BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig12936

Length=1857
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009589755.1|  PREDICTED: pectinesterase-like                     770   0.0      Nicotiana tomentosiformis
ref|XP_009769268.1|  PREDICTED: pectinesterase-like                     770   0.0      Nicotiana sylvestris
ref|XP_009771261.1|  PREDICTED: pectinesterase-like                     763   0.0      Nicotiana sylvestris
ref|XP_009589961.1|  PREDICTED: LOW QUALITY PROTEIN: pectinestera...    760   0.0      
ref|XP_004232737.1|  PREDICTED: pectinesterase-like                     732   0.0      Solanum lycopersicum
ref|XP_010316615.1|  PREDICTED: pectinesterase-like                     731   0.0      Solanum lycopersicum
emb|CDO99718.1|  unnamed protein product                                716   0.0      Coffea canephora [robusta coffee]
ref|XP_010267745.1|  PREDICTED: pectinesterase                          706   0.0      Nelumbo nucifera [Indian lotus]
ref|XP_002518523.1|  Pectinesterase precursor, putative                 698   0.0      Ricinus communis
ref|XP_002317208.1|  pectin methylesterase family protein               696   0.0      
emb|CDO99717.1|  unnamed protein product                                692   0.0      Coffea canephora [robusta coffee]
ref|XP_011000694.1|  PREDICTED: pectinesterase                          692   0.0      Populus euphratica
ref|XP_006348082.1|  PREDICTED: pectinesterase/pectinesterase inh...    686   0.0      Solanum tuberosum [potatoes]
ref|XP_007025998.1|  Pectinesterase/pectinesterase inhibitor, put...    686   0.0      
ref|XP_012091398.1|  PREDICTED: pectinesterase                          681   0.0      Jatropha curcas
ref|XP_008224789.1|  PREDICTED: pectinesterase                          670   0.0      Prunus mume [ume]
gb|KDO75533.1|  hypothetical protein CISIN_1g008722mg                   665   0.0      Citrus sinensis [apfelsine]
ref|XP_007213952.1|  hypothetical protein PRUPE_ppa003697mg             665   0.0      Prunus persica
ref|XP_006449081.1|  hypothetical protein CICLE_v10014787mg             664   0.0      Citrus clementina [clementine]
gb|KJB67143.1|  hypothetical protein B456_010G177500                    662   0.0      Gossypium raimondii
ref|XP_010101471.1|  Pectinesterase/pectinesterase inhibitor            662   0.0      Morus notabilis
ref|XP_009364480.1|  PREDICTED: pectinesterase                          662   0.0      Pyrus x bretschneideri [bai li]
ref|XP_006467993.1|  PREDICTED: pectinesterase/pectinesterase inh...    661   0.0      Citrus sinensis [apfelsine]
ref|XP_008371117.1|  PREDICTED: pectinesterase                          657   0.0      
emb|CAD29733.1|  pectin methylesterase                                  655   0.0      Sesbania rostrata
ref|XP_007157172.1|  hypothetical protein PHAVU_002G048700g             655   0.0      Phaseolus vulgaris [French bean]
gb|AAC14742.1|  pectin methylesterase                                   654   0.0      Pisum sativum [garden pea]
gb|KJB57711.1|  hypothetical protein B456_009G176700                    654   0.0      Gossypium raimondii
ref|XP_002266980.1|  PREDICTED: pectinesterase                          653   0.0      Vitis vinifera
emb|CAA47810.1|  pectinesterase                                         653   0.0      Pisum sativum [garden pea]
dbj|BAC67661.1|  pectin methylesterase                                  652   0.0      Pisum sativum [garden pea]
ref|XP_007157170.1|  hypothetical protein PHAVU_002G048500g             652   0.0      Phaseolus vulgaris [French bean]
ref|XP_006573891.1|  PREDICTED: pectinesterase/pectinesterase inh...    651   0.0      Glycine max [soybeans]
ref|XP_003622688.1|  Pectinesterase                                     651   0.0      Medicago truncatula
gb|AFK35109.1|  unknown                                                 648   0.0      Medicago truncatula
gb|ACJ85768.1|  unknown                                                 647   0.0      Medicago truncatula
gb|KHG26245.1|  Pectinesterase/pectinesterase inhibitor                 643   0.0      Gossypium arboreum [tree cotton]
dbj|BAC67662.1|  pectin methylesterase                                  639   0.0      Pisum sativum [garden pea]
ref|XP_011030843.1|  PREDICTED: pectinesterase-like                     637   0.0      Populus euphratica
gb|KHN30453.1|  Pectinesterase 2.2                                      634   0.0      Glycine soja [wild soybean]
ref|XP_011016647.1|  PREDICTED: pectinesterase-like                     637   0.0      Populus euphratica
ref|XP_011016743.1|  PREDICTED: pectinesterase-like                     635   0.0      Populus euphratica
ref|XP_010057972.1|  PREDICTED: pectinesterase-like                     635   0.0      Eucalyptus grandis [rose gum]
ref|XP_011095339.1|  PREDICTED: pectinesterase 2.1-like                 635   0.0      Sesamum indicum [beniseed]
gb|AFK44272.1|  unknown                                                 634   0.0      Lotus japonicus
ref|XP_004293266.1|  PREDICTED: pectinesterase                          630   0.0      Fragaria vesca subsp. vesca
ref|XP_003622699.1|  Pectinesterase                                     632   0.0      Medicago truncatula
ref|XP_006377839.1|  hypothetical protein POPTR_0011s13830g             630   0.0      
ref|XP_004492227.1|  PREDICTED: pectinesterase/pectinesterase inh...    629   0.0      Cicer arietinum [garbanzo]
ref|XP_004492228.1|  PREDICTED: pectinesterase 2.1-like                 629   0.0      Cicer arietinum [garbanzo]
gb|AHC69829.1|  pectin methylesterase PME2.1                            624   0.0      Nicotiana tabacum [American tobacco]
ref|XP_009768199.1|  PREDICTED: pectinesterase 2.1-like                 624   0.0      Nicotiana sylvestris
ref|XP_007157171.1|  hypothetical protein PHAVU_002G048600g             623   0.0      Phaseolus vulgaris [French bean]
ref|XP_010057974.1|  PREDICTED: pectinesterase-like                     620   0.0      Eucalyptus grandis [rose gum]
ref|XP_002522859.1|  Pectinesterase-2 precursor, putative               620   0.0      Ricinus communis
gb|EYU19222.1|  hypothetical protein MIMGU_mgv1a003983mg                613   0.0      Erythranthe guttata [common monkey flower]
ref|XP_010553426.1|  PREDICTED: pectinesterase/pectinesterase inh...    613   0.0      Tarenaya hassleriana [spider flower]
ref|XP_006360082.1|  PREDICTED: pectinesterase 3-like                   611   0.0      Solanum tuberosum [potatoes]
gb|AAF23891.1|  pectin methyl esterase                                  610   0.0      Solanum tuberosum [potatoes]
ref|NP_001274785.1|  pectin methyl esterase                             610   0.0      Solanum tuberosum [potatoes]
ref|XP_003622696.1|  Pectinesterase                                     609   0.0      Medicago truncatula
ref|XP_007157169.1|  hypothetical protein PHAVU_002G048400g             608   0.0      Phaseolus vulgaris [French bean]
ref|NP_001233948.1|  pectinesterase 2.1                                 604   0.0      Solanum lycopersicum
ref|XP_006417343.1|  hypothetical protein EUTSA_v10007263mg             603   0.0      Eutrema salsugineum [saltwater cress]
gb|AAB67739.1|  pectin methylesterase PME2.1                            602   0.0      Solanum lycopersicum
sp|Q96575.1|PME22_SOLLC  RecName: Full=Pectinesterase 2.2; Short=...    601   0.0      Solanum lycopersicum
ref|XP_006360083.1|  PREDICTED: pectinesterase 2.1-like                 599   0.0      Solanum tuberosum [potatoes]
ref|XP_006307176.1|  hypothetical protein CARUB_v10008769mg             597   0.0      Capsella rubella
ref|NP_001234151.1|  pectinesterase 1 precursor                         597   0.0      Solanum lycopersicum
gb|AAK59760.1|  At1g11580/T23J18_33                                     596   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|NP_172624.1|  methylesterase PCR A                                  596   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_010476087.1|  PREDICTED: pectinesterase/pectinesterase inh...    594   0.0      Camelina sativa [gold-of-pleasure]
emb|CDP05792.1|  unnamed protein product                                589   0.0      Coffea canephora [robusta coffee]
ref|XP_010101474.1|  Pectinesterase/pectinesterase inhibitor            593   0.0      Morus notabilis
ref|XP_010923950.1|  PREDICTED: pectinesterase-like                     591   0.0      Elaeis guineensis
emb|CBI23178.3|  unnamed protein product                                589   0.0      Vitis vinifera
ref|XP_010458561.1|  PREDICTED: pectinesterase/pectinesterase inh...    590   0.0      Camelina sativa [gold-of-pleasure]
ref|XP_010324324.1|  PREDICTED: pectinesterase 3                        590   0.0      
sp|P83947.1|PME1_FICPW  RecName: Full=Pectinesterase/pectinestera...    590   0.0      Ficus pumila var. awkeotsang [jelly fig]
sp|Q96576.1|PME3_SOLLC  RecName: Full=Pectinesterase 3; Short=PE ...    589   0.0      Solanum lycopersicum
ref|XP_009118185.1|  PREDICTED: pectinesterase/pectinesterase inh...    587   0.0      
ref|XP_008809854.1|  PREDICTED: pectinesterase-like                     587   0.0      Phoenix dactylifera
ref|XP_010493017.1|  PREDICTED: pectinesterase/pectinesterase inh...    586   0.0      Camelina sativa [gold-of-pleasure]
ref|XP_010088582.1|  Pectinesterase/pectinesterase inhibitor            590   0.0      
gb|AFC98398.1|  pectin methylesterase                                   585   0.0      Lepidium sativum
gb|KFK43434.1|  hypothetical protein AALP_AA1G125000                    583   0.0      Arabis alpina [alpine rockcress]
ref|XP_002889876.1|  At1g11580/T23J18_33                                583   0.0      
ref|XP_009397166.1|  PREDICTED: pectinesterase-like                     576   0.0      Musa acuminata subsp. malaccensis [pisang utan]
gb|AAB67740.1|  PME1.9                                                  568   0.0      Solanum lycopersicum
gb|AAB38794.1|  pectin methylesterase                                   567   0.0      Solanum lycopersicum
emb|CDY34642.1|  BnaC08g42010D                                          567   0.0      Brassica napus [oilseed rape]
ref|XP_004134752.1|  PREDICTED: pectinesterase                          569   0.0      Cucumis sativus [cucumbers]
ref|XP_011095338.1|  PREDICTED: pectinesterase 2.1-like                 557   0.0      Sesamum indicum [beniseed]
ref|XP_008439965.1|  PREDICTED: pectinesterase                          554   0.0      Cucumis melo [Oriental melon]
gb|ACJ02103.1|  pectin methylesterase                                   553   0.0      Oncidium hybrid cultivar
ref|XP_003564371.1|  PREDICTED: pectinesterase                          550   0.0      Brachypodium distachyon [annual false brome]
emb|CAA96434.1|  pectin methylesterase                                  540   0.0      Nicotiana plumbaginifolia [leadwort-leaved tobacco]
gb|ERN05249.1|  hypothetical protein AMTR_s00007p00101250               548   0.0      Amborella trichopoda
emb|CAA96435.1|  pectin methylesterase                                  537   0.0      Nicotiana plumbaginifolia [leadwort-leaved tobacco]
gb|ABK94644.1|  unknown                                                 536   0.0      Populus trichocarpa [western balsam poplar]
gb|ABK24761.1|  unknown                                                 539   0.0      Picea sitchensis
gb|EAY76103.1|  hypothetical protein OsI_04029                          538   0.0      Oryza sativa Indica Group [Indian rice]
ref|NP_001044480.1|  Os01g0788400                                       538   0.0      
pir||S00629  pectinesterase (EC 3.1.1.11) precursor (clone PE1) -...    522   5e-178
ref|XP_006646399.1|  PREDICTED: LOW QUALITY PROTEIN: pectinestera...    521   2e-175   
emb|CAA64217.1|  pectinmethylesterase                                   509   5e-174   Vigna radiata var. radiata [golden gram]
dbj|BAK05307.1|  predicted protein                                      514   1e-172   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006843574.2|  PREDICTED: pectinesterase 2.1                      506   3e-172   
ref|XP_002456465.1|  hypothetical protein SORBIDRAFT_03g036790          511   5e-171   Sorghum bicolor [broomcorn]
emb|CDM84519.1|  unnamed protein product                                496   9e-167   Triticum aestivum [Canadian hard winter wheat]
pdb|1XG2|A  Chain A, Crystal Structure Of The Complex Between Pec...    489   5e-166   Actinidia chinensis
gb|EPS63029.1|  hypothetical protein M569_11757                         487   3e-162   Genlisea aurea
ref|XP_010259481.1|  PREDICTED: pectinesterase-like                     488   1e-161   Nelumbo nucifera [Indian lotus]
emb|CAA96436.1|  pectin methylesterase                                  476   1e-161   Nicotiana plumbaginifolia [leadwort-leaved tobacco]
ref|XP_008795768.1|  PREDICTED: pectinesterase-like                     486   2e-161   Phoenix dactylifera
ref|XP_006841486.1|  PREDICTED: pectinesterase                          478   3e-158   Amborella trichopoda
ref|XP_007141001.1|  hypothetical protein PHAVU_008G158900g             479   6e-158   Phaseolus vulgaris [French bean]
ref|XP_003608136.1|  Pectinesterase                                     474   3e-157   Medicago truncatula
ref|XP_010273801.1|  PREDICTED: pectinesterase                          474   2e-156   Nelumbo nucifera [Indian lotus]
ref|XP_004498516.1|  PREDICTED: probable pectinesterase/pectinest...    474   4e-156   Cicer arietinum [garbanzo]
ref|XP_010273802.1|  PREDICTED: pectinesterase/pectinesterase inh...    469   1e-155   Nelumbo nucifera [Indian lotus]
ref|XP_010271268.1|  PREDICTED: pectinesterase-like                     468   7e-155   Nelumbo nucifera [Indian lotus]
gb|KHN44643.1|  Putative pectinesterase/pectinesterase inhibitor 61     471   1e-154   Glycine soja [wild soybean]
ref|XP_008812473.1|  PREDICTED: pectinesterase-like                     467   2e-154   Phoenix dactylifera
ref|XP_010269596.1|  PREDICTED: pectinesterase-like                     468   2e-154   Nelumbo nucifera [Indian lotus]
ref|XP_003588521.1|  Pectinesterase                                     469   4e-154   Medicago truncatula
gb|AGG23325.1|  pectin methylesterase 1                                 467   6e-154   Musa acuminata AAA Group [Cavendish banana]
ref|XP_009382521.1|  PREDICTED: pectinesterase-like                     467   7e-154   Musa acuminata subsp. malaccensis [pisang utan]
gb|ACQ85264.1|  pectin methylesterase                                   467   7e-154   Musa acuminata AAA Group [Cavendish banana]
ref|XP_010932330.1|  PREDICTED: pectinesterase-like                     466   1e-153   Elaeis guineensis
ref|XP_010917364.1|  PREDICTED: pectinesterase                          464   2e-153   Elaeis guineensis
ref|XP_010271269.1|  PREDICTED: pectinesterase-like                     464   2e-153   Nelumbo nucifera [Indian lotus]
ref|XP_010910186.1|  PREDICTED: pectinesterase-like                     463   7e-153   
ref|XP_009359674.1|  PREDICTED: pectinesterase/pectinesterase inh...    462   9e-153   Pyrus x bretschneideri [bai li]
ref|XP_008806757.1|  PREDICTED: LOW QUALITY PROTEIN: probable pec...    465   1e-152   
gb|ERM94148.1|  hypothetical protein AMTR_s00010p00161740               462   1e-152   Amborella trichopoda
ref|XP_006826911.2|  PREDICTED: pectinesterase                          461   2e-152   Amborella trichopoda
dbj|BAF42041.1|  pectin methylesterase 4                                461   3e-152   Pyrus communis
ref|XP_008337790.1|  PREDICTED: pectinesterase/pectinesterase inh...    461   4e-152   Malus domestica [apple tree]
ref|XP_009776000.1|  PREDICTED: probable pectinesterase/pectinest...    462   1e-151   Nicotiana sylvestris
ref|XP_007220109.1|  hypothetical protein PRUPE_ppa021446mg             458   2e-151   
ref|XP_010915944.1|  PREDICTED: probable pectinesterase/pectinest...    461   2e-151   Elaeis guineensis
gb|KJB41904.1|  hypothetical protein B456_007G127000                    460   4e-151   Gossypium raimondii
ref|XP_008783207.1|  PREDICTED: probable pectinesterase/pectinest...    461   4e-151   Phoenix dactylifera
ref|XP_010266280.1|  PREDICTED: pectinesterase-like                     459   4e-151   Nelumbo nucifera [Indian lotus]
ref|XP_002527782.1|  Pectinesterase-1 precursor, putative               458   7e-151   Ricinus communis
ref|XP_006852649.1|  PREDICTED: probable pectinesterase/pectinest...    461   7e-151   Amborella trichopoda
ref|XP_008359413.1|  PREDICTED: pectinesterase-like                     460   8e-151   
ref|XP_006828586.1|  PREDICTED: pectinesterase                          459   1e-150   Amborella trichopoda
ref|XP_008803383.1|  PREDICTED: pectinesterase                          457   1e-150   Phoenix dactylifera
ref|XP_009404434.1|  PREDICTED: probable pectinesterase/pectinest...    459   1e-150   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008803239.1|  PREDICTED: pectinesterase                          457   2e-150   
ref|XP_006828588.1|  PREDICTED: pectinesterase/pectinesterase inh...    457   2e-150   Amborella trichopoda
ref|XP_004972208.1|  PREDICTED: LOW QUALITY PROTEIN: pectinestera...    457   2e-150   
ref|XP_009614734.1|  PREDICTED: probable pectinesterase/pectinest...    459   2e-150   Nicotiana tomentosiformis
ref|XP_008235121.1|  PREDICTED: pectinesterase-like                     457   3e-150   Prunus mume [ume]
ref|XP_004290811.1|  PREDICTED: pectinesterase-like                     458   3e-150   Fragaria vesca subsp. vesca
ref|XP_012083608.1|  PREDICTED: pectinesterase 2 isoform X1             456   3e-150   Jatropha curcas
gb|AGJ83739.1|  pectinesterase/pectinesterase inhibitor PPE8B-lik...    454   4e-150   Caragana korshinskii
ref|XP_008448427.1|  PREDICTED: pectinesterase/pectinesterase inh...    457   6e-150   Cucumis melo [Oriental melon]
gb|ABZ89800.1|  pectin methylesterase-like protein                      457   7e-150   Taiwania cryptomerioides
ref|XP_004303758.1|  PREDICTED: pectinesterase-like                     457   1e-149   Fragaria vesca subsp. vesca
ref|XP_010271267.1|  PREDICTED: pectinesterase-like                     455   1e-149   Nelumbo nucifera [Indian lotus]
gb|KCW73020.1|  hypothetical protein EUGRSUZ_E01454                     453   1e-149   Eucalyptus grandis [rose gum]
ref|XP_006350555.1|  PREDICTED: probable pectinesterase/pectinest...    457   2e-149   Solanum tuberosum [potatoes]
ref|XP_012082811.1|  PREDICTED: pectinesterase-like                     455   2e-149   Jatropha curcas
ref|XP_009369733.1|  PREDICTED: pectinesterase/pectinesterase inh...    454   2e-149   Pyrus x bretschneideri [bai li]
ref|XP_004234960.1|  PREDICTED: probable pectinesterase/pectinest...    456   2e-149   Solanum lycopersicum
ref|XP_004508051.1|  PREDICTED: pectinesterase/pectinesterase inh...    454   2e-149   Cicer arietinum [garbanzo]
ref|XP_004146188.2|  PREDICTED: pectinesterase/pectinesterase inh...    456   2e-149   Cucumis sativus [cucumbers]
gb|AFB77929.1|  pectin methylesterase                                   456   3e-149   Gossypium hirsutum [American cotton]
ref|XP_010056335.1|  PREDICTED: pectinesterase 2-like                   453   3e-149   Eucalyptus grandis [rose gum]
ref|XP_011076334.1|  PREDICTED: probable pectinesterase/pectinest...    452   3e-149   
ref|XP_010656074.1|  PREDICTED: pectinesterase-like                     456   3e-149   Vitis vinifera
ref|XP_009385345.1|  PREDICTED: pectinesterase-like                     454   4e-149   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008234391.1|  PREDICTED: pectinesterase 2-like                   453   4e-149   Prunus mume [ume]
gb|KHG05999.1|  putative pectinesterase/pectinesterase inhibitor ...    454   5e-149   Gossypium arboreum [tree cotton]
ref|XP_011031815.1|  PREDICTED: pectinesterase-like                     455   5e-149   Populus euphratica
ref|XP_004502642.1|  PREDICTED: probable pectinesterase/pectinest...    456   6e-149   
ref|XP_010925933.1|  PREDICTED: probable pectinesterase/pectinest...    455   9e-149   Elaeis guineensis
ref|XP_010264199.1|  PREDICTED: pectinesterase 2-like                   452   1e-148   Nelumbo nucifera [Indian lotus]
ref|XP_008228105.1|  PREDICTED: pectinesterase                          454   1e-148   Prunus mume [ume]
ref|XP_007145198.1|  hypothetical protein PHAVU_007G218500g             453   1e-148   Phaseolus vulgaris [French bean]
ref|XP_006441080.1|  hypothetical protein CICLE_v10019376mg             455   1e-148   Citrus clementina [clementine]
gb|KHG08631.1|  Pectinesterase 3                                        454   2e-148   Gossypium arboreum [tree cotton]
ref|XP_006360163.1|  PREDICTED: probable pectinesterase/pectinest...    454   2e-148   Solanum tuberosum [potatoes]
ref|XP_003595386.1|  Pectinesterase                                     452   2e-148   Medicago truncatula
ref|XP_002265171.1|  PREDICTED: pectinesterase                          455   2e-148   Vitis vinifera
ref|XP_002304257.2|  pectinesterase family protein                      454   2e-148   Populus trichocarpa [western balsam poplar]
ref|XP_007163135.1|  hypothetical protein PHAVU_001G209400g             454   2e-148   Phaseolus vulgaris [French bean]
ref|XP_010056339.1|  PREDICTED: pectinesterase 2-like                   451   2e-148   Eucalyptus grandis [rose gum]
ref|XP_004148139.2|  PREDICTED: pectinesterase 2                        453   2e-148   Cucumis sativus [cucumbers]
dbj|BAJ96804.1|  predicted protein                                      453   2e-148   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KJB57093.1|  hypothetical protein B456_009G147900                    454   2e-148   Gossypium raimondii
ref|XP_007052106.1|  Pectinesterase 2                                   451   3e-148   
ref|XP_008439095.1|  PREDICTED: pectinesterase-like                     452   4e-148   
ref|XP_009383893.1|  PREDICTED: pectinesterase-like                     452   4e-148   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007201179.1|  hypothetical protein PRUPE_ppa003400mg             452   6e-148   
ref|XP_011010963.1|  PREDICTED: pectinesterase-like                     452   6e-148   Populus euphratica
ref|XP_011015915.1|  PREDICTED: pectinesterase-like                     452   6e-148   Populus euphratica
ref|XP_006401715.1|  hypothetical protein EUTSA_v10013056mg             452   1e-147   Eutrema salsugineum [saltwater cress]
ref|XP_007038413.1|  Pectinesterase                                     449   1e-147   
gb|ACN40984.1|  unknown                                                 452   1e-147   Picea sitchensis
ref|XP_004307817.2|  PREDICTED: pectinesterase 2-like                   449   2e-147   Fragaria vesca subsp. vesca
gb|EYU29495.1|  hypothetical protein MIMGU_mgv1a005211mg                448   2e-147   Erythranthe guttata [common monkey flower]
gb|AFW03475.1|  pectin methylesterase 1                                 451   2e-147   Gossypium barbadense [Egyptian cotton]
ref|XP_010271283.1|  PREDICTED: pectinesterase                          449   2e-147   
ref|XP_010259035.1|  PREDICTED: pectinesterase 2-like                   449   3e-147   Nelumbo nucifera [Indian lotus]
ref|XP_010049304.1|  PREDICTED: pectinesterase/pectinesterase inh...    449   4e-147   Eucalyptus grandis [rose gum]
gb|ABQ42392.1|  pectin methylesterase-like protein                      451   4e-147   Taiwania cryptomerioides
gb|ABJ99594.1|  pectinesterase inhibitor                                450   4e-147   Lycoris aurea [golden hurricane-lily]
ref|XP_009763675.1|  PREDICTED: probable pectinesterase/pectinest...    451   5e-147   Nicotiana sylvestris
gb|ABJ99595.1|  pectinesterase inhibitor                                450   5e-147   Lycoris aurea [golden hurricane-lily]
ref|NP_001274969.1|  pectin methyl esterase                             450   6e-147   Solanum tuberosum [potatoes]
gb|AFW03480.1|  pectin methylesterase 1                                 450   6e-147   Gossypium hirsutum [American cotton]
emb|CDY49170.1|  BnaA02g10290D                                          445   7e-147   Brassica napus [oilseed rape]
gb|KEH24404.1|  pectinesterase/pectinesterase inhibitor                 449   7e-147   Medicago truncatula
ref|XP_002510940.1|  Pectinesterase-2 precursor, putative               445   7e-147   
ref|XP_002278061.1|  PREDICTED: probable pectinesterase/pectinest...    450   9e-147   Vitis vinifera
emb|CDP20891.1|  unnamed protein product                                447   1e-146   Coffea canephora [robusta coffee]
ref|XP_002280446.1|  PREDICTED: pectinesterase 2                        447   1e-146   
emb|CAB95025.1|  pectin methylesterase                                  449   1e-146   Nicotiana tabacum [American tobacco]
ref|XP_008775930.1|  PREDICTED: pectinesterase-like                     447   1e-146   Phoenix dactylifera
ref|XP_002865971.1|  pectinesterase family protein                      449   1e-146   Arabidopsis lyrata subsp. lyrata
ref|XP_012090423.1|  PREDICTED: probable pectinesterase/pectinest...    447   1e-146   Jatropha curcas
ref|XP_002301486.2|  hypothetical protein POPTR_0002s20370g             448   2e-146   
ref|XP_010056338.1|  PREDICTED: pectinesterase 2-like                   446   2e-146   Eucalyptus grandis [rose gum]
ref|XP_010101099.1|  putative pectinesterase/pectinesterase inhib...    446   2e-146   Morus notabilis
gb|KDP28190.1|  hypothetical protein JCGZ_13961                         443   2e-146   Jatropha curcas
ref|XP_009606552.1|  PREDICTED: pectinesterase/pectinesterase inh...    449   2e-146   Nicotiana tomentosiformis
ref|XP_007024770.1|  Pectin methylesterase 3 isoform 1                  448   2e-146   
gb|KFK26958.1|  hypothetical protein AALP_AA8G315400                    448   2e-146   Arabis alpina [alpine rockcress]
ref|XP_007217169.1|  hypothetical protein PRUPE_ppa003285mg             448   3e-146   Prunus persica
ref|XP_002317777.2|  hypothetical protein POPTR_0012s02170g             449   3e-146   Populus trichocarpa [western balsam poplar]
sp|Q43062.1|PME_PRUPE  RecName: Full=Pectinesterase/pectinesteras...    446   3e-146   Prunus persica
ref|NP_001233857.2|  pectinesterase/pectinesterase inhibitor U1 p...    448   4e-146   Solanum lycopersicum
ref|XP_002322401.1|  putative pectin methylesterase family protein      445   6e-146   Populus trichocarpa [western balsam poplar]
ref|XP_010267633.1|  PREDICTED: probable pectinesterase/pectinest...    448   7e-146   Nelumbo nucifera [Indian lotus]
emb|CDY35644.1|  BnaC09g29660D                                          442   7e-146   Brassica napus [oilseed rape]
ref|XP_009762395.1|  PREDICTED: pectinesterase/pectinesterase inh...    447   7e-146   Nicotiana sylvestris
ref|XP_010056336.1|  PREDICTED: pectinesterase 2-like                   445   7e-146   Eucalyptus grandis [rose gum]
gb|KHG19575.1|  Uncharacterized protein F383_07269                      445   7e-146   Gossypium arboreum [tree cotton]
gb|AFW03479.1|  pectin methylesterase 5                                 445   8e-146   Gossypium barbadense [Egyptian cotton]
ref|XP_007204326.1|  hypothetical protein PRUPE_ppa004300mg             445   9e-146   Prunus persica
gb|KHN08672.1|  Putative pectinesterase/pectinesterase inhibitor 40     443   1e-145   Glycine soja [wild soybean]
ref|XP_010230835.1|  PREDICTED: pectinesterase-like                     446   1e-145   Brachypodium distachyon [annual false brome]
ref|XP_010271372.1|  PREDICTED: pectinesterase-like                     444   1e-145   Nelumbo nucifera [Indian lotus]
ref|XP_003627458.1|  Pectinesterase                                     446   2e-145   Medicago truncatula
emb|CDX96216.1|  BnaC02g14350D                                          441   2e-145   
ref|XP_007154532.1|  hypothetical protein PHAVU_003G126500g             444   2e-145   Phaseolus vulgaris [French bean]
gb|KJB09419.1|  hypothetical protein B456_001G140500                    445   2e-145   Gossypium raimondii
ref|XP_008389982.1|  PREDICTED: pectinesterase                          444   3e-145   
ref|XP_004136014.1|  PREDICTED: pectinesterase-like                     445   3e-145   Cucumis sativus [cucumbers]
ref|XP_006493306.1|  PREDICTED: probable pectinesterase/pectinest...    446   3e-145   Citrus sinensis [apfelsine]
ref|XP_011024825.1|  PREDICTED: probable pectinesterase/pectinest...    446   4e-145   Populus euphratica
ref|XP_010654104.1|  PREDICTED: pectinesterase                          444   4e-145   Vitis vinifera
ref|XP_002511679.1|  Pectinesterase-2 precursor, putative               443   4e-145   Ricinus communis
ref|XP_010101977.1|  putative pectinesterase/pectinesterase inhib...    443   4e-145   
gb|EYU19641.1|  hypothetical protein MIMGU_mgv1a003247mg                446   4e-145   Erythranthe guttata [common monkey flower]
ref|XP_003519757.1|  PREDICTED: probable pectinesterase/pectinest...    444   4e-145   Glycine max [soybeans]
ref|XP_010035249.1|  PREDICTED: probable pectinesterase/pectinest...    446   4e-145   Eucalyptus grandis [rose gum]
ref|XP_007136533.1|  hypothetical protein PHAVU_009G053000g             445   4e-145   Phaseolus vulgaris [French bean]
ref|XP_009389951.1|  PREDICTED: probable pectinesterase/pectinest...    446   4e-145   
emb|CDY14384.1|  BnaA10g06710D                                          441   5e-145   Brassica napus [oilseed rape]
gb|KGN44975.1|  Pectinesterase                                          446   5e-145   Cucumis sativus [cucumbers]
ref|XP_009127175.1|  PREDICTED: probable pectinesterase/pectinest...    445   6e-145   Brassica rapa
ref|XP_002320714.1|  putative pectin methylesterase LuPME1 family...    442   6e-145   Populus trichocarpa [western balsam poplar]
ref|XP_008343201.1|  PREDICTED: pectinesterase 2                        442   6e-145   Malus domestica [apple tree]
ref|NP_200149.1|  pectin methylesterase PCR fragment F                  445   6e-145   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006419127.1|  hypothetical protein EUTSA_v10002482mg             442   7e-145   Eutrema salsugineum [saltwater cress]
ref|XP_009596446.1|  PREDICTED: probable pectinesterase/pectinest...    445   7e-145   Nicotiana tomentosiformis
ref|XP_004494389.1|  PREDICTED: probable pectinesterase/pectinest...    443   8e-145   Cicer arietinum [garbanzo]
ref|XP_002877272.1|  pectinesterase family protein                      442   9e-145   Arabidopsis lyrata subsp. lyrata
ref|XP_007139063.1|  hypothetical protein PHAVU_009G261700g             444   9e-145   Phaseolus vulgaris [French bean]
gb|KJB41089.1|  hypothetical protein B456_007G090100                    442   9e-145   Gossypium raimondii
ref|XP_009378667.1|  PREDICTED: pectinesterase 2-like                   442   1e-144   Pyrus x bretschneideri [bai li]
ref|XP_007138594.1|  hypothetical protein PHAVU_009G222100g             442   1e-144   Phaseolus vulgaris [French bean]
ref|XP_010047423.1|  PREDICTED: pectinesterase-like                     444   1e-144   Eucalyptus grandis [rose gum]
ref|XP_008242144.1|  PREDICTED: pectinesterase/pectinesterase inh...    442   1e-144   Prunus mume [ume]
gb|KHF97563.1|  Pectinesterase/pectinesterase inhibitor PPE8B           442   1e-144   
ref|XP_008234745.1|  PREDICTED: probable pectinesterase/pectinest...    444   2e-144   
ref|XP_004240956.1|  PREDICTED: probable pectinesterase/pectinest...    444   2e-144   
ref|XP_008451545.1|  PREDICTED: pectinesterase-like                     444   2e-144   
ref|XP_010056337.1|  PREDICTED: pectinesterase 2-like                   441   2e-144   
ref|XP_003602238.1|  Pectinesterase                                     444   2e-144   
ref|XP_012077139.1|  PREDICTED: pectinesterase-like                     443   3e-144   
ref|XP_010534986.1|  PREDICTED: pectinesterase/pectinesterase inh...    443   3e-144   
gb|AFQ23194.1|  pectin methylesterase                                   443   3e-144   
gb|AER38244.1|  PME5                                                    441   3e-144   
gb|KJB06866.1|  hypothetical protein B456_001G018300                    441   3e-144   
sp|P83948.1|PME3_CITSI  RecName: Full=Pectinesterase 3; Short=PE ...    443   3e-144   
ref|XP_010062184.1|  PREDICTED: pectinesterase-like                     441   3e-144   
ref|XP_004307984.1|  PREDICTED: probable pectinesterase/pectinest...    443   4e-144   
ref|XP_003634048.1|  PREDICTED: pectinesterase 2-like                   441   4e-144   
gb|AER38246.1|  PME3                                                    440   4e-144   
gb|KJB65433.1|  hypothetical protein B456_010G094800                    440   4e-144   
ref|XP_012077135.1|  PREDICTED: pectinesterase/pectinesterase inh...    440   4e-144   
gb|AFW03477.1|  pectin methylesterase 3                                 440   5e-144   
ref|XP_011084508.1|  PREDICTED: probable pectinesterase/pectinest...    443   5e-144   
gb|AAO85706.1|  pectin methyl-esterase                                  442   5e-144   
ref|XP_010503036.1|  PREDICTED: probable pectinesterase/pectinest...    440   6e-144   
ref|XP_002523113.1|  Pectinesterase-3 precursor, putative               441   6e-144   
ref|XP_009783075.1|  PREDICTED: pectinesterase-like                     442   6e-144   
ref|XP_003608135.1|  Pectinesterase                                     440   7e-144   
ref|XP_010266532.1|  PREDICTED: probable pectinesterase/pectinest...    442   7e-144   
gb|KFK33850.1|  hypothetical protein AALP_AA5G068300                    440   1e-143   
ref|XP_011017474.1|  PREDICTED: pectinesterase 2                        439   1e-143   
gb|AFW03483.1|  pectin methylesterase 4                                 439   1e-143   
emb|CBI27741.3|  unnamed protein product                                434   1e-143   
gb|AFW03484.1|  pectin methylesterase 5                                 439   1e-143   
gb|AFW03478.1|  pectin methylesterase 4                                 439   1e-143   
ref|XP_006578909.1|  PREDICTED: probable pectinesterase/pectinest...    441   1e-143   
gb|KJB06868.1|  hypothetical protein B456_001G018300                    439   1e-143   
ref|XP_009592542.1|  PREDICTED: pectinesterase-like                     441   2e-143   
ref|XP_011010931.1|  PREDICTED: pectinesterase 2-like                   439   2e-143   
gb|KJB54563.1|  hypothetical protein B456_009G039100                    441   2e-143   
ref|XP_002318285.1|  putative pectin methylesterase family protein      439   2e-143   
ref|XP_007220895.1|  hypothetical protein PRUPE_ppa003047mg             442   2e-143   
ref|XP_003546532.1|  PREDICTED: pectinesterase/pectinesterase inh...    439   2e-143   
ref|XP_009370475.1|  PREDICTED: pectinesterase 2-like                   438   2e-143   
ref|XP_009766156.1|  PREDICTED: pectinesterase 2-like                   439   3e-143   
ref|XP_011005053.1|  PREDICTED: pectinesterase/pectinesterase inh...    439   3e-143   
gb|AER38245.1|  PME4                                                    438   4e-143   
gb|KHN42841.1|  Pectinesterase/pectinesterase inhibitor PPE8B           438   4e-143   
gb|KJB06867.1|  hypothetical protein B456_001G018300                    438   4e-143   
ref|NP_001268091.1|  pectin methylesterase PME1 precursor               438   4e-143   
ref|NP_001061940.1|  Os08g0450100                                       439   5e-143   
emb|CBI29628.3|  unnamed protein product                                438   5e-143   
emb|CAN76835.1|  hypothetical protein VITISV_043176                     437   5e-143   
ref|XP_007012502.1|  Pectin methylesterase 3                            439   5e-143   
gb|EEC82670.1|  hypothetical protein OsI_27314                          439   6e-143   
ref|XP_011078159.1|  PREDICTED: pectinesterase-like isoform X1          439   6e-143   
ref|XP_009372890.1|  PREDICTED: pectinesterase 2-like                   437   7e-143   
ref|XP_006412377.1|  hypothetical protein EUTSA_v10024900mg             437   8e-143   
ref|XP_012068793.1|  PREDICTED: pectinesterase-like                     439   8e-143   
ref|NP_001060620.1|  Os07g0675100                                       439   8e-143   
ref|XP_004234932.2|  PREDICTED: probable pectinesterase/pectinest...    437   8e-143   
ref|XP_010537086.1|  PREDICTED: probable pectinesterase/pectinest...    439   9e-143   
gb|AJH66132.1|  pectin methylesterase                                   439   1e-142   
ref|XP_004287682.1|  PREDICTED: pectinesterase/pectinesterase inh...    437   1e-142   
ref|XP_009628696.1|  PREDICTED: pectinesterase 2                        438   1e-142   
ref|XP_006290897.1|  hypothetical protein CARUB_v10017009mg             437   1e-142   
ref|XP_003553658.2|  PREDICTED: probable pectinesterase/pectinest...    440   1e-142   
gb|AFI23411.1|  pectin methylesterase                                   439   1e-142   
ref|XP_011029953.1|  PREDICTED: pectinesterase 2-like                   437   1e-142   
ref|XP_003609932.1|  Pectinesterase                                     439   1e-142   
ref|XP_010321856.1|  PREDICTED: pectinesterase                          438   1e-142   
ref|XP_011034009.1|  PREDICTED: pectinesterase 2                        436   1e-142   
ref|XP_010526022.1|  PREDICTED: probable pectinesterase/pectinest...    437   1e-142   
ref|XP_006412378.1|  hypothetical protein EUTSA_v10024900mg             437   1e-142   
ref|XP_004514851.1|  PREDICTED: pectinesterase 2-like                   436   1e-142   
gb|AFB77928.1|  pectin methylesterase                                   438   2e-142   
emb|CBI24285.3|  unnamed protein product                                433   2e-142   
emb|CDY45033.1|  BnaA08g11860D                                          436   2e-142   
emb|CDX75340.1|  BnaA01g03620D                                          436   2e-142   
gb|KHF97383.1|  Pectinesterase/pectinesterase inhibitor U1              438   2e-142   
ref|XP_006283426.1|  hypothetical protein CARUB_v10004474mg             438   2e-142   
ref|XP_008348472.1|  PREDICTED: pectinesterase-like                     438   2e-142   
ref|XP_002265740.2|  PREDICTED: pectinesterase 2-like                   436   2e-142   
ref|XP_010520512.1|  PREDICTED: probable pectinesterase/pectinest...    436   2e-142   
emb|CDX68957.1|  BnaC01g04960D                                          436   2e-142   
emb|CDY28287.1|  BnaC03g66720D                                          435   2e-142   
gb|EYU29496.1|  hypothetical protein MIMGU_mgv1a003055mg                439   3e-142   
ref|XP_010541676.1|  PREDICTED: probable pectinesterase/pectinest...    436   3e-142   
ref|XP_002271665.2|  PREDICTED: pectinesterase-like                     437   3e-142   
ref|XP_010049073.1|  PREDICTED: probable pectinesterase/pectinest...    438   3e-142   
ref|XP_010445741.1|  PREDICTED: probable pectinesterase/pectinest...    438   3e-142   
ref|XP_011006351.1|  PREDICTED: probable pectinesterase/pectinest...    439   3e-142   
ref|XP_006853048.1|  PREDICTED: pectinesterase                          436   4e-142   
gb|EAZ07184.1|  hypothetical protein OsI_29430                          437   4e-142   
gb|KHN43496.1|  Putative pectinesterase/pectinesterase inhibitor 40     434   4e-142   
ref|XP_003526711.1|  PREDICTED: probable pectinesterase/pectinest...    437   4e-142   
ref|XP_006367816.1|  PREDICTED: probable pectinesterase/pectinest...    434   5e-142   
ref|XP_012072269.1|  PREDICTED: pectinesterase                          436   5e-142   
ref|XP_010501842.1|  PREDICTED: pectinesterase/pectinesterase inh...    437   5e-142   
ref|XP_003534983.1|  PREDICTED: pectinesterase/pectinesterase inh...    435   6e-142   
ref|XP_009108811.1|  PREDICTED: probable pectinesterase/pectinest...    435   6e-142   
ref|XP_002302526.1|  putative pectin methylesterase LuPME1 family...    435   6e-142   
ref|XP_006452917.1|  hypothetical protein CICLE_v10007993mg             435   6e-142   
ref|XP_006490097.1|  PREDICTED: pectinesterase 2-like                   435   7e-142   
gb|AAQ21124.1|  pectinesterase                                          434   7e-142   
ref|XP_010442899.1|  PREDICTED: probable pectinesterase/pectinest...    437   7e-142   
ref|NP_189913.3|  probable pectinesterase/pectinesterase inhibito...    435   7e-142   
gb|ABK92470.1|  unknown                                                 435   8e-142   
ref|XP_010047425.1|  PREDICTED: pectinesterase-like                     437   8e-142   
ref|XP_006381541.1|  Pectinesterase PPE8B precursor family protein      435   8e-142   
gb|KDO65446.1|  hypothetical protein CISIN_1g010103mg                   434   8e-142   
ref|XP_002455538.1|  hypothetical protein SORBIDRAFT_03g012830          436   8e-142   
ref|XP_009421463.1|  PREDICTED: probable pectinesterase/pectinest...    437   9e-142   
ref|XP_008232606.1|  PREDICTED: pectinesterase 2                        434   9e-142   
ref|XP_011093902.1|  PREDICTED: pectinesterase/pectinesterase inh...    434   9e-142   
ref|XP_010271266.1|  PREDICTED: pectinesterase-like                     435   1e-141   
ref|XP_006421695.1|  hypothetical protein CICLE_v10004742mg             434   1e-141   
ref|XP_010465323.1|  PREDICTED: pectinesterase/pectinesterase inh...    437   1e-141   
gb|AAC50023.1|  ATPME2 precursor                                        436   1e-141   
ref|NP_001275859.1|  pectinesterase 1 precursor                         436   2e-141   
ref|XP_009773838.1|  PREDICTED: pectinesterase 2-like                   434   2e-141   
gb|AHB84678.1|  pectin methylesterase                                   435   2e-141   
ref|XP_002265599.1|  PREDICTED: pectinesterase 2                        433   2e-141   
emb|CAN83663.1|  hypothetical protein VITISV_017689                     433   2e-141   
gb|AAG17110.1|AF188895_1  putative pectin methylesterase 3              435   2e-141   
ref|XP_003551027.1|  PREDICTED: pectinesterase/pectinesterase inh...    433   2e-141   
ref|XP_009123268.1|  PREDICTED: probable pectinesterase/pectinest...    432   2e-141   
ref|XP_011048630.1|  PREDICTED: pectinesterase-like                     436   2e-141   
gb|EYU21270.1|  hypothetical protein MIMGU_mgv1a003278mg                436   2e-141   
ref|XP_006444399.1|  hypothetical protein CICLE_v100237231mg            434   3e-141   
ref|NP_001265901.1|  pectinesterase 3-like                              435   3e-141   
ref|XP_006279604.1|  hypothetical protein CARUB_v10026136mg             435   3e-141   
ref|XP_002264156.1|  PREDICTED: pectinesterase 2                        433   3e-141   
ref|XP_006474555.1|  PREDICTED: pectinesterase/pectinesterase inh...    433   4e-141   
gb|KHG26122.1|  putative pectinesterase/pectinesterase inhibitor ...    434   5e-141   
ref|XP_006355816.1|  PREDICTED: pectinesterase-like                     431   5e-141   
ref|XP_006576426.1|  PREDICTED: pectinesterase 2-like                   432   5e-141   
ref|XP_006480001.1|  PREDICTED: probable pectinesterase/pectinest...    434   6e-141   
ref|XP_007012504.1|  Pectinesterase/pectinesterase inhibitor PPE8B      433   6e-141   
ref|XP_010047424.1|  PREDICTED: pectinesterase-like                     434   6e-141   
ref|XP_009123267.1|  PREDICTED: probable pectinesterase/pectinest...    432   6e-141   
ref|XP_002321999.2|  pectin methylesterase family protein               435   7e-141   
ref|XP_012084535.1|  PREDICTED: probable pectinesterase/pectinest...    435   7e-141   
sp|O04886.1|PME1_CITSI  RecName: Full=Pectinesterase 1; Short=PE ...    434   8e-141   
ref|XP_009123835.1|  PREDICTED: probable pectinesterase/pectinest...    432   8e-141   
ref|XP_009767827.1|  PREDICTED: pectinesterase-like                     434   8e-141   
gb|KHN17768.1|  Pectinesterase/pectinesterase inhibitor PPE8B           432   8e-141   
ref|XP_006388348.1|  hypothetical protein POPTR_0214s00200g             434   1e-140   
ref|XP_009123782.1|  PREDICTED: probable pectinesterase/pectinest...    432   1e-140   
ref|XP_010447268.1|  PREDICTED: probable pectinesterase/pectinest...    432   1e-140   
ref|XP_009119880.1|  PREDICTED: probable pectinesterase/pectinest...    434   1e-140   
ref|XP_009601611.1|  PREDICTED: pectinesterase-like                     434   1e-140   
emb|CDX98441.1|  BnaC05g39340D                                          433   1e-140   
ref|XP_009627969.1|  PREDICTED: probable pectinesterase/pectinest...    431   2e-140   
ref|XP_008386148.1|  PREDICTED: pectinesterase-like                     432   2e-140   
ref|XP_011012638.1|  PREDICTED: pectinesterase-like                     433   2e-140   
emb|CDY33229.1|  BnaC01g37020D                                          433   2e-140   
ref|XP_002894191.1|  predicted protein                                  431   2e-140   
emb|CDY12333.1|  BnaA06g20110D                                          431   2e-140   
ref|XP_008437596.1|  PREDICTED: LOW QUALITY PROTEIN: probable pec...    434   2e-140   
gb|KJB74684.1|  hypothetical protein B456_012G002600                    432   2e-140   
ref|XP_007220661.1|  hypothetical protein PRUPE_ppa004413mg             431   3e-140   
ref|XP_009351519.1|  PREDICTED: pectinesterase-like                     431   3e-140   
ref|XP_009123745.1|  PREDICTED: probable pectinesterase/pectinest...    431   3e-140   
ref|XP_008436965.1|  PREDICTED: pectinesterase 2-like                   431   3e-140   
gb|KDO73733.1|  hypothetical protein CISIN_1g008261mg                   432   3e-140   
ref|XP_010100757.1|  putative pectinesterase/pectinesterase inhib...    433   4e-140   
ref|XP_010029512.1|  PREDICTED: pectinesterase-like                     432   4e-140   
ref|XP_011038599.1|  PREDICTED: pectinesterase-like                     431   4e-140   
emb|CDY08206.1|  BnaA05g14130D                                          432   4e-140   
ref|XP_002314796.1|  pectin methylesterase 6 family protein             431   4e-140   
gb|EYU24929.1|  hypothetical protein MIMGU_mgv1a025888mg                429   4e-140   
ref|XP_010684346.1|  PREDICTED: pectinesterase-like                     432   4e-140   
ref|NP_175786.1|  pectin methylesterase 2                               432   4e-140   
ref|XP_008391160.1|  PREDICTED: pectinesterase-like                     431   5e-140   
ref|XP_006392745.1|  hypothetical protein EUTSA_v10011343mg             432   5e-140   
ref|XP_006841646.1|  PREDICTED: pectinesterase                          431   6e-140   
ref|XP_010437787.1|  PREDICTED: probable pectinesterase/pectinest...    430   7e-140   
ref|XP_011076457.1|  PREDICTED: probable pectinesterase/pectinest...    432   8e-140   
gb|AFW03482.1|  pectin methylesterase 3                                 429   8e-140   
ref|XP_006445298.1|  hypothetical protein CICLE_v10019773mg             429   9e-140   
ref|XP_011078160.1|  PREDICTED: pectinesterase-like isoform X2          431   1e-139   
sp|Q43143.1|PMEU1_SOLLC  RecName: Full=Pectinesterase/pectinester...    431   1e-139   
emb|CDY08117.1|  BnaA06g16090D                                          428   1e-139   
ref|XP_003517029.1|  PREDICTED: pectinesterase 2-like                   429   1e-139   
emb|CAB36796.1|  pectinesterase-like protein                            427   1e-139   
ref|XP_010101979.1|  putative pectinesterase/pectinesterase inhib...    427   1e-139   
ref|XP_010479961.1|  PREDICTED: pectinesterase 2-like                   431   1e-139   
emb|CDP05068.1|  unnamed protein product                                432   2e-139   
ref|NP_567917.4|  pectinesterase 44                                     429   2e-139   
dbj|BAF42038.1|  pectin methylesterase 1                                432   2e-139   
ref|XP_004306939.1|  PREDICTED: probable pectinesterase/pectinest...    428   2e-139   
emb|CAN78759.1|  hypothetical protein VITISV_000562                     428   2e-139   
ref|XP_010462289.1|  PREDICTED: pectinesterase 2                        431   2e-139   
ref|XP_006452919.1|  hypothetical protein CICLE_v10007806mg             431   2e-139   
ref|XP_002869219.1|  predicted protein                                  428   2e-139   
ref|XP_008462453.1|  PREDICTED: pectinesterase-like                     431   2e-139   
gb|KJB70037.1|  hypothetical protein B456_011G055100                    430   2e-139   
ref|NP_001147569.1|  pectinesterase PPE8B precursor                     429   2e-139   
gb|AAK69696.1|AF355057_1  putative pectin methylesterase LuPME5         429   2e-139   
emb|CAC01624.1|  putative pectin methylesterase                         430   2e-139   
gb|EPS74082.1|  hypothetical protein M569_00674                         427   3e-139   
ref|XP_010482728.1|  PREDICTED: probable pectinesterase/pectinest...    431   3e-139   
emb|CDY05911.1|  BnaC08g20880D                                          427   3e-139   
ref|XP_010264200.1|  PREDICTED: pectinesterase 2-like                   427   3e-139   
ref|XP_011654619.1|  PREDICTED: probable pectinesterase/pectinest...    431   4e-139   
ref|XP_002891774.1|  ATPME2                                             430   4e-139   
ref|XP_002885033.1|  ATPME3                                             430   4e-139   
ref|XP_008370416.1|  PREDICTED: putative pectinesterase/pectinest...    428   4e-139   
gb|EYU33116.1|  hypothetical protein MIMGU_mgv1a022674mg                427   5e-139   
ref|XP_010261668.1|  PREDICTED: pectinesterase-like                     429   5e-139   
ref|XP_010029511.1|  PREDICTED: pectinesterase-like                     429   5e-139   
ref|XP_006658118.1|  PREDICTED: pectinesterase 3-like                   429   5e-139   
gb|KFK29933.1|  hypothetical protein AALP_AA7G197000                    427   5e-139   
ref|NP_001275846.1|  putative thermostable pectinesterase               431   6e-139   
ref|XP_004143735.1|  PREDICTED: pectinesterase 2                        427   6e-139   
ref|XP_008376726.1|  PREDICTED: probable pectinesterase/pectinest...    430   6e-139   
ref|XP_010501045.1|  PREDICTED: pectinesterase 2-like                   430   6e-139   
ref|XP_006307088.1|  hypothetical protein CARUB_v10008673mg             429   6e-139   
ref|XP_004141734.1|  PREDICTED: pectinesterase-like                     430   7e-139   
ref|NP_001289259.1|  probable pectinesterase/pectinesterase inhib...    430   7e-139   
ref|XP_006599763.1|  PREDICTED: pectinesterase/pectinesterase inh...    426   7e-139   
gb|EEC70505.1|  hypothetical protein OsI_01594                          429   8e-139   
ref|XP_010432596.1|  PREDICTED: probable pectinesterase/pectinest...    427   8e-139   



>ref|XP_009589755.1| PREDICTED: pectinesterase-like [Nicotiana tomentosiformis]
Length=548

 Score =   770 bits (1989),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 403/550 (73%), Positives = 465/550 (85%), Gaps = 2/550 (0%)
 Frame = +3

Query  45    MATTSHLPLLFTPKRKPSSCRalyvllylaaIVGSVALVSIWALRTSSSSPSLWKARVCD  224
             MAT S  PLL TPK K  S +ALYVLL +AAIVGSV LVSIWA+  SS S SL  A VCD
Sbjct  1     MATNSSQPLLDTPKTKSPSSKALYVLLSIAAIVGSVGLVSIWAINGSSPSTSL-TADVCD  59

Query  225   PAHDPPSCMAIVSEVSSAAPTETDGVAllqmllhssllRIQDAVKLSANVNRRINDRKVQ  404
              AHD PSC+A+VSEV+ A    T  V LLQM+LH S L+I + + L  NVN RIN+ K Q
Sbjct  60    QAHDQPSCLAMVSEVAPAGSMNTKTVDLLQMVLHKSSLKIHETIDLVRNVNSRINNGKEQ  119

Query  405   AAVADCMELLDLSQDKVMDSMVALGNLSARARTDAHSWLSSVLTNHDTCLDGLSEPARSI  584
             AA+ADC+EL+DLS+D++MDSM++LGNLS++A  D H+WLSS+LTNH TC DGL+  A+SI
Sbjct  120   AALADCLELMDLSRDRLMDSMMSLGNLSSQAHFDVHTWLSSILTNHVTCKDGLNAQAQSI  179

Query  585   MEPMIKDLISRAKsslavlvavaPSTEDDLRALNGEFPSWVSASDRRLLEASanavaanv  764
             M+PM+KDLI+RAK+SLA++V +APS   DL ++    PSWV+++DRRLL+ SANA+ ANV
Sbjct  180   MKPMLKDLIARAKTSLALMVKMAPSNTMDLPSVTHGLPSWVTSNDRRLLQLSANAITANV  239

Query  765   vvaKDGSGKYKTVAEAVASAPDNGKTRYVIYIKKGTYKENVEIGKKKTNVMLIGDGLSAT  944
             VVAKDGSGK+KTV EAVASAPDNGKTRYVIY+KKG YKENVEIGKKK NVML+GDG+  T
Sbjct  240   VVAKDGSGKFKTVKEAVASAPDNGKTRYVIYVKKGIYKENVEIGKKKKNVMLVGDGMDTT  299

Query  945   IITGSLNYVDGATTFNSATVAAVGDGFIAQDLRIQNTAGPEKHQAVALRLGADQSVINRC  1124
             IITG+LN VDGATTFNSATVAAVGDGFIAQDL+ QNTAG  KHQAVALR+GADQSVINRC
Sbjct  300   IITGNLNVVDGATTFNSATVAAVGDGFIAQDLQFQNTAGAAKHQAVALRVGADQSVINRC  359

Query  1125  KIDAYQDTLYAHSQRQFYRDCYITGTVDFIFGNAAAVIQNSQVVARKPMAAQKNMVTAQG  1304
             KIDA+QDTLY HS RQFYRDCYITGTVDFIFGNAA V QNS++ ARKP + QKNMVTAQG
Sbjct  360   KIDAFQDTLYTHSLRQFYRDCYITGTVDFIFGNAAVVFQNSKIAARKPGSGQKNMVTAQG  419

Query  1305  RTDPNQNTGTSIQNCNVSPSSDLGPVKGTIQTYLGRPWKEYSRTVFMESNIGDHIDPAGW  1484
             R DPNQNTGTSIQNC++  SSDL PVKG+++TYLGRPWK YSRTVFM+SNIGDHIDP GW
Sbjct  420   REDPNQNTGTSIQNCDIIASSDLAPVKGSVKTYLGRPWKAYSRTVFMQSNIGDHIDPEGW  479

Query  1485  FPWDGDFALKTLYYGEYMNRGPGAGTSKRVNWPGYHVITDKAEAMKFTVAQLIQGGSWLK  1664
               WDGDFALKTLYYGEYMN+GPGAGTSKRV WPGYHV++  +EA KFTV+QLIQGG WLK
Sbjct  480   SVWDGDFALKTLYYGEYMNKGPGAGTSKRVKWPGYHVLS-ASEATKFTVSQLIQGGVWLK  538

Query  1665  NTGVDYTEGL  1694
             +TGV YTEGL
Sbjct  539   STGVAYTEGL  548



>ref|XP_009769268.1| PREDICTED: pectinesterase-like [Nicotiana sylvestris]
Length=548

 Score =   770 bits (1988),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 402/550 (73%), Positives = 463/550 (84%), Gaps = 2/550 (0%)
 Frame = +3

Query  45    MATTSHLPLLFTPKRKPSSCRalyvllylaaIVGSVALVSIWALRTSSSSPSLWKARVCD  224
             MAT S  PLL TPK K SS +ALY+LL LAAIVGSV LVSIWA+  SSSS SL  A VCD
Sbjct  1     MATNSSQPLLDTPKTKSSSSKALYILLSLAAIVGSVGLVSIWAINGSSSSISL-TAHVCD  59

Query  225   PAHDPPSCMAIVSEVSSAAPTETDGVAllqmllhssllRIQDAVKLSANVNRRINDRKVQ  404
              AHD PSC+A VSEV+ A   +T  V LLQM+LH S L+I + + L +NVN RIN+   Q
Sbjct  60    QAHDQPSCLATVSEVAPAGLMDTTTVDLLQMVLHKSSLKIHETIDLVSNVNGRINNDNEQ  119

Query  405   AAVADCMELLDLSQDKVMDSMVALGNLSARARTDAHSWLSSVLTNHDTCLDGLSEPARSI  584
             AA+ADC+EL++LS+D++MDSM+ALGNLSA+A  D H+WLSS+LTNH TC+DGL+  A+SI
Sbjct  120   AALADCLELMNLSRDRLMDSMMALGNLSAQAHFDVHTWLSSILTNHVTCMDGLNGQAQSI  179

Query  585   MEPMIKDLISRAKsslavlvavaPSTEDDLRALNGEFPSWVSASDRRLLEASanavaanv  764
             M+PM+KDLI RAK+SLA++V + PS   DL ++    PSWV+++DRRLL+ SANA+ ANV
Sbjct  180   MKPMLKDLIVRAKTSLALMVKMTPSNTMDLPSVTDGLPSWVTSNDRRLLQLSANAIKANV  239

Query  765   vvaKDGSGKYKTVAEAVASAPDNGKTRYVIYIKKGTYKENVEIGKKKTNVMLIGDGLSAT  944
             +VAKDGSGKYKTV EAVASAPDN KTRYVIY+KKG YKENVEIGKKK NVML+GDG+ AT
Sbjct  240   IVAKDGSGKYKTVKEAVASAPDNSKTRYVIYVKKGIYKENVEIGKKKKNVMLVGDGMDAT  299

Query  945   IITGSLNYVDGATTFNSATVAAVGDGFIAQDLRIQNTAGPEKHQAVALRLGADQSVINRC  1124
             IITGSLN VDG+TTF SATVAAVGDGFIAQDLR QNTAG  KHQAVALR+GADQSVINRC
Sbjct  300   IITGSLNVVDGSTTFKSATVAAVGDGFIAQDLRFQNTAGAAKHQAVALRVGADQSVINRC  359

Query  1125  KIDAYQDTLYAHSQRQFYRDCYITGTVDFIFGNAAAVIQNSQVVARKPMAAQKNMVTAQG  1304
             KIDA+QDTLYAHS RQFYRDCYI GTVDFIFGNAA V QNS++ ARKP   QKNMVTAQG
Sbjct  360   KIDAFQDTLYAHSLRQFYRDCYIAGTVDFIFGNAAVVFQNSKIAARKPGPGQKNMVTAQG  419

Query  1305  RTDPNQNTGTSIQNCNVSPSSDLGPVKGTIQTYLGRPWKEYSRTVFMESNIGDHIDPAGW  1484
             R DPNQNTGTSIQNC++  +SDL PVKG+++TYLGRPWK YSRTVFM+SNIGDHIDP GW
Sbjct  420   REDPNQNTGTSIQNCDIIATSDLAPVKGSVKTYLGRPWKAYSRTVFMQSNIGDHIDPEGW  479

Query  1485  FPWDGDFALKTLYYGEYMNRGPGAGTSKRVNWPGYHVITDKAEAMKFTVAQLIQGGSWLK  1664
               W GDFALKTLYYGEYMN+GPGAGTSKRV WPGYH++ + AEA KFTV QLIQGG+WLK
Sbjct  480   SVWQGDFALKTLYYGEYMNKGPGAGTSKRVKWPGYHIL-NAAEARKFTVGQLIQGGAWLK  538

Query  1665  NTGVDYTEGL  1694
             +TGV YTEGL
Sbjct  539   STGVAYTEGL  548



>ref|XP_009771261.1| PREDICTED: pectinesterase-like [Nicotiana sylvestris]
Length=547

 Score =   763 bits (1971),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 399/550 (73%), Positives = 462/550 (84%), Gaps = 3/550 (1%)
 Frame = +3

Query  45    MATTSHLPLLFTPKRKPSSCRalyvllylaaIVGSVALVSIWALRTSSSSPSLWKARVCD  224
             MA++S  PLL TPKRK S+ +ALYVLL LAAIVGSV LVSIWA+  SS S SL  A VCD
Sbjct  1     MASSSQ-PLLDTPKRKSSTSKALYVLLSLAAIVGSVGLVSIWAINVSSPSLSL-TAHVCD  58

Query  225   PAHDPPSCMAIVSEVSSAAPTETDGVAllqmllhssllRIQDAVKLSANVNRRINDRKVQ  404
              AHD PSC+A+VSEV+     ++  V LLQM+LH S L+I + + L +NVN RIND K Q
Sbjct  59    QAHDQPSCLAMVSEVAPVGLMDSTTVDLLQMVLHKSSLKIHETIDLVSNVNVRINDGKEQ  118

Query  405   AAVADCMELLDLSQDKVMDSMVALGNLSARARTDAHSWLSSVLTNHDTCLDGLSEPARSI  584
             AA+ADC+EL+DLS D++MDSM+ LGNLSA+   D H+WLSS+LTNH TC+DGLS  AR+I
Sbjct  119   AALADCLELMDLSSDRLMDSMMLLGNLSAQTHFDVHTWLSSILTNHATCMDGLSGLARTI  178

Query  585   MEPMIKDLISRAKsslavlvavaPSTEDDLRALNGEFPSWVSASDRRLLEASanavaanv  764
             M+P++KDLI RAK+SLA++V +APS   DL ++    PSWV++ DRRLL+ SANA+ ANV
Sbjct  179   MKPILKDLIVRAKTSLALMVKMAPSNTMDLPSVTDGLPSWVTSYDRRLLQLSANAITANV  238

Query  765   vvaKDGSGKYKTVAEAVASAPDNGKTRYVIYIKKGTYKENVEIGKKKTNVMLIGDGLSAT  944
             VVAKDGSGK+KT+ EAVASAPDN KTRYVIY+KKG YKENVEIGKKK NVML+GDG+ AT
Sbjct  239   VVAKDGSGKFKTIKEAVASAPDNSKTRYVIYVKKGIYKENVEIGKKKKNVMLVGDGMDAT  298

Query  945   IITGSLNYVDGATTFNSATVAAVGDGFIAQDLRIQNTAGPEKHQAVALRLGADQSVINRC  1124
             IITGSLN VDGATTFNSATVAAVGDGFIAQDL+ QNTAG  KHQAVALR+GADQSVINRC
Sbjct  299   IITGSLNVVDGATTFNSATVAAVGDGFIAQDLQFQNTAGAAKHQAVALRVGADQSVINRC  358

Query  1125  KIDAYQDTLYAHSQRQFYRDCYITGTVDFIFGNAAAVIQNSQVVARKPMAAQKNMVTAQG  1304
             KIDA+QDTLY HS RQFYRDCYITGTVDFIFGNAA V QNS++ ARKP   QKNMVTAQG
Sbjct  359   KIDAFQDTLYTHSLRQFYRDCYITGTVDFIFGNAAVVFQNSKIAARKPGPGQKNMVTAQG  418

Query  1305  RTDPNQNTGTSIQNCNVSPSSDLGPVKGTIQTYLGRPWKEYSRTVFMESNIGDHIDPAGW  1484
             R DPNQNTGTSIQNC++  +SDL P+KG+++TYLGRPWK YSRTVFM+SNIGDHIDP GW
Sbjct  419   REDPNQNTGTSIQNCDIIATSDLAPLKGSVKTYLGRPWKAYSRTVFMQSNIGDHIDPEGW  478

Query  1485  FPWDGDFALKTLYYGEYMNRGPGAGTSKRVNWPGYHVITDKAEAMKFTVAQLIQGGSWLK  1664
               WDGDFALKTLYYGEYMN+GPGAG SKRV WPGYH+++  +EA KFTV QLIQGG WLK
Sbjct  479   SVWDGDFALKTLYYGEYMNKGPGAGISKRVKWPGYHILS-ASEATKFTVGQLIQGGVWLK  537

Query  1665  NTGVDYTEGL  1694
             +TGV YTEGL
Sbjct  538   STGVAYTEGL  547



>ref|XP_009589961.1| PREDICTED: LOW QUALITY PROTEIN: pectinesterase-like [Nicotiana 
tomentosiformis]
Length=548

 Score =   760 bits (1962),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 395/550 (72%), Positives = 459/550 (83%), Gaps = 2/550 (0%)
 Frame = +3

Query  45    MATTSHLPLLFTPKRKPSSCRalyvllylaaIVGSVALVSIWALRTSSSSPSLWKARVCD  224
             MAT S  PLL T   K SS +ALY LL   AIVGSV LVSIW + +SS S SL  A VCD
Sbjct  1     MATNSSQPLLDTLPTKSSSSKALYDLLSFVAIVGSVGLVSIWTINSSSPSLSL-TAHVCD  59

Query  225   PAHDPPSCMAIVSEVSSAAPTETDGVAllqmllhssllRIQDAVKLSANVNRRINDRKVQ  404
              A D PSC+A+VSEV+     +T  V LLQM+LH S L+I +A+ L  NVN RIN+ K Q
Sbjct  60    RAQDQPSCLAMVSEVAPTGVMDTKTVDLLQMVLHKSSLKIHEAIDLVRNVNSRINNDKEQ  119

Query  405   AAVADCMELLDLSQDKVMDSMVALGNLSARARTDAHSWLSSVLTNHDTCLDGLSEPARSI  584
             AA+ADC+EL+DLS+D++MDSM++LGNLS +   D H+WLSS+LTNH TC DGL+   +SI
Sbjct  120   AALADCLELMDLSRDRLMDSMMSLGNLSTQVHFDVHTWLSSILTNHVTCKDGLNGLVQSI  179

Query  585   MEPMIKDLISRAKsslavlvavaPSTEDDLRALNGEFPSWVSASDRRLLEASanavaanv  764
             MEPM+KDLI+RAK+SLA++V +AP    DL ++    PSWV+++DRRLL+ SANA+ ANV
Sbjct  180   MEPMLKDLITRAKTSLALMVKMAPVKTMDLPSVTHGLPSWVTSNDRRLLQLSANAITANV  239

Query  765   vvaKDGSGKYKTVAEAVASAPDNGKTRYVIYIKKGTYKENVEIGKKKTNVMLIGDGLSAT  944
             VVAKDGSGK+KTV EAVASAPDNGKTRYVIY+KKG YKENVEIGKKK NVML+GDG+ AT
Sbjct  240   VVAKDGSGKFKTVKEAVASAPDNGKTRYVIYVKKGIYKENVEIGKKKKNVMLVGDGMDAT  299

Query  945   IITGSLNYVDGATTFNSATVAAVGDGFIAQDLRIQNTAGPEKHQAVALRLGADQSVINRC  1124
             IITGSLN+VDG+TTF SATVAAVGDGFIAQDL+ QNTAGP KHQAVALR+GADQSVINRC
Sbjct  300   IITGSLNFVDGSTTFKSATVAAVGDGFIAQDLQFQNTAGPSKHQAVALRIGADQSVINRC  359

Query  1125  KIDAYQDTLYAHSQRQFYRDCYITGTVDFIFGNAAAVIQNSQVVARKPMAAQKNMVTAQG  1304
             KIDA+QDTLY HS RQFYRDCYITGTVDFIFGNAA V QNS++ ARKP + QKNMVTAQG
Sbjct  360   KIDAFQDTLYTHSLRQFYRDCYITGTVDFIFGNAAVVFQNSKIAARKPGSGQKNMVTAQG  419

Query  1305  RTDPNQNTGTSIQNCNVSPSSDLGPVKGTIQTYLGRPWKEYSRTVFMESNIGDHIDPAGW  1484
             R DPNQNTGTSIQNC++  +SDL  VKG+++TYLGRPWK YSRTVFM+SNIGDHIDP GW
Sbjct  420   REDPNQNTGTSIQNCDIIATSDLASVKGSVKTYLGRPWKAYSRTVFMQSNIGDHIDPEGW  479

Query  1485  FPWDGDFALKTLYYGEYMNRGPGAGTSKRVNWPGYHVITDKAEAMKFTVAQLIQGGSWLK  1664
               WDGDFALKTLYYGEYMN+GPGAGTSKRV WPGYHV++  +EA KFTV+QLIQGG+WLK
Sbjct  480   SVWDGDFALKTLYYGEYMNKGPGAGTSKRVKWPGYHVLS-ASEATKFTVSQLIQGGAWLK  538

Query  1665  NTGVDYTEGL  1694
             +TGV YTEGL
Sbjct  539   STGVAYTEGL  548



>ref|XP_004232737.1| PREDICTED: pectinesterase-like [Solanum lycopersicum]
Length=546

 Score =   732 bits (1890),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 366/519 (71%), Positives = 439/519 (85%), Gaps = 4/519 (1%)
 Frame = +3

Query  138   IVGSVALVSIWALRTSSSSPSLWKARVCDPAHDPPSCMAIVSEVSSAAPTETDGVAllqm  317
             IVGSV  +SIWA+  +S S +    RVCD AHD PSC+A++SEV+ A   +   V LLQM
Sbjct  32    IVGSVGFISIWAINRTSISLT---TRVCDTAHDQPSCLAMLSEVAPAGLMDIKTVDLLQM  88

Query  318   llhssllRIQDAVKLSANVNRRINDRKVQAAVADCMELLDLSQDKVMDSMVALGNLSARA  497
             +LH S L+I + + L++NVN RIN+ + Q A+ DC+EL+DLS+D++MDSMV LGNL+ +A
Sbjct  89    VLHKSSLKIHETIHLASNVNGRINNGQEQVALEDCLELMDLSRDRLMDSMVGLGNLTVQA  148

Query  498   RTDAHSWLSSVLTNHDTCLDGLSEPARSIMEPMIKDLISRAKsslavlvavaPSTEDDLR  677
               D HSWLSS+LTNH TC+DGL+   RSIMEPM+ DL++RA++SLA++VA+AP  ++ + 
Sbjct  149   HFDVHSWLSSILTNHVTCIDGLNGQVRSIMEPMLNDLVARARTSLALMVAIAPQ-KNIVP  207

Query  678   ALNGEFPSWVSASDRRLLEASanavaanvvvaKDGSGKYKTVAEAVASAPDNGKTRYVIY  857
              ++   PSWVSA+DRRLL+ SANA+AANVVVAKDGSGKYKTV EAVASAPDN KTRYVIY
Sbjct  208   TVSDGLPSWVSANDRRLLQLSANAIAANVVVAKDGSGKYKTVKEAVASAPDNSKTRYVIY  267

Query  858   IKKGTYKENVEIGKKKTNVMLIGDGLSATIITGSLNYVDGATTFNSATVAAVGDGFIAQD  1037
             +KKGTYKENVEIGKKK N+ML+GDG+ ATIITG+LN +DG+TTF SATVAAVGDGFIAQD
Sbjct  268   VKKGTYKENVEIGKKKKNIMLVGDGMDATIITGNLNVIDGSTTFKSATVAAVGDGFIAQD  327

Query  1038  LRIQNTAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYAHSQRQFYRDCYITGTVDFIF  1217
             ++ QNTAGP+KHQAVALR+GADQSVINRCK+DA+QDTLY H+ RQFYRDCYI GTVDFIF
Sbjct  328   IQFQNTAGPQKHQAVALRVGADQSVINRCKMDAFQDTLYTHTLRQFYRDCYIIGTVDFIF  387

Query  1218  GNAAAVIQNSQVVARKPMAAQKNMVTAQGRTDPNQNTGTSIQNCNVSPSSDLGPVKGTIQ  1397
             GNAA V QNS++ ARKPM+ QKNMVTAQGR DPNQNTGTSIQNC++ PSSDL PVKG+++
Sbjct  388   GNAAVVFQNSKLAARKPMSGQKNMVTAQGREDPNQNTGTSIQNCDIIPSSDLAPVKGSVK  447

Query  1398  TYLGRPWKEYSRTVFMESNIGDHIDPAGWFPWDGDFALKTLYYGEYMNRGPGAGTSKRVN  1577
             TYLGRPWK YSRTV+M+SNIGDHIDPAGW  WDGDFALKTLYYGEYMN+G GAG SKRVN
Sbjct  448   TYLGRPWKAYSRTVYMQSNIGDHIDPAGWSEWDGDFALKTLYYGEYMNKGAGAGISKRVN  507

Query  1578  WPGYHVITDKAEAMKFTVAQLIQGGSWLKNTGVDYTEGL  1694
             WPGYH     +EA KFTV QLIQG +WLK+TGV YT+GL
Sbjct  508   WPGYHKALTTSEATKFTVGQLIQGAAWLKSTGVAYTDGL  546



>ref|XP_010316615.1| PREDICTED: pectinesterase-like [Solanum lycopersicum]
Length=548

 Score =   731 bits (1887),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 366/519 (71%), Positives = 439/519 (85%), Gaps = 4/519 (1%)
 Frame = +3

Query  138   IVGSVALVSIWALRTSSSSPSLWKARVCDPAHDPPSCMAIVSEVSSAAPTETDGVAllqm  317
             IVGSV  +SIWA+  +S S +    RVCD AHD PSC+A++SEV+ A   +T  V LLQM
Sbjct  34    IVGSVGFISIWAINRTSISLT---TRVCDTAHDQPSCLAMLSEVAPAGLMDTKTVDLLQM  90

Query  318   llhssllRIQDAVKLSANVNRRINDRKVQAAVADCMELLDLSQDKVMDSMVALGNLSARA  497
             +LH S L+I + + L++NVN RIN+ + Q A+ DC+EL+DLS+D++MDSM+ LGNL+A+A
Sbjct  91    VLHKSSLKIHETIHLASNVNGRINNGQEQVALEDCLELMDLSRDRLMDSMMGLGNLTAQA  150

Query  498   RTDAHSWLSSVLTNHDTCLDGLSEPARSIMEPMIKDLISRAKsslavlvavaPSTEDDLR  677
               D HSWLSS+LTNH TC+DGL+   RSIMEPM+ DL++RA++SLA++VA+AP  ++ + 
Sbjct  151   HFDVHSWLSSILTNHVTCIDGLNGQVRSIMEPMLNDLVARARTSLALMVAIAPQ-KNIVP  209

Query  678   ALNGEFPSWVSASDRRLLEASanavaanvvvaKDGSGKYKTVAEAVASAPDNGKTRYVIY  857
              ++   PSWVSA+DRRLL+ SANA+AANVVVAKDGSGKYKTV EAVASAPDN KTRYVIY
Sbjct  210   TVSDGLPSWVSANDRRLLQLSANAIAANVVVAKDGSGKYKTVKEAVASAPDNSKTRYVIY  269

Query  858   IKKGTYKENVEIGKKKTNVMLIGDGLSATIITGSLNYVDGATTFNSATVAAVGDGFIAQD  1037
             +KKG YKENVEIGK K N+ML+GDG+ ATIITG+LN +DG+TTF SATVAAVGDGFIAQD
Sbjct  270   VKKGIYKENVEIGKTKKNLMLVGDGMDATIITGNLNVIDGSTTFKSATVAAVGDGFIAQD  329

Query  1038  LRIQNTAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYAHSQRQFYRDCYITGTVDFIF  1217
             ++ QNTAGP+KHQAVALR+GADQSVINRCK+DA+QDTLY H+ RQFYRDCYITGTVDFIF
Sbjct  330   IQFQNTAGPQKHQAVALRVGADQSVINRCKMDAFQDTLYTHTLRQFYRDCYITGTVDFIF  389

Query  1218  GNAAAVIQNSQVVARKPMAAQKNMVTAQGRTDPNQNTGTSIQNCNVSPSSDLGPVKGTIQ  1397
             GNAA V QNS++ ARKPM+ Q NMVTAQGR DPNQNTGTSIQNC++ PSSDL PVKG+++
Sbjct  390   GNAAVVFQNSKLAARKPMSGQSNMVTAQGREDPNQNTGTSIQNCDIIPSSDLEPVKGSVK  449

Query  1398  TYLGRPWKEYSRTVFMESNIGDHIDPAGWFPWDGDFALKTLYYGEYMNRGPGAGTSKRVN  1577
             TYLGRPWK YSRTV+M+SNIGDHIDPAGW  WDGDFALKTLYYGEYMN+G GAG SKRVN
Sbjct  450   TYLGRPWKAYSRTVYMQSNIGDHIDPAGWSEWDGDFALKTLYYGEYMNKGAGAGISKRVN  509

Query  1578  WPGYHVITDKAEAMKFTVAQLIQGGSWLKNTGVDYTEGL  1694
             WPGYH     +EA KFTV QLIQG +WLK+TGV YTEGL
Sbjct  510   WPGYHKALTTSEATKFTVGQLIQGAAWLKSTGVAYTEGL  548



>emb|CDO99718.1| unnamed protein product [Coffea canephora]
Length=548

 Score =   716 bits (1847),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 375/552 (68%), Positives = 455/552 (82%), Gaps = 6/552 (1%)
 Frame = +3

Query  45    MATTSHLPLLFTPKRKPSSCRalyvllylaaIVGSVALVSIWALRTSSSSPS-LWKARVC  221
             MA T + PLL  PK++ S  + LYV+L LAAI+G++++VS+  L +S +S S L    +C
Sbjct  1     MANT-YQPLLDIPKKR-SGFKVLYVVLSLAAILGAISIVSVAILSSSQTSTSSLRGGHLC  58

Query  222   DPAHDPPSCMAIVSEVSSAAPTETDGVAllqmllhssllRIQDAVKLSANVNRRINDRKV  401
               AHD  SC+  VSEV+S+   ++  V LLQM+L  S  +IQ+ +KL+ N+NRRIND++ 
Sbjct  59    SHAHDQSSCLQAVSEVASSG--QSSDVDLLQMILAKSSAQIQETIKLTENINRRINDQRE  116

Query  402   QAAVADCMELLDLSQDKVMDSMVALGNLSARARTDAHSWLSSVLTNHDTCLDGLSEPARS  581
             QAA+ADC+EL+D+S D++MDSMVALG+ +A++++DAHSWL SVLTNH TCLDGL+ PARS
Sbjct  117   QAALADCLELMDMSVDRLMDSMVALGSQTAQSQSDAHSWLGSVLTNHVTCLDGLNGPARS  176

Query  582   IMEPMIKDLISRAKsslavlvavaPSTEDDL-RALNGEFPSWVSASDRRLLEASanavaa  758
             ++EPM+KDLI +A++SLA++VA+AP  E+ + + LNG+ PSWV++ DRRLLEA    V A
Sbjct  177   VVEPMMKDLILKARTSLAMVVAIAPPKEEMIEQPLNGDLPSWVTSKDRRLLEALPKDVKA  236

Query  759   nvvvaKDGSGKYKTVAEAVASAPDNGKTRYVIYIKKGTYKENVEIGKKKTNVMLIGDGLS  938
             N VVAKDGSG YKTV EAV +AP+N ++RYVIY+K GTYKE V+IGK K N+ML+GDG+ 
Sbjct  237   NSVVAKDGSGNYKTVQEAVNAAPNNAQSRYVIYVKAGTYKEKVDIGKNKKNLMLVGDGMD  296

Query  939   ATIITGSLNYVDGATTFNSATVAAVGDGFIAQDLRIQNTAGPEKHQAVALRLGADQSVIN  1118
              TIITGSLN VDG+TTFNSATVAAV DGFIAQDL  QNTAGP+KHQAVALR+GAD+SVIN
Sbjct  297   KTIITGSLNVVDGSTTFNSATVAAVADGFIAQDLGFQNTAGPQKHQAVALRVGADKSVIN  356

Query  1119  RCKIDAYQDTLYAHSQRQFYRDCYITGTVDFIFGNAAAVIQNSQVVARKPMAAQKNMVTA  1298
             RCKIDA+QDTLY HS RQF+RDCYITGTVDFIFG+AA V QNS++ ARKPM+ Q+NMVTA
Sbjct  357   RCKIDAFQDTLYTHSLRQFFRDCYITGTVDFIFGDAAVVFQNSKLAARKPMSNQQNMVTA  416

Query  1299  QGRTDPNQNTGTSIQNCNVSPSSDLGPVKGTIQTYLGRPWKEYSRTVFMESNIGDHIDPA  1478
             QGR DPN NTGTSIQNC+V PSSDL PVKG+I+TYLGRPWKEYSRTV M+SNI +HI P 
Sbjct  417   QGRVDPNSNTGTSIQNCDVIPSSDLAPVKGSIKTYLGRPWKEYSRTVVMQSNIDNHIVPE  476

Query  1479  GWFPWDGDFALKTLYYGEYMNRGPGAGTSKRVNWPGYHVITDKAEAMKFTVAQLIQGGSW  1658
             GW  W GDFALKTLYYGEY NRGPGAGTS RV WPGYHVIT  AEA KFTVAQLIQGG W
Sbjct  477   GWSVWSGDFALKTLYYGEYQNRGPGAGTSGRVKWPGYHVITSAAEASKFTVAQLIQGGEW  536

Query  1659  LKNTGVDYTEGL  1694
             LKNTGV YTEGL
Sbjct  537   LKNTGVAYTEGL  548



>ref|XP_010267745.1| PREDICTED: pectinesterase [Nelumbo nucifera]
Length=553

 Score =   706 bits (1821),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 365/554 (66%), Positives = 444/554 (80%), Gaps = 5/554 (1%)
 Frame = +3

Query  45    MATTSHLPLLFTPKRKPSSCRalyvllylaaIVGSVALVSIWALRT---SSSSPSLWKAR  215
             M    H PLL  PKR  SSC+ LY+ L LAAIV    +V+   + T   S+ S S+ +AR
Sbjct  1     MMEAGHQPLLGAPKRTSSSCKILYIFLSLAAIVSLTVIVAPHLINTTGPSNLSDSV-QAR  59

Query  216   VCDPAHDPPSCMAIVSE-VSSAAPTETDGVAllqmllhssllRIQDAVKLSANVNRRIND  392
             +C PAHD  SC+++V E V++    + + V LL+  L  S L +++A+K++ +VN RIND
Sbjct  60    LCHPAHDRESCLSMVYEAVAAKGAKQLNDVDLLRSFLEKSALLVKEALKVAHSVNSRIND  119

Query  393   RKVQAAVADCMELLDLSQDKVMDSMVALGNLSARARTDAHSWLSSVLTNHDTCLDGLSEP  572
             R  QAA+ DC+EL+DLS D++ D++  LG  ++R+  DAHSWLSS+LTNH TCLDGL+  
Sbjct  120   RTEQAALVDCVELMDLSIDRLTDTVAVLGTRTSRSPADAHSWLSSILTNHVTCLDGLNGS  179

Query  573   ARSIMEPMIKDLISRAKsslavlvavaPSTEDDLRALNGEFPSWVSASDRRLLEASanav  752
             AR+ ME  ++ LI+RAK+SLA+L A++ S ED LR L+G+FPSWV+ +DR+LL++    +
Sbjct  180   ARAAMEDKLQGLIARAKTSLAMLTAISSSKEDALRPLDGKFPSWVTKNDRKLLQSLPRNI  239

Query  753   aanvvvaKDGSGKYKTVAEAVASAPDNGKTRYVIYIKKGTYKENVEIGKKKTNVMLIGDG  932
              ANVVVAKDGSG Y+TV EAV SAPD GK+RYVIY+KKGTYKENVE+GKKK NVML+GDG
Sbjct  240   KANVVVAKDGSGNYQTVQEAVNSAPDKGKSRYVIYVKKGTYKENVEVGKKKMNVMLVGDG  299

Query  933   LSATIITGSLNYVDGATTFNSATVAAVGDGFIAQDLRIQNTAGPEKHQAVALRLGADQSV  1112
             + +TIITGSLN VDG+TTF SATVAAVGDGFIAQD+  QNTAGPEKHQAVALR+GADQSV
Sbjct  300   MDSTIITGSLNVVDGSTTFKSATVAAVGDGFIAQDMWFQNTAGPEKHQAVALRVGADQSV  359

Query  1113  INRCKIDAYQDTLYAHSQRQFYRDCYITGTVDFIFGNAAAVIQNSQVVARKPMAAQKNMV  1292
             INRC+IDAYQDTLY HS RQFYRD YITGTVDFIFG+AA V QN ++VARKPMA+QKNMV
Sbjct  360   INRCRIDAYQDTLYVHSLRQFYRDSYITGTVDFIFGDAAVVFQNCKLVARKPMASQKNMV  419

Query  1293  TAQGRTDPNQNTGTSIQNCNVSPSSDLGPVKGTIQTYLGRPWKEYSRTVFMESNIGDHID  1472
             TAQGR DPNQNTG SIQ C++  SSDL PVK +  +YLGRPWKEYSRTV M+S IGDHI 
Sbjct  420   TAQGRVDPNQNTGISIQKCDIIASSDLAPVKNSFPSYLGRPWKEYSRTVVMQSYIGDHIA  479

Query  1473  PAGWFPWDGDFALKTLYYGEYMNRGPGAGTSKRVNWPGYHVITDKAEAMKFTVAQLIQGG  1652
             PAGW  W G+FALKTLYYGEY+N GPGAG SKRV WPGYHVIT+ AEA+KFTVA+LIQGG
Sbjct  480   PAGWSIWSGEFALKTLYYGEYLNSGPGAGISKRVTWPGYHVITNSAEALKFTVAELIQGG  539

Query  1653  SWLKNTGVDYTEGL  1694
             +WLK+TGVDYTEGL
Sbjct  540   AWLKSTGVDYTEGL  553



>ref|XP_002518523.1| Pectinesterase precursor, putative [Ricinus communis]
 gb|EEF43910.1| Pectinesterase precursor, putative [Ricinus communis]
Length=547

 Score =   698 bits (1801),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 358/543 (66%), Positives = 439/543 (81%), Gaps = 2/543 (0%)
 Frame = +3

Query  66    PLLFTPKRKPSSCRalyvllylaaIVGSVALVSIWALRTSSSSPSLWKARVCDPAHDPPS  245
             PLL + K  P     LY++L +AAI+ S AL+++     + S P + +  +CD A D  S
Sbjct  7     PLLDSLKASPHKL-TLYLVLSIAAILSSAALLTLHFNHITLSHPQIIQT-LCDRATDEAS  64

Query  246   CMAIVSEVSSAAPTETDGVAllqmllhssllRIQDAVKLSANVNRRINDRKVQAAVADCM  425
             C A+VSE+++    + + V LLQ+LL  S   IQ+A+  + +V   IND   QAA+ DC+
Sbjct  65    CQAMVSEIATNTTMKLNHVKLLQVLLTKSTSHIQNAILEANHVRIMINDPVNQAALVDCV  124

Query  426   ELLDLSQDKVMDSMVALGNLSARARTDAHSWLSSVLTNHDTCLDGLSEPARSIMEPMIKD  605
             +L++LS DK+ +S++AL N++  +  DAHSWLS+VLTNH TCLDGL   ARS MEP +KD
Sbjct  125   DLMELSLDKIKNSVLALDNVTTDSHADAHSWLSTVLTNHVTCLDGLKGLARSTMEPGLKD  184

Query  606   LISRAKsslavlvavaPSTEDDLRALNGEFPSWVSASDRRLLEASanavaanvvvaKDGS  785
             +I+RA++SLA++VA++P+  D +  LNG+FPSWV++ DR+LLE+S   + A+V+VAKDGS
Sbjct  185   IITRARTSLAMVVAISPAKNDLISPLNGDFPSWVTSKDRKLLESSGKNINADVIVAKDGS  244

Query  786   GKYKTVAEAVASAPDNGKTRYVIYIKKGTYKENVEIGKKKTNVMLIGDGLSATIITGSLN  965
             GKYKTV EAVA+AP+NGKTRYVIY+KKGTYKENVEIG  K N+ML+GD + +TIITGSLN
Sbjct  245   GKYKTVKEAVAAAPNNGKTRYVIYVKKGTYKENVEIGNSKKNIMLVGDSMDSTIITGSLN  304

Query  966   YVDGATTFNSATVAAVGDGFIAQDLRIQNTAGPEKHQAVALRLGADQSVINRCKIDAYQD  1145
              VDG+TTFNSATVAAVGDGFIAQD+  QNTAGP+KHQAVALR+G+DQSVINRC+IDAYQD
Sbjct  305   VVDGSTTFNSATVAAVGDGFIAQDIWFQNTAGPQKHQAVALRVGSDQSVINRCRIDAYQD  364

Query  1146  TLYAHSQRQFYRDCYITGTVDFIFGNAAAVIQNSQVVARKPMAAQKNMVTAQGRTDPNQN  1325
             TLYAHS R FYRD +ITGTVDFIFGNAAAV QN ++VARKPMA QKNMVTAQGRTDPNQN
Sbjct  365   TLYAHSDRHFYRDSFITGTVDFIFGNAAAVFQNCKIVARKPMAGQKNMVTAQGRTDPNQN  424

Query  1326  TGTSIQNCNVSPSSDLGPVKGTIQTYLGRPWKEYSRTVFMESNIGDHIDPAGWFPWDGDF  1505
             TGTSIQ C+V  SSDL PVKG+  +YLGRPWKEYSRTV M+SNIGDHIDPAGW  WDG+F
Sbjct  425   TGTSIQKCDVIASSDLQPVKGSFPSYLGRPWKEYSRTVVMQSNIGDHIDPAGWSIWDGEF  484

Query  1506  ALKTLYYGEYMNRGPGAGTSKRVNWPGYHVITDKAEAMKFTVAQLIQGGSWLKNTGVDYT  1685
             ALKTLYYGEYMN+G GAGTSKRV WPGYHVIT   EA KFTVA+LIQGG+WLK+TGV +T
Sbjct  485   ALKTLYYGEYMNKGAGAGTSKRVKWPGYHVITSATEAKKFTVAELIQGGAWLKSTGVAFT  544

Query  1686  EGL  1694
             EGL
Sbjct  545   EGL  547



>ref|XP_002317208.1| pectin methylesterase family protein [Populus trichocarpa]
 gb|EEE97820.1| pectin methylesterase family protein [Populus trichocarpa]
Length=549

 Score =   696 bits (1797),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 358/551 (65%), Positives = 443/551 (80%), Gaps = 8/551 (1%)
 Frame = +3

Query  54    TSHLPLLFTPK--RKPSSCRalyvllylaaIVGSVALVSI-WALRTSSSSPSLWKARVCD  224
             T + PLL TPK  R+ + C    ++L + AI+ S  LV++ +  +T  SSP      +CD
Sbjct  3     TMNTPLLATPKTSRRKTIC----LVLSMVAILSSTTLVTMRYYTKTDPSSPPGLLQNLCD  58

Query  225   PAHDPPSCMAIVSEVSSAAPTETDGVAllqmllhssllRIQDAVKLSANVNRRINDRKVQ  404
              A+D  SC+A+VS+++S   T+   V LLQ+LL  S   IQ+ ++ +  ++ RIND + Q
Sbjct  59    HAYDQESCLAMVSQIASNTSTKMSQVGLLQLLLGKSTPHIQNTIEKAEVIHSRINDAREQ  118

Query  405   AAVADCMELLDLSQDKVMDSMVALGNLSARARTDAHSWLSSVLTNHDTCLDGLSEPARSI  584
             AA+ DC+EL+++S+ ++ D++VAL  +++++  +A +WLSSVLTNHDTCLDGL+ PARS 
Sbjct  119   AALGDCVELMEISKYRIKDTIVALERVTSKSHANALTWLSSVLTNHDTCLDGLNGPARST  178

Query  585   MEPMIKDLISRAKsslavlvavaPSTED-DLRALNGEFPSWVSASDRRLLEASanavaan  761
             MEP + DLI RA++SLA+L A++PS E+ D+ +L  +FPSW+ + DR+LL A    + A+
Sbjct  179   MEPDLNDLILRARTSLAILAAISPSKENNDIFSLKEDFPSWLPSMDRKLLVALPKDINAD  238

Query  762   vvvaKDGSGKYKTVAEAVASAPDNGKTRYVIYIKKGTYKENVEIGKKKTNVMLIGDGLSA  941
             V VAKDGSGKYKTV EAVASAPDNGKTRYVIY+KKGTYKENVE+GKKK NVML+GDG+ +
Sbjct  239   VTVAKDGSGKYKTVKEAVASAPDNGKTRYVIYVKKGTYKENVEVGKKKKNVMLVGDGMDS  298

Query  942   TIITGSLNYVDGATTFNSATVAAVGDGFIAQDLRIQNTAGPEKHQAVALRLGADQSVINR  1121
             TIITGSLN VDG+TTFNSATVAAVGDGFIAQD+  QNTAGPEKHQAVALR+GADQSVINR
Sbjct  299   TIITGSLNVVDGSTTFNSATVAAVGDGFIAQDIWFQNTAGPEKHQAVALRVGADQSVINR  358

Query  1122  CKIDAYQDTLYAHSQRQFYRDCYITGTVDFIFGNAAAVIQNSQVVARKPMAAQKNMVTAQ  1301
             C+IDAYQDTLY HS RQFYRD YITGTVDFIFGNAA V+QN ++V RKPM+ QKNMVTAQ
Sbjct  359   CRIDAYQDTLYTHSLRQFYRDSYITGTVDFIFGNAAVVLQNCKLVPRKPMSGQKNMVTAQ  418

Query  1302  GRTDPNQNTGTSIQNCNVSPSSDLGPVKGTIQTYLGRPWKEYSRTVFMESNIGDHIDPAG  1481
             GRTDPNQNTGTSIQ C++  SSDL PVK + +++LGRPWKEYSRTV M+SNIGD IDPAG
Sbjct  419   GRTDPNQNTGTSIQKCDIIASSDLTPVKSSFKSFLGRPWKEYSRTVVMQSNIGDLIDPAG  478

Query  1482  WFPWDGDFALKTLYYGEYMNRGPGAGTSKRVNWPGYHVITDKAEAMKFTVAQLIQGGSWL  1661
             W  WDG+FALKTLYYGEY+N+G GAGTSKRVNW GYHVIT   EA KFTVA+LIQGG WL
Sbjct  479   WSAWDGEFALKTLYYGEYLNQGAGAGTSKRVNWAGYHVITSANEAKKFTVAELIQGGVWL  538

Query  1662  KNTGVDYTEGL  1694
             K+TGV YTEGL
Sbjct  539   KSTGVSYTEGL  549



>emb|CDO99717.1| unnamed protein product [Coffea canephora]
Length=533

 Score =   692 bits (1786),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 368/555 (66%), Positives = 446/555 (80%), Gaps = 27/555 (5%)
 Frame = +3

Query  45    MATTSHLPLLFTPKRKPSSCRalyvllylaaIVGSVALVSIWALRTS----SSSPSLWKA  212
             MA T +  LL TPK K +  + L+++L+LAAI+G++A+VSI  L+++    SSSP   ++
Sbjct  1     MANT-YQSLLDTPK-KNTGFKVLFLVLFLAAILGAIAIVSITILKSTQTVISSSP---RS  55

Query  213   RVCDPAHDPPSCMAIVSEVSSAAPTETDGVAllqmllhssllRIQDAVKLSANVNRRIND  392
              +C  AHD PSCMA+VSE++SA   ++  V LLQMLL  S  RIQ+ ++L+ N+NRRIND
Sbjct  56    HLCSKAHDQPSCMALVSELTSAGLLQSSDVELLQMLLAKSSSRIQETIELTNNINRRIND  115

Query  393   RKVQAAVADCMELLDLSQDKVMDSMVALGNLSARARTDAHSWLSSVLTNHDTCLDGLSEP  572
             +K QAA+ADC+EL+D+S D+VMDSMV+LG+ +A + +D HSWLSSVLTNH TCLDGL+  
Sbjct  116   QKGQAALADCLELMDISMDRVMDSMVSLGSQTANSHSDVHSWLSSVLTNHVTCLDGLNGL  175

Query  573   ARSIMEPMIKDLISRAKsslavlvavaPSTEDDLRA-LNGEFPSWVSASDRRLLEASana  749
             AR  MEP++K+LISRA++SLA+LVA+APS E+ ++  LNG+FPSWV+  DRRLL++SA  
Sbjct  176   ARPAMEPLMKELISRARTSLAMLVAIAPSEEEMIQEPLNGDFPSWVTHKDRRLLQSSAKN  235

Query  750   vaanvvvaKDGSGKYKTVAEAVASAPDNGKTRYVIYIKKGTYKENVEIGKKKTNVMLIGD  929
             + ANVVVA+DGSG YKTV EAV +AP+N +TRYVIY+KKGTYKE V+IGK K N+ML+GD
Sbjct  236   INANVVVAQDGSGNYKTVQEAVTAAPNNPQTRYVIYVKKGTYKEKVDIGKSKKNLMLVGD  295

Query  930   GLSATIITGSLNYVDGATTFNSATVAAVGDGFIAQDLRIQNTAGPEKHQAVALRLGADQS  1109
             G+  TIITGSLN VDG TTF SATVAAV DGFI QD+  QNTAGP+K QAVALR+GADQS
Sbjct  296   GMDLTIITGSLNVVDGTTTFQSATVAAVADGFIGQDIWFQNTAGPQKQQAVALRVGADQS  355

Query  1110  VINRCKIDAYQDTLYAHSQRQFYRDCYITGTVDFIFGNAAAVIQNSQVVARKPMAAQKNM  1289
             VINRCKIDA+QDTLYAHS RQFYRDCYITGTVD+IFG+AA V QNSQ+VARKP++ Q+NM
Sbjct  356   VINRCKIDAFQDTLYAHSLRQFYRDCYITGTVDYIFGDAAVVFQNSQLVARKPLSNQQNM  415

Query  1290  VTAQGRTDPNQNTGTSIQNCNVSPSSDLGPVKGTIQTYLGRPWKEYSRTVFMESNIGDHI  1469
             VTAQGR DPN NTGTSIQNC++  SSDL PVK TI+T+LGRPWKEYSRTV M+SNIGDHI
Sbjct  416   VTAQGRVDPNSNTGTSIQNCDIIASSDLAPVKATIKTFLGRPWKEYSRTVVMQSNIGDHI  475

Query  1470  DPAGWFPWDGDFALKTLYYGEYMNRGPGAGTSKRVNWPGYHVITDKAEAMKFTVAQLIQG  1649
             DP GW PW                  PGAGTSKRVNWPGY VIT  AEA KFTVAQLIQG
Sbjct  476   DPTGWAPW-----------------SPGAGTSKRVNWPGYRVITTAAEASKFTVAQLIQG  518

Query  1650  GSWLKNTGVDYTEGL  1694
             G WLKNTGV YTEGL
Sbjct  519   GQWLKNTGVAYTEGL  533



>ref|XP_011000694.1| PREDICTED: pectinesterase [Populus euphratica]
Length=557

 Score =   692 bits (1786),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 357/554 (64%), Positives = 439/554 (79%), Gaps = 6/554 (1%)
 Frame = +3

Query  42    AMATTSHLPLLFTPKRKPSSCRaly-vllylaaIVGSVALVSI-WALRTSSSSPSLWKAR  215
             A   T + PLL TPK   +SCR    +++ + AI+ S  LV++ +  +T  SSP      
Sbjct  7     ATMATMNTPLLATPK---TSCRKTICLVISMVAILSSTTLVTMRYYTKTDPSSPPGLLQN  63

Query  216   VCDPAHDPPSCMAIVSEVSSAAPTETDGVAllqmllhssllRIQDAVKLSANVNRRINDR  395
             +CD A+D  SC+A+VS+++S   T+   V LLQ+LL  S   IQD ++ +  ++ RIND 
Sbjct  64    LCDHAYDQESCLAMVSQIASYTSTKMSQVGLLQLLLGKSTSHIQDTIEKAEVIHSRINDA  123

Query  396   KVQAAVADCMELLDLSQDKVMDSMVALGNLSARARTDAHSWLSSVLTNHDTCLDGLSEPA  575
             + QAA+ DC+EL+++S+ ++ D++VAL  +++ +  +A +WLSSVLTNHDTCLDGL+ PA
Sbjct  124   REQAALGDCVELMEISKYRIKDTIVALERVTSESHANALTWLSSVLTNHDTCLDGLNGPA  183

Query  576   RSIMEPMIKDLISRAKsslavlvavaPSTED-DLRALNGEFPSWVSASDRRLLEASanav  752
             RS ME  + DLI RA++SLA+L A++PS E+ D+  L  +FPSW+ + DR+LL      +
Sbjct  184   RSTMELDLNDLILRARTSLAILAAISPSKENNDIFPLKEDFPSWLPSMDRKLLITLPKDI  243

Query  753   aanvvvaKDGSGKYKTVAEAVASAPDNGKTRYVIYIKKGTYKENVEIGKKKTNVMLIGDG  932
              A+V VAKDGSGKYKTV EAVASAPDNGKTRYVIY+KKGTYKENVE+GKKK NVML+GDG
Sbjct  244   NADVTVAKDGSGKYKTVKEAVASAPDNGKTRYVIYVKKGTYKENVEVGKKKKNVMLVGDG  303

Query  933   LSATIITGSLNYVDGATTFNSATVAAVGDGFIAQDLRIQNTAGPEKHQAVALRLGADQSV  1112
             + +TIITG+LN VDG+TTF SATVAAVGDGFIAQD+  QNTAGPEKHQAVALR+GADQSV
Sbjct  304   MDSTIITGNLNVVDGSTTFKSATVAAVGDGFIAQDIWFQNTAGPEKHQAVALRVGADQSV  363

Query  1113  INRCKIDAYQDTLYAHSQRQFYRDCYITGTVDFIFGNAAAVIQNSQVVARKPMAAQKNMV  1292
             INRC+IDAYQDTLY HS RQFYRD YITGTVDFIFGNAA V+QN ++V RKPM+ QKNMV
Sbjct  364   INRCRIDAYQDTLYTHSLRQFYRDSYITGTVDFIFGNAAVVLQNCKLVPRKPMSGQKNMV  423

Query  1293  TAQGRTDPNQNTGTSIQNCNVSPSSDLGPVKGTIQTYLGRPWKEYSRTVFMESNIGDHID  1472
             TAQGRTDPNQNTGTSIQ C++  SSDL PVK + ++YLGRPWKEYSRTV M+SNIGD ID
Sbjct  424   TAQGRTDPNQNTGTSIQKCDIIASSDLTPVKSSFKSYLGRPWKEYSRTVVMQSNIGDLID  483

Query  1473  PAGWFPWDGDFALKTLYYGEYMNRGPGAGTSKRVNWPGYHVITDKAEAMKFTVAQLIQGG  1652
             PAGW  WDG+FALKTLYYGEY+N+G GAGTSKRV WPGYHVIT   EA KFTVA+LIQGG
Sbjct  484   PAGWSAWDGEFALKTLYYGEYLNQGAGAGTSKRVKWPGYHVITSANEAKKFTVAELIQGG  543

Query  1653  SWLKNTGVDYTEGL  1694
              WLK+TGV YTEGL
Sbjct  544   VWLKSTGVSYTEGL  557



>ref|XP_006348082.1| PREDICTED: pectinesterase/pectinesterase inhibitor 18-like [Solanum 
tuberosum]
Length=486

 Score =   686 bits (1771),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 350/486 (72%), Positives = 414/486 (85%), Gaps = 6/486 (1%)
 Frame = +3

Query  255   IVSEVSSAAPT-ETDGVAllqmllhssllRIQDAVKLSANVNRRINDRKVQAAVADCMEL  431
             +V+EV+ A    +T  V LLQM+LH S L+I + + L++NVN RIN+ + QAA+ADC+EL
Sbjct  1     MVTEVAPAGVVMDTKTVDLLQMVLHKSSLKIHETIHLASNVNGRINNGQEQAALADCLEL  60

Query  432   LDLSQDKVMDSMVALGNLSARARTDAHSWLSSVLTNHDTCLDGLSEPARSIMEPMIKDLI  611
             +DLS+D++MDSM+ LGNLSA+A  D HSWLSS+LTNH TC+DGL+  ARSIMEPM+ DLI
Sbjct  61    MDLSRDRLMDSMMGLGNLSAQAHFDVHSWLSSILTNHVTCIDGLNGQARSIMEPMLNDLI  120

Query  612   SRAKsslavlvavaPSTEDDLRA-----LNGEFPSWVSASDRRLLEASanavaanvvvaK  776
             +RA++SLA++VA+AP    +        ++   PSWVSA+DR+LL+ SANA+AANVVVAK
Sbjct  121   ARARTSLALMVAIAPPKSTNNNNNLPPTVSDGLPSWVSANDRKLLQLSANAIAANVVVAK  180

Query  777   DGSGKYKTVAEAVASAPDNGKTRYVIYIKKGTYKENVEIGKKKTNVMLIGDGLSATIITG  956
             DGSGKYKTV EAVASAPDNGKTR+VIY+KKGTYKENVEIGKKK N+ML+GDG+ ATIITG
Sbjct  181   DGSGKYKTVKEAVASAPDNGKTRFVIYVKKGTYKENVEIGKKKKNIMLMGDGMDATIITG  240

Query  957   SLNYVDGATTFNSATVAAVGDGFIAQDLRIQNTAGPEKHQAVALRLGADQSVINRCKIDA  1136
             +LN +DG+TTF SATVAAVGDGFIAQDL+ QNTAGP+KHQAVALR+GADQSVINRCKIDA
Sbjct  241   NLNVIDGSTTFKSATVAAVGDGFIAQDLQFQNTAGPQKHQAVALRVGADQSVINRCKIDA  300

Query  1137  YQDTLYAHSQRQFYRDCYITGTVDFIFGNAAAVIQNSQVVARKPMAAQKNMVTAQGRTDP  1316
             ++DTLY H+ RQFYRDCYITGTVDFIFGNAA V QNS++ ARKPM+ QKNMVTAQGR DP
Sbjct  301   FRDTLYTHTLRQFYRDCYITGTVDFIFGNAAVVFQNSKLAARKPMSGQKNMVTAQGREDP  360

Query  1317  NQNTGTSIQNCNVSPSSDLGPVKGTIQTYLGRPWKEYSRTVFMESNIGDHIDPAGWFPWD  1496
             NQ TGTSIQNC + PSSDL PVKG+++TYLGRPWK YSRTV+M+SNIGDHIDPAGW  WD
Sbjct  361   NQVTGTSIQNCEIIPSSDLAPVKGSVKTYLGRPWKAYSRTVYMQSNIGDHIDPAGWSEWD  420

Query  1497  GDFALKTLYYGEYMNRGPGAGTSKRVNWPGYHVITDKAEAMKFTVAQLIQGGSWLKNTGV  1676
             GDFALKTLYYGEYMN+G GAG SKRVNW GYH     +EA KFTV QLIQG +WLK+TGV
Sbjct  421   GDFALKTLYYGEYMNKGAGAGISKRVNWAGYHKALTTSEAAKFTVGQLIQGAAWLKSTGV  480

Query  1677  DYTEGL  1694
              YTEGL
Sbjct  481   AYTEGL  486



>ref|XP_007025998.1| Pectinesterase/pectinesterase inhibitor, putative [Theobroma 
cacao]
 gb|EOY28620.1| Pectinesterase/pectinesterase inhibitor, putative [Theobroma 
cacao]
Length=543

 Score =   686 bits (1770),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/547 (64%), Positives = 431/547 (79%), Gaps = 6/547 (1%)
 Frame = +3

Query  54    TSHLPLLFTPKRKPSSCRalyvllylaaIVGSVALVSIWALRTSSSSPSLWKARVCDPAH  233
             T+H PLL  PK    + + L ++  +AAIV + ALV+I  ++ SS +P     +VC  A 
Sbjct  3     TAHQPLLHRPK----TSKVLPLIFSIAAIVCTAALVTIRLVKISSFTP--LPDQVCLGAV  56

Query  234   DPPSCMAIVSEVSSAAPTETDGVAllqmllhssllRIQDAVKLSANVNRRINDRKVQAAV  413
             D  SC A++SEV+S +  +  GV +L   L  S  ++Q+A+ L+ N   RIN+ + QAA+
Sbjct  57    DQKSCSALLSEVASNSTIKMKGVDVLHAFLEKSTAQMQNAINLANNFKHRINNPRDQAAL  116

Query  414   ADCMELLDLSQDKVMDSMVALGNLSARARTDAHSWLSSVLTNHDTCLDGLSEPARSIMEP  593
             ADC+EL++ S D++ DSMVALG     + +DAH+WLSSVLTNH TCLDG+   AR++MEP
Sbjct  117   ADCLELMESSMDRIADSMVALGKKDVDSHSDAHAWLSSVLTNHVTCLDGVQGSARTLMEP  176

Query  594   MIKDLISRAKsslavlvavaPSTEDDLRALNGEFPSWVSASDRRLLEASanavaanvvva  773
              + DLISRA++SLAV V+++P     +     EFPSWVS+ DR+LL+A  N + ANVVVA
Sbjct  177   GLNDLISRARTSLAVFVSISPGKTRFVDPSIDEFPSWVSSKDRKLLQALLNEIKANVVVA  236

Query  774   KDGSGKYKTVAEAVASAPDNGKTRYVIYIKKGTYKENVEIGKKKTNVMLIGDGLSATIIT  953
             KDGSG YKT+AEAVA+APD  K RY+I++K GTYKENVEIGKKK N+M++GDG+++TIIT
Sbjct  237   KDGSGNYKTLAEAVAAAPDKSKIRYIIHVKNGTYKENVEIGKKKKNLMIVGDGMNSTIIT  296

Query  954   GSLNYVDGATTFNSATVAAVGDGFIAQDLRIQNTAGPEKHQAVALRLGADQSVINRCKID  1133
             GSLN+VDG TTF SATVAAVGDGFIAQD+  QNTAGPEKHQAVALR+GADQSVINRCKID
Sbjct  297   GSLNFVDGTTTFKSATVAAVGDGFIAQDIWFQNTAGPEKHQAVALRVGADQSVINRCKID  356

Query  1134  AYQDTLYAHSQRQFYRDCYITGTVDFIFGNAAAVIQNSQVVARKPMAAQKNMVTAQGRTD  1313
             AYQDTLY HS RQFYRD Y+TGTVDFIFGNAA V QN ++VARKPM++Q NMVTAQGRTD
Sbjct  357   AYQDTLYTHSNRQFYRDSYVTGTVDFIFGNAAVVFQNCKLVARKPMSSQSNMVTAQGRTD  416

Query  1314  PNQNTGTSIQNCNVSPSSDLGPVKGTIQTYLGRPWKEYSRTVFMESNIGDHIDPAGWFPW  1493
             PNQNTGT IQNCN+  S+DL PVK +I++YLGRPWKEYSRTV M+S I DHIDP+GW  W
Sbjct  417   PNQNTGTFIQNCNIIASADLRPVKASIKSYLGRPWKEYSRTVVMQSYIADHIDPSGWSIW  476

Query  1494  DGDFALKTLYYGEYMNRGPGAGTSKRVNWPGYHVITDKAEAMKFTVAQLIQGGSWLKNTG  1673
             +GDFALKTLYYGEYMNRGPGAGT KRV WPGY ++T   EA  FTVA+LIQGGSWLK+TG
Sbjct  477   NGDFALKTLYYGEYMNRGPGAGTCKRVKWPGYRILTKAEEAKPFTVAELIQGGSWLKSTG  536

Query  1674  VDYTEGL  1694
             V YTEGL
Sbjct  537   VAYTEGL  543



>ref|XP_012091398.1| PREDICTED: pectinesterase [Jatropha curcas]
 gb|KDP20786.1| hypothetical protein JCGZ_21257 [Jatropha curcas]
Length=544

 Score =   681 bits (1756),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 358/550 (65%), Positives = 438/550 (80%), Gaps = 6/550 (1%)
 Frame = +3

Query  45    MATTSHLPLLFTPKRKPSSCRalyvllylaaIVGSVALVSIWALRTSSSSPSLWKARVCD  224
             MAT  H PLL +PK   S  + LY+LL LAAI+ S A++++     + S+P L    +CD
Sbjct  1     MAT--HEPLLASPK--TSHKKTLYLLLCLAAIILSAAILTLHFTELTFSNPPL--QNLCD  54

Query  225   PAHDPPSCMAIVSEVSSAAPTETDGVAllqmllhssllRIQDAVKLSANVNRRINDRKVQ  404
              AHD  SC+ IV+E++S    + + V LLQ+LL  S  +IQ++++ + +V+R+IND   Q
Sbjct  55    NAHDKASCLGIVTEIASNTSKKPNQVNLLQILLKKSKYQIQNSIQEATHVSRQINDPVNQ  114

Query  405   AAVADCMELLDLSQDKVMDSMVALGNLSARARTDAHSWLSSVLTNHDTCLDGLSEPARSI  584
             AA+ DC++L++LS D+  DS+VAL + +  +  +AH WLSSVLTNH TCLDGL+ PARSI
Sbjct  115   AALVDCVQLMELSIDRTNDSIVALQSGTVNSHANAHVWLSSVLTNHFTCLDGLTGPARSI  174

Query  585   MEPMIKDLISRAKsslavlvavaPSTEDDLRALNGEFPSWVSASDRRLLEASanavaanv  764
             MEP + DLIS++++SLA+LV ++P+ +  +  LN +FPSWV+  DR+LLEAS   + ANV
Sbjct  175   MEPELNDLISKSRTSLALLVGISPAKDYLISPLNRDFPSWVTTKDRKLLEASVKDIKANV  234

Query  765   vvaKDGSGKYKTVAEAVASAPDNGKTRYVIYIKKGTYKENVEIGKKKTNVMLIGDGLSAT  944
             +VAKDGSG YKT+ EAVA+AP+NGKTR+VIY+KKGTYKE VEIGK K NVML+GDG+  T
Sbjct  235   IVAKDGSGNYKTIKEAVAAAPNNGKTRHVIYVKKGTYKEQVEIGKSKKNVMLVGDGMDLT  294

Query  945   IITGSLNYVDGATTFNSATVAAVGDGFIAQDLRIQNTAGPEKHQAVALRLGADQSVINRC  1124
             IITGSLN VDG+TTF+SATVAAVGDGFIAQD+  QNTAGPEKHQAVALR+GADQSVINRC
Sbjct  295   IITGSLNVVDGSTTFDSATVAAVGDGFIAQDIWFQNTAGPEKHQAVALRVGADQSVINRC  354

Query  1125  KIDAYQDTLYAHSQRQFYRDCYITGTVDFIFGNAAAVIQNSQVVARKPMAAQKNMVTAQG  1304
             ++DAYQDTLY HS RQFYRD  ITGTVDFIFGNAA V QN ++VARKPM  QKNMVTAQG
Sbjct  355   RMDAYQDTLYTHSNRQFYRDSLITGTVDFIFGNAAVVFQNCKLVARKPMNGQKNMVTAQG  414

Query  1305  RTDPNQNTGTSIQNCNVSPSSDLGPVKGTIQTYLGRPWKEYSRTVFMESNIGDHIDPAGW  1484
             R DPNQNTGTSIQ C +  SSDL PVK ++++YLGRPWKEYSRTV M+SNI DHIDPAGW
Sbjct  415   RIDPNQNTGTSIQKCEIIASSDLEPVKSSVKSYLGRPWKEYSRTVVMQSNIADHIDPAGW  474

Query  1485  FPWDGDFALKTLYYGEYMNRGPGAGTSKRVNWPGYHVITDKAEAMKFTVAQLIQGGSWLK  1664
               W+GDFALKTLYYGEYMNRG GAGTSKRV W GY VIT   EA KFTVA+LIQGG WLK
Sbjct  475   SIWEGDFALKTLYYGEYMNRGAGAGTSKRVKWAGYRVITSATEAQKFTVAELIQGGVWLK  534

Query  1665  NTGVDYTEGL  1694
             +TGV +TEGL
Sbjct  535   STGVAFTEGL  544



>ref|XP_008224789.1| PREDICTED: pectinesterase [Prunus mume]
Length=555

 Score =   670 bits (1729),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 359/552 (65%), Positives = 424/552 (77%), Gaps = 11/552 (2%)
 Frame = +3

Query  66    PLLFTPKRKPSSCRalyvllylaaIVGSVALVSIWAL-RTSSSSPSLWKARVCDPAHDPP  242
             PLL +PK     C+ LY++L LAAI+ S  LV I  + + SSSS       +CD AHD  
Sbjct  6     PLLESPKTSTPHCKPLYLILCLAAILSSTTLVGIQVMTKISSSSSYPPPTHICDHAHDQK  65

Query  243   SCMAIVSEVSSAAPTETDGVAllqmllhssllRIQDAVKLSANVNRRINDRKVQAAVADC  422
             SC+A+V+EV+         V LLQ LL  S  RI+ A++++ + + RIN+ K QAA+ADC
Sbjct  66    SCLAMVTEVAGDKTKPVSDVHLLQSLLEKSTPRIEKALEIAKDASSRINNPKDQAAIADC  125

Query  423   MELLDLSQDKVMDSMVALGNLSAR-ARTDAHSWLSSVLTNHDTCLDGLSEPARSIMEPMI  599
             +EL+D+S D+VM S +AL N + + +  DAH+WLSS+LTNH TCLDGL  PAR+IMEP +
Sbjct  126   VELMDVSIDRVMHSTIALQNFTLQNSLEDAHAWLSSILTNHVTCLDGLQGPARTIMEPRL  185

Query  600   KDLISRAKsslavlvavaPSTEDDLRA-----LNGEFPSWVSASDRRLLEASanavaanv  764
              DLISR+++SLA++VA+  S    L+A     LNGEFPSWV++ DRRLL+    A     
Sbjct  186   NDLISRSRASLAIMVAI--SNLSKLKAEIHEPLNGEFPSWVTSRDRRLLQDYNLAKEVKA  243

Query  765   --vvaKDGSGKYKTVAEAVASAPDNGKTRYVIYIKKGTYKENVEIGKKKTNVMLIGDGLS  938
               VVAKDGSG YKTV EAVA+AP+N KTRY+IY+KKGTYKENVE+GK K N+M++GDG+ 
Sbjct  244   NIVVAKDGSGNYKTVKEAVAAAPNNSKTRYIIYVKKGTYKENVEVGKNKKNLMIVGDGMD  303

Query  939   ATIITGSLNYVDGATTFNSATVAAVGDGFIAQDLRIQNTAGPEKHQAVALRLGADQSVIN  1118
              T+ITGSLN VDG+TTF SAT+AAVGDGFIAQD+  QNTAG  KHQAVALR+GADQSVIN
Sbjct  304   NTVITGSLNVVDGSTTFKSATLAAVGDGFIAQDMWFQNTAGAVKHQAVALRVGADQSVIN  363

Query  1119  RCKIDAYQDTLYAHSQRQFYRDCYITGTVDFIFGNAAAVIQNSQVVARKPMAAQKNMVTA  1298
             RC+IDAYQDTLY HS RQFYRD YITGTVDFIFGNAA V QN Q+VARKPM  Q NMVTA
Sbjct  364   RCRIDAYQDTLYTHSNRQFYRDSYITGTVDFIFGNAAVVFQNCQLVARKPMTGQNNMVTA  423

Query  1299  QGRTDPNQNTGTSIQNCNVSPSSDLGPVKGTIQTYLGRPWKEYSRTVFMESNIGDHIDPA  1478
             QGR DPNQNTGTSIQ C++  SSDL PVKGTI++YLGRPWKEYSRTV M+S IGDHIDP 
Sbjct  424   QGRIDPNQNTGTSIQKCDIIASSDLEPVKGTIRSYLGRPWKEYSRTVVMQSKIGDHIDPT  483

Query  1479  GWFPWDGDFALKTLYYGEYMNRGPGAGTSKRVNWPGYHVITDKAEAMKFTVAQLIQGGSW  1658
             GW  W GDFALKTLYYGEY N G GAGTSKRV W GYHVIT   EA  FTVAQLIQGGSW
Sbjct  484   GWSIWSGDFALKTLYYGEYANSGAGAGTSKRVKWAGYHVITSPTEAQNFTVAQLIQGGSW  543

Query  1659  LKNTGVDYTEGL  1694
             LK+TGV YTEGL
Sbjct  544   LKSTGVAYTEGL  555



>gb|KDO75533.1| hypothetical protein CISIN_1g008722mg [Citrus sinensis]
Length=556

 Score =   665 bits (1717),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/556 (63%), Positives = 421/556 (76%), Gaps = 6/556 (1%)
 Frame = +3

Query  45    MATTSHLPLLFTPKRKPSSCRalyvllylaaIVGSVALVSIWALRTSSSSPSLWKARVCD  224
             MAT     LL     K S  + L ++L + +++ S   V+I  ++  +S+      + C 
Sbjct  1     MATIDRPLLLKLHTPKASKRKILLLILSVVSVMCSATFVAIHCIKAINSNNHWSLHQFCA  60

Query  225   PAHDPPSCMAIVSEVSSA-APTETDGVAllqmllhssllRIQDAVKLSANVNRRINDRKV  401
              A D  SC+A+VSE +S  A T+ + V LL + L  S   IQ+ ++++ +V  RIN  + 
Sbjct  61    KAQDQSSCIAMVSETTSINATTKMNEVDLLLIFLSKSTSNIQETIEVANHVKHRINSPRG  120

Query  402   QAAVADCMELLDLSQDKVMDSMVALGNLSARARTDAHSWLSSVLTNHDTCLDGLSEPARS  581
             QAA+ DC+ELL+LS D++ DSM AL      +  DAH+WLS VLTNH TCLDGL   A  
Sbjct  121   QAALTDCVELLELSVDRITDSMAALKKRRTSSNEDAHAWLSGVLTNHVTCLDGLDGSATK  180

Query  582   IMEPMIKDLISRAKsslavlvavaPSTEDDLRAL----NGEFPSWVSASDRRLLEASana  749
             +MEP + +L++RA +SLA+LVA++P   + ++        +FPSWV++ DR LL  S   
Sbjct  181   LMEPRLVELMARAANSLAILVAISPYNTNVIQQYYLRKEIQFPSWVTSRDRLLLRPSQAE  240

