGVVTGVPIW  182



>ref|XP_002320774.1| BON association protein 1 [Populus trichocarpa]
 gb|EEE99089.1| BON association protein 1 [Populus trichocarpa]
Length=184

 Score =   135 bits (341),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 74/178 (42%), Positives = 113/178 (63%), Gaps = 13/178 (7%)
 Frame = +1

Query  97   SSRDLEITVISGEGLRVGKKNV----FVTVKSEFSCNVKATGVDKGGGSFPAWNEKLVVD  264
            +SR +E+TV+S E LR+ +K+V    +V  ++    N  +T  D  GGS P+WNEKL +D
Sbjct  8    ASRTVEVTVLSAENLRLDRKSVKKGTYVIARAS-PLNSGSTKADFEGGSNPSWNEKLTLD  66

Query  265  LPMHARYLTLQVQCKTFSGVKVVGEAKVPAKDFVGGFVPESYVRFLSYRLKDRKGEKNGI  444
            +P   R+++L+V+CKT SG +V+G A +P  D +G + PE+++ FLSYRL+D  G +NG+
Sbjct  67   IPFQTRFISLEVKCKTSSGDRVIGTASLPISDILGDYTPENHLHFLSYRLRDSSGGRNGV  126

Query  445  INISVRVK-------NSAAENAAVASCSSQYSRRpwtglppptgnptnAAVVTGIPVW  597
            IN+S RVK        SA +N +   CSS + ++P  G+P        + VVTG+PVW
Sbjct  127  INVSARVKMPVDSVCPSATKNPSGYGCSSSW-QQPALGVPVGHQQNYYSGVVTGVPVW  183



>ref|NP_001237568.1| uncharacterized protein LOC100527030 [Glycine max]
 gb|ACU16067.1| unknown [Glycine max]
Length=170

 Score =   133 bits (334),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 78/173 (45%), Positives = 113/173 (65%), Gaps = 14/173 (8%)
 Frame = +1

Query  115  ITVISGEGLRVGKKNV----FVTVKSEFSCN--VKATGVDKGGGSFPAWNEKLVVDLPMH  276
            +T++S E L++ +K +    F TV+S+ S +    AT VD  GGS+P+WNEK+V+D+P+H
Sbjct  1    MTILSAENLQMNRKPIRGSTFATVQSDASSDDTSAATKVDLEGGSYPSWNEKVVMDVPLH  60

Query  277  ARYLTLQVQCKTFS-GVKVVGEAKVPAKDFVGGFVPESYVRFLSYRLKDRKGEKNGIINI  453
            AR++T++V+CKT S G   V  A+ P  DF+GG++PE+ + FLSYRL D K  +NG+INI
Sbjct  61   ARFITVEVKCKTSSSGSNSVDVAQTPVSDFIGGYMPENQLHFLSYRLWDGKVRRNGVINI  120

Query  454  SVRVKNSAAENAAVASCSSQYSRRpwtglppptgnptnAAVVTGIP-VWCSYQ  609
            SVRVK   AE+   +SC+   S         P     ++ VVTGIP VW +YQ
Sbjct  121  SVRVK--VAEH---SSCNLN-SMSLSAVTGVPVTGDGSSGVVTGIPAVWVNYQ  167



>ref|XP_007156626.1| hypothetical protein PHAVU_002G004000g [Phaseolus vulgaris]
 gb|ESW28620.1| hypothetical protein PHAVU_002G004000g [Phaseolus vulgaris]
Length=179

 Score =   133 bits (334),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 80/181 (44%), Positives = 117/181 (65%), Gaps = 17/181 (9%)
 Frame = +1

Query  100  SRDLEITVISGEGLRVGKK----NVFVTVKSEFSCNVKA-TGVDKGGGSFPAWNEKLVVD  264
            SR +E+TV+S E L++ +K    N FVTV S+ S +  A T VD  GGS+P+WNEK+VV+
Sbjct  2    SRTVEVTVLSAENLQMNRKPARGNTFVTVHSDASTDAGAVTKVDSEGGSYPSWNEKVVVN  61

Query  265  LPMHARYLTLQVQCKTFSGVKV-----VGEAKVPAKDFVGGFVPESYVRFLSYRLKDRKG  429
            +P+HAR+++++V+CKT S   +     VG A++P  DF+GG+VPE+ + FLSYRL D   
Sbjct  62   VPLHARFISVEVKCKTSSSSSLTGSNSVGVARIPVSDFIGGYVPENQLHFLSYRLWDGNV  121

Query  430  EKNGIINISVRVKNSAAENAAVASCSSQYSRRpwtglppptgnptnAAVVTGIP-VWCSY  606
             +NG+INISVRVK    E ++ +S S  ++         P     +  VVTGIP +W +Y
Sbjct  122  RRNGVINISVRVK--VPERSSCSSSSMSFA----AVTGVPVAGNGSTGVVTGIPALWLNY  175

Query  607  Q  609
            Q
Sbjct  176  Q  176



>ref|XP_011016831.1| PREDICTED: BON1-associated protein 2-like [Populus euphratica]
Length=184

 Score =   132 bits (332),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 74/178 (42%), Positives = 109/178 (61%), Gaps = 13/178 (7%)
 Frame = +1

Query  97   SSRDLEITVISGEGLRVG----KKNVFVTVKSEFSCNVKATGVDKGGGSFPAWNEKLVVD  264
            +SR +E+TV+S E LR+     KKN +VT ++    N  +T  D  GGS P+WNEKL +D
Sbjct  8    ASRTIEVTVLSAENLRLDRKSVKKNTYVTARAS-PLNSGSTKADFEGGSNPSWNEKLTLD  66

Query  265  LPMHARYLTLQVQCKTFSGVKVVGEAKVPAKDFVGGFVPESYVRFLSYRLKDRKGEKNGI  444
            +P    +++L+V CKT SG +V+G A +P  D +  + PE+++ FLSYRL+D KG +NG+
Sbjct  67   MPFQTSFISLEVICKTSSGDRVIGTANLPISDILEDYTPENHLHFLSYRLRDSKGGRNGV  126

Query  445  INISVRVK-------NSAAENAAVASCSSQYSRRpwtglppptgnptnAAVVTGIPVW  597
            IN+S RVK        S  +N     CSS + ++P  G+P        + VVTG+PVW
Sbjct  127  INVSARVKMPVDSVCPSVTKNPIGYGCSSSW-QQPALGVPVGHQKNYYSGVVTGVPVW  183



>gb|KDO86040.1| hypothetical protein CISIN_1g036193mg, partial [Citrus sinensis]
Length=198

 Score =   132 bits (333),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 81/192 (42%), Positives = 110/192 (57%), Gaps = 20/192 (10%)
 Frame = +1

Query  82   FDMETS----SRDLEITVISGEGLRVG----KKNVFVTVKSEFSCNVKATGVDKGGGSFP  237
              ME S    SR +EITV+S E LRV     KK  F  VK +   N + T VD  GGS+P
Sbjct  12   LHMENSCSSHSRTVEITVLSAEDLRVDGRSVKKKAFAVVKLD-PFNNRVTKVDAIGGSYP  70

Query  238  AWNEKLVVDLPMHARYLTLQVQCKTFSGV--KVVGEAKVPAKDFVGGFVPESYVRFLSYR  411
            AW+EKLV+ LPMH  ++TL+VQC+T SG   ++VG A +   DF+GG+VPE+++ FLSY 
Sbjct  71   AWDEKLVMKLPMHVTFITLEVQCRTCSGSGDRLVGRATLLVSDFIGGYVPENHLNFLSYL  130

Query  412  LKDRKGEKNGIINISVRVKNSAAENAAVASCSSQY-----SRRpwtglppptgnptnAAV  576
            L+D +G ++GI+N+SVRVK    E + +    S+Y     S                  +
Sbjct  131  LRDARGIRSGILNVSVRVK----EGSGLGLLKSRYEYCSSSPSAQQKPVIGADAKKFNGL  186

Query  577  VTGIPVWCSYQV  612
            V  IPVW  Y V
Sbjct  187  VAEIPVWNPYPV  198



>ref|XP_006445134.1| hypothetical protein CICLE_v10022449mg [Citrus clementina]
 ref|XP_006491025.1| PREDICTED: BON1-associated protein 2-like [Citrus sinensis]
 gb|ESR58374.1| hypothetical protein CICLE_v10022449mg [Citrus clementina]
Length=185

 Score =   132 bits (332),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 78/184 (42%), Positives = 108/184 (59%), Gaps = 16/184 (9%)
 Frame = +1

Query  94   TSSRDLEITVISGEGLRVG----KKNVFVTVKSEFSCNVKATGVDKGGGSFPAWNEKLVV  261
            + SR +EITV+S E LRV     KK  F  VK +   N + T VD  GGS+PAW+EKLV+
Sbjct  7    SHSRTVEITVLSAEDLRVDGRSVKKKAFAVVKLD-PFNNRVTKVDAIGGSYPAWDEKLVM  65

Query  262  DLPMHARYLTLQVQCKTFSGV--KVVGEAKVPAKDFVGGFVPESYVRFLSYRLKDRKGEK  435
             LPMH  ++TL+VQC+T SG   ++VG A +   DF+GG+VPE+++ FLSY L+D +G +
Sbjct  66   KLPMHVTFITLEVQCRTCSGSGDRLVGRATLLVSDFIGGYVPENHLNFLSYLLRDARGIR  125

Query  436  NGIINISVRVKNSAAENAAVASCSSQY-----SRRpwtglppptgnptnAAVVTGIPVWC  600
            +GI+N+SVRVK    E + +    S+Y     S                  +V  IPVW 
Sbjct  126  SGILNVSVRVK----EGSGLGLLKSRYEYCSSSPSAQQKPVIGADAKKFNGLVAEIPVWN  181

Query  601  SYQV  612
             Y V
Sbjct  182  PYPV  185



>ref|XP_004134335.1| PREDICTED: BON1-associated protein 2-like [Cucumis sativus]
 gb|KGN56544.1| hypothetical protein Csa_3G123170 [Cucumis sativus]
Length=176

 Score =   131 bits (330),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 66/126 (52%), Positives = 85/126 (67%), Gaps = 5/126 (4%)
 Frame = +1

Query  100  SRDLEITVISGEGLRVG----KKNVFVTVKSEFSCNVKATGVDKGGGSFPAWNEKLVVDL  267
            SR LEITVIS E L       KKN F +VK + S N  +T +D  GGS+P WN +L ++L
Sbjct  6    SRTLEITVISAEDLHRHRKPIKKNSFASVKID-SQNPVSTQIDDKGGSYPLWNNRLALEL  64

Query  268  PMHARYLTLQVQCKTFSGVKVVGEAKVPAKDFVGGFVPESYVRFLSYRLKDRKGEKNGII  447
            P +  ++T+ V    FS  K+VG   VP  DF+ GF+PESY+ FLSYRL+D KGE+NGI+
Sbjct  65   PSNVSFMTIDVHSGNFSRHKIVGTVNVPVSDFLSGFLPESYLHFLSYRLRDGKGERNGIV  124

Query  448  NISVRV  465
            NISVRV
Sbjct  125  NISVRV  130



>ref|XP_010255486.1| PREDICTED: BON1-associated protein 2 [Nelumbo nucifera]
Length=176

 Score =   131 bits (329),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 64/126 (51%), Positives = 90/126 (71%), Gaps = 6/126 (5%)
 Frame = +1

Query  100  SRDLEITVISGEGLRVG----KKNVFVTVKSEFSCNVKATGVDKGGGSFPAWNEKLVVDL  267
            S +LEI VIS E LR+     KKN FV V+++ S N ++T VD  GGS+P WNEKL + L
Sbjct  8    SLELEINVISAEDLRLRHRSIKKNAFVVVRTD-SHNYRSTRVDTEGGSYPYWNEKLNLAL  66

Query  268  PMHARYLTLQVQCKTFSG-VKVVGEAKVPAKDFVGGFVPESYVRFLSYRLKDRKGEKNGI  444
            P  A+++T++VQCKT SG  + VG A +P  DF+G + P  Y+ FLSYRL+++ GE+NGI
Sbjct  67   PNSAKFITVEVQCKTASGRARSVGTASIPVSDFIGDYTPAYYLHFLSYRLREQNGERNGI  126

Query  445  INISVR  462
            +N+S+R
Sbjct  127  VNLSIR  132



>ref|XP_008439354.1| PREDICTED: BON1-associated protein 2-like [Cucumis melo]
Length=173

 Score =   130 bits (327),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 65/130 (50%), Positives = 86/130 (66%), Gaps = 5/130 (4%)
 Frame = +1

Query  88   METSSRDLEITVISGEGLRVGKK----NVFVTVKSEFSCNVKATGVDKGGGSFPAWNEKL  255
            M   SR LEITVIS E L   +K    N F +VK + S N+ +T +D  GGS+P WN++L
Sbjct  1    MAPISRTLEITVISAEDLHRHRKPITKNSFASVKID-SQNLGSTHIDDKGGSYPLWNDRL  59

Query  256  VVDLPMHARYLTLQVQCKTFSGVKVVGEAKVPAKDFVGGFVPESYVRFLSYRLKDRKGEK  435
             + LP    ++T+ V    FS  K+VG   +P  DF+ GF+PESY+ FLSYRL+D KGE+
Sbjct  60   ALKLPSTVSFMTIDVHSGNFSRHKIVGTVNIPVSDFLSGFLPESYLHFLSYRLRDGKGER  119

Query  436  NGIINISVRV  465
            NGI+NISVRV
Sbjct  120  NGIVNISVRV  129



>ref|XP_011035593.1| PREDICTED: BON1-associated protein 2-like [Populus euphratica]
Length=184

 Score =   130 bits (327),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 73/178 (41%), Positives = 109/178 (61%), Gaps = 13/178 (7%)
 Frame = +1

Query  97   SSRDLEITVISGEGLRVG----KKNVFVTVKSEFSCNVKATGVDKGGGSFPAWNEKLVVD  264
            +SR +E+TV+S E LR+     KKN +VT ++    N  +T  D  GGS P+WNEKL ++
Sbjct  8    ASRTIEVTVLSAENLRLDRKSVKKNTYVTARAS-PLNSGSTKADFEGGSNPSWNEKLTLE  66

Query  265  LPMHARYLTLQVQCKTFSGVKVVGEAKVPAKDFVGGFVPESYVRFLSYRLKDRKGEKNGI  444
            +P    +++L+V CKT SG +V+G A +P  D +  + PE+++ FLSYRL+D KG +NG+
Sbjct  67   MPFQTSFISLEVICKTNSGDRVIGTASLPISDILEDYTPENHLHFLSYRLRDSKGGRNGV  126

Query  445  INISVRVK-------NSAAENAAVASCSSQYSRRpwtglppptgnptnAAVVTGIPVW  597
            IN+S RVK        S  +N     CSS + ++P  G+P        + VVTG+PVW
Sbjct  127  INVSARVKMPVDSVCPSVTKNPIGYGCSSSW-QQPALGVPVGHQKNYYSGVVTGVPVW  183



>ref|XP_010055220.1| PREDICTED: BON1-associated protein 2-like [Eucalyptus grandis]
Length=180

 Score =   129 bits (323),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 79/180 (44%), Positives = 108/180 (60%), Gaps = 14/180 (8%)
 Frame = +1

Query  94   TSSRDLEITVISGEGLRVG----KKNVFVTVKSEFSCNV---KATGVDKGGGSFPAWNEK  252
            T  R LE+TVISGE LR+     K N FVTVK++   +     +T  D  G S+P W+EK
Sbjct  4    THHRRLEVTVISGEDLRINDKSIKNNAFVTVKADSHSSTSLYDSTKPDGRGESYPYWDEK  63

Query  253  LVVDLPMHARYLTLQVQCKT-FSGVKVVGEAKVPAKDFVGGFVPESYVRFLSYRLKDRKG  429
            L VDLP  +RYL ++V  ++  +G  +VG A +P  DFVGG+ PE+Y  FLSYRL+D KG
Sbjct  64   LPVDLPAGSRYLVVEVHRRSSLAGDVLVGTAWIPVSDFVGGYAPENYQHFLSYRLRDAKG  123

Query  430  EKNGIINISVRVKNSAAENAAVASCSSQYSRRpwtglppptgnptnAAVVTGIPVWCSYQ  609
            ++NGIINISVR+  S+ +  + +S SS            P     N+  VTG+P+W   Q
Sbjct  124  QRNGIINISVRMVTSSYKGTSSSSSSS------VPEFGIPMDREKNSRTVTGVPIWYPNQ  177



>gb|KHN42635.1| BON1-associated protein 2 [Glycine soja]
Length=406

 Score =   133 bits (335),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 77/173 (45%), Positives = 112/173 (65%), Gaps = 12/173 (7%)
 Frame = +1

Query  100  SRDLEITVISGEGLRVGKKNV----FVTVKSEFSCNVKA-TGVDKGGGSFPAWNEKLVVD  264
            SR +E+T++S E L++ +K++    FVTV+S+ S +  A T VD  GGS+P+WNEK+V+D
Sbjct  2    SRTVEMTILSAENLQMNRKSIRGSTFVTVQSDTSSDTSAATKVDSEGGSYPSWNEKVVMD  61

Query  265  LPMHARYLTLQVQCKTFSGVKVVGE-AKVPAKDFVGGFVPESYVRFLSYRLKDRKGEKNG  441
            +P+HAR++T++V+CKT S        A++P  DF+GG++PE+ + FLSYRL D K  +NG
Sbjct  62   VPLHARFITVEVKCKTSSSGSNSVGVAQIPVSDFIGGYMPENQLHFLSYRLWDGKVRRNG  121

Query  442  IINISVRVKNSAAENAAVASCSSQYSRRpwtglppptgnptnAAVVTGIPVWC  600
            +INISVRVK   AE+   +SC+   S         P        VVTGIP  C
Sbjct  122  VINISVRVK--VAEH---SSCNLN-SMSLSAVTGVPVAGNGPTGVVTGIPAVC  168



>gb|KEH18937.1| C2 domain protein [Medicago truncatula]
Length=179

 Score =   127 bits (320),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 81/177 (46%), Positives = 115/177 (65%), Gaps = 9/177 (5%)
 Frame = +1

Query  100  SRDLEITVISGEGLRVGKK----NVFVTVKSEFSC-NVKATGVDKGGGSFPAWNEKLVVD  264
            SR +EIT++S E L+  KK    N FVTV+ + S   V  T +D  GGS+P WNEKLV+D
Sbjct  2    SRTIEITILSAENLQENKKAIKGNTFVTVQCDGSNREVSTTKLDSEGGSYPTWNEKLVMD  61

Query  265  LPMHARYLTLQVQCKTF-SGVKVVGEAKVPAKDFVGGFVPESYVRFLSYRLKDRKGEKNG  441
            +P+HAR+LT++V+ KT  S    VG A++P  DF+GG+V E+ ++FLSYRL D +  +NG
Sbjct  62   VPLHARFLTIEVKYKTRGSSSNSVGMARIPVSDFLGGYVHENQLQFLSYRLWDNRVRRNG  121

Query  442  IINISVRVKNSAAENAAVASCSSQYSRRpwtglppptgnptnAAVVTGIP-VWCSYQ  609
            ++NISV+VK S   + + +  S+           P TGN + + VVTGIP VW +YQ
Sbjct  122  VVNISVKVKMSQQNSCSSSMSSTVSG--VPVTGVPVTGNGSCSGVVTGIPAVWLNYQ  176



>gb|KEH18936.1| BON1-associated-like protein [Medicago truncatula]
Length=179

 Score =   127 bits (320),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 79/177 (45%), Positives = 114/177 (64%), Gaps = 9/177 (5%)
 Frame = +1

Query  100  SRDLEITVISGEGLRVGKK----NVFVTVKSEFSCN-VKATGVDKGGGSFPAWNEKLVVD  264
            SR +EIT++S E L+  KK    N FVTV+ + S N V  T +D  GGS+P WNEK+V+D
Sbjct  2    SRTIEITILSAENLQENKKAIKGNTFVTVQCDGSNNEVSTTKLDSEGGSYPTWNEKVVID  61

Query  265  LPMHARYLTLQVQCKTF-SGVKVVGEAKVPAKDFVGGFVPESYVRFLSYRLKDRKGEKNG  441
            +P+HAR++T++V+ KT  S    VG A++P  DFVGG+V E+ ++FLSYRL D +  +NG
Sbjct  62   VPLHARFVTIEVKYKTRGSSSNSVGMARIPVSDFVGGYVHENQLQFLSYRLWDNRVMRNG  121

Query  442  IINISVRVKNSAAENAAVASCSSQYSRRpwtglppptgnptnAAVVTGIP-VWCSYQ  609
            ++NISV+VK S   + + +  S+           P  GN + + V TGIP VW +YQ
Sbjct  122  VVNISVKVKMSQQNSCSSSMSSTMNG--VPVTGVPVAGNGSCSRVATGIPAVWLNYQ  176



>ref|XP_010693564.1| PREDICTED: BON1-associated protein 2-like [Beta vulgaris subsp. 
vulgaris]
Length=135

 Score =   125 bits (315),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 63/126 (50%), Positives = 84/126 (67%), Gaps = 9/126 (7%)
 Frame = +1

Query  103  RDLEITVISGEGLRVG----KKNVFVTVKSEFSCNVKATGVDKGGGSFPAWNEKLVVDLP  270
            R LEI +IS + LR+     KKN    V+S+ S NV +T +DK GGSFP W++K  + LP
Sbjct  10   RILEINIISAQDLRIDGRSIKKNAIAYVRSDPS-NVGSTKIDKEGGSFPVWDDKFDLKLP  68

Query  271  MHARYLTLQVQCKTFSGVKVVGEAKVPAKDFVGGFVPESYVRFLSYRLKDRKGEKNGIIN  450
            MHAR L +QV C      K++G A +P  DF+G + P SY+ FL YRL+D++G  NGIIN
Sbjct  69   MHARNLVVQVLCDK----KLIGSATIPTSDFIGDYTPSSYLHFLCYRLRDQRGVCNGIIN  124

Query  451  ISVRVK  468
            +SVRVK
Sbjct  125  LSVRVK  130



>ref|XP_011469060.1| PREDICTED: BON1-associated protein 2 [Fragaria vesca subsp. vesca]
Length=137

 Score =   125 bits (313),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 62/129 (48%), Positives = 88/129 (68%), Gaps = 7/129 (5%)
 Frame = +1

Query  97   SSRDLEITVISGEGLRVG----KKNVFVTVKSEFSCNVK-ATGVDKGGGSFPAWNEKLVV  261
            SSR +EITV+S E L+      KKN FVTV++  +   +  TG     G  P WNEK+V+
Sbjct  5    SSRLVEITVLSAENLQYNRKPLKKNSFVTVRTNLAVTKRYRTGQTDCEGGVPKWNEKIVM  64

Query  262  DLPMHARYLTLQVQCKTFSGVKVVGEAKVPAKDFVGGFVPESYVRFLSYRLKDRKGEKNG  441
            + P  AR L ++VQC+  +G + +G A +P  DF+GG+VPE+Y+ FLSYRL+D +G +NG
Sbjct  65   EFPAQARNLIVEVQCQ--NGARTIGAASIPVSDFIGGWVPENYLHFLSYRLRDERGLRNG  122

Query  442  IINISVRVK  468
            I+NISVR+K
Sbjct  123  IVNISVRMK  131



>gb|AFK45660.1| unknown [Medicago truncatula]
 gb|KEH18934.1| BON1-associated-like protein [Medicago truncatula]
Length=178

 Score =   126 bits (316),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 77/176 (44%), Positives = 112/176 (64%), Gaps = 8/176 (5%)
 Frame = +1

Query  100  SRDLEITVISGEGLRVGKK----NVFVTVKSEFSCN-VKATGVDKGGGSFPAWNEKLVVD  264
            S+ +EIT++S E L+  KK    N FV V+ + S N V  T +D  GGS+P WNEK+V+D
Sbjct  2    SQTIEITILSAENLQENKKAIKGNTFVMVQCDGSNNEVSTTKLDSEGGSYPTWNEKVVID  61

Query  265  LPMHARYLTLQVQCKTFSGVKVVGEAKVPAKDFVGGFVPESYVRFLSYRLKDRKGEKNGI  444
            +P+HAR++T++V+ KT      VG A+VP  DFVGG+V E+ ++FLSYRL D +  +NG+
Sbjct  62   VPLHARFVTIEVKYKTRGSSNSVGIARVPVSDFVGGYVHENQLQFLSYRLWDNRVMRNGV  121

Query  445  INISVRVKNSAAENAAVASCSSQYSRRpwtglppptgnptnAAVVTGIP-VWCSYQ  609
            +NISV+VK S   + + +  S+           P  GN + + V TGIP VW +YQ
Sbjct  122  VNISVKVKMSQQNSCSSSMSSTMNG--VPVTGVPVAGNGSCSRVATGIPAVWLNYQ  175



>gb|KEH18933.1| BON1-associated-like protein [Medicago truncatula]
Length=179

 Score =   126 bits (316),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 65/129 (50%), Positives = 93/129 (72%), Gaps = 6/129 (5%)
 Frame = +1

Query  100  SRDLEITVISGEGLRVGKK----NVFVTVKSEFSCN-VKATGVDKGGGSFPAWNEKLVVD  264
            S+ +EIT++S E L+  KK    N FVTV+ + S N V  T +D  GGS+P WNEK+V+D
Sbjct  2    SQTIEITILSAENLQENKKAIKGNTFVTVQCDGSNNEVSTTKLDSEGGSYPTWNEKVVID  61

Query  265  LPMHARYLTLQVQCKTF-SGVKVVGEAKVPAKDFVGGFVPESYVRFLSYRLKDRKGEKNG  441
            +P+HAR++T++V+ KT  S    VG A+VP  DFVGG+V E+ ++FLSYRL D +  +NG
Sbjct  62   MPLHARFVTIEVKYKTRGSSSNSVGIARVPVSDFVGGYVHENQLQFLSYRLWDNRVMRNG  121

Query  442  IINISVRVK  468
            ++NISV+VK
Sbjct  122  VVNISVKVK  130



>emb|CDP21768.1| unnamed protein product [Coffea canephora]
Length=134

 Score =   124 bits (311),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 63/133 (47%), Positives = 83/133 (62%), Gaps = 4/133 (3%)
 Frame = +1

Query  211  VDKGGGSFPAWNEKLVVDLPMHARYLTLQVQCKTFSGVKVVGEAKVPAKDFVGGFVPESY  390
            +DK GG  PAW+EK V+D+PMHARY T +V+CKT +G ++VG A +PA DF+G +VPE+Y
Sbjct  1    MDKDGGGHPAWDEKFVMDMPMHARYFTAEVRCKTAAGSRIVGTAVIPASDFLGDYVPENY  60

Query  391  VRFLSYRLKDRKGEKNGIINI-SVRVKNSAAENAAVASCSSQY---SRRpwtglppptgn  558
            + FLSYRL D  GE+NGI+N+      +S+ +NA    CSS     S             
Sbjct  61   LHFLSYRLWDSHGERNGILNLSVRVKSSSSVKNAYGGGCSSHSAGCSCPWSGIAVGGQQV  120

Query  559  ptnAAVVTGIPVW  597
                 VVTGIPVW
Sbjct  121  SNGEGVVTGIPVW  133



>ref|XP_004134334.1| PREDICTED: BON1-associated protein 2-like [Cucumis sativus]
 gb|KGN56542.1| hypothetical protein Csa_3G122660 [Cucumis sativus]
Length=183

 Score =   125 bits (314),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 75/182 (41%), Positives = 111/182 (61%), Gaps = 13/182 (7%)
 Frame = +1

Query  94   TSSRDLEITVISGEGLRVGKKNV----FVTVKSE---FSCNVKAT-GVDKGGGSFPAWNE  249
            TS R +EITV+SGE LR+ +K V    F TVK +   F     +T  +D+ GGS+P WNE
Sbjct  4    TSFRSIEITVVSGEDLRIDRKPVKRKTFATVKFDRQSFGGGGGSTENIDERGGSYPLWNE  63

Query  250  KLVVDLPMHARYLTLQVQCKTFSGVKVVGEAKVPAKDFVGGFVPESYVRFLSYRLKDRKG  429
            K+ +++P+   +LT++V   + S  ++VG A VP  DF+G + PESY+  LSYRL+D  G
Sbjct  64   KMGLEIPVDTVFLTIEVHYCSNSRNRIVGTANVPVSDFLGRYRPESYLHLLSYRLRDGNG  123

Query  430  EKNGIINISVRVKNSAAENAAVASCSSQYSRRpwtglppptgnptnAAVVTGIPVW--CS  603
            E+NGI+NISVRVK    E+ +  + +S+ + R            +   VV G+P+W  CS
Sbjct  124  ERNGIVNISVRVKE--LESDSEPAIASKATVR-VPVAETAAFCRSRGGVVIGVPIWSSCS  180

Query  604  YQ  609
            Y+
Sbjct  181  YK  182



>ref|XP_010523731.1| PREDICTED: BON1-associated protein 2-like [Tarenaya hassleriana]
Length=194

 Score =   125 bits (315),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 75/193 (39%), Positives = 115/193 (60%), Gaps = 21/193 (11%)
 Frame = +1

Query  88   METSSRDLEITVISGEGLRV------GKKNVFVTVKSEFSCNVKATGVDKGGGSFPAWNE  249
            M   SR LEITVIS E LRV       ++N F  VK+    NV+ T  D+ GG+ P WN+
Sbjct  1    MYPMSRRLEITVISAEDLRVNRRPISARRNTFAVVKT-VPFNVRKTKADECGGTHPKWND  59

Query  250  KLVVDLPMHAR--YLTLQVQCKTFSGV-KVVGEAKVPAKDFVGGFVPESYVRFLSYRLKD  420
            K  V++PM+ R  +++++V  +T SG  K VG A++P  DF+GG+ PE ++ FLSYRL+D
Sbjct  60   KFEVEMPMNGRSQFVSVEVCYRTGSGSEKQVGFARIPVTDFMGGYYPEGHLNFLSYRLRD  119

Query  421  RKGEKNGIINISVRV--------KNSAAENAAV--ASCSSQYSRRpwtglppptgnptnA  570
              G+K+G++N+S+RV        + +A +   V  ++CSS ++   W          +  
Sbjct  120  EYGDKSGVVNVSIRVEPDSRFGQQKTAEKKPTVDFSACSS-HAVGFWRPEKTIGTAVSGG  178

Query  571  AVVTGIPVWCSYQ  609
             +VTG+P+WC YQ
Sbjct  179  QIVTGVPIWCGYQ  191



>ref|XP_004308401.1| PREDICTED: BON1-associated protein 1 [Fragaria vesca subsp. vesca]
Length=181

 Score =   125 bits (314),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 76/183 (42%), Positives = 108/183 (59%), Gaps = 21/183 (11%)
 Frame = +1

Query  97   SSRDLEITVISGEGLRVG----KKNVFVTVKSE-FSCNVKATGVDKGGGSFPAWNEKLVV  261
            ++R +EITV+S E L+      KKN FVTV+++     V  T      G  P WNEK+V+
Sbjct  2    ATRSIEITVLSAENLQSNRKPLKKNSFVTVRTDSLVTKVYRTAETDCEGGGPKWNEKIVM  61

Query  262  DLPMHARYLTLQVQCKTFSGVKVVGEAKVPAKDFVGGFVPESYVRFLSYRLKDRKGEKNG  441
            ++P HA+ L L+VQC+  +G + +G A +P  +F GG+VPESY+ FLSYRL+D +G +NG
Sbjct  62   EVPAHAKNLILEVQCQ--NGARPIGAASIPVTEFTGGWVPESYLHFLSYRLRDERGVRNG  119

Query  442  IINISVRVKNSAAENAAVASCSSQYSRRpwtglppptgnpt-------nAAVVTGIPV-W  597
            I+NISVR+K            SS Y R+  +G    +           N+AV TG+PV W
Sbjct  120  IVNISVRMK------VEEGGTSSMYGRKLSSGCASTSSQVKLGYPVVDNSAVATGVPVNW  173

Query  598  CSY  606
             SY
Sbjct  174  KSY  176



>ref|XP_010544695.1| PREDICTED: BON1-associated protein 2-like isoform X1 [Tarenaya 
hassleriana]
Length=194

 Score =   125 bits (314),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 73/188 (39%), Positives = 109/188 (58%), Gaps = 24/188 (13%)
 Frame = +1

Query  100  SRDLEITVISGEGLRV------GKKNVFVTVKSEFSCNVKATGVDKGGGSFPAWNEKLVV  261
            SR LEIT+IS E LRV      G++N F  VK++   NV+ T  D+ GGS P WN+K  +
Sbjct  2    SRHLEITLISAEDLRVNRRPIAGRRNTFAVVKTD-PFNVRKTKPDECGGSHPTWNDKFEM  60

Query  262  DLPMHAR--YLTLQVQCKTFSGV-KVVGEAKVPAKDFVGGFVPESYVRFLSYRLKDRKGE  432
            ++PM+ R  +++++V  +T SG  K +G A +PA DF+GG+ PE ++ FLSYRL+D  G+
Sbjct  61   EMPMNGRVQFVSVEVLYRTGSGSEKQIGLATIPATDFIGGYSPEGHLNFLSYRLRDEYGD  120

Query  433  KNGIINISVRVK---------NSAAENAAVAS---CSSQYSRRpwtglppptgnptnAAV  576
            K+GI+N+S+RVK             E    A+   CSS  +              +   +
Sbjct  121  KSGIVNVSIRVKPDPRFGPEKTPTTEKKPAANYSVCSSPAA--GLWRPATTMTAFSGGRI  178

Query  577  VTGIPVWC  600
            VTG+P+WC
Sbjct  179  VTGVPIWC  186



>ref|XP_010058155.1| PREDICTED: BON1-associated protein 1-like [Eucalyptus grandis]
 gb|KCW71684.1| hypothetical protein EUGRSUZ_E00200 [Eucalyptus grandis]
Length=183