Query  750   vaan-vvvaKDGSGKYKTVAEAVASAPDNGKTRYVIYIKKGTYKENVEIGKKKTNVMLIG  926
              A   VVVAKDGSG YKTV EAVASAPDN KTRYVIY+KKGTYKENVE+GKKK N+M++G
Sbjct  241   AAKANVVVAKDGSGNYKTVKEAVASAPDNSKTRYVIYVKKGTYKENVEVGKKKKNLMIVG  300

Query  927   DGLSATIITGSLNYVDGATTFNSATVAAVGDGFIAQDLRIQNTAGPEKHQAVALRLGADQ  1106
             DG+  TIITGSLN VDG+TTF SAT+A  GDGFIAQDL IQNTAGPEKHQAVALR+ ADQ
Sbjct  301   DGMDLTIITGSLNVVDGSTTFKSATIAVGGDGFIAQDLWIQNTAGPEKHQAVALRVSADQ  360

Query  1107  SVINRCKIDAYQDTLYAHSQRQFYRDCYITGTVDFIFGNAAAVIQNSQVVARKPMAAQKN  1286
             SVINRC+IDAYQDTLYAH+ RQFYRDCYITGTVDFIFGNAA V+QN ++ ARKPM+ Q N
Sbjct  361   SVINRCRIDAYQDTLYAHTNRQFYRDCYITGTVDFIFGNAAVVLQNCKIAARKPMSKQSN  420

Query  1287  MVTAQGRTDPNQNTGTSIQNCNVSPSSDLGPVKGTIQTYLGRPWKEYSRTVFMESNIGDH  1466
             MVTAQGRTDPNQNTGTSIQ C+V  SSDL PVKG+I++YLGRPWKEYSRTV M+S+IGDH
Sbjct  421   MVTAQGRTDPNQNTGTSIQKCDVIASSDLEPVKGSIRSYLGRPWKEYSRTVVMQSHIGDH  480

Query  1467  IDPAGWFPWDGDFALKTLYYGEYMNRGPGAGTSKRVNWPGYHVITDKAEAMKFTVAQLIQ  1646
             IDPAGW  W GDFALKTLYYGEY+NRGPGAGTSKRV WPGYHVITD  EA KFTVA+LI 
Sbjct  481   IDPAGWSEWSGDFALKTLYYGEYLNRGPGAGTSKRVKWPGYHVITDPEEAKKFTVAELIG  540

Query  1647  GGSWLKNTGVDYTEGL  1694
             GGSWLK+TGV YTEGL
Sbjct  541   GGSWLKSTGVAYTEGL  556



>ref|XP_007213952.1| hypothetical protein PRUPE_ppa003697mg [Prunus persica]
 gb|EMJ15151.1| hypothetical protein PRUPE_ppa003697mg [Prunus persica]
Length=555

 Score =   665 bits (1715),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/550 (64%), Positives = 421/550 (77%), Gaps = 9/550 (2%)
 Frame = +3

Query  69    LLFTPKRKPSSCRalyvllylaaIVGSVALVSIWAL-RTSSSSPSLWKARVCDPAHDPPS  245
             LL +PK   S C+ LY++L LAAI+ S  LV I  + + +SSS       +CD AHD  S
Sbjct  7     LLDSPKTSTSHCKPLYLILCLAAILSSTTLVGIQVMTKITSSSSYPPPTHICDHAHDQKS  66

Query  246   CMAIVSEVSSAAPTETDGVAllqmllhssllRIQDAVKLSANVNRRINDRKVQAAVADCM  425
             C+A+V+EV+         V LLQ LL  S   I+ A++++ + +  IN+ K  AA+ADC+
Sbjct  67    CLAMVTEVAGDKTKPVSDVDLLQALLEKSTPHIEKALEIAKDASSGINNPKNLAAIADCV  126

Query  426   ELLDLSQDKVMDSMVALGNLSAR-ARTDAHSWLSSVLTNHDTCLDGLSEPARSIMEPMIK  602
             EL+D+S+D+VM S++AL N + + +  DAH+WLSS+LTNH TCLDGL  PAR+IMEP + 
Sbjct  127   ELMDVSRDRVMHSIIALQNFTLQNSLEDAHAWLSSILTNHVTCLDGLQGPARTIMEPRLN  186

Query  603   DLISRAKsslavlva----vaPSTEDDLRALNGEFPSWVSASDRRLLEASanavaanv--  764
             DLISR+++SLA++VA      P  E     LNGEFPSWV++ DRRLL+    A       
Sbjct  187   DLISRSRASLAIMVAISNPSKPKAEIH-EPLNGEFPSWVTSRDRRLLQDYNLAKEVKANI  245

Query  765   vvaKDGSGKYKTVAEAVASAPDNGKTRYVIYIKKGTYKENVEIGKKKTNVMLIGDGLSAT  944
             VVAKDGSG YKT+ EAVA+AP+N KTRY+IY+KKGTYKENVE+GK K N+M++GDG+  T
Sbjct  246   VVAKDGSGNYKTLKEAVAAAPNNSKTRYIIYVKKGTYKENVEVGKDKKNLMIVGDGMDDT  305

Query  945   IITGSLNYVDGATTFNSATVAAVGDGFIAQDLRIQNTAGPEKHQAVALRLGADQSVINRC  1124
             +ITGSLN VDG+TTF SAT+AAVGDGFIAQD+  QNTAG  KHQAVALR+GADQSVINRC
Sbjct  306   VITGSLNVVDGSTTFKSATLAAVGDGFIAQDMWFQNTAGAVKHQAVALRVGADQSVINRC  365

Query  1125  KIDAYQDTLYAHSQRQFYRDCYITGTVDFIFGNAAAVIQNSQVVARKPMAAQKNMVTAQG  1304
             +IDAYQDTLY HS RQFYRD YITGTVDFIFGNAA V QN ++VARKPM  Q NMVTAQG
Sbjct  366   RIDAYQDTLYTHSNRQFYRDSYITGTVDFIFGNAAVVFQNCKLVARKPMTGQNNMVTAQG  425

Query  1305  RTDPNQNTGTSIQNCNVSPSSDLGPVKGTIQTYLGRPWKEYSRTVFMESNIGDHIDPAGW  1484
             R DPNQNTGTSIQ C++  SSDL PVKGTI++YLGRPWKEYSRTV M+S IGDHIDP+GW
Sbjct  426   RIDPNQNTGTSIQKCDIIASSDLEPVKGTIRSYLGRPWKEYSRTVVMQSKIGDHIDPSGW  485

Query  1485  FPWDGDFALKTLYYGEYMNRGPGAGTSKRVNWPGYHVITDKAEAMKFTVAQLIQGGSWLK  1664
               W GDFALKTLYYGEY N G GAGTSKRV W GYHVIT   EA  FTVAQLIQGGSWLK
Sbjct  486   SIWSGDFALKTLYYGEYANSGAGAGTSKRVKWAGYHVITSPTEAQTFTVAQLIQGGSWLK  545

Query  1665  NTGVDYTEGL  1694
             +TGV YTEGL
Sbjct  546   STGVAYTEGL  555



>ref|XP_006449081.1| hypothetical protein CICLE_v10014787mg [Citrus clementina]
 gb|ESR62321.1| hypothetical protein CICLE_v10014787mg [Citrus clementina]
Length=556

 Score =   664 bits (1713),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/556 (63%), Positives = 421/556 (76%), Gaps = 6/556 (1%)
 Frame = +3

Query  45    MATTSHLPLLFTPKRKPSSCRalyvllylaaIVGSVALVSIWALRTSSSSPSLWKARVCD  224
             MAT     LL     K S  + L ++L + +++ S   V+I  ++  +S+      ++C 
Sbjct  1     MATIDRPLLLKLHTPKASKRKILLLILSVVSVMCSATFVAIHCIKAINSNNHWSLHQICA  60

Query  225   PAHDPPSCMAIVSEVSSA-APTETDGVAllqmllhssllRIQDAVKLSANVNRRINDRKV  401
              A D  SCMA+VSE +S  A T+ + V LL + L+ S   IQ+ ++++ +V  RIN  + 
Sbjct  61    NARDQSSCMAMVSETTSINATTKMNEVDLLLIFLNKSTSYIQETIEVANHVKHRINSPRG  120

Query  402   QAAVADCMELLDLSQDKVMDSMVALGNLSARARTDAHSWLSSVLTNHDTCLDGLSEPARS  581
             QAA+ DC+ELL+LS D++ DSM AL      +  DAH+WLS VLTNH TCLDGL   A  
Sbjct  121   QAALTDCVELLELSVDRITDSMAALKKRRTSSNEDAHAWLSGVLTNHVTCLDGLDGSATK  180

Query  582   IMEPMIKDLISRAKsslavlvavaPSTEDDLRAL----NGEFPSWVSASDRRLLEASana  749
             +MEP + +L++RA +SLA+LVA++P   + ++        +FPSWV++ DR LL  S   
Sbjct  181   LMEPRLVELMARAANSLAILVAISPYNTNVIQQYYLRKEIQFPSWVTSRDRLLLRPSQAE  240

Query  750   vaan-vvvaKDGSGKYKTVAEAVASAPDNGKTRYVIYIKKGTYKENVEIGKKKTNVMLIG  926
              A   VVVAKDGSG YKTV EAVASAPDN KTRYVIY+KKGTYKENVE+GKKK N+M++G
Sbjct  241   AAKANVVVAKDGSGNYKTVKEAVASAPDNSKTRYVIYVKKGTYKENVEVGKKKKNLMIVG  300

Query  927   DGLSATIITGSLNYVDGATTFNSATVAAVGDGFIAQDLRIQNTAGPEKHQAVALRLGADQ  1106
             DG+  TIITGSLN VDG+TTF SAT+A  GDGFIAQDL IQNTAGPEKHQAVALR+ ADQ
Sbjct  301   DGMDLTIITGSLNVVDGSTTFKSATIAVGGDGFIAQDLWIQNTAGPEKHQAVALRVSADQ  360

Query  1107  SVINRCKIDAYQDTLYAHSQRQFYRDCYITGTVDFIFGNAAAVIQNSQVVARKPMAAQKN  1286
             SVINRC+IDAYQDTLYAH+ RQFYRDCYITGTVDFIFGNAA V+QN ++ ARKPM+ Q N
Sbjct  361   SVINRCRIDAYQDTLYAHTNRQFYRDCYITGTVDFIFGNAAVVLQNCKIAARKPMSKQSN  420

Query  1287  MVTAQGRTDPNQNTGTSIQNCNVSPSSDLGPVKGTIQTYLGRPWKEYSRTVFMESNIGDH  1466
             MVTAQGRTDPNQNTGTSIQ C V  SSDL PVKG+I++YLGRPWKEYSRTV M+S+IG H
Sbjct  421   MVTAQGRTDPNQNTGTSIQKCEVIASSDLEPVKGSIRSYLGRPWKEYSRTVVMQSHIGGH  480

Query  1467  IDPAGWFPWDGDFALKTLYYGEYMNRGPGAGTSKRVNWPGYHVITDKAEAMKFTVAQLIQ  1646
             IDPAGW  W GDFALKTLYYGEY+NRGPGAGTSKRV WPGYHVITD  EA KFTVA+LI 
Sbjct  481   IDPAGWSEWSGDFALKTLYYGEYLNRGPGAGTSKRVKWPGYHVITDPGEAKKFTVAELIG  540

Query  1647  GGSWLKNTGVDYTEGL  1694
             GGSWLK+TGV YTEGL
Sbjct  541   GGSWLKSTGVAYTEGL  556



>gb|KJB67143.1| hypothetical protein B456_010G177500 [Gossypium raimondii]
Length=547

 Score =   662 bits (1708),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 348/549 (63%), Positives = 425/549 (77%), Gaps = 4/549 (1%)
 Frame = +3

Query  51    TTSHLPLLFTPKRKPSSCRalyvllylaaIVGSVALVSIWALRTSSSSPSLWKARVCDPA  230
             TT H PLL   + K S  R L ++L L AI+ S ALVS+  +R SSS  +L   R C+ A
Sbjct  2     TTPHQPLL--DRSKTSYTRILLLILTLVAIMCSAALVSVRLVRFSSSGTAL-PYRFCERA  58

Query  231   HDPPSCMAIVSEVSSAAPTET-DGVAllqmllhssllRIQDAVKLSANVNRRINDRKVQA  407
              D  SC  ++SE++S    +  D   +LQ  L  S +R+Q+A+ ++     R+N+   QA
Sbjct  59    VDKKSCSVLLSEMASNTTLKMKDAGDVLQAFLEQSKVRMQNAMNVAKKFKHRVNNPGEQA  118

Query  408   AVADCMELLDLSQDKVMDSMVALGNLSARARTDAHSWLSSVLTNHDTCLDGLSEPARSIM  587
             A+ADCMEL++ S D++MDS+VA+    A + ++AH+WLSSVLTNH TCLDGL   AR++M
Sbjct  119   ALADCMELMESSMDRIMDSIVAVEKQDAISYSNAHTWLSSVLTNHVTCLDGLEGSARTLM  178

Query  588   EPMIKDLISRAKsslavlvavaPSTEDDLRALNGEFPSWVSASDRRLLEASanavaanvv  767
             EP   DLISRA++SLA+ V+ +P     +  L   FPSWVS  DR+LL++  N + ANVV
Sbjct  179   EPGFNDLISRARTSLAIFVSFSPRKTKLIDPLIDRFPSWVSNKDRKLLQSLPNEIKANVV  238

Query  768   vaKDGSGKYKTVAEAVASAPDNGKTRYVIYIKKGTYKENVEIGKKKTNVMLIGDGLSATI  947
             VAKDGSGKYKT+ EAVA+APD  KTRY+IY+KKGTYKENVEIGK K N+M++GDG+ +TI
Sbjct  239   VAKDGSGKYKTLGEAVAAAPDKSKTRYIIYVKKGTYKENVEIGKNKKNLMIVGDGMKSTI  298

Query  948   ITGSLNYVDGATTFNSATVAAVGDGFIAQDLRIQNTAGPEKHQAVALRLGADQSVINRCK  1127
             ITGSLN +DG+TTF SATVAAVGDGF+AQD+  QNTAGP+KHQAVALR+GADQSV+NRC+
Sbjct  299   ITGSLNVIDGSTTFRSATVAAVGDGFMAQDIWFQNTAGPQKHQAVALRVGADQSVLNRCQ  358

Query  1128  IDAYQDTLYAHSQRQFYRDCYITGTVDFIFGNAAAVIQNSQVVARKPMAAQKNMVTAQGR  1307
             ID YQDTLY HS RQFYRD  ITGTVDFIFG+AA V QN ++V RKPM  Q NMVTAQGR
Sbjct  359   IDGYQDTLYTHSNRQFYRDSEITGTVDFIFGDAAVVFQNCKLVVRKPMDKQSNMVTAQGR  418

Query  1308  TDPNQNTGTSIQNCNVSPSSDLGPVKGTIQTYLGRPWKEYSRTVFMESNIGDHIDPAGWF  1487
              DPNQNTGTSIQ+CN+  SSDL PVKG+ ++YLGRPWKEYSRTV M+S+IGDHIDP+GW 
Sbjct  419   IDPNQNTGTSIQSCNIIASSDLEPVKGSFKSYLGRPWKEYSRTVVMQSHIGDHIDPSGWS  478

Query  1488  PWDGDFALKTLYYGEYMNRGPGAGTSKRVNWPGYHVITDKAEAMKFTVAQLIQGGSWLKN  1667
              W+GDFALKTLYYGEY+N+GPGAGTSKRV WPGYHVIT   EA KFTVA LIQGGSWLK 
Sbjct  479   VWNGDFALKTLYYGEYVNKGPGAGTSKRVKWPGYHVITSAEEAKKFTVAGLIQGGSWLKP  538

Query  1668  TGVDYTEGL  1694
             TGV +TEGL
Sbjct  539   TGVIFTEGL  547



>ref|XP_010101471.1| Pectinesterase/pectinesterase inhibitor [Morus notabilis]
 gb|EXB88454.1| Pectinesterase/pectinesterase inhibitor [Morus notabilis]
Length=552

 Score =   662 bits (1708),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/556 (62%), Positives = 428/556 (77%), Gaps = 10/556 (2%)
 Frame = +3

Query  45    MATTSHLPLLFTPKRKPSSCRalyvllylaaIVGSVALVSIWALRTSSSS--PSLWKARV  218
             MAT    PLL T K   S    L ++   A +  S A  +I +++T+S S  P+L   ++
Sbjct  1     MATNQ--PLLETSKSSHSKIPYLLLISIAALV--STAFFAIHSIKTTSLSTPPNLPLHKI  56

Query  219   CDPAHDPPSCMAIVSEVSSAAPTETDGVAllqmllhssllRIQDAVKLSANVNRRINDRK  398
             CD + D  SC+A+VSE +    T  D   LL+  L  +  RIQ A+K++ +V  RIN+ +
Sbjct  57    CDQSVDKESCLAMVSEAARQYSTVADHHDLLKAFLEKTTPRIQQALKMANDVRLRINNPR  116

Query  399   VQAAVADCMELLDLSQDKVMDSM--VALGNLSARARTDAHSWLSSVLTNHDTCLDGLSEP  572
              +A + DC EL+D+S+D+V+DS+  + L   ++ +  D H+WLSSVLTNH TCLD L + 
Sbjct  117   DRATLLDCAELMDISKDRVVDSISTLFLQKQTSHSHEDVHAWLSSVLTNHVTCLDALEDG  176

Query  573   --ARSIMEPMIKDLISRAKsslavlvavaPSTEDDLRALNGEFPSWVSASDRRLLEASan  746
               A+++M+  + +LI RA++SLA+LV+V PS  + +  L  + P+WV+A DRRLL+AS  
Sbjct  177   SYAKNLMDSHLNELILRARTSLAILVSVFPSNSEAIETLTDDLPTWVTAGDRRLLQASVK  236

Query  747   avaanvvvaKDGSGKYKTVAEAVASAPDNGKTRYVIYIKKGTYKENVEIGKKKTNVMLIG  926
             A+ A++VVA+DGSGKYKTV EAVA+ PDN KTR+ IY+KKGTYKENVEIGKKK NVML+G
Sbjct  237   AIKADIVVAEDGSGKYKTVKEAVAAVPDNSKTRFTIYVKKGTYKENVEIGKKKKNVMLVG  296

Query  927   DGLSATIITGSLNYVDGATTFNSATVAAVGDGFIAQDLRIQNTAGPEKHQAVALRLGADQ  1106
             DG+ +TIITGSLN +DG+TTFNSATVAAVGDGFIAQD+  QNTAGP+KHQAVALR+GADQ
Sbjct  297   DGMDSTIITGSLNVIDGSTTFNSATVAAVGDGFIAQDIWFQNTAGPQKHQAVALRVGADQ  356

Query  1107  SVINRCKIDAYQDTLYAHSQRQFYRDCYITGTVDFIFGNAAAVIQNSQVVARKPMAAQKN  1286
             SVINRC+IDAYQDTLYAHS RQFYRD  +TGTVDFIFGNAA V QN ++VARK M+ QKN
Sbjct  357   SVINRCRIDAYQDTLYAHSNRQFYRDSTVTGTVDFIFGNAAVVFQNCKLVARKGMSGQKN  416

Query  1287  MVTAQGRTDPNQNTGTSIQNCNVSPSSDLGPVKGTIQTYLGRPWKEYSRTVFMESNIGDH  1466
             MVTAQGRTDPNQNTGTSIQ C +S SSDL PVK + ++YLGRPWKEYSRTV M+S IGD 
Sbjct  417   MVTAQGRTDPNQNTGTSIQKCEISASSDLEPVKASYKSYLGRPWKEYSRTVVMQSTIGDL  476

Query  1467  IDPAGWFPWDGDFALKTLYYGEYMNRGPGAGTSKRVNWPGYHVITDKAEAMKFTVAQLIQ  1646
             IDPAGW  WD DFALKTLYYGEY N+GPGAGTSKRVNW GYHVIT  +EA KFTVA+LIQ
Sbjct  477   IDPAGWAEWDKDFALKTLYYGEYANQGPGAGTSKRVNWAGYHVITSPSEAQKFTVAELIQ  536

Query  1647  GGSWLKNTGVDYTEGL  1694
             GG WLKN+GV YTEGL
Sbjct  537   GGYWLKNSGVAYTEGL  552



>ref|XP_009364480.1| PREDICTED: pectinesterase [Pyrus x bretschneideri]
Length=558

 Score =   662 bits (1707),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 353/553 (64%), Positives = 419/553 (76%), Gaps = 10/553 (2%)
 Frame = +3

Query  66    PLLFTPKRKPSSCRalyvllylaaIVGSVALVSIWALR--TSSSSPSLWK-ARVCDPAHD  236
             PLL  PK   S C+   ++L L A++ S  L SI  L    S S+P L     +CD A D
Sbjct  6     PLLEAPKTITSHCKPYSLVLCLVAVISSTTLFSIHVLTKLASFSNPPLTGLTHICDHALD  65

Query  237   PPSCMAIVSEVSSAAPTETDGVAllqmllhssllRIQDAVKLSANVNRRINDRKVQAAVA  416
               SC++IVSE S        G  LLQ +L +S+ ++Q  ++++   + RIN  K +AA+ 
Sbjct  66    QKSCLSIVSETSHGTTKPMSGADLLQTILQNSIPQLQKTLEIAKVAHSRINSPKDRAAIV  125

Query  417   DCMELLDLSQDKVMDSMVALGNLSAR---ARTDAHSWLSSVLTNHDTCLDGLSEPARSIM  587
             DC+EL+D+++D+VMDSMVAL    A+   +  D H WLSSVLTNH TCLDGL  PAR++M
Sbjct  126   DCVELMDVTKDRVMDSMVALQKFGAQNYYSLEDVHGWLSSVLTNHVTCLDGLEGPARTMM  185

Query  588   EPMIKDLISRAKsslavlvava-PSTEDDLRA-LNGEFPSWVSASDRRLLEAS--anava  755
             EP + DL+SR+++SLA++VA++ PS  + ++  L+G FP+WV++ DRRLL  S  A    
Sbjct  186   EPWLNDLVSRSRASLAIVVAISDPSKSNTIKERLDGNFPTWVTSKDRRLLLDSNLAKESN  245

Query  756   anvvvaKDGSGKYKTVAEAVASAPDNGKTRYVIYIKKGTYKENVEIGKKKTNVMLIGDGL  935
             AN VVAKDGSG YKTV EAVA+APDN KTRY I++KKGTYKEN E+GKKK N+M+ GDG+
Sbjct  246   ANAVVAKDGSGNYKTVKEAVAAAPDNSKTRYTIHVKKGTYKENFEVGKKKKNLMITGDGM  305

Query  936   SATIITGSLNYVDGATTFNSATVAAVGDGFIAQDLRIQNTAGPEKHQAVALRLGADQSVI  1115
               TIITGSLN VDGATTFNSAT+AAVGDGFIAQD+  QNTAG  KHQAVALR+GADQSVI
Sbjct  306   HNTIITGSLNVVDGATTFNSATLAAVGDGFIAQDIWFQNTAGAAKHQAVALRVGADQSVI  365

Query  1116  NRCKIDAYQDTLYAHSQRQFYRDCYITGTVDFIFGNAAAVIQNSQVVARKPMAAQKNMVT  1295
             NRC+IDAYQDTLYAHS RQFYRD  ITGTVDFIFGNAA V QN ++VARKPM  Q NMVT
Sbjct  366   NRCRIDAYQDTLYAHSNRQFYRDSNITGTVDFIFGNAAVVFQNCKIVARKPMTGQNNMVT  425

Query  1296  AQGRTDPNQNTGTSIQNCNVSPSSDLGPVKGTIQTYLGRPWKEYSRTVFMESNIGDHIDP  1475
             AQGR DPNQNTGTSIQ C+V  SSDL PVKGTI+TYLGRPWKEYSRTV M+S IGDHIDP
Sbjct  426   AQGRIDPNQNTGTSIQKCDVVASSDLEPVKGTIRTYLGRPWKEYSRTVVMQSKIGDHIDP  485

Query  1476  AGWFPWDGDFALKTLYYGEYMNRGPGAGTSKRVNWPGYHVITDKAEAMKFTVAQLIQGGS  1655
             AGW  W GDFALKTLYYGEY N GPGAGT+KRV W GYHVI    +A  FTVA LIQGGS
Sbjct  486   AGWSIWSGDFALKTLYYGEYANSGPGAGTNKRVKWAGYHVIKSPKKAQPFTVANLIQGGS  545

Query  1656  WLKNTGVDYTEGL  1694
             WLK+TGV YTEGL
Sbjct  546   WLKSTGVTYTEGL  558



>ref|XP_006467993.1| PREDICTED: pectinesterase/pectinesterase inhibitor-like [Citrus 
sinensis]
Length=556

 Score =   661 bits (1705),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 348/556 (63%), Positives = 419/556 (75%), Gaps = 6/556 (1%)
 Frame = +3

Query  45    MATTSHLPLLFTPKRKPSSCRalyvllylaaIVGSVALVSIWALRTSSSSPSLWKARVCD  224
             MAT     LL     K S  + L ++L + +++ S   V+I  ++  +S+      + C 
Sbjct  1     MATIDRPLLLKLHTPKASKRKILLLILSVVSVMCSATFVAIHCIKAINSNNHWSLHQFCA  60

Query  225   PAHDPPSCMAIVSEVSSA-APTETDGVAllqmllhssllRIQDAVKLSANVNRRINDRKV  401
              A D  SC+A+VSE +S  A T+ + V LL + L  S   IQ+ ++++ +V  RIN  + 
Sbjct  61    KAQDQSSCIAMVSETTSINATTKMNEVDLLLIFLSKSTSNIQETIEVANHVKHRINSPRG  120

Query  402   QAAVADCMELLDLSQDKVMDSMVALGNLSARARTDAHSWLSSVLTNHDTCLDGLSEPARS  581
             QAA+ DC+ELL+LS D++ DSM AL      +  DAH+WLS VLTNH TCLDGL   A  
Sbjct  121   QAALTDCVELLELSVDRITDSMAALKKRRTSSNEDAHAWLSGVLTNHVTCLDGLDGSATK  180

Query  582   IMEPMIKDLISRAKsslavlvavaPSTEDDLRAL----NGEFPSWVSASDRRLLEASana  749
             +MEP + +L++RA +SLA+LVA++P   + ++        +FPSWV++ DR LL  S   
Sbjct  181   LMEPRLVELMARAANSLAILVAISPYNTNVIQQYYLRKEIQFPSWVTSRDRLLLRPSQAE  240

Query  750   vaan-vvvaKDGSGKYKTVAEAVASAPDNGKTRYVIYIKKGTYKENVEIGKKKTNVMLIG  926
              A   VVVAKDGSG YKTV EAVASAPDN KTRYVIY+KKGTYKENVE+GKKK N+M++G
Sbjct  241   AAKANVVVAKDGSGNYKTVKEAVASAPDNSKTRYVIYVKKGTYKENVEVGKKKKNLMIVG  300

Query  927   DGLSATIITGSLNYVDGATTFNSATVAAVGDGFIAQDLRIQNTAGPEKHQAVALRLGADQ  1106
             DG+  TIITGSLN VDG+TTF SAT+A  GDGFIAQDL IQNTAGPEKHQAVALR+ ADQ
Sbjct  301   DGMDLTIITGSLNVVDGSTTFKSATIAVGGDGFIAQDLWIQNTAGPEKHQAVALRVSADQ  360

Query  1107  SVINRCKIDAYQDTLYAHSQRQFYRDCYITGTVDFIFGNAAAVIQNSQVVARKPMAAQKN  1286
             SVINRC+IDAYQDTLYAH+ RQFYRDC ITGTVDFIFGNAA V+QN ++ ARKPM+ Q N
Sbjct  361   SVINRCRIDAYQDTLYAHTNRQFYRDCDITGTVDFIFGNAAVVLQNCKIAARKPMSKQSN  420

Query  1287  MVTAQGRTDPNQNTGTSIQNCNVSPSSDLGPVKGTIQTYLGRPWKEYSRTVFMESNIGDH  1466
             MVTAQGRTDPNQNTGTSIQ C V  SSDL PVKG+I++YLGRPWKEYSRTV M+S+IGDH
Sbjct  421   MVTAQGRTDPNQNTGTSIQKCEVIASSDLEPVKGSIRSYLGRPWKEYSRTVVMQSHIGDH  480

Query  1467  IDPAGWFPWDGDFALKTLYYGEYMNRGPGAGTSKRVNWPGYHVITDKAEAMKFTVAQLIQ  1646
             IDPAGW  W GDFALKTLYYGEY+NRGPGAGTSKRV WPGYHVITD  EA KFTVA+LI 
Sbjct  481   IDPAGWSEWSGDFALKTLYYGEYLNRGPGAGTSKRVKWPGYHVITDPEEAKKFTVAELIG  540

Query  1647  GGSWLKNTGVDYTEGL  1694
             GGSWLK+TGV YTEGL
Sbjct  541   GGSWLKSTGVAYTEGL  556



>ref|XP_008371117.1| PREDICTED: pectinesterase [Malus domestica]
Length=558

 Score =   657 bits (1695),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/553 (64%), Positives = 415/553 (75%), Gaps = 10/553 (2%)
 Frame = +3

Query  66    PLLFTPKRKPSSCRalyvllylaaIVGSVALVSIWALR--TSSSSPSLWK-ARVCDPAHD  236
             PLL   K   S C+   ++L L A++ S    SI  L    SSS+P L    +VCD A D
Sbjct  6     PLLEAXKTTTSHCKPYSLVLCLVAVISSTTJFSIHVLTKFASSSNPPLTGLTQVCDHALD  65

Query  237   PPSCMAIVSEVSSAAPTETDGVAllqmllhssllRIQDAVKLSANVNRRINDRKVQAAVA  416
               SC++IVSE S        G  LLQ +L +S+ ++Q  + ++   + RIN  K +AA+ 
Sbjct  66    QKSCLSIVSETSHGTTKPMSGADLLQTILQNSMPQLQKTLDIAKVAHSRINSPKDRAAIV  125

Query  417   DCMELLDLSQDKVMDSMVALGNLSAR---ARTDAHSWLSSVLTNHDTCLDGLSEPARSIM  587
             DC+EL+D+++D+VMDSMVAL    A    +  D H WLSSVLTNH TCLDGL  PAR++M
Sbjct  126   DCVELMDVTKDRVMDSMVALQKFGAHNYYSLEDVHGWLSSVLTNHVTCLDGLEGPARTMM  185

Query  588   EPMIKDLISRAKsslavlvavaPSTEDD--LRALNGEFPSWVSASDRRLLEAS--anava  755
             EP + DL+SR+ +SLA++VA++  ++ +     L+G FP+WV++ DRRLL  S  A    
Sbjct  186   EPWLNDLVSRSXASLAIVVAISDRSKSNPIKERLDGIFPTWVTSKDRRLLLDSNLAKESN  245

Query  756   anvvvaKDGSGKYKTVAEAVASAPDNGKTRYVIYIKKGTYKENVEIGKKKTNVMLIGDGL  935
             AN VVAKDGSG YKTV EAVA+APDN KTRY I++KKGTYKENVE+GKKK N+M  GDG+
Sbjct  246   ANAVVAKDGSGNYKTVKEAVAAAPDNSKTRYXIHVKKGTYKENVEVGKKKKNLMXTGDGM  305

Query  936   SATIITGSLNYVDGATTFNSATVAAVGDGFIAQDLRIQNTAGPEKHQAVALRLGADQSVI  1115
               TIITGSLN VDGATTFNSAT+AAVGDGFIAQD+  QNTAG  KHQAVALR+GAD+SVI
Sbjct  306   HNTIITGSLNVVDGATTFNSATLAAVGDGFIAQDIWFQNTAGAAKHQAVALRVGADRSVI  365

Query  1116  NRCKIDAYQDTLYAHSQRQFYRDCYITGTVDFIFGNAAAVIQNSQVVARKPMAAQKNMVT  1295
             NRC+IDAYQDTLYAHS RQFYRD  ITGTVDFIFGNAA V QN ++VARKPM  Q NMVT
Sbjct  366   NRCRIDAYQDTLYAHSNRQFYRDSXITGTVDFIFGNAAVVFQNCKIVARKPMTGQNNMVT  425

Query  1296  AQGRTDPNQNTGTSIQNCNVSPSSDLGPVKGTIQTYLGRPWKEYSRTVFMESNIGDHIDP  1475
             AQGR DPNQNTGTSIQ C+V  SSDL PVKGTI++YLGRPWKEYSRTV M+S IGDHIDP
Sbjct  426   AQGRIDPNQNTGTSIQKCDVVASSDLEPVKGTIRSYLGRPWKEYSRTVVMQSKIGDHIDP  485

Query  1476  AGWFPWDGDFALKTLYYGEYMNRGPGAGTSKRVNWPGYHVITDKAEAMKFTVAQLIQGGS  1655
             AGW  W GDFALKTLYYGEY N GPGAGTSKRV W GYHVIT   +A  FTVA LIQGGS
Sbjct  486   AGWSIWSGDFALKTLYYGEYANSGPGAGTSKRVKWAGYHVITSPKKAQPFTVANLIQGGS  545

Query  1656  WLKNTGVDYTEGL  1694
             WLK+TGV YTEGL
Sbjct  546   WLKSTGVTYTEGL  558



>emb|CAD29733.1| pectin methylesterase [Sesbania rostrata]
Length=554

 Score =   655 bits (1690),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 340/528 (64%), Positives = 413/528 (78%), Gaps = 10/528 (2%)
 Frame = +3

Query  138   IVGSVALVSIWALRTSSSSPSLWKARVCDPAHDPPSCMAIVSEVSSA---APTETDGVAl  308
             I+ S AL++ +    +S         VC+ A D  SC+A VSEV+     A T+   + L
Sbjct  28    IISSSALIASYLFNPTSFFNLTSSPHVCEHALDTKSCLAHVSEVAQGPILATTKDHKLNL  87

Query  309   lqmllhssllRIQDAVKLSANVNRRINDRKVQAAVADCMELLDLSQDKVMDSMVALGNLS  488
             L  LL  S  +IQ+A+     +  +IN+ K +AA+ DC +L+DLS D+V DS+VAL   +
Sbjct  88    LISLLTQSTPQIQNAMDTVKAIKHKINNPKEEAALHDCEQLMDLSIDRVWDSVVALTKNT  147

Query  489   ARARTDAHSWLSSVLTNHDTCLDGLSEPARSIMEPMIKDLISRAKsslavlvavaPSTED  668
               ++ D HSWLSSVLTNH TCLDGL   +R++ME  ++DL+SRA++SLA+LVAV P   +
Sbjct  148   IDSQQDTHSWLSSVLTNHATCLDGLEGTSRALMEAELEDLMSRARTSLAMLVAVLPPKGN  207

Query  669   DL---RALNGEFPSWVSASDRRLLEASanavaanvvvaKDGSGKYKTVAEAVASAPDNGK  839
             +     +LNG+FPSWV++ DRRLLE+S   + ANVVVAKDGSGK+KTVAEA+ASAPDNGK
Sbjct  208   EQFIDESLNGDFPSWVTSKDRRLLESSIRDIKANVVVAKDGSGKFKTVAEAIASAPDNGK  267

Query  840   TRYVIYIKKGTYKENVEIGKKKTNVMLIGDGLSATIITGSLNYVDGATTFNSATVAAVGD  1019
             TRYVIY+KKGTYKENVEIGKKKTNVML+GDG+ AT+ITG+LN +DG+TTF SATVAAVGD
Sbjct  268   TRYVIYVKKGTYKENVEIGKKKTNVMLVGDGMDATVITGNLNVIDGSTTFKSATVAAVGD  327

Query  1020  GFIAQDLRIQNTAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYAHSQRQFYRDCYITG  1199
             GFIAQD+  QNTAGP+KHQAVALR+GADQSVINRC++DA+QDTLYAHS RQFYRD +ITG
Sbjct  328   GFIAQDIWFQNTAGPQKHQAVALRVGADQSVINRCRMDAFQDTLYAHSNRQFYRDSFITG  387

Query  1200  TVDFIFGNAAAVIQNSQVVARKPMAAQKNMVTAQGRTDPNQNTGTSIQNCNVSPSSDLGP  1379
             TVDFIFGNA  V Q  ++VARKPM  QKNMVTAQGR DPNQNTGTSIQ C+V+PSSDL P
Sbjct  388   TVDFIFGNAPVVFQKCKLVARKPMNNQKNMVTAQGREDPNQNTGTSIQQCDVTPSSDLKP  447

Query  1380  VKGTIQTYLGRPWKEYSRTVFMESNIGDHIDPAGWFPWDG---DFALKTLYYGEYMNRGP  1550
             V G+I+T+LGRPWK++SRTV ++S + +HIDP GW  WD    DF L TLYYGEYMN GP
Sbjct  448   VVGSIKTFLGRPWKKFSRTVVLQSFVDNHIDPTGWAEWDAQSKDF-LNTLYYGEYMNNGP  506

Query  1551  GAGTSKRVNWPGYHVITDKAEAMKFTVAQLIQGGSWLKNTGVDYTEGL  1694
             GAGTSKRVNWPGYHVIT  AEA KFTV QLIQG  WLKNTGV++ EGL
Sbjct  507   GAGTSKRVNWPGYHVITSAAEASKFTVRQLIQGNVWLKNTGVNFIEGL  554



>ref|XP_007157172.1| hypothetical protein PHAVU_002G048700g [Phaseolus vulgaris]
 gb|ESW29166.1| hypothetical protein PHAVU_002G048700g [Phaseolus vulgaris]
Length=549

 Score =   655 bits (1689),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/556 (63%), Positives = 415/556 (75%), Gaps = 18/556 (3%)
 Frame = +3

Query  54    TSHLPLLFTPKRKPSSCRalyvllylaaIVGSVALVSIWALRTSSSSPSLWKARVCDPAH  233
             T    LL  PK KP S + + + L + A++ S A ++ +    SS         VCD A 
Sbjct  3     TQQQSLLEKPK-KPVS-KTICLFLSVIAVLSSSAFIASYLFNNSSLH------HVCDQAL  54

Query  234   DPPSCMAIVSEVSSAAPTETDG---VAllqmllhssllRIQDAVKLSANVNRRINDRKVQ  404
             D  SC+  VSEV+      T     + LL+  L      I+  +  ++ +  R+N+ + +
Sbjct  55    DTASCLTHVSEVTKTHTFTTTEHHKLNLLKSFLMKYTSHIEKVMDTTSAIKLRVNNPREE  114

Query  405   AAVADCMELLDLSQDKVMDSMVALGNLSARARTDAHSWLSSVLTNHDTCLDGLSEPARSI  584
             AA+ DC EL+DLS D+V  SM+A+   S  +R DAH+WLSSVLTNH TCLDGL   +RS+
Sbjct  115   AALRDCAELMDLSLDRVWSSMLAVTEQSIESRQDAHTWLSSVLTNHATCLDGLEGASRSV  174

Query  585   MEPMIKDLISRAKsslavlvava--PSTEDDL-RALNGEFPSWVSASDRRLLEASanava  755
             ME  ++DLISRA++SLA+LV     P  E+ +   LNGEFPSWVS+ DRRLLE+    + 
Sbjct  175   MEGEVEDLISRARTSLAILVGSVLPPKVEEIIDEPLNGEFPSWVSSKDRRLLESGVGDIK  234

Query  756   anvvvaKDGSGKYKTVAEAVASAPDNGKTRYVIYIKKGTYKENVEIGKKKTNVMLIGDGL  935
             ANVVVAKDGSGK+KTV EAVASAPDNGKTRYVIY+KKGTYKENVEIGKKK NVML+GDG+
Sbjct  235   ANVVVAKDGSGKFKTVTEAVASAPDNGKTRYVIYVKKGTYKENVEIGKKKKNVMLVGDGM  294

Query  936   SATIITGSLNYVDGATTFNSATVAAVGDGFIAQDLRIQNTAGPEKHQAVALRLGADQSVI  1115
              ATIITGSLN++DG TTFNSATVAAVGDGFI QD+  QNTAGPEKHQAVALR+GADQSVI
Sbjct  295   DATIITGSLNFIDGTTTFNSATVAAVGDGFIGQDIWFQNTAGPEKHQAVALRVGADQSVI  354

Query  1116  NRCKIDAYQDTLYAHSQRQFYRDCYITGTVDFIFGNAAAVIQNSQVVARKPMAAQKNMVT  1295
             NRC+IDA+QDTLYAHS RQFYRD +ITGTVDFIFGNAA V Q   +VARKPM+ QKNMVT
Sbjct  355   NRCRIDAFQDTLYAHSNRQFYRDSFITGTVDFIFGNAAVVFQKCNLVARKPMSNQKNMVT  414

Query  1296  AQGRTDPNQNTGTSIQNCNVSPSSDLGPVKGTIQTYLGRPWKEYSRTVFMESNIGDHIDP  1475
             AQGR DPNQNTGTSIQ CN++PSSDL PV G+I+T+LGRPWK+YSRTV M+S I +H+DP
Sbjct  415   AQGREDPNQNTGTSIQQCNLTPSSDLKPVVGSIKTFLGRPWKKYSRTVVMQSTIDNHVDP  474

Query  1476  AGWFPWDG---DFALKTLYYGEYMNRGPGAGTSKRVNWPGYHVITDKAEAMKFTVAQLIQ  1646
              GW  WD    DF L+TLYYGEYMN G GAGTSKRV WPGYHVI   AEA KFTV QLIQ
Sbjct  475   TGWAEWDAQSKDF-LQTLYYGEYMNSGAGAGTSKRVTWPGYHVIKTAAEASKFTVTQLIQ  533

Query  1647  GGSWLKNTGVDYTEGL  1694
             G  WLKNTGV++ EGL
Sbjct  534   GNVWLKNTGVNFIEGL  549



>gb|AAC14742.1| pectin methylesterase [Pisum sativum]
 gb|AAC32273.1| pectin methylesterase [Pisum sativum]
Length=554

 Score =   654 bits (1688),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/528 (65%), Positives = 408/528 (77%), Gaps = 10/528 (2%)
 Frame = +3

Query  138   IVGSVALVSIWALRTSSSSPSLWKARVCDPAHDPPSCMAIVSEV---SSAAPTETDGVAl  308
             I+GS AL+     +  S  P      +C+ A D  SC+  VSEV    + A T+   ++ 
Sbjct  28    IIGSSALIVSHLNKPISFFPLSSAPNLCEHAVDTKSCLTHVSEVVQGQALANTKDHKLST  87

Query  309   lqmllhssllRIQDAVKLSANVNRRINDRKVQAAVADCMELLDLSQDKVMDSMVALGNLS  488
             L  LL  S   IQ A++ +  + RR+N  K + A+ DC +L+DLS D+V DS++ L   +
Sbjct  88    LISLLTKSTSHIQKAMETANVIKRRVNSPKKETALNDCEQLMDLSMDRVWDSVLTLTKNN  147

Query  489   ARARTDAHSWLSSVLTNHDTCLDGLSEPARSIMEPMIKDLISRAKsslavlvavaPSTED  668
               ++ DAH+WLSSVLTNH TCL+GL   +R +ME  ++DLISRA+SSLAVLV+V P+  +
Sbjct  148   IDSQQDAHTWLSSVLTNHATCLNGLEGTSRVVMESDLQDLISRARSSLAVLVSVLPAKSN  207

Query  669   DL---RALNGEFPSWVSASDRRLLEASanavaanvvvaKDGSGKYKTVAEAVASAPDNGK  839
             D     +LNGEFPSWV++ DRRLLE++   + ANVVVAKDGSGK+KTVAEAVASAPDNGK
Sbjct  208   DGFIDESLNGEFPSWVTSKDRRLLESTVGDIKANVVVAKDGSGKFKTVAEAVASAPDNGK  267

Query  840   TRYVIYIKKGTYKENVEIGKKKTNVMLIGDGLSATIITGSLNYVDGATTFNSATVAAVGD  1019
              RYVIY+K+GTYKE VEIGKKKTNVML+GDG+ ATIITG+LN++DG TTFNSATVAAVGD
Sbjct  268   ARYVIYVKRGTYKEKVEIGKKKTNVMLVGDGMDATIITGNLNFIDGTTTFNSATVAAVGD  327

Query  1020  GFIAQDLRIQNTAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYAHSQRQFYRDCYITG  1199
             GFIAQD+  QNTAGPEKHQAVALR+GADQSVINRCKIDA+QDTLYAHS RQFYRD +ITG
Sbjct  328   GFIAQDIGFQNTAGPEKHQAVALRVGADQSVINRCKIDAFQDTLYAHSNRQFYRDSFITG  387

Query  1200  TVDFIFGNAAAVIQNSQVVARKPMAAQKNMVTAQGRTDPNQNTGTSIQNCNVSPSSDLGP  1379
             TVDFIFGNA  V Q S++VARKPM+ QKNMVTAQGR DPNQNT TSIQ CNV PSSDL P
Sbjct  388   TVDFIFGNAGVVFQKSKLVARKPMSNQKNMVTAQGREDPNQNTATSIQQCNVIPSSDLKP  447

Query  1380  VKGTIQTYLGRPWKEYSRTVFMESNIGDHIDPAGWFPWDG---DFALKTLYYGEYMNRGP  1550
             V+G+I+TYLGRPWK+YSRTV ++S +  HIDPAGW  WD    DF L+TLYYGEY+N G 
Sbjct  448   VQGSIKTYLGRPWKKYSRTVVLQSVVDSHIDPAGWAEWDAASKDF-LQTLYYGEYLNSGA  506

Query  1551  GAGTSKRVNWPGYHVITDKAEAMKFTVAQLIQGGSWLKNTGVDYTEGL  1694
             GAGTSKRV WPGYH+I   AEA KFTV QLIQG  WLKNTGV + EGL
Sbjct  507   GAGTSKRVTWPGYHIIKTAAEASKFTVTQLIQGNVWLKNTGVAFIEGL  554



>gb|KJB57711.1| hypothetical protein B456_009G176700 [Gossypium raimondii]
Length=547

 Score =   654 bits (1688),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/549 (62%), Positives = 421/549 (77%), Gaps = 10/549 (2%)
 Frame = +3

Query  60    HLPLLFTPKRKPSSCRalyvllylaaIVGSVALVSIWALRTS---SSSPSLWKARVCDPA  230
             H PLL  P+   S  R   ++  L  ++   ALV+I  +R S   ++ P     + C+ A
Sbjct  5     HQPLLDRPR--GSYSRDCPLIFTLVLLICLAALVAIPLVRFSFFDANHP----YKYCERA  58

Query  231   HDPPSCMAIVSEVSSAAPTETDGVAllqmllhssllRIQDAVKLSANVNRRINDRKVQAA  410
              D  SC A++SEV+S     T GV LL   L  S   +Q+ +  + N N  IN+R+ QA+
Sbjct  59    VDQKSCSALLSEVASKTTVRTKGVDLLHAFLERSASDMQNVINQARNFNDGINNRREQAS  118

Query  411   VADCMELLDLSQDKVMDSMVALGNLSARARTDAHSWLSSVLTNHDTCLDGLSEPARSIME  590
              ADC+EL++LS+D++MDSMV +        ++A +WLSSVLTNH TCLDGL    R++ME
Sbjct  119   SADCLELMELSRDRIMDSMVGVEKQDVNWHSNAQAWLSSVLTNHVTCLDGLQGSVRTLME  178

Query  591   PMIKDLISRAKsslavlvavaPS-TEDDLRALNGEFPSWVSASDRRLLEASanavaanvv  767
             P + DLISRA++SLA+LV+V+P+ TE D   L G FPSW+S+ DR+LL+A  N + A+VV
Sbjct  179   PGLSDLISRARTSLAILVSVSPTKTEFDDDPLTGGFPSWLSSKDRKLLQALPNEIKADVV  238

Query  768   vaKDGSGKYKTVAEAVASAPDNGKTRYVIYIKKGTYKENVEIGKKKTNVMLIGDGLSATI  947
             VAKDGSG YK++ EAVA+APD  KT Y+I++KKGTYKENVEIG  K N+M++GDG+++TI
Sbjct  239   VAKDGSGNYKSLGEAVATAPDKSKTTYIIHVKKGTYKENVEIGANKKNLMIVGDGMNSTI  298

Query  948   ITGSLNYVDGATTFNSATVAAVGDGFIAQDLRIQNTAGPEKHQAVALRLGADQSVINRCK  1127
             ITGSLN +DG+TTF SATVAAVGDGF+AQD+  QNTAGP+KHQAVA+R+GADQSVINRCK
Sbjct  299   ITGSLNVIDGSTTFKSATVAAVGDGFMAQDIWFQNTAGPQKHQAVAIRVGADQSVINRCK  358

Query  1128  IDAYQDTLYAHSQRQFYRDCYITGTVDFIFGNAAAVIQNSQVVARKPMAAQKNMVTAQGR  1307
             IDAYQDTLYAHS RQFYRD Y+TGTVDFIFGNAA V QN ++VARKPM +Q NM TAQGR
Sbjct  359   IDAYQDTLYAHSNRQFYRDSYVTGTVDFIFGNAAVVFQNCKLVARKPMNSQSNMFTAQGR  418

Query  1308  TDPNQNTGTSIQNCNVSPSSDLGPVKGTIQTYLGRPWKEYSRTVFMESNIGDHIDPAGWF  1487
              DPNQNTGTSIQNCN+  S+DL PVKG+I++YLGRPWKEYSRTV M+S IGDHIDP+GW 
Sbjct  419   LDPNQNTGTSIQNCNILASADLEPVKGSIKSYLGRPWKEYSRTVVMQSYIGDHIDPSGWS  478

Query  1488  PWDGDFALKTLYYGEYMNRGPGAGTSKRVNWPGYHVITDKAEAMKFTVAQLIQGGSWLKN  1667
              W GDFALKTLYYGEYMNRG GA TSKRV WPG+HVIT   EA KFTVA+LIQGGSWLK+
Sbjct  479   VWSGDFALKTLYYGEYMNRGSGADTSKRVKWPGFHVITSAEEAKKFTVAELIQGGSWLKS  538

Query  1668  TGVDYTEGL  1694
             TGV + E L
Sbjct  539   TGVTFKEWL  547



>ref|XP_002266980.1| PREDICTED: pectinesterase [Vitis vinifera]
Length=528

 Score =   653 bits (1685),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/547 (62%), Positives = 425/547 (78%), Gaps = 21/547 (4%)
 Frame = +3

Query  54    TSHLPLLFTPKRKPSSCRalyvllylaaIVGSVALVSIWALRTSSSSPSLWKARVCDPAH  233
             TS  PLL + + K S C++LY++++LAAI+  +AL SI  ++T S+ P            
Sbjct  3     TSLEPLLRSSQIKASHCKSLYLVIFLAAIITPIALFSIPLIKTISTGPP-----------  51

Query  234   DPPSCMAIVSEVSSAAPTETDGVAllqmllhssllRIQDAVKLSANVNRRINDRKVQAAV  413
                        V      E + V  LQ  L  S+  +Q  ++++ +VNRR+ND + QAA+
Sbjct  52    ----------RVLHNHVMEMEDVDQLQRFLKESMSHLQGVMEMTVDVNRRMNDPRDQAAL  101

Query  414   ADCMELLDLSQDKVMDSMVALGNLSARARTDAHSWLSSVLTNHDTCLDGLSEPARSIMEP  593
             +DC+EL+DLS  ++ DS+ ALG  +  +  DAH+WLS VLTN+ TC DG++ P+R  ME 
Sbjct  102   SDCVELMDLSMGRIRDSVEALGRGTVDSHADAHAWLSGVLTNYITCTDGINGPSRISMER  161

Query  594   MIKDLISRAKsslavlvavaPSTEDDLRALNGEFPSWVSASDRRLLEASanavaanvvva  773
              +K LISRA++SLA+LVAV+P+ ED L+ L+ EFP WV + DR++LE+S+  + ANVVVA
Sbjct  162   GLKHLISRAETSLAMLVAVSPAKEDVLQPLHSEFPPWVDSRDRKILESSSKDIKANVVVA  221

Query  774   KDGSGKYKTVAEAVASAPDNGKTRYVIYIKKGTYKENVEIGKKKTNVMLIGDGLSATIIT  953
             KDGSG YKTV EA+AS P+N KTRYVI++KKGTYKENVEI  K+ NVM++GDG+ +T+IT
Sbjct  222   KDGSGNYKTVKEAIASVPNNSKTRYVIHVKKGTYKENVEIVTKQKNVMIVGDGMDSTVIT  281

Query  954   GSLNYVDGATTFNSATVAAVGDGFIAQDLRIQNTAGPEKHQAVALRLGADQSVINRCKID  1133
             GSLN +DG+TTF SAT+AAVGDGFIAQD+  QNTAGP+KHQAVALR+GADQ+VINRC+ID
Sbjct  282   GSLNVIDGSTTFKSATLAAVGDGFIAQDIWFQNTAGPQKHQAVALRVGADQAVINRCRID  341

Query  1134  AYQDTLYAHSQRQFYRDCYITGTVDFIFGNAAAVIQNSQVVARKPMAAQKNMVTAQGRTD  1313
             AYQDTLYAH+ RQFYRDCYITGTVDFIFGNAA V QN ++VARKPM  Q NMVTAQGRT+
Sbjct  342   AYQDTLYAHTNRQFYRDCYITGTVDFIFGNAAVVFQNCKLVARKPMDKQANMVTAQGRTN  401

Query  1314  PNQNTGTSIQNCNVSPSSDLGPVKGTIQTYLGRPWKEYSRTVFMESNIGDHIDPAGWFPW  1493
             P QNTGTSIQNCN+  SSDL PVKGTI++YLGRPWKEYSR V ++S IGDHIDPAGW  W
Sbjct  402   PYQNTGTSIQNCNIIASSDLEPVKGTIKSYLGRPWKEYSRAVVLQSYIGDHIDPAGWSVW  461

Query  1494  DGDFALKTLYYGEYMNRGPGAGTSKRVNWPGYHVITDKAEAMKFTVAQLIQGGSWLKNTG  1673
             DG+FALKTLYYGEY+NRGPGAGTSKRV WPGY VIT  AEA  FTVA+LIQGG+WL++TG
Sbjct  462   DGEFALKTLYYGEYVNRGPGAGTSKRVKWPGYRVITSPAEARNFTVAELIQGGTWLESTG  521

Query  1674  VDYTEGL  1694
             V YTEGL
Sbjct  522   VAYTEGL  528



>emb|CAA47810.1| pectinesterase [Pisum sativum]
Length=554

 Score =   653 bits (1685),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 340/528 (64%), Positives = 408/528 (77%), Gaps = 10/528 (2%)
 Frame = +3

Query  138   IVGSVALVSIWALRTSSSSPSLWKARVCDPAHDPPSCMAIVSEV---SSAAPTETDGVAl  308
             I+GS AL+     +  S  P      +C+ A D  SC+  VSEV    + A T+   ++ 
Sbjct  28    IIGSSALIVSHLNKPISFFPLSSAPNLCEHAVDTKSCLTHVSEVVQGQALANTKDHKLST  87

Query  309   lqmllhssllRIQDAVKLSANVNRRINDRKVQAAVADCMELLDLSQDKVMDSMVALGNLS  488
             L  LL  S   IQ A++ +  + RR+N  + + A+ DC +L+DLS D+V DS++ L   +
Sbjct  88    LISLLTKSTSHIQKAMETANVIKRRVNSPREETALNDCEQLMDLSMDRVWDSVLTLTKNN  147

Query  489   ARARTDAHSWLSSVLTNHDTCLDGLSEPARSIMEPMIKDLISRAKsslavlvavaPSTED  668
               ++ DAH+WLSSVLTNH TCL+GL   +R +ME  ++DLISRA+SSLAVLV+V P+  +
Sbjct  148   IDSQQDAHTWLSSVLTNHATCLNGLEGTSRVVMESDLQDLISRARSSLAVLVSVLPAKSN  207

Query  669   DL---RALNGEFPSWVSASDRRLLEASanavaanvvvaKDGSGKYKTVAEAVASAPDNGK  839
             D     +LNGEFPSWV++ DRRLLE++   + ANVVVAKDGSGK+KTVAEAVASAPDNGK
Sbjct  208   DGFIDESLNGEFPSWVTSKDRRLLESTVGDIKANVVVAKDGSGKFKTVAEAVASAPDNGK  267

Query  840   TRYVIYIKKGTYKENVEIGKKKTNVMLIGDGLSATIITGSLNYVDGATTFNSATVAAVGD  1019
              RYVIY+K+GTYKE VEIGKKKTNVML+GDG+ ATIITG+LN++DG TTFNSATVAAVGD
Sbjct  268   ARYVIYVKRGTYKEKVEIGKKKTNVMLVGDGMDATIITGNLNFIDGTTTFNSATVAAVGD  327

Query  1020  GFIAQDLRIQNTAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYAHSQRQFYRDCYITG  1199
             GFIAQD+  QNTAGPEKHQAVALR+GADQSVINRCKIDA+QDTLYAHS RQFYRD +ITG
Sbjct  328   GFIAQDIGFQNTAGPEKHQAVALRVGADQSVINRCKIDAFQDTLYAHSNRQFYRDSFITG  387

Query  1200  TVDFIFGNAAAVIQNSQVVARKPMAAQKNMVTAQGRTDPNQNTGTSIQNCNVSPSSDLGP  1379
             TVDFIFGNA  V Q S++VARKPM+ QKNMVTAQGR DPNQNT TSIQ CNV PSSDL P
Sbjct  388   TVDFIFGNAGVVFQKSKLVARKPMSNQKNMVTAQGREDPNQNTATSIQQCNVIPSSDLKP  447

Query  1380  VKGTIQTYLGRPWKEYSRTVFMESNIGDHIDPAGWFPWDG---DFALKTLYYGEYMNRGP  1550
             V+G+I+TYLGRPWK+YSRTV ++S +  HIDPAGW  WD    DF L+TLYYGEY+N G 
Sbjct  448   VQGSIKTYLGRPWKKYSRTVVLQSVVDSHIDPAGWAEWDAASKDF-LQTLYYGEYLNSGA  506

Query  1551  GAGTSKRVNWPGYHVITDKAEAMKFTVAQLIQGGSWLKNTGVDYTEGL  1694
             GAGTSKRV WPGYH+I   AEA KFTV QLIQG  WLKNTGV + EGL
Sbjct  507   GAGTSKRVTWPGYHIIKTAAEASKFTVTQLIQGNVWLKNTGVAFIEGL  554



>dbj|BAC67661.1| pectin methylesterase [Pisum sativum]
Length=554

 Score =   652 bits (1683),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 340/528 (64%), Positives = 408/528 (77%), Gaps = 10/528 (2%)
 Frame = +3

Query  138   IVGSVALVSIWALRTSSSSPSLWKARVCDPAHDPPSCMAIVSEV---SSAAPTETDGVAl  308
             I+GS AL+     +  S  P      +C+ A D  SC+  VSEV    + A T+   ++ 
Sbjct  28    IIGSSALIVSHLNKPISFFPLSSAPNLCEHAVDTKSCLTHVSEVVQGQALANTKDHKLST  87

Query  309   lqmllhssllRIQDAVKLSANVNRRINDRKVQAAVADCMELLDLSQDKVMDSMVALGNLS  488
             L  LL  S   IQ A++ +  + RR+N  + + A+ DC +L+DLS D+V DS++ L   +
Sbjct  88    LISLLTKSTSHIQKAMETANVIKRRVNSPREETALNDCEQLMDLSMDRVWDSVLTLTKNN  147

Query  489   ARARTDAHSWLSSVLTNHDTCLDGLSEPARSIMEPMIKDLISRAKsslavlvavaPSTED  668
               ++ DAH+WLSSVLTNH TCL+GL   +R +ME  ++DLISRA+SSLAVLV+V P+  +
Sbjct  148   IDSQQDAHTWLSSVLTNHATCLNGLEGTSRVVMEGDLQDLISRARSSLAVLVSVLPAKSN  207

Query  669   DL---RALNGEFPSWVSASDRRLLEASanavaanvvvaKDGSGKYKTVAEAVASAPDNGK  839
             D     +LNGEFPSWV++ DRRLLE++   + ANVVVAKDGSGK+KTVAEAVASAPDNGK
Sbjct  208   DGFIDESLNGEFPSWVTSKDRRLLESTVGDIKANVVVAKDGSGKFKTVAEAVASAPDNGK  267

Query  840   TRYVIYIKKGTYKENVEIGKKKTNVMLIGDGLSATIITGSLNYVDGATTFNSATVAAVGD  1019
              RYVIY+K+GTYKE VEIGKKKTNVML+GDG+ ATIITG+LN++DG TTFNSATVAAVGD
Sbjct  268   ARYVIYVKRGTYKEKVEIGKKKTNVMLVGDGMDATIITGNLNFIDGTTTFNSATVAAVGD  327

Query  1020  GFIAQDLRIQNTAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYAHSQRQFYRDCYITG  1199
             GFIAQD+  QNTAGPEKHQAVALR+GADQSVINRCKIDA+QDTLYAHS RQFYRD +ITG
Sbjct  328   GFIAQDIGFQNTAGPEKHQAVALRVGADQSVINRCKIDAFQDTLYAHSNRQFYRDSFITG  387

Query  1200  TVDFIFGNAAAVIQNSQVVARKPMAAQKNMVTAQGRTDPNQNTGTSIQNCNVSPSSDLGP  1379
             TVDFIFGNA  V Q S++VARKPM+ QKNMVTAQGR DPNQNT TSIQ CNV PSSDL P
Sbjct  388   TVDFIFGNAGVVFQKSKLVARKPMSNQKNMVTAQGREDPNQNTATSIQQCNVIPSSDLKP  447

Query  1380  VKGTIQTYLGRPWKEYSRTVFMESNIGDHIDPAGWFPWDG---DFALKTLYYGEYMNRGP  1550
             V+G+I+TYLGRPWK+YSRTV ++S +  HIDPAGW  WD    DF L+TLYYGEY+N G 
Sbjct  448   VQGSIKTYLGRPWKKYSRTVVLQSVVDSHIDPAGWAEWDAASKDF-LQTLYYGEYLNSGA  506

Query  1551  GAGTSKRVNWPGYHVITDKAEAMKFTVAQLIQGGSWLKNTGVDYTEGL  1694
             GAGTSKRV WPGYH+I   AEA KFTV QLIQG  WLKNTGV + EGL
Sbjct  507   GAGTSKRVTWPGYHIIKTAAEASKFTVTQLIQGNVWLKNTGVAFIEGL  554



>ref|XP_007157170.1| hypothetical protein PHAVU_002G048500g [Phaseolus vulgaris]
 gb|ESW29164.1| hypothetical protein PHAVU_002G048500g [Phaseolus vulgaris]
Length=552

 Score =   652 bits (1681),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/501 (66%), Positives = 389/501 (78%), Gaps = 8/501 (2%)
 Frame = +3

Query  213   RVCDPAHDPPSCMAIVSEVSSA---APTETDGVAllqmllhssllRIQDAVKLSANVNRR  383
              +C  A D PSC+A +SEV        T+     L    L  S   IQ A+  ++++  R
Sbjct  53    HLCHHALDNPSCLAHLSEVVQGPIFTTTKDHSFNLFHSFLLKSTSHIQRAMNTASSIKLR  112

Query  384   INDRKVQAAVADCMELLDLSQDKVMDSMVALGNLSARARTDAHSWLSSVLTNHDTCLDGL  563
             +N  K +AA+ DC+EL+DLS D+V+DSM+ L N +  ++ DAH+WLSSVLTNH TCLDGL
Sbjct  113   VNSPKEEAALNDCVELMDLSIDRVLDSMLTLTNQTTESQQDAHTWLSSVLTNHATCLDGL  172

Query  564   SEPARSIMEPMIKDLISRAKsslavlvavaPSTEDDL-RALNGEFPSWVSASDRRLLEAS  740
                AR++ME  ++DLISRA+++LA+ V V P   + +   LNGEFPSW+S+ DRRLLE+S
Sbjct  173   EGTARALMEAELEDLISRARTALAMFVTVLPPRVEPIDEPLNGEFPSWLSSKDRRLLESS  232

Query  741   anavaanvvvaKDGSGKYKTVAEAVASAPDNGKTRYVIYIKKGTYKENVEIGKKKTNVML  920
                + ANVVVAKDGSGK+KTVAEAVASAPDN KTRYVIY+KKGTYKENVEIGKKK NVML
Sbjct  233   VGDINANVVVAKDGSGKFKTVAEAVASAPDNSKTRYVIYVKKGTYKENVEIGKKKKNVML  292

Query  921   IGDGLSATIITGSLNYVDGATTFNSATVAAVGDGFIAQDLRIQNTAGPEKHQAVALRLGA  1100
             +GDG   T+ITGSLNY+DG  TF +ATVAAVGDGFI QD+  QNTAGP+KHQAVALR+GA
Sbjct  293   VGDGKDLTVITGSLNYIDGTGTFQTATVAAVGDGFIGQDIWFQNTAGPQKHQAVALRVGA  352

Query  1101  DQSVINRCKIDAYQDTLYAHSQRQFYRDCYITGTVDFIFGNAAAVIQNSQVVARKPMAAQ  1280
             DQSVINRC++DAYQDTLYAH+ RQFYRD +ITGTVDFIFGNAA V Q   +VARKPM+ Q
Sbjct  353   DQSVINRCRVDAYQDTLYAHTNRQFYRDSFITGTVDFIFGNAAVVFQKCYLVARKPMSNQ  412

Query  1281  KNMVTAQGRTDPNQNTGTSIQNCNVSPSSDLGPVKGTIQTYLGRPWKEYSRTVFMESNIG  1460
             KNMVTAQGR DPNQNTGTSIQ CN++PSSDL PV G+I+TYLGRPWK+YSRTV M+S I 
Sbjct  413   KNMVTAQGREDPNQNTGTSIQQCNITPSSDLKPVAGSIKTYLGRPWKKYSRTVVMQSTIE  472

Query  1461  DHIDPAGWFPWDG---DFALKTLYYGEYMNRGPGAGTSKRVNWPGYHVITDKAEAMKFTV  1631
             +HIDPAGW  WD    DF L+TLYY EYMN G GAGTSKRVNWPGYH     AEA KFTV
Sbjct  473   NHIDPAGWAEWDDKSKDF-LQTLYYAEYMNSGAGAGTSKRVNWPGYHKTITTAEANKFTV  531

Query  1632  AQLIQGGSWLKNTGVDYTEGL  1694
              Q IQG  WLKNTGV+Y EGL
Sbjct  532   KQFIQGNVWLKNTGVNYIEGL  552



>ref|XP_006573891.1| PREDICTED: pectinesterase/pectinesterase inhibitor 18-like [Glycine 
max]
Length=553

 Score =   651 bits (1680),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/527 (64%), Positives = 403/527 (76%), Gaps = 9/527 (2%)
 Frame = +3

Query  138   IVGSVALVSIWALRTSSSSPSLWKARVCDPAHDPPSCMAIVSEVSSA---APTETDGVAl  308
             ++ S A V  + ++++S         +CD A D  +C+  VSEV       PT+     L
Sbjct  28    VMISSAFVGSYLIKSTSFFNQSSPQHLCDHALDRATCLTHVSEVVQGPILTPTKDHKFNL  87

Query  309   lqmllhssllRIQDAVKLSANVNRRINDRKVQAAVADCMELLDLSQDKVMDSMVALGNLS  488
             LQ  L      I+  +  ++++  RIN  K + A+ DC+EL+DLS  +V DSMV L   +
Sbjct  88    LQSFLMKYTSHIKRVMNTASSIKLRINSPKEEEALHDCVELMDLSISRVRDSMVTLTKQT  147

Query  489   ARARTDAHSWLSSVLTNHDTCLDGLSEPARSIMEPMIKDLISRAKsslavlvavaPSTED  668
               ++ DAH+WLSSVLTNH TCLDGL   AR+ M+  ++DLISRA++SLA+ VAV P   +
Sbjct  148   IESQQDAHTWLSSVLTNHATCLDGLEGSARAFMKDELEDLISRARTSLAMFVAVLPPKVE  207

Query  669   DL--RALNGEFPSWVSASDRRLLEASanavaanvvvaKDGSGKYKTVAEAVASAPDNGKT  842
              +    L+G+FPSWVS+ DRRLLE++   + ANVVVAKDGSGK+KTVAEAVASAPDNGKT
Sbjct  208   QIIDEPLSGDFPSWVSSKDRRLLESTVGDIKANVVVAKDGSGKFKTVAEAVASAPDNGKT  267

Query  843   RYVIYIKKGTYKENVEIGKKKTNVMLIGDGLSATIITGSLNYVDGATTFNSATVAAVGDG  1022
             RYVIY+KKGTYKENVEIGKKKTNVML+GDG  AT+ITG+LN++DG TTF +ATVAAVGDG
Sbjct  268   RYVIYVKKGTYKENVEIGKKKTNVMLVGDGKDATVITGNLNFIDGTTTFKTATVAAVGDG  327

Query  1023  FIAQDLRIQNTAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYAHSQRQFYRDCYITGT  1202
             FIAQD+  QNTAGP+KHQAVALR+GADQSVINRC+IDA+QDTLYAHS RQFYRD +ITGT
Sbjct  328   FIAQDIWFQNTAGPQKHQAVALRVGADQSVINRCRIDAFQDTLYAHSNRQFYRDSFITGT  387

Query  1203  VDFIFGNAAAVIQNSQVVARKPMAAQKNMVTAQGRTDPNQNTGTSIQNCNVSPSSDLGPV  1382
             VDFIFGNAA V Q   +VARKPM  Q NMVTAQGR DPNQNTGTSIQ CN++PSSDL PV
Sbjct  388   VDFIFGNAAVVFQKCDLVARKPMDKQNNMVTAQGREDPNQNTGTSIQQCNLTPSSDLKPV  447

Query  1383  KGTIQTYLGRPWKEYSRTVFMESNIGDHIDPAGWFPWDG---DFALKTLYYGEYMNRGPG  1553
              G+I+T+LGRPWK+YSRTV M+S +  HIDP GW  WD    DF L+TLYYGEYMN GPG
Sbjct  448   VGSIKTFLGRPWKKYSRTVVMQSTLDSHIDPTGWAEWDAQSKDF-LQTLYYGEYMNNGPG  506

Query  1554  AGTSKRVNWPGYHVITDKAEAMKFTVAQLIQGGSWLKNTGVDYTEGL  1694
             AGTSKRVNWPGYH+I   AEA KFTVAQLIQG  WLKNTGV++ EGL
Sbjct  507   AGTSKRVNWPGYHIIKTAAEASKFTVAQLIQGNVWLKNTGVNFIEGL  553



>ref|XP_003622688.1| Pectinesterase [Medicago truncatula]
 gb|AES78906.1| pectinesterase/pectinesterase inhibitor [Medicago truncatula]
Length=554

 Score =   651 bits (1680),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 339/512 (66%), Positives = 402/512 (79%), Gaps = 15/512 (3%)
 Frame = +3

Query  186   SSSPSLWKARVCDPAHDPPSCMAIVSEV---SSAAPTETDGVAllqmllhssllRIQDAV  356
             SS+P+L     C+ A D  SC+  VSEV   S+ + T+   ++ L  LL  S   I+ A+
Sbjct  49    SSAPNL-----CEHALDTKSCLTHVSEVVQGSTLSNTKDHKLSTLVSLLTKSTAHIRKAM  103

Query  357   KLSANVNRRINDRKVQAAVADCMELLDLSQDKVMDSMVALGNLSARARTDAHSWLSSVLT  536
               +  + RR+N  + + A+ DC EL+DLS D+V DS++ L   +  ++ DAH+WLSSVLT
Sbjct  104   DTANVIKRRVNSPREEIALNDCEELMDLSMDRVWDSVLTLTKNNIDSQHDAHTWLSSVLT  163

Query  537   NHDTCLDGLSEPARSIMEPMIKDLISRAKsslavlvavaPSTEDDL---RALNGEFPSWV  707
             NH TCLDGL   +R +ME  + DLISRA+SSLAVLV+V P   +D      LNG+FPSWV
Sbjct  164   NHATCLDGLEGSSRVVMESDLHDLISRARSSLAVLVSVLPPKANDGFIDEKLNGDFPSWV  223

Query  708   SASDRRLLEASanavaanvvvaKDGSGKYKTVAEAVASAPDNGKTRYVIYIKKGTYKENV  887
             ++ DRRLLE+S   + ANVVVA+DGSGK+KTVA+AVASAPDNGKTRYVIY+KKGTYKEN+
Sbjct  224   TSKDRRLLESSVGDIKANVVVAQDGSGKFKTVAQAVASAPDNGKTRYVIYVKKGTYKENI  283

Query  888   EIGKKKTNVMLIGDGLSATIITGSLNYVDGATTFNSATVAAVGDGFIAQDLRIQNTAGPE  1067
             EIGKKKTNVML+GDG+ ATIITGSLN++DG TTF SATVAAVGDGFIAQD+R QNTAGP+
Sbjct  284   EIGKKKTNVMLVGDGMDATIITGSLNFIDGTTTFKSATVAAVGDGFIAQDIRFQNTAGPQ  343

Query  1068  KHQAVALRLGADQSVINRCKIDAYQDTLYAHSQRQFYRDCYITGTVDFIFGNAAAVIQNS  1247
             KHQAVALR+GADQSVINRCKIDA+QDTLYAHS RQFYRD YITGTVDFIFGNAA V Q S
Sbjct  344   KHQAVALRVGADQSVINRCKIDAFQDTLYAHSNRQFYRDSYITGTVDFIFGNAAVVFQKS  403

Query  1248  QVVARKPMAAQKNMVTAQGRTDPNQNTGTSIQNCNVSPSSDLGPVKGTIQTYLGRPWKEY  1427
             ++ ARKPMA QKNMVTAQGR DPNQNT TSIQ C+V PSSDL PV+G+I+TYLGRPWK+Y
Sbjct  404   KLAARKPMANQKNMVTAQGREDPNQNTATSIQQCDVIPSSDLKPVQGSIKTYLGRPWKKY  463

Query  1428  SRTVFMESNIGDHIDPAGWFPWDG---DFALKTLYYGEYMNRGPGAGTSKRVNWPGYHVI  1598
             SRTV ++S +  HIDPAGW  WD    DF L+TLYYGEYMN G GAGT KRV WPGYH+I
Sbjct  464   SRTVVLQSVVDGHIDPAGWAEWDAASKDF-LQTLYYGEYMNSGAGAGTGKRVTWPGYHII  522

Query  1599  TDKAEAMKFTVAQLIQGGSWLKNTGVDYTEGL  1694
              + AEA KFTV QLIQG  WLKNTGV + EGL
Sbjct  523   KNAAEASKFTVTQLIQGNVWLKNTGVAFIEGL  554



>gb|AFK35109.1| unknown [Medicago truncatula]
Length=554

 Score =   648 bits (1671),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 337/512 (66%), Positives = 400/512 (78%), Gaps = 15/512 (3%)
 Frame = +3

Query  186   SSSPSLWKARVCDPAHDPPSCMAIVSEV---SSAAPTETDGVAllqmllhssllRIQDAV  356
             SS+P+L     C+ A D  SC+  VSEV   S+ + T+   ++ L  LL  S   I+ A+
Sbjct  49    SSAPNL-----CEHALDTKSCLTHVSEVVQGSTLSNTKDHKLSTLVSLLTKSTAHIRKAM  103

Query  357   KLSANVNRRINDRKVQAAVADCMELLDLSQDKVMDSMVALGNLSARARTDAHSWLSSVLT  536
               +  + RR+N  + + A+ DC EL+DLS D+V DS++ L   +  ++ DAH+WLSSVLT
Sbjct  104   DTANVIKRRVNSPREEIALNDCEELMDLSMDRVWDSVLTLTKNNIDSQHDAHTWLSSVLT  163

Query  537   NHDTCLDGLSEPARSIMEPMIKDLISRAKsslavlvavaPSTEDDL---RALNGEFPSWV  707
             NH TCLDGL   +R +ME  + DLISRA+SSLAVLV+V P   +D      LNG+FPSWV
Sbjct  164   NHATCLDGLEGSSRVVMESDLHDLISRARSSLAVLVSVLPPKANDGFIDEKLNGDFPSWV  223

Query  708   SASDRRLLEASanavaanvvvaKDGSGKYKTVAEAVASAPDNGKTRYVIYIKKGTYKENV  887
             ++ DRRLLE+S   + ANVVVA+DGSGK+KTVA+AVASAPDNGKTRYVIY+KKGTYKEN+
Sbjct  224   TSKDRRLLESSVGDIKANVVVAQDGSGKFKTVAQAVASAPDNGKTRYVIYVKKGTYKENI  283

Query  888   EIGKKKTNVMLIGDGLSATIITGSLNYVDGATTFNSATVAAVGDGFIAQDLRIQNTAGPE  1067
             EIGKKKTNVML+GDG+ ATIITGSLN++DG TTF SATVAAVGDGFIAQD+R QNTAGP+
Sbjct  284   EIGKKKTNVMLVGDGMDATIITGSLNFIDGTTTFKSATVAAVGDGFIAQDIRFQNTAGPQ  343

Query  1068  KHQAVALRLGADQSVINRCKIDAYQDTLYAHSQRQFYRDCYITGTVDFIFGNAAAVIQNS  1247
             KHQAVALR+GADQSVINRCKIDA+QDTLYAHS RQFYRD YITGTVDFIFGNAA V Q S
Sbjct  344   KHQAVALRVGADQSVINRCKIDAFQDTLYAHSNRQFYRDSYITGTVDFIFGNAAVVFQKS  403

Query  1248  QVVARKPMAAQKNMVTAQGRTDPNQNTGTSIQNCNVSPSSDLGPVKGTIQTYLGRPWKEY  1427
             ++  RKPMA QKNMVTAQGR DPNQNT TSIQ C+V PSSDL PV+G+I+TYLGRPWK+Y
Sbjct  404   KLATRKPMANQKNMVTAQGREDPNQNTATSIQQCDVIPSSDLKPVQGSIKTYLGRPWKKY  463

Query  1428  SRTVFMESNIGDHIDPAGWFPWDG---DFALKTLYYGEYMNRGPGAGTSKRVNWPGYHVI  1598
             SRTV ++S +  HIDPAGW  WD    DF L+TLYYGEYMN G GAGT KRV WPGYH+I
Sbjct  464   SRTVVLQSVVDGHIDPAGWAEWDAASKDF-LQTLYYGEYMNSGAGAGTGKRVTWPGYHII  522

Query  1599  TDKAEAMKFTVAQLIQGGSWLKNTGVDYTEGL  1694
              + AEA KFTV QLIQG  WLKNTG  + EGL
Sbjct  523   KNAAEASKFTVTQLIQGNVWLKNTGAAFIEGL  554



>gb|ACJ85768.1| unknown [Medicago truncatula]
Length=554

 Score =   647 bits (1668),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 337/512 (66%), Positives = 400/512 (78%), Gaps = 15/512 (3%)
 Frame = +3

Query  186   SSSPSLWKARVCDPAHDPPSCMAIVSEV---SSAAPTETDGVAllqmllhssllRIQDAV  356
             SS+P+L     C+ A D  SC+  VSEV   S+ + T+   ++ L  LL  S   I+ A+
Sbjct  49    SSAPNL-----CEHALDTKSCLTHVSEVVQGSTLSNTKDHKLSTLVSLLTKSTAHIRKAM  103

Query  357   KLSANVNRRINDRKVQAAVADCMELLDLSQDKVMDSMVALGNLSARARTDAHSWLSSVLT  536
               +  + RR+N  + + A+ DC EL+DLS D+V DS++ L   +  ++ DAH+WLSSVLT
Sbjct  104   DTANVIKRRVNSPREEIALNDCEELMDLSMDRVWDSVLTLTKNNIDSQHDAHTWLSSVLT  163

Query  537   NHDTCLDGLSEPARSIMEPMIKDLISRAKsslavlvavaPSTEDDL---RALNGEFPSWV  707
             NH TCLDGL   +R +ME  + DLISRA+SSLAVLV+V P   +D      LNG+FPSWV
Sbjct  164   NHATCLDGLEGSSRVVMESDLHDLISRARSSLAVLVSVLPPKANDGFIDEKLNGDFPSWV  223

Query  708   SASDRRLLEASanavaanvvvaKDGSGKYKTVAEAVASAPDNGKTRYVIYIKKGTYKENV  887
             ++ DRRLLE+S   + ANVVVA+DGSGK+KTVA+AVASAPDNG+TRYVIY+KKGTYKEN+
Sbjct  224   TSKDRRLLESSVGDIKANVVVAQDGSGKFKTVAQAVASAPDNGETRYVIYVKKGTYKENI  283

Query  888   EIGKKKTNVMLIGDGLSATIITGSLNYVDGATTFNSATVAAVGDGFIAQDLRIQNTAGPE  1067
             EIGKKKTNVML+GDG+ ATIITGSLN+ DG TTF SATVAAVGDGFIAQD+R QNTAGP+
Sbjct  284   EIGKKKTNVMLVGDGMDATIITGSLNFTDGTTTFKSATVAAVGDGFIAQDIRFQNTAGPQ  343

Query  1068  KHQAVALRLGADQSVINRCKIDAYQDTLYAHSQRQFYRDCYITGTVDFIFGNAAAVIQNS  1247
             KHQAVAL +GADQSVINRCKIDA+QDTLYAHS RQFYRD YITGTVDFIFGNAA V Q S
Sbjct  344   KHQAVALHVGADQSVINRCKIDAFQDTLYAHSNRQFYRDSYITGTVDFIFGNAAVVFQKS  403

Query  1248  QVVARKPMAAQKNMVTAQGRTDPNQNTGTSIQNCNVSPSSDLGPVKGTIQTYLGRPWKEY  1427
             ++ ARKPMA QKNMVTAQGR DPNQNT TSIQ C+V PSSDL PV+G+I+TYLGRPWK+Y
Sbjct  404   KLAARKPMANQKNMVTAQGREDPNQNTATSIQQCDVIPSSDLKPVQGSIKTYLGRPWKKY  463

Query  1428  SRTVFMESNIGDHIDPAGWFPWDG---DFALKTLYYGEYMNRGPGAGTSKRVNWPGYHVI  1598
             SRTV ++S +  HIDPAGW  WD    DF L+TLYYGEYMN G GAGT KRV WPGYH+I
Sbjct  464   SRTVVLQSVVDGHIDPAGWAEWDAASKDF-LQTLYYGEYMNSGAGAGTGKRVTWPGYHII  522

Query  1599  TDKAEAMKFTVAQLIQGGSWLKNTGVDYTEGL  1694
              + AEA KFTV QLIQG  WLKNTGV + EGL
Sbjct  523   KNAAEASKFTVTQLIQGNVWLKNTGVAFIEGL  554



>gb|KHG26245.1| Pectinesterase/pectinesterase inhibitor [Gossypium arboreum]
Length=477

 Score =   643 bits (1659),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/452 (69%), Positives = 373/452 (83%), Gaps = 0/452 (0%)
 Frame = +3

Query  339   RIQDAVKLSANVNRRINDRKVQAAVADCMELLDLSQDKVMDSMVALGNLSARARTDAHSW  518
             R+Q+A+ ++     RIN+   QAA+ADCMEL++ S D++MDSMVA+    A + ++AH+W
Sbjct  26    RMQNAMNVAKKFKHRINNPGEQAALADCMELMESSMDRIMDSMVAVDKQDATSYSNAHAW  85

Query  519   LSSVLTNHDTCLDGLSEPARSIMEPMIKDLISRAKsslavlvavaPSTEDDLRALNGEFP  698
             LSSVLTNH TCLDGL   AR++MEP + DLISRA++SLA+ V+ +P     +  L   FP
Sbjct  86    LSSVLTNHVTCLDGLEGSARTLMEPGLNDLISRARTSLAIFVSFSPRKTKLIDPLIDGFP  145

Query  699   SWVSASDRRLLEASanavaanvvvaKDGSGKYKTVAEAVASAPDNGKTRYVIYIKKGTYK  878
             SWVS+ DR+LL++  N + ANVVVAKDGSGKYKT+ EAVA+APD  KTRY+IY+KKGTYK
Sbjct  146   SWVSSKDRKLLQSLPNEIKANVVVAKDGSGKYKTLGEAVAAAPDKSKTRYIIYVKKGTYK  205

Query  879   ENVEIGKKKTNVMLIGDGLSATIITGSLNYVDGATTFNSATVAAVGDGFIAQDLRIQNTA  1058
             ENVEIGK K N+M++GDG+ +TIITGSLN +DG+TTF SATVAAVGDGF+AQD+  QNTA
Sbjct  206   ENVEIGKNKKNLMIVGDGMKSTIITGSLNVIDGSTTFRSATVAAVGDGFMAQDIWFQNTA  265

Query  1059  GPEKHQAVALRLGADQSVINRCKIDAYQDTLYAHSQRQFYRDCYITGTVDFIFGNAAAVI  1238
             GP+KHQAVALR+GADQSVINRC+ID YQDTLY HS RQFYRD  ITGTVDFIFG+AA V 
Sbjct  266   GPQKHQAVALRVGADQSVINRCQIDGYQDTLYTHSNRQFYRDSEITGTVDFIFGDAAVVF  325

Query  1239  QNSQVVARKPMAAQKNMVTAQGRTDPNQNTGTSIQNCNVSPSSDLGPVKGTIQTYLGRPW  1418
             QN ++V RKPM  Q NMVTAQGR DPNQNTGTSIQ+CN+  SSDL PVKG+ ++YLGRPW
Sbjct  326   QNCKLVVRKPMDKQSNMVTAQGRIDPNQNTGTSIQSCNIIASSDLEPVKGSFKSYLGRPW  385

Query  1419  KEYSRTVFMESNIGDHIDPAGWFPWDGDFALKTLYYGEYMNRGPGAGTSKRVNWPGYHVI  1598
             KEYSRTV M+S+IGDHIDP+GW  W GDFALKTLYYGEYMN+GPGAGTSKRV WPGYHVI
Sbjct  386   KEYSRTVVMQSHIGDHIDPSGWSVWTGDFALKTLYYGEYMNKGPGAGTSKRVKWPGYHVI  445

Query  1599  TDKAEAMKFTVAQLIQGGSWLKNTGVDYTEGL  1694
             T   EA KFTVA LIQGGSWLK TGV +TEGL
Sbjct  446   TSADEAKKFTVAGLIQGGSWLKPTGVTFTEGL  477



>dbj|BAC67662.1| pectin methylesterase [Pisum sativum]
Length=553

 Score =   639 bits (1648),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 340/535 (64%), Positives = 411/535 (77%), Gaps = 25/535 (5%)
 Frame = +3

Query  138   IVGSVALV--------SIWALRTSSSSPSLWKARVCDPAHDPPSCMAIVSEVS---SAAP  284
             I+GS AL+        S + L   SS+P+L     C+ A D  SC+  VSEV+   + A 
Sbjct  28    IIGSSALIVSHLNKPTSFFHL---SSAPNL-----CEHALDTESCLTHVSEVAQGPTLAN  79

Query  285   TETDGVAllqmllhssllRIQDAVKLSANVNRRINDRKVQAAVADCMELLDLSQDKVMDS  464
             T+   ++ L  LL  S   I++A+  ++ +  R+N  K + A+ DC +L+ LS ++V DS
Sbjct  80    TKDHKLSTLISLLTKSTTHIREAMNKASVIKSRVNSGKEEIALNDCEQLMKLSIERVWDS  139

Query  465   MVALGNLSARARTDAHSWLSSVLTNHDTCLDGLSEPARSIMEPMIKDLISRAKsslavlv  644
             ++ L   +  ++ DAH+WLSSVLTNH TCLDGL   +R +ME  ++DLISRA+SSLAVLV
Sbjct  140   VLTLTQDNMDSQQDAHTWLSSVLTNHATCLDGLEGTSRMVMESDLQDLISRARSSLAVLV  199

Query  645   avaPSTEDDL---RALNGEFPSWVSASDRRLLEASanavaanvvvaKDGSGKYKTVAEAV  815
             AV P   +D     +LNGEFPSWV++ DRRLLE+S   + ANVVVAKDGSGK+KTVAEAV
Sbjct  200   AVLPEKSNDGFIDESLNGEFPSWVTSKDRRLLESSVGDITANVVVAKDGSGKFKTVAEAV  259

Query  816   ASAPDNGKTRYVIYIKKGTYKENVEIGKKKTNVMLIGDGLSATIITGSLNYVDGATTFNS  995
             AS P+ GKTRYVIY+KKGTYKENVEI  +KTNVML+GDG+ ATIITGSLN VDG  TF S
Sbjct  260   ASVPNKGKTRYVIYVKKGTYKENVEISSQKTNVMLVGDGMDATIITGSLNVVDGTGTFQS  319

Query  996   ATVAAVGDGFIAQDLRIQNTAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYAHSQRQF  1175
             ATVAAVGDGFIAQD+  +NTAGPEKHQAVALR+G+DQSVINRC+IDA+QDTLYAHS RQF
Sbjct  320   ATVAAVGDGFIAQDIGFKNTAGPEKHQAVALRVGSDQSVINRCRIDAFQDTLYAHSNRQF  379

Query  1176  YRDCYITGTVDFIFGNAAAVIQNSQVVARKPMAAQKNMVTAQGRTDPNQNTGTSIQNCNV  1355
             YRDC+ITGT+DFIFGNAAAV Q S++VARKPM+ QKNMVTAQGR DPNQNT TSIQ C++
Sbjct  380   YRDCFITGTIDFIFGNAAAVFQKSKLVARKPMSNQKNMVTAQGRLDPNQNTATSIQQCDI  439

Query  1356  SPSSDLGPVKGTIQTYLGRPWKEYSRTVFMESNIGDHIDPAGWFPWD--GDFALKTLYYG  1529
              PS+DL PV G+I+TYLGRPWK YSRTV M+S IG+HIDP GW  WD      LKTLYYG
Sbjct  440   IPSTDLKPVLGSIKTYLGRPWKPYSRTVVMQSPIGNHIDPTGWAEWDDASKAFLKTLYYG  499

Query  1530  EYMNRGPGAGTSKRVNWPGYHVITDKAEAMKFTVAQLIQGGSWLKNTGVDYTEGL  1694
             EY+N GPGAGT+KRVNWPGYHV+ + AEA KFTVAQLIQG  WLKNTGV + EGL
Sbjct  500   EYLNSGPGAGTAKRVNWPGYHVL-NTAEATKFTVAQLIQGNVWLKNTGVAFIEGL  553



>ref|XP_011030843.1| PREDICTED: pectinesterase-like [Populus euphratica]
Length=550

 Score =   637 bits (1644),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/552 (59%), Positives = 414/552 (75%), Gaps = 4/552 (1%)
 Frame = +3

Query  45    MATTSHLPLLFTPKRKPSSCRalyvllylaaIVGSVALVSIWALRTSSSSPSLWKARVCD  224
             MA+++H PLL T     S  +     + L A++ S   ++   ++ S SSPS    ++C+
Sbjct  1     MASSAHHPLLNTTNNTKSHVKIFIFSISLFAVILSSVFLASHFIKVSQSSPS--TPQICN  58

Query  225   PAHDPPSCMAIVSE-VSSAAPTETDGVAllqmllhssllRIQDAVKLSANVNRRINDRKV  401
              AHDP  C++I+SE VS+    E++GV LL+  L  SL +++ A   +  VN +IND K 
Sbjct  59    QAHDPQECLSILSEAVSTEGVQESNGVGLLKTFLVKSLSQMRMAKAAANAVNSKINDHKH  118

Query  402   QAAVADCMELLDLSQDKVMDSMVALGNLSARA-RTDAHSWLSSVLTNHDTCLDGLSEPAR  578
             QAA+ADC+EL+D+S D+V D++ ALGN  +++  +DA++WLS VLTNH TCLDG+    +
Sbjct  119   QAALADCVELMDMSIDRVTDTLSALGNWGSQSDASDANTWLSGVLTNHVTCLDGVDTIDQ  178

Query  579   SIMEPMIKDLISRAKsslavlvavaPSTEDDLRALNGEFPSWVSASDRRLLEASanavaa  758
               M+ +++DLISR ++SLA + +++ S  D ++ LNG FPSW+   DR+LLE+S + V A
Sbjct  179   PSMKKLLQDLISRMRTSLATVSSLSASDTDLVQPLNGGFPSWILGRDRKLLESSVSNVEA  238

Query  759   nvvvaKDGSGKYKTVAEAVASAPDNGKTRYVIYIKKGTYKENVEIGKKKTNVMLIGDGLS  938
             NV+VA+DGSG Y T+ EAV S PD  K+RYVI++K G YKENVE+GKKK NVM++GDG+ 
Sbjct  239   NVIVAQDGSGDYTTIQEAVNSVPDKSKSRYVIHVKSGIYKENVEVGKKKKNVMIVGDGMD  298

Query  939   ATIITGSLNYVDGATTFNSATVAAVGDGFIAQDLRIQNTAGPEKHQAVALRLGADQSVIN  1118
              TI+TG+LN VDG+TTF SAT+A  GDGFI QD+ IQNTAGPEKHQAVALR+ ADQSVIN
Sbjct  299   FTILTGNLNVVDGSTTFRSATLAVAGDGFILQDIWIQNTAGPEKHQAVALRVSADQSVIN  358

Query  1119  RCKIDAYQDTLYAHSQRQFYRDCYITGTVDFIFGNAAAVIQNSQVVARKPMAAQKNMVTA  1298
             RC+IDAYQDTLY H+ RQFYRDC I GT+DFIFGN A V+QN Q+++RKPMA QKNMVTA
Sbjct  359   RCRIDAYQDTLYTHNYRQFYRDCSIIGTIDFIFGNGAVVLQNCQIISRKPMANQKNMVTA  418

Query  1299  QGRTDPNQNTGTSIQNCNVSPSSDLGPVKGTIQTYLGRPWKEYSRTVFMESNIGDHIDPA  1478
             QGR DPNQNTG SIQNC++  SSDL   +    TYLGRPWK+YSRTV M+S IG HIDP 
Sbjct  419   QGRIDPNQNTGISIQNCDIVASSDLESDQNKFPTYLGRPWKQYSRTVVMQSKIGGHIDPT  478

Query  1479  GWFPWDGDFALKTLYYGEYMNRGPGAGTSKRVNWPGYHVITDKAEAMKFTVAQLIQGGSW  1658
             GW  WD +FAL TLYYGEY NRG GAG S RVNWPGYHVITD  EA +FTVA+LIQGG+W
Sbjct  479   GWAEWDKEFALTTLYYGEYANRGLGAGVSMRVNWPGYHVITDPNEAKQFTVAELIQGGAW  538

Query  1659  LKNTGVDYTEGL  1694
             L +TGV +TEGL
Sbjct  539   LGSTGVSFTEGL  550



>gb|KHN30453.1| Pectinesterase 2.2 [Glycine soja]
Length=461

 Score =   634 bits (1635),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/457 (69%), Positives = 372/457 (81%), Gaps = 6/457 (1%)
 Frame = +3

Query  339   RIQDAVKLSANVNRRINDRKVQAAVADCMELLDLSQDKVMDSMVALGNLSARARTDAHSW  518
              I+  +  ++++  RIN  K + A+ DC+EL+DLS  +V DSMV L   +  ++ DAH+W
Sbjct  6     HIKRVMNTASSIKLRINSPKEEEALHDCVELMDLSISRVRDSMVTLTKQTIESQQDAHTW  65

Query  519   LSSVLTNHDTCLDGLSEPARSIMEPMIKDLISRAKsslavlvavaPSTEDDL--RALNGE  692
             LSSVLTNH TCLDGL   A + M+  ++DLISRA++SLA+ VAV P   + +    L+G+
Sbjct  66    LSSVLTNHATCLDGLEGSASAFMKDELEDLISRARTSLAMFVAVLPPKVEQIIDEPLSGD  125

Query  693   FPSWVSASDRRLLEASanavaanvvvaKDGSGKYKTVAEAVASAPDNGKTRYVIYIKKGT  872
             FPSWVS+ DRRLLE++   + ANVVVAKDGSGK+KTVAEAVASAPDNGKTRYVIY+KKGT
Sbjct  126   FPSWVSSKDRRLLESTVGDIKANVVVAKDGSGKFKTVAEAVASAPDNGKTRYVIYVKKGT  185

Query  873   YKENVEIGKKKTNVMLIGDGLSATIITGSLNYVDGATTFNSATVAAVGDGFIAQDLRIQN  1052
             YKENVEIGKKKTNVML+GDG  AT+ITG+LN++DG TTF +ATVAAVGDGFIAQD+  QN
Sbjct  186   YKENVEIGKKKTNVMLVGDGKDATVITGNLNFIDGTTTFKTATVAAVGDGFIAQDIWFQN  245

Query  1053  TAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYAHSQRQFYRDCYITGTVDFIFGNAAA  1232
             TAGP+KHQAVALR+GADQSVINRC+IDA+QDTLYAHS RQFYRD +ITGTVDFIFGNAA 
Sbjct  246   TAGPQKHQAVALRVGADQSVINRCRIDAFQDTLYAHSNRQFYRDSFITGTVDFIFGNAAV  305

Query  1233  VIQNSQVVARKPMAAQKNMVTAQGRTDPNQNTGTSIQNCNVSPSSDLGPVKGTIQTYLGR  1412
             V Q   +VARKPM  Q NMVTAQGR DPNQNTGTSIQ CN++PSSDL PV G+I+T+LGR
Sbjct  306   VFQKCDLVARKPMDKQNNMVTAQGREDPNQNTGTSIQQCNLTPSSDLKPVVGSIKTFLGR  365

Query  1413  PWKEYSRTVFMESNIGDHIDPAGWFPWDG---DFALKTLYYGEYMNRGPGAGTSKRVNWP  1583
             PWK+YSRTV M+S +  HIDP GW  WD    DF L+TLYYGEYMN GPGAGTSKRVNWP
Sbjct  366   PWKKYSRTVVMQSTLDSHIDPTGWAEWDAQSKDF-LQTLYYGEYMNNGPGAGTSKRVNWP  424

Query  1584  GYHVITDKAEAMKFTVAQLIQGGSWLKNTGVDYTEGL  1694
             GYH+I   AEA KFTVAQLIQG  WLKNTGV++ EGL
Sbjct  425   GYHIIKTAAEASKFTVAQLIQGNVWLKNTGVNFIEGL  461



>ref|XP_011016647.1| PREDICTED: pectinesterase-like [Populus euphratica]
Length=550

 Score =   637 bits (1644),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/552 (59%), Positives = 414/552 (75%), Gaps = 4/552 (1%)
 Frame = +3

Query  45    MATTSHLPLLFTPKRKPSSCRalyvllylaaIVGSVALVSIWALRTSSSSPSLWKARVCD  224
             MA+++H PLL T     S  +     + L A++ S   ++   ++ S SSPS    ++C+
Sbjct  1     MASSAHHPLLNTTNNTKSHVKIFIFSISLFAVILSSVFLASHFIKVSQSSPS--TPQICN  58

Query  225   PAHDPPSCMAIVSE-VSSAAPTETDGVAllqmllhssllRIQDAVKLSANVNRRINDRKV  401
              AHDP  C++I+SE VS+    E++GV LL+  L  SL +++ A   +  VN +IND K 
Sbjct  59    QAHDPQECLSILSEAVSTEGVQESNGVGLLKTFLVKSLSQMRMAKAAANAVNSKINDHKH  118

Query  402   QAAVADCMELLDLSQDKVMDSMVALGNLSARA-RTDAHSWLSSVLTNHDTCLDGLSEPAR  578
             QAA+ADC+EL+D+S D+V D++ ALGN  +++  +DA++WLS VLTNH TCLDG+    +
Sbjct  119   QAALADCVELMDMSIDRVTDTLSALGNWGSQSDASDANTWLSGVLTNHVTCLDGVDTIDQ  178

Query  579   SIMEPMIKDLISRAKsslavlvavaPSTEDDLRALNGEFPSWVSASDRRLLEASanavaa  758
               M+ +++DLISR ++SLA + +++ S  D ++ LNG FPSW+   DR+LLE+S + V A
Sbjct  179   PSMKKLLQDLISRMRTSLATVSSLSASDTDLVQPLNGGFPSWILGRDRKLLESSVSNVEA  238

Query  759   nvvvaKDGSGKYKTVAEAVASAPDNGKTRYVIYIKKGTYKENVEIGKKKTNVMLIGDGLS  938
             NV+VA+DGSG Y T+ EAV S PD  K+RYVI++K G YKENVE+GKKK NVM++GDG+ 
Sbjct  239   NVIVAQDGSGDYTTIQEAVNSVPDKSKSRYVIHVKSGIYKENVEVGKKKKNVMIVGDGMD  298

Query  939   ATIITGSLNYVDGATTFNSATVAAVGDGFIAQDLRIQNTAGPEKHQAVALRLGADQSVIN  1118
              TI+TG+LN VDG+TTF SAT+A  GDGFI QD+ IQNTAGPEKHQAVALR+ ADQSVIN
Sbjct  299   FTILTGNLNVVDGSTTFRSATLAVAGDGFILQDIWIQNTAGPEKHQAVALRVSADQSVIN  358

Query  1119  RCKIDAYQDTLYAHSQRQFYRDCYITGTVDFIFGNAAAVIQNSQVVARKPMAAQKNMVTA  1298
             RC+IDAYQDTLY H+ RQFYRDC I GT+DFIFGN A V+QN Q+++RKPMA QKNMVTA
Sbjct  359   RCRIDAYQDTLYTHNYRQFYRDCSIIGTIDFIFGNGAVVLQNCQIISRKPMANQKNMVTA  418

Query  1299  QGRTDPNQNTGTSIQNCNVSPSSDLGPVKGTIQTYLGRPWKEYSRTVFMESNIGDHIDPA  1478
             QGR DPNQNTG SIQNC++  SSDL   +    TYLGRPWK+YSRTV M+S IG HIDP 
Sbjct  419   QGRIDPNQNTGISIQNCDIVASSDLESEQNKFPTYLGRPWKQYSRTVVMQSKIGGHIDPT  478

Query  1479  GWFPWDGDFALKTLYYGEYMNRGPGAGTSKRVNWPGYHVITDKAEAMKFTVAQLIQGGSW  1658
             GW  WD +FAL TLYYGEY NRG GAG S RVNWPGYHVITD  EA +FTVA+LIQGG+W
Sbjct  479   GWAEWDKEFALTTLYYGEYANRGLGAGVSMRVNWPGYHVITDPNEAKQFTVAELIQGGAW  538

Query  1659  LKNTGVDYTEGL  1694
             L +TGV +TEGL
Sbjct  539   LGSTGVSFTEGL  550



>ref|XP_011016743.1| PREDICTED: pectinesterase-like [Populus euphratica]
Length=550

 Score =   635 bits (1637),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/552 (59%), Positives = 414/552 (75%), Gaps = 4/552 (1%)
 Frame = +3

Query  45    MATTSHLPLLFTPKRKPSSCRalyvllylaaIVGSVALVSIWALRTSSSSPSLWKARVCD  224
             MA+++H PLL T     S  +     + L AI+ S   ++   ++ S SSPS    ++C+
Sbjct  1     MASSAHQPLLNTTNNTKSHVKIFIFSISLFAIILSSVFLASHFIKVSQSSPS--TPQICN  58

Query  225   PAHDPPSCMAIVSE-VSSAAPTETDGVAllqmllhssllRIQDAVKLSANVNRRINDRKV  401
              AHDP  C++I+SE VS+    E++GV LL++ L  SL +++ A  ++  VN +IND K 
Sbjct  59    QAHDPQECLSILSEAVSTEGVQESNGVGLLKIFLVKSLSQMRMAKAVANAVNSKINDHKH  118

Query  402   QAAVADCMELLDLSQDKVMDSMVALGNLSARA-RTDAHSWLSSVLTNHDTCLDGLSEPAR  578
             QAA+ADC+EL+D+S D+V D++ ALGN  +++  +DA++WLS VLTNH TCLDG+    +
Sbjct  119   QAALADCVELMDMSIDRVTDTLSALGNWGSQSDASDANTWLSGVLTNHVTCLDGVDTIDQ  178

Query  579   SIMEPMIKDLISRAKsslavlvavaPSTEDDLRALNGEFPSWVSASDRRLLEASanavaa  758
               M+ +++DLISR ++SLA + +++    D ++ LNG  PSW+   DR+LLE+S + V A
Sbjct  179   PSMKKLLQDLISRMRTSLATVSSLSAPDTDLVQPLNGGVPSWILGRDRKLLESSVSNVEA  238

Query  759   nvvvaKDGSGKYKTVAEAVASAPDNGKTRYVIYIKKGTYKENVEIGKKKTNVMLIGDGLS  938
             NVVVA+DGSG Y T+ EAV S PD  K+RYVI++K G YKENVE+GKKK NVM++GDG+ 
Sbjct  239   NVVVAQDGSGDYTTIQEAVNSVPDKSKSRYVIHVKSGIYKENVEVGKKKKNVMIVGDGMD  298

Query  939   ATIITGSLNYVDGATTFNSATVAAVGDGFIAQDLRIQNTAGPEKHQAVALRLGADQSVIN  1118
              TI+TG+LN VDG+TTF SAT+A  GDGFI QD+ IQNTAGPEKHQAVALR+ ADQSVIN
Sbjct  299   FTILTGNLNVVDGSTTFRSATLAVAGDGFILQDIWIQNTAGPEKHQAVALRVSADQSVIN  358

Query  1119  RCKIDAYQDTLYAHSQRQFYRDCYITGTVDFIFGNAAAVIQNSQVVARKPMAAQKNMVTA  1298
             RC+IDAYQDTLY H+ RQFYRDC I GT+DFIFGN A V+QN Q+++RKPMA QKNMVTA
Sbjct  359   RCRIDAYQDTLYTHNYRQFYRDCSIIGTIDFIFGNGAVVLQNCQIISRKPMANQKNMVTA  418

Query  1299  QGRTDPNQNTGTSIQNCNVSPSSDLGPVKGTIQTYLGRPWKEYSRTVFMESNIGDHIDPA  1478
             QGR DPNQNTG SIQNC++  SSDL   +    TYLGRPWK+YSRTV M+S IG HIDP 
Sbjct  419   QGRIDPNQNTGISIQNCDIVASSDLESDQNKFPTYLGRPWKQYSRTVVMQSKIGGHIDPT  478

Query  1479  GWFPWDGDFALKTLYYGEYMNRGPGAGTSKRVNWPGYHVITDKAEAMKFTVAQLIQGGSW  1658
             GW  WD +FAL TLYYGEY NRG GAG S RVNWPGYHVITD  EA KFTVA+LIQGG+W
Sbjct  479   GWAEWDKEFALTTLYYGEYANRGLGAGVSMRVNWPGYHVITDPNEAKKFTVAELIQGGAW  538

Query  1659  LKNTGVDYTEGL  1694
             L +TGV +TEGL
Sbjct  539   LGSTGVSFTEGL  550



>ref|XP_010057972.1| PREDICTED: pectinesterase-like [Eucalyptus grandis]
Length=549

 Score =   635 bits (1637),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 342/559 (61%), Positives = 428/559 (77%), Gaps = 19/559 (3%)
 Frame = +3

Query  45    MATTSHLPLLFTPKRKPSSCRalyvllylaaIVGSVALVSIWALRTS--SSSPSLWKARV  218
             MATT+  PLL T   + S  R+L ++L L AI+ S A+++   ++ S  +++P    A V
Sbjct  1     MATTTQ-PLLNT---QTSHNRSLCLILSLIAIIFSFAVITDHLIKASDFANAP---LASV  53

Query  219   CDPAHDPPSCMAIVSEV--SSAAPTETDGVAllqmllhssllRIQDAVKLSANVNRRIND  392
             C  A D   C A+VSE+    AA   +D   LLQ+ +    +R  +AV+   +V RR+N 
Sbjct  54    CSKAQDQAQCRALVSEIVPYGAASFMSDD-KLLQVFVKKMAIRTGNAVEAVKDVRRRVNY  112

Query  393   RKVQAAVADCMELLDLSQDKVMDSMVALGNLSARARTDAHSWLSSVLTNHDTCLDGL--S  566
              + +AA+ADC+EL+++S D++ DS  +L    + A  D H+WLSS LTN+ TCLDG   S
Sbjct  113   PREEAALADCVELMEMSVDRLEDSTRSLQEQKSSA--DVHTWLSSSLTNYITCLDGFEGS  170

Query  567   EPARSIMEPMIKDLISRAKsslav-lvavaPSTE--DDLRALNGEFPSWVSASDRRLLEA  737
               A+S ++P++ DLISRA++SLA+ +   +P     D L +L G+FPSWV+  D RLL++
Sbjct  171   SSAKSSIKPILSDLISRARTSLAIFVSTSSPEGRRPDVLESLIGDFPSWVTRKDHRLLQS  230

Query  738   SanavaanvvvaKDGSGKYKTVAEAVASAPDNGKTRYVIYIKKGTYKENVEIGKKKTNVM  917
               NAV A+VVVAKDG+GK+KTV EA+A+AP   +TRYVIY+KKGTYKENVE+ K KTN+M
Sbjct  231   LVNAVNADVVVAKDGTGKFKTVKEAIAAAPSKAQTRYVIYVKKGTYKENVEVAKTKTNIM  290

Query  918   LIGDGLSATIITGSLNYVDGATTFNSATVAAVGDGFIAQDLRIQNTAGPEKHQAVALRLG  1097
             L+GDG+ +T+ITGSLN +DGATTFNSATVA  GDGFIAQD+  QNTAGP+KHQAVALR+ 
Sbjct  291   LVGDGMDSTVITGSLNVIDGATTFNSATVAVNGDGFIAQDIWFQNTAGPQKHQAVALRVS  350

Query  1098  ADQSVINRCKIDAYQDTLYAHSQRQFYRDCYITGTVDFIFGNAAAVIQNSQVVARKPMAA  1277
             AD+SVINRC+IDAYQDTLY H+ RQFYRD YITGTVDFIFGNA  V QN  +VARKPM+ 
Sbjct  351   ADKSVINRCRIDAYQDTLYTHTSRQFYRDSYITGTVDFIFGNAGVVFQNCNLVARKPMSG  410

Query  1278  QKNMVTAQGRTDPNQNTGTSIQNCNVSPSSDLGPVKGTIQTYLGRPWKEYSRTVFMESNI  1457
             Q NMVTAQGRTDPNQNTG SIQ+CN++ SSDL PVKG+I++YLGRPWKEYSRTV M+SNI
Sbjct  411   QSNMVTAQGRTDPNQNTGISIQSCNMTASSDLVPVKGSIKSYLGRPWKEYSRTVVMQSNI  470

Query  1458  GDHIDPAGWFPWDGDFALKTLYYGEYMNRGPGAGTSKRVNWPGYHVITDKAEAMKFTVAQ  1637
             GDHIDP GW  W GDFALKTLYYGEYMN+GPGAGTSKRVNWPGYHVIT   EA KFTVA+
Sbjct  471   GDHIDPTGWSVWSGDFALKTLYYGEYMNKGPGAGTSKRVNWPGYHVITSATEAKKFTVAE  530

Query  1638  LIQGGSWLKNTGVDYTEGL  1694
             LIQGG+WLK++GV YTEGL
Sbjct  531   LIQGGTWLKSSGVSYTEGL  549



>ref|XP_011095339.1| PREDICTED: pectinesterase 2.1-like [Sesamum indicum]
Length=550

 Score =   635 bits (1637),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/558 (60%), Positives = 417/558 (75%), Gaps = 16/558 (3%)
 Frame = +3

Query  45    MATTSHLPLLFTPKRKPSSCRalyvllylaaIVGSVALVSIWALRT----SSSSPSLWKA  212
             MA+T H PLL TP +  S+C+ L+  +   A++ S A +     +       S+PS    
Sbjct  1     MAST-HQPLLNTPNKTTSACKILFFTVSGFALLISAAFLLPNLTKNINLKGQSTPSF---  56

Query  213   RVCDPAHDPPSCMAIVSEVSSAAPTETDGVAllqmllhssllRIQDAV----KLSANVNR  380
              +C  A +P +C   VSEV S      D   +LQ  L + +  +  A+    KL   +N 
Sbjct  57    -LCRTAFNPRACQGFVSEVVSDGVAPRDATIVLQKFLINQVHHLNGALFNTRKLKNQLNG  115

Query  381   RINDRKVQAAVADCMELLDLSQDKVMDSMVALGNLSARARTDAHSWLSSVLTNHDTCLDG  560
             + N+     A+ADC+EL+DLS D V DS+ AL N ++ +  DA +WLS+VL NH TC DG
Sbjct  116   QNNE---HGALADCVELIDLSIDLVFDSIKALRNETSTSHADAQAWLSAVLDNHVTCFDG  172

Query  561   LSEPARSIMEPMIKDLISRAKsslavlvavaPSTEDDLRALNGEFPSWVSASDRRLLEAS  740
             L+   R+ +  +++DLISRA++SLA+L AV+   ++ +++L G+ PSW++A DR+LL++ 
Sbjct  173   LNSFGRNSLGAVLEDLISRARASLAMLAAVSEPEKEMVQSLRGKLPSWITAVDRKLLQSR  232

Query  741   anavaanvvvaKDGSGKYKTVAEAVASAPDNGKTRYVIYIKKGTYKENVEIGKKKTNVML  920
             ANA+ A++VVAKDGSG YKTVAEA+A+APD  K RYVIY+KKGTYKENVE+GK K N+M+
Sbjct  233   ANAIDADLVVAKDGSGNYKTVAEAIAAAPDKSKKRYVIYVKKGTYKENVEVGKNKKNLMI  292

Query  921   IGDGLSATIITGSLNYVDGATTFNSATVAAVGDGFIAQDLRIQNTAGPEKHQAVALRLGA  1100
             IGDG+ +TIITG LN VDG+TTF SAT+AAVG+GF+ QD+RIQNTAGPEKHQAVALR+GA
Sbjct  293   IGDGMDSTIITGDLNVVDGSTTFKSATLAAVGEGFMLQDIRIQNTAGPEKHQAVALRVGA  352

Query  1101  DQSVINRCKIDAYQDTLYAHSQRQFYRDCYITGTVDFIFGNAAAVIQNSQVVARKPMAAQ  1280
             D+SVINRC+IDAYQDTLYAHS RQFYRD YITGTVDFIFGNAA V Q  ++VARKPM +Q
Sbjct  353   DKSVINRCRIDAYQDTLYAHSLRQFYRDSYITGTVDFIFGNAAVVFQKCKLVARKPMKSQ  412

Query  1281  KNMVTAQGRTDPNQNTGTSIQNCNVSPSSDLGPVKGTIQTYLGRPWKEYSRTVFMESNIG  1460
             KNMVTAQGRTDPNQNTGTSIQ+C +  S DL PVK +  TYLGRPWKEYSRTV M+S IG
Sbjct  413   KNMVTAQGRTDPNQNTGTSIQDCEIRASEDLEPVKSSFPTYLGRPWKEYSRTVVMQSYIG  472

Query  1461  DHIDPAGWFPWDGDFALKTLYYGEYMNRGPGAGTSKRVNWPGYHVITDKAEAMKFTVAQL  1640
             DHIDP GW  W GDFALKTLYYGEYMN+GPGAGTSKRV W GYHVIT+ AEA KFTV +L
Sbjct  473   DHIDPVGWSEWSGDFALKTLYYGEYMNKGPGAGTSKRVKWAGYHVITNAAEAAKFTVKEL  532

Query  1641  IQGGSWLKNTGVDYTEGL  1694
             IQG  WL +TGV YTEGL
Sbjct  533   IQGVEWLGSTGVAYTEGL  550



>gb|AFK44272.1| unknown [Lotus japonicus]
Length=554

 Score =   634 bits (1634),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 334/528 (63%), Positives = 411/528 (78%), Gaps = 11/528 (2%)
 Frame = +3

Query  138   IVGSVALVSIWALRTSSSSPSLWKARVCDPAHDPPSCMAIVSEVSSA--APTETDGVAll  311
             I+ S AL++ + L+ +S +  L     C+ A D  SC+A VSEVS +  + T+   + +L
Sbjct  29    IISSSALIASY-LKPTSFNLFLSPPHGCEHALDASSCLAHVSEVSQSPISATKDPKLNIL  87

Query  312   qmllhssllRIQDAVKLSANVNRRINDRKVQAAVADCMELLDLSQDKVMDSMVALGNLSA  491
               L+  S   IQ+A+  +  +  RIN+ + +AA++DC +L+DLS D+V DS++AL   + 
Sbjct  88    ISLMTKSTSHIQEAMVKTKAIKNRINNPREEAALSDCEQLMDLSIDRVWDSVMALTKDNT  147

Query  492   RARTDAHSWLSSVLTNHDTCLDGLSEPARSIMEPMIKDLISRAKsslavlvav-aPSTED  668
              +  DAH+WLS VLTNH TCLDGL  P+R++ME  I+DLISR+K+SLA+LV+V AP   +
Sbjct  148   DSHQDAHAWLSGVLTNHATCLDGLEGPSRALMEAEIEDLISRSKTSLALLVSVLAPKGGN  207

Query  669   DL---RALNGEFPSWVSASDRRLLEASanavaanvvvaKDGSGKYKTVAEAVASAPDNGK  839
             +      L+G+FPSWV+  DRRLLE+S   V ANVVVAKDGSG++KTVAEAVASAPD+GK
Sbjct  208   EQIIDEPLDGDFPSWVTRKDRRLLESSVGDVNANVVVAKDGSGRFKTVAEAVASAPDSGK  267

Query  840   TRYVIYIKKGTYKENVEIGKKKTNVMLIGDGLSATIITGSLNYVDGATTFNSATVAAVGD  1019
             TRYVIY+KKGTYKEN+EIGKKKTNVML GDG+ ATIITG+LN +DG+TTF SATVAAVGD
Sbjct  268   TRYVIYVKKGTYKENIEIGKKKTNVMLTGDGMDATIITGNLNVIDGSTTFKSATVAAVGD  327

Query  1020  GFIAQDLRIQNTAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYAHSQRQFYRDCYITG  1199
             GFIAQD+  QNTAGPEKHQAVALR+GADQS+INRC+IDAYQDTLYAH+ RQF RD +ITG
Sbjct  328   GFIAQDIWFQNTAGPEKHQAVALRVGADQSIINRCRIDAYQDTLYAHTNRQFSRDSFITG  387

Query  1200  TVDFIFGNAAAVIQNSQVVARKPMAAQKNMVTAQGRTDPNQNTGTSIQNCNVSPSSDLGP  1379
             TVDFIFGNAA V Q   +VARKPM+ QKNM+TAQGR DPNQNTGTSIQ CN++PS DL P
Sbjct  388   TVDFIFGNAAVVFQKCNIVARKPMSNQKNMLTAQGREDPNQNTGTSIQQCNLTPSQDLKP  447

Query  1380  VKGTIQTYLGRPWKEYSRTVFMESNIGDHIDPAGWFPWDG---DFALKTLYYGEYMNRGP  1550
             V G+I+TYLGRPWK+YSRT+ ++S+I  HIDP GW  WD    DF L+TLYYGEY N G 
Sbjct  448   VAGSIKTYLGRPWKKYSRTIVLQSSIDSHIDPTGWAEWDAQSKDF-LQTLYYGEYSNIGA  506

Query  1551  GAGTSKRVNWPGYHVITDKAEAMKFTVAQLIQGGSWLKNTGVDYTEGL  1694
             GAGT KRVNWPG+HVI   AEA KFTVAQLIQG  WLK  GV++ EGL
Sbjct  507   GAGTGKRVNWPGFHVIKTAAEASKFTVAQLIQGNVWLKGKGVNFIEGL  554



>ref|XP_004293266.1| PREDICTED: pectinesterase [Fragaria vesca subsp. vesca]
Length=528

 Score =   630 bits (1626),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 340/548 (62%), Positives = 403/548 (74%), Gaps = 32/548 (6%)
 Frame = +3

Query  69    LLFTPKRKPSSCRalyvllylaaIVGSVALVSIWALRTSSSSPSLWKARVCDPAHDPPSC  248
             LL  PK   S C++LY++L LAAI+GSV L+SI  +  +SSS S            PP  
Sbjct  7     LLDAPK-ATSRCKSLYLILSLAAIIGSVTLLSIQVMIKTSSSNS------------PPGV  53

Query  249   MAIVSEVSSAAPTETDGVAllqmllhssllRIQDAVKLSANVNRRINDRKVQAAVADCME  428
             M    ++      E+                +Q A++ + +   +IND K +AA+ DC+E
Sbjct  54    MIADVDLLQGLLEES-------------TPHLQQALETAKDAYAKINDPKDRAALVDCVE  100

Query  429   LLDLSQDKVMDSMVALGNLSAR-ARTDAHSWLSSVLTNHDTCLDGLSE-PARSIMEPMIK  602
             L++++ D+++DS VAL NL  +    D H+WLSSVLTNH TCLDGL    AR+IMEP + 
Sbjct  101   LMEVTMDRILDSRVALKNLKVQNTMEDVHTWLSSVLTNHVTCLDGLKGLSARTIMEPRLN  160

Query  603   DLISRAKsslavlvavaPSTED---DLRALNGEFPSWVSASDRRLLEASana-vaanvvv  770
              LIS++K+ LA LV ++PS E    D     G+FP+WV   DRRL+       V ANVVV
Sbjct  161   GLISKSKAFLAKLVEISPSKEKVIGDQPLEIGDFPTWVKRRDRRLMSRDFQKGVEANVVV  220

Query  771   aKDGSGKYKTVAEAVASAPDNGKTRYVIYIKKGTYKENVEIGKKKTNVMLIGDGLSATII  950
             A DGSGKYKTV EAVA+APD   TRYVIY+KKGTYKENVE+ K K N+M++GDG+  TII
Sbjct  221   ANDGSGKYKTVKEAVAAAPDKSTTRYVIYVKKGTYKENVEVVKNKKNLMIVGDGMDKTII  280

Query  951   TGSLNYVDGATTFNSATVAAVGDGFIAQDLRIQNTAGPEKHQAVALRLGADQSVINRCKI  1130
             TGSLN VDG+TTFNSAT+AAVGDGFIAQD+  QNTAGP+KHQAVALR+GADQSVINRC+I
Sbjct  281   TGSLNVVDGSTTFNSATLAAVGDGFIAQDIWFQNTAGPDKHQAVALRVGADQSVINRCRI  340

Query  1131  DAYQDTLYAHSQRQFYRDCYITGTVDFIFGNAAAVIQNSQVVARKPMAAQKNMVTAQGRT  1310
             DAYQDTLYAHS RQFYRDCYITGTVDFIFGNAA V+QN ++VARKP + Q NMVTAQGRT
Sbjct  341   DAYQDTLYAHSNRQFYRDCYITGTVDFIFGNAAVVLQNCKIVARKPASGQNNMVTAQGRT  400

Query  1311  DPNQNTGTSIQNCNVSPSSDLGPVKGTIQTYLGRPWKEYSRTVFMESNIGDHIDPAGWFP  1490
             DPNQNTGTSIQ C V  SSDL PVKGT+++YLGRPWKEYSRTV M+S IGDHIDP GW  
Sbjct  401   DPNQNTGTSIQKCQVIASSDLEPVKGTVRSYLGRPWKEYSRTVVMQSTIGDHIDPTGWSI  460

Query  1491  WDGDFALKTLYYGEYMNRGPGAGTSKRVNWPGYHVITDKAEAMKFTVAQLIQGGSWLKNT  1670
             W GDFALKTLYYGEY N GPGAGTSKRV W GYHVI   +EA  FTVA LIQGGSWLK+T
Sbjct  461   WSGDFALKTLYYGEYANSGPGAGTSKRVTWAGYHVIKTASEAQSFTVAGLIQGGSWLKST  520