 Score =   124 bits (312),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 74/178 (42%), Positives = 104/178 (58%), Gaps = 11/178 (6%)
 Frame = +1

Query  100  SRDLEITVISGEGLRVG----KKNVFVTVKSEFSCNV---KATGVDKGGGSFPAWNEKLV  258
            +R LE+T+ISGE LR+     K N FVTVK+   C+     +T  D  G S+P W+EKL 
Sbjct  6    NRSLEVTIISGEDLRINDRPIKNNAFVTVKANSRCSPSSQDSTKPDARGESYPYWDEKLH  65

Query  259  VDLPM-HARYLTLQVQCKTFSGVKVVGEAKVPAKDFVGGFVPESYVRFLSYRLKDRKGEK  435
            ++LP      +    +  + +G K+VG A +P  DF+G + PE+Y+ FLSYRL+D KG +
Sbjct  66   MELPTGSRYVVVEVRRRSSSAGDKLVGTAWIPVSDFIGDYTPENYLHFLSYRLRDAKGLR  125

Query  436  NGIINISVRVKNSAAENAAVASCSSQYSRRpwtglppptgnptnAAVVTGIPVWCSYQ  609
            NGIINISVRV +S+ +    +SCSS+           P     +   VTG+PVWC  Q
Sbjct  126  NGIINISVRVASSSYK--GTSSCSSRQP-PLVPAFRMPVDRENHGGTVTGVPVWCPNQ  180



>ref|XP_002320329.2| hypothetical protein POPTR_0014s07460g [Populus trichocarpa]
 gb|EEE98644.2| hypothetical protein POPTR_0014s07460g [Populus trichocarpa]
Length=161

 Score =   124 bits (310),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 62/127 (49%), Positives = 87/127 (69%), Gaps = 6/127 (5%)
 Frame = +1

Query  91   ETSS-RDLEITVISGEGLRVG----KKNVFVTVKSEFSCNVKATGVDKGGGSFPAWNEKL  255
            ETSS   LEITV+S E LRV     KKN  V V+++   N + T  D  GGS+P+W++KL
Sbjct  8    ETSSFHTLEITVLSCEDLRVNGRSVKKNTCVVVRTD-PLNFRETTTDTEGGSYPSWDQKL  66

Query  256  VVDLPMHARYLTLQVQCKTFSGVKVVGEAKVPAKDFVGGFVPESYVRFLSYRLKDRKGEK  435
             +D+ +    +TL+V C+T S  +++G A++P  DF+GG+ PE Y+ FLSYRLKD KG +
Sbjct  67   TLDMSIRETCITLEVHCRTLSVDRIIGSARMPVSDFMGGYFPEGYLSFLSYRLKDTKGFE  126

Query  436  NGIINIS  456
            NGIIN+S
Sbjct  127  NGIINVS  133



>gb|KCW71682.1| hypothetical protein EUGRSUZ_E00198 [Eucalyptus grandis]
Length=188

 Score =   124 bits (311),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 83/185 (45%), Positives = 107/185 (58%), Gaps = 14/185 (8%)
 Frame = +1

Query  85   DMETSS-RDLEITVISGEGLRVG----KKNVFVTVKSEFSCNV----KATGVDKGGGSFP  237
            DM  S  R LE+TVISGE LR+     K N FVTVK++ SC +     +T  D    S+P
Sbjct  5    DMTNSHHRRLEVTVISGEDLRINDRPIKNNAFVTVKAD-SCGLPSSQDSTKPDAQSESYP  63

Query  238  AWNEKLVVDLPMHARYLTLQVQCKTFS-GVKVVGEAKVPAKDFVGGFVPESYVRFLSYRL  414
             W+EKL VDLP  +RY+ ++V  +T S G K V  A +P  DFVG + PE+Y+ FLSYRL
Sbjct  64   YWDEKLHVDLPAGSRYIVVEVCRRTSSAGDKFVATAWIPVSDFVGDYTPENYLHFLSYRL  123

Query  415  KDRKGEKNGIINISVRVKNSAAENAAVASCSSQYSRRpwtglppptgnptnAAVVTGIPV  594
            +D KG +NGIINISVRV +S+ +    +S     S         P     N   VTG+PV
Sbjct  124  RDAKGLRNGIINISVRVVSSSYKGTLSSSSRLPPS---VLEFRMPVDRERNGGTVTGMPV  180

Query  595  WCSYQ  609
            W   Q
Sbjct  181  WYPNQ  185



>ref|XP_010058153.1| PREDICTED: BON1-associated protein 1-like [Eucalyptus grandis]
Length=183

 Score =   123 bits (308),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 80/181 (44%), Positives = 105/181 (58%), Gaps = 13/181 (7%)
 Frame = +1

Query  94   TSSRDLEITVISGEGLRVG----KKNVFVTVKSEFSCNV----KATGVDKGGGSFPAWNE  249
            +  R LE+TVISGE LR+     K N FVTVK++ SC +     +T  D    S+P W+E
Sbjct  4    SHHRRLEVTVISGEDLRINDRPIKNNAFVTVKAD-SCGLPSSQDSTKPDAQSESYPYWDE  62

Query  250  KLVVDLPMHARYLTLQVQCKTFS-GVKVVGEAKVPAKDFVGGFVPESYVRFLSYRLKDRK  426
            KL VDLP  +RY+ ++V  +T S G K V  A +P  DFVG + PE+Y+ FLSYRL+D K
Sbjct  63   KLHVDLPAGSRYIVVEVCRRTSSAGDKFVATAWIPVSDFVGDYTPENYLHFLSYRLRDAK  122

Query  427  GEKNGIINISVRVKNSAAENAAVASCSSQYSRRpwtglppptgnptnAAVVTGIPVWCSY  606
            G +NGIINISVRV +S+ +    +S     S         P     N   VTG+PVW   
Sbjct  123  GLRNGIINISVRVVSSSYKGTLSSSSRLPPS---VLEFRMPVDRERNGGTVTGMPVWYPN  179

Query  607  Q  609
            Q
Sbjct  180  Q  180



>ref|XP_002882032.1| hypothetical protein ARALYDRAFT_483714 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH58291.1| hypothetical protein ARALYDRAFT_483714 [Arabidopsis lyrata subsp. 
lyrata]
Length=200

 Score =   122 bits (307),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 76/193 (39%), Positives = 113/193 (59%), Gaps = 21/193 (11%)
 Frame = +1

Query  94   TSSRDLEITVISGEGLRVGKKNVFVTVKSEFSCNVK--ATGVDKGGGSFPAWNEKLVVDL  267
            T  R LEI VIS EGL+V +K +     S    + K  A+ +D+ GGS+P W +K  +++
Sbjct  5    TVKRSLEIEVISAEGLKVDRKPLKKKTYSVVRIDEKSWASKLDELGGSYPIWKDKFDMEM  64

Query  268  PMHA--RYLTLQVQCKTFSGV-KVVGEAKVPAKDFVGGFVPESYVRFLSYRLKDRKGEKN  438
            P++A  R+++++V  +T SG  K VG AK+P  DF+GGF P+ ++ FLSYRL+D  G+K 
Sbjct  65   PINASVRFISIEVYYRTSSGSDKNVGYAKIPVTDFIGGFAPQGHLNFLSYRLRDEYGDKC  124

Query  439  GIINISVRVK---NSAAENAAV-----ASCS--------SQYSRRpwtglppptgnptnA  570
            GI+N+S+ VK   N  + + AV     A+CS        +Q  R   +     T      
Sbjct  125  GIVNVSIMVKPDGNDKSSSFAVAPVDYAACSWQATTASNNQMWRPRTSSSMASTAGYGGG  184

Query  571  AVVTGIPVWCSYQ  609
             VVTG+PVWC+YQ
Sbjct  185  RVVTGVPVWCAYQ  197



>ref|XP_010910674.1| PREDICTED: BON1-associated protein 2-like [Elaeis guineensis]
Length=172

 Score =   122 bits (305),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 63/133 (47%), Positives = 90/133 (68%), Gaps = 9/133 (7%)
 Frame = +1

Query  97   SSRDLEITVISGEGLRVG----KKNVFVTVKSEF--SCNVKATGVDKGGGSFPAWNEKLV  258
            +S  LEIT+IS E LR+     KKN FVTV+S    +    +T +D+ GGS+P WNEKL 
Sbjct  3    NSATLEITIISAEDLRLSHRPLKKNAFVTVRSSTLNAGGASSTSLDRDGGSYPYWNEKLE  62

Query  259  VDLPMHARYLTLQVQCKTFSGVKVVGEAKVPAKDFVGGFVPESYVRFLSYRLKDRKGEKN  438
            V LP  AR ++++V+CKT +G ++V  A +P  DF     P  Y+ FLSYRL++R GE+N
Sbjct  63   VGLPSSARSISVEVRCKTGTGERLVAVAAIPVSDFC---EPADYLHFLSYRLRERDGERN  119

Query  439  GIINISVRVKNSA  477
            GIIN+S+R+K ++
Sbjct  120  GIINLSLRMKGAS  132



>ref|XP_010544696.1| PREDICTED: BON1-associated protein 2-like isoform X2 [Tarenaya 
hassleriana]
Length=192

 Score =   121 bits (303),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 62/132 (47%), Positives = 92/132 (70%), Gaps = 10/132 (8%)
 Frame = +1

Query  100  SRDLEITVISGEGLRV------GKKNVFVTVKSEFSCNVKATGVDKGGGSFPAWNEKLVV  261
            SR LEIT+IS E LRV      G++N F  VK++   NV+ T  D+ GGS P WN+K  +
Sbjct  2    SRHLEITLISAEDLRVNRRPIAGRRNTFAVVKTD-PFNVRKTKPDECGGSHPTWNDKFEM  60

Query  262  DLPMHAR--YLTLQVQCKTFSGV-KVVGEAKVPAKDFVGGFVPESYVRFLSYRLKDRKGE  432
            ++PM+ R  +++++V  +T SG  K +G A +PA DF+GG+ PE ++ FLSYRL+D  G+
Sbjct  61   EMPMNGRVQFVSVEVLYRTGSGSEKQIGLATIPATDFIGGYSPEGHLNFLSYRLRDEYGD  120

Query  433  KNGIINISVRVK  468
            K+GI+N+S+RVK
Sbjct  121  KSGIVNVSIRVK  132



>ref|XP_003528878.1| PREDICTED: BON1-associated protein 2-like [Glycine max]
Length=179

 Score =   119 bits (299),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 70/180 (39%), Positives = 106/180 (59%), Gaps = 12/180 (7%)
 Frame = +1

Query  88   METSSRDLEITVISGEGLRVGKKNVFVTVKSE-FSCNVKATGVDKGGGSFPAWNEKLVVD  264
            M  ++R LEITVISGE LRV  ++ +V V++E  +C    T  D G     +WNEK ++D
Sbjct  1    MGINTRTLEITVISGENLRV-TEDAYVVVRAESLNCCTTRTAKDDGT-KLLSWNEKFLLD  58

Query  265  LPMHARYLTLQVQCKTFSGVKVVGEAKVPAKDFVGGFVPESYVRFLSYRLKDRKGEKNGI  444
            +PMHAR +T +VQC  F G + +G A++ A DF+GG VPE+ ++ LSY L+D +G +NG+
Sbjct  59   MPMHARSITFEVQCNRFKGFRPLGVARIAASDFLGGAVPENGLQVLSYGLRDWEGRRNGV  118

Query  445  INISVRVKNSAAENAAVASCSSQYSR------RpwtglppptgnptnAAVVTGIPVWCSY  606
            I+ +VRV   AA +++   C +          R   G     G   +  V  G+P+W +Y
Sbjct  119  IHFAVRV---AATSSSTEECLNSKPAVEPVVPRKGCGDRINVGGNKSDEVAVGVPIWWNY  175



>ref|XP_010040908.1| PREDICTED: BON1-associated protein 1-like [Eucalyptus grandis]
 gb|KCW44793.1| hypothetical protein EUGRSUZ_L01641 [Eucalyptus grandis]
Length=175

 Score =   119 bits (298),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 75/175 (43%), Positives = 102/175 (58%), Gaps = 10/175 (6%)
 Frame = +1

Query  94   TSSRDLEITVISGEGLRVG----KKNVFVTVKS--EFSCNVKATGVDKGGGSFPAWNEKL  255
            +  R LE+TVISGE LR+     K N FVTV      + +  +T  D    S+P W+EKL
Sbjct  4    SHHRRLEVTVISGEDLRINDRPIKNNAFVTVNDCCGSTSSQDSTKPDAQSESYPYWDEKL  63

Query  256  VVDLPMHARYLTLQVQCKTFS-GVKVVGEAKVPAKDFVGGFVPESYVRFLSYRLKDRKGE  432
             +DLP  +RY+ ++V  +T S G K+VG A +P  DFVG + PE+Y+ FLSYRL+D KG 
Sbjct  64   HMDLPTGSRYIVVEVCRRTSSAGDKLVGTAWIPVSDFVGDYTPENYLHFLSYRLRDAKGL  123

Query  433  KNGIINISVRVKNSAAENAAVASCSSQYSRRpwtglppptgnptnAAVVTGIPVW  597
            +NGIINISVRV +S+ +    +S     S         P     N   VTG+P+W
Sbjct  124  RNGIINISVRVVSSSYKGTLSSSSRLPPS---VLEFRMPVDRERNGGTVTGVPIW  175



>ref|XP_009133750.1| PREDICTED: BON1-associated protein 2-like [Brassica rapa]
 emb|CDY53895.1| BnaA03g56970D [Brassica napus]
Length=202

 Score =   119 bits (297),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 77/196 (39%), Positives = 108/196 (55%), Gaps = 27/196 (14%)
 Frame = +1

Query  94   TSSRDLEITVISGEGLRVGKKNV----FVTVKSEFSCNVKATGVDKGGGSFPAWNEKLVV  261
            T  R LEI +IS EGL+V +K V    F  V+       KA   D+ GGS+P W +K+ +
Sbjct  5    TMRRSLEIELISAEGLKVDRKPVKRKTFCIVR--IDQESKACKPDELGGSYPVWKDKIEM  62

Query  262  DLPMHA--RYLTLQVQCKTFSGV-KVVGEAKVPAKDFVGGFVPESYVRFLSYRLKDRKGE  432
            D+ M+   R+++++V  KT  G  K VG AK+P  DF+GGF P+ ++ FLSYRL+D  G+
Sbjct  63   DMAMNGSVRFISIEVLYKTSGGAEKSVGLAKIPVTDFMGGFAPQGHLNFLSYRLRDDYGD  122

Query  433  KNGIINISVRVK----------NSAAENAAVASCSSQYS--------RRpwtglppptgn  558
            K+GIIN+S+ VK           S A  A  A+CSSQ +        R   +     T  
Sbjct  123  KSGIINVSIMVKPDGNGLKYTSPSMAAPADYAACSSQAAVAANGQMWRPRTSSSMALTTG  182

Query  559  ptnAAVVTGIPVWCSY  606
                 VVTG+PVW +Y
Sbjct  183  YRGRVVVTGVPVWGAY  198



>gb|AFK45603.1| unknown [Lotus japonicus]
Length=159

 Score =   117 bits (293),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 62/134 (46%), Positives = 87/134 (65%), Gaps = 9/134 (7%)
 Frame = +1

Query  88   METSSRDLEITVISGEGLRVGKKNVFVTVKSE-FSCNVKATGVDKGGG-------SFPAW  243
            M  SSR LEITVISGE LRV   + +V V+ E  +C    T  D G G       S  +W
Sbjct  1    MGISSRTLEITVISGENLRV-TDDAYVVVRGESLNCCTTRTVKDSGEGDKNNRNSSLLSW  59

Query  244  NEKLVVDLPMHARYLTLQVQCKTFSGVKVVGEAKVPAKDFVGGFVPESYVRFLSYRLKDR  423
            NEK ++D+P HAR +T +VQC  F GV+ VG A++   DF+G  VP+S +R LSY+L+D 
Sbjct  60   NEKFLLDMPAHARSITFEVQCGKFKGVRPVGVARIAVSDFLGCDVPDSCLRVLSYKLRDW  119

Query  424  KGEKNGIINISVRV  465
            +G++NG+++ +VRV
Sbjct  120  EGKRNGVLHFAVRV  133



>ref|XP_010040911.1| PREDICTED: BON1-associated protein 2-like [Eucalyptus grandis]
 gb|KCW44796.1| hypothetical protein EUGRSUZ_L01644 [Eucalyptus grandis]
Length=173

 Score =   117 bits (293),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 81/175 (46%), Positives = 105/175 (60%), Gaps = 20/175 (11%)
 Frame = +1

Query  103  RDLEITVISGEGLRVGKK---NVFVTVKSE--FSCNVKATGVDKGGGSFPAWNEKLVVDL  267
            R LEIT+IS E +R+ KK   N  V V++E    C+ K    DKG  + P WNE LVVDL
Sbjct  3    RALEITLISAENIRLNKKPVKNAVVAVRAEPGHECSTKP-APDKG--TNPQWNENLVVDL  59

Query  268  PMHARYLTLQVQCKTFSG-VKVVGEAKVPAKDFVGGF-VPESYVRFLSYRLKDRKGEK-N  438
            P+HA ++TL+V+CK+ SG  K+VG   VPA DF G F  PE Y+RFLSYRL+D  G + +
Sbjct  60   PLHAGFITLEVKCKSSSGSYKLVGGVTVPASDFAGDFGTPEGYMRFLSYRLRDSNGVRTD  119

Query  439  GIINISVRVKNSAAENAAVASCSSQYSRRpwtglppptgnptnAA--VVTGIPVW  597
            GIINIS ++       AA A   +    RP   +P    +   AA  +VTG PVW
Sbjct  120  GIINISAKM-------AAPALARTYEVPRPEIRVPVGDQSKMVAAGGLVTGFPVW  167



>ref|XP_006295550.1| hypothetical protein CARUB_v10024657mg [Capsella rubella]
 gb|EOA28448.1| hypothetical protein CARUB_v10024657mg [Capsella rubella]
Length=196

 Score =   117 bits (294),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 71/188 (38%), Positives = 106/188 (56%), Gaps = 16/188 (9%)
 Frame = +1

Query  94   TSSRDLEITVISGEGLRVGKKNVFVTVKSEFSCNVK--ATGVDKGGGSFPAWNEKLVVDL  267
            T  R LEI VIS EGL+  +K +     S  S + K  A+  D  GGS P W  K  +++
Sbjct  6    TMKRSLEIEVISAEGLKADRKPLKRKTYSVVSIDQKYFASKPDDLGGSCPVWKHKFDMEM  65

Query  268  PMHAR--YLTLQVQCKTFSGV-KVVGEAKVPAKDFVGGFVPESYVRFLSYRLKDRKGEKN  438
            P++    ++T++V+ +T  G  K VG AK+P  DF+GGF P+ ++ FLSYRL+D  G+K 
Sbjct  66   PINGTVGFITVEVRYRTSGGAEKHVGYAKIPVTDFMGGFAPQGHLNFLSYRLRDEYGDKC  125

Query  439  GIINISVRVKNSAA-----ENAAVASCSSQYS------RRpwtglppptgnptnAAVVTG  585
            G++N+S+ VK   +      +++ A CSSQ +      R   +     T       VVTG
Sbjct  126  GVVNVSIMVKPDRSIPVPLPSSSFAPCSSQAAANNHMWRPRTSSSMASTAVYGGGRVVTG  185

Query  586  IPVWCSYQ  609
            +PVWC+YQ
Sbjct  186  VPVWCAYQ  193



>ref|XP_006397758.1| hypothetical protein EUTSA_v10001640mg [Eutrema salsugineum]
 gb|ESQ39211.1| hypothetical protein EUTSA_v10001640mg [Eutrema salsugineum]
Length=200

 Score =   117 bits (294),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 76/212 (36%), Positives = 113/212 (53%), Gaps = 59/212 (28%)
 Frame = +1

Query  94   TSSRDLEITVISGEGLRVGKKNV----FVTVK-SEFSCNVKATGVDKGGGSFPAWNEKLV  258
            T+ R LEI +IS EGL+V +K V    F  V+  E S N K   +D+ GGS+P W +K+ 
Sbjct  5    TTKRSLEIELISAEGLKVDRKPVKRKTFCVVRIDEKSKNSK---LDEPGGSYPVWKDKIE  61

Query  259  VDLPMHA--RYLTLQVQCKTFSGV-KVVGEAKVPAKDFVGGFVPESYVRFLSYRLKDRKG  429
            +++P++   R+++++V  +T  GV K VG AK+P  DF+GGF P+ ++ FLSYRL+D  G
Sbjct  62   MEMPVNGSVRFISIEVLYRTGGGVEKSVGHAKIPVTDFMGGFAPQGHLNFLSYRLRDEYG  121

Query  430  EKNGIINISVRVKNSAAE---------------------------NAAVASCSSQ-----  513
            +K+GI+N+S+ VK    +                           N  + + SSQ     
Sbjct  122  DKSGIVNVSIMVKPEGRDIKYSSPSPSMVVPADYAACSSQAAAAANGQMWTSSSQAATVG  181

Query  514  YSRRpwtglppptgnptnAAVVTGIPVWCSYQ  609
            Y RR                VVTG+PVWC+YQ
Sbjct  182  YGRR----------------VVTGVPVWCAYQ  197



>ref|XP_010508111.1| PREDICTED: BON1-associated protein 2-like [Camelina sativa]
Length=202

 Score =   117 bits (293),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 72/199 (36%), Positives = 112/199 (56%), Gaps = 32/199 (16%)
 Frame = +1

Query  94   TSSRDLEITVISGEGLRVGKKNV------FVTVKSEFSCNVKATGVDKGGGSFPAWNEKL  255
            T  R LE+ VIS EGL+V +K +       V++  ++S N   + +D  GGS P W +K+
Sbjct  6    TMKRSLEVEVISAEGLKVNRKPLKKKTYSVVSIDDKYSWN---SNLDDLGGSCPVWKKKI  62

Query  256  VVDLPMHA--RYLTLQVQCKTFSGV-KVVGEAKVPAKDFVGGFVPESYVRFLSYRLKDRK  426
             +++P++   R++T+ V+ +T +G  K+VG AK+P  DF+GGF P+ ++ FLSYRL+D  
Sbjct  63   DMEMPINGSVRFITVDVRYRTSNGAEKLVGHAKIPVTDFMGGFAPQGHLNFLSYRLRDDY  122

Query  427  GEKNGIINISVRVKNSAAEN------------------AAVASCSSQYSRRpwtglpppt  552
            G+K GIIN+S+ VK   + N                   A A+ ++Q  R+        T
Sbjct  123  GDKCGIINVSIMVKPDGSYNDHKSILPLPSSSFAACSSQAAAATNTQMWRQ--RTSMAST  180

Query  553  gnptnAAVVTGIPVWCSYQ  609
                   VVTG+PVWC+YQ
Sbjct  181  AGYGGGHVVTGVPVWCAYQ  199



>ref|XP_010058154.1| PREDICTED: BON1-associated protein 1-like [Eucalyptus grandis]
 gb|KCW71683.1| hypothetical protein EUGRSUZ_E00199 [Eucalyptus grandis]
Length=173

 Score =   116 bits (290),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 80/175 (46%), Positives = 105/175 (60%), Gaps = 20/175 (11%)
 Frame = +1

Query  103  RDLEITVISGEGLRVGKK---NVFVTVKSE--FSCNVKATGVDKGGGSFPAWNEKLVVDL  267
            R LEIT+IS E +R+ KK   N  V V+++    C+ K    DKG  + P WNE LVVDL
Sbjct  3    RALEITLISAENIRLNKKPVKNAVVAVRADPGHECSTKP-APDKG--TNPQWNENLVVDL  59

Query  268  PMHARYLTLQVQCKTFSG-VKVVGEAKVPAKDFVGGF-VPESYVRFLSYRLKDRKGEK-N  438
            P+HA ++TL+V+CK+ SG  K+VG A VP+ DF G F  PE YVRFLSYRL+D  G + +
Sbjct  60   PLHAGFITLEVKCKSSSGSYKLVGGATVPSSDFAGDFGTPEGYVRFLSYRLRDSNGVRTD  119

Query  439  GIINISVRVKNSAAENAAVASCSSQYSRRpwtglppptgnptnAA--VVTGIPVW  597
             IINIS ++       AA A   +    RP   +P        AA  +VTG+PVW
Sbjct  120  SIINISAKM-------AAPALARTYEVPRPEIRVPVGDQRKMVAAGGLVTGVPVW  167



>emb|CDY18902.1| BnaC04g04480D [Brassica napus]
Length=201

 Score =   116 bits (291),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 73/196 (37%), Positives = 107/196 (55%), Gaps = 26/196 (13%)
 Frame = +1

Query  94   TSSRDLEITVISGEGLRVGKKNV----FVTVKSEFSCNVKATGVDKGGGSFPAWNEKLVV  261
            T  R LEI +IS EGL+V +K V    F  VK       +   +D+ GGS P W +K+ +
Sbjct  5    TMQRSLEIELISAEGLKVDRKPVKRKTFCVVK--IDQKTRVCKLDESGGSCPTWKDKIEM  62

Query  262  DLPMHA--RYLTLQVQCKTFSGV-KVVGEAKVPAKDFVGGFVPESYVRFLSYRLKDRKGE  432
            ++P++   R+++++V  +T  G  K VG AK+P  DF+GGF P+ ++ FLSYRL+D  G+
Sbjct  63   EMPINGSVRFISIEVLSRTSGGAEKNVGYAKIPVTDFMGGFAPQGHLNFLSYRLRDEYGD  122

Query  433  KNGIINISVRVKNSA------------AENAAVASCSSQYS-----RRpwtglppptgnp  561
            K+GI+N+S+ VK                     A+CSSQ +      RP T      G  
Sbjct  123  KSGILNVSIMVKPDGNNIKYSTPSPLVVATRDYAACSSQAAVNGQMWRPKTSSSMAVGAG  182

Query  562  tnAAVVTGIPVWCSYQ  609
                 VTG+PVWC+YQ
Sbjct  183  YGGREVTGVPVWCTYQ  198



>ref|XP_009143170.1| PREDICTED: BON1-associated protein 2-like isoform X1 [Brassica 
rapa]
Length=201

 Score =   116 bits (290),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 74/196 (38%), Positives = 107/196 (55%), Gaps = 26/196 (13%)
 Frame = +1

Query  94   TSSRDLEITVISGEGLRVGKKNV----FVTVKSEFSCNVKATGVDKGGGSFPAWNEKLVV  261
            T  R LEI +IS EGL+V +K V    F  V+       +   +D+ GGS P W +K+ +
Sbjct  5    TMKRSLEIELISAEGLKVDRKPVKRKTFCIVR--IDQKTRVCKLDESGGSCPTWKDKIEM  62

Query  262  DLPMHA--RYLTLQVQCKTFSGV-KVVGEAKVPAKDFVGGFVPESYVRFLSYRLKDRKGE  432
            ++P++   R+L+++V  +T  G  K VG AK+P  DF+GGF P+ ++ FLSYRL+D  G+
Sbjct  63   EMPINGSVRFLSIEVLYRTSGGADKNVGFAKIPVTDFMGGFAPQGHLNFLSYRLRDEYGD  122

Query  433  KNGIINISVRVKNSA------------AENAAVASCSSQYS-----RRpwtglppptgnp  561
            K+GIIN+S+ VK                     A+CSSQ +      RP T      G  
Sbjct  123  KSGIINVSIMVKPDGNNIKYSTPSPLVVATRDYAACSSQAAVNGQMWRPKTSSSMAVGAG  182

Query  562  tnAAVVTGIPVWCSYQ  609
                 VTG+PVWC+YQ
Sbjct  183  YGGREVTGVPVWCTYQ  198



>ref|XP_003551648.2| PREDICTED: BON1-associated protein 2-like [Glycine max]
Length=155

 Score =   114 bits (285),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 66/141 (47%), Positives = 92/141 (65%), Gaps = 11/141 (8%)
 Frame = +1

Query  103  RDLEITVISGEGLRVGKKN----VFVTVKSEFSCNVKATGVDKGGGSFPAWNEKLVVDLP  270
            R LE+TV+S E L V  K+    ++V V++E S    +TG     G  P+WNEKLVVD+P
Sbjct  5    RTLELTVLSLEELHVDWKHAAESLYVVVRAE-SITSYSTGTATESGGNPSWNEKLVVDVP  63

Query  271  MHARYLTLQVQCKTFSGVKVVGEAKVPAKDFVGG--FVPESYVRFLSYRLKDRKGEKNGI  444
            +HAR +TL+V+CK    VK +G A++   DF+GG    PE  ++FLSYRL+D +G ++G+
Sbjct  64   VHARSITLEVKCKDAPSVKDLGIARIAISDFLGGGTMAPEQCLQFLSYRLRDWEGRRSGV  123

Query  445  INISVRVKNSAAENAAVASCS  507
            IN SVRV+  A E A   SCS
Sbjct  124  INFSVRVR--ATEKA--CSCS  140



>ref|XP_010058151.1| PREDICTED: BON1-associated protein 1-like [Eucalyptus grandis]
 gb|KCW71681.1| hypothetical protein EUGRSUZ_E00195 [Eucalyptus grandis]
Length=184

 Score =   115 bits (287),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 77/181 (43%), Positives = 104/181 (57%), Gaps = 12/181 (7%)
 Frame = +1

Query  94   TSSRDLEITVISGEGLRVG----KKNVFVTVKSEF----SCNVKATGVDKGGGSFPAWNE  249
            T  R LE+TVISGE LR      K N FVTVK++     S    +T  +  G S P W+E
Sbjct  4    THHRSLEVTVISGEDLRTNGRPVKNNAFVTVKADSCGSPSLPPSSTKPNAHGESNPYWDE  63

Query  250  KLVVDLPMHARYLTLQVQCKTFSGVK-VVGEAKVPAKDFVGGFVPESYVRFLSYRLKDRK  426
            KL VDLP  +R++ ++V+ ++ S    +VG A +P  DFVG + PE+Y+RFLSYRL+D K
Sbjct  64   KLHVDLPAGSRHVVVEVRQRSSSSRDRLVGTAWIPVSDFVGDYTPENYLRFLSYRLRDAK  123

Query  427  GEKNGIINISVRVKNSAAENAAVASCSSQYSRRpwtglppptgnptnAAVVTGIPVWCSY  606
            G +NGIINISVRV  S+ + ++  S        P      P     +   VTG+PVW   
Sbjct  124  GLRNGIINISVRVVTSSCKGSSSCSLRPP---PPLPEFRMPVDREEHGGTVTGVPVWYPS  180

Query  607  Q  609
            Q
Sbjct  181  Q  181



>gb|AAP22496.1| hypothetical protein At2g45760 [Arabidopsis thaliana]
Length=207

 Score =   114 bits (286),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 73/201 (36%), Positives = 111/201 (55%), Gaps = 30/201 (15%)
 Frame = +1

Query  94   TSSRDLEITVISGEGLRVGKKNVFVTVKSEFSCNVK--ATGVDKGGGSFPAWNEKLVVDL  267
            T  R LEI VIS EGL+V +K +     S    + K  A+ VD+ GGS+P W ++  +++
Sbjct  5    TFKRSLEIEVISAEGLKVDRKPLKKKTYSVXRIDEKSWASKVDELGGSYPIWKDRFDMEM  64

Query  268  PMHA--RYLTLQVQCKTFSGV---KVVGEAKVPAKDFVGGFVPESYVRFLSYRLKDRKGE  432
            P++A  R+++++V  +T SG    K VG AK+P  DF+GGF P+ ++ FLSYRL+D  G+
Sbjct  65   PINASVRFISIEVYYRT-SGSGRDKNVGYAKIPVTDFMGGFAPQGHLNFLSYRLRDEYGD  123

Query  433  KNGIINISVRVKNSAAENAA-------------VASCS---------SQYSRRpwtglpp  546
            K GI+N+S+ VK    ++ +              A+CS         +Q  R   +    
Sbjct  124  KCGIVNVSIMVKPDGNDHKSSLPXSSFAVAPVDYAACSWQATAAARNNQMWRPRTSSSMV  183

Query  547  ptgnptnAAVVTGIPVWCSYQ  609
             T       VVTG+PVWC+YQ
Sbjct  184  STAGYGGGRVVTGVPVWCAYQ  204



>ref|NP_182100.2| BON1-associated protein 2 [Arabidopsis thaliana]
 sp|Q58FX0.1|BAP2_ARATH RecName: Full=BON1-associated protein 2; AltName: Full=Protein 
BON1-ASSOCIATED PROTEIN 1-LIKE [Arabidopsis thaliana]
 gb|AAX55165.1| hypothetical protein At2g45760 [Arabidopsis thaliana]
 gb|ABF19016.1| At2g45760 [Arabidopsis thaliana]
 gb|AEC10598.1| BON1-associated protein 2 [Arabidopsis thaliana]
Length=207

 Score =   114 bits (286),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 73/201 (36%), Positives = 111/201 (55%), Gaps = 30/201 (15%)
 Frame = +1

Query  94   TSSRDLEITVISGEGLRVGKKNVFVTVKSEFSCNVK--ATGVDKGGGSFPAWNEKLVVDL  267
            T  R LEI VIS EGL+V +K +     S    + K  A+ VD+ GGS+P W ++  +++
Sbjct  5    TFKRSLEIEVISAEGLKVDRKPLKKKTYSVVRIDEKSWASKVDELGGSYPIWKDRFDMEM  64

Query  268  PMHA--RYLTLQVQCKTFSGV---KVVGEAKVPAKDFVGGFVPESYVRFLSYRLKDRKGE  432
            P++A  R+++++V  +T SG    K VG AK+P  DF+GGF P+ ++ FLSYRL+D  G+
Sbjct  65   PINASVRFISIEVYYRT-SGSGRDKNVGYAKIPVTDFMGGFAPQGHLNFLSYRLRDEYGD  123

Query  433  KNGIINISVRVKNSAAENAA-------------VASCS---------SQYSRRpwtglpp  546
            K GI+N+S+ VK    ++ +              A+CS         +Q  R   +    
Sbjct  124  KCGIVNVSIMVKPDGNDHKSSLPSSSFAVAPVDYAACSWQATAAARNNQMWRPRTSSSMV  183

Query  547  ptgnptnAAVVTGIPVWCSYQ  609
             T       VVTG+PVWC+YQ
Sbjct  184  STAGYGGGRVVTGVPVWCAYQ  204



>ref|XP_010508112.1| PREDICTED: BON1-associated protein 2-like isoform X1 [Camelina 
sativa]
Length=201

 Score =   114 bits (284),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 71/195 (36%), Positives = 109/195 (56%), Gaps = 25/195 (13%)
 Frame = +1

Query  94   TSSRDLEITVISGEGLRVGKKNVFVTVKSEFSCNVK--ATGVDKGGGSFPAWNEKLVVDL  267
            T  R LE+ VIS EGL+V +K +     S  S + +   + +D  GGS P W +K  +++
Sbjct  6    TMKRSLELEVISAEGLKVDRKPLKKKTYSVVSIDEQYWESKLDDLGGSCPVWKKKFDIEM  65

Query  268  PMHA--RYLTLQVQCKTFSGV-KVVGEAKVPAKDFVGGFVPESYVRFLSYRLKDRKGEKN  438
            P++   R++T++V+ +T +G  K+VG AK+P  DF+GGF P+ ++ FLSYRL+D  G+K 
Sbjct  66   PINGSVRFITVEVRYRTSNGAEKLVGHAKIPVTDFMGGFAPQGHLNFLSYRLRDDYGDKC  125

Query  439  GIINISVRVKNSAAEN------------------AAVASCSSQYSRRpwtglppptgnpt  564
            GIIN+S+ VK   + N                   A A+ ++Q  R+        T    
Sbjct  126  GIINVSIMVKPDGSYNDHKSILPLPSSSYAACSSQAAAATNTQMWRQ--RTSMASTAGYG  183

Query  565  nAAVVTGIPVWCSYQ  609
               VVTG+PVWC+YQ
Sbjct  184  GGRVVTGVPVWCAYQ  198



>ref|XP_003521921.1| PREDICTED: BON1-associated protein 2-like [Glycine max]
Length=184

 Score =   113 bits (283),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 57/132 (43%), Positives = 86/132 (65%), Gaps = 3/132 (2%)
 Frame = +1

Query  88   METSSRDLEITVISGEGLRVGKKNVFVTVKSEF--SCNVKATGVDKGGGSFPAWNEKLVV  261
            M  S+R LEITVIS E L   K + +V V++E    C  +   VD G     +WN+K ++
Sbjct  1    MGISTRTLEITVISCENLHGVKDDAYVVVRAESLNCCTTRRVKVDDGTKKLLSWNQKFLL  60

Query  262  DLPMHARYLTLQVQCKTFSGVKVVGEAKVPAKDFVGG-FVPESYVRFLSYRLKDRKGEKN  438
            D+PMHAR +T +VQC  F G + +G A++ A DF+GG  +PE+ ++ LSY L+D +G++N
Sbjct  61   DMPMHARSITFEVQCNRFKGSRPLGVARIAASDFLGGAALPENRLQVLSYGLRDWEGKRN  120

Query  439  GIINISVRVKNS  474
            G+I+ +VRV  S
Sbjct  121  GVIHFAVRVAAS  132



>gb|AFK46253.1| unknown [Lotus japonicus]
Length=186

 Score =   113 bits (283),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 72/183 (39%), Positives = 109/183 (60%), Gaps = 24/183 (13%)
 Frame = +1

Query  97   SSRDLEITVISGEGLRVGK----KNVFVTVKSE--FSCNVKATGVDKGGGSFPAWNEKLV  258
            + R LE+TV+S E LRV +    +N++V V++E   S      G +    +  +WNEKL+
Sbjct  10   TERTLELTVLSAEDLRVDRNLNTENIYVVVRAESIHSYATGTAGSNSNSHNNFSWNEKLL  69

Query  259  VDLPMHARYLTLQVQCKTF--SGVKVVGEAKVPAKDFVGGFVPESYVRFLSYRLKDRKGE  432
            VD+P+HAR +TL+V+CKT   SG K +G A+V   DF+GG VP+  ++FLSYRL++ +G+
Sbjct  70   VDMPVHARSITLEVKCKTSRGSGSKDIGVARVAVSDFLGGSVPDDCLQFLSYRLRNWEGK  129

Query  433  KNGIINISVRVKN----SAAENAAVASCSSQYSRRpwtglppptgnptnAAVVTGIP-VW  597
            +NG++N SVR++     +A     V SC  Q SR                 VVTG+P +W
Sbjct  130  RNGVVNFSVRLRTRERVAATPEMVVGSCGFQISR-----------VSVTGGVVTGVPLLW  178

Query  598  CSY  606
             +Y
Sbjct  179  NNY  181



>emb|CDX74764.1| BnaA05g05100D [Brassica napus]
Length=201

 Score =   113 bits (283),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 72/196 (37%), Positives = 107/196 (55%), Gaps = 26/196 (13%)
 Frame = +1

Query  94   TSSRDLEITVISGEGLRVGKKNV----FVTVKSEFSCNVKATGVDKGGGSFPAWNEKLVV  261
            T    LEI +IS EGL+V +K V    F  V+       K   +D+ GGS P W +K+ +
Sbjct  5    TMKHSLEIELISAEGLKVDRKPVKRKTFCIVR--IDQKTKVCKLDESGGSCPTWKDKIEM  62

Query  262  DLPMHA--RYLTLQVQCKTFSGV-KVVGEAKVPAKDFVGGFVPESYVRFLSYRLKDRKGE  432
            ++P++   R+L+++V  +T  G  K VG AK+P  DF+GGF P+ ++ FLSYRL+D  G+
Sbjct  63   EMPINGSVRFLSIEVLYRTSGGADKNVGFAKIPVTDFMGGFAPQGHLNFLSYRLRDEYGD  122

Query  433  KNGIINISVRVKNSA------------AENAAVASCSSQYS-----RRpwtglppptgnp  561
            K+GI+N+S+ VK                  +  A+CSSQ +      RP T      G  
Sbjct  123  KSGIVNVSIMVKPDGNNIKYSTPSPLVVATSDYAACSSQAAVNGQMWRPKTSSSMAVGAG  182

Query  562  tnAAVVTGIPVWCSYQ  609
                 VTG+PVWC+Y+
Sbjct  183  YGGREVTGVPVWCTYR  198



>ref|XP_010518213.1| PREDICTED: BON1-associated protein 2-like [Camelina sativa]
Length=200

 Score =   113 bits (282),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 70/194 (36%), Positives = 108/194 (56%), Gaps = 24/194 (12%)
 Frame = +1

Query  94   TSSRDLEITVISGEGLRVGKKNVFVTVKSEFSCNVKAT---GVDKGGGSFPAWNEKLVVD  264
            T  R LE+ VIS EGL+V +K +     S  S + K +    +D  GGS P W +K  ++
Sbjct  6    TMKRSLEVEVISAEGLKVDRKPLKKKTYSVVSIDDKHSWKSNLDDLGGSCPVWKDKFDIE  65

Query  265  LPMHA--RYLTLQVQCKTFSGV-KVVGEAKVPAKDFVGGFVPESYVRFLSYRLKDRKGEK  435
            +P++   R+++++V+ +T +G  K+VG AK+P  DF+GGF P+ ++ FLSYRL+D  G+K
Sbjct  66   MPINGSVRFISVEVRYRTSNGAEKLVGHAKIPVTDFMGGFAPQGHLNFLSYRLRDDYGDK  125

Query  436  NGIINISVRVKNSAAEN----------------AAVASCSSQYSRRpwtglppptgnptn  567
             GIIN+S+ VK     +                 A A+ ++Q  R+        T     
Sbjct  126  CGIINVSIMVKPDGNNDYKSLPLPSSSYAACSSQAAAATNNQMWRQ--RTSMASTAGYGG  183

Query  568  AAVVTGIPVWCSYQ  609
              VVTG+PVWC+YQ
Sbjct  184  GRVVTGVPVWCAYQ  197



>gb|KCW71688.1| hypothetical protein EUGRSUZ_E00205, partial [Eucalyptus grandis]
Length=162

 Score =   110 bits (276),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 67/157 (43%), Positives = 94/157 (60%), Gaps = 10/157 (6%)
 Frame = +1

Query  151  KKNVFVTVKSEFSCNV---KATGVDKGGGSFPAWNEKLVVDLPMHARYLTLQVQCKT-FS  318
            K N FVTVK++   +     +T  D  G S+P W+EKL VDLP  +RYL ++V  ++  +
Sbjct  9    KNNAFVTVKADSHSSTSLYDSTKPDGRGESYPYWDEKLPVDLPAGSRYLVVEVHRRSSLA  68

Query  319  GVKVVGEAKVPAKDFVGGFVPESYVRFLSYRLKDRKGEKNGIINISVRVKNSAAENAAVA  498
            G  +VG A +P  DFVGG+ PE+Y  FLSYRL+D KG++NGIINISVR+  S+ +  + +
Sbjct  69   GDVLVGTAWIPVSDFVGGYAPENYQHFLSYRLRDAKGQRNGIINISVRMVTSSYKGTSSS  128

Query  499  SCSSQYSRRpwtglppptgnptnAAVVTGIPVWCSYQ  609
            S SS            P     N+  VTG+P+W   Q
Sbjct  129  SSSS------VPEFGIPMDREKNSRTVTGVPIWYPNQ  159



>gb|KEH18941.1| BON1-associated-like protein [Medicago truncatula]
Length=177

 Score =   111 bits (277),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 57/132 (43%), Positives = 85/132 (64%), Gaps = 7/132 (5%)
 Frame = +1

Query  88   METSSRDLEITVISGEGLRVGKKNVFVTVKSE-FSCNVKATGVDKG-----GGSFPAWNE  249
            M  +SR LEITVISGE + V  ++ +V V+ E  +C    T  D         SF +WNE
Sbjct  1    MGVASRTLEITVISGENIHV-TEDAYVVVRGESLNCYTTKTLKDNNDNCGKNSSFLSWNE  59

Query  250  KLVVDLPMHARYLTLQVQCKTFSGVKVVGEAKVPAKDFVGGFVPESYVRFLSYRLKDRKG  429
            K ++++P+HAR +T +VQCK F  V+ +G A++   DF+ G VPE+  + LSY+L+D +G
Sbjct  60   KFLLNMPLHARSITFEVQCKKFKSVRPIGVARIGVSDFLNGTVPENCSQILSYKLRDWEG  119

Query  430  EKNGIINISVRV  465
             +NG+I+ SVRV
Sbjct  120  RQNGVIHFSVRV  131



>gb|AFK36493.1| unknown [Medicago truncatula]
 gb|KEH18943.1| BON1-associated-like protein [Medicago truncatula]
Length=184

 Score =   110 bits (276),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 57/132 (43%), Positives = 85/132 (64%), Gaps = 7/132 (5%)
 Frame = +1

Query  88   METSSRDLEITVISGEGLRVGKKNVFVTVKSE-FSCNVKATGVDKG-----GGSFPAWNE  249
            M  +SR LEITVISGE + V  ++ +V V+ E  +C    T  D         SF +WNE
Sbjct  1    MGVASRTLEITVISGENIHV-TEDAYVVVRGESLNCYTTKTLKDNNDNCGKNSSFLSWNE  59

Query  250  KLVVDLPMHARYLTLQVQCKTFSGVKVVGEAKVPAKDFVGGFVPESYVRFLSYRLKDRKG  429
            K ++++P+HAR +T +VQCK F  V+ +G A++   DF+ G VPE+  + LSY+L+D +G
Sbjct  60   KFLLNMPLHARSITFEVQCKKFKSVRPIGVARIGVSDFLNGAVPENCSQILSYKLRDWEG  119

Query  430  EKNGIINISVRV  465
             +NG+I+ SVRV
Sbjct  120  RQNGVIHFSVRV  131



>gb|KEH18939.1| BON1-associated-like protein [Medicago truncatula]
 gb|KEH18940.1| BON1-associated-like protein [Medicago truncatula]
Length=184

 Score =   109 bits (273),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 65/184 (35%), Positives = 100/184 (54%), Gaps = 15/184 (8%)
 Frame = +1

Query  88   METSSRDLEITVISGEGLRVGKKNVFVTVKSE-FSCNVKATGVDKGG----GSFPAWNEK  252
            M  +S+ LEITVISGE + V  ++ +V V+ E  +C    T  D        SF +WNEK
Sbjct  1    MVVTSQTLEITVISGENIHV-TEDAYVVVRGESLNCYTTKTVKDNDNCGKNSSFLSWNEK  59

Query  253  LVVDLPMHARYLTLQVQCKTFSGVKVVGEAKVPAKDFVGGFVPESYVRFLSYRLKDRKGE  432
             ++++P+HAR +T +VQCK F  V+ +G A++   DF+ G  PE+ ++ LSY+L++ +G 
Sbjct  60   FLLNMPLHARSITFEVQCKKFKSVRPIGVARIALSDFLNGIAPENCLQILSYKLRNWEGR  119

Query  433  KNGIINISVRVKNSAAENAAVA------SCSSQYSRRpwtglppptgnptnAAVVTGIPV  594
            +NG+I+ SVRV      +A VA      +    Y  R          +     V  GIP 
Sbjct  120  QNGVIHFSVRVVVPEKTSATVAVEKQTVADGKNYGGRLTGMDVGTKDSN---GVAIGIPF  176

Query  595  WCSY  606
            W +Y
Sbjct  177  WWNY  180



>ref|XP_010055222.1| PREDICTED: BON1-associated protein 2-like [Eucalyptus grandis]
 gb|KCW71690.1| hypothetical protein EUGRSUZ_E00208 [Eucalyptus grandis]
Length=170

 Score =   108 bits (271),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 66/174 (38%), Positives = 98/174 (56%), Gaps = 19/174 (11%)
 Frame = +1

Query  109  LEITVISGEGLRVGKK---NVFVTVKSEFS--CNVKATGVDKGGGSFPAWNEKLVVDLPM  273
            LEIT ISGE LR  KK   N  V V+++ +  C  +    D   G+ P WN+KL +D+P+
Sbjct  5    LEITAISGEDLRFHKKPLKNAIVVVRADSADPCMTEPAAED---GTNPRWNKKLTLDVPL  61

Query  274  HARYLTLQVQCK--TFSGVKVVGEAKVPAKDFVGGFVPESYVRFLSYRLKDRKGEKNGII  447
            H  ++T++V CK  ++   K+VG  ++P  + +GG  P +Y+ FLSYRL+D  G +NGII
Sbjct  62   HGEFITVEVHCKRSSWRDHKLVGGVRIPVSEILGGLTPANYLHFLSYRLRDNYGIRNGII  121

Query  448  NISVRVKNSAAENAAVASCSSQYSRRpwtglppptgnptnAAVVTGIPVWCSYQ  609
            NISV+         + A        +P  G+P       +  VVTG+PVW  +Q
Sbjct  122  NISVK---------STAPAYVMPGPQPELGVPMGGRKVASNVVVTGVPVWFPHQ  166



>ref|XP_010040909.1| PREDICTED: BON1-associated protein 2-like [Eucalyptus grandis]
 gb|KCW44794.1| hypothetical protein EUGRSUZ_L01642 [Eucalyptus grandis]
Length=175

 Score =   108 bits (271),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 73/176 (41%), Positives = 100/176 (57%), Gaps = 22/176 (13%)
 Frame = +1

Query  103  RDLEITVISGEGLRVGKK---NVFVTVKSE--FSCNVKATGVDKGGGSFPAWNEKLVVDL  267
            R LEIT IS E +R+ KK   N  V ++ E  + C+ K    DKG  + P WNE LVVDL
Sbjct  4    RALEITSISAENIRLNKKPVKNAVVVIRVEHGYECSTKPAP-DKG--TNPKWNESLVVDL  60

Query  268  PMHARYLTLQVQCKTFSG-VKVVGEAKVPAKDFVGGF-VPESYVRFLSYRLKDRKGEK-N  438
            P+HA ++T++V+CK+ SG   +VG A VP  DF G F  PE +V FLSYRL+D  G + +
Sbjct  61   PLHAGFITVEVKCKSSSGKYNLVGGAIVPISDFAGEFGAPEGHVHFLSYRLRDSSGVRTD  120

Query  439  GIINISVRVKNSAAENAAVASCSSQY---SRRpwtglppptgnptnAAVVTGIPVW  597
            GIINIS ++        A+A+ +  Y          +  P        +VTG+PVW
Sbjct  121  GIINISAKM--------AIAALAHTYEVPQPEIGVPVGDPRRMMAAGGLVTGVPVW  168



>ref|XP_004144363.2| PREDICTED: BON1-associated protein 2-like [Cucumis sativus]
Length=177

 Score =   108 bits (270),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 53/111 (48%), Positives = 78/111 (70%), Gaps = 6/111 (5%)
 Frame = +1

Query  151  KKNVFVTVKSEFSCNVKATG--VDKGGGSFPAWNEKLVVDLPMHARYLTLQVQCKTFSG-  321
            K ++F T++S+      +    +D+ G  FP WNEKLVVD PMHA ++ ++V C++ S  
Sbjct  37   KSDLFDTIRSDLQSENDSINKKIDRDGDGFPRWNEKLVVDRPMHAAFVVVEV-CRSASSG  95

Query  322  --VKVVGEAKVPAKDFVGGFVPESYVRFLSYRLKDRKGEKNGIINISVRVK  468
              VK+VG+++V   DFV G++PES+++FLSY L+D +GE NGIIN SVRVK
Sbjct  96   WKVKIVGKSRVSMADFVVGYLPESHLQFLSYSLRDERGEMNGIINFSVRVK  146



>ref|XP_010055221.1| PREDICTED: BON1-associated protein 2-like [Eucalyptus grandis]
Length=174

 Score =   108 bits (269),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 66/136 (49%), Positives = 85/136 (63%), Gaps = 11/136 (8%)
 Frame = +1

Query  103  RDLEITVISGEGLRVGKK---NVFVTVKSEFS--CNVKATGVDKGGGSFPAWNEKLVVDL  267
            R LEIT+ISGE LR+ KK   N  V V+ E S  C+ K    DKG  + P WNEKL  DL
Sbjct  3    RALEITLISGENLRLNKKPVKNAVVAVRVEASHECSTKPA-PDKG--TNPQWNEKLAFDL  59

Query  268  PMHARYLTLQVQCKTFSG-VKVVGEAKVPAKDFVG-GFVPESYVRFLSYRLKDRKG-EKN  438
            P+HA ++TL+V+C++ SG  K+VG A VP  D  G    PE  V FLSYRL+D  G + +
Sbjct  60   PLHAGFITLEVKCRSSSGSYKLVGGATVPVSDLAGEPGTPEGLVHFLSYRLRDSNGVQTD  119

Query  439  GIINISVRVKNSAAEN  486
            GIINIS ++   A  +
Sbjct  120  GIINISAKMSGPAPAH  135



>ref|XP_010506554.1| PREDICTED: BON1-associated protein 2-like isoform X1 [Camelina 
sativa]
Length=202

 Score =   108 bits (271),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 71/197 (36%), Positives = 106/197 (54%), Gaps = 28/197 (14%)
 Frame = +1

Query  94   TSSRDLEITVISGEGLRVG----KKNVFVTVKSEFSCNVKATGVDKGGGSFPAWNEKLVV  261
            T  R LE+ VIS +GL+V     KK  F  V  +   + K+  +D  GGS P W  K  +
Sbjct  6    TMKRSLEVEVISAQGLKVDRKPLKKKTFTVVSIDDKHSWKSN-LDDLGGSCPVWKYKFDI  64

Query  262  DLPMHA--RYLTLQVQCKTFSGV-KVVGEAKVPAKDFVGGFVPESYVRFLSYRLKDRKGE  432
            ++P++   R++++ V  +T +G  K+VG AK+P  DF+GGF P+ ++ FLSYRL+D  G+
Sbjct  65   EMPINGSVRFISVDVFYRTSNGAEKLVGHAKIPVTDFMGGFAPQGHLNFLSYRLRDDYGD  124

Query  433  KNGIINISVRVKNSAAEN------------------AAVASCSSQYSRRpwtglppptgn  558
            K GIIN+S+ VK   + N                   A A+ ++Q  R+        T  
Sbjct  125  KCGIINVSIMVKPDGSYNDHKSILPLPSSSFAACSSQAAAATNNQMWRQ--RTSMASTAG  182

Query  559  ptnAAVVTGIPVWCSYQ  609
                 VVTG+PVWC+YQ
Sbjct  183  YGGGRVVTGVPVWCAYQ  199



>ref|XP_010055219.1| PREDICTED: BON1-associated protein 2-like [Eucalyptus grandis]
 gb|KCW71687.1| hypothetical protein EUGRSUZ_E00204 [Eucalyptus grandis]
Length=175

 Score =   107 bits (266),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 72/174 (41%), Positives = 99/174 (57%), Gaps = 22/174 (13%)
 Frame = +1

Query  109  LEITVISGEGLRVGKK---NVFVTVKSE--FSCNVKATGVDKGGGSFPAWNEKLVVDLPM  273
            LEIT IS E +R+ KK   N  V ++ E  + C+ K    DKG  + P WNE L VDLP+
Sbjct  6    LEITSISAENIRLNKKPVKNAVVVIRVEHGYECSTKPAP-DKG--TNPKWNESLAVDLPL  62

Query  274  HARYLTLQVQCKTFSG-VKVVGEAKVPAKDFVGGF-VPESYVRFLSYRLKDRKGEK-NGI  444
            HA ++T++V+CK+ SG  K+VG A VP  DF G F  PE +V FLSYRL+D  G + +GI
Sbjct  63   HAGFITVEVKCKSSSGKYKLVGGAIVPISDFAGEFGAPEGHVHFLSYRLRDSSGVRTDGI  122

Query  445  INISVRVKNSAAENAAVASCSSQYS---RRpwtglppptgnptnAAVVTGIPVW  597
            INIS ++        A+A+ +  Y          +  P        +VTG+PVW
Sbjct  123  INISAKM--------AIAALAHTYEVPRPEIGVLVGDPRRMMVAGGLVTGVPVW  168



>emb|CDY27361.1| BnaC04g50440D [Brassica napus]
Length=201

 Score =   107 bits (267),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 72/194 (37%), Positives = 106/194 (55%), Gaps = 24/194 (12%)
 Frame = +1

Query  97   SSRDLEITVISGEGLRVG----KKNVFVTVKSEFSCNVKATGVDKGGGSFPAWNEKLVVD  264
            S R LEI +IS EGL V     K+  F  V+ +   + K   VD+ GGS+P W +++  +
Sbjct  6    SKRSLEIELISAEGLEVNGKPVKRQTFGVVRIDQETHHKCK-VDEQGGSYPIWQDRIKTE  64

Query  265  LPMHA--RYLTLQVQCKTFSGV-KVVGEAKVPAKDFVGGFVPESYVRFLSYRLKDRKGEK  435
            + +    R++T++V  KT  G  K VG AK+P  DF+GGF P  ++ FLSYRL+D  G+K
Sbjct  65   MAVDGSVRFITVEVFYKTSGGAEKNVGVAKIPVTDFMGGFAPRGHLNFLSYRLRDEYGDK  124

Query  436  NGIINISVRVKNSAAE---------NAAVASCSSQYSR------RpwtglppptgnptnA  570
            +GI+N+S+ VK   ++         +    +CSSQ  R      RP T     T      
Sbjct  125  SGIVNVSIMVKPDFSDVKYPSPSLPSLGYTACSSQAVRANGQMWRPMTSSSMATTTGYGG  184

Query  571  AVVTGIPV-WCSYQ  609
             +VTG+PV W +YQ
Sbjct  185  RIVTGVPVNWPAYQ  198



>ref|XP_009143172.1| PREDICTED: BON1-associated protein 2-like isoform X2 [Brassica 
rapa]
Length=200

 Score =   106 bits (265),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 71/192 (37%), Positives = 103/192 (54%), Gaps = 26/192 (14%)
 Frame = +1

Query  94   TSSRDLEITVISGEGLRVGKKNV----FVTVKSEFSCNVKATGVDKGGGSFPAWNEKLVV  261
            T  R LEI +IS EGL+V +K V    F  V+       +   +D+ GGS P W +K+ +
Sbjct  5    TMKRSLEIELISAEGLKVDRKPVKRKTFCIVR--IDQKTRVCKLDESGGSCPTWKDKIEM  62

Query  262  DLPMHA--RYLTLQVQCKTFSGV-KVVGEAKVPAKDFVGGFVPESYVRFLSYRLKDRKGE  432
            ++P++   R+L+++V  +T  G  K VG AK+P  DF+GGF P+ ++ FLSYRL+D  G+
Sbjct  63   EMPINGSVRFLSIEVLYRTSGGADKNVGFAKIPVTDFMGGFAPQGHLNFLSYRLRDEYGD  122

Query  433  KNGIINISVRVKNSA------------AENAAVASCSSQYS-----RRpwtglppptgnp  561
            K+GIIN+S+ VK                     A+CSSQ +      RP T      G  
Sbjct  123  KSGIINVSIMVKPDGNNIKYSTPSPLVVATRDYAACSSQAAVNGQMWRPKTSSSMAVGAG  182

Query  562  tnAAVVTGIPVW  597
                 VTG+PVW
Sbjct  183  YGGREVTGVPVW  194



>ref|XP_006583339.1| PREDICTED: BON1-associated protein 1-like [Glycine max]
Length=163

 Score =   105 bits (262),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 70/181 (39%), Positives = 97/181 (54%), Gaps = 26/181 (14%)
 Frame = +1

Query  88   METSSRDLEITVISGEGLRV----GKKNVFVTVKSEFSCNVKATGVDKGG-GSFPAWNEK  252
            M T  + LE+TV+S EGL V      KNVF  V++E S     T +  G    F  WNEK
Sbjct  1    MATKPKVLELTVLSAEGLHVRGKPANKNVFTVVRAE-SLTSHTTAMANGNENGFHTWNEK  59

Query  253  LVVDLPMHARYLTLQVQCKTFSGV-KVVGEAKVPAKDFVGGFVPESYVRFLSYRLKDRKG  429
              V+L   AR LT++V+CKT +GV + +G A++   DF+GG VP+  ++ L YRL+D  G
Sbjct  60   FRVELGPQARCLTIEVKCKTETGVVRDIGVARIAVSDFLGGSVPDHSLQSLCYRLRDWDG  119

Query  430  EKNGIINISVRVKNSAAENAAVASCSSQYSRRpwtglppptgnptnAAVVTGIPVWCSYQ  609
             +NG++N SVRV    A  AA   CSS                  +  VVT IPV+ +  
Sbjct  120  RENGVVNFSVRVAGPPA--AAENDCSSS-----------------SGGVVTAIPVYLNNS  160

Query  610  V  612
            +
Sbjct  161  I  161



>ref|XP_003521920.1| PREDICTED: BON1-associated protein 2-like [Glycine max]
 gb|KHN27287.1| BON1-associated protein 2 [Glycine soja]
Length=166

 Score =   105 bits (262),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 56/134 (42%), Positives = 87/134 (65%), Gaps = 6/134 (4%)
 Frame = +1

Query  109  LEITVISGEGLRVGKKNVFVTVKSEFSCNVKATGVDKGGGS----FPAWNEKLVVDLPMH  276
            LEITVIS E LRV  ++ +V V++E S N   + + K  GS      +WNEKL++++PMH
Sbjct  9    LEITVISCENLRV-TEDPYVVVRAE-SLNCCTSNIAKDCGSNKTSLFSWNEKLMLNMPMH  66

Query  277  ARYLTLQVQCKTFSGVKVVGEAKVPAKDFVGGFVPESYVRFLSYRLKDRKGEKNGIINIS  456
            AR +T +VQC  F G +  G A++   DF+GG V E+ +  LSYRL+D +G++NG+I+ +
Sbjct  67   ARSITFEVQCNRFKGFRPAGVARIAVSDFLGGAVSENCMHVLSYRLRDWEGKENGVIHFT  126

Query  457  VRVKNSAAENAAVA  498
            +RV  +  +   V+
Sbjct  127  MRVAAAPVKGTVVS  140



>ref|XP_010508113.1| PREDICTED: BON1-associated protein 2-like isoform X2 [Camelina 
sativa]
Length=200

 Score =   106 bits (264),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 56/136 (41%), Positives = 88/136 (65%), Gaps = 5/136 (4%)
 Frame = +1

Query  94   TSSRDLEITVISGEGLRVGKKNVFVTVKSEFSCNVK--ATGVDKGGGSFPAWNEKLVVDL  267
            T  R LE+ VIS EGL+V +K +     S  S + +   + +D  GGS P W +K  +++
Sbjct  6    TMKRSLELEVISAEGLKVDRKPLKKKTYSVVSIDEQYWESKLDDLGGSCPVWKKKFDIEM  65

Query  268  PMHA--RYLTLQVQCKTFSGV-KVVGEAKVPAKDFVGGFVPESYVRFLSYRLKDRKGEKN  438
            P++   R++T++V+ +T +G  K+VG AK+P  DF+GGF P+ ++ FLSYRL+D  G+K 
Sbjct  66   PINGSVRFITVEVRYRTSNGAEKLVGHAKIPVTDFMGGFAPQGHLNFLSYRLRDDYGDKC  125

Query  439  GIINISVRVKNSAAEN  486
            GIIN+S+ VK   + N
Sbjct  126  GIINVSIMVKPDGSYN  141



>emb|CDX95663.1| BnaC03g25440D [Brassica napus]
Length=203

 Score =   105 bits (263),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 73/197 (37%), Positives = 105/197 (53%), Gaps = 28/197 (14%)
 Frame = +1

Query  94   TSSRDLEITVISGEGLRVGKKNV----FVTVKSEFSCNVKATGVDKGGGSFPAWNEKLVV  261
            T  R LEI +IS EGL+V +K V    F  V+       +A   D+ GGS+P W +K+ +
Sbjct  5    TMKRSLEIELISAEGLKVDRKPVKRKTFCIVR--IDQKSQACKPDELGGSYPVWKDKIEM  62

Query  262  DLPMHA--RYLTLQVQCKTFSGV-KVVGEAKVPAKDFVGGFVPESYVRFLSYRLKDRKGE  432
            D+ M+   R+++++V  KT  G  K VG AK+P  DF+GGF P+ ++ FLSYRL+D  G+
Sbjct  63   DMAMNGSVRFISIEVLYKTSGGAEKSVGLAKIPVTDFMGGFAPQGHLNFLSYRLRDEYGD  122

Query  433  KNGIINISVRVKN-------SAAENAAVAS-----------CSSQYSRRpwtglppptgn  558
            K+GI+N+S+ VK        S+   AA A             + Q  R P T        
Sbjct  123  KSGIVNVSIMVKPDGNGLKYSSPSMAAPADYAACSSQAAAAANGQMWRPPRTSSSMALTT  182

Query  559  ptnA-AVVTGIPVWCSY  606
                  VVTG+PVW +Y
Sbjct  183  GYRGRVVVTGVPVWGAY  199



>ref|XP_003623819.1| hypothetical protein MTR_7g076000 [Medicago truncatula]
 gb|AES80037.1| BON1-associated-like protein [Medicago truncatula]
Length=167

 Score =   105 bits (261),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 69/177 (39%), Positives = 97/177 (55%), Gaps = 26/177 (15%)
 Frame = +1

Query  100  SRDLEITVISGEGLRVGK----KNVFVTVK----SEFSCNVKATGVDKGGGSFPAWNEKL  255
            SR LEIT+++ E L + K    KN FV++K    +E   + K    + GGGS  AWNE L
Sbjct  2    SRILEITILNAENLHMNKNSINKNAFVSLKCDSSNEICYSTKENSEECGGGSCLAWNETL  61

Query  256  VVDLPMHARYLTLQVQCKT-FSGVKVVGEAKVPAKDFVGGFVPESYVRFLSYRLKDRKGE  432
            V++ P++ARY+   V+CKT +  +K VG A++P  D    ++ +  V+FLSYRL D +  
Sbjct  62   VMEAPLNARYIIADVKCKTSWGNIKTVGMARIPVSDL---YLQDDQVQFLSYRLWDSRVR  118

Query  433  KNGIINISVRVKNSAAENAAVASCSSQYSRRpwtglppptgnptnAAVVTGIPVWCS  603
            +NG+INISV VK     N                   P  G+  +  VVTGIPVW S
Sbjct  119  RNGVINISVTVKVMEYSNPVTG--------------IPVAGDNGSDGVVTGIPVWLS  161



>ref|XP_007134958.1| hypothetical protein PHAVU_010G090000g [Phaseolus vulgaris]
 gb|ESW06952.1| hypothetical protein PHAVU_010G090000g [Phaseolus vulgaris]
Length=178

 Score =   105 bits (261),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 54/128 (42%), Positives = 86/128 (67%), Gaps = 4/128 (3%)
 Frame = +1

Query  88   METSSRDLEITVISGEGLRVGKKNVFVTVKSE-FSCNVKATGVDKGGGSFPAWNEKLVVD  264
            M   SR LEITVISGE +R+  ++ +V V++E  +C    +  D G  +F +WNEK ++D
Sbjct  1    MGLRSRTLEITVISGENVRI-MEDAYVVVRAESLNCCTTRSAKDHGT-NFLSWNEKFLLD  58

Query  265  LPMHARYLTLQVQCKTFSGVKVVGEAKVPAKDFVG-GFVPESYVRFLSYRLKDRKGEKNG  441
            +PMHAR +T +VQC  F   + +G A++ A DF+G   VPE+ ++  SY L+D +G++NG
Sbjct  59   VPMHARSITFEVQCTKFKAFRPLGVARIAASDFLGDAAVPENQLQEWSYGLRDWEGKRNG  118

Query  442  IINISVRV  465
            +I+ +VR+
Sbjct  119  VIHFAVRL  126



>gb|KCW71689.1| hypothetical protein EUGRSUZ_E00206 [Eucalyptus grandis]
Length=271