Query  1671  GVDYTEGL  1694
             GV +TEGL
Sbjct  521   GVSFTEGL  528



>ref|XP_003622699.1| Pectinesterase [Medicago truncatula]
 gb|ABD33414.1| Pectinesterase; Pectinesterase inhibitor [Medicago truncatula]
 gb|AES78917.1| pectinesterase/pectinesterase inhibitor [Medicago truncatula]
Length=555

 Score =   632 bits (1629),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/501 (64%), Positives = 390/501 (78%), Gaps = 10/501 (2%)
 Frame = +3

Query  219   CDPAHDPPSCMAIVSEVS---SAAPTETDGVAllqmllhssllRIQDAVKLSANVNRRIN  389
             C+ A D  SC+A VSEVS   +   T+   + +L  LL  S   IQ+A+  ++ + RRIN
Sbjct  56    CEHAVDTKSCLAHVSEVSHVPTLVTTKDQNLHVLLSLLTKSTTHIQNAMDTASVIKRRIN  115

Query  390   DRKVQAAVADCMELLDLSQDKVMDSMVALGNLSARARTDAHSWLSSVLTNHDTCLDGLSE  569
               + + A++DC +L+DLS +++ D+M+ L   +  ++ DAH+WLSSVLTNH TCLDGL  
Sbjct  116   SPREEIALSDCEQLMDLSMNRIWDTMLKLTKNNIDSQQDAHTWLSSVLTNHATCLDGLEG  175

Query  570   PARSIMEPMIKDLISRAKsslavlvavaPSTEDDL---RALNGEFPSWVSASDRRLLEAS  740
              +R +ME  ++DLISRA+SSLAV + V P  + D      L GEFPSWV++ DRRLLE +
Sbjct  176   SSRVVMENDLQDLISRARSSLAVFLVVFPQKDRDQFIDETLIGEFPSWVTSKDRRLLETA  235

Query  741   anavaanvvvaKDGSGKYKTVAEAVASAPDNGKTRYVIYIKKGTYKENVEIGKKKTNVML  920
                + ANVVVA+DGSGK+KTVAEAVASAPDNGKT+YVIY+KKGTYKENVEIG KKTNVML
Sbjct  236   VGDIKANVVVAQDGSGKFKTVAEAVASAPDNGKTKYVIYVKKGTYKENVEIGSKKTNVML  295

Query  921   IGDGLSATIITGSLNYVDGATTFNSATVAAVGDGFIAQDLRIQNTAGPEKHQAVALRLGA  1100
             +GDG+ ATIITG+LN++DG TTF S+TVAAVGDGFIAQD+  QN AG  KHQAVALR+G+
Sbjct  296   VGDGMDATIITGNLNFIDGTTTFKSSTVAAVGDGFIAQDIWFQNMAGAAKHQAVALRVGS  355

Query  1101  DQSVINRCKIDAYQDTLYAHSQRQFYRDCYITGTVDFIFGNAAAVIQNSQVVARKPMAAQ  1280
             DQSVINRC+IDA+QDTLYAHS RQFYRD  ITGT+DFIFGNAA V Q  ++VARKPMA Q
Sbjct  356   DQSVINRCRIDAFQDTLYAHSNRQFYRDSVITGTIDFIFGNAAVVFQKCKLVARKPMANQ  415

Query  1281  KNMVTAQGRTDPNQNTGTSIQNCNVSPSSDLGPVKGTIQTYLGRPWKEYSRTVFMESNIG  1460
              NM TAQGR DP QNTGTSIQ C+++PSSDL PV G+I+T+LGRPWK+YSRTV M+S + 
Sbjct  416   NNMFTAQGREDPGQNTGTSIQQCDLTPSSDLKPVVGSIKTFLGRPWKKYSRTVVMQSFLD  475

Query  1461  DHIDPAGWFPWDG---DFALKTLYYGEYMNRGPGAGTSKRVNWPGYHVITDKAEAMKFTV  1631
              HIDP GW  WD    DF L+TLYYGEY+N GPGAGT+KRV WPGYHVI   AEA KFTV
Sbjct  476   SHIDPTGWAEWDAASKDF-LQTLYYGEYLNNGPGAGTAKRVTWPGYHVINTAAEASKFTV  534

Query  1632  AQLIQGGSWLKNTGVDYTEGL  1694
             AQLIQG  WLKNTGV +TEGL
Sbjct  535   AQLIQGNVWLKNTGVAFTEGL  555



>ref|XP_006377839.1| hypothetical protein POPTR_0011s13830g [Populus trichocarpa]
 gb|ERP55636.1| hypothetical protein POPTR_0011s13830g [Populus trichocarpa]
Length=550

 Score =   630 bits (1625),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/552 (58%), Positives = 413/552 (75%), Gaps = 4/552 (1%)
 Frame = +3

Query  45    MATTSHLPLLFTPKRKPSSCRalyvllylaaIVGSVALVSIWALRTSSSSPSLWKARVCD  224
             MA+++H PLL T     S  + L   + L A++ S   ++   ++ S SSPS    ++C+
Sbjct  1     MASSTHQPLLNTTNNTKSHVKILIFAISLFAVIFSSVFLASRLIKVSQSSPS--TPQICN  58

Query  225   PAHDPPSCMAIVSE-VSSAAPTETDGVAllqmllhssllRIQDAVKLSANVNRRINDRKV  401
              A DP  C++I+SE VS+    E++GV LL+  L  SL +++ A   +  VN +IN  K 
Sbjct  59    QARDPQECLSILSEAVSTEGVQESNGVGLLKTFLVKSLSQMRMAKAAANAVNSKINGHKH  118

Query  402   QAAVADCMELLDLSQDKVMDSMVALGNLSARA-RTDAHSWLSSVLTNHDTCLDGLSEPAR  578
             QAA+ADC+EL+D+S D+V D++ AL N  +++  +DA++WLS VLTNH TCLDG+    +
Sbjct  119   QAALADCVELMDMSIDRVTDTLSALANWGSQSDASDANTWLSGVLTNHVTCLDGIDTIDQ  178

Query  579   SIMEPMIKDLISRAKsslavlvavaPSTEDDLRALNGEFPSWVSASDRRLLEASanavaa  758
               M+ +++DLISR ++SLA + +++ S  D ++ LNG FPSW+   DR+LLE+S + V A
Sbjct  179   PSMKKLLQDLISRMRTSLAAVSSLSASDTDLVQPLNGGFPSWILGRDRKLLESSVSTVEA  238

Query  759   nvvvaKDGSGKYKTVAEAVASAPDNGKTRYVIYIKKGTYKENVEIGKKKTNVMLIGDGLS  938
             NVVVA+DGSG   T+ E+V S PD  K+RYVI +K G YKENVE+GKKK NVM++GDG+ 
Sbjct  239   NVVVAQDGSGDNTTIQESVNSVPDKSKSRYVICVKSGIYKENVEVGKKKKNVMIVGDGMD  298

Query  939   ATIITGSLNYVDGATTFNSATVAAVGDGFIAQDLRIQNTAGPEKHQAVALRLGADQSVIN  1118
             +TI+TG+LN VDG+TTF SAT+A  GDGF+ QD+ IQNTAGPEKHQAVALR+ ADQSVIN
Sbjct  299   STILTGNLNVVDGSTTFRSATLAVAGDGFVLQDIWIQNTAGPEKHQAVALRVSADQSVIN  358

Query  1119  RCKIDAYQDTLYAHSQRQFYRDCYITGTVDFIFGNAAAVIQNSQVVARKPMAAQKNMVTA  1298
             RC+IDAYQDTLY H+ RQFYRDC+I GT+DFIFGN A V+QN  +++RKPMA QKNMVTA
Sbjct  359   RCRIDAYQDTLYTHNYRQFYRDCFIIGTIDFIFGNGAVVLQNCHIISRKPMANQKNMVTA  418

Query  1299  QGRTDPNQNTGTSIQNCNVSPSSDLGPVKGTIQTYLGRPWKEYSRTVFMESNIGDHIDPA  1478
             QGR DPNQNTG SIQNC++  SSDL   +    TYLGRPWKEYSRTV M+SNIG HIDP 
Sbjct  419   QGRIDPNQNTGISIQNCDIVASSDLESEQNKFPTYLGRPWKEYSRTVVMQSNIGGHIDPT  478

Query  1479  GWFPWDGDFALKTLYYGEYMNRGPGAGTSKRVNWPGYHVITDKAEAMKFTVAQLIQGGSW  1658
             GW  WD +FAL TLYYGEY NRG GAG SKRVNWPGYHVITD  EA +FTVA+LIQGG+W
Sbjct  479   GWAEWDKEFALTTLYYGEYANRGLGAGVSKRVNWPGYHVITDPNEAKQFTVAELIQGGAW  538

Query  1659  LKNTGVDYTEGL  1694
             L +TGV +TEGL
Sbjct  539   LGSTGVSFTEGL  550



>ref|XP_004492227.1| PREDICTED: pectinesterase/pectinesterase inhibitor 18-like [Cicer 
arietinum]
Length=557

 Score =   629 bits (1623),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 339/539 (63%), Positives = 400/539 (74%), Gaps = 26/539 (5%)
 Frame = +3

Query  138   IVGSVALVSIWALRTS-----------SSSPSLWKARVCDPAHDPPSCMAIVSEVS---S  275
             I+  VA++S  AL  S           SS+P L     C  A D  SC+  VSEVS   +
Sbjct  25    ILSLVAIISSSALVISHLNKPISFFHLSSAPHL-----CQLAIDTKSCLTHVSEVSQHQT  79

Query  276   AAPTETDGVAllqmllhssllRIQDAVKLSANVNRRINDRKVQAAVADCMELLDLSQDKV  455
                T+      L  LL  S   I+  +  +  + RR+N  K + A+ DC EL+DLS D+V
Sbjct  80    LPNTKDHKFNTLISLLTKSTTHIKKTMDKANVIKRRVNSPKEELALNDCEELMDLSMDRV  139

Query  456   MDSMVALGNLSARARTDAHSWLSSVLTNHDTCLDGLSEPARSIMEPMIKDLISRAKssla  635
              +S++ L N +  ++ +AH+WLS+VLTNH TCLDGL   +  +ME  + DLISRA+SSLA
Sbjct  140   WNSVLTLTNNNIDSQQNAHTWLSTVLTNHVTCLDGLEGSSLVVMESDLHDLISRARSSLA  199

Query  636   vlvavaPSTEDD---LRALNGEFPSWVSASDRRLLEASanavaanvvvaKDGSGKYKTVA  806
             VLVAV PS + D      LNG+FPSWV++ DR+LLE+S   + ANVVVAKDGSGK+KTV 
Sbjct  200   VLVAVFPSKDSDGFIEEKLNGDFPSWVTSKDRKLLESSIGDIKANVVVAKDGSGKFKTVV  259

Query  807   EAVASAPDNGKTRYVIYIKKGTYKENVEIGKKKTNVMLIGDGLSATIITGSLNYVDGATT  986
             EAVASAPDNG TRYVIY+KKG YKENVEIGKKK NVML+GDG+  T ITGSLN +DG+TT
Sbjct  260   EAVASAPDNGNTRYVIYVKKGIYKENVEIGKKKKNVMLVGDGMDVTTITGSLNVIDGSTT  319

Query  987   FNSATVAAVGDGFIAQDLRIQNTAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYAHSQ  1166
             F SATVAAVGDGFIAQD+  QNTAGPEKHQAVALR+GADQSVINRC+IDA+QDTLYAHS 
Sbjct  320   FKSATVAAVGDGFIAQDIGFQNTAGPEKHQAVALRVGADQSVINRCRIDAFQDTLYAHSN  379

Query  1167  RQFYRDCYITGTVDFIFGNAAAVIQNSQVVARKPMAAQKNMVTAQGRTDPNQNTGTSIQN  1346
             RQFYRD YITGTVDFIFGNAA V Q S++ AR+PM+ QKNMVTAQGR DPNQNT TSIQ 
Sbjct  380   RQFYRDSYITGTVDFIFGNAAVVFQKSKLAARRPMSNQKNMVTAQGREDPNQNTATSIQQ  439

Query  1347  CNVSPSSDLGPVKGTIQTYLGRPWKEYSRTVFMESNIGDHIDPAGWFPWDG---DFALKT  1517
             C+V PSSDL PV  +I+TYLGRPWK+YSRTV ++S I +HIDP GW  W+    DF L+T
Sbjct  440   CDVIPSSDLKPVVSSIKTYLGRPWKKYSRTVVLQSLIDNHIDPTGWAEWNDASKDF-LQT  498

Query  1518  LYYGEYMNRGPGAGTSKRVNWPGYHVITDKAEAMKFTVAQLIQGGSWLKNTGVDYTEGL  1694
             LYYGEY+N GPGAGTSKRVNWPGYHVIT   EA KFTV QLIQG  WLKNTGV + EGL
Sbjct  499   LYYGEYLNNGPGAGTSKRVNWPGYHVITSATEASKFTVKQLIQGNVWLKNTGVAFIEGL  557



>ref|XP_004492228.1| PREDICTED: pectinesterase 2.1-like [Cicer arietinum]
Length=555

 Score =   629 bits (1622),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/512 (63%), Positives = 391/512 (76%), Gaps = 14/512 (3%)
 Frame = +3

Query  186   SSSPSLWKARVCDPAHDPPSCMAIVSEVSSA---APTETDGVAllqmllhssllRIQDAV  356
             +S+P ++    C+ A D  SC+  VSEVS       T+   + +L  LL  S   IQ  +
Sbjct  49    TSAPHVY----CEHALDAKSCLTHVSEVSQGPILVTTKDHKLHVLLSLLTKSTTHIQKTM  104

Query  357   KLSANVNRRINDRKVQAAVADCMELLDLSQDKVMDSMVALGNLSARARTDAHSWLSSVLT  536
               +  +  RIN  + + A+ DC +L+++S D++ DSM+AL   +  ++ DAH+WLSSVLT
Sbjct  105   DTTNAIKSRINSPREETALRDCEQLMEISMDRIWDSMLALTKNTIDSQQDAHTWLSSVLT  164

Query  537   NHDTCLDGLSEPARSIMEPMIKDLISRAKsslavlvavaPSTEDDL---RALNGEFPSWV  707
             NH TCLDGL   ++ +ME   +DLISRA++SLAV +AV P    D      LNG+FPSW+
Sbjct  165   NHVTCLDGLEAISQVLMESDFQDLISRARTSLAVFLAVFPQQGHDQFVDETLNGDFPSWI  224

Query  708   SASDRRLLEASanavaanvvvaKDGSGKYKTVAEAVASAPDNGKTRYVIYIKKGTYKENV  887
             ++ DRRLLE+S   + ANVVVAKDGSGK+KTVAEAVA+APDNGKTRYVIY+KKGTYKEN+
Sbjct  225   TSKDRRLLESSVGDIKANVVVAKDGSGKFKTVAEAVATAPDNGKTRYVIYVKKGTYKENI  284

Query  888   EIGKKKTNVMLIGDGLSATIITGSLNYVDGATTFNSATVAAVGDGFIAQDLRIQNTAGPE  1067
             EIG  K NVML+GDG+ ATIITG+LN++DG TTF SATVAAVGDGFIAQD+  QNTAG E
Sbjct  285   EIGSIKKNVMLVGDGMDATIITGNLNFIDGTTTFKSATVAAVGDGFIAQDIGFQNTAGAE  344

Query  1068  KHQAVALRLGADQSVINRCKIDAYQDTLYAHSQRQFYRDCYITGTVDFIFGNAAAVIQNS  1247
             KHQAVALR+GADQSVINRC+IDA+QDTLYAHS RQFYRD  ITGT+DFIFGNAA V Q  
Sbjct  345   KHQAVALRVGADQSVINRCRIDAFQDTLYAHSNRQFYRDSVITGTIDFIFGNAAVVFQKC  404

Query  1248  QVVARKPMAAQKNMVTAQGRTDPNQNTGTSIQNCNVSPSSDLGPVKGTIQTYLGRPWKEY  1427
             ++VARKPMA Q NM TAQGR DP QNTGTSIQ C+++P++DL PV G+I+T+LGRPWK+Y
Sbjct  405   KLVARKPMANQNNMYTAQGREDPGQNTGTSIQQCDLTPTADLKPVVGSIKTFLGRPWKKY  464

Query  1428  SRTVFMESNIGDHIDPAGWFPWDG---DFALKTLYYGEYMNRGPGAGTSKRVNWPGYHVI  1598
             SRTV M+S +  HIDP GW  WD    DF L+TLYYGEYMN G GAGTSKRVNWPGYHVI
Sbjct  465   SRTVVMQSFLDSHIDPTGWAEWDAASKDF-LQTLYYGEYMNNGAGAGTSKRVNWPGYHVI  523

Query  1599  TDKAEAMKFTVAQLIQGGSWLKNTGVDYTEGL  1694
             T  AEA KFTVAQLIQG  WLKNTGV + EGL
Sbjct  524   TSAAEASKFTVAQLIQGNVWLKNTGVAFIEGL  555



>gb|AHC69829.1| pectin methylesterase PME2.1 [Nicotiana tabacum]
Length=559

 Score =   624 bits (1610),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 332/555 (60%), Positives = 411/555 (74%), Gaps = 8/555 (1%)
 Frame = +3

Query  54    TSHLPLL-FTPKRKPS-SCRalyvllylaaIVGSVA-LVSIWALRTSSSS-PSLWKARVC  221
             T + PLL  TPK+ P  SC+ L  ++     + SV  LV+ +      S+  SL   ++C
Sbjct  3     TPYQPLLPETPKQNPIISCKILTFVMTFVVALFSVVFLVAPYQFEVKHSNLSSLPGPQLC  62

Query  222   DPAHDPPSCMAIVSEVSS--AAPTETDGVAllqmllhssllRIQDAVKLSANVNRRINDR  395
             + A D   C++ VSE+ S     +++DG+ +LQ  L   +  +  A+ +   +  +IND 
Sbjct  63    EAAQDSQLCLSYVSELVSNGIVTSDSDGLTVLQKFLVKYVHHMNSAIPVVHKIRNQINDI  122

Query  396   KVQAAVADCMELLDLSQDKVMDSMVALGNLSAR-ARTDAHSWLSSVLTNHDTCLDGLSEP  572
               + A+ADC+ELLDLS + V DS+ ALG   +R A  +A  WLS +LTNH TCLDGL+  
Sbjct  123   SHKGALADCLELLDLSIELVTDSIAALGKSRSRLAHANAQIWLSGMLTNHVTCLDGLNSL  182

Query  573   ARSI-MEPMIKDLISRAKsslavlvavaPSTEDDLRALNGEFPSWVSASDRRLLEASana  749
             + +  +  ++++LISRAK++LA+L +V    E+    L+G  PSWV++ DR+LLE+SA  
Sbjct  183   SNTTSIGTILEELISRAKTALAILASVTTPNEEVFTPLSGRMPSWVNSRDRKLLESSAKE  242

Query  750   vaanvvvaKDGSGKYKTVAEAVASAPDNGKTRYVIYIKKGTYKENVEIGKKKTNVMLIGD  929
             + AN VVA+DGSG Y+T+ EAVA+APD  KTRYVIY+KKG YKENVE+ KKK N+M++GD
Sbjct  243   IKANAVVAQDGSGDYQTLTEAVAAAPDKSKTRYVIYVKKGIYKENVEVTKKKMNLMIVGD  302

Query  930   GLSATIITGSLNYVDGATTFNSATVAAVGDGFIAQDLRIQNTAGPEKHQAVALRLGADQS  1109
             G+++TIITGSLN VDG+TTF SAT+AAVG GFI QD+ IQNTAGPEKHQAVALR+GAD S
Sbjct  303   GMNSTIITGSLNVVDGSTTFRSATLAAVGQGFILQDICIQNTAGPEKHQAVALRVGADMS  362

Query  1110  VINRCKIDAYQDTLYAHSQRQFYRDCYITGTVDFIFGNAAAVIQNSQVVARKPMAAQKNM  1289
             VINRC+IDAYQDTLYAHS RQFYRDCY+TGTVDFIFGNAA V Q  Q+V RKP   QKNM
Sbjct  363   VINRCRIDAYQDTLYAHSLRQFYRDCYVTGTVDFIFGNAAVVFQKCQLVPRKPGKNQKNM  422

Query  1290  VTAQGRTDPNQNTGTSIQNCNVSPSSDLGPVKGTIQTYLGRPWKEYSRTVFMESNIGDHI  1469
             VTAQGRTDPNQ TGTSIQ C++  S DL PVK   +TYLGRPWKEYSRTV MES +GD I
Sbjct  423   VTAQGRTDPNQATGTSIQFCDIIASPDLEPVKSEYKTYLGRPWKEYSRTVVMESYLGDLI  482

Query  1470  DPAGWFPWDGDFALKTLYYGEYMNRGPGAGTSKRVNWPGYHVITDKAEAMKFTVAQLIQG  1649
             DPAGW  W GDFALKTLYYGEYMN GPGAGTSKRV WPGYHVITD AEA  FTVA+LIQG
Sbjct  483   DPAGWSEWSGDFALKTLYYGEYMNNGPGAGTSKRVTWPGYHVITDAAEARPFTVAELIQG  542

Query  1650  GSWLKNTGVDYTEGL  1694
             GSWL +TGV + EGL
Sbjct  543   GSWLSSTGVTFVEGL  557



>ref|XP_009768199.1| PREDICTED: pectinesterase 2.1-like [Nicotiana sylvestris]
Length=559

 Score =   624 bits (1609),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 332/555 (60%), Positives = 411/555 (74%), Gaps = 8/555 (1%)
 Frame = +3

Query  54    TSHLPLL-FTPKRKPS-SCRalyvllylaaIVGSVA-LVSIWALRTSSSS-PSLWKARVC  221
             T + PLL  TPK+ P  SC+ L  ++     + SV  LV+ +      S+  SL   ++C
Sbjct  3     TPYQPLLPETPKQNPIISCKILTFVITFVVALFSVVFLVAPYQFEVKHSNLSSLPGPQLC  62

Query  222   DPAHDPPSCMAIVSEVSS--AAPTETDGVAllqmllhssllRIQDAVKLSANVNRRINDR  395
             + A D   C++ VSE+ S     +++DG+ +LQ  L   +  +  A+ +   +  +IND 
Sbjct  63    EAAQDSQLCLSYVSELVSNGIVTSDSDGLTVLQKFLVKYVHHMNSAIPVVHKIRNQINDI  122

Query  396   KVQAAVADCMELLDLSQDKVMDSMVALGNLSAR-ARTDAHSWLSSVLTNHDTCLDGLSEP  572
               + A+ADC+ELLDLS + V DS+ ALG   +R A  +A  WLS +LTNH TCLDGL+  
Sbjct  123   SHKGALADCLELLDLSIELVTDSIAALGKSRSRLAHANAQIWLSGMLTNHVTCLDGLNSL  182

Query  573   ARSI-MEPMIKDLISRAKsslavlvavaPSTEDDLRALNGEFPSWVSASDRRLLEASana  749
             + +  +  ++++LISRAK++LA+L +V    E+    L+G  PSWV++ DR+LLE+SA  
Sbjct  183   SNTTSIGTILEELISRAKTALAILASVTTPNEEVFTPLSGRMPSWVNSRDRKLLESSAKE  242

Query  750   vaanvvvaKDGSGKYKTVAEAVASAPDNGKTRYVIYIKKGTYKENVEIGKKKTNVMLIGD  929
             + AN VVA+DGSG Y+T+ EAVA+APD  KTRYVIY+KKG YKENVE+ KKK N+M++GD
Sbjct  243   IKANAVVAQDGSGDYQTLTEAVAAAPDKSKTRYVIYVKKGIYKENVEVTKKKMNLMIVGD  302

Query  930   GLSATIITGSLNYVDGATTFNSATVAAVGDGFIAQDLRIQNTAGPEKHQAVALRLGADQS  1109
             G+++TIITGSLN VDG+TTF SAT+AAVG GFI QD+ IQNTAGPEKHQAVALR+GAD S
Sbjct  303   GMNSTIITGSLNVVDGSTTFRSATLAAVGQGFILQDICIQNTAGPEKHQAVALRVGADMS  362

Query  1110  VINRCKIDAYQDTLYAHSQRQFYRDCYITGTVDFIFGNAAAVIQNSQVVARKPMAAQKNM  1289
             VINRC+IDAYQDTLYAHS RQFYRDCY+TGTVDFIFGNAA V Q  Q+V RKP   QKNM
Sbjct  363   VINRCRIDAYQDTLYAHSLRQFYRDCYVTGTVDFIFGNAAVVFQKCQLVPRKPGKNQKNM  422

Query  1290  VTAQGRTDPNQNTGTSIQNCNVSPSSDLGPVKGTIQTYLGRPWKEYSRTVFMESNIGDHI  1469
             VTAQGRTDPNQ TGTSIQ C++  S DL PVK   +TYLGRPWKEYSRTV MES +GD I
Sbjct  423   VTAQGRTDPNQATGTSIQFCDIIASPDLEPVKSEYKTYLGRPWKEYSRTVVMESYLGDLI  482

Query  1470  DPAGWFPWDGDFALKTLYYGEYMNRGPGAGTSKRVNWPGYHVITDKAEAMKFTVAQLIQG  1649
             DPAGW  W GDFALKTLYYGEYMN GPGAGTSKRV WPGYHVITD AEA  FTVA+LIQG
Sbjct  483   DPAGWSEWSGDFALKTLYYGEYMNNGPGAGTSKRVTWPGYHVITDAAEARPFTVAELIQG  542

Query  1650  GSWLKNTGVDYTEGL  1694
             GSWL +TGV + EGL
Sbjct  543   GSWLSSTGVTFVEGL  557



>ref|XP_007157171.1| hypothetical protein PHAVU_002G048600g [Phaseolus vulgaris]
 gb|ESW29165.1| hypothetical protein PHAVU_002G048600g [Phaseolus vulgaris]
Length=553

 Score =   623 bits (1606),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/502 (64%), Positives = 380/502 (76%), Gaps = 9/502 (2%)
 Frame = +3

Query  213   RVCDPAHDPPSCMAIVSEVSSA---APTETDGVAllqmllhssllRIQDAVKLSANVNRR  383
              +C  A D PSC+A +SEV        T+     L    L  S   IQ A+  ++++  R
Sbjct  53    HLCHHALDNPSCLAHLSEVVQGPIFTTTKDHSFNLFHSFLLKSTSHIQRAMNTASSIKLR  112

Query  384   INDRKVQAAVADCMELLDLSQDKVMDSMVALGNLSARARTDAHSWLSSVLTNHDTCLDGL  563
             +N  K +AA+ DC+EL+DLS D+V+DSM+ L N +  ++ DAH+WLSSVLTNH TCLDGL
Sbjct  113   VNSPKEEAALNDCVELMDLSIDRVLDSMLTLTNQTTESQQDAHTWLSSVLTNHATCLDGL  172

Query  564   SEPARSIMEPMIKDLISRAKsslavlvavaPSTEDDL--RALNGEFPSWVSASDRRLLEA  737
                AR++ME  ++DLISRA+++LA+ V V P   + +    LNGEFPSW+ + DRRLLE+
Sbjct  173   EGTARALMEAELEDLISRARTTLAMFVTVLPPRVEPIVDEPLNGEFPSWLRSKDRRLLES  232

Query  738   SanavaanvvvaKDGSGKYKTVAEAVASAPDNGKTRYVIYIKKGTYKENVEIGKKKTNVM  917
             S   + ANVVVAKDGS K+KTVAEAV SAP N KTRYVIY+KKGTYKENVEI + K NVM
Sbjct  233   SVGDINANVVVAKDGSDKFKTVAEAVKSAPVNSKTRYVIYVKKGTYKENVEICQTKKNVM  292

Query  918   LIGDGLSATIITGSLNYVDGATTFNSATVAAVGDGFIAQDLRIQNTAGPEKHQAVALRLG  1097
             L+GDG   T+ITGSLNYVDG  TF +ATVAAVGDGFI QD+  QNTAGP+K QAVALR+G
Sbjct  293   LVGDGKDLTVITGSLNYVDGTGTFQTATVAAVGDGFIGQDIWFQNTAGPQKQQAVALRVG  352

Query  1098  ADQSVINRCKIDAYQDTLYAHSQRQFYRDCYITGTVDFIFGNAAAVIQNSQVVARKPMAA  1277
             AD+SVINRC+IDA+QDTLYAHS RQFYRD +ITGTVDFIFGNAA V Q   +VARKPM+ 
Sbjct  353   ADKSVINRCRIDAFQDTLYAHSNRQFYRDSFITGTVDFIFGNAAVVFQKCNLVARKPMSN  412

Query  1278  QKNMVTAQGRTDPNQNTGTSIQNCNVSPSSDLGPVKGTIQTYLGRPWKEYSRTVFMESNI  1457
             QKNMVTAQGR DPNQNTGTSIQ CN++PSSDL PV G+I+TYLGRPWK+YSRTV M+S I
Sbjct  413   QKNMVTAQGREDPNQNTGTSIQQCNLTPSSDLKPVVGSIKTYLGRPWKKYSRTVVMQSTI  472

Query  1458  GDHIDPAGWFPWD---GDFALKTLYYGEYMNRGPGAGTSKRVNWPGYHVITDKAEAMKFT  1628
              +HI P GW  WD    DF L+TLYY EY N G GAG+SKRVNWPGYH      EA KFT
Sbjct  473   ENHIYPTGWAEWDEKSKDF-LQTLYYAEYNNSGAGAGSSKRVNWPGYHKSITATEASKFT  531

Query  1629  VAQLIQGGSWLKNTGVDYTEGL  1694
             V QLIQG  WLKNTGV+YTEGL
Sbjct  532   VTQLIQGNVWLKNTGVNYTEGL  553



>ref|XP_010057974.1| PREDICTED: pectinesterase-like [Eucalyptus grandis]
Length=549

 Score =   620 bits (1600),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/503 (63%), Positives = 391/503 (78%), Gaps = 12/503 (2%)
 Frame = +3

Query  210   ARVCDPAHDPPSCMAIVSEV---SSAAPTETDGVAllqmllhssllRIQDAVKLSANVNR  380
             AR+C  A D   C  +VSE+    +A+    D +  L++ +    +R  +AV+   +V R
Sbjct  51    ARICSKAQDQARCRVLVSEIVPYDAASFMSNDKL--LRVFVEKMAIRTGNAVEAVKDVRR  108

Query  381   RINDRKVQAAVADCMELLDLSQDKVMDSMVALGNLSARARTDAHSWLSSVLTNHDTCLDG  560
              +ND + +AA+ADC+EL+++S D++ DS  +L    + A  D H+WLSS LTN+ TCLDG
Sbjct  109   LVNDLREEAALADCVELMEMSLDRLEDSTRSLREQKSSA--DVHTWLSSSLTNYVTCLDG  166

Query  561   L--SEPARSIMEPMIKDLISRAKsslavlvavaP---STEDDLRALNGEFPSWVSASDRR  725
                S  A+S++EP++ DLISRA++SLA+ V+ +       D L +L G+FPSWV+  DRR
Sbjct  167   FEGSSSAKSLIEPILSDLISRARTSLAIFVSTSSPEGRKPDVLESLIGDFPSWVTGKDRR  226

Query  726   LLEASanavaanvvvaKDGSGKYKTVAEAVASAPDNGKTRYVIYIKKGTYKENVEIGKKK  905
             LL++ ANAV A+VVVAKDGSGKYKTV +A+A+AP   +TRYVI++KKGTYKENVE+ K K
Sbjct  227   LLQSPANAVNADVVVAKDGSGKYKTVKQAIAAAPSKAQTRYVIHVKKGTYKENVEVAKTK  286

Query  906   TNVMLIGDGLSATIITGSLNYVDGATTFNSATVAAVGDGFIAQDLRIQNTAGPEKHQAVA  1085
              N+ML+GDG++ T+ITGSLN +DGATTF SATVA  GDGFIAQD+  QNTAGP+KHQAVA
Sbjct  287   KNIMLVGDGMNLTVITGSLNVIDGATTFKSATVAVNGDGFIAQDIWFQNTAGPQKHQAVA  346

Query  1086  LRLGADQSVINRCKIDAYQDTLYAHSQRQFYRDCYITGTVDFIFGNAAAVIQNSQVVARK  1265
             LR+ AD+SVINRC+IDAYQDTLY H+ RQFYRD YITGTVDFIFG+A  V QN ++VARK
Sbjct  347   LRVSADKSVINRCRIDAYQDTLYTHTNRQFYRDSYITGTVDFIFGDAGVVFQNCKLVARK  406

Query  1266  PMAAQKNMVTAQGRTDPNQNTGTSIQNCNVSPSSDLGPVKGTIQTYLGRPWKEYSRTVFM  1445
             PM  Q NMVTAQGRTDP QNTG SIQ C+V  SSDL PVKG+I++YLGRPWK YSRTV M
Sbjct  407   PMRGQSNMVTAQGRTDPYQNTGISIQRCHVIASSDLAPVKGSIKSYLGRPWKLYSRTVVM  466

Query  1446  ESNIGDHIDPAGWFPWDGDFALKTLYYGEYMNRGPGAGTSKRVNWPGYHVITDKAEAMKF  1625
             +SNIGDHIDP GW  W GD ALKTLYYGEYMN+GPGAGTSKRV WPGYHVIT  AEA KF
Sbjct  467   QSNIGDHIDPTGWSVWSGDHALKTLYYGEYMNKGPGAGTSKRVKWPGYHVITSPAEAKKF  526

Query  1626  TVAQLIQGGSWLKNTGVDYTEGL  1694
             TVA+LIQGG+WLK+TGV YTEGL
Sbjct  527   TVAELIQGGTWLKSTGVSYTEGL  549



>ref|XP_002522859.1| Pectinesterase-2 precursor, putative [Ricinus communis]
 gb|EEF39557.1| Pectinesterase-2 precursor, putative [Ricinus communis]
Length=553

 Score =   620 bits (1600),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/510 (62%), Positives = 392/510 (77%), Gaps = 3/510 (1%)
 Frame = +3

Query  174   LRTSSSSPSLWKARVCDPAHDPPSCMAIVSEVSSA--APTETDGVAllqmllhssllRIQ  347
             L T S S  +  A VCD AH+P +C+ +VSE  +A     E +GV LL+ LL  SL +++
Sbjct  44    LITFSHSKPIAPASVCDRAHEPQACLRMVSEAVAADDGVQELNGVHLLKTLLIESLPQMR  103

Query  348   DAVKLSANVNRRINDRKVQAAVADCMELLDLSQDKVMDSMVALGNLSARARTD-AHSWLS  524
               ++ +  + RR ND K +AA+ADC+EL+DLS D+V  ++ AL N  +++  D AH+WLS
Sbjct  104   MGIESAGYIIRRTNDHKDKAALADCLELMDLSIDRVNHTLAALANWGSKSDADDAHTWLS  163

Query  525   SVLTNHDTCLDGLSEPARSIMEPMIKDLISRAKsslavlvavaPSTEDDLRALNGEFPSW  704
              VLTNH TCLDG+    +  ++ +++DLISR ++SLAVL +++ S + +LR L+G FP W
Sbjct  164   GVLTNHVTCLDGIVLTGQQSIKNLMQDLISRTRTSLAVLASLSASNKGNLRPLSGGFPWW  223

Query  705   VSASDRRLLEASanavaanvvvaKDGSGKYKTVAEAVASAPDNGKTRYVIYIKKGTYKEN  884
             +   DR++L +S+  + ANVVVA+DGSG Y T+ EAVASAPD  KTRYVIY+KKGTY EN
Sbjct  224   IRVKDRKILGSSSENIQANVVVAQDGSGDYSTIQEAVASAPDKSKTRYVIYVKKGTYIEN  283

Query  885   VEIGKKKTNVMLIGDGLSATIITGSLNYVDGATTFNSATVAAVGDGFIAQDLRIQNTAGP  1064
             VEI KKK N+M+ GDG++ TIITGSLN  DG+TTF SAT+A  GDGFI QD+ +QNTAGP
Sbjct  284   VEIAKKKKNLMIFGDGMNLTIITGSLNVADGSTTFRSATLAVAGDGFILQDVWVQNTAGP  343

Query  1065  EKHQAVALRLGADQSVINRCKIDAYQDTLYAHSQRQFYRDCYITGTVDFIFGNAAAVIQN  1244
             EKHQAVALR+ ADQ+VINRC+IDA+QDTLYAHS RQFYRDCYI GT+DFIFGNAA V+Q 
Sbjct  344   EKHQAVALRVSADQAVINRCQIDAFQDTLYAHSYRQFYRDCYILGTIDFIFGNAAVVLQK  403

Query  1245  SQVVARKPMAAQKNMVTAQGRTDPNQNTGTSIQNCNVSPSSDLGPVKGTIQTYLGRPWKE  1424
              +++ARKPM+ QKNMVTAQGR DPNQNTG SIQ+C + P  DL PV     TYLGRPWKE
Sbjct  404   CEIIARKPMSHQKNMVTAQGRVDPNQNTGISIQDCRIIPGQDLEPVPDVFPTYLGRPWKE  463

Query  1425  YSRTVFMESNIGDHIDPAGWFPWDGDFALKTLYYGEYMNRGPGAGTSKRVNWPGYHVITD  1604
             YSRTV MES I  HIDPAGW  W+ +FAL TLYYGEY NRGPGAGTSKRVNW G+HVITD
Sbjct  464   YSRTVVMESYIDKHIDPAGWAEWNKEFALSTLYYGEYANRGPGAGTSKRVNWDGFHVITD  523

Query  1605  KAEAMKFTVAQLIQGGSWLKNTGVDYTEGL  1694
               EA KFTVA+LIQGG+WL +TGV +TEGL
Sbjct  524   PIEARKFTVAELIQGGAWLSSTGVSFTEGL  553



>gb|EYU19222.1| hypothetical protein MIMGU_mgv1a003983mg [Erythranthe guttata]
Length=551

 Score =   613 bits (1580),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/560 (59%), Positives = 408/560 (73%), Gaps = 19/560 (3%)
 Frame = +3

Query  45    MATTSHLPLLFTPKRKPSSCRalyvllylaaIVGSVALVSIWALRTSSSSPSLWKARVCD  224
             MA+T+  PLL   K   S+C+ ++  + ++A+V S  L+     +++S +  L     C 
Sbjct  1     MASTNQ-PLLHKTK---SNCKFIFFTISISALVISAVLLLPNQYQSNSKTSHL-----CS  51

Query  225   PAHDPPSCMAIVSEVSS-----AAPTETDGVAllqmllhssllRIQDAVKLSANVNRRIN  389
              A +P SC   VSEV+S     A   + DG  LLQ  L      +  A+  +  +  R+N
Sbjct  52    RALNPQSCQDFVSEVTSDNSAIAITPQQDGTTLLQKFLIRQAHHMSRAISQTRKLKNRMN  111

Query  390   DRKVQAAVADCMELLDLSQDKVMDSMVALGN-LSARARTDAHSWLSSVLTNHDTCLDGLS  566
              +  + A+ADC+ L+DLS D V+DS+  L N  SA +R +A +WLS VLTNH TC DGL 
Sbjct  112   AQIERGALADCLHLIDLSIDLVLDSIRDLNNETSAMSRDNARAWLSGVLTNHVTCFDGLD  171

Query  567   EPARSIMEPMIKDLISRAKsslavlvavaPS---TEDDLRALNGEF-PSWVSASDRRLLE  734
                +  +  +I+DLI RA +SLAV           E D+ +    + PSW++  +R+LL+
Sbjct  172   SFEKQYLGEVIEDLIERASASLAVFAVAVSKLDHNEVDIPSFGQNYMPSWITKVERQLLQ  231

Query  735   ASanavaanvvvaKDGSGKYKTVAEAVASAPDNGKTRYVIYIKKGTYKENVEIGKKKTNV  914
             ++A+AVAA++ VA DGSG YKTVAEAVA+APD  K RYVIY+KKGTYKENVE+GK K N+
Sbjct  232   STADAVAADLTVAADGSGNYKTVAEAVAAAPDKSKKRYVIYVKKGTYKENVEVGKNKKNL  291

Query  915   MLIGDGLSATIITGSLNYVDGATTFNSATVAAVGDGFIAQDLRIQNTAGPEKHQAVALRL  1094
             M+IGDG++ TIITG LN  DGATTFNSAT+AAVG+GFI QD+ IQNTAGPEKHQAVALR+
Sbjct  292   MIIGDGMNNTIITGDLNVADGATTFNSATLAAVGEGFIMQDICIQNTAGPEKHQAVALRV  351

Query  1095  GADQSVINRCKIDAYQDTLYAHSQRQFYRDCYITGTVDFIFGNAAAVIQNSQVVARKPMA  1274
             GAD+SVINRC+IDAYQDTLY HS RQFYR+ Y+TGTVDFIFGNAA V Q  ++VARKPM 
Sbjct  352   GADKSVINRCRIDAYQDTLYTHSLRQFYRESYVTGTVDFIFGNAAVVFQKCKLVARKPMK  411

Query  1275  AQKNMVTAQGRTDPNQNTGTSIQNCNVSPSSDLGPVKGTIQTYLGRPWKEYSRTVFMESN  1454
             +QKNMVTAQGRTDPNQNTGTSIQ+C +  S+DL PVKG+  TYLGRPWKEYSRTV M+S 
Sbjct  412   SQKNMVTAQGRTDPNQNTGTSIQDCEIIASADLAPVKGSFPTYLGRPWKEYSRTVVMQST  471

Query  1455  IGDHIDPAGWFPWDGDFALKTLYYGEYMNRGPGAGTSKRVNWPGYHVITDKAEAMKFTVA  1634
             IGD IDPAGW  W GDFALKTLYYGEYMN+G GAGTSKRVNW GYHVITD AEA KFTV 
Sbjct  472   IGDLIDPAGWAEWSGDFALKTLYYGEYMNKGGGAGTSKRVNWTGYHVITDAAEATKFTVK  531

Query  1635  QLIQGGSWLKNTGVDYTEGL  1694
             +LIQGG WL +TGV +TEGL
Sbjct  532   ELIQGGDWLGSTGVTFTEGL  551



>ref|XP_010553426.1| PREDICTED: pectinesterase/pectinesterase inhibitor 18 [Tarenaya 
hassleriana]
Length=555

 Score =   613 bits (1580),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 325/558 (58%), Positives = 415/558 (74%), Gaps = 11/558 (2%)
 Frame = +3

Query  45    MATTSHLPLLFTPKRKPSSCRalyvllylaaIVGSVALVSIWALRTSSSSPSLWKARVCD  224
             M++  H PLL  PK    + + L + L   AI+ S A ++   +   +++  L  A++C 
Sbjct  1     MSSADH-PLLDKPKSL--NHKNLCLALSFVAILSSSAFITFQLVTIRATNGYLTTAQICQ  57

Query  225   PAHDPPSCMAIVSEV--SSAAP-TETDGVAllqmllhssllRIQDAVKLSANVNRRINDR  395
              AHD  SC + +SE+  S A+P ++   + L+   L SS+ R+++ ++       R N  
Sbjct  58    GAHDKDSCHSHLSELETSPASPLSKLKRLGLMHGFLKSSVSRLENVMEAVNEAKNRANRA  117

Query  396   KVQAAVADCMELLDLSQDKVMDSMVAL-GNLSARARTDAHSWLSSVLTNHDTCLDGLSE-  569
             +  A +ADC ELLD+S+D++++SM  L GN S  + ++ HSWLSSVLTN+ TCLDG+++ 
Sbjct  118   RDFAGLADCEELLDVSKDRMVNSMEELRGNPSFLSYSNVHSWLSSVLTNYMTCLDGINDS  177

Query  570   -PARSIMEPMIKDLISRAKsslavlvavaPSTEDDLRALNGEFPSWVSASDRRLLEAS--  740
               A+  +EP ++DL+SRA++ LA+ V+++PS  D ++ ++GEFP W++A  R+LLE+   
Sbjct  178   IEAKREVEPKLEDLVSRARAGLALFVSISPSETDMIKTVSGEFPRWLTAXXRKLLESEPV  237

Query  741   anavaanvvvaKDGSGKYKTVAEAVASAPDNGKTRYVIYIKKGTYKENVEIGKKKTNVML  920
                  A+VVVA DGSGKYKTV EAVA+AP N + RYVI++KKG YKENV+I K K N+M+
Sbjct  238   KVQANADVVVATDGSGKYKTVNEAVAAAPANSQKRYVIFVKKGVYKENVDIAKNKKNLMI  297

Query  921   IGDGLSATIITGSLNYVDGATTFNSATVAAVGDGFIAQDLRIQNTAGPEKHQAVALRLGA  1100
             +G+G  ATIITGSLN VDG+TTF SAT+AA GDGF+AQD+  QNTAGP+KHQAVALR+ A
Sbjct  298   VGEGQDATIITGSLNVVDGSTTFRSATLAANGDGFMAQDIWFQNTAGPQKHQAVALRVSA  357

Query  1101  DQSVINRCKIDAYQDTLYAHSQRQFYRDCYITGTVDFIFGNAAAVIQNSQVVARKPMAAQ  1280
             DQ+VINRC+IDAYQDTLY H+ RQFYRD YITGTVDFIFGNAA V QN  +VARKP   Q
Sbjct  358   DQAVINRCRIDAYQDTLYTHTLRQFYRDSYITGTVDFIFGNAAVVFQNCDIVARKPDKGQ  417

Query  1281  KNMVTAQGRTDPNQNTGTSIQNCNVSPSSDLGPVKGTIQTYLGRPWKEYSRTVFMESNIG  1460
             KNM+TAQGR DPNQNTGTSIQNC V+PSSDL PVKGT +TYLGRPWK YSRTVFM+S I 
Sbjct  418   KNMLTAQGREDPNQNTGTSIQNCKVTPSSDLAPVKGTFKTYLGRPWKMYSRTVFMQSYIE  477

Query  1461  DHIDPAGWFPWDGDFALKTLYYGEYMNRGPGAGTSKRVNWPGYHVITDKAEAMKFTVAQL  1640
             DHIDP+GWFPWDGDFAL TLYYGEY N GPG+ TSKRVNW GY VI D  EA +FTVA+L
Sbjct  478   DHIDPSGWFPWDGDFALSTLYYGEYANTGPGSDTSKRVNWKGYRVIKDPKEAEQFTVAKL  537

Query  1641  IQGGSWLKNTGVDYTEGL  1694
             IQGGSWLK TGV Y E L
Sbjct  538   IQGGSWLKPTGVAYQEWL  555



>ref|XP_006360082.1| PREDICTED: pectinesterase 3-like [Solanum tuberosum]
Length=540

 Score =   611 bits (1575),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/495 (62%), Positives = 375/495 (76%), Gaps = 7/495 (1%)
 Frame = +3

Query  210   ARVCDPAHDPPSCMAIVSEVSSAAPTETDGVAllqmllhssllRIQDAVKLSANVNRRIN  389
             + +C  A D   C+  VSE+ +   +++DG+++L+  L   + ++ +A+ +   +   IN
Sbjct  51    SNLCKTAQDSQLCLTCVSEIVT---SDSDGLSILKKFLVKYVHQMNNAIPVVRKIKNHIN  107

Query  390   DRKVQAAVADCMELLDLSQDKVMDSMVALGNLSARARTDAHSWLSSVLTNHDTCLDGLSE  569
             D   Q A+ DC+ELLDLS D V DS+VA+   S     +A SWLS VL NH TCLD LS 
Sbjct  108   DIHQQEALTDCLELLDLSVDLVSDSIVAIDKRSHSGHANAQSWLSGVLANHVTCLDSLSN  167

Query  570   PARSIMEPMIKDLISRAKsslavlvavaPSTEDDLRALNGEFPSWVSASDRRLLEASana  749
                ++++    +LI+RAK +LA+L +V    ED  R + G+ PSWVS  DR+L+E+S   
Sbjct  168   KNGTVLD----ELITRAKVALAMLASVTTQNEDVFRTVLGKMPSWVSLRDRKLMESSGKD  223

Query  750   vaanvvvaKDGSGKYKTVAEAVASAPDNGKTRYVIYIKKGTYKENVEIGKKKTNVMLIGD  929
             + AN VVA+DG+G Y+T+AEAVA+APD  KTRYVIY+K G YKENVE+ KKK N+M++GD
Sbjct  224   IIANAVVAQDGTGDYQTLAEAVAAAPDKNKTRYVIYVKMGIYKENVEVTKKKMNLMIVGD  283

Query  930   GLSATIITGSLNYVDGATTFNSATVAAVGDGFIAQDLRIQNTAGPEKHQAVALRLGADQS  1109
             G++ATIITGSLN VDG+TTF SAT+AAVG GFI QDL IQNTAGPEK QAVALR+GAD S
Sbjct  284   GMNATIITGSLNVVDGSTTFRSATLAAVGQGFILQDLCIQNTAGPEKGQAVALRVGADMS  343

Query  1110  VINRCKIDAYQDTLYAHSQRQFYRDCYITGTVDFIFGNAAAVIQNSQVVARKPMAAQKNM  1289
             VINRC+IDAYQDTLYAHS RQFYRD Y+TGTVDFIFGNAA V Q  Q+VARKP   QKNM
Sbjct  344   VINRCRIDAYQDTLYAHSLRQFYRDSYVTGTVDFIFGNAAVVFQKCQLVARKPNKRQKNM  403

Query  1290  VTAQGRTDPNQNTGTSIQNCNVSPSSDLGPVKGTIQTYLGRPWKEYSRTVFMESNIGDHI  1469
             VTAQGRTDPNQ TGTSIQ C++  S DL PV    +TYLGRPWK+YSRTV M+S +G HI
Sbjct  404   VTAQGRTDPNQATGTSIQFCDIIASPDLEPVVNEFKTYLGRPWKKYSRTVVMQSYLGGHI  463

Query  1470  DPAGWFPWDGDFALKTLYYGEYMNRGPGAGTSKRVNWPGYHVITDKAEAMKFTVAQLIQG  1649
             DP+GWF W GDFALKTLYYGE+MN GPGAGTSKRV WPGYHVITD A+AM FTVA+LIQG
Sbjct  464   DPSGWFEWRGDFALKTLYYGEFMNNGPGAGTSKRVKWPGYHVITDPAKAMPFTVAELIQG  523

Query  1650  GSWLKNTGVDYTEGL  1694
             GSWL +T V Y EGL
Sbjct  524   GSWLNSTSVAYVEGL  538



>gb|AAF23891.1| pectin methyl esterase [Solanum tuberosum]
Length=530

 Score =   610 bits (1572),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/497 (61%), Positives = 376/497 (76%), Gaps = 6/497 (1%)
 Frame = +3

Query  210   ARVCDPAHDPPSCMAIVSEVSS--AAPTETDGVAllqmllhssllRIQDAVKLSANVNRR  383
             + +C  A D   C++ VS++ S     + +DG+++L+  L   + ++  A+ +   +  +
Sbjct  36    SNLCKAAQDSQLCLSYVSDLMSNEIVTSSSDGLSILKKFLVKYVHQMNSAIPVVRKIKNQ  95

Query  384   INDRKVQAAVADCMELLDLSQDKVMDSMVALGNLSARARTDAHSWLSSVLTNHDTCLDGL  563
             IND + Q A+ DC+ELLDLS D V DS+VA+   S     +A SWLS VLTNH TCLD L
Sbjct  96    INDIRQQGALTDCLELLDLSVDLVSDSIVAIDKRSHSGHANAQSWLSGVLTNHVTCLDSL  155

Query  564   SEPARSIMEPMIKDLISRAKsslavlvavaPSTEDDLRALNGEFPSWVSASDRRLLEASa  743
             S    ++++    +LI+RA+ +LA+L +V    ED  R + G+ PSWVS+ DR+L+E+S 
Sbjct  156   STKNGTVLD----ELITRARVALAMLASVTTQNEDVFRTVLGKMPSWVSSRDRKLMESSG  211

Query  744   navaanvvvaKDGSGKYKTVAEAVASAPDNGKTRYVIYIKKGTYKENVEIGKKKTNVMLI  923
               + AN VVA+DG+G Y+T+AEAVA+APD  KTRYVIY+K G YKENVE+  +K N+M++
Sbjct  212   KDIKANAVVAQDGTGDYQTLAEAVAAAPDKSKTRYVIYVKMGIYKENVEVTSRKMNLMIV  271

Query  924   GDGLSATIITGSLNYVDGATTFNSATVAAVGDGFIAQDLRIQNTAGPEKHQAVALRLGAD  1103
             GDG++ATIITGSLNYVDG TTF SAT+AAVG GFI QD+ IQNTAGPEKHQAVALR+G D
Sbjct  272   GDGMNATIITGSLNYVDGTTTFRSATLAAVGQGFILQDICIQNTAGPEKHQAVALRVGGD  331

Query  1104  QSVINRCKIDAYQDTLYAHSQRQFYRDCYITGTVDFIFGNAAAVIQNSQVVARKPMAAQK  1283
              SVINRC IDAYQDTLYAHSQRQFYRD Y++GT+DFIFGNAA V Q  Q+VARKP   QK
Sbjct  332   MSVINRCPIDAYQDTLYAHSQRQFYRDSYVSGTIDFIFGNAAVVFQKCQLVARKPSKNQK  391

Query  1284  NMVTAQGRTDPNQNTGTSIQNCNVSPSSDLGPVKGTIQTYLGRPWKEYSRTVFMESNIGD  1463
             NMVTAQGRTDPNQ TGTSIQ C++  S DL PV    +TYLGRPWKEYSRTV M+S +G 
Sbjct  392   NMVTAQGRTDPNQATGTSIQFCDIIASPDLEPVVKEFKTYLGRPWKEYSRTVVMQSYLGG  451

Query  1464  HIDPAGWFPWDGDFALKTLYYGEYMNRGPGAGTSKRVNWPGYHVITDKAEAMKFTVAQLI  1643
              IDPAGW  W G+FALKTLYYGEYMN GPGAGTSKRV WPGYHVITD AEAM FTVA+LI
Sbjct  452   LIDPAGWAEWSGEFALKTLYYGEYMNNGPGAGTSKRVKWPGYHVITDPAEAMPFTVAELI  511

Query  1644  QGGSWLKNTGVDYTEGL  1694
             QGGSWL +TGV Y +GL
Sbjct  512   QGGSWLSSTGVAYVDGL  528



>ref|NP_001274785.1| pectin methyl esterase [Solanum tuberosum]
 emb|CBY44654.1| pectin methyl esterase [Solanum tuberosum]
Length=545

 Score =   610 bits (1572),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/497 (61%), Positives = 376/497 (76%), Gaps = 6/497 (1%)
 Frame = +3

Query  210   ARVCDPAHDPPSCMAIVSEVSS--AAPTETDGVAllqmllhssllRIQDAVKLSANVNRR  383
             + +C  A D   C++ VS++ S     + +DG+++L+  L   + ++  A+ +   +  +
Sbjct  51    SNLCKAAQDSQLCLSYVSDLMSNEIVTSSSDGLSILKKFLVKYVHQMNSAIPVVRKIKNQ  110

Query  384   INDRKVQAAVADCMELLDLSQDKVMDSMVALGNLSARARTDAHSWLSSVLTNHDTCLDGL  563
             IND + Q A+ DC+ELLDLS D V DS+VA+   S     +A SWLS VLTNH TCLD L
Sbjct  111   INDIRQQGALTDCLELLDLSVDLVSDSIVAIDKRSHSGHANAQSWLSGVLTNHVTCLDSL  170

Query  564   SEPARSIMEPMIKDLISRAKsslavlvavaPSTEDDLRALNGEFPSWVSASDRRLLEASa  743
             S    ++++    +LI+RA+ +LA+L +V    ED  R + G+ PSWVS+ DR+L+E+S 
Sbjct  171   STKNGTVLD----ELITRARVALAMLASVTTQNEDVFRTVLGKMPSWVSSRDRKLMESSG  226

Query  744   navaanvvvaKDGSGKYKTVAEAVASAPDNGKTRYVIYIKKGTYKENVEIGKKKTNVMLI  923
               + AN VVA+DG+G Y+T+AEAVA+APD  KTRYVIY+K G YKENVE+  +K N+M++
Sbjct  227   KDIKANAVVAQDGTGDYQTLAEAVAAAPDKSKTRYVIYVKMGIYKENVEVTSRKMNLMIV  286

Query  924   GDGLSATIITGSLNYVDGATTFNSATVAAVGDGFIAQDLRIQNTAGPEKHQAVALRLGAD  1103
             GDG++ATIITGSLNYVDG TTF SAT+AAVG GFI QD+ IQNTAGPEKHQAVALR+G D
Sbjct  287   GDGMNATIITGSLNYVDGTTTFRSATLAAVGQGFILQDICIQNTAGPEKHQAVALRVGGD  346

Query  1104  QSVINRCKIDAYQDTLYAHSQRQFYRDCYITGTVDFIFGNAAAVIQNSQVVARKPMAAQK  1283
              SVINRC IDAYQDTLYAHSQRQFYRD Y++GT+DFIFGNAA V Q  Q+VARKP   QK
Sbjct  347   MSVINRCPIDAYQDTLYAHSQRQFYRDSYVSGTIDFIFGNAAVVFQKCQLVARKPSKNQK  406

Query  1284  NMVTAQGRTDPNQNTGTSIQNCNVSPSSDLGPVKGTIQTYLGRPWKEYSRTVFMESNIGD  1463
             NMVTAQGRTDPNQ TGTSIQ C++  S DL PV    +TYLGRPWKEYSRTV M+S +G 
Sbjct  407   NMVTAQGRTDPNQATGTSIQFCDIIASPDLEPVVKEFKTYLGRPWKEYSRTVVMQSYLGG  466

Query  1464  HIDPAGWFPWDGDFALKTLYYGEYMNRGPGAGTSKRVNWPGYHVITDKAEAMKFTVAQLI  1643
              IDPAGW  W G+FALKTLYYGEYMN GPGAGTSKRV WPGYHVITD AEAM FTVA+LI
Sbjct  467   LIDPAGWAEWSGEFALKTLYYGEYMNNGPGAGTSKRVKWPGYHVITDPAEAMPFTVAELI  526

Query  1644  QGGSWLKNTGVDYTEGL  1694
             QGGSWL +TGV Y +GL
Sbjct  527   QGGSWLSSTGVAYVDGL  543



>ref|XP_003622696.1| Pectinesterase [Medicago truncatula]
 gb|AES78914.1| pectinesterase/pectinesterase inhibitor [Medicago truncatula]
Length=553

 Score =   609 bits (1570),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/512 (63%), Positives = 394/512 (77%), Gaps = 16/512 (3%)
 Frame = +3

Query  186   SSSPSLWKARVCDPAHDPPSCMAIVSEV---SSAAPTETDGVAllqmllhssllRIQDAV  356
             SS+P+     VC+ A D  SC+  V+EV   S+   T+   ++ L  LL  S   I+ A+
Sbjct  49    SSAPN-----VCEHAVDTNSCLTHVAEVVQGSTLDNTKDHKLSTLISLLTKSTTHIRKAM  103

Query  357   KLSANVNRRINDRKVQAAVADCMELLDLSQDKVMDSMVALGNLSARARTDAHSWLSSVLT  536
               +  + RRIN  + + A+  C +L++LS ++V DS++ L   +  ++ DAH+WLSSVLT
Sbjct  104   DTANVIKRRINSPREENALNVCEKLMNLSMERVWDSVLTLTKDNMDSQQDAHTWLSSVLT  163

Query  537   NHDTCLDGLSEPARSIMEPMIKDLISRAKsslavlvavaPSTEDDL---RALNGEFPSWV  707
             NH TCLDGL   +R++ME  I+DLI+RA+SSLAVLVAV P  + D     +LNG+FPSWV
Sbjct  164   NHATCLDGLEGTSRAVMENDIQDLIARARSSLAVLVAVLPPKDHDEFIDESLNGDFPSWV  223

Query  708   SASDRRLLEASanavaanvvvaKDGSGKYKTVAEAVASAPDNGKTRYVIYIKKGTYKENV  887
             ++ DRRLLE+S   V ANVVVAKDGSGK+KTVAEAVASAP+ G  RYVIY+KKG YKENV
Sbjct  224   TSKDRRLLESSVGDVKANVVVAKDGSGKFKTVAEAVASAPNKGTARYVIYVKKGIYKENV  283

Query  888   EIGKKKTNVMLIGDGLSATIITGSLNYVDGATTFNSATVAAVGDGFIAQDLRIQNTAGPE  1067
             EI   KTNVML+GDG+ ATIITGSLNYVDG  TF +ATVAAVGD FIAQD+  QNTAGP+
Sbjct  284   EIASSKTNVMLLGDGMDATIITGSLNYVDGTGTFQTATVAAVGDWFIAQDIGFQNTAGPQ  343

Query  1068  KHQAVALRLGADQSVINRCKIDAYQDTLYAHSQRQFYRDCYITGTVDFIFGNAAAVIQNS  1247
             KHQAVALR+G+D+SVINRCKIDA+QDTLYAH+ RQFYRD +ITGT+DFIFG+AA V+Q  
Sbjct  344   KHQAVALRVGSDRSVINRCKIDAFQDTLYAHTNRQFYRDSFITGTIDFIFGDAAVVLQKC  403

Query  1248  QVVARKPMAAQKNMVTAQGRTDPNQNTGTSIQNCNVSPSSDLGPVKGTIQTYLGRPWKEY  1427
             ++VARKPMA Q NMVTAQGR DPNQNT TSIQ C+V PS+DL PV G+++TYLGRPWK+Y
Sbjct  404   KLVARKPMANQNNMVTAQGRIDPNQNTATSIQQCDVIPSTDLKPVIGSVKTYLGRPWKKY  463

Query  1428  SRTVFMESNIGDHIDPAGWFPWDG---DFALKTLYYGEYMNRGPGAGTSKRVNWPGYHVI  1598
             SRTV M+S +G HIDP GW  WD    DF L+TLYYGEYMN GPGAGTSKRV WPGYH+I
Sbjct  464   SRTVVMQSLLGAHIDPTGWAEWDAASKDF-LQTLYYGEYMNSGPGAGTSKRVKWPGYHII  522

Query  1599  TDKAEAMKFTVAQLIQGGSWLKNTGVDYTEGL  1694
              + AEA KFTVAQLIQG  WLKNTGV +  GL
Sbjct  523   -NTAEANKFTVAQLIQGNVWLKNTGVAFIAGL  553



>ref|XP_007157169.1| hypothetical protein PHAVU_002G048400g [Phaseolus vulgaris]
 gb|ESW29163.1| hypothetical protein PHAVU_002G048400g [Phaseolus vulgaris]
Length=549

 Score =   608 bits (1568),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/553 (58%), Positives = 413/553 (75%), Gaps = 7/553 (1%)
 Frame = +3

Query  45    MATTSHLPLLFTPKRKPSSCRalyvllylaaIVGSVALVSIWALRTSSSSPSLWKARVCD  224
             MAT  H  LL  P RKP S + + ++L +A ++ S AL++ +  + +          VCD
Sbjct  1     MAT--HQSLLENP-RKPVS-KTICLILSVAVVLTSSALIASYLTKPTILFSHTISHHVCD  56

Query  225   PAHDPPSCMAIVSEVSSAAPTETDGVAllqmllhssllRIQDAVKLSANVNRRINDRKVQ  404
              A D P+C+A V E+     ++     LLQ  L  S   I+ A++ +     R+N+ + +
Sbjct  57    HAIDTPACLAHVLELVQDPISQNHKFGLLQSFLARSASHIEKAMEAANATRVRMNNPREE  116

Query  405   AAVADCMELLDLSQDKVMDSMVALGNLSARARTDAHSWLSSVLTNHDTCLDGLSEPARSI  584
             AA+ DC+EL++LS ++V DS  +L   +A +  DAH+WLSSVLTNH TCLDGL E    +
Sbjct  117   AALRDCVELMELSMERVRDSKASLAKDTADSVEDAHTWLSSVLTNHVTCLDGLEERGGRV  176

Query  585   MEPMIKDLISRAKsslavlvavaP-STEDDLRALNGEFPSWVSASDRRLLEASanavaan  761
             ME  +++LISRA++SLA+LVAV P + + +  + NG+FPSWV + DR+LLE+ A  + AN
Sbjct  177   MEEEVQELISRARTSLAMLVAVLPPNPKVEEVSENGKFPSWVRSRDRKLLESWAGEITAN  236

Query  762   vvvaKDGSGKYKTVAEAVASAPDNGKTRYVIYIKKGTYKENVEIGKKKTNVMLIGDGLSA  941
             VVVAKDGSG +KTVAEAVASAP+  K RYVI++K GTYKENVEIGK+K NVML+GDG++ 
Sbjct  237   VVVAKDGSGDFKTVAEAVASAPEKSKKRYVIHVKSGTYKENVEIGKRKKNVMLVGDGMNT  296

Query  942   TIITGSLNYVDGATTFNSATVAAVGDGFIAQDLRIQNTAGPEKHQAVALRLGADQSVINR  1121
             TIITGSLN++DG  TF +ATVAAVGDGFIAQD+  QNTAGPEKHQAVALR+G+D+SVINR
Sbjct  297   TIITGSLNFIDGTGTFRTATVAAVGDGFIAQDIWFQNTAGPEKHQAVALRVGSDESVINR  356

Query  1122  CKIDAYQDTLYAHSQRQFYRDCYITGTVDFIFGNAAAVIQNSQVVARKPMAAQKNMVTAQ  1301
             C++DAYQDTLYAHS RQFYRD +I GT+DFIFGNAAAV QN ++ ARKPM++QKNMVTAQ
Sbjct  357   CRVDAYQDTLYAHSNRQFYRDSFIAGTIDFIFGNAAAVFQNCKLEARKPMSSQKNMVTAQ  416

Query  1302  GRTDPNQNTGTSIQNCNVSPSSDLGPVKGTIQTYLGRPWKEYSRTVFMESNIGDHIDPAG  1481
             GRTDPNQNTGTSIQ C +SP +DL PV  + +TYLGRPWK +SRTV M+S +  HIDP G
Sbjct  417   GRTDPNQNTGTSIQQCELSPCADLRPVIDSFKTYLGRPWKNFSRTVVMQSFLDKHIDPEG  476

Query  1482  WFPWDGDFA--LKTLYYGEYMNRGPGAGTSKRVNWPGYHVITDKAEAMKFTVAQLIQGGS  1655
             W  WD +    L+TLYYGEYMN+GPGAGTS+RVNW GYH+I  +AEA  FTV  LIQG  
Sbjct  477   WAEWDAEHKSYLETLYYGEYMNKGPGAGTSERVNWSGYHIIKTEAEANHFTVKNLIQGDV  536

Query  1656  WLKNTGVDYTEGL  1694
             WLKN+GV++ EGL
Sbjct  537   WLKNSGVNFIEGL  549



>ref|NP_001233948.1| pectinesterase 2.1 [Solanum lycopersicum]
 sp|P09607.2|PME21_SOLLC RecName: Full=Pectinesterase 2.1; Short=PE 2.1; AltName: Full=Pectin 
methylesterase 2.1; Flags: Precursor [Solanum lycopersicum]
 emb|CAA52704.1| pectin esterase [Solanum lycopersicum]
Length=550

 Score =   604 bits (1558),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/498 (61%), Positives = 382/498 (77%), Gaps = 3/498 (1%)
 Frame = +3

Query  210   ARVCDPAHDPPSCMAIVSEVSS--AAPTETDGVAllqmllhssllRIQDAVKLSANVNRR  383
             + +C  A D   C++ VS++ S     +++DG+++L+  L  S+ ++ +A+ +   +  +
Sbjct  51    SNLCKTAQDSQLCLSYVSDLISNEIVTSDSDGLSILKKFLVYSVHQMNNAIPVVRKIKNQ  110

Query  384   INDRKVQAAVADCMELLDLSQDKVMDSMVALGNLSARARTDAHSWLSSVLTNHDTCLDGL  563
             IND + Q A+ DC+ELLDLS D V DS+ A+   S     +A SWLS VLTNH TCLD L
Sbjct  111   INDIREQGALTDCLELLDLSVDLVCDSIAAIDKRSRSEHANAQSWLSGVLTNHVTCLDEL  170

Query  564   SEPARSIMEPM-IKDLISRAKsslavlvavaPSTEDDLRALNGEFPSWVSASDRRLLEAS  740
                 ++++    + +LISRAK +LA+L +V    ++ LR   G+ PSWVS+ DR+L+E+S
Sbjct  171   DSFTKAMINGTNLDELISRAKVALAMLASVTTPNDEVLRPGLGKMPSWVSSRDRKLMESS  230

Query  741   anavaanvvvaKDGSGKYKTVAEAVASAPDNGKTRYVIYIKKGTYKENVEIGKKKTNVML  920
                + AN VVAKDG+GKY+T+AEAVA+APD  KTRYVIY+K+GTYKENVE+  +K N+M+
Sbjct  231   GKDIGANAVVAKDGTGKYRTLAEAVAAAPDKSKTRYVIYVKRGTYKENVEVSSRKMNLMI  290

Query  921   IGDGLSATIITGSLNYVDGATTFNSATVAAVGDGFIAQDLRIQNTAGPEKHQAVALRLGA  1100
             IGDG+ ATIITGSLN VDG+TTF+SAT+AAVG GFI QD+ IQNTAGP KHQAVALR+GA
Sbjct  291   IGDGMYATIITGSLNVVDGSTTFHSATLAAVGKGFILQDICIQNTAGPAKHQAVALRVGA  350

Query  1101  DQSVINRCKIDAYQDTLYAHSQRQFYRDCYITGTVDFIFGNAAAVIQNSQVVARKPMAAQ  1280
             D+SVINRC+IDAYQDTLYAHSQRQFYRD Y+TGT+DFIFGNAA V Q  Q+VARKP   Q
Sbjct  351   DKSVINRCRIDAYQDTLYAHSQRQFYRDSYVTGTIDFIFGNAAVVFQKCQLVARKPGKYQ  410

Query  1281  KNMVTAQGRTDPNQNTGTSIQNCNVSPSSDLGPVKGTIQTYLGRPWKEYSRTVFMESNIG  1460
             +NMVTAQGRTDPNQ TGTSIQ C++  S DL PV     TYLGRPWK+YSRTV MES +G
Sbjct  411   QNMVTAQGRTDPNQATGTSIQFCDIIASPDLKPVVKEFPTYLGRPWKKYSRTVVMESYLG  470

Query  1461  DHIDPAGWFPWDGDFALKTLYYGEYMNRGPGAGTSKRVNWPGYHVITDKAEAMKFTVAQL  1640
               IDP+GW  W GDFALKTLYYGE+MN GPGAGTSKRV WPGYHVITD AEAM FTVA+L
Sbjct  471   GLIDPSGWAEWHGDFALKTLYYGEFMNNGPGAGTSKRVKWPGYHVITDPAEAMSFTVAKL  530

Query  1641  IQGGSWLKNTGVDYTEGL  1694
             IQGGSWL++T V Y +GL
Sbjct  531   IQGGSWLRSTDVAYVDGL  548



>ref|XP_006417343.1| hypothetical protein EUTSA_v10007263mg [Eutrema salsugineum]
 gb|ESQ35696.1| hypothetical protein EUTSA_v10007263mg [Eutrema salsugineum]
Length=557

 Score =   603 bits (1554),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/529 (58%), Positives = 397/529 (75%), Gaps = 10/529 (2%)
 Frame = +3

Query  138   IVGSVALVS--IWALRTSSSSPSLWKARVCDPAHDPPSCMAIVSEVSSAAPTETDGVAll  311
             I+GS A  +  + ++ T++    L  +++C  AHD  SC A++SE ++ + ++   + LL
Sbjct  29    ILGSAAFFTAQLISITTTNDESLLTPSQICHGAHDHYSCQALLSEFTTLSLSKLKRLDLL  88

Query  312   qmllhssllRIQDAVKLSANVNRRINDRKVQAAVADCMELLDLSQDKVMDSMVAL--GNL  485
              + L +S+ R++ A+ +      R N+ + +A  ADC E++D+S+D+++ SM  +  GNL
Sbjct  89    HVFLKNSVWRLKSAINMVNEARTRSNEARDEARFADCEEMMDVSKDRMVSSMEEMRGGNL  148

Query  486   SARARTDAHSWLSSVLTNHDTCLDGLSEPARSI----MEPMIKDLISRAKsslavlvava  653
             +  + ++ HSWLSSVLTN+ TCLDG S+ +       ++P ++DL+SRA+ +LA+ V+V 
Sbjct  149   NLESYSNVHSWLSSVLTNYMTCLDGFSDASVDSKLLGVKPKLEDLVSRARVALAIFVSVL  208

Query  654   PSTEDDLRALNGEFPSWVSASDRRLLEAS--anavaanvvvaKDGSGKYKTVAEAVASAP  827
             PS ++        FPSW+SA DR+LLE++     V ANVVVAKDG+GKYKTV EAVA+AP
Sbjct  209   PSRDEHEMFFPIHFPSWLSALDRKLLESAPKTLEVNANVVVAKDGTGKYKTVNEAVAAAP  268

Query  828   DNGKTRYVIYIKKGTYKENVEIGKKKTNVMLIGDGLSATIITGSLNYVDGATTFNSATVA  1007
             +N KTRYVIY+KKG YKE V+IGKKKTN+ML+GDG   TIITGSLN +DG+TTF SATVA
Sbjct  269   ENSKTRYVIYVKKGVYKETVDIGKKKTNLMLVGDGKDTTIITGSLNVIDGSTTFRSATVA  328

Query  1008  AVGDGFIAQDLRIQNTAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYAHSQRQFYRDC  1187
             A GDGF+AQD+  QNTAGP KHQAVALR+ ADQ+VINRC+IDAYQDTLY H+ RQFYRDC
Sbjct  329   ANGDGFMAQDIWFQNTAGPAKHQAVALRVSADQTVINRCRIDAYQDTLYTHTLRQFYRDC  388

Query  1188  YITGTVDFIFGNAAAVIQNSQVVARKPMAAQKNMVTAQGRTDPNQNTGTSIQNCNVSPSS  1367
             YITGTVDFIFGN+A V QN  +VARKP A QKNMVTAQGR D NQNT  S Q C ++ SS
Sbjct  389   YITGTVDFIFGNSAVVFQNCDIVARKPGAGQKNMVTAQGREDQNQNTAISFQKCKITASS  448

Query  1368  DLGPVKGTIQTYLGRPWKEYSRTVFMESNIGDHIDPAGWFPWDGDFALKTLYYGEYMNRG  1547
             DL PVKG+++T+LGRPWK YSRTV M+S IGDHIDPAGWFPWDG+FAL TLYYGEY N G
Sbjct  449   DLAPVKGSVKTFLGRPWKLYSRTVIMQSFIGDHIDPAGWFPWDGEFALSTLYYGEYANNG  508

Query  1548  PGAGTSKRVNWPGYHVITDKAEAMKFTVAQLIQGGSWLKNTGVDYTEGL  1694
             PG+ TSKRV W G+ VI +  EA +FTVA+LIQGG WLK TGV Y E L
Sbjct  509   PGSDTSKRVKWKGFRVIRNSKEAEQFTVAKLIQGGLWLKPTGVTYQEWL  557



>gb|AAB67739.1| pectin methylesterase PME2.1 [Solanum lycopersicum]
Length=550

 Score =   602 bits (1553),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/498 (61%), Positives = 381/498 (77%), Gaps = 3/498 (1%)
 Frame = +3

Query  210   ARVCDPAHDPPSCMAIVSEVSS--AAPTETDGVAllqmllhssllRIQDAVKLSANVNRR  383
             + +C  A D   C++ VS++ S     +++DG+++L+  L  S+ ++ +A+ +   +  +
Sbjct  51    SNLCKTAQDSQLCLSYVSDLISNEIVTSDSDGLSILKKFLVYSVHQMNNAIPVVRKIKNQ  110

Query  384   INDRKVQAAVADCMELLDLSQDKVMDSMVALGNLSARARTDAHSWLSSVLTNHDTCLDGL  563
             IND + Q A+ DC+ELLDLS D V DS+ A+   S     +A SWLS VLTNH TCLD L
Sbjct  111   INDIREQGALTDCLELLDLSVDLVCDSIAAIDKRSRSEHANAQSWLSGVLTNHVTCLDEL  170

Query  564   SEPARSIMEPM-IKDLISRAKsslavlvavaPSTEDDLRALNGEFPSWVSASDRRLLEAS  740
                 ++++    + +LISRAK +LA+L +V    ++ LR   G+ PSWVS+ DR+L+E+S
Sbjct  171   DSFTKAMINGTNLDELISRAKVALAMLASVTTPNDEVLRPGLGKMPSWVSSRDRKLMESS  230

Query  741   anavaanvvvaKDGSGKYKTVAEAVASAPDNGKTRYVIYIKKGTYKENVEIGKKKTNVML  920
                + AN VVAKDG+GKY+T+AEAVA+APD  KTRYVIY+K+GTYKENVE+  +K N+M+
Sbjct  231   GKDIGANAVVAKDGTGKYRTLAEAVAAAPDKSKTRYVIYVKRGTYKENVEVSSRKMNLMI  290

Query  921   IGDGLSATIITGSLNYVDGATTFNSATVAAVGDGFIAQDLRIQNTAGPEKHQAVALRLGA  1100
             IGDG+ ATIITGSLN VDG+TTF+SAT+AAVG GFI QD+ IQNTAGP KHQAVALR+GA
Sbjct  291   IGDGMYATIITGSLNVVDGSTTFHSATLAAVGKGFILQDICIQNTAGPAKHQAVALRVGA  350

Query  1101  DQSVINRCKIDAYQDTLYAHSQRQFYRDCYITGTVDFIFGNAAAVIQNSQVVARKPMAAQ  1280
             D+SVINRC+IDAYQDTLYAHSQRQFYRD Y+TGT+DFIFGNAA V Q  Q+VARKP   Q
Sbjct  351   DKSVINRCRIDAYQDTLYAHSQRQFYRDSYVTGTIDFIFGNAAVVFQKCQLVARKPGKYQ  410

Query  1281  KNMVTAQGRTDPNQNTGTSIQNCNVSPSSDLGPVKGTIQTYLGRPWKEYSRTVFMESNIG  1460
             +NMVTAQGRTDPNQ TGTSIQ C++  S DL PV     TYLGRPWK+YSRTV MES +G
Sbjct  411   QNMVTAQGRTDPNQATGTSIQFCDIIASPDLKPVVKEFPTYLGRPWKKYSRTVVMESYLG  470

Query  1461  DHIDPAGWFPWDGDFALKTLYYGEYMNRGPGAGTSKRVNWPGYHVITDKAEAMKFTVAQL  1640
               IDP+GW  W GDFALKTLYYGE+MN GPGAGTSKRV WPGYH ITD AEAM FTVA+L
Sbjct  471   GLIDPSGWAEWHGDFALKTLYYGEFMNNGPGAGTSKRVKWPGYHCITDPAEAMSFTVAKL  530

Query  1641  IQGGSWLKNTGVDYTEGL  1694
             IQGGSWL++T V Y +GL
Sbjct  531   IQGGSWLRSTDVAYVDGL  548



>sp|Q96575.1|PME22_SOLLC RecName: Full=Pectinesterase 2.2; Short=PE 2.2; AltName: Full=Pectin 
methylesterase 2.2; Flags: Precursor [Solanum lycopersicum]
 gb|AAB38792.1| pectin methylesterase [Solanum lycopersicum]
Length=550

 Score =   601 bits (1550),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/498 (61%), Positives = 381/498 (77%), Gaps = 3/498 (1%)
 Frame = +3

Query  210   ARVCDPAHDPPSCMAIVSEVSS--AAPTETDGVAllqmllhssllRIQDAVKLSANVNRR  383
             + +C  A D   C++ VS++ S     T++DG+++L   L + + ++ +A+ + + +  +
Sbjct  51    SNLCKTAQDSQLCLSYVSDLMSNEIVTTDSDGLSILMKFLVNYVHQMNNAIPVVSKMKNQ  110

Query  384   INDRKVQAAVADCMELLDLSQDKVMDSMVALGNLSARARTDAHSWLSSVLTNHDTCLDGL  563
             IND + + A+ DC+ELLD S D V DS+ A+   +     +A SWLS VLTNH TCLD L
Sbjct  111   INDIRQEGALTDCLELLDQSVDLVSDSIAAIDKRTHSEHANAQSWLSGVLTNHVTCLDEL  170

Query  564   SEPARSIMEPM-IKDLISRAKsslavlvavaPSTEDDLRALNGEFPSWVSASDRRLLEAS  740
                 ++++    + +LISRAK +LA+L +V    +D LR   G+ PSWVS+ DR+L+E+S
Sbjct  171   DSFTKAMINGTNLDELISRAKVALAMLASVTTPNDDVLRPGLGKMPSWVSSRDRKLMESS  230

Query  741   anavaanvvvaKDGSGKYKTVAEAVASAPDNGKTRYVIYIKKGTYKENVEIGKKKTNVML  920
                + AN VVAKDG+GKY+T+AEAVA+APD  KTRYVIY+K+G YKENVE+  +K  +M+
Sbjct  231   GKDIGANAVVAKDGTGKYRTLAEAVAAAPDKSKTRYVIYVKRGIYKENVEVSSRKMKLMI  290

Query  921   IGDGLSATIITGSLNYVDGATTFNSATVAAVGDGFIAQDLRIQNTAGPEKHQAVALRLGA  1100
             +GDG+ ATIITG+LN VDG+TTF+SAT+AAVG GFI QD+ IQNTAGP KHQAVALR+GA
Sbjct  291   VGDGMHATIITGNLNVVDGSTTFHSATLAAVGKGFILQDICIQNTAGPAKHQAVALRVGA  350

Query  1101  DQSVINRCKIDAYQDTLYAHSQRQFYRDCYITGTVDFIFGNAAAVIQNSQVVARKPMAAQ  1280
             D+SVINRC+IDAYQDTLYAHSQRQFYRD Y+TGT+DFIFGNAA V Q  ++VARKP   Q
Sbjct  351   DKSVINRCRIDAYQDTLYAHSQRQFYRDSYVTGTIDFIFGNAAVVFQKCKLVARKPGKYQ  410

Query  1281  KNMVTAQGRTDPNQNTGTSIQNCNVSPSSDLGPVKGTIQTYLGRPWKEYSRTVFMESNIG  1460
             +NMVTAQGRTDPNQ TGTSIQ CN+  SSDL PV     TYLGRPWK+YSRTV MES +G
Sbjct  411   QNMVTAQGRTDPNQATGTSIQFCNIIASSDLEPVLKEFPTYLGRPWKKYSRTVVMESYLG  470

Query  1461  DHIDPAGWFPWDGDFALKTLYYGEYMNRGPGAGTSKRVNWPGYHVITDKAEAMKFTVAQL  1640
               I+PAGW  WDGDFALKTLYYGE+MN GPGAGTSKRV WPGYH ITD AEAM FTVA+L
Sbjct  471   GLINPAGWAEWDGDFALKTLYYGEFMNNGPGAGTSKRVKWPGYHCITDPAEAMPFTVAKL  530

Query  1641  IQGGSWLKNTGVDYTEGL  1694
             IQGGSWL++TGV Y +GL
Sbjct  531   IQGGSWLRSTGVAYVDGL  548



>ref|XP_006360083.1| PREDICTED: pectinesterase 2.1-like [Solanum tuberosum]
Length=550

 Score =   599 bits (1544),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/498 (61%), Positives = 371/498 (74%), Gaps = 3/498 (1%)
 Frame = +3

Query  210   ARVCDPAHDPPSCMAIVSEVSS--AAPTETDGVAllqmllhssllRIQDAVKLSANVNRR  383
             + +C  A D   C++ VS++ S     + +DG+++L+  L   + ++ +A+ +   +  +
Sbjct  51    SNLCKTAQDSQLCLSYVSDLMSNEIVTSNSDGLSILKKFLVKYVHQMNNAIPVVRKIKNQ  110

Query  384   INDRKVQAAVADCMELLDLSQDKVMDSMVALGNLSARARTDAHSWLSSVLTNHDTCLDGL  563
             IND   Q A+ DC+ELLDLS D V DS+ A+   S     +A SWLS VLTNH TCLD L
Sbjct  111   INDIHQQGALTDCLELLDLSVDLVSDSIEAIDKTSGSGHANAQSWLSGVLTNHVTCLDEL  170

Query  564   SEPARSIMEPM-IKDLISRAKsslavlvavaPSTEDDLRALNGEFPSWVSASDRRLLEAS  740
                 ++++    + +LISRAK +LA+L +V    ED  R + G  PSWVS+ DR+L+E+ 
Sbjct  171   DSFTKTMINGTNLDELISRAKVALAMLASVTTHNEDVFRTVLGRMPSWVSSRDRKLMESL  230

Query  741   anavaanvvvaKDGSGKYKTVAEAVASAPDNGKTRYVIYIKKGTYKENVEIGKKKTNVML  920
                +  N VVA+DG+G Y+T+AEAVA+APDN K RYVIY+K G YKENVE+   K N+M+
Sbjct  231   GKDIKTNAVVAQDGTGDYQTLAEAVAAAPDNSKKRYVIYVKMGIYKENVEVTNNKMNLMI  290

Query  921   IGDGLSATIITGSLNYVDGATTFNSATVAAVGDGFIAQDLRIQNTAGPEKHQAVALRLGA  1100
             +GDG++ATIITGSLN VDG+TTF SAT+AAVG GFI QD+ IQNTAGP+KHQAVALR+GA
Sbjct  291   VGDGMNATIITGSLNVVDGSTTFRSATLAAVGQGFILQDICIQNTAGPDKHQAVALRVGA  350

Query  1101  DQSVINRCKIDAYQDTLYAHSQRQFYRDCYITGTVDFIFGNAAAVIQNSQVVARKPMAAQ  1280
             D SVINRC IDAYQDTLYA S RQFYRD Y+TGTVDFIFGNAA V Q  Q+VARKP   Q
Sbjct  351   DMSVINRCHIDAYQDTLYAFSLRQFYRDSYVTGTVDFIFGNAAVVFQKCQLVARKPNKNQ  410

Query  1281  KNMVTAQGRTDPNQNTGTSIQNCNVSPSSDLGPVKGTIQTYLGRPWKEYSRTVFMESNIG  1460
             +NMVTAQGRTDPNQ TGTSIQ C++  S DL PV    +TYLGRPWKEYSRTV M+S +G
Sbjct  411   QNMVTAQGRTDPNQATGTSIQFCDIIASPDLEPVVNEFKTYLGRPWKEYSRTVVMQSYLG  470

Query  1461  DHIDPAGWFPWDGDFALKTLYYGEYMNRGPGAGTSKRVNWPGYHVITDKAEAMKFTVAQL  1640
               IDPAGW  WDGDFALKTLYYGE+MN GPGAGTSKRV WPGYHVITD AEAM FTVA+L
Sbjct  471   GLIDPAGWAEWDGDFALKTLYYGEFMNNGPGAGTSKRVKWPGYHVITDPAEAMPFTVAEL  530

Query  1641  IQGGSWLKNTGVDYTEGL  1694
             IQGGSWL +TGV Y +GL
Sbjct  531   IQGGSWLSSTGVAYVDGL  548



>ref|XP_006307176.1| hypothetical protein CARUB_v10008769mg [Capsella rubella]
 gb|EOA40074.1| hypothetical protein CARUB_v10008769mg [Capsella rubella]
Length=547

 Score =   597 bits (1539),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/554 (58%), Positives = 409/554 (74%), Gaps = 14/554 (3%)
 Frame = +3

Query  51    TTSHLPLLFTPK--RKPSSCRalyvllylaaIVGSVALVSIWALRTSSSSPSLWKARVCD  224
             + S+ PLL  PK  +  + C    ++L  AAI+GS A  S   + TS  S  L  +++C+
Sbjct  2     SNSNQPLLSKPKSLKHKNLC----LVLSFAAILGSAAFFSAQLIYTSDDSL-LTPSQICN  56

Query  225   PAHDPPSCMAIVSEVSSAAPTETDGVAllqmllhssllRIQDAVKLSANVNRRINDRKVQ  404
              AHD  SC  ++SE ++ + ++ + + LL + L +S+ R+  A+ +      R+N  + +
Sbjct  57    GAHDQDSCQVLLSEFTTLSLSKLNRLDLLHVFLKNSVSRVDSAMSMVKEARTRLNGARDE  116

Query  405   AAVADCMELLDLSQDKVMDSMVAL--GNLSARARTDAHSWLSSVLTNHDTCLDGLSEPAR  578
             A +ADC E++D+S+D+++ S+  L  GNL+  + ++ H+WLSSVLTN+ TCLD  +EP  
Sbjct  117   AGLADCEEMMDVSRDRMVSSVEELRGGNLNLESYSNVHTWLSSVLTNYMTCLDTTNEPR-  175

Query  579   SIMEPMIKDLISRAKsslavlvavaPSTEDDLRALNGEFPSWVSASDRRLLEAS--anav  752
               ++  ++DL+SRA+ +LA+ V+V P+ +D    L   FPSW++  DR LLE++  A  V
Sbjct  176   --VKAQLEDLVSRARVALAIFVSVLPARDDLKMILFDHFPSWLTTLDRELLESAPKALKV  233

Query  753   aanvvvaKDGSGKYKTVAEAVASAPDNGKTRYVIYIKKGTYKENVEIGKKKTNVMLIGDG  932
              ANVVVAKDGSGKYKTV EAVA+AP+N  +RYVIY+KKG YKE ++IGKKK N+ML+GDG
Sbjct  234   NANVVVAKDGSGKYKTVNEAVAAAPENSNSRYVIYVKKGVYKETIDIGKKKKNLMLVGDG  293

Query  933   LSATIITGSLNYVDGATTFNSATVAAVGDGFIAQDLRIQNTAGPEKHQAVALRLGADQSV  1112
               ATIITGSLN VDG+TTF SAT+AA GDGF+AQDL IQNTAGP KHQAVALR+ ADQ+V
Sbjct  294   KDATIITGSLNVVDGSTTFRSATIAANGDGFMAQDLWIQNTAGPAKHQAVALRVSADQTV  353

Query  1113  INRCKIDAYQDTLYAHSQRQFYRDCYITGTVDFIFGNAAAVIQNSQVVARKPMAAQKNMV  1292
             INRC+IDAYQDTLY H+ RQFYRD YITGTVDFIFGN+A V QN  +VARKP A QKNMV
Sbjct  354   INRCRIDAYQDTLYTHTLRQFYRDSYITGTVDFIFGNSAVVFQNCDIVARKPGAGQKNMV  413

Query  1293  TAQGRTDPNQNTGTSIQNCNVSPSSDLGPVKGTIQTYLGRPWKEYSRTVFMESNIGDHID  1472
             TAQGR D NQNT  SIQ C ++ SSDL PVKG++QT+LGRPWK YSRTV M+S I +HI+
Sbjct  414   TAQGREDQNQNTAISIQKCKITASSDLAPVKGSVQTFLGRPWKLYSRTVIMQSFIDNHIN  473

Query  1473  PAGWFPWDGDFALKTLYYGEYMNRGPGAGTSKRVNWPGYHVITDKAEAMKFTVAQLIQGG  1652
             PAGWFPWDG+FAL TLYYGEY N GPGA TSKRV W G+ VI D  EA +FTVA+LIQGG
Sbjct  474   PAGWFPWDGEFALSTLYYGEYANTGPGADTSKRVTWKGFKVIRDAKEAEQFTVAKLIQGG  533

Query  1653  SWLKNTGVDYTEGL  1694
              WLK TGV Y E L
Sbjct  534   LWLKPTGVTYQEWL  547



>ref|NP_001234151.1| pectinesterase 1 precursor [Solanum lycopersicum]
 sp|P14280.5|PME1_SOLLC RecName: Full=Pectinesterase 1; Short=PE 1; AltName: Full=Pectin 
methylesterase 1; Flags: Precursor [Solanum lycopersicum]
 emb|CAA52703.1| pectin esterase [Solanum lycopersicum]
Length=546

 Score =   597 bits (1539),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/498 (61%), Positives = 374/498 (75%), Gaps = 3/498 (1%)
 Frame = +3

Query  210   ARVCDPAHDPPSCMAIVSEVSS--AAPTETDGVAllqmllhssllRIQDAVKLSANVNRR  383
             + +C  A D   C++ VS++ S     TE+DG ++L   L + + ++ +A+ +   +  +
Sbjct  47    SNLCKTAQDSQLCLSYVSDLISNEIVTTESDGHSILMKFLVNYVHQMNNAIPVVRKMKNQ  106

Query  384   INDRKVQAAVADCMELLDLSQDKVMDSMVALGNLSARARTDAHSWLSSVLTNHDTCLDGL  563
             IND +   A+ DC+ELLD S D   DS+ A+   S     +A SWLS VLTNH TCLD L
Sbjct  107   INDIRQHGALTDCLELLDQSVDFASDSIAAIDKRSRSEHANAQSWLSGVLTNHVTCLDEL  166

Query  564   SEPARSIMEPM-IKDLISRAKsslavlvavaPSTEDDLRALNGEFPSWVSASDRRLLEAS  740
                 ++++    +++LISRAK +LA+L ++    ED    + G+ PSWVS+ DR+L+E+S
Sbjct  167   DSFTKAMINGTNLEELISRAKVALAMLASLTTQDEDVFMTVLGKMPSWVSSMDRKLMESS  226

Query  741   anavaanvvvaKDGSGKYKTVAEAVASAPDNGKTRYVIYIKKGTYKENVEIGKKKTNVML  920
                + AN VVA+DG+G Y+T+AEAVA+APD  KTRYVIY+K+GTYKENVE+   K N+M+
Sbjct  227   GKDIIANAVVAQDGTGDYQTLAEAVAAAPDKSKTRYVIYVKRGTYKENVEVASNKMNLMI  286

Query  921   IGDGLSATIITGSLNYVDGATTFNSATVAAVGDGFIAQDLRIQNTAGPEKHQAVALRLGA  1100
             +GDG+ AT ITGSLN VDG+TTF SAT+AAVG GFI QD+ IQNTAGP K QAVALR+GA
Sbjct  287   VGDGMYATTITGSLNVVDGSTTFRSATLAAVGQGFILQDICIQNTAGPAKDQAVALRVGA  346

Query  1101  DQSVINRCKIDAYQDTLYAHSQRQFYRDCYITGTVDFIFGNAAAVIQNSQVVARKPMAAQ  1280
             D SVINRC+IDAYQDTLYAHSQRQFYRD Y+TGTVDFIFGNAA V Q  Q+VARKP   Q
Sbjct  347   DMSVINRCRIDAYQDTLYAHSQRQFYRDSYVTGTVDFIFGNAAVVFQKCQLVARKPGKYQ  406

Query  1281  KNMVTAQGRTDPNQNTGTSIQNCNVSPSSDLGPVKGTIQTYLGRPWKEYSRTVFMESNIG  1460
             +NMVTAQGRTDPNQ TGTSIQ CN+  SSDL PV     TYLGRPWKEYSRTV MES +G
Sbjct  407   QNMVTAQGRTDPNQATGTSIQFCNIIASSDLEPVLKEFPTYLGRPWKEYSRTVVMESYLG  466

Query  1461  DHIDPAGWFPWDGDFALKTLYYGEYMNRGPGAGTSKRVNWPGYHVITDKAEAMKFTVAQL  1640
               I+PAGW  WDGDFALKTLYYGE+MN GPGAGTSKRV WPGYHVITD A+AM FTVA+L
Sbjct  467   GLINPAGWAEWDGDFALKTLYYGEFMNNGPGAGTSKRVKWPGYHVITDPAKAMPFTVAKL  526

Query  1641  IQGGSWLKNTGVDYTEGL  1694
             IQGGSWL++TGV Y +GL
Sbjct  527   IQGGSWLRSTGVAYVDGL  544



>gb|AAK59760.1| At1g11580/T23J18_33 [Arabidopsis thaliana]
Length=557

 Score =   596 bits (1537),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/560 (56%), Positives = 416/560 (74%), Gaps = 16/560 (3%)
 Frame = +3

Query  51    TTSHLPLLFTPK--RKPSSCRalyvllylaaIVGSVALVS--IWALRTSSSSPSLWK-AR  215
             + S+ PLL  PK  +  + C    ++L   AI+GSVA  +  + ++ T+++  SL   ++
Sbjct  2     SNSNQPLLSKPKYLKHKNLC----LVLSFVAILGSVAFFTAQLISVNTNNNDDSLLTTSQ  57

Query  216   VCDPAHDPPSCMAIVSEVSSAAPTETDGVAllqmllhssllRIQDAVKLSANVNRRINDR  395
             +C  AHD  SC A++SE ++ + ++ + + LL + L +S+ R++  + + +    R N  
Sbjct  58    ICHGAHDQDSCQALLSEFTTLSLSKLNRLDLLHVFLKNSVWRLESTMTMVSEARIRSNGV  117

Query  396   KVQAAVADCMELLDLSQDKVMDSMVAL--GNLSARARTDAHSWLSSVLTNHDTCLDGLSE  569
             + +A  ADC E++D+S+D++M SM  L  GN +  + ++ H+WLSSVLTN+ TCL+ +S+
Sbjct  118   RDKAGFADCEEMMDVSKDRMMSSMEELRGGNYNLESYSNVHTWLSSVLTNYMTCLESISD  177

Query  570   ---PARSIMEPMIKDLISRAKsslavlvavaPSTEDDLRALNGEFPSWVSASDRRLLEAS  740
                 ++ I++P ++DL+SRA+ +LA+ V+V P+ +D    ++  FPSW++A DR+LLE+S
Sbjct  178   VSVNSKQIVKPQLEDLVSRARVALAIFVSVLPARDDLKMIISNRFPSWLTALDRKLLESS  237

Query  741   --anavaanvvvaKDGSGKYKTVAEAVASAPDNGKTRYVIYIKKGTYKENVEIGKKKTNV  914
                  V ANVVVAKDG+GK+KTV EAVA+AP+N  TRYVIY+KKG YKE ++IGKKK N+
Sbjct  238   PKTLKVTANVVVAKDGTGKFKTVNEAVAAAPENSNTRYVIYVKKGVYKETIDIGKKKKNL  297

Query  915   MLIGDGLSATIITGSLNYVDGATTFNSATVAAVGDGFIAQDLRIQNTAGPEKHQAVALRL  1094
             ML+GDG  ATIITGSLN +DG+TTF SATVAA GDGF+AQD+  QNTAGP KHQAVALR+
Sbjct  298   MLVGDGKDATIITGSLNVIDGSTTFRSATVAANGDGFMAQDIWFQNTAGPAKHQAVALRV  357

Query  1095  GADQSVINRCKIDAYQDTLYAHSQRQFYRDCYITGTVDFIFGNAAAVIQNSQVVARKPMA  1274
              ADQ+VINRC+IDAYQDTLY H+ RQFYRD YITGTVDFIFGN+A V QN  +VAR P A
Sbjct  358   SADQTVINRCRIDAYQDTLYTHTLRQFYRDSYITGTVDFIFGNSAVVFQNCDIVARNPGA  417

Query  1275  AQKNMVTAQGRTDPNQNTGTSIQNCNVSPSSDLGPVKGTIQTYLGRPWKEYSRTVFMESN  1454
              QKNM+TAQGR D NQNT  SIQ C ++ SSDL PVKG+++T+LGRPWK YSRTV M+S 
Sbjct  418   GQKNMLTAQGREDQNQNTAISIQKCKITASSDLAPVKGSVKTFLGRPWKLYSRTVIMQSF  477

Query  1455  IGDHIDPAGWFPWDGDFALKTLYYGEYMNRGPGAGTSKRVNWPGYHVITDKAEAMKFTVA  1634
             I +HIDPAGWFPWDG+FAL TLYYGEY N GPGA TSKRVNW G+ VI D  EA +FTVA
Sbjct  478   IDNHIDPAGWFPWDGEFALSTLYYGEYANTGPGADTSKRVNWKGFKVIKDSKEAEQFTVA  537

Query  1635  QLIQGGSWLKNTGVDYTEGL  1694
             +LIQGG WLK TGV + E L
Sbjct  538   KLIQGGLWLKPTGVTFQEWL  557



>ref|NP_172624.1| methylesterase PCR A [Arabidopsis thaliana]
 sp|Q1JPL7.3|PME18_ARATH RecName: Full=Pectinesterase/pectinesterase inhibitor 18; AltName: 
Full=AtPMEpcrA; Contains: RecName: Full=Pectinesterase 
inhibitor 18; AltName: Full=Pectin methylesterase inhibitor 
18; Contains: RecName: Full=Bifunctional pectinesterase 18/rRNA 
N-glycosylase; Short=PE 18; AltName: Full=Pectin methylesterase 
18; AltName: Full=Pectin methylesterase 4; Short=AtPME4; 
AltName: Full=Ribosome-inactivating protein; Flags: Precursor 
[Arabidopsis thaliana]
 gb|ABF57292.1| At1g11580 [Arabidopsis thaliana]
 gb|AEE28755.1| methylesterase PCR A [Arabidopsis thaliana]
Length=557

 Score =   596 bits (1537),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/560 (56%), Positives = 416/560 (74%), Gaps = 16/560 (3%)
 Frame = +3

Query  51    TTSHLPLLFTPK--RKPSSCRalyvllylaaIVGSVALVS--IWALRTSSSSPSLWK-AR  215
             + S+ PLL  PK  +  + C    ++L   AI+GSVA  +  + ++ T+++  SL   ++
Sbjct  2     SNSNQPLLSKPKSLKHKNLC----LVLSFVAILGSVAFFTAQLISVNTNNNDDSLLTTSQ  57

Query  216   VCDPAHDPPSCMAIVSEVSSAAPTETDGVAllqmllhssllRIQDAVKLSANVNRRINDR  395
             +C  AHD  SC A++SE ++ + ++ + + LL + L +S+ R++  + + +    R N  
Sbjct  58    ICHGAHDQDSCQALLSEFTTLSLSKLNRLDLLHVFLKNSVWRLESTMTMVSEARIRSNGV  117

Query  396   KVQAAVADCMELLDLSQDKVMDSMVAL--GNLSARARTDAHSWLSSVLTNHDTCLDGLSE  569
             + +A  ADC E++D+S+D++M SM  L  GN +  + ++ H+WLSSVLTN+ TCL+ +S+
Sbjct  118   RDKAGFADCEEMMDVSKDRMMSSMEELRGGNYNLESYSNVHTWLSSVLTNYMTCLESISD  177

Query  570   ---PARSIMEPMIKDLISRAKsslavlvavaPSTEDDLRALNGEFPSWVSASDRRLLEAS  740
                 ++ I++P ++DL+SRA+ +LA+ V+V P+ +D    ++  FPSW++A DR+LLE+S
Sbjct  178   VSVNSKQIVKPQLEDLVSRARVALAIFVSVLPARDDLKMIISNRFPSWLTALDRKLLESS  237

Query  741   --anavaanvvvaKDGSGKYKTVAEAVASAPDNGKTRYVIYIKKGTYKENVEIGKKKTNV  914
                  V ANVVVAKDG+GK+KTV EAVA+AP+N  TRYVIY+KKG YKE ++IGKKK N+
Sbjct  238   PKTLKVTANVVVAKDGTGKFKTVNEAVAAAPENSNTRYVIYVKKGVYKETIDIGKKKKNL  297

Query  915   MLIGDGLSATIITGSLNYVDGATTFNSATVAAVGDGFIAQDLRIQNTAGPEKHQAVALRL  1094
             ML+GDG  ATIITGSLN +DG+TTF SATVAA GDGF+AQD+  QNTAGP KHQAVALR+
Sbjct  298   MLVGDGKDATIITGSLNVIDGSTTFRSATVAANGDGFMAQDIWFQNTAGPAKHQAVALRV  357

Query  1095  GADQSVINRCKIDAYQDTLYAHSQRQFYRDCYITGTVDFIFGNAAAVIQNSQVVARKPMA  1274
              ADQ+VINRC+IDAYQDTLY H+ RQFYRD YITGTVDFIFGN+A V QN  +VAR P A
Sbjct  358   SADQTVINRCRIDAYQDTLYTHTLRQFYRDSYITGTVDFIFGNSAVVFQNCDIVARNPGA  417

Query  1275  AQKNMVTAQGRTDPNQNTGTSIQNCNVSPSSDLGPVKGTIQTYLGRPWKEYSRTVFMESN  1454
              QKNM+TAQGR D NQNT  SIQ C ++ SSDL PVKG+++T+LGRPWK YSRTV M+S 
Sbjct  418   GQKNMLTAQGREDQNQNTAISIQKCKITASSDLAPVKGSVKTFLGRPWKLYSRTVIMQSF  477

Query  1455  IGDHIDPAGWFPWDGDFALKTLYYGEYMNRGPGAGTSKRVNWPGYHVITDKAEAMKFTVA  1634
             I +HIDPAGWFPWDG+FAL TLYYGEY N GPGA TSKRVNW G+ VI D  EA +FTVA
Sbjct  478   IDNHIDPAGWFPWDGEFALSTLYYGEYANTGPGADTSKRVNWKGFKVIKDSKEAEQFTVA  537

Query  1635  QLIQGGSWLKNTGVDYTEGL  1694
             +LIQGG WLK TGV + E L
Sbjct  538   KLIQGGLWLKPTGVTFQEWL  557



>ref|XP_010476087.1| PREDICTED: pectinesterase/pectinesterase inhibitor 18 [Camelina 
sativa]
Length=550

 Score =   594 bits (1531),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/556 (56%), Positives = 410/556 (74%), Gaps = 15/556 (3%)
 Frame = +3

Query  51    TTSHLPLLFTPK--RKPSSCRalyvllylaaIVGSVALVSIWALRTSSSSPS--LWKARV  218
             + S+ PLL  PK  +  + C    ++L  AAI+GS A  +   + T++++    L  +++
Sbjct  2     SNSNEPLLSKPKSLKHKNLC----LVLSFAAILGSAAFFAAQLIYTNTTNDDSVLTPSQI  57

Query  219   CDPAHDPPSCMAIVSEVSSAAPTETDGVAllqmllhssllRIQDAVKLSANVNRRINDRK  398
             C  AHD  SC  ++SE ++ + ++ + + LL + L +S+ R++  + +      R N  +
Sbjct  58    CHGAHDQESCQVLLSEFTTLSLSKLNRLDLLHVFLKNSVWRLERTMNMVKETRTRSNGVR  117

Query  399   VQAAVADCMELLDLSQDKVMDSMVAL--GNLSARARTDAHSWLSSVLTNHDTCLDGLSEP  572
              +A +ADC E++D+S+D++++SM  L  GNL+  + ++ H+WLSSVLTN+ TCLD  +EP
Sbjct  118   DEAVLADCEEMMDVSKDRMVNSMEQLRGGNLNFESYSNVHTWLSSVLTNYMTCLDTTNEP  177

Query  573   ARSIMEPMIKDLISRAKsslavlvavaPSTEDDLRALNGEFPSWVSASDRRLLEA--San  746
                 ++P ++DL+SRA+ +LA+ V+V P+ +D    L   FPSW++A DR LLE+     
Sbjct  178   K---VKPQLEDLVSRARVALAIFVSVLPARDDLKMVLFDHFPSWLTALDRELLESDPKTI  234

Query  747   avaanvvvaKDGSGKYKTVAEAVASAPDNGKTRYVIYIKKGTYKENVEIGKKKTNVMLIG  926
              V ANVVVAKDGSGK+KTV EAVA+AP+N  +RYVIY+KKG YKE ++IGKKK N+ML+G
Sbjct  235   KVNANVVVAKDGSGKFKTVNEAVAAAPENSNSRYVIYVKKGVYKETIDIGKKKKNLMLVG  294

Query  927   DGLSATIITGSLNYVDGATTFNSATVAAVGDGFIAQDLRIQNTAGPEKHQAVALRLGADQ  1106
             DG  ATIITGSLN VDG+TTF SAT+AA GDGF+AQDL IQNTAGP KHQAVALR+ ADQ
Sbjct  295   DGKDATIITGSLNVVDGSTTFRSATIAANGDGFMAQDLWIQNTAGPAKHQAVALRVSADQ  354

Query  1107  SVINRCKIDAYQDTLYAHSQRQFYRDCYITGTVDFIFGNAAAVIQNSQVVARKPMAAQKN  1286
             +VINRC+IDAYQDTLY H+ RQFYRD +ITGTVDFIFGN+A V QN  +VARKP A QKN
Sbjct  355   TVINRCRIDAYQDTLYTHTLRQFYRDSFITGTVDFIFGNSAVVFQNCDIVARKPGAGQKN  414

Query  1287  MVTAQGRTDPNQNTGTSIQNCNVSPSSDLGPVKGTIQTYLGRPWKEYSRTVFMESNIGDH  1466
             MVTAQGR D NQNT  SIQ C ++ SSDL PVKG+++T+LGRPWK YSRTV M++ I +H
Sbjct  415   MVTAQGREDQNQNTAISIQRCKITASSDLAPVKGSVKTFLGRPWKLYSRTVIMQTFIDNH  474

Query  1467  IDPAGWFPWDGDFALKTLYYGEYMNRGPGAGTSKRVNWPGYHVITDKAEAMKFTVAQLIQ  1646
             IDPAGWFPWDG+FAL TLYYGEY N GPGA TSKRV W G+ VI D  EA +FTVA+LIQ
Sbjct  475   IDPAGWFPWDGEFALSTLYYGEYANSGPGADTSKRVKWKGFKVIRDSKEAEQFTVAKLIQ  534

Query  1647  GGSWLKNTGVDYTEGL  1694
             GG WLK TGV Y E L
Sbjct  535   GGLWLKPTGVTYQEWL  550



>emb|CDP05792.1| unnamed protein product [Coffea canephora]
Length=454

 Score =   589 bits (1519),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/454 (66%), Positives = 361/454 (80%), Gaps = 3/454 (1%)
 Frame = +3

Query  342   IQDAVKLSANVNRRINDRKVQAAVADCMELLDLSQDKVMDSMVALGNLSAR-ARTDAHSW  518
             +  A+  +  +  +IND+  Q A+ DC++LLDLS D+V DSM+ALG  + R +  +  +W
Sbjct  1     MNHAILETQKIMNQINDQNEQGALEDCLDLLDLSVDRVTDSMMALGGGTTRISYLNVQTW  60

Query  519   LSSVLTNHDTCLDGLSEPARSIMEPMIKDLISRAKsslavlva--vaPSTEDDLRALNGE  692
             LS  LTNH TC DGL+   R +M  +++DLISRA++SLA+L A   AP+ E+ ++ L GE
Sbjct  61    LSGALTNHVTCFDGLNISGRKLMGEVVQDLISRARASLAMLAAVHTAPNEEEMMQPLKGE  120

Query  693   FPSWVSASDRRLLEASanavaanvvvaKDGSGKYKTVAEAVASAPDNGKTRYVIYIKKGT  872
              PSW++  DR+LLE SA  + A+ VVA+DG+G YKT+AEAVA+APD  K RYVIY+KKGT
Sbjct  121   APSWLTLRDRKLLEKSAEDIKADAVVARDGTGDYKTIAEAVAAAPDKSKKRYVIYVKKGT  180

Query  873   YKENVEIGKKKTNVMLIGDGLSATIITGSLNYVDGATTFNSATVAAVGDGFIAQDLRIQN  1052
             Y ENVE+ KKK N+M++GDG+  T+++GSLN VDG+TTF SAT+AAVGDG I QD+ IQN
Sbjct  181   YVENVEVTKKKKNLMIVGDGMDLTVVSGSLNVVDGSTTFKSATLAAVGDGLILQDICIQN  240

Query  1053  TAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYAHSQRQFYRDCYITGTVDFIFGNAAA  1232
             TAGPEKHQAVALR+GADQSVINRC+IDAYQDTLY+HS RQFYRDCY+TGT+DFIFGNAA 
Sbjct  241   TAGPEKHQAVALRVGADQSVINRCRIDAYQDTLYSHSLRQFYRDCYVTGTIDFIFGNAAV  300

Query  1233  VIQNSQVVARKPMAAQKNMVTAQGRTDPNQNTGTSIQNCNVSPSSDLGPVKGTIQTYLGR  1412
             V+QN  +V R PM  QKNMVTAQGR DPNQNTGTSIQNC +  S DL PVK +  TYLGR
Sbjct  301   VLQNCTLVPRLPMKDQKNMVTAQGRIDPNQNTGTSIQNCEIIASQDLEPVKSSFPTYLGR  360

Query  1413  PWKEYSRTVFMESNIGDHIDPAGWFPWDGDFALKTLYYGEYMNRGPGAGTSKRVNWPGYH  1592
             PWKEY+R   +ES IGD IDPAGW  W GDFALKTLY+GEYMNRGPGAGTSKRVNW G+H
Sbjct  361   PWKEYARVAVLESYIGDEIDPAGWSVWSGDFALKTLYFGEYMNRGPGAGTSKRVNWTGFH  420

Query  1593  VITDKAEAMKFTVAQLIQGGSWLKNTGVDYTEGL  1694
             VITD +EAMKFTVA LIQGG WL +TGV YTEGL
Sbjct  421   VITDPSEAMKFTVAGLIQGGEWLPSTGVAYTEGL  454



>ref|XP_010101474.1| Pectinesterase/pectinesterase inhibitor [Morus notabilis]
 gb|EXB88457.1| Pectinesterase/pectinesterase inhibitor [Morus notabilis]
Length=556

 Score =   593 bits (1528),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/498 (61%), Positives = 374/498 (75%), Gaps = 6/498 (1%)
 Frame = +3

Query  216   VCDPAHDPPSCMAIVSEVSSAAPTETDGVAllqmllhssllRIQDAVKLSANVNRRIN-D  392
             +CD + +  SC+A+VSE +    T  D   LL+  L  +  RIQ A+++  NV+RRIN  
Sbjct  58    ICDQSVNKESCLAMVSEAAQEYSTMADH-ELLKAFLEKTNPRIQLALEMVNNVSRRINIS  116

Query  393   RKVQAAVADCMELLDLSQDKVMDSM--VALGNLSARARTDAHSWLSSVLTNHDTCLDGLS  566
              + +AA+ DC EL+DLS+D+V+DS+  + L NL+  +R D ++WLS +L+NH TCLDGL 
Sbjct  117   PRDRAALLDCAELMDLSKDRVLDSISTLLLQNLTTHSREDVNAWLSGILSNHVTCLDGLE  176

Query  567   EP--ARSIMEPMIKDLISRAKsslavlvavaPSTEDDLRALNGEFPSWVSASDRRLLEAS  740
             +   A+++ME  + +LIS A++SLA+LV+ + S  + L  L  +FP+WV+  DRRLL + 
Sbjct  177   DGSYAKNLMESHLNELISGARTSLAILVSFSQSKCEALEPLTKDFPTWVTPGDRRLLRSL  236

Query  741   anavaanvvvaKDGSGKYKTVAEAVASAPDNGKTRYVIYIKKGTYKENVEIGKKKTNVML  920
                +  ++VVAKDGSG Y TV EAVA+ P N K R+VIY+  G Y ENVE+ K K NVML
Sbjct  237   EKEITPDIVVAKDGSGDYTTVNEAVAAVPKNSKKRFVIYVTTGVYYENVELAKNKKNVML  296

Query  921   IGDGLSATIITGSLNYVDGATTFNSATVAAVGDGFIAQDLRIQNTAGPEKHQAVALRLGA  1100
             +GDG+  TIIT SLN  DG+TT+ SATVA  GDGFIAQD+  QNTAGP+KHQAVALR+ A
Sbjct  297   LGDGMDYTIITASLNVDDGSTTYKSATVAVNGDGFIAQDMWFQNTAGPQKHQAVALRVSA  356

Query  1101  DQSVINRCKIDAYQDTLYAHSQRQFYRDCYITGTVDFIFGNAAAVIQNSQVVARKPMAAQ  1280
             D+SVINRC+IDAYQDTLY HS RQFYRD  +TGTVDFIFGNAA V+Q  +++ RK M  Q
Sbjct  357   DKSVINRCRIDAYQDTLYTHSHRQFYRDSTVTGTVDFIFGNAAVVLQRCKIIPRKGMTGQ  416

Query  1281  KNMVTAQGRTDPNQNTGTSIQNCNVSPSSDLGPVKGTIQTYLGRPWKEYSRTVFMESNIG  1460
             KNMVTAQGRTDPNQNTGTSI NC +  S DL PVK +  +YLGRPWKEYSRTV M+S IG
Sbjct  417   KNMVTAQGRTDPNQNTGTSIHNCEIFASPDLEPVKDSFPSYLGRPWKEYSRTVVMQSYIG  476

Query  1461  DHIDPAGWFPWDGDFALKTLYYGEYMNRGPGAGTSKRVNWPGYHVITDKAEAMKFTVAQL  1640
             D IDPAGWF WDGDFAL TLYYGEY NRGPGAGTSKRV W GYHVIT   EA KFTV +L
Sbjct  477   DLIDPAGWFEWDGDFALNTLYYGEYANRGPGAGTSKRVKWVGYHVITSPDEAQKFTVVEL  536

Query  1641  IQGGSWLKNTGVDYTEGL  1694
             IQGG WL++TGVDYTEGL
Sbjct  537   IQGGPWLESTGVDYTEGL  554



>ref|XP_010923950.1| PREDICTED: pectinesterase-like [Elaeis guineensis]
Length=547

 Score =   591 bits (1524),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/553 (60%), Positives = 411/553 (74%), Gaps = 16/553 (3%)
 Frame = +3

Query  57    SHLPLLFTPKRKPSS--CRalyvllylaaIVGSVALVSIWALRTSSSSPSLWKARVCDPA  230
             SH PLL +P  K ++  C AL   L +A+++   AL+++  L T++ +PS     +C  +
Sbjct  4     SHEPLLSSPATKKTTHRCNALLFTLSIASLICIAALITL-QLNTTTPNPS----HLCANS  58

Query  231   HDPPSCMAIVSEVSSAAP--TETDGVAllqmllhssllRIQDAVKLSANVNRRIN--DRK  398
              +P +C A +S   SA     + D V +LQ +LH SLL I   +  + N  R I   D  
Sbjct  59    PNPATCNAAISTALSALGRRPKPDPVQVLQTVLHRSLLLIDSFLTFANNSYRPIGGPDTI  118

Query  399   VQAAVADCMELLDLSQDKVMDSMVALGNLSARARTDAHSWLSSVLTNHDTCLDGLSEPAR  578
              ++ +ADC+ L+DLS+D  +DS  A+   SA A TDA +WLS+VLTNH TC DGLS P  
Sbjct  119   QRSPLADCIHLMDLSRDLFLDSASAI---SAEAYTDARTWLSAVLTNHVTCSDGLSGPIG  175

Query  579   SIMEPMIKDLISRAKsslavlvavaPSTEDDLRALNGEFPSWVSASDRRLLEASan-ava  755
               ME  ++ L + A ++LAVL AV+PS  D +  ++  FPSW++  DR+LLE+S++  VA
Sbjct  176   PPMEAHLESLTALAGATLAVLSAVSPSDGDAIERVS-RFPSWLTVKDRKLLESSSSDGVA  234

Query  756   anvvvaKDGSGKYKTVAEAVASAPDNGKTRYVIYIKKGTYKENVEIGKKKTNVMLIGDGL  935
              NV VA DGSG YKTV EAV SAPD GK RYVIY+K+GTYKENV +GKKKTNVM++GDG+
Sbjct  235   VNVTVAADGSGDYKTVQEAVDSAPDKGKVRYVIYVKEGTYKENVIVGKKKTNVMIVGDGM  294

Query  936   SATIITGSLNYVDGATTFNSATVAAVGDGFIAQDLRIQNTAGPEKHQAVALRLGADQSVI  1115
             ++T+ITGSLN VDG+TTFNSAT+AAVG+GFI QD+ I+NTAGPEKHQAVALR+GAD+SVI
Sbjct  295   NSTVITGSLNVVDGSTTFNSATLAAVGEGFILQDICIENTAGPEKHQAVALRVGADRSVI  354

Query  1116  NRCKIDAYQDTLYAHSQRQFYRDCYITGTVDFIFGNAAAVIQNSQVVARKPMAAQKNMVT  1295
             NRC++D YQDTLYAHS RQFY D  I+GTVDFIFGNAA V QN  ++ARKPM+ Q+N+VT
Sbjct  355   NRCRVDGYQDTLYAHSLRQFYGDSIISGTVDFIFGNAAVVFQNCNLIARKPMSNQQNLVT  414

Query  1296  AQGRTDPNQNTGTSIQNCNVSPSSDLGPVKGTIQTYLGRPWKEYSRTVFMESNIGDHIDP  1475
             AQGR DPNQNTGTSIQ C V PS DL PVKG+I TYLGRPWKEYSRTVFM+S I DH+DP
Sbjct  415   AQGRVDPNQNTGTSIQKCKVLPSDDLVPVKGSIPTYLGRPWKEYSRTVFMQSYIDDHVDP  474

Query  1476  AGWFPWDGDFALKTLYYGEYMNRGPGAGTSKRVNWPGYHVITDKAEAMKFTVAQLIQGGS  1655
              GW  W GDFAL TL+YGEY N GPGAGTS RVNW GYHVITD   A  FTVA+LIQGG+
Sbjct  475   KGWEEWSGDFALDTLFYGEYANVGPGAGTSGRVNWTGYHVITDPNVAKDFTVAELIQGGT  534

Query  1656  WLKNTGVDYTEGL  1694
             WL++TGV +TEGL
Sbjct  535   WLQSTGVAFTEGL  547



>emb|CBI23178.3| unnamed protein product [Vitis vinifera]
Length=503

 Score =   589 bits (1518),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/547 (58%), Positives = 401/547 (73%), Gaps = 46/547 (8%)
 Frame = +3

Query  54    TSHLPLLFTPKRKPSSCRalyvllylaaIVGSVALVSIWALRTSSSSPSLWKARVCDPAH  233
             TS  PLL + + K S C++LY++++LAAI+  +AL SI  ++T S+ P            
Sbjct  3     TSLEPLLRSSQIKASHCKSLYLVIFLAAIITPIALFSIPLIKTISTGPP-----------  51

Query  234   DPPSCMAIVSEVSSAAPTETDGVAllqmllhssllRIQDAVKLSANVNRRINDRKVQAAV  413
                        V      E + V  LQ  L  S+  +Q  ++++ +VNRR+ND + QAA+
Sbjct  52    ----------RVLHNHVMEMEDVDQLQRFLKESMSHLQGVMEMTVDVNRRMNDPRDQAAL  101

Query  414   ADCMELLDLSQDKVMDSMVALGNLSARARTDAHSWLSSVLTNHDTCLDGLSEPARSIMEP  593
             +DC+EL+DLS  ++ DS+ ALG  +  +  DAH+WLS VLTN+ TC DG++ P+R  ME 
Sbjct  102   SDCVELMDLSMGRIRDSVEALGRGTVDSHADAHAWLSGVLTNYITCTDGINGPSRISMER  161

Query  594   MIKDLISRAKsslavlvavaPSTEDDLRALNGEFPSWVSASDRRLLEASanavaanvvva  773
              +K LISRA++SLA+LVAV+P+ ED L+ L+ EFP WV + DR++LE+S+  + ANVVVA
Sbjct  162   GLKHLISRAETSLAMLVAVSPAKEDVLQPLHSEFPPWVDSRDRKILESSSKDIKANVVVA  221

Query  774   KDGSGKYKTVAEAVASAPDNGKTRYVIYIKKGTYKENVEIGKKKTNVMLIGDGLSATIIT  953
             KDGSG YKTV EA+AS P+N KTRYVI++KKGTYKENVEI  K+ NVM++GDG+ +T+IT
Sbjct  222   KDGSGNYKTVKEAIASVPNNSKTRYVIHVKKGTYKENVEIVTKQKNVMIVGDGMDSTVIT  281

Query  954   GSLNYVDGATTFNSATVAAVGDGFIAQDLRIQNTAGPEKHQAVALRLGADQSVINRCKID  1133
             GSLN +DG+TTF SAT+AAVGDGFIAQD+  QNTAGP+KHQAVALR+GADQ+VINRC+ID
Sbjct  282   GSLNVIDGSTTFKSATLAAVGDGFIAQDIWFQNTAGPQKHQAVALRVGADQAVINRCRID  341