 Score =   107 bits (266),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 65/134 (49%), Positives = 84/134 (63%), Gaps = 11/134 (8%)
 Frame = +1

Query  109  LEITVISGEGLRVGKK---NVFVTVKSEFS--CNVKATGVDKGGGSFPAWNEKLVVDLPM  273
            LEIT+ISGE LR+ KK   N  V V+ E S  C+ K    DKG  + P WNEKL  DLP+
Sbjct  102  LEITLISGENLRLNKKPVKNAVVAVRVEASHECSTKP-APDKG--TNPQWNEKLAFDLPL  158

Query  274  HARYLTLQVQCKTFSG-VKVVGEAKVPAKDFVG-GFVPESYVRFLSYRLKDRKG-EKNGI  444
            HA ++TL+V+C++ SG  K+VG A VP  D  G    PE  V FLSYRL+D  G + +GI
Sbjct  159  HAGFITLEVKCRSSSGSYKLVGGATVPVSDLAGEPGTPEGLVHFLSYRLRDSNGVQTDGI  218

Query  445  INISVRVKNSAAEN  486
            INIS ++   A  +
Sbjct  219  INISAKMSGPAPAH  232



>ref|XP_007134959.1| hypothetical protein PHAVU_010G090100g [Phaseolus vulgaris]
 gb|ESW06953.1| hypothetical protein PHAVU_010G090100g [Phaseolus vulgaris]
Length=178

 Score =   104 bits (259),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 63/178 (35%), Positives = 99/178 (56%), Gaps = 9/178 (5%)
 Frame = +1

Query  88   METSSRDLEITVISGEGLRVGKKNVFVTVKSE-FSCNVKATGVDKGGGSFPAWNEKLVVD  264
            M   SR LEITVISGE +R+  ++ +V V++E  +C       D G  +F +WNEK ++D
Sbjct  1    MGLRSRTLEITVISGENVRI-MEDAYVVVRAESLNCCTTRPAKDDGT-NFLSWNEKFLLD  58

Query  265  LPMHARYLTLQVQCKTFSGVKVVGEAKVPAKDFVG-GFVPESYVRFLSYRLKDRKGEKNG  441
            +PMHAR +T +VQC  F   + +G A++ A D +G   VPE+ ++ LSY L+D +G++NG
Sbjct  59   MPMHARSITFEVQCTKFKAFRPLGVARIAASDILGDAAVPENQLQELSYGLRDWEGKRNG  118

Query  442  IINISVRV---KNSAAENAAVASCSSQYSRRpwtglppptgnptnAAVVTGIPVWCSY  606
            +I+ +V+V     +  E     S  +  + +                VV G+P WC Y
Sbjct  119  VIHFTVKVVPPPPTTEEKCLKPSVKAVVTGK--GCGDGMKVGDKKKEVVVGVPFWCYY  174



>ref|XP_004510855.1| PREDICTED: BON1-associated protein 2-like [Cicer arietinum]
Length=166

 Score =   103 bits (257),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 56/129 (43%), Positives = 82/129 (64%), Gaps = 7/129 (5%)
 Frame = +1

Query  88   METSSRDLEITVISGEGLRVGKKNVFVTVKSEFSCNVKATGVDKG-----GGSFPAWNEK  252
            M  +S  LEITVIS E + V K++ +V V+ E S N   T + K        SF +WNEK
Sbjct  4    MGVTSFTLEITVISCENVHV-KEDAYVVVRGE-SLNCYTTKMVKNKDCENNSSFLSWNEK  61

Query  253  LVVDLPMHARYLTLQVQCKTFSGVKVVGEAKVPAKDFVGGFVPESYVRFLSYRLKDRKGE  432
             ++D+P+HAR +  +VQCK F G + +G A++   D +G  VPE+ ++ LSYRL+D +G 
Sbjct  62   FLLDMPLHARSIKFEVQCKKFKGFRPIGVARIEVSDILGEVVPENGLKVLSYRLRDWEGR  121

Query  433  KNGIINISV  459
            +NGII+ SV
Sbjct  122  QNGIIHFSV  130



>gb|AAC28548.1| hypothetical protein [Arabidopsis thaliana]
Length=279

 Score =   105 bits (263),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 70/197 (36%), Positives = 107/197 (54%), Gaps = 30/197 (15%)
 Frame = +1

Query  94   TSSRDLEITVISGEGLRVGKKNVFVTVKSEFSCNVK--ATGVDKGGGSFPAWNEKLVVDL  267
            T  R LEI VIS EGL+V +K +     S    + K  A+ VD+ GGS+P W ++  +++
Sbjct  5    TFKRSLEIEVISAEGLKVDRKPLKKKTYSVVRIDEKSWASKVDELGGSYPIWKDRFDMEM  64

Query  268  PMHA--RYLTLQVQCKTFSGV---KVVGEAKVPAKDFVGGFVPESYVRFLSYRLKDRKGE  432
            P++A  R+++++V  +T SG    K VG AK+P  DF+GGF P+ ++ FLSYRL+D  G+
Sbjct  65   PINASVRFISIEVYYRT-SGSGRDKNVGYAKIPVTDFMGGFAPQGHLNFLSYRLRDEYGD  123

Query  433  KNGIINISVRVKNSAAENAA-------------VASCS---------SQYSRRpwtglpp  546
            K GI+N+S+ VK    ++ +              A+CS         +Q  R   +    
Sbjct  124  KCGIVNVSIMVKPDGNDHKSSLPSSSFAVAPVDYAACSWQATAAARNNQMWRPRTSSSMV  183

Query  547  ptgnptnAAVVTGIPVW  597
             T       VVTG+PVW
Sbjct  184  STAGYGGGRVVTGVPVW  200



>emb|CDY37063.1| BnaA04g26410D [Brassica napus]
Length=205

 Score =   103 bits (258),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 71/198 (36%), Positives = 108/198 (55%), Gaps = 28/198 (14%)
 Frame = +1

Query  97   SSRDLEITVISGEGLRVG----KKNVFVTVKSEFSCNVKATGVDKGGGSFPAWNEKLVVD  264
            S R LEI +IS EGL+V     K+  F  V+ +   + K   VD+ GGS+P W +++  +
Sbjct  6    SKRSLEIELISAEGLKVNGKPVKRQTFGVVRIDQETHHKCK-VDEQGGSYPIWKDRIKTE  64

Query  265  LPMHA--RYLTLQVQCKTFSGVK-VVGEAKVPAKDFVGGFVPESYVRFLSYRLKDRKGEK  435
            + +    R+++++V   T  G K  VG AK+P  DF+GGF P+ ++ FLSYRL+D  G+K
Sbjct  65   MAVDGSVRFISVEVFYLTSGGAKKSVGVAKIPVTDFMGGFTPQGHLNFLSYRLRDEYGDK  124

Query  436  NGIINISVRVKNSAAENAAVA------------SCSSQYSR-------Rpwtglppptgn  558
            +GI+N+S+ VK    +   V+            +CSSQ ++       RP T     T  
Sbjct  125  SGIVNVSIMVKPDVNDVKYVSPSPLMVPSLGYTACSSQAAKAVNGQMWRPTTSSSMATTI  184

Query  559  ptnAAVVTGIPV-WCSYQ  609
                 VVTG+PV W +YQ
Sbjct  185  GYGGRVVTGVPVNWPTYQ  202



>ref|XP_009142364.1| PREDICTED: BON1-associated protein 2 [Brassica rapa]
Length=205

 Score =   103 bits (258),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 71/198 (36%), Positives = 108/198 (55%), Gaps = 28/198 (14%)
 Frame = +1

Query  97   SSRDLEITVISGEGLRVG----KKNVFVTVKSEFSCNVKATGVDKGGGSFPAWNEKLVVD  264
            S R LEI +IS EGL+V     K+  F  V+ +   + K   VD+ GGS+P W +++  +
Sbjct  6    SKRSLEIELISAEGLKVNGKPVKRQTFGVVRIDQETHHKCK-VDEQGGSYPIWKDRIKTE  64

Query  265  LPMHA--RYLTLQVQCKTFSGVK-VVGEAKVPAKDFVGGFVPESYVRFLSYRLKDRKGEK  435
            + +    R+++++V   T  G K  VG AK+P  DF+GGF P+ ++ FLSYRL+D  G+K
Sbjct  65   MAVDGSVRFISVEVFYLTSGGAKKSVGVAKIPVTDFMGGFTPQGHLNFLSYRLRDEYGDK  124

Query  436  NGIINISVRVKNSAAENAAVA------------SCSSQYSR-------Rpwtglppptgn  558
            +GI+N+S+ VK    +   V+            +CSSQ ++       RP T     T  
Sbjct  125  SGIVNVSIMVKPDVNDVKYVSPSPLMVPSLGYTACSSQAAKAVNGQMWRPMTSSSMATTI  184

Query  559  ptnAAVVTGIPV-WCSYQ  609
                 VVTG+PV W +YQ
Sbjct  185  GYGGRVVTGVPVNWPTYQ  202



>ref|XP_002878369.1| hypothetical protein ARALYDRAFT_486595 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH54628.1| hypothetical protein ARALYDRAFT_486595 [Arabidopsis lyrata subsp. 
lyrata]
Length=179

 Score =   102 bits (255),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 66/178 (37%), Positives = 101/178 (57%), Gaps = 11/178 (6%)
 Frame = +1

Query  100  SRDLEITVISGEGLRVG-----KKNVFVTVKSEFSCNVKATGVDKGGGSFPAWNEKLVVD  264
            ++ LEI + S EGL++      KK + V    E S N   + +D+   S P WN K  + 
Sbjct  2    TKTLEIDLRSAEGLKLNRRPIKKKTLCVVTIDEKSRN---SNLDESRRSNPTWNYKSEIP  58

Query  265  LPMHARYLTLQVQCKTFSG-VKVVGEAKVPAKDFVGGFVPESYVRFLSYRLKDRKGEKNG  441
            +  + R++T++V  +T SG  K +GEAK+P KDF+G + PE ++ FLSYRL+D  G+K G
Sbjct  59   INGNVRFITIEVFYRTGSGHQKKIGEAKIPTKDFMGRYSPEGHLNFLSYRLRDEFGDKCG  118

Query  442  IINISVRVKNSAAENAAVASCSSQYSRRp--wtglppptgnptnAAVVTGIPVWCSYQ  609
            I+N+S+ VK+S        +CSSQ +           P+ +     +VTG+PVW  YQ
Sbjct  119  IVNLSILVKSSTTAIRDYGACSSQAADTGLWRPRSETPSIDGYGGRIVTGVPVWGVYQ  176



>gb|KEH18942.1| BON1-associated-like protein [Medicago truncatula]
Length=183

 Score =   102 bits (255),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 65/184 (35%), Positives = 98/184 (53%), Gaps = 16/184 (9%)
 Frame = +1

Query  88   METSSRDLEITVISGEGLRVGKKNVFVTVKSE-FSCNVKATGVDKGG----GSFPAWNEK  252
            M  +S+ LEIT+ISGE + V  ++ +V V+ E  +C    T  D        SF +WNEK
Sbjct  1    MVVASQTLEITIISGENIHV-TEDAYVVVRGESLNCYTTKTVKDNDNCGKNSSFLSWNEK  59

Query  253  LVVDLPMHARYLTLQVQCKTFSGVKVVGEAKVPAKDFVGGFVPESYVRFLSYRLKDRKGE  432
             ++++P+HAR +T +VQCK F  V+ +G A++   D + G   E+  R LSY+L++ +G 
Sbjct  60   FLLNMPLHARSITFEVQCKKFKSVRPIGVARIAVSDILNGDESENCSRILSYKLRNWEGR  119

Query  433  KNGIINISVRV------KNSAAENAAVASCSSQYSRRpwtglppptgnptnAAVVTGIPV  594
            +NG+I+  VRV        + AE   VA   S   R          G   +   V GIPV
Sbjct  120  QNGVIHFGVRVVVPEQRTVTVAEKQPVADGKSYGDR----LTGIDVGTKNSNGAVIGIPV  175

Query  595  WCSY  606
            W +Y
Sbjct  176  WWNY  179



>ref|XP_007139959.1| hypothetical protein PHAVU_008G073100g [Phaseolus vulgaris]
 gb|ESW11953.1| hypothetical protein PHAVU_008G073100g [Phaseolus vulgaris]
Length=163

 Score =   102 bits (253),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 67/174 (39%), Positives = 100/174 (57%), Gaps = 21/174 (12%)
 Frame = +1

Query  109  LEITVISGEGLRVG----KKNVFVTVKSEFSCNVKATGVDKGGGSF-PAWNEKLVVDLPM  273
            +EIT+IS E L +     KK+ +V V ++       T  ++ GGS  P+WNEK +VD   
Sbjct  1    MEITIISAENLCMNGKPIKKDTYVVVHTQSCTKFFTTSTEEEGGSNNPSWNEKFLVD---  57

Query  274  HARYLTLQVQCKTFSGVKVVGEAKVPAKDF-VGGFVPESYVRFLSYRLKDRKGEKNGIIN  450
             A  +TL+V+CKT+ GVK VG A++   +F +GGF  E+ ++FLSYRL D KG++NG+IN
Sbjct  58   GANCITLEVKCKTWFGVKSVGAARIAVSEFNLGGFAAENSLQFLSYRLWDEKGKRNGVIN  117

Query  451  ISVRVKNSAAENAAVASCSSQYSRRpwtglppptgnptnAAVVTGIPVWCSYQV  612
             SVRV  +  E      C S    +         G    A +VTG+PV+ ++ +
Sbjct  118  FSVRVVKAPPE------CESSVWMQ------VTVGENDAAGLVTGVPVFLNFPL  159



>gb|AES70909.2| BON1-associated-like protein [Medicago truncatula]
Length=244

 Score =   103 bits (257),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 62/188 (33%), Positives = 102/188 (54%), Gaps = 8/188 (4%)
 Frame = +1

Query  88   METSSRDLEITVISGEGLRVGKKNVFVTVKSE-FSCNVKATGVDKG----GGSFPAWNEK  252
            M  +SR LEITVI+GE + +  ++ +V V+ E  +C    T  +K       SF +WNEK
Sbjct  1    MGIASRTLEITVITGENIHI-TEDAYVVVRGESLNCYTTKTVKNKDDCGKNSSFLSWNEK  59

Query  253  LVVDLPMHARYLTLQVQCKTFSGVKVVGEAKVPAKDFVGGFVPESYVRFLSYRLKDRKGE  432
             ++++P+HAR +T +VQCK F  V+ +G  ++   D + G   E+  R LSY+L++ +G 
Sbjct  60   FLLNMPLHARSITFEVQCKKFKSVRPIGVTRIAVLDILNGAELENCSRILSYKLRNWEGR  119

Query  433  KNGIINISVRVKNSAAENAAVASCSSQYSRRp--wtglppptgnptnAAVVTGIPVWCSY  606
            +NG+I+  VRV      +  V    +   ++           G   + +VV GIPVW +Y
Sbjct  120  QNGVIHFGVRVVMPEKRSVTVVKNKTTADKKSYGDRLTGIDVGTKNSNSVVIGIPVWWNY  179

Query  607  QV*VLVGL  630
             + +L  L
Sbjct  180  PIDLLDDL  187



>ref|XP_003521254.1| PREDICTED: uncharacterized protein LOC100802552 [Glycine max]
 gb|KHN27289.1| hypothetical protein glysoja_034642 [Glycine soja]
Length=180

 Score =   101 bits (251),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 57/143 (40%), Positives = 87/143 (61%), Gaps = 12/143 (8%)
 Frame = +1

Query  82   FDMETSSRDLEITVISGEGLRV----GKKNVFVTVKSEF--SCNVKATGVDKGGGSFPAW  243
             + +  +R LEITV+SGE + V    G +NV+V V++E   SC  K    DKG     AW
Sbjct  1    MEAKPQARTLEITVMSGENICVDRSSGAENVYVVVRAESLNSCTTKTVNEDKG---VHAW  57

Query  244  NEKLVVDLPMHARYLTLQVQCKTFSGVKVVGEAKVPAKDFVGG---FVPESYVRFLSYRL  414
            NEKL++D+P HAR +T +VQCK + GV+ +G A++   DF+      V ES  +   Y L
Sbjct  58   NEKLLLDIPTHARSVTFEVQCKKYKGVRPIGVARIALSDFLSNDTKIVSESVPQMYCYGL  117

Query  415  KDRKGEKNGIINISVRVKNSAAE  483
            ++ +G +NG+I+ SV+V + A +
Sbjct  118  RNWEGRQNGVIHFSVKVVSLAGD  140



>ref|XP_004510906.1| PREDICTED: BON1-associated protein 2-like [Cicer arietinum]
Length=186

 Score =   101 bits (251),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 60/181 (33%), Positives = 101/181 (56%), Gaps = 11/181 (6%)
 Frame = +1

Query  88   METSSRDLEITVISGEGLRVGKKNVFVTVKSE-FSCNVKATGVDKGGG---SFPAWNEKL  255
            M  +S  LEITVIS E + V K++ +V V+ E  +C       +K  G   SF +WNEK 
Sbjct  1    MGVTSCTLEITVISCENVNV-KEDAYVVVRGESLNCYTTKMVKNKDCGNNSSFLSWNEKF  59

Query  256  VVDLPMHARYLTLQVQCKTFSGVKVVGEAKVPAKDFVGGFVPESYVRFLSYRLKDRKGEK  435
            ++D+P+HAR +T +VQCK   GV+ +G+A++   D +   V E+ ++ LSY L+D +G +
Sbjct  60   LLDMPLHARSITFEVQCKKLKGVRPIGKARIALSDILEDIVSENSLKILSYGLRDWEGRR  119

Query  436  NGIINISVRVKNSAAENAAVASCSSQ---YSRRpwtglppptgnptnA-AVVTGIPVWCS  603
            NG+I+  VRV    ++  ++ +   +   Y +     +         +  VV G+P+W +
Sbjct  120  NGVIHFGVRV--VVSKKCSITTAEKEMVVYEKNSDELITEIDVGAKMSNGVVIGVPLWWN  177

Query  604  Y  606
            Y
Sbjct  178  Y  178



>ref|XP_010506555.1| PREDICTED: BON1-associated protein 2-like isoform X2 [Camelina 
sativa]
Length=201

 Score =   101 bits (251),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 56/138 (41%), Positives = 85/138 (62%), Gaps = 8/138 (6%)
 Frame = +1

Query  94   TSSRDLEITVISGEGLRVG----KKNVFVTVKSEFSCNVKATGVDKGGGSFPAWNEKLVV  261
            T  R LE+ VIS +GL+V     KK  F  V  +   + K+  +D  GGS P W  K  +
Sbjct  6    TMKRSLEVEVISAQGLKVDRKPLKKKTFTVVSIDDKHSWKSN-LDDLGGSCPVWKYKFDI  64

Query  262  DLPMHA--RYLTLQVQCKTFSGV-KVVGEAKVPAKDFVGGFVPESYVRFLSYRLKDRKGE  432
            ++P++   R++++ V  +T +G  K+VG AK+P  DF+GGF P+ ++ FLSYRL+D  G+
Sbjct  65   EMPINGSVRFISVDVFYRTSNGAEKLVGHAKIPVTDFMGGFAPQGHLNFLSYRLRDDYGD  124

Query  433  KNGIINISVRVKNSAAEN  486
            K GIIN+S+ VK   + N
Sbjct  125  KCGIINVSIMVKPDGSYN  142



>emb|CDX71760.1| BnaC08g31140D [Brassica napus]
Length=211

 Score =   101 bits (251),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 66/187 (35%), Positives = 100/187 (53%), Gaps = 17/187 (9%)
 Frame = +1

Query  94   TSSRDLEITVISGEGL----RVGKKNVFVTVKSEFSCNVKATGVDKGGGSFPAWNEKLVV  261
            T ++ LEI + S EGL    R+ KK  F   +       + + +D  GGS P WN KL +
Sbjct  24   TMTKTLEIDIRSAEGLKLNRRLLKKKTFAVAR--IGEKSRPSHLDVSGGSSPTWNCKLEM  81

Query  262  DLPMHARYLTLQVQCKTFSG-VKVVGEAKVPAKDFVGGFVPESYVRFLSYRLKDRKGEKN  438
             +    +++ ++V  +T SG  K +GEAK+P  DF+G + PE ++ FLSYRL+D  G+K 
Sbjct  82   PMSGTEQFIYIEVLFRTSSGREKKIGEAKIPTSDFMGRYSPEGHLNFLSYRLRDEYGDKC  141

Query  439  GIINISVRV--------KNSAAENAAVASCSSQYSRRp--wtglppptgnptnAAVVTGI  588
            GI+N+S+ V        K+S+       +CSSQ +          PP  +     +VTG+
Sbjct  142  GIVNVSIMVKPYSTDEFKSSSTAMKDYGACSSQAAETGLWRPRSEPPAIDGYGGRIVTGV  201

Query  589  PVWCSYQ  609
            PVWC  Q
Sbjct  202  PVWCVLQ  208



>ref|XP_006402510.1| hypothetical protein EUTSA_v10006244mg [Eutrema salsugineum]
 gb|ESQ43963.1| hypothetical protein EUTSA_v10006244mg [Eutrema salsugineum]
Length=200

 Score =   100 bits (249),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 62/182 (34%), Positives = 98/182 (54%), Gaps = 14/182 (8%)
 Frame = +1

Query  100  SRDLEITVISGEGLRVGKKNV----FVTVKSEFSCNVKATGVDKGGGSFPAWNEKLVVDL  267
            ++ LEI + S EGL+V ++ V    F   +       + +  D+ GGS P WN K  + +
Sbjct  18   TKTLEIDIRSAEGLKVNRRPVKRKTFAVAR--IGEKSRTSNPDESGGSNPTWNFKSEIPI  75

Query  268  PMHARYLTLQVQCKTFSG-VKVVGEAKVPAKDFVGGFVPESYVRFLSYRLKDRKGEKNGI  444
                ++++++V  +T S  VK +GEAK+PA DF+G + PE +  FLSYRL+D  G+K GI
Sbjct  76   NSSVQFISIEVFYRTGSRRVKKIGEAKIPATDFMGRYSPEGHFNFLSYRLRDEFGDKCGI  135

Query  445  INISVRVKNSAAENAAV----ASCSSQYSRR---pwtglppptgnptnAAVVTGIPVWCS  603
            +N+S+ VK  + E+        +CSSQ +          P          +VTG+P+WC 
Sbjct  136  VNVSILVKPDSTESTTAMNDYGACSSQAAETGLWRPRSEPLSIDGYGGGRIVTGVPIWCV  195

Query  604  YQ  609
             Q
Sbjct  196  IQ  197



>ref|XP_006576358.1| PREDICTED: BON1-associated protein 2-like [Glycine max]
Length=174

 Score = 99.8 bits (247),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 66/172 (38%), Positives = 93/172 (54%), Gaps = 16/172 (9%)
 Frame = +1

Query  109  LEITVISGEGLRVGKKNVFVTVKSE-FSCNVKATGVDKGG---GSFPAWNEKLVVDLPMH  276
            LEITVIS E LRV  ++ +V V++E   C       D G    G F +WNEKL++++PMH
Sbjct  9    LEITVISCENLRV-TEDPYVVVRAESLKCCTTKMAKDSGSNKTGLF-SWNEKLMLNMPMH  66

Query  277  ARYLTLQVQCKTFSGVKVVGEAKVPAKDFVGG-FVPESYVRFLSYRLKDRKGEKNGIINI  453
            AR +T +VQC  F G++ VG A++   DF+GG  V E+ +  LSYRL+D +G+ NG+I+ 
Sbjct  67   ARSITFEVQCNRFKGLRPVGVARIAVSDFLGGAAVSENCLHELSYRLRDWEGKGNGVIHF  126

Query  454  SVR-VKNSAAENAAVASCSSQYSRRpwtglppptgnptnAAVVTGIPVWCSY  606
             VR V      NAAV         +                 V G+P W +Y
Sbjct  127  GVRVVPPEERSNAAVKPVKGMTVSKDSGDYKSNE--------VVGVPFWWNY  170



>ref|XP_003600658.1| hypothetical protein MTR_3g064780 [Medicago truncatula]
Length=486

 Score =   103 bits (257),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 62/188 (33%), Positives = 102/188 (54%), Gaps = 8/188 (4%)
 Frame = +1

Query  88   METSSRDLEITVISGEGLRVGKKNVFVTVKSE-FSCNVKATGVDKG----GGSFPAWNEK  252
            M  +SR LEITVI+GE + +  ++ +V V+ E  +C    T  +K       SF +WNEK
Sbjct  1    MGIASRTLEITVITGENIHI-TEDAYVVVRGESLNCYTTKTVKNKDDCGKNSSFLSWNEK  59

Query  253  LVVDLPMHARYLTLQVQCKTFSGVKVVGEAKVPAKDFVGGFVPESYVRFLSYRLKDRKGE  432
             ++++P+HAR +T +VQCK F  V+ +G  ++   D + G   E+  R LSY+L++ +G 
Sbjct  60   FLLNMPLHARSITFEVQCKKFKSVRPIGVTRIAVLDILNGAELENCSRILSYKLRNWEGR  119

Query  433  KNGIINISVRVKNSAAENAAVASCSSQYSRRp--wtglppptgnptnAAVVTGIPVWCSY  606
            +NG+I+  VRV      +  V    +   ++           G   + +VV GIPVW +Y
Sbjct  120  QNGVIHFGVRVVMPEKRSVTVVKNKTTADKKSYGDRLTGIDVGTKNSNSVVIGIPVWWNY  179

Query  607  QV*VLVGL  630
             + +L  L
Sbjct  180  PIDLLDDL  187



>gb|KEH18945.1| BON1-associated-like protein [Medicago truncatula]
Length=183

 Score = 99.4 bits (246),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 54/142 (38%), Positives = 84/142 (59%), Gaps = 6/142 (4%)
 Frame = +1

Query  88   METSSRDLEITVISGEGLRVGKKNVFVTVKSE-FSCNVKATGVD----KGGGSFPAWNEK  252
            M  +S  LEITVISGE + V  ++ +V V+ E  +C    T  D    +   SF +WNEK
Sbjct  1    MGVASHTLEITVISGENIHV-IEDAYVVVRGESLNCYTTKTVKDNDDCRKNSSFLSWNEK  59

Query  253  LVVDLPMHARYLTLQVQCKTFSGVKVVGEAKVPAKDFVGGFVPESYVRFLSYRLKDRKGE  432
             ++++P+HAR +T +VQCK F  V+ +G A++   D + G   E+  R LSY+L+D +G 
Sbjct  60   FLLNMPLHARSITFEVQCKKFKSVRPIGVARIAVSDILNGAESENCSRILSYKLRDWEGR  119

Query  433  KNGIINISVRVKNSAAENAAVA  498
            +NG+I+  V+V      +  VA
Sbjct  120  QNGVIHFGVKVVAPEERSVTVA  141



>gb|KFK35317.1| hypothetical protein AALP_AA5G268700 [Arabis alpina]
Length=171

 Score = 99.0 bits (245),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 62/175 (35%), Positives = 96/175 (55%), Gaps = 19/175 (11%)
 Frame = +1

Query  100  SRDLEITVISGEGLRVGKK----NVFVTVK---SEFSCNVKATGVDKGGGSFPAWNEKLV  258
            ++ LEI + S EGL+V KK    N F  VK        N+  +G   G  S P WN K  
Sbjct  2    TKSLEIHITSAEGLKVNKKLIKQNTFAVVKIGEKSLPSNLNLSG---GENSNPTWNYKTE  58

Query  259  VDLPMHARYLTLQVQCKTFSGV-KVVGEAKVPAKDFVGGFVPESYVRFLSYRLKDRKGEK  435
             ++ +  +++ ++V  +T SG  K +GEAK+P  DF+G + P+ ++  LSYRL+D  G+K
Sbjct  59   TEIDILLQFIFIEVFYRTGSGRDKKIGEAKIPTNDFMGRYSPQGHLNILSYRLRDEYGDK  118

Query  436  NGIINISVRVKNSAAENAAVASCSSQYSRRpwtglppptgnptnAAVVTGIPVWC  600
             GI+N+S+ VK +++E      CSS+           P  +     +VTG+PVWC
Sbjct  119  CGIVNVSIMVKPNSSE---YGDCSSE-----VRTESLPCIDGYGGRIVTGVPVWC  165



>ref|XP_009116781.1| PREDICTED: BON1-associated protein 1 [Brassica rapa]
 emb|CDY69632.1| BnaAnng31050D [Brassica napus]
Length=211

 Score = 99.4 bits (246),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 65/187 (35%), Positives = 100/187 (53%), Gaps = 17/187 (9%)
 Frame = +1

Query  94   TSSRDLEITVISGEGL----RVGKKNVFVTVKSEFSCNVKATGVDKGGGSFPAWNEKLVV  261
            T ++ +EI + S EGL    R+ KK  F   +       + + +D  GGS P WN KL +
Sbjct  24   TMTKTVEIDIRSAEGLKLNRRLLKKKTFAVAR--IGEKSRPSHLDVSGGSSPTWNCKLEM  81

Query  262  DLPMHARYLTLQVQCKTFSG-VKVVGEAKVPAKDFVGGFVPESYVRFLSYRLKDRKGEKN  438
             +    +++ ++V  +T SG  K +GEAK+P  DF+G + PE ++ FLSYRL+D  G+K 
Sbjct  82   PMSGTEQFIYIEVLFRTSSGREKKIGEAKIPTSDFMGRYSPEGHLNFLSYRLRDEYGDKC  141

Query  439  GIINISVRV--------KNSAAENAAVASCSSQYSRRp--wtglppptgnptnAAVVTGI  588
            GI+N+S+ V        K+S+       +CSSQ +          PP  +     +VTG+
Sbjct  142  GIVNVSIMVKPYSTDEFKSSSTAMKDYGACSSQAAETGLWRPRSEPPAIDGYGGRIVTGV  201

Query  589  PVWCSYQ  609
            PVWC  Q
Sbjct  202  PVWCVLQ  208



>gb|AAM64568.1| unknown [Arabidopsis thaliana]
Length=177

 Score = 98.2 bits (243),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 59/175 (34%), Positives = 96/175 (55%), Gaps = 7/175 (4%)
 Frame = +1

Query  100  SRDLEITVISGEGLRVG----KKNVFVTVKSEFSCNVKATGVDKGGGSFPAWNEKLVVDL  267
            ++ LEI + S EGL++     KK  F  VK +  C  + + +D+   S P WN K  + +
Sbjct  2    TKTLEIDLRSAEGLKLNRRPIKKKTFAVVKIDEKC--RKSNLDESRRSNPTWNYKSEMPI  59

Query  268  PMHARYLTLQVQCKTFSGV-KVVGEAKVPAKDFVGGFVPESYVRFLSYRLKDRKGEKNGI  444
              + +++ ++V  +T SG  K +GEAK+P  DF+G + PE ++ FLSYRL+D  G+K GI
Sbjct  60   NGNEQFIFIEVFYRTGSGHDKKIGEAKIPTNDFMGRYSPEGHLNFLSYRLRDEFGDKCGI  119

Query  445  INISVRVKNSAAENAAVASCSSQYSRRpwtglppptgnptnAAVVTGIPVWCSYQ  609
            +N+S+ VK+    +    S  +  +      L   + +      VTG+PVW  YQ
Sbjct  120  VNLSILVKSDPTRDYGACSSQAAVTGLWRPRLETASIDGYGGRTVTGVPVWGLYQ  174



>ref|NP_001190150.1| BON association protein 1 [Arabidopsis thaliana]
 emb|CAB71049.1| putative protein [Arabidopsis thaliana]
 gb|AEE80171.1| BON association protein 1 [Arabidopsis thaliana]
Length=178

 Score = 98.2 bits (243),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 59/175 (34%), Positives = 96/175 (55%), Gaps = 7/175 (4%)
 Frame = +1

Query  100  SRDLEITVISGEGLRVG----KKNVFVTVKSEFSCNVKATGVDKGGGSFPAWNEKLVVDL  267
            ++ LEI + S EGL++     KK  F  VK +  C  + + +D+   S P WN K  + +
Sbjct  3    TKTLEIDLRSAEGLKLNRRPIKKKTFAVVKIDEKC--RKSNLDESRRSNPTWNYKSEMPI  60

Query  268  PMHARYLTLQVQCKTFSGV-KVVGEAKVPAKDFVGGFVPESYVRFLSYRLKDRKGEKNGI  444
              + +++ ++V  +T SG  K +GEAK+P  DF+G + PE ++ FLSYRL+D  G+K GI
Sbjct  61   NGNEQFIFIEVFYRTGSGHDKKIGEAKIPTNDFMGRYSPEGHLNFLSYRLRDEFGDKCGI  120

Query  445  INISVRVKNSAAENAAVASCSSQYSRRpwtglppptgnptnAAVVTGIPVWCSYQ  609
            +N+S+ VK+    +    S  +  +      L   + +      VTG+PVW  YQ
Sbjct  121  VNLSILVKSDPTRDYGACSSQAAVTGLWRPRLETASIDGYGGRTVTGVPVWGLYQ  175



>gb|KHN04629.1| BON1-associated protein 2 [Glycine soja]
Length=190

 Score = 98.2 bits (243),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 63/188 (34%), Positives = 98/188 (52%), Gaps = 13/188 (7%)
 Frame = +1

Query  82   FDMETSSRDLEITVISGEGLRVGKK----NVFVTVKSEFSCNVKATGVDKGGGSFPAWNE  249
             + ++ SR LEITV+SGE + V +     NV+V V++E S N   T +  G G   AWNE
Sbjct  1    MEAKSHSRILEITVMSGENISVDRSSVAANVYVVVRAE-SLNSCTTKMVNGDGGVHAWNE  59

Query  250  KLVVDLPMHARYLTLQVQCKTFSGVKVVGEAKVPAKDFVGG---FVPESYVRFLSYRLKD  420
            K ++ +P +AR +T +VQC  + GV+ +G A++   D +      V ES  + L Y L++
Sbjct  60   KFLLGIPSYARSVTFEVQCMNYKGVRPIGVARIALSDLLSNNTKIVSESVPQMLCYGLRN  119

Query  421  RKGEKNGIINISVRV----KNSAAENAAVASCSS-QYSRRpwtglppptgnptnAAVVTG  585
             +G +NG+I+ SVR+     N  +E       ++  Y       +        +  V  G
Sbjct  120  WEGRRNGVIHFSVRMVAPGDNLCSETKQEKEITTVNYRGIEHEVMGIQVEAKNSTHVAIG  179

Query  586  IPVWCSYQ  609
            IPVW SYQ
Sbjct  180  IPVWWSYQ  187



>ref|NP_567111.1| BON association protein 1 [Arabidopsis thaliana]
 sp|Q941L2.1|BAP1_ARATH RecName: Full=BON1-associated protein 1 [Arabidopsis thaliana]
 gb|AAK98798.1| BON1-associated protein 1 [Arabidopsis thaliana]
 dbj|BAC41910.1| putative BON1-associated protein 1 BAP1 [Arabidopsis thaliana]
 gb|AAO39955.1| At3g61190 [Arabidopsis thaliana]
 gb|AEE80170.1| BON association protein 1 [Arabidopsis thaliana]
Length=192

 Score = 98.2 bits (243),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 59/175 (34%), Positives = 96/175 (55%), Gaps = 7/175 (4%)
 Frame = +1

Query  100  SRDLEITVISGEGLRVG----KKNVFVTVKSEFSCNVKATGVDKGGGSFPAWNEKLVVDL  267
            ++ LEI + S EGL++     KK  F  VK +  C  + + +D+   S P WN K  + +
Sbjct  17   TKTLEIDLRSAEGLKLNRRPIKKKTFAVVKIDEKC--RKSNLDESRRSNPTWNYKSEMPI  74

Query  268  PMHARYLTLQVQCKTFSGV-KVVGEAKVPAKDFVGGFVPESYVRFLSYRLKDRKGEKNGI  444
              + +++ ++V  +T SG  K +GEAK+P  DF+G + PE ++ FLSYRL+D  G+K GI
Sbjct  75   NGNEQFIFIEVFYRTGSGHDKKIGEAKIPTNDFMGRYSPEGHLNFLSYRLRDEFGDKCGI  134

Query  445  INISVRVKNSAAENAAVASCSSQYSRRpwtglppptgnptnAAVVTGIPVWCSYQ  609
            +N+S+ VK+    +    S  +  +      L   + +      VTG+PVW  YQ
Sbjct  135  VNLSILVKSDPTRDYGACSSQAAVTGLWRPRLETASIDGYGGRTVTGVPVWGLYQ  189



>emb|CDY51153.1| BnaA09g51880D [Brassica napus]
Length=173

 Score = 97.1 bits (240),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 58/135 (43%), Positives = 78/135 (58%), Gaps = 13/135 (10%)
 Frame = +1

Query  100  SRDLEITVISGEGLRVG----KKNVFVT--VKSEFSCNVKATGVDKGGGSFPAWNEKLVV  261
            +R LEIT IS EGL  G    KKN FV   +          T +D+ GG +PAW +KL +
Sbjct  28   TRKLEITAISAEGLLEGRKPVKKNAFVAFEIAGNHCSGAIRTRIDEVGGDYPAWEDKLEM  87

Query  262  D--LPMHAR----YLTLQVQCKTFSGV-KVVGEAKVPAKDFVGGFVPESYVRFLSYRLKD  420
            +  LP   +    +L + V C+  SG  K VG A+VP KDF GG+ PE ++  LSYRL D
Sbjct  88   EFSLPEEKKDKESFLYVGVYCQLVSGKDKHVGTARVPIKDFTGGYAPEGFLHCLSYRLWD  147

Query  421  RKGEKNGIINISVRV  465
              G++NGI+N S R+
Sbjct  148  EYGKRNGIVNFSARI  162



>ref|XP_009415833.1| PREDICTED: LOW QUALITY PROTEIN: BON1-associated protein 2-like 
[Musa acuminata subsp. malaccensis]
Length=174

 Score = 95.9 bits (237),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 61/143 (43%), Positives = 81/143 (57%), Gaps = 11/143 (8%)
 Frame = +1

Query  88   METSSRDLEITVISGEGLRVGK----KNVFVTVKSEFSCNVK-ATGVDKGGGSFPAWNEK  252
            ME ++  +EIT+IS E LR G+    K  FV V+S    + + ATGVD+ GG +P WNEK
Sbjct  1    MERTATTVEITIISAEELRRGRRPLDKGAFVAVRSGSDTHGQVATGVDRDGGGYPCWNEK  60

Query  253  LVVDLPMHARYLTLQVQCKT---FSGVKVVGEAKVPAKDFVGGFVPESYVRFLSYRLKDR  423
            L + LP  AR L+L V C++         V  A+VP  DF+     E Y+  LSY+L+D 
Sbjct  61   LTMTLPPSARSLSLGVYCRSKMGAGAACAVAAAEVPVSDFL---WLEDYLHLLSYKLRDS  117

Query  424  KGEKNGIINISVRVKNSAAENAA  492
             G  NGIIN SVRV     +  A
Sbjct  118  NGVGNGIINFSVRVIGGEGKRGA  140



>ref|XP_010671765.1| PREDICTED: BON1-associated protein 1-like [Beta vulgaris subsp. 
vulgaris]
Length=203

 Score = 94.4 bits (233),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 55/133 (41%), Positives = 78/133 (59%), Gaps = 8/133 (6%)
 Frame = +1

Query  94   TSSRDLEITVISGEGLRVG-----KKNVFVTVKSEFSC---NVKATGVDKGGGSFPAWNE  249
            +SS  LEIT+ S E L +G     KKNVFV++ ++       ++    D+     P WNE
Sbjct  6    SSSYSLEITLKSAEELIIGNHKPIKKNVFVSISTDNQVCMNKLQTKLSDEANNGKPTWNE  65

Query  250  KLVVDLPMHARYLTLQVQCKTFSGVKVVGEAKVPAKDFVGGFVPESYVRFLSYRLKDRKG  429
            KL++    +A ++ L+V  K  S  K +G AKVP  DF+G  +P +Y+  LSYRL+D+ G
Sbjct  66   KLLMTTSKNANFVHLEVYYKKRSSEKFIGIAKVPTSDFIGKNMPLNYLHCLSYRLRDQNG  125

Query  430  EKNGIINISVRVK  468
              NGIIN SV VK
Sbjct  126  APNGIINFSVIVK  138



>emb|CDY42491.1| BnaC04g21900D [Brassica napus]
Length=181

 Score = 92.8 bits (229),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 56/175 (32%), Positives = 96/175 (55%), Gaps = 18/175 (10%)
 Frame = +1

Query  94   TSSRDLEITVISGEGLRVGKKNVFVTVKSEFSC------NVKATGVDKGGGSFPAWNEKL  255
            T ++ LEI + S EGL++ ++   +  K  F+       + + + +D  GGS P WN K 
Sbjct  14   TMTKTLEIDIRSAEGLKINRR--LIKKKKTFAVARIGEKSSRPSSLDDSGGSNPKWNFKS  71

Query  256  VVDLPMHARYLTLQVQCKTFSG-VKVVGEAKVPAKDFVGGFVPESYVRFLSYRLKDRKGE  432
             + +    ++++++V  +T  G  K +GEA++PA DF+G +  E ++ FLSYRL+D  G+
Sbjct  72   EMPMKGSVQFISIEVFYRTRCGREKQIGEARIPATDFMGRYSHEGHLNFLSYRLRDEYGD  131

Query  433  KNGIINISVRVKNSAAENAAVASCSSQYSRRpwtglppptgnptnAAVVTGIPVW  597
            K GI+N+S+ VK  + E     + SS  +         P+ +      VTG+PVW
Sbjct  132  KCGIVNVSIVVKPHSTETTMFMASSSSET---------PSIDGYRGRTVTGLPVW  177



>gb|KHN27288.1| BON1-associated protein 2 [Glycine soja]
Length=191

 Score = 92.8 bits (229),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 60/195 (31%), Positives = 105/195 (54%), Gaps = 26/195 (13%)
 Frame = +1

Query  82   FDMETSSRDLEITVISGEGLRVGK----KNVFVTVKSEFSCNVKATGVDKGGGSFPAWNE  249
             +++  +R LEITV+SGE + + +    +NV+V V++E   + +   V++ GG   AWNE
Sbjct  1    MEVKPQARTLEITVMSGENISMDRSSVAENVYVVVRAESLNSCRTKMVNEEGGVH-AWNE  59

Query  250  KLVVDLPMHARYLTLQVQCKTFSGVKVVGEAKVPAKDFVG--------GFVPESYVRFLS  405
            K ++D+P++A+ +T +VQCK + GV+ +G A++   D +         G VP+     L 
Sbjct  60   KFLLDIPLYAKSVTFEVQCKKYKGVRPIGVARIALSDLLSNNTKVVSEGSVPQ----MLC  115

Query  406  YRLKDRKGEKNGIINISVR-------VKNSAAENAAVASCSSQYSRRpwtglppptgnpt  564
            Y L++ +G  NG+I+ SVR       + +   +   + + SS+       G+        
Sbjct  116  YGLRNSEGRPNGVIHFSVRMVAPRDNLYSLTKQEKDITTMSSKGIEHEVMGIQVDPKISP  175

Query  565  nAAVVTGIPVWCSYQ  609
            + A+  GIPVW SYQ
Sbjct  176  HVAI--GIPVWWSYQ  188



>emb|CDX89102.1| BnaA04g00840D [Brassica napus]
Length=184

 Score = 92.0 bits (227),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 59/174 (34%), Positives = 96/174 (55%), Gaps = 13/174 (7%)
 Frame = +1

Query  94   TSSRDLEITVISGEGLRVG-----KKNVFVTVKSEFSCNVKATGVDKGGGSFPAWNEKLV  258
            T ++ LEI + S EGL++      KK  F  VK       +++ +D  GGS P WN K  
Sbjct  14   TMTKTLEIDIRSAEGLKINRRLIKKKKTFAVVK--IGEKSRSSDLDDSGGSNPTWNFKSE  71

Query  259  VDLPMHARYLTLQVQCKTFSGV-KVVGEAKVPAKDFVGGFVPESYVRFLSYRLKDRKGEK  435
            + +    ++++++V  +T  G  K +GEA++PA DF+G +  E ++ FLSYRL+D  G+K
Sbjct  72   MPMKGSVQFISIEVFYRTRCGRDKKIGEARIPATDFMGRYSHEGHLNFLSYRLRDEYGDK  131

Query  436  NGIINISVRVKNSAAENAAVASCSSQYSRRpwtglppptgnptnAAVVTGIPVW  597
             GI+N+S+ VK  + E   +   SS       +    P+ +     +VTG+PVW
Sbjct  132  CGIVNVSIVVKPHSTETTTMFMASSS-----SSSSETPSIDGYRGRIVTGLPVW  180



>gb|ACU19695.1| unknown [Glycine max]
Length=198

 Score = 92.4 bits (228),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 51/135 (38%), Positives = 81/135 (60%), Gaps = 8/135 (6%)
 Frame = +1

Query  82   FDMETSSRDLEITVISGEGLRVGKK----NVFVTVKSEFSCNVKATGVDKGGGSFPAWNE  249
             + ++ SR LEITV+SGE + V +     NV+V V++E S N   T +  G G   AWNE
Sbjct  1    MEAKSHSRILEITVMSGENISVDRSSVAANVYVVVRAE-SLNSCTTKMVNGDGGVHAWNE  59

Query  250  KLVVDLPMHARYLTLQVQCKTFSGVKVVGEAKVPAKDFVGG---FVPESYVRFLSYRLKD  420
            K ++ +P +AR +T +VQC  + GV+ +G A++   D +      V ES  + L Y L++
Sbjct  60   KFLLGIPSYARSVTFEVQCMNYKGVRPIGVARIALSDLLSNNTKIVSESVPQMLCYGLRN  119

Query  421  RKGEKNGIINISVRV  465
             +G +NG+I+ SVR+
Sbjct  120  WEGRRNGVIHFSVRM  134



>ref|XP_009138789.1| PREDICTED: BON1-associated protein 1-like [Brassica rapa]
Length=183

 Score = 92.0 bits (227),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 59/174 (34%), Positives = 96/174 (55%), Gaps = 14/174 (8%)
 Frame = +1

Query  94   TSSRDLEITVISGEGLRVG-----KKNVFVTVKSEFSCNVKATGVDKGGGSFPAWNEKLV  258
            T ++ LEI + S EGL++      KK  F  VK       +++ +D  GGS P WN K  
Sbjct  14   TMTKTLEIDIRSAEGLKINRRLIKKKKTFAVVK--IGEKSRSSDLDDSGGSNPTWNFKSE  71

Query  259  VDLPMHARYLTLQVQCKTFSGV-KVVGEAKVPAKDFVGGFVPESYVRFLSYRLKDRKGEK  435
            + +    ++++++V  +T  G  K +GEA++PA DF+G +  E ++ FLSYRL+D  G+K
Sbjct  72   MPMKGSVQFISIEVFYRTRCGRDKKIGEARIPATDFMGRYSHEGHLNFLSYRLRDEYGDK  131

Query  436  NGIINISVRVKNSAAENAAVASCSSQYSRRpwtglppptgnptnAAVVTGIPVW  597
             GI+N+S+ VK  + E     + SS       +    P+ +     +VTG+PVW
Sbjct  132  CGIVNVSIVVKPHSTETTMFMASSSS------SSFETPSIDGYRGRIVTGLPVW  179



>gb|KEH18944.1| C2 domain protein [Medicago truncatula]
Length=185

 Score = 89.7 bits (221),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 49/123 (40%), Positives = 76/123 (62%), Gaps = 6/123 (5%)
 Frame = +1

Query  109  LEITVISGEGLRVGKK----NVFVTVKSEFSCNVKATGVDKGGGSFPAWNEKLVVDLPMH  276
            LEIT+ISG+ + V +     +++V V++E S N   T + K      +WNEK ++D+P H
Sbjct  10   LEITIISGQNISVDRNSKGDDIYVVVRAE-SLNSCTTKMVKENEGLLSWNEKFLLDIPSH  68

Query  277  ARYLTLQVQCKTFSGVKVVGEAKVPAKDFVGGFVP-ESYVRFLSYRLKDRKGEKNGIINI  453
            A+ +T +VQCK + G   +G A++   DF+G     +S V+ L+Y L+D  G KNG+IN 
Sbjct  69   AKSVTFEVQCKKYKGAHPIGVARIALSDFLGDDSSLQSGVQTLNYGLRDWDGRKNGVINF  128

Query  454  SVR  462
            SVR
Sbjct  129  SVR  131



>ref|XP_003551649.2| PREDICTED: BON1-associated protein 2-like [Glycine max]
Length=180

 Score = 88.6 bits (218),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 63/180 (35%), Positives = 94/180 (52%), Gaps = 24/180 (13%)
 Frame = +1

Query  109  LEITVISGEGLRVG----KKNVFVTVKSEFSCN--------VKATGVDKGGGSFPAWNEK  252
            +EIT+IS E L +     K + +V V ++ SC          +  G  K   + P+WN+K
Sbjct  9    MEITIISAENLCMNGKPLKDHPYVVVHTQ-SCTKFFTTRMPTQEEGGSKSTNNNPSWNDK  67

Query  253  LVVDLPMHARYLTLQVQCKTFSGVKVVGEAKVPAKDFVGGFVPESYVRFLSYRLKDRKGE  432
              VD    +  +TL+VQCKT+ GV+ VG A++   DF      E  ++ LSYRL D KG 
Sbjct  68   FRVD-DGDSDCITLEVQCKTWFGVRSVGAARIAVADFAA----EKSLQLLSYRLWDGKGR  122

Query  433  KNGIINISVRVKNSAAENAAVASCSSQYSRRpwtglppptgnptnAAVVTGIPVWCSYQV  612
            +NG+IN SVRV    AE+ ++ S     ++R   G            +VTGIPV+ +Y +
Sbjct  123  RNGVINFSVRVVEKPAESESLCSMHEAEAQRTIGGNDDSR------GIVTGIPVFWNYPL  176



>gb|KHN24278.1| BON1-associated protein 1 [Glycine soja]
Length=180

 Score = 88.2 bits (217),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 63/178 (35%), Positives = 93/178 (52%), Gaps = 24/178 (13%)
 Frame = +1

Query  109  LEITVISGEGLRVG----KKNVFVTVKSEFSCN--------VKATGVDKGGGSFPAWNEK  252
            +EIT+IS E L +     K + +V V ++ SC          +  G  K   + P+WN+K
Sbjct  9    MEITIISAENLCMNGKPLKDHPYVVVHTQ-SCTKFFTTRMPTQEEGGSKSTNNNPSWNDK  67

Query  253  LVVDLPMHARYLTLQVQCKTFSGVKVVGEAKVPAKDFVGGFVPESYVRFLSYRLKDRKGE  432
              VD    +  +TL+VQCKT+ GV+ VG A++   DF      E  ++ LSYRL D KG 
Sbjct  68   FRVD-DGDSDCITLEVQCKTWFGVRSVGAARIAVADFAA----EKSLQLLSYRLWDGKGR  122

Query  433  KNGIINISVRVKNSAAENAAVASCSSQYSRRpwtglppptgnptnAAVVTGIPVWCSY  606
            +NG+IN SVRV    AE+ ++ S     ++R   G            +VTGIPV+ +Y
Sbjct  123  RNGVINFSVRVVEKPAESESLCSMHEAEAQRTIGGNDDSR------GIVTGIPVFWNY  174



>ref|XP_006396251.1| hypothetical protein EUTSA_v10029351mg, partial [Eutrema salsugineum]
 gb|ESQ37704.1| hypothetical protein EUTSA_v10029351mg, partial [Eutrema salsugineum]
Length=139

 Score = 86.7 bits (213),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 53/130 (41%), Positives = 76/130 (58%), Gaps = 10/130 (8%)
 Frame = +1

Query  103  RDLEITVISGEGLRVG----KKNVFVTVKSEFSCNVKATGVDKGGGSFPAWNEKLVVDL-  267
            R LEI+ IS EGL  G    KK  FV  +   +  V+ T VD+ GG +P W EKL  +  
Sbjct  4    RKLEISAISAEGLVDGGKPMKKKAFVDFEIAGNRAVR-TSVDEVGGDYPTWKEKLETEFW  62

Query  268  ---PMHARYLTLQVQCK-TFSGVKVVGEAKVPAKDFVGGFVPESYVRFLSYRLKDRKGEK  435
                   R++ ++V C+ + +  K VG A+VP KDF G + PE +++ LSYRL D  G++
Sbjct  63   SPEKKEERFMYVRVYCQISDNKDKHVGTARVPVKDFTGEYAPEGFMQCLSYRLWDDLGKR  122

Query  436  NGIINISVRV  465
            NGI+N S R+
Sbjct  123  NGIVNFSARI  132



>ref|XP_010512453.1| PREDICTED: BON1-associated protein 1-like [Camelina sativa]
Length=169

 Score = 85.9 bits (211),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 60/175 (34%), Positives = 93/175 (53%), Gaps = 15/175 (9%)
 Frame = +1

Query  100  SRDLEITVISGEGLRVG----KKNVFVTVKSEFSCNVKATGVDKGGGSFPAWNEKLVVDL  267
            ++ LEI + S EGL++     KK     VK       + +  D+   S P WN KL + +
Sbjct  2    TKTLEIHLKSAEGLKLNRRPLKKKTHAVVK--IDEKERTSEPDESRVSNPTWNHKLEMPI  59

Query  268  PMHARYLTLQVQCKTFSGV-KVVGEAKVPAKDFVGGFVPESYVRFLSYRLKDRKGEKNGI  444
              + +++ ++V  +T SG  K VGEAK+P  DF+G + PE ++  LSYRL+D  G+K GI
Sbjct  60   NGNVQFIYIEVFYRTRSGQNKSVGEAKIPTSDFMGKYSPEGHLNCLSYRLRDEFGDKCGI  119

Query  445  INISVRVKNSAAENAAVASCSSQYSRRpwtglppptgnptnAAVVTGIPVWCSYQ  609
            +N S+ VK   ++  AV+       R        P+ +     +VTG+PVW  YQ
Sbjct  120  VNFSILVK---SDPKAVSDTGLWRPR-----SDTPSIDGYGGRIVTGVPVWGLYQ  166



>ref|XP_007158774.1| hypothetical protein PHAVU_002G180900g [Phaseolus vulgaris]
 gb|ESW30768.1| hypothetical protein PHAVU_002G180900g [Phaseolus vulgaris]
Length=180

 Score = 85.5 bits (210),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 48/132 (36%), Positives = 79/132 (60%), Gaps = 9/132 (7%)
 Frame = +1

Query  109  LEITVISGEGLRVGKKNV----FVTVKSEFSCNVKATGVDKGGGSFPAWNEKLVVDLPMH  276
            LEIT++SGE + V + ++    +V V++E S N   T +  G     AWNEK+++++P +
Sbjct  10   LEITLMSGENISVDRNSIAEKAYVVVRAE-SLNCCTTKMVNGDDGMHAWNEKMLLEVPSY  68

Query  277  ARYLTLQVQCKTFSGVKVVGEAKVPAKDFV----GGFVPESYVRFLSYRLKDRKGEKNGI  444
            AR +T +VQ K F GV+ VG A++   D +       + ES  +   Y L++ +G +NGI
Sbjct  69   ARSVTFEVQSKKFKGVRPVGVARIALSDLLIDKNDNVLSESVSQMFCYGLRNWEGRRNGI  128

Query  445  INISVRVKNSAA  480
            I+ SVRV N+ +
Sbjct  129  IHFSVRVMNNLS  140



>ref|XP_006292593.1| hypothetical protein CARUB_v10018832mg [Capsella rubella]
 gb|EOA25491.1| hypothetical protein CARUB_v10018832mg [Capsella rubella]
Length=203

 Score = 85.9 bits (211),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 61/183 (33%), Positives = 97/183 (53%), Gaps = 15/183 (8%)
 Frame = +1

Query  100  SRDLEITVISGEGLRVG----KKNVFVTVKSEFSCNVKATGVDKGGGSFPAWNEKLVVDL  267
            ++ LEI + S EGL++     KK  F  V+ +     + + +D+   S P WN K  + +
Sbjct  19   TKTLEIHLRSAEGLKLNRKALKKKTFAVVRIDEKS--RNSNLDESRVSNPTWNFKSEIPI  76

Query  268  PMHARYLTLQVQCKTFSGV-KVVGEAKVPAKDFVGGFVPESYVRFLSYRLKDRKGEKNGI  444
                +++ ++V  +T SG  K +GEAK+P  DF+G + PE ++  LSYRL+D  G+K GI
Sbjct  77   NASVQFIFVEVFYRTRSGHDKKLGEAKIPKSDFMGRYSPEGHLNCLSYRLRDEFGDKCGI  136

Query  445  INISVRVKNSAAENAA------VASCSSQYSR--RpwtglppptgnptnAAVVTGIPVWC  600
            +N+S+ VK+     A         SCSSQ +           P+ +     +VTG+PVW 
Sbjct  137  VNVSILVKSDPTTTATTTAVRDYGSCSSQATDIGMWRPRSETPSIDGYGGRIVTGVPVWN  196

Query  601  SYQ  609
             YQ
Sbjct  197  VYQ  199



>ref|XP_007135000.1| hypothetical protein PHAVU_010G093500g, partial [Phaseolus vulgaris]
 gb|ESW06994.1| hypothetical protein PHAVU_010G093500g, partial [Phaseolus vulgaris]
Length=170

 Score = 85.1 bits (209),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 47/137 (34%), Positives = 83/137 (61%), Gaps = 9/137 (7%)
 Frame = +1

Query  106  DLEITVISGEGLRV----GKKNVFVTVKSE-FSCNVKATGVDKGGGSFPAWNEKLVVDLP  270
            +LE T++S EGL +      K+VF+ V+++  + +  AT  +  G    +W+E  +V++ 
Sbjct  28   NLEFTLLSAEGLHLRGKPANKDVFLVVRADSIASHTTATATETNGSL--SWSEAFLVEVG  85

Query  271  MHARYLTLQVQCKTFSGVKVVGEAKVPAKDFVGGFVPESYVRFLSYRLKDRKGEKNGIIN  450
             HAR +T++V+C+T +G + VG A++   DF+GG  P+  ++ + YRL+D  G +NG++N
Sbjct  86   PHARCVTIEVKCRTGAGERDVGVARIALSDFLGGSGPD--LQAMCYRLRDWDGRENGMVN  143

Query  451  ISVRVKNSAAENAAVAS  501
             SVRV +        AS
Sbjct  144  FSVRVVSPTPSPPHAAS  160



>ref|XP_007158773.1| hypothetical protein PHAVU_002G180800g [Phaseolus vulgaris]
 gb|ESW30767.1| hypothetical protein PHAVU_002G180800g [Phaseolus vulgaris]
Length=180

 Score = 85.1 bits (209),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 48/132 (36%), Positives = 79/132 (60%), Gaps = 9/132 (7%)
 Frame = +1

Query  109  LEITVISGEGLRVGKKNV----FVTVKSEFSCNVKATGVDKGGGSFPAWNEKLVVDLPMH  276
            LEIT++SGE + V + ++    +V V++E S N   T +  G     AWNEK+++++P +
Sbjct  10   LEITLMSGENISVDRNSIAEKAYVVVRAE-SLNCCTTKMVNGDDGMHAWNEKILLEVPSY  68

Query  277  ARYLTLQVQCKTFSGVKVVGEAKVPAKDFV----GGFVPESYVRFLSYRLKDRKGEKNGI  444
            AR +T +VQ K F GV+ VG A++   D +       + ES  +   Y L++ +G +NGI
Sbjct  69   ARSVTFEVQSKKFKGVRPVGVARIALSDLLIDKNDNVLSESVSQMFCYGLRNWEGRRNGI  128

Query  445  INISVRVKNSAA  480
            I+ SVRV N+ +
Sbjct  129  IHFSVRVMNNLS  140



>ref|XP_010424040.1| PREDICTED: BON1-associated protein 2-like [Camelina sativa]
Length=149

 Score = 84.0 bits (206),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 51/131 (39%), Positives = 72/131 (55%), Gaps = 9/131 (7%)
 Frame = +1

Query  100  SRDLEITVISGEGL----RVGKKNVFVT--VKSEFSCNVKATGVDKGGGSFPAWNEKLVV  261
            SR ++IT IS E L    R  KKN  V   +      ++  T VD+ GG +P W +KL  
Sbjct  2    SRKIQITGISAEDLVYNKRPVKKNAVVAFGMAGNNWKHLMRTSVDETGGDYPVWEDKLET  61

Query  262  DLPMHARYLTL---QVQCKTFSGVKVVGEAKVPAKDFVGGFVPESYVRFLSYRLKDRKGE  432
            +        T+   +V C++    K VG A+VP KDF G + PE ++  LSYRL D  G+
Sbjct  62   EFSSGKELPTVMYVEVSCRSSGEDKRVGTARVPVKDFTGEYAPEGFLHCLSYRLWDEYGK  121

Query  433  KNGIINISVRV  465
            +NGI+N SVR+
Sbjct  122  RNGIVNFSVRI  132



>ref|XP_002872946.1| hypothetical protein ARALYDRAFT_912190 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH49205.1| hypothetical protein ARALYDRAFT_912190 [Arabidopsis lyrata subsp. 
lyrata]
Length=153

 Score = 84.3 bits (207),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 50/133 (38%), Positives = 73/133 (55%), Gaps = 13/133 (10%)
 Frame = +1

Query  100  SRDLEITVISGEGLRVGKK----NVFV--TVKSEFSCNVKATGVDKGGGSFPAWNEKLVV  261
            +R ++IT IS E L  G+K    N FV   +   +      T +D+ GG+ P W +KL  
Sbjct  2    TRKIQITAISAEDLVDGRKPVDKNAFVAFNMAGNYWKQPLRTSLDEVGGNHPMWEDKLET  61

Query  262  DL-----PMHARYLTLQVQCKTFSGVKVVGEAKVPAKDFVGGFVPESYVRFLSYRLKDRK  426
            +      P    Y+  QV  ++    K VG A+VP K+F GG+ PE ++  LSYRL D +
Sbjct  62   EFSSEKEPTSVMYV--QVYYRSSGKDKHVGTARVPVKEFTGGYAPEGFMHCLSYRLWDEQ  119

Query  427  GEKNGIINISVRV  465
            G +NGI+N SVR+
Sbjct  120  GRRNGIVNFSVRI  132



>gb|KHN04631.1| BON1-associated protein 1 [Glycine soja]
Length=119

 Score = 83.2 bits (204),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 50/128 (39%), Positives = 71/128 (55%), Gaps = 20/128 (16%)
 Frame = +1

Query  232  FPAWNEKLVVDLPMHARYLTLQVQCKTFSGV-KVVGEAKVPAKDFVGGFVPESYVRFLSY  408
            F  WNEK  V+L   AR LT++V+CKT +GV + +G A++   DF+GG VP+  ++ L Y
Sbjct  9    FHTWNEKFRVELGPQARCLTIEVKCKTETGVVRDIGVARIAVSDFLGGSVPDHSLQSLCY  68

Query  409  RLKDRKGEKNGIINISVRVKNSAAENAAVASCSSQYSRRpwtglppptgnptnAAVVTGI  588
            RL+D  G +NG++N SVRV    A  AA   CSS                  +  VVT I
Sbjct  69   RLRDWDGRENGVVNFSVRVAVPPA--AAENDCSSS-----------------SGGVVTAI  109

Query  589  PVWCSYQV  612
            PV+ +  +
Sbjct  110  PVYLNNSI  117



>ref|XP_006289418.1| hypothetical protein CARUB_v10002917mg [Capsella rubella]
 gb|EOA22316.1| hypothetical protein CARUB_v10002917mg [Capsella rubella]
Length=153

 Score = 84.0 bits (206),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 52/135 (39%), Positives = 74/135 (55%), Gaps = 13/135 (10%)
 Frame = +1

Query  100  SRDLEITVISGEGL----RVGKKNVFVTVKS--EFSCNVKATGVDKGGGSFPAWNEKLVV  261
            SR +EIT IS E L    R  KKN +V   +  ++      T VD+  G++P W +KL  
Sbjct  2    SRKIEITGISAEDLVYKKRRVKKNAYVAFDTAGKYMKQPMRTSVDEISGNYPMWEDKLET  61

Query  262  DLPMHARYLT------LQVQCKTFSGV-KVVGEAKVPAKDFVGGFVPESYVRFLSYRLKD  420
            +       +T      +QV C++ +G    VG A+VP KDF G + PE ++  LSYRL D
Sbjct  62   EFSPGKEAVTATSVMYVQVLCRSSAGEDHCVGTARVPVKDFTGEYAPEGFLHCLSYRLWD  121

Query  421  RKGEKNGIINISVRV  465
              G +NGI+N SVR+
Sbjct  122  ESGCRNGIVNFSVRI  136



>gb|KHN04630.1| hypothetical protein glysoja_021929 [Glycine soja]
Length=176

 Score = 84.0 bits (206),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 62/175 (35%), Positives = 90/175 (51%), Gaps = 16/175 (9%)
 Frame = +1

Query  124  ISGEGLRVGKK----NVFVTVKSEF--SCNVKATGVDKGGGSFPAWNEKLVVDLPMHARY  285
            +SGE + V +     NV+V V +E   SC  K    D   G   AWNE  ++D+P +AR 
Sbjct  1    MSGENISVDQSSVAANVYVVVGAESLNSCTTKMVNED---GGVHAWNETFLLDVPSYARS  57

Query  286  LTLQVQCKTFSGVKVVGEAKVPAKDFVGG--FVPESYVRFLSYRLKDRKGEKNGIINISV  459
            +T +VQCK + GV+ +G A++   DF+GG   V ES  +   Y L++ +G +NG+I+ SV
Sbjct  58   VTFEVQCKKYKGVRPIGVARIALSDFLGGNNVVSESVPQMYCYGLRNWEGRRNGVIHFSV  117

Query  460  RV----KNSAAENAAVASCSSQYSRRpwtglppptgnptnA-AVVTGIPVWCSYQ  609
            RV     N  +E           S+     +     N  N+  VV GIPV  SYQ
Sbjct  118  RVVTLGDNLCSETKEEKETKMVNSKETEHEVMGFQVNSKNSNDVVIGIPVRWSYQ  172



>ref|XP_009128620.1| PREDICTED: BON1-associated protein 2-like [Brassica rapa]
 emb|CDY54055.1| BnaA02g36410D [Brassica napus]
Length=176

 Score = 83.6 bits (205),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 53/134 (40%), Positives = 75/134 (56%), Gaps = 14/134 (10%)
 Frame = +1

Query  97   SSRDLEITVISGEGLRVG----KKNVFVT--VKSEFSCNVKATGVDKGGGSFPAWNEKLV  258
            ++R LEIT +S EGL +G    KKN FV   +   +S     T V    G  P W E L 
Sbjct  32   TTRKLEITAVSAEGLLIGGKPVKKNAFVAFDIAGNYSNRAMRTEV---CGDHPVWKENLE  88

Query  259  VD--LPMHAR--YLTLQVQCKTFSGV-KVVGEAKVPAKDFVGGFVPESYVRFLSYRLKDR  423
             +  LP   +  ++ ++V C+   G  K VG A+VP KDF G + PE +++ LSYRL D 
Sbjct  89   TEFSLPPEKKEGFMYVRVYCEISGGKDKHVGTARVPIKDFTGEYAPEGFLQCLSYRLWDD  148

Query  424  KGEKNGIINISVRV  465
             G++NGI+N S R+
Sbjct  149  YGKRNGIVNFSARI  162



>ref|XP_006576357.1| PREDICTED: BON1-associated protein 1-like [Glycine max]
Length=185