Query  1134  AYQDTLYAHSQRQFYRDCYITGTVDFIFGNAAAVIQNSQVVARKPMAAQKNMVTAQGRTD  1313
             AYQDTLYAH+ RQFYRDCYITGTVDFIFGNAA V QN ++VARKPM  Q NMVTAQGRT+
Sbjct  342   AYQDTLYAHTNRQFYRDCYITGTVDFIFGNAAVVFQNCKLVARKPMDKQANMVTAQGRTN  401

Query  1314  PNQNTGTSIQNCNVSPSSDLGPVKGTIQTYLGRPWKEYSRTVFMESNIGDHIDPAGWFPW  1493
             P QNTGTSIQNCN+  SSDL PVKGTI++YLGRPWKEYSR V ++S IGDHIDPAGW   
Sbjct  402   PYQNTGTSIQNCNIIASSDLEPVKGTIKSYLGRPWKEYSRAVVLQSYIGDHIDPAGW---  458

Query  1494  DGDFALKTLYYGEYMNRGPGAGTSKRVNWPGYHVITDKAEAMKFTVAQLIQGGSWLKNTG  1673
                                   + KRV WPGY VIT  AEA  FTVA+LIQGG+WL++TG
Sbjct  459   ----------------------SVKRVKWPGYRVITSPAEARNFTVAELIQGGTWLESTG  496

Query  1674  VDYTEGL  1694
             V YTEGL
Sbjct  497   VAYTEGL  503



>ref|XP_010458561.1| PREDICTED: pectinesterase/pectinesterase inhibitor 18-like [Camelina 
sativa]
Length=547

 Score =   590 bits (1522),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/554 (57%), Positives = 406/554 (73%), Gaps = 14/554 (3%)
 Frame = +3

Query  51    TTSHLPLLFTPK--RKPSSCRalyvllylaaIVGSVALVSIWALRTSSSSPSLWKARVCD  224
             + S+ PLL  PK  +  + C    ++L  AAI+GS A  +   + T+  S  L  +++C 
Sbjct  2     SNSNQPLLSKPKSLKHKNLC----LVLSFAAILGSAAFFAAQLIYTNDDS-VLTPSQICH  56

Query  225   PAHDPPSCMAIVSEVSSAAPTETDGVAllqmllhssllRIQDAVKLSANVNRRINDRKVQ  404
               HD  SC  ++SE +  + ++ + + LL + L +S+ R++  + +        N  + +
Sbjct  57    RTHDQDSCQVLLSEFTMLSLSKLNRLDLLHVFLKNSVWRLERTMTMVKEARTSSNGVRDE  116

Query  405   AAVADCMELLDLSQDKVMDSMVAL--GNLSARARTDAHSWLSSVLTNHDTCLDGLSEPAR  578
             A +ADC E++D+S+D++++SM  L  GNL+  + ++ H+WLSSVLTN+ TCLD  +EP  
Sbjct  117   AVLADCEEMMDVSKDRMVNSMEQLRGGNLNFESYSNVHTWLSSVLTNYMTCLDTTNEPR-  175

Query  579   SIMEPMIKDLISRAKsslavlvavaPSTEDDLRALNGEFPSWVSASDRRLLEAS--anav  752
               ++P ++DL+SRA+ +LA+ V+V P+ +D    L   FPSW++A DR LLE++     V
Sbjct  176   --VKPQLEDLVSRARVALAIFVSVLPARDDLKMVLFDHFPSWLTALDRELLESAPKTLKV  233

Query  753   aanvvvaKDGSGKYKTVAEAVASAPDNGKTRYVIYIKKGTYKENVEIGKKKTNVMLIGDG  932
              ANVVVAKDGSGKYKTV EAVA+AP+N  +RYVIY+KKG YKE ++IGKKK N+ML+GDG
Sbjct  234   NANVVVAKDGSGKYKTVNEAVAAAPENSNSRYVIYVKKGVYKETIDIGKKKKNLMLVGDG  293

Query  933   LSATIITGSLNYVDGATTFNSATVAAVGDGFIAQDLRIQNTAGPEKHQAVALRLGADQSV  1112
               ATIITGSLN VDG+TTF SAT+AA GDGF+AQDL IQNTAGP KHQAVALR+ ADQ+V
Sbjct  294   KDATIITGSLNVVDGSTTFRSATIAANGDGFMAQDLWIQNTAGPAKHQAVALRVSADQTV  353

Query  1113  INRCKIDAYQDTLYAHSQRQFYRDCYITGTVDFIFGNAAAVIQNSQVVARKPMAAQKNMV  1292
             INRC+IDAYQDTLY H+ RQFYRD +ITGTVDFIFGN+A V QN  +VARKP A QKNMV
Sbjct  354   INRCRIDAYQDTLYTHTLRQFYRDSFITGTVDFIFGNSAVVFQNCDIVARKPGAGQKNMV  413

Query  1293  TAQGRTDPNQNTGTSIQNCNVSPSSDLGPVKGTIQTYLGRPWKEYSRTVFMESNIGDHID  1472
             TAQGR D NQNT  SIQ C ++ SSDL PVKG+++T+LGRPWK YSRTV M++ I +HID
Sbjct  414   TAQGREDQNQNTAISIQRCKITASSDLAPVKGSVKTFLGRPWKLYSRTVIMQTFIDNHID  473

Query  1473  PAGWFPWDGDFALKTLYYGEYMNRGPGAGTSKRVNWPGYHVITDKAEAMKFTVAQLIQGG  1652
             PAGWFPWDG+FAL TLYYGEY N GPGA TSKRV W G+ VI D  EA +FTVA+LIQGG
Sbjct  474   PAGWFPWDGEFALSTLYYGEYANSGPGADTSKRVKWKGFKVIRDSKEAEQFTVAKLIQGG  533

Query  1653  SWLKNTGVDYTEGL  1694
              WLK TGV Y E L
Sbjct  534   LWLKPTGVTYQEWL  547



>ref|XP_010324324.1| PREDICTED: pectinesterase 3 [Solanum lycopersicum]
Length=543

 Score =   590 bits (1520),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/495 (61%), Positives = 369/495 (75%), Gaps = 4/495 (1%)
 Frame = +3

Query  210   ARVCDPAHDPPSCMAIVSEVSSAAPTETDGVAllqmllhssllRIQDAVKLSANVNRRIN  389
             + +C  A     C++ VSE+ +   TE+DGV +L+  L   + ++ +A+ +   +  +IN
Sbjct  51    SNLCKSAQGSQLCLSYVSEIVT---TESDGVTVLKKFLVKYVHQMNNAIPVVRKIKNQIN  107

Query  390   DRKVQAAVADCMELLDLSQDKVMDSMVALGNLSARARTDAHSWLSSVLTNHDTCLDGLSE  569
             D +   A+ DC+ELLD S D V DS+ A+   S     +  SWLS VLTNH TCLD L+ 
Sbjct  108   DIRQHGALTDCLELLDQSVDLVSDSIAAIDKRSRLEHANVQSWLSGVLTNHVTCLDELTS  167

Query  570   PARSIMEPMIKDLISRAKsslavlvavaPSTEDDLRALNGEFPSWVSASDRRLLEASana  749
              +      ++ +LI+RAK +LA+L +V    ++ LR   G+ P WVS+ DR+L+E+S   
Sbjct  168   LSTK-NGTVLDELITRAKVALAMLASVTTPNDEVLRQGLGKMPYWVSSRDRKLMESSGKD  226

Query  750   vaanvvvaKDGSGKYKTVAEAVASAPDNGKTRYVIYIKKGTYKENVEIGKKKTNVMLIGD  929
             + AN VVA+DG+G Y+T+AEAV +APD  KTRYVIY+K G YKENV + KKK N+M++GD
Sbjct  227   IIANAVVAQDGTGDYQTLAEAVDAAPDKNKTRYVIYVKMGIYKENVVVTKKKMNLMIVGD  286

Query  930   GLSATIITGSLNYVDGATTFNSATVAAVGDGFIAQDLRIQNTAGPEKHQAVALRLGADQS  1109
             G++ATIITGSLN VDG+TTF SAT+AAVG GFI QDL IQNTAGPEK QAVALR+GAD S
Sbjct  287   GMNATIITGSLNVVDGSTTFRSATLAAVGQGFILQDLCIQNTAGPEKGQAVALRVGADMS  346

Query  1110  VINRCKIDAYQDTLYAHSQRQFYRDCYITGTVDFIFGNAAAVIQNSQVVARKPMAAQKNM  1289
             VINRC+IDAYQDTLYAHSQRQFYRD Y+TGTVDFIFGNAA V Q  Q+VARKP   QKNM
Sbjct  347   VINRCRIDAYQDTLYAHSQRQFYRDSYVTGTVDFIFGNAAVVFQKCQIVARKPNKRQKNM  406

Query  1290  VTAQGRTDPNQNTGTSIQNCNVSPSSDLGPVKGTIQTYLGRPWKEYSRTVFMESNIGDHI  1469
             VTAQGRTDPNQ TGTSIQ C++  S DL PV    +TYLGRPWK++SRTV M+S +  HI
Sbjct  407   VTAQGRTDPNQATGTSIQFCDIIASPDLEPVMNEYKTYLGRPWKKHSRTVVMQSYLDGHI  466

Query  1470  DPAGWFPWDGDFALKTLYYGEYMNRGPGAGTSKRVNWPGYHVITDKAEAMKFTVAQLIQG  1649
             DP+GWF W GDFALKTLYYGEYMN GPGAGTSKRV WPGYHVITD  EAM FTVA+LIQG
Sbjct  467   DPSGWFEWRGDFALKTLYYGEYMNNGPGAGTSKRVKWPGYHVITDPNEAMPFTVAELIQG  526

Query  1650  GSWLKNTGVDYTEGL  1694
             GSWL +T V Y EGL
Sbjct  527   GSWLNSTSVAYVEGL  541



>sp|P83947.1|PME1_FICPW RecName: Full=Pectinesterase/pectinesterase inhibitor; Includes: 
RecName: Full=Pectinesterase inhibitor; AltName: Full=Pectin 
methylesterase inhibitor; Includes: RecName: Full=Pectinesterase; 
Short=PE; AltName: Full=Pectin methylesterase; Flags: 
Precursor [Ficus pumila var. awkeotsang]
Length=545

 Score =   590 bits (1520),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/526 (57%), Positives = 387/526 (74%), Gaps = 14/526 (3%)
 Frame = +3

Query  138   IVGSVALVSIWALRTSSSSPSL-WKARVCDPAHDPPSCMAIVSEVSSAAPTETDGVAllq  314
             ++   ALVS     T  SSP L    ++CD + +  SC+A++SEV+       D   LL+
Sbjct  25    VISFAALVS-----TGFSSPELSLHHKICDQSVNKESCLAMISEVTGL--NMADHRNLLK  77

Query  315   mllhssllRIQDAVKLSANVNRRINDRKVQAAVADCMELLDLSQDKVMDSMVAL--GNLS  488
               L  +  RIQ A + + + +RRIN+ + + A+ DC EL+DLS+++V+DS+  L   NL+
Sbjct  78    SFLEKTTPRIQKAFETANDASRRINNPQERTALLDCAELMDLSKERVVDSISILFHQNLT  137

Query  489   ARARTDAHSWLSSVLTNHDTCLDGLSEPA----RSIMEPMIKDLISRAKsslavlvavaP  656
              R+  D H WLS VLTNH TCLDGL E +    +++ME  + +LI RA++SLA+ V + P
Sbjct  138   TRSHEDLHVWLSGVLTNHVTCLDGLEEGSTDYIKTLMESHLNELILRARTSLAIFVTLFP  197

Query  657   STEDDLRALNGEFPSWVSASDRRLLEASanavaanvvvaKDGSGKYKTVAEAVASAPDNG  836
             +  + +  + G FP+WV+A DRRLL+     +  ++VVAKDGSG Y+T+ EAVA+ PDN 
Sbjct  198   AKSNVIEPVTGNFPTWVTAGDRRLLQTLGKDIEPDIVVAKDGSGDYETLNEAVAAIPDNS  257

Query  837   KTRYVIYIKKGTYKENVEIGKKKTNVMLIGDGLSATIITGSLNYVDGATTFNSATVAAVG  1016
             K R ++ ++ G Y+ENV+ G +K NVML+G+G+  TIITGS N VDG+TTF+SATVAAVG
Sbjct  258   KKRVIVLVRTGIYEENVDFGYQKKNVMLVGEGMDYTIITGSRNVVDGSTTFDSATVAAVG  317

Query  1017  DGFIAQDLRIQNTAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYAHSQRQFYRDCYIT  1196
             DGFIAQD+  QNTAGPEK+QAVALR+GAD++VINRC+IDAYQDTLY H+ RQFYRD  IT
Sbjct  318   DGFIAQDICFQNTAGPEKYQAVALRIGADETVINRCRIDAYQDTLYPHNYRQFYRDRNIT  377

Query  1197  GTVDFIFGNAAAVIQNSQVVARKPMAAQKNMVTAQGRTDPNQNTGTSIQNCNVSPSSDLG  1376
             GTVDFIFGNAA V QN  ++ RK M  Q+N +TAQGRTDPNQNTGTSIQNC +  S+DL 
Sbjct  378   GTVDFIFGNAAVVFQNCNLIPRKQMKGQENTITAQGRTDPNQNTGTSIQNCEIFASADLE  437

Query  1377  PVKGTIQTYLGRPWKEYSRTVFMESNIGDHIDPAGWFPWDGDFALKTLYYGEYMNRGPGA  1556
             PV+ T ++YLGRPWKEYSRTV MES I D IDPAGW  WD DFALKTL+YGEY N GPG+
Sbjct  438   PVEDTFKSYLGRPWKEYSRTVVMESYISDVIDPAGWLEWDRDFALKTLFYGEYRNGGPGS  497

Query  1557  GTSKRVNWPGYHVITDKAEAMKFTVAQLIQGGSWLKNTGVDYTEGL  1694
             GTS+RV WPGYHVIT    A +FTVA+LIQGGSWL +TGVDYT GL
Sbjct  498   GTSERVKWPGYHVITSPEVAEQFTVAELIQGGSWLGSTGVDYTAGL  543



>sp|Q96576.1|PME3_SOLLC RecName: Full=Pectinesterase 3; Short=PE 3; AltName: Full=Pectin 
methylesterase 3; Flags: Precursor [Solanum lycopersicum]
 gb|AAB38793.1| pectin methylesterase [Solanum lycopersicum]
Length=544

 Score =   589 bits (1518),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/496 (61%), Positives = 371/496 (75%), Gaps = 5/496 (1%)
 Frame = +3

Query  210   ARVCDPAHDPPSCMAIVSEVSSAAPTETDGVAllqmllhssllRIQDAVKLSANVNRRIN  389
             + +C  A D   C++ VSE+ +   TE+DGV +L+  L   + ++ +A+ +   +  +IN
Sbjct  51    SNLCKTAQDSQLCLSYVSEIVT---TESDGVTVLKKFLVKYVHQMNNAIPVVRKIKNQIN  107

Query  390   DRKVQAAVADCMELLDLSQDKVMDSMVALGNLSARARTDAHSWLSSVLTNHDTCLDGLSE  569
             D + Q A+ DC+ELLD S D V DS+ A+   S     +A SWLS VLTNH TCLD L+ 
Sbjct  108   DIRQQGALTDCLELLDQSVDLVSDSIAAIDKRSRSEHANAQSWLSGVLTNHVTCLDELTS  167

Query  570   PARSIMEPMIKD-LISRAKsslavlvavaPSTEDDLRALNGEFPSWVSASDRRLLEASan  746
              + S     + D LI+RAK +LA+L +V    ++ LR   G+ P WVS+ DR+L+E+S  
Sbjct  168   FSLSTKNGTVLDELITRAKVALAMLASVTTPNDEVLRQGLGKMPYWVSSRDRKLMESSGK  227

Query  747   avaanvvvaKDGSGKYKTVAEAVASAPDNGKTRYVIYIKKGTYKENVEIGKKKTNVMLIG  926
              + AN VVA+DG+G Y+T+AEAVA+APD  KTRYVIY+K G YKENV + KKK N+M++G
Sbjct  228   DIIANRVVAQDGTGDYQTLAEAVAAAPDKNKTRYVIYVKMGIYKENVVVTKKKMNLMIVG  287

Query  927   DGLSATIITGSLNYVDGATTFNSATVAAVGDGFIAQDLRIQNTAGPEKHQAVALRLGADQ  1106
             DG++ATIITGSLN VDG+T F S T+AAVG GFI QD+ IQNTAGPEK QAVALR+GAD 
Sbjct  288   DGMNATIITGSLNVVDGST-FPSNTLAAVGQGFILQDICIQNTAGPEKDQAVALRVGADM  346

Query  1107  SVINRCKIDAYQDTLYAHSQRQFYRDCYITGTVDFIFGNAAAVIQNSQVVARKPMAAQKN  1286
             SVINRC+IDAYQDTLYAHSQRQFYRD Y+TGTVDFIFGNAA V Q  Q+VARKP   QKN
Sbjct  347   SVINRCRIDAYQDTLYAHSQRQFYRDSYVTGTVDFIFGNAAVVFQKCQIVARKPNKRQKN  406

Query  1287  MVTAQGRTDPNQNTGTSIQNCNVSPSSDLGPVKGTIQTYLGRPWKEYSRTVFMESNIGDH  1466
             MVTAQGRTDPNQ TGTSIQ C++  S DL PV    +TYLGRPWK++SRTV M+S +  H
Sbjct  407   MVTAQGRTDPNQATGTSIQFCDIIASPDLEPVMNEYKTYLGRPWKKHSRTVVMQSYLDGH  466

Query  1467  IDPAGWFPWDGDFALKTLYYGEYMNRGPGAGTSKRVNWPGYHVITDKAEAMKFTVAQLIQ  1646
             IDP+GWF W GDFALKTLYYGE+MN GPGAGTSKRV WPGYHVITD  EAM FTVA+LIQ
Sbjct  467   IDPSGWFEWRGDFALKTLYYGEFMNNGPGAGTSKRVKWPGYHVITDPNEAMPFTVAELIQ  526

Query  1647  GGSWLKNTGVDYTEGL  1694
             GGSWL +T V Y EGL
Sbjct  527   GGSWLNSTSVAYVEGL  542



>ref|XP_009118185.1| PREDICTED: pectinesterase/pectinesterase inhibitor 18 [Brassica 
rapa]
Length=556

 Score =   587 bits (1513),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/512 (58%), Positives = 385/512 (75%), Gaps = 7/512 (1%)
 Frame = +3

Query  180   TSSSSPSLWKARVCDPAHDPPSCMAIVSEVSSAAPTETDGVAllqmllhssllRIQDAVK  359
             T++    L  +++C  AHDP SC  ++SE ++ + ++   + LL + L +S+ +++    
Sbjct  45    TTTDDSLLTPSQICHGAHDPDSCQTLLSEFTTLSLSKPKRLDLLHVFLKNSVWQLESTTN  104

Query  360   LSANVNRRINDRKVQAAVADCMELLDLSQDKVMDSMVAL--GNLSARARTDAHSWLSSVL  533
             +      R N+ + +A  ADC E++D+S+D+++ SM  L  GNL+  + ++ H+WLSSVL
Sbjct  105   MVNEARTRSNEVRDKAHFADCKEMMDVSKDRMVSSMEELRGGNLNLESYSNVHTWLSSVL  164

Query  534   TNHDTCLDGLSE---PARSIMEPMIKDLISRAKsslavlvavaPSTEDDLRALNGEFPSW  704
             TN+ TCLD +S+    ++  ++P ++DL+SRA+ +L++ V+V PS +     L   FPSW
Sbjct  165   TNYMTCLDSISDVSIDSKHRVQPKLEDLVSRARVALSIFVSVLPSKDYLEMILPIHFPSW  224

Query  705   VSASDRRLLEAS--anavaanvvvaKDGSGKYKTVAEAVASAPDNGKTRYVIYIKKGTYK  878
             +++ DR+LLE++     V ANVVVAKDG+GKYKTV EAVA+AP+N  +RYVIY+KKG YK
Sbjct  225   LNSLDRKLLESAPKTFEVKANVVVAKDGTGKYKTVNEAVAAAPENSNSRYVIYVKKGVYK  284

Query  879   ENVEIGKKKTNVMLIGDGLSATIITGSLNYVDGATTFNSATVAAVGDGFIAQDLRIQNTA  1058
             E ++IGKKK N+ML+GDG   TIITGSLN VDG+TTF SATVAA GDGF+AQD+  QNTA
Sbjct  285   ETIDIGKKKKNLMLVGDGKDVTIITGSLNVVDGSTTFRSATVAANGDGFMAQDIWFQNTA  344

Query  1059  GPEKHQAVALRLGADQSVINRCKIDAYQDTLYAHSQRQFYRDCYITGTVDFIFGNAAAVI  1238
             GP KHQAVALR+ ADQSVINRC+IDAYQDTLY H+ RQFYRD +ITGTVDFIFGN+A V 
Sbjct  345   GPAKHQAVALRVSADQSVINRCRIDAYQDTLYTHTLRQFYRDSFITGTVDFIFGNSAVVF  404

Query  1239  QNSQVVARKPMAAQKNMVTAQGRTDPNQNTGTSIQNCNVSPSSDLGPVKGTIQTYLGRPW  1418
             QN  +VARKP A QKNM+TAQGR DPNQNT  S Q C ++ SSDL PVKG+++TYLGRPW
Sbjct  405   QNCDIVARKPGAGQKNMLTAQGREDPNQNTAISFQKCRLTASSDLAPVKGSVKTYLGRPW  464

Query  1419  KEYSRTVFMESNIGDHIDPAGWFPWDGDFALKTLYYGEYMNRGPGAGTSKRVNWPGYHVI  1598
             K YSRTV M+S I +HIDPAGWFPWDGDFAL TLYYGEY N GPGA TSKRV W G+ VI
Sbjct  465   KLYSRTVIMQSFIDNHIDPAGWFPWDGDFALSTLYYGEYANNGPGADTSKRVKWKGFKVI  524

Query  1599  TDKAEAMKFTVAQLIQGGSWLKNTGVDYTEGL  1694
              D  EA +FTVA+LIQGG WLK TGV + EGL
Sbjct  525   RDSKEADQFTVAKLIQGGLWLKPTGVTFQEGL  556



>ref|XP_008809854.1| PREDICTED: pectinesterase-like [Phoenix dactylifera]
Length=550

 Score =   587 bits (1512),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 325/554 (59%), Positives = 411/554 (74%), Gaps = 15/554 (3%)
 Frame = +3

Query  57    SHLPLL---FTPKRKPSSCRalyvllylaaIVGSVALVSIWALRTSSSSPSLWKARVCDP  227
             SH PLL    T ++    C AL   L LA+++ +  L+++  L T++++P+   + +C  
Sbjct  4     SHEPLLSSTATSRKTTHRCNALLFTLSLASLICTATLITV-QLNTNTTTPN--PSHLCAN  60

Query  228   AHDPPSCMAIVSEVSSAAP--TETDGVAllqmllhssllRIQDAVKLSANVNRRINDRKV  401
             +  P  C A++S   SA    ++ D V +LQ +LH SLL+I   + ++ N +R I+    
Sbjct  61    SPSPAPCNAVISTALSALGRRSKPDPVQVLQTILHQSLLQIDSFLTVADNFHRPIDGTGS  120

Query  402   --QAAVADCMELLDLSQDKVMDSMVALGNLSARARTDAHSWLSSVLTNHDTCLDGLSEPA  575
               ++A+ADC+ L+DLS+D + DS  A+   SA A T A +WLS+ LTNH TC DGL+ P 
Sbjct  121   IQRSALADCIHLMDLSRDLLRDSASAI---SAEAYTKARTWLSAALTNHVTCSDGLTRPI  177

Query  576   RSIMEPMIKDLISRAKsslavlvavaPSTEDDLRALNGEFPSWVSASDRRLLEASan-av  752
               +ME  ++ L + A +SLAVL AV+PS  D +  +   FPSW++  DR+LLE+S++  +
Sbjct  178   GPLMEAHLESLTALASASLAVLSAVSPSDGDAIERVR-RFPSWLTVKDRKLLESSSSDGI  236

Query  753   aanvvvaKDGSGKYKTVAEAVASAPDNGKTRYVIYIKKGTYKENVEIGKKKTNVMLIGDG  932
             AANV VA +GSG YKTV EAV SAPD GK RYVIY+K+GTYKENV +GKKKTNV ++GDG
Sbjct  237   AANVTVAAEGSGDYKTVQEAVDSAPDKGKVRYVIYVKEGTYKENVVVGKKKTNVTIVGDG  296

Query  933   LSATIITGSLNYVDGATTFNSATVAAVGDGFIAQDLRIQNTAGPEKHQAVALRLGADQSV  1112
             +++T+ITGSLN VDG+TTFNSAT AAVG+GFI QD+ I+NTAGPEKHQAVALR+GAD+S 
Sbjct  297   MNSTVITGSLNVVDGSTTFNSATFAAVGEGFILQDICIENTAGPEKHQAVALRVGADRSA  356

Query  1113  INRCKIDAYQDTLYAHSQRQFYRDCYITGTVDFIFGNAAAVIQNSQVVARKPMAAQKNMV  1292
             INRC++D YQDTLYAHS RQFYRD  I+GTVDFIFGNAA V QN  ++ARKPM+ Q+N+V
Sbjct  357   INRCRLDGYQDTLYAHSLRQFYRDSVISGTVDFIFGNAAVVFQNCNLIARKPMSHQQNLV  416

Query  1293  TAQGRTDPNQNTGTSIQNCNVSPSSDLGPVKGTIQTYLGRPWKEYSRTVFMESNIGDHID  1472
             TAQGR DPNQNTGTSIQ+C V PS DL PVKG+I TYLGRPWKEYSRTVFM+S I DH+D
Sbjct  417   TAQGRVDPNQNTGTSIQSCKVVPSDDLKPVKGSIPTYLGRPWKEYSRTVFMQSYIDDHVD  476

Query  1473  PAGWFPWDGDFALKTLYYGEYMNRGPGAGTSKRVNWPGYHVITDKAEAMKFTVAQLIQGG  1652
             P GW  W GDFAL TLYYGEY N GPGAGTS RVNW GYHVITD   A  FTVA LIQGG
Sbjct  477   PKGWMEWSGDFALDTLYYGEYANIGPGAGTSGRVNWTGYHVITDPNVAKDFTVAGLIQGG  536

Query  1653  SWLKNTGVDYTEGL  1694
             +WL+ TGV +TEGL
Sbjct  537   TWLQPTGVAFTEGL  550



>ref|XP_010493017.1| PREDICTED: pectinesterase/pectinesterase inhibitor 18-like [Camelina 
sativa]
Length=547

 Score =   586 bits (1511),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/552 (57%), Positives = 404/552 (73%), Gaps = 10/552 (2%)
 Frame = +3

Query  51    TTSHLPLLFTPKRKPSSCRalyvllylaaIVGSVALVSIWALRTSSSSPSLWKARVCDPA  230
             + S+ PLL  PK    + + L ++L  AAI+GS A  +   L  S+    L  +++C   
Sbjct  2     SNSNQPLLSKPK--SLTHKNLCLVLSFAAILGSAAFFAA-QLIYSNDDAVLTPSQICHGT  58

Query  231   HDPPSCMAIVSEVSSAAPTETDGVAllqmllhssllRIQDAVKLSANVNRRINDRKVQAA  410
             HD  SC  ++SE ++ + ++ + + LL + L +S+ R++  + +        N  + +A 
Sbjct  59    HDQDSCQVLLSEFTTLSLSKLNRLDLLHVFLKNSVWRLERTMNMVKEARTSSNGVRDEAV  118

Query  411   VADCMELLDLSQDKVMDSMVAL--GNLSARARTDAHSWLSSVLTNHDTCLDGLSEPARSI  584
             +ADC E++D S+D++++SM  L  GNL+  + ++ H+WLSSVLTN+ TCLD  +EP    
Sbjct  119   LADCEEMMDASKDRMVNSMEQLRGGNLNFESYSNVHTWLSSVLTNYMTCLDTTNEPR---  175

Query  585   MEPMIKDLISRAKsslavlvavaPSTEDDLRALNGEFPSWVSASDRRLLEA--Sanavaa  758
             ++P ++DL+SRA+ +LA+ V+V P+ +D    L   FPSW++A DR LLE+      V A
Sbjct  176   VKPQLEDLVSRARVALAIFVSVLPARDDLKMVLFDHFPSWLTALDRELLESDPKTLKVNA  235

Query  759   nvvvaKDGSGKYKTVAEAVASAPDNGKTRYVIYIKKGTYKENVEIGKKKTNVMLIGDGLS  938
             NVVVAKDGSGKYKTV EAVA+AP+N  +RYVIY+KKG YKE ++IGKKK N+ML+GDG  
Sbjct  236   NVVVAKDGSGKYKTVNEAVAAAPENSNSRYVIYVKKGVYKETIDIGKKKKNLMLVGDGKD  295

Query  939   ATIITGSLNYVDGATTFNSATVAAVGDGFIAQDLRIQNTAGPEKHQAVALRLGADQSVIN  1118
             AT+ITGSLN VDG+TTF SAT+AA GDGF+AQDL IQNTAGP KHQAVALR+ ADQ+VIN
Sbjct  296   ATVITGSLNVVDGSTTFRSATIAANGDGFMAQDLWIQNTAGPAKHQAVALRVSADQTVIN  355

Query  1119  RCKIDAYQDTLYAHSQRQFYRDCYITGTVDFIFGNAAAVIQNSQVVARKPMAAQKNMVTA  1298
             RC+IDAYQDTLY H+ RQFYRD YITGTVDFIFGN+A V QN  +VARKP A QKNMVTA
Sbjct  356   RCRIDAYQDTLYTHTLRQFYRDSYITGTVDFIFGNSAVVFQNCDIVARKPGAGQKNMVTA  415

Query  1299  QGRTDPNQNTGTSIQNCNVSPSSDLGPVKGTIQTYLGRPWKEYSRTVFMESNIGDHIDPA  1478
             QGR D NQNT  SIQ C ++ SSDL PVKG+++T+LGRPWK YSRTV M++ I +H+DPA
Sbjct  416   QGREDQNQNTAISIQRCKITASSDLAPVKGSVKTFLGRPWKLYSRTVIMQTFIDNHVDPA  475

Query  1479  GWFPWDGDFALKTLYYGEYMNRGPGAGTSKRVNWPGYHVITDKAEAMKFTVAQLIQGGSW  1658
             GWFPWDG+FAL TLYYGEY N GPGA TSKRV W G+ VI +  EA +FTVA+LIQGG W
Sbjct  476   GWFPWDGEFALSTLYYGEYANSGPGADTSKRVKWKGFKVIRNSKEAEQFTVAKLIQGGLW  535

Query  1659  LKNTGVDYTEGL  1694
             LK TGV Y E L
Sbjct  536   LKPTGVTYQEWL  547



>ref|XP_010088582.1| Pectinesterase/pectinesterase inhibitor [Morus notabilis]
 gb|EXB36723.1| Pectinesterase/pectinesterase inhibitor [Morus notabilis]
Length=658

 Score =   590 bits (1520),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/499 (61%), Positives = 371/499 (74%), Gaps = 7/499 (1%)
 Frame = +3

Query  216   VCDPAHDPPSCMAIVSEVSSAAPTETDGVAllqmllhssllRIQDAVKLSANVNRRIN-D  392
             +CD + +  SC+A+VSE      T  D   LL+  L  +   IQ A+++  NV+RRIN  
Sbjct  159   ICDQSVNKESCLAMVSEAVQEYSTMADH-ELLKAFLEKTNPLIQLALEMLNNVSRRINVS  217

Query  393   RKVQAAVADCMELLDLSQDKVMDSM--VALGNLSARARTDAHSWLSSVLTNHDTCLDGLS  566
              + +AA+ DC EL+DLS+D+V+DS+  + L NL+  +R D ++WLS +LTNH TCLDGL 
Sbjct  218   PRDRAALLDCAELMDLSKDRVLDSISTLLLQNLTTHSREDVNAWLSGILTNHVTCLDGLE  277

Query  567   EP---ARSIMEPMIKDLISRAKsslavlvavaPSTEDDLRALNGEFPSWVSASDRRLLEA  737
                  A+++ME  + +LISRA++SLA+LV+ + S  + L  L  +FP+WV+  DRRLL +
Sbjct  278   RDGSYAKNLMESHLNELISRARTSLAILVSFSQSKFEALEPLTKDFPTWVTPGDRRLLRS  337

Query  738   SanavaanvvvaKDGSGKYKTVAEAVASAPDNGKTRYVIYIKKGTYKENVEIGKKKTNVM  917
                 + A++VVAKDGSG Y TV EAVA+ P N K R VIY+  G Y EN E+ K K NVM
Sbjct  338   LGKEITADIVVAKDGSGDYTTVNEAVAAVPKNSKKRLVIYVTTGVYYENFELAKNKKNVM  397

Query  918   LIGDGLSATIITGSLNYVDGATTFNSATVAAVGDGFIAQDLRIQNTAGPEKHQAVALRLG  1097
             L+GDG+  T+IT SLN  DG+TTF SATVA  GDGFIAQD+  QNTAGP+KHQAVALR+ 
Sbjct  398   LLGDGMDYTLITASLNADDGSTTFKSATVAVNGDGFIAQDIWFQNTAGPQKHQAVALRVS  457

Query  1098  ADQSVINRCKIDAYQDTLYAHSQRQFYRDCYITGTVDFIFGNAAAVIQNSQVVARKPMAA  1277
             AD+SVINRC IDAY+DTLY HS RQFYRD  +TGTVDFIFGNAA  +Q  ++++RK M  
Sbjct  458   ADKSVINRCHIDAYEDTLYTHSHRQFYRDSTVTGTVDFIFGNAAVALQRCKIISRKGMRG  517

Query  1278  QKNMVTAQGRTDPNQNTGTSIQNCNVSPSSDLGPVKGTIQTYLGRPWKEYSRTVFMESNI  1457
             QKNMVTAQGRTDPNQNTGTSI NC +  S DL PVK +  +YLGRPWKEYSRTV M+S I
Sbjct  518   QKNMVTAQGRTDPNQNTGTSIHNCEIFASPDLEPVKDSFPSYLGRPWKEYSRTVVMQSYI  577

Query  1458  GDHIDPAGWFPWDGDFALKTLYYGEYMNRGPGAGTSKRVNWPGYHVITDKAEAMKFTVAQ  1637
             GD IDPAGWF WDGDFAL TLYYGEY NRGPGAGTSKRV W GYHVIT   EA KFTVA+
Sbjct  578   GDLIDPAGWFEWDGDFALNTLYYGEYANRGPGAGTSKRVKWAGYHVITSPDEAQKFTVAE  637

Query  1638  LIQGGSWLKNTGVDYTEGL  1694
             LIQGG WL++TGVDYTEGL
Sbjct  638   LIQGGPWLESTGVDYTEGL  656



>gb|AFC98398.1| pectin methylesterase [Lepidium sativum]
Length=556

 Score =   585 bits (1507),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/557 (55%), Positives = 404/557 (73%), Gaps = 11/557 (2%)
 Frame = +3

Query  51    TTSHLPLLFTPKRKPSSCRalyvllylaaIVGSVALVSI-WALRTSSSSPSLWK-ARVCD  224
             + S+ PLL   K K  + ++L + L  A I+GS A  +  +  R +S+  S+   +++C 
Sbjct  2     SNSNQPLL--SKSKSLNTKSLCLFLSFAVILGSAAFFTTQFIFRNTSNDDSILSPSQICH  59

Query  225   PAHDPPSCMAIVSEVSSAAPTETDGVAllqmllhssllRIQDAVKLSANVNRRINDRKVQ  404
               HD  SC  ++SE ++   ++ +   LLQ+ L +S+ R++    +        N    +
Sbjct  60    GVHDQDSCQVLLSEFTTLPLSKVNRQDLLQVFLKNSVWRLERTTSIVKEARTSSNGLNDK  119

Query  405   AAVADCMELLDLSQDKVMDSMVAL--GNLSARARTDAHSWLSSVLTNHDTCLDGLSE---  569
               ++DC E++D+S+D+++ S+  L  GNL   + ++ H+WLSSVLTN+ TC + +++   
Sbjct  120   VGLSDCDEMMDVSKDRMVSSIKELRGGNLELESYSNVHTWLSSVLTNYMTCQESITDVSV  179

Query  570   PARSIMEPMIKDLISRAKsslavlvavaPSTEDDLRALNGEFPSWVSASDRRLLEAS--a  743
              + S + P ++DL+SRA+ +LA+ V+V P  +D    ++  FPSW++  DR+LLE++  +
Sbjct  180   DSNSRVMPQLEDLVSRARVALAIFVSVTPVKDDLQMIVSNHFPSWLTTFDRKLLESAPKS  239

Query  744   navaanvvvaKDGSGKYKTVAEAVASAPDNGKTRYVIYIKKGTYKENVEIGKKKTNVMLI  923
               V ANVVVAKDG+GK+KTV EAV +AP+N  +RYV+Y+KKG YKE ++IGKKK N+ML+
Sbjct  240   LEVNANVVVAKDGTGKFKTVNEAVTAAPENSNSRYVVYVKKGVYKETIDIGKKKKNLMLV  299

Query  924   GDGLSATIITGSLNYVDGATTFNSATVAAVGDGFIAQDLRIQNTAGPEKHQAVALRLGAD  1103
             GDG   TIITGSLN VDG+TTF SATVAA GDGF+AQD+ IQNTAGP KHQAVALR+ AD
Sbjct  300   GDGKDLTIITGSLNVVDGSTTFRSATVAANGDGFMAQDIWIQNTAGPAKHQAVALRVSAD  359

Query  1104  QSVINRCKIDAYQDTLYAHSQRQFYRDCYITGTVDFIFGNAAAVIQNSQVVARKPMAAQK  1283
             QSVINRC+IDAYQDTLY H+ RQFYRDC+ITGTVDFIFGN+A V QN  +VARKP A QK
Sbjct  360   QSVINRCRIDAYQDTLYTHTLRQFYRDCFITGTVDFIFGNSAVVFQNCDIVARKPDAGQK  419

Query  1284  NMVTAQGRTDPNQNTGTSIQNCNVSPSSDLGPVKGTIQTYLGRPWKEYSRTVFMESNIGD  1463
             NM+TAQGR DPNQNT  SIQ CN+ PSS+L PVK +++TYLGRPWK YSRTV M+S I +
Sbjct  420   NMLTAQGREDPNQNTAISIQKCNIKPSSELAPVKESVKTYLGRPWKLYSRTVIMQSFIDN  479

Query  1464  HIDPAGWFPWDGDFALKTLYYGEYMNRGPGAGTSKRVNWPGYHVITDKAEAMKFTVAQLI  1643
             HIDPAGWFPWDG+FAL TLYYGEY N GPGAGTSKRV W GY VI D  EA KFTVA LI
Sbjct  480   HIDPAGWFPWDGEFALSTLYYGEYANNGPGAGTSKRVTWKGYRVIKDSKEAAKFTVANLI  539

Query  1644  QGGSWLKNTGVDYTEGL  1694
             QGG WLK TGV + EGL
Sbjct  540   QGGLWLKPTGVAFQEGL  556



>gb|KFK43434.1| hypothetical protein AALP_AA1G125000 [Arabis alpina]
Length=556

 Score =   583 bits (1504),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/557 (56%), Positives = 405/557 (73%), Gaps = 11/557 (2%)
 Frame = +3

Query  51    TTSHLPLLFTPKRKPSSCRalyvllylaaIVGSVALVS--IWALRTSSSSPSLWKARVCD  224
             + S+ PLL  PK      + L ++L   AI+GS A  +  + +L  ++    L  +++C 
Sbjct  2     SNSNQPLLSKPK--SFHHKNLCLVLSFVAILGSAAFFTSQLISLNNTNGDSLLTTSQICH  59

Query  225   PAHDPPSCMAIVSEVSSAAPTETDGVAllqmllhssllRIQDAVKLSANVNRRINDRKVQ  404
              AHD  SC A++SE ++ + ++ + + LL + L +S+ R+   +        R N  + +
Sbjct  60    GAHDQASCQALLSEFTTLSLSKLNRLDLLHVFLKNSVWRLDSTMNTVNEAKTRSNGVRDE  119

Query  405   AAVADCMELLDLSQDKVMDSMVAL--GNLSARARTDAHSWLSSVLTNHDTCLDGLSEPAR  578
             A  ADC E++D+S+D+V+ S+  L  GNL+  + ++ H+WLSSVLTN+ TCLD +S+ + 
Sbjct  120   AHFADCEEMMDVSKDRVISSIEELRGGNLNLESYSNVHTWLSSVLTNYMTCLDSISDISI  179

Query  579   SI---MEPMIKDLISRAKsslavlvavaPSTEDDLRALNGEFPSWVSASDRRLLEAS--a  743
                  ++P ++DL+SRA+ +LA+ V+V PS ++        FP W++A DR+LLE++   
Sbjct  180   DSKLSVKPKLEDLVSRARVALAIFVSVLPSRDELDMIFPIHFPYWLTALDRKLLESTPKT  239

Query  744   navaanvvvaKDGSGKYKTVAEAVASAPDNGKTRYVIYIKKGTYKENVEIGKKKTNVMLI  923
               V ANV+VAKDG+GKYKTV EAV +AP+N  TRYVIY+KKG YKE ++IGKKK N+ML+
Sbjct  240   LEVTANVIVAKDGTGKYKTVNEAVTAAPENSNTRYVIYVKKGVYKETIDIGKKKKNLMLV  299

Query  924   GDGLSATIITGSLNYVDGATTFNSATVAAVGDGFIAQDLRIQNTAGPEKHQAVALRLGAD  1103
             GDG   TIITGSLN +DG+TTF SATVAA GDGF+AQD+  QNTAGP+KHQAVALR+ AD
Sbjct  300   GDGKDLTIITGSLNVIDGSTTFRSATVAANGDGFMAQDIWFQNTAGPDKHQAVALRVSAD  359

Query  1104  QSVINRCKIDAYQDTLYAHSQRQFYRDCYITGTVDFIFGNAAAVIQNSQVVARKPMAAQK  1283
             Q+VINRC+IDAYQDTLY HS RQFYRD YITGTVDFIFGN+A V QN  +VARKP A QK
Sbjct  360   QTVINRCRIDAYQDTLYTHSLRQFYRDSYITGTVDFIFGNSAVVFQNCDIVARKPGAGQK  419

Query  1284  NMVTAQGRTDPNQNTGTSIQNCNVSPSSDLGPVKGTIQTYLGRPWKEYSRTVFMESNIGD  1463
             NMVTAQGR DPNQNT  S Q C ++ SSDL PVKG+++T+LGRPWK YSRTV M+S+IGD
Sbjct  420   NMVTAQGREDPNQNTAISFQKCKITASSDLAPVKGSVKTFLGRPWKLYSRTVIMQSSIGD  479

Query  1464  HIDPAGWFPWDGDFALKTLYYGEYMNRGPGAGTSKRVNWPGYHVITDKAEAMKFTVAQLI  1643
             HIDPAGWFPWDG+FAL TLYYGEY N GPGA TSKRV W G+ VI D  EA +FTVA+LI
Sbjct  480   HIDPAGWFPWDGEFALSTLYYGEYANNGPGADTSKRVKWKGFKVIRDSKEAEQFTVAKLI  539

Query  1644  QGGSWLKNTGVDYTEGL  1694
             QGG WLK TGV Y E L
Sbjct  540   QGGLWLKPTGVTYQEWL  556



>ref|XP_002889876.1| At1g11580/T23J18_33 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH66135.1| At1g11580/T23J18_33 [Arabidopsis lyrata subsp. lyrata]
Length=556

 Score =   583 bits (1503),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/559 (54%), Positives = 412/559 (74%), Gaps = 15/559 (3%)
 Frame = +3

Query  51    TTSHLPLLFTPK--RKPSSCRalyvllylaaIVGSVALVS--IWALRTSSSSPSLWKARV  218
             + S+ PLL  PK  +  + C    ++L   AI+GS A+ +  + ++ TS+    L  +++
Sbjct  2     SNSNQPLLSKPKSFKHKNLC----LVLSFVAILGSAAIYTSQLISINTSNDDSLLTPSQI  57

Query  219   CDPAHDPPSCMAIVSEVSSAAPTETDGVAllqmllhssllRIQDAVKLSANVNRRINDRK  398
             C  AH+  SC A++SE ++ + ++ + + LL + L +S+ R++  + + +    R N  +
Sbjct  58    CHGAHNQDSCQALLSEFTTLSLSKVNRLDLLHVFLKNSVWRLESTMTMVSEARIRSNGVR  117

Query  399   VQAAVADCMELLDLSQDKVMDSMVAL--GNLSARARTDAHSWLSSVLTNHDTCLDGLSE-  569
              +A +ADC E++D+S+D+++ SM  L  GN +  + ++ H+WLSSVLTN+ TCL+ +S+ 
Sbjct  118   DKAGLADCEEMMDVSKDRMVSSMEELRGGNYNLESYSNVHTWLSSVLTNYMTCLESISDV  177

Query  570   --PARSIMEPMIKDLISRAKsslavlvavaPSTEDDLRALNGEFPSWVSASDRRLLEAS-  740
                ++  ++P ++DL+SRA+ +LA+ V+V P+ +D    ++  FPSW++A DR+LLE++ 
Sbjct  178   SVNSKPRVKPQLEDLVSRARVALAIFVSVLPARDDLKMIISNSFPSWLTALDRKLLESAP  237

Query  741   -anavaanvvvaKDGSGKYKTVAEAVASAPDNGKTRYVIYIKKGTYKENVEIGKKKTNVM  917
                 V ANVVVAKDG+GK+KTV EAVA+AP+N  +RYVIY+KKG YKE ++IGKKK N+M
Sbjct  238   KTLKVTANVVVAKDGTGKFKTVNEAVAAAPENSNSRYVIYVKKGVYKETIDIGKKKKNLM  297

Query  918   LIGDGLSATIITGSLNYVDGATTFNSATVAAVGDGFIAQDLRIQNTAGPEKHQAVALRLG  1097
             L+GDG   T+ITGSLN +DG+TTF SATVAA GDGF+AQD+  QNTAGP KHQAVALR+ 
Sbjct  298   LVGDGKDVTVITGSLNVIDGSTTFRSATVAANGDGFMAQDIWFQNTAGPAKHQAVALRVS  357

Query  1098  ADQSVINRCKIDAYQDTLYAHSQRQFYRDCYITGTVDFIFGNAAAVIQNSQVVARKPMAA  1277
             ADQ+VINRC+IDAYQDTLY H+ RQFYRD YITGTVDFIFGN+A V QN  +VAR P A 
Sbjct  358   ADQTVINRCRIDAYQDTLYTHTLRQFYRDSYITGTVDFIFGNSAVVFQNCDIVARNPGAG  417

Query  1278  QKNMVTAQGRTDPNQNTGTSIQNCNVSPSSDLGPVKGTIQTYLGRPWKEYSRTVFMESNI  1457
             QKNM+TAQGR D NQNT  SIQ C ++ SSDL PVKG+++T+LGRPWK YSRTV M+S I
Sbjct  418   QKNMLTAQGREDQNQNTAISIQKCKLTASSDLAPVKGSVKTFLGRPWKLYSRTVIMQSFI  477

Query  1458  GDHIDPAGWFPWDGDFALKTLYYGEYMNRGPGAGTSKRVNWPGYHVITDKAEAMKFTVAQ  1637
              +HIDPAGWFPWDG+FAL TLYYGEY N GPGA TSKRV W G+ VI D  EA +FTVA+
Sbjct  478   DNHIDPAGWFPWDGEFALSTLYYGEYANTGPGADTSKRVKWKGFKVIKDSKEAEQFTVAK  537

Query  1638  LIQGGSWLKNTGVDYTEGL  1694
             LIQGG WLK TGV + E L
Sbjct  538   LIQGGLWLKPTGVTFQEWL  556



>ref|XP_009397166.1| PREDICTED: pectinesterase-like [Musa acuminata subsp. malaccensis]
Length=553

 Score =   576 bits (1485),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/561 (58%), Positives = 409/561 (73%), Gaps = 19/561 (3%)
 Frame = +3

Query  45    MATTSHLPLLFTPKRKPS--SCRalyvllylaaIVGSVALVSI-WALRTSSSSPSLWKAR  215
             MA  +  PLL +P    +   C+AL + L LA +V   A ++I     T++ +P L  + 
Sbjct  1     MAAPTTEPLLSSPATHTTRLPCKALLLTLSLATVVCLTAFMTIQLMTTTTTMNPPLQPSD  60

Query  216   VCDPAHDPPSCMAIVSEV--SSAAPTETDGVAllqmllhssllRIQDAVKLSANVNRRI-  386
             +C  + +P SC AIVS+V  +SA       V + + LLH+SL+++  A   +A+++ R+ 
Sbjct  61    LCAKSPNPTSCHAIVSQVMLTSAENHHPTPVQIFRSLLHNSLVQLDAAAASAADIHLRLL  120

Query  387   NDRKVQAAVADCMELLDLSQDKVMDSMVALGNLSARARTDAHSWLSSVLTNHDTCLDGLS  566
              + K QAA+ADCM+LL LS+D+++ S  A G       TDA +W+S+VLTNH TCLDGL 
Sbjct  121   KEPKQQAALADCMQLLQLSRDRIVSSGDAAG-------TDARTWMSAVLTNHATCLDGLH  173

Query  567   EPARSIMEPMIKDLISRAKsslavlvavaPSTE----DDLRALNGEFPSWVSASDRRLLE  734
               A+S M+  ++ L + A +SLAVL AV PS+E    DD+      FPSW+S  DR+LL+
Sbjct  174   GAAKSAMQAHLESLKASASASLAVLHAV-PSSEHDNDDDIVKPVATFPSWLSHRDRKLLQ  232

Query  735   -ASanavaanvvvaKDGSGKYKTVAEAVASAPDNGKTRYVIYIKKGTYKENVEIGKKKTN  911
               S NAV AN VVAKDGSG +KTV  AV S P+  K RYVIY+KKG YKENV +GKK TN
Sbjct  233   MTSPNAVQANAVVAKDGSGTFKTVQAAVDSVPNGNKNRYVIYVKKGVYKENVSLGKKTTN  292

Query  912   VMLIGDGLSATIITGSLNYVDGATTFNSATVAAVGDGFIAQDLRIQNTAGPEKHQAVALR  1091
             VM++GDG+ AT+ITGSLN VDG+TTF+SAT+AAVGDG I QDL+I+NTAGP+KHQAVALR
Sbjct  293   VMIVGDGMDATVITGSLNVVDGSTTFDSATLAAVGDGLILQDLKIENTAGPQKHQAVALR  352

Query  1092  LGADQSVINRCKIDAYQDTLYAHSQRQFYRDCYITGTVDFIFGNAAAVIQNSQVVARKPM  1271
             +GAD+SVINRC++D YQDTLYAH+ RQFYRD +I+GTVDF+FGNAA V QN  + AR+PM
Sbjct  353   VGADRSVINRCRLDGYQDTLYAHTLRQFYRDSFISGTVDFVFGNAAVVFQNCNLTARRPM  412

Query  1272  AAQKNMVTAQGRTDPNQNTGTSIQNCNVSPSSDLGPVKGTIQTYLGRPWKEYSRTVFMES  1451
               Q+N+VTAQGR DPNQNTGTSIQNCNV P+ DL PVKG+I +YLGRPWK YSRTV M+S
Sbjct  413   DNQQNLVTAQGREDPNQNTGTSIQNCNVVPADDLIPVKGSIPSYLGRPWKAYSRTVVMQS  472

Query  1452  NIGDHIDPAGWFPWDGDFALKTLYYGEYMNRGPGAGTSKRVNWPGYHVITDKAEAMKFTV  1631
              I  HI+  GW  WDG+FALKTL+YGEY NRGPGAGT  RV WPGYHVITD   A  FTV
Sbjct  473   YIDSHINSKGWLEWDGEFALKTLFYGEYQNRGPGAGTGGRVKWPGYHVITDANTAKAFTV  532

Query  1632  AQLIQGGSWLKNTGVDYTEGL  1694
             A LIQGGSWLK TGV + EGL
Sbjct  533   ASLIQGGSWLKETGVAFAEGL  553



>gb|AAB67740.1| PME1.9 [Solanum lycopersicum]
Length=430

 Score =   568 bits (1464),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/427 (66%), Positives = 337/427 (79%), Gaps = 1/427 (0%)
 Frame = +3

Query  417   DCMELLDLSQDKVMDSMVALGNLSARARTDAHSWLSSVLTNHDTCLDGLSEPARSIMEPM  596
             DC+ELLD S D   DS+ A+   S     +A SWLS VLTNH TCLD L    ++++   
Sbjct  2     DCLELLDQSVDFASDSIAAIDKRSRSEHANAQSWLSGVLTNHVTCLDELDSFTKAMINGT  61

Query  597   -IKDLISRAKsslavlvavaPSTEDDLRALNGEFPSWVSASDRRLLEASanavaanvvva  773
              +++LISRAK +LA+L ++    ED L  + G+ PSWVS+ DR+L+E+S   + AN VVA
Sbjct  62    NLEELISRAKVALAMLASLTTQDEDVLMTVLGKMPSWVSSMDRKLMESSGKDIIANAVVA  121

Query  774   KDGSGKYKTVAEAVASAPDNGKTRYVIYIKKGTYKENVEIGKKKTNVMLIGDGLSATIIT  953
             +DG+G Y+T+AEAVA+APD  KTRYVIY+K+GTYKENVE+   K N+M++GDG+ AT IT
Sbjct  122   QDGTGDYQTLAEAVAAAPDKSKTRYVIYVKRGTYKENVEVSSNKMNLMIVGDGMYATTIT  181

Query  954   GSLNYVDGATTFNSATVAAVGDGFIAQDLRIQNTAGPEKHQAVALRLGADQSVINRCKID  1133
             GSLN VDG+TTF SAT+AAVG GFI QD+ IQNTAGP K QAVALR+GAD SVINRC+ID
Sbjct  182   GSLNVVDGSTTFRSATLAAVGQGFILQDICIQNTAGPAKDQAVALRVGADMSVINRCRID  241

Query  1134  AYQDTLYAHSQRQFYRDCYITGTVDFIFGNAAAVIQNSQVVARKPMAAQKNMVTAQGRTD  1313
             AYQDTLYAHSQRQFYRD Y+TGTVDFIFGNAA V Q  Q+VARKP   Q+NMVTAQGRTD
Sbjct  242   AYQDTLYAHSQRQFYRDSYVTGTVDFIFGNAAVVFQKCQLVARKPGKYQQNMVTAQGRTD  301

Query  1314  PNQNTGTSIQNCNVSPSSDLGPVKGTIQTYLGRPWKEYSRTVFMESNIGDHIDPAGWFPW  1493
             PNQ TGTSIQ C++  SSDL P+     TYLGRPWKEYSRTV MES +G  I+PAGW  W
Sbjct  302   PNQATGTSIQFCDIIASSDLEPLLKEFPTYLGRPWKEYSRTVVMESYLGGLINPAGWAEW  361

Query  1494  DGDFALKTLYYGEYMNRGPGAGTSKRVNWPGYHVITDKAEAMKFTVAQLIQGGSWLKNTG  1673
             DGDFALKTLYYGE+MN GPGAGTSKRV WPGYHVITD A+A+ FTVA+LIQGGSWL++TG
Sbjct  362   DGDFALKTLYYGEFMNNGPGAGTSKRVKWPGYHVITDPAKAIPFTVAKLIQGGSWLRSTG  421

Query  1674  VDYTEGL  1694
             V Y +GL
Sbjct  422   VAYVDGL  428



>gb|AAB38794.1| pectin methylesterase, partial [Solanum lycopersicum]
Length=439

 Score =   567 bits (1461),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/437 (65%), Positives = 338/437 (77%), Gaps = 1/437 (0%)
 Frame = +3

Query  387   NDRKVQAAVADCMELLDLSQDKVMDSMVALGNLSARARTDAHSWLSSVLTNHDTCLDGLS  566
             ND +   A+ DC+ELLD S D   DS+ A+   S     ++ SWLS VLTNH TCLD L 
Sbjct  1     NDIRQHGALTDCLELLDQSVDLASDSIAAIDKRSRSEHANSESWLSGVLTNHVTCLDELD  60

Query  567   EPARSIMEPM-IKDLISRAKsslavlvavaPSTEDDLRALNGEFPSWVSASDRRLLEASa  743
                ++++    +++LISRAK +LA+L ++    ED      G+ PSWVS+ DR+L+E+S 
Sbjct  61    SFTKAMINGTNLEELISRAKVALAMLASLTTQDEDVFMTGLGKMPSWVSSMDRKLMESSG  120

Query  744   navaanvvvaKDGSGKYKTVAEAVASAPDNGKTRYVIYIKKGTYKENVEIGKKKTNVMLI  923
               + AN VVA+DG+GKY+T+AEAVA+AP+  K RYVIY+K+G YKENVE+   K N+M++
Sbjct  121   KDIIANRVVAQDGTGKYRTLAEAVAAAPNRSKKRYVIYVKRGIYKENVEVSSNKMNLMIV  180

Query  924   GDGLSATIITGSLNYVDGATTFNSATVAAVGDGFIAQDLRIQNTAGPEKHQAVALRLGAD  1103
             GDG+ AT ITGSLN VDG+TTF SAT+AAVG GFI QD+ IQNTAGP K QAVALR+GAD
Sbjct  181   GDGMYATTITGSLNVVDGSTTFRSATLAAVGQGFILQDICIQNTAGPAKDQAVALRVGAD  240

Query  1104  QSVINRCKIDAYQDTLYAHSQRQFYRDCYITGTVDFIFGNAAAVIQNSQVVARKPMAAQK  1283
              SVINRC+IDAYQDTLYAHSQRQFYRD Y+TGTVDFIFGNAA V Q  Q+VARKP   Q+
Sbjct  241   MSVINRCRIDAYQDTLYAHSQRQFYRDSYVTGTVDFIFGNAAVVFQKCQLVARKPGKYQQ  300

Query  1284  NMVTAQGRTDPNQNTGTSIQNCNVSPSSDLGPVKGTIQTYLGRPWKEYSRTVFMESNIGD  1463
             NMVTAQG TDPNQ TGTSIQ CN+  SSDL PV     TYLGRPWKEYSRTV MES +G 
Sbjct  301   NMVTAQGTTDPNQATGTSIQFCNIIASSDLEPVLKEFPTYLGRPWKEYSRTVVMESYLGG  360

Query  1464  HIDPAGWFPWDGDFALKTLYYGEYMNRGPGAGTSKRVNWPGYHVITDKAEAMKFTVAQLI  1643
              I+PAGW  WDGDFALKTLYYGE+MN GPGAGTSKRV WPGYHVITD A+AM FTVA+LI
Sbjct  361   LINPAGWAEWDGDFALKTLYYGEFMNNGPGAGTSKRVKWPGYHVITDPAKAMPFTVAKLI  420

Query  1644  QGGSWLKNTGVDYTEGL  1694
             QGGSWL++TGV Y +GL
Sbjct  421   QGGSWLRSTGVAYVDGL  437



>emb|CDY34642.1| BnaC08g42010D [Brassica napus]
Length=451

 Score =   567 bits (1461),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/449 (63%), Positives = 352/449 (78%), Gaps = 7/449 (2%)
 Frame = +3

Query  369   NVNRRINDRKVQAAVADCMELLDLSQDKVMDSMVAL--GNLSARARTDAHSWLSSVLTNH  542
             N  RR N+ + +A  ADC E++D+S+D+++ SM  L  GNL+  + ++ H+WLSSVLTN+
Sbjct  3     NEARRSNEVRDEAHFADCKEMMDVSKDRMVSSMEELRGGNLNLESYSNVHTWLSSVLTNY  62

Query  543   DTCLDGLSE---PARSIMEPMIKDLISRAKsslavlvavaPSTEDDLRALNGEFPSWVSA  713
              TCLD +S+    ++  ++P ++DL+SRA+ +L++ V+V+PS +     L   FPSW+++
Sbjct  63    MTCLDSISDVSIDSKHRVQPKLEDLVSRARVALSIFVSVSPSKDYLEMILPIHFPSWLNS  122

Query  714   SDRRLLEAS--anavaanvvvaKDGSGKYKTVAEAVASAPDNGKTRYVIYIKKGTYKENV  887
              DR+LLE++     V ANVVVAKDG+GKYKTV EAVA+AP+N  +RYVIY+KKG YKE +
Sbjct  123   LDRKLLESAPKTLEVKANVVVAKDGTGKYKTVNEAVAAAPENSNSRYVIYVKKGVYKETI  182

Query  888   EIGKKKTNVMLIGDGLSATIITGSLNYVDGATTFNSATVAAVGDGFIAQDLRIQNTAGPE  1067
             +IGKKK N+ML+GDG   TIITGSLN VDG+TTF SATVAA GDGF+AQD+  QNTAGP 
Sbjct  183   DIGKKKKNLMLVGDGKDVTIITGSLNVVDGSTTFRSATVAANGDGFMAQDIWFQNTAGPA  242

Query  1068  KHQAVALRLGADQSVINRCKIDAYQDTLYAHSQRQFYRDCYITGTVDFIFGNAAAVIQNS  1247
             KHQAVALR+ ADQSVINRC+IDAYQDTLY H+ RQFYRD +ITGTVDFIFGN+A V QN 
Sbjct  243   KHQAVALRVSADQSVINRCRIDAYQDTLYTHTLRQFYRDSFITGTVDFIFGNSAVVFQNC  302

Query  1248  QVVARKPMAAQKNMVTAQGRTDPNQNTGTSIQNCNVSPSSDLGPVKGTIQTYLGRPWKEY  1427
              +VARKP A QKNM+TAQGR DPNQNT  S Q C ++ SS L PVKG+++T+LGRPWK Y
Sbjct  303   DIVARKPGAGQKNMLTAQGREDPNQNTAISFQKCRLTASSYLAPVKGSVKTFLGRPWKLY  362

Query  1428  SRTVFMESNIGDHIDPAGWFPWDGDFALKTLYYGEYMNRGPGAGTSKRVNWPGYHVITDK  1607
             SRTV M+S I +HIDPAGWFPWDGDFAL TLYYGEY N GPGA TSKRV W G+ VI D 
Sbjct  363   SRTVIMQSFIDNHIDPAGWFPWDGDFALSTLYYGEYANNGPGADTSKRVKWKGFKVIRDS  422

Query  1608  AEAMKFTVAQLIQGGSWLKNTGVDYTEGL  1694
              EA KFTVA+LIQGG WLK TGV + EGL
Sbjct  423   KEADKFTVAKLIQGGLWLKPTGVTFQEGL  451



>ref|XP_004134752.1| PREDICTED: pectinesterase [Cucumis sativus]
 gb|KGN49128.1| Pectinesterase [Cucumis sativus]
Length=555

 Score =   569 bits (1467),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/559 (56%), Positives = 396/559 (71%), Gaps = 13/559 (2%)
 Frame = +3

Query  45    MATTSHLPLLFTPKRKPSSCRalyvllylaaIVGSVALVSIWALRTSSSSPSL-WKARVC  221
             MAT  H PLL     K S  + +  LL  AA++ S   ++   ++ + S   L +   +C
Sbjct  1     MAT--HQPLLLLQPPKTSRSKTIPTLLCFAAVLCSAIFITNKFIKPNPSENDLPFLQNIC  58

Query  222   DPAHDPPSCMAIV-SEVSSAAPTETDGVAllqmllhssllRIQDAVKLSANVNRRINDRK  398
               A+DP SC+ +  SE   +    T+ V  LQ  L  S+ ++   ++ + ++ +RIN  +
Sbjct  59    HKAYDPSSCIEMAASEFPLSIIKTTNEVDFLQSFLRKSMPKVISTIERAKDIRQRINSPR  118

Query  399   VQAAVADCMELLDLSQDKVMDSMVALGNLSARARTDAHSWLSSVLTNHDTCLDGLSEPAR  578
              +AA+ADC+EL+++S  ++MDS++AL N ++ +  ++H+WLSSVLTNH TC D + E + 
Sbjct  119   GEAALADCIELMEISNGRIMDSVLALKNRTSGSIENSHTWLSSVLTNHVTCWDEV-ESSL  177

Query  579   SIMEPM---IKDLISRAKsslavlvavaPSTEDDLRAL----NGEFPSWVSASDRRLLEA  737
             S   PM   +++LI R ++SL +LV++      +L  L    NG +PSW+   DRRLL  
Sbjct  178   SRAAPMDLGLEELIMRGRNSLGMLVSIWGLDIKNLGELEKKGNG-YPSWLKKGDRRLLGV  236

Query  738   SanavaanvvvaKDGSGKYKTVAEAVASAPDNGKTRYVIYIKKGTYKENVEIGKKKTNVM  917
                 +  N+VVAKDGSG +KTV EAV S PD  K R VIY+K+GTY+ENVE+GKKK NVM
Sbjct  237   LGREMEPNIVVAKDGSGNFKTVKEAVESVPDKSKNRIVIYVKRGTYEENVEVGKKKKNVM  296

Query  918   LIGDGLSATIITGSLNYVDGATTFNSATVAAVGDGFIAQDLRIQNTAGPEKHQAVALRLG  1097
             ++GDG+ +TIITGSLN VDG+TTF SATVAAVGDGFIAQD+  QNTAGPEKHQAVALR+G
Sbjct  297   IVGDGMDSTIITGSLNVVDGSTTFKSATVAAVGDGFIAQDIWFQNTAGPEKHQAVALRVG  356

Query  1098  ADQSVINRCKIDAYQDTLYAHSQRQFYRDCYITGTVDFIFGNAAAVIQNSQVVARKPMAA  1277
             ADQSVINRC+IDAYQDTLY HS RQFYRD  ITGTVDFIFGNAA V+QN ++  R+PM  
Sbjct  357   ADQSVINRCRIDAYQDTLYTHSNRQFYRDSTITGTVDFIFGNAAVVLQNCKIEPRRPMNN  416

Query  1278  QKNMVTAQGRTDPNQNTGTSIQNCNVSPSSDLGPVKGTIQTYLGRPWKEYSRTVFMESNI  1457
             Q NMVTAQGR DPNQNTGTSIQ C++  SSDL PVK +I+TYLGRPWKEYSRTV M+S I
Sbjct  417   QANMVTAQGRIDPNQNTGTSIQQCDIVASSDLEPVKKSIKTYLGRPWKEYSRTVIMQSRI  476

Query  1458  GDHIDPAGWFPWDGDFALKTLYYGEYMNRGPGAGTSKRVNWPGYHVITDKAEAMKFTVAQ  1637
             GD I PAGW  W+GDFALKTLYYGEY N GPG+  SKRV W GYH+IT  +EA KFTV  
Sbjct  477   GDLIQPAGWAEWNGDFALKTLYYGEYSNTGPGSDVSKRVKWDGYHIITSPSEAQKFTVDS  536

Query  1638  LIQGGSWLKNTGVDYTEGL  1694
             LIQGG WL  +G  +  GL
Sbjct  537   LIQGGEWLGPSGATFIPGL  555



>ref|XP_011095338.1| PREDICTED: pectinesterase 2.1-like [Sesamum indicum]
Length=587

 Score =   557 bits (1435),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/555 (55%), Positives = 393/555 (71%), Gaps = 11/555 (2%)
 Frame = +3

Query  45    MATTSHLPLLFTPKRKPSSCRalyvllylaaIVGSVALVSIWALRTSS----SSPSLWKA  212
             MA+T H PLL TP +  S+C+ L+  + ++A+V  V  +    +  S     S+PS    
Sbjct  39    MAST-HQPLLNTPNKTISACKILFFTISISAVVLLVFDLLPIIMGDSRLKGLSTPSY---  94

Query  213   RVCDPAHDPPSCMAIVSEVSSAAPTETDGVAllqmllhssllRIQDAVKLSANVNRRIND  392
              +C  A +P +C   VSEV S   T  D   +LQ  L      +  A+  +  +  ++N 
Sbjct  95    -LCRTALNPQACQDYVSEVVSDGVTPPDATMVLQKFLIKQAHHLNSAIFRAGKLKNKLNG  153

Query  393   RK-VQAAVADCMELLDLSQDKVMDSMVALGNLSARARTDAHSWLSSVLTNHDTCLDGLSE  569
             +   Q A+ADC+EL+DLS + V DS+ ALG  +  +  DA +WLS VL NH TCLDGL+ 
Sbjct  154   QNDKQGAIADCVELIDLSINLVSDSIKALGKKTRTSHADAQAWLSGVLANHITCLDGLNS  213

Query  570   PARSIMEPMIKDLISRAKsslavlvavaPSTEDDLRALNGEFPSWVSASDRRLLEASana  749
               R  +   I+DL+SRA++SLAVL AV+   ++ +++L G  PSW+  +DR+LL+ +ANA
Sbjct  214   SGRKSLGATIEDLVSRARASLAVLAAVSEQDKEMMQSLRGRLPSWIRPADRKLLQKTANA  273

Query  750   vaanvvvaKDGSGKYKTVAEAVASAPDNGKTRYVIYIKKGTYKENVEIGKKKTNVMLIGD  929
             + A++VVAKDGSG +KTVAEAVA+AP N + RYVIY+KKGTYKENVE+G ++ N+M+IGD
Sbjct  274   IEADLVVAKDGSGDFKTVAEAVAAAPSNSERRYVIYVKKGTYKENVEVGSRQRNLMIIGD  333

Query  930   GLSATIITGSLNYVDGATTFNSATVAAVGDGFIAQDLRIQNTAGPEKHQAVALRLGADQS  1109
             G+++TIITG     +  TTF +AT+AAVG GFI QD+ IQNTAGPE  QAVALR+GAD+S
Sbjct  334   GMNSTIITGDRYNSENFTTFRTATLAAVGKGFILQDICIQNTAGPENGQAVALRIGADES  393

Query  1110  VINRCKIDAYQDTLYAHSQRQFYRDCYITGTVDFIFGNAAAVIQNSQVVARKPMAAQKNM  1289
             +INRC +DAYQDTLY HSQRQFYRDCYITGTVDFIFG A AV+Q  ++VAR+P   Q NM
Sbjct  394   IINRCYMDAYQDTLYTHSQRQFYRDCYITGTVDFIFGFAPAVLQKCELVARRPRVGQSNM  453

Query  1290  VTAQGRTDPNQNTGTSIQNCNVSPSSDLGPVKGTIQTYLGRPWKEYSRTVFMESNIGDHI  1469
             VTAQGR+DPN+NTG SIQ C +  S DL PVK + +TYLGRPW+++SRTV M+S IGD I
Sbjct  454   VTAQGRSDPNENTGISIQECEIKASDDLEPVKDSFRTYLGRPWRDFSRTVVMQSCIGDLI  513

Query  1470  DPAGWFPWDGDFALKTLYYGEYMNRGPGAGTSKRVNWPGYHVITDKAEAMKFTVAQLIQG  1649
             DPAGW  W G   +  LYYGEY N GPG+ TS+RVNW GYHVITD AEA KFTV +LIQG
Sbjct  514   DPAGWSEWAGR-PVDKLYYGEYRNLGPGSDTSRRVNWTGYHVITDPAEAEKFTVRELIQG  572

Query  1650  GSWLKNTGVDYTEGL  1694
               WL +T VDY EGL
Sbjct  573   QEWLDSTVVDYIEGL  587



>ref|XP_008439965.1| PREDICTED: pectinesterase [Cucumis melo]
Length=555

 Score =   554 bits (1428),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/558 (54%), Positives = 386/558 (69%), Gaps = 11/558 (2%)
 Frame = +3

Query  45    MATTSHLPLLFTPKRKPSSCRalyvllylaaIVGSVALVSIWALRTSSSSPSL-WKARVC  221
             MAT  H PLL     K S  + +  +L  A ++ S   V+   ++ +     L +   +C
Sbjct  1     MAT--HQPLLHLQPPKTSCSKTISTILCFAVVLCSAIFVTNKFIKLNPYENDLPFLHNIC  58

Query  222   DPAHDPPSCMAIV-SEVSSAAPTETDGVAllqmllhssllRIQDAVKLSANVNRRINDRK  398
               A++P SC+ +  SE   +    T+    LQ  L  S+ ++ + ++ + ++ +RIN  +
Sbjct  59    HKAYNPSSCIEMAASEFPLSIIKTTNEEHFLQSFLKKSMPKVINTIERAKDLRQRINSPR  118

Query  399   VQAAVADCMELLDLSQDKVMDSMVALGNLSARARTDAHSWLSSVLTNHDTCLDGL--SEP  572
              + A+ DC+EL+++S  ++MDS++AL N ++     +H+WLSSVLTNH TC D +  S  
Sbjct  119   GEGALDDCIELMEISNGRIMDSVLALKNRTSGYIESSHTWLSSVLTNHVTCWDEVESSLS  178

Query  573   ARSIMEPMIKDLISRAKsslavlvavaPSTEDDLRAL----NGEFPSWVSASDRRLLEAS  740
               + M+  +++LI R ++SL +LV++      +L  L    NG +PSW+   DRRLL   
Sbjct  179   RAAAMDLGLEELIMRGRNSLGMLVSIWGLEIKNLGELGKRGNG-YPSWLKKGDRRLLGVL  237

Query  741   anavaanvvvaKDGSGKYKTVAEAVASAPDNGKTRYVIYIKKGTYKENVEIGKKKTNVML  920
                +  N+VVAKDGSG +KTV EAV S PD  K R VIY+KKGTYKENVE+GKKK NVM+
Sbjct  238   GREMEPNIVVAKDGSGNFKTVQEAVESVPDKSKNRIVIYVKKGTYKENVEVGKKKKNVMI  297

Query  921   IGDGLSATIITGSLNYVDGATTFNSATVAAVGDGFIAQDLRIQNTAGPEKHQAVALRLGA  1100
             +GDG+ +TIITGSLN VDG+TTF SATVAAVGDGFIAQD+  QNTAGP KHQAVALR+GA
Sbjct  298   VGDGMDSTIITGSLNVVDGSTTFKSATVAAVGDGFIAQDIWFQNTAGPAKHQAVALRVGA  357

Query  1101  DQSVINRCKIDAYQDTLYAHSQRQFYRDCYITGTVDFIFGNAAAVIQNSQVVARKPMAAQ  1280
             DQSVINRC+IDAYQDTLY HS RQFYRD  ITGTVDFIFGNAA V+QN ++  R+PM  Q
Sbjct  358   DQSVINRCRIDAYQDTLYTHSNRQFYRDSTITGTVDFIFGNAAVVLQNCKIEPRRPMNNQ  417

Query  1281  KNMVTAQGRTDPNQNTGTSIQNCNVSPSSDLGPVKGTIQTYLGRPWKEYSRTVFMESNIG  1460
              NMVTAQGR DPNQNTGTSIQ C++  S DL PVK +I+TYLGRPWKEYSRTV M+S IG
Sbjct  418   ANMVTAQGRIDPNQNTGTSIQQCDIVASFDLEPVKKSIKTYLGRPWKEYSRTVVMQSRIG  477

Query  1461  DHIDPAGWFPWDGDFALKTLYYGEYMNRGPGAGTSKRVNWPGYHVITDKAEAMKFTVAQL  1640
             D I PAGW  W GDFALKTLYYGEY N GPG+  SKRV W GYHVIT  +EA KFTV  L
Sbjct  478   DLIQPAGWAEWSGDFALKTLYYGEYSNTGPGSDVSKRVKWAGYHVITSPSEAQKFTVNSL  537

Query  1641  IQGGSWLKNTGVDYTEGL  1694
             IQGG WL  +G  +  GL
Sbjct  538   IQGGEWLGPSGASFIPGL  555



>gb|ACJ02103.1| pectin methylesterase [Oncidium hybrid cultivar]
Length=529

 Score =   553 bits (1424),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/455 (61%), Positives = 342/455 (75%), Gaps = 15/455 (3%)
 Frame = +3

Query  339   RIQDAVKLSANVNRRINDRKVQAAVADCMELLDLSQDKVMDSMVALGNLSARARTDAHSW  518
              I   +  S N++R+IND  +    ADC+ELLDLS+D+++ S  A+   +A +  DA +W
Sbjct  87    EIHATLSQSTNLHRQINDPHI----ADCIELLDLSRDRILSSNAAI---AAGSYADARTW  139

Query  519   LSSVLTNHDTCLDGLSEPARSIMEPMIKDLISRAKsslavlvavaPSTED--DLRALNGE  692
             LS+VLTNH TC DGL++P+     P+   L S    + A L  +   T D  +L  L  E
Sbjct  140   LSAVLTNHVTCRDGLNDPS-----PLKAHLDSLTAQTSAALAVLRAVTVDGGELMELVTE  194

Query  693   FPSWVSASDRRLLEA-SanavaanvvvaKDGSGKYKTVAEAVASAPDNGKTRYVIYIKKG  869
              P WVS +DR+LLEA S  AV A+V V+ +G G YKTV  AV +AP+ G +RYVIY+KKG
Sbjct  195   LPKWVSPADRKLLEATSLAAVTADVTVSANGGGNYKTVQAAVDAAPEKGNSRYVIYVKKG  254

Query  870   TYKENVEIGKKKTNVMLIGDGLSATIITGSLNYVDGATTFNSATVAAVGDGFIAQDLRIQ  1049
             TYKENV +GKKK N+M++GDG S TIITGSLN+VDG TT+NSAT+A++GDGFI QDL ++
Sbjct  255   TYKENVIVGKKKKNLMIVGDGQSNTIITGSLNFVDGTTTYNSATLASMGDGFILQDLCVE  314

Query  1050  NTAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYAHSQRQFYRDCYITGTVDFIFGNAA  1229
             NTAGP+KHQAVALR+ ADQ+V+NRC+I AYQDTLY HS RQFYR+  I+GTVDFIFGNAA
Sbjct  315   NTAGPQKHQAVALRINADQAVVNRCQIRAYQDTLYTHSLRQFYRESLISGTVDFIFGNAA  374

Query  1230  AVIQNSQVVARKPMAAQKNMVTAQGRTDPNQNTGTSIQNCNVSPSSDLGPVKGTIQTYLG  1409
              V Q SQ+ ARKPM+ QKN VTAQGR DPNQNTGTSIQNC + PS+DL PV G+  TYLG
Sbjct  375   VVFQKSQLEARKPMSGQKNAVTAQGRVDPNQNTGTSIQNCKLVPSADLRPVAGSFPTYLG  434

Query  1410  RPWKEYSRTVFMESNIGDHIDPAGWFPWDGDFALKTLYYGEYMNRGPGAGTSKRVNWPGY  1589
             RPWK+YSRTV M+S I  H++P GW  WDGDFALKTL+YGEY N GPGAGT+ RVNW GY
Sbjct  435   RPWKQYSRTVVMQSYIDSHVNPKGWLEWDGDFALKTLFYGEYSNSGPGAGTAGRVNWAGY  494

Query  1590  HVITDKAEAMKFTVAQLIQGGSWLKNTGVDYTEGL  1694
             HVITD   A  FTVA+LIQGG WL+ TGV +TEGL
Sbjct  495   HVITDPNVANDFTVAKLIQGGQWLRATGVAFTEGL  529



>ref|XP_003564371.1| PREDICTED: pectinesterase [Brachypodium distachyon]
Length=549

 Score =   550 bits (1418),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/560 (54%), Positives = 395/560 (71%), Gaps = 24/560 (4%)
 Frame = +3

Query  51    TTSHLPLLFTPKRKPSSCRalyvllylaaIVGSVALVSIWALRTSSSSPSLWKARVCDPA  230
             T S+ PLL +P ++      + ++    ++   + +V+   L  + ++P L     C  +
Sbjct  2     TRSNEPLLSSPSQRDGHPCKVILVTLTLSLATLLCVVAACFLLPNPATPDL-----CRSS  56

Query  231   HDPPSCMAIVSE--VSSAAPTETDGVAllqmllhssllRIQDAVKLSANVNRR-INDRKV  401
              DP +C AIV++  ++S  P  T  V +L+ +L  SL +   A    A ++RR ++DR  
Sbjct  57    PDPATCHAIVADAVLASQTPHPTPPVQVLRAILARSLHQHDAAASALAGMHRRAVSDRSG  116

Query  402   Q-AAVADCMELLDLSQDKVMDSMVALGNLSARARTDAHSWLSSVLTNHDTCLDGLS---E  569
             Q A +ADC+ LL+L++D++ D+ VA      R   DA +WLS+VLT+H TCLDGL    +
Sbjct  117   QRAPLADCILLLELARDRLADAAVA------RHEDDARTWLSAVLTDHVTCLDGLDDDDQ  170

Query  570   PARSIMEPMIKDLISRAKsslavlvavaPSTEDDL----RALNGEFPSWVSASDRRLLEA  737
             P R ++   ++ L S A +SLAVL  V+     D+     A++G FPSWV   DR LLE 
Sbjct  171   PLRDVVGAHLEPLKSLASASLAVLNTVSSDDARDVLQLAEAVDG-FPSWVPTRDRALLEG  229

Query  738   S-anavaanvvvaKDGSGKYKTVAEAVASAPDNGKTRYVIYIKKGTYKENVEIGKKKTNV  914
                 AV A+VVVAKDGSG+YKTV EAV +AP+N   RYVI +KKG YKENVE+G+KK  +
Sbjct  230   GGERAVEADVVVAKDGSGRYKTVKEAVDAAPENKGRRYVIRVKKGVYKENVEVGRKKREL  289

Query  915   MLIGDGLSATIITGSLNYVDGATTFNSATVAAVGDGFIAQDLRIQNTAGPEKHQAVALRL  1094
             M++GDG+ AT+ITGS N VDGATTFNSAT+A  GDG I QDL+I+NTAGPEKHQAVALR+
Sbjct  290   MIVGDGMDATVITGSRNVVDGATTFNSATLAVAGDGIILQDLKIENTAGPEKHQAVALRV  349

Query  1095  GADQSVINRCKIDAYQDTLYAHSQRQFYRDCYITGTVDFIFGNAAAVIQNSQVVARKPMA  1274
              AD++VI+RC++D YQDTLYAH  RQFYR C+++GTVDF+FGNAAAV+Q+  + AR+PM 
Sbjct  350   SADRAVISRCRVDGYQDTLYAHQLRQFYRGCFVSGTVDFVFGNAAAVLQDCTLAARRPMR  409

Query  1275  AQKNMVTAQGRTDPNQNTGTSIQNCNVSPSSDLGPVKGTIQTYLGRPWKEYSRTVFMESN  1454
             AQKN VTAQGR DPNQNTGTS+Q C V P  DL PV     T+LGRPWK YSRTV+M+S 
Sbjct  410   AQKNAVTAQGREDPNQNTGTSLQRCRVVPGRDLAPVAQAFPTFLGRPWKAYSRTVYMQSF  469

Query  1455  IGDHIDPAGWFPWDGDFALKTLYYGEYMNRGPGAGTSKRVNWPGYHVITDKAEAMKFTVA  1634
             +G H+DP GW  WDG+FAL+TL+YGEY N GPGAGT+ RV WPGYHVITD+A A++FTV 
Sbjct  470   LGPHVDPKGWLEWDGEFALRTLFYGEYQNEGPGAGTAGRVRWPGYHVITDRAVALQFTVG  529

Query  1635  QLIQGGSWLKNTGVDYTEGL  1694
             + IQGG WLK+TGVDY EGL
Sbjct  530   KFIQGGRWLKDTGVDYDEGL  549



>emb|CAA96434.1| pectin methylesterase [Nicotiana plumbaginifolia]
Length=315

 Score =   540 bits (1391),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 252/307 (82%), Positives = 275/307 (90%), Gaps = 1/307 (0%)
 Frame = +3

Query  774   KDGSGKYKTVAEAVASAPDNGKTRYVIYIKKGTYKENVEIGKKKTNVMLIGDGLSATIIT  953
             KDGSGKYKTV EAVAS PDN  +RYVIY+KKG YKENVEIGKKK NVML+GDG+ ATIIT
Sbjct  10    KDGSGKYKTVKEAVASVPDNSNSRYVIYVKKGIYKENVEIGKKKKNVMLVGDGMDATIIT  69

Query  954   GSLNYVDGATTFNSATVAAVGDGFIAQDLRIQNTAGPEKHQAVALRLGADQSVINRCKID  1133
             G+LN VDGATTFNSATVAAVGDGFIAQD++ QNTAG  KHQAVALR+GADQSVINRCKID
Sbjct  70    GNLNVVDGATTFNSATVAAVGDGFIAQDVQFQNTAGAAKHQAVALRVGADQSVINRCKID  129

Query  1134  AYQDTLYAHSQRQFYRDCYITGTVDFIFGNAAAVIQNSQVVARKPMAAQKNMVTAQGRTD  1313
             A+QDTLY HS RQFYRDCYITGTVDFIFGNAA V QNS++ ARKP + QKNMVTAQGR D
Sbjct  130   AFQDTLYTHSLRQFYRDCYITGTVDFIFGNAAVVFQNSKIAARKPGSGQKNMVTAQGRED  189

Query  1314  PNQNTGTSIQNCNVSPSSDLGPVKGTIQTYLGRPWKEYSRTVFMESNIGDHIDPAGWFPW  1493
             PNQNTGTSIQNC++ PSSDL PVKG+++TYLGRPWK YSRTVFM+SNIGDHIDP GW  W
Sbjct  190   PNQNTGTSIQNCDIIPSSDLAPVKGSVKTYLGRPWKAYSRTVFMQSNIGDHIDPEGWSVW  249

Query  1494  DGDFALKTLYYGEYMNRGPGAGTSKRVNWPGYHVITDKAEAMKFTVAQLIQGGSWLKNTG  1673
             DGDFALKTLYYGEYMN+GPGAGTSKRV WPGYH+++  AEA KFTV QLIQGG WLK+TG
Sbjct  250   DGDFALKTLYYGEYMNKGPGAGTSKRVKWPGYHILS-AAEATKFTVGQLIQGGVWLKSTG  308

Query  1674  VDYTEGL  1694
             V YTEGL
Sbjct  309   VAYTEGL  315



>gb|ERN05249.1| hypothetical protein AMTR_s00007p00101250 [Amborella trichopoda]
Length=553

 Score =   548 bits (1413),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/442 (60%), Positives = 332/442 (75%), Gaps = 15/442 (3%)
 Frame = +3

Query  414   ADCMELLDLSQDKVMDSMVALGNLSARARTDAHSWLSSVLTNHDTCLDGLSEPARSIMEP  593
             ADC ELLD ++D+++++  AL   S  +  +AH+WLS+ LTN+ TC DGL+E    +   
Sbjct  112   ADCTELLDQARDRLLETRAALRTPSPLSLAEAHTWLSATLTNYITCEDGLNEGKTKLEAK  171

Query  594   MIKDLI----------SRAKsslavlvavaPSTEDD-----LRALNGEFPSWVSASDRRL  728
               K ++          S + ++++ +     STE       +   +   P+WV   + RL
Sbjct  172   ATKAMVVALGECKAMASTSLATISAMRNALGSTEASGYEPMIEVGSTRLPAWVRDIETRL  231

Query  729   LEASanavaanvvvaKDGSGKYKTVAEAVASAPDNGKTRYVIYIKKGTYKENVEIGKKKT  908
             LE+  + + A+VVVAKDGSG YKTV+EAVA+APD  K RYVIY+KKGTY+E VEIGK K 
Sbjct  232   LESKVSEIKADVVVAKDGSGNYKTVSEAVAAAPDKSKKRYVIYVKKGTYEEKVEIGKNKK  291

Query  909   NVMLIGDGLSATIITGSLNYVDGATTFNSATVAAVGDGFIAQDLRIQNTAGPEKHQAVAL  1088
             N+ML+GDG+  T+ITGSLN++DG TTFNSAT+A VG+GFIAQD+  QNTAGP+KHQAVAL
Sbjct  292   NLMLVGDGMDFTVITGSLNFIDGTTTFNSATLAVVGEGFIAQDMCFQNTAGPKKHQAVAL  351

Query  1089  RLGADQSVINRCKIDAYQDTLYAHSQRQFYRDCYITGTVDFIFGNAAAVIQNSQVVARKP  1268
             R+GAD+S+INRC+I+ YQDTLYAHSQRQFYRD  I+GT+DFIFGNAA V+QN  ++ARKP
Sbjct  352   RVGADKSIINRCRIEGYQDTLYAHSQRQFYRDSVISGTIDFIFGNAAVVLQNCTIIARKP  411

Query  1269  MAAQKNMVTAQGRTDPNQNTGTSIQNCNVSPSSDLGPVKGTIQTYLGRPWKEYSRTVFME  1448
             M+ Q+N+VTAQGRTDPNQNTGT+IQ   +  S+DL PVK  + TYLGRPWKEYSRTV+M+
Sbjct  412   MSNQQNLVTAQGRTDPNQNTGTTIQFSRIQASTDLEPVKNILPTYLGRPWKEYSRTVYMQ  471

Query  1449  SNIGDHIDPAGWFPWDGDFALKTLYYGEYMNRGPGAGTSKRVNWPGYHVITDKAEAMKFT  1628
             +NIGDHI   GW PW G FALKTLYY EYMN GPGAGTS RV WPGYHVITD  EA KFT
Sbjct  472   NNIGDHIAAEGWLPWSGGFALKTLYYAEYMNGGPGAGTSGRVKWPGYHVITDANEAKKFT  531

Query  1629  VAQLIQGGSWLKNTGVDYTEGL  1694
             V + IQGG WL+ TGV YTEGL
Sbjct  532   VGEFIQGGEWLQATGVAYTEGL  553



>emb|CAA96435.1| pectin methylesterase [Nicotiana plumbaginifolia]
Length=315

 Score =   537 bits (1384),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 250/306 (82%), Positives = 274/306 (90%), Gaps = 1/306 (0%)
 Frame = +3

Query  777   DGSGKYKTVAEAVASAPDNGKTRYVIYIKKGTYKENVEIGKKKTNVMLIGDGLSATIITG  956
             DGSGKYKT+ EAVAS PDN  +RYVIY+KKG YKENVEIGKKK NVML+GDG+ ATIITG
Sbjct  11    DGSGKYKTIKEAVASVPDNSNSRYVIYVKKGIYKENVEIGKKKKNVMLVGDGMDATIITG  70

Query  957   SLNYVDGATTFNSATVAAVGDGFIAQDLRIQNTAGPEKHQAVALRLGADQSVINRCKIDA  1136
             +LN VDGATTFNSATVAAVGDGFIAQD++ QNTAG  KHQAVALR+GADQSVINRCKIDA
Sbjct  71    NLNVVDGATTFNSATVAAVGDGFIAQDVQFQNTAGAAKHQAVALRVGADQSVINRCKIDA  130

Query  1137  YQDTLYAHSQRQFYRDCYITGTVDFIFGNAAAVIQNSQVVARKPMAAQKNMVTAQGRTDP  1316
             +QDTLY HS RQFYRDCYITGTVDFIFGNAA V QNS++ ARKP + QKNMVTAQGR DP
Sbjct  131   FQDTLYTHSLRQFYRDCYITGTVDFIFGNAAVVFQNSKIAARKPGSGQKNMVTAQGREDP  190

Query  1317  NQNTGTSIQNCNVSPSSDLGPVKGTIQTYLGRPWKEYSRTVFMESNIGDHIDPAGWFPWD  1496
             NQNTGTSIQNC++ PSSDL PVKG+++TYLGRPWK YSRTVFM+SNIGDHIDP GW  WD
Sbjct  191   NQNTGTSIQNCDIIPSSDLAPVKGSVKTYLGRPWKAYSRTVFMQSNIGDHIDPEGWSVWD  250

Query  1497  GDFALKTLYYGEYMNRGPGAGTSKRVNWPGYHVITDKAEAMKFTVAQLIQGGSWLKNTGV  1676
             GDFALKTLYYGEYMN+GPGAGTSKRV WPGYH+++  AEA KFTV QLIQGG WLK+TGV
Sbjct  251   GDFALKTLYYGEYMNKGPGAGTSKRVKWPGYHILS-AAEATKFTVGQLIQGGVWLKSTGV  309

Query  1677  DYTEGL  1694
              YTEGL
Sbjct  310   AYTEGL  315



>gb|ABK94644.1| unknown [Populus trichocarpa]
Length=327

 Score =   536 bits (1382),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 259/326 (79%), Positives = 287/326 (88%), Gaps = 0/326 (0%)
 Frame = +3

Query  717   DRRLLEASanavaanvvvaKDGSGKYKTVAEAVASAPDNGKTRYVIYIKKGTYKENVEIG  896
             DR+LL A    + A+V VAKDGSGKYKTV EAVASAPDNGKTRYVIY+KKGTYKENVE+G
Sbjct  2     DRKLLVALPKDINADVTVAKDGSGKYKTVKEAVASAPDNGKTRYVIYVKKGTYKENVEVG  61

Query  897   KKKTNVMLIGDGLSATIITGSLNYVDGATTFNSATVAAVGDGFIAQDLRIQNTAGPEKHQ  1076
             KKK NVML+GDG+ +TIITGSLN VDG+TTFNSATVAAVGDGFIAQD+  QNTAGPEKHQ
Sbjct  62    KKKKNVMLVGDGMDSTIITGSLNVVDGSTTFNSATVAAVGDGFIAQDIWFQNTAGPEKHQ  121

Query  1077  AVALRLGADQSVINRCKIDAYQDTLYAHSQRQFYRDCYITGTVDFIFGNAAAVIQNSQVV  1256
             AVALR+GADQSVINR +IDAYQDTLY HS RQFYRD YITGTVDFIFGNAA V+QN ++V
Sbjct  122   AVALRVGADQSVINRSRIDAYQDTLYTHSLRQFYRDSYITGTVDFIFGNAAVVLQNCKLV  181

Query  1257  ARKPMAAQKNMVTAQGRTDPNQNTGTSIQNCNVSPSSDLGPVKGTIQTYLGRPWKEYSRT  1436
              RKPM+ QKNMVTAQGRTDPNQNTGTSIQ C++  SSDL PVK + +++LGRPWKEYSRT
Sbjct  182   PRKPMSGQKNMVTAQGRTDPNQNTGTSIQKCDIIASSDLTPVKSSFKSFLGRPWKEYSRT  241

Query  1437  VFMESNIGDHIDPAGWFPWDGDFALKTLYYGEYMNRGPGAGTSKRVNWPGYHVITDKAEA  1616
             V M+SNIGD IDPAGW  WDG+FALKTLYYGEY+N+G GAGTSKRVNW GYHVIT   EA
Sbjct  242   VVMQSNIGDLIDPAGWSAWDGEFALKTLYYGEYLNQGAGAGTSKRVNWAGYHVITSANEA  301

Query  1617  MKFTVAQLIQGGSWLKNTGVDYTEGL  1694
              KFTVA+LIQGG WLK+TGV YTEGL
Sbjct  302   KKFTVAELIQGGVWLKSTGVSYTEGL  327



>gb|ABK24761.1| unknown [Picea sitchensis]
Length=557

 Score =   539 bits (1388),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/468 (58%), Positives = 343/468 (73%), Gaps = 21/468 (4%)
 Frame = +3

Query  342   IQDAVKLSANVNRRINDRKVQAAVADCMELLDLSQDKVMDSMVAL---GNLSARAR---T  503
             +++A K  A V R +   K  +A+ DCMEL+D+++D+ +DS +AL    +L A  R   +
Sbjct  92    LEEANKAFALVLRFV---KQTSALQDCMELMDITRDQ-LDSSIALLKRHDLKALMREQAS  147

Query  504   DAHSWLSSVLTNHDTCLDGLSEPARSIMEPMIKD-------LISRAKsslavlvavaPST  662
             D  +WLS+ +TN DTCLDG+S+ ++SI   ++++       LIS + +         P  
Sbjct  148   DLQTWLSASITNQDTCLDGISDYSKSIARALVENSVQNVRKLISNSLAIAKAAYESRPYP  207

Query  663   EDDLR----ALNGEFPSWVSASDRRLLEASanavaanvvvaKDGSGKYKTVAEAVASAPD  830
                LR    ++  +FPSW+S  DRRLL  SAN V  NV+VA+DGSG +KT+ +A+A+AP+
Sbjct  208   SPALRLPSDSIKDDFPSWLSPGDRRLLRTSANDVVPNVIVAQDGSGNFKTITQAIAAAPE  267

Query  831   NGKTRYVIYIKKGTYKENVEIGKKKTNVMLIGDGLSATIITGSLNYVDGATTFNSATVAA  1010
                 RYVI +KKGTYKENV++GK KTN+MLIG+G+ ATI+TGS N +DG+TTFNSAT AA
Sbjct  268   KSPKRYVIKVKKGTYKENVQVGKTKTNIMLIGEGMEATIVTGSRNVIDGSTTFNSATFAA  327

Query  1011  VGDGFIAQDLRIQNTAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYAHSQRQFYRDCY  1190
             VG+GF+AQD+   NTAGP+KHQAVALR+G+DQSV+ RCKI AYQDTLYAHS RQFYR+C 
Sbjct  328   VGNGFMAQDMAFVNTAGPQKHQAVALRVGSDQSVLYRCKIAAYQDTLYAHSLRQFYRECK  387

Query  1191  ITGTVDFIFGNAAAVIQNSQVVARKPMAAQKNMVTAQGRTDPNQNTGTSIQNCNVSPSSD  1370
             I+GTVDFIFGNAA V Q+  +V RKP A QKN +TAQGRTDPNQNTG SI NC ++P +D
Sbjct  388   ISGTVDFIFGNAAVVFQSCILVPRKPGANQKNAITAQGRTDPNQNTGISIHNCKITPGTD  447

Query  1371  LGPVKGTIQTYLGRPWKEYSRTVFMESNIGDHIDPAGWFPWDGDFALKTLYYGEYMNRGP  1550
             L PVK +  TYLGRPWKEYSRTVFM+S I   I PAGW  WDGDFALKTLYYGEYMN GP
Sbjct  448   LVPVKSSFPTYLGRPWKEYSRTVFMQSYIDGFIQPAGWLEWDGDFALKTLYYGEYMNTGP  507

Query  1551  GAGTSKRVNWPGYHVITDKAEAMKFTVAQLIQGGSWLKNTGVDYTEGL  1694
             G+GT  RV WPGY VI    EA KFTV + IQG SWL++TGV Y +GL
Sbjct  508   GSGTGNRVKWPGYRVIKSPQEASKFTVGEFIQGDSWLQSTGVHYVDGL  555



>gb|EAY76103.1| hypothetical protein OsI_04029 [Oryza sativa Indica Group]
Length=546

 Score =   538 bits (1386),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/497 (57%), Positives = 361/497 (73%), Gaps = 6/497 (1%)
 Frame = +3

Query  216   VCDPAHDPPSCMAIVSEVSSAAPTE--TDGVAllqmllhssllRIQDAVKLSANVNRRIN  389
             +C  + DP SC AIV++   A+P    +    +L+ +L +SL R   A +  A + RR +
Sbjct  52    LCASSPDPASCQAIVADAVLASPHAHPSRPAHVLRAILATSLDRHDAAAEAVAGMRRRAS  111

Query  390   DRKVQAAVADCMELLDLSQDKVMDSMVALGNLSARARTDAHSWLSSVLTNHDTCLDGLSE  569
             D + +AA+ DC++L+ L++D++ D+  A          D  +WLS+VLT+H TCLDGL +
Sbjct  112   DPRHRAALEDCVQLMGLARDRLADA--AGAPDVDVDVDDVRTWLSAVLTDHVTCLDGLDD  169

Query  570   -PARSIMEPMIKDLISRAKsslavlvavaPSTEDDLRALNGEFPSWVSASDRRLLEASan  746
              P R  +   ++ L S A +SLAVL A      D L      FPSW++A DR LL+A A 
Sbjct  170   GPLRDSVGAHLEPLKSLASASLAVLSAAGRGARDVLAEAVDRFPSWLTARDRTLLDAGAG  229

Query  747   avaanvvvaKDGSGKYKTVAEAVASAPDNGKTRYVIYIKKGTYKENVEIGKKKTNVMLIG  926
             AV A+VVVAKDGSGKY T+ EAV +APD GK+RYVIY+KKG YKEN+E+GK K  +M++G
Sbjct  230   AVQADVVVAKDGSGKYTTIKEAVDAAPDGGKSRYVIYVKKGVYKENLEVGKTKRVLMIVG  289

Query  927   DGLSATIITGSLNYVDGATTFNSATVAAVGDGFIAQDLRIQNTAGPEKHQAVALRLGADQ  1106
             DG+  T+ITGS N VDG+TTFNSAT+A  GDG I QDL+++NTAG EK QAVALR+ AD+
Sbjct  290   DGMDQTVITGSRNVVDGSTTFNSATLALSGDGIILQDLKVENTAGAEKQQAVALRVSADR  349

Query  1107  SVINRCKIDAYQDTLYAHSQRQFYRDCYITGTVDFIFGNAAAVIQNSQVVARKPMAAQKN  1286
             +VINRC++D YQDTLYAH  RQFYRDC ++GTVDF+FGNAAAV+Q   + AR+P  AQKN
Sbjct  350   AVINRCRLDGYQDTLYAHQLRQFYRDCAVSGTVDFVFGNAAAVLQGCVLTARRPAQAQKN  409

Query  1287  MVTAQGRTDPNQNTGTSIQNCNVSPSSDLGPVKGTIQTYLGRPWKEYSRTVFMESNIGDH  1466
              VTAQGRTDPNQNTGTSI  C V P+ DL P      T+LGRPWKEYSRTV+M S +  H
Sbjct  410   AVTAQGRTDPNQNTGTSIHRCRVVPAPDLAPAAKQFPTFLGRPWKEYSRTVYMLSYLDSH  469

Query  1467  IDPAGWFPWDG-DFALKTLYYGEYMNRGPGAGTSKRVNWPGYHVITDKAEAMKFTVAQLI  1643
             +DP GW  W+G DFALKTL+YGEY N+GPGAGT+ RVNWPGYHVITD++ AM+FTV Q I
Sbjct  470   VDPRGWLEWNGADFALKTLFYGEYQNQGPGAGTAGRVNWPGYHVITDQSVAMQFTVGQFI  529

Query  1644  QGGSWLKNTGVDYTEGL  1694
             QGG+WLK TGV+Y EGL
Sbjct  530   QGGNWLKATGVNYNEGL  546



>ref|NP_001044480.1| Os01g0788400 [Oryza sativa Japonica Group]
 dbj|BAD53265.1| putative pectin esterase [Oryza sativa Japonica Group]
 dbj|BAF06394.1| Os01g0788400 [Oryza sativa Japonica Group]
 dbj|BAH00252.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE55512.1| hypothetical protein OsJ_03720 [Oryza sativa Japonica Group]
Length=546

 Score =   538 bits (1385),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/497 (57%), Positives = 361/497 (73%), Gaps = 6/497 (1%)
 Frame = +3

Query  216   VCDPAHDPPSCMAIVSEVSSAAPTE--TDGVAllqmllhssllRIQDAVKLSANVNRRIN  389
             +C  + DP SC AIV++   A+P    +    +L+ +L +SL R   A +  A + RR +
Sbjct  52    LCASSPDPASCQAIVADAVLASPHSHPSRPAHVLRAILATSLDRHDAAAEAVAGMRRRAS  111

Query  390   DRKVQAAVADCMELLDLSQDKVMDSMVALGNLSARARTDAHSWLSSVLTNHDTCLDGLSE  569
             D + +AA+ DC++L+ L++D++ D+  A          DA +WLS+VLT+H TCLDGL +
Sbjct  112   DPRHRAALEDCVQLMGLARDRLADA--AGAPDVDVDVDDARTWLSAVLTDHVTCLDGLDD  169

Query  570   -PARSIMEPMIKDLISRAKsslavlvavaPSTEDDLRALNGEFPSWVSASDRRLLEASan  746
              P R  +   ++ L S A +SLAVL A      D L      FPSW++A DR LL+A A 
Sbjct  170   GPLRDSVGAHLEPLKSLASASLAVLSAAGRGARDVLAEAVDRFPSWLTARDRTLLDAGAG  229

Query  747   avaanvvvaKDGSGKYKTVAEAVASAPDNGKTRYVIYIKKGTYKENVEIGKKKTNVMLIG  926
             AV A+VVVAKDGSGKY T+ EAV +APD GK+RYVIY+KKG YKEN+E+GK K  +M++G
Sbjct  230   AVQADVVVAKDGSGKYTTIKEAVDAAPDGGKSRYVIYVKKGVYKENLEVGKTKRVLMIVG  289

Query  927   DGLSATIITGSLNYVDGATTFNSATVAAVGDGFIAQDLRIQNTAGPEKHQAVALRLGADQ  1106
             DG+  T+ITGS N VDG+TTFNSAT+A  GDG I QDL+++NTAG EK QAVALR+ AD+
Sbjct  290   DGMDQTVITGSRNVVDGSTTFNSATLALSGDGIILQDLKVENTAGAEKQQAVALRVSADR  349

Query  1107  SVINRCKIDAYQDTLYAHSQRQFYRDCYITGTVDFIFGNAAAVIQNSQVVARKPMAAQKN  1286
             +VINRC++D YQDTLYAH  RQFYRDC ++GTVDF+FGNAAAV+Q   + AR+P  AQKN
Sbjct  350   AVINRCRLDGYQDTLYAHQLRQFYRDCAVSGTVDFVFGNAAAVLQGCVLTARRPAQAQKN  409

Query  1287  MVTAQGRTDPNQNTGTSIQNCNVSPSSDLGPVKGTIQTYLGRPWKEYSRTVFMESNIGDH  1466
              VTAQGRTDPNQNTGTSI  C V P+ DL P      T+LGRPWKEYSRTV+M S +  H
Sbjct  410   AVTAQGRTDPNQNTGTSIHRCRVVPAPDLAPAAKQFPTFLGRPWKEYSRTVYMLSYLDSH  469

Query  1467  IDPAGWFPWDG-DFALKTLYYGEYMNRGPGAGTSKRVNWPGYHVITDKAEAMKFTVAQLI  1643
             +DP GW  W+G DFALKTL+YGEY N+GPGA T+ RVNWPGYHVITD++ AM+FTV Q I
Sbjct  470   VDPRGWLEWNGADFALKTLFYGEYQNQGPGASTAGRVNWPGYHVITDQSVAMQFTVGQFI  529

Query  1644  QGGSWLKNTGVDYTEGL  1694
             QGG+WLK TGV+Y EGL
Sbjct  530   QGGNWLKATGVNYNEGL  546



>pir||S00629 pectinesterase (EC 3.1.1.11) precursor (clone PE1) - tomato
 emb|CAA30746.1| unnamed protein product [Solanum lycopersicum]
Length=389

 Score =   522 bits (1345),  Expect = 5e-178, Method: Compositional matrix adjust.
 Identities = 259/375 (69%), Positives = 309/375 (82%), Gaps = 0/375 (0%)
 Frame = +3

Query  597   IKDLISRAKsslavlvavaPSTEDDLRALNGEFPSWVSASDRRLLEASanavaanvvvaK  776
             + +LISRAK +LA+L +V    ++ LR   G+ PSWVS+ DR+L+E+S   + AN VVAK
Sbjct  7     LDELISRAKVALAMLASVTTPNDEVLRPGLGKMPSWVSSRDRKLMESSGKDIGANAVVAK  66

Query  777   DGSGKYKTVAEAVASAPDNGKTRYVIYIKKGTYKENVEIGKKKTNVMLIGDGLSATIITG  956
             DG+GKY+T+AEAVA+APD  KTRYVIY+K+GTYKENVE+  +K N+M+IGDG+ ATIITG
Sbjct  67    DGTGKYRTLAEAVAAAPDKSKTRYVIYVKRGTYKENVEVSSRKMNLMIIGDGMYATIITG  126

Query  957   SLNYVDGATTFNSATVAAVGDGFIAQDLRIQNTAGPEKHQAVALRLGADQSVINRCKIDA  1136
             SLN VDG+TTF+SAT+AAVG GFI QD+ IQNTAGP KHQAVALR+GAD+SVINRC+IDA
Sbjct  127   SLNVVDGSTTFHSATLAAVGKGFILQDICIQNTAGPAKHQAVALRVGADKSVINRCRIDA  186

Query  1137  YQDTLYAHSQRQFYRDCYITGTVDFIFGNAAAVIQNSQVVARKPMAAQKNMVTAQGRTDP  1316
             YQDTLYAHSQRQFY+  Y+TGT+DFIFGNAA V Q  Q+VARKP   Q+NMVTAQGRTDP
Sbjct  187   YQDTLYAHSQRQFYQSSYVTGTIDFIFGNAAVVFQKCQLVARKPGKYQQNMVTAQGRTDP  246

Query  1317  NQNTGTSIQNCNVSPSSDLGPVKGTIQTYLGRPWKEYSRTVFMESNIGDHIDPAGWFPWD  1496
             NQ TGTSIQ C++  S DL PV     TYLGRPWK+YSRTV MES++G  IDP+GW  W 
Sbjct  247   NQATGTSIQFCDIIASPDLKPVVKEFPTYLGRPWKKYSRTVVMESSLGGLIDPSGWAEWH  306

Query  1497  GDFALKTLYYGEYMNRGPGAGTSKRVNWPGYHVITDKAEAMKFTVAQLIQGGSWLKNTGV  1676
             GDFALKTLYYGE+MN GPGAGTSKRV WPGYHVITD AEAM FTVA+LIQGGSWL++T V
Sbjct  307   GDFALKTLYYGEFMNNGPGAGTSKRVKWPGYHVITDPAEAMSFTVAKLIQGGSWLRSTDV  366

Query  1677  DYTEGL*K*NKIRLV  1721
              Y +GL   + I+L+
Sbjct  367   AYVDGLYDYSDIKLL  381



>ref|XP_006646399.1| PREDICTED: LOW QUALITY PROTEIN: pectinesterase 2.2-like [Oryza 
brachyantha]
Length=523

 Score =   521 bits (1341),  Expect = 2e-175, Method: Compositional matrix adjust.
 Identities = 284/501 (57%), Positives = 349/501 (70%), Gaps = 31/501 (6%)
 Frame = +3

Query  216   VCDPAHDPPSCMAIVSEV----SSAAPTETDGVAllqmllhssllRIQDAVKLSANVNRR  383
             +C  + DP SC  IV++     S  A   +    +L+ ++ +SL R   A +  A + RR
Sbjct  46    LCANSPDPASCQTIVADAVLASSPHAHRPSRPAQILRAIIATSLDRHDAAAEAVAGMRRR  105

Query  384   INDRKVQAAVADCMELLDLSQDKVMDSMVALGNLSARARTDAHSWLSSVLTNHDTCLDGL  563
              +D + +AA+ DC++L+D                      DA +WLS+VLT+H TCLDGL
Sbjct  106   ASDPRQRAALEDCVQLMD----------------------DARTWLSAVLTDHVTCLDGL  143

Query  564   SE--PARSIMEPMIKDLISRAKsslavlvavaPSTEDDLRALNGEFPSWVSASDRRLLEA  737
                 P R  +   ++ L S A +SLAVL AV     D L  +   FPSWV A DR LLEA
Sbjct  144   DADGPLRDSVGAHLEPLKSLASASLAVLNAVG-GARDVLAEVVDRFPSWVPARDRALLEA  202

Query  738   SanavaanvvvaKDGSGKYKTVAEAVASAPDNGKTRYVIYIKKGTYKENVEIGKKKTNVM  917
              A AV A+VVVA+DGSGKYKT+ EAV +APD GK+RYVIY+KKG YKEN+E+GKKK  VM
Sbjct  203   GAGAVQADVVVAQDGSGKYKTIKEAVDAAPDGGKSRYVIYVKKGVYKENLEVGKKKREVM  262

Query  918   LIGDGLSATIITGSLNYVDGATTFNSATVAAVGDGFIAQDLRIQNTAGPEKHQAVALRLG  1097
             ++GDG+  T+ITGS N VDGATTFNSAT+A  GDG I QDLR++NTAGPEKHQA ALR  
Sbjct  263   IVGDGMDQTVITGSRNVVDGATTFNSATLALSGDGIILQDLRVENTAGPEKHQAGALRAS  322

Query  1098  ADQSVINRCKIDAYQDTLYAHSQRQFYRDCYITGTVDFIFGNAAAVIQNSQVVARKPMAA  1277
             AD++VINRC +D YQDTLYAH  RQFYRDC ++GTVDF+FGNAAAV+Q   + AR+P AA
Sbjct  323   ADRAVINRCSLDGYQDTLYAHQLRQFYRDCAVSGTVDFVFGNAAAVLQGCVLTARRPAAA  382

Query  1278  QKNMVTAQGRTDPNQNTGTSIQNCNVSPSSDLGPVKGTIQTYLGRPWKEYSRTVFMESNI  1457
             QKN VTAQGRTDPNQNTGTS+  C V P+ DL PV     T+LGRPWKEYSRTV+M S +
Sbjct  383   QKNAVTAQGRTDPNQNTGTSVHRCRVVPAPDLAPVAKQFPTFLGRPWKEYSRTVYMLSYL  442

Query  1458  GDHIDPAGWFPWDGDFALKTLYYGEYMNRGPGAGTSKRVNWPGYHVIT--DKAEAMKFTV  1631
               H+DPAGW  W+GDFALKTL+YGEY N+GPGAGT+ RV WPG   IT  D++ AM+FTV
Sbjct  443   DAHVDPAGWLAWNGDFALKTLFYGEYQNQGPGAGTAARVGWPGDRGITTGDRSVAMQFTV  502

Query  1632  AQLIQGGSWLKNTGVDYTEGL  1694
              Q IQGG WL  TGV Y +GL
Sbjct  503   GQFIQGGDWLNATGVTYNDGL  523



>emb|CAA64217.1| pectinmethylesterase [Vigna radiata var. radiata]
Length=320

 Score =   509 bits (1312),  Expect = 5e-174, Method: Compositional matrix adjust.
 Identities = 240/310 (77%), Positives = 267/310 (86%), Gaps = 4/310 (1%)
 Frame = +3

Query  774   KDGSGKYKTVAEAVASAPDNGKTRYVIYIKKGTYKENVEIGKKKTNVMLIGDGLSATIIT  953
             +DGSGK+KTV EAVASAPDNGKTRYVIY+KKGTYKE+VEIGKKK N+ML+GDG+ ATIIT
Sbjct  12    QDGSGKFKTVTEAVASAPDNGKTRYVIYVKKGTYKEHVEIGKKKKNIMLVGDGMDATIIT  71

Query  954   GSLNYVDGATTFNSATVAAVGDGFIAQDLRIQNTAGPEKHQAVALRLGADQSVINRCKID  1133
             GSLN++DG TTFNSATVAAVGDGFI QD+  QNTAG  KHQAVALR+GADQSVINRC+ID
Sbjct  72    GSLNFIDGTTTFNSATVAAVGDGFIGQDIWFQNTAGAAKHQAVALRVGADQSVINRCRID  131

Query  1134  AYQDTLYAHSQRQFYRDCYITGTVDFIFGNAAAVIQNSQVVARKPMAAQKNMVTAQGRTD  1313
             A+QDTLYAHS RQFYRD  ITGT+DFIFGNAA V Q   +VARKPM+ QKNMVTAQGR D
Sbjct  132   AFQDTLYAHSNRQFYRDSVITGTIDFIFGNAAVVFQKCNLVARKPMSNQKNMVTAQGRED  191

Query  1314  PNQNTGTSIQNCNVSPSSDLGPVKGTIQTYLGRPWKEYSRTVFMESNIGDHIDPAGWFPW  1493
             PNQNTGTSIQ CN++PSSDL  V G+I+TYLGRPWK+YSRTV M+S+I  HIDP GW  W
Sbjct  192   PNQNTGTSIQQCNLTPSSDLKAVVGSIKTYLGRPWKKYSRTVIMQSSIDSHIDPTGWAEW  251

Query  1494  DG---DFALKTLYYGEYMNRGPGAGTSKRVNWPGYHVITDKAEAMKFTVAQLIQGGSWLK  1664
             D    DF L+TLYYGEYMN G GAGTSKRVNWPGYH+IT  AEA KFTV QLIQG  WLK
Sbjct  252   DAQSKDF-LQTLYYGEYMNSGAGAGTSKRVNWPGYHIITSAAEASKFTVTQLIQGNVWLK  310

Query  1665  NTGVDYTEGL  1694
             NTGV++ EGL
Sbjct  311   NTGVNFIEGL  320



>dbj|BAK05307.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=548

 Score =   514 bits (1325),  Expect = 1e-172, Method: Compositional matrix adjust.
 Identities = 266/502 (53%), Positives = 347/502 (69%), Gaps = 14/502 (3%)
 Frame = +3

Query  216   VCDPAHDPPSCMAIVSEVSSAAPTETDGVAllqmllhssllRIQDAVKLSAN--VNRRIN  389
             +C  + DP SC AIV++    +P          +         Q      A   ++RR +
Sbjct  52    LCTNSPDPASCHAIVADAVLTSPGAHPSRPSQVLRAIIDRSLYQHDAAAVAVADMHRRAS  111

Query  390   DRKVQAAVADCMELLDLSQDKVMDSMVALGNLSARARTDAHSWLSSVLTNHDTCLDGL-S  566
             D + +AA+ADC++L++L++++    +    + +  A  DA +WLS+ LT+H TCLDGL  
Sbjct  112   DPRQRAALADCVQLMELARER----LAGAADRAKVAPEDARTWLSAALTDHVTCLDGLDG  167

Query  567   EPAR----SIMEPMIKDLISRAKsslavlvavaPSTEDDLRALNG-EFPSWVSASDRRLL  731
              P R    + +EP+ + L S + + L  + +   +  D  R +   E PSW+  +DR LL
Sbjct  168   GPLRDAVGAHLEPL-ESLASASLAVLNAVGSGTAAAADIARDVAADELPSWLPTADRALL  226

Query  732   E-ASanavaanvvvaKDGSGKYKTVAEAVASAPDNGKTRYVIYIKKGTYKENVEIGKKKT  908
             E   A AV  +VVVAKDGSGKY TV  AV +APD GK+RYVIY+KKG YKEN+E+GKKK 
Sbjct  227   ELEGARAVQPDVVVAKDGSGKYTTVQAAVDAAPDGGKSRYVIYVKKGVYKENLEVGKKKR  286

Query  909   NVMLIGDGLSATIITGSLNYVDGATTFNSATVAAVGDGFIAQDLRIQNTAGPEKHQAVAL  1088
              +M++ DG+ AT+ITGS N VDGATTFNSAT+A   DG I QDLRI+NTAGPEKHQAVAL
Sbjct  287   KLMIVRDGMDATVITGSRNVVDGATTFNSATLAVAADGVILQDLRIENTAGPEKHQAVAL  346

Query  1089  RLGADQSVINRCKIDAYQDTLYAHSQRQFYRDCYITGTVDFIFGNAAAVIQNSQVVARKP  1268
             R+ AD++VINRC++D YQDTLYAH  R FYRDC ++GTVDF+FGNAAAV+Q   + AR+P
Sbjct  347   RVSADRAVINRCRVDGYQDTLYAHQLRHFYRDCAVSGTVDFVFGNAAAVLQGCVLTARRP  406

Query  1269  MAAQKNMVTAQGRTDPNQNTGTSIQNCNVSPSSDLGPVKGTIQTYLGRPWKEYSRTVFME  1448
                QKN VTAQGRTDPNQNTGTS+Q C + P+ DL PV     T+LGRPWK YSRTV+M+
Sbjct  407   ARGQKNAVTAQGRTDPNQNTGTSLQRCRLLPADDLAPVAEASPTFLGRPWKAYSRTVYMQ  466

Query  1449  SNIGDHIDPAGWFPWDGDFALKTLYYGEYMNRGPGAGTSKRVNWPGYHVITDKAEAMKFT  1628
             S +G H+ P GW  WDGDFAL+TL+YGEY N GPGAGT+ RV WPGY VITD++ A++FT
Sbjct  467   SYLGAHVHPRGWLEWDGDFALRTLFYGEYANEGPGAGTAGRVKWPGYRVITDRSVAVQFT  526

Query  1629  VAQLIQGGSWLKNTGVDYTEGL  1694
             V + IQG +W+K TGV Y +GL
Sbjct  527   VGRFIQGANWIKGTGVAYDDGL  548



>ref|XP_006843574.2| PREDICTED: pectinesterase 2.1 [Amborella trichopoda]
Length=342

 Score =   506 bits (1302),  Expect = 3e-172, Method: Compositional matrix adjust.
 Identities = 236/334 (71%), Positives = 278/334 (83%), Gaps = 0/334 (0%)
 Frame = +3

Query  693   FPSWVSASDRRLLEASanavaanvvvaKDGSGKYKTVAEAVASAPDNGKTRYVIYIKKGT  872
              P+WV   + RLLE+  + + A+VVVAKDGSG YKTV+EAVA+APD  K RYVIY+KKGT
Sbjct  9     LPAWVRDIETRLLESKVSEIKADVVVAKDGSGNYKTVSEAVAAAPDKSKKRYVIYVKKGT  68

Query  873   YKENVEIGKKKTNVMLIGDGLSATIITGSLNYVDGATTFNSATVAAVGDGFIAQDLRIQN  1052
             Y+E VEIGK K N+ML+GDG+  T+ITGSLN++DG TTFNSAT+A VG+GFIAQD+  QN
Sbjct  69    YEEKVEIGKNKKNLMLVGDGMDFTVITGSLNFIDGTTTFNSATLAVVGEGFIAQDMCFQN  128

Query  1053  TAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYAHSQRQFYRDCYITGTVDFIFGNAAA  1232
             TAGP+KHQAVALR+GAD+S+INRC+I+ YQDTLYAHSQRQFYRD  I+GT+DFIFGNAA 
Sbjct  129   TAGPKKHQAVALRVGADKSIINRCRIEGYQDTLYAHSQRQFYRDSVISGTIDFIFGNAAV  188

Query  1233  VIQNSQVVARKPMAAQKNMVTAQGRTDPNQNTGTSIQNCNVSPSSDLGPVKGTIQTYLGR  1412
             V+QN  ++ARKPM+ Q+N+VTAQGRTDPNQNTGT+IQ   +  S+DL PVK  + TYLGR
Sbjct  189   VLQNCTIIARKPMSNQQNLVTAQGRTDPNQNTGTTIQFSRIQASTDLEPVKNILPTYLGR  248

Query  1413  PWKEYSRTVFMESNIGDHIDPAGWFPWDGDFALKTLYYGEYMNRGPGAGTSKRVNWPGYH  1592
             PWKEYSRTV+M++NIGDHI   GW PW G FALKTLYY EYMN GPGAGTS RV WPGYH
Sbjct  249   PWKEYSRTVYMQNNIGDHIAAEGWLPWSGGFALKTLYYAEYMNGGPGAGTSGRVKWPGYH  308

Query  1593  VITDKAEAMKFTVAQLIQGGSWLKNTGVDYTEGL  1694
             VITD  EA KFTV + IQGG WL+ TGV YTEGL
Sbjct  309   VITDANEAKKFTVGEFIQGGEWLQATGVAYTEGL  342



>ref|XP_002456465.1| hypothetical protein SORBIDRAFT_03g036790 [Sorghum bicolor]
 gb|EES01585.1| hypothetical protein SORBIDRAFT_03g036790 [Sorghum bicolor]
Length=552

 Score =   511 bits (1315),  Expect = 5e-171, Method: Compositional matrix adjust.
 Identities = 289/564 (51%), Positives = 377/564 (67%), Gaps = 31/564 (5%)
 Frame = +3

Query  54    TSHLPLLFTP-KRKPSSCRalyvllylaaIVGSVALVSIWA--LRTSSSSPSLWKARVCD  224
             +S+ PLL +P +R  S CR   +L+     + S AL+   A  L  +  +P L     C 
Sbjct  3     SSNEPLLSSPYQRNASPCRRPVLLIT----LSSAALLCAGAAFLLLNLPTPDL-----CA  53