 Score = 83.2 bits (204),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 68/195 (35%), Positives = 93/195 (48%), Gaps = 44/195 (23%)
 Frame = +1

Query  88   METSSRDLEITVISGEGLRVGKK-----NVFVTVKSE--------FSCNVKATGVDKGGG  228
            M T  + LE+T++S EGL V  K      VF  V++E                G D G  
Sbjct  1    MATKPKTLELTILSAEGLHVRGKPTPNIKVFAVVRAESITSHTTAMVTTTTTNGSDNGFQ  60

Query  229  SFPAWNEKLVVDLPMHARYLTLQVQCKTFSGV-KVVGEAKVPAKDFVGGF-VPESYVRFL  402
                WNEK  V+L   AR +T++V+C+T +GV + VG A++   DF+GG  VP+  ++ L
Sbjct  61   YL--WNEKFWVELGPRARCVTIEVKCRTETGVVRDVGVARIAVSDFLGGSSVPDHCLQSL  118

Query  403  SYRLKDRKGEKNGIINISVRV-----------KNSAAENAAVASCSSQYSRRpwtglppp  549
             YRL+D  G +NG++N SVRV               AE A +  CSS  S          
Sbjct  119  CYRLRDWDGRENGVVNFSVRVAPPPTPPPPPPPPPPAEGAEIY-CSSSTS----------  167

Query  550  tgnptnAAVVTGIPV  594
                    VVTGIPV
Sbjct  168  -----GTGVVTGIPV  177



>ref|XP_010469043.1| PREDICTED: BON1-associated protein 1-like [Camelina sativa]
Length=196

 Score = 83.6 bits (205),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 59/174 (34%), Positives = 93/174 (53%), Gaps = 9/174 (5%)
 Frame = +1

Query  109  LEITVISGEGLRVGKKNVFVTVKSEFSCNVK--ATGVDKGGGSFPAWNEKLVVDLPMHA-  279
            LEI + S EGL++ ++ +     +  S   K   +  D+   S P WN K   D+P++  
Sbjct  22   LEIHLRSAEGLKLNRRALKKKTLAVVSIGEKKRTSKPDESRVSNPTWNFK--ADMPINGN  79

Query  280  -RYLTLQVQCKTFSGV-KVVGEAKVPAKDFVGGFVPESYVRFLSYRLKDRKGEKNGIINI  453
             +++ ++V  +T SG  K VG+AK+P  DF+G + PE ++  LSYRL+D  G+K GI+N 
Sbjct  80   VQFIFIEVLYRTRSGQDKSVGKAKIPTSDFMGKYSPEGHLNCLSYRLRDEFGDKCGIVNF  139

Query  454  SVRVKNSAAENAAVASCSSQYSRRp--wtglppptgnptnAAVVTGIPVWCSYQ  609
            S+ VK+         +CSSQ             P+ +     +VTG+PVW  YQ
Sbjct  140  SILVKSDPKAVRDYDACSSQARDTGLWRPRSDTPSIDGYGGRIVTGVPVWGLYQ  193



>emb|CDY01978.1| BnaC02g27490D [Brassica napus]
Length=177

 Score = 82.8 bits (203),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 52/134 (39%), Positives = 75/134 (56%), Gaps = 14/134 (10%)
 Frame = +1

Query  97   SSRDLEITVISGEGLRVG----KKNVFVT--VKSEFSCNVKATGVDKGGGSFPAWNEKLV  258
            ++R LEIT +S EGL +G    KK  FV   +   +S     T V    G +P W E L 
Sbjct  33   TTRKLEITAVSAEGLLIGGKPVKKTAFVAFDIAGNYSNRAMRTEV---CGDYPVWKENLE  89

Query  259  VD--LPMHAR--YLTLQVQCKTFSGV-KVVGEAKVPAKDFVGGFVPESYVRFLSYRLKDR  423
             +  LP   +  ++ ++V C+   G  K VG A+VP KDF G + PE +++ LSYRL D 
Sbjct  90   TEFSLPPEKKEGFMYVRVYCEISGGKDKHVGTARVPIKDFTGEYAPEGFLQCLSYRLWDD  149

Query  424  KGEKNGIINISVRV  465
             G++NGI+N S R+
Sbjct  150  YGKRNGIVNFSARI  163



>ref|XP_007134957.1| hypothetical protein PHAVU_010G089900g [Phaseolus vulgaris]
 gb|ESW06951.1| hypothetical protein PHAVU_010G089900g [Phaseolus vulgaris]
Length=177

 Score = 80.5 bits (197),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 57/175 (33%), Positives = 86/175 (49%), Gaps = 17/175 (10%)
 Frame = +1

Query  109  LEITVISGEGLRVGKK-----NVFVTVKSEFSCNVKATGVDKGGGSFPAWNEKLVVDLPM  273
            LEIT++SGE + V +      NV V  +S   C  K    D G     AWNEKL++++P 
Sbjct  11   LEITIMSGENISVDQNSVTEMNVVVRAESLNCCRTKMVNGDDG---VHAWNEKLLLEVPS  67

Query  274  HARYLTLQVQCKTFSGVKVVGEAKVPAKDFVGGFVPESYVRFLSYRLKDRKGEKNGIINI  453
            +AR LT +VQC  +   + VG A++   D + G       +   Y L++ +G +NG+I+ 
Sbjct  68   YARSLTFEVQCNKYKEFRPVGVARIALSDLLCGKNNNVLSQMFCYGLRNWEGRRNGVIHF  127

Query  454  SVR-VKNSAAENAAVASCSSQYSRRpwtglppptgnptnAAVVTGIPV-WCSYQV  612
             V+ V N +AE       + Q                T + VV GIPV WC+ Q+
Sbjct  128  WVKVVDNLSAE-------TKQEKDIKMVNCRGIENEVTGSDVVIGIPVNWCTNQM  175



>ref|XP_007134999.1| hypothetical protein PHAVU_010G093400g [Phaseolus vulgaris]
 gb|ESW06993.1| hypothetical protein PHAVU_010G093400g [Phaseolus vulgaris]
Length=177

 Score = 80.1 bits (196),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 57/175 (33%), Positives = 86/175 (49%), Gaps = 17/175 (10%)
 Frame = +1

Query  109  LEITVISGEGLRVGKK-----NVFVTVKSEFSCNVKATGVDKGGGSFPAWNEKLVVDLPM  273
            LEIT++SGE + V +      NV V  +S   C  K    D G     AWNEKL++++P 
Sbjct  11   LEITIMSGENISVDRNSVAEMNVVVRAESLNCCRTKMVNGDDG---VHAWNEKLLLEVPS  67

Query  274  HARYLTLQVQCKTFSGVKVVGEAKVPAKDFVGGFVPESYVRFLSYRLKDRKGEKNGIINI  453
            +AR LT +VQC  +   + VG A++   D + G       +   Y L++ +G +NG+I+ 
Sbjct  68   YARSLTFEVQCNKYKEFRPVGVARIALSDLLFGKNNNVLSQMFCYGLRNWEGRRNGVIHF  127

Query  454  SVR-VKNSAAENAAVASCSSQYSRRpwtglppptgnptnAAVVTGIPV-WCSYQV  612
             V+ V N +AE       + Q                T + VV GIPV WC+ Q+
Sbjct  128  WVKVVDNLSAE-------TKQEKDIKMVNCRGIENEVTGSDVVIGIPVNWCTNQM  175



>ref|XP_006282258.1| hypothetical protein CARUB_v10028535mg [Capsella rubella]
 gb|EOA15156.1| hypothetical protein CARUB_v10028535mg [Capsella rubella]
Length=153

 Score = 76.6 bits (187),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 50/135 (37%), Positives = 71/135 (53%), Gaps = 13/135 (10%)
 Frame = +1

Query  100  SRDLEITVISGEGL----RVGKKNVF--VTVKSEFSCNVKATGVDKGGGSFPAWNEKLVV  261
            SR +EIT IS E L    R  KKN +       ++      T VD+  G++P W +KL  
Sbjct  2    SRKIEITGISAEDLVYKKRRVKKNAYGAFDTAGKYMKQPMRTSVDEISGNYPMWEDKLET  61

Query  262  DLPMHARYLT------LQVQCKTFSGV-KVVGEAKVPAKDFVGGFVPESYVRFLSYRLKD  420
            +       +T      +QV C++ +G    VG A+VP KDF G +  E ++  LSYRL D
Sbjct  62   EFSPGKEAVTATSVMYVQVLCRSSAGEDHCVGTARVPVKDFTGEYALEGFLHCLSYRLWD  121

Query  421  RKGEKNGIINISVRV  465
              G +NGI+N SVR+
Sbjct  122  ESGCRNGIVNFSVRI  136



>ref|XP_007209531.1| hypothetical protein PRUPE_ppa010653mg [Prunus persica]
 gb|EMJ10730.1| hypothetical protein PRUPE_ppa010653mg [Prunus persica]
Length=241

 Score = 77.4 bits (189),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 47/140 (34%), Positives = 70/140 (50%), Gaps = 23/140 (16%)
 Frame = +1

Query  109  LEITVISGEGLRVGKKNVF----------VTVKSEFSCNVKATGVDKGGGSFPAWNEKLV  258
            +EITVIS +GL+      F           T   +  C+V +TGVD  GG  P W +K  
Sbjct  3    MEITVISAQGLKTTSPTTFSNKIRTFITLTTTNGDHKCHVYSTGVDDEGGINPTWGDKFH  62

Query  259  VDLPMHARYLTLQVQC--------KTFSGVKVVGEAKVPAKDFVGGFVPESYVRFLSYRL  414
            V  P+   + T +  C        +   G   +G  ++ A+D   GF P    R+LSYRL
Sbjct  63   V--PVDTSFFTNRYSCIYLQLYSKRLIMGRTQLGWCQISAQDI--GFPPAGSARYLSYRL  118

Query  415  KDRKGEK-NGIINISVRVKN  471
            + R G + NGI+N+SV+++N
Sbjct  119  RARDGSRTNGIVNLSVKLEN  138



>gb|KGN54699.1| hypothetical protein Csa_4G429320 [Cucumis sativus]
Length=99

 Score = 73.6 bits (179),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 36/69 (52%), Positives = 53/69 (77%), Gaps = 4/69 (6%)
 Frame = +1

Query  271  MHARYLTLQVQCKTFSG---VKVVGEAKVPAKDFVGGFVPESYVRFLSYRLKDRKGEKNG  441
            MHA ++ ++V C++ S    VK+VG+++V   DFV G++PES+++FLSY L+D +GE NG
Sbjct  1    MHAAFVVVEV-CRSASSGWKVKIVGKSRVSMADFVVGYLPESHLQFLSYSLRDERGEMNG  59

Query  442  IINISVRVK  468
            IIN SVRVK
Sbjct  60   IINFSVRVK  68



>emb|CAN82266.1| hypothetical protein VITISV_009284 [Vitis vinifera]
Length=246

 Score = 72.8 bits (177),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 50/157 (32%), Positives = 76/157 (48%), Gaps = 28/157 (18%)
 Frame = +1

Query  82   FDMETSSRDLEITVISGEGLR------VGKKNVFVTVKSEFSCNVKATGVDKG-------  222
            FD       +EIT++S EGL+        +   F+T+ +      K TG DK        
Sbjct  2    FDXNRQPFVIEITIVSAEGLKNTSTFFSKRIRPFITLTTAPPTPYKPTGADKQSQVYMTR  61

Query  223  ----GGSFPAWNEKLVVDLPMHARYLT-------LQVQCKTFSGVKV-VGEAKVPAKDFV  366
                GG  P W +K    LPM A + +       L +  K     K+ +G  ++PA D +
Sbjct  62   VDDEGGINPTWGDKF--RLPMEATFFSHRYSAIYLHIYTKRLMKGKIQLGWCQIPAGDIL  119

Query  367  GGFVPESYVRFLSYRLKDRKGEK-NGIINISVRVKNS  474
             GF P   +R LSYRL+DR G + +GI+N++VR++ S
Sbjct  120  EGFSPAGTLRHLSYRLRDRDGTRGHGIVNVAVRLEGS  156



>ref|XP_003631424.1| PREDICTED: BON1-associated protein 2-like [Vitis vinifera]
Length=230

 Score = 72.4 bits (176),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 50/157 (32%), Positives = 76/157 (48%), Gaps = 28/157 (18%)
 Frame = +1

Query  82   FDMETSSRDLEITVISGEGLR------VGKKNVFVTVKSEFSCNVKATGVDKG-------  222
            FD       +EIT++S EGL+        +   F+T+ +      K TG DK        
Sbjct  2    FDTNRQPFVIEITIVSAEGLKNTSTFFSKRIRPFITLTTAPPTPYKPTGADKQSQVYMTR  61

Query  223  ----GGSFPAWNEKLVVDLPMHARYLT-------LQVQCKTFSGVKV-VGEAKVPAKDFV  366
                GG  P W +K    LPM A + +       L +  K     K+ +G  ++PA D +
Sbjct  62   VDDEGGINPTWGDKF--RLPMEATFFSHRYSAIYLHIYTKRLMKGKIQLGWCQIPAGDIL  119

Query  367  GGFVPESYVRFLSYRLKDRKGEK-NGIINISVRVKNS  474
             GF P   +R LSYRL+DR G + +GI+N++VR++ S
Sbjct  120  EGFSPAGTLRHLSYRLRDRDGTRGHGIVNVAVRLEGS  156



>emb|CDP09792.1| unnamed protein product [Coffea canephora]
Length=207

 Score = 71.2 bits (173),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 54/195 (28%), Positives = 83/195 (43%), Gaps = 37/195 (19%)
 Frame = +1

Query  109  LEITVISGEGLRVGKKNVF-----------VTVKSEFSCNVKA---------------TG  210
            LEITVIS +GL+    +             +T    FS    A               T 
Sbjct  7    LEITVISAQGLKASSSSTLFPPRRLRPFATITTTPPFSFRPPAAAANMSCKKLSTVCRTK  66

Query  211  VDKGGGSFPAWNEKLVVDLPMHARYLTLQVQCKT----FSGVKVVGEAKVPAKDFVGGFV  378
            VD  GG  P W EK  + L  H   + LQ+  K     F+G   +G  ++P  D + G +
Sbjct  67   VDDKGGVNPTWGEKFQLPLDAHFSCMCLQLYTKKKNFFFTGYTHLGWCQIPVTDILDGLL  126

Query  379  PESYVRFLSYRLKDRKGEK-NGIINISVRVKNSAAENAAVASCSSQYSRRpwtglppptg  555
            P   +R L+Y+L+ R G + +GI+N++V+++++     A    SS  S            
Sbjct  127  PAGSLRHLAYQLRARDGSRGHGIVNVAVKLESTVPLPMAHPQWSSTCSN------TQYWP  180

Query  556  nptnAAVVTGIPVWC  600
                + +V GIPV C
Sbjct  181  EMNASRMVVGIPVEC  195



>gb|KHN27290.1| BON1-associated protein 2 [Glycine soja]
Length=179

 Score = 70.5 bits (171),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 47/125 (38%), Positives = 70/125 (56%), Gaps = 19/125 (15%)
 Frame = +1

Query  88   METSSRDLEITVISGEGLRVGKK-----NVFVTVKSEFSCNVKATGVDKGGGSFPAWNEK  252
            M T  + LE+TV+S EGL V  K      VF  V++           D  G  +  WN+K
Sbjct  1    MATKPKTLELTVLSAEGLHVRGKPTPNIKVFAVVRA-----------DDNGFQY-LWNDK  48

Query  253  LVVDLPMHARYLTLQVQCKTFSG-VKVVGEAKVPAKDFVGG-FVPESYVRFLSYRLKDRK  426
              V+L   AR +T++V+C+T +G V+ VG A++   DF+GG  VP+  ++ L YRL+D  
Sbjct  49   FWVELGPRARCVTIEVKCRTETGVVRDVGVARIAVSDFLGGSSVPDHCLQSLCYRLRDWD  108

Query  427  GEKNG  441
            G +NG
Sbjct  109  GRENG  113



>ref|XP_002509742.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF51129.1| conserved hypothetical protein [Ricinus communis]
Length=223

 Score = 70.5 bits (171),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 49/147 (33%), Positives = 76/147 (52%), Gaps = 30/147 (20%)
 Frame = +1

Query  109  LEITVISGEGLRV-------GKKNVFVTVKS---------EFSCNVKATGVDKGGGSFPA  240
            +EITV+S EGL+         +   FVT+ +         + +C V  T +D  GG+ P 
Sbjct  1    MEITVLSAEGLKSTSSRPFSHRLRPFVTLTTYQPVPCNTTDKNCQVFTTRIDDQGGANPT  60

Query  241  WNEKLVVDLPMHA------RYLTLQVQCKT---FSGVKVVGEAKVPAKDFVGGFVPESYV  393
            W +K  V  PM A      RY  + V+  T     G  ++G  ++P  D   GF P+S V
Sbjct  61   WGDKFHV--PMDAATLFANRYSCIYVELYTKRLLKGKVLLGWCQIPVTDI--GFPPDSSV  116

Query  394  RFLSYRLKDRKGEK-NGIINISVRVKN  471
            R LSYR++DR G +  GIIN+++++ +
Sbjct  117  RHLSYRIRDRDGTRGQGIINLAIKLTD  143



>gb|KHN04628.1| hypothetical protein glysoja_021927 [Glycine soja]
Length=163

 Score = 69.3 bits (168),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 45/123 (37%), Positives = 68/123 (55%), Gaps = 5/123 (4%)
 Frame = +1

Query  109  LEITVISGEGLRVGKKNVFVTVKSE-FSCNVKATGVDKGGG--SFPAWNEKLVVDLPMHA  279
            LEITVIS E LRV  ++ +V V++E  +C       D G    S  +WNEKL++++PMHA
Sbjct  9    LEITVISCENLRV-MEDPYVVVRAESLNCCTTKMAKDSGSNKTSLFSWNEKLMLNMPMHA  67

Query  280  RYLTLQVQCKTFSGVKVVGEAKVPAKDFVGGFVPESYVRFLSYRLKDRKGEKNGIINISV  459
                 +   K       +G  + P + F      E    + SYRLKD +G++NG+I+ +V
Sbjct  68   WSTRSRCNAKGSRVFDRLGWPESPCRIFSAAACREISCTW-SYRLKDWEGKENGVIHFAV  126

Query  460  RVK  468
            RV+
Sbjct  127  RVE  129



>ref|XP_008355606.1| PREDICTED: BON1-associated protein 1-like [Malus domestica]
Length=196

 Score = 66.2 bits (160),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 50/150 (33%), Positives = 73/150 (49%), Gaps = 31/150 (21%)
 Frame = +1

Query  109  LEITVISGEGLRVGKKNVF-------VTVKSEFS-----CNVKATG----------VDKG  222
            +EITV+S +GL+    ++F       VT+ +  S     C  K  G          VD  
Sbjct  13   MEITVLSAQGLKTSSPSLFSNKIRPFVTITTLPSTIAQPCTPKTNGDRTLHVYKTRVDDQ  72

Query  223  GGSFPAWNEKLVVDLP---MHARYLTLQVQCKT---FSGVKVVGEAKVPAKDFVGGFVPE  384
            GG  P W +K  V +     + RY  + +Q  T     G   +G  ++P  D   GF P 
Sbjct  73   GGVSPTWGDKFHVPIDTTFFNNRYSCIYLQLFTKRLIMGRVELGWCQIPVNDI--GFPPA  130

Query  385  SYVRFLSYRLKDRKGEK-NGIINISVRVKN  471
            S  RFLSYRL+ R G + NGI+N+SV+++N
Sbjct  131  SSARFLSYRLRARDGSRTNGIVNLSVKLEN  160



>ref|XP_006440566.1| hypothetical protein CICLE_v10022388mg [Citrus clementina]
 gb|ESR53806.1| hypothetical protein CICLE_v10022388mg [Citrus clementina]
 gb|KDO63533.1| hypothetical protein CISIN_1g029535mg [Citrus sinensis]
Length=192

 Score = 65.1 bits (157),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 45/143 (31%), Positives = 72/143 (50%), Gaps = 25/143 (17%)
 Frame = +1

Query  109  LEITVISGEGLRVGKKNVF---------------VTVKSEFSCNVKATGVDKGGGSFPAW  243
            +EIT++S +GL+     +F                T   +  C+V  T VD  GG  P W
Sbjct  1    MEITILSAQGLKNTSFTLFSSRIRPFVTITTYPPATTSGDKHCHVYRTRVDDHGGVNPTW  60

Query  244  NEKLVVDLPMHA----RY--LTLQVQCKTF-SGVKVVGEAKVPAKDFVGGFVPESYVRFL  402
             +K  V    +A    RY  + LQ+  KT  SG  ++G  ++P  D   GF P   VR L
Sbjct  61   GDKFYVPTDCNAFFANRYACIYLQLYTKTLISGQTLLGWCQIPVNDI--GFPPGGSVRNL  118

Query  403  SYRLKDRKGEK-NGIINISVRVK  468
            SYRL+ R G + +G++N++++++
Sbjct  119  SYRLRARDGSRGHGVVNLAIKLE  141



>ref|XP_011029373.1| PREDICTED: BON1-associated protein 2-like [Populus euphratica]
Length=175

 Score = 64.7 bits (156),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 45/141 (32%), Positives = 69/141 (49%), Gaps = 24/141 (17%)
 Frame = +1

Query  109  LEITVISGEGLR-------VGKKNVFVTV--------KSEFSCNVKATGVDKGGGSFPAW  243
            +EITVIS +GL+         +   F+T+         S   C +  T VD  GG  P W
Sbjct  1    MEITVISAQGLKKTSSGPFSHRLRPFITITAYPPNPHNSNEKCQMYRTRVDDQGGVNPTW  60

Query  244  NEKLVVDLPM---HARYLTLQVQCKT---FSGVKVVGEAKVPAKDFVGGFVPESYVRFLS  405
             +K  V + M     RY  + +   T    +G   +G  +VP  D   GF+PE  VR+LS
Sbjct  61   GDKFHVPIDMAFFQNRYSCIYLHLYTKRLITGQVQLGWCQVPVTDI--GFLPEGSVRYLS  118

Query  406  YRLKDRKGEKN-GIINISVRV  465
            YR+  R G +  G++N+++R+
Sbjct  119  YRILARDGTRTPGVVNLAIRL  139



>ref|XP_002462702.1| hypothetical protein SORBIDRAFT_02g030480 [Sorghum bicolor]
 gb|EER99223.1| hypothetical protein SORBIDRAFT_02g030480 [Sorghum bicolor]
Length=194

 Score = 64.3 bits (155),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 42/130 (32%), Positives = 65/130 (50%), Gaps = 15/130 (12%)
 Frame = +1

Query  109  LEITVISGEGLRVGK-----KNVFVTVKSEFSCNVKATGVDKGGGSFPAWNEKLVVDLPM  273
            LE+T++SGE +RV          +  V +  S        D     +P W E + V LP 
Sbjct  6    LEVTIVSGEDVRVPSGRPLCHGAYAVVHTPSSSAPTRVDQDPDCHGYPHWGEAVRVALPA  65

Query  274  HARYLTLQVQCKTFSGVK--VVGEAKVPAKDFVGGFVPESYVRFLSYRL-----KDRKGE  432
             AR+L +++ C+  +G K   V  A+VP +DF  G  P  ++  LSYRL     +     
Sbjct  66   GARWLDVEI-CRAHAGGKSETVAAARVPVEDFTVG--PPGHLHCLSYRLFGSAERGMMRR  122

Query  433  KNGIINISVR  462
            +NGI+NI+V+
Sbjct  123  RNGIVNITVK  132



>ref|XP_009770722.1| PREDICTED: BON1-associated protein 2-like [Nicotiana sylvestris]
Length=179

 Score = 63.9 bits (154),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 43/140 (31%), Positives = 73/140 (52%), Gaps = 18/140 (13%)
 Frame = +1

Query  109  LEITVISGEGLR----VGKKNVFVTVKSEFSCNVKAT-------GVDKGGGSFPAWNEKL  255
            +EIT+IS +GL+      +   F TV +  + ++ AT        VD+ GG  P W +K 
Sbjct  1    MEITIISAQGLKNNTTWWRLRPFATVSTVATASISATTTEVYTTSVDEKGGENPKWGDKF  60

Query  256  VVDLP----MHARY-LTLQVQCKTFSGVKV-VGEAKVPAKDFVGGFVPESYVRFLSYRLK  417
             + L     +H    + LQ+  K F   +  +G   +PA D     +P  +VR  SYRL+
Sbjct  61   HLSLDASLFLHGHLCIYLQIYSKNFFNRRSELGWCMIPAADVFDRLLPTGFVRQFSYRLR  120

Query  418  DRKGEK-NGIINISVRVKNS  474
            ++ G + +G++NISV+++ S
Sbjct  121  NKDGSRGHGVVNISVKMEAS  140



>gb|KJB47079.1| hypothetical protein B456_008G010000 [Gossypium raimondii]
Length=285

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 50/150 (33%), Positives = 73/150 (49%), Gaps = 23/150 (15%)
 Frame = +1

Query  103  RDLEITVISGEGLR----VGKKNVFVTVKSEF--SCNVKATGVDKGGGSFPAWNEKLV--  258
            R LE+TV+S EGL+    + K +V+V VK     S   + T V K GG+ P WN  +V  
Sbjct  4    RPLELTVVSAEGLKKVKHLSKMDVYVVVKVSGGESTTEQKTPVHKDGGTSPKWNHPMVFS  63

Query  259  ----------VDLPMHARYLTLQVQCKTFSGVKVVGEAKVPAKDFVGGFVPESYVRFLSY  408
                       DL +  R +     C+TF G K +GEA+VP K+ + G    +  ++ +Y
Sbjct  64   FNESLAQTNTTDLAITFRLMC----CRTFRGDKEIGEARVPIKELLDGAGNGNSAKYTTY  119

Query  409  RLKDRKGEKNGIINISVRVKNSAAENAAVA  498
             +K   G+  G +N   R    AA NA  A
Sbjct  120  PVKKPSGKAKGKLNFVYRFGEKAA-NAVPA  148



>ref|XP_010278593.1| PREDICTED: BON1-associated protein 2 [Nelumbo nucifera]
Length=239

 Score = 64.7 bits (156),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 47/157 (30%), Positives = 74/157 (47%), Gaps = 28/157 (18%)
 Frame = +1

Query  73   LLGFDMETSSRDLEITVISGEGLRV-------GKKNVFVTVKSEFSCNVKA---------  204
            ++  +M      LEITV+S +GL+         +   F+ + ++ S   K          
Sbjct  7    IMSNNMNAQPFTLEITVLSAQGLKSISSFLFSQRLRPFIILTTDLSNPSKPDYAGTGRHV  66

Query  205  ---TGVDKGGGSFPAWNEK--LVVDLPMHAR-YLTLQVQ----CKTFSGVKVVGEAKVPA  354
               T VD+GGGS P W +K  L +D    +R Y ++  Q    C      ++ G  ++P 
Sbjct  67   YFQTRVDQGGGSNPTWGDKFLLPIDPSFFSRKYCSIDFQIFTKCPLLRKTQL-GWCQIPG  125

Query  355  KDFVGGFVPESYVRFLSYRLKDRKGEK-NGIINISVR  462
             D + GF P   VR LSYR++DR G    G +N++VR
Sbjct  126  SDLIEGFRPPGSVRHLSYRVRDRDGSTGEGYVNVAVR  162



>ref|XP_002512696.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF50148.1| conserved hypothetical protein [Ricinus communis]
Length=230

 Score = 63.9 bits (154),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 50/163 (31%), Positives = 80/163 (49%), Gaps = 22/163 (13%)
 Frame = +1

Query  88   METSSRDLEITVISGEGLRV----GKKNVFVTVKSEFSCNVKA--------TGVDKGGGS  231
            ME SS  LE+ +IS   LR      K +V+  V S F+  +K         T VD  GG 
Sbjct  1    MEWSS--LELKLISCRDLRAFNLFQKLSVYAVVSS-FNDELKKKDAEDRQKTPVDTQGGR  57

Query  232  FPAWNEKLVVDL-PM---HARYLTLQVQCK-TFSGVKVVGEAKVPAKDFVGGFVPESYVR  396
             P WN  +  DL P+      +L  +++C     G + +GE +VP KD +  +     VR
Sbjct  58   HPEWNHSMHFDLEPVSLADHLFLKFKLRCAGVIFGKRTIGEVRVPFKDLIDEY--SGTVR  115

Query  397  FLSYRLKDRKGEKNGIINISVRVKNSAAENAAVASCSSQYSRR  525
            F+SY+++   G+ +G++N S R+K  + E      C++  S +
Sbjct  116  FMSYQVRSGDGKPSGVLNFSYRLKGKSKEKEDDCPCATGESEK  158



>ref|XP_009369028.1| PREDICTED: uncharacterized protein LOC103958488 [Pyrus x bretschneideri]
Length=223

 Score = 63.5 bits (153),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 45/152 (30%), Positives = 67/152 (44%), Gaps = 35/152 (23%)
 Frame = +1

Query  109  LEITVISGEGLRVGKKNVFVTVKSEF------------SCNVKATG----------VDKG  222
            +EITV+S +GL+    ++F      F             C  K  G          VD  
Sbjct  13   MEITVLSAQGLKTTSPSLFSNKIRPFITLTTLPGTIAPPCTPKTNGDHTFHAYKTRVDDQ  72

Query  223  GGSFPAWNEKLVVDLPMHARYLTLQVQC--------KTFSGVKVVGEAKVPAKDFVGGFV  378
            GG  P W +K  V  P+   +   +  C        +   G   +G  ++PA+D   GF 
Sbjct  73   GGVNPTWGDKFHV--PIDTTFFNNRCSCIHLQLFTKRLIMGRAQLGWCQIPAQDI--GFP  128

Query  379  PESYVRFLSYRLKDRKGEKN-GIINISVRVKN  471
            P    RFLSYRL+ R G +  GI+N+SV+++N
Sbjct  129  PAGSARFLSYRLRARDGSRTKGIVNLSVKLEN  160



>ref|XP_010112552.1| hypothetical protein L484_010557 [Morus notabilis]
 gb|EXC34099.1| hypothetical protein L484_010557 [Morus notabilis]
Length=196

 Score = 62.8 bits (151),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 47/147 (32%), Positives = 66/147 (45%), Gaps = 31/147 (21%)
 Frame = +1

Query  109  LEITVISGEGLRVGKKNVFV-------------------TVKSEFSCNVKATGVDKGGGS  231
            +EITV+S EGL+     +F                    T   +  C+V  T VD  GG+
Sbjct  1    MEITVVSAEGLKTSSSALFAHRIRPFITISTVPPDPYFSTTNGDKRCHVYKTRVDDQGGT  60

Query  232  FPAWNEKLVVDLPMHA----RYLTLQVQCKT---FSGVKVVGEAKVPAKDFVGGFVPESY  390
             P W +K  + +   A    RY  + +   T   F G   +G   +PA D   G  P   
Sbjct  61   NPTWGDKFRLPIDGTAFFTNRYSGININLYTKRLFLGQSHLGSCHIPAHDI--GLPPS--  116

Query  391  VRFLSYRLKDRKGEKN-GIINISVRVK  468
            +R LSYRL+ R G +  GIIN+SVR +
Sbjct  117  LRHLSYRLRARDGSRTRGIINLSVRFE  143



>ref|XP_012088683.1| PREDICTED: uncharacterized protein LOC105647276 [Jatropha curcas]
Length=245

 Score = 62.0 bits (149),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 37/117 (32%), Positives = 64/117 (55%), Gaps = 11/117 (9%)
 Frame = +1

Query  199  KATGVDKGGGSFPAWNEKLVVDLPMHAR------YLTLQVQCK-TFSGVKVVGEAKVPAK  357
            + T +D GGGS P WN+ +  DL   ++      +L  +++C     G + +G+  VP K
Sbjct  54   QKTLIDGGGGSNPEWNQVMQFDLKHVSQIESDHLFLKFKLRCAGVLYGKRSIGKVCVPFK  113

Query  358  DFVGGFVPESYVRFLSYRLKDRKGEKNGIINISVRVKNSAAE--NAAVASCSSQYSR  522
            D +  F  +  VRF+SY+++   G+ NG++N S +VK    +    A A+ +S +SR
Sbjct  114  DLIEEF--DGNVRFVSYQVRTSDGKPNGVLNFSYKVKKEGDDLPRTAAATTTSHFSR  168



>gb|KDP23239.1| hypothetical protein JCGZ_23072 [Jatropha curcas]
Length=243

 Score = 62.0 bits (149),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 37/117 (32%), Positives = 64/117 (55%), Gaps = 11/117 (9%)
 Frame = +1

Query  199  KATGVDKGGGSFPAWNEKLVVDLPMHAR------YLTLQVQCK-TFSGVKVVGEAKVPAK  357
            + T +D GGGS P WN+ +  DL   ++      +L  +++C     G + +G+  VP K
Sbjct  52   QKTLIDGGGGSNPEWNQVMQFDLKHVSQIESDHLFLKFKLRCAGVLYGKRSIGKVCVPFK  111

Query  358  DFVGGFVPESYVRFLSYRLKDRKGEKNGIINISVRVKNSAAE--NAAVASCSSQYSR  522
            D +  F  +  VRF+SY+++   G+ NG++N S +VK    +    A A+ +S +SR
Sbjct  112  DLIEEF--DGNVRFVSYQVRTSDGKPNGVLNFSYKVKKEGDDLPRTAAATTTSHFSR  166



>tpg|DAA62422.1| TPA: BAP2 [Zea mays]
Length=195

 Score = 60.5 bits (145),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 42/129 (33%), Positives = 67/129 (52%), Gaps = 14/129 (11%)
 Frame = +1

Query  109  LEITVISGEGLR---VGK---KNVFVTVKSEFSCNVKATGVDKGGGSFPAWNEKLVVDLP  270
            +E+TV+SGE +R    G+   +  +  V +  S        D     +P W + + V LP
Sbjct  13   IEVTVLSGEDVRRVPSGRPLCRGAYAVVHTASSSAPTRVDQDPDCHGYPHWGDAVRVALP  72

Query  271  MHARYLTLQVQCKTFSG--VKVVGEAKVPAKDFVGGFVPESYVRFLSYRLKDRKG---EK  435
              AR+L ++V C+  +G   + V  A+VP +DF  G  P  ++  LSYRL    G    +
Sbjct  73   AGARWLDVEV-CRARAGGQSEPVAAARVPVEDFTVG--PPGHLHCLSYRLFHSAGGMQRR  129

Query  436  NGIINISVR  462
            NGI+NI+V+
Sbjct  130  NGIVNITVK  138



>gb|KJB20714.1| hypothetical protein B456_003G160700 [Gossypium raimondii]
Length=190

 Score = 59.7 bits (143),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 43/145 (30%), Positives = 67/145 (46%), Gaps = 29/145 (20%)
 Frame = +1

Query  109  LEITVISGEGLRVGKKNVFVTVKSEF----------------SCNVKATGVDKGGGSFPA  240
            LE+TV+S +GL+     +F      F                SC    T VD  GG  P 
Sbjct  11   LEMTVVSAQGLKNTSSFLFTHRLRPFITITTFPPPLEAADLKSCRGFQTRVDDQGGVNPT  70

Query  241  WNEKLVVDLPMHARYLTLQVQC--------KTFSGVKVVGEAKVPAKDFVGGFVPESYVR  396
            W +K +V  P+H  +   +  C        +  SG   +G  ++PA D   G  P   VR
Sbjct  71   WGDKFLV--PIHHTFFANRYSCIYLQLFTKRLISGKAQLGWCQIPAADI--GLPPVGSVR  126

Query  397  FLSYRLKDRKGEK-NGIINISVRVK  468
             LSYRL++  G + +G++N++V++K
Sbjct  127  QLSYRLREADGTRTHGVVNVAVKLK  151



>ref|NP_001175951.1| Os09g0526500 [Oryza sativa Japonica Group]
 dbj|BAD46356.1| hypothetical protein [Oryza sativa Japonica Group]
 gb|EAZ09819.1| hypothetical protein OsI_32107 [Oryza sativa Indica Group]
 gb|EAZ45424.1| hypothetical protein OsJ_30074 [Oryza sativa Japonica Group]
 dbj|BAH94679.1| Os09g0526500 [Oryza sativa Japonica Group]
Length=193

 Score = 59.7 bits (143),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 48/143 (34%), Positives = 72/143 (50%), Gaps = 20/143 (14%)
 Frame = +1

Query  88   METSSRDLEITVISGEGL------RVGKKNVFVTVKSEFSCNVK----ATGVDKGGGS--  231
            M + +  LE+TV+S E +      R   +  +  V++  S +       T VD+  G   
Sbjct  1    MASRTMTLEVTVVSAEEVVLPPTRRPLGRGAYAVVRTAASASSPAAAVCTRVDEESGGDC  60

Query  232  --FPAWNEKLVVDLPMHARYLTLQVQCKTFSG-VKVVGEAKVPAKDFVGGFVPESYVRFL  402
              +P W E L V LP  AR+L +++  +  +G V+ V  A VP  DF  G  P  ++  L
Sbjct  61   NGYPYWKETLRVALPEGARWLDVEICRRRPNGQVEAVAAASVPVGDFTVG--PPGHLHCL  118

Query  403  SYRLKDRKG---EKNGIINISVR  462
            SYRL D  G    +NGI+NI+VR
Sbjct  119  SYRLFDASGCRTRRNGIVNITVR  141



>ref|XP_012087217.1| PREDICTED: BON1-associated protein 2-like [Jatropha curcas]
 gb|KDP25484.1| hypothetical protein JCGZ_20640 [Jatropha curcas]
Length=183

 Score = 58.9 bits (141),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 39/143 (27%), Positives = 71/143 (50%), Gaps = 28/143 (20%)
 Frame = +1

Query  109  LEITVISGEGLRV-------GKKNVFVTVKSEFS--------CNVKATGVDKGGGSFPAW  243
            +EITVIS +GL+         +   F+T+ +  S        C+V +T +D  GG  P W
Sbjct  1    MEITVISAQGLKSKSSGPFSHRLRPFITITTYPSTPFNGNKKCHVYSTRIDDQGGVNPTW  60

Query  244  NEKLVVDLPMHARYLTLQVQC--------KTFSGVKVVGEAKVPAKDFVGGFVPESYVRF  399
             +K    +P+   +L  +  C        +   G  ++G  ++P  D   GF P + V+ 
Sbjct  61   GDKF--HMPIDTAFLANRYNCICLELYTKRLIMGKVLLGWCQIPVTDI--GFPPVNSVKH  116

Query  400  LSYRLKDRKGEK-NGIINISVRV  465
            LSYR++ R G + +G +N+++++
Sbjct  117  LSYRIRARDGTRGHGTVNLAIKL  139



>ref|XP_010090794.1| 16 kDa phloem protein 2 [Morus notabilis]
 gb|EXB40827.1| 16 kDa phloem protein 2 [Morus notabilis]
Length=271

 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 42/141 (30%), Positives = 69/141 (49%), Gaps = 11/141 (8%)
 Frame = +1

Query  103  RDLEITVISGEGLR----VGKKNVFVTVKSEFSCNV-KATGVDKGGGSFPAWNEKLVV--  261
            R +EIT+IS + L+    + K +V+V V       + + T VDKG G  P WN  +    
Sbjct  4    RPMEITIISAKDLKRVKHLSKMDVYVLVSLSGGPQIEQKTPVDKGSGPNPTWNFPMNFNI  63

Query  262  ---DLPMHARYLTLQVQC-KTFSGVKVVGEAKVPAKDFVGGFVPESYVRFLSYRLKDRKG  429
               D       L  +V C +     K +GEA VP K+ +       +V++++Y+LK   G
Sbjct  64   DEEDAKKDRLILNFKVMCHRRIHSDKEIGEANVPVKELLDNGGDGKFVKYVTYQLKKPNG  123

Query  430  EKNGIINISVRVKNSAAENAA  492
            +  G +N+S +  N A E ++
Sbjct  124  KHRGQLNLSYKFANQALETSS  144



>gb|ABG73463.1| unknown protein [Oryza brachyantha]
Length=183

 Score = 57.8 bits (138),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 46/138 (33%), Positives = 72/138 (52%), Gaps = 17/138 (12%)
 Frame = +1

Query  109  LEITVISGEG--LRVGKK---NVFVTVKSEFSCNVKATGVDKGG--GSFPAWNEKLVVDL  267
            LE+TV+S E   L  G+      +  V++  +        D  G    +P W+E + V +
Sbjct  3    LEVTVVSAEEVVLPTGRALGGGAYAVVRTASAAACTHVDEDSYGDCNGYPYWSEAVRVAV  62

Query  268  PMHARYLTLQVQCKTFSG-VKVVGEAKVPAKDFVGGFVPESYVRFLSYRLKD----RKGE  432
            P  A  L +++  +  +G V+ V  A+VPA DF+ G  P  ++  LSYRL D    R   
Sbjct  63   PAGAGGLAVEICRRRSNGRVETVAAARVPADDFMVG--PPGHLHCLSYRLFDAAGGRSSR  120

Query  433  KNGIINISVR---VKNSA  477
            +NGI+NI+VR   VK++A
Sbjct  121  RNGIVNITVRRTDVKHTA  138



>ref|XP_002298055.1| hypothetical protein POPTR_0001s08960g [Populus trichocarpa]
 gb|EEE82860.1| hypothetical protein POPTR_0001s08960g [Populus trichocarpa]
Length=175

 Score = 57.8 bits (138),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 42/143 (29%), Positives = 68/143 (48%), Gaps = 24/143 (17%)
 Frame = +1

Query  109  LEITVISGEGLR-------VGKKNVFVTV--------KSEFSCNVKATGVDKGGGSFPAW  243
            +EITVIS +GL+         +   F+T+         S   C +  T VD  GG  P W
Sbjct  1    MEITVISAQGLKKTSSGPFSHRLRPFITITAYPPNPHNSNEKCQMYRTRVDDQGGENPTW  60

Query  244  NEKLVVDLP---MHARYLTLQVQCKT---FSGVKVVGEAKVPAKDFVGGFVPESYVRFLS  405
             +K  V +       RY  + V   T    +G   +G  +VP  D   GF+ E  +++LS
Sbjct  61   GDKFHVPIDTAFFQNRYSCIYVHLYTKRPITGQVQLGWCQVPVTDI--GFLSEGSLKYLS  118

Query  406  YRLKDRKGEKN-GIINISVRVKN  471
            YR+  R G +  G++N+++R+ +
Sbjct  119  YRILARDGTRTPGVVNLAIRLTS  141



>ref|XP_002297893.1| hypothetical protein POPTR_0001s12710g [Populus trichocarpa]
 gb|EEE82698.1| hypothetical protein POPTR_0001s12710g [Populus trichocarpa]
Length=350

 Score = 58.9 bits (141),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 34/97 (35%), Positives = 53/97 (55%), Gaps = 10/97 (10%)
 Frame = +1

Query  199  KATGVDKGGGSFPAWNEKLVVDL-----PMHARYL--TLQVQCK-TFSGVKVVGEAKVPA  354
            + T  D+ GGS P WN  +  DL     P H  +L    +++C+    G K +GE  VP 
Sbjct  116  QKTPADREGGSNPEWNHMMEFDLNTTSLPGHGDHLFFKFELRCEGAIFGNKSIGEVCVPF  175

Query  355  KDFVGGFVPESYVRFLSYRLKDRKGEKNGIINISVRV  465
            KD +  F     VRF+SY++++  G+ NG++N+S  V
Sbjct  176  KDLIEEF--NGSVRFVSYQVRNSDGKPNGVLNLSYEV  210



>ref|XP_002272904.1| PREDICTED: cytokinesis protein sepA-like [Vitis vinifera]
Length=291

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 40/130 (31%), Positives = 66/130 (51%), Gaps = 10/130 (8%)
 Frame = +1

Query  103  RDLEITVISGEGLR----VGKKNVFVTVKSEFSCNVKA-TGVDKGGGSFPAWN--EKLVV  261
            R LEI VIS + L+    + K +V+V V        K  T VD+ GG+ P WN   K  V
Sbjct  4    RTLEINVISAKDLKDVNLISKMDVYVVVSINGDSRSKQKTPVDRDGGTNPTWNFPMKFTV  63

Query  262  DLPMHAR---YLTLQVQCKTFSGVKVVGEAKVPAKDFVGGFVPESYVRFLSYRLKDRKGE  432
            D     +    L+ +++C+   G K +GE  VP K+ +        ++F+SY+++   G+
Sbjct  64   DESAAQQNRLTLSFKLRCERTLGDKDIGEVNVPIKELLDPAGESKPIQFVSYQVRKPSGK  123

Query  433  KNGIINISVR  462
              G +N+S +
Sbjct  124  PKGELNLSYK  133



>gb|KJB46046.1| hypothetical protein B456_007G345600 [Gossypium raimondii]
Length=291

 Score = 56.6 bits (135),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 39/135 (29%), Positives = 60/135 (44%), Gaps = 9/135 (7%)
 Frame = +1

Query  94   TSSRDLEITVISGEGLRVGKKNV----FVTVKSEFSCNVKATGVDKGGGSFPAWNEKLVV  261
            T SR LEI +IS + L     N+     V V+ E  C  K   VD+ GG+ P WNEK + 
Sbjct  7    TPSRLLEINLISAQDLFSASNNMKTYAVVWVQQENKCTTK---VDQSGGTDPTWNEKFMF  63

Query  262  DLPMHARYLTLQVQCKTFSGVKVVGEAKVPAKDFVGGFVPESYVRFLSYRLKDRKGEKNG  441
             +      ++++V    +     +G   VP  D      P +  R L+  +    G   G
Sbjct  64   KVDKDDAVISVEVYAAAWDKDATIGYVNVPLNDIFDS--PSAVTRTLALPISRPSGRSQG  121

Query  442  IINISVRVKNSAAEN  486
            I+N+ V  K +  E+
Sbjct  122  ILNMEVSHKLTTTED  136



>ref|XP_002304627.1| hypothetical protein POPTR_0003s15870g [Populus trichocarpa]
 gb|EEE79606.1| hypothetical protein POPTR_0003s15870g [Populus trichocarpa]
Length=322

 Score = 55.8 bits (133),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 35/104 (34%), Positives = 52/104 (50%), Gaps = 10/104 (10%)
 Frame = +1

Query  199  KATGVDKGGGSFPAWNEKL-----VVDLPMHARYL--TLQVQCK-TFSGVKVVGEAKVPA  354
            + T VD+ GGS P WN  +        LP +  +L    +++CK +  G K +GE  VP 
Sbjct  93   QKTPVDREGGSNPKWNHMMQFNLNTTSLPDYGDHLFFKFELRCKGSIFGNKTIGEVCVPF  152

Query  355  KDFVGGFVPESYVRFLSYRLKDRKGEKNGIINISVRVKNSAAEN  486
            KD    F     VRF+SY++++  G  NG++N S  V      N
Sbjct  153  KDLNEEF--NGSVRFVSYQVRNSDGRPNGVLNFSYEVNGKVKRN  194



>ref|XP_011020919.1| PREDICTED: uncharacterized protein LOC105123120 [Populus euphratica]
Length=322

 Score = 55.8 bits (133),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 35/102 (34%), Positives = 52/102 (51%), Gaps = 10/102 (10%)
 Frame = +1

Query  205  TGVDKGGGSFPAWNEKLVVDL-----PMHARYL--TLQVQCK-TFSGVKVVGEAKVPAKD  360
            T VD+ GGS P WN  +  +L     P +  +L    +++CK +  G K +GE  VP KD
Sbjct  95   TPVDREGGSNPTWNHMMQFNLNTPSLPDYGDHLFFKFELRCKGSIFGNKTIGEVCVPFKD  154

Query  361  FVGGFVPESYVRFLSYRLKDRKGEKNGIINISVRVKNSAAEN  486
                F     VRF+SY++++  G  NG++N S  V      N
Sbjct  155  LNEEF--NGSVRFVSYQVRNSDGRPNGVLNFSYEVNGKVKRN  194



>gb|EAY99500.1| hypothetical protein OsI_21469 [Oryza sativa Indica Group]
Length=225

 Score = 55.1 bits (131),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 42/144 (29%), Positives = 65/144 (45%), Gaps = 30/144 (21%)
 Frame = +1

Query  109  LEITVISGEGLRVGKKNVF----------VTVKSEFS-CNVKATGVDKGGGSFPAWNEKL  255
            LE+TV+S E LR+   + +          VTV S  S C+        G  S   WN+ L
Sbjct  31   LEVTVLSAESLRLPPPSYYSLIPRRLRPYVTVSSAASACSTDVAAAASGEHS---WNDTL  87

Query  256  VVDLPMHARYLTL------------QVQCKTFSGVKVVGEAKVPAKDFVGGFVPESYVRF  399
            VV  P+ A +L              +  C+   G   +G  ++PA D + G  P   +R 
Sbjct  88   VV--PVGAEFLESRGGGGVHVAVYSEPACRLVGGATPLGWCRIPAADVLDGLRPPRALRR  145

Query  400  LSYRLKDRK--GEKNGIINISVRV  465
            LSY L+  +  G   G+++++VRV
Sbjct  146  LSYSLRCPRTGGPARGVVHLAVRV  169



>emb|CDP19532.1| unnamed protein product [Coffea canephora]
Length=288

 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 41/133 (31%), Positives = 68/133 (51%), Gaps = 15/133 (11%)
 Frame = +1

Query  109  LEITVISGEGLR----VGKKNVFVTVK-SEFSCNVKATGVDKGGGSFPAWNE--KLVVDL  267
            L++T+IS EGL+      + +V+  VK   +  N + T VDK GG+ P WN   K ++D 
Sbjct  6    LDLTIISAEGLKNVNVFSRMDVYAKVKILGYPKNKQKTHVDKNGGTAPKWNHHMKFIIDE  65

Query  268  P-MHARYLTLQVQCK---TFSGVKVVGEAKVPAKDFVGGFVP----ESYVRFLSYRLKDR  423
            P ++   ++L ++ K   TF   K +GE  +P  +   G V     +S  R L Y+++  
Sbjct  66   PSLNNPGVSLLIKLKSDRTFGSDKEIGEVNLPISELFNGGVDADTKDSGERVLEYQVRTS  125

Query  424  KGEKNGIINISVR  462
             G+  G I  S +
Sbjct  126  SGKPKGTIKFSYK  138



>ref|XP_009588589.1| PREDICTED: pollen-specific leucine-rich repeat extensin-like 
protein 4 [Nicotiana tomentosiformis]
Length=319

 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 43/147 (29%), Positives = 68/147 (46%), Gaps = 14/147 (10%)
 Frame = +1

Query  106  DLEITVISGEGLR-----VGKKNVFVTVKSEFSCNVKATGVDKGGGSFPAWNEKLVVDLP  270
            DLEIT++S + L+      G    +V    +   N +AT  D  G + P WNE+ V+ LP
Sbjct  15   DLEITIVSAKHLKNVNWHHGDLKPYVIFWVD-PDNRRATQADDSGNTRPVWNERFVLHLP  73

Query  271  M--HARYLTLQV-QCKTFSGVK-VVGEAKVPAKDFVGGFVPESYVRFLSYRLKDRKGEKN  438
               H   LTL+V   K     K +VG  ++P KD V    P    +   + L+   G  +
Sbjct  74   QSPHDTVLTLEVFHSKPSETPKPLVGTLRIPLKDLVNLDDPN---KIRPFELRRPSGRPH  130

Query  439  GIINISVRVKNSA-AENAAVASCSSQY  516
            G I + + ++ S   ++  +   SS Y
Sbjct  131  GKIRLKIAIRESPTPQDYQIPPPSSYY  157



>gb|KJB75514.1| hypothetical protein B456_012G044800 [Gossypium raimondii]
Length=264

 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 33/101 (33%), Positives = 53/101 (52%), Gaps = 8/101 (8%)
 Frame = +1

Query  199  KATGVDKGGGSFPAWNEKLVVDL----PMHARYLTLQVQCKTFSGV-KVVGEAKVPAKDF  363
            + TG+ KGG + P WN     DL    P  + +L L+   +    V + +GE +VP K  
Sbjct  55   QKTGIAKGGKN-PEWNHVFEFDLESLPPEESDHLFLKFDLRADGLVNRTIGEVRVPLKAL  113

Query  364  VGGFVPESYVRFLSYRLKDRKGEKNGIINISVRVKNSAAEN  486
            +  F     VRF+SY+++D  G+ NG++N S ++K     N
Sbjct  114  IDDFC--GVVRFVSYQVRDSDGKPNGVLNFSYKLKGKVKTN  152



>ref|XP_007035560.1| Soybean gene regulated by cold-2, putative [Theobroma cacao]
 gb|EOY06486.1| Soybean gene regulated by cold-2, putative [Theobroma cacao]
Length=290

 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 39/138 (28%), Positives = 70/138 (51%), Gaps = 13/138 (9%)
 Frame = +1

Query  88   METSSRDLEITVISGEGLR----VGKKNVF--VTVKSEFSCNVKAT--GVDKGGGSFPAW  243
            M  + R  EI VIS +GL+    + K +V+  V++K + S + + T   VDK  G  P W
Sbjct  1    MAMAHRTFEINVISAKGLKNVNLIDKMDVYAIVSLKGDSSKDKQKTKTPVDKDCGKDPTW  60

Query  244  N--EKLVVDLPMHARY---LTLQVQCKTFSGVKVVGEAKVPAKDFVGGFVPESYVRFLSY  408
            N   K  +D  +  +    L  +++C+   G K +G+  VP K+ +        ++F+SY
Sbjct  61   NFPVKFTIDESLAQKNNLNLKFKIKCERILGDKELGQVNVPVKELLDSTSEGGSMKFVSY  120

Query  409  RLKDRKGEKNGIINISVR  462
            +++   G+  G +N S +
Sbjct  121  QVRKPSGKPEGTLNFSYK  138



>gb|ABU98655.1| SRC2 protein [Taiwania cryptomerioides]
Length=324

 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 44/142 (31%), Positives = 75/142 (53%), Gaps = 16/142 (11%)
 Frame = +1

Query  88   METSSRDLEITVISGEGLR----VGKKNVFVT--VKSEFSCNVKATGVDKGGGSFPAWNE  249
            MET  R +E+T+IS   ++      K  V+    ++ +     + T  DK  G+ P+WN+
Sbjct  1    MET--RTIEVTLISARDIQDVNLFTKSKVYAVAWIRGDPRPTKQRTVSDKENGTNPSWNK  58

Query  250  KL---VVDLPMHARYLTLQVQCK---TFSGVKVVGEAKVPAKDFVGGFVPESYVRFLSYR  411
             +   V +  +    L L+V+ +   TF G K VG   VP K+F+G   P   V F+SY+
Sbjct  59   SMSFAVDEAALQQGRLVLEVEIRSEGTF-GDKEVGHVSVPMKEFLGK-KPTGGVDFVSYQ  116

Query  412  LKDRKGEKNGIINISVRVKNSA  477
            ++   G+  G +N+SV++ N+A
Sbjct  117  VRKPSGKAKGTLNLSVKLNNTA  138



>ref|XP_011004332.1| PREDICTED: uncharacterized protein LOC105110855 [Populus euphratica]
Length=349

 Score = 54.3 bits (129),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 33/97 (34%), Positives = 53/97 (55%), Gaps = 11/97 (11%)
 Frame = +1

Query  199  KATGVDKGGGSFPAWNEKLVVDL-----PMHARYL--TLQVQCK-TFSGVKVVGEAKVPA  354
            + T  D+GG S P WN  +  DL     P H  +L    +++C+    G K +GE  VP 
Sbjct  116  QKTPADRGG-SNPEWNHMMQFDLNTTSLPGHGDHLFFKFELRCEGAIFGNKSIGEVCVPF  174

Query  355  KDFVGGFVPESYVRFLSYRLKDRKGEKNGIINISVRV  465
            +D +  F     VRF+SY++++  G+ NG++N+S  V
Sbjct  175  RDLIEEF--NGSVRFVSYQVRNSDGKPNGVLNLSYEV  209



>gb|EPS59428.1| hypothetical protein M569_15381 [Genlisea aurea]
Length=279

 Score = 53.9 bits (128),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 49/137 (36%), Positives = 69/137 (50%), Gaps = 15/137 (11%)
 Frame = +1

Query  88   METSSRDLEITVISGEGLR----VGKKNVFVTVK-SEFSCNVKATGVDKGGGSFPAWNEK  252
            M T  R L+I +IS EGL+    +GK +++  V  + +  + K + VDK  G  P WN K
Sbjct  1    MATEYRPLKINLISAEGLKDVKLIGKMDLYAEVSLAGYPQSNKKSYVDKNSGPNPKWNFK  60

Query  253  --LVVDLPMHARY-LTLQVQCK---TFSGVKVVGEAKVPAKD-FVGGFVPESYVRFLSYR  411
               VVD P   +  LTL VQ     TF+  KVVG   VP  + F GG   E   R + Y+
Sbjct  61   TEFVVDEPYLTKPGLTLLVQIMDEGTFND-KVVGSVSVPVHELFRGGDSHED--RVVEYQ  117

Query  412  LKDRKGEKNGIINISVR  462
            +  + G+  G +  S R
Sbjct  118  VHTQSGKPKGTLKFSYR  134



>dbj|BAK04679.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=263

 Score = 53.9 bits (128),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 46/151 (30%), Positives = 69/151 (46%), Gaps = 15/151 (10%)
 Frame = +1

Query  103  RDLEITVISGEGLR----VGKKNVFVTVK---SEFSCNVKATGVDKGGGSFPAWNEKLVV  261
            R LE+T+IS + L+      K  V+  V     +       T  D+ GG  P W+  L  
Sbjct  4    RVLEVTLISAKDLKKVTVFSKMRVYAVVSISGGDPRTPTHRTHSDRHGGRNPMWHAPLRF  63

Query  262  DLPMHA--RYLTLQVQCK---TFSGVKVVGEAKVPAKDFVGGFVPESYVRFLSYRLK-DR  423
             +P  A  R L L V  +   +F G + VGE  VP +D      P    R LSY+++   
Sbjct  64   PIPTAADPRGLALHVLLRAERSF-GDRDVGEVLVPVQDLASAAPPAGEHRHLSYQVRSPM  122

Query  424  KGEKNGIINISVRVKNSAAENAAVASCSSQY  516
             G K G+++IS  + ++ A  AA     +QY
Sbjct  123  SGRKRGVLHISYSLSDAPAPTAA-GPGDAQY  152



>ref|XP_002268514.1| PREDICTED: uncharacterized protein LOC100245456 [Vitis vinifera]
Length=292

 Score = 53.5 bits (127),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 36/141 (26%), Positives = 67/141 (48%), Gaps = 15/141 (11%)
 Frame = +1

Query  115  ITVISGEGLRVGKKNVFVTVKSEFSCNVKATGVDKGGGSFPAWNEKLVVDL------PMH  276
            +++IS E     +K+    ++ +       T VD+ G   P WN +L  DL         
Sbjct  32   VSIISDESKNSNQKHQIQCLQRQ------KTPVDRDGNGNPEWNHQLQFDLRDISLADSA  85

Query  277  ARYLTLQVQCKTFS-GVKVVGEAKVPAKDFVGGFVPESYVRFLSYRLKDRKGEKNGIINI  453
              Y+   ++C+    G K +GE  VP K+ +  F     VRF+SY+++   G+ NG++N 
Sbjct  86   NYYVKFSLRCEGIVFGNKTIGEVCVPLKELIDEF--NRAVRFVSYQVRTTDGKPNGVLNF  143

Query  454  SVRVKNSAAENAAVASCSSQY  516
            S ++    ++  AV +   ++
Sbjct  144  SYKLNIKGSDLPAVEAPEDEH  164



>emb|CDM86357.1| unnamed protein product [Triticum aestivum]
Length=157

 Score = 51.6 bits (122),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 42/141 (30%), Positives = 68/141 (48%), Gaps = 18/141 (13%)
 Frame = +1

Query  109  LEITVISGEGLRVG-------KKNVFVTVKSEFSCNVKATGVDKGGGS---FPAWNEKLV  258
            LE+TV+S E +  G        ++ F  V ++ S     TG +   G    +P W E + 
Sbjct  3    LEVTVLSAEKVVTGWLWRRPLDRDAFAAVNTDSSS--ARTGFNDEDGDCNGYPYWGEAVR  60

Query  259  VDLPMHARYLTLQVQCKTFSGVK-VVGEAKVPAKDFVGGFVPESYVRFLSYRLKDR---K  426
            V +P  +R + +++  +   G +  V  A VP  DF  G  P  ++  LSYRL D     
Sbjct  61   VTVPKQSRTIDVEIYRQRGDGRQEFVAAALVPVADFRAG--PPGHLHCLSYRLFDTGLMM  118

Query  427  GEKNGIINISVRVKNSAAENA  489
              +NGI+NI+V+  + A  +A
Sbjct  119  ETRNGIVNITVKRLDGAQASA  139



>ref|XP_009387361.1| PREDICTED: uncharacterized protein LOC103974297 [Musa acuminata 
subsp. malaccensis]
Length=290

 Score = 53.1 bits (126),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 44/144 (31%), Positives = 75/144 (52%), Gaps = 13/144 (9%)
 Frame = +1

Query  109  LEITVISGEGLR----VGKKNVFVTVK-SEFSCNVKATGVDKGGGSFPAWNEKLVVDLP-  270
            LEIT++S +GL+      K  V+  V  S+     + T  D+ GG  P+WN  L + +P 
Sbjct  6    LEITLVSAKGLKDVNLFFKMAVYAVVSLSDNRLARQRTPPDREGGRNPSWNSTLHLTIPA  65

Query  271  ---MHARYLTLQVQCKTFSGVKVVGEAKVPAKDFVGGF--VPESYVRFLSYRL-KDRKGE  432
               +   +L + ++ K   G + VGE +VP  + + G    P S V+F+SY++ +   G+
Sbjct  66   DGDLACHFLHILLRTKRVLGDRDVGEVRVPLPELLSGAGDGPTS-VQFVSYQVHRVTSGK  124

Query  433  KNGIINISVRVKNSAAENAAVASC  504
              GI+N S ++    A +A+ AS 
Sbjct  125  PKGILNFSYKLSERVAVSASEAST  148



>emb|CBI29284.3| unnamed protein product [Vitis vinifera]
Length=512

 Score = 53.1 bits (126),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 32/111 (29%), Positives = 55/111 (50%), Gaps = 9/111 (8%)
 Frame = +1

Query  205  TGVDKGGGSFPAWNEKLVVDL------PMHARYLTLQVQCK-TFSGVKVVGEAKVPAKDF  363
            T VD+ G   P WN +L  DL           Y+   ++C+    G K +GE  VP K+ 
Sbjct  180  TPVDRDGNGNPEWNHQLQFDLRDISLADSANYYVKFSLRCEGIVFGNKTIGEVCVPLKEL  239

Query  364  VGGFVPESYVRFLSYRLKDRKGEKNGIINISVRVKNSAAENAAVASCSSQY  516
            +  F     VRF+SY+++   G+ NG++N S ++    ++  AV +   ++
Sbjct  240  IDEF--NRAVRFVSYQVRTTDGKPNGVLNFSYKLNIKGSDLPAVEAPEDEH  288



>ref|XP_010269468.1| PREDICTED: abl interactor homolog [Nelumbo nucifera]
Length=278

 Score = 52.8 bits (125),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 39/130 (30%), Positives = 64/130 (49%), Gaps = 10/130 (8%)
 Frame = +1

Query  103  RDLEITVISGEGLR----VGKKNVFVTVK-SEFSCNVKATGVDKGGGSFPAWN--EKLVV  261
            R L+ITVIS + L+      K +V+  V  S  S +   T +DK GG+ P+WN   K  V
Sbjct  4    RTLDITVISAKDLKDVNLFSKMDVYAVVSLSGDSRSKHKTPIDKDGGTSPSWNFPMKFTV  63

Query  262  D---LPMHARYLTLQVQCKTFSGVKVVGEAKVPAKDFVGGFVPESYVRFLSYRLKDRKGE  432
            D      +   L  +++C    G K +G+  VP K+ +         +F+SY+++   G+
Sbjct  64   DEAAAKQNRLMLVFELRCDRSLGDKDIGQVHVPVKELLDNTGDGKSAQFVSYQVRKPSGK  123

Query  433  KNGIINISVR  462
              G +N S +
Sbjct  124  PKGTLNFSYK  133



>ref|XP_011087410.1| PREDICTED: uncharacterized protein LOC105168911 [Sesamum indicum]
Length=345

 Score = 52.8 bits (125),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 46/141 (33%), Positives = 67/141 (48%), Gaps = 15/141 (11%)
 Frame = +1

Query  73   LLGFDMETSSRDLEITVISGEGLR----VGKKNVFVTVK-SEFSCNVKATGVDKGGGSFP  237
            L+   ME   R L ITVIS E L+      K +V+  V  + +  + K T VDK  G+ P
Sbjct  59   LIALKMEY--RPLNITVISCEDLKDVKVFSKMDVYTEVSIAGYPLSKKTTFVDKNSGTNP  116

Query  238  AWNEKL--VVDLPMHARY-LTLQVQCK---TFSGVKVVGEAKVPAKDFVGGFVPESYVRF  399
             WN ++  +VD P   +  L+L  + K   TFSG K +G   VP  +       E  V  
Sbjct  117  KWNHRMEFMVDEPYLTKPGLSLLFEIKAESTFSGYKDIGSVTVPIYELYQPDATEDKV--  174

Query  400  LSYRLKDRKGEKNGIINISVR  462
            + Y++  R G+  G +  S R
Sbjct  175  VEYQVHTRSGKPKGTLKFSYR  195



>gb|EYU29829.1| hypothetical protein MIMGU_mgv1a021847mg [Erythranthe guttata]
Length=166

 Score = 51.2 bits (121),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 40/150 (27%), Positives = 68/150 (45%), Gaps = 21/150 (14%)
 Frame = +1

Query  109  LEITVISGEGLRVGKKNV--------FVTVKSEFSCNVK------ATGVDKGGGSFPAWN  246
            +EIT+IS + +   K           F+ + +  S   K       T  D+ GG  P W 
Sbjct  10   IEITIISAQNIAKNKSYFTFSRRIRPFIILSAASSARNKDLQRLYETREDENGGVNPTWG  69

Query  247  EKLVVDLP---MHARYLTLQVQCKT---FSGVKVVGEAKVPAKDFVGGFVPESYVRFLSY  408
            +K  + L     + RY  + +Q  T     G   +G   +PA D +  F      +FLSY
Sbjct  70   DKFRLSLTHNFFNQRYPGIYLQLYTKHLLLGQSQLGWCMIPASDILNRFSHVGSTQFLSY  129

Query  409  RLKDRKGEK-NGIINISVRVKNSAAENAAV  495
            RL+   G +  G++N++VR++ S  ++ +V
Sbjct  130  RLRSGDGSRGQGVVNVAVRLEESLCDDHSV  159



>ref|XP_009359909.1| PREDICTED: uncharacterized protein LOC103950433 [Pyrus x bretschneideri]
Length=293

 Score = 52.4 bits (124),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 27/96 (28%), Positives = 48/96 (50%), Gaps = 8/96 (8%)
 Frame = +1

Query  199  KATGVDKGGGSFPAWNEKLVVDL-------PMHARYLTLQVQCKTFSGVKVVGEAKVPAK  357
            + T VD+ G   P WN  +  D             ++   ++C +  G K +G+ +VP  
Sbjct  61   QKTPVDREGDCNPEWNHPMQFDTKDLSLVDEFDNLFVEFDIRCDSVFGKKSIGKVRVPFA  120