Query  225   PAHDPPSCMAIVSEVSSAAP---TETDGVAllqmllhssllRIQDAVKLSANVNRRI---  386
              + DP SC AIV++   A+P       G A +   + +  L   DA   + +   R    
Sbjct  54    SSPDPTSCHAIVADAVLASPRAHLTRPGPAQVLRAIVARSLVQHDAAAAAVSGMLRHTGS  113

Query  387   -NDRKVQAAVADCMELLDLSQDKVMDSMVALGNLSARARTDAHSWLSSVLTNHDTCLDG-  560
              +D + +AA+ADC++L+DL++D++ D+  A+   +A A  DA +WLS+ LT + TC DG 
Sbjct  114   DSDPRQRAALADCVQLMDLARDRLADASPAV---AAAAADDARTWLSAALTYYATCTDGV  170

Query  561   -----LSEPARSIMEPMIKDLISRAKsslavlvavaPSTEDDLRALNGEFPSWVSASDRR  725
                  L +   + +EP+ K L S + + L+ +V  + S +  L      FPSWV A DR 
Sbjct  171   VVDGPLRDAVVARLEPL-KSLASASLAVLSAVVDDSGSRDAGLADTTYTFPSWVPARDRA  229

Query  726   LLEASanavaanvvvaKDGSGKYKTVAEAVASAPDNGKTRYVIYIKKGTYKENVEIGKKK  905
             LLEA A   A  VV  +DGSGK++TV EAV +APD GK+RYVIY+KKG YKENVE+GKKK
Sbjct  230   LLEAGAAIEADVVVA-QDGSGKFRTVKEAVDAAPDGGKSRYVIYVKKGVYKENVEVGKKK  288

Query  906   TNVMLIGDGLSATIITGSLNYVDGATTFNSATVAAVGDGFIAQDLRIQNTAGPEKHQAVA  1085
               +M++GDG+ AT+ITGS N VDGATTFNSAT+A  GDG I QDLR++NTAGP KHQAVA
Sbjct  289   RELMIVGDGMDATVITGSRNVVDGATTFNSATLAVAGDGIILQDLRVENTAGPAKHQAVA  348

Query  1086  LRLGADQSVINRCKIDAYQDTLYAHSQRQFYRDCYITGTVDFIFGNAAAVIQNSQVVARK  1265
             LR+ AD++V  RC++D YQDTLYAH+ R  YR+C+++GTVDF+FGNAAAV+Q   + AR 
Sbjct  349   LRVSADRAVAYRCRVDGYQDTLYAHALRHLYRECFVSGTVDFVFGNAAAVLQGCALAARL  408

Query  1266  PMAAQKNMVTAQGRTDPNQNTGTSIQNCNVSPSSDLGPVKGT-IQTYLGRPWKEYSRTVF  1442
             P+  Q+N VTAQGR DPNQNTGTS+  C V P+ DL PV GT   T+LGRPWK YSRTV 
Sbjct  409   PLRGQQNAVTAQGREDPNQNTGTSLHRCRVVPAPDLAPVAGTDFPTFLGRPWKAYSRTVV  468

Query  1443  MESNIGDHIDPAGWFPWDGDFALKTLYYGEYMNRGPGAGTSKRVNWPGYHVITDKAEAMK  1622
             M S +  H+D  GW  WDGDFALKTL+YGEY N GPGA T+ RVNWPGYHVITD++ A++
Sbjct  469   MLSYLDAHVDARGWLEWDGDFALKTLFYGEYQNEGPGAATAGRVNWPGYHVITDRSVAVQ  528

Query  1623  FTVAQLIQGGSWLKNTGVDYTEGL  1694
             FTV Q IQGG+WL  TGV Y EGL
Sbjct  529   FTVGQFIQGGNWLNGTGVPYIEGL  552



>emb|CDM84519.1| unnamed protein product [Triticum aestivum]
Length=441

 Score =   496 bits (1276),  Expect = 9e-167, Method: Compositional matrix adjust.
 Identities = 250/405 (62%), Positives = 299/405 (74%), Gaps = 9/405 (2%)
 Frame = +3

Query  504   DAHSWLSSVLTNHDTCLDGLSE-PARSIMEPMIKDLISRAKsslavlvavaPSTE-DDL-  674
             DA +WLS++LT+H TCLDGL+  P R  +   ++ L+S A +SLAVL AV   T  DD+ 
Sbjct  38    DARTWLSAMLTDHVTCLDGLNNGPPRDAVGAQLEPLMSLASASLAVLNAVGSCTAADDIA  97

Query  675   -----RALNGEFPSWVSASDRRLLEASanavaanvvvaKDGSGKYKTVAEAVASAPDNGK  839
                   A   E PSWV ++DR LLE S    A  VV  KDGSGKY TV  AV +APD GK
Sbjct  98    RDVLAEAAADELPSWVPSADRALLEGSGAVQADVVVA-KDGSGKYNTVQAAVDAAPDRGK  156

Query  840   TRYVIYIKKGTYKENVEIGKKKTNVMLIGDGLSATIITGSLNYVDGATTFNSATVAAVGD  1019
              RYVIY+KKG YKEN+ + KKK  +M++GDG+ AT+ITGS N VDGATTFNSAT+A   D
Sbjct  157   RRYVIYVKKGVYKENLAVWKKKRELMIVGDGMDATVITGSRNVVDGATTFNSATLAVAAD  216

Query  1020  GFIAQDLRIQNTAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYAHSQRQFYRDCYITG  1199
             G I QDLRI NTAGPEKHQAVALR+ AD++VINRC++D YQDTLYAH  RQFYRDC+++G
Sbjct  217   GVILQDLRIDNTAGPEKHQAVALRVSADRAVINRCRVDGYQDTLYAHQLRQFYRDCFVSG  276

Query  1200  TVDFIFGNAAAVIQNSQVVARKPMAAQKNMVTAQGRTDPNQNTGTSIQNCNVSPSSDLGP  1379
             TVDF+FGNAAAV+QN  +  R+P   QKN VTAQGRTDPNQNTGTS+  C V P+ DL P
Sbjct  277   TVDFVFGNAAAVLQNCVITTRRPARGQKNAVTAQGRTDPNQNTGTSLHRCRVVPADDLAP  336

Query  1380  VKGTIQTYLGRPWKEYSRTVFMESNIGDHIDPAGWFPWDGDFALKTLYYGEYMNRGPGAG  1559
             V     T+LGRPWK YSRTV+M+S +G HI P GW  W+GDFAL  L+YGEY N GPGAG
Sbjct  337   VAEAFPTFLGRPWKVYSRTVYMQSYLGAHIHPRGWLDWNGDFALNRLFYGEYANEGPGAG  396

Query  1560  TSKRVNWPGYHVITDKAEAMKFTVAQLIQGGSWLKNTGVDYTEGL  1694
             T+ RV WPGY VITD++ A++FTV Q IQGG WLK TG  Y +GL
Sbjct  397   TAGRVKWPGYRVITDQSVAVQFTVGQFIQGGYWLKGTGEAYDDGL  441



>pdb|1XG2|A Chain A, Crystal Structure Of The Complex Between Pectin Methylesterase 
And Its Inhibitor Protein
Length=317

 Score =   489 bits (1259),  Expect = 5e-166, Method: Compositional matrix adjust.
 Identities = 231/307 (75%), Positives = 260/307 (85%), Gaps = 0/307 (0%)
 Frame = +3

Query  774   KDGSGKYKTVAEAVASAPDNGKTRYVIYIKKGTYKENVEIGKKKTNVMLIGDGLSATIIT  953
             +DG+G Y+T+AEAVA+APD  KTRYVIY+K+GTYKENVE+   K N+M++GDG+ AT IT
Sbjct  9     QDGTGDYQTLAEAVAAAPDKSKTRYVIYVKRGTYKENVEVASNKMNLMIVGDGMYATTIT  68

Query  954   GSLNYVDGATTFNSATVAAVGDGFIAQDLRIQNTAGPEKHQAVALRLGADQSVINRCKID  1133
             GSLN VDG+TTF SAT+AAVG GFI QD+ IQNTAGP K QAVALR+GAD SVINRC+ID
Sbjct  69    GSLNVVDGSTTFRSATLAAVGQGFILQDICIQNTAGPAKDQAVALRVGADMSVINRCRID  128

Query  1134  AYQDTLYAHSQRQFYRDCYITGTVDFIFGNAAAVIQNSQVVARKPMAAQKNMVTAQGRTD  1313
             AYQDTLYAHSQRQFYRD Y+TGTVDFIFGNAA V Q  Q+VARKP   Q+NMVTAQGRTD
Sbjct  129   AYQDTLYAHSQRQFYRDSYVTGTVDFIFGNAAVVFQKCQLVARKPGKYQQNMVTAQGRTD  188

Query  1314  PNQNTGTSIQNCNVSPSSDLGPVKGTIQTYLGRPWKEYSRTVFMESNIGDHIDPAGWFPW  1493
             PNQ TGTSIQ CN+  SSDL PV     TYLGRPWKEYSRTV MES +G  I+PAGW  W
Sbjct  189   PNQATGTSIQFCNIIASSDLEPVLKEFPTYLGRPWKEYSRTVVMESYLGGLINPAGWAEW  248

Query  1494  DGDFALKTLYYGEYMNRGPGAGTSKRVNWPGYHVITDKAEAMKFTVAQLIQGGSWLKNTG  1673
             DGDFALKTLYYGE+MN GPGAGTSKRV WPGYHVITD A+AM FTVA+LIQGGSWL++TG
Sbjct  249   DGDFALKTLYYGEFMNNGPGAGTSKRVKWPGYHVITDPAKAMPFTVAKLIQGGSWLRSTG  308

Query  1674  VDYTEGL  1694
             V Y +GL
Sbjct  309   VAYVDGL  315



>gb|EPS63029.1| hypothetical protein M569_11757, partial [Genlisea aurea]
Length=526

 Score =   487 bits (1254),  Expect = 3e-162, Method: Compositional matrix adjust.
 Identities = 261/495 (53%), Positives = 344/495 (69%), Gaps = 5/495 (1%)
 Frame = +3

Query  219   CDPAHDPPSCMAIVSEVSSAAPTETDGVAllqmllhssllRIQDAVKLSANVNRRINDRK  398
             C  A +P SC   V    S   + ++   L   LL+  +  ++ A+ L   +  R N  +
Sbjct  34    CHKALNPESCRDTVLRAVSDDGSASEAADLQPKLLNRQVDEMRRALVLIQKL--RSNQAE  91

Query  399   VQAAVADCMELLDLSQDKVMDSMVALGNLSARAR-TDAHSWLSSVLTNHDTCLDGLSEPA  575
                A++DC EL+++S D V++S+  L     R++ TDA +WLS VLTNH TC D +    
Sbjct  92    ESGALSDCEELMEISIDLVLNSIRELEKGMGRSQYTDAQTWLSGVLTNHFTCADEIGGGR  151

Query  576   RSIMEPMIKDLISRAKsslavlvava-PSTEDDLRAL-NGEFPSWVSASDRRLLEASana  749
                +  M + LI   ++SLAVL +V  P  E  +R + +G  P+W++  DR+LL+ +A+ 
Sbjct  152   LLGIRSMTEGLIDTTRASLAVLASVTLPEDEITIRPVTSGMDPTWLTPMDRKLLQVTADR  211

Query  750   vaanvvvaKDGSGKYKTVAEAVASAPDNGKTRYVIYIKKGTYKENVEIGKKKTNVMLIGD  929
             V A++VVA+DGSG ++TV+ AV +AP+N + R+VI +KKGTY+ENV +GK K N+M+IGD
Sbjct  212   VKADLVVARDGSGDFRTVSGAVDAAPENSEKRFVIRVKKGTYRENVVVGKNKKNLMIIGD  271

Query  930   GLSATIITGSLNYVDGATTFNSATVAAVGDGFIAQDLRIQNTAGPEKHQAVALRLGADQS  1109
             G   T IT  LN VDG+TT+NSAT+AAVG+GFI QD+RI+NTAG EK QAVALR+G+D+S
Sbjct  272   GKGKTTITAHLNVVDGSTTYNSATLAAVGEGFILQDIRIRNTAGREKAQAVALRIGSDKS  331

Query  1110  VINRCKIDAYQDTLYAHSQRQFYRDCYITGTVDFIFGNAAAVIQNSQVVARKPMAAQKNM  1289
              INRCKI+ YQDTLYAHS RQFYRD  I GT+DFIFG+AA V+Q   + AR P+ +QKN 
Sbjct  332   AINRCKIEGYQDTLYAHSLRQFYRDSTIKGTIDFIFGDAAVVLQKCTIEARIPLKSQKNT  391

Query  1290  VTAQGRTDPNQNTGTSIQNCNVSPSSDLGPVKGTIQTYLGRPWKEYSRTVFMESNIGDHI  1469
             VTAQGR+DPNQNTGTSIQ+C + P+ DL P++ +  T+LGRPW+ +SRT  +ES IGDH+
Sbjct  392   VTAQGRSDPNQNTGTSIQDCVIKPTRDLEPLRLSYPTFLGRPWRNFSRTAVLESYIGDHV  451

Query  1470  DPAGWFPWDGDFALKTLYYGEYMNRGPGAGTSKRVNWPGYHVITDKAEAMKFTVAQLIQG  1649
             DPAGWF W GDFAL TLYYGEY NRGPG+ T  RVNW GYH I   AEA  FTV +LI G
Sbjct  452   DPAGWFEWSGDFALDTLYYGEYKNRGPGSVTENRVNWKGYHAIDSAAEAWSFTVRELING  511

Query  1650  GSWLKNTGVDYTEGL  1694
               WL  TGV Y  GL
Sbjct  512   DEWLGYTGVPYNVGL  526



>ref|XP_010259481.1| PREDICTED: pectinesterase-like [Nelumbo nucifera]
Length=583

 Score =   488 bits (1256),  Expect = 1e-161, Method: Compositional matrix adjust.
 Identities = 254/532 (48%), Positives = 333/532 (63%), Gaps = 23/532 (4%)
 Frame = +3

Query  159   VSIWALRTSSSSPSLWKARV----CDPAHDPPSCMAIVSEVSSAAPTETDGVAllqmllh  326
             ++++ ++ SSS P L   ++    C+    P  C++ +S            +    +   
Sbjct  54    ITLFLVQASSSIPVLHHLQIAHSACEGTLYPELCVSTLSSFPDLTSKTISQMISSTVNYT  113

Query  327   ssllRIQDAVKLSANVNRRINDRKVQAAVADCMELLDLSQDKVMDSMVALGNLSARARTD  506
                + I  +       N +  D   Q A+ DC+EL D   + + +   AL +LS ++   
Sbjct  114   VKEVEISASNCTDIRKNLKAQDPLEQRALDDCLELFD---ETISELQTALSDLSPKSSPS  170

Query  507   AH-----SWLSSVLTNHDTCLDGLSEPARSIMEPMIK---DLISRAKsslavlvavaPST  662
              H     + LS+ +TN  TCLDGLS     ++   IK   + IS   S+   ++   P  
Sbjct  171   KHYNDLQTLLSAAMTNQYTCLDGLSLGNEQVIREEIKQNLNNISHLVSNSLAMLTKMPKA  230

Query  663   EDDLR--------ALNGEFPSWVSASDRRLLEASanavaanvvvaKDGSGKYKTVAEAVA  818
              D L+         + G FP WVS  DR+LL+AS N +  ++VVAKDGSG ++T+ EAVA
Sbjct  231   ADTLKDEVFPEYGKMAGRFPGWVSPKDRKLLQASTNTMKFDLVVAKDGSGNFRTIGEAVA  290

Query  819   SAPDNGKTRYVIYIKKGTYKENVEIGKKKTNVMLIGDGLSATIITGSLNYVDGATTFNSA  998
             +AP++  TR+VIYIK GTY ENV++GKKKT +M +GDG+  T++  S N VDG TTF SA
Sbjct  291   AAPNSSATRFVIYIKAGTYFENVDVGKKKTMLMFVGDGIGKTVVKASRNVVDGWTTFRSA  350

Query  999   TVAAVGDGFIAQDLRIQNTAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYAHSQRQFY  1178
             TVA VG+GFIA+D+ I+N AGP KHQAVALR G+D S   RC    YQDTLY HS RQFY
Sbjct  351   TVAVVGNGFIARDMTIENAAGPSKHQAVALRSGSDLSAFYRCSFVGYQDTLYVHSLRQFY  410

Query  1179  RDCYITGTVDFIFGNAAAVIQNSQVVARKPMAAQKNMVTAQGRTDPNQNTGTSIQNCNVS  1358
             R+C I GTVDFIFGNAA V QN  + AR+P A QKN+ TAQGR DPNQNTG SI NC V+
Sbjct  411   RECDIYGTVDFIFGNAAVVFQNCNLYARRPNANQKNIFTAQGREDPNQNTGISILNCKVT  470

Query  1359  PSSDLGPVKGTIQTYLGRPWKEYSRTVFMESNIGDHIDPAGWFPWDGDFALKTLYYGEYM  1538
              ++DL PVK +  TYLGRPWKEYSRTVF+ S + D I+PAGW  W G+F L TLYYGEYM
Sbjct  471   LAADLSPVKSSFHTYLGRPWKEYSRTVFIGSYLDDLINPAGWLEWSGNFGLSTLYYGEYM  530

Query  1539  NRGPGAGTSKRVNWPGYHVITDKAEAMKFTVAQLIQGGSWLKNTGVDYTEGL  1694
             N+GPG+ T+ RV WPGY VI    EA +FTVA  IQGG WL +TG+ Y+ GL
Sbjct  531   NKGPGSDTTNRVKWPGYRVINSSTEATQFTVASFIQGGGWLSSTGIPYSAGL  582



>emb|CAA96436.1| pectin methylesterase [Nicotiana plumbaginifolia]
Length=274

 Score =   476 bits (1225),  Expect = 1e-161, Method: Compositional matrix adjust.
 Identities = 222/271 (82%), Positives = 243/271 (90%), Gaps = 1/271 (0%)
 Frame = +3

Query  882   NVEIGKKKTNVMLIGDGLSATIITGSLNYVDGATTFNSATVAAVGDGFIAQDLRIQNTAG  1061
             NVEIGKKK NVML+GDG+ ATIITG+LN VDGATTFNSATVAAVGDGFIAQD++ QNTAG
Sbjct  5     NVEIGKKKKNVMLVGDGMDATIITGNLNVVDGATTFNSATVAAVGDGFIAQDVQFQNTAG  64

Query  1062  PEKHQAVALRLGADQSVINRCKIDAYQDTLYAHSQRQFYRDCYITGTVDFIFGNAAAVIQ  1241
               KHQAVALR+GA QSVINRCKIDA+QDTLY HS RQFYRDCYITGTVDFIFGNAA V Q
Sbjct  65    AAKHQAVALRVGAGQSVINRCKIDAFQDTLYTHSLRQFYRDCYITGTVDFIFGNAAVVFQ  124

Query  1242  NSQVVARKPMAAQKNMVTAQGRTDPNQNTGTSIQNCNVSPSSDLGPVKGTIQTYLGRPWK  1421
             NS++ ARKP + QKNMVTAQGR DPNQNTGTSIQNC++ PSSDL PVKG+++TYLGRPWK
Sbjct  125   NSKIAARKPGSGQKNMVTAQGREDPNQNTGTSIQNCDIIPSSDLAPVKGSVKTYLGRPWK  184

Query  1422  EYSRTVFMESNIGDHIDPAGWFPWDGDFALKTLYYGEYMNRGPGAGTSKRVNWPGYHVIT  1601
              YSRTVFM+SNIGDHIDP GW  WDGDFALKTLYYGEYMN+GPGAGTSKRV WPGYH+++
Sbjct  185   AYSRTVFMQSNIGDHIDPEGWSVWDGDFALKTLYYGEYMNKGPGAGTSKRVKWPGYHILS  244

Query  1602  DKAEAMKFTVAQLIQGGSWLKNTGVDYTEGL  1694
               AEA KFTV QLIQGG WLK+TGV YTEGL
Sbjct  245   -AAEATKFTVGQLIQGGVWLKSTGVAYTEGL  274



>ref|XP_008795768.1| PREDICTED: pectinesterase-like [Phoenix dactylifera]
Length=557

 Score =   486 bits (1251),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 254/506 (50%), Positives = 337/506 (67%), Gaps = 12/506 (2%)
 Frame = +3

Query  210   ARVCDPAHDPPSCMAIVSEVSSAAPTETDGVAllqmllhssllRIQDAVKLSANVNRRIN  389
             +R CD    P  C++ ++++ + +      V    +   ++ +R   A   ++ ++RR +
Sbjct  53    SRHCDGTLYPDLCVSTLADIPNLSSKPLPDVIAAVVNRTAAAVR-SSASNCTSYLHRRGH  111

Query  390   -DRKVQAAVADCMELLDLSQDKVMDSMVALGNLSARAR-TDAHSWLSSVLTNHDTCLDGL  563
              D + + A+ DC+ELLD + D +  ++  L   ++ A  +D  + LS+ +TN  TCLDG 
Sbjct  112   MDFRQRLALNDCLELLDQTLDDLRTAIADLAGCNSSAHVSDLQTVLSAAITNQYTCLDGF  171

Query  564   SEPARSIMEPMIK-------DLISRAKsslavlvavaPSTE--DDLRALNGEFPSWVSAS  716
             +      + P I+        L+S + + +  +       E  ++   ++G FP+WV+  
Sbjct  172   AYVNGGGVRPSIEGRLYHVSHLVSNSLAMVKKIRRQRRGREAFEEYGRMSGGFPTWVTRK  231

Query  717   DRRLLEASanavaanvvvaKDGSGKYKTVAEAVASAPDNGKTRYVIYIKKGTYKENVEIG  896
             DRRLL+A+ANA + ++VVAKDGSG + T+ EAVA+AP+N  TR+VIYIK G Y ENV++ 
Sbjct  232   DRRLLQAAANATSPDLVVAKDGSGNFTTIGEAVAAAPNNSATRFVIYIKAGAYFENVDVA  291

Query  897   KKKTNVMLIGDGLSATIITGSLNYVDGATTFNSATVAAVGDGFIAQDLRIQNTAGPEKHQ  1076
             K K N+M IGDG+  T++  S N VDG TTF SATVA VGDGF+A+D+ I+N+AGP KHQ
Sbjct  292   KNKKNLMFIGDGIGKTVVKASRNVVDGWTTFRSATVAVVGDGFLARDITIENSAGPSKHQ  351

Query  1077  AVALRLGADQSVINRCKIDAYQDTLYAHSQRQFYRDCYITGTVDFIFGNAAAVIQNSQVV  1256
             AVALR+GAD S   RC   AYQDTLY HS RQFYRDC + GTVDFIFGNAA V+Q+  + 
Sbjct  352   AVALRVGADLSAFYRCSFVAYQDTLYVHSLRQFYRDCDVYGTVDFIFGNAAVVLQSCNLY  411

Query  1257  ARKPMAAQKNMVTAQGRTDPNQNTGTSIQNCNVSPSSDLGPVKGTIQTYLGRPWKEYSRT  1436
             ARKP   QKN+ TAQGR DPNQNTG SIQ C V+ +SDL PV+    TYLGRPWK+YSRT
Sbjct  412   ARKPDPNQKNIFTAQGREDPNQNTGISIQKCKVAAASDLIPVQSNFSTYLGRPWKQYSRT  471

Query  1437  VFMESNIGDHIDPAGWFPWDGDFALKTLYYGEYMNRGPGAGTSKRVNWPGYHVITDKAEA  1616
             VFM+S +G  IDPAGW  WDGDFAL TLYYGEYMN+GPG+ TS+RV WPGY VIT  AEA
Sbjct  472   VFMQSFLGSLIDPAGWLEWDGDFALSTLYYGEYMNQGPGSNTSRRVTWPGYRVITSAAEA  531

Query  1617  MKFTVAQLIQGGSWLKNTGVDYTEGL  1694
               FTVA  IQG  WL  T V +T GL
Sbjct  532   SNFTVASFIQGDQWLGATSVPFTSGL  557



>ref|XP_006841486.1| PREDICTED: pectinesterase [Amborella trichopoda]
 gb|ERN03161.1| hypothetical protein AMTR_s00003p00120050 [Amborella trichopoda]
Length=540

 Score =   478 bits (1229),  Expect = 3e-158, Method: Compositional matrix adjust.
 Identities = 261/536 (49%), Positives = 346/536 (65%), Gaps = 23/536 (4%)
 Frame = +3

Query  138   IVGSVALVSIWALRTSSSSPSLWKARVCDPAHDPPSCMAIVSEVSSAAPTETDGVAllqm  317
             I  +VA ++ + L    SS +L  + +C+    P  C++ +S      P ++    L   
Sbjct  10    ITMAVATIATFLLLFIPSSSALSHSHMCEDTLYPDLCLSTLSSSLKTTPRQSIAATLNLT  69

Query  318   llhssllRIQDAVKLSANVNRRIN--DRKVQAAVADCMELLDLSQDKVMDSMVALGNLSA  491
                ++     +A+   +N++  I+  D   Q A++DC ELL  S   +   +  L N S+
Sbjct  70    AKSAT-----EAISSCSNLSHEISSTDLPDQRALSDCEELLSTSLGDISSCLADLSNSSS  124

Query  492   RART-DAHSWLSSVLTNHDTCLDGLS---EPARSIMEPMIKDLISRAKsslavlvavaPS  659
             R+ +    ++LS+ +TN  TCLDG S      RS +E  I + ISR  S+   +     +
Sbjct  125   RSSSIHLQTFLSAAITNQYTCLDGFSYANHTLRSRIEANIVN-ISRHISNSLAMFKKVRA  183

Query  660   TE-----------DDLRALNGEFPSWVSASDRRLLEASanavaanvvvaKDGSGKYKTVA  806
             +E           ++   ++G FP+W+   DRRLL+ASAN   A++VVAKDGSG + T++
Sbjct  184   SELPENSDSGEVFEEYGRVDGGFPAWIPPKDRRLLQASANQTNADLVVAKDGSGDFTTIS  243

Query  807   EAVASAPDNGKTRYVIYIKKGTYKENVEIGKKKTNVMLIGDGLSATIITGSLNYVDGATT  986
             EA+A  PDNGKTR+VIYIK G Y ENV++G+KKTN+MLIGDG+  T++  S N VDG TT
Sbjct  244   EAIAKVPDNGKTRFVIYIKTGEYLENVDVGEKKTNLMLIGDGIEKTVVKASRNVVDGWTT  303

Query  987   FNSATVAAVGDGFIAQDLRIQNTAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYAHSQ  1166
             F SAT A VG  FIA+D+  +N+AGP KHQAVALR GAD S   RC    YQDTLY HS 
Sbjct  304   FRSATFAVVGSNFIARDMSFENSAGPSKHQAVALRSGADLSAFYRCSFVGYQDTLYVHSL  363

Query  1167  RQFYRDCYITGTVDFIFGNAAAVIQNSQVVARKPMAAQKNMVTAQGRTDPNQNTGTSIQN  1346
             RQFYR+C + GTVDFIFGNAA V+Q+  + AR+P   Q+N+ TAQGR DPNQNTG SIQN
Sbjct  364   RQFYRECDVYGTVDFIFGNAAVVLQDCNLYARRPNPNQRNLFTAQGRVDPNQNTGISIQN  423

Query  1347  CNVSPSSDLGPVKGTIQTYLGRPWKEYSRTVFMESNIGDHIDPAGWFPWDGDFALKTLYY  1526
             C V+ ++DL PV+ + + YLGRPWK+YSRT+FM+S+IGD IDPAGWF W GDFAL TLYY
Sbjct  424   CKVAAAADLIPVQSSFKNYLGRPWKQYSRTIFMQSDIGDLIDPAGWFEWSGDFALSTLYY  483

Query  1527  GEYMNRGPGAGTSKRVNWPGYHVITDKAEAMKFTVAQLIQGGSWLKNTGVDYTEGL  1694
             GEYMNRGPGA TS RV WPGY VI   +EA +FTVA  IQG  WL  + V +  GL
Sbjct  484   GEYMNRGPGADTSNRVKWPGYRVINSSSEASQFTVASFIQGNEWLPASNVAFYAGL  539



>ref|XP_007141001.1| hypothetical protein PHAVU_008G158900g [Phaseolus vulgaris]
 gb|ESW12995.1| hypothetical protein PHAVU_008G158900g [Phaseolus vulgaris]
Length=609

 Score =   479 bits (1233),  Expect = 6e-158, Method: Compositional matrix adjust.
 Identities = 256/556 (46%), Positives = 348/556 (63%), Gaps = 43/556 (8%)
 Frame = +3

Query  147   SVALVSIWALRTSSSS--PSLWK------ARVCDPAHDPPSCM-AIVSEVSSAAPTETDG  299
             S  LV++   R SS+   PSL +      +R C     P  C+ +++    S   +E D 
Sbjct  55    SAVLVTVVRSRASSNQNGPSLSRKPTQAISRTCSKTRFPTLCVNSLLDFPGSTTASEQDL  114

Query  300   VAllqmllhssllRIQDAVKLSANVNRRINDRKVQAAVADCMELLDLSQDKV---MDSMV  470
             V +   +    + R   A   S+ ++    + KV+AA  DC+ELL+ S D +   +DS++
Sbjct  115   VHISFNMTLRHVSR---AFFASSGLSFAATEPKVRAAYEDCLELLEESMDSLSRSLDSIL  171

Query  471   A---------LGNLSARARTDAHSWLSSVLTNHDTCLDGLSEPARSIMEPMIKDL-----  608
             +         L + S  +  D  +WLS+ LTNHDTC +G  E + S+   M+ +L     
Sbjct  172   SPSAISNGGGLRSGSDGSTEDVITWLSAALTNHDTCAEGFEESSGSVKNQMVNNLKDLSE  231

Query  609   -----ISRAKsslavlvavaP--------STEDDLRALNGEFPSWVSASDRRLLEASana  749
                  ++    S +   +  P          EDD   ++G+FP W++  DRRLL  + +A
Sbjct  232   LVSNCLAIFSGSGSGDFSGVPIQNKRRLMGEEDDEANISGKFPRWLNKRDRRLLNLATSA  291

Query  750   vaanvvvaKDGSGKYKTVAEAVASAPDNGKTRYVIYIKKGTYKEN-VEIGKKKTNVMLIG  926
             + A++VV+K+G G  KT+AEA+  AP++   R++IY++ G Y+EN +++G+KKTNVM IG
Sbjct  292   IQADIVVSKNGEGTVKTIAEAIKKAPEHSSRRFIIYVRAGRYEENNLKVGRKKTNVMFIG  351

Query  927   DGLSATIITGSLNYVDGATTFNSATVAAVGDGFIAQDLRIQNTAGPEKHQAVALRLGADQ  1106
             DG   T+ITG  N +DG TTF++A+ AA G GFIA+D+  +N AGP KHQAVALR+GAD 
Sbjct  352   DGKGKTVITGKRNVIDGMTTFHTASFAASGAGFIARDITFENYAGPAKHQAVALRVGADH  411

Query  1107  SVINRCKIDAYQDTLYAHSQRQFYRDCYITGTVDFIFGNAAAVIQNSQVVARKPMAAQKN  1286
             +V+ RC I  YQD+ Y HS RQF+R+C I GTVDFIFGNAA V Q   + ARKPMA QKN
Sbjct  412   AVVYRCNIVGYQDSCYVHSNRQFFRECDIYGTVDFIFGNAAVVFQKCNIYARKPMAQQKN  471

Query  1287  MVTAQGRTDPNQNTGTSIQNCNVSPSSDLGPVKGTIQTYLGRPWKEYSRTVFMESNIGDH  1466
              +TAQ R DPNQNTG S+ NC + P+ DL PVKG+  TYLGRPWK++SRTVFM S +GDH
Sbjct  472   TITAQNRKDPNQNTGISMHNCRIQPAPDLVPVKGSFPTYLGRPWKQFSRTVFMLSYMGDH  531

Query  1467  IDPAGWFPWDGDFALKTLYYGEYMNRGPGAGTSKRVNWPGYHVITDKAEAMKFTVAQLIQ  1646
             I   GW  W+GDFAL TLYYGEYMN GPGAG  +RV WPGY VIT   EA +FTVAQ I 
Sbjct  532   IHSRGWLEWNGDFALDTLYYGEYMNYGPGAGVGQRVKWPGYRVITSAVEANRFTVAQFIS  591

Query  1647  GGSWLKNTGVDYTEGL  1694
             G +WL +TGV +  GL
Sbjct  592   GSAWLPSTGVAFAAGL  607



>ref|XP_003608136.1| Pectinesterase [Medicago truncatula]
 ref|XP_003609931.1| Pectinesterase [Medicago truncatula]
 gb|AES90333.1| pectinesterase/pectinesterase inhibitor [Medicago truncatula]
Length=518

 Score =   474 bits (1220),  Expect = 3e-157, Method: Compositional matrix adjust.
 Identities = 243/458 (53%), Positives = 305/458 (67%), Gaps = 12/458 (3%)
 Frame = +3

Query  342   IQDAVKLSANVNRRINDRKVQAAVADCMELLDLSQDKVMDSMVAL------GNLSARART  503
             +Q  + + +         +   AV+DC++LLD+S D++  S+ A        N + +   
Sbjct  64    LQKVISILSRFTNVFGHSRTSNAVSDCLDLLDMSLDQLNQSISAAQKPKEKDNSTGKLNC  123

Query  504   DAHSWLSSVLTNHDTCLDGLSEPARSIMEPMIKDLISRAKsslavlvavaPSTEDDLRAL  683
             D  +WLS+VL   DTC++GL     SI++ +I   +    S +A L+    S  DD  A 
Sbjct  124   DLRTWLSAVLVYPDTCIEGLEG---SIVKGLISSGLDHVMSLVANLLGEVVSGNDDQLAT  180

Query  684   NGE-FPSWVSASDRRLLEASanavaanvvvaKDGSGKYKTVAEAVASAPDNGKTRYVIYI  860
             N + FPSW+   D +LL+A+     A V    DGSG Y  V +AV++AP++   RYVIY+
Sbjct  181   NKDRFPSWIRDEDTKLLQANGVTADAVVAA--DGSGDYAKVMDAVSAAPESSMKRYVIYV  238

Query  861   KKGTYKENVEIGKKKTNVMLIGDGLSATIITGSLNYVDGATTFNSATVAAVGDGFIAQDL  1040
             KKG Y ENVEI KKK N+MLIG+G+ ATII+GS NYVDG+TTF SAT A  G GFIA+D+
Sbjct  239   KKGVYVENVEIKKKKWNIMLIGEGMDATIISGSRNYVDGSTTFRSATFAVSGRGFIARDI  298

Query  1041  RIQNTAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYAHSQRQFYRDCYITGTVDFIFG  1220
               QNTAG EKHQAVALR  +D SV  RC I  YQD+LY H+ RQFYR+C I+GTVDFIFG
Sbjct  299   SFQNTAGAEKHQAVALRSDSDLSVFYRCGIFGYQDSLYTHTMRQFYRECKISGTVDFIFG  358

Query  1221  NAAAVIQNSQVVARKPMAAQKNMVTAQGRTDPNQNTGTSIQNCNVSPSSDLGPVKGTIQT  1400
             +A AV QN Q++A+K M  QKN VTAQGR DPNQ TG S Q CN+S  SDL P   TI T
Sbjct  359   DATAVFQNCQILAKKGMPKQKNTVTAQGRKDPNQPTGFSFQFCNISADSDLLPSVTTIPT  418

Query  1401  YLGRPWKEYSRTVFMESNIGDHIDPAGWFPWDGDFALKTLYYGEYMNRGPGAGTSKRVNW  1580
             YLGRPWK YSRT+FM+S + D I P GW  W+G+FAL TLYY EYMN GPGAG + RV W
Sbjct  419   YLGRPWKTYSRTIFMQSYMSDAIRPEGWLEWNGNFALNTLYYAEYMNSGPGAGVANRVKW  478

Query  1581  PGYHVITDKAEAMKFTVAQLIQGGSWLKNTGVDYTEGL  1694
              GYHV+ D +EA KFTVAQ I+G  WL +TGV YT GL
Sbjct  479   SGYHVLNDSSEATKFTVAQFIEGNLWLPSTGVTYTSGL  516



>ref|XP_010273801.1| PREDICTED: pectinesterase [Nelumbo nucifera]
Length=580

 Score =   474 bits (1220),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 241/461 (52%), Positives = 306/461 (66%), Gaps = 24/461 (5%)
 Frame = +3

Query  375   NRRINDRKVQAAVADCMELLDLSQDKVMDSMVALGNLSARARTDAHS-----WLSSVLTN  539
             + ++ +R+ + A+ DC+E++D + D++ ++   L     +   D H+      LS+ +TN
Sbjct  123   HEKLTERE-KTALHDCLEMVDETLDELHETAEDLKQYPNKKSLDEHAEDLKILLSAAMTN  181

Query  540   HDTCLDGLS--EPARSIMEPMIKDLISRAKsslavlvavaPSTEDDL--------RAL--  683
              DTC+DG S  +  + +   ++K            L  +   T+ D+        R L  
Sbjct  182   QDTCIDGFSHEQADKEVRNALLKGQEHVYHMCSNALAMIKNMTDTDMAEEKLKMGRKLGE  241

Query  684   -NGE---FPSWVSASDRRLLEASanavaanvvvaKDGSGKYKTVAEAVASAPDNGKTRYV  851
               GE   FP W+SA DRRLL+AS       V    DGSG YKTV+EAVA+AP N   RY+
Sbjct  242   STGEIDGFPGWLSAGDRRLLQASTVTPDVTVAS--DGSGNYKTVSEAVAAAPINSNKRYI  299

Query  852   IYIKKGTYKENVEIGKKKTNVMLIGDGLSATIITGSLNYVDGATTFNSATVAAVGDGFIA  1031
             I IK G YKENV++ KKK N+M +GDG   TIITGS N VDG+TTF+SATVAAVG+GF+A
Sbjct  300   IRIKAGVYKENVDVSKKKKNIMFVGDGRKNTIITGSRNVVDGSTTFHSATVAAVGEGFLA  359

Query  1032  QDLRIQNTAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYAHSQRQFYRDCYITGTVDF  1211
             +D+  QNTAGP KHQAVALR+G+D+S   RC + AYQDTLY HS RQFY DC I GTVDF
Sbjct  360   RDITFQNTAGPSKHQAVALRVGSDKSAFYRCDMLAYQDTLYVHSLRQFYVDCLIVGTVDF  419

Query  1212  IFGNAAAVIQNSQVVARKPMAAQKNMVTAQGRTDPNQNTGTSIQNCNVSPSSDLGPVKGT  1391
             IFGNAAAV QN  + AR+P + QKNM+TAQGR DPNQNTG  IQNC ++ +SDL  VK +
Sbjct  420   IFGNAAAVFQNCDIHARRPNSGQKNMLTAQGRDDPNQNTGIVIQNCRIAATSDLQAVKSS  479

Query  1392  IQTYLGRPWKEYSRTVFMESNIGDHIDPAGWFPWDGDFALKTLYYGEYMNRGPGAGTSKR  1571
               TYLGRPWKEYSRTV M+S I D I PAGW  W G+FAL TLYY EY N GPGA T+ R
Sbjct  480   FPTYLGRPWKEYSRTVIMQSTISDVIHPAGWHEWSGNFALTTLYYAEYQNTGPGAATANR  539

Query  1572  VNWPGYHVITDKAEAMKFTVAQLIQGGSWLKNTGVDYTEGL  1694
             V+W GY VIT   EA++FTV+  I GGSWL +TG  ++ GL
Sbjct  540   VSWKGYKVITSATEALRFTVSNFIAGGSWLGSTGFPFSSGL  580



>ref|XP_004498516.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 34-like 
[Cicer arietinum]
Length=606

 Score =   474 bits (1221),  Expect = 4e-156, Method: Compositional matrix adjust.
 Identities = 250/553 (45%), Positives = 341/553 (62%), Gaps = 40/553 (7%)
 Frame = +3

Query  147   SVALVSIWALRTSSS--SPSLWK------ARVCDPAHDPPSCM-AIVSEVSSAAPTETDG  299
             S AL+++   R SS+  SP+L        +R C     P  C+ +++    S + +E + 
Sbjct  55    SAALITVVRSRASSNQNSPNLRAKPTQAISRTCSKTRFPTLCINSLLDFPGSTSASEQEL  114

Query  300   VAllqmllhssllRIQDAVKLSANVNRRINDRKVQAAVADCMELLDLSQDKVMDSMVALG  479
             V    +  + +   I  A+  S+ ++    + +V+AA  DC+ELLD S D V  SM +L 
Sbjct  115   V---HISFNMTHRHIGKALFASSGLSYTAANPRVRAAYEDCLELLDESMDSVKLSMDSLN  171

Query  480   NLSARAR------------TDAHSWLSSVLTNHDTCLDGLSEPARSIMEPMIKDLISRAK  623
               S  +R             D  +WLS+ LTN DTCL+G  + + S+ + M+ +L   ++
Sbjct  172   TFSTLSRDDDTLSNIAGSNEDVMTWLSAALTNQDTCLEGFEDTSGSVKDQMVGNLKDLSE  231

Query  624   sslavlvavaPSTEDDLRA---------------LNGEFPSWVSASDRRLLEASanavaa  758
                  L   + S + D                  ++ EFP W+   DRRLL    + + A
Sbjct  232   LVSNSLAIFSASGDGDFTTGVPIQNKRRLLEIGEISREFPKWIKKRDRRLLSLPVSEIQA  291

Query  759   nvvvaKDGSGKYKTVAEAVASAPDNGKTRYVIYIKKGTYKEN-VEIGKKKTNVMLIGDGL  935
             ++VV+K G+G  +T+AEA+  APD+   R++IY+  G Y+EN +++GKKKTN+MLIGDG 
Sbjct  292   DIVVSKSGNGTVRTIAEAIKKAPDHSSRRFIIYVMAGRYEENNLKVGKKKTNIMLIGDGR  351

Query  936   SATIITGSLNYVDGATTFNSATVAAVGDGFIAQDLRIQNTAGPEKHQAVALRLGADQSVI  1115
               T+ITG  +  DG TTF++A+ AA G  F+A+D+  +N AGP KHQAVALR+GAD +V+
Sbjct  352   GKTVITGRKSVADGMTTFHTASFAASGARFMARDITFENYAGPSKHQAVALRIGADHAVV  411

Query  1116  NRCKIDAYQDTLYAHSQRQFYRDCYITGTVDFIFGNAAAVIQNSQVVARKPMAAQKNMVT  1295
              RC I  YQD+ Y HS RQF+R+C I GTVDFIFGNAA V Q   + ARKPM  QKN +T
Sbjct  412   FRCNILGYQDSCYVHSNRQFFRECDIYGTVDFIFGNAAVVFQKCNIYARKPMDQQKNTIT  471

Query  1296  AQGRTDPNQNTGTSIQNCNVSPSSDLGPVKGTIQTYLGRPWKEYSRTVFMESNIGDHIDP  1475
             AQ R DPNQNTG SI +C + P+ DL PVKG++QTYLGRPWK YSR V+M S +GDH+DP
Sbjct  472   AQNRKDPNQNTGISIHDCRILPAPDLAPVKGSVQTYLGRPWKMYSRAVYMLSYMGDHVDP  531

Query  1476  AGWFPWDGDFALKTLYYGEYMNRGPGAGTSKRVNWPGYHVITDKAEAMKFTVAQLIQGGS  1655
              GW  W+GDFAL TLYYGEYMN GPGA   +RV WPGY VIT   EA ++TVAQ I G S
Sbjct  532   HGWLEWNGDFALDTLYYGEYMNYGPGAAIGQRVKWPGYRVITSNVEANRYTVAQFISGSS  591

Query  1656  WLKNTGVDYTEGL  1694
             WL +TGV +  GL
Sbjct  592   WLPSTGVAFLAGL  604



>ref|XP_010273802.1| PREDICTED: pectinesterase/pectinesterase inhibitor PPE8B [Nelumbo 
nucifera]
Length=502

 Score =   469 bits (1208),  Expect = 1e-155, Method: Compositional matrix adjust.
 Identities = 241/463 (52%), Positives = 312/463 (67%), Gaps = 12/463 (3%)
 Frame = +3

Query  339   RIQDAVKLSANVNRRINDRKVQAAVADCMELLDLSQDKVMDSMVAL------GNLSARAR  500
              +Q  + L +    + +D ++  A+ DC++LLD S D++  ++ A        N +    
Sbjct  39    EVQGVISLVSKFANQFDDFRLSNALNDCVDLLDYSADELGWTLSATENPNSNDNSTGNRN  98

Query  501   TDAHSWLSSVLTNHDTCLDGLSEPARSIMEPMIKDLISRAKsslavlvavaPSTEDDLRA  680
             +D  +WLS+ L N DTCLDG  E   S ++ ++   +    S ++ ++   PS     R 
Sbjct  99    SDLKAWLSAALGNQDTCLDGF-EGTNSFVKGLVAGSLDTVTSLVSEVLGQIPSGGRLGRK  157

Query  681   L-----NGEFPSWVSASDRRLLEASanavaanvvvaKDGSGKYKTVAEAVASAPDNGKTR  845
             L      G FP+W+  SDRRLL+A A  V+A+ VVA+DG+G++ +V +AV +APD  + R
Sbjct  158   LKSVSEGGGFPAWMKGSDRRLLQAPAGGVSADAVVAQDGTGQFTSVMDAVLAAPDYSERR  217

Query  846   YVIYIKKGTYKENVEIGKKKTNVMLIGDGLSATIITGSLNYVDGATTFNSATVAAVGDGF  1025
             YVIY+K+G YKENVEI KKK N+M++GDG+  TII+GS N+VDG TTF SAT A  G GF
Sbjct  218   YVIYVKRGVYKENVEIKKKKWNLMIVGDGMDVTIISGSRNFVDGWTTFRSATFAVSGKGF  277

Query  1026  IAQDLRIQNTAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYAHSQRQFYRDCYITGTV  1205
             IA+D+  +NTAGPEKHQAVALR  +D S   RC I  YQDTLYAHS RQFYR+C I+GTV
Sbjct  278   IARDITFENTAGPEKHQAVALRSDSDLSAYYRCAIKGYQDTLYAHSLRQFYRECRISGTV  337

Query  1206  DFIFGNAAAVIQNSQVVARKPMAAQKNMVTAQGRTDPNQNTGTSIQNCNVSPSSDLGPVK  1385
             DFIFGN A VIQN Q++A+K +  QKN +TAQGR DPNQNTG S+Q  N+S  SDL    
Sbjct  338   DFIFGNGAVVIQNCQILAKKGLPNQKNTITAQGRKDPNQNTGFSLQFSNMSADSDLIGSA  397

Query  1386  GTIQTYLGRPWKEYSRTVFMESNIGDHIDPAGWFPWDGDFALKTLYYGEYMNRGPGAGTS  1565
              +  TYLGRPWK+YSRTVFM+S + D I P GW  W G+FAL TLYYGEYMN GPGAG S
Sbjct  398   NSTLTYLGRPWKQYSRTVFMQSYMSDVIRPEGWLEWQGNFALDTLYYGEYMNYGPGAGLS  457

Query  1566  KRVNWPGYHVITDKAEAMKFTVAQLIQGGSWLKNTGVDYTEGL  1694
              RV WPG H IT+ ++A  FTVAQ I G  WL +TGV +T GL
Sbjct  458   SRVKWPGLHAITNSSQASAFTVAQFIDGNLWLPSTGVKFTAGL  500



>ref|XP_010271268.1| PREDICTED: pectinesterase-like [Nelumbo nucifera]
Length=529

 Score =   468 bits (1205),  Expect = 7e-155, Method: Compositional matrix adjust.
 Identities = 236/446 (53%), Positives = 313/446 (70%), Gaps = 17/446 (4%)
 Frame = +3

Query  390   DRKVQAAVADCMELLDLSQDKVMDSMVALGNLSARARTDAHSWLSSVLTNHDTCLDGLSE  569
             D K + A ADC+EL     D V      +G+ +  + +DA +WLS+ +TN  TC +G +E
Sbjct  90    DDKAKVAWADCVELY---ADTVTQLNRTMGSKNPLSWSDAQTWLSAAITNEQTCQNGFTE  146

Query  570   ---PAR--------SIMEPMIKDLISRAKsslavlvavaPSTEDDLRALNGEFPSWVSAS  716
                P+         S    M+ + ++  K++ + + ++      + R L+  FP+WVSA+
Sbjct  147   LNLPSYLSSFPFMLSNFSKMVSNSLAINKAAASSVASLMGKQGGNRRLLSDGFPTWVSAA  206

Query  717   DRRLLEASanavaanvvvaKDGSGKYKTVAEAVASAPDNGKTRYVIYIKKGTYKENVEIG  896
             DR+LL++S+ A  A+VVVA DGSG Y+T+++AVA++      R+VIY+K+G YKENVEI 
Sbjct  207   DRKLLQSSSAASQADVVVAADGSGNYRTISQAVAASSKRSGKRFVIYVKRGVYKENVEI-  265

Query  897   KKKTNVMLIGDGLSATIITGSLNYVDGATTFNSATVAAVGDGFIAQDLRIQNTAGPEKHQ  1076
              K +N+MLIGDG+ ATI+TGS N  DG+TTF SATVA  G GFIA+D+  QNTAGP+KHQ
Sbjct  266   -KASNIMLIGDGIDATIVTGSKNVQDGSTTFRSATVAVTGGGFIARDMTFQNTAGPQKHQ  324

Query  1077  AVALRLGADQSVINRCKIDAYQDTLYAHSQRQFYRDCYITGTVDFIFGNAAAVIQNSQVV  1256
             AVALR G+D SV  RC    YQDTLY +SQRQFYRDC I GTVDFIFG+A AV+QN  + 
Sbjct  325   AVALRSGSDLSVFYRCSFKGYQDTLYVYSQRQFYRDCDIYGTVDFIFGDAVAVLQNCNIY  384

Query  1257  ARKPMAAQKNMVTAQGRTDPNQNTGTSIQNCNVSPSSDLGPVKGTIQTYLGRPWKEYSRT  1436
              RKPM+ QKN VTAQGR DPN+NTG SI N  V+ +SDL PV+G+ +TYLGRPW++YSRT
Sbjct  385   VRKPMSGQKNTVTAQGRKDPNENTGISIHNSRVTAASDLRPVQGSFKTYLGRPWQKYSRT  444

Query  1437  VFMESNIGDHIDPAGWFPWDGDFALKTLYYGEYMNRGPGAGTSKRVNWPGYHVITDKAEA  1616
             VFM++++   IDPAGW  W G+FAL TLYYGEYMN G GA TS+RV WPG+HV++  ++A
Sbjct  445   VFMKTSLDSLIDPAGWLEWSGNFALSTLYYGEYMNTGAGASTSRRVKWPGFHVMS-ASDA  503

Query  1617  MKFTVAQLIQGGSWLKNTGVDYTEGL  1694
              KFTV   + GGSW+   GV +T GL
Sbjct  504   GKFTVGNFLGGGSWIAAAGVPFTSGL  529



>gb|KHN44643.1| Putative pectinesterase/pectinesterase inhibitor 61 [Glycine 
soja]
Length=610

 Score =   471 bits (1211),  Expect = 1e-154, Method: Compositional matrix adjust.
 Identities = 238/497 (48%), Positives = 313/497 (63%), Gaps = 47/497 (9%)
 Frame = +3

Query  345   QDAVKLSANVNRRINDR-----------KVQAAVADCMELLDLSQD---KVMDSMVALGN  482
             QD + +S N+  R   R           KV AA  DC+ELL+ S +   + +DS+++   
Sbjct  112   QDLIHISFNMTLRHVSRAFYLSFAATNPKVSAAYNDCLELLEESMEALSRSLDSVLSPSA  171

Query  483   LSARART---------DAHSWLSSVLTNHDTCLDGLSEPARSIMEPMIKDLISRAKssla  635
             LS              D  +WLS+ LTN DTC +GL + + S+ + MI +L   ++    
Sbjct  172   LSGSTEVRPATVGSTEDVMTWLSTALTNQDTCAEGLQDTSGSVKDQMIDNLKDLSELVSN  231

Query  636   vlvavaPSTEDDL-----------------------RALNGEFPSWVSASDRRLLEASan  746
              L   + S   D                        R ++G+FP W++  DRRLL    +
Sbjct  232   CLAIFSASGSGDFSGVPIQNKRRLMENKEEEEENVNRDISGKFPGWLNKRDRRLLSLPVS  291

Query  747   avaanvvvaKDGSGKYKTVAEAVASAPDNGKTRYVIYIKKGTYKEN-VEIGKKKTNVMLI  923
             A+ A++ V+K G+G  KT+AEA+  AP++   R++IY++ G Y+EN +++G+KKTNVM I
Sbjct  292   AIQADITVSKTGNGTVKTIAEAIKKAPEHSTRRFIIYVRAGRYEENNLKVGRKKTNVMFI  351

Query  924   GDGLSATIITGSLNYVDGATTFNSATVAAVGDGFIAQDLRIQNTAGPEKHQAVALRLGAD  1103
             GDG   T+ITG  N +DG TTF+SA+ AA G GFIA+D+  +N AGP KHQAVALR+GAD
Sbjct  352   GDGKGKTVITGKKNVIDGMTTFHSASFAASGAGFIARDITFENYAGPAKHQAVALRVGAD  411

Query  1104  QSVINRCKIDAYQDTLYAHSQRQFYRDCYITGTVDFIFGNAAAVIQNSQVVARKPMAAQK  1283
              +V+ RC I  YQD+ Y HS RQF+R+C I GTVDFIFGNAA V Q   + ARKPMA QK
Sbjct  412   HAVVYRCNIVGYQDSCYVHSNRQFFRECNIYGTVDFIFGNAAVVFQKCNIYARKPMAQQK  471

Query  1284  NMVTAQGRTDPNQNTGTSIQNCNVSPSSDLGPVKGTIQTYLGRPWKEYSRTVFMESNIGD  1463
             N +TAQ R DPNQNTG S+ NC + P+ DL PVKG+  TYLGRPWK+YSRTV++ S +GD
Sbjct  472   NTITAQNRKDPNQNTGISLHNCRILPAPDLAPVKGSFPTYLGRPWKQYSRTVYLVSYMGD  531

Query  1464  HIDPAGWFPWDGDFALKTLYYGEYMNRGPGAGTSKRVNWPGYHVITDKAEAMKFTVAQLI  1643
             HI P GW  W+GDFAL TLYYGEYMN GPGA   +RV WPGY VI    EA +FTVAQ I
Sbjct  532   HIHPRGWLEWNGDFALNTLYYGEYMNYGPGAAVGQRVQWPGYRVIKSTMEANRFTVAQFI  591

Query  1644  QGGSWLKNTGVDYTEGL  1694
              G +WL +TGV +  GL
Sbjct  592   SGSAWLPSTGVAFAAGL  608



>ref|XP_008812473.1| PREDICTED: pectinesterase-like [Phoenix dactylifera]
Length=515

 Score =   467 bits (1201),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 246/515 (48%), Positives = 335/515 (65%), Gaps = 26/515 (5%)
 Frame = +3

Query  177   RTSSSSPSLWKARVCDPAHDPPSCMAIV--SEVSSAAPTETDGVAllqmllhssllRIQD  350
             R ++S P+L     C    +P  C ++V  S + + A T++  + L         +R+ +
Sbjct  18    RDATSDPTL----SCSQNPNPHVCSSMVGSSPLFAQAKTQSGFLHLALQAAKDRAVRVHE  73

Query  351   AVKLSANVNRRINDRKVQAAVADCMELLDLSQDKVMDSMVALGNLSARARTDAHSWLSSV  530
                L++ ++    D+  +AA  DC+EL + +  K+  SM      S+ +  DA +WLS+ 
Sbjct  74    ---LASAMDVSSLDKGAKAAWVDCLELCEDTIGKLNRSM------SSSSYDDAQTWLSAA  124

Query  531   LTNHDTCLDGLSEPARSI---MEPMIKDLISRAKsslavlvavaPSTED--DLRALNGEF  695
             + N  TC +G  E   S      P     IS + S+   +     + +   + R L+G F
Sbjct  125   MANQQTCRNGFIELGSSFPFGSSPFTSYNISESLSNSLAINKATTAAKSGGNRRLLSGGF  184

Query  696   PSWVSASDRRLLEASanavaanvvvaKDGSGKYKTVAEAVASAP--DNGKTRYVIYIKKG  869
             P+W+SA+DR+LL +S       V   KDGSG YKT++EA+A+A    NG++R+VI++K G
Sbjct  185   PNWLSAADRKLLHSSTINADLVVA--KDGSGNYKTISEAIAAATKQSNGRSRFVIHVKAG  242

Query  870   TYKENVEIGKKKTNVMLIGDGLSATIITGSLNYVDGATTFNSATVAAVGDGFIAQDLRIQ  1049
              Y ENV+   K  N+M++GDG++AT++TGS N  DG+TTF SAT A  GDGFIA+D+  Q
Sbjct  243   VYNENVQTPMK--NLMIVGDGMNATVVTGSRNVQDGSTTFRSATFAVTGDGFIARDMTFQ  300

Query  1050  NTAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYAHSQRQFYRDCYITGTVDFIFGNAA  1229
             NTAGP KHQAVALR G+D SV  RC  + YQDTLY +SQRQFYR+C + GTVDFIFG+AA
Sbjct  301   NTAGPHKHQAVALRSGSDLSVFYRCSFEGYQDTLYIYSQRQFYRNCDVYGTVDFIFGDAA  360

Query  1230  AVIQNSQVVARKPMAAQKNMVTAQGRTDPNQNTGTSIQNCNVSPSSDLGPVKGTIQTYLG  1409
              V+QN  +  RKPM+ QKN VTAQGRTDPN+NTG SI +  V+ +S+L PV+G+ +TYLG
Sbjct  361   VVLQNCSMYVRKPMSGQKNTVTAQGRTDPNENTGISIHDSAVTAASELKPVQGSFKTYLG  420

Query  1410  RPWKEYSRTVFMESNIGDHIDPAGWFPWDGDFALKTLYYGEYMNRGPGAGTSKRVNWPGY  1589
             RPWK+YSRTVFM++++   IDPAGW  W G+FAL TLYYGEYMN G GA TS+RV WPGY
Sbjct  421   RPWKKYSRTVFMKTSLDCLIDPAGWLEWSGNFALSTLYYGEYMNTGAGADTSQRVKWPGY  480

Query  1590  HVITDKAEAMKFTVAQLIQGGSWLKNTGVDYTEGL  1694
             HVIT   EA KFTVA  + G SW+  TGV +T GL
Sbjct  481   HVITSATEASKFTVANFLSGNSWIPATGVAFTSGL  515



>ref|XP_010269596.1| PREDICTED: pectinesterase-like [Nelumbo nucifera]
Length=561

 Score =   468 bits (1205),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 250/507 (49%), Positives = 319/507 (63%), Gaps = 18/507 (4%)
 Frame = +3

Query  219   CDPAHDPPSCMAIVSEVSSAAPTETDGVAllqmllhssllRIQDAVKLSANVNRRINDRK  398
             C+    P  C++ VS     A      +    +    + +R   +      + RR  D  
Sbjct  57    CEGTLYPELCVSTVSSFPDLASKTIPDIISATVQHTVNEVRTSASNCTGJRMKRRTLDPL  116

Query  399   VQAAVADCMELLDLSQDKVMDSMVALGNLS-----ARARTDAHSWLSSVLTNHDTCLDGL  563
              Q A+ DC+ELLD   + V +   AL +LS     +R   D  + LS+ +TN  TCLDG 
Sbjct  117   QQMALDDCLELLD---ETVAELKSALSDLSPKNSPSRHYNDLGTLLSAAMTNEYTCLDGF  173

Query  564   SEPARSIMEPMIKDL--ISRAKsslavlvavaPSTEDDLRA--------LNGEFPSWVSA  713
                  ++ E + + L  IS + S+   ++   P +    +A        + G FP WVS 
Sbjct  174   VHSKGNVREEIKQGLYNISHSVSNSLAMLKKIPKSNRSSKAEVFPEYGRMVGGFPRWVSP  233

Query  714   SDRRLLEASanavaanvvvaKDGSGKYKTVAEAVASAPDNGKTRYVIYIKKGTYKENVEI  893
              DR+LL+AS N    ++VVAKDGSG + T+++AVA+AP++  TR+VIYIK G Y ENV++
Sbjct  234   RDRKLLQASTNTTKFDLVVAKDGSGNFTTISDAVAAAPNSTTTRFVIYIKAGAYFENVDV  293

Query  894   GKKKTNVMLIGDGLSATIITGSLNYVDGATTFNSATVAAVGDGFIAQDLRIQNTAGPEKH  1073
              KKKT +M +GDG+  T++  + + VDG TTF SATVA VG+GFIA+D+  +N+AGP KH
Sbjct  294   DKKKTMLMFVGDGIGKTVVKANRSVVDGWTTFRSATVAVVGNGFIARDMTFENSAGPNKH  353

Query  1074  QAVALRLGADQSVINRCKIDAYQDTLYAHSQRQFYRDCYITGTVDFIFGNAAAVIQNSQV  1253
             QAVALR G+D S   RC    YQDTLY HS RQFYRDC I GTVDFIFGNAA V QN  +
Sbjct  354   QAVALRSGSDLSAFYRCSFVGYQDTLYVHSLRQFYRDCDIYGTVDFIFGNAAVVFQNCNL  413

Query  1254  VARKPMAAQKNMVTAQGRTDPNQNTGTSIQNCNVSPSSDLGPVKGTIQTYLGRPWKEYSR  1433
              AR+P   QKN+ TAQGR DPNQNT  SI +  V+ +SDL PVK + +TYLGRPWKEYSR
Sbjct  414   YARRPNDNQKNIFTAQGRQDPNQNTXISILDSKVTAASDLIPVKSSFKTYLGRPWKEYSR  473

Query  1434  TVFMESNIGDHIDPAGWFPWDGDFALKTLYYGEYMNRGPGAGTSKRVNWPGYHVITDKAE  1613
             TVF+ S + D IDPAGW  W GDFAL TLYYGEYMNRGPGA TS RV+WPGY VI    E
Sbjct  474   TVFLRSFLDDLIDPAGWLEWSGDFALTTLYYGEYMNRGPGANTSSRVSWPGYRVINSSTE  533

Query  1614  AMKFTVAQLIQGGSWLKNTGVDYTEGL  1694
             A +FTVA  IQG  WL +TGV Y  GL
Sbjct  534   ASQFTVASFIQGNEWLSSTGVPYFSGL  560



>ref|XP_003588521.1| Pectinesterase [Medicago truncatula]
 gb|AES58772.1| pectinesterase/pectinesterase inhibitor [Medicago truncatula]
Length=609

 Score =   469 bits (1208),  Expect = 4e-154, Method: Compositional matrix adjust.
 Identities = 247/556 (44%), Positives = 343/556 (62%), Gaps = 43/556 (8%)
 Frame = +3

Query  147   SVALVSIWALRTSS-------SSPSLWKARVCDPAHDPPSCM-AIVSEVSSAAPTETDGV  302
             S AL+++   R SS       S P+   +R C     P  C+ +++    S + +E + V
Sbjct  55    SAALITVVRSRASSNNSNLLHSKPTQAISRTCSKTRYPSLCINSLLDFPGSTSASEQELV  114

Query  303   AllqmllhssllRIQDAVKLSANVNRRINDRKVQAAVADCMELLDLSQDKVMDSMVALGN  482
                 +  + +   I  A+  S+ ++  + + +V+AA  DC+EL+D S D +  SM +L  
Sbjct  115   ---HISFNMTHRHISKALFASSGLSYTVANPRVRAAYEDCLELMDESMDAIRSSMDSLMT  171

Query  483   LS----------------ARARTDAHSWLSSVLTNHDTCLDGLSEPARSIMEPMIKDLIS  614
              S                A +  D  +WLS+ LTN DTCL+G  + + ++ + M+ +L  
Sbjct  172   TSSTLSNDDGESRQFSNVAGSTEDVMTWLSAALTNQDTCLEGFEDTSGTVKDQMVGNLKD  231

Query  615   RAKsslavlvavaPSTEDDL--------RALNG------EFPSWVSASDRRLLEASanav  752
              ++     L   + S ++D         R L G      EFP W+   DRRLL    + +
Sbjct  232   LSELVSNSLAIFSASGDNDFTGVPIQNKRRLMGMSDISREFPKWLEKRDRRLLSLPVSEI  291

Query  753   aanvvvaKDG-SGKYKTVAEAVASAPDNGKTRYVIYIKKGTYKEN-VEIGKKKTNVMLIG  926
              A+++V+K G +G  KT+ EA+  AP++ + R++IY++ G Y+EN +++GKKKTN+M IG
Sbjct  292   QADIIVSKSGGNGTVKTITEAIKKAPEHSRRRFIIYVRAGRYEENNLKVGKKKTNIMFIG  351

Query  927   DGLSATIITGSLNYVDGATTFNSATVAAVGDGFIAQDLRIQNTAGPEKHQAVALRLGADQ  1106
             DG   T+ITG  +  DG TTF++A+ AA G GF+A+D+  +N AGPEKHQAVALR+G+D 
Sbjct  352   DGRGKTVITGKRSVGDGMTTFHTASFAASGPGFMARDITFENYAGPEKHQAVALRVGSDH  411

Query  1107  SVINRCKIDAYQDTLYAHSQRQFYRDCYITGTVDFIFGNAAAVIQNSQVVARKPMAAQKN  1286
             +V+ RC I  YQD  Y HS RQF+R+C I GTVDFIFGNAA V Q   + ARKPMA QKN
Sbjct  412   AVVYRCNIVGYQDACYVHSNRQFFRECNIYGTVDFIFGNAAVVFQKCNIYARKPMAQQKN  471

Query  1287  MVTAQGRTDPNQNTGTSIQNCNVSPSSDLGPVKGTIQTYLGRPWKEYSRTVFMESNIGDH  1466
              +TAQ R DPNQNTG SI +C + P+ DL   KG+I+TYLGRPWK YSRTV+M S +GDH
Sbjct  472   TITAQNRKDPNQNTGISIHDCRILPAPDLASSKGSIETYLGRPWKMYSRTVYMLSYMGDH  531

Query  1467  IDPAGWFPWDGDFALKTLYYGEYMNRGPGAGTSKRVNWPGYHVITDKAEAMKFTVAQLIQ  1646
             + P GW  W+GDFALKTLYYGEYMN GPGA   +RV WPGY VIT   EA ++TVAQ I 
Sbjct  532   VHPHGWLEWNGDFALKTLYYGEYMNFGPGAAIGQRVKWPGYRVITSTLEANRYTVAQFIS  591

Query  1647  GGSWLKNTGVDYTEGL  1694
             G SWL +TGV +  GL
Sbjct  592   GSSWLPSTGVAFLAGL  607



>gb|AGG23325.1| pectin methylesterase 1 [Musa acuminata AAA Group]
Length=566

 Score =   467 bits (1202),  Expect = 6e-154, Method: Compositional matrix adjust.
 Identities = 235/449 (52%), Positives = 302/449 (67%), Gaps = 15/449 (3%)
 Frame = +3

Query  390   DRKVQAAVADCMELLDLSQDKVMDSMVALGNLSARARTDAHSWLSSVLTNHDTCLDGLSE  569
             D + + A+ DC++L   + D+++D+   L            + LS+ +TN  TCLDG + 
Sbjct  118   DTRQRYALTDCLDLFSQTLDELLDATSDLTANPGSHVDHVQTLLSAAITNQYTCLDGFAY  177

Query  570   PA-----RSIME-PM--IKDLISRAKsslavlvavaPSTEDDLRALNGE------FPSWV  707
                    RS++E P+  +  L+S + + +  +    P       AL G       FP WV
Sbjct  178   VGKDGGYRSVIEQPLYHVSHLVSNSLAMMKKIQRQKPX-HPRREALEGYGEVAEGFPVWV  236

Query  708   SASDRRLLEASanavaanvvvaKDGSGKYKTVAEAVASAPDNGKTRYVIYIKKGTYKENV  887
             S  DRRLL+A+AN    N++VAKDGSG + T+++AVA+AP   +TR+VIYIK G Y ENV
Sbjct  237   SGKDRRLLQAAANTTTPNLIVAKDGSGNFTTISDAVAAAPSKSETRFVIYIKAGAYLENV  296

Query  888   EIGKKKTNVMLIGDGLSATIITGSLNYVDGATTFNSATVAAVGDGFIAQDLRIQNTAGPE  1067
             E+GK KTN+M +GDG+  T++  S N VDG TTF SATVA VG+GF+ +D+ I+N+AGP 
Sbjct  297   EVGKSKTNLMFMGDGIGKTVVKASRNVVDGWTTFRSATVAIVGNGFLMRDMTIENSAGPS  356

Query  1068  KHQAVALRLGADQSVINRCKIDAYQDTLYAHSQRQFYRDCYITGTVDFIFGNAAAVIQNS  1247
             KHQAVALR+GAD S   RC    YQDTLYAHS RQFYR+C + GT+DFIFGNA  V+QN 
Sbjct  357   KHQAVALRVGADLSAFYRCSFVGYQDTLYAHSLRQFYRECDVYGTIDFIFGNAGVVLQNC  416

Query  1248  QVVARKPMAAQKNMVTAQGRTDPNQNTGTSIQNCNVSPSSDLGPVKGTIQTYLGRPWKEY  1427
              + ARKP++ QKN+ TAQGR DPNQNTG SIQNC V+ +SDL PV+    TYLGRPWK Y
Sbjct  417   NLYARKPLSNQKNIFTAQGREDPNQNTGISIQNCKVAAASDLAPVQSNFSTYLGRPWKAY  476

Query  1428  SRTVFMESNIGDHIDPAGWFPWDGDFALKTLYYGEYMNRGPGAGTSKRVNWPGYHVITDK  1607
             SRTV+M+S +   I+PAGW  WDGDFAL TLYYGEYMNRGPG+ T+ RV WPGY VI   
Sbjct  477   SRTVYMQSLLDSLINPAGWLEWDGDFALSTLYYGEYMNRGPGSSTANRVKWPGYRVINSS  536

Query  1608  AEAMKFTVAQLIQGGSWLKNTGVDYTEGL  1694
             AEA  FTV   I+G  WL +T V +T GL
Sbjct  537   AEASMFTVESFIEGDQWLGSTSVPFTAGL  565



>ref|XP_009382521.1| PREDICTED: pectinesterase-like [Musa acuminata subsp. malaccensis]
Length=566

 Score =   467 bits (1202),  Expect = 7e-154, Method: Compositional matrix adjust.
 Identities = 235/449 (52%), Positives = 302/449 (67%), Gaps = 15/449 (3%)
 Frame = +3

Query  390   DRKVQAAVADCMELLDLSQDKVMDSMVALGNLSARARTDAHSWLSSVLTNHDTCLDGLSE  569
             D + + A+ DC++L   + D+++D+   L            + LS+ +TN  TCLDG + 
Sbjct  118   DTRQRYALTDCLDLFSQTLDELLDATSDLTANPGSHVDHVQTLLSAAITNQYTCLDGFAY  177

Query  570   PA-----RSIME-PM--IKDLISRAKsslavlvavaPSTEDDLRALNGE------FPSWV  707
                    RS++E P+  +  L+S + + +  +    P       AL G       FP WV
Sbjct  178   VGKDGGYRSVIEQPLYHVSHLVSNSLAMMKKIQRQKPP-HPRREALEGYGEVAEGFPVWV  236

Query  708   SASDRRLLEASanavaanvvvaKDGSGKYKTVAEAVASAPDNGKTRYVIYIKKGTYKENV  887
             S  DRRLL+A+AN    N++VAKDGSG + T++EAVA+AP   +TR+VIYIK G Y ENV
Sbjct  237   SGKDRRLLQAAANTTTPNLIVAKDGSGNFTTISEAVAAAPSKSETRFVIYIKAGAYLENV  296

Query  888   EIGKKKTNVMLIGDGLSATIITGSLNYVDGATTFNSATVAAVGDGFIAQDLRIQNTAGPE  1067
             E+GK +TN+M +GDG+  T++  S N VDG TTF SATVA VG+GF+ +D+ I+N+AGP 
Sbjct  297   EVGKSQTNLMFMGDGIGKTVVKASRNVVDGWTTFRSATVAIVGNGFLMRDMTIENSAGPS  356

Query  1068  KHQAVALRLGADQSVINRCKIDAYQDTLYAHSQRQFYRDCYITGTVDFIFGNAAAVIQNS  1247
             KHQAVALR+GAD S   RC    YQDTLYAHS RQFYR+C + GT+DFIFGNA  V+QN 
Sbjct  357   KHQAVALRVGADLSAFYRCSFVGYQDTLYAHSLRQFYRECDVYGTIDFIFGNAGVVLQNC  416

Query  1248  QVVARKPMAAQKNMVTAQGRTDPNQNTGTSIQNCNVSPSSDLGPVKGTIQTYLGRPWKEY  1427
              + ARKP++ QKN+ TAQGR DPNQNTG SIQNC V+ +SDL PV+    TYLGRPWK Y
Sbjct  417   NLYARKPLSNQKNVFTAQGREDPNQNTGISIQNCKVAAASDLAPVQSNFSTYLGRPWKAY  476

Query  1428  SRTVFMESNIGDHIDPAGWFPWDGDFALKTLYYGEYMNRGPGAGTSKRVNWPGYHVITDK  1607
             SRTV+M+S +   I+PAGW  WDGDFAL TLYYGEYMNRGPG+ T+ RV WPGY VI   
Sbjct  477   SRTVYMQSLLDSLINPAGWLEWDGDFALSTLYYGEYMNRGPGSSTANRVKWPGYRVINSS  536

Query  1608  AEAMKFTVAQLIQGGSWLKNTGVDYTEGL  1694
             AEA  FTV   I+G  WL +T V +T GL
Sbjct  537   AEASMFTVESFIEGDQWLGSTSVPFTAGL  565



>gb|ACQ85264.1| pectin methylesterase [Musa acuminata AAA Group]
Length=565

 Score =   467 bits (1202),  Expect = 7e-154, Method: Compositional matrix adjust.
 Identities = 235/449 (52%), Positives = 302/449 (67%), Gaps = 15/449 (3%)
 Frame = +3

Query  390   DRKVQAAVADCMELLDLSQDKVMDSMVALGNLSARARTDAHSWLSSVLTNHDTCLDGLSE  569
             D + + A+ DC++L   + D+++D+   L            + LS+ +TN  TCLDG + 
Sbjct  117   DTRQRYALTDCLDLFSQTLDELLDATSDLTANPGSHVDHVQTLLSAAITNQYTCLDGFAY  176

Query  570   PA-----RSIME-PM--IKDLISRAKsslavlvavaPSTEDDLRALNGE------FPSWV  707
                    RS++E P+  +  L+S + + +  +    P       AL G       FP WV
Sbjct  177   VGKDGGYRSVIEQPLYHVSHLVSNSLAMMKKIQRQKPP-HPRREALEGYGEVAEGFPVWV  235

Query  708   SASDRRLLEASanavaanvvvaKDGSGKYKTVAEAVASAPDNGKTRYVIYIKKGTYKENV  887
             S  DRRLL+A+AN    N++VAKDGSG + T+++AVA+AP   +TR+VIYIK G Y ENV
Sbjct  236   SGKDRRLLQAAANTTTPNLIVAKDGSGNFTTISDAVAAAPSKSETRFVIYIKAGAYLENV  295

Query  888   EIGKKKTNVMLIGDGLSATIITGSLNYVDGATTFNSATVAAVGDGFIAQDLRIQNTAGPE  1067
             E+GK KTN+M +GDG+  T++  S N VDG TTF SATVA VG+GF+ +D+ I+N+AGP 
Sbjct  296   EVGKSKTNLMFMGDGIGKTVVKASRNVVDGWTTFRSATVAIVGNGFLMRDMTIENSAGPS  355

Query  1068  KHQAVALRLGADQSVINRCKIDAYQDTLYAHSQRQFYRDCYITGTVDFIFGNAAAVIQNS  1247
             KHQAVALR+GAD S   RC    YQDTLYAHS RQFYR+C + GT+DFIFGNA  V+QN 
Sbjct  356   KHQAVALRVGADLSAFYRCSFVGYQDTLYAHSLRQFYRECDVYGTIDFIFGNAGVVLQNC  415

Query  1248  QVVARKPMAAQKNMVTAQGRTDPNQNTGTSIQNCNVSPSSDLGPVKGTIQTYLGRPWKEY  1427
              + ARKP++ QKN+ TAQGR DPNQNTG SIQNC V+ +SDL PV+    TYLGRPWK Y
Sbjct  416   NLYARKPLSNQKNIFTAQGREDPNQNTGISIQNCKVAAASDLAPVQSNFSTYLGRPWKAY  475

Query  1428  SRTVFMESNIGDHIDPAGWFPWDGDFALKTLYYGEYMNRGPGAGTSKRVNWPGYHVITDK  1607
             SRTV+M+S +   I+PAGW  WDGDFAL TLYYGEYMNRGPG+ T+ RV WPGY VI   
Sbjct  476   SRTVYMQSLLDSLINPAGWLEWDGDFALSTLYYGEYMNRGPGSSTANRVKWPGYRVINSS  535

Query  1608  AEAMKFTVAQLIQGGSWLKNTGVDYTEGL  1694
             AEA  FTV   I+G  WL +T V +T GL
Sbjct  536   AEASMFTVESFIEGDQWLGSTSVPFTAGL  564



>ref|XP_010932330.1| PREDICTED: pectinesterase-like [Elaeis guineensis]
Length=537

 Score =   466 bits (1198),  Expect = 1e-153, Method: Compositional matrix adjust.
 Identities = 248/451 (55%), Positives = 303/451 (67%), Gaps = 19/451 (4%)
 Frame = +3

Query  396   KVQAAVADCMELLDLSQDKVMDSMVALGNLSARA-------RTDAHSWLSSVLTNHDTC-  551
             ++ +AV+DC++LLDLS D++  ++ A    +A A       R+D  SWLS+ L N +TC 
Sbjct  86    RLSSAVSDCLDLLDLSSDEISSTISASQPSTASATAGTGNRRSDVRSWLSAALGNQETCK  145

Query  552   --LDGLSEPARSIMEPMIKDLISRA----KsslavlvavaPSTEDDLRALNGE----FPS  701
               L+G +    S++   ++ + S      +   A    V  +     R L G+    FP 
Sbjct  146   ESLEGTNSVLGSLVSGGLQSITSLVADSLRDVAAGSGGVGGAGNAGRRRLMGKVSDGFPG  205

Query  702   WVSASDRRLLEASanavaanvvvaKDGSGKYKTVAEAVASAPDNGKTRYVIYIKKGTYKE  881
             WVS  DRRLL+A A   A  VV  KDGSGKY TV  AVA+AP     RYVIY+KKG YKE
Sbjct  206   WVSLGDRRLLQAPAGTAADAVVA-KDGSGKYTTVGAAVAAAPTESTKRYVIYVKKGAYKE  264

Query  882   NVEIGKKKTNVMLIGDGLSATIITGSLNYVDGATTFNSATVAAVGDGFIAQDLRIQNTAG  1061
             NVEI KK  N+ML+GDGL  TII+GS N+VDG TT+ SAT A  G GFI +DL I+NTAG
Sbjct  265   NVEIKKKTWNIMLVGDGLGQTIISGSRNFVDGWTTYRSATFAVSGKGFIVRDLTIENTAG  324

Query  1062  PEKHQAVALRLGADQSVINRCKIDAYQDTLYAHSQRQFYRDCYITGTVDFIFGNAAAVIQ  1241
             P KHQAVALR  +D SV  RC    YQDTLYAHS RQFYR+C I GTVDF+FG+AAAV Q
Sbjct  325   PSKHQAVALRSDSDLSVYYRCSFLGYQDTLYAHSLRQFYRECRIAGTVDFVFGDAAAVFQ  384

Query  1242  NSQVVARKPMAAQKNMVTAQGRTDPNQNTGTSIQNCNVSPSSDLGPVKGTIQTYLGRPWK  1421
             +  ++AR+P+  QKN VTAQGR DPNQNTG S+Q CNVS  SDL     +  TYLGRPWK
Sbjct  385   SCTLLARRPLPDQKNSVTAQGRKDPNQNTGFSLQFCNVSADSDLAGFTNSTATYLGRPWK  444

Query  1422  EYSRTVFMESNIGDHIDPAGWFPWDGDFALKTLYYGEYMNRGPGAGTSKRVNWPGYHVIT  1601
             EYSRTV M+S +G  + P GW  W+GDFAL+TLYYGEYMN GPG+G + RV WPGYHVIT
Sbjct  445   EYSRTVVMQSYLGVAVRPEGWLEWNGDFALRTLYYGEYMNYGPGSGLAGRVKWPGYHVIT  504

Query  1602  DKAEAMKFTVAQLIQGGSWLKNTGVDYTEGL  1694
             D A+A+ FTV Q I G  WL +TGV YT GL
Sbjct  505   DSAQAVNFTVGQFIDGNLWLPSTGVKYTAGL  535



>ref|XP_010917364.1| PREDICTED: pectinesterase [Elaeis guineensis]
Length=520

 Score =   464 bits (1195),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 241/454 (53%), Positives = 300/454 (66%), Gaps = 20/454 (4%)
 Frame = +3

Query  390   DRKVQAAVADCMELLDLSQDKVMDSMVA------------LGNLSARARTDAHSWLSSVL  533
             D ++ +A++DC++LLDLS D++  ++ A                +   R+D  SWLS+ L
Sbjct  66    DLRLSSAISDCLDLLDLSSDELSLTISASQASRTSTATSSAAEGTGNRRSDLRSWLSAAL  125

Query  534   TNHDTC---LDGLSEPARSIMEPMIKDLISRAKsslavlvavaPSTEDDLRALNGE----  692
              N DTC   LDG S    S++   ++ + S     L  +VA +       R L G+    
Sbjct  126   GNQDTCKESLDGTSSVVGSLVGGGLETVTSLVADGLRQVVAGSGGGNAGRRRLLGKVSEG  185

Query  693   FPSWVSASDRRLLEASanavaanvvvaKDGSGKYKTVAEAVASAPDNGKTRYVIYIKKGT  872
             FP WVSA DRRLL+A     A  VV  +DGSG+Y TV  AV +AP     RYVIY+K+G 
Sbjct  186   FPKWVSAGDRRLLQAPGAVAADAVVA-QDGSGQYTTVGAAVEAAPTESTKRYVIYVKRGV  244

Query  873   YKENVEIGKKKTNVMLIGDGLSATIITGSLNYVDGATTFNSATVAAVGDGFIAQDLRIQN  1052
             Y ENV+I KK  N+ML+GDG+  TII+GS N+VDG TT+ SAT A  G GFIA+DL I+N
Sbjct  245   YNENVDIKKKWWNIMLVGDGMGQTIISGSRNFVDGWTTYRSATFAVSGKGFIARDLTIEN  304

Query  1053  TAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYAHSQRQFYRDCYITGTVDFIFGNAAA  1232
             TAGP KHQAVALR  +D SV  RC    YQDTLYAH+ RQFYR+C ITGTVDF+FGNAAA
Sbjct  305   TAGPSKHQAVALRSDSDLSVYYRCSFLGYQDTLYAHALRQFYRECLITGTVDFVFGNAAA  364

Query  1233  VIQNSQVVARKPMAAQKNMVTAQGRTDPNQNTGTSIQNCNVSPSSDLGPVKGTIQTYLGR  1412
             V QN  ++AR+P+  QKN VTA GR DPNQNTG ++Q CN+S  SDL     +  TYLGR
Sbjct  365   VFQNCVLLARRPLPDQKNSVTAHGRKDPNQNTGFALQFCNISADSDLAGFTNSTATYLGR  424

Query  1413  PWKEYSRTVFMESNIGDHIDPAGWFPWDGDFALKTLYYGEYMNRGPGAGTSKRVNWPGYH  1592
             PWKEYSRTVFM+S +G  + P GW  WDG+FAL TLYY EYMN GPG+G + RV W GYH
Sbjct  425   PWKEYSRTVFMQSYLGGLLRPEGWLEWDGNFALDTLYYAEYMNSGPGSGLAGRVKWTGYH  484

Query  1593  VITDKAEAMKFTVAQLIQGGSWLKNTGVDYTEGL  1694
             V+T+ AEA+ FTV Q I G  WL +TGV YT GL
Sbjct  485   VMTNSAEAVNFTVGQFIDGNLWLPSTGVKYTSGL  518



>ref|XP_010271269.1| PREDICTED: pectinesterase-like [Nelumbo nucifera]
Length=529

 Score =   464 bits (1195),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 232/446 (52%), Positives = 310/446 (70%), Gaps = 17/446 (4%)
 Frame = +3

Query  390   DRKVQAAVADCMELLDLSQDKVMDSMVALGNLSARARTDAHSWLSSVLTNHDTCLDGLSE  569
             D K + A  DC+EL     D V     ALG+ +  + +DA +WLS+ +TN  TC +G  E
Sbjct  90    DEKARIAWDDCVELY---ADTVTQLNRALGSKNPLSWSDAQTWLSAAITNQQTCQNGFIE  146

Query  570   PARSI-----------MEPMIKDLISRAKsslavlvavaPSTEDDLRALNGEFPSWVSAS  716
               +S               M+ + ++  K + +   ++      + R L+  FP+WVSA+
Sbjct  147   LGKSSYLSSFPFMLSNFSKMVSNSLAINKEAASSAASLLGKQGGNRRLLSDGFPTWVSAA  206

Query  717   DRRLLEASanavaanvvvaKDGSGKYKTVAEAVASAPDNGKTRYVIYIKKGTYKENVEIG  896
             DR+LL++ + A  A+VVVA DGSG YKT+++AVA++P     R+VIY+K+G Y+ENVEI 
Sbjct  207   DRKLLQSPSAASQADVVVAADGSGNYKTISQAVAASPKRSGKRFVIYVKRGVYRENVEI-  265

Query  897   KKKTNVMLIGDGLSATIITGSLNYVDGATTFNSATVAAVGDGFIAQDLRIQNTAGPEKHQ  1076
                +N+MLIGDG+ AT +TGS N  DG+TTF +ATVA  GDGFIA+D+  +NTAGP+KHQ
Sbjct  266   -TASNIMLIGDGIDATTVTGSKNVQDGSTTFRTATVAVTGDGFIARDMTFENTAGPQKHQ  324

Query  1077  AVALRLGADQSVINRCKIDAYQDTLYAHSQRQFYRDCYITGTVDFIFGNAAAVIQNSQVV  1256
             AV+LR G+D SV  RC    YQDTLY +SQRQFYRDC I GTVDFIFG+A AV+QN  + 
Sbjct  325   AVSLRSGSDLSVFYRCSFKGYQDTLYVYSQRQFYRDCDIYGTVDFIFGDAVAVLQNCNIY  384

Query  1257  ARKPMAAQKNMVTAQGRTDPNQNTGTSIQNCNVSPSSDLGPVKGTIQTYLGRPWKEYSRT  1436
              RKPM+ Q+N VTAQGRTDPN+NTG SI N  V+ +SDL PV+G+ +TYLGRPW++YSRT
Sbjct  385   VRKPMSGQQNTVTAQGRTDPNENTGISIHNSRVTAASDLRPVQGSFKTYLGRPWQKYSRT  444

Query  1437  VFMESNIGDHIDPAGWFPWDGDFALKTLYYGEYMNRGPGAGTSKRVNWPGYHVITDKAEA  1616
             VFM++++   +DPAGW  W G+FAL TLYYGEYMN G GA TS+RV WPG+HV++  ++A
Sbjct  445   VFMKTSLDSLVDPAGWLEWSGNFALSTLYYGEYMNIGGGASTSRRVKWPGFHVMS-ASDA  503

Query  1617  MKFTVAQLIQGGSWLKNTGVDYTEGL  1694
              KFTV   + GGSW+  TGV +T GL
Sbjct  504   GKFTVENFLGGGSWIAATGVPFTSGL  529



>ref|XP_010910186.1| PREDICTED: pectinesterase-like [Elaeis guineensis]
Length=516

 Score =   463 bits (1191),  Expect = 7e-153, Method: Compositional matrix adjust.
 Identities = 253/522 (48%), Positives = 337/522 (65%), Gaps = 21/522 (4%)
 Frame = +3

Query  150   VALVSIWALRTSSSSPSLWKARVCDPAHDPPSCMAIVSEVSSAAPTETDGVAllqmllhs  329
              A     A R ++S P L     C     P  C ++VS     A  +T       + L +
Sbjct  9     FAFSLFMAFRIATSEPILIS---CRQTPYPHVCSSMVSSSPLFAQAKTQS-GFRHLALQA  64

Query  330   sllRIQDAVKLSANVNRRINDRKVQAAVADCMELLDLSQDKVMDSMVALGNLSARARTDA  509
             ++ R   A +L++ ++    D +V+AA ADC+EL + +  K+  SM      S+ +  DA
Sbjct  65    AIDRAIRAHELASTMDVSSLDERVKAAWADCLELCEDTIGKLNRSM------SSSSYDDA  118

Query  510   HSWLSSVLTNHDTCLDGLSEPARSI---MEPMIKDLISRA-KsslavlvavaPSTED-DL  674
              +WLS+ + N  TC +G  E   S      P +   IS +  + LA+ +A  P+    + 
Sbjct  119   QTWLSAAMANQQTCRNGFLELDSSFPLGSSPFMSYNISESLSNLLAINMATTPAMSGGNR  178

Query  675   RALNGEFPSWVSASDRRLLEASanavaanvvvaKDGSGKYKTVAEAVASA--PDNGKTRY  848
             R L+  FP+W+SA+DR+LL +S       V   KDGSG YKT++EA+A+A    +GK+R+
Sbjct  179   RLLSDGFPNWLSATDRKLLRSSTINADLVVA--KDGSGDYKTISEAIAAAMKQSSGKSRF  236

Query  849   VIYIKKGTYKENVEIGKKKTNVMLIGDGLSATIITGSLNYVDGATTFNSATVAAVGDGFI  1028
             VI++K G Y ENV+   K  N+M+IGDG+ AT++TGS N  DG+TTF SAT A  GDGFI
Sbjct  237   VIHVKTGVYDENVQTSMK--NLMIIGDGMDATVVTGSKNVKDGSTTFRSATFAVTGDGFI  294

Query  1029  AQDLRIQNTAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYAHSQRQFYRDCYITGTVD  1208
             A+D+  +NTAGP+K QAVALR G+D SV  +C    YQDTLY +SQRQFYR+C I GTVD
Sbjct  295   ARDMTFENTAGPQKQQAVALRSGSDLSVFYQCSFKGYQDTLYVYSQRQFYRNCDIYGTVD  354

Query  1209  FIFGNAAAVIQNSQVVARKPMAAQKNMVTAQGRTDPNQNTGTSIQNCNVSPSSDLGPVKG  1388
             FIFG+AA V+QN  +  RKPM+ QKN VTAQGRTDPN+NTG SI +  V+ +SDL PV+G
Sbjct  355   FIFGDAAVVLQNCNMHVRKPMSGQKNTVTAQGRTDPNENTGISIHDSAVTAASDLKPVQG  414

Query  1389  TIQTYLGRPWKEYSRTVFMESNIGDHIDPAGWFPWDGDFALKTLYYGEYMNRGPGAGTSK  1568
             + +TYLGRPW+EYSRTVFM++++   IDPAGW  W G+FAL TLYYGEYMN GPGA TS+
Sbjct  415   SFETYLGRPWQEYSRTVFMKTSLDSLIDPAGWLEWSGNFALSTLYYGEYMNTGPGADTSQ  474

Query  1569  RVNWPGYHVITDKAEAMKFTVAQLIQGGSWLKNTGVDYTEGL  1694
             RV WPGYHVIT  AEA KFTV   + G SW+  T V +T GL
Sbjct  475   RVKWPGYHVITSAAEASKFTVGNFLSGNSWIPATEVPFTSGL  516



>ref|XP_009359674.1| PREDICTED: pectinesterase/pectinesterase inhibitor PPE8B-like 
[Pyrus x bretschneideri]
Length=509

 Score =   462 bits (1189),  Expect = 9e-153, Method: Compositional matrix adjust.
 Identities = 238/458 (52%), Positives = 303/458 (66%), Gaps = 12/458 (3%)
 Frame = +3

Query  342   IQDAVKLSANVNRRINDRKVQAAVADCMELLDLSQDKVMDSMVA------LGNLSARART  503
             +Q    + +       D  +  A++DC++LLD + D++  S+ A        N + +  +
Sbjct  55    VQQVASILSQFATAFGDFHLSNAISDCLDLLDFTADELNWSLSASQNPEGKDNSTGKLSS  114

Query  504   DAHSWLSSVLTNHDTCLDGLSEPARSIMEPMIKDLISRAKssla-vlvavaPSTEDDLRA  680
             D  +WLS+ L N DTC DG  E   SI++ ++   +++  S +  +L  V P+T  D   
Sbjct  115   DLRTWLSAALVNQDTCSDGF-EGTNSIVKGLVTTGLNQVTSLVQGLLTQVQPNT--DHHG  171

Query  681   LNGEFPSWVSASDRRLLEASanavaanvvvaKDGSGKYKTVAEAVASAPDNGKTRYVIYI  860
              NGE PSWV A DR+LL+A    V A V   +DG+G +  V +AV +APD   TRYVIYI
Sbjct  172   PNGEIPSWVKAEDRKLLQAGGVNVDAVVA--QDGTGNFTNVTDAVLAAPDESMTRYVIYI  229

Query  861   KKGTYKENVEIGKKKTNVMLIGDGLSATIITGSLNYVDGATTFNSATVAAVGDGFIAQDL  1040
             K+GTYKENVEI KKK N+M+IGDG+ ATII+GS N+VDG TTF SAT A  G GFIA+DL
Sbjct  230   KRGTYKENVEIKKKKWNLMMIGDGMDATIISGSRNFVDGWTTFRSATFAVSGRGFIARDL  289

Query  1041  RIQNTAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYAHSQRQFYRDCYITGTVDFIFG  1220
               +NTAGPEKHQAVALR  +D SV  RC+I  YQDTLYAH+ RQFYRDC I+GTVDFIFG
Sbjct  290   TFENTAGPEKHQAVALRSDSDLSVFYRCQIRGYQDTLYAHAMRQFYRDCKISGTVDFIFG  349

Query  1221  NAAAVIQNSQVVARKPMAAQKNMVTAQGRTDPNQNTGTSIQNCNVSPSSDLGPVKGTIQT  1400
             +A  V QN Q++A+K +  QKN VTAQGR DPN+ TG SIQ CN++  +DL P   +  T
Sbjct  350   DATVVFQNCQILAKKGLPNQKNSVTAQGRKDPNEPTGISIQFCNITADADLLPFVNSTST  409

Query  1401  YLGRPWKEYSRTVFMESNIGDHIDPAGWFPWDGDFALKTLYYGEYMNRGPGAGTSKRVNW  1580
             YLGRPWK YSRTV M+S + + I P GW  W+ DFAL TL YGEY+N GPGAG   RV W
Sbjct  410   YLGRPWKLYSRTVIMQSFLSNAIRPEGWLEWNADFALSTLSYGEYINYGPGAGLESRVKW  469

Query  1581  PGYHVITDKAEAMKFTVAQLIQGGSWLKNTGVDYTEGL  1694
             PGY V  +  +   +TVAQ I+G  WL  TGV YT GL
Sbjct  470   PGYRVFNESTQVQNYTVAQFIEGDLWLPTTGVKYTAGL  507



>ref|XP_008806757.1| PREDICTED: LOW QUALITY PROTEIN: probable pectinesterase/pectinesterase 
inhibitor 34 [Phoenix dactylifera]
Length=587

 Score =   465 bits (1196),  Expect = 1e-152, Method: Compositional matrix adjust.
 Identities = 239/450 (53%), Positives = 300/450 (67%), Gaps = 19/450 (4%)
 Frame = +3

Query  402   QAAVADCMELLDLSQDKVMDSMVALG----NLSARARTDAHSWLSSVLTNHDTCLDGLSE  569
             +AA  DCMELLD S D++  S+  +       +  +  D  +WLS+ LTN DTC +GL++
Sbjct  136   RAAYEDCMELLDDSLDQLSQSLAVVSPSASGPAGSSDVDVLTWLSAALTNQDTCTEGLAD  195

Query  570   PA----RSIMEPMIKDLISRAKsslavlvava--------PSTEDDLRAL---NGEFPSW  704
              A    R  ME  +KDL     + LA+  A          P      R L   +GEFP W
Sbjct  196   VADGYVRGQMESYLKDLAELVSNCLAIFSATRRNKDFSGIPIQNKKRRLLSSGDGEFPEW  255

Query  705   VSASDRRLLEASanavaanvvvaKDGSGKYKTVAEAVASAPDNGKTRYVIYIKKGTYKEN  884
             +   DRRLL+     + A++VV+KDG+G +K++A+AV +AP++   R VIY+K G Y EN
Sbjct  256   LGRRDRRLLQVPVAKIQADMVVSKDGNGTHKSIADAVKAAPEHSTRRIVIYVKAGRYDEN  315

Query  885   VEIGKKKTNVMLIGDGLSATIITGSLNYVDGATTFNSATVAAVGDGFIAQDLRIQNTAGP  1064
             ++I +KKTN+M IGDG + TI+ GS +  +  TTF++AT A+ G+GFI +D+ I+N AGP
Sbjct  316   IKISRKKTNLMFIGDGKAKTIVAGSRSVAENYTTFHTATFASTGNGFIMRDMTIENWAGP  375

Query  1065  EKHQAVALRLGADQSVINRCKIDAYQDTLYAHSQRQFYRDCYITGTVDFIFGNAAAVIQN  1244
              KHQAVALR+GAD +V+ RC I  YQDTLY HSQRQF+R+C + GTVDFIFGNAA V+QN
Sbjct  376   AKHQAVALRVGADHAVVYRCNIIGYQDTLYVHSQRQFFRECDVYGTVDFIFGNAAVVLQN  435

Query  1245  SQVVARKPMAAQKNMVTAQGRTDPNQNTGTSIQNCNVSPSSDLGPVKGTIQTYLGRPWKE  1424
               + ARKPMA QKN +TAQ R DPNQNTG SI  C V  + DL PVK    TYLGRPWK 
Sbjct  436   CSLWARKPMAMQKNTITAQNRKDPNQNTGISIHACRVVATPDLEPVKSNYSTYLGRPWKL  495

Query  1425  YSRTVFMESNIGDHIDPAGWFPWDGDFALKTLYYGEYMNRGPGAGTSKRVNWPGYHVITD  1604
             YSRTV+M S +GDHI PAGW  W+  FAL TLYYGEYMN GPGA   KRV WPGY VIT 
Sbjct  496   YSRTVYMLSYMGDHIHPAGWLEWNATFALDTLYYGEYMNYGPGAAVGKRVKWPGYRVITL  555

Query  1605  KAEAMKFTVAQLIQGGSWLKNTGVDYTEGL  1694
               EA KFTVAQ I G SWL +TGV +  GL
Sbjct  556   PEEASKFTVAQFIYGSSWLPSTGVAFLAGL  585



>gb|ERM94148.1| hypothetical protein AMTR_s00010p00161740 [Amborella trichopoda]
Length=515

 Score =   462 bits (1189),  Expect = 1e-152, Method: Compositional matrix adjust.
 Identities = 234/440 (53%), Positives = 301/440 (68%), Gaps = 14/440 (3%)
 Frame = +3

Query  396   KVQAAVADCMELLDLSQDKVMDSMVALGNLSARARTDAHSWLSSVLTNHDTCLDGLSEP-  572
             + QAA ADC+EL + +  K+  ++V+    S  A +D  +WLS+ +TN DTC  G SE  
Sbjct  83    RAQAAWADCLELTEDTVSKLNKTLVS----SNLASSDTLTWLSAAITNDDTCRTGFSETP  138

Query  573   --ARSIMEPMIKDLISRAKsslavlvavaPSTEDDLRALNGE-FPSWVSASDRRLLEASa  743
                 + +  ++ + ++  KS  A L  ++  T   L ++    FP WV A DRRLL+AS 
Sbjct  139   WLKSTDLSKLLSNSLAVEKSFAARLDGLSGHTNRKLLSVQSRGFPEWVVAGDRRLLQAST  198

Query  744   navaanvvvaKDGSGKYKTVAEAVASAPDNGKT---RYVIYIKKGTYKENVEIGKKKTNV  914
                   V   KDGSG + T++ A+ ++    KT   R+VIY+K+GTYKEN+EI K   N+
Sbjct  199   GKANLVVA--KDGSGGFATISAAITASEKQRKTSTSRFVIYVKEGTYKENIEIKKSMKNL  256

Query  915   MLIGDGLSATIITGSLNYVDGATTFNSATVAAVGDGFIAQDLRIQNTAGPEKHQAVALRL  1094
             M +GDG+  TIITGS N  DG+TTF SAT A   DGFIA+DL  +NTAGP+KHQAVA R 
Sbjct  257   MFVGDGIDKTIITGSRNVQDGSTTFRSATFAVAADGFIAKDLTFENTAGPQKHQAVAFRS  316

Query  1095  GADQSVINRCKIDAYQDTLYAHSQRQFYRDCYITGTVDFIFGNAAAVIQNSQVVARKPMA  1274
             G+D SV+ RC    YQDTLY +SQRQFYR+C I GTVDFIFGNAAAV+QN  +  RKPM+
Sbjct  317   GSDLSVLYRCSFKGYQDTLYTYSQRQFYRECDIYGTVDFIFGNAAAVLQNCNIYVRKPMS  376

Query  1275  AQKNMVTAQGRTDPNQNTGTSIQNCNVSPSSDLGPVKGTIQTYLGRPWKEYSRTVFMESN  1454
             +QKN +TAQGRTDPNQNTG SI +  VS SSDL  V+ + +TYLGRPWKEYSRTVFM++ 
Sbjct  377   SQKNTITAQGRTDPNQNTGLSIHDSKVSASSDLKAVQNSFKTYLGRPWKEYSRTVFMKTA  436

Query  1455  IGDHIDPAGWFPWDGDFALKTLYYGEYMNRGPGAGTSKRVNWPGYHVITDKAEAMKFTVA  1634
             + + IDP+GW  W G+FAL+TLYYGEYMN G GA T  RV W G+HV++  +EA KFTV 
Sbjct  437   LDNLIDPSGWLQWSGNFALRTLYYGEYMNSGAGAVTKSRVKWSGFHVMS-ASEAAKFTVG  495

Query  1635  QLIQGGSWLKNTGVDYTEGL  1694
               I GGSW+ NTG+ YT GL
Sbjct  496   SFISGGSWIPNTGLPYTSGL  515



>ref|XP_006826911.2| PREDICTED: pectinesterase [Amborella trichopoda]
Length=510

 Score =   461 bits (1187),  Expect = 2e-152, Method: Compositional matrix adjust.
 Identities = 234/440 (53%), Positives = 301/440 (68%), Gaps = 14/440 (3%)
 Frame = +3

Query  396   KVQAAVADCMELLDLSQDKVMDSMVALGNLSARARTDAHSWLSSVLTNHDTCLDGLSEP-  572
             + QAA ADC+EL + +  K+  ++V+    S  A +D  +WLS+ +TN DTC  G SE  
Sbjct  78    RAQAAWADCLELTEDTVSKLNKTLVS----SNLASSDTLTWLSAAITNDDTCRTGFSETP  133

Query  573   --ARSIMEPMIKDLISRAKsslavlvavaPSTEDDLRALNGE-FPSWVSASDRRLLEASa  743
                 + +  ++ + ++  KS  A L  ++  T   L ++    FP WV A DRRLL+AS 
Sbjct  134   WLKSTDLSKLLSNSLAVEKSFAARLDGLSGHTNRKLLSVQSRGFPEWVVAGDRRLLQAST  193

Query  744   navaanvvvaKDGSGKYKTVAEAVASAPDNGKT---RYVIYIKKGTYKENVEIGKKKTNV  914
                   V   KDGSG + T++ A+ ++    KT   R+VIY+K+GTYKEN+EI K   N+
Sbjct  194   GKANLVVA--KDGSGGFATISAAITASEKQRKTSTSRFVIYVKEGTYKENIEIKKSMKNL  251

Query  915   MLIGDGLSATIITGSLNYVDGATTFNSATVAAVGDGFIAQDLRIQNTAGPEKHQAVALRL  1094
             M +GDG+  TIITGS N  DG+TTF SAT A   DGFIA+DL  +NTAGP+KHQAVA R 
Sbjct  252   MFVGDGIDKTIITGSRNVQDGSTTFRSATFAVAADGFIAKDLTFENTAGPQKHQAVAFRS  311

Query  1095  GADQSVINRCKIDAYQDTLYAHSQRQFYRDCYITGTVDFIFGNAAAVIQNSQVVARKPMA  1274
             G+D SV+ RC    YQDTLY +SQRQFYR+C I GTVDFIFGNAAAV+QN  +  RKPM+
Sbjct  312   GSDLSVLYRCSFKGYQDTLYTYSQRQFYRECDIYGTVDFIFGNAAAVLQNCNIYVRKPMS  371

Query  1275  AQKNMVTAQGRTDPNQNTGTSIQNCNVSPSSDLGPVKGTIQTYLGRPWKEYSRTVFMESN  1454
             +QKN +TAQGRTDPNQNTG SI +  VS SSDL  V+ + +TYLGRPWKEYSRTVFM++ 
Sbjct  372   SQKNTITAQGRTDPNQNTGLSIHDSKVSASSDLKAVQNSFKTYLGRPWKEYSRTVFMKTA  431

Query  1455  IGDHIDPAGWFPWDGDFALKTLYYGEYMNRGPGAGTSKRVNWPGYHVITDKAEAMKFTVA  1634
             + + IDP+GW  W G+FAL+TLYYGEYMN G GA T  RV W G+HV++  +EA KFTV 
Sbjct  432   LDNLIDPSGWLQWSGNFALRTLYYGEYMNSGAGAVTKSRVKWSGFHVMS-ASEAAKFTVG  490

Query  1635  QLIQGGSWLKNTGVDYTEGL  1694
               I GGSW+ NTG+ YT GL
Sbjct  491   SFISGGSWIPNTGLPYTSGL  510



>dbj|BAF42041.1| pectin methylesterase 4 [Pyrus communis]
Length=509

 Score =   461 bits (1186),  Expect = 3e-152, Method: Compositional matrix adjust.
 Identities = 238/458 (52%), Positives = 302/458 (66%), Gaps = 12/458 (3%)
 Frame = +3

Query  342   IQDAVKLSANVNRRINDRKVQAAVADCMELLDLSQDKVMDSMVA------LGNLSARART  503
             +Q    + +       D  +  A++DC++LLD + D++  S+ A        N + +  +
Sbjct  55    VQQVASILSQFATAFGDFHLSNAISDCLDLLDFTADELNWSLSASQNPEGKDNSTGKLSS  114

Query  504   DAHSWLSSVLTNHDTCLDGLSEPARSIMEPMIKDLISRAKssla-vlvavaPSTEDDLRA  680
             D  +WLS+ L N DTC DG  E   SI++ ++   +++  S +  +L  V P+T  D   
Sbjct  115   DLRTWLSAALVNQDTCSDGF-EGTNSIVKGLVTTGLNQVTSLVQGLLTQVQPNT--DHHG  171

Query  681   LNGEFPSWVSASDRRLLEASanavaanvvvaKDGSGKYKTVAEAVASAPDNGKTRYVIYI  860
              NGE PSWV A DR+LL+A    V A V   +DG+G +  V +AV +APD   TRYVIYI
Sbjct  172   PNGEIPSWVKAEDRKLLQAGGVNVDAVVA--QDGTGNFTNVTDAVLAAPDESMTRYVIYI  229

Query  861   KKGTYKENVEIGKKKTNVMLIGDGLSATIITGSLNYVDGATTFNSATVAAVGDGFIAQDL  1040
             K GTYKENVEI KKK N+M+IGDG+ ATII+GS N+VDG TTF SAT A  G GFIA+DL
Sbjct  230   KGGTYKENVEIKKKKWNLMMIGDGMDATIISGSRNFVDGWTTFRSATFAVSGRGFIARDL  289

Query  1041  RIQNTAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYAHSQRQFYRDCYITGTVDFIFG  1220
               +NTAGPEKHQAVALR  +D SV  RC+I  YQDTLYAH+ RQFYRDC I+GTVDFIFG
Sbjct  290   TFENTAGPEKHQAVALRSDSDLSVFYRCQIRGYQDTLYAHAMRQFYRDCKISGTVDFIFG  349

Query  1221  NAAAVIQNSQVVARKPMAAQKNMVTAQGRTDPNQNTGTSIQNCNVSPSSDLGPVKGTIQT  1400
             +A  V QN Q++A+K +  QKN VTAQGR DPN+ TG SIQ CN++  +DL P   +  T
Sbjct  350   DATVVFQNCQILAKKGLPNQKNSVTAQGRKDPNEPTGISIQFCNITADADLLPFVNSTST  409

Query  1401  YLGRPWKEYSRTVFMESNIGDHIDPAGWFPWDGDFALKTLYYGEYMNRGPGAGTSKRVNW  1580
             YLGRPWK YSRTV M+S + + I P GW  W+ DFAL TL YGEY+N GPGAG   RV W
Sbjct  410   YLGRPWKLYSRTVIMQSFLSNAIRPEGWLEWNADFALSTLSYGEYINYGPGAGLESRVKW  469

Query  1581  PGYHVITDKAEAMKFTVAQLIQGGSWLKNTGVDYTEGL  1694
             PGY V  +  +   +TVAQ I+G  WL  TGV YT GL
Sbjct  470   PGYRVFNESTQVQNYTVAQFIEGDLWLPTTGVKYTAGL  507



>ref|XP_008337790.1| PREDICTED: pectinesterase/pectinesterase inhibitor PPE8B [Malus 
domestica]
Length=509

 Score =   461 bits (1185),  Expect = 4e-152, Method: Compositional matrix adjust.
 Identities = 238/458 (52%), Positives = 303/458 (66%), Gaps = 12/458 (3%)
 Frame = +3

Query  342   IQDAVKLSANVNRRINDRKVQAAVADCMELLDLSQDKVMDSMVA------LGNLSARART  503
             +Q    + +       D ++  A++DC++LLD S D++  S+ A        N + +  +
Sbjct  55    VQQVASILSQFANAFGDFRLSNAISDCLDLLDFSADELNWSLSASQNPEGKDNSTGKLSS  114

Query  504   DAHSWLSSVLTNHDTCLDGLSEPARSIMEPMIKDLISRAKssla-vlvavaPSTEDDLRA  680
             D  +WLS+ L N DTC DG  E   SI++ ++   +++  S +  +L  V P+T  D   
Sbjct  115   DLRTWLSAALVNQDTCSDGF-EGTNSIVKGLVSTGLNQVTSLVQGLLTQVHPNT--DHHG  171

Query  681   LNGEFPSWVSASDRRLLEASanavaanvvvaKDGSGKYKTVAEAVASAPDNGKTRYVIYI  860
              NGE PSWV   DR+LL+A    V A V   +DG+G +  V +AV +APD   TRYVIYI
Sbjct  172   PNGEIPSWVKTEDRKLLQAGGVNVDAVVA--QDGTGNFTNVMDAVLAAPDERMTRYVIYI  229

Query  861   KKGTYKENVEIGKKKTNVMLIGDGLSATIITGSLNYVDGATTFNSATVAAVGDGFIAQDL  1040
             KKGTYKENVEI KKK N+M+IGDG+ ATII+G+ N+VDG TTF SAT A  G GFIA+DL
Sbjct  230   KKGTYKENVEIKKKKWNLMMIGDGMDATIISGNRNFVDGWTTFRSATFAVSGRGFIARDL  289

Query  1041  RIQNTAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYAHSQRQFYRDCYITGTVDFIFG  1220
               +NTAGPEKHQAVALR  +D SV  RC+I  YQDTLYAH+ RQFYRDC I+GTVDFIFG
Sbjct  290   TFENTAGPEKHQAVALRSDSDLSVFYRCQIRGYQDTLYAHAMRQFYRDCKISGTVDFIFG  349

Query  1221  NAAAVIQNSQVVARKPMAAQKNMVTAQGRTDPNQNTGTSIQNCNVSPSSDLGPVKGTIQT  1400
             +A  V QN Q++A+K +  QKN VTAQGR DPN+ TG SIQ CN++  +DL P+  +  T
Sbjct  350   DATVVFQNCQILAKKGLPNQKNSVTAQGRKDPNEPTGISIQFCNITADADLLPLVNSTST  409

Query  1401  YLGRPWKEYSRTVFMESNIGDHIDPAGWFPWDGDFALKTLYYGEYMNRGPGAGTSKRVNW  1580
             YLGRPWK YSRTV M+S + + I P GW  W+ DFAL TL YGEYMN GPGAG   RV W
Sbjct  410   YLGRPWKLYSRTVIMQSFLSNAIRPEGWLEWNADFALSTLSYGEYMNYGPGAGLESRVKW  469

Query  1581  PGYHVITDKAEAMKFTVAQLIQGGSWLKNTGVDYTEGL  1694
             PGY V  +  +   +TVAQ I+G  WL  TGV Y  GL
Sbjct  470   PGYRVFNESTQVQNYTVAQFIEGDLWLPPTGVKYIAGL  507



>ref|XP_009776000.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 61 
[Nicotiana sylvestris]
Length=598

 Score =   462 bits (1190),  Expect = 1e-151, Method: Compositional matrix adjust.
 Identities = 253/573 (44%), Positives = 351/573 (61%), Gaps = 38/573 (7%)
 Frame = +3

Query  81    PKRKPSSCRalyvllylaaIVGSVALVSIWALRTSSSS----PSLWKARVCDPAHDPPSC  248
             PK + S  + L ++  +  I   +++  +  +R +S +    PS   AR C     P  C
Sbjct  27    PKSRSSKLKFLIIVATVLLIASVISVAVLVGVRKNSGNRIDKPSQAMARTCSRTLYPSLC  86

Query  249   M-AIVSEVSSAAPTETDGVAllqmllhssllRIQDAVKLSANVNRRINDRKVQAAVADCM  425
             + ++++   + + +++D V    + ++ +L R   A+ +S+++N    +  +++A  DC+
Sbjct  87    LNSLINYPGAKSASDSDLV---HISVNLTLQRFGKALYISSDINNLEMNTHIRSAYDDCL  143

Query  426   ELLDLSQDKVMDSMVAL------GNLSARARTDAHSWLSSVLTNHDTCLDGLSEPARSIM  587
             ELL+ S D +  S+ ++      GN  A +  D  +WLS+ LTN DTC D  ++   ++ 
Sbjct  144   ELLEESVDLLSHSLNSVFPGDGGGNSPAGSTQDVMTWLSAALTNQDTCTDSFADVTGNVK  203

Query  588   EPMIKDLISRAKsslavlvavaPSTEDD-------------LRAL----------NGEFP  698
             + M ++L   ++     L   A +  DD             L  L          + +FP
Sbjct  204   DQMSENLKDLSELVSNALAIYAAANGDDDFSGIPIQNRRRRLMELEHNDVPTTNEHDDFP  263

Query  699   SWVSASDRRLLEASanavaanvvvaKDGSGKYKTVAEAVASAPDNGKTRYVIYIKKGTYK  878
              W+S  DR+LL  S +A+ A+++VAKDGSG  KT+AEA+   P+    R +IY+K G Y+
Sbjct  264   KWLSRRDRKLLNKSVSAIQADIIVAKDGSGTVKTIAEAIKKVPEKSNRRTIIYVKAGRYE  323

Query  879   ENV-EIGKKKTNVMLIGDGLSATIITGSLNYVDGATTFNSATVAAVGDGFIAQDLRIQNT  1055
             EN+ ++G+KK NVM IGDG   T+ITG  +     TTF++A+ AA G GF+A+D+  +N 
Sbjct  324   ENILKVGRKKMNVMFIGDGKGKTVITGGKSVSQNITTFHTASFAATGAGFVARDMTFENY  383

Query  1056  AGPEKHQAVALRLGADQSVINRCKIDAYQDTLYAHSQRQFYRDCYITGTVDFIFGNAAAV  1235
             AGP KHQAVALR+G D +V+ RC I  YQDTLY HSQRQFYR+C I GTVDFIFGNAA V
Sbjct  384   AGPSKHQAVALRIGGDHAVVFRCNIIGYQDTLYVHSQRQFYRECDIYGTVDFIFGNAAVV  443

Query  1236  IQNSQVVARKPMAAQKNMVTAQGRTDPNQNTGTSIQNCNVSPSSDLGPVKGTIQTYLGRP  1415
             +QN  + ARKPMA QKN +TAQ R DPNQNTG SI  C +  + DL   KG+  TYLGRP
Sbjct  444   LQNCNIYARKPMANQKNTITAQNRKDPNQNTGISIHACKILATPDLEASKGSFPTYLGRP  503

Query  1416  WKEYSRTVFMESNIGDHIDPAGWFPWDGDFALKTLYYGEYMNRGPGAGTSKRVNWPGYHV  1595
             WK YSRTV+M SN+GDHI P+GW  W+GDFAL TLYYGEYMN GPGA   KRV WPGY V
Sbjct  504   WKMYSRTVYMLSNMGDHIHPSGWLEWNGDFALDTLYYGEYMNFGPGAAVGKRVTWPGYRV  563

Query  1596  ITDKAEAMKFTVAQLIQGGSWLKNTGVDYTEGL  1694
             I    EA KFTVA+ I G SWL +TGV Y  GL
Sbjct  564   IKSVEEASKFTVAKFIYGSSWLPSTGVAYLAGL  596



>ref|XP_007220109.1| hypothetical protein PRUPE_ppa021446mg, partial [Prunus persica]
 gb|EMJ21308.1| hypothetical protein PRUPE_ppa021446mg, partial [Prunus persica]
Length=482

 Score =   458 bits (1178),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 238/458 (52%), Positives = 305/458 (67%), Gaps = 18/458 (4%)
 Frame = +3

Query  342   IQDAVKLSAN---VNRRINDRKVQAAVADCMELLDLSQDKVMDSMVALGNLSARARTDAH  512
             +Q A+K  ++   +  +  ++  +AA ADC   L L QD +M     +   +     DA 
Sbjct  36    MQQALKAQSHNKWLGPKCRNKIEKAAWADC---LSLYQDTIMLLNQTIDPATKCTDYDAQ  92

Query  513   SWLSSVLTNHDTCLDGLSEPARS-IMEPMIKDLISR--AKsslavlvavaPSTEDDLRAL  683
             +WLS+ LTN DTC  G  E   S  + P++ + +S+  + +      +  P+  +  +  
Sbjct  93    TWLSTALTNLDTCRAGFVELGVSDFVLPLMSNNVSKLISNTLSIGNGSNVPAVTNRYKE-  151

Query  684   NGEFPSWVSASDRRLLEASanavaanvvvaKDGSGKYKTVAEAVASAPD-NGKTRYVIYI  860
                FP+WVS  DR+LL++S  A        +DGSG YKT+ E +A+A   +G  R+VI++
Sbjct  152   --GFPTWVSPGDRKLLQSSPAADVVVA---QDGSGNYKTIKEGLAAAEKRSGSNRFVIHV  206

Query  861   KKGTYKENVEIGKKKTNVMLIGDGLSATIITGSLNYVDGATTFNSATVAAVGDGFIAQDL  1040
             K+G YKEN+EI  K  N+ML+GDGL  TIITGS + V G+TTFNSATVA  GDGFIA+ +
Sbjct  207   KRGVYKENLEI--KLKNIMLLGDGLRYTIITGSRSVVGGSTTFNSATVAVTGDGFIARGI  264

Query  1041  RIQNTAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYAHSQRQFYRDCYITGTVDFIFG  1220
               +NTAGPE HQAVALR GAD SV  RC  + YQDTLY HSQRQFY++CY+ GTVDFIFG
Sbjct  265   TFRNTAGPENHQAVALRSGADLSVFYRCGFEGYQDTLYVHSQRQFYKECYVYGTVDFIFG  324

Query  1221  NAAAVIQNSQVVARKPMAAQKNMVTAQGRTDPNQNTGTSIQNCNVSPSSDLGPVKGTIQT  1400
             NAA V+QN  + AR+PM  QKN +TAQGRTDPNQNTG SI +  V   SDL PV  +++T
Sbjct  325   NAAVVLQNCMIYARRPMNGQKNTITAQGRTDPNQNTGISIHDSRVMAGSDLKPVLSSVKT  384

Query  1401  YLGRPWKEYSRTVFMESNIGDHIDPAGWFPWDGDFALKTLYYGEYMNRGPGAGTSKRVNW  1580
             YLGRPWKEYSRTVF++S +   +DPAGW  WDG+FALKTLYYGEY N GPG+ TS RVNW
Sbjct  385   YLGRPWKEYSRTVFLQSYLDTLVDPAGWLEWDGNFALKTLYYGEYKNTGPGSSTSGRVNW  444

Query  1581  PGYHVITDKAEAMKFTVAQLIQGGSWLKNTGVDYTEGL  1694
              GYHVIT  +EA KFTV   I G SWL  T V +T GL
Sbjct  445   GGYHVITSSSEASKFTVGNFIAGSSWLPATNVPFTAGL  482



>ref|XP_010915944.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 34 
[Elaeis guineensis]
Length=587

 Score =   461 bits (1187),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 240/455 (53%), Positives = 303/455 (67%), Gaps = 20/455 (4%)
 Frame = +3

Query  390   DRKVQAAVADCMELLDLSQDKVMDSMVALGNLSARART----DAHSWLSSVLTNHDTCLD  557
             D   ++A  DCMELLD S D++  S+  +     R  +    D  +WLS+ L+N DTC D
Sbjct  131   DSLARSAYDDCMELLDDSLDQLSQSLAVIAPTELRPASASDEDVLTWLSAALSNQDTCTD  190

Query  558   GLSEPA----RSIMEPMIKDLISRAKsslavlvava--------PSTEDDLRAL----NG  689
             GL++ A    R+ ME  +KDL     + LA+  A +        P      R L    +G
Sbjct  191   GLADVANGYVRAQMESNLKDLAELVSNCLAIFSAASRNKDFSGIPIQNKKRRLLSSAGDG  250

Query  690   EFPSWVSASDRRLLEASanavaanvvvaKDGSGKYKTVAEAVASAPDNGKTRYVIYIKKG  869
             EFP W+   DRRLL+  A  + A++VVAKDG+G +K++A+AV +AP+N   R +IY+K G
Sbjct  251   EFPEWLGWRDRRLLQVPAAKIQADMVVAKDGTGTHKSIADAVKAAPENSARRIIIYVKAG  310

Query  870   TYKENVEIGKKKTNVMLIGDGLSATIITGSLNYVDGATTFNSATVAAVGDGFIAQDLRIQ  1049
              Y EN+++ +KKTN+M IGDG   T + GS +  D  TTF++AT A+ G+GFI +D+ I+
Sbjct  311   RYNENIKVTRKKTNLMFIGDGKGITTVAGSRSVADKYTTFHTATFASTGNGFIMRDMTIE  370

Query  1050  NTAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYAHSQRQFYRDCYITGTVDFIFGNAA  1229
             N AGPEKHQAVALR+GAD +V+ RC I  YQDTLY HSQRQF+R+C I GTVDF+FGNAA
Sbjct  371   NWAGPEKHQAVALRVGADHAVVYRCNIVGYQDTLYVHSQRQFFRECDIYGTVDFVFGNAA  430

Query  1230  AVIQNSQVVARKPMAAQKNMVTAQGRTDPNQNTGTSIQNCNVSPSSDLGPVKGTIQTYLG  1409
              V+QN  + ARKPMA QKN +TAQ R DPNQNTG SI  C V  + +L PVK T  TYLG
Sbjct  431   VVLQNCSLWARKPMAMQKNTITAQNRRDPNQNTGISIHACRVLATPELEPVKWTYPTYLG  490