Query  358  DFVGGFVPESYVRFLSYRLKDRKGEKNGIINISVRV  465
            D +     E+ VRF+SY+++   G+ NG++N S +V
Sbjct  121  DLIDDQCNEA-VRFVSYQVRTSDGKPNGVLNFSYKV  155



>ref|XP_010249359.1| PREDICTED: uncharacterized protein LOC104591911 [Nelumbo nucifera]
Length=287

 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 37/122 (30%), Positives = 57/122 (47%), Gaps = 20/122 (16%)
 Frame = +1

Query  205  TGVDKGGGSFPAWNEKLVVDLPMHARYLT-------LQVQCK-TFSGVKVVGEAKVPAKD  360
            T +D+ G   P WN ++  DL  H  +L          ++C     G K +GE +VP K 
Sbjct  51   TPIDRNGDGNPEWNHEMEFDL-KHISFLDCDHVFIDFDLRCDGIIFGDKSIGEVRVPFKH  109

Query  361  FVGGFVPESYVRFLSYRLKDRKGEKNGIINISVRV-----KNSAAENA----AVASCSSQ  513
             V  F  +  VRF SY+++   G+ NG++N S ++     K  A+EN      V S  + 
Sbjct  110  LVDEF--DGSVRFASYQVRSADGKPNGVLNFSYKLNDKGKKYPASENENGGFPVPSVEAH  167

Query  514  YS  519
            Y 
Sbjct  168  YP  169



>gb|EYU20982.1| hypothetical protein MIMGU_mgv1a011603mg [Erythranthe guttata]
Length=276

 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 42/134 (31%), Positives = 66/134 (49%), Gaps = 17/134 (13%)
 Frame = +1

Query  103  RDLEITVISGEGLR----VGKKNVFVTVK-SEFSCNVKATGVDKGGGSFPAWNEKL--VV  261
            R L+I VIS +G++      K +V+  V  + +  ++K T VDK  G+ P WN ++  +V
Sbjct  4    RPLKINVISADGIKDVKLFSKMDVYAQVSIAGYPQSMKKTFVDKNSGTTPKWNHRMEFIV  63

Query  262  DLPMHARY-LTLQVQCK---TFSGVKVVGEAKVPAKDFVGGFVPESYV---RFLSYRLKD  420
            D P   +  L+L  Q K   TF   K +G A +P  D    F P+S     R + Y+L  
Sbjct  64   DEPYLTKPGLSLLFQLKAESTFGSDKEIGSATIPIHDL---FNPDSTTQEDRQVEYQLHT  120

Query  421  RKGEKNGIINISVR  462
              G+  G +  S +
Sbjct  121  PSGKSKGSLKFSYQ  134



>ref|XP_009383915.1| PREDICTED: BON1-associated protein 2-like [Musa acuminata subsp. 
malaccensis]
Length=262

 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 46/151 (30%), Positives = 77/151 (51%), Gaps = 19/151 (13%)
 Frame = +1

Query  103  RDLEITVISGEGLR----VGKKNVFVTVK-SEFSCNVKATGVDKGGGSFPAWNEKLVVDL  267
            R LEIT++S +GL+    + K  V+  V  S      + T  D+ GG  P WN  + + +
Sbjct  4    RTLEITLVSAKGLKDVNLISKMAVYAVVSLSGKRRGRQLTPPDREGGRNPTWNSTIRLTV  63

Query  268  PMH---ARYLTLQVQCKTFSGV--KVVGEAKVPAKDFV----GGFVPESYVRFLSYRL-K  417
            P+    AR+ ++ +  +T   +  + VGE +VP  D +    GG  P   V+F+SY++ +
Sbjct  64   PVDVDLARH-SIHILLRTKRALRDRDVGEVRVPLSDLLSGACGGPPP---VQFVSYQVHR  119

Query  418  DRKGEKNGIINISVRVKNSAAENAAVASCSS  510
               G+ NG++N S +     A  A V S S+
Sbjct  120  VTSGKPNGVLNFSYKPGECVAAFALVPSASA  150



>ref|XP_010259736.1| PREDICTED: uncharacterized protein LOC104599071 [Nelumbo nucifera]
Length=222

 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 43/140 (31%), Positives = 69/140 (49%), Gaps = 22/140 (16%)
 Frame = +1

Query  109  LEITVISGEGLRVGKKNVF---------VTVKSEFSCNVKATGVDKGGGSFPAWNEKL--  255
            LEITVIS   LR  ++ VF         V+V S+ +  ++ T VD+ GG+ P WN  +  
Sbjct  5    LEITVISARDLRNVRR-VFKSHMRVYAVVSVSSDPN-KIQRTPVDQKGGTNPNWNCTMNF  62

Query  256  ---VVDLPMHAR---YLTLQVQCKTFSGVKVVGEAKVPAKDFVGGFVP---ESYVRFLSY  408
                 DL +H      L+ ++ C    G K++GE  VP  D +    P    +  R +S 
Sbjct  63   SLGECDLSVHRNKPILLSFKLCCNRTRGDKLLGEVFVPIIDLLNNAPPTGNSTPTRTISC  122

Query  409  RLKDRKGEKNGIINISVRVK  468
            +++D  G  +GI+N S + +
Sbjct  123  QVRDLLGNLHGILNFSYKFR  142



>ref|XP_008369595.1| PREDICTED: uncharacterized protein LOC103433141 [Malus domestica]
Length=292

 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 27/96 (28%), Positives = 48/96 (50%), Gaps = 8/96 (8%)
 Frame = +1

Query  199  KATGVDKGGGSFPAWNEKLVVDL-------PMHARYLTLQVQCKTFSGVKVVGEAKVPAK  357
            + T VD+ G   P WN  +  D             ++   ++C +  G K +G+ +VP  
Sbjct  61   QKTPVDREGDCNPEWNHPMQFDTKDLSLVDEFDNLFVEFNIRCDSVFGKKSIGKVRVPFA  120

Query  358  DFVGGFVPESYVRFLSYRLKDRKGEKNGIINISVRV  465
            D +     E+ VRF+SY+++   G+ NG++N S +V
Sbjct  121  DLIDDQCNEA-VRFVSYQVRTSDGKPNGVLNFSYKV  155



>ref|XP_002965668.1| hypothetical protein SELMODRAFT_407234 [Selaginella moellendorffii]
 gb|EFJ33088.1| hypothetical protein SELMODRAFT_407234 [Selaginella moellendorffii]
Length=373

 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 39/133 (29%), Positives = 67/133 (50%), Gaps = 15/133 (11%)
 Frame = +1

Query  109  LEITVISGEGLR----VGKKNVFVTVKSEFSCNVK-ATGVDKGGGSFPAWNEKLVVDLPM  273
            LE+T+IS +GLR     G+ + +    +     VK  T V    GS PAW+ K+ +  P 
Sbjct  27   LEVTIISAQGLRDTCIFGRMSPYAL--AWIDPEVKYCTHVAHNAGSNPAWDHKMYIPRPG  84

Query  274  HARYLTLQVQC---KTFSGVKVVGEAKVPAKDFVGGFVPESYVRFLSYRLKDRKGEKNGI  444
              R + L VQ     + +   +VG  K+P  D + G      +++++ +L+   G  +G+
Sbjct  85   SLRGVELCVQIFSRGSGTNDPIVGSTKIPLGDVIDGG-----LQYMACQLQRPSGRIHGL  139

Query  445  INISVRVKNSAAE  483
            +NISV+  +S  E
Sbjct  140  LNISVQTCHSDRE  152



>ref|XP_010682216.1| PREDICTED: optomotor-blind protein-like [Beta vulgaris subsp. 
vulgaris]
Length=347

 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 31/93 (33%), Positives = 51/93 (55%), Gaps = 8/93 (9%)
 Frame = +1

Query  205  TGVDKGGGSFPAWNEKLVVDL-PMHA-RYLTLQVQCKT-----FSGVKVVGEAKVPAKDF  363
            T VD  G   P WN  +  DL P+++   L+L  + +      F   K +GE +VP  D 
Sbjct  60   TPVDDNGDGNPEWNYSIKFDLRPLNSINDLSLLFEMRNQGQLQFLWDKTIGEVRVPLTDL  119

Query  364  VGGFVPESYVRFLSYRLKDRKGEKNGIINISVR  462
            +   +PE  VRF+SY +++ +G+ NGI++ S +
Sbjct  120  IQSGMPEV-VRFVSYEVRNPEGKHNGILDFSYK  151



>ref|XP_002315561.1| shock protein SRC2 [Populus trichocarpa]
 gb|EEF01732.1| shock protein SRC2 [Populus trichocarpa]
Length=289

 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 40/136 (29%), Positives = 66/136 (49%), Gaps = 17/136 (13%)
 Frame = +1

Query  103  RDLEITVISGEGLR----VGKKNVFVTV-------KSEFSCNVKATGVDKGGGSFPAWNE  249
            R LEI VIS   L+    + K +V+  V       K +     K T VD+ GG  P WN 
Sbjct  4    RTLEINVISARDLKDVNYISKMDVYAVVSISGVDSKQQPKQKTK-TPVDRDGGKNPTWNF  62

Query  250  KLVVDLP---MHARYLTL--QVQCKTFSGVKVVGEAKVPAKDFVGGFVPESYVRFLSYRL  414
             +   +P   +   +L+L  +++C+   G K +GE  VP K+ +        ++F+SY++
Sbjct  63   PIKFTIPETSLAENHLSLVFKLKCERALGDKDIGEVNVPIKELLDSAGDGKSMKFVSYQV  122

Query  415  KDRKGEKNGIINISVR  462
            +   G+  G IN S +
Sbjct  123  RKPSGKPKGEINFSFK  138



>ref|XP_007218347.1| hypothetical protein PRUPE_ppa008681mg [Prunus persica]
 gb|EMJ19546.1| hypothetical protein PRUPE_ppa008681mg [Prunus persica]
Length=322

 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 39/129 (30%), Positives = 63/129 (49%), Gaps = 11/129 (9%)
 Frame = +1

Query  106  DLEITVISGEGLR-VGKKNVFVTVKSEFSCNVK---ATGVDKGGGSFPAWNEKLVVD--L  267
            DL++T++S + L+ V  KN  +   + F  +     AT  D  G + P WNE+  V   L
Sbjct  54   DLDLTIVSAKHLKNVNWKNGDLKPYAVFWVDSDRRLATKSDDSGSTRPVWNERFTVPLTL  113

Query  268  PMHARYLTLQV-QCKTFSGVK-VVGEAKVPAKDFVGGFVPESYVRFLSYRLKDRKGEKNG  441
            P+H  +LTL++   K     K +VG  +VP KD      P+   R  +++L    G   G
Sbjct  114  PVHDSFLTLEIFHSKPSDTPKPLVGTLRVPLKDLPD---PDDSTRIRTFQLVRPSGRPQG  170

Query  442  IINISVRVK  468
             I + + V+
Sbjct  171  KIRVKLAVR  179



>ref|XP_007050005.1| Calcium-dependent lipid-binding family protein, putative [Theobroma 
cacao]
 gb|EOX94162.1| Calcium-dependent lipid-binding family protein, putative [Theobroma 
cacao]
Length=270

 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 35/115 (30%), Positives = 59/115 (51%), Gaps = 14/115 (12%)
 Frame = +1

Query  199  KATGVDKGGGSFPAWNEKLVVDL---PMHAR---YLTLQVQCKTFSGVKVVGEAKVPAKD  360
            + T +D+GG + P WN     DL   P       +L   ++ +   G + +GE +VP KD
Sbjct  51   QKTSIDRGGKN-PEWNHVFQFDLKSLPSEETDRLFLKFDLRHEGLVG-RTIGEVRVPLKD  108

Query  361  FVGGFVPESYVRFLSYRLKDRKGEKNGIINISVRV----KNSAAENAAVASCSSQ  513
             +  F     VRF+SY++++  G+ NG++N S ++    KNS   +  V S S +
Sbjct  109  LIEEFC--GVVRFVSYQVRNSDGKPNGVLNFSYKLIGGSKNSGNASPQVDSSSEK  161



>ref|XP_002970540.1| hypothetical protein SELMODRAFT_441151 [Selaginella moellendorffii]
 gb|EFJ28670.1| hypothetical protein SELMODRAFT_441151 [Selaginella moellendorffii]
Length=270

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 41/138 (30%), Positives = 65/138 (47%), Gaps = 19/138 (14%)
 Frame = +1

Query  88   METSSRDLEITVISGEGLR----VGKKNVFVTVKSEFSCNVKATGVDKGGGSFPAWNEKL  255
            M T  R LE+T IS E L+    VGK   +V    + S    +T + +  G  P WNEKL
Sbjct  1    MTTELRMLEVTPISAEDLKDVKLVGKMQTYVVAWVDPSRKA-STNLSQLPGKNPRWNEKL  59

Query  256  VVD-----LPMHARYLTLQVQCKTFSGVKVVGEAKVPAKDFVG---GFVPESYVRFLSYR  411
            ++      L     +L L++  + F    +VG A +P ++      G  P      LS++
Sbjct  60   MLSVEDQLLQQPGAFLVLEIYHRGFLESTIVGRANIPLQEISAKGSGDAP------LSFK  113

Query  412  LKDRKGEKNGIINISVRV  465
            ++   G   G I++SV+V
Sbjct  114  VRRPSGRLQGTIHVSVKV  131



>ref|XP_010054786.1| PREDICTED: uncharacterized protein LOC104443136 [Eucalyptus grandis]
Length=190

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 45/138 (33%), Positives = 63/138 (46%), Gaps = 33/138 (24%)
 Frame = +1

Query  109  LEITVISGEGLRVGKKNVFVTVK-----------------SEFSCNVKATGVDKGGGSFP  237
            +EITVIS +GLR    N   + +                 +       ATGVD+ GG+ P
Sbjct  13   VEITVISAQGLRNPTLNALFSRRLKPYATLAVAAAAAAAAAAAPRPAHATGVDRRGGTNP  72

Query  238  AWNEK--LVVDLPMHAR-----YLTLQVQCKTFSGVKVVGEAKVPAKDFVGGFVPESY--  390
             WN+K  L VD    A      YL ++ + +   G  V+G   +PA D +    PE+   
Sbjct  73   TWNQKFRLPVDPGFFADLRSSVYLDVRAR-RLVGGEAVLGWCLIPAGDIIS---PEAAAA  128

Query  391  ---VRFLSYRLKDRKGEK  435
               V FLSYRL+DR G +
Sbjct  129  AGSVVFLSYRLRDRDGTR  146



>ref|XP_011044520.1| PREDICTED: actin cytoskeleton-regulatory complex protein pan-1-like 
[Populus euphratica]
Length=289

 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 44/156 (28%), Positives = 70/156 (45%), Gaps = 19/156 (12%)
 Frame = +1

Query  103  RDLEITVISGEGLR----VGKKNVFVTV-------KSEFSCNVKATGVDKGGGSFPAWNE  249
            R LEI VIS   L+    + K +V+  V       K +     K T VD+ GG  P WN 
Sbjct  4    RTLEINVISARDLKDVNYISKMDVYAVVSISGVDSKQQPKQKTK-TPVDRAGGKNPTWNF  62

Query  250  KLVVDLPMHARY-----LTLQVQCKTFSGVKVVGEAKVPAKDFVGGFVPESYVRFLSYRL  414
             +   +P  +       L  +++C+   G K +GE  VP K+ +        ++F+SY++
Sbjct  63   PIKFTIPETSLAENRLSLVFKLKCERALGDKDIGEVNVPIKELLDSAGDGKSMKFVSYQV  122

Query  415  KDRKGEKNGIINISVRVKNSAAENAAVASCSSQYSR  522
            +   G+  G I+ S +      E  AV   SS  S+
Sbjct  123  RKPSGKPKGEISFSFKF--GEIEKVAVPEASSSASK  156



>ref|XP_002978619.1| hypothetical protein SELMODRAFT_443918 [Selaginella moellendorffii]
 gb|EFJ20605.1| hypothetical protein SELMODRAFT_443918 [Selaginella moellendorffii]
Length=393

 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 41/138 (30%), Positives = 65/138 (47%), Gaps = 19/138 (14%)
 Frame = +1

Query  88   METSSRDLEITVISGEGLR----VGKKNVFVTVKSEFSCNVKATGVDKGGGSFPAWNEKL  255
            M T  R LE+T IS E L+    VGK   +V    + S    +T + +  G  P WNEKL
Sbjct  1    MTTELRMLEVTPISAEDLKDVKLVGKMQTYVVAWVDPSRKA-STNLSQLPGKNPRWNEKL  59

Query  256  VVD-----LPMHARYLTLQVQCKTFSGVKVVGEAKVPAKDFV---GGFVPESYVRFLSYR  411
            ++      L     +L L++  + F    +VG A +P ++      G  P      LS++
Sbjct  60   MLSVEDQLLQQPGAFLVLEIYHRGFLESTIVGRANIPLQEISTKGSGDAP------LSFK  113

Query  412  LKDRKGEKNGIINISVRV  465
            ++   G   G I++SV+V
Sbjct  114  VRRPSGRLQGTIHVSVKV  131



>ref|XP_011012859.1| PREDICTED: formin-like protein 18 [Populus euphratica]
Length=302

 Score = 50.4 bits (119),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 43/151 (28%), Positives = 66/151 (44%), Gaps = 17/151 (11%)
 Frame = +1

Query  103  RDLEITVISGEGLR----VGKKNVFVTVK------SEFSCNVKATGVDKGGGSFPAWNEK  252
            R LEI VIS  GL+    + K +V+  V        +       T VD+ GG  P WN  
Sbjct  4    RTLEINVISARGLKDVNYISKMDVYAVVSISGDDSKQKPKQKTKTPVDRAGGKNPTWNFP  63

Query  253  LVVDLPM-----HARYLTLQVQCKTFSGVKVVGEAKVPAKDFVGGFVPESYVRFLSYRLK  417
            +   +P      +   L   ++C+   G K VGE  VP K+ +        ++F+SY+++
Sbjct  64   IKFSIPPTPLAENRLNLVFNLKCERALGDKDVGEVNVPVKELLDSASDGKSMKFVSYQVR  123

Query  418  DRKGEKNGIINISVRVKNSAAENAAVASCSS  510
               G+  G   +S   K S  E   VA  S+
Sbjct  124  KPSGKPKG--EVSFSFKFSGIEKVLVAEVST  152



>ref|XP_006844679.2| PREDICTED: splicing factor 3B subunit 4 [Amborella trichopoda]
Length=298

 Score = 50.4 bits (119),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 34/138 (25%), Positives = 71/138 (51%), Gaps = 12/138 (9%)
 Frame = +1

Query  97   SSRDLEITVISGEGLRV----GKKNVFVTVKSEFSCNVKATGVDKGGGSFPAWNEKLVVD  264
            + + +E+T++SG+GL+      K +VF  V        +    DK G   P W   + +D
Sbjct  2    AKKKMELTLLSGKGLKAFNFFRKLSVFAEVSVGDQKTKQKIPADKIGDGNPEWKHAMTID  61

Query  265  LP---MHARYLTLQVQCKTFSGVKVVGEAKVPAKDFVG-GFVPESYVRFLSYRLKDRKGE  432
            L    +    LT++++ +     +++GE  +P +  +  GF     +R++SY++ D  G+
Sbjct  62   LDDPGLDQMILTVKLKSEGLF-ERLIGEVHIPVQSLLEEGF---GVLRYVSYQVSDPNGK  117

Query  433  KNGIINISVRVKNSAAEN  486
             NG++++S ++  +  EN
Sbjct  118  PNGVLSLSYKITGNFLEN  135



>ref|XP_003576757.1| PREDICTED: BON1-associated protein 2-like [Brachypodium distachyon]
Length=232

 Score = 50.1 bits (118),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 44/156 (28%), Positives = 73/156 (47%), Gaps = 25/156 (16%)
 Frame = +1

Query  82   FDMETSSRDLEITVISGEGLRVGKKNV----------FVTVKSEFSCNVKATGVDKGGGS  231
            F  ET+   +E+TV+S E + +G              +  V +  S   +    D+ GG 
Sbjct  19   FAWETT---VEVTVVSAEEVVLGGSGALRRRPLSGGAYAAVHT-MSSAARTRVDDEDGGD  74

Query  232  ---FPAWNEKLVVDLPMHARYLTLQVQCKTFSGVKV--VGEAKVPAKDFVGGFVPESYVR  396
               +P W E + V +P  +  + +++ C+T    +V  V  A+VP  DF  G  P  ++ 
Sbjct  75   CNGYPYWGEAVRVKVPAWSSAIDVEI-CRTRGDGRVESVASARVPVADF--GVGPPGHLH  131

Query  397  FLSYRLKD---RKGEKNGIINISVRVKNSAAENAAV  495
             LSYRL D   R   +NG++NI V+  +  A   A+
Sbjct  132  CLSYRLFDSGSRMTSRNGVVNIRVKRLDGCAPPGAI  167



>ref|XP_010684409.1| PREDICTED: splicing factor 3B subunit 4-like [Beta vulgaris subsp. 
vulgaris]
Length=350

 Score = 50.4 bits (119),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 41/132 (31%), Positives = 73/132 (55%), Gaps = 12/132 (9%)
 Frame = +1

Query  103  RDLEITVISGEGLR----VGKKNVFVTVK-SEFSCNVKATGVDKGGGSFPAWN--EKLVV  261
            + LE+T+IS + L+    +GK +V+V V  S+   N + T V + GG+ P+WN   +  V
Sbjct  4    KTLELTLISAKDLKNVNLIGKMDVYVVVHLSDDPKNKQKTPVHQDGGTNPSWNYVMRFTV  63

Query  262  DLPMHA---RYLTLQVQCKTFSGV-KVVGEAKVPAKDFVGGFVPESYVRFLSYRLKD-RK  426
            D  + A   +Y+ L ++ +T  G  K +GE  +P K+ + G    S  +F++Y++K    
Sbjct  64   DDAVAAKPGKYVVLTLKHETTLGADKDLGEVLLPLKELLEGVKDPSSPQFVTYQVKRVSS  123

Query  427  GEKNGIINISVR  462
            G+  G I +S +
Sbjct  124  GKAQGEIKLSYK  135



>emb|CDY31113.1| BnaA08g26630D [Brassica napus]
Length=319

 Score = 50.1 bits (118),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 40/134 (30%), Positives = 65/134 (49%), Gaps = 14/134 (10%)
 Frame = +1

Query  103  RDLEITVISGEGLR----VGKKNVFVTVKSEFSCNVKA-TGVDKGGGSFPAWNEKL---V  258
            R L++T+IS E L+    +GK++++  V        K  T VDK  G+ P WN ++   V
Sbjct  4    RPLDLTIISAEDLKDIQLIGKQDLYAVVSLNNDARTKQKTKVDKDCGTKPKWNHQIKLTV  63

Query  259  VDLPMHARYLTLQVQC---KTFSGVKVVGEAKVPAKDFVGGFVPESYV---RFLSYRLKD  420
             D      +LTL +Q    +  +G K VGE  VP K+ +     E  V   + ++Y +K 
Sbjct  64   DDTAARENHLTLVIQIIADRPIAGDKPVGEVSVPLKELLDQNNKEGDVEEEKTVTYAVKL  123

Query  421  RKGEKNGIINISVR  462
              G+  G +  S +
Sbjct  124  PNGKTKGSLKFSFK  137



>ref|XP_009110855.1| PREDICTED: small nuclear ribonucleoprotein-associated protein 
B-like [Brassica rapa]
Length=316

 Score = 50.1 bits (118),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 40/134 (30%), Positives = 65/134 (49%), Gaps = 14/134 (10%)
 Frame = +1

Query  103  RDLEITVISGEGLR----VGKKNVFVTVKSEFSCNVKA-TGVDKGGGSFPAWNEKL---V  258
            R L++T+IS E L+    +GK++++  V        K  T VDK  G+ P WN ++   V
Sbjct  4    RPLDLTIISAEDLKDIQLIGKQDLYAVVSLNNDARTKQKTKVDKDCGTKPKWNHQIKLTV  63

Query  259  VDLPMHARYLTLQVQC---KTFSGVKVVGEAKVPAKDFVGGFVPESYV---RFLSYRLKD  420
             D      +LTL +Q    +  +G K VGE  VP K+ +     E  V   + ++Y +K 
Sbjct  64   DDTAARENHLTLVIQIIADRPIAGDKPVGEVSVPLKELLDQNNKEGDVEEEKTVTYAVKL  123

Query  421  RKGEKNGIINISVR  462
              G+  G +  S +
Sbjct  124  PNGKTKGSLKFSFK  137



>ref|XP_006446875.1| hypothetical protein CICLE_v10017662mg [Citrus clementina]
 gb|ESR60115.1| hypothetical protein CICLE_v10017662mg [Citrus clementina]
Length=331

 Score = 50.1 bits (118),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 47/151 (31%), Positives = 70/151 (46%), Gaps = 25/151 (17%)
 Frame = +1

Query  88   METSSRDLEITVISGEGLRV----GKKNVFVTV--------KSEFSCNVKATGVDKGGGS  231
            ME+SS  LEI V+ G+ L+      K  ++V V        K+        T  DK G  
Sbjct  1    MESSS--LEIKVMFGKDLKAFNFFQKLTLYVLVSIVSDDPAKTLEQKQKHRTPTDKEGDG  58

Query  232  FPAWNEKLVVDLP---MH-ARYLTLQVQCK---TFSGVKVVGEAKVPAKDFVGGFVPESY  390
             P WN  +  DL     H   ++ +Q + K      G K +GE +VP KD +  F     
Sbjct  59   NPEWNHGMQFDLKGILFHDGGHIFVQFELKHEGVMFGDKTIGEVRVPIKDLISEF--NGV  116

Query  391  VRFLSYRLKDRKGEKNGIINISVRVK--NSA  477
            VRF+ Y +++  G+ NG++  S +V   NSA
Sbjct  117  VRFVDYEVRNPDGKPNGVLTFSYKVNGMNSA  147



>ref|XP_002971671.1| hypothetical protein SELMODRAFT_412188 [Selaginella moellendorffii]
 gb|EFJ27420.1| hypothetical protein SELMODRAFT_412188 [Selaginella moellendorffii]
Length=373

 Score = 50.1 bits (118),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 39/133 (29%), Positives = 66/133 (50%), Gaps = 15/133 (11%)
 Frame = +1

Query  109  LEITVISGEGLR----VGKKNVFVTVKSEFSCNVK-ATGVDKGGGSFPAWNEKLVVDLPM  273
            LE+T+IS +GLR     G+ + +    +     VK  T V    GS PAW+ K+ +  P 
Sbjct  27   LEVTIISAQGLRDTCIFGRMSPYAL--AWIDPEVKYCTHVAHNAGSNPAWDHKMYIPRPG  84

Query  274  HARYLTLQVQC---KTFSGVKVVGEAKVPAKDFVGGFVPESYVRFLSYRLKDRKGEKNGI  444
              R + L VQ     + +   +VG  K+P  D   G      +++++ +L+   G  +G+
Sbjct  85   SLRGVELCVQIFSRGSGTNDPIVGSTKIPLGDVSDGG-----LQYMACQLQRPSGRIHGL  139

Query  445  INISVRVKNSAAE  483
            +NISV+  +S  E
Sbjct  140  LNISVQTCHSDRE  152



>ref|XP_009353538.1| PREDICTED: uncharacterized protein LOC103944799 [Pyrus x bretschneideri]
Length=783

 Score = 50.4 bits (119),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 29/93 (31%), Positives = 45/93 (48%), Gaps = 8/93 (9%)
 Frame = +1

Query  205  TGVDKGGGSFPAWNEKLVVDL-------PMHARYLTLQVQCKTFSGVKVVGEAKVPAKDF  363
            T VD+ G   P WN  +  D+             L   +QC+T  G K +G+ +VP  D 
Sbjct  68   TLVDREGDCNPEWNHTMQFDMNDVCPVDEFDNSLLEFDMQCETVIGKKSIGKIRVPLADL  127

Query  364  VGGFVPESYVRFLSYRLKDRKGEKNGIINISVR  462
            +     E+ VRF+SY+     G+ NG++N S +
Sbjct  128  IDDQCNEA-VRFVSYQFWSSLGKPNGVLNFSYK  159



>gb|ERN06354.1| hypothetical protein AMTR_s00016p00243850 [Amborella trichopoda]
Length=293

 Score = 50.1 bits (118),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 34/134 (25%), Positives = 69/134 (51%), Gaps = 12/134 (9%)
 Frame = +1

Query  109  LEITVISGEGLRV----GKKNVFVTVKSEFSCNVKATGVDKGGGSFPAWNEKLVVDLP--  270
            +E+T++SG+GL+      K +VF  V        +    DK G   P W   + +DL   
Sbjct  1    MELTLLSGKGLKAFNFFRKLSVFAEVSVGDQKTKQKIPADKIGDGNPEWKHAMTIDLDDP  60

Query  271  -MHARYLTLQVQCKTFSGVKVVGEAKVPAKDFVG-GFVPESYVRFLSYRLKDRKGEKNGI  444
             +    LT++++ +     +++GE  +P +  +  GF     +R++SY++ D  G+ NG+
Sbjct  61   GLDQMILTVKLKSEGLF-ERLIGEVHIPVQSLLEEGF---GVLRYVSYQVSDPNGKPNGV  116

Query  445  INISVRVKNSAAEN  486
            +++S ++  +  EN
Sbjct  117  LSLSYKITGNFLEN  130



>ref|XP_009409984.1| PREDICTED: wiskott-Aldrich syndrome protein family member 2-like 
[Musa acuminata subsp. malaccensis]
Length=316

 Score = 50.1 bits (118),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 31/100 (31%), Positives = 50/100 (50%), Gaps = 7/100 (7%)
 Frame = +1

Query  205  TGVDKGGGSFPAWNEKLVVDLPMHARYLTLQVQCKTFSGV----KVVGEAKVPAKDFVGG  372
            T VD+ GG  P W++ +  D       L L+ + K   G+    K+VG A VP  D    
Sbjct  50   TTVDRDGGENPEWDQPMRFD--RDGDDLVLEFELKDHGGLLPGDKIVGRASVPVADLAAE  107

Query  373  FVPESYVRFLSYRLKDRKGEKNGIINISVRVKNSAAENAA  492
             +P ++ R +SY+L    G+ NGI++ + R+    A+ A 
Sbjct  108  RLPGAFRR-VSYQLLAPDGKPNGILSFAYRIDGRGADIAP  146



>emb|CAN74734.1| hypothetical protein VITISV_044234 [Vitis vinifera]
Length=276

 Score = 49.7 bits (117),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 31/113 (27%), Positives = 53/113 (47%), Gaps = 12/113 (11%)
 Frame = +1

Query  199  KATGVDKGGGSFPAWNE----KLVVDLPMHARYLTLQVQCKTFS---GVKVVGEAKVPAK  357
            + T  DK G   P WN      L+    +H  ++   ++C+      G K +GE +VP  
Sbjct  54   QRTPADKEGDGNPEWNHLMEFNLIEGFGLHHLFIHFDLRCEGLVFGIGDKALGEVRVPLD  113

Query  358  DFVGGFVPES--YVRFLSYRLKDRKGEKNGIINISVRVKNSAAENAAVASCSS  510
            D +    P+S   +RF+SY+++   G+ NG++N S +   +         CSS
Sbjct  114  DLI---QPDSNGIMRFVSYQVRSGDGKPNGVLNFSYKAVMNEMGKKEEMGCSS  163



>ref|XP_010660769.1| PREDICTED: uncharacterized protein LOC100244618 [Vitis vinifera]
Length=1141

 Score = 50.1 bits (118),  Expect = 8e-04, Method: Composition-based stats.
 Identities = 42/169 (25%), Positives = 72/169 (43%), Gaps = 26/169 (15%)
 Frame = +1

Query  73    LLGFDMETSSRDLEITVISGEGLRV----GKKNVFVTVK----------SEFSCNVKATG  210
             LL  +  TS   +++ V+S + LR      K +V+  V                  + T 
Sbjct  863   LLSMESNTSRNSIQVKVMSCKDLRAFNFFQKLSVYAIVSLVSDDPDQKLEPHHQQQQRTP  922

Query  211   VDKGGGSFPAWNE----KLVVDLPMHARYLTLQVQCKTFS---GVKVVGEAKVPAKDFVG  369
              DK G   P WN      L+    +H  ++   ++C+      G K +GE +VP  D + 
Sbjct  923   ADKEGDGNPEWNHLMEFNLIEGFGLHHLFIHFDLRCEGLVFGIGDKALGEVRVPLDDLIQ  982

Query  370   GFVPES--YVRFLSYRLKDRKGEKNGIINISVRVKNSAAENAAVASCSS  510
                P+S   +RF+SY+++   G+ NG++N S +   +         CSS
Sbjct  983   ---PDSNGIMRFVSYQVRSGDGKPNGVLNFSYKAVMNEMGKKEEMGCSS  1028



>gb|EMT21195.1| hypothetical protein F775_15531 [Aegilops tauschii]
Length=262

 Score = 49.3 bits (116),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 41/135 (30%), Positives = 61/135 (45%), Gaps = 12/135 (9%)
 Frame = +1

Query  103  RDLEITVISGEGLR----VGKKNVFVTVK---SEFSCNVKATGVDKGGGSFPAWNEKLVV  261
            R LE+T+IS + L+      K  V+  V     +       T  D+ GG  P W+  L  
Sbjct  4    RVLEVTLISAKDLKKVTLFSKMRVYAVVSISGGDPRTPTHRTHSDRHGGRNPMWHAPLRF  63

Query  262  DLPMHA--RYLTLQVQCKTFS--GVKVVGEAKVPAKDFVGGFVPESYVRFLSYRLKD-RK  426
             +P  A  R L L V  +     G + VGE  VP +D V    P    R LSY+++    
Sbjct  64   PIPTAADPRGLALHVLLRAERSFGDRDVGEVVVPVQDLVAVAPPAGEHRHLSYQVRSPMS  123

Query  427  GEKNGIINISVRVKN  471
            G K G+++IS  + +
Sbjct  124  GRKRGVLHISYSLSD  138



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1133412046677