Query  1410  RPWKEYSRTVFMESNIGDHIDPAGWFPWDGDFALKTLYYGEYMNRGPGAGTSKRVNWPGY  1589
             RPWK YSRTV+M S +GDHI   GW  W+G FAL TLYYGEYMN GPGA   KRV WPGY
Sbjct  491   RPWKLYSRTVYMLSYLGDHIHSVGWLEWNGSFALDTLYYGEYMNYGPGAALGKRVKWPGY  550

Query  1590  HVITDKAEAMKFTVAQLIQGGSWLKNTGVDYTEGL  1694
              VIT   EA KFTVA+ I G SWL +TGV +  GL
Sbjct  551   RVITLPEEASKFTVARFIYGSSWLPSTGVAFVAGL  585



>gb|KJB41904.1| hypothetical protein B456_007G127000 [Gossypium raimondii]
Length=560

 Score =   460 bits (1183),  Expect = 4e-151, Method: Compositional matrix adjust.
 Identities = 240/510 (47%), Positives = 323/510 (63%), Gaps = 24/510 (5%)
 Frame = +3

Query  219   CDPAHDPPSCMAIVSEVSSAAPTETDGVAllqmllhssllRIQDAVKLSANVNRRIND--  392
             C+    P  C++ +S +   A      +    +      +R+  A      + +RI    
Sbjct  56    CEATLYPDLCVSTISVLPDLASKSLPELIQATLNQTMYEVRLSSAN--CTGIEKRIKSYS  113

Query  393   RKVQAAVADCMELLDLSQDKVMDSMVALGNLS------ARARTDAHSWLSSVLTNHDTCL  554
             ++ +AA+ DC+EL D   D + +  VAL +L+      +R   D  ++LS+ +TN  TCL
Sbjct  114   KREEAAINDCLELFD---DTLEELKVALADLAPKKLAVSRNYHDLQTFLSAAMTNQYTCL  170

Query  555   DGLSEP---ARSIMEPMIKDL---ISRAKsslavlvavaPSTEDDL----RALNGEFPSW  704
             DG +      R+I++  + ++   +S +   L  +  V  S  +      R  NG FPSW
Sbjct  171   DGFARSKGNVRNIIKKGLHNITHHVSNSLVMLKKVPGVNKSKSEYFPQQGRLKNG-FPSW  229

Query  705   VSASDRRLLEASanavaanvvvaKDGSGKYKTVAEAVASAPDNGKTRYVIYIKKGTYKEN  884
             +S  DR+LL+AS N    +++VAKDG+G + T+ +AVA+AP+N  TR+VIYIK G+Y EN
Sbjct  230   LSRKDRKLLQASVNETEFDLIVAKDGTGNFTTINDAVAAAPNNSNTRFVIYIKAGSYLEN  289

Query  885   VEIGKKKTNVMLIGDGLSATIITGSLNYVDGATTFNSATVAAVGDGFIAQDLRIQNTAGP  1064
             VE+ KKK  +M +GDG+  T++  S N VDG TTF SATVA VG+GFIA+ +  +N+AGP
Sbjct  290   VEVVKKKKMLMFVGDGIGKTVVKASRNVVDGFTTFRSATVAVVGEGFIAKGITFENSAGP  349

Query  1065  EKHQAVALRLGADQSVINRCKIDAYQDTLYAHSQRQFYRDCYITGTVDFIFGNAAAVIQN  1244
              KHQAVALR G+D S   +C   AYQDTLY HS RQFYR+C I GTVDFIFGNAA V Q+
Sbjct  350   SKHQAVALRSGSDLSAFYKCSFVAYQDTLYVHSLRQFYRECDIYGTVDFIFGNAAVVFQD  409

Query  1245  SQVVARKPMAAQKNMVTAQGRTDPNQNTGTSIQNCNVSPSSDLGPVKGTIQTYLGRPWKE  1424
               + ARKP   QKN+ TAQGR DPNQNTG SI NC ++ ++DL PVK + +TYLGRPWKE
Sbjct  410   CNLYARKPNPNQKNIFTAQGREDPNQNTGISILNCKIAAAADLVPVKSSFKTYLGRPWKE  469

Query  1425  YSRTVFMESNIGDHIDPAGWFPWDGDFALKTLYYGEYMNRGPGAGTSKRVNWPGYHVITD  1604
             YSRTV M S I D +DPAGW  W+G FAL TLYYGEY+NRGPG+ TS RV WPGY VI  
Sbjct  470   YSRTVIMRSYIDDSVDPAGWLEWNGTFALSTLYYGEYLNRGPGSNTSARVTWPGYRVINS  529

Query  1605  KAEAMKFTVAQLIQGGSWLKNTGVDYTEGL  1694
               EA +FT+   IQG  WL ++ + +  GL
Sbjct  530   STEATQFTIEPFIQGNEWLNSSNIPFALGL  559



>ref|XP_008783207.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 34 
[Phoenix dactylifera]
Length=588

 Score =   461 bits (1186),  Expect = 4e-151, Method: Compositional matrix adjust.
 Identities = 263/540 (49%), Positives = 342/540 (63%), Gaps = 26/540 (5%)
 Frame = +3

Query  147   SVALVSIWALRTSSS----SPSLWKARVCDPAHDPPSCMAIVSEVSSAAPTETDGVAllq  314
             SV L+  +  RTS S    +P+   ++ C     P  C++ + +   A   E     L+ 
Sbjct  49    SVGLLVRFRARTSGSGTNRTPTQAISQTCALTRYPALCVSSLLDFPGA--LEAGDRDLVH  106

Query  315   mllhssllRIQDAVKLSANVNRRINDRKVQAAVADCMELLDLSQDKVMDSMVAL---GNL  485
             + L+ ++ R+  A+  ++ V     D   ++A  DCMELLD S D++  S+  +   G+ 
Sbjct  107   ISLNMTVQRVGKALYQASAVAGVSMDFLARSAYDDCMELLDDSLDQLSQSLAVIAPTGSH  166

Query  486   SARAR-TDAHSWLSSVLTNHDTCLDGLSEPA----RSIMEPMIKDLISRAKsslavlvav  650
              A A   D  +WLSS +TN DTC +GL++ A    R+ ME  +KDL     + LA+  A 
Sbjct  167   PAGASDEDVLTWLSSAVTNQDTCTEGLADVANGYVRAQMESNLKDLAELVSNCLAIFSAA  226

Query  651   a--------PSTEDDLRAL----NGEFPSWVSASDRRLLEASanavaanvvvaKDGSGKY  794
             +        P      R L    +GEFP WV   DRRLL+  A  + A++VVAKDG+G +
Sbjct  227   SRNKDFSGIPIQNKKRRLLSSAGDGEFPEWVGRRDRRLLQVPAAKIQADMVVAKDGNGTH  286

Query  795   KTVAEAVASAPDNGKTRYVIYIKKGTYKENVEIGKKKTNVMLIGDGLSATIITGSLNYVD  974
             K++A AV +AP+    R +IY+K G Y EN+++G+KKTN+M IGDG   TI+ GS +  D
Sbjct  287   KSIAAAVKAAPELSARRIIIYVKAGRYVENIKVGRKKTNLMFIGDGKGMTIVAGSRSVAD  346

Query  975   GATTFNSATVAAVGDGFIAQDLRIQNTAGPEKHQAVALRLGADQSVINRCKIDAYQDTLY  1154
               TTF++AT A+ G+GFI +D+ I+N AGP KHQAVALR+GADQ+V+ RC I  YQDTLY
Sbjct  347   KYTTFSTATFASTGNGFIMKDMTIENWAGPAKHQAVALRVGADQAVVYRCNIIGYQDTLY  406

Query  1155  AHSQRQFYRDCYITGTVDFIFGNAAAVIQNSQVVARKPMAAQKNMVTAQGRTDPNQNTGT  1334
              HSQRQF+R+C I GTVDFIFGNAA V+QN  + ARKPM  QKN +TAQ R DPNQNTG 
Sbjct  407   VHSQRQFFRECDIFGTVDFIFGNAAVVLQNCSLWARKPMEKQKNTITAQNRKDPNQNTGI  466

Query  1335  SIQNCNVSPSSDLGPVKGTIQTYLGRPWKEYSRTVFMESNIGDHIDPAGWFPWDGDFALK  1514
             SI  C V  + +L  VK T  TYLGRPWK YSRTV+M S +GDHI PAGW  W+G FAL 
Sbjct  467   SIHACRVVATPELERVKWTYPTYLGRPWKLYSRTVYMLSYMGDHIHPAGWLEWNGAFALD  526

Query  1515  TLYYGEYMNRGPGAGTSKRVNWPGYHVITDKAEAMKFTVAQLIQGGSWLKNTGVDYTEGL  1694
             TLYYGEYMN GPGA   KRV WPGY VIT   EA KFTVA+ I G SWL +TGV +  GL
Sbjct  527   TLYYGEYMNYGPGAALGKRVKWPGYRVITLPEEASKFTVAKFIYGSSWLPSTGVAFMAGL  586



>ref|XP_010266280.1| PREDICTED: pectinesterase-like [Nelumbo nucifera]
Length=529

 Score =   459 bits (1180),  Expect = 4e-151, Method: Compositional matrix adjust.
 Identities = 240/448 (54%), Positives = 309/448 (69%), Gaps = 19/448 (4%)
 Frame = +3

Query  390   DRKVQAAVADCMELLDLSQDKVMDSMVALGNLSARARTDAHSWLSSVLTNHDTCLDGLSE  569
             D K + A ADC+EL   +  ++  SM +   L     +DA +WLS+ +TN  TC +G  E
Sbjct  88    DDKSKMAWADCVELYADTVSQLNRSMASKNPL---IWSDAQTWLSAAITNEQTCRNGFIE  144

Query  570   PARSIMEP----MIKDL---------ISRAKsslavlvavaPSTEDDLRALNGEFPSWVS  710
              + S        M+ +L         I++A +S +          ++ R L+  FP+WVS
Sbjct  145   LSSSSQLSSFPFMLTNLSKMVSNSLAINKAAASTSSASLFGKQGANNRRLLSDGFPTWVS  204

Query  711   ASDRRLLEASanavaanvvvaKDGSGKYKTVAEAVASAPDNGKTRYVIYIKKGTYKENVE  890
             A+DR+LL++S  A  A+VVVA DGSG YKT++EAVA++     +R+VIY+K+G YKENVE
Sbjct  205   AADRKLLQSSGAASQADVVVAADGSGNYKTISEAVAASSKRSGSRFVIYVKRGVYKENVE  264

Query  891   IGKKKTNVMLIGDGLSATIITGSLNYVDGATTFNSATVAAVGDGFIAQDLRIQNTAGPEK  1070
             I  K +N+MLIGDG+ ATI+TGS N  DG+TTF SATVA  G GFIA+D+  +NTAGP+K
Sbjct  265   I--KASNIMLIGDGIDATIVTGSRNVQDGSTTFRSATVAVTGGGFIARDMTFENTAGPQK  322

Query  1071  HQAVALRLGADQSVINRCKIDAYQDTLYAHSQRQFYRDCYITGTVDFIFGNAAAVIQNSQ  1250
             HQAVALR G+D SV  RC +  YQDTLY +SQRQFYRDC I GTVDFIFG+A AVIQN  
Sbjct  323   HQAVALRSGSDLSVFYRCSLKGYQDTLYVYSQRQFYRDCDIYGTVDFIFGDAVAVIQNCN  382

Query  1251  VVARKPMAAQKNMVTAQGRTDPNQNTGTSIQNCNVSPSSDLGPVKGTIQTYLGRPWKEYS  1430
             +  RKPM+ QKN VTAQGRTDPN+NTG SI N  V+ +SDL  V+G+ +TYLGRPW++YS
Sbjct  383   IYVRKPMSGQKNTVTAQGRTDPNENTGISIHNSRVTAASDLRAVQGSFKTYLGRPWQKYS  442

Query  1431  RTVFMESNIGDHIDPAGWFPWDGDFALKTLYYGEYMNRGPGAGTSKRVNWPGYHVITDKA  1610
             RTVFM++++   IDPAGW  W G FAL TLYYGEYMN G GA T  RV W GYHV++  A
Sbjct  443   RTVFMKTSLDSLIDPAGWLEWSGSFALSTLYYGEYMNTGAGASTGGRVKWAGYHVMS-AA  501

Query  1611  EAMKFTVAQLIQGGSWLKNTGVDYTEGL  1694
             +A KFTV   + GGSW+ + GV +T GL
Sbjct  502   DAGKFTVGSFLGGGSWIGSAGVPFTSGL  529



>ref|XP_002527782.1| Pectinesterase-1 precursor, putative [Ricinus communis]
 gb|EEF34592.1| Pectinesterase-1 precursor, putative [Ricinus communis]
Length=529

 Score =   458 bits (1179),  Expect = 7e-151, Method: Compositional matrix adjust.
 Identities = 237/461 (51%), Positives = 307/461 (67%), Gaps = 19/461 (4%)
 Frame = +3

Query  351   AVKLSANVNRRINDRKVQAAVADCMELLDLSQDKVMDSMVALGNLSARARTDAHSWLSSV  530
             A ++ +++N +  D+K + A  DCMEL + + D +  S      LS+    D+ +WLS+ 
Sbjct  75    AHQMVSSMNFKSFDKKAKLAWDDCMELYEDTVDHLNRS------LSSTIPIDSQTWLSAA  128

Query  531   LTNHDTCLDGLSEPARSI---MEPMIKDLISRAKsslavlvavaPSTEDDLRALNGE---  692
             + N  TC +G  +   S    +E M   L + +      L     S   + + +NG    
Sbjct  129   IANQQTCQNGFIDLNLSYDDHLESMPIMLSNLSMLLSNSLAVNKVSVPHNTKQVNGRRLL  188

Query  693   ----FPSWVSASDRRLLEASanav-aanvvvaKDGSGKYKTVAEAVASAPD--NGKTRYV  851
                 FPSWVSA+DRRLL++S+     A++VVA+DGSG YKT+ EAVA+A    +G  R V
Sbjct  189   IFDGFPSWVSATDRRLLQSSSGVAPKADIVVAQDGSGNYKTITEAVAAAVKQRSGSKRLV  248

Query  852   IYIKKGTYKENVEIGKKKTNVMLIGDGLSATIITGSLNYVDGATTFNSATVAAVGDGFIA  1031
             IY+KKG YKEN+EI K   N+M +GDG+ ATI+TGS N  DG+TTF SAT A  G GFIA
Sbjct  249   IYVKKGIYKENIEIKKSMKNLMFVGDGIDATIVTGSKNAKDGSTTFRSATFAVSGQGFIA  308

Query  1032  QDLRIQNTAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYAHSQRQFYRDCYITGTVDF  1211
             + +  +NTAGP+KHQAVALR G+D SV   C    YQDTLY +SQRQFYRDC I GT+DF
Sbjct  309   KGMTFENTAGPQKHQAVALRSGSDFSVFYGCSFKGYQDTLYVYSQRQFYRDCDIYGTIDF  368

Query  1212  IFGNAAAVIQNSQVVARKPMAAQKNMVTAQGRTDPNQNTGTSIQNCNVSPSSDLGPVKGT  1391
             IFG+A AV+QN  +  R+PM  QKN VTAQGR DPN+NTG  I N NV  +SD+ PV+G+
Sbjct  369   IFGDAVAVLQNCNIYVRRPMNGQKNTVTAQGRKDPNENTGIVIHNSNVMATSDMRPVQGS  428

Query  1392  IQTYLGRPWKEYSRTVFMESNIGDHIDPAGWFPWDGDFALKTLYYGEYMNRGPGAGTSKR  1571
              +TYLGRPW++YSRT+FM+SN+   IDPAGW PW G+FAL TLYYGEYMN G GA T++R
Sbjct  429   FKTYLGRPWQKYSRTLFMKSNLDGLIDPAGWLPWSGNFALSTLYYGEYMNTGSGASTARR  488

Query  1572  VNWPGYHVITDKAEAMKFTVAQLIQGGSWLKNTGVDYTEGL  1694
             VNWPGYHVIT   +A KFTV   + G SW+  TGV +  GL
Sbjct  489   VNWPGYHVITKATDAGKFTVGNFLAGDSWIPGTGVPFDSGL  529



>ref|XP_006852649.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 34 
[Amborella trichopoda]
 gb|ERN14116.1| hypothetical protein AMTR_s00021p00242180 [Amborella trichopoda]
Length=613

 Score =   461 bits (1186),  Expect = 7e-151, Method: Compositional matrix adjust.
 Identities = 240/487 (49%), Positives = 311/487 (64%), Gaps = 35/487 (7%)
 Frame = +3

Query  339   RIQDAVKLSANVNRRINDRKVQAAVADCMELLDLSQDKVMDSM-VALGNLSARARTDAHS  515
             R+  A   +A +N    D +V+ A  DC+ELLD S  ++ DS+ V  G++   +  D  +
Sbjct  125   RVGKAFSAAALLNGLEMDTRVRGAYDDCIELLDDSMQELYDSLGVVSGSVKRASFADVST  184

Query  516   WLSSVLTNHDTC---LDGLSEPARSIMEPMIKDL------------------------IS  614
             WLS+ LTN DTC   L+G++   +  ME  +KDL                        I 
Sbjct  185   WLSAALTNQDTCREGLEGVTGNVKEKMEMHLKDLSELISNCLAIFSANGGGDEFQGIPIQ  244

Query  615   RAKsslavlvavaPSTEDDLR-------ALNGEFPSWVSASDRRLLEASanavaanvvva  773
               +  +    ++ PST+   +          G FP+WV+A +RRLL AS   V A+VVV 
Sbjct  245   NKRRLMGAGESIFPSTKSGFQEKKGGFWGGKGGFPAWVTAGERRLLLASVAGVQADVVVD  304

Query  774   KDGSGKYKTVAEAVASAPDNGKTRYVIYIKKGTYKENVEIGKKKTNVMLIGDGLSATIIT  953
             K G+G +KT++EAV  A +    R +IY+K G Y+EN+++G+KKTN+M IGDG+  T+++
Sbjct  305   KSGNGTFKTISEAVKWAAEESSKRIIIYVKAGRYEENIKVGRKKTNLMFIGDGIGNTVVS  364

Query  954   GSLNYVDGATTFNSATVAAVGDGFIAQDLRIQNTAGPEKHQAVALRLGADQSVINRCKID  1133
             GS +  DG TTF++AT AA G GFIA+D+  +NTAGP KHQAVALR+GAD  V+ RC I 
Sbjct  365   GSRSVSDGFTTFHTATFAASGTGFIARDMTFENTAGPGKHQAVALRVGADHGVVYRCNII  424

Query  1134  AYQDTLYAHSQRQFYRDCYITGTVDFIFGNAAAVIQNSQVVARKPMAAQKNMVTAQGRTD  1313
              YQDTLY HSQRQF+R+C I GTVDFIFGNAA VIQN  + ARKPM  QKN +TAQ R D
Sbjct  425   GYQDTLYVHSQRQFFRECAIYGTVDFIFGNAAVVIQNCSLYARKPMPLQKNTITAQNRKD  484

Query  1314  PNQNTGTSIQNCNVSPSSDLGPVKGTIQTYLGRPWKEYSRTVFMESNIGDHIDPAGWFPW  1493
             PNQNTG SI NC + P++DL PVK +  TYLGRPWK YSR V+M S +GDHI PAGW  W
Sbjct  485   PNQNTGISIHNCRIYPTADLEPVKSSFPTYLGRPWKLYSRVVYMLSYMGDHIHPAGWLEW  544

Query  1494  DGDFALKTLYYGEYMNRGPGAGTSKRVNWPGYHVITDKAEAMKFTVAQLIQGGSWLKNTG  1673
             +    +  LYYGEYMN GPG    +RV W G+HVIT  AEA +FTVAQ I G SWL +TG
Sbjct  545   NATSPVNNLYYGEYMNYGPGGAVGQRVQWQGFHVITTVAEASRFTVAQFIYGSSWLPSTG  604

Query  1674  VDYTEGL  1694
             V +  GL
Sbjct  605   VAFLAGL  611



>ref|XP_008359413.1| PREDICTED: pectinesterase-like [Malus domestica]
Length=579

 Score =   460 bits (1183),  Expect = 8e-151, Method: Compositional matrix adjust.
 Identities = 239/458 (52%), Positives = 298/458 (65%), Gaps = 28/458 (6%)
 Frame = +3

Query  402   QAAVADCMELLDLSQDKVMDSMVALG---NLSARARTDAHSWLSSVLTNHDTCLDGLSEP  572
             Q A+ DC+ELLD + D++  ++  L     L++    D  + LS+ +TN DTCLDG S  
Sbjct  121   QWALDDCLELLDNTIDELKSAISDLSXNKTLNSNRYYDLKALLSAAMTNQDTCLDGFSAN  180

Query  573   -----------ARSIMEPMIKDLISRAKsslavlvavaPSTED-------------DLRA  680
                         RS +E  I + IS+  S+  V++   P                 D   
Sbjct  181   GTAPRSSNXGIVRSEIEGRI-NTISQHVSNALVMLKKIPGAHKYEYSETMKSEMFPDFGP  239

Query  681   LNGEFPSWVSASDRRLLEASanavaanvvvaKDGSGKYKTVAEAVASAPDNGKTRYVIYI  860
                +FP+WVS+ DRRLL++S N    ++VVAKDG+G + T++EAV  AP++  TR+VIYI
Sbjct  240   AKKKFPTWVSSKDRRLLQSSTNETKYDLVVAKDGTGNFTTISEAVDVAPNSSATRFVIYI  299

Query  861   KKGTYKENVEIGKKKTNVMLIGDGLSATIITGSLNYVDGATTFNSATVAAVGDGFIAQDL  1040
             K G Y ENVE+ KKKTN+M +GDG+  TI+  S N VDG TTF SATVA VG+GFIA+ +
Sbjct  300   KAGAYFENVEVVKKKTNLMFLGDGIGNTIVKASRNVVDGWTTFRSATVAVVGBGFIAKGI  359

Query  1041  RIQNTAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYAHSQRQFYRDCYITGTVDFIFG  1220
               +N AGP KHQAVALR GAD S   +C    YQDTLY HS RQFYR+C + GTVDFIFG
Sbjct  360   TFENGAGPSKHQAVALRSGADFSAFYKCSFVGYQDTLYVHSLRQFYRECDVYGTVDFIFG  419

Query  1221  NAAAVIQNSQVVARKPMAAQKNMVTAQGRTDPNQNTGTSIQNCNVSPSSDLGPVKGTIQT  1400
             NAA V+QN  + ARKP   QKN+ TAQGR DPNQNTG SI NC V+  SDL PVK    T
Sbjct  420   NAAVVLQNCNLYARKPNENQKNIFTAQGREDPNQNTGISILNCKVTAGSDLIPVKSNFTT  479

Query  1401  YLGRPWKEYSRTVFMESNIGDHIDPAGWFPWDGDFALKTLYYGEYMNRGPGAGTSKRVNW  1580
             YLGRPWKEYSRTV+++S I D +DPAGW  W+G FAL TLYYGEY+NRGPG+ TS RV W
Sbjct  480   YLGRPWKEYSRTVYLKSYIDDLVDPAGWLEWNGSFALSTLYYGEYLNRGPGSNTSARVTW  539

Query  1581  PGYHVITDKAEAMKFTVAQLIQGGSWLKNTGVDYTEGL  1694
             PGY VI    EA +FTV + IQG  WL +T + Y  GL
Sbjct  540   PGYRVINSSVEASQFTVGEFIQGSDWLNSTNIPYFLGL  577



>ref|XP_006828586.1| PREDICTED: pectinesterase [Amborella trichopoda]
 gb|ERM96002.1| hypothetical protein AMTR_s00129p00044320 [Amborella trichopoda]
Length=564

 Score =   459 bits (1181),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 244/456 (54%), Positives = 303/456 (66%), Gaps = 27/456 (6%)
 Frame = +3

Query  402   QAAVADCMELLDLSQDKVMDSMVALGNLSARARTDAH-----SWLSSVLTNHDTCLDGLS  566
               A+ DC+EL+D + D++  +   L    ++     H     + LS  +TN +TCLDG S
Sbjct  111   HTALHDCLELVDETLDELRKTDEELELYPSKKSISDHASDLKTLLSGAMTNQETCLDGFS  170

Query  567   E----PARSIM-------EPMIKDLISRAKsslavlvavaPST------EDDL-RALNGE  692
                    R I+       E +I + ++  K+     +A   S       E++L  +  GE
Sbjct  171   HIKGGGVRKIISGGCVYVEKLISNALAMIKNMTDTDMAAERSAAGRKLEENNLPESFAGE  230

Query  693   --FPSWVSASDRRLLEASanavaanvvvaKDGSGKYKTVAEAVASAPDNGKTRYVIYIKK  866
               FP+W+SA DRRLL++S+      V    DGSG +KTVA AVA+AP+    RYVI IK 
Sbjct  231   DGFPAWMSAGDRRLLQSSSVTPNVVVAA--DGSGDFKTVAAAVAAAPEKSSKRYVIRIKA  288

Query  867   GTYKENVEIGKKKTNVMLIGDGLSATIITGSLNYVDGATTFNSATVAAVGDGFIAQDLRI  1046
             G Y+ENVE+ KKKTN+M +GDG   TIITGS N  DG+TTF SATVAAVG+ F+A+D+  
Sbjct  289   GVYRENVEVPKKKTNIMFLGDGRMKTIITGSKNVKDGSTTFRSATVAAVGERFLARDITF  348

Query  1047  QNTAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYAHSQRQFYRDCYITGTVDFIFGNA  1226
             QNTAGP KHQAVALR+G+D S   RC + AYQDTLY HS RQFYR+C+I GTVDFIFGNA
Sbjct  349   QNTAGPSKHQAVALRVGSDFSAFYRCDMIAYQDTLYVHSLRQFYRECFIYGTVDFIFGNA  408

Query  1227  AAVIQNSQVVARKPMAAQKNMVTAQGRTDPNQNTGTSIQNCNVSPSSDLGPVKGTIQTYL  1406
             AAV+QN  ++AR+P + QKNMVTAQGR DPNQNTG SI  C +S  SDL PVK +  TYL
Sbjct  409   AAVLQNCDILARRPNSGQKNMVTAQGREDPNQNTGISIHKCRISADSDLAPVKSSFPTYL  468

Query  1407  GRPWKEYSRTVFMESNIGDHIDPAGWFPWDGDFALKTLYYGEYMNRGPGAGTSKRVNWPG  1586
             GRPWKEYSRTV M+S I D I+PAGW  W+G+FAL TLYYGEY N G GAGTS RV W G
Sbjct  469   GRPWKEYSRTVIMQSTISDVINPAGWHEWNGNFALNTLYYGEYQNTGAGAGTSGRVKWKG  528

Query  1587  YHVITDKAEAMKFTVAQLIQGGSWLKNTGVDYTEGL  1694
             Y VIT  +EA +FTV   I GGSWL +TG  +T G 
Sbjct  529   YKVITSASEAKQFTVGDFINGGSWLGSTGFPFTAGF  564



>ref|XP_008803383.1| PREDICTED: pectinesterase [Phoenix dactylifera]
Length=532

 Score =   457 bits (1177),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 238/453 (53%), Positives = 302/453 (67%), Gaps = 23/453 (5%)
 Frame = +3

Query  390   DRKVQAAVADCMELLDLSQDKVMDSMVA------------LGNLSARARTDAHSWLSSVL  533
             D ++ +AV+DC++LLDLS D++  ++ A                + +  +D  SWLS+ L
Sbjct  83    DLRLSSAVSDCLDLLDLSSDELSLTISASQPSTTSTAASAAAEGTGKRLSDLRSWLSAAL  142

Query  534   TNHDTC---LDGLSEPARSIMEPMIKDLISRAKsslavlvavaPSTEDDLRALNGE---F  695
              N DTC   LDG S    S++  ++   +    S +A  +   P+     R +      F
Sbjct  143   GNQDTCKESLDGTS----SVVGSLVGGGLQTVTSLVANGLRQVPAGSGRRRLMGKASEGF  198

Query  696   PSWVSASDRRLLEASanavaanvvvaKDGSGKYKTVAEAVASAPDNGKTRYVIYIKKGTY  875
             P+W+SA DRRLL+A A   A  VV  +DGSG+Y TV  AV +AP     RYVI++K+G Y
Sbjct  199   PAWLSAGDRRLLQAPAGVAADAVVA-QDGSGQYTTVGAAVEAAPTESTKRYVIHVKRGVY  257

Query  876   KENVEIGKKKTNVMLIGDGLSATIITGSLNYVDGATTFNSATVAAVGDGFIAQDLRIQNT  1055
             KENVEI KKK N+ML+GDG+  +II+ S N+VDG TT+ SAT A  G GFIA+DL I+NT
Sbjct  258   KENVEIKKKKWNIMLVGDGMGQSIISASRNFVDGWTTYRSATFAVSGKGFIARDLTIENT  317

Query  1056  AGPEKHQAVALRLGADQSVINRCKIDAYQDTLYAHSQRQFYRDCYITGTVDFIFGNAAAV  1235
             AGP KHQAVALR  +D SV  R     YQDTLYAHS RQFYRDC ITGTVDF+FGNAAAV
Sbjct  318   AGPSKHQAVALRSDSDLSVYYRSSFLGYQDTLYAHSLRQFYRDCLITGTVDFVFGNAAAV  377

Query  1236  IQNSQVVARKPMAAQKNMVTAQGRTDPNQNTGTSIQNCNVSPSSDLGPVKGTIQTYLGRP  1415
              QN  ++AR+P+  QKN VTAQGR DPNQNTG S+Q CNVS  +DL  +  +  +YLGRP
Sbjct  378   FQNCVLLARRPLPDQKNSVTAQGRKDPNQNTGFSLQFCNVSAGADLAGLTNSTASYLGRP  437

Query  1416  WKEYSRTVFMESNIGDHIDPAGWFPWDGDFALKTLYYGEYMNRGPGAGTSKRVNWPGYHV  1595
             WKEYSRTVFM+S +G  + P GW  W+G+FAL TLYY EYMN GPG+G + RV WPGY V
Sbjct  438   WKEYSRTVFMQSYLGGLLRPEGWLEWNGNFALDTLYYAEYMNYGPGSGLAGRVKWPGYRV  497

Query  1596  ITDKAEAMKFTVAQLIQGGSWLKNTGVDYTEGL  1694
             +T+ A+A+ FTV Q I G  WL +TGV YT GL
Sbjct  498   LTNSADAVNFTVGQFIDGNLWLPSTGVKYTSGL  530



>ref|XP_009404434.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 34 
[Musa acuminata subsp. malaccensis]
Length=589

 Score =   459 bits (1182),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 253/533 (47%), Positives = 328/533 (62%), Gaps = 32/533 (6%)
 Frame = +3

Query  183   SSSSPSLWKARVCDPAHDPPSCMAIVSEVSSAAPT-ETDGVAllqmllhssllRIQDAVK  359
             +S +P+   AR C     P  C++ + +   A    E D V    + L+ +L R+  A+ 
Sbjct  58    ASRAPTQAIARACSLTRYPALCVSSLLDFPGALEAGERDLV---HISLNMTLHRVGAAIY  114

Query  360   LSANVNRRINDRKVQAAVADCMELLDLSQDKVMDSMVAL-----------GNLSARARTD  506
              ++ +     D   +AA  DCMELLD S D++ DS++ +             +   +  D
Sbjct  115   GASAIVGTAMDTLARAAYDDCMELLDDSLDQLSDSLLVIFPSASPSPSSQARVKGASDDD  174

Query  507   AHSWLSSVLTNHDTCLDGLSEP----ARSIMEPMIKDLISR--------AKsslavlvav  650
               +WLS  LTN DTC +GL +      +  ME  +KDL           A        A 
Sbjct  175   VLTWLSGALTNQDTCNEGLQQVKNLYVKGHMENQLKDLTELVSNCLAIFAGVGRNKDFAG  234

Query  651   aPSTEDDLRALNG-----EFPSWVSASDRRLLEASanavaanvvvaKDGSGKYKTVAEAV  815
              P      + LN      EFP+W+   DRRLL+ SA ++ A++VV+K G+G Y+++A+AV
Sbjct  235   IPIHNKRRKLLNAIEDDDEFPTWMGKKDRRLLQVSAASIQADMVVSKGGNGTYRSIADAV  294

Query  816   ASAPDNGKTRYVIYIKKGTYKENVEIGKKKTNVMLIGDGLSATIITGSLNYVDGATTFNS  995
              +APD    R VIYIK G Y EN+++G+KKTN+M IGDG + TI+ GS +  D  TTF++
Sbjct  295   KAAPDYSSRRIVIYIKAGRYDENIKVGRKKTNLMFIGDGKTRTIVAGSRSVYDNFTTFHT  354

Query  996   ATVAAVGDGFIAQDLRIQNTAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYAHSQRQF  1175
             AT AA G GFI +D+ IQN AGPEKHQAVALR+GAD++ + RC I  YQDTLY HSQRQF
Sbjct  355   ATFAATGTGFIMRDITIQNWAGPEKHQAVALRVGADRAAVYRCNIIGYQDTLYVHSQRQF  414

Query  1176  YRDCYITGTVDFIFGNAAAVIQNSQVVARKPMAAQKNMVTAQGRTDPNQNTGTSIQNCNV  1355
             +R+C + GTVDFIFGNAA V+QN  + AR+PMA+QKN +TAQ R DPNQNTG SI  C V
Sbjct  415   FRECDVYGTVDFIFGNAAVVLQNCTLWARRPMASQKNTITAQNRKDPNQNTGISIHACRV  474

Query  1356  SPSSDLGPVKGTIQTYLGRPWKEYSRTVFMESNIGDHIDPAGWFPWDGDFALKTLYYGEY  1535
               ++DL   K +  TYLGRPWK YSR V+M S +GDHI PAGW  W+  FAL TLYYGEY
Sbjct  475   VAAADLEQAKASYATYLGRPWKLYSRVVYMLSYMGDHIHPAGWLEWNATFALDTLYYGEY  534

Query  1536  MNRGPGAGTSKRVNWPGYHVITDKAEAMKFTVAQLIQGGSWLKNTGVDYTEGL  1694
             MN GPGA   +RV WPGY VI   AEA KFTVAQ I G SWL  TGV +  GL
Sbjct  535   MNYGPGAALGRRVTWPGYRVIKLPAEASKFTVAQFIYGSSWLPPTGVAFLAGL  587



>ref|XP_008803239.1| PREDICTED: pectinesterase [Phoenix dactylifera]
Length=534

 Score =   457 bits (1176),  Expect = 2e-150, Method: Compositional matrix adjust.
 Identities = 251/516 (49%), Positives = 336/516 (65%), Gaps = 11/516 (2%)
 Frame = +3

Query  150   VALVSIWALRTSSS---SPSLWKARVCDPAHDPPSCMAIVSEVSSAAPTETDGVAllqml  320
             V L  +  L+ SSS   S  L  +  C    D  SC+A  + ++    ++   V +L  +
Sbjct  21    VCLTFLITLQLSSSTTLSHQLSTSDPCSSTVDLSSCLAKATLIA-GIKSQASPVQVLTTI  79

Query  321   lhssllRIQDAVKLSANVNRRINDRKVQAAVADCMELLDLSQDKVMDSMVALGNLSARAR  500
             L+ SL  +  A  ++  +  + N+ + + A+ADCM L+DLS+D   +S +A+   +  A 
Sbjct  80    LNKSLDEMNVANAMATYIYDQSNETRQRVALADCMHLMDLSRDHATNSALAI---TKGAW  136

Query  501   TDAHSWLSSVLTNHDTCLDGLSEPARSIMEPMIKDLISRAKsslavlvavaPSTEDDLRA  680
              DA +W+S+VLTNH+TCLD L  PARS ME ++K L +   +SL  L A++PS+ED  R+
Sbjct  137   IDAQTWMSAVLTNHNTCLDWLKGPARSAMESVLKGLTTLTATSLCALKAISPSSEDFFRS  196

Query  681   LNGEFPSWVSASDRRLLEASanavaa-nvvvaKDGSGKYKTVAEAVASAPDNGKTRYVIY  857
                + PSW+   D++LL          NVVVA DGSG YKTV +A+ SAP++   RYVI+
Sbjct  197   SAVDVPSWLPHHDKKLLRHPFKNEVQPNVVVAADGSGNYKTVQQAMDSAPNSSAQRYVIH  256

Query  858   IKKGTYKENVEIGKKKTNVMLIGDGLSATIITGSLNYVDGATTFNSATVAAVGDGFIAQD  1037
             +K G YKE V I + KTN+M++G+G  +TIITGSL+   G  T +SAT+AA G G I QD
Sbjct  257   VKNGVYKETVRIHRTKTNIMIVGEGFDSTIITGSLSNASGVRTIHSATLAAFGAGLILQD  316

Query  1038  LRIQNTAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYAHSQRQFYRDCYITGTVDFIF  1217
             L+I+N AGP   QAVAL +  DQSVINRC I+ Y DTLYAHS RQFYRD +I+GTVD IF
Sbjct  317   LKIENKAGPHGVQAVALLVAGDQSVINRCGIEGYHDTLYAHSNRQFYRDSWISGTVDVIF  376

Query  1218  GNAAAVIQNSQVVARKPMAAQ-KNMVTAQGRTDPNQNTGTSIQNCNVSPSSDLGPVKGTI  1394
             GNAAA  QN Q+ ARKP+    KN +TAQGR  P QN+G S Q+C V P+ DL PV G++
Sbjct  377   GNAAAAFQNCQIFARKPLNGHNKNTITAQGRICPTQNSGMSFQDCQVLPADDLKPVMGSV  436

Query  1395  QTYLGRPWKEYSRTVFMESNIGDHIDPAGWFPWDGDFALKTLYYGEYMNRGPGAGTSKRV  1574
             +TYLGRPW+ Y+R VFM+S + +HIDP G+  W+      T+YYGEY N GPGA T  RV
Sbjct  437   RTYLGRPWRTYARVVFMQSFLAEHIDPKGYISWNA--GPDTVYYGEYQNWGPGANTKDRV  494

Query  1575  NWPGYHVITDKAEAMKFTVAQLIQGGSWLKNTGVDY  1682
              WPG H  TD +E   FTVA+LIQG +WLK +GV Y
Sbjct  495   KWPGCHSFTDSSEVEDFTVARLIQGDTWLKYSGVPY  530



>ref|XP_006828588.1| PREDICTED: pectinesterase/pectinesterase inhibitor PPE8B [Amborella 
trichopoda]
 gb|ERM96004.1| hypothetical protein AMTR_s00129p00047530 [Amborella trichopoda]
Length=535

 Score =   457 bits (1176),  Expect = 2e-150, Method: Compositional matrix adjust.
 Identities = 236/478 (49%), Positives = 297/478 (62%), Gaps = 29/478 (6%)
 Frame = +3

Query  339   RIQDAVKLSANVNRRINDRKVQAAVADCMELLDLSQDKVMDSMVALGN---------LSA  491
              IQ A+ L +     I + + + A+ DC++LLDLS D++  ++    N          + 
Sbjct  59    EIQKALSLLSKFTEFIPNFRQRTAIQDCVDLLDLSSDELTWTLSQTPNSGVSRPVFPATG  118

Query  492   RARTDAHSWLSSVLTNHDTCLDGLSEPARSIME-----------------PMIKDLISRA  620
             R + D  +WLS+ L N DTCLDG       + E                  M+K + +  
Sbjct  119   RRKNDVATWLSAALGNQDTCLDGFEGTDGVVKELILGSLVQVTGLVGEILGMVKQIATVP  178

Query  621   KsslavlvavaPSTEDDLRALNGEFPSWVSASDRRLLEASanavaanvvvaKDGSGKYKT  800
                         +TE   R L G FPSW  + DRRLL+     VA N  VA DG+G Y T
Sbjct  179   LGKPLSGAGKQLATEG--RRLMGGFPSWFPSKDRRLLQIPVGGVAVNATVAADGTGNYTT  236

Query  801   VAEAVASAPDNGKTRYVIYIKKGTYKENVEIGKKKTNVMLIGDGLSATIITGSLNYVDGA  980
             V +A+ +APD+ + RYVIY+KKG Y ENVE+ KKKTN+ML+GDG   T+ITG+ N+VDG 
Sbjct  237   VTDAITAAPDHSEQRYVIYVKKGVYNENVEVKKKKTNIMLLGDGKDVTVITGNRNFVDGW  296

Query  981   TTFNSATVAAVGDGFIAQDLRIQNTAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYAH  1160
             TTF SAT A  G+GFIA+ +  +N+AGPEKHQAVA R+ +D S   +C    +QDTLYAH
Sbjct  297   TTFRSATFAVSGNGFIARGITFENSAGPEKHQAVAARVDSDLSAFYQCSFKGFQDTLYAH  356

Query  1161  SQRQFYRDCYITGTVDFIFGNAAAVIQNSQVVARKPMAAQKNMVTAQGRTDPNQNTGTSI  1340
             S RQFYRDC I GTVDFIFGNAAA+ QN +++ RKP+  QKN +TA GR DPNQ TG SI
Sbjct  357   SLRQFYRDCDIFGTVDFIFGNAAAIFQNCRILPRKPLPNQKNSITAHGRKDPNQITGFSI  416

Query  1341  QNCNVSPSSDLGPVKGTIQTYLGRPWKEYSRTVFMESNIGDHIDPAGWFPWDGDFALKTL  1520
             Q CN+S   +L P K + +TYLGRPWK+YSRTV M+S + D I P GW  W GDFAL TL
Sbjct  417   QFCNISGDPELFPTKNSTETYLGRPWKQYSRTVIMQSYMSDVIHPQGWLAWQGDFALDTL  476

Query  1521  YYGEYMNRGPGAGTSKRVNWPGYHVITDKAEAMKFTVAQLIQGGSWLKNTGVDYTEGL  1694
             YYGEYMN GPGAG   RV WPGY  +    EA  FTV+Q I GG WL  TGV +T GL
Sbjct  477   YYGEYMNYGPGAGLGGRVKWPGYRAM-GSVEATNFTVSQFIDGGLWLPATGVKFTAGL  533



>ref|XP_004972208.1| PREDICTED: LOW QUALITY PROTEIN: pectinesterase 2.1-like, partial 
[Setaria italica]
Length=525

 Score =   457 bits (1175),  Expect = 2e-150, Method: Compositional matrix adjust.
 Identities = 243/437 (56%), Positives = 312/437 (71%), Gaps = 23/437 (5%)
 Frame = +3

Query  423   MELLDLSQDKVMDSMVALGNLSARARTDAHSWLSSVLTNHDTCLDGLSEPARS---IMEP  593
             + L+DL++D+       L + SA    DA +W+S+ LT + TC DG+ E +     +   
Sbjct  99    LXLMDLARDR-------LADSSAADDDDARTWISAALTFYATCADGVGEGSLRYAVVARL  151

Query  594   MIKDLISRA-KsslavlvavaPSTEDDLRALN--GEFPSWVSASDRRLLE-ASanavaan  761
              +K L S +     AV    + S  DD+ A +    FPSW++A D  L+E  +   + A+
Sbjct  152   RLKSLASASLAVLNAVGGGGSGSRGDDVLAEDVVDAFPSWMTARDPALMEQGAGVDIKAD  211

Query  762   vvvaKDGSGKYKTVAEAVASAPDNGKTRYVIYIKKGTYKENVEIGKKKTN-VMLIGDGLS  938
             VVVA+DGSGKY+TV EAV +APD GK RYVIY+KKG YKENVE+GKKK   +M++GDG+ 
Sbjct  212   VVVAQDGSGKYRTVKEAVDAAPDGGKIRYVIYVKKGVYKENVEVGKKKKKKLMIVGDGVD  271

Query  939   ATIITGSLNYVDGATTFNSATVA----AVGDGFIAQDLRIQNTAGPEKHQAVALRLGADQ  1106
             AT+ITGS N VDGATTFNSAT+A      GDG I QDLR++NTAGP KHQAVALR+ AD 
Sbjct  272   ATVITGSRNVVDGATTFNSATLARXXSVAGDGIILQDLRVENTAGPAKHQAVALRVSADH  331

Query  1107  SVINRCKIDAYQDTLYAHSQRQFYRDCYITGTVDFIFGNAAAVIQNSQVVARKPMAAQKN  1286
             +V +RC++D +QDTLYAH+ R FYR+C ++GTVDF+FGNAAAV+Q   + AR P+  Q+N
Sbjct  332   AVAHRCRVDGHQDTLYAHALRHFYRECSVSGTVDFVFGNAAAVLQGCALAARLPLRGQQN  391

Query  1287  MVTAQGRTDPNQNTGTSIQNCNVSPSSDLGPVKGT-IQTYLGRPWKEYSRTVFMESNIGD  1463
              VTAQGR DPNQN GTS+  C    + DL PV G  ++T+LGRPWK YSRTV+M S +G 
Sbjct  392   AVTAQGREDPNQNKGTSVHRCX---APDLAPVAGAEVKTFLGRPWKAYSRTVYMRSYVGA  448

Query  1464  HIDPAGWFPWDGDFALKTLYYGEYMNRGPGAGTSKRVNWPGYHVITDKAEAMKFTVAQLI  1643
             H+DP GW  W+G+FALKTL+YGEY N GPGAGT+ RV WPGYHVITD++ A++FTV Q I
Sbjct  449   HVDPRGWLEWNGNFALKTLFYGEYENEGPGAGTAARVRWPGYHVITDRSVAVQFTVGQFI  508

Query  1644  QGGSWLKNTGVDYTEGL  1694
             QGGSWLK+TGV Y  GL
Sbjct  509   QGGSWLKSTGVAYINGL  525



>ref|XP_009614734.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 61 
[Nicotiana tomentosiformis]
Length=585

 Score =   459 bits (1180),  Expect = 2e-150, Method: Compositional matrix adjust.
 Identities = 249/566 (44%), Positives = 349/566 (62%), Gaps = 31/566 (5%)
 Frame = +3

Query  81    PKRKPSSCRalyvllylaaIVGSVALVSIWALRTSSSS----PSLWKARVCDPAHDPPSC  248
             PK + S  + L +   +  I  ++++  +  +R +S +    PS   AR C     P  C
Sbjct  21    PKSRSSKLKILIIFATVLLIASAISVAVLVGVRKNSGNRIDKPSQAMARTCSRTLYPSLC  80

Query  249   M-AIVSEVSSAAPTETDGVAllqmllhssllRIQDAVKLSANVNRRINDRKVQAAVADCM  425
             + ++++   + + ++ D V    + ++ +L R   A+ +S+++N    + ++++A  DC+
Sbjct  81    LNSLINYPGAKSASDNDLV---HISVNLTLQRFGKALYISSDINNLQMNTQIRSAYDDCL  137

Query  426   ELLDLSQDKVMDSMVAL-----GNLSARART-DAHSWLSSVLTNHDTCLDGLSEPARSIM  587
             ELL+ S D +  S+ ++     G+ S    T D  +WLS+ LTN DTC DG ++   ++ 
Sbjct  138   ELLEESVDLLSHSLNSVFPGGDGSNSPTGSTHDVMTWLSAALTNQDTCTDGFADVTGNVK  197

Query  588   EPMIKDLISRAKsslavlvavaPSTEDD----------------LRALNGEFPSWVSASD  719
             + M ++L   ++     L   A +  DD                    + +FP W+S  D
Sbjct  198   DQMSENLKDLSELVSNALAIYAAANGDDDFSGIPIQNRRRRLMKFEKHHDDFPKWLSRRD  257

Query  720   RRLLEASanavaanvvvaKDGSGKYKTVAEAVASAPDNGKTRYVIYIKKGTYKE-NVEIG  896
             R+LL  S +A+ A+++VAKDGSG  KT+AEA+   P+    R +IY+K G Y+E N+++G
Sbjct  258   RKLLNKSVSAIQADIIVAKDGSGTVKTIAEAIKKVPEKSNRRTIIYVKAGRYEEDNLKVG  317

Query  897   KKKTNVMLIGDGLSATIITGSLNYVDGATTFNSATVAAVGDGFIAQDLRIQNTAGPEKHQ  1076
             +KK NVM IGDG   T+ITG  +     TTF++A+ AA G GF+A+D+  +N AGP  HQ
Sbjct  318   RKKMNVMFIGDGKGKTVITGGKSVAQHITTFHTASFAATGAGFVARDMTFENYAGPSNHQ  377

Query  1077  AVALRLGADQSVINRCKIDAYQDTLYAHSQRQFYRDCYITGTVDFIFGNAAAVIQNSQVV  1256
             AVALR+G D +V+ RC I  YQDTLY HSQRQFYR+C I GTVDFIFGNAA V+QN  + 
Sbjct  378   AVALRIGGDHAVVFRCNIIGYQDTLYVHSQRQFYRECDIYGTVDFIFGNAAVVLQNCNIY  437

Query  1257  ARKPMAAQKNMVTAQGRTDPNQNTGTSIQNCNVSPSSDLGPVKGTIQTYLGRPWKEYSRT  1436
             ARKPMA QKN +TAQ R DPNQNTG SI  C +  + DL   KG+  TYLGRPWK YSRT
Sbjct  438   ARKPMANQKNTITAQNRKDPNQNTGISIHACKLLATPDLEASKGSFPTYLGRPWKLYSRT  497

Query  1437  VFMESNIGDHIDPAGWFPWDGDFALKTLYYGEYMNRGPGAGTSKRVNWPGYHVITDKAEA  1616
             V+M SN+GDHI P+GW  W+G+FAL TLYYGEYMN GPGA   +RV WPGY VI    EA
Sbjct  498   VYMLSNMGDHIHPSGWLEWNGNFALDTLYYGEYMNFGPGAAVGQRVTWPGYRVIKSVEEA  557

Query  1617  MKFTVAQLIQGGSWLKNTGVDYTEGL  1694
              KFTVA+ I G SWL +TGV Y  GL
Sbjct  558   SKFTVAKFIYGSSWLPSTGVAYLAGL  583



>ref|XP_008235121.1| PREDICTED: pectinesterase-like [Prunus mume]
Length=562

 Score =   457 bits (1177),  Expect = 3e-150, Method: Compositional matrix adjust.
 Identities = 232/444 (52%), Positives = 295/444 (66%), Gaps = 13/444 (3%)
 Frame = +3

Query  402   QAAVADCMELLD--LSQDKVMDSMVALGNLSARARTDAHSWLSSVLTNHDTCLDGLSEPA  575
             Q A+ DC+EL D  +++   + S +++  LS+    D  + LS  +TN  TCLDG ++  
Sbjct  117   QIALDDCLELFDDTIAELNAVISDLSIKKLSSNRYYDLKTLLSGAMTNQYTCLDGFNDTG  176

Query  576   ----------RSIMEPMIKDLISRAKsslavlvavaPSTE-DDLRALNGEFPSWVSASDR  722
                       ++I + +   L+   K   A+    + S    +   +   FP+WVS+ DR
Sbjct  177   IVRQEIQSRLQTISQHVSNALVMLKKIPGALKYENSKSEMFPEFGPMKNGFPTWVSSKDR  236

Query  723   RLLEASanavaanvvvaKDGSGKYKTVAEAVASAPDNGKTRYVIYIKKGTYKENVEIGKK  902
             +LL++ AN    ++VVAKDG+G + T++EAVA AP++  TR+VIYIK G Y ENVE+ +K
Sbjct  237   KLLQSVANGTKYDLVVAKDGTGNFTTISEAVAVAPNSSATRFVIYIKSGAYFENVEVVRK  296

Query  903   KTNVMLIGDGLSATIITGSLNYVDGATTFNSATVAAVGDGFIAQDLRIQNTAGPEKHQAV  1082
             KTN+M +GDG+  T++  S N VDG TTF SATVA VGDGFIAQ +  +N AGP KHQAV
Sbjct  297   KTNLMFLGDGIGKTVVKASRNVVDGWTTFRSATVAVVGDGFIAQGITFENAAGPSKHQAV  356

Query  1083  ALRLGADQSVINRCKIDAYQDTLYAHSQRQFYRDCYITGTVDFIFGNAAAVIQNSQVVAR  1262
             A R G+D S   +C    YQDTLY HS RQFYR+C I GTVDFIFGNAA V+QN  + AR
Sbjct  357   AFRSGSDFSAFYKCSFVGYQDTLYVHSLRQFYRECDIYGTVDFIFGNAAVVLQNCNLYAR  416

Query  1263  KPMAAQKNMVTAQGRTDPNQNTGTSIQNCNVSPSSDLGPVKGTIQTYLGRPWKEYSRTVF  1442
             KP   QKNM TAQGR DPNQNTG SI NC V+ +SDL PVK T +TYLGRPWKEYSRTV+
Sbjct  417   KPNENQKNMFTAQGREDPNQNTGISILNCKVAAASDLVPVKSTFKTYLGRPWKEYSRTVY  476

Query  1443  MESNIGDHIDPAGWFPWDGDFALKTLYYGEYMNRGPGAGTSKRVNWPGYHVITDKAEAMK  1622
             M+S I D + PAGW  W+G FAL TLYYGEY+NRGPG+ TS RV WPGY VI    EA +
Sbjct  477   MKSYIDDLVQPAGWLEWNGTFALSTLYYGEYLNRGPGSNTSARVKWPGYRVINSSDEANQ  536

Query  1623  FTVAQLIQGGSWLKNTGVDYTEGL  1694
             FTV   IQG  WL +T + Y  GL
Sbjct  537   FTVGPFIQGNEWLNSTNIPYFIGL  560



>ref|XP_004290811.1| PREDICTED: pectinesterase-like [Fragaria vesca subsp. vesca]
Length=567

 Score =   458 bits (1178),  Expect = 3e-150, Method: Compositional matrix adjust.
 Identities = 231/449 (51%), Positives = 293/449 (65%), Gaps = 21/449 (5%)
 Frame = +3

Query  402   QAAVADCMELLDLSQDKVMDSMVALGNLSARARTDAHSW------LSSVLTNHDTCLDGL  563
             Q A+ DC+EL D   D V    V +  LS++    A  +      LS+ +TN  TCL+G 
Sbjct  121   QQALDDCLELFD---DTVAQLKVTMSELSSKKSPAAKHYNHLRTLLSAAMTNQYTCLEGF  177

Query  564   SEPARSIMEPMIKDLISRAKsslavlvav-----------aPSTEDDLRALNGEFPSWVS  710
                  S ++ +  +L SR  ++                     + D+  A+   FP+WV 
Sbjct  178   DSSTSSTVKAVKAELESRLNTTCKHFSNALVMLKKIRGVVERESTDEFGAMKNGFPTWVG  237

Query  711   ASDRRLLE-ASanavaanvvvaKDGSGKYKTVAEAVASAPDNGKTRYVIYIKKGTYKENV  887
             +  R+LL+ +SAN    +++VAKDGSG + T+ +AVA+AP++  TR+VIYIK G Y ENV
Sbjct  238   SKARKLLQTSSANQTKYDLLVAKDGSGNFTTITDAVAAAPNSSATRFVIYIKAGAYFENV  297

Query  888   EIGKKKTNVMLIGDGLSATIITGSLNYVDGATTFNSATVAAVGDGFIAQDLRIQNTAGPE  1067
             E+  KKTN+M +GDG+  T++  S N VDG TTF SATVA VG GFIA+ +  +N+AGP 
Sbjct  298   EVVSKKTNLMFLGDGIGKTVVKASRNVVDGWTTFRSATVAVVGGGFIAKGITFENSAGPS  357

Query  1068  KHQAVALRLGADQSVINRCKIDAYQDTLYAHSQRQFYRDCYITGTVDFIFGNAAAVIQNS  1247
             KHQAVALR G+D S   +C    YQDTLY HS RQFYR+C I GTVDFIFGNAA V QN 
Sbjct  358   KHQAVALRSGSDLSAFYQCSFVGYQDTLYVHSLRQFYRECDIYGTVDFIFGNAAVVFQNC  417

Query  1248  QVVARKPMAAQKNMVTAQGRTDPNQNTGTSIQNCNVSPSSDLGPVKGTIQTYLGRPWKEY  1427
              + ARKP   QKN+ TAQGR DPNQNTG SI NC V+ +SDL PVK T +TYLGRPWKEY
Sbjct  418   NLYARKPNDGQKNIFTAQGREDPNQNTGISILNCKVTAASDLIPVKSTFKTYLGRPWKEY  477

Query  1428  SRTVFMESNIGDHIDPAGWFPWDGDFALKTLYYGEYMNRGPGAGTSKRVNWPGYHVITDK  1607
             SRTV++ SNI D +DPAGW  W+G FAL TLYYGEY+NRG G+GT+ RV WPGY VI + 
Sbjct  478   SRTVYLRSNIDDTVDPAGWLEWNGTFALSTLYYGEYLNRGNGSGTTARVTWPGYRVINNS  537

Query  1608  AEAMKFTVAQLIQGGSWLKNTGVDYTEGL  1694
              EA +FTV   IQG  WL +TG+ Y  GL
Sbjct  538   TEASQFTVGAFIQGNEWLNSTGIPYFAGL  566



>ref|XP_012083608.1| PREDICTED: pectinesterase 2 isoform X1 [Jatropha curcas]
 gb|KDP28780.1| hypothetical protein JCGZ_14551 [Jatropha curcas]
Length=514

 Score =   456 bits (1173),  Expect = 3e-150, Method: Compositional matrix adjust.
 Identities = 241/494 (49%), Positives = 322/494 (65%), Gaps = 13/494 (3%)
 Frame = +3

Query  219   CDPAHDPPSCMAIVSEVSSAAPTETDGVAllqmllhssllRIQDAVKLSANVNRRINDRK  398
             C    +P  C   +S      P + +    L++    +L R   A   + ++ ++  + +
Sbjct  32    CKKTPNPGPCEYFLSHEPQNIPIKQES-DFLKISKQLALERALHAQAHTYSLGKKCRNER  90

Query  399   VQAAVADCMELLDLSQDKVMDSMVALGNLSARARTDAHSWLSSVLTNHDTCLDGLSEPAR  578
              +AA ADC+EL + +   +  +       S  ++ DA +WLS+ LTN +TC  G  E   
Sbjct  91    EKAAWADCLELYEYTVLWLNQTTT-----SKCSKYDAQTWLSTALTNLETCKTGFEELGV  145

Query  579   S-IMEPMIKDLISRAKsslavlvavaPSTEDDLRALNGEFPSWVSASDRRLLEASanava  755
             S  + P++ + +S+      + +   P TE   +     FP+W+   DR+LL++++ A  
Sbjct  146   SDYILPLMSNNVSKL-ICNTLALNKVPYTEPSYKE---GFPTWLKPGDRKLLQSTSPASQ  201

Query  756   anvvvaKDGSGKYKTVAEAVASAPD-NGKTRYVIYIKKGTYKENVEIGKKKTNVMLIGDG  932
             AN+VVA+DGSG YKT+ EAVA+A   +G  RY+IY+K GTYKENV+IGK   N+M +GDG
Sbjct  202   ANIVVAQDGSGNYKTINEAVAAASKRSGTGRYIIYVKSGTYKENVQIGKSLKNIMFVGDG  261

Query  933   LSATIITGSLNYVDGATTFNSATVAAVGDGFIAQDLRIQNTAGPEKHQAVALRLGADQSV  1112
             +  TI+TGS +   GATTFNSAT A VGDGFIA+D+  +NTAGP+ HQAVALR GAD SV
Sbjct  262   IGKTIVTGSKSVGGGATTFNSATFAVVGDGFIARDMTFRNTAGPQNHQAVALRSGADLSV  321

Query  1113  INRCKIDAYQDTLYAHSQRQFYRDCYITGTVDFIFGNAAAVIQNSQVVARKPMAAQKNMV  1292
               +C  + YQDTLY HSQRQFYR+C I GTVDFIFGNAA V+QN  +  R P   + N +
Sbjct  322   FYKCSFEGYQDTLYVHSQRQFYRECDIYGTVDFIFGNAAVVLQNCNIYPRNP-PNKTNTL  380

Query  1293  TAQGRTDPNQNTGTSIQNCNVSPSSDLGPVKGTIQTYLGRPWKEYSRTVFMESNIGDHID  1472
             TAQGRTDPNQNTG SI N  V+ +SDL PV+G+++TYLGRPWK+YSRTVFM++ +   I+
Sbjct  381   TAQGRTDPNQNTGISIHNSRVTAASDLTPVQGSVRTYLGRPWKQYSRTVFMKTYLDSLIN  440

Query  1473  PAGWFPWDGDFALKTLYYGEYMNRGPGAGTSKRVNWPGYHVITDKAEAMKFTVAQLIQGG  1652
             PAGW  W G+FAL TLYYGEYMN GPG+ T+ RVNW GYHVIT   EA +FTV   I G 
Sbjct  441   PAGWMEWSGNFALDTLYYGEYMNTGPGSSTANRVNWKGYHVITSPTEASQFTVGNFISGN  500

Query  1653  SWLKNTGVDYTEGL  1694
             SWL  T V +T GL
Sbjct  501   SWLPGTNVPFTSGL  514



>gb|AGJ83739.1| pectinesterase/pectinesterase inhibitor PPE8B-like protein, partial 
[Caragana korshinskii]
Length=480

 Score =   454 bits (1169),  Expect = 4e-150, Method: Compositional matrix adjust.
 Identities = 233/447 (52%), Positives = 302/447 (68%), Gaps = 18/447 (4%)
 Frame = +3

Query  384   INDRKVQAAVADCMELLDLSQDKVMDSMVAL----------GNLSARARTDAHSWLSSVL  533
               D ++  AV+DC++LLDLS D++  S+ A           GNLS+  RT    WLS+ L
Sbjct  40    FGDFRLSNAVSDCLDLLDLSFDELDWSVSATDNPKGKHNSTGNLSSDLRT----WLSAAL  95

Query  534   TNHDTCLDGLSEPARSIMEPMIKDLISRAKsslavlvavaPSTEDDLRALNGEFPSWVSA  713
              N +TC+DG  E   SI++ ++        S L  L+       D      G+FPSWV  
Sbjct  96    ANPETCMDGF-EGTNSIVKGLVSTGFGEMTSLLKQLLTQVSPVSDHFPQ-QGKFPSWVKQ  153

Query  714   SDRRLLEASanavaanvvvaKDGSGKYKTVAEAVASAPDNGKTRYVIYIKKGTYKENVEI  893
              +R+LL+A+   V A V    DG+G +  V +AV +AP++   RYVIYIK+G Y E+VEI
Sbjct  154   GERKLLQANRVHVDAVVAA--DGTGNFTKVMDAVHAAPEHSMERYVIYIKRGVYNESVEI  211

Query  894   GKKKTNVMLIGDGLSATIITGSLNYVDGATTFNSATVAAVGDGFIAQDLRIQNTAGPEKH  1073
              KKK N+M+IGDG++AT+I+G+ ++VDG TTF SAT A  G GFIA+D+  QNTAGPEKH
Sbjct  212   KKKKWNLMMIGDGMNATVISGNRSFVDGWTTFRSATFAVSGRGFIARDITFQNTAGPEKH  271

Query  1074  QAVALRLGADQSVINRCKIDAYQDTLYAHSQRQFYRDCYITGTVDFIFGNAAAVIQNSQV  1253
             QAVALR  +D SV  RC I  YQD+LY H+ RQFYR+C I+GTVDFIFG+A A+ QN Q+
Sbjct  272   QAVALRSDSDLSVFYRCGIFGYQDSLYTHTMRQFYRECKISGTVDFIFGDATALFQNCQI  331

Query  1254  VARKPMAAQKNMVTAQGRTDPNQNTGTSIQNCNVSPSSDLGPVKGTIQTYLGRPWKEYSR  1433
             +A+K +  QKN +TA GR DPN+ TG SIQ CN+S  SDL PV  + QTYLGRPWK YSR
Sbjct  332   LAKKGLPNQKNPITAHGRKDPNEPTGFSIQFCNISADSDLLPVVNSTQTYLGRPWKPYSR  391

Query  1434  TVFMESNIGDHIDPAGWFPWDGDFALKTLYYGEYMNRGPGAGTSKRVNWPGYHVITDKAE  1613
             T+FM+S I D + P GW  W+GDFAL TLYY EYMN GPGAG + RV WPGYH++ D ++
Sbjct  392   TIFMQSYISDVLRPEGWLEWNGDFALDTLYYAEYMNYGPGAGRANRVKWPGYHMMNDSSQ  451

Query  1614  AMKFTVAQLIQGGSWLKNTGVDYTEGL  1694
             A  FTV+Q I+G  WL +TGV +T GL
Sbjct  452   ASNFTVSQFIEGNLWLPSTGVTFTAGL  478



>ref|XP_008448427.1| PREDICTED: pectinesterase/pectinesterase inhibitor PPE8B-like 
[Cucumis melo]
Length=576

 Score =   457 bits (1177),  Expect = 6e-150, Method: Compositional matrix adjust.
 Identities = 231/457 (51%), Positives = 302/457 (66%), Gaps = 13/457 (3%)
 Frame = +3

Query  342   IQDAVKLSANVNRRINDRKVQAAVADCMELLDLSQDKVMDSMVALGNLSARART------  503
             ++  + + +  ++ + D ++  A++DC++LLD S D++  S+ A  N  A+  +      
Sbjct  124   VRQVMAIFSPFSKLLGDFRLSTAISDCLDLLDSSADQLSWSLSATQNPKAKDHSTGDLSS  183

Query  504   DAHSWLSSVLTNHDTCLDGLSEPARSIMEPMIKDLISRAKsslavlvavaPSTEDDLRAL  683
             D  +WLS+ + N +TC+DG  E   SI    IK L+S   + L   +    S    +   
Sbjct  184   DLKTWLSAAVVNPETCMDGF-EGTNSI----IKGLVSGGINQLTSQLYDLLSMVKSIPNQ  238

Query  684   NGEFPSWVSASDRRLLEASanavaanvvvaKDGSGKYKTVAEAVASAPDNGKTRYVIYIK  863
               EFPSW+ + DR LL+ +  A  A V    DG+G +  V +AV +APD    RYVIYIK
Sbjct  239   PSEFPSWLKSEDRNLLQLNDLAADATVAA--DGTGDFTNVMDAVLAAPDKSTRRYVIYIK  296

Query  864   KGTYKENVEIGKKKTNVMLIGDGLSATIITGSLNYVDGATTFNSATVAAVGDGFIAQDLR  1043
             KG Y ENVEI KKK N+M+IGDG+ ATII+G+ +++DG TTF SAT A  G GFIA+D+ 
Sbjct  297   KGVYLENVEIKKKKWNLMMIGDGIDATIISGNRSFIDGWTTFRSATFAVSGRGFIARDIT  356

Query  1044  IQNTAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYAHSQRQFYRDCYITGTVDFIFGN  1223
              +NTAG EKHQAVALR  +D SV  RC+I  YQDTLY H+ RQFYR+C I+GTVDF+FG+
Sbjct  357   FENTAGAEKHQAVALRSDSDLSVFFRCRIRGYQDTLYTHTMRQFYRECQISGTVDFLFGD  416

Query  1224  AAAVIQNSQVVARKPMAAQKNMVTAQGRTDPNQNTGTSIQNCNVSPSSDLGPVKGTIQTY  1403
             A  V QN  ++A+K +  QKN +TAQGR DPNQ TG SIQ CN+S  SDL P   T  TY
Sbjct  417   ATVVFQNCSILAKKGLPNQKNTITAQGRKDPNQPTGFSIQFCNISADSDLKPSVNTTATY  476

Query  1404  LGRPWKEYSRTVFMESNIGDHIDPAGWFPWDGDFALKTLYYGEYMNRGPGAGTSKRVNWP  1583
             LGRPWKEYSRT+ M+S I D I P GW  W+G+FAL TL+Y E+MN GPGAG +KRVNWP
Sbjct  477   LGRPWKEYSRTIIMQSYISDAIRPEGWLEWNGNFALNTLFYAEFMNYGPGAGLAKRVNWP  536

Query  1584  GYHVITDKAEAMKFTVAQLIQGGSWLKNTGVDYTEGL  1694
             GYH +   +EA  FTVAQ I+G  WL +TGV YT GL
Sbjct  537   GYHRLNQTSEATNFTVAQFIEGNMWLPSTGVKYTAGL  573



>gb|ABZ89800.1| pectin methylesterase-like protein [Taiwania cryptomerioides]
Length=584

 Score =   457 bits (1177),  Expect = 7e-150, Method: Compositional matrix adjust.
 Identities = 236/461 (51%), Positives = 301/461 (65%), Gaps = 26/461 (6%)
 Frame = +3

Query  390   DRKVQAAVADCMELLDLSQDKVMDSMVALGNLS----ARARTDAHSWLSSVLTNHDTCLD  557
             D + + A+ DCME+ D + +++ D++  L N +     +   D  + LS  +TN  TCLD
Sbjct  123   DFRQRGALKDCMEMFDDTLEELQDTLTDLQNATFMSLPKYADDLKTLLSGAITNQYTCLD  182

Query  558   GLSEPARSIMEPM------IKDLISRA-------KsslavlvavaPSTEDDLRAL-----  683
             G       + + +      I  L+S +            + +  A S  D  R L     
Sbjct  183   GFHLCKGHLRQDLNAELLNISHLVSNSLAMVCNFSQQANLALGNADSLSDRRRRLLSNDF  242

Query  684   ----NGEFPSWVSASDRRLLEASanavaanvvvaKDGSGKYKTVAEAVASAPDNGKTRYV  851
                 +  FPSW+SA DRRLL+  A  + AN VVAKDGSG Y T++ AVA+AP+   +RYV
Sbjct  243   MSSDDHGFPSWMSAGDRRLLQTPAQNINANAVVAKDGSGSYTTISAAVAAAPEKSTSRYV  302

Query  852   IYIKKGTYKENVEIGKKKTNVMLIGDGLSATIITGSLNYVDGATTFNSATVAAVGDGFIA  1031
             I+IKKG Y+ENV+I K K N+M IGDG   T++T + N VDG TTF+SAT A  G GF+A
Sbjct  303   IHIKKGVYQENVDIPKNKHNLMFIGDGKDVTVVTANRNVVDGYTTFHSATAAVTGKGFVA  362

Query  1032  QDLRIQNTAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYAHSQRQFYRDCYITGTVDF  1211
             +D+  +NTAGP KHQAVALR+G+D S   RC  + YQDTLY HS RQFYR+C + GTVDF
Sbjct  363   RDMTFKNTAGPTKHQAVALRVGSDLSAFLRCTFEGYQDTLYVHSLRQFYRECDVYGTVDF  422

Query  1212  IFGNAAAVIQNSQVVARKPMAAQKNMVTAQGRTDPNQNTGTSIQNCNVSPSSDLGPVKGT  1391
             +FGNAA V+QN  ++ARKP A QK M TAQGR DPNQNTG SIQNC +S +SDL   K +
Sbjct  423   VFGNAAVVLQNCNIMARKPSANQKIMYTAQGREDPNQNTGISIQNCRLSATSDLVAAKSS  482

Query  1392  IQTYLGRPWKEYSRTVFMESNIGDHIDPAGWFPWDGDFALKTLYYGEYMNRGPGAGTSKR  1571
              Q YLGRPWK+YSRTV ++S++ D I PAGW  WDG+FAL TLYYGEYMNRGPGA T+ R
Sbjct  483   FQVYLGRPWKQYSRTVILQSHLDDLIHPAGWHEWDGNFALSTLYYGEYMNRGPGAATANR  542

Query  1572  VNWPGYHVITDKAEAMKFTVAQLIQGGSWLKNTGVDYTEGL  1694
             V W G+ VIT  +EA +FTV Q +QG SWL  TGV YT G 
Sbjct  543   VKWGGHRVITSSSEANQFTVNQFLQGDSWLPATGVQYTAGF  583



>ref|XP_004303758.1| PREDICTED: pectinesterase-like [Fragaria vesca subsp. vesca]
Length=578

 Score =   457 bits (1175),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 234/458 (51%), Positives = 299/458 (65%), Gaps = 26/458 (6%)
 Frame = +3

Query  393   RKVQAAVADCMELLDLSQDKVMDSMVALGNLSARART------DAHSWLSSVLTNHDTCL  554
             ++ + A+ DC+E +D + D++ +++  L    +  +T      D  + +SS +TN +TCL
Sbjct  123   KRERCALHDCLETIDETLDELHEAVKDLFQYPSINKTLTAHADDLKTLISSAITNQETCL  182

Query  555   DGLS------------EPARSIMEPMIKDLISRAKssl-----avlvavaPSTEDDLRAL  683
             DG S            E  +  +E +  + ++  K+         + A++ +T   L+  
Sbjct  183   DGFSHAEADKIVRKSLEKGQKYVEKLCSNALAMIKNMTDNDIANEMKAMSSTTNRKLKEE  242

Query  684   NGE-FPSWVSASDRRLLEASanavaanvvvaKDGSGKYKTVAEAVASAPDNGKTRYVIYI  860
               E +P W+SA+DR LL++S       V    DGSG YKTV+EAVA+AP    +RYVI I
Sbjct  243   RSEGWPEWLSAADRHLLQSSTVTPNVIVAA--DGSGNYKTVSEAVAAAPSKSTSRYVIRI  300

Query  861   KKGTYKENVEIGKKKTNVMLIGDGLSATIITGSLNYVDGATTFNSATVAAVGDGFIAQDL  1040
             K G Y+ENV++ K KTN+M +GDG + TIITGS N VDG TTFNSATVAAVG GF+A+D+
Sbjct  301   KAGVYRENVDVPKAKTNIMFLGDGRTTTIITGSRNVVDGDTTFNSATVAAVGAGFLARDI  360

Query  1041  RIQNTAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYAHSQRQFYRDCYITGTVDFIFG  1220
               QNTAGP KHQAVALR+G+D S   RC I AYQD+LY HS RQF+  C+I GTVDFIFG
Sbjct  361   TFQNTAGPSKHQAVALRVGSDLSAFYRCDILAYQDSLYVHSNRQFFEGCFIAGTVDFIFG  420

Query  1221  NAAAVIQNSQVVARKPMAAQKNMVTAQGRTDPNQNTGTSIQNCNVSPSSDLGPVKGTIQT  1400
             NAA V+QN  + ARKP + QKNM+TAQGRTDPNQNTG  IQ   +  +SDL  VKG+ +T
Sbjct  421   NAAVVLQNCDIHARKPNSGQKNMLTAQGRTDPNQNTGIVIQKSRIGATSDLQAVKGSFKT  480

Query  1401  YLGRPWKEYSRTVFMESNIGDHIDPAGWFPWDGDFALKTLYYGEYMNRGPGAGTSKRVNW  1580
             YLGRPWKEYSRTV M+S+I D IDPAGW+ W G FAL TL+Y EY N G GA TS RV W
Sbjct  481   YLGRPWKEYSRTVIMQSSITDIIDPAGWYEWSGTFALDTLFYAEYANTGAGASTSNRVTW  540

Query  1581  PGYHVITDKAEAMKFTVAQLIQGGSWLKNTGVDYTEGL  1694
              GY VIT   EA  FT    I GGSWL  TG  +T GL
Sbjct  541   KGYKVITSATEAQAFTPGNFIAGGSWLSATGFPFTLGL  578



>ref|XP_010271267.1| PREDICTED: pectinesterase-like [Nelumbo nucifera]
Length=526

 Score =   455 bits (1170),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 231/446 (52%), Positives = 304/446 (68%), Gaps = 17/446 (4%)
 Frame = +3

Query  390   DRKVQAAVADCMELLDLSQDKVMDSMVALGNLSARARTDAHSWLSSVLTNHDTCLDGLSE  569
             D K + A ADC+EL     D V     A+G+ +  + +DA +WLS+ +TN  TC +G  E
Sbjct  87    DEKAKMAWADCVELY---SDTVTQLNRAMGSKNPLSWSDAQTWLSAAITNQQTCQNGFVE  143

Query  570   PARSI-----------MEPMIKDLISRAKsslavlvavaPSTEDDLRALNGEFPSWVSAS  716
               +S               M+ + ++  K + +   ++      + R L+  FP+WVSA+
Sbjct  144   LGKSSYLSSFPFMLSNFSKMVSNSLAINKEADSSAASLLGKQGGNRRLLSDGFPTWVSAA  203

Query  717   DRRLLEASanavaanvvvaKDGSGKYKTVAEAVASAPDNGKTRYVIYIKKGTYKENVEIG  896
             DR+LL++ + A  A+VVVA DGSG YKT++EAVA++      R+VIY+KKG YKENVEI 
Sbjct  204   DRKLLQSPSAASQADVVVAADGSGNYKTISEAVAASSKRSGKRFVIYVKKGVYKENVEI-  262

Query  897   KKKTNVMLIGDGLSATIITGSLNYVDGATTFNSATVAAVGDGFIAQDLRIQNTAGPEKHQ  1076
              K +N+MLIGDG+ ATI+T S N  DG+TTF +ATV   GDGF+A+D+  +NTAGP+KHQ
Sbjct  263   -KASNIMLIGDGIDATIVTDSKNAQDGSTTFRTATVGVTGDGFMARDMTFENTAGPQKHQ  321

Query  1077  AVALRLGADQSVINRCKIDAYQDTLYAHSQRQFYRDCYITGTVDFIFGNAAAVIQNSQVV  1256
             AVALR G+D SV   C    YQDTLY +SQRQFYRDC I GTVDFIFG+A AV+QN  + 
Sbjct  322   AVALRSGSDLSVFYSCSFKGYQDTLYVYSQRQFYRDCDIYGTVDFIFGDAVAVLQNCNIY  381

Query  1257  ARKPMAAQKNMVTAQGRTDPNQNTGTSIQNCNVSPSSDLGPVKGTIQTYLGRPWKEYSRT  1436
              RKPM+ QKN VTAQGRTDPN+NTG SI N  V+ +SDL  V+G+ +TYLGRPW++YSRT
Sbjct  382   VRKPMSGQKNTVTAQGRTDPNENTGISIHNSRVTAASDLRAVQGSFKTYLGRPWQKYSRT  441

Query  1437  VFMESNIGDHIDPAGWFPWDGDFALKTLYYGEYMNRGPGAGTSKRVNWPGYHVITDKAEA  1616
             VFM++++   +D AGW  W G FAL +LYYGEYMN GPGA TS RVNW G+HV++   +A
Sbjct  442   VFMKTSLDSLVDRAGWLEWSGKFALSSLYYGEYMNTGPGASTSGRVNWEGFHVMSAD-DA  500

Query  1617  MKFTVAQLIQGGSWLKNTGVDYTEGL  1694
              KFTV   + GGSW+   GV +T GL
Sbjct  501   GKFTVGSFLGGGSWIAAAGVPFTPGL  526



>gb|KCW73020.1| hypothetical protein EUGRSUZ_E01454 [Eucalyptus grandis]
Length=480

 Score =   453 bits (1165),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 234/454 (52%), Positives = 310/454 (68%), Gaps = 12/454 (3%)
 Frame = +3

Query  339   RIQDAVKLSANVNRRINDRKVQAAVADCMELLDLSQDKVMDSMVALGNLSARARTDAHSW  518
             R Q A   + ++  + ++   +AA ADC++L + +  ++  ++V         + +A +W
Sbjct  37    RAQMAHSNTHSLGSKCSNEHEKAAWADCLQLYEYTILRLNRTIV-----HDCTQDEAQTW  91

Query  519   LSSVLTNHDTCLDGLSEPARS-IMEPMIKDLISRAKsslavlvavaPSTEDDLRALNGEF  695
             LS+ LTN +TC  G  E   S  + P++ + +S+  S+   L     +T +  +    +F
Sbjct  92    LSTALTNLETCQAGFVELGVSGNVLPLMSNNVSKLISNTLALNYAPYTTPNYTK----KF  147

Query  696   PSWVSASDRRLLEASanavaanvvvaKDGSGKYKTVAEAV-ASAPDNGKTRYVIYIKKGT  872
             P+WV   DR+LL++S+    AN++VA+DGSG YKT++EA+ A++  +G  RY+IYIK GT
Sbjct  148   PTWVRPGDRKLLQSSSAVSKANIIVAQDGSGNYKTISEAITAASKRSGTARYIIYIKAGT  207

Query  873   YKENVEIGKKKTNVMLIGDGLSATIITGSLNYVDGATTFNSATVAAVGDGFIAQDLRIQN  1052
             Y ENVE+G K  N+M +GDG+  TIITGS +   G+TTFNSATVA VGDGFIAQD+  +N
Sbjct  208   YSENVEVGSKLENIMFVGDGIGKTIITGSKSVGGGSTTFNSATVAVVGDGFIAQDITFRN  267

Query  1053  TAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYAHSQRQFYRDCYITGTVDFIFGNAAA  1232
             TAG   HQAVALR G+D SV  RC  + YQDTLY HS+RQFYR+C I GTVDFIFGNAA 
Sbjct  268   TAGAANHQAVALRSGSDLSVFYRCGFEGYQDTLYVHSERQFYRECDIYGTVDFIFGNAAV  327

Query  1233  VIQNSQVVARKPMAAQKNMVTAQGRTDPNQNTGTSIQNCNVSPSSDLGPVKGTIQTYLGR  1412
             V+QN  + AR P   + N VTAQGRTDPNQNTG SI NC V+ +SDL  V+ +++TYLGR
Sbjct  328   VLQNCNIYARNP-PNKVNTVTAQGRTDPNQNTGISIHNCKVTAASDLKSVQSSVKTYLGR  386

Query  1413  PWKEYSRTVFMESNIGDHIDPAGWFPWDGDFALKTLYYGEYMNRGPGAGTSKRVNWPGYH  1592
             PW+EYSRTVFM++ +   I+ AGW  WDG+FAL TLYYGEY+N GPG+ T+ RV W GYH
Sbjct  387   PWQEYSRTVFMKTYLDSLINSAGWMEWDGNFALDTLYYGEYLNTGPGSSTASRVTWAGYH  446

Query  1593  VITDKAEAMKFTVAQLIQGGSWLKNTGVDYTEGL  1694
             VIT   EA KFTV   I GGSWL  TGV YT GL
Sbjct  447   VITSATEASKFTVGSFIAGGSWLPATGVPYTSGL  480



>ref|XP_006350555.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 61-like 
[Solanum tuberosum]
Length=585

 Score =   457 bits (1175),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 244/573 (43%), Positives = 348/573 (61%), Gaps = 29/573 (5%)
 Frame = +3

Query  54    TSHLPLLFTPKRKPSSCRalyvllylaaIVGSVALVSIWALRTSSSS----PSLWKARVC  221
             TS   ++  P  + S  + + +   +  I  ++A+  +  +R  + +    PS   AR C
Sbjct  14    TSGRVIIPNPNPRNSKIKIMLISATVLLIASAIAVAVLIGVRHKAGNRIDKPSQAMARTC  73

Query  222   DPAHDPPSCM-AIVSEVSSAAPTETDGVAllqmllhssllRIQDAVKLSANVNRRINDRK  398
                  P  C+ ++++   + + +++D V    + ++ +L R    +  ++++N    + +
Sbjct  74    SRTLYPSLCLNSLINYPGANSASDSDLV---HISVNLTLQRFGKGLYKASDINNLQMNTQ  130

Query  399   VQAAVADCMELLDLSQDKVMDSMVAL----GNLSARARTDAHSWLSSVLTNHDTCLDGLS  566
             +++A  DC+ELL+ S D +  S+ ++    G+    +  D  +WLS+ LTNHDTC DG +
Sbjct  131   IRSAYDDCLELLEESVDLLSHSLNSVFSGDGDSPTGSTQDVMTWLSAALTNHDTCTDGFA  190

Query  567   EPARSIMEPMIKDLISRAKsslavlvavaPSTEDD----------------LRALNGEFP  698
                 ++ + + ++L   ++     L   A +  DD                    + EFP
Sbjct  191   NVTGNVKDHISENLKDLSELVSNALAIYAAANGDDDFSRIPIQNRRRRLMEFETHHDEFP  250

Query  699   SWVSASDRRLLEASanavaanvvvaKDGSGKYKTVAEAVASAPDNGKTRYVIYIKKGTYK  878
              W+S  DR+L+  S +A+ A+++VAKDGSG  KT+AEA+   P+    R +IY+K G Y+
Sbjct  251   KWMSRRDRKLMNKSVSAIQADIIVAKDGSGTVKTIAEAIKKVPEKSNHRTIIYVKAGRYE  310

Query  879   EN-VEIGKKKTNVMLIGDGLSATIITGSLNYVDGATTFNSATVAAVGDGFIAQDLRIQNT  1055
             EN +++G+KK NVM IGDG   T+ITG  +     TTF++A+ AA G GFIA+D+  +N 
Sbjct  311   ENNLKVGRKKMNVMFIGDGKGKTVITGGKSVSQHLTTFHTASFAATGAGFIARDMTFENY  370

Query  1056  AGPEKHQAVALRLGADQSVINRCKIDAYQDTLYAHSQRQFYRDCYITGTVDFIFGNAAAV  1235
             AGP  HQAVALR+G D +V+ RC +  YQDTLY HSQRQFYR+C I GTVDFIFGNAA V
Sbjct  371   AGPNNHQAVALRIGGDHAVVFRCNVIGYQDTLYVHSQRQFYRECDIYGTVDFIFGNAAVV  430

Query  1236  IQNSQVVARKPMAAQKNMVTAQGRTDPNQNTGTSIQNCNVSPSSDLGPVKGTIQTYLGRP  1415
             +QN  + ARKPMA QKN +TAQ R DPNQNTG SI  C +  + DL   KG+  TYLGRP
Sbjct  431   LQNCNIYARKPMANQKNTITAQNRKDPNQNTGISIHACKIMATPDLQASKGSFSTYLGRP  490

Query  1416  WKEYSRTVFMESNIGDHIDPAGWFPWDGDFALKTLYYGEYMNRGPGAGTSKRVNWPGYHV  1595
             WK YSRTV+M SN+GDHI P GW  W+GDFAL TLYYGEYMN GPGA   +RV WPGY V
Sbjct  491   WKMYSRTVYMLSNMGDHIHPHGWLEWNGDFALNTLYYGEYMNFGPGAAVGQRVTWPGYRV  550

Query  1596  ITDKAEAMKFTVAQLIQGGSWLKNTGVDYTEGL  1694
             I    EA KFTV++ I G SWL +TGV +  GL
Sbjct  551   IKSVEEASKFTVSKFIYGSSWLPSTGVSFLAGL  583



>ref|XP_012082811.1| PREDICTED: pectinesterase-like [Jatropha curcas]
Length=557

 Score =   455 bits (1171),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 235/450 (52%), Positives = 306/450 (68%), Gaps = 18/450 (4%)
 Frame = +3

Query  390   DRKVQAAVADCMELLDLSQDKVMDSMVALGNLSARARTDAH-----SWLSSVLTNHDTCL  554
             D+  + A+ DC+EL   + D++    VAL +L +R     H     + LS+ +TN  TCL
Sbjct  110   DKLERVALNDCLELFSETMDELK---VALNDLYSRKSASQHYHELQTLLSAAMTNQYTCL  166

Query  555   DGLSEPARSIMEPMIKDL--ISRAKsslavlvavaP----STEDDLRALNGE----FPSW  704
             DG +    ++ + +  +L  IS   S+  V++   P    S + ++   +G+    FPSW
Sbjct  167   DGFAYSEGNVRKVIKSNLYNISHHVSNSLVMLKKIPGVNISNKSEVFTGHGDIKHGFPSW  226

Query  705   VSASDRRLLEASanavaanvvvaKDGSGKYKTVAEAVASAPDNGKTRYVIYIKKGTYKEN  884
             +S+ DR+LL+A  NA   N++VAKDGSG + TV+EAVA+AP++   R+VIYIK G Y EN
Sbjct  227   LSSKDRKLLQAPLNATTFNLIVAKDGSGNFTTVSEAVAAAPNSSNARFVIYIKAGAYFEN  286

Query  885   VEIGKKKTNVMLIGDGLSATIITGSLNYVDGATTFNSATVAAVGDGFIAQDLRIQNTAGP  1064
             V++ KKK  +M IGDG+  T+I  + + VDG TTF SATVA VG+GFIA+ +  +N+AGP
Sbjct  287   VDVHKKKNMLMFIGDGIGKTVIKANRSVVDGWTTFRSATVAVVGNGFIAKGITFENSAGP  346

Query  1065  EKHQAVALRLGADQSVINRCKIDAYQDTLYAHSQRQFYRDCYITGTVDFIFGNAAAVIQN  1244
               HQAVALR G+D S   +C    YQDTLY HS RQFYR+C + GT+DFIFGNAA V QN
Sbjct  347   SMHQAVALRSGSDLSAFYQCSFVGYQDTLYVHSLRQFYRECDVYGTIDFIFGNAAVVFQN  406

Query  1245  SQVVARKPMAAQKNMVTAQGRTDPNQNTGTSIQNCNVSPSSDLGPVKGTIQTYLGRPWKE  1424
               + AR+P   QKN+VTAQGR DPNQNTG SI NC V+ ++DL PVK + +TYLGRPWKE
Sbjct  407   CNLYARQPNENQKNIVTAQGREDPNQNTGISILNCKVAAAADLIPVKSSFKTYLGRPWKE  466

Query  1425  YSRTVFMESNIGDHIDPAGWFPWDGDFALKTLYYGEYMNRGPGAGTSKRVNWPGYHVITD  1604
             YSRTV++ S I D IDPAGW  W+GDFALKTLYYGEYMNRGPG+ TS RV WPGY VI +
Sbjct  467   YSRTVYITSYIDDLIDPAGWLEWNGDFALKTLYYGEYMNRGPGSNTSGRVTWPGYRVINN  526

Query  1605  KAEAMKFTVAQLIQGGSWLKNTGVDYTEGL  1694
              AEA +F V   IQG  WL  TGV ++ GL
Sbjct  527   SAEASQFAVEPFIQGSEWLNATGVPFSLGL  556



>ref|XP_009369733.1| PREDICTED: pectinesterase/pectinesterase inhibitor PPE8B [Pyrus 
x bretschneideri]
Length=509

 Score =   454 bits (1167),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 229/457 (50%), Positives = 299/457 (65%), Gaps = 10/457 (2%)
 Frame = +3

Query  342   IQDAVKLSANVNRRINDRKVQAAVADCMELLDLSQDKVMDSMVALGNLSARART------  503
             +Q    + +       D ++  A++DC++LLD S D++  S+ A  N   ++ +      
Sbjct  55    VQQVATILSQFANAFGDFRLSNAISDCLDLLDFSADELNWSLSASQNQKGKSNSTGKLSS  114

Query  504   DAHSWLSSVLTNHDTCLDGLSEPARSIMEPMIKDLISRAKsslavlvavaPSTEDDLRAL  683
             D  +WLS+ L N DTC DG  E   SI++ ++   +++  S +  L+       D  +  
Sbjct  115   DLRTWLSAALVNQDTCSDGF-EGTNSIVKGLVSTGLNQVTSLVQDLLTQVHPNSDH-QGP  172

Query  684   NGEFPSWVSASDRRLLEASanavaanvvvaKDGSGKYKTVAEAVASAPDNGKTRYVIYIK  863
             NG+ P+WV   DR+LL+A    V A V   +DG+G +  V +AV +APD   +RYVIYIK
Sbjct  173   NGQIPTWVKTEDRKLLQADGVNVDAVVA--QDGTGNFTNVMDAVLAAPDYSMSRYVIYIK  230

Query  864   KGTYKENVEIGKKKTNVMLIGDGLSATIITGSLNYVDGATTFNSATVAAVGDGFIAQDLR  1043
             KGTYKENVEI KKK N+M+IGDG+ ATII+G+ +Y+DG TTF SAT A  G GFIA+D+ 
Sbjct  231   KGTYKENVEIKKKKWNLMMIGDGMDATIISGNRSYIDGWTTFRSATFAVSGRGFIARDIT  290

Query  1044  IQNTAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYAHSQRQFYRDCYITGTVDFIFGN  1223
              +NTAGP+KHQAVALR  +D SV  RC+I  YQDTLYAH+ RQFYRDC I+GTVDFIFG+
Sbjct  291   FENTAGPQKHQAVALRSDSDLSVFYRCEIRGYQDTLYAHTMRQFYRDCKISGTVDFIFGD  350

Query  1224  AAAVIQNSQVVARKPMAAQKNMVTAQGRTDPNQNTGTSIQNCNVSPSSDLGPVKGTIQTY  1403
             A  V QN Q++A+K +  QKN VTAQGR DPN+ TG SIQ CN++  +DL P   +  TY
Sbjct  351   ATVVFQNCQILAKKGLPNQKNSVTAQGRKDPNEPTGISIQFCNITADADLLPFVNSTFTY  410

Query  1404  LGRPWKEYSRTVFMESNIGDHIDPAGWFPWDGDFALKTLYYGEYMNRGPGAGTSKRVNWP  1583
             LGRPWK YSRTV M+S + + I P GW  W+ DFAL TL YGEYMN GPGAG   RV WP
Sbjct  411   LGRPWKLYSRTVIMQSFLSNAIRPEGWLEWNADFALSTLSYGEYMNYGPGAGLGSRVKWP  470

Query  1584  GYHVITDKAEAMKFTVAQLIQGGSWLKNTGVDYTEGL  1694
             GY V  +  +   +TVAQ I+G  WL  TGV YT G 
Sbjct  471   GYQVFNESTQVKNYTVAQFIEGNLWLPPTGVKYTAGF  507



>ref|XP_004234960.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 61 
[Solanum lycopersicum]
Length=583

 Score =   456 bits (1174),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 236/522 (45%), Positives = 325/522 (62%), Gaps = 25/522 (5%)
 Frame = +3

Query  195   PSLWKARVCDPAHDPPSCM-AIVSEVSSAAPTETDGVAllqmllhssllRIQDAVKLSAN  371
             PS   AR C     P  C+ ++++   + + +++D V    + ++ +L R    +  +++
Sbjct  63    PSQAMARTCSRTLYPSLCLNSLINYPGANSASDSDLV---HISVNLTLQRFGKGLYKASD  119

Query  372   VNRRINDRKVQAAVADCMELLDLSQDKVMDSMVAL----GNLSARARTDAHSWLSSVLTN  539
             +N    + +V++A  DC+ELL+ S D +  S+ ++    G+    +  D  +WLS+ LTN
Sbjct  120   INNLQMNTQVRSAYDDCLELLEESVDLLSHSLDSVFSGDGDSPTGSTQDVMTWLSAALTN  179

Query  540   HDTCLDGLSEPARSIMEPMIKDLISRAKsslavlvavaPSTEDD----------------  671
              DTC DG ++   ++ + M ++L   ++     L     +  DD                
Sbjct  180   QDTCTDGFADVTGNVKDHMSENLKDLSELVSNALAIYTAANGDDDFSGIPIQNRRRRLME  239

Query  672   LRALNGEFPSWVSASDRRLLEASanavaanvvvaKDGSGKYKTVAEAVASAPDNGKTRYV  851
                 + EFP W+S  DR+L+  S + + A+++VAKDGSG  KT+AEA+   P+    R +
Sbjct  240   FETYHDEFPKWMSRRDRKLMNKSVSTIQADIIVAKDGSGTVKTIAEAIKKVPEKSNHRTI  299

Query  852   IYIKKGTYKEN-VEIGKKKTNVMLIGDGLSATIITGSLNYVDGATTFNSATVAAVGDGFI  1028
             IY+K G Y+EN +++G+KK NVM IGDG   T+ITG  +     TTF++A+ AA G GFI
Sbjct  300   IYVKAGRYEENNLKVGRKKMNVMFIGDGKGKTVITGGKSVSQHLTTFHTASFAATGAGFI  359

Query  1029  AQDLRIQNTAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYAHSQRQFYRDCYITGTVD  1208
             A+D+  +N AGP  HQAVALR+G D +V+ RC +  YQDTLY HSQRQFYR+C I GTVD
Sbjct  360   ARDMTFENYAGPNNHQAVALRIGGDHAVVFRCNVIGYQDTLYVHSQRQFYRECDIYGTVD  419

Query  1209  FIFGNAAAVIQNSQVVARKPMAAQKNMVTAQGRTDPNQNTGTSIQNCNVSPSSDLGPVKG  1388
             FIFGNAA V+QN  + ARKPMA QKN +TAQ R DPNQNTG SI  C +  + DL   KG
Sbjct  420   FIFGNAAVVLQNCNIYARKPMANQKNTITAQNRKDPNQNTGISIHACKIMATPDLQASKG  479

Query  1389  TIQTYLGRPWKEYSRTVFMESNIGDHIDPAGWFPWDGDFALKTLYYGEYMNRGPGAGTSK  1568
             +  TYLGRPWK YSRTV+M SN+GDHI P GW  W+GDFAL TLYYGEYMN GPGA   +
Sbjct  480   SFSTYLGRPWKMYSRTVYMLSNMGDHIHPHGWLEWNGDFALNTLYYGEYMNFGPGAAVGQ  539

Query  1569  RVNWPGYHVITDKAEAMKFTVAQLIQGGSWLKNTGVDYTEGL  1694
             RV WPGY VI    EA KFTV++ I G SWL +TGV +  GL
Sbjct  540   RVTWPGYRVIKSVEEASKFTVSKFIYGSSWLPSTGVSFLAGL  581



>ref|XP_004508051.1| PREDICTED: pectinesterase/pectinesterase inhibitor PPE8B-like 
[Cicer arietinum]
Length=510

 Score =   454 bits (1167),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 235/463 (51%), Positives = 298/463 (64%), Gaps = 19/463 (4%)
 Frame = +3

Query  342   IQDAVKLSANVNRRINDRKVQAAVADCMELLDLSQDKVMDSMVA----------LGNLSA  491
             +Q    + +       + +   A+ DC++LLDL  D++  +M A           GNLS+
Sbjct  53    LQQVTSILSRFGNVFGNSRFSHAITDCLDLLDLCSDELNWAMSASQNSNGKDNSTGNLSS  112

Query  492   RARTDAHSWLSSVLTNHDTCLDGLSEPARSIMEPMIKDLISRAKsslavlvavaPSTEDD  671
               RT    WLS+VL N DTC++GL E    I+E ++   + R  S +  L+       D 
Sbjct  113   DLRT----WLSAVLVNPDTCIEGL-EGTNGIVEGLVSTGLVRIMSLVKNLLLQVDPISDH  167

Query  672   LRALNGE--FPSWVSASDRRLLEASanavaanvvvaKDGSGKYKTVAEAVASAPDNGKTR  845
                  G+  FPSW+  +D +LL+ +     A V    DGSG Y TV +AV +APDN   R
Sbjct  168   FETKLGKDRFPSWLKDADMKLLKTNGVTADAVVAA--DGSGDYTTVMDAVMAAPDNSMKR  225

Query  846   YVIYIKKGTYKENVEIGKKKTNVMLIGDGLSATIITGSLNYVDGATTFNSATVAAVGDGF  1025
             YVIY+KKG Y ENVEI KKK N+M+IG+G+ AT+I+GS +Y DG TTF SAT A  G GF
Sbjct  226   YVIYVKKGVYVENVEIKKKKWNIMIIGEGMDATVISGSRSYGDGWTTFRSATFAVSGRGF  285

Query  1026  IAQDLRIQNTAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYAHSQRQFYRDCYITGTV  1205
             IA+D+  QNTAGPEKHQAVALR  +D SV  RC I  YQD+LY H+ RQFYR+C I+GTV
Sbjct  286   IARDISFQNTAGPEKHQAVALRSDSDLSVFYRCGILGYQDSLYTHTMRQFYRECKISGTV  345

Query  1206  DFIFGNAAAVIQNSQVVARKPMAAQKNMVTAQGRTDPNQNTGTSIQNCNVSPSSDLGPVK  1385
             DFIFG+A A+ QN Q++A+K M  QKN +TAQGR DPNQ TG S Q CN+S  SDL P+ 
Sbjct  346   DFIFGDATAMFQNCQILAKKGMEKQKNTITAQGRKDPNQPTGFSFQFCNISADSDLLPLV  405

Query  1386  GTIQTYLGRPWKEYSRTVFMESNIGDHIDPAGWFPWDGDFALKTLYYGEYMNRGPGAGTS  1565
             G+I TYLGRPWK YSRT+FM+S + + I   GW  W+  FAL TLYY EYMN G GAG  
Sbjct  406   GSIPTYLGRPWKTYSRTIFMQSYMSNVIWSEGWLEWNESFALDTLYYAEYMNSGAGAGVG  465

Query  1566  KRVNWPGYHVITDKAEAMKFTVAQLIQGGSWLKNTGVDYTEGL  1694
              RV WPGYHV+   ++A  FTVAQ I+G  WL +TGV YT GL
Sbjct  466   NRVKWPGYHVLNAASQATSFTVAQFIEGNLWLPSTGVTYTAGL  508



>ref|XP_004146188.2| PREDICTED: pectinesterase/pectinesterase inhibitor PPE8B-like 
[Cucumis sativus]
 gb|KGN55582.1| hypothetical protein Csa_3G000060 [Cucumis sativus]
Length=576

 Score =   456 bits (1173),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 239/501 (48%), Positives = 315/501 (63%), Gaps = 31/501 (6%)
 Frame = +3

Query  225   PAHDPP-----SCMAIVSEVSSAAPTETDGVAllqmllhssllRIQDAVKLSANVNRRIN  389
             PA  PP      C+++ S   S +   T  V             ++  + + +  ++ + 
Sbjct  93    PASSPPDLVQTECLSVPSSQFSNSLLSTIDV-------------VRQVMAIFSPFSKLLG  139

Query  390   DRKVQAAVADCMELLDLSQDKVMDSMVALGNLSARART------DAHSWLSSVLTNHDTC  551
             D ++  A++DC++LLD S D++  S+ A  N  A+  +      D  +WLS+ + N +TC
Sbjct  140   DFRLSTAISDCLDLLDSSADQLSWSLSATQNPKAKNHSTGDLSSDLKTWLSAAVVNPETC  199

Query  552   LDGLSEPARSIMEPMIKDLISRAKsslavlvavaPSTEDDLRALNGEFPSWVSASDRRLL  731
             +DG  E   SI    IK L+S   + L   +    S    +     EFPSW+ + D+ LL
Sbjct  200   MDGF-EGTNSI----IKGLVSGGVNQLTSQLYDLLSMVKSIPNQPSEFPSWLKSEDQNLL  254

Query  732   EASanavaanvvvaKDGSGKYKTVAEAVASAPDNGKTRYVIYIKKGTYKENVEIGKKKTN  911
             + +  A  A V    DG+G +  V +AV +APDN   RYVIYIKKG Y ENVEI KKK N
Sbjct  255   QINDLAADATVAA--DGTGDFTNVMDAVLAAPDNSIRRYVIYIKKGVYLENVEIKKKKWN  312

Query  912   VMLIGDGLSATIITGSLNYVDGATTFNSATVAAVGDGFIAQDLRIQNTAGPEKHQAVALR  1091
             +M+IGDG+ ATII+G+ +++DG TTF SAT A  G GFIA+D+  +NTAG EKHQAVALR
Sbjct  313   LMMIGDGIDATIISGNRSFIDGWTTFRSATFAVSGRGFIARDITFENTAGAEKHQAVALR  372

Query  1092  LGADQSVINRCKIDAYQDTLYAHSQRQFYRDCYITGTVDFIFGNAAAVIQNSQVVARKPM  1271
               +D SV  RC+I  YQDTLY H+ RQFYR+C I+GTVDF+FG+A  V QN  ++A+K +
Sbjct  373   SDSDLSVFFRCRIRGYQDTLYTHTMRQFYRECQISGTVDFLFGDATVVFQNCSILAKKGL  432

Query  1272  AAQKNMVTAQGRTDPNQNTGTSIQNCNVSPSSDLGPVKGTIQTYLGRPWKEYSRTVFMES  1451
               QKN +TAQGR DPNQ TG SIQ CN+S  SDL P   T  TYLGRPWKEYSRT+ M+S
Sbjct  433   PNQKNTITAQGRKDPNQPTGFSIQFCNISADSDLKPSVNTTATYLGRPWKEYSRTIIMQS  492

Query  1452  NIGDHIDPAGWFPWDGDFALKTLYYGEYMNRGPGAGTSKRVNWPGYHVITDKAEAMKFTV  1631
              I D I P GW  W+ +FAL TL+Y E+MN GPGAG +KRVNWPGYH +   +EA  FTV
Sbjct  493   YISDAIRPEGWLEWNANFALNTLFYAEFMNYGPGAGLAKRVNWPGYHRLNQTSEATNFTV  552

Query  1632  AQLIQGGSWLKNTGVDYTEGL  1694
             AQ I+G  WL +TGV YT GL
Sbjct  553   AQFIEGNLWLPSTGVKYTAGL  573



>gb|AFB77929.1| pectin methylesterase [Gossypium hirsutum]
Length=582

 Score =   456 bits (1173),  Expect = 3e-149, Method: Compositional matrix adjust.
 Identities = 231/453 (51%), Positives = 294/453 (65%), Gaps = 24/453 (5%)
 Frame = +3

Query  402   QAAVADCMELLDLSQDKVMDSMVALGNLSARARTDAH-----SWLSSVLTNHDTCLDGLS  566
             + A+ DC+E +D + D++ +++  L     +     H     + +S+ +TN +TCLDG S
Sbjct  132   KTALHDCLETIDETLDELHEAVEDLHEYPNKKSLTQHADDLKTLMSAAMTNQETCLDGFS  191

Query  567   EPA-----RSIM---EPMIKDLISRAKsslavlvavaPSTEDDLRALNGEF---------  695
                     R ++   E  ++ + S A + +  +     + E  L++ N +          
Sbjct  192   HEGADKKIREVLIDGEKYVEKMCSNALAMIKNMTDTDIANEMMLKSSNRKLKEDESGIAW  251

Query  696   PSWVSASDRRLLEASanavaanvvvaKDGSGKYKTVAEAVASAPDNGKTRYVIYIKKGTY  875
             P W+SA DRRLL++S+      V    DGSG +KTV+EAVA AP+    RY+I IK G Y
Sbjct  252   PEWLSAGDRRLLQSSSVTPNVVVAA--DGSGNFKTVSEAVAKAPEKSSKRYIIRIKAGVY  309

Query  876   KENVEIGKKKTNVMLIGDGLSATIITGSLNYVDGATTFNSATVAAVGDGFIAQDLRIQNT  1055
             +ENVE+ KKK+N+M IGDG + TIITGS N VDG+TTF+SATVAAVG+ F+A+D+  QNT
Sbjct  310   RENVEVPKKKSNIMFIGDGRTKTIITGSRNVVDGSTTFHSATVAAVGEKFLARDITFQNT  369

Query  1056  AGPEKHQAVALRLGADQSVINRCKIDAYQDTLYAHSQRQFYRDCYITGTVDFIFGNAAAV  1235
             AGP KHQAVALR+G+D S    C + AYQDTLY HS RQFY +C + GTVDFIFGNAAAV
Sbjct  370   AGPSKHQAVALRVGSDLSAFYNCDMLAYQDTLYVHSNRQFYVNCLVAGTVDFIFGNAAAV  429

Query  1236  IQNSQVVARKPMAAQKNMVTAQGRTDPNQNTGTSIQNCNVSPSSDLGPVKGTIQTYLGRP  1415
              QN  + ARKP + QKNMVTAQGRTDPNQNTG  IQ C +  +SDL PV+    TYLGRP
Sbjct  430   FQNCDIHARKPNSGQKNMVTAQGRTDPNQNTGIVIQKCRIGATSDLQPVRKNFPTYLGRP  489

Query  1416  WKEYSRTVFMESNIGDHIDPAGWFPWDGDFALKTLYYGEYMNRGPGAGTSKRVNWPGYHV  1595
             WKEYSRTV M+S I D I PAGW  W G FALKTL+Y EY N G GA TS RV W GY V
Sbjct  490   WKEYSRTVVMQSTISDVIQPAGWHEWSGSFALKTLFYAEYQNTGAGASTSARVKWGGYKV  549

Query  1596  ITDKAEAMKFTVAQLIQGGSWLKNTGVDYTEGL  1694
             IT  +EA  FT  + I GGSWL +TG  +  GL
Sbjct  550   ITSASEAQAFTPGRFIAGGSWLSSTGFPFALGL  582



>ref|XP_010056335.1| PREDICTED: pectinesterase 2-like [Eucalyptus grandis]
Length=515

 Score =   453 bits (1166),  Expect = 3e-149, Method: Compositional matrix adjust.
 Identities = 234/454 (52%), Positives = 310/454 (68%), Gaps = 12/454 (3%)
 Frame = +3

Query  339   RIQDAVKLSANVNRRINDRKVQAAVADCMELLDLSQDKVMDSMVALGNLSARARTDAHSW  518
             R Q A   + ++  + ++   +AA ADC++L + +  ++  ++V         + +A +W
Sbjct  72    RAQMAHSNTHSLGSKCSNEHEKAAWADCLQLYEYTILRLNRTIV-----HDCTQDEAQTW  126

Query  519   LSSVLTNHDTCLDGLSEPARS-IMEPMIKDLISRAKsslavlvavaPSTEDDLRALNGEF  695
             LS+ LTN +TC  G  E   S  + P++ + +S+  S+   L     +T +  +    +F
Sbjct  127   LSTALTNLETCQAGFVELGVSGNVLPLMSNNVSKLISNTLALNYAPYTTPNYTK----KF  182

Query  696   PSWVSASDRRLLEASanavaanvvvaKDGSGKYKTVAEAV-ASAPDNGKTRYVIYIKKGT  872
             P+WV   DR+LL++S+    AN++VA+DGSG YKT++EA+ A++  +G  RY+IYIK GT
Sbjct  183   PTWVRPGDRKLLQSSSAVSKANIIVAQDGSGNYKTISEAITAASKRSGTARYIIYIKAGT  242

Query  873   YKENVEIGKKKTNVMLIGDGLSATIITGSLNYVDGATTFNSATVAAVGDGFIAQDLRIQN  1052
             Y ENVE+G K  N+M +GDG+  TIITGS +   G+TTFNSATVA VGDGFIAQD+  +N
Sbjct  243   YSENVEVGSKLENIMFVGDGIGKTIITGSKSVGGGSTTFNSATVAVVGDGFIAQDITFRN  302

Query  1053  TAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYAHSQRQFYRDCYITGTVDFIFGNAAA  1232
             TAG   HQAVALR G+D SV  RC  + YQDTLY HS+RQFYR+C I GTVDFIFGNAA 
Sbjct  303   TAGAANHQAVALRSGSDLSVFYRCGFEGYQDTLYVHSERQFYRECDIYGTVDFIFGNAAV  362

Query  1233  VIQNSQVVARKPMAAQKNMVTAQGRTDPNQNTGTSIQNCNVSPSSDLGPVKGTIQTYLGR  1412
             V+QN  + AR P   + N VTAQGRTDPNQNTG SI NC V+ +SDL  V+ +++TYLGR
Sbjct  363   VLQNCNIYARNP-PNKVNTVTAQGRTDPNQNTGISIHNCKVTAASDLKSVQSSVKTYLGR  421

Query  1413  PWKEYSRTVFMESNIGDHIDPAGWFPWDGDFALKTLYYGEYMNRGPGAGTSKRVNWPGYH  1592
             PW+EYSRTVFM++ +   I+ AGW  WDG+FAL TLYYGEY+N GPG+ T+ RV W GYH
Sbjct  422   PWQEYSRTVFMKTYLDSLINSAGWMEWDGNFALDTLYYGEYLNTGPGSSTASRVTWAGYH  481

Query  1593  VITDKAEAMKFTVAQLIQGGSWLKNTGVDYTEGL  1694
             VIT   EA KFTV   I GGSWL  TGV YT GL
Sbjct  482   VITSATEASKFTVGSFIAGGSWLPATGVPYTSGL  515



>ref|XP_011076334.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 17 
[Sesamum indicum]
Length=475

 Score =   452 bits (1163),  Expect = 3e-149, Method: Compositional matrix adjust.
 Identities = 231/441 (52%), Positives = 302/441 (68%), Gaps = 14/441 (3%)
 Frame = +3

Query  387   NDRKVQAAVADCMELLD--LSQ-DKVMDSMVALGNLSARARTDAHSWLSSVLTNHDTCLD  557
             N+R+ +AA ADC++L D  + Q +K +D      +       DA +WLS+ LTN +TC  
Sbjct  44    NERE-KAAWADCVKLYDNAIEQLNKTIDPNTKCTDF------DAQTWLSTALTNLETCRT  96

Query  558   GLSEPARS-IMEPMIKDLISRAKsslavlvavaPSTEDDLRALNGEFPSWVSASDRRLLE  734
             G  E   S  + P++ + +S+   +   L +   + E      +  FP+WVS  DRRLL+
Sbjct  97    GFVELGVSDFVLPLMSNNVSKLICNTLALGSNKTTHETSGYYKDDGFPTWVSPGDRRLLQ  156

Query  735   ASanavaanvvvaKDGSGKYKTVAEAV-ASAPDNGKTRYVIYIKKGTYKENVEIGKKKTN  911
             +S+      V   +DGSG Y+T+  A+ A+A  +G  R+VI++K+G Y+EN+EIG K  N
Sbjct  157   SSSVRPNLVVA--QDGSGNYRTIKAALDAAAGRSGSGRFVIHVKRGVYRENLEIGSKLRN  214

Query  912   VMLIGDGLSATIITGSLNYVDGATTFNSATVAAVGDGFIAQDLRIQNTAGPEKHQAVALR  1091
             +ML+GDG+  TIITGS +   G+TTFNSATVA  G+GFIA+ +  +NTAGP+ HQAVALR
Sbjct  215   IMLVGDGMKYTIITGSRSVGGGSTTFNSATVAVTGEGFIARGITFRNTAGPQNHQAVALR  274

Query  1092  LGADQSVINRCKIDAYQDTLYAHSQRQFYRDCYITGTVDFIFGNAAAVIQNSQVVARKPM  1271
              G+D SV  RC  + YQDTLY HSQRQFY++CY+ GTVDFIFGNAA V+QN  + AR+PM
Sbjct  275   SGSDLSVFYRCGFEGYQDTLYVHSQRQFYKECYVFGTVDFIFGNAAVVLQNCMIYARRPM  334

Query  1272  AAQKNMVTAQGRTDPNQNTGTSIQNCNVSPSSDLGPVKGTIQTYLGRPWKEYSRTVFMES  1451
               QKN +TAQGRTDPNQNTG SI N  V  S+DL PV G+ +++LGRPWKEYSRTVFM++
Sbjct  335   DKQKNTITAQGRTDPNQNTGISIHNSRVMASADLVPVLGSFRSFLGRPWKEYSRTVFMQT  394

Query  1452  NIGDHIDPAGWFPWDGDFALKTLYYGEYMNRGPGAGTSKRVNWPGYHVITDKAEAMKFTV  1631
              +   +DPAGW  WDG+FAL TLYYGEY N GPG+ TS+RV W GY VIT  AEA +FTV
Sbjct  395   YLDSLVDPAGWLEWDGNFALNTLYYGEYRNTGPGSSTSRRVRWRGYRVITSAAEAGRFTV  454

Query  1632  AQLIQGGSWLKNTGVDYTEGL  1694
             A  I G SWL  TGV +T GL
Sbjct  455   ANFIAGQSWLPATGVPFTAGL  475



>ref|XP_010656074.1| PREDICTED: pectinesterase-like [Vitis vinifera]
Length=578

 Score =   456 bits (1172),  Expect = 3e-149, Method: Compositional matrix adjust.
 Identities = 234/456 (51%), Positives = 302/456 (66%), Gaps = 27/456 (6%)
 Frame = +3

Query  402   QAAVADCMELLDLSQDKVMDSMVALGNLS-----ARARTDAHSWLSSVLTNHDTCLDGLS  566
             +AA+ DC+E++D + D++  S + L + S     ++   D  + LS+ +TN +TC+DG S
Sbjct  125   KAALHDCLEMVDDTLDELHKSALDLQDYSLNKSISQQADDLITLLSAAMTNQETCIDGFS  184

Query  567   EPA--RSIMEPMIKDLISRAKsslavlvavaPSTEDDL--------RALNGE--------  692
                  + I + ++   +   +    VL  +   T+ D+        R L  E        
Sbjct  185   HDGADKKIRKGLMDGQMQAFRLCSNVLAMIKNLTDTDMAAAASAAGRQLREEEEEATATA  244

Query  693   --FPSWVSASDRRLLEASanavaanvvvaKDGSGKYKTVAEAVASAPDNGKTRYVIYIKK  866
               +P W+SA DRRLL+AS       V    DGSG YKTV EAVASAP+    RY+I IK 
Sbjct  245   IEWPEWLSAGDRRLLQASTVTADVTVAA--DGSGNYKTVGEAVASAPERSSKRYIIRIKA  302

Query  867   GTYKENVEIGKKKTNVMLIGDGLSATIITGSLNYVDGATTFNSATVAAVGDGFIAQDLRI  1046
             G YKENVE+ KKKTN+M +GDG + TIIT S N VDG+TTF+SATVA VGDGF+A+D+  
Sbjct  303   GVYKENVEVPKKKTNIMFVGDGRTNTIITASRNVVDGSTTFHSATVAVVGDGFLARDITF  362

Query  1047  QNTAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYAHSQRQFYRDCYITGTVDFIFGNA  1226
             QNTAGP KHQAVALR+G+D S   RC + AYQDTLY HS RQF+  C + GTVDFIFGNA
Sbjct  363   QNTAGPSKHQAVALRVGSDLSAFYRCDVLAYQDTLYVHSLRQFFVGCLVAGTVDFIFGNA  422

Query  1227  AAVIQNSQVVARKPMAAQKNMVTAQGRTDPNQNTGTSIQNCNVSPSSDLGPVKGTIQTYL  1406
             AAV+Q+  + AR+P + Q+NMVTAQGR DPNQNTG  IQ C +  +SDL PV+ +  TYL
Sbjct  423   AAVLQDCDIHARRPNSGQRNMVTAQGRDDPNQNTGIVIQKCRIGATSDLKPVQSSFPTYL  482

Query  1407  GRPWKEYSRTVFMESNIGDHIDPAGWFPWDGDFALKTLYYGEYMNRGPGAGTSKRVNWPG  1586
             GRPWKEYSRTV M+++I D I+PAGW+PW+G+FAL TL+Y EY N G GA TSKRVNW G
Sbjct  483   GRPWKEYSRTVVMQTSISDVINPAGWYPWNGNFALDTLFYAEYQNTGAGADTSKRVNWKG  542

Query  1587  YHVITDKAEAMKFTVAQLIQGGSWLKNTGVDYTEGL  1694
             + VIT  +EA  FT    I G SWL +TG  ++ GL
Sbjct  543   FKVITSASEAQAFTAGSFIGGSSWLPSTGFPFSLGL  578



>ref|XP_009385345.1| PREDICTED: pectinesterase-like [Musa acuminata subsp. malaccensis]
Length=522

 Score =   454 bits (1167),  Expect = 4e-149, Method: Compositional matrix adjust.
 Identities = 245/499 (49%), Positives = 326/499 (65%), Gaps = 13/499 (3%)
 Frame = +3

Query  219   CDPAHDPPSCMAIVSEVSSAAPTETDGVAllqmllhssllRIQDAVKLSANVNRRINDRK  398
             C     P  C ++VS V   A +ET       +LL ++L R   A K ++ +N    D  
Sbjct  30    CSQTPYPQVCSSMVSGVPLFAQSETQS-GFRDLLLQTTLDRTLLAHKHASAMNLAPLDEP  88

Query  399   VQAAVADCMELLDLSQDKVMDSMVALGNLSARARTDAHSWLSSVLTNHDTCLDGLSEPAR  578
              +AA ADC+EL    +D +     +LG+ S+    DA +WLS+ + N  TC +G +E   
Sbjct  89    AKAAWADCLELF---EDTIGHLNRSLGHSSSAE--DAQTWLSAAMANQQTCKNGFAELGT  143

Query  579   SIM---EPMIKDLISRAKsslavlvavaPSTE--DDLRALNGEFPSWVSASDRRLLEASa  743
             S +      + + IS + S+   +    P  +   + R L+  FP WV A+DR+LL++S+
Sbjct  144   SFLFTSSLFMANNISESLSNSLAVNNAMPRGKAPGNRRLLSQGFPGWVKAADRKLLQSSS  203

Query  744   navaanvvvaKDGSGKYKTVAEAVASAPD--NGKTRYVIYIKKGTYKENVEIGKKKTNVM  917
             + + AN+VVAKDGSG YKT++EAVA++    +G +R+VI +K G Y ENV I     N+M
Sbjct  204   STIKANLVVAKDGSGDYKTISEAVAASAKLRSGTSRFVILVKSGIYNENVVITNSMKNIM  263

Query  918   LIGDGLSATIITGSLNYVDGATTFNSATVAAVGDGFIAQDLRIQNTAGPEKHQAVALRLG  1097
             +IGDG+ AT++TGS N  DG+TTF SAT A  G GFIA+D+  QNTAGP+KHQAVALR G
Sbjct  264   MIGDGMDATVVTGSKNVQDGSTTFRSATFAVSGGGFIARDMTFQNTAGPQKHQAVALRSG  323

Query  1098  ADQSVINRCKIDAYQDTLYAHSQRQFYRDCYITGTVDFIFGNAAAVIQNSQVVARKPMAA  1277
             +D SV  RC    YQDTLY +SQRQFYR+C I GTVDFIFG+A  V Q+  +  RKPM+ 
Sbjct  324   SDLSVFYRCSFKGYQDTLYVYSQRQFYRNCDIYGTVDFIFGDAVVVFQSCNIYVRKPMSG  383

Query  1278  QKNMVTAQGRTDPNQNTGTSIQNCNVSPSSDLGPVKGTIQTYLGRPWKEYSRTVFMESNI  1457
             Q+N VTAQGRTD N+NTG SI N  V+ +SDL PV+G+ +TYLGRPW++YSRTVFM++++
Sbjct  384   QQNTVTAQGRTDHNENTGISIHNSIVTAASDLRPVQGSFKTYLGRPWQKYSRTVFMKTSL  443

Query  1458  GDHIDPAGWFPWDGDFALKTLYYGEYMNRGPGAGTSKRVNWPGYHVITDKAEAMKFTVAQ  1637
                I+PAGW  W G F L TLYY EYMN G GA TSKRVNWPGYHVI   +EA KFTV  
Sbjct  444   DSLINPAGWLEWSGSFGLSTLYYAEYMNTGAGADTSKRVNWPGYHVIASSSEASKFTVGG  503

Query  1638  LIQGGSWLKNTGVDYTEGL  1694
              + G SW+  TGV ++ GL
Sbjct  504   FLSGDSWIPATGVPFSFGL  522



>ref|XP_008234391.1| PREDICTED: pectinesterase 2-like [Prunus mume]
Length=517

 Score =   453 bits (1166),  Expect = 4e-149, Method: Compositional matrix adjust.
 Identities = 241/458 (53%), Positives = 309/458 (67%), Gaps = 18/458 (4%)
 Frame = +3

Query  342   IQDAVKLSAN---VNRRINDRKVQAAVADCMELLDLSQDKVMDSMVALGNLSARARTDAH  512
             +Q A+K  ++   +  +  ++  +AA ADC   L L QD +M     +   +     DA 
Sbjct  71    MQQALKAQSHNKWLGPKCRNKIEKAAWADC---LSLYQDTIMLLNQTIDPATKCTDYDAQ  127

Query  513   SWLSSVLTNHDTCLDGLSEPARS-IMEPMIKDLISR--AKsslavlvavaPSTEDDLRAL  683
             +WLS+ LTN DTC  G  E   S  + P++ + +S+  + +      +  P+  +  +  
Sbjct  128   TWLSTALTNLDTCRAGFVELGVSDFVLPLMSNNVSKLISNTLSIGNGSNVPAVTNRYKE-  186

Query  684   NGEFPSWVSASDRRLLEASanavaanvvvaKDGSGKYKTVAEAVASAPD-NGKTRYVIYI  860
                FP+WVS  DR+LL++     AA+VVVA+DGSG YKT+ EA+A+A   +G  R+VI++
Sbjct  187   --GFPTWVSPGDRKLLQS---LPAADVVVAQDGSGNYKTIKEALAAAAKRSGSKRFVIHV  241

Query  861   KKGTYKENVEIGKKKTNVMLIGDGLSATIITGSLNYVDGATTFNSATVAAVGDGFIAQDL  1040
             K+G YKEN+EI  K  N+ML+GDGL  TIITGS + V G+TTFNSATVA  GDGFIA+ +
Sbjct  242   KRGVYKENLEITLK--NIMLLGDGLRYTIITGSRSVVGGSTTFNSATVAVTGDGFIARGI  299

Query  1041  RIQNTAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYAHSQRQFYRDCYITGTVDFIFG  1220
               +NTAGPE HQAVALR GAD SV  RC  + YQDTLY HSQRQFY++CY+ GTVDFIFG
Sbjct  300   TFRNTAGPENHQAVALRSGADLSVFYRCGFEGYQDTLYVHSQRQFYKECYVYGTVDFIFG  359

Query  1221  NAAAVIQNSQVVARKPMAAQKNMVTAQGRTDPNQNTGTSIQNCNVSPSSDLGPVKGTIQT  1400
             NAA V+QN  + AR+PM  QKN +TAQGRTDPNQNTG SI +  V   SDL PV  +++T
Sbjct  360   NAAVVLQNCMIYARRPMNGQKNTITAQGRTDPNQNTGISIHDSRVMAGSDLKPVLSSVKT  419

Query  1401  YLGRPWKEYSRTVFMESNIGDHIDPAGWFPWDGDFALKTLYYGEYMNRGPGAGTSKRVNW  1580
             YLGRPWKEYSRTVF++S +   +D AGW  WDG+FALKTLYYGEY N GPG+ T  RVNW
Sbjct  420   YLGRPWKEYSRTVFLQSYLDTLVDSAGWLEWDGNFALKTLYYGEYKNTGPGSSTRGRVNW  479

Query  1581  PGYHVITDKAEAMKFTVAQLIQGGSWLKNTGVDYTEGL  1694
              GYHVIT  +EA KFTV   I G SWL  T V +T GL
Sbjct  480   GGYHVITSSSEASKFTVGNFIAGSSWLPATNVPFTAGL  517



>gb|KHG05999.1| putative pectinesterase/pectinesterase inhibitor 40 -like protein 
[Gossypium arboreum]
Length=560

 Score =   454 bits (1169),  Expect = 5e-149, Method: Compositional matrix adjust.
 Identities = 239/510 (47%), Positives = 322/510 (63%), Gaps = 24/510 (5%)
 Frame = +3

Query  219   CDPAHDPPSCMAIVSEVSSAAPTETDGVAllqmllhssllRIQDAVKLSANVNRRIND--  392
             C+    P  C++ +S +   A      +    +      +R+  A      + +RI    
Sbjct  56    CEGTLYPDLCVSTISVLPDLASKTLPELIQATLNQTMYEVRLSSAN--CTGIEKRIKSYS  113

Query  393   RKVQAAVADCMELLDLSQDKVMDSMVALGNLS------ARARTDAHSWLSSVLTNHDTCL  554
             ++ +AA+ DC+EL D   D + +  VAL +L+      +R   D  ++LS+ +TN  TCL
Sbjct  114   KREEAAINDCLELFD---DTLEELKVALADLAPKKLAVSRNYHDLQTFLSAAMTNQYTCL  170

Query  555   DGLSEP---ARSIMEPMIKDL---ISRAKsslavlvavaPSTEDDL----RALNGEFPSW  704
             DG +      R+I++  + ++   +S +   L  +  V  S  +      R  NG FPSW
Sbjct  171   DGFARSKGNVRNIIKKGLHNITHHVSNSLVMLKKVPGVNKSKSEYFPQQGRLKNG-FPSW  229

Query  705   VSASDRRLLEASanavaanvvvaKDGSGKYKTVAEAVASAPDNGKTRYVIYIKKGTYKEN  884
             +S  DR LL+AS N    +++VAKDG+G + T+ +AVA+AP+N  TR+VIYIK G+Y EN
Sbjct  230   LSRQDRILLQASVNETEFDLIVAKDGTGNFTTINDAVAAAPNNSNTRFVIYIKAGSYFEN  289

Query  885   VEIGKKKTNVMLIGDGLSATIITGSLNYVDGATTFNSATVAAVGDGFIAQDLRIQNTAGP  1064
             VE+ KKK  +M +GDG+  T++  + N VDG TTF SATVA VG+GFIA+ +  +N+AGP
Sbjct  290   VEVVKKKKMLMFVGDGIGKTVVKANRNVVDGFTTFRSATVAVVGEGFIAKGITFENSAGP  349

Query  1065  EKHQAVALRLGADQSVINRCKIDAYQDTLYAHSQRQFYRDCYITGTVDFIFGNAAAVIQN  1244
              KHQAVALR G+D S   +C   AYQDTLY HS RQFYR+C I GTVDFIFGNAA V Q+
Sbjct  350   SKHQAVALRSGSDLSAFYKCSFVAYQDTLYVHSLRQFYRECDIYGTVDFIFGNAAVVFQD  409

Query  1245  SQVVARKPMAAQKNMVTAQGRTDPNQNTGTSIQNCNVSPSSDLGPVKGTIQTYLGRPWKE  1424
               + ARKP   QKN+ TAQGR DPNQNTG SI NC ++ ++DL PVK + +TYLGRPWKE
Sbjct  410   CNLYARKPNPNQKNIFTAQGREDPNQNTGISILNCKIAAAADLVPVKSSFKTYLGRPWKE  469

Query  1425  YSRTVFMESNIGDHIDPAGWFPWDGDFALKTLYYGEYMNRGPGAGTSKRVNWPGYHVITD  1604
             YSRTV M S I D +DPAGW  W+G FAL TLYYGEY+NRGPG+ TS RV WPGY VI  
Sbjct  470   YSRTVIMRSYIDDSVDPAGWLEWNGTFALSTLYYGEYLNRGPGSSTSARVTWPGYRVINS  529

Query  1605  KAEAMKFTVAQLIQGGSWLKNTGVDYTEGL  1694
               EA +FT+   IQG  WL ++ + +  GL
Sbjct  530   STEATQFTIEPFIQGNEWLNSSNIPFALGL  559



>ref|XP_011031815.1| PREDICTED: pectinesterase-like [Populus euphratica]
Length=580

 Score =   455 bits (1171),  Expect = 5e-149, Method: Compositional matrix adjust.
 Identities = 234/457 (51%), Positives = 299/457 (65%), Gaps = 25/457 (5%)
 Frame = +3

Query  393   RKVQAAVADCMELLDLSQDKVMDSMVALG----NLSARARTD-AHSWLSSVLTNHDTCLD  557
             ++ + A+ DC+E++D + D++ +++V L     N S +   D   + LSS +TN +TCLD
Sbjct  126   KREKTALHDCLEIIDETLDELHEALVDLNEYPNNKSLKKHADDLKTLLSSAITNQETCLD  185

Query  558   GLS--EPARSIMEPMIKDLISRAKsslavlvavaPSTEDDL--------RAL--------  683
             G S  E  + + + ++K  I   K    VL  +   T+ D+        R L        
Sbjct  186   GFSHDEADKKVRKALLKGQIHVEKMCSNVLAMIKNMTDTDVANELKITNRKLMQQEKEGN  245

Query  684   NGEFPSWVSASDRRLLEASanavaanvvvaKDGSGKYKTVAEAVASAPDNGKTRYVIYIK  863
               E+P W+S +DRRLL++S+      V    DGSG YKTV+ AVA+AP     RY+I IK
Sbjct  246   ESEWPEWMSVADRRLLQSSSVTPDVVVAA--DGSGNYKTVSAAVAAAPKKSSKRYIIRIK  303

Query  864   KGTYKENVEIGKKKTNVMLIGDGLSATIITGSLNYVDGATTFNSATVAAVGDGFIAQDLR  1043
              G Y+ENV++ K KTN+M +GDG   TIIT S N VDG+TTFNSATVAAVG GF+A+ + 
Sbjct  304   AGVYRENVDVPKDKTNIMFMGDGRKTTIITASRNVVDGSTTFNSATVAAVGQGFLARGIT  363

Query  1044  IQNTAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYAHSQRQFYRDCYITGTVDFIFGN  1223
              QNTAGP KHQAVALR+G+D S    C + AYQDTLY HS RQF+ +C+I GTVDFIFGN
Sbjct  364   FQNTAGPSKHQAVALRVGSDLSAFYDCDMLAYQDTLYVHSNRQFFINCFIAGTVDFIFGN  423

Query  1224  AAAVIQNSQVVARKPMAAQKNMVTAQGRTDPNQNTGTSIQNCNVSPSSDLGPVKGTIQTY  1403
             AA V+Q+  + AR+P + QKNMVTAQGRTDPNQNTG  IQ   +  +SDL PVK +  TY
Sbjct  424   AAVVLQDCDIHARRPNSGQKNMVTAQGRTDPNQNTGIVIQKSRIGATSDLQPVKSSFPTY  483

Query  1404  LGRPWKEYSRTVFMESNIGDHIDPAGWFPWDGDFALKTLYYGEYMNRGPGAGTSKRVNWP  1583
             LGRPWKEYSRTV M+S+I D I PAGWF W G FAL TLYY EY N G GAGTS+RV W 
Sbjct  484   LGRPWKEYSRTVIMQSSITDVIQPAGWFEWSGSFALNTLYYAEYQNSGAGAGTSRRVTWK  543

Query  1584  GYHVITDKAEAMKFTVAQLIQGGSWLKNTGVDYTEGL  1694
             GY VIT   EA +FT    I G SWL++T   ++ GL
Sbjct  544   GYRVITSATEAQRFTPGNFIAGSSWLRSTTFPFSLGL  580



>ref|XP_004502642.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 34-like 
[Cicer arietinum]
Length=595

 Score =   456 bits (1172),  Expect = 6e-149, Method: Compositional matrix adjust.
 Identities = 228/456 (50%), Positives = 295/456 (65%), Gaps = 23/456 (5%)
 Frame = +3

Query  396   KVQAAVADCMELLDLSQDKVMDSMVA---------LGNLSARARTDAHSWLSSVLTNHDT  548
             +++ A  DC+ELLD S D V  S+ +         +  L+A +  D  +WLS+ LTN DT
Sbjct  138   RIRTAYQDCLELLDDSIDAVAKSLTSVKPSTSSGSIKPLAASSTDDVLTWLSAALTNQDT  197

Query  549   CLDGLSEPARSIMEPMIKDLISRAKsslavlvavaPSTEDD-------------LRALNG  689
             C +G S+ +  +   M  +L   ++     L   + S   D             L     
Sbjct  198   CAEGFSDTSGEVKNQMTNNLKDLSELVSNCLAIFSASGVGDDFSGVPIQNKRRLLTMRED  257

Query  690   EFPSWVSASDRRLLEASanavaanvvvaKDGSGKYKTVAEAVASAPDNGKTRYVIYIKKG  869
              FP W+S  +RRLL  + + + A+V+V+KDG+G  KT+AEA+   P+ G  R++IYI++G
Sbjct  258   NFPKWLSRRERRLLNLAVSEIQADVIVSKDGNGTVKTIAEAIKKIPEYGNRRFIIYIRQG  317

Query  870   TYKE-NVEIGKKKTNVMLIGDGLSATIITGSLNYVDGATTFNSATVAAVGDGFIAQDLRI  1046
              Y+E N++IG+KKTNVM+IGDG   T+ITG  N +   TTF++A+ AA G GFIA+D+  
Sbjct  318   RYEEDNLKIGRKKTNVMIIGDGKGKTVITGGKNVMQNLTTFHTASFAASGPGFIARDVTF  377

Query  1047  QNTAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYAHSQRQFYRDCYITGTVDFIFGNA  1226
             +N AGP KHQAVALR+GAD +V+ RC I  YQDT+Y HS RQFYR+C I GTVDFIFGNA
Sbjct  378   ENYAGPAKHQAVALRVGADHAVVYRCNIIGYQDTMYVHSNRQFYRECDIYGTVDFIFGNA  437

Query  1227  AAVIQNSQVVARKPMAAQKNMVTAQGRTDPNQNTGTSIQNCNVSPSSDLGPVKGTIQTYL  1406
             A V QN  + ARKPMA QKN +TAQ R DPNQNTG SI NC +  + DL   KG+ QTYL
Sbjct  438   AVVFQNCSLYARKPMAQQKNTITAQNRKDPNQNTGISIHNCRILATPDLEASKGSFQTYL  497

Query  1407  GRPWKEYSRTVFMESNIGDHIDPAGWFPWDGDFALKTLYYGEYMNRGPGAGTSKRVNWPG  1586
             GRPWK YS+TV+M S +GDHI P GW  W+  FAL TLYYGEYMN GPG    +RV WPG
Sbjct  498   GRPWKLYSKTVYMLSYMGDHIHPRGWLEWNATFALDTLYYGEYMNYGPGGAIGQRVTWPG  557

Query  1587  YHVITDKAEAMKFTVAQLIQGGSWLKNTGVDYTEGL  1694
             + VIT   EA +FTVAQ I G SWL +TGV +  GL
Sbjct  558   FRVITSTVEANRFTVAQFISGSSWLPSTGVAFVAGL  593



>ref|XP_010925933.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 34 
[Elaeis guineensis]
Length=587

 Score =   455 bits (1170),  Expect = 9e-149, Method: Compositional matrix adjust.
 Identities = 232/459 (51%), Positives = 301/459 (66%), Gaps = 29/459 (6%)
 Frame = +3

Query  390   DRKVQAAVADCMELLDLSQDKVMDSMVALG----NLSARARTDAHSWLSSVLTNHDTCLD  557
             D   +AA  DCMELL+ S D++ +S+  +       +  +  D  +WLS+ LTN DTC +
Sbjct  132   DALARAAYEDCMELLEDSLDQLSESLAVVSPSASGPAGASNEDVLTWLSAALTNQDTCTE  191

Query  558   GLSEPA----RSIMEPMIKDL-------------ISRAKsslavlvavaPSTEDDLRAL-  683
             GL++ A    R+ M+  +KDL             +SR K    +     P      R L 
Sbjct  192   GLTDVADGYVRAQMQSKLKDLAELVSNCLAIFSAVSRNKDFSGI-----PIKNKKRRLLS  246

Query  684   --NGEFPSWVSASDRRLLEASanavaanvvvaKDGSGKYKTVAEAVASAPDNGKTRYVIY  857
               +G+FP W+   DR+LL+     + A++VV+KDG+G YK++A+AV +AP+    R +IY
Sbjct  247   SGDGDFPEWLGRRDRKLLQVPVAQIQADMVVSKDGNGTYKSIADAVKAAPERSTRRIIIY  306

Query  858   IKKGTYKENVEIGKKKTNVMLIGDGLSATIITGSLNYVDGATTFNSATVAAVGDGFIAQD  1037
             +K G Y EN+++ +KKTN+M IGDG   TI+  S +  +  TTF++AT A+ G+GFI +D
Sbjct  307   VKAGRYDENIKVSRKKTNLMFIGDGKGKTIVAASRSVAENYTTFHTATFASTGNGFIMRD  366

Query  1038  LRIQNTAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYAHSQRQFYRDCYITGTVDFIF  1217
             + I+N AGP KHQAVALR+GAD +V+ RC I  YQDTLY HSQRQF+R+C + GTVDFIF
Sbjct  367   MTIENWAGPAKHQAVALRVGADHAVVYRCNIIGYQDTLYVHSQRQFFRECDVYGTVDFIF  426

Query  1218  GNAAAVIQNSQVVARKPMAAQKNMVTAQGRTDPNQNTGTSIQNCNVSPSSDLGPVKGTIQ  1397
             GNAA V+QN  + ARKPM  QKN +TAQ R DPNQNTG SI  C V+ + DL PV+    
Sbjct  427   GNAAVVLQNCSLWARKPMPMQKNTITAQNRKDPNQNTGISIHACRVAATPDLVPVRWNYS  486

Query  1398  TYLGRPWKEYSRTVFMESNIGDHIDPAGWFPWDGDFALKTLYYGEYMNRGPGAGTSKRVN  1577
             TYLGRPWK YSRTV+M S +GDHI+PAGW  W+  FAL TLYYGEYMN GPGA   KRVN
Sbjct  487   TYLGRPWKLYSRTVYMLSYMGDHINPAGWLEWNATFALDTLYYGEYMNYGPGAALGKRVN  546

Query  1578  WPGYHVITDKAEAMKFTVAQLIQGGSWLKNTGVDYTEGL  1694
             W GY VIT   EA KFTVAQ I G SWL +TGV +  GL
Sbjct  547   WTGYRVITLPEEASKFTVAQFIYGSSWLPSTGVAFLAGL  585



>ref|XP_010264199.1| PREDICTED: pectinesterase 2-like [Nelumbo nucifera]
Length=527

 Score =   452 bits (1164),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 230/441 (52%), Positives = 301/441 (68%), Gaps = 8/441 (2%)
 Frame = +3

Query  381   RINDRKVQAAVADCMELLDLSQDKVMDSMVALGNLSARARTDAHSWLSSVLTNHDTCLDG  560
             +  +++ + A ADC++L    Q+ V+     L   S     D  +WLS+ LTN +TC  G
Sbjct  92    KCRNKREKVAWADCLQLY---QNTVLQLNTTLNPYSRYTDVDVQTWLSTALTNLETCKTG  148

Query  561   LSEPARS-IMEPMIKDLISRAKsslavlvavaPSTEDDLRALNGEFPSWVSASDRRLLEA  737
               E   S  M P++ + +S+  S+   +   A +T++  ++  G +PSWVSA DR+LL++
Sbjct  149   FIELGVSDFMLPLMSNNVSKLISNTLAINNNATTTQN--QSYTGGYPSWVSAGDRKLLQS  206

Query  738   SanavaanvvvaKDGSGKYKTVAEAVASAPDN--GKTRYVIYIKKGTYKENVEIGKKKTN  911
             S+ A  AN+VVA+DGSG ++T+ EA+++A     G  R+VIY+KKG Y EN+EIG    N
Sbjct  207   SSPASQANIVVAQDGSGNFRTIKEALSAASQQRTGSGRFVIYVKKGAYIENLEIGSSLQN  266

Query  912   VMLIGDGLSATIITGSLNYVDGATTFNSATVAAVGDGFIAQDLRIQNTAGPEKHQAVALR  1091
             +ML+GDG+  TIITG+ +   G+TTFNSATVA  G GFIA  +  +NTAGPE HQAVALR
Sbjct  267   IMLVGDGMRNTIITGNRSVGGGSTTFNSATVAVTGQGFIAMGITFRNTAGPENHQAVALR  326

Query  1092  LGADQSVINRCKIDAYQDTLYAHSQRQFYRDCYITGTVDFIFGNAAAVIQNSQVVARKPM  1271
              G+D SV  RC  + YQDTLY HSQRQ Y++CYI GTVDFIFGNAA V+QN  + AR+PM
Sbjct  327   SGSDLSVFYRCGFEGYQDTLYVHSQRQLYKECYIYGTVDFIFGNAAVVLQNCMIFARRPM  386

Query  1272  AAQKNMVTAQGRTDPNQNTGTSIQNCNVSPSSDLGPVKGTIQTYLGRPWKEYSRTVFMES  1451
               Q N+VTAQGRTDPNQNTG SI N  +  SSDL PV  + +T+LGRPWK+YSRTV++ S
Sbjct  387   DNQNNVVTAQGRTDPNQNTGISIHNSRIMASSDLVPVLSSFKTFLGRPWKQYSRTVYLTS  446

Query  1452  NIGDHIDPAGWFPWDGDFALKTLYYGEYMNRGPGAGTSKRVNWPGYHVITDKAEAMKFTV  1631
              I   +DPAGW  W G+FAL TLYYGEY N GPG+ T+ RVNW GY VIT  +EA +FTV
Sbjct  447   YIDTLVDPAGWMEWSGNFALDTLYYGEYKNYGPGSSTANRVNWGGYRVITKSSEASQFTV  506

Query  1632  AQLIQGGSWLKNTGVDYTEGL  1694
              + I G SWL  TGV +  GL
Sbjct  507   GKFISGDSWLPATGVPFKSGL  527



>ref|XP_008228105.1| PREDICTED: pectinesterase [Prunus mume]
Length=587

 Score =   454 bits (1169),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 233/454 (51%), Positives = 298/454 (66%), Gaps = 25/454 (6%)
 Frame = +3

Query  402   QAAVADCMELLDLSQDKVMDSMVALGNLSARART------DAHSWLSSVLTNHDTCLDGL  563
             + A+ DC+E +D + D++  ++  L     + ++      D  + +SS +TN +TCLDG 
Sbjct  136   KVALHDCLENIDETLDELHAAVADLHEYPNKKKSLTQYADDLKTLISSAITNQETCLDGF  195

Query  564   S-----EPARSIMEP---MIKDLISRAKsslavlvavaPSTEDDL---RALNGE------  692
             S     +  R ++E     ++ L S A + +  +     +    +   R L  E      
Sbjct  196   SHDDADKKVRKVLEKGQVHVEQLCSNALAMIRNMTDNDIANASKMNVNRKLKEEVVEEKG  255

Query  693   FPSWVSASDRRLLEASanavaanvvvaKDGSGKYKTVAEAVASAPDNGKTRYVIYIKKGT  872
             +P W+S +DRRLL++S       V    DGSG YKTV+EAVA+AP+   TRYVI IK G 
Sbjct  256   WPEWLSVADRRLLQSSTVTPNVVVAA--DGSGNYKTVSEAVAAAPEKSSTRYVIRIKAGV  313

Query  873   YKENVEIGKKKTNVMLIGDGLSATIITGSLNYVDGATTFNSATVAAVGDGFIAQDLRIQN  1052
             Y+ENV++ KKKTN+M +GDG ++TIIT S N VDG+TTFNSATVAAVG+ FIA+D+  QN
Sbjct  314   YRENVDVPKKKTNIMFLGDGRTSTIITASRNVVDGSTTFNSATVAAVGEKFIARDITFQN  373

Query  1053  TAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYAHSQRQFYRDCYITGTVDFIFGNAAA  1232
             TAGP KHQAVALR+G+D S   R  I AYQD+LY HS RQF+  C + GTVDFIFGNAA 
Sbjct  374   TAGPSKHQAVALRVGSDLSAFYRVDILAYQDSLYVHSNRQFFEGCLVAGTVDFIFGNAAV  433

Query  1233  VIQNSQVVARKPMAAQKNMVTAQGRTDPNQNTGTSIQNCNVSPSSDLGPVKGTIQTYLGR  1412
             V+QN  + ARKP + QKNMVTAQGRTDPNQNTG  IQ   +  +SDL  VKG+ +T+LGR
Sbjct  434   VLQNCDIHARKPNSGQKNMVTAQGRTDPNQNTGIVIQKSRIGATSDLQAVKGSFKTFLGR  493

Query  1413  PWKEYSRTVFMESNIGDHIDPAGWFPWDGDFALKTLYYGEYMNRGPGAGTSKRVNWPGYH  1592
             PWKEYSRTV M+S+I D IDPAGW  W G FAL TL+YGEY N G GAGTS RV W G+ 
Sbjct  494   PWKEYSRTVIMQSSISDIIDPAGWHEWSGTFALDTLFYGEYANTGAGAGTSNRVTWKGFK  553

Query  1593  VITDKAEAMKFTVAQLIQGGSWLKNTGVDYTEGL  1694
             VIT   EA  FT    I GGSWL +TG  ++ GL
Sbjct  554   VITSATEAQTFTPGSFIAGGSWLSSTGFPFSLGL  587



>ref|XP_007145198.1| hypothetical protein PHAVU_007G218500g [Phaseolus vulgaris]
 gb|ESW17192.1| hypothetical protein PHAVU_007G218500g [Phaseolus vulgaris]
Length=553

 Score =   453 bits (1166),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 229/447 (51%), Positives = 295/447 (66%), Gaps = 19/447 (4%)
 Frame = +3

Query  402   QAAVADCMELLDLSQDKVMDSMVALGNLS-----ARARTDAHSWLSSVLTNHDTCLDGLS  566
             Q A+ DC++L    QD  ++    + +LS     ++   D  + LS  +TN  TCLDG +
Sbjct  109   QRALDDCLKLF---QDTNLELKTTIDDLSKSSIGSKRHHDLQTLLSGAMTNLYTCLDGFA  165

Query  567   EPARSIMEPMIKDL--ISRAKsslavlvavaPSTED---------DLRALNGEFPSWVSA  713
                  + + + K L  IS   S+   ++   P  +          +   +   FP WVS 
Sbjct  166   YSKGRVRDRIEKKLLEISHHMSNSLAMLKKVPGVKTRTSKSEVFPEYGKMKKGFPLWVSP  225

Query  714   SDRRLLEASanavaanvvvaKDGSGKYKTVAEAVASAPDNGKTRYVIYIKKGTYKENVEI  893
              DR+LL+AS N    ++VVAKDG+G + T+ EA+A AP++  TR+VI+IK+G Y ENVE+
Sbjct  226   KDRKLLQASVNESKFDLVVAKDGTGNFTTIGEALALAPNSSTTRFVIHIKEGAYFENVEV  285

Query  894   GKKKTNVMLIGDGLSATIITGSLNYVDGATTFNSATVAAVGDGFIAQDLRIQNTAGPEKH  1073
              +KKTN+M +GDG+  T++ GS N VDG TTF SATVA +G+GFIA+ +  +N+AGPEKH
Sbjct  286   IRKKTNLMFVGDGIGKTVVKGSRNVVDGWTTFQSATVAVLGEGFIAKGITFENSAGPEKH  345

Query  1074  QAVALRLGADQSVINRCKIDAYQDTLYAHSQRQFYRDCYITGTVDFIFGNAAAVIQNSQV  1253
             QAVALR GAD S   RC    YQDTLY HS RQFYR+C I GTVDFIFGNAA V QN  +
Sbjct  346   QAVALRSGADFSAFFRCSFVGYQDTLYVHSLRQFYRECDIYGTVDFIFGNAAVVFQNCNL  405

Query  1254  VARKPMAAQKNMVTAQGRTDPNQNTGTSIQNCNVSPSSDLGPVKGTIQTYLGRPWKEYSR  1433
              AR+P   QKN+ TAQGR DPNQNTG SI NC ++ +SDL PVK + ++YLGRPWK YSR
Sbjct  406   YARRPNENQKNLFTAQGREDPNQNTGISIFNCKIAAASDLIPVKSSFKSYLGRPWKTYSR  465

Query  1434  TVFMESNIGDHIDPAGWFPWDGDFALKTLYYGEYMNRGPGAGTSKRVNWPGYHVITDKAE  1613
             TV+++S I D IDPAGW  W+  FAL TLYYGEYMNRGPG+ TS RV WPGY +I    E
Sbjct  466   TVYLKSYIEDLIDPAGWLEWNDTFALDTLYYGEYMNRGPGSNTSARVTWPGYRIINSSTE  525

Query  1614  AMKFTVAQLIQGGSWLKNTGVDYTEGL  1694
             A +FTVAQ IQG  WL  TG+ +  GL
Sbjct  526   ASQFTVAQFIQGNDWLNTTGIPFLSGL  552



>ref|XP_006441080.1| hypothetical protein CICLE_v10019376mg [Citrus clementina]
 gb|ESR54320.1| hypothetical protein CICLE_v10019376mg [Citrus clementina]
Length=604

 Score =   455 bits (1170),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 249/555 (45%), Positives = 331/555 (60%), Gaps = 39/555 (7%)
 Frame = +3

Query  138   IVGSVALVSIWALRTSSSSPSLWK------ARVCDPAHDPPSCMA-IVSEVSSAAPTETD  296
             I  +V+ V +  L+TS+  P++        +R C     P  C++ +++   S   +E D
Sbjct  51    IASAVSAVLLVGLKTSAVGPTIGHKPTQAISRTCSKTLYPNLCVSSLLNFPGSLTASEQD  110

Query  297   GVAllqmllhssllRIQDAVKLSANVNRRINDRKVQAAVADCMELLDLSQDKV---MDSM  467
              V +   +      R   A+  ++ ++    D  V++A  DC+ELLD S D +   + S+
Sbjct  111   LVHISFNMTLQHFSR---ALYFTSGISYLQMDPHVRSAFDDCLELLDDSVDALSRSLGSV  167

Query  468   VALGNLSARARTDAHSWLSSVLTNHDTCLDGLSE---PARSIMEPMIKDL----------  608
             + L       R D  +WLS+ LTNHDTC +G  E   P +  +   +KDL          
Sbjct  168   LLLPGGDINKREDVLTWLSAALTNHDTCSEGFEELNGPVKDQVSDKLKDLSELVSNCLAI  227

Query  609   ---------ISRAKsslavlvavaPSTEDDLRALNGE---FPSWVSASDRRLLEASanav  752
                       S           ++ S EDD    N +    P WVS   RRLL      +
Sbjct  228   FSAGGDSDDFSGVPIQNRRRRLLSSSEEDDTWGENDDDDNVPRWVSRETRRLLSLPVPHI  287

Query  753   aanvvvaKDGSGKYKTVAEAVASAPDNGKTRYVIYIKKGTYKE-NVEIGKKKTNVMLIGD  929
              A+++V+KDG+G  KT+AEA+  AP+N   R +IY++ G Y+E N+++G+KK N+M IGD
Sbjct  288   QADIIVSKDGTGTVKTIAEAIKKAPENSDRRTIIYVRAGRYEESNLKVGRKKRNLMFIGD  347

Query  930   GLSATIITGSLNYVDGATTFNSATVAAVGDGFIAQDLRIQNTAGPEKHQAVALRLGADQS  1109
             G   TIITG  N  D  TTF++A+ AA G GFIA+D+  +N AGP KHQAVALR+GAD +
Sbjct  348   GKGKTIITGGRNVFDKLTTFHTASFAATGAGFIARDMTFENFAGPAKHQAVALRVGADHA  407

Query  1110  VINRCKIDAYQDTLYAHSQRQFYRDCYITGTVDFIFGNAAAVIQNSQVVARKPMAAQKNM  1289
             V+ RC +  YQDTLY HS RQFYR+C I GTVDFIFGNAA V+Q   + ARKPMA QKN 
Sbjct  408   VVYRCNVIGYQDTLYVHSNRQFYRECDIYGTVDFIFGNAAVVLQKCAIYARKPMANQKNT  467

Query  1290  VTAQGRTDPNQNTGTSIQNCNVSPSSDLGPVKGTIQTYLGRPWKEYSRTVFMESNIGDHI  1469
             +TAQ R DPNQNTG SI +C++  + DL   KG+I TYLGRPWK YSR V+M + +GDHI
Sbjct  468   ITAQNRKDPNQNTGISIHDCSLYAAPDLQASKGSIPTYLGRPWKLYSRVVYMLTYMGDHI  527

Query  1470  DPAGWFPWDGDFALKTLYYGEYMNRGPGAGTSKRVNWPGYHVITDKAEAMKFTVAQLIQG  1649
              P GW  W+GDFAL TLYYGEYMN GPG+    RV WPGY VIT   EA KFTV+Q I G
Sbjct  528   QPRGWLEWNGDFALDTLYYGEYMNSGPGSAVGHRVRWPGYRVITSATEASKFTVSQFIYG  587

Query  1650  GSWLKNTGVDYTEGL  1694
              SWL +TGV +  GL
Sbjct  588   SSWLPSTGVAFLGGL  602



>gb|KHG08631.1| Pectinesterase 3 [Gossypium arboreum]
Length=582

 Score =   454 bits (1168),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 231/453 (51%), Positives = 293/453 (65%), Gaps = 24/453 (5%)
 Frame = +3

Query  402   QAAVADCMELLDLSQDKVMDSMVALGNLSARARTDAH-----SWLSSVLTNHDTCLDGLS  566
             + A+ DC+E +D + D++ +++  L     +     H     + +S+ +TN +TCLDG S
Sbjct  132   KTALHDCLETIDETLDELHEAVEDLHEYPNKKSLTQHADDLKTLMSAAMTNQETCLDGFS  191

Query  567   EPA-----RSIM---EPMIKDLISRAKsslavlvavaPSTEDDLRALNGEF---------  695
                     R ++   E  ++ + S A + +  +     + E  L++ N +          
Sbjct  192   HEGADKKIREVLIDGEKYVEKMCSNALAMIKNMTDTDIANEMMLKSSNRKLKEDESGIAW  251

Query  696   PSWVSASDRRLLEASanavaanvvvaKDGSGKYKTVAEAVASAPDNGKTRYVIYIKKGTY  875
             P W+SA DRRLL++S+      V    DGSG +KTV+EAVA AP+    RY+I IK G Y
Sbjct  252   PEWLSAGDRRLLQSSSVTPNVVVAA--DGSGNFKTVSEAVAKAPEKSSKRYIIRIKAGVY  309

Query  876   KENVEIGKKKTNVMLIGDGLSATIITGSLNYVDGATTFNSATVAAVGDGFIAQDLRIQNT  1055
              ENVE+ KKK+N+M IGDG + TIITGS N VDG+TTF+SATVAAVG+ F+A+D+  QNT
Sbjct  310   IENVEVPKKKSNIMFIGDGRTKTIITGSRNVVDGSTTFHSATVAAVGEKFLARDITFQNT  369

Query  1056  AGPEKHQAVALRLGADQSVINRCKIDAYQDTLYAHSQRQFYRDCYITGTVDFIFGNAAAV  1235
             AGP KHQAVALR+G+D S    C + AYQDTLY HS RQFY +C + GTVDFIFGNAAAV
Sbjct  370   AGPSKHQAVALRVGSDLSAFYNCDMLAYQDTLYVHSNRQFYVNCLVAGTVDFIFGNAAAV  429

Query  1236  IQNSQVVARKPMAAQKNMVTAQGRTDPNQNTGTSIQNCNVSPSSDLGPVKGTIQTYLGRP  1415
              QN  + ARKP + QKNMVTAQGRTDPNQNTG  IQ C +  +SDL PV+    TYLGRP
Sbjct  430   FQNCDIHARKPNSGQKNMVTAQGRTDPNQNTGIVIQKCRIGATSDLQPVRKNFPTYLGRP  489

Query  1416  WKEYSRTVFMESNIGDHIDPAGWFPWDGDFALKTLYYGEYMNRGPGAGTSKRVNWPGYHV  1595
             WKEYSRTV M+S I D I PAGW  W G FALKTL+Y EY N G GA TS RV W GY V
Sbjct  490   WKEYSRTVVMQSTISDVIQPAGWHEWSGSFALKTLFYAEYQNTGAGASTSARVKWGGYKV  549

Query  1596  ITDKAEAMKFTVAQLIQGGSWLKNTGVDYTEGL  1694
             IT  +EA  FT  + I GGSWL +TG  +  GL
Sbjct  550   ITSASEAQAFTPGRFIAGGSWLSSTGFPFALGL  582



>ref|XP_006360163.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 34-like 
[Solanum tuberosum]
Length=595

 Score =   454 bits (1169),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 241/523 (46%), Positives = 325/523 (62%), Gaps = 25/523 (5%)
 Frame = +3

Query  195   PSLWKARVCDPAHDPPSCMAIVSEVSSAAPTETDGVAllqmllhssllRIQDAVKLSANV  374
             PS   +R C     P  C+  + E   A  T +D   L+ + ++++L R   A  +++++
Sbjct  73    PSQAISRTCSRTRFPTLCLNSLHEFPGAL-TASDA-ELVHISVNATLQRFGRAFYMASDI  130

Query  375   NRRINDRKVQAAVADCMELLDLSQDKVMDSMVALGNLSARA----RTDAHSWLSSVLTNH  542
             N  + D++ ++A   C+ELL+ S   +  S+ ++   + ++      D  +WLS+ LTN 
Sbjct  131   NSLVMDKRTRSAYESCLELLEDSVYLLSRSLTSVAPGAGKSPPGNNNDVQTWLSAALTNQ  190

Query  543   DTCLDGLSEPARSIMEPMIKDLISRAKsslavlvavaPSTEDD-----------------  671
             DTC +G ++ + ++ + M  +L   ++     L   A    +D                 
Sbjct  191   DTCTEGFADVSGNVKDQMATNLKDLSQLVSNCLAIFAAVNGNDDFAGVPIHNRRRRLMST  250

Query  672   -LRALNGEFPSWVSASDRRLLEASanavaanvvvaKDGSGKYKTVAEAVASAPDNGKTRY  848
                A N  FP W+S  DR+LL+A  + + A+++V+KDG+G +KT+AEA+   PD    R 
Sbjct  251   VASAKNENFPKWLSRKDRKLLDAPVSTIQADMIVSKDGNGTFKTIAEAIKKLPDYSSRRI  310

Query  849   VIYIKKGTYKENV-EIGKKKTNVMLIGDGLSATIITGSLNYVDGATTFNSATVAAVGDGF  1025
             +IY+K G Y+E++ ++G+KKTNVM IGDG   T+I+G  +     TTF++A+ AA G GF
Sbjct  311   IIYVKAGRYEEDILKVGRKKTNVMFIGDGKGQTMISGGKSVSQNLTTFHTASFAATGAGF  370

Query  1026  IAQDLRIQNTAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYAHSQRQFYRDCYITGTV  1205
             IA+D+  QN AGP KHQAVALR+GAD +VI RC I  YQDTLY HSQRQFYR+C I GTV
Sbjct  371   IARDITFQNWAGPGKHQAVALRIGADHAVIYRCNIIGYQDTLYVHSQRQFYRECDIYGTV  430

Query  1206  DFIFGNAAAVIQNSQVVARKPMAAQKNMVTAQGRTDPNQNTGTSIQNCNVSPSSDLGPVK  1385
             DFIFGNAA VIQN  + ARKPM  QKN +TAQ R DPNQNTG SI  C +  +SDL   K
Sbjct  431   DFIFGNAAVVIQNCSIYARKPMDFQKNTITAQNRKDPNQNTGISIHACKIIATSDLQASK  490

Query  1386  GTIQTYLGRPWKEYSRTVFMESNIGDHIDPAGWFPWDGDFALKTLYYGEYMNRGPGAGTS  1565
             G+  TYLGRPWK YSRTV M S +GDHI P GW  W+  FAL TLYYGEYMN GPGA   
Sbjct  491   GSFPTYLGRPWKLYSRTVVMLSYLGDHIHPHGWLEWNATFALDTLYYGEYMNYGPGAAVG  550

Query  1566  KRVNWPGYHVITDKAEAMKFTVAQLIQGGSWLKNTGVDYTEGL  1694
             +RV WPGYHVI    EA KFTVAQ I G SWL +TGV +  GL
Sbjct  551   QRVKWPGYHVINSTDEASKFTVAQFIFGSSWLPSTGVAFLAGL  593



>ref|XP_003595386.1| Pectinesterase [Medicago truncatula]
 gb|AES65637.1| pectinesterase/pectinesterase inhibitor [Medicago truncatula]
Length=527

 Score =   452 bits (1162),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 226/445 (51%), Positives = 293/445 (66%), Gaps = 11/445 (2%)
 Frame = +3

Query  384   INDRKVQAAVADCMELLDLSQDKVMDSMVALGNLSAR------ARTDAHSWLSSVLTNHD  545
               D ++  AV+DC+++LDLS D +  S  A  N   +        +D  +WLSS L N +
Sbjct  84    FGDSRLSNAVSDCIDMLDLSSDALTWSASAAQNPKGKHNSTGNVNSDVRTWLSSALANPE  143

Query  546   TCLDGLSEPARSIMEPMIKDLISRAKsslavlvavaPSTEDDL--RALNGEFPSWVSASD  719
             TC+DG  E    I   ++   +S+  S LA L+       D    +   G FPSWV   D
Sbjct  144   TCMDGF-EGTSGIESQLVSTGLSQMMSMLAELLTQVDPNLDSFTQKEQKGRFPSWVKRDD  202

Query  720   RRLLEASanavaanvvvaKDGSGKYKTVAEAVASAPDNGKTRYVIYIKKGTYKENVEIGK  899
             R+LL+A+   V   V    DGSG +  V +AV +APD    RYVIY+K+G Y ENVEI K
Sbjct  203   RKLLQANGVNVDVVVAT--DGSGNFTKVMDAVHAAPDYSMKRYVIYVKRGVYIENVEIKK  260

Query  900   KKTNVMLIGDGLSATIITGSLNYVDGATTFNSATVAAVGDGFIAQDLRIQNTAGPEKHQA  1079
             KK N+M++GDG++ATIITG+ +++DG TTF SAT A  G GFIA+D+  QNTAGPEKHQA
Sbjct  261   KKWNLMMVGDGMNATIITGNRSFIDGWTTFRSATFAVSGRGFIARDISFQNTAGPEKHQA  320

Query  1080  VALRLGADQSVINRCKIDAYQDTLYAHSQRQFYRDCYITGTVDFIFGNAAAVIQNSQVVA  1259
             VALR  +D SV  RC I  YQD+LY H+ RQF+R+C I+GTVDFIFG+A  + QN Q++ 
Sbjct  321   VALRSDSDLSVFYRCGIFGYQDSLYTHTMRQFFRECKISGTVDFIFGDATTLFQNCQILV  380

Query  1260  RKPMAAQKNMVTAQGRTDPNQNTGTSIQNCNVSPSSDLGPVKGTIQTYLGRPWKEYSRTV  1439
             +K +  QKN +TA GR DPN+ TG SIQ CN++  +DL P   +  TYLGRPWKEYSRT+
Sbjct  381   KKGLPNQKNTITAHGRKDPNEPTGFSIQFCNITADTDLLPSVNSTYTYLGRPWKEYSRTI  440

Query  1440  FMESNIGDHIDPAGWFPWDGDFALKTLYYGEYMNRGPGAGTSKRVNWPGYHVITDKAEAM  1619
             FM+S+I D + P GW  W+GDFAL TLYY EYMN G GAG +KRV WPGYH++ D ++A 
Sbjct  441   FMQSHISDVLRPEGWLEWNGDFALDTLYYAEYMNYGSGAGLNKRVKWPGYHIMNDSSQAS  500

Query  1620  KFTVAQLIQGGSWLKNTGVDYTEGL  1694
              FTV Q I+G  WL  TGV +T GL
Sbjct  501   NFTVTQFIEGNLWLPTTGVAFTAGL  525



>ref|XP_002265171.1| PREDICTED: pectinesterase [Vitis vinifera]
Length=611

 Score =   455 bits (1170),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 234/454 (52%), Positives = 298/454 (66%), Gaps = 22/454 (5%)
 Frame = +3

Query  393   RKVQAAVADCMELLDLSQDKVMDSMVALGNLSARARTDAH-----SWLSSVLTNHDTCLD  557
             ++ +AA+ DC+E +D + D++  +M  L     +     H     + +S+ +TN +TCLD
Sbjct  160   KREKAALHDCLETIDETLDELHVAMDDLDEYPDKKSLTQHADDLKTLMSAAMTNQETCLD  219

Query  558   GLS--EPARSIMEPMIKDLISRAKsslavlvavaPSTEDDL----RALNGEF--------  695
             G S  +  + + E ++K            L  +   T+ D+     A+N +         
Sbjct  220   GFSHDDADKHVREVLLKGQRHVEHMCSNALAMIKNMTDTDIAREREAMNRKLMEERDESG  279

Query  696   -PSWVSASDRRLLEASanavaanvvvaKDGSGKYKTVAEAVASAPDNGKTRYVIYIKKGT  872
              P W+SA DRRLL++S+      V    DGSG YKTV+ AVA+AP+    RY+I IK G 
Sbjct  280   WPKWLSAGDRRLLQSSSVTPDVVVAA--DGSGDYKTVSAAVAAAPEKSSKRYIIGIKAGV  337

Query  873   YKENVEIGKKKTNVMLIGDGLSATIITGSLNYVDGATTFNSATVAAVGDGFIAQDLRIQN  1052
             YKENVE+GKKKTN+M +GDG S TIITGS N VDG+TTFNSATVA VG+ FIA+D+  QN
Sbjct  338   YKENVEVGKKKTNIMFLGDGRSNTIITGSKNVVDGSTTFNSATVAVVGEKFIARDITFQN  397

Query  1053  TAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYAHSQRQFYRDCYITGTVDFIFGNAAA  1232
             TAGP KHQAVALR+G+D S   +C + AYQDTLY HS RQFY +C + GTVDFIFGNAAA
Sbjct  398   TAGPSKHQAVALRVGSDLSAFYKCDMLAYQDTLYVHSNRQFYINCLVAGTVDFIFGNAAA  457

Query  1233  VIQNSQVVARKPMAAQKNMVTAQGRTDPNQNTGTSIQNCNVSPSSDLGPVKGTIQTYLGR  1412
             V Q+  + AR+P + QKNM+TAQGRTDPNQNTG  IQ C +  +SDL  V  + +TYLGR
Sbjct  458   VFQDCDIHARRPNSGQKNMLTAQGRTDPNQNTGIVIQKCRIGATSDLQAVISSFKTYLGR  517

Query  1413  PWKEYSRTVFMESNIGDHIDPAGWFPWDGDFALKTLYYGEYMNRGPGAGTSKRVNWPGYH  1592
             PWKEYSRTV M+++I + IDPAGW  W G FAL TLYYGEY N G GAGTSKRV W G+ 
Sbjct  518   PWKEYSRTVVMQTSITNVIDPAGWHEWSGSFALSTLYYGEYQNTGAGAGTSKRVTWKGFK  577

Query  1593  VITDKAEAMKFTVAQLIQGGSWLKNTGVDYTEGL  1694
             VIT  +EA  FT    I G SWL +TG  Y+ GL
Sbjct  578   VITSASEAQGFTPGTFIAGSSWLGSTGFPYSLGL  611



>ref|XP_002304257.2| pectinesterase family protein [Populus trichocarpa]
 gb|EEE79236.2| pectinesterase family protein [Populus trichocarpa]
Length=584

 Score =   454 bits (1167),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 231/456 (51%), Positives = 296/456 (65%), Gaps = 24/456 (5%)
 Frame = +3

Query  393   RKVQAAVADCMELLDLSQDKVMDSMVALGNLSARARTDAH-----SWLSSVLTNHDTCLD  557
             ++ + A+ DC+E++D + D++ +++V L +         H     + LSS +TN +TCLD
Sbjct  131   KREKTALHDCLEIIDETLDELHEALVDLNDYPNNKSLKKHADDLKTLLSSAITNQETCLD  190

Query  558   GLS--EPARSIMEPMIKDLISRAKsslavlvavaPSTEDD----LRALN-----------  686
             G S  E  + + + ++K  I   K    VL  +   T+ D    L+  N           
Sbjct  191   GFSHDEADKKVRKALLKGQIHVEKMCSNVLAMIKNMTDTDVANELKTTNRKLMQEKEGNE  250

Query  687   GEFPSWVSASDRRLLEASanavaanvvvaKDGSGKYKTVAEAVASAPDNGKTRYVIYIKK  866
              E+P W+S +DRRLL++S+      V    DGSG YKTV+ AVA+AP     RY+I IK 
Sbjct  251   SEWPEWMSVADRRLLQSSSVTPDVVVAA--DGSGNYKTVSAAVAAAPKKSSKRYIIRIKA  308

Query  867   GTYKENVEIGKKKTNVMLIGDGLSATIITGSLNYVDGATTFNSATVAAVGDGFIAQDLRI  1046
             G Y+ENV++ K KTN+M +GDG   TIIT S N VDG+TTFNSATVAAVG GF+A+ +  
Sbjct  309   GVYRENVDVPKDKTNIMFMGDGRKTTIITASRNVVDGSTTFNSATVAAVGQGFLARGITF  368

Query  1047  QNTAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYAHSQRQFYRDCYITGTVDFIFGNA  1226
             QNTAGP KHQAVALR+G+D S    C + AYQDTLY HS RQF+ +C + GTVDFIFGNA
Sbjct  369   QNTAGPSKHQAVALRVGSDLSAFYDCDMLAYQDTLYVHSNRQFFINCLVAGTVDFIFGNA  428

Query  1227  AAVIQNSQVVARKPMAAQKNMVTAQGRTDPNQNTGTSIQNCNVSPSSDLGPVKGTIQTYL  1406
             A V+Q+  + AR+P + QKNMVTAQGRTDPNQNTG  IQ   +  +SDL PVK +  TYL
Sbjct  429   AVVLQDCDIHARRPNSGQKNMVTAQGRTDPNQNTGIVIQKSRIGATSDLQPVKSSFPTYL  488

Query  1407  GRPWKEYSRTVFMESNIGDHIDPAGWFPWDGDFALKTLYYGEYMNRGPGAGTSKRVNWPG  1586
             GRPWKEYSRTV M+S+I D I PAGWF W G FAL TLYY EY N G GAGTS+RV W G
Sbjct  489   GRPWKEYSRTVIMQSSITDVIQPAGWFEWSGSFALNTLYYAEYQNSGAGAGTSRRVTWKG  548

Query  1587  YHVITDKAEAMKFTVAQLIQGGSWLKNTGVDYTEGL  1694
             Y VIT   EA +FT    I G SWL++T   ++ GL
Sbjct  549   YRVITSATEAQRFTPGNFIAGSSWLRSTTFPFSLGL  584



>ref|XP_007163135.1| hypothetical protein PHAVU_001G209400g [Phaseolus vulgaris]
 gb|ESW35129.1| hypothetical protein PHAVU_001G209400g [Phaseolus vulgaris]
Length=601

 Score =   454 bits (1169),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 227/441 (51%), Positives = 303/441 (69%), Gaps = 12/441 (3%)
 Frame = +3

Query  408   AVADCMELLDLSQDKVMDSMVALGN--LSARARTDAHSWLSSVLTNHDTCLDGLSEPARS  581
             A+ DC+ L D + +++  ++  L    + ++   D+ ++LS  +TN  TCLDG +    +
Sbjct  160   ALDDCLNLFDETVEELKTTVKDLSQSTIGSKRYHDSQTFLSGAMTNLYTCLDGFAYSKGN  219

Query  582   IMEPM------IKDLISRAKsslavlvavaPSTEDDLRALNGE----FPSWVSASDRRLL  731
             + + +      I  L+S + + L  +      +++++    G+    FPSWVS +DR+LL
Sbjct  220   VRDRIEEGVLEISHLVSNSLAMLKKVPEKKKQSKNEVFPEYGKMKDGFPSWVSPNDRKLL  279

Query  732   EASanavaanvvvaKDGSGKYKTVAEAVASAPDNGKTRYVIYIKKGTYKENVEIGKKKTN  911
             +A+ N    ++VVAKDGSG + T+  AVA+AP++  TR+VI+IK G Y ENVE+ +KK+N
Sbjct  280   QAAVNETKFDLVVAKDGSGNFTTIGAAVAAAPNSSATRFVIHIKAGAYFENVEVIRKKSN  339

Query  912   VMLIGDGLSATIITGSLNYVDGATTFNSATVAAVGDGFIAQDLRIQNTAGPEKHQAVALR  1091
             +M +GDG+  T++  S N VDG TTF SATVA VGDGFIA+ +  +N+AGP KHQAVALR
Sbjct  340   LMWVGDGIGKTVVKASRNVVDGWTTFQSATVAVVGDGFIAKGITFENSAGPSKHQAVALR  399

Query  1092  LGADQSVINRCKIDAYQDTLYAHSQRQFYRDCYITGTVDFIFGNAAAVIQNSQVVARKPM  1271
              GAD S   +C   AYQDTLY HS RQFYR+C + GTVDFIFGNAAAV+QN  + ARKP 
Sbjct  400   SGADLSAFYQCSFVAYQDTLYVHSLRQFYRECDVYGTVDFIFGNAAAVLQNCNLYARKPN  459

Query  1272  AAQKNMVTAQGRTDPNQNTGTSIQNCNVSPSSDLGPVKGTIQTYLGRPWKEYSRTVFMES  1451
               QKN+ TAQGR DPNQNTG SI NC V+ ++DL PVK   + YLGRPWK+YSRTV++ S
Sbjct  460   PNQKNLFTAQGREDPNQNTGISIINCKVAAAADLIPVKSEFKNYLGRPWKKYSRTVYLNS  519

Query  1452  NIGDHIDPAGWFPWDGDFALKTLYYGEYMNRGPGAGTSKRVNWPGYHVITDKAEAMKFTV  1631
              + D IDPAGW  WDG+FAL TLYYGEY NRGPGA TS+RV WPGY VIT+  EA +FTV
Sbjct  520   LMEDLIDPAGWLEWDGNFALDTLYYGEYNNRGPGANTSRRVTWPGYRVITNSTEASQFTV  579

Query  1632  AQLIQGGSWLKNTGVDYTEGL  1694
             A  IQG  WL + G+ +  GL
Sbjct  580   ANFIQGNEWLTSLGIPFFSGL  600



>ref|XP_010056339.1| PREDICTED: pectinesterase 2-like [Eucalyptus grandis]
 gb|KCW73022.1| hypothetical protein EUGRSUZ_E01463 [Eucalyptus grandis]
Length=515

 Score =   451 bits (1161),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 233/454 (51%), Positives = 309/454 (68%), Gaps = 12/454 (3%)
 Frame = +3

Query  339   RIQDAVKLSANVNRRINDRKVQAAVADCMELLDLSQDKVMDSMVALGNLSARARTDAHSW  518
             R Q A   + ++  + ++ + +A  ADC++L + +  ++  ++V           +A +W
Sbjct  72    RAQMAHSNTHSLGSKCSNEREKAVWADCLQLYEHTILRLNRTIV-----HDCTHDEAQTW  126

Query  519   LSSVLTNHDTCLDGLSEPARS-IMEPMIKDLISRAKsslavlvavaPSTEDDLRALNGEF  695
             LS+ LTN +TC  G  E   S  + P++ + +S+  S+   L     +T +  +    +F
Sbjct  127   LSTALTNLETCRAGFVELGVSGNVLPLMSNNVSKLISNTLALNYAPYTTPNYTK----KF  182

Query  696   PSWVSASDRRLLEASanavaanvvvaKDGSGKYKTVAEAV-ASAPDNGKTRYVIYIKKGT  872
             P+WV   DR+LL++S+    AN++VA+DGSG YKT++EA+ A++  +G  RY+IYIK GT
Sbjct  183   PTWVRPGDRKLLQSSSAVSKANIIVAQDGSGNYKTISEAITAASKRSGTARYIIYIKAGT  242

Query  873   YKENVEIGKKKTNVMLIGDGLSATIITGSLNYVDGATTFNSATVAAVGDGFIAQDLRIQN  1052
             Y ENVE+G K  N+M +GDG+  TIITGS +   G+TTFNSATVA VGDGFIAQD+  +N
Sbjct  243   YSENVEVGSKLENIMFVGDGIGKTIITGSKSVGGGSTTFNSATVAVVGDGFIAQDITFRN  302

Query  1053  TAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYAHSQRQFYRDCYITGTVDFIFGNAAA  1232
             TAG   HQAVALR G+D SV  RC  + YQDTLY HS+RQFYR+C I GTVDFIFGNAA 
Sbjct  303   TAGAANHQAVALRSGSDLSVFYRCGFEGYQDTLYVHSERQFYRECDIYGTVDFIFGNAAV  362

Query  1233  VIQNSQVVARKPMAAQKNMVTAQGRTDPNQNTGTSIQNCNVSPSSDLGPVKGTIQTYLGR  1412
             V+QN  + AR P   + N VTAQGRTDPNQNTG SI NC V+ +SDL  V+ +++TYLGR
Sbjct  363   VLQNCNIYARNP-PNKVNTVTAQGRTDPNQNTGISIHNCKVTAASDLKSVQSSVKTYLGR  421

Query  1413  PWKEYSRTVFMESNIGDHIDPAGWFPWDGDFALKTLYYGEYMNRGPGAGTSKRVNWPGYH  1592
             PW+EYSRTVFM++ +   I+ AGW  WDG+FAL TLYYGEY+N GPG+ T+ RV W GYH
Sbjct  422   PWQEYSRTVFMKTYLDSLINSAGWMEWDGNFALDTLYYGEYLNTGPGSSTASRVTWAGYH  481

Query  1593  VITDKAEAMKFTVAQLIQGGSWLKNTGVDYTEGL  1694
             VIT   EA KFTV   I GGSWL  TGV YT GL
Sbjct  482   VITSATEASKFTVGSFIAGGSWLPATGVPYTSGL  515



>ref|XP_004148139.2| PREDICTED: pectinesterase 2 [Cucumis sativus]
 gb|KGN57272.1| hypothetical protein Csa_3G175720 [Cucumis sativus]
Length=571

 Score =   453 bits (1166),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 243/499 (49%), Positives = 311/499 (62%), Gaps = 18/499 (4%)
 Frame = +3

Query  219   CDPAHDPPSCMAIVSEVSSAAPTETDGVAllqmllhssllRIQDAVKLSANVNRRINDRK  398
             C     P +C    +  + + P   D     +M++  ++ R   A   +  V  +  + K
Sbjct  84    CKKTTYPETCKYFFNHGTKSPPK--DMTDFKKMVIQFAMERALSAESHTKGVGSKCRNGK  141

Query  399   VQAAVADCMELLDLSQDKVMDSMVALGNLSARARTDAHSWLSSVLTNHDTCLDGLSEPAR  578
              +AA ADC++L    Q+ ++     L + +     D  +WLS+ LTN +TC  G +E   
Sbjct  142   EKAAWADCLKLY---QNTILQLNQTLDSSTKSTEFDIQTWLSTALTNLETCRTGFAELNV  198

Query  579   S------IMEPMIKDLISRAKsslavlvavaPSTEDDLRALNGEFPSWVSASDRRLLEAS  740
             S      IM   + +LIS + +       V    E   +     FPSW+S  DRRLL++S
Sbjct  199   SDYILPLIMSDNVTELISNSLAINNASAGVGNGKETYKKG----FPSWLSGGDRRLLQSS  254

Query  741   anavaanvvvaKDGSGKYKTVAEAVASAPDNGKT-RYVIYIKKGTYKENVEIGKKKTNVM  917
             +  V   V   +DGSG Y TV  A+  A     + R+VI +K+G Y+EN+EIG K  N+M
Sbjct  255   STKVDLVVA--QDGSGNYTTVGAALEEAAKRKTSGRFVIQVKRGVYRENLEIGSKMKNIM  312

Query  918   LIGDGLSATIITGSLNYVDGATTFNSATVAAVGDGFIAQDLRIQNTAGPEKHQAVALRLG  1097
             LIGDG+  T ITG+ +   G+TTFNSATVA  G+GFIA+ +  +NTAGPE HQAVALR G
Sbjct  313   LIGDGMRFTFITGNRSVGGGSTTFNSATVAVTGEGFIARGITFRNTAGPENHQAVALRSG  372

Query  1098  ADQSVINRCKIDAYQDTLYAHSQRQFYRDCYITGTVDFIFGNAAAVIQNSQVVARKPMAA  1277
             AD SV  RC  + YQDTLY HSQRQFY++CYI GTVDFIFGNAA V+QN  + ARKPM  
Sbjct  373   ADLSVFYRCAFEGYQDTLYVHSQRQFYKECYIYGTVDFIFGNAAVVLQNCMIYARKPMNG  432

Query  1278  QKNMVTAQGRTDPNQNTGTSIQNCNVSPSSDLGPVKGTIQTYLGRPWKEYSRTVFMESNI  1457
             QKN VTAQGRTDPNQNTG SI N  V  + DL PV+ T++TYLGRPWKEYSRTVFM++ I
Sbjct  433   QKNAVTAQGRTDPNQNTGISIHNSRVMATDDLKPVESTVKTYLGRPWKEYSRTVFMKTYI  492

Query  1458  GDHIDPAGWFPWDGDFALKTLYYGEYMNRGPGAGTSKRVNWPGYHVITDKAEAMKFTVAQ  1637
                +DPAGW  WDGDFAL TLYYGEY N GPG+  S+RV W GYHVIT+  EA +FTV  
Sbjct  493   DSLVDPAGWLEWDGDFALNTLYYGEYNNIGPGSPISQRVKWKGYHVITNLTEASEFTVQN  552

Query  1638  LIQGGSWLKNTGVDYTEGL  1694
              I G SWL +T V +T GL
Sbjct  553   FIAGQSWLPDTEVPFTPGL  571



>dbj|BAJ96804.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=566

 Score =   453 bits (1165),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 240/476 (50%), Positives = 309/476 (65%), Gaps = 29/476 (6%)
 Frame = +3

Query  348   DAVKLSANVNRRINDRKVQA----AVADCMELLDLSQDKVMDSMVALGNLSARART---D  506
             +   +SAN +  + +R +      AV DCMELL+ + ++++ +   L + SA  R     
Sbjct  93    EVTTMSANCSGYLRERSLSGRDHLAVTDCMELLETTMEELVATTADLESPSAARRPTMDH  152

Query  507   AHSWLSSVLTNHDTCLDGLSE----PARSIMEP-------MIKDLISRAKsslavlvava  653
             A + LS+ +TN  TCL+G S       R  MEP       M+ + ++ AK          
Sbjct  153   AMTVLSAAITNQQTCLEGFSYQKGGEVRRYMEPGILHIAKMVSNSLAMAKKLPGATKPS-  211

Query  654   PSTEDDL---------RALNGEFPSWVSASDRRLLEASanavaanvvvaKDGSGKYKTVA  806
              STE  +         + + G FP WV   DRRLL+A A+ + AN VVAKDGSG + TV+
Sbjct  212   -STERSVARQPFTGYGQVVKGGFPRWVRPGDRRLLQAPASGIKANAVVAKDGSGGFTTVS  270

Query  807   EAVASAPDNGKTRYVIYIKKGTYKENVEIGKKKTNVMLIGDGLSATIITGSLNYVDGATT  986
              AVA+AP N ++RYVIYIK G Y ENVE+GK   N+M +GDG+  T+I  SLN VDG+TT
Sbjct  271   AAVAAAPTNSQSRYVIYIKAGAYMENVEVGKNHKNLMFMGDGMGKTVIKASLNVVDGSTT  330

Query  987   FNSATVAAVGDGFIAQDLRIQNTAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYAHSQ  1166
             F SATVA VG+ F+A+DL I+N AGP KHQAVALR+GAD S   RC    YQDTLY HS 
Sbjct  331   FRSATVAVVGNNFLARDLTIENAAGPSKHQAVALRVGADLSAFYRCSFVGYQDTLYVHSL  390

Query  1167  RQFYRDCYITGTVDFIFGNAAAVIQNSQVVARKPMAAQKNMVTAQGRTDPNQNTGTSIQN  1346
             RQF+R+C I GT+DF+FGN+AAV+Q+  + AR+P+  Q N+ TAQGRTDPNQNTG SIQ 
Sbjct  391   RQFFRECDIYGTIDFVFGNSAAVLQSCNLYARRPLPNQSNIYTAQGRTDPNQNTGISIQK  450

Query  1347  CNVSPSSDLGPVKGTIQTYLGRPWKEYSRTVFMESNIGDHIDPAGWFPWDGDFALKTLYY  1526
             C V+ +SDL  V+ + +TYLGRPWK+YSRTVFM+S +   ++PAGW  WDG FAL TLYY
Sbjct  451   CKVAAASDLAAVQSSFKTYLGRPWKQYSRTVFMQSELDSVVNPAGWLAWDGTFALDTLYY  510

Query  1527  GEYMNRGPGAGTSKRVNWPGYHVITDKAEAMKFTVAQLIQGGSWLKNTGVDYTEGL  1694
             GEY N GPGAGTS RV W GY VIT  +EA  FTV   I G  WL  T + ++ GL
Sbjct  511   GEYQNTGPGAGTSGRVTWKGYRVITSASEASTFTVGSFIDGDVWLAGTSIPFSAGL  566



>gb|KJB57093.1| hypothetical protein B456_009G147900 [Gossypium raimondii]
Length=582

 Score =   454 bits (1167),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 229/453 (51%), Positives = 293/453 (65%), Gaps = 24/453 (5%)
 Frame = +3

Query  402   QAAVADCMELLDLSQDKVMDSMVALGNLSARARTDAH-----SWLSSVLTNHDTCLDGLS  566
             + A+ DC+E +D + D++ +++  L     +     H     + +S+ +TN +TCLDG S
Sbjct  132   KTALHDCLETIDETLDELHEAVEDLHEYPNKKSLTQHADDLKTLMSAAMTNQETCLDGFS  191

Query  567   EPA-----RSIM---EPMIKDLISRAKsslavlvavaPSTEDDLRALNGEF---------  695
                     R ++   E  ++ + S A + +  +     + E  L++ N +          
Sbjct  192   HEGADKKIREVLIDGEKYVEKMCSNALAMIKNMTDTDIANEMMLKSSNRKLKEDESGIAW  251

Query  696   PSWVSASDRRLLEASanavaanvvvaKDGSGKYKTVAEAVASAPDNGKTRYVIYIKKGTY  875
             P W+SA DRRLL++S+      V    DGSG +KT++EAVA AP+    RY+I IK G Y
Sbjct  252   PEWLSAGDRRLLQSSSVTPNVVVAA--DGSGNFKTLSEAVAKAPEKSSKRYIIRIKAGVY  309

Query  876   KENVEIGKKKTNVMLIGDGLSATIITGSLNYVDGATTFNSATVAAVGDGFIAQDLRIQNT  1055
             +ENVE+ KKK+N+M IGDG + TIITGS N VDG+TTF+SATVA VG+ F+A+D+  QNT
Sbjct  310   RENVEVPKKKSNIMFIGDGRTKTIITGSRNVVDGSTTFHSATVAVVGEKFLARDITFQNT  369

Query  1056  AGPEKHQAVALRLGADQSVINRCKIDAYQDTLYAHSQRQFYRDCYITGTVDFIFGNAAAV  1235
             AGP KHQAVALR+G+D S    C + AYQDTLY HS RQFY +C + GTVDFIFGNAAAV
Sbjct  370   AGPSKHQAVALRVGSDLSAFYNCDMLAYQDTLYVHSNRQFYVNCLVAGTVDFIFGNAAAV  429

Query  1236  IQNSQVVARKPMAAQKNMVTAQGRTDPNQNTGTSIQNCNVSPSSDLGPVKGTIQTYLGRP  1415
              QN  + ARKP + QKNMVTAQGRTDPNQNTG  IQ C +  +SDL PV+    TYLGRP
Sbjct  430   FQNCDIHARKPNSGQKNMVTAQGRTDPNQNTGIVIQKCRIGATSDLQPVRKNFPTYLGRP  489

Query  1416  WKEYSRTVFMESNIGDHIDPAGWFPWDGDFALKTLYYGEYMNRGPGAGTSKRVNWPGYHV  1595
             WKEYSRTV M+S I D I PAGW  W G FALKTL+Y EY N G GA TS RV W GY V
Sbjct  490   WKEYSRTVVMQSTISDVIQPAGWHEWSGSFALKTLFYAEYQNTGAGASTSARVKWGGYKV  549

Query  1596  ITDKAEAMKFTVAQLIQGGSWLKNTGVDYTEGL  1694
             IT  +EA  FT  + I GGSWL +TG  +  GL
Sbjct  550   ITSASEAQAFTPGRFIAGGSWLSSTGFPFALGL  582



>ref|XP_007052106.1| Pectinesterase 2 [Theobroma cacao]
 gb|EOX96263.1| Pectinesterase 2 [Theobroma cacao]
Length=517

 Score =   451 bits (1160),  Expect = 3e-148, Method: Compositional matrix adjust.
 Identities = 247/503 (49%), Positives = 322/503 (64%), Gaps = 29/503 (6%)
 Frame = +3

Query  219   CDPAHDPPSCMAIVSEVSSAAPT--ETDGVAllqmllhssllRIQDAVKLSANVNRRIND  392
             C    +P  C   +S      P   E D + +   L      R Q    L   +  +  +
Sbjct  33    CSKTPNPQPCEYFLSNDPKNTPIKDEPDFLKISMQLALERAERAQSHTYL---LGPKCRN  89

Query  393   RKVQAAVADCMELLDLS---QDKVMDSMVALGNLSARARTDAHSWLSSVLTNHDTCLDGL  563
             ++ +AA ADC+ L +L+    +K +DS + L       + DA +WLS+ LTN +TC  G 
Sbjct  90    KREKAAWADCLNLYELTILRLNKTVDSSIKLN------KDDAQTWLSTALTNLETCRTGF  143

Query  564   SEPA-----RSIMEPMIKDLISRAKsslavlvavaPSTEDDLRALNGEFPSWVSASDRRL  728
              E         +M   + +LIS    +L       PS +D        FP+WV   DR+L
Sbjct  144   IELGVPDYILPMMSNNVSNLISNT-LALNKAPYKEPSYKDG-------FPTWVKPGDRKL  195

Query  729   LEASanavaanvvvaKDGSGKYKTVAEAVASAPD-NGKTRYVIYIKKGTYKENVEIGKKK  905
             L++S+ A  AN+VVA+DGSG YKT+ +A+++A   +G  RYVIY+K GTYKENVEI  K 
Sbjct  196   LQSSSPASRANIVVAQDGSGNYKTIKDAISAASKRSGSGRYVIYVKAGTYKENVEIRSKL  255

Query  906   TNVMLIGDGLSATIITGSLNYVDGATTFNSATVAAVGDGFIAQDLRIQNTAGPEKHQAVA  1085
              N+ML+GDG+  TIITGS +   G+TTFNSATVAAVGDGFIA+D+ I+NTAGP+ HQAV+
Sbjct  256   KNIMLVGDGIGKTIITGSKSVGQGSTTFNSATVAAVGDGFIARDITIRNTAGPQNHQAVS  315

Query  1086  LRLGADQSVINRCKIDAYQDTLYAHSQRQFYRDCYITGTVDFIFGNAAAVIQNSQVVARK  1265
             LR G+D SV  RC  + YQDTLY HS+RQFYR+C I GTVD IFGNAA V+QN  + AR+
Sbjct  316   LRSGSDLSVFYRCSFEGYQDTLYVHSERQFYRECDIYGTVDVIFGNAAVVLQNCNIYARR  375

Query  1266  PMAAQKNMVTAQGRTDPNQNTGTSIQNCNVSPSSDLGPVKGTIQTYLGRPWKEYSRTVFM  1445
             P   + N VTAQ RTDPNQNTG  I N  V+ +SDL PV+ +++TYLGRPWK+YSRTVFM
Sbjct  376   P-PNKTNTVTAQSRTDPNQNTGIIIHNSRVTAASDLKPVQSSVKTYLGRPWKQYSRTVFM  434

Query  1446  ESNIGDHIDPAGWFPWDGDFALKTLYYGEYMNRGPGAGTSKRVNWPGYHVITDKAEAMKF  1625
             ++ +   I+PAGW  WDG+FAL TLYY EYMN G G+ TS RV W GYHV+T  +EA KF
Sbjct  435   KTFLDSLINPAGWMEWDGNFALNTLYYAEYMNTGTGSSTSNRVKWRGYHVLTSASEASKF  494

Query  1626  TVAQLIQGGSWLKNTGVDYTEGL  1694
             TV+  + G SWL  TGV +T GL
Sbjct  495   TVSNFLAGNSWLPATGVPFTSGL  517



>ref|XP_008439095.1| PREDICTED: pectinesterase-like [Cucumis melo]
Length=571

 Score =   452 bits (1164),  Expect = 4e-148, Method: Compositional matrix adjust.
 Identities = 239/495 (48%), Positives = 312/495 (63%), Gaps = 10/495 (2%)
 Frame = +3

Query  219   CDPAHDPPSCMAIVSEVSSAAPTETDGVAllqmllhssllRIQDAVKLSANVNRRINDRK  398
             C     P +C    +  + + P   D     +M++  ++ R   A   +  V  +  + K
Sbjct  84    CKKTTYPETCKYFFNHGTKSPPK--DMTDFKKMVIQFAMERALSAESHTKGVGSKCRNGK  141

Query  399   VQAAVADCMELLDLSQDKVMDSMVALGNLSARARTDAHSWLSSVLTNHDTCLDGLSE-PA  575
              +AA ADC++L    Q+ ++     L + + R   D  +WLS+ LTN +TC  G +E   
Sbjct  142   EKAAWADCLKLY---QNTILQLNQTLDSSTKRTEFDIQTWLSTALTNLETCRTGFAELNV  198

Query  576   RSIMEPMI-KDLISRAKsslavlvavaPSTEDDLRALNGEFPSWVSASDRRLLEASanav  752
                + P+I  D +++  S+   +   + +  +        FPSW+S  DRRLL++++  V
Sbjct  199   LDYIWPLIMSDNVTKLISNSLAINNASAAVGNGKVTYKKGFPSWLSGGDRRLLQSASTKV  258

Query  753   aanvvvaKDGSGKYKTVAEAVASAPDNGKT-RYVIYIKKGTYKENVEIGKKKTNVMLIGD  929
                V   +DGSG Y TV  A+  A     + R+VI +K+G Y+EN+EIG K  N+MLIGD
Sbjct  259   DLVVA--QDGSGNYTTVGAALEEAAKRKTSGRFVIQVKRGVYRENLEIGSKMKNIMLIGD  316

Query  930   GLSATIITGSLNYVDGATTFNSATVAAVGDGFIAQDLRIQNTAGPEKHQAVALRLGADQS  1109
             G+  T ITG+ +   G+TTFNSATVA  G+GFIA+ +  QNTAGPE HQAVALR GAD S
Sbjct  317   GMRFTFITGNRSVGGGSTTFNSATVAVTGEGFIARGITFQNTAGPENHQAVALRSGADLS  376

Query  1110  VINRCKIDAYQDTLYAHSQRQFYRDCYITGTVDFIFGNAAAVIQNSQVVARKPMAAQKNM  1289
             V  RC  + YQDTLY HSQRQFY++CYI GTVDFIFGNAA V+QN  + ARKPM  QKN 
Sbjct  377   VFYRCAFEGYQDTLYVHSQRQFYKECYIYGTVDFIFGNAAVVLQNCMIYARKPMNGQKNA  436

Query  1290  VTAQGRTDPNQNTGTSIQNCNVSPSSDLGPVKGTIQTYLGRPWKEYSRTVFMESNIGDHI  1469
             VTAQGRTDPNQNTG SI N  V  + DL PV+ T++TYLGRPWKEYSRTVFM++ I   +
Sbjct  437   VTAQGRTDPNQNTGISIHNSRVMATDDLKPVESTVKTYLGRPWKEYSRTVFMKTYIDSLV  496

Query  1470  DPAGWFPWDGDFALKTLYYGEYMNRGPGAGTSKRVNWPGYHVITDKAEAMKFTVAQLIQG  1649
             DP GW  WDGDFAL TLYYGEY N GPG+  S+RV W GYHVI++  EA +FTV   I G
Sbjct  497   DPTGWLEWDGDFALNTLYYGEYNNIGPGSPISQRVKWKGYHVISNSTEASEFTVQNFIAG  556

Query  1650  GSWLKNTGVDYTEGL  1694
              SWL NT V +T GL
Sbjct  557   QSWLPNTEVPFTPGL  571



>ref|XP_009383893.1| PREDICTED: pectinesterase-like [Musa acuminata subsp. malaccensis]
Length=567

 Score =   452 bits (1164),  Expect = 4e-148, Method: Compositional matrix adjust.
 Identities = 237/467 (51%), Positives = 305/467 (65%), Gaps = 17/467 (4%)
 Frame = +3

Query  342   IQDAVKLSANVNRRIN--DRKVQAAVADCMELLDLSQDKVMDSMVALGNLSARARTDAHS  515
             +++A K   N   R    D + + AV DC++L   + D++  +  AL    A    D  +
Sbjct  101   VRNAAKNCTNFLHRRGYLDPRQRLAVTDCLDLFSQTLDELGAASAALAADPAAHVDDVQT  160

Query  516   WLSSVLTNHDTCLDGLS--------EPARSIMEPMIKDLISRAKsslavlvavaPSTEDD  671
              LS+ +TN  TCLDG +         PA       +  L+S +  ++   +    ++   
Sbjct  161   VLSAAITNQYTCLDGFAYVGRGGGYRPAIERRLYHVSHLVSNS-LAMVKRIRRRRASRPR  219

Query  672   LRALNGE------FPSWVSASDRRLLEASanavaanvvvaKDGSGKYKTVAEAVASAPDN  833
               AL G       FP+WVSA DR+LL+A  NA   ++ VAKDGSG + T+++AVA+AP+N
Sbjct  220   RGALEGYGEVSEGFPAWVSAKDRKLLQAPTNATIPDLEVAKDGSGNFTTISDAVAAAPNN  279

Query  834   GKTRYVIYIKKGTYKENVEIGKKKTNVMLIGDGLSATIITGSLNYVDGATTFNSATVAAV  1013
               TR+VIY+K G Y ENVE+GK KTN++LIGDG+  T++  S + VDG TTF SATVA V
Sbjct  280   TDTRFVIYVKAGAYFENVEVGKSKTNLLLIGDGIGKTVVKASRSVVDGWTTFRSATVAVV  339

Query  1014  GDGFIAQDLRIQNTAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYAHSQRQFYRDCYI  1193
             GDGF+ +D+ I+N AGP KHQAVALR+GAD S   RC    YQDTLY HS RQFYR+C +
Sbjct  340   GDGFLMRDITIENAAGPSKHQAVALRVGADLSAFYRCSFVGYQDTLYVHSLRQFYRECNV  399

Query  1194  TGTVDFIFGNAAAVIQNSQVVARKPMAAQKNMVTAQGRTDPNQNTGTSIQNCNVSPSSDL  1373
              GTVDFIFGNAA V+QN  + ARKP+  Q+N+ TAQGR DPNQNTG SIQ C V+ ++DL
Sbjct  400   YGTVDFIFGNAAVVLQNCNLYARKPLPNQQNIFTAQGREDPNQNTGISIQRCKVAAAADL  459

Query  1374  GPVKGTIQTYLGRPWKEYSRTVFMESNIGDHIDPAGWFPWDGDFALKTLYYGEYMNRGPG  1553
              PV+    TYLGRPWKEYSRTVFM+S +   I PAGW  W+G FAL TLYYGEYMNRGPG
Sbjct  460   IPVQANFSTYLGRPWKEYSRTVFMQSYLDSLISPAGWLEWNGSFALSTLYYGEYMNRGPG  519

Query  1554  AGTSKRVNWPGYHVITDKAEAMKFTVAQLIQGGSWLKNTGVDYTEGL  1694
             + TS RV WPG+ VI D AEA  FT A  +QG  WL +T V ++ GL
Sbjct  520   SNTSSRVAWPGFRVIGDAAEASNFTAAAFVQGDQWLGSTSVPFSLGL  566



>ref|XP_007201179.1| hypothetical protein PRUPE_ppa003400mg [Prunus persica]
 gb|EMJ02378.1| hypothetical protein PRUPE_ppa003400mg [Prunus persica]
Length=578

 Score =   452 bits (1164),  Expect = 6e-148, Method: Compositional matrix adjust.
 Identities = 230/448 (51%), Positives = 294/448 (66%), Gaps = 17/448 (4%)
 Frame = +3

Query  402   QAAVADCMELLD--LSQDKVMDSMVALGNLSARARTDAHSWLSSVLTNHDTCLDGLSEPA  575
             Q A+ DC+EL D  +++ K + S +++  LS+    D  + LS  +TN  TCLDG ++  
Sbjct  129   QIALDDCLELFDDTIAELKAVISDLSVEKLSSDRYYDLKTLLSGAMTNQYTCLDGFNDTG  188

Query  576   ----------RSIMEPMIKDLISRAKsslavlvavaPSTED-----DLRALNGEFPSWVS  710
                       ++I + +   L+   K   A+    + S+       +   +   FP+WVS
Sbjct  189   IVRHEIQSRLQTISQHVSNALVMLKKIPGALKYENSKSSTSSEMFPEFGPMRNGFPTWVS  248

Query  711   ASDRRLLEASanavaanvvvaKDGSGKYKTVAEAVASAPDNGKTRYVIYIKKGTYKENVE  890
             + DR+LL++  N    ++VVAKDG+G + T++EAVA AP++  TR+VIYIK G Y ENVE
Sbjct  249   SKDRKLLQSVVNGTKYDLVVAKDGTGNFTTISEAVAVAPNSSATRFVIYIKSGAYFENVE  308

Query  891   IGKKKTNVMLIGDGLSATIITGSLNYVDGATTFNSATVAAVGDGFIAQDLRIQNTAGPEK  1070
             + +KKT +M +GDG+  T++  S N VDG TTF SATVA VGDGFIAQ +  +N AGP K
Sbjct  309   VVRKKTKLMFLGDGIGKTVVKASRNVVDGWTTFRSATVAVVGDGFIAQGITFENAAGPSK  368

Query  1071  HQAVALRLGADQSVINRCKIDAYQDTLYAHSQRQFYRDCYITGTVDFIFGNAAAVIQNSQ  1250
             HQAVA R G+D S   +C    YQDTLY HS RQFYR+C I GTVDFIFGNAA V+QN  
Sbjct  369   HQAVAFRSGSDFSAFYKCSFVGYQDTLYVHSLRQFYRECDIYGTVDFIFGNAAVVLQNCN  428

Query  1251  VVARKPMAAQKNMVTAQGRTDPNQNTGTSIQNCNVSPSSDLGPVKGTIQTYLGRPWKEYS  1430
             + ARKP   QKNM TAQGR DPNQNTG SI N  V+ +SDL PVK   +TYLGRPWKEYS
Sbjct  429   LYARKPNENQKNMFTAQGREDPNQNTGISILNSKVAAASDLVPVKAMFKTYLGRPWKEYS  488

Query  1431  RTVFMESNIGDHIDPAGWFPWDGDFALKTLYYGEYMNRGPGAGTSKRVNWPGYHVITDKA  1610
             RTV+M+S I D ++PAGW  W+G FAL TLYYGEY+NRGPG+ TS RV WPGY VI   A
Sbjct  489   RTVYMKSYIDDLVEPAGWLEWNGTFALSTLYYGEYLNRGPGSNTSARVTWPGYRVINSSA  548

Query  1611  EAMKFTVAQLIQGGSWLKNTGVDYTEGL  1694
             EA +FTV   IQG  WL  T + Y  GL
Sbjct  549   EANQFTVGPFIQGNEWLNATNIPYFIGL  576



>ref|XP_011010963.1| PREDICTED: pectinesterase-like [Populus euphratica]
Length=558

 Score =   452 bits (1162),  Expect = 6e-148, Method: Compositional matrix adjust.
 Identities = 233/462 (50%), Positives = 302/462 (65%), Gaps = 21/462 (5%)
 Frame = +3

Query  363   SANVNRRINDRKV----QAAVADCMELLDLSQDKVMDSMVALGNLSARARTDAH-----S  515
             SAN N   N  K+    + A+ DC+EL D   D + +   A+ +L+ R  T  H     +
Sbjct  99    SANCNAIRNKIKLGPLEKVALKDCIELFD---DTIAELKSAISDLAPRKSTSKHYHDLQT  155

Query  516   WLSSVLTNHDTCLDGLSEPARSIMEPMIKDL--ISRAKsslavlvavaPSTEDDLRALNG  689
              LS  +TN  TCLDG +     + + + K L  IS   S+   ++   P        +  
Sbjct  156   LLSGAMTNQYTCLDGFARSKGKVRKAIKKGLYNISHHVSNSLAMLKKIPGVNTSKSEVFP  215

Query  690   E-------FPSWVSASDRRLLEASanavaanvvvaKDGSGKYKTVAEAVASAPDNGKTRY  848
             E       FPSW+S+ DR+LL+ASANA   +++VAKDG+G + T++EAV +AP++  TR+
Sbjct  216   EYGNVKHGFPSWLSSKDRKLLQASANATKFDLIVAKDGTGNFTTISEAVRAAPNSSDTRF  275

Query  849   VIYIKKGTYKENVEIGKKKTNVMLIGDGLSATIITGSLNYVDGATTFNSATVAAVGDGFI  1028
             VIYIK G Y ENVE+ +KK  ++ IGDG+  T++    + VDG TTF SATVA VGDGFI
Sbjct  276   VIYIKAGAYFENVEVERKKKMLVFIGDGIGKTVVKAKRSVVDGWTTFRSATVAVVGDGFI  335

Query  1029  AQDLRIQNTAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYAHSQRQFYRDCYITGTVD  1208
             A+ +  +N+AGP KHQAVALR G+D S   +C    YQDTLY HS RQFYR+C + GT+D
Sbjct  336   AKGITFENSAGPSKHQAVALRSGSDLSAFYQCSFVGYQDTLYVHSLRQFYRECDVYGTID  395

Query  1209  FIFGNAAAVIQNSQVVARKPMAAQKNMVTAQGRTDPNQNTGTSIQNCNVSPSSDLGPVKG  1388
             FIFGNAA V Q S + ARKP + Q+N+ TAQGR DPNQNTG SI NC V+ ++DL PVK 
Sbjct  396   FIFGNAAVVFQTSNLYARKPNSNQRNIFTAQGREDPNQNTGISILNCKVAAAADLIPVKS  455

Query  1389  TIQTYLGRPWKEYSRTVFMESNIGDHIDPAGWFPWDGDFALKTLYYGEYMNRGPGAGTSK  1568
             + QT+LGRPWKEYSRTVF+ S I D +DPAGW  W+  FAL TLYYGEYMNRGPG+ TS 
Sbjct  456   SFQTFLGRPWKEYSRTVFLRSYIDDLVDPAGWLEWNASFALSTLYYGEYMNRGPGSNTSA  515

Query  1569  RVNWPGYHVITDKAEAMKFTVAQLIQGGSWLKNTGVDYTEGL  1694
             RV WPGY VIT+  EA +FTV   IQG +WL +T + Y   L
Sbjct  516   RVTWPGYRVITNSTEASQFTVGAFIQGNTWLNSTDIPYFLNL  557



>ref|XP_011015915.1| PREDICTED: pectinesterase-like [Populus euphratica]
Length=558

 Score =   452 bits (1162),  Expect = 6e-148, Method: Compositional matrix adjust.
 Identities = 233/462 (50%), Positives = 302/462 (65%), Gaps = 21/462 (5%)
 Frame = +3

Query  363   SANVNRRINDRKV----QAAVADCMELLDLSQDKVMDSMVALGNLSARARTDAH-----S  515
             SAN N   N  K+    + A+ DC+EL D   D + +   A+ +L+ R  T  H     +
Sbjct  99    SANCNAIRNKIKLGPLEKVALKDCIELFD---DTIAELKSAISDLAPRKSTSKHYHDLQT  155

Query  516   WLSSVLTNHDTCLDGLSEPARSIMEPMIKDL--ISRAKsslavlvavaPSTEDDLRALNG  689
              LS  +TN  TCLDG +     + + + K L  IS   S+   ++   P        +  
Sbjct  156   LLSGAMTNQYTCLDGFARSKGKVRKAIKKGLYNISHHVSNSLAMLKKIPGVNTSKSEVFP  215

Query  690   E-------FPSWVSASDRRLLEASanavaanvvvaKDGSGKYKTVAEAVASAPDNGKTRY  848
             E       FPSW+S+ DR+LL+ASANA   +++VAKDG+G + T++EAV +AP++  TR+
Sbjct  216   EYGNVKHGFPSWLSSKDRKLLQASANATKFDLIVAKDGTGNFTTISEAVRAAPNSSDTRF  275

Query  849   VIYIKKGTYKENVEIGKKKTNVMLIGDGLSATIITGSLNYVDGATTFNSATVAAVGDGFI  1028
             VIYIK G Y ENVE+ +KK  ++ IGDG+  T++    + VDG TTF SATVA VGDGFI
Sbjct  276   VIYIKAGAYFENVEVERKKKMLVFIGDGIGKTVVKAKRSVVDGWTTFRSATVAVVGDGFI  335

Query  1029  AQDLRIQNTAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYAHSQRQFYRDCYITGTVD  1208
             A+ +  +N+AGP KHQAVALR G+D S   +C    YQDTLY HS RQFYR+C + GT+D
Sbjct  336   AKGITFENSAGPSKHQAVALRSGSDLSAFYQCSFVGYQDTLYVHSLRQFYRECDVYGTID  395

Query  1209  FIFGNAAAVIQNSQVVARKPMAAQKNMVTAQGRTDPNQNTGTSIQNCNVSPSSDLGPVKG  1388
             FIFGNAA V Q S + ARKP + Q+N+ TAQGR DPNQNTG SI NC V+ ++DL PVK 
Sbjct  396   FIFGNAAVVFQTSNLYARKPNSNQRNIFTAQGREDPNQNTGISILNCKVAAAADLIPVKS  455

Query  1389  TIQTYLGRPWKEYSRTVFMESNIGDHIDPAGWFPWDGDFALKTLYYGEYMNRGPGAGTSK  1568
             + QT+LGRPWKEYSRTVF+ S I D +DPAGW  W+  FAL TLYYGEYMNRGPG+ TS 
Sbjct  456   SFQTFLGRPWKEYSRTVFLRSYIDDLVDPAGWLEWNASFALSTLYYGEYMNRGPGSNTSA  515

Query  1569  RVNWPGYHVITDKAEAMKFTVAQLIQGGSWLKNTGVDYTEGL  1694
             RV WPGY VIT+  EA +FTV   IQG +WL +T + Y   L
Sbjct  516   RVTWPGYRVITNSTEASQFTVGAFIQGNTWLNSTDIPYFLNL  557



>ref|XP_006401715.1| hypothetical protein EUTSA_v10013056mg [Eutrema salsugineum]
 gb|ESQ43168.1| hypothetical protein EUTSA_v10013056mg [Eutrema salsugineum]
Length=589

 Score =   452 bits (1163),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 222/451 (49%), Positives = 294/451 (65%), Gaps = 18/451 (4%)
 Frame = +3

Query  396   KVQAAVADCMELLDLSQDKVMDSMVALGNLSARARTDAHSWLSSVLTNHDTCLDGLSEPA  575
             +V++A   C+ELLD S D +  ++ ++ + +  +R+D  +WLSS +TNHDTC DG  E  
Sbjct  137   RVRSAYDSCLELLDDSVDALSRALSSVSSSNDESRSDVMTWLSSAMTNHDTCTDGFEEIE  196

Query  576   RSIMEPMIKDLISRAKsslavlvavaPSTEDDLRALNG-----------------EFPSW  704
                   +   +I   K    ++         +++ L G                 EFP W
Sbjct  197   DGGGGGVKDQIIGAVKDLSEMVSNCLAIFSGNVKDLTGVPVVNNRRLLGEKETTEEFPIW  256

Query  705   VSASDRRLLEASanavaanvvvaKDGSGKYKTVAEAVASAPDNGKTRYVIYIKKGTYKE-  881
             +   DR LL   A A+ A++ V+KDG+G +KT+AEA+  AP++   R+VIY+K G Y+E 
Sbjct  257   LKRRDRELLGTPATAIQADITVSKDGTGTFKTIAEAIKKAPEHSSRRFVIYVKSGRYEEE  316

Query  882   NVEIGKKKTNVMLIGDGLSATIITGSLNYVDGATTFNSATVAAVGDGFIAQDLRIQNTAG  1061
             N+++G+KKTN+M IGDG   T+ITG  +  D  TTF++AT AA G GFI +D+  +N AG
Sbjct  317   NLKVGRKKTNLMFIGDGKGKTVITGGKSITDDLTTFHTATFAATGAGFIVRDMTFENYAG  376

Query  1062  PEKHQAVALRLGADQSVINRCKIDAYQDTLYAHSQRQFYRDCYITGTVDFIFGNAAAVIQ  1241
             P KHQAVALR+G D +V+ RC I  YQD LY HS RQF+R+C I GTVDFIFGNAA ++Q
Sbjct  377   PAKHQAVALRVGGDHAVVYRCNIIGYQDALYVHSNRQFFRECDIYGTVDFIFGNAAVILQ  436

Query  1242  NSQVVARKPMAAQKNMVTAQGRTDPNQNTGTSIQNCNVSPSSDLGPVKGTIQTYLGRPWK  1421
             +  + ARKPMA QK  +TAQ R DPNQNTG SI  C +  ++DL   +G+  TYLGRPWK
Sbjct  437   SCNIYARKPMAQQKITITAQNRKDPNQNTGISIHACKLLATADLEASRGSFPTYLGRPWK  496

Query  1422  EYSRTVFMESNIGDHIDPAGWFPWDGDFALKTLYYGEYMNRGPGAGTSKRVNWPGYHVIT  1601
              YSR V+M S++GDHIDP GW  W+G FAL TLYYGEYMNRG G+GT +RV WPGY VIT
Sbjct  497   LYSRVVYMMSDMGDHIDPRGWLEWNGPFALDTLYYGEYMNRGAGSGTGQRVKWPGYRVIT  556

Query  1602  DKAEAMKFTVAQLIQGGSWLKNTGVDYTEGL  1694
                EA KFTVAQ I G +WL +TGV +  GL
Sbjct  557   STVEASKFTVAQFIAGSAWLPSTGVAFFSGL  587



>ref|XP_007038413.1| Pectinesterase [Theobroma cacao]
 gb|EOY22914.1| Pectinesterase [Theobroma cacao]
Length=516

 Score =   449 bits (1156),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 234/461 (51%), Positives = 302/461 (66%), Gaps = 25/461 (5%)
 Frame = +3

Query  339   RIQDAVKLSANVNRRINDRKVQAAVADCMELLD---LSQDKVMDSMVALGNLSARARTDA  509
             R  +A   +  + ++  + K +AA ADC++L +   L  ++ +DS       +     D 
Sbjct  72    RALNAQSHNKGLGKKCRNDKEKAAWADCLKLYEETILQLNQTLDS-------TKCTDFDV  124

Query  510   HSWLSSVLTNHDTCLDGLSEPARS-----IMEPMIKDLISRAKsslavlvavaPSTEDDL  674
              +WLS+ LTN +TC  G  E   S     +M   +  LIS    +L    +  P T    
Sbjct  125   QTWLSTALTNLETCRAGFVELGVSDYILPLMSNNVSKLISNT-LALNNNASFVPQTYKH-  182

Query  675   RALNGEFPSWVSASDRRLLEASanavaanvvvaKDGSGKYKTVAEAV-ASAPDNGKTRYV  851
                   FP W+ A DR+LL++S+      V   +DGSG ++T+ EA+ A+A  +G  R+V
Sbjct  183   -----GFPRWLKAGDRKLLQSSSPTPNLVVA--QDGSGNHRTIKEALDAAAKRSGSGRFV  235

Query  852   IYIKKGTYKENVEIGKKKTNVMLIGDGLSATIITGSLNYVDGATTFNSATVAAVGDGFIA  1031
             I++K+G YKEN+EIG K  N+ML+GDGL  TIITGS +   G+TTFNSATVA  G+GFIA
Sbjct  236   IHVKRGVYKENLEIGNKLKNIMLVGDGLRYTIITGSRSVGGGSTTFNSATVAVTGEGFIA  295

Query  1032  QDLRIQNTAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYAHSQRQFYRDCYITGTVDF  1211
             + +  +NTAGP+ HQAVALR G+D SV  RC  + YQDTLY HSQRQFY++CYI GTVDF
Sbjct  296   RGITFRNTAGPQNHQAVALRSGSDLSVFYRCGFEGYQDTLYVHSQRQFYKECYIYGTVDF  355

Query  1212  IFGNAAAVIQNSQVVARKPMAAQKNMVTAQGRTDPNQNTGTSIQNCNVSPSSDLGPVKGT  1391
             IFGNAA V+QN  + AR+PM  QKN+VTAQGRTDPNQNTG SI N  V  ++DL PV  +
Sbjct  356   IFGNAAVVLQNCMIYARRPMDKQKNIVTAQGRTDPNQNTGISIHNSRVMAANDLTPVLSS  415

Query  1392  IQTYLGRPWKEYSRTVFMESNIGDHIDPAGWFPWDGDFALKTLYYGEYMNRGPGAGTSKR  1571
              +T+LGRPWKEYSRTVFM++ +   +DPAGWF WDGDFAL TLYYGEY N GP A TS+R
Sbjct  416   FKTFLGRPWKEYSRTVFMQTYLDSLVDPAGWFEWDGDFALNTLYYGEYKNIGPAAPTSRR  475

Query  1572  VNWPGYHVITDKAEAMKFTVAQLIQGGSWLKNTGVDYTEGL  1694
             V W GY VIT   EA KFTV   I G SWL +TG+ +T GL
Sbjct  476   VTWKGYRVITSATEASKFTVTNFIAGRSWLPDTGIPFTSGL  516



>gb|ACN40984.1| unknown [Picea sitchensis]
Length=601

 Score =   452 bits (1163),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 231/461 (50%), Positives = 307/461 (67%), Gaps = 25/461 (5%)
 Frame = +3

Query  384   INDRKVQAAVADCMELLDLSQDKVMDSMVALGN---LSARART-DAHSWLSSVLTNHDTC  551
             ++ RK + A+ DC+EL D + D++ +++  L N   +SA  +  D  + LS+ +TN  TC
Sbjct  141   LSHRK-RGALQDCLELFDETLDELYETVSNLKNGSCMSAPEKVNDLETLLSAAITNQYTC  199

Query  552   LD-------------GLSEPARSIMEPM--IKDLISRAKsslavlvavaPSTEDD----L  674
             LD             GL   +  +   +  +K++ +RA +     +       DD     
Sbjct  200   LDSSARSNLRQELQGGLMSISHLVSNSLAIVKNIATRASNVTVNSIHNRRLLSDDQGSEF  259

Query  675   RALNGE-FPSWVSASDRRLLEASanavaanvvvaKDGSGKYKTVAEAVASAPDNGKTRYV  851
              A+  + FPSW+SA +R LL++S + +  N VVAKDGSG + ++ +AV +AP   +TRYV
Sbjct  260   MAMESDGFPSWMSAKERSLLQSSRDNIMPNAVVAKDGSGHHTSIGDAVNAAPQKSRTRYV  319

Query  852   IYIKKGTYKENVEIGKKKTNVMLIGDGLSATIITGSLNYVDGATTFNSATVAAVGDGFIA  1031
             I+IK G Y ENVE+ KKKT++M IGDG+ AT++ G+ N  DG TT+ SATVA  G+GFIA
Sbjct  320   IHIKAGIYWENVEVNKKKTHLMFIGDGIGATVVAGNRNVKDGYTTYRSATVAVNGNGFIA  379

Query  1032  QDLRIQNTAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYAHSQRQFYRDCYITGTVDF  1211
             +D+  +NTAG  KHQAVALR+G+D S   RC    YQDTLY HS RQFYR+C + GTVDF
Sbjct  380   RDITFENTAGAAKHQAVALRVGSDFSAFYRCSFQGYQDTLYVHSLRQFYRECNVYGTVDF  439

Query  1212  IFGNAAAVIQNSQVVARKPMAAQKNMVTAQGRTDPNQNTGTSIQNCNVSPSSDLGPVKGT  1391
             IFGNAA V+QN  + ARKP+A Q+ + TAQGR DPN+NTG SIQNC V  +SDL PVK +
Sbjct  440   IFGNAAVVLQNCNLFARKPLANQQIVYTAQGRQDPNENTGISIQNCQVIAASDLIPVKRS  499

Query  1392  IQTYLGRPWKEYSRTVFMESNIGDHIDPAGWFPWDGDFALKTLYYGEYMNRGPGAGTSKR  1571
                YLGRPW++YSRTVFM+S +GD I PAGW  W+G+FAL TLYYGE+MNRGPGAG + R
Sbjct  500   FPAYLGRPWRQYSRTVFMQSYLGDLIQPAGWLEWNGNFALNTLYYGEFMNRGPGAGVANR  559

Query  1572  VNWPGYHVITDKAEAMKFTVAQLIQGGSWLKNTGVDYTEGL  1694
             V WPGY  I    EA +FTV+Q I+G SWL +TGV Y  G 
Sbjct  560   VRWPGYRAIRSSNEAKQFTVSQFIKGDSWLPSTGVKYVSGF  600



>ref|XP_004307817.2| PREDICTED: pectinesterase 2-like [Fragaria vesca subsp. vesca]
Length=518

 Score =   449 bits (1155),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 234/463 (51%), Positives = 309/463 (67%), Gaps = 28/463 (6%)
 Frame = +3

Query  342   IQDAVKLSAN---VNRRINDRKVQAAVADCMELLDLSQDKVMDSMVALGNLSARART---  503
             I++A+K  ++   + ++    K +AA +DC++L + S        ++L N +    T   
Sbjct  72    IENALKTQSHNKWLGQKCRTEKEKAAWSDCLKLYEES--------ISLLNRTVDPNTKCT  123

Query  504   --DAHSWLSSVLTNHDTCLDGLSEPARS-IMEPMIKDLISR--AKsslavlvavaPSTED  668
               D+ +WLS+ LTN +TC  G  E   S  + P++ + +S+  + +      + AP+  +
Sbjct  124   EFDSQTWLSTALTNLETCRAGFVELGVSDFVLPLMSNNVSKLISNTLSINNGSSAPAVTN  183

Query  669   DLRALNGEFPSWVSASDRRLLEASanavaanvvvaKDGSGKYKTVAEAV-ASAPDNGKTR  845
                     FPSWV    RRLL+++  A        +DGSG YKT+ EA+ A+A  +G  R
Sbjct  184   QYTE---GFPSWVKPGVRRLLQSTPAANVVVA---QDGSGNYKTIKEALDAAAKRSGSQR  237

Query  846   YVIYIKKGTYKENVEIGKKKTNVMLIGDGLSATIITGSLNYVDGATTFNSATVAAVGDGF  1025
             +VI +K G YKEN+EI  K  N+ L+GDGL +TIITGS + V G+TTFNSATVA  GDGF
Sbjct  238   FVIRVKSGVYKENLEI--KLKNIYLLGDGLRSTIITGSRSVVGGSTTFNSATVAVTGDGF  295

Query  1026  IAQDLRIQNTAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYAHSQRQFYRDCYITGTV  1205
             IA+ +  +NTAGP+ HQAVALR GAD SV  RC  + YQDTLY HSQRQFY++CYI GTV
Sbjct  296   IARGITFRNTAGPQNHQAVALRSGADLSVFYRCSFEGYQDTLYTHSQRQFYKECYIYGTV  355

Query  1206  DFIFGNAAAVIQNSQVVARKPMAAQKNMVTAQGRTDPNQNTGTSIQNCNVSPSSDLGPVK  1385
             DFIFGNAA V+QN  + ARKPM+ QKN +TAQGRTDPNQNTG SI +  +  ++DL PV 
Sbjct  356   DFIFGNAAVVLQNCMIYARKPMSGQKNTITAQGRTDPNQNTGISIHDSRIMAAADLAPVI  415

Query  1386  GTIQTYLGRPWKEYSRTVFMESNIGDHIDPAGWFPWDGDFALKTLYYGEYMNRGPGAGTS  1565
              +++T+LGRPWK YSRTVF++S +   +DPAGW  WDG+FALKTLYYGEY N+GPG+GTS
Sbjct  416   KSVKTFLGRPWKTYSRTVFLQSYLDSLVDPAGWLEWDGNFALKTLYYGEYKNKGPGSGTS  475

Query  1566  KRVNWPGYHVITDKAEAMKFTVAQLIQGGSWLKNTGVDYTEGL  1694
              RV W GY VIT  +EA KFTV  LI G SWL  TGV +T GL
Sbjct  476   GRVKWGGYRVITSSSEASKFTVGNLIAGSSWLPATGVPFTSGL  518



>gb|EYU29495.1| hypothetical protein MIMGU_mgv1a005211mg [Erythranthe guttata]
Length=493

 Score =   448 bits (1153),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 232/454 (51%), Positives = 294/454 (65%), Gaps = 25/454 (6%)
 Frame = +3

Query  402   QAAVADCMELLDLSQDKVMDSMVALGNLSARARTDA------HSWLSSVLTNHDTCLDGL  563
             + A+ DC+E++D + D++  S + L +   +  T A       + LS+  TN ++CLDG 
Sbjct  42    KGALHDCLEVIDDTLDELRYSEMELKDYGFKNYTLADHKERLMTLLSAAQTNQESCLDGF  101

Query  564   SEPA--RSIMEPMIKDLISRAKsslavlvavaPSTEDDLRALN---------------GE  692
             S     + + + ++       K    VL  +    + ++  LN               GE
Sbjct  102   SHENADKVVRKVLLAGQKHVFKLVSNVLAIIKNLADAEMARLNSSPAAAGRRLGEEGYGE  161

Query  693   FPSWVSASDRRLLEASanavaanvvvaKDGSGKYKTVAEAVASAPDNGKTRYVIYIKKGT  872
             +P W+S  DRRLL+AS       V    DGSG Y+TV+ AVA+AP+    RYVI IK G 
Sbjct  162   WPDWLSFGDRRLLQASTVKPDVTVAA--DGSGNYRTVSAAVAAAPERSSRRYVIRIKAGV  219

Query  873   YKENVEIGKKKTNVMLIGDGLSATIITGSLNYVDGATTFNSATVAAVGDGFIAQDLRIQN  1052
             Y+ENVEI K KTN+M +GDG + TIITGS N VDG+TTFNSATVA VGDGF+A+DL  QN
Sbjct  220   YRENVEIPKSKTNLMFVGDGQATTIITGSRNVVDGSTTFNSATVAVVGDGFLARDLTFQN  279

Query  1053  TAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYAHSQRQFYRDCYITGTVDFIFGNAAA  1232
             +AGP KHQAVALR+ AD S  +RC + AYQDTLY HS RQFY  CY+ GTVDFIFGNAAA
Sbjct  280   SAGPSKHQAVALRVNADLSAFHRCGMIAYQDTLYVHSLRQFYTGCYVAGTVDFIFGNAAA  339

Query  1233  VIQNSQVVARKPMAAQKNMVTAQGRTDPNQNTGTSIQNCNVSPSSDLGPVKGTIQTYLGR  1412
             V+QN  + AR+P   QKNMVTAQGR DPNQNTG  IQ C +  ++DL PV+ +  TYLGR
Sbjct  340   VLQNCDIHARRPNPGQKNMVTAQGRDDPNQNTGIVIQKCRIGATADLVPVQSSFPTYLGR  399

Query  1413  PWKEYSRTVFMESNIGDHIDPAGWFPWDGDFALKTLYYGEYMNRGPGAGTSKRVNWPGYH  1592
             PWKEYSRTV M++ I + I+PAGWF WDG+FAL TL+Y EY N G GAGT+ RV W G+ 
Sbjct  400   PWKEYSRTVVMQTQISNVINPAGWFEWDGNFALNTLFYAEYKNTGAGAGTANRVTWKGFR  459

Query  1593  VITDKAEAMKFTVAQLIQGGSWLKNTGVDYTEGL  1694
             V+   AEA  FT  + I GGSWL  TG  +T GL
Sbjct  460   VLKSDAEAQPFTAGRFISGGSWLAATGFPFTLGL  493



>gb|AFW03475.1| pectin methylesterase 1 [Gossypium barbadense]
Length=582

 Score =   451 bits (1160),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 229/453 (51%), Positives = 292/453 (64%), Gaps = 24/453 (5%)
 Frame = +3

Query  402   QAAVADCMELLDLSQDKVMDSMVALGNLSARARTDAH-----SWLSSVLTNHDTCLDGLS  566
             + A+ DC+E +D + D++ +++  L     +     H     + +S+ +TN +TCLDG S
Sbjct  132   KTALHDCLETIDETLDELHEAVEDLHEYPNKKSLTQHADDLKTLMSAAMTNQETCLDGFS  191

Query  567   EPA-----RSIM---EPMIKDLISRAKsslavlvavaPSTEDDLRALNGEF---------  695
                     R ++   E  ++ + S A + +  +     + E  L++ N +          
Sbjct  192   HEGADKKIREVLIDGEKYVEKMCSNALAMIKNMTDTDIANEMMLKSSNRKLKEDESGIAW  251

Query  696   PSWVSASDRRLLEASanavaanvvvaKDGSGKYKTVAEAVASAPDNGKTRYVIYIKKGTY  875
             P W+SA DRRLL++S+      V    DGSG +KTV+EAVA AP+    RY+I IK G Y
Sbjct  252   PEWLSAGDRRLLQSSSVTPNVVVAA--DGSGNFKTVSEAVAKAPEKSSKRYIIRIKAGVY  309

Query  876   KENVEIGKKKTNVMLIGDGLSATIITGSLNYVDGATTFNSATVAAVGDGFIAQDLRIQNT  1055
             +ENVE+ KKK+N+M IGDG + TIITGS N VDG+TTF+SATVA VG+ F+A+D+  QNT
Sbjct  310   RENVEVPKKKSNIMFIGDGRTKTIITGSRNVVDGSTTFHSATVAVVGEKFLARDITFQNT  369

Query  1056  AGPEKHQAVALRLGADQSVINRCKIDAYQDTLYAHSQRQFYRDCYITGTVDFIFGNAAAV  1235
             AGP KHQAVALR+G+D S    C + AYQDTLY HS RQFY +C + GTVDFIF NAAAV
Sbjct  370   AGPSKHQAVALRVGSDLSAFYNCDMLAYQDTLYVHSNRQFYVNCLVAGTVDFIFENAAAV  429

Query  1236  IQNSQVVARKPMAAQKNMVTAQGRTDPNQNTGTSIQNCNVSPSSDLGPVKGTIQTYLGRP  1415
              QN  + ARKP + QKNMVTAQGRTDPNQNTG  IQ C +  +SDL PV+    TYLGRP
Sbjct  430   FQNCDIHARKPNSGQKNMVTAQGRTDPNQNTGIVIQKCRIGATSDLQPVRKNFPTYLGRP  489

Query  1416  WKEYSRTVFMESNIGDHIDPAGWFPWDGDFALKTLYYGEYMNRGPGAGTSKRVNWPGYHV  1595
             WKEYSRTV M+S I D I PAGW  W G FALKTL+Y EY N G GA TS RV W GY V
Sbjct  490   WKEYSRTVVMQSTISDVIQPAGWHEWSGSFALKTLFYAEYQNTGAGASTSARVKWGGYKV  549

Query  1596  ITDKAEAMKFTVAQLIQGGSWLKNTGVDYTEGL  1694
             IT  +EA  FT  + I GGSWL +TG  +  GL
Sbjct  550   ITSASEAQAFTPGRFIAGGSWLSSTGFPFALGL  582



>ref|XP_010271283.1| PREDICTED: pectinesterase [Nelumbo nucifera]
Length=531

 Score =   449 bits (1155),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 228/448 (51%), Positives = 308/448 (69%), Gaps = 19/448 (4%)
 Frame = +3

Query  390   DRKVQAAVADCMELLDLSQDKVMDSMVALGNLSARAR-TDAHSWLSSVLTNHDTCLDGLS  566
             D K + A ADC+EL     D +      +G+     R +DA +WLS+ +TN  TC +G +
Sbjct  90    DDKAKVAWADCVELY---ADTITQLNRTMGSNKNPLRWSDAQTWLSAAITNQQTCQNGFT  146

Query  567   EP------------ARSIMEPMIKDLISRAKsslavlvavaPSTEDDLRALNGEFPSWVS  710
             E               S    MI + ++  K++ + + ++      + R L+  FP+WVS
Sbjct  147   ELNLSSYLSNSFPFMLSNFSKMISNSLAINKAAASSVASLMGKQGGNRRLLSDGFPTWVS  206

Query  711   ASDRRLLEASanavaanvvvaKDGSGKYKTVAEAVASAPDNGKTRYVIYIKKGTYKENVE  890
             A+DR+LL++S+ A  A+VVVA DGSG Y+T+++AVA++      R+VIY+K+G YKENVE
Sbjct  207   AADRKLLQSSSAASQADVVVAADGSGNYRTISQAVAASSKRSGKRFVIYVKRGVYKENVE  266

Query  891   IGKKKTNVMLIGDGLSATIITGSLNYVDGATTFNSATVAAVGDGFIAQDLRIQNTAGPEK  1070
             I  K +N+MLIGDG+ ATI+TGS N  DG+TTF SATVA   D F+A+D+  +NTAGP+K
Sbjct  267   I--KASNIMLIGDGIDATIVTGSKNVQDGSTTFRSATVAVTRDRFMARDMTFENTAGPQK  324

Query  1071  HQAVALRLGADQSVINRCKIDAYQDTLYAHSQRQFYRDCYITGTVDFIFGNAAAVIQNSQ  1250
             HQAVALR G+D SV  RC    YQDTLY +SQRQFYRDC I GTVDFIFG+A AV+QN  
Sbjct  325   HQAVALRSGSDLSVFYRCSFKGYQDTLYVYSQRQFYRDCDIYGTVDFIFGDAVAVLQNCN  384

Query  1251  VVARKPMAAQKNMVTAQGRTDPNQNTGTSIQNCNVSPSSDLGPVKGTIQTYLGRPWKEYS  1430
             +  RKPM+ Q+N +TAQGRTDPN+NTG SI N  V+ +SDL P++G+ +TYLGRPW++YS
Sbjct  385   IYVRKPMSGQRNTLTAQGRTDPNENTGISIHNSRVTAASDLRPLQGSFKTYLGRPWQKYS  444

Query  1431  RTVFMESNIGDHIDPAGWFPWDGDFALKTLYYGEYMNRGPGAGTSKRVNWPGYHVITDKA  1610
             RTVFM++++   IDP GW  W G FAL TLYYGEYMN G GA TS+RV WPG+HV++  +
Sbjct  445   RTVFMKTSLDSLIDPDGWLEWSGSFALSTLYYGEYMNTGVGASTSQRVKWPGFHVMS-AS  503

Query  1611  EAMKFTVAQLIQGGSWLKNTGVDYTEGL  1694
             +A KFTV   + G +W+  TGV +T G+
Sbjct  504   DAGKFTVGNFLGGDTWIPATGVPFTSGM  531



>ref|XP_010259035.1| PREDICTED: pectinesterase 2-like [Nelumbo nucifera]
Length=528

 Score =   449 bits (1154),  Expect = 3e-147, Method: Compositional matrix adjust.
 Identities = 229/439 (52%), Positives = 298/439 (68%), Gaps = 10/439 (2%)
 Frame = +3

Query  387   NDRKVQAAVADCMELLDLSQDKVMDSMVALGNLSARARTDAHSWLSSVLTNHDTCLDGLS  566
             N+R+ +AA ADC++L    QD V+     L         DA +WLS+ LTN  TC  G  
Sbjct  97    NERE-KAAWADCLKLY---QDTVLQLNRTLDPSIKCTDFDAQTWLSTALTNLQTCRAGFI  152

Query  567   EPARS-IMEPMIKDLISRAKsslavlvavaPSTEDDLRALNGEFPSWVSASDRRLLEASa  743
             E   S  M P++ + +S+  S+   +       ++     +G FPSWVS  DR+LL++S+
Sbjct  153   ELGVSDFMLPLMSNNVSKLISNTLAINKAISQNQN---YTDGRFPSWVSPGDRKLLQSSS  209

Query  744   navaanvvvaKDGSGKYKTVAEAV--ASAPDNGKTRYVIYIKKGTYKENVEIGKKKTNVM  917
              A  AN+VVA+DGSG ++T+  A+   S    G  R++I++K G Y+EN+EIG    N+M
Sbjct  210   PASRANMVVAQDGSGNFRTIKAALDAVSKQRKGSGRFIIHVKAGVYRENLEIGNGMKNIM  269

Query  918   LIGDGLSATIITGSLNYVDGATTFNSATVAAVGDGFIAQDLRIQNTAGPEKHQAVALRLG  1097
             L+GDG+ +TIITGS +   G TTFNSATVA  G+GFIA  +  +NTAGP+ HQAVALR G
Sbjct  270   LVGDGMRSTIITGSRSVGGGFTTFNSATVAVTGEGFIAMGITFRNTAGPQNHQAVALRSG  329

Query  1098  ADQSVINRCKIDAYQDTLYAHSQRQFYRDCYITGTVDFIFGNAAAVIQNSQVVARKPMAA  1277
             +D SV  RC  + YQDTLY HSQRQFYR+CYI GTVDFIFGNAA V+QN  ++ R+PM  
Sbjct  330   SDLSVFYRCGFEGYQDTLYVHSQRQFYRECYIYGTVDFIFGNAAVVLQNCMILPRRPMDG  389

Query  1278  QKNMVTAQGRTDPNQNTGTSIQNCNVSPSSDLGPVKGTIQTYLGRPWKEYSRTVFMESNI  1457
             Q N+VTAQGRTDPNQNTG SI NC V  SSDL PV+ + +T+LGRPWKEYSRTV++++ +
Sbjct  390   QSNVVTAQGRTDPNQNTGISIHNCRVMASSDLKPVQSSFKTFLGRPWKEYSRTVYLQTYL  449

Query  1458  GDHIDPAGWFPWDGDFALKTLYYGEYMNRGPGAGTSKRVNWPGYHVITDKAEAMKFTVAQ  1637
                +DPAGW  W G+FAL TLYYGEY N GP + T++RV W GY VIT+ +EA +FTV  
Sbjct  450   DTLVDPAGWMEWSGNFALNTLYYGEYRNFGPASSTARRVKWRGYRVITNPSEASRFTVGN  509

Query  1638  LIQGGSWLKNTGVDYTEGL  1694
              I GGSWL  TGV +  GL
Sbjct  510   FISGGSWLPATGVPFNSGL  528



>ref|XP_010049304.1| PREDICTED: pectinesterase/pectinesterase inhibitor PPE8B [Eucalyptus 
grandis]
Length=534

 Score =   449 bits (1154),  Expect = 4e-147, Method: Compositional matrix adjust.
 Identities = 231/459 (50%), Positives = 297/459 (65%), Gaps = 25/459 (5%)
 Frame = +3

Query  384   INDRKVQAAVADCMELLDLSQDKVMDSMVALGNLSARART------DAHSWLSSVLTNHD  545
               D ++  AV DC++LLD S D++  ++ A  N   +  +      D  +WLS+ L N +
Sbjct  77    FGDFRLSNAVTDCLDLLDFSSDELSWTISATQNPKGKHNSTGDLSSDLRTWLSAALANQE  136

Query  546   TCLDGLSEPARSIMEPM-------IKDLISR------AKsslavlvavaPSTEDDLRAL-  683
             TC DG  E    I++ +       I  L++R        S      A A  ++   R L 
Sbjct  137   TCRDGF-EGTSGIVKSVVSGSLNQITSLLTRLLTMVHPSSGSNSAAAAAAGSKGPGRKLF  195

Query  684   --NGEFPSWVSASDRRLLEASanavaanvvvaKDGSGKYKTVAEAVASAPDNGKTRYVIY  857
                 +FP WV   DRRLL A+  A    V   +DGS  +  V +A+A+ PD G  R+VIY
Sbjct  196   DDGPQFPRWVKTKDRRLLLANGVAADLVVA--QDGSSNFTKVEDAIAAVPDYGTRRFVIY  253

Query  858   IKKGTYKENVEIGKKKTNVMLIGDGLSATIITGSLNYVDGATTFNSATVAAVGDGFIAQD  1037
             +KKG Y+ENVEI KKK N+M+IGDG+ ATII+G+ N+VDG TTF +AT A  G GFIA+D
Sbjct  254   VKKGVYRENVEIKKKKWNIMMIGDGIDATIISGNRNFVDGWTTFRTATFAVSGRGFIARD  313

Query  1038  LRIQNTAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYAHSQRQFYRDCYITGTVDFIF  1217
             +  +NTAGPEKHQAVALR  +D SV  RC I  YQD+LY H+ RQFYR+C I+GT+DF+F
Sbjct  314   MAFENTAGPEKHQAVALRSDSDLSVYYRCAIRGYQDSLYTHTMRQFYRECRISGTIDFVF  373

Query  1218  GNAAAVIQNSQVVARKPMAAQKNMVTAQGRTDPNQNTGTSIQNCNVSPSSDLGPVKGTIQ  1397
             GNAA V QN Q++A+K +  QKN +TAQGR DPNQ TG S Q CNVS  SDL P   +  
Sbjct  374   GNAAVVFQNCQILAKKGLPQQKNTITAQGRKDPNQPTGFSFQFCNVSADSDLAPFVNSTP  433

Query  1398  TYLGRPWKEYSRTVFMESNIGDHIDPAGWFPWDGDFALKTLYYGEYMNRGPGAGTSKRVN  1577
             TYLGRPWK YSRT+FM+S + + I P GW  W+GDFAL TLYYGE+MN GPGAG + RV 
Sbjct  434   TYLGRPWKLYSRTIFMQSYMSNAIRPEGWLEWNGDFALDTLYYGEFMNSGPGAGLTGRVT  493

Query  1578  WPGYHVITDKAEAMKFTVAQLIQGGSWLKNTGVDYTEGL  1694
             WPG+HV+ + A+A  FTVAQ I+G +WL  TGV YT GL
Sbjct  494   WPGFHVLNNTAQANNFTVAQFIEGNAWLPPTGVAYTAGL  532



>gb|ABQ42392.1| pectin methylesterase-like protein [Taiwania cryptomerioides]
Length=595

 Score =   451 bits (1159),  Expect = 4e-147, Method: Compositional matrix adjust.
 Identities = 234/462 (51%), Positives = 302/462 (65%), Gaps = 28/462 (6%)
 Frame = +3

Query  390   DRKVQAAVADCMELLDLSQDKVMDSMVALGNLSA----RARTDAHSWLSSVLTNHDTCLD  557
             D + + A+ DCME+ D + D++ D++  L N +     +   D  + LS+ +TN  TCL+
Sbjct  134   DSRQRGALNDCMEMYDDTLDELHDTLSDLHNATFLSMPKHAADLETLLSAAITNQFTCLE  193

Query  558   GLSEPARSIMEPM------IKDLISRA-------KsslavlvavaPSTEDDLRALNGEF-  695
             G +     + + +      +  L+S +        +     + +A S  D  R L+  F 
Sbjct  194   GFTLCKGHLKQQVKGELHNVSHLVSNSLATVGNISARAKQALGIADSLADRRRLLSESFV  253

Query  696   -------PSWVSASDRRLLEASanavaanvvvaKDGSGKYKTVAEAVASAPDNGKTRYVI  854
                    PSW+S  DRRLL+ +   + AN VVAKDGSG Y T++ AV +AP+   TR++I
Sbjct  254   STDEEGFPSWMSVGDRRLLQVNVTNITANAVVAKDGSGHYSTISAAVDAAPEKSTTRFII  313

Query  855   YIKKGTYKENVEIGKKKTNVMLIGDGLSATIITGSLNYVDGA--TTFNSATVAAVGDGFI  1028
             Y+KKG Y+ENVEI KKK  +M IGDG   T++T S + V G+  TTF+SATVA  G GFI
Sbjct  314   YVKKGVYQENVEIHKKKHFLMFIGDGEGVTVVTASRS-VRGSNHTTFHSATVAVTGKGFI  372

Query  1029  AQDLRIQNTAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYAHSQRQFYRDCYITGTVD  1208
             A+D+  +NTAGP  HQAVALR+G+D SV  RC    YQDTLY HS RQF+RDC I GTVD
Sbjct  373   ARDMTFENTAGPSNHQAVALRVGSDFSVFYRCSFKGYQDTLYVHSLRQFFRDCDIYGTVD  432

Query  1209  FIFGNAAAVIQNSQVVARKPMAAQKNMVTAQGRTDPNQNTGTSIQNCNVSPSSDLGPVKG  1388
             FIFGNAA V QN  + ARKP+  Q+ M TAQGR DPNQNTG SI NC V+  SD+  VK 
Sbjct  433   FIFGNAAVVFQNCNLYARKPLENQQIMYTAQGRQDPNQNTGISIHNCRVTADSDMAAVKS  492

Query  1389  TIQTYLGRPWKEYSRTVFMESNIGDHIDPAGWFPWDGDFALKTLYYGEYMNRGPGAGTSK  1568
             + +TYLGRPWKEYSRTVF++S + D I PAGW  W+  FAL TLYYGEYMN GPGAGT+ 
Sbjct  493   SFKTYLGRPWKEYSRTVFLQSYLDDLIHPAGWLEWNETFALSTLYYGEYMNTGPGAGTAN  552

Query  1569  RVNWPGYHVITDKAEAMKFTVAQLIQGGSWLKNTGVDYTEGL  1694
             RVNWPGY VIT   EA +FTV Q I+G +WL +TGV+Y+ GL
Sbjct  553   RVNWPGYRVITSATEASQFTVNQFIEGDTWLPSTGVEYSSGL  594



>gb|ABJ99594.1| pectinesterase inhibitor [Lycoris aurea]
Length=580

 Score =   450 bits (1158),  Expect = 4e-147, Method: Compositional matrix adjust.
 Identities = 235/456 (52%), Positives = 298/456 (65%), Gaps = 21/456 (5%)
 Frame = +3

Query  390   DRKVQAAVADCMELLDLSQDKVMDSMVALGNLSARART--------DAHSWLSSVLTNHD  545
             D   ++A  DC+ELLD S D++  SM+ +G + ++           D  +WLS+ LTN D
Sbjct  123   DTYARSAYEDCIELLDSSIDQLSRSMLVVGPVQSQKPMGGPPSDDEDELTWLSAALTNQD  182

Query  546   TCLDGLS----EPARSIMEPMIKDLISRAKsslavlvavaPS-------TEDDLRALNG-  689
             TC DGLS    +  R  M   +KDL     +SLA+    + +        ++  R L G 
Sbjct  183   TCSDGLSGVTDDYVRQQMTGYLKDLSELVSNSLAIFAISSKNKDFSGIPIQNKKRNLLGM  242

Query  690   -EFPSWVSASDRRLLEASanavaanvvvaKDGSGKYKTVAEAVASAPDNGKTRYVIYIKK  866
               FP+WV  SDRRLL+  A  V A++VV+KDG+G Y T+A+A+  AP+    R +IY+K 
Sbjct  243   ENFPNWVEKSDRRLLQVPATGVQADIVVSKDGNGTYTTIADAIKHAPEGSSRRIIIYVKA  302

Query  867   GTYKENVEIGKKKTNVMLIGDGLSATIITGSLNYVDGATTFNSATVAAVGDGFIAQDLRI  1046
             G Y+EN+++G+KK N+M IGDG   T+I GS +  D  TTF++AT AA G GFI +D+ I
Sbjct  303   GRYEENIKVGRKKINLMFIGDGKGKTVIAGSRSVFDSYTTFHTATFAATGAGFIMRDMTI  362

Query  1047  QNTAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYAHSQRQFYRDCYITGTVDFIFGNA  1226
             +N AGP+KHQAVALR+GAD+SV+ RC I  YQDTLY HSQRQF+R+C + GTVDFIFGNA
Sbjct  363   ENWAGPQKHQAVALRVGADRSVVYRCDIIGYQDTLYVHSQRQFFRECDVYGTVDFIFGNA  422

Query  1227  AAVIQNSQVVARKPMAAQKNMVTAQGRTDPNQNTGTSIQNCNVSPSSDLGPVKGTIQTYL  1406
             A V QN  + ARKPM  QKN +TAQ R DPNQNTG SI  CN+  + +L   K    TYL
Sbjct  423   AVVFQNCSLWARKPMMMQKNTITAQNRKDPNQNTGISIHACNILATPELEAAKWAYPTYL  482

Query  1407  GRPWKEYSRTVFMESNIGDHIDPAGWFPWDGDFALKTLYYGEYMNRGPGAGTSKRVNWPG  1586
             GRPWK YSR V++ S +GDHI P GW  W+  FAL TLYYGEYMN GPGA   KRV WPG
Sbjct  483   GRPWKLYSRVVYLMSYMGDHIHPLGWLEWNAAFALDTLYYGEYMNYGPGAAVGKRVTWPG  542

Query  1587  YHVITDKAEAMKFTVAQLIQGGSWLKNTGVDYTEGL  1694
             Y VIT   EA KFTV Q I G SWL +TGV +  GL
Sbjct  543   YRVITMPEEASKFTVGQFIYGSSWLPSTGVAFLAGL  578



>ref|XP_009763675.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 34 
[Nicotiana sylvestris]
Length=602

 Score =   451 bits (1159),  Expect = 5e-147, Method: Compositional matrix adjust.
 Identities = 237/531 (45%), Positives = 325/531 (61%), Gaps = 31/531 (6%)
 Frame = +3

Query  189   SSPSLWKARVCDPAHDPPSCMAIVSEVSSAAPTETDGVAllqmllhssllRIQDAVKLSA  368
             S P++  +R C        C++ + E   A     D +  + + L     R   A+ +++
Sbjct  72    SKPTVAMSRTCSRTRFTTLCLSSLHEFPGALSASDDDLVHISVNLTLQ--RFGKALYMAS  129

Query  369   NVNRRINDRKVQAAVADCMELLDLSQDKVMDSMVALGNLSARART-DAHSWLSSVLTNHD  545
             +++    D ++++A  DC+ELL+ S D +  S+ ++ + + ++   D  +WLS+ LTN D
Sbjct  130   DISNLYMDTRIRSAYEDCLELLEESIDLLARSLTSVSHGAGKSNNHDVLTWLSAALTNQD  189

Query  546   TCLDGLSEPARSIMEPMIKDLISRAKsslavlvavaPSTEDD----------LRALNGE-  692
             TC +G ++   ++ + M + L + ++     L   A    DD           R L G  
Sbjct  190   TCTEGFADVNGNVKDQMTEKLRNLSELVSNCLAIFAAMNGDDDFSGVPIQNRRRRLMGST  249

Query  693   ----------------FPSWVSASDRRLLEASanavaanvvvaKDGSGKYKTVAEAVASA  824
                             FP W++  +R LL+   +A+ A+++V+KDG+G +KT+A+A+   
Sbjct  250   DDAGTVVSAKDEDFAPFPKWLNRKERMLLDTPVSAIQADIIVSKDGNGTFKTIADAIKKV  309

Query  825   PDNGKTRYVIYIKKGTYKE-NVEIGKKKTNVMLIGDGLSATIITGSLNYVDGATTFNSAT  1001
             P     R +IY+K G Y+E N++IG+KKTNVM IGDG   T+ITG  +     TTF++A+
Sbjct  310   PQYSNRRIIIYVKAGRYEEDNLKIGRKKTNVMFIGDGKGKTVITGGKSVSQNLTTFHTAS  369

Query  1002  VAAVGDGFIAQDLRIQNTAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYAHSQRQFYR  1181
              AA G GFI +D+  +N AGP KHQAVALR+GAD +V+ RC I  YQDTLY HSQRQFYR
Sbjct  370   FAATGAGFIVRDITFENYAGPSKHQAVALRIGADHAVVYRCNIIGYQDTLYVHSQRQFYR  429

Query  1182  DCYITGTVDFIFGNAAAVIQNSQVVARKPMAAQKNMVTAQGRTDPNQNTGTSIQNCNVSP  1361
             +C I GTVDFIFGNAA V+QN  + ARKPM  QKN +TAQ R DPNQNTG SI  C ++ 
Sbjct  430   ECDIYGTVDFIFGNAAVVLQNCSIYARKPMDFQKNTITAQNRKDPNQNTGISIHACKIAA  489

Query  1362  SSDLGPVKGTIQTYLGRPWKEYSRTVFMESNIGDHIDPAGWFPWDGDFALKTLYYGEYMN  1541
             +SDL   KG+  TYLGRPWK YSRTV M SN+GDHI P GW  W+  FAL+TLYYGEYMN
Sbjct  490   ASDLEASKGSFPTYLGRPWKLYSRTVVMLSNLGDHIHPRGWLEWNATFALETLYYGEYMN  549

Query  1542  RGPGAGTSKRVNWPGYHVITDKAEAMKFTVAQLIQGGSWLKNTGVDYTEGL  1694
              GPGA   +RV WPGY VIT   EA KFTVAQ I G SWL +TGV +  GL
Sbjct  550   YGPGAAVGQRVTWPGYRVITSVEEASKFTVAQFIFGSSWLPSTGVAFLAGL  600



>gb|ABJ99595.1| pectinesterase inhibitor [Lycoris aurea]
Length=580

 Score =   450 bits (1157),  Expect = 5e-147, Method: Compositional matrix adjust.
 Identities = 251/530 (47%), Positives = 325/530 (61%), Gaps = 27/530 (5%)
 Frame = +3

Query  174   LRTSSSSPSLWKARVCDPAHDPPSCMAIVSEVSSA-APTETDGVAllqmllhssllR-IQ  347
             ++ +   P+   +R C  A  P  C++ + E   A +  E D V +   +      R + 
Sbjct  53    IQATRPRPTQAISRTCGLARYPDLCVSSLVEFPGALSAGERDLVHISLNMTLQHFSRALY  112

Query  348   DAVKLSANVNRRINDRKVQAAVADCMELLDLSQDKVMDSMVALGNL-SARAR-------T  503
             DA  ++        D   ++A  DC+ELLD S D++  SM+ +G + S + R        
Sbjct  113   DASAIAGVAM----DAYARSAYEDCIELLDSSIDQLSRSMLVVGPVQSQKPRGGPPFDDE  168

Query  504   DAHSWLSSVLTNHDTCLDGLS----EPARSIMEPMIKDLISRAKsslavlvavaPS----  659
             D  +WLS+ LTN DTC DGLS    +  R  M   +KDL     +SLA+    + +    
Sbjct  169   DVLTWLSAALTNQDTCSDGLSGVTDDYVRQQMTGYLKDLSELVSNSLAIFAISSKNKDFS  228

Query  660   ---TEDDLRALNG--EFPSWVSASDRRLLEASanavaanvvvaKDGSGKYKTVAEAVASA  824
                 ++  R L G   FP+WV  SDRRLL+  A  V A++VV+KDG+G Y T+A+A+  A
Sbjct  229   GIPIQNKKRKLLGMENFPNWVKKSDRRLLQVPATGVQADIVVSKDGNGTYTTIADAIKHA  288

Query  825   PDNGKTRYVIYIKKGTYKENVEIGKKKTNVMLIGDGLSATIITGSLNYVDGATTFNSATV  1004
             P+    R +IY+K G Y+EN+++G+KK N+M IGDG   T+I GS +  D  TTF++AT 
Sbjct  289   PEGSSRRIIIYVKAGRYEENIKVGRKKINLMFIGDGKEKTVIAGSRSVFDSYTTFHTATF  348

Query  1005  AAVGDGFIAQDLRIQNTAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYAHSQRQFYRD  1184
             AA G GFI +D+ I+N AGP+KHQAVALR+GAD+SV+ RC I  YQDTLY HSQRQF+R+
Sbjct  349   AATGAGFIMRDMTIENWAGPQKHQAVALRVGADRSVVYRCNIIGYQDTLYVHSQRQFFRE  408

Query  1185  CYITGTVDFIFGNAAAVIQNSQVVARKPMAAQKNMVTAQGRTDPNQNTGTSIQNCNVSPS  1364
             C + GTVDFIFGNAA V QN  + ARKPM  QKN +TAQ R DPNQNTG SI  C +  +
Sbjct  409   CDVYGTVDFIFGNAAVVFQNCSLWARKPMTMQKNTITAQNRKDPNQNTGISIHACKILAT  468

Query  1365  SDLGPVKGTIQTYLGRPWKEYSRTVFMESNIGDHIDPAGWFPWDGDFALKTLYYGEYMNR  1544
              DL   K    TYLGRPWK YSR V+M S +GDHI P GW  W+  FAL TLYYGEYMN 
Sbjct  469   PDLEAAKWAYPTYLGRPWKLYSRVVYMMSYMGDHIHPLGWLEWNAAFALDTLYYGEYMNY  528

Query  1545  GPGAGTSKRVNWPGYHVITDKAEAMKFTVAQLIQGGSWLKNTGVDYTEGL  1694
             GPGA   KRV W GY VIT   EA KFTV Q I G SWL +TGV +  GL
Sbjct  529   GPGAAVGKRVTWQGYRVITMPEEASKFTVGQFIYGSSWLPSTGVAFLAGL  578



>ref|NP_001274969.1| pectin methyl esterase [Solanum tuberosum]
 gb|AAF23892.1|AF152172_1 pectin methyl esterase [Solanum tuberosum]
Length=576

 Score =   450 bits (1157),  Expect = 6e-147, Method: Compositional matrix adjust.
 Identities = 248/527 (47%), Positives = 327/527 (62%), Gaps = 28/527 (5%)
 Frame = +3

Query  183   SSSSPSLWKARVCDPAHDPPSCMAI---VSEVSSAAPTETDGVAllqmllhssllRIQDA  353
             SSS+ ++ K+   +  H P  C +    V++ S    ++ D + L   +   ++ R   A
Sbjct  55    SSSAHAIVKSACSNTLH-PELCYSAIVNVTDFSKKVTSQKDVIELSLNITVKAVRRNYYA  113

Query  354   VKLSANVNRRINDRKVQAAVADCMELLDLSQDKVMDSMVAL------GNLSARARTDAHS  515
             VK      + +  R+ + A+ DC+E +D + D++  ++  L       +L   A  D  +
Sbjct  114   VKELIKTRKGLTPRE-KVALHDCLETMDETLDELHTAVADLELYPNKKSLKEHAE-DLKT  171

Query  516   WLSSVLTNHDTCLDGLS--EPARSIMEPMIKDLISRAKsslavlvavaPSTEDDL-----  674
              +SS +TN +TCLDG S  E  + + + ++K      K     L  +   T  D+     
Sbjct  172   LISSAITNQETCLDGFSHDEADKKVRKVLLKGQKHVEKMCSNALAMICNMTNTDIANEMK  231

Query  675   ----RAL---NGEFPSWVSASDRRLLEASanavaanvvvaKDGSGKYKTVAEAVASAPDN  833
                 R L   NGE+P W+SA DRRLL++S       V    DGSG YKTV+EAVA AP+ 
Sbjct  232   LSGSRKLVEDNGEWPEWLSAGDRRLLQSSTVTPDVVVAA--DGSGDYKTVSEAVAKAPEK  289

Query  834   GKTRYVIYIKKGTYKENVEIGKKKTNVMLIGDGLSATIITGSLNYVDGATTFNSATVAAV  1013
                RYVI IK G Y+ENV++ KKKTN+M +GDG S TIIT S N  DG+TTF+SATVAAV
Sbjct  290   SSKRYVIRIKAGVYRENVDVPKKKTNIMFMGDGRSNTIITASRNVQDGSTTFHSATVAAV  349

Query  1014  GDGFIAQDLRIQNTAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYAHSQRQFYRDCYI  1193
             G+ F+A+D+  QNTAG  KHQAVALR+G+D S   +C I AYQDTLY HS RQF+  C +
Sbjct  350   GEKFLARDITFQNTAGASKHQAVALRVGSDLSAFYKCDILAYQDTLYVHSNRQFFVQCLV  409

Query  1194  TGTVDFIFGNAAAVIQNSQVVARKPMAAQKNMVTAQGRTDPNQNTGTSIQNCNVSPSSDL  1373
              GTVDFIFGN AAV+Q+  + AR+P + QKNMVTAQGRTDPNQNTG  IQ C +  +SDL
Sbjct  410   AGTVDFIFGNGAAVLQDCDIHARRPGSGQKNMVTAQGRTDPNQNTGIVIQKCRIGATSDL  469

Query  1374  GPVKGTIQTYLGRPWKEYSRTVFMESNIGDHIDPAGWFPWDGDFALKTLYYGEYMNRGPG  1553
              PV+ +  TYLGRPWKEYSRTV M+S+I D I PAGW  W+G+FAL TL+YGEY N G G
Sbjct  470   RPVQKSFPTYLGRPWKEYSRTVIMQSSITDVIQPAGWHEWNGNFALNTLFYGEYANTGAG  529

Query  1554  AGTSKRVNWPGYHVITDKAEAMKFTVAQLIQGGSWLKNTGVDYTEGL  1694
             A TS RV W G+ VIT   EA  +T    I GGSWL +TG  ++ GL
Sbjct  530   AATSGRVKWKGHKVITSSTEAQAYTPGSFIAGGSWLSSTGFPFSLGL  576



>gb|AFW03480.1| pectin methylesterase 1 [Gossypium hirsutum]
Length=582

 Score =   450 bits (1157),  Expect = 6e-147, Method: Compositional matrix adjust.
 Identities = 228/453 (50%), Positives = 292/453 (64%), Gaps = 24/453 (5%)
 Frame = +3

Query  402   QAAVADCMELLDLSQDKVMDSMVALGNLSARARTDAH-----SWLSSVLTNHDTCLDGLS  566
             + A+ DC+E +D + D++ +++  L     +     H     + +S+ +TN +TCLDG S
Sbjct  132   KTALHDCLETIDETLDELHEAVEDLHEYPNKKSLTQHADDLKTLMSAAMTNQETCLDGFS  191

Query  567   EPA-----RSIM---EPMIKDLISRAKsslavlvavaPSTEDDLRALNGEF---------  695
                     R ++   E  ++ + S A + +  +     + E  L++ N +          
Sbjct  192   HEGADKKIREVLIDGEKYVEKMCSNALAMIKNMTDTDIANEMMLKSSNRKLKEDESGIAW  251

Query  696   PSWVSASDRRLLEASanavaanvvvaKDGSGKYKTVAEAVASAPDNGKTRYVIYIKKGTY  875
             P W+SA DRRLL++S+      V    DGSG +KTV+EAVA AP+    RY I IK G Y
Sbjct  252   PEWLSAGDRRLLQSSSVTPNVVVAA--DGSGNFKTVSEAVAKAPEKSSKRYTIRIKAGVY  309

Query  876   KENVEIGKKKTNVMLIGDGLSATIITGSLNYVDGATTFNSATVAAVGDGFIAQDLRIQNT  1055
             +ENVE+ KKK+++M IGDG + TIITGS N VDG+TTF+SATVA VG+ F+A+++  QNT
Sbjct  310   RENVEVPKKKSSIMFIGDGRTKTIITGSRNVVDGSTTFHSATVAVVGEKFLAREITFQNT  369

Query  1056  AGPEKHQAVALRLGADQSVINRCKIDAYQDTLYAHSQRQFYRDCYITGTVDFIFGNAAAV  1235
             AGP KHQAVALR+G+D S    C + AYQDTLY HS RQFY +C + GTVDFIFGNAAAV
Sbjct  370   AGPSKHQAVALRVGSDLSAFYNCDMLAYQDTLYVHSNRQFYVNCLVAGTVDFIFGNAAAV  429

Query  1236  IQNSQVVARKPMAAQKNMVTAQGRTDPNQNTGTSIQNCNVSPSSDLGPVKGTIQTYLGRP  1415
              QN  + ARKP + QKNMVTAQGRTDPNQNTG  IQ C +  +SDL PV+    TYLGRP
Sbjct  430   FQNCDIHARKPNSGQKNMVTAQGRTDPNQNTGIVIQKCRIGATSDLQPVRKNFPTYLGRP  489

Query  1416  WKEYSRTVFMESNIGDHIDPAGWFPWDGDFALKTLYYGEYMNRGPGAGTSKRVNWPGYHV  1595
             WKEYSRTV M+S I D I PAGW  W G FALKTL+Y EY N G GA TS RV W GY V
Sbjct  490   WKEYSRTVVMQSTISDVIQPAGWHEWSGSFALKTLFYAEYQNTGAGASTSARVKWGGYKV  549

Query  1596  ITDKAEAMKFTVAQLIQGGSWLKNTGVDYTEGL  1694
             IT  +EA  FT  + I GGSWL +TG  +  GL
Sbjct  550   ITSASEAQAFTPGRFIAGGSWLSSTGFPFALGL  582



>emb|CDY49170.1| BnaA02g10290D [Brassica napus]
Length=454

 Score =   445 bits (1145),  Expect = 7e-147, Method: Compositional matrix adjust.
 Identities = 224/449 (50%), Positives = 296/449 (66%), Gaps = 16/449 (4%)
 Frame = +3

Query  396   KVQAAVADCMELLDLSQD---KVMDSMVALGNLSARARTDAHSWLSSVLTNHDTCLDGLS  566
             +V++A   C+ELLD S D   + + S+V   + +  + +D  +WLSS +TNHDTC DG  
Sbjct  4     RVRSAYDSCLELLDDSVDALSRALSSVVISSSGNDESHSDVMTWLSSAMTNHDTCTDGFE  63

Query  567   EPARSIMEPMIKDLISRAKsslavlvavaPSTEDDL-------RALNG-----EFPSWVS  710
                   ++  +   +      ++  +A+     +D+       R L G     EFPSW+ 
Sbjct  64    GVGNGEVKDQVVGAVKGLSEMVSNCLALFSGNVNDVNGVPVANRKLLGVEETEEFPSWLK  123

Query  711   ASDRRLLEASanavaanvvvaKDGSGKYKTVAEAVASAPDNGKTRYVIYIKKGTYKE-NV  887
               DR LL   A A+ A++ V+KDG+G  KT+AEA+  AP+    R+VIY+K G+Y+E N+
Sbjct  124   RGDRELLGTPATAIQADITVSKDGNGTVKTIAEAIKKAPEQSSRRFVIYVKSGSYEEDNL  183

Query  888   EIGKKKTNVMLIGDGLSATIITGSLNYVDGATTFNSATVAAVGDGFIAQDLRIQNTAGPE  1067
             ++G+KKTN+M IGDG   T+ITG  +  D  TTF++AT AA G GFI +D+  +N AGP 
Sbjct  184   KVGRKKTNLMFIGDGKGKTVITGGKSIADDLTTFHTATFAATGAGFIVKDITFENYAGPS  243

Query  1068  KHQAVALRLGADQSVINRCKIDAYQDTLYAHSQRQFYRDCYITGTVDFIFGNAAAVIQNS  1247
             KHQAVALR+G D +V+ RC I  YQDTLY HS RQF+R+C I GTVDFIFGNAA ++Q+ 
Sbjct  244   KHQAVALRVGGDHAVVYRCNIIGYQDTLYVHSNRQFFRECDIYGTVDFIFGNAAVILQSC  303

Query  1248  QVVARKPMAAQKNMVTAQGRTDPNQNTGTSIQNCNVSPSSDLGPVKGTIQTYLGRPWKEY  1427
              + ARKPM  QK  +TAQ R DPNQNTG SI  C +  ++DL   KG+  TYLGRPWK Y
Sbjct  304   NIYARKPMPQQKITITAQNRKDPNQNTGISIHACKLLATADLEASKGSFPTYLGRPWKLY  363

Query  1428  SRTVFMESNIGDHIDPAGWFPWDGDFALKTLYYGEYMNRGPGAGTSKRVNWPGYHVITDK  1607
             +R V+M S++GDHI+P GW  W+G FAL TLYYGEYMNRG GAG  +RV WPGYHVIT  
Sbjct  364   ARVVYMMSDMGDHINPRGWLEWNGPFALDTLYYGEYMNRGVGAGIGQRVKWPGYHVITST  423

Query  1608  AEAMKFTVAQLIQGGSWLKNTGVDYTEGL  1694
              EA KFTVAQ I G +WL +TGV +  GL
Sbjct  424   VEASKFTVAQFISGSTWLPSTGVAFFSGL  452



>gb|KEH24404.1| pectinesterase/pectinesterase inhibitor [Medicago truncatula]
Length=557

 Score =   449 bits (1155),  Expect = 7e-147, Method: Compositional matrix adjust.
 Identities = 224/442 (51%), Positives = 293/442 (66%), Gaps = 15/442 (3%)
 Frame = +3

Query  402   QAAVADCMELLDLSQDKVMDSMVALGN----LSARARTDAHSWLSSVLTNHDTCLDGLS-  566
             Q A+ DC+ L D + D++  ++  L      +++ ++ D  + LS  +TN  TCLDG + 
Sbjct  111   QRALEDCVNLFDTTIDELKTTISDLSQTQTTVASSSKRDCQTLLSGAMTNVYTCLDGFAY  170

Query  567   --EPARSIMEPMIKDLISRA--------KsslavlvavaPSTEDDLRALNGEFPSWVSAS  716
                  R  +E  + D+ S          K       A    T  +   +   FPSWVS  
Sbjct  171   SKSKLRKKIEAKLNDISSHVSNSLAMLKKVPGVKTKASESETFPEYGKVKDGFPSWVSPK  230

Query  717   DRRLLEASanavaanvvvaKDGSGKYKTVAEAVASAPDNGKTRYVIYIKKGTYKENVEIG  896
             DR+LL+A+ N    ++VVAKDG+G + T+ EA+A+AP++  TR+VI+IK G Y ENVE+ 
Sbjct  231   DRKLLQAAVNQTKFDLVVAKDGTGNFATIGEAIAAAPNSSATRFVIHIKAGAYFENVEVI  290

Query  897   KKKTNVMLIGDGLSATIITGSLNYVDGATTFNSATVAAVGDGFIAQDLRIQNTAGPEKHQ  1076
             KKKTN+ML+GDG+  T++  S N VDG TTF S+T A VGD FIA+ +  +N+AGP KHQ
Sbjct  291   KKKTNLMLVGDGIGQTVVKASRNVVDGWTTFQSSTFAVVGDKFIAKGITFENSAGPSKHQ  350

Query  1077  AVALRLGADQSVINRCKIDAYQDTLYAHSQRQFYRDCYITGTVDFIFGNAAAVIQNSQVV  1256
             AVA+R GAD S   +C   AYQDTLY HS RQFYR+C + GTVDFIFGNAA V QN  + 
Sbjct  351   AVAVRNGADFSAFYQCSFVAYQDTLYVHSLRQFYRECDVYGTVDFIFGNAAVVFQNCNLY  410

Query  1257  ARKPMAAQKNMVTAQGRTDPNQNTGTSIQNCNVSPSSDLGPVKGTIQTYLGRPWKEYSRT  1436
             ARKP   QKN+ TAQGR DPNQNTG SI NC ++ ++DL PV+ T ++YLGRPWK+YSRT
Sbjct  411   ARKPDPKQKNLFTAQGREDPNQNTGISILNCKIAAAADLIPVQSTFKSYLGRPWKKYSRT  470

Query  1437  VFMESNIGDHIDPAGWFPWDGDFALKTLYYGEYMNRGPGAGTSKRVNWPGYHVITDKAEA  1616
             V++ S I + IDPAGW  W+G FAL TL+YGEY NRGPG+ TS RV WPGY VIT+  EA
Sbjct  471   VYLNSFIDNLIDPAGWLEWNGTFALDTLFYGEYKNRGPGSNTSARVTWPGYKVITNATEA  530

Query  1617  MKFTVAQLIQGGSWLKNTGVDY  1682
              +FTV Q IQG  WL +TGV +
Sbjct  531   SQFTVRQFIQGNEWLNSTGVPF  552



>ref|XP_002510940.1| Pectinesterase-2 precursor, putative [Ricinus communis]
 gb|EEF51542.1| Pectinesterase-2 precursor, putative [Ricinus communis]
Length=455

 Score =   445 bits (1145),  Expect = 7e-147, Method: Compositional matrix adjust.
 Identities = 229/444 (52%), Positives = 292/444 (66%), Gaps = 17/444 (4%)
 Frame = +3

Query  381   RINDRKVQAAVADCMELLDLSQDKVMDSMVALGNLSARARTDAHSWLSSVLTNHDTCLDG  560
             +  + K +AA ADC++L    +D ++     L   +     DA +WLS+ LTN +TC  G
Sbjct  23    KCRNEKEKAAWADCLKLY---EDTIIQLNHTLDPNTKCTDYDAQTWLSTALTNLETCRAG  79

Query  561   LSEPARS-IMEPMIKD----LISRAKsslavlvavaPSTEDDLRALNGEFPSWVSASDRR  725
               E   S  M P++ +    LI    +      + +P T  D       FPSWV   DR+
Sbjct  80    FVELGVSDFMLPLMSNNVSKLIGNTLAINNGSSSASPQTYKD------GFPSWVKPGDRK  133

Query  726   LLEASanavaanvvvaKDGSGKYKTVAEAV-ASAPDNGKTRYVIYIKKGTYKENVEIGKK  902
             LL+ S++     V   +DGSG Y+T+ +A+ A+A  +GK R+VI IK G Y+EN+EIG K
Sbjct  134   LLQTSSSTPNLVVA--QDGSGNYRTIKQALDAAAKRSGKGRFVIRIKSGIYRENLEIGNK  191

Query  903   KTNVMLIGDGLSATIITGSLNYVDGATTFNSATVAAVGDGFIAQDLRIQNTAGPEKHQAV  1082
               N+ML+GDGL  TIITGS +   G+TTFNSATVA  G+GFIA  +  +NTAGP+ HQAV
Sbjct  192   MKNIMLVGDGLRNTIITGSRSVGGGSTTFNSATVAVTGEGFIASGITFRNTAGPQNHQAV  251

Query  1083  ALRLGADQSVINRCKIDAYQDTLYAHSQRQFYRDCYITGTVDFIFGNAAAVIQNSQVVAR  1262
             ALR G+D SV  RC  + YQDTLY HSQRQFY++CYI GTVDFIFGNAA V+QN  + AR
Sbjct  252   ALRSGSDLSVFYRCGFEGYQDTLYIHSQRQFYKECYIYGTVDFIFGNAAVVLQNCMIYAR  311

Query  1263  KPMAAQKNMVTAQGRTDPNQNTGTSIQNCNVSPSSDLGPVKGTIQTYLGRPWKEYSRTVF  1442
             +PM  QKN +TAQGRTDPNQNTG SI N  V  +SDL PV  + +T+LGRPWK+YSRTVF
Sbjct  312   RPMDKQKNTITAQGRTDPNQNTGISIHNSRVMAASDLKPVLSSFKTFLGRPWKQYSRTVF  371

Query  1443  MESNIGDHIDPAGWFPWDGDFALKTLYYGEYMNRGPGAGTSKRVNWPGYHVITDKAEAMK  1622
             +++ +   +DPAGW  WDG+FAL TLYYGEY N GP + TS RV W GY VIT   EA +
Sbjct  372   LQTYLDSLVDPAGWLEWDGNFALNTLYYGEYKNMGPASSTSGRVKWRGYRVITSATEASQ  431

Query  1623  FTVAQLIQGGSWLKNTGVDYTEGL  1694
             FTVA  I G SWL  TGV ++ GL
Sbjct  432   FTVANFIAGRSWLPATGVPFSSGL  455



>ref|XP_002278061.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 34 
[Vitis vinifera]
Length=597

 Score =   450 bits (1157),  Expect = 9e-147, Method: Compositional matrix adjust.
 Identities = 233/478 (49%), Positives = 305/478 (64%), Gaps = 26/478 (5%)
 Frame = +3

Query  339   RIQDAVKLSANVNRRINDRKVQAAVADCMELLDLSQDKVMDSMVAL---GNLSARART-D  506
             R   A+ +S+ +     D +V+AA  DC+ELL+ S +++  S+ ++   G+  A   T D
Sbjct  118   RFGKALYVSSEIANLQMDTRVRAAYEDCLELLEESVEQLSRSLTSVAGGGDGQAVGSTQD  177

Query  507   AHSWLSSVLTNHDTCLDGLSEPARSIMEPMIK------DLISR-----AKsslavlvava  653
               +WLS+ +TN DTC +G  + +  + + M++      DL+S      A S      A  
Sbjct  178   VLTWLSAAMTNQDTCTEGFDDVSGFVKDQMVEKLRDLSDLVSNCLAIFAASGGDNDFAGV  237

Query  654   PSTEDDLRALNGE----------FPSWVSASDRRLLEASanavaanvvvaKDGSGKYKTV  803
             P      R +             FP W++  +R LL+    A+ A+++V++DG+G YKT+
Sbjct  238   PIQNRRRRLMQDSDISANQDSTGFPKWLTRRERSLLQMPVPAIQADIIVSQDGNGTYKTI  297

Query  804   AEAVASAPDNGKTRYVIYIKKGTYKEN-VEIGKKKTNVMLIGDGLSATIITGSLNYVDGA  980
              EA+  AP+    R +IY+K G Y+EN +++G+KKTN+M IGDG   TIITG  +  +  
Sbjct  298   TEAIKKAPEYSSRRTIIYVKAGRYEENNLKVGRKKTNLMFIGDGKGKTIITGGKSVFNNL  357

Query  981   TTFNSATVAAVGDGFIAQDLRIQNTAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYAH  1160
             TTF++A+ AA G GFIA+D+  +N AGP KHQAVALR+GAD  V+ RC I  YQDTLY H
Sbjct  358   TTFHTASFAATGAGFIARDMTFENWAGPGKHQAVALRVGADHGVVYRCNIIGYQDTLYVH  417

Query  1161  SQRQFYRDCYITGTVDFIFGNAAAVIQNSQVVARKPMAAQKNMVTAQGRTDPNQNTGTSI  1340
             SQRQF+R+C I GTVDFIFGNAA V QN  + ARKPMA QKN +TAQ R DPNQNTG SI
Sbjct  418   SQRQFFRECDIYGTVDFIFGNAAVVFQNCSLYARKPMAQQKNTITAQNRKDPNQNTGISI  477

Query  1341  QNCNVSPSSDLGPVKGTIQTYLGRPWKEYSRTVFMESNIGDHIDPAGWFPWDGDFALKTL  1520
               C + P+ DL PVKG+  TYLGRPWK YSRTV+M S +GDHI P GW  W+  FAL TL
Sbjct  478   HACRILPAGDLAPVKGSFPTYLGRPWKLYSRTVYMLSYMGDHIHPKGWLEWNTTFALDTL  537

Query  1521  YYGEYMNRGPGAGTSKRVNWPGYHVITDKAEAMKFTVAQLIQGGSWLKNTGVDYTEGL  1694
             YYGEYMN GPG    +RVNWPGY VIT   EA KFTV Q I G SWL +TGV +  GL
Sbjct  538   YYGEYMNYGPGGAVGQRVNWPGYRVITSVVEATKFTVGQFIYGSSWLPSTGVAFLAGL  595



>emb|CDP20891.1| unnamed protein product [Coffea canephora]
Length=523

 Score =   447 bits (1150),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 225/449 (50%), Positives = 300/449 (67%), Gaps = 14/449 (3%)
 Frame = +3

Query  363   SANVNRRINDRKVQAAVADCMELLD---LSQDKVMDSMVALGNLSARARTDAHSWLSSVL  533
             + N+  +  + + +AA ADC++L +   L  ++ +DS     +       DA +WLS+ L
Sbjct  84    TENLESKCRNEREKAAWADCLKLYENTILQLNRTLDSNTKCTDF------DAQTWLSTAL  137

Query  534   TNHDTCLDGLSEPARS-IMEPMIKDLISRAKsslavlvavaPSTEDDLRALNGEFPSWVS  710
             TN +TC  G  E   S  + P++ + +S+   +   L      + +     +G FP+WV+
Sbjct  138   TNLETCRSGFQELGVSDFVLPLMSNNVSKLICNTLALNNNINVSVETQTYKDG-FPTWVT  196

Query  711   ASDRRLLEASanavaanvvvaKDGSGKYKTVAEAV-ASAPDNGKTRYVIYIKKGTYKENV  887
               DR+LL++S       V   +DGSG Y+T+  A+ A+A  +G  R+VI +K+GTY+EN+
Sbjct  197   PGDRKLLQSSLVRPNLIVA--QDGSGNYRTIKAALDAAAKRSGSGRFVIQVKRGTYRENL  254

Query  888   EIGKKKTNVMLIGDGLSATIITGSLNYVDGATTFNSATVAAVGDGFIAQDLRIQNTAGPE  1067
             EIG K  N+ML+G G+  TIITGS +   G+TTF+SATVA  GDGFIAQ +  +NTAGP+
Sbjct  255   EIGNKMKNIMLLGAGMRDTIITGSRSVGGGSTTFDSATVAVTGDGFIAQGITFRNTAGPQ  314

Query  1068  KHQAVALRLGADQSVINRCKIDAYQDTLYAHSQRQFYRDCYITGTVDFIFGNAAAVIQNS  1247
              HQAVALR G+D SV +RC  + YQDTLY HSQRQFY++CYI GTVDFIFGNAA V+QN 
Sbjct  315   NHQAVALRSGSDLSVFHRCGFEGYQDTLYVHSQRQFYKECYIYGTVDFIFGNAAVVLQNC  374

Query  1248  QVVARKPMAAQKNMVTAQGRTDPNQNTGTSIQNCNVSPSSDLGPVKGTIQTYLGRPWKEY  1427
              + AR+PM  QKN +TAQGRTDPNQNTG SI N  V  +SDL PV  + +TYLGRPWK+Y
Sbjct  375   MIYARRPMDKQKNTITAQGRTDPNQNTGISIHNSRVMAASDLRPVLSSFKTYLGRPWKQY  434

Query  1428  SRTVFMESNIGDHIDPAGWFPWDGDFALKTLYYGEYMNRGPGAGTSKRVNWPGYHVITDK  1607
             SRTVF+++ +   +DPAGW  WDG+FA  TLYYGEY N GPG+ TS+RV W GYHVIT+ 
Sbjct  435   SRTVFIQTYLDSLVDPAGWLEWDGNFAFNTLYYGEYKNSGPGSSTSRRVKWRGYHVITNP  494

Query  1608  AEAMKFTVAQLIQGGSWLKNTGVDYTEGL  1694
              EA +FTVA  I G SWL  T V +  GL
Sbjct  495   TEASRFTVANFIAGRSWLPATNVPFAAGL  523



>ref|XP_002280446.1| PREDICTED: pectinesterase 2 [Vitis vinifera]
Length=513

 Score =   447 bits (1149),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 234/436 (54%), Positives = 298/436 (68%), Gaps = 16/436 (4%)
 Frame = +3

Query  402   QAAVADCMELLD---LSQDKVMDSMVALGNLSARARTDAHSWLSSVLTNHDTCLDGLSEP  572
             + A +DC++L +   L  +K +D           ++ D+ +WLS+ LTN +TC  G  E 
Sbjct  89    KTAWSDCLKLYEYTILRLNKTVDPNTKC------SQVDSQTWLSTALTNLETCRAGFVEL  142

Query  573   ARS-IMEPMIKDLISRAKsslavlvavaPSTEDDLRALNGEFPSWVSASDRRLLEASana  749
               S  + P++ + +S+   S  + +   P TE   +     FP+WV   DR+LL++S+ A
Sbjct  143   GVSDYLLPLMSNNVSKL-ISNTLSLNKVPYTEPSYKE---GFPTWVKPGDRKLLQSSSPA  198

Query  750   vaanvvvaKDGSGKYKTVAEAVASAPD-NGKTRYVIYIKKGTYKENVEIGKKKTNVMLIG  926
               AN+VVAKDGSG Y T+  AV++A   +G  RYVIY+K GTY EN+EIG K  N+ML+G
Sbjct  199   SQANIVVAKDGSGDYTTITAAVSAASKRSGTGRYVIYVKAGTYNENIEIGAKLKNIMLLG  258

Query  927   DGLSATIITGSLNYVDGATTFNSATVAAVGDGFIAQDLRIQNTAGPEKHQAVALRLGADQ  1106
             DG+  TIITGS +   G+TTFNSATVAAVGDGFI + L I+NTAG   HQAVALR G+D 
Sbjct  259   DGIGKTIITGSKSVGGGSTTFNSATVAAVGDGFIGRGLTIRNTAGAANHQAVALRSGSDL  318

Query  1107  SVINRCKIDAYQDTLYAHSQRQFYRDCYITGTVDFIFGNAAAVIQNSQVVARKPMAAQKN  1286
             SV  +C  + YQDTLY HS+RQFYR+C I GTVDFIFGNAA V+QN  +  R P   + N
Sbjct  319   SVFYQCSFEGYQDTLYVHSERQFYRECDIYGTVDFIFGNAAVVLQNCNIYPRNP-PNKTN  377

Query  1287  MVTAQGRTDPNQNTGTSIQNCNVSPSSDLGPVKGTIQTYLGRPWKEYSRTVFMESNIGDH  1466
              +TAQGRTDPNQNTG SI NC V+ +SDL  V+ +++TYLGRPWKEYSRTVFM++ +   
Sbjct  378   TITAQGRTDPNQNTGISIHNCKVTAASDLKSVQSSVKTYLGRPWKEYSRTVFMKTYLDSL  437

Query  1467  IDPAGWFPWDGDFALKTLYYGEYMNRGPGAGTSKRVNWPGYHVITDKAEAMKFTVAQLIQ  1646
             I+PAGW  W G+FALKTLYYGEYMN GPG+ TS RVNW GYHVIT  +EA KFTV   I 
Sbjct  438   INPAGWMEWSGNFALKTLYYGEYMNTGPGSSTSNRVNWAGYHVITSSSEASKFTVGNFIA  497

Query  1647  GGSWLKNTGVDYTEGL  1694
             G SWL  T V +T GL
Sbjct  498   GNSWLPATNVPFTSGL  513



>emb|CAB95025.1| pectin methylesterase [Nicotiana tabacum]
Length=579

 Score =   449 bits (1155),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 244/531 (46%), Positives = 319/531 (60%), Gaps = 56/531 (11%)
 Frame = +3

Query  219   CDPAHDPPSCMAIVSEVSSAAPTETDGVAllqmllhssllRIQDAVKLSANVNRR-----  383
             C+    P  C + ++ VS  +   T                 +D ++LS N+  R     
Sbjct  66    CENTLHPELCYSTIASVSDFSKKVTSQ---------------KDVIELSLNITCRAVQHN  110

Query  384   -------INDRK-----VQAAVADCMELLDLSQDKVMDSMVALGNLSARARTDAH-----  512
                    I  RK      + A+ DC+E +D + D++  ++  L     +    AH     
Sbjct  111   FFKVEKLIKTRKGLKPREKVALHDCLETIDETLDELHTAIKDLELYPNKKSLKAHADDLK  170

Query  513   SWLSSVLTNHDTCLDGLS--EPARSIMEPMIKDLISRAKsslavlvavaPSTEDD-----  671
             + +SS +TN +TCLDG S  +  + + + ++K      K     L  +   T+ D     
Sbjct  171   TLISSAITNQETCLDGFSHDDADKKVRKALLKGQKHVEKMCSNALAMICNMTDTDIANEQ  230

Query  672   ----------LRALNGEFPSWVSASDRRLLEASanavaanvvvaKDGSGKYKTVAEAVAS  821
                       LR  N E+P W+SA DRRLL++S       V    DGSG +KTV+EAVA 
Sbjct  231   KLKGTTTNRKLREDNSEWPEWLSAGDRRLLQSSTVRPDVVVAA--DGSGNFKTVSEAVAK  288

Query  822   APDNGKTRYVIYIKKGTYKENVEIGKKKTNVMLIGDGLSATIITGSLNYVDGATTFNSAT  1001
             AP+    RYVI IK G Y+ENV++ KKKTN+M +GDG S TIITGS N  DG+TTF+SAT
Sbjct  289   APEKSSKRYVIRIKAGVYRENVDVPKKKTNIMFMGDGRSNTIITGSRNVKDGSTTFHSAT  348

Query  1002  VAAVGDGFIAQDLRIQNTAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYAHSQRQFYR  1181
             VAAVG+ F+A+D+  QNTAG  KHQAVALR+G+D S   RC I AYQD+LY HS RQ++ 
Sbjct  349   VAAVGEKFLARDITFQNTAGAAKHQAVALRVGSDLSAFYRCDILAYQDSLYVHSNRQYFV  408

Query  1182  DCYITGTVDFIFGNAAAVIQNSQVVARKPMAAQKNMVTAQGRTDPNQNTGTSIQNCNVSP  1361
              C I GTVDFIFGNAAAV+QN  + AR+P + QKNMVTAQGR+DPNQNTG  IQ C +  
Sbjct  409   QCLIAGTVDFIFGNAAAVLQNCDIHARRPGSGQKNMVTAQGRSDPNQNTGIVIQKCRIGA  468

Query  1362  SSDLGPVKGTIQTYLGRPWKEYSRTVFMESNIGDHIDPAGWFPWDGDFALKTLYYGEYMN  1541
             +SDL PV+ +  TYLGRPWKEYSRTV M+S+I D I+ AGW  W+G+FAL TL+YGEY N
Sbjct  469   TSDLRPVQKSFPTYLGRPWKEYSRTVIMQSSITDVINSAGWHEWNGNFALNTLFYGEYQN  528

Query  1542  RGPGAGTSKRVNWPGYHVITDKAEAMKFTVAQLIQGGSWLKNTGVDYTEGL  1694
              G GAGTS RV W G+ VIT   EA  +T  + I GGSWL +TG  ++ GL
Sbjct  529   TGAGAGTSGRVKWKGFKVITSATEAQAYTPGRFIAGGSWLSSTGFPFSLGL  579



>ref|XP_008775930.1| PREDICTED: pectinesterase-like [Phoenix dactylifera]
Length=515

 Score =   447 bits (1149),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 250/531 (47%), Positives = 340/531 (64%), Gaps = 32/531 (6%)
 Frame = +3

Query  138   IVGSVALVSIWALRTSSSSPSLWKARVCDPAHDPPSCMAIVSEVSSAAPTETDGVAllqm  317
             I    AL  I  +  ++S+P L     C     P  C +++S    AA T+T       +
Sbjct  5     ITHFFALSLIMVISVATSNPIL----SCQETPHPHVCSSVISTSPLAAQTKTQS-GFRNL  59

Query  318   llhssllRIQDAVKLSANVNRRINDRKVQAAVADCMELLDLSQDKVMDSMVALGNLSARA  497
              L +++ R   A++L + ++    D + +AA ADC+EL   +  K+  SM      S+ +
Sbjct  60    ALQAAMDRAARALELVSAMDVSSLDGQAKAAWADCLELCQDTIGKLNRSM------SSPS  113

Query  498   RTDAHSWLSSVLTNHDTCLDGLSEPARSIMEPM---------IKDLISRAKsslavlvav  650
               D+ +WLS+ + NH TC +G  E   S   P+         I +L+S +   LA+  A+
Sbjct  114   YDDSQTWLSAAMANHQTCRNGFIELGSSF--PLDSLPFTSYNISELLSNS---LAINKAM  168

Query  651   aPSTEDDLRALNGE-FPSWVSASDRRLLEASanavaanvvvaKDGSGKYKTVAEAVA--S  821
             AP+    +R L  + FP+W+SA+DR+LL++S+      V   KDGSG Y T++ A+A  +
Sbjct  169   APAKSGGIRRLLSDGFPNWLSAADRKLLQSSSINADLVVA--KDGSGDYDTISAAIAAAT  226

Query  822   APDNGKTRYVIYIKKGTYKENVEIGKKKTNVMLIGDGLSATIITGSLNYVDGATTFNSAT  1001
                +G +R+VI++K G Y ENV  G    N+M+IGDG+ AT++TGS N  DG+TTF+SAT
Sbjct  227   KQSSGTSRFVIHVKAGVYNENV--GTSIKNLMIIGDGIDATVVTGSKNVQDGSTTFSSAT  284

Query  1002  VAAVGDGFIAQDLRIQNTAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYAHSQRQFYR  1181
              A  GDGFIA+ +  QNTAGP+K+QAVA R  +D S   +C  + YQDTLY +SQRQFYR
Sbjct  285   FAVTGDGFIARGMTFQNTAGPQKNQAVAFRSSSDLSAYYQCSFEGYQDTLYVYSQRQFYR  344

Query  1182  DCYITGTVDFIFGNAAAVIQNSQVVARKPMAAQKNMVTAQGRTDPNQNTGTSIQNCNVSP  1361
             DC I GTVDFIFG+AA V QN  +  RKPM+ QKN VTAQGRTDPN+NTG SI +  V+ 
Sbjct  345   DCNIYGTVDFIFGDAAVVFQNCDMYVRKPMSGQKNTVTAQGRTDPNENTGISIHDSAVTA  404

Query  1362  SSDLGPVKGTIQTYLGRPWKEYSRTVFMESNIGDHIDPAGWFPWDGDFALKTLYYGEYMN  1541
             +SDL PV+G+ QTYLGRPW++YSRTV+M++++   IDPAGW  W+GDFAL TLYYGEYMN
Sbjct  405   ASDLKPVQGSFQTYLGRPWQKYSRTVYMKTSLDSLIDPAGWLEWNGDFALSTLYYGEYMN  464

Query  1542  RGPGAGTSKRVNWPGYHVITDKAEAMKFTVAQLIQGGSWLKNTGVDYTEGL  1694
              G GA TS+RVNWPGYHVIT  A A +FTV   + GGSW+  TGV YT  L
Sbjct  465   TGAGADTSRRVNWPGYHVITSAAVASQFTVGNFLSGGSWIPATGVPYTSDL  515



>ref|XP_002865971.1| pectinesterase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH42230.1| pectinesterase family protein [Arabidopsis lyrata subsp. lyrata]
Length=587

 Score =   449 bits (1155),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 235/522 (45%), Positives = 325/522 (62%), Gaps = 23/522 (4%)
 Frame = +3

Query  186   SSSPSLWKARVCDPAHDPPSCMAIVSEVSSAAPTETDGVAllqmllhssllRIQDAVKLS  365
             +S P+   +R C  +  P  C+  + +   +   + + +  + +  +++L R   A+  S
Sbjct  68    TSKPTQAISRTCSKSLYPNLCIDTLLDFPGSLTADENEL--IHISFNATLQRFSKALYTS  125

Query  366   ANVNRRINDRKVQAAVADCMELLDLSQDKVMDSMVALGNLSA-RARTDAHSWLSSVLTNH  542
             + +       +V++A   C+ELLD S D +  ++ ++  +S   + +D  +WLSS +TNH
Sbjct  126   STITYTQMPPRVRSAYDSCLELLDDSVDALTRALSSVVVVSGDESHSDVMTWLSSAMTNH  185

Query  543   DTCLDGLSEPARSIMEPMIKD-LISRAKsslavlvavaPSTEDDLRALNG----------  689
             DTC DG  E      E  +KD +I   K    ++          ++ L+G          
Sbjct  186   DTCTDGFDEIEGQGGE--VKDQVIGAVKDLSEMVSNCLAIFAGKVKDLSGVPVVNNRKLL  243

Query  690   ------EFPSWVSASDRRLLEASanavaanvvvaKDGSGKYKTVAEAVASAPDNGKTRYV  851
                   E P+W+   DR LL    +AV A++ V+KDGSG +KT+AEA+  AP++   R+V
Sbjct  244   GTEETEELPNWLKREDRELLGTPTSAVQADITVSKDGSGTFKTIAEAIKKAPEHSSRRFV  303

Query  852   IYIKKGTYKE-NVEIGKKKTNVMLIGDGLSATIITGSLNYVDGATTFNSATVAAVGDGFI  1028
             IY+K G Y+E N+++G+KKTN+M IGDG   T+ITG  +  D  TTF++AT AA G GFI
Sbjct  304   IYVKSGRYEEENLKVGRKKTNLMFIGDGKGKTVITGGKSIADDLTTFHTATFAATGAGFI  363

Query  1029  AQDLRIQNTAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYAHSQRQFYRDCYITGTVD  1208
              +D+  +N AGP KHQAVALR+G D +V+ RC I  YQD LY HS RQF+R+C I GTVD
Sbjct  364   VRDITFENYAGPAKHQAVALRVGGDHAVVYRCSIIGYQDALYVHSNRQFFRECEIYGTVD  423

Query  1209  FIFGNAAAVIQNSQVVARKPMAAQKNMVTAQGRTDPNQNTGTSIQNCNVSPSSDLGPVKG  1388
             FIFGNAA ++Q+  + ARKPMA QK  +TAQ R DPNQNTG SI  C +  + DL   KG
Sbjct  424   FIFGNAAVILQSCNIYARKPMAQQKITITAQNRKDPNQNTGISIHACKLLATPDLEASKG  483

Query  1389  TIQTYLGRPWKEYSRTVFMESNIGDHIDPAGWFPWDGDFALKTLYYGEYMNRGPGAGTSK  1568
             +  TYLGRPWK YSR V+M S++GDHIDP GW  W+G +AL TLYYGEYMN+GPG+G  +
Sbjct  484   SYPTYLGRPWKLYSRVVYMMSDMGDHIDPRGWLEWNGPYALDTLYYGEYMNKGPGSGMGQ  543

Query  1569  RVNWPGYHVITDKAEAMKFTVAQLIQGGSWLKNTGVDYTEGL  1694
             R+ WPGYHVIT   EA KFTVAQ I G SWL +TGV +  GL
Sbjct  544   RIKWPGYHVITSMVEASKFTVAQFISGSSWLPSTGVAFFSGL  585



>ref|XP_012090423.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 17 
[Jatropha curcas]
 gb|KDP22414.1| hypothetical protein JCGZ_26245 [Jatropha curcas]
Length=523

 Score =   447 bits (1149),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 230/458 (50%), Positives = 300/458 (66%), Gaps = 17/458 (4%)
 Frame = +3

Query  339   RIQDAVKLSANVNRRINDRKVQAAVADCMELLDLSQDKVMDSMVALGNLSARARTDAHSW  518
             R Q A   +  + ++  + K +AA+ADC++L    +D +++    +   +     D  +W
Sbjct  77    RAQTAQSQNKWLGKKCRNEKEKAALADCLKLY---EDTIINLNHTIDPSAKCTDYDVQTW  133

Query  519   LSSVLTNHDTCLDGLSEPARS-IMEPMIKD----LISRAKsslavlvavaPSTEDDLRAL  683
             LS+ LTN +TC  G  E   +  M P++ +    LI    +      +V P T  D    
Sbjct  134   LSTALTNLETCKAGFVELGVTDFMLPLMSNNVSSLIRNTLAINNSSTSVLPQTYKD----  189

Query  684   NGEFPSWVSASDRRLLEASanavaanvvvaKDGSGKYKTVAEAV-ASAPDNGKTRYVIYI  860
                FP WV++ DR+LL+ S+ +    V   +DGSG ++T+ +A+ A+A  +G  R+VI+I
Sbjct  190   --GFPHWVTSGDRKLLQTSSPSPNLVVA--QDGSGNFRTIKQALDAAAKRSGSGRFVIHI  245

Query  861   KKGTYKENVEIGKKKTNVMLIGDGLSATIITGSLNYVDGATTFNSATVAAVGDGFIAQDL  1040
             K G Y+EN+EIG    N+ML+GDGL  TIITGS +   G+TTFNSATVA  GDGFIA+ +
Sbjct  246   KSGIYRENLEIGNDMINIMLVGDGLRNTIITGSRSVGGGSTTFNSATVAVTGDGFIARGI  305

Query  1041  RIQNTAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYAHSQRQFYRDCYITGTVDFIFG  1220
               +NTAGP+ HQAVALR G+D SV  RC  + YQDTLY HSQRQFY++CYI GTVDFIFG
Sbjct  306   TFRNTAGPQNHQAVALRSGSDLSVFYRCGFEGYQDTLYVHSQRQFYKECYIYGTVDFIFG  365

Query  1221  NAAAVIQNSQVVARKPMAAQKNMVTAQGRTDPNQNTGTSIQNCNVSPSSDLGPVKGTIQT  1400
             NAA V+QN  + AR+PM  QKN+VTAQGRTDPNQNTG SI N  V  S DL PV  + +T
Sbjct  366   NAAVVLQNCMIYARRPMDKQKNVVTAQGRTDPNQNTGISIHNSRVMASPDLKPVLSSFKT  425

Query  1401  YLGRPWKEYSRTVFMESNIGDHIDPAGWFPWDGDFALKTLYYGEYMNRGPGAGTSKRVNW  1580
             YLGRPWK+YSRTV++++ +   +DPAGW  WDGDFAL TLYYGEY N GP A TS RV W
Sbjct  426   YLGRPWKQYSRTVYLQTYLDSLVDPAGWLEWDGDFALNTLYYGEYKNVGPSASTSGRVTW  485

Query  1581  PGYHVITDKAEAMKFTVAQLIQGGSWLKNTGVDYTEGL  1694
              GY VIT   EA +FTVA  I GGSWL  + V +T GL
Sbjct  486   RGYRVITSSTEANRFTVANFIAGGSWLPASSVPFTSGL  523



>ref|XP_002301486.2| hypothetical protein POPTR_0002s20370g [Populus trichocarpa]
 gb|EEE80759.2| hypothetical protein POPTR_0002s20370g [Populus trichocarpa]
Length=558

 Score =   448 bits (1152),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 232/462 (50%), Positives = 302/462 (65%), Gaps = 21/462 (5%)
 Frame = +3

Query  363   SANVNRRINDRKV----QAAVADCMELLDLSQDKVMDSMVALGNLSARARTDAH-----S  515
             SA+ N   N  K+    + A+ DC+EL D   D + +   A+ NL+ R  T  H     +
Sbjct  99    SADCNAIRNKMKLGPLEKVALKDCIELFD---DTIAELKSAISNLALRKPTSKHYHDLQT  155

Query  516   WLSSVLTNHDTCLDGLSEPARSIMEPMIKDL--ISRAKsslavlvavaPSTEDDLRALNG  689
              LS  +TN  TCLDG +     + + + K L  IS   S+   ++   P        +  
Sbjct  156   LLSGAMTNQYTCLDGFARSKGKVRKAIKKGLYNISHHVSNSLAMLKKIPGVNASKSEVFP  215

Query  690   E-------FPSWVSASDRRLLEASanavaanvvvaKDGSGKYKTVAEAVASAPDNGKTRY  848
             E       FPSW+S  DR+LL+ASANA   +++VAKDG+G + T++EAV +AP++  TR+
Sbjct  216   EYGNVKHGFPSWLSTKDRKLLQASANATKFDLIVAKDGTGNFTTISEAVRAAPNSSDTRF  275

Query  849   VIYIKKGTYKENVEIGKKKTNVMLIGDGLSATIITGSLNYVDGATTFNSATVAAVGDGFI  1028
             VI+IK G Y ENVE+ +KK  ++ IGDG+  T++  + + VDG TTF SATVA VGDGFI
Sbjct  276   VIHIKAGAYFENVEVERKKKMLVFIGDGIGKTVVKANRSVVDGWTTFRSATVAVVGDGFI  335

Query  1029  AQDLRIQNTAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYAHSQRQFYRDCYITGTVD  1208
             A+ +  +N+AGP KHQAVALR G+D S   +C    YQDTLY H+ RQFYR+C I GT+D
Sbjct  336   AKGITFENSAGPSKHQAVALRSGSDLSAFYQCSFVGYQDTLYVHTLRQFYRECDIYGTID  395

Query  1209  FIFGNAAAVIQNSQVVARKPMAAQKNMVTAQGRTDPNQNTGTSIQNCNVSPSSDLGPVKG  1388
             FIFGNAA V QNS + ARKP + QKN+ TAQGR DPNQNTG SI NC V+ ++DL PVK 
Sbjct  396   FIFGNAAVVFQNSNLYARKPNSNQKNIFTAQGREDPNQNTGISILNCKVAAAADLIPVKS  455

Query  1389  TIQTYLGRPWKEYSRTVFMESNIGDHIDPAGWFPWDGDFALKTLYYGEYMNRGPGAGTSK  1568
             + QT+LGRPWKEYSRTVF+ S I D +DPAGW  W+  FAL TLYY EYMNRGPG+ TS 
Sbjct  456   SFQTFLGRPWKEYSRTVFLRSYIDDLVDPAGWLEWNASFALSTLYYREYMNRGPGSNTSA  515

Query  1569  RVNWPGYHVITDKAEAMKFTVAQLIQGGSWLKNTGVDYTEGL  1694
             RV WPGY +IT+  EA +FTV   IQG +WL +T + Y   L
Sbjct  516   RVTWPGYRIITNSTEASQFTVGAFIQGNTWLNSTDIPYFLNL  557



>ref|XP_010056338.1| PREDICTED: pectinesterase 2-like [Eucalyptus grandis]
Length=515

 Score =   446 bits (1148),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 230/454 (51%), Positives = 308/454 (68%), Gaps = 12/454 (3%)
 Frame = +3

Query  339   RIQDAVKLSANVNRRINDRKVQAAVADCMELLDLSQDKVMDSMVALGNLSARARTDAHSW  518
             R Q A   + ++  + ++ + +AA ADC++L +     V+     +G+   +   +A +W
Sbjct  72    RAQLAHDHTHSLESKCSNEREKAAWADCLQLYE---HTVLRLNRTIGHECTQ--DEAQTW  126

Query  519   LSSVLTNHDTCLDGLSEPARS-IMEPMIKDLISRAKsslavlvavaPSTEDDLRALNGEF  695
             LS+ LTN +TC  G  E   S  + P++ + +S+  S+   L     +T +  +    +F
Sbjct  127   LSTALTNLETCRAGFVELGISDNVLPLMSNNVSKLISNTLALNYAPFTTPNYTK----KF  182

Query  696   PSWVSASDRRLLEASanavaanvvvaKDGSGKYKTVAEAV-ASAPDNGKTRYVIYIKKGT  872
             P+WV  SDR+LL++S+    AN+VVA+DGSG YKT++EA+ A++   G  RY+IYIK GT
Sbjct  183   PTWVRPSDRKLLQSSSAVSKANIVVARDGSGNYKTISEAITAASKQTGAARYIIYIKAGT  242

Query  873   YKENVEIGKKKTNVMLIGDGLSATIITGSLNYVDGATTFNSATVAAVGDGFIAQDLRIQN  1052
             Y EN+E+G K  N+M +GDG+  TIITGS +   G+TTF SATVA VGDGF+AQD+  +N
Sbjct  243   YNENIEVGSKLDNIMFVGDGIGKTIITGSKSVGGGSTTFKSATVAVVGDGFVAQDITFRN  302

Query  1053  TAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYAHSQRQFYRDCYITGTVDFIFGNAAA  1232
             TAG   HQAVALR G+D SV  RC  + YQDTLY HS+RQFYR+C I GTVDFIFGNAA 
Sbjct  303   TAGAANHQAVALRSGSDLSVFYRCSFEGYQDTLYVHSERQFYRECDIYGTVDFIFGNAAV  362

Query  1233  VIQNSQVVARKPMAAQKNMVTAQGRTDPNQNTGTSIQNCNVSPSSDLGPVKGTIQTYLGR  1412
             V QN  + AR P   + N +TAQGRTDPNQNTG SI NC V+ +SDL  ++ +++TYLGR
Sbjct  363   VFQNCNIYARNP-PNKVNTLTAQGRTDPNQNTGISIHNCKVTAASDLKSIQSSVKTYLGR  421

Query  1413  PWKEYSRTVFMESNIGDHIDPAGWFPWDGDFALKTLYYGEYMNRGPGAGTSKRVNWPGYH  1592
             PWK+YSRTVFM++ +   ++ AGW  WDG+FAL TLYYGEY+N GPG+ T+ RV W GYH
Sbjct  422   PWKQYSRTVFMKTYLDSLVNSAGWMEWDGNFALDTLYYGEYVNTGPGSSTANRVKWVGYH  481

Query  1593  VITDKAEAMKFTVAQLIQGGSWLKNTGVDYTEGL  1694
             VIT   EA KFTV   + GGSWL  TGV YT GL
Sbjct  482   VITSATEAAKFTVGSFLVGGSWLPATGVPYTSGL  515



>ref|XP_010101099.1| putative pectinesterase/pectinesterase inhibitor 17 [Morus notabilis]
 gb|EXC45243.1| putative pectinesterase/pectinesterase inhibitor 17 [Morus notabilis]
Length=523

 Score =   446 bits (1148),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 234/442 (53%), Positives = 296/442 (67%), Gaps = 17/442 (4%)
 Frame = +3

Query  387   NDRKVQAAVADCMELLD---LSQDKVMDSMVALGNLSARARTDAHSWLSSVLTNHDTCLD  557
             ND++ +AA +DC++L +   L  +K +D      +       DA +WLS+ LTN DTC  
Sbjct  93    NDKE-KAAWSDCLKLYEDAILLLNKTLDPSTKCTDF------DAQTWLSTALTNLDTCRA  145

Query  558   GLSEPARS-IMEPMIKDLISRAKsslavlvavaPSTEDDLRALNGEFPSWVSASDRRLLE  734
             G  E   S  + P++ + +S  K     L     S      A    FP W+S  DR+LL+
Sbjct  146   GFVELGVSDFVWPLMSNNVS--KLISNTLATNNASAPPVTNAYKDGFPIWLSPGDRKLLQ  203

Query  735   ASanavaanvvvaKDGSGKYKTVAEAV-ASAPDNGKTRYVIYIKKGTYKENVEIGKKKTN  911
             +S+ +    V   KDGSG ++T+  A+ A+A  +G  R++I++K+G Y EN+EIG K  N
Sbjct  204   SSSQSPNLVVA--KDGSGDHETIKAALDAAAKRSGSGRFIIHVKRGVYNENLEIGNKLKN  261

Query  912   VMLIGDGLSATIITGSLNYVDGA-TTFNSATVAAVGDGFIAQDLRIQNTAGPEKHQAVAL  1088
             +ML+GDGL  TIITGS +   G  TTFNSATVA  G+GFIAQ +  +NTAGPE HQAVAL
Sbjct  262   IMLVGDGLRYTIITGSRSVGGGGYTTFNSATVAVTGEGFIAQGITFRNTAGPENHQAVAL  321

Query  1089  RLGADQSVINRCKIDAYQDTLYAHSQRQFYRDCYITGTVDFIFGNAAAVIQNSQVVARKP  1268
             R GAD SV  RC  + YQDTLY HSQRQFY++CYI GTVDFIFGNAAAV+QN  + AR+P
Sbjct  322   RSGADLSVFYRCGFEGYQDTLYVHSQRQFYKECYIYGTVDFIFGNAAAVLQNCMIYARRP  381

Query  1269  MAAQKNMVTAQGRTDPNQNTGTSIQNCNVSPSSDLGPVKGTIQTYLGRPWKEYSRTVFME  1448
             M+ QKN +TAQGRTDPNQNTG SI N  V  ++DL PV  + +TYLGRPWK+YSRTVFM+
Sbjct  382   MSKQKNTITAQGRTDPNQNTGISIHNSRVMAAADLKPVLSSFKTYLGRPWKQYSRTVFMQ  441

Query  1449  SNIGDHIDPAGWFPWDGDFALKTLYYGEYMNRGPGAGTSKRVNWPGYHVITDKAEAMKFT  1628
             + +   +DPAGW  WDGDFAL TLYYGEY N GP A TS+RV W GY VIT  +EA +FT
Sbjct  442   TYLDSLVDPAGWLEWDGDFALNTLYYGEYRNLGPAASTSRRVKWSGYRVITSSSEASQFT  501

Query  1629  VAQLIQGGSWLKNTGVDYTEGL  1694
             VA  I G SWL  TGV +T GL
Sbjct  502   VANFIAGQSWLPATGVRFTAGL  523



>gb|KDP28190.1| hypothetical protein JCGZ_13961 [Jatropha curcas]
Length=430

 Score =   443 bits (1139),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 230/429 (54%), Positives = 295/429 (69%), Gaps = 16/429 (4%)
 Frame = +3

Query  456   MDSM-VALGNLSARARTDAH-----SWLSSVLTNHDTCLDGLSEPARSIMEPMIKDL--I  611
             MD + VAL +L +R     H     + LS+ +TN  TCLDG +    ++ + +  +L  I
Sbjct  1     MDELKVALNDLYSRKSASQHYHELQTLLSAAMTNQYTCLDGFAYSEGNVRKVIKSNLYNI  60

Query  612   SRAKsslavlvavaP----STEDDLRALNGE----FPSWVSASDRRLLEASanavaanvv  767
             S   S+  V++   P    S + ++   +G+    FPSW+S+ DR+LL+A  NA   N++
Sbjct  61    SHHVSNSLVMLKKIPGVNISNKSEVFTGHGDIKHGFPSWLSSKDRKLLQAPLNATTFNLI  120

Query  768   vaKDGSGKYKTVAEAVASAPDNGKTRYVIYIKKGTYKENVEIGKKKTNVMLIGDGLSATI  947
             VAKDGSG + TV+EAVA+AP++   R+VIYIK G Y ENV++ KKK  +M IGDG+  T+
Sbjct  121   VAKDGSGNFTTVSEAVAAAPNSSNARFVIYIKAGAYFENVDVHKKKNMLMFIGDGIGKTV  180

Query  948   ITGSLNYVDGATTFNSATVAAVGDGFIAQDLRIQNTAGPEKHQAVALRLGADQSVINRCK  1127
             I  + + VDG TTF SATVA VG+GFIA+ +  +N+AGP  HQAVALR G+D S   +C 
Sbjct  181   IKANRSVVDGWTTFRSATVAVVGNGFIAKGITFENSAGPSMHQAVALRSGSDLSAFYQCS  240

Query  1128  IDAYQDTLYAHSQRQFYRDCYITGTVDFIFGNAAAVIQNSQVVARKPMAAQKNMVTAQGR  1307
                YQDTLY HS RQFYR+C + GT+DFIFGNAA V QN  + AR+P   QKN+VTAQGR
Sbjct  241   FVGYQDTLYVHSLRQFYRECDVYGTIDFIFGNAAVVFQNCNLYARQPNENQKNIVTAQGR  300

Query  1308  TDPNQNTGTSIQNCNVSPSSDLGPVKGTIQTYLGRPWKEYSRTVFMESNIGDHIDPAGWF  1487
              DPNQNTG SI NC V+ ++DL PVK + +TYLGRPWKEYSRTV++ S I D IDPAGW 
Sbjct  301   EDPNQNTGISILNCKVAAAADLIPVKSSFKTYLGRPWKEYSRTVYITSYIDDLIDPAGWL  360

Query  1488  PWDGDFALKTLYYGEYMNRGPGAGTSKRVNWPGYHVITDKAEAMKFTVAQLIQGGSWLKN  1667
              W+GDFALKTLYYGEYMNRGPG+ TS RV WPGY VI + AEA +F V   IQG  WL  
Sbjct  361   EWNGDFALKTLYYGEYMNRGPGSNTSGRVTWPGYRVINNSAEASQFAVEPFIQGSEWLNA  420

Query  1668  TGVDYTEGL  1694
             TGV ++ GL
Sbjct  421   TGVPFSLGL  429



>ref|XP_009606552.1| PREDICTED: pectinesterase/pectinesterase inhibitor U1 [Nicotiana 
tomentosiformis]
Length=589

 Score =   449 bits (1154),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 244/531 (46%), Positives = 320/531 (60%), Gaps = 56/531 (11%)
 Frame = +3

Query  219   CDPAHDPPSCMAIVSEVSSAAPTETDGVAllqmllhssllRIQDAVKLSAN---------  371
             C+    P  C + ++ VS  +   T                 +D ++LS N         
Sbjct  76    CENTLHPELCYSTIASVSDFSKKVTSQ---------------KDVIELSLNITCKAVQHN  120

Query  372   ---VNRRINDRK-----VQAAVADCMELLDLSQDKVMDSMVALGNLSARARTDAH-----  512
                V + I  RK      + A+ DC+E +D + D++  ++  L     +     H     
Sbjct  121   FFTVEKLIKTRKGLTPREKVALHDCLETIDETLDELHTAIDDLELYPNKKSLKDHADDLK  180

Query  513   SWLSSVLTNHDTCLDGLS--EPARSIMEPMIKDLISRAKsslavlvavaPSTEDD-----  671
             + +SS +TN +TCLDG S  +  + + + ++K      K     L  +   T+ D     
Sbjct  181   TLISSAITNQETCLDGFSHDDADKKVRKALLKGQKHVEKMCSNALAMICNMTDTDIANEM  240

Query  672   ----------LRALNGEFPSWVSASDRRLLEASanavaanvvvaKDGSGKYKTVAEAVAS  821
                       LR  N E+P W+SA DRR+L++S  +    V    DGSG ++TV+EAVA 
Sbjct  241   KLKGTTTNRKLREDNSEWPEWLSAGDRRMLQSSTVSPDVVVAA--DGSGNFRTVSEAVAK  298

Query  822   APDNGKTRYVIYIKKGTYKENVEIGKKKTNVMLIGDGLSATIITGSLNYVDGATTFNSAT  1001
             AP+    RYVI IK G Y+ENV++ KKKTN+M +GDG S TIITGS N  DG+TTFNSAT
Sbjct  299   APEKSSKRYVIRIKAGVYRENVDVPKKKTNIMFMGDGRSNTIITGSRNVKDGSTTFNSAT  358

Query  1002  VAAVGDGFIAQDLRIQNTAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYAHSQRQFYR  1181
             VAAVG+ F+A+D+  QNTAG  KHQAVALR+G+D S   RC I AYQD+LY HS RQ++ 
Sbjct  359   VAAVGEKFLARDITFQNTAGAAKHQAVALRVGSDLSAFYRCDILAYQDSLYVHSNRQYFV  418

Query  1182  DCYITGTVDFIFGNAAAVIQNSQVVARKPMAAQKNMVTAQGRTDPNQNTGTSIQNCNVSP  1361
              C I GTVDFIFGNAAAV+QN  + AR+P + QKNMVTAQGRTDPNQNTG  IQNC +  
Sbjct  419   QCLIAGTVDFIFGNAAAVLQNCDIHARRPGSGQKNMVTAQGRTDPNQNTGIVIQNCRIGA  478

Query  1362  SSDLGPVKGTIQTYLGRPWKEYSRTVFMESNIGDHIDPAGWFPWDGDFALKTLYYGEYMN  1541
             +SDL PV+ +  TYLGRPWKEYSRTV M+S+I D I+ AGW  W+G+FAL TL+YGEY N
Sbjct  479   TSDLRPVQKSFPTYLGRPWKEYSRTVIMQSSITDVINSAGWHEWNGNFALNTLFYGEYQN  538

Query  1542  RGPGAGTSKRVNWPGYHVITDKAEAMKFTVAQLIQGGSWLKNTGVDYTEGL  1694
              G GAGTS RV W G+ VIT   EA  +T  + I GGSWL +TG  ++ GL
Sbjct  539   TGAGAGTSGRVKWRGFKVITSATEAQAYTPGRFIAGGSWLGSTGFPFSLGL  589



>ref|XP_007024770.1| Pectin methylesterase 3 isoform 1 [Theobroma cacao]
 gb|EOY27392.1| Pectin methylesterase 3 isoform 1 [Theobroma cacao]
Length=582

 Score =   448 bits (1153),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 234/453 (52%), Positives = 293/453 (65%), Gaps = 24/453 (5%)
 Frame = +3

Query  402   QAAVADCMELLDLSQDKVMDSMVALGNLSARARTDAH-----SWLSSVLTNHDTCLDGLS  566
             + A+ DC+E +D + D++ +++  L     +     H     + +S+ +TN +TCLDG S
Sbjct  132   KTALHDCLETIDETLDELHEAVEDLHEYPNKKSLTQHADDLKTLMSAAMTNQETCLDGFS  191

Query  567   EPA-----RSIM-------EPMIKDLISRAKsslavlvavaPSTEDDLRAL----NG-EF  695
               A     R ++       E M  + ++  K+     +A         R L    NG  +
Sbjct  192   HDAADKKIRKVLIDGEKYVERMCSNALAMIKNMTDTDIANEMLKTSSNRKLKEQENGIAW  251

Query  696   PSWVSASDRRLLEASanavaanvvvaKDGSGKYKTVAEAVASAPDNGKTRYVIYIKKGTY  875
             P W+SA DRRLL++S+      V    DGSG YKTV+EAVA AP     RYVI IK G Y
Sbjct  252   PEWLSAGDRRLLQSSSVTPDVVVAA--DGSGNYKTVSEAVAKAPQRSSKRYVIKIKAGVY  309

Query  876   KENVEIGKKKTNVMLIGDGLSATIITGSLNYVDGATTFNSATVAAVGDGFIAQDLRIQNT  1055
             +ENVE+ KKKTN+M +GDG + TIITGS N VDG+TTF+SATVA VG+ F+A+D+  QNT
Sbjct  310   RENVEVPKKKTNIMFLGDGRTETIITGSRNVVDGSTTFHSATVAVVGERFLARDITFQNT  369

Query  1056  AGPEKHQAVALRLGADQSVINRCKIDAYQDTLYAHSQRQFYRDCYITGTVDFIFGNAAAV  1235
             AGP KHQAVALR+GAD S    C + AYQDTLYAHS RQFY +C I GTVDFIFGNAAAV
Sbjct  370   AGPSKHQAVALRVGADLSAFYECDMLAYQDTLYAHSNRQFYVNCIIAGTVDFIFGNAAAV  429

Query  1236  IQNSQVVARKPMAAQKNMVTAQGRTDPNQNTGTSIQNCNVSPSSDLGPVKGTIQTYLGRP  1415
              QN  + AR+P + QKNMVTAQGRTDPNQNTG  IQ C +  +SDL  V+    TYLGRP
Sbjct  430   FQNCDIHARRPNSGQKNMVTAQGRTDPNQNTGIVIQKCRIGATSDLQSVRSNFPTYLGRP  489

Query  1416  WKEYSRTVFMESNIGDHIDPAGWFPWDGDFALKTLYYGEYMNRGPGAGTSKRVNWPGYHV  1595
             WKEYSRTV M+S I D I PAGW  W   FAL+TL+YGEY N G GAGTS RV W GY V
Sbjct  490   WKEYSRTVVMQSVISDVIHPAGWHEWSESFALRTLFYGEYQNTGAGAGTSGRVKWEGYKV  549

Query  1596  ITDKAEAMKFTVAQLIQGGSWLKNTGVDYTEGL  1694
             IT  +EA  ++  + I GGSWL +TG  ++ GL
Sbjct  550   ITSASEAQAYSPGRFIAGGSWLSSTGFPFSLGL  582



>gb|KFK26958.1| hypothetical protein AALP_AA8G315400 [Arabis alpina]
Length=584

 Score =   448 bits (1153),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 220/449 (49%), Positives = 300/449 (67%), Gaps = 16/449 (4%)
 Frame = +3

Query  396   KVQAAVADCMELLDLSQDKVMD--SMVALGNL-SARARTDAHSWLSSVLTNHDTCLDGLS  566
             +V++A   C+ELLD S D +    S+VA+ +  +    +D  +WLSS +TNHDTC DG  
Sbjct  134   RVRSAYDSCLELLDDSVDALSRALSLVAIASEDNGEHHSDVVTWLSSAMTNHDTCTDGFE  193

Query  567   EPARSIMEPMIKDLISRAKsslavlvavaPSTED--------DLRALNGE----FPSWVS  710
             E +  + + +I+ +   ++     L   + + +D        + + LN E    FP W++
Sbjct  194   EISSGVKDQIIEAVKDLSEMVSNCLAIFSGNVKDLSGVPVVNNRKLLNTEETEEFPKWLN  253

Query  711   ASDRRLLEASanavaanvvvaKDGSGKYKTVAEAVASAPDNGKTRYVIYIKKGTYKE-NV  887
               DR LL   A  + A++ V+KDG+G +KT+AEA+  AP++   R+VIY+K G Y+E N+
Sbjct  254   RGDRELLGTPATTIQADITVSKDGNGTFKTIAEAIKKAPEHSSRRFVIYVKSGRYEEENL  313

Query  888   EIGKKKTNVMLIGDGLSATIITGSLNYVDGATTFNSATVAAVGDGFIAQDLRIQNTAGPE  1067
             ++G+KKTN+M IGDG   T+ITG  +  +  TTF++AT AA G GFI +D+  +N AGP 
Sbjct  314   KVGRKKTNIMFIGDGKGKTVITGGKSIANDLTTFHTATFAATGAGFIVRDMTFENYAGPA  373

Query  1068  KHQAVALRLGADQSVINRCKIDAYQDTLYAHSQRQFYRDCYITGTVDFIFGNAAAVIQNS  1247
             KHQAVALR+G D +V+ RC +  YQD LY HS RQF+R+C I GTVDFIFGNAA ++Q+ 
Sbjct  374   KHQAVALRVGGDHAVVYRCNVIGYQDALYVHSNRQFFRECDIYGTVDFIFGNAAVILQSC  433

Query  1248  QVVARKPMAAQKNMVTAQGRTDPNQNTGTSIQNCNVSPSSDLGPVKGTIQTYLGRPWKEY  1427
              + ARKPM  QK  +TAQ R DPNQNTG SI  C +  ++DL   KG+  TYLGRPWK Y
Sbjct  434   NIYARKPMPQQKITITAQNRKDPNQNTGISIHACKLLATADLEASKGSYPTYLGRPWKLY  493

Query  1428  SRTVFMESNIGDHIDPAGWFPWDGDFALKTLYYGEYMNRGPGAGTSKRVNWPGYHVITDK  1607
             SR V+M S++GDHI+P GW  W+G FAL TLYYGEYMNRG G+GT +R+ WPGYH+IT  
Sbjct  494   SRVVYMMSDMGDHINPQGWLEWNGPFALDTLYYGEYMNRGAGSGTGQRIKWPGYHIITST  553

Query  1608  AEAMKFTVAQLIQGGSWLKNTGVDYTEGL  1694
              EA KFTVAQ I G +WL +TGV +  GL
Sbjct  554   VEASKFTVAQFISGSAWLPSTGVSFFSGL  582



>ref|XP_007217169.1| hypothetical protein PRUPE_ppa003285mg [Prunus persica]
 gb|EMJ18368.1| hypothetical protein PRUPE_ppa003285mg [Prunus persica]
Length=587

 Score =   448 bits (1153),  Expect = 3e-146, Method: Compositional matrix adjust.
 Identities = 231/454 (51%), Positives = 295/454 (65%), Gaps = 25/454 (6%)
 Frame = +3

Query  402   QAAVADCMELLDLSQDKVMDSMVALGNLSARAR------TDAHSWLSSVLTNHDTCLDGL  563
             + A+ DC+E +D + D++  ++  L     + +       D  + +SS +TN +TCLDG 
Sbjct  136   KVALHDCLENIDETLDELHAAVADLHEYPNKNKPLTQYADDLKTLISSAITNQETCLDGF  195

Query  564   S-----EPARSIMEP---MIKDLISRAKsslavlvavaPSTEDDL---RALNGE------  692
             S     +  R ++E     ++ L S A + +  +     +    +   R L  E      
Sbjct  196   SHDDADKKVRKVLEKGQVHVEQLCSNALAMIRNMTDNDIANASKMNVNRKLKEEVVEEKG  255

Query  693   FPSWVSASDRRLLEASanavaanvvvaKDGSGKYKTVAEAVASAPDNGKTRYVIYIKKGT  872
             +P W+S +DRRLL++S       V    DGSG YKTV+EAVA+AP+   TRYVI IK G 
Sbjct  256   WPEWLSVADRRLLQSSTVTPNVVVAA--DGSGNYKTVSEAVAAAPEKSSTRYVIRIKAGV  313

Query  873   YKENVEIGKKKTNVMLIGDGLSATIITGSLNYVDGATTFNSATVAAVGDGFIAQDLRIQN  1052
             Y+ENV++ KKKTN+M +GDG ++TIIT S N VDG+TTFNSATVAAVG+ F+A+D+  QN
Sbjct  314   YRENVDVPKKKTNIMFLGDGRTSTIITASRNVVDGSTTFNSATVAAVGEKFLARDITFQN  373

Query  1053  TAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYAHSQRQFYRDCYITGTVDFIFGNAAA  1232
             TAGP KHQAVALR+G+D S   R  I AYQD+LY HS RQF+  C + GTVDFIFGNAA 
Sbjct  374   TAGPSKHQAVALRVGSDLSAFYRVDILAYQDSLYVHSNRQFFEGCLVAGTVDFIFGNAAV  433

Query  1233  VIQNSQVVARKPMAAQKNMVTAQGRTDPNQNTGTSIQNCNVSPSSDLGPVKGTIQTYLGR  1412
             V+QN  + ARKP + QKNMVTAQGRTDPNQNTG  IQ   +  +SDL  VKG+ +T+LGR
Sbjct  434   VLQNCDIHARKPNSGQKNMVTAQGRTDPNQNTGIVIQKSRIGATSDLQAVKGSFKTFLGR  493

Query  1413  PWKEYSRTVFMESNIGDHIDPAGWFPWDGDFALKTLYYGEYMNRGPGAGTSKRVNWPGYH  1592
             PWKEYSRTV M+S I D IDPAGW  W G FAL TL+YGEY N G GAG S RV W G+ 
Sbjct  494   PWKEYSRTVIMQSAISDIIDPAGWHEWSGTFALDTLFYGEYANTGAGAGISNRVTWKGFK  553

Query  1593  VITDKAEAMKFTVAQLIQGGSWLKNTGVDYTEGL  1694
             VIT   EA  FT    I GGSWL +TG  ++ GL
Sbjct  554   VITSATEAQTFTPGSFIAGGSWLSSTGFPFSLGL  587



>ref|XP_002317777.2| hypothetical protein POPTR_0012s02170g [Populus trichocarpa]
 gb|EEE95997.2| hypothetical protein POPTR_0012s02170g [Populus trichocarpa]
Length=602

 Score =   449 bits (1155),  Expect = 3e-146, Method: Compositional matrix adjust.
 Identities = 244/521 (47%), Positives = 327/521 (63%), Gaps = 24/521 (5%)
 Frame = +3

Query  195   PSLWKARVCDPAHDPPSCMAIVSEV-SSAAPTETDGVAllqmllhssllRIQDAVKLSAN  371
             P+   ++ C     P  C++ + +   S   +E+D V    +  + +LL +  A+ LS+ 
Sbjct  83    PTQAISKACSKTRFPALCVSSLLDFPGSMTASESDLV---HISFNMTLLHLDKALYLSSG  139

Query  372   VNRRINDRKVQAAVADCMELLDLSQDKVMDSM--VALGNLSARARTDAHSWLSSVLTNHD  545
             ++    +   ++A  DC+ELL+ S D +  S+  V+  +    +  D  +WLS+ LTN D
Sbjct  140   ISYVNMETHERSAFDDCLELLEDSIDALTRSLSTVSPSSGGGGSPEDVVTWLSAALTNQD  199

Query  546   TC---LDGLSEPARSIMEPMIKDLISRAKsslavlvavaPS--------------TEDDL  674
             TC    +G++   +  M   +KDL     + LA+  A                  TED  
Sbjct  200   TCSEGFEGVNGTVKDQMTEKLKDLTELVSNCLAIFSATNGGDFSGVPIQNKRRLMTEDGD  259

Query  675   RALNGEFPSWVSASDRRLLEASanavaanvvvaKDGSGKYKTVAEAVASAPDNGKTRYVI  854
              +    FPSW+   +RRLL    +A+ A+++V+ DGSG +KT++EA+  AP++   R +I
Sbjct  260   ISEEDNFPSWLGRRERRLLGLPVSAIQADIIVSGDGSGTFKTISEAIKKAPEHSNRRTII  319

Query  855   YIKKGTYKE-NVEIGKKKTNVMLIGDGLSATIITGSLNYVDGATTFNSATVAAVGDGFIA  1031
             Y++ G Y E N+++G+KK N+M IGDG+  TIITGS +  +  TTF++A+ AA G GFIA
Sbjct  320   YVRAGRYVEDNLKVGRKKWNLMFIGDGMGKTIITGSRSVFNHITTFHTASFAATGAGFIA  379

Query  1032  QDLRIQNTAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYAHSQRQFYRDCYITGTVDF  1211
             +D+  +N AGP KHQAVALR+GAD +V+ RC I  YQDTLY HS RQFYR+C I GTVDF
Sbjct  380   RDMTFENWAGPAKHQAVALRVGADHAVVYRCSIIGYQDTLYVHSNRQFYRECDIYGTVDF  439

Query  1212  IFGNAAAVIQNSQVVARKPMAAQKNMVTAQGRTDPNQNTGTSIQNCNVSPSSDLGPVKGT  1391
             IFGNAA V+QN  + ARKPMA+QKN +TAQ R DPNQNTG SI  C +  +SDL P KGT
Sbjct  440   IFGNAAVVLQNCSIYARKPMASQKNTITAQNRKDPNQNTGISIHACKILAASDLAPSKGT  499

Query  1392  IQTYLGRPWKEYSRTVFMESNIGDHIDPAGWFPWDGDFALKTLYYGEYMNRGPGAGTSKR  1571
               TYLGRPWK YSRTV+M S +GDHI P GW  WD  FAL TLYYGEYMN GPGA   +R
Sbjct  500   FPTYLGRPWKLYSRTVYMLSFMGDHIHPRGWLEWDASFALDTLYYGEYMNYGPGAAVGQR  559

Query  1572  VNWPGYHVITDKAEAMKFTVAQLIQGGSWLKNTGVDYTEGL  1694
             V WPGY VIT   EA KFTVAQ I G SWL +TGV +  GL
Sbjct  560   VKWPGYRVITSTVEANKFTVAQFIYGSSWLPSTGVAFLAGL  600



>sp|Q43062.1|PME_PRUPE RecName: Full=Pectinesterase/pectinesterase inhibitor PPE8B; 
Includes: RecName: Full=Pectinesterase inhibitor PPE8B; AltName: 
Full=Pectin methylesterase inhibitor PPE8B; Includes: RecName: 
Full=Pectinesterase PPE8B; Short=PE PPE8B; AltName: 
Full=Pectin methylesterase PPE8B; Flags: Precursor [Prunus persica]
 emb|CAA65237.1| pectinesterase [Prunus persica]
Length=522

 Score =   446 bits (1147),  Expect = 3e-146, Method: Compositional matrix adjust.
 Identities = 227/455 (50%), Positives = 298/455 (65%), Gaps = 11/455 (2%)
 Frame = +3

Query  342   IQDAVKLSANVNRRINDRKVQAAVADCMELLDLSQDKVMDSMVA------LGNLSARART  503
             +Q    + +       D ++  A++DC++LLD S D++  S+ A        N + +  +
Sbjct  67    VQQVASILSQFANAFGDFRLANAISDCLDLLDFSADELNWSLSASQNQKGKNNSTGKLSS  126

Query  504   DAHSWLSSVLTNHDTCLDGLSEPARSIMEPMIKDLISRAKsslavlvavaPSTEDDLRAL  683
             D  +WLS+ L N DTC +G  E   SI++ +I   + +  S +  L+       +  +  
Sbjct  127   DLRTWLSAALVNQDTCSNGF-EGTNSIVQGLISAGLGQVTSLVQELLTQVHPNSNQ-QGP  184

Query  684   NGEFPSWVSASDRRLLEASanavaanvvvaKDGSGKYKTVAEAVASAPDNGKTRYVIYIK  863
             NG+ PSWV   DR+LL+A   +V A V   +DG+G +  V +AV +APD    RYVIYIK
Sbjct  185   NGQIPSWVKTKDRKLLQADGVSVDAIVA--QDGTGNFTNVTDAVLAAPDYSMRRYVIYIK  242

Query  864   KGTYKENVEIGKKKTNVMLIGDGLSATIITGSLNYVDGATTFNSATVAAVGDGFIAQDLR  1043
             +GTYKENVEI KKK N+M+IGDG+ ATII+G+ ++VDG TTF SAT A  G GFIA+D+ 
Sbjct  243   RGTYKENVEIKKKKWNLMMIGDGMDATIISGNRSFVDGWTTFRSATFAVSGRGFIARDIT  302

Query  1044  IQNTAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYAHSQRQFYRDCYITGTVDFIFGN  1223
              +NTAGPEKHQAVALR  +D SV  RC I  YQDTLY H+ RQFYRDC I+GTVDFIFG+
Sbjct  303   FENTAGPEKHQAVALRSDSDLSVFYRCNIRGYQDTLYTHTMRQFYRDCKISGTVDFIFGD  362

Query  1224  AAAVIQNSQVVARKPMAAQKNMVTAQGRTDPNQNTGTSIQNCNVSPSSDLGPVK-GTIQT  1400
             A  V QN Q++A+K +  QKN +TAQGR DPN+ TG SIQ CN++  SDL      +  T
Sbjct  363   ATVVFQNCQILAKKGLPNQKNSITAQGRKDPNEPTGISIQFCNITADSDLEAASVNSTPT  422

Query  1401  YLGRPWKEYSRTVFMESNIGDHIDPAGWFPWDGDFALKTLYYGEYMNRGPGAGTSKRVNW  1580
             YLGRPWK YSRTV M+S + + I P GW  W+GDFAL +L+YGEYMN GPGAG   RV W
Sbjct  423   YLGRPWKLYSRTVIMQSFLSNVIRPEGWLEWNGDFALNSLFYGEYMNYGPGAGLGSRVKW  482

Query  1581  PGYHVITDKAEAMKFTVAQLIQGGSWLKNTGVDYT  1685
             PGY V  +  +A  +TVAQ I+G  WL +TGV YT
Sbjct  483   PGYQVFNESTQAKNYTVAQFIEGNLWLPSTGVKYT  517



>ref|NP_001233857.2| pectinesterase/pectinesterase inhibitor U1 precursor [Solanum 
lycopersicum]
Length=583

 Score =   448 bits (1152),  Expect = 4e-146, Method: Compositional matrix adjust.
 Identities = 249/530 (47%), Positives = 328/530 (62%), Gaps = 31/530 (6%)
 Frame = +3

Query  183   SSSSPSLWKARVCDPAHDPPSCMAI---VSEVSSAAPTETDGVAllqmllhssllRIQDA  353
             SSS+ ++ K+   +  H P  C +    VS+ S    ++ D + L   +   ++ R   A
Sbjct  59    SSSAHAIVKSACSNTLH-PELCYSAIVNVSDFSKKVTSQKDVIELSLNITVKAVRRNYYA  117

Query  354   VKLSANVNRRINDRKVQAAVADCMELLDLSQDKVMDSMVAL------GNLSARARTDAHS  515
             VK      + +  R+ + A+ DC+E +D + D++  ++  L       +L   A  D  +
Sbjct  118   VKELIKTRKGLTPRE-KVALHDCLETMDETLDELHTAVEDLELYPNKKSLKEHAE-DLKT  175

Query  516   WLSSVLTNHDTCLDGLS--EPARSIMEPMIKDLISRAKsslavlvavaPSTEDDL-----  674
              +SS +TN +TCLDG S  E  + + + ++K      K     L  +   T+ D+     
Sbjct  176   LISSAITNQETCLDGFSHDEADKKVRKVLLKGQKHVEKMCSNALAMICNMTDTDIANEMK  235

Query  675   -------RAL---NGEFPSWVSASDRRLLEASanavaanvvvaKDGSGKYKTVAEAVASA  824
                    R L   NGE+P W+SA DRRLL++S       V    DGSG YKTV+EAVA A
Sbjct  236   LSAPANNRKLVEDNGEWPEWLSAGDRRLLQSSTVTPDVVVAA--DGSGDYKTVSEAVAKA  293

Query  825   PDNGKTRYVIYIKKGTYKENVEIGKKKTNVMLIGDGLSATIITGSLNYVDGATTFNSATV  1004
             P+    RYVI IK G Y+ENV++ KKKTN+M +GDG S TIIT S N  DG+TTF+SATV
Sbjct  294   PEKSSKRYVIRIKAGVYRENVDVPKKKTNIMFMGDGKSNTIITASRNVQDGSTTFHSATV  353

Query  1005  AAVGDGFIAQDLRIQNTAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYAHSQRQFYRD  1184
             AAVG+ F+A+D+  QNTAG  KHQAVALR+G+D S   RC + AYQDTLY HS RQF+  
Sbjct  354   AAVGEKFLARDITFQNTAGASKHQAVALRVGSDLSAFYRCDMLAYQDTLYVHSNRQFFVQ  413

Query  1185  CYITGTVDFIFGNAAAVIQNSQVVARKPMAAQKNMVTAQGRTDPNQNTGTSIQNCNVSPS  1364
             C + GTVDFIFGN AAV Q+  + AR+P + QKNMVTAQGRTDPNQNTG  IQ C +  +
Sbjct  414   CLVAGTVDFIFGNGAAVFQDCDIHARRPGSGQKNMVTAQGRTDPNQNTGIVIQKCRIGAT  473

Query  1365  SDLGPVKGTIQTYLGRPWKEYSRTVFMESNIGDHIDPAGWFPWDGDFALKTLYYGEYMNR  1544
             SDL PV+ +  TYLGRPWKEYSRTV M+S+I D I PAGW  W+G+FAL TL+YGEY N 
Sbjct  474   SDLRPVQKSFPTYLGRPWKEYSRTVIMQSSITDVIQPAGWHEWNGNFALDTLFYGEYANT  533

Query  1545  GPGAGTSKRVNWPGYHVITDKAEAMKFTVAQLIQGGSWLKNTGVDYTEGL  1694
             G GA TS RV W G+ VIT   EA  +T  + I GGSWL +TG  ++ GL
Sbjct  534   GAGAPTSGRVKWKGHKVITSSTEAQAYTPGRFIAGGSWLSSTGFPFSLGL  583



>ref|XP_002322401.1| putative pectin methylesterase family protein [Populus trichocarpa]
 gb|EEF06528.1| putative pectin methylesterase family protein [Populus trichocarpa]
Length=517

 Score =   445 bits (1145),  Expect = 6e-146, Method: Compositional matrix adjust.
 Identities = 229/444 (52%), Positives = 291/444 (66%), Gaps = 17/444 (4%)
 Frame = +3

Query  381   RINDRKVQAAVADCMELLDLSQDKVMDSMVALGNLSARARTDAHSWLSSVLTNHDTCLDG  560
             +  + K +AA ADC++L    +D + +    + + +   + DA +WLS+ LTN +TC  G
Sbjct  85    KCRNEKEKAAWADCLKLY---EDTIAELNHTIDSNTKCTQFDAQTWLSTALTNLETCKAG  141

Query  561   LSEPARS-----IMEPMIKDLISRAKsslavlvavaPSTEDDLRALNGEFPSWVSASDRR  725
               +   S     +M   +  LI    +      +  P T  D       FPSWV A DR+
Sbjct  142   FKDLGVSDFVLPLMSNNVSKLIRNTLALKDNASSTLPQTYKD------GFPSWVKAGDRK  195

Query  726   LLEASanavaanvvvaKDGSGKYKTVAEAV-ASAPDNGKTRYVIYIKKGTYKENVEIGKK  902
             LL+ S+ +    V   +DGSG ++T+  A+ A+A  +G  R+VI IK G Y+EN++IGKK
Sbjct  196   LLQTSSPSPNLVVA--QDGSGNHRTIKAALDAAAKRSGSRRFVIRIKSGVYRENLDIGKK  253

Query  903   KTNVMLIGDGLSATIITGSLNYVDGATTFNSATVAAVGDGFIAQDLRIQNTAGPEKHQAV  1082
               N+ML+GDGL  TIITGS +   G TTFNSATVA  G+GFIA+ +  +NTAGP+ HQAV
Sbjct  254   LKNIMLVGDGLRNTIITGSRSVGGGFTTFNSATVAVTGEGFIARGITFRNTAGPQNHQAV  313

Query  1083  ALRLGADQSVINRCKIDAYQDTLYAHSQRQFYRDCYITGTVDFIFGNAAAVIQNSQVVAR  1262
             ALR G+D SV  RC  + YQDTLY HSQRQFY++CYI GTVDFIFGNAA ++QN  + AR
Sbjct  314   ALRSGSDLSVFYRCGFEGYQDTLYVHSQRQFYKECYIYGTVDFIFGNAAVILQNCMIYAR  373

Query  1263  KPMAAQKNMVTAQGRTDPNQNTGTSIQNCNVSPSSDLGPVKGTIQTYLGRPWKEYSRTVF  1442
             +PM  QKN+VTAQGRTDPNQNTG SI N  V  SSDL PV  + +TYLGRPWKEYSRTVF
Sbjct  374   RPMDKQKNVVTAQGRTDPNQNTGISIHNSRVMASSDLRPVLSSFKTYLGRPWKEYSRTVF  433

Query  1443  MESNIGDHIDPAGWFPWDGDFALKTLYYGEYMNRGPGAGTSKRVNWPGYHVITDKAEAMK  1622
             +++ +   +DPAGW  WDG+FAL TLYYGEY N GPGA T  RV W GY VIT   EA +
Sbjct  434   LQTYLDSLVDPAGWLEWDGNFALNTLYYGEYRNSGPGASTRGRVKWRGYRVITSSTEASR  493

Query  1623  FTVAQLIQGGSWLKNTGVDYTEGL  1694
             FTVA  I G SWL  TGV +  GL
Sbjct  494   FTVANFIAGRSWLPATGVPFYPGL  517



>ref|XP_010267633.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 61 
[Nelumbo nucifera]
Length=604

 Score =   448 bits (1152),  Expect = 7e-146, Method: Compositional matrix adjust.
 Identities = 249/543 (46%), Positives = 327/543 (60%), Gaps = 39/543 (7%)
 Frame = +3

Query  171   ALRTSSSS---------PSLWKARVCDPAHDPPSCMAIVSEVSSA-APTETDGVAllqml  320
              LRT  SS         P+   +R C     P  C+  + E   A A  + D V +   +
Sbjct  64    GLRTKGSSGALSPVRKRPTQAISRTCSKTRYPDLCINSLVEFPGALAAGDRDLVHISFNM  123

Query  321   lhssllRIQDAVKLSANVNRRINDRKVQAAVADCMELLDLSQDKVMDSMVAL------GN  482
                 + +    V   ANV     D   ++A  DC+ELL+ S D++  S+ ++      G 
Sbjct  124   TLQRVGKALYGVSEIANVAM---DALARSAYEDCLELLEDSMDQLSLSLNSVAPPEQGGG  180

Query  483   LSARARTDAHSWLSSVLTNHDTCLDGLSEPARSIMEPM------IKDLISR-----AKss  629
                 +  D  +WLS+ LTN DTC +GLS+ + ++ + M      I +L+S      A SS
Sbjct  181   KGVGSTEDVMTWLSAALTNQDTCNEGLSDVSGNVKDQMQNRLSDISELVSNCLAIFASSS  240

Query  630   lavlvavaP-------STEDDLRALNGEFPSWVSASDRRLLEASanavaanvvvaKDGSG  788
                  +  P        TE   +    E P+W++  +RRLLE   +++ A++VV+KDG+G
Sbjct  241   GNEDFSGIPIQNKRRLMTESSFQT-EEELPAWLTRRERRLLEMPVSSIQADIVVSKDGTG  299

Query  789   KYKTVAEAVASAPDNGKTRYVIYIKKGTYKE-NVEIGKKKTNVMLIGDGLSATIITGSLN  965
              YKT+ EA+ + P++   R +IY+K GTY+E N+++G+KKTN+M IGDG   T+ITG  N
Sbjct  300   TYKTITEAIKAVPEHSNRRTIIYVKAGTYEESNLKVGRKKTNLMFIGDGRGKTVITGGKN  359

Query  966   YVDGATTFNSATVAAVGDGFIAQDLRIQNTAGPEKHQAVALRLGADQSVINRCKIDAYQD  1145
               +  TTF++A+ AA G GFIA+D+  +N AGP  HQAVALR+GAD +V+ RC I  YQD
Sbjct  360   VFEKYTTFHTASFAATGAGFIARDMTFENYAGPSNHQAVALRVGADHAVVYRCNIIGYQD  419

Query  1146  TLYAHSQRQFYRDCYITGTVDFIFGNAAAVIQNSQVVARKPMAAQKNMVTAQGRTDPNQN  1325
             TLY HSQRQFYR+C I GTVDFIFGNAA V+QN  + ARKPM  QKN +TAQ R DPNQN
Sbjct  420   TLYVHSQRQFYRECDIYGTVDFIFGNAAVVLQNCTIYARKPMDQQKNTITAQNRKDPNQN  479

Query  1326  TGTSIQNCNVSPSSDLGPVKGTIQTYLGRPWKEYSRTVFMESNIGDHIDPAGWFPWDGDF  1505
             TG SI NC +  +SDL   K    TYLGRPWK YSRTV++ S +GDHI P GW  W+  F
Sbjct  480   TGISIHNCRILATSDLEASKAYFPTYLGRPWKLYSRTVYLLSYMGDHIHPRGWLEWNATF  539

Query  1506  ALKTLYYGEYMNRGPGAGTSKRVNWPGYHVITDKAEAMKFTVAQLIQGGSWLKNTGVDYT  1685
             AL TLYYGEYMN GPGA    RV WPGY VIT   EA KFTV Q I G SWL +TGV + 
Sbjct  540   ALDTLYYGEYMNYGPGAAVGLRVKWPGYRVITSTVEASKFTVGQFISGSSWLPSTGVAFL  599

Query  1686  EGL  1694
              GL
Sbjct  600   AGL  602



>emb|CDY35644.1| BnaC09g29660D [Brassica napus]
Length=456

 Score =   442 bits (1138),  Expect = 7e-146, Method: Compositional matrix adjust.
 Identities = 224/452 (50%), Positives = 297/452 (66%), Gaps = 20/452 (4%)
 Frame = +3

Query  396   KVQAAVADCMELLDLSQD---KVMDSMVALGNLSARARTDAHSWLSSVLTNHDTCLDGLS  566
             +V++A   C+ELLD S D   + + S+VA  + S  + +D  +WLSS +TNHDTC +G  
Sbjct  4     RVRSAYDSCLELLDDSVDALSRALSSIVAASS-SDESHSDVMTWLSSAMTNHDTCTEGFD  62

Query  567   EPARS---IMEPMIKDLISRAKsslavlvavaPSTED-------DLRALNGE-----FPS  701
             E       + + +I  +   ++     L   + +  D       + R L GE     FP+
Sbjct  63    EAGDGGGGVKDQVIGAVKDLSEMVSNCLAIFSGNVNDLSGVPVVNHRKLLGEEETEEFPN  122

Query  702   WVSASDRRLLEASanavaanvvvaKDGSGKYKTVAEAVASAPDNGKTRYVIYIKKGTYKE  881
             W+   DR LL   A  + A++ V+KDG+G +KT+AEA+  AP++   R+VIY+K G Y+E
Sbjct  123   WLKRGDRELLGTPATKIQADITVSKDGNGTFKTIAEAIKKAPEHSSRRFVIYVKAGKYEE  182

Query  882   NV-EIGKKKTNVMLIGDGLSATIITGSLNYVDGATTFNSATVAAVGDGFIAQDLRIQNTA  1058
              + ++G+KKTN+M IGDG   T+ITG  + VD  TTF++AT AA G GFI +D+  +N A
Sbjct  183   EILKVGRKKTNLMFIGDGKGRTVITGGKSIVDDLTTFHTATFAATGAGFIVRDITFENYA  242

Query  1059  GPEKHQAVALRLGADQSVINRCKIDAYQDTLYAHSQRQFYRDCYITGTVDFIFGNAAAVI  1238
             GP KHQAVALR+G D +V+ RC I  YQD LY HS RQF+R+C I GTVDFIFGNAA ++
Sbjct  243   GPAKHQAVALRVGGDHAVVYRCSIIGYQDALYVHSNRQFFRECEIYGTVDFIFGNAAVIL  302

Query  1239  QNSQVVARKPMAAQKNMVTAQGRTDPNQNTGTSIQNCNVSPSSDLGPVKGTIQTYLGRPW  1418
             Q+  + ARKPM  QK  +TAQ R DPNQNTG SI  C +  ++DL   KG+  TYLGRPW
Sbjct  303   QSCNIYARKPMPQQKITITAQNRKDPNQNTGISIHACKLLATADLEASKGSYPTYLGRPW  362

Query  1419  KEYSRTVFMESNIGDHIDPAGWFPWDGDFALKTLYYGEYMNRGPGAGTSKRVNWPGYHVI  1598
             K YSR V+M S++GDHI+P GW  W+G FAL +LYYGEYMNRGPG+ T +RV WPGYHVI
Sbjct  363   KLYSRVVYMMSDMGDHINPRGWLEWNGPFALDSLYYGEYMNRGPGSSTGQRVKWPGYHVI  422

Query  1599  TDKAEAMKFTVAQLIQGGSWLKNTGVDYTEGL  1694
             T   EA KFTV Q I G SWL +TGV +  GL
Sbjct  423   TSTVEASKFTVGQFIGGSSWLPSTGVAFFSGL  454



>ref|XP_009762395.1| PREDICTED: pectinesterase/pectinesterase inhibitor U1 [Nicotiana 
sylvestris]
Length=589

 Score =   447 bits (1151),  Expect = 7e-146, Method: Compositional matrix adjust.
 Identities = 243/531 (46%), Positives = 319/531 (60%), Gaps = 56/531 (11%)
 Frame = +3

Query  219   CDPAHDPPSCMAIVSEVSSAAPTETDGVAllqmllhssllRIQDAVKLSANVNRR-----  383
             C+    P  C + ++ VS  +   T                 +D ++LS N+  R     
Sbjct  76    CENTLHPELCYSTIASVSDFSKKVTSQ---------------KDVIELSLNITCRAVQHN  120

Query  384   -------INDRK-----VQAAVADCMELLDLSQDKVMDSMVALGNLSARARTDAH-----  512
                    I  RK      + A+ DC+E +D + D++  ++  L     +    AH     
Sbjct  121   FFKVEKLIKTRKGLKPREKVALHDCLETIDETLDELHTAIKDLELYPNKKSLKAHADDLK  180

Query  513   SWLSSVLTNHDTCLDGLS--EPARSIMEPMIKDLISRAKsslavlvavaPSTEDD-----  671
             + +SS +TN +TCLDG S  +  + + + ++K      K     L  +   T+ D     
Sbjct  181   TLISSAITNQETCLDGFSHDDADKKVRKALLKGQKHVEKMCSNALAMICNMTDTDIANEQ  240

Query  672   ----------LRALNGEFPSWVSASDRRLLEASanavaanvvvaKDGSGKYKTVAEAVAS  821
                       LR  N E+P W+SA DRRLL++S       V    DGSG +KTV+EAVA 
Sbjct  241   KLKGTTTNRKLREDNSEWPEWLSAGDRRLLQSSTVRPDVVVAA--DGSGNFKTVSEAVAK  298

Query  822   APDNGKTRYVIYIKKGTYKENVEIGKKKTNVMLIGDGLSATIITGSLNYVDGATTFNSAT  1001
             AP+    RYVI IK G Y+ENV++ KKKTN+M +GDG S TIITGS N  DG+TTF+SAT
Sbjct  299   APEKSSKRYVIRIKAGVYRENVDVPKKKTNIMFMGDGRSNTIITGSRNVKDGSTTFHSAT  358

Query  1002  VAAVGDGFIAQDLRIQNTAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYAHSQRQFYR  1181
             VAAVG+ F+A+D+  QNTAG  KHQAVALR+G+D S   RC I AYQD+LY HS RQ++ 
Sbjct  359   VAAVGEKFLARDITFQNTAGAAKHQAVALRVGSDLSAFYRCDILAYQDSLYVHSNRQYFV  418

Query  1182  DCYITGTVDFIFGNAAAVIQNSQVVARKPMAAQKNMVTAQGRTDPNQNTGTSIQNCNVSP  1361
              C I GTVDFIFGNAAAV+Q+  + AR+P + QKNMVTAQGR+DPNQNTG  IQ C +  
Sbjct  419   QCLIAGTVDFIFGNAAAVLQDCDIHARRPGSGQKNMVTAQGRSDPNQNTGIVIQKCRIGA  478

Query  1362  SSDLGPVKGTIQTYLGRPWKEYSRTVFMESNIGDHIDPAGWFPWDGDFALKTLYYGEYMN  1541
             +SDL PV+ +  TYLGRPWKEYSRTV M+S+I D I+ AGW  W+G+FAL TL+YGEY N
Sbjct  479   TSDLRPVQKSFPTYLGRPWKEYSRTVIMQSSITDVINSAGWHEWNGNFALNTLFYGEYQN  538

Query  1542  RGPGAGTSKRVNWPGYHVITDKAEAMKFTVAQLIQGGSWLKNTGVDYTEGL  1694
              G GAGTS RV W G+ VIT   EA  +T  + I GGSWL +TG  ++ GL
Sbjct  539   TGAGAGTSGRVKWKGFKVITSATEAQAYTPGRFIAGGSWLSSTGFPFSLGL  589



>ref|XP_010056336.1| PREDICTED: pectinesterase 2-like [Eucalyptus grandis]
Length=515

 Score =   445 bits (1144),  Expect = 7e-146, Method: Compositional matrix adjust.
 Identities = 230/454 (51%), Positives = 307/454 (68%), Gaps = 12/454 (3%)
 Frame = +3

Query  339   RIQDAVKLSANVNRRINDRKVQAAVADCMELLDLSQDKVMDSMVALGNLSARARTDAHSW  518
             R Q A   + ++  + ++ + + A ADC++L    +  V+     +G+   +   +A +W
Sbjct  72    RAQLAHDHTHSLESKCSNEREKVAWADCLQLY---EHTVLRLNRTIGHDCTQ--DEAQTW  126

Query  519   LSSVLTNHDTCLDGLSEPARS-IMEPMIKDLISRAKsslavlvavaPSTEDDLRALNGEF  695
             LS+ LTN +TC  G  E   S  + P++ + +S+  S+   L     +T +  +    +F
Sbjct  127   LSTALTNLETCRAGFVELGISDNVLPLMSNNVSKLISNTLALNYAPFTTPNYTK----KF  182

Query  696   PSWVSASDRRLLEASanavaanvvvaKDGSGKYKTVAEAV-ASAPDNGKTRYVIYIKKGT  872
             P+WV  SDR+LL++S+    AN+VVA+D SG YKT++EA+ A++   G  RY+IYIK GT
Sbjct  183   PTWVRPSDRKLLQSSSAVSKANIVVARDSSGNYKTISEAITAASKRTGTARYIIYIKAGT  242

Query  873   YKENVEIGKKKTNVMLIGDGLSATIITGSLNYVDGATTFNSATVAAVGDGFIAQDLRIQN  1052
             Y EN+E+G K  N+M IGDG+  TIITGS +   G+TTFNSATVA VGDGFIAQD+  +N
Sbjct  243   YNENIEVGSKLDNIMFIGDGIGKTIITGSKSVGGGSTTFNSATVAVVGDGFIAQDITFRN  302

Query  1053  TAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYAHSQRQFYRDCYITGTVDFIFGNAAA  1232
             TAG   HQAVALR G+D SV  RC  + YQDTLY HS+RQFYR+C I GTVDFIFGNAA 
Sbjct  303   TAGAANHQAVALRSGSDLSVFYRCGFEGYQDTLYVHSERQFYRECDIYGTVDFIFGNAAV  362

Query  1233  VIQNSQVVARKPMAAQKNMVTAQGRTDPNQNTGTSIQNCNVSPSSDLGPVKGTIQTYLGR  1412
             V QN  + AR P   + N +TAQGRTDPNQNTG SI NC V+ +SDL  ++ +++TYLGR
Sbjct  363   VFQNCNIYARNP-PNKVNTLTAQGRTDPNQNTGISIHNCKVTAASDLKSIQSSVKTYLGR  421

Query  1413  PWKEYSRTVFMESNIGDHIDPAGWFPWDGDFALKTLYYGEYMNRGPGAGTSKRVNWPGYH  1592
             PWK+YSRT+FM++ +   ++ AGW  WDG+FAL TLYYGEY+N GPG+ T+ RV W GYH
Sbjct  422   PWKQYSRTIFMKTYLDSLVNSAGWMEWDGNFALDTLYYGEYVNTGPGSSTTNRVKWAGYH  481

Query  1593  VITDKAEAMKFTVAQLIQGGSWLKNTGVDYTEGL  1694
             VIT   EA KFTV   + GGSWL  TGV YT GL
Sbjct  482   VITSATEAAKFTVGSFLAGGSWLPATGVPYTSGL  515



>gb|KHG19575.1| Uncharacterized protein F383_07269 [Gossypium arboreum]
Length=519

 Score =   445 bits (1144),  Expect = 7e-146, Method: Compositional matrix adjust.
 Identities = 240/494 (49%), Positives = 324/494 (66%), Gaps = 11/494 (2%)
 Frame = +3

Query  219   CDPAHDPPSCMAIVSEVSSAAPTETDGVAllqmllhssllRIQDAVKLSANVNRRINDRK  398
             C    +P  C   +S      P + D     ++  H +L R   A   + ++  +  + +
Sbjct  35    CRKTPNPQPCEYFLSHDPKKTPIK-DEFQFFKISTHLALERAARAESNTHSLGTKCRNER  93

Query  399   VQAAVADCMELLDLSQDKVMDSMVALGNLSARARTDAHSWLSSVLTNHDTCLDGLSE-PA  575
              +AA +DC+ L +L+  ++  ++ +  NL+   + DA +WLS+ LTN +TC  G  E   
Sbjct  94    EKAAWSDCVNLYELTILRLNKTVDSGTNLN---KDDAQTWLSTALTNLETCRTGFMELGV  150

Query  576   RSIMEPMIKDLISRAKsslavlvavaPSTEDDLRALNGEFPSWVSASDRRLLEASanava  755
                + PM+ + +S+   S  + +  AP  E   +     FP+WV   DR+LL++S+ A  
Sbjct  151   PDYLLPMMSNNVSQL-ISNTLALNKAPYKEPTYK---DGFPTWVKPGDRKLLQSSSPAST  206

Query  756   anvvvaKDGSGKYKTVAEAVASAPD-NGKTRYVIYIKKGTYKENVEIGKKKTNVMLIGDG  932
             AN+VVA+DGSG YKT+ +A+++A   +G  RYVIY+K GTYKENVEIG K  N+M++GDG
Sbjct  207   ANIVVAQDGSGNYKTIKDAISAASKRSGSGRYVIYVKAGTYKENVEIGSKLKNIMMVGDG  266

Query  933   LSATIITGSLNYVDGATTFNSATVAAVGDGFIAQDLRIQNTAGPEKHQAVALRLGADQSV  1112
             +  TIITGS +   G+TTFNSATVA VGDGFIA+ +  +NTAGP  HQAVALR G+D SV
Sbjct  267   IGKTIITGSKSVGGGSTTFNSATVAVVGDGFIARGITFRNTAGPTNHQAVALRSGSDLSV  326

Query  1113  INRCKIDAYQDTLYAHSQRQFYRDCYITGTVDFIFGNAAAVIQNSQVVARKPMAAQKNMV  1292
               +C  + YQDTLY HS+RQFYR+C I GTVD+IFGNAA V Q+  + AR P   + N V
Sbjct  327   FYKCSFEGYQDTLYVHSERQFYRECDIYGTVDWIFGNAAVVFQDCNIYARNP-PNKTNTV  385

Query  1293  TAQGRTDPNQNTGTSIQNCNVSPSSDLGPVKGTIQTYLGRPWKEYSRTVFMESNIGDHID  1472
             TAQGRTDPNQNTG  I N  V+ +SDL PV+ +++TYLGRPWK+YSRTVFM++ +   I+
Sbjct  386   TAQGRTDPNQNTGIIIHNSRVTAASDLKPVQSSVKTYLGRPWKQYSRTVFMKTYLDSLIN  445

Query  1473  PAGWFPWDGDFALKTLYYGEYMNRGPGAGTSKRVNWPGYHVITDKAEAMKFTVAQLIQGG  1652
             PAGW  WDGDFALKTLYY EYMN GPG+ TS RV W GYHV+   +E  KFTV   + G 
Sbjct  446   PAGWMEWDGDFALKTLYYAEYMNTGPGSSTSNRVKWGGYHVLKSASEVSKFTVGNFLAGN  505

Query  1653  SWLKNTGVDYTEGL  1694
             SWL +TGV +T GL
Sbjct  506   SWLPSTGVPFTSGL  519



>gb|AFW03479.1| pectin methylesterase 5 [Gossypium barbadense]
Length=519

 Score =   445 bits (1144),  Expect = 8e-146, Method: Compositional matrix adjust.
 Identities = 242/497 (49%), Positives = 322/497 (65%), Gaps = 17/497 (3%)
 Frame = +3

Query  219   CDPAHDPPSCMAIVSEVSSAAPTETDGVAllqmllhssllRIQDAVKLSANVNRRINDRK  398
             C    +P  C   +S      P + D     ++  H +L R   A   + ++  +  + +
Sbjct  35    CRKTPNPQPCEYFLSHDPKKTPIK-DEFQFFKISTHLALERAARAESNTHSLGTKCRNER  93

Query  399   VQAAVADCMELLDLS---QDKVMDSMVALGNLSARARTDAHSWLSSVLTNHDTCLDGLSE  569
              +AA +DC+ L +L+    +K +DS       +   + DA +WLS+ LTN +TC  G  E
Sbjct  94    EKAAWSDCVNLYELTILRLNKTVDSG------TNHNKDDAQTWLSTALTNLETCRTGFME  147

Query  570   -PARSIMEPMIKDLISRAKsslavlvavaPSTEDDLRALNGEFPSWVSASDRRLLEASan  746
                   + PM+ + +S+   S  + +  AP  E   +     FP+WV   DR+LL++S+ 
Sbjct  148   LGVPDYLLPMMSNNVSQL-ISNTLALNKAPYKEPTYK---DGFPTWVKPGDRKLLQSSSP  203

Query  747   avaanvvvaKDGSGKYKTVAEAVASAPD-NGKTRYVIYIKKGTYKENVEIGKKKTNVMLI  923
             A  AN+VVA+DGSG YKT+ +A+++A   +G  RYVIY+K GTYKENVEIG K  N+M++
Sbjct  204   ASTANIVVAQDGSGNYKTIKDAISAASKRSGSGRYVIYVKAGTYKENVEIGSKLKNIMMV  263

Query  924   GDGLSATIITGSLNYVDGATTFNSATVAAVGDGFIAQDLRIQNTAGPEKHQAVALRLGAD  1103
             GDG+  TIITGS +   G+TTFNSATVA VGDGFIA+ +  +NTAGP  HQAVALR G+D
Sbjct  264   GDGIGKTIITGSKSVGGGSTTFNSATVAVVGDGFIARGITFRNTAGPTNHQAVALRSGSD  323

Query  1104  QSVINRCKIDAYQDTLYAHSQRQFYRDCYITGTVDFIFGNAAAVIQNSQVVARKPMAAQK  1283
              SV  +C  + YQDTLY HS+RQFYR+C I GTVD+IFGNAA V QN  + AR P   + 
Sbjct  324   LSVFYKCSFEGYQDTLYVHSERQFYRECDIYGTVDWIFGNAAVVFQNCNIYARNP-PNKT  382

Query  1284  NMVTAQGRTDPNQNTGTSIQNCNVSPSSDLGPVKGTIQTYLGRPWKEYSRTVFMESNIGD  1463
             N VTAQGRTDPNQNTG  I N  V+ +SDL PV+ +++TYLGRPWK+YSRTVFM++ +  
Sbjct  383   NTVTAQGRTDPNQNTGIIIHNSRVTAASDLKPVQSSVKTYLGRPWKQYSRTVFMKTYLDS  442

Query  1464  HIDPAGWFPWDGDFALKTLYYGEYMNRGPGAGTSKRVNWPGYHVITDKAEAMKFTVAQLI  1643
              I+PAGW  WDGDFALKTLYY EYMN GPG+ TS RV W GYHV+   +E  KFTV   +
Sbjct  443   LINPAGWMEWDGDFALKTLYYAEYMNTGPGSSTSNRVKWGGYHVLKSASEVSKFTVGNFL  502

Query  1644  QGGSWLKNTGVDYTEGL  1694
              G SWL +TGV +T GL
Sbjct  503   AGNSWLPSTGVPFTSGL  519



>ref|XP_007204326.1| hypothetical protein PRUPE_ppa004300mg [Prunus persica]
 gb|EMJ05525.1| hypothetical protein PRUPE_ppa004300mg [Prunus persica]
Length=517

 Score =   445 bits (1144),  Expect = 9e-146, Method: Compositional matrix adjust.
 Identities = 226/455 (50%), Positives = 298/455 (65%), Gaps = 11/455 (2%)
 Frame = +3

Query  342   IQDAVKLSANVNRRINDRKVQAAVADCMELLDLSQDKVMDSMVA------LGNLSARART  503
             +Q    + +       D ++  A++DC++LLD S D++  S+ A        N + +  +
Sbjct  62    VQQVASILSQFANAFGDFRLANAISDCLDLLDFSADELNWSLSASQNQKGKNNSTGKLSS  121

Query  504   DAHSWLSSVLTNHDTCLDGLSEPARSIMEPMIKDLISRAKsslavlvavaPSTEDDLRAL  683
             D  +WLS+ L N DTC +G  E   SI++ +I   + +  S +  L+       +  +  
Sbjct  122   DLRTWLSAALVNQDTCSNGF-EGTNSIVQGLISAGLGQVTSLVQELLTQVHPNSNQ-QGP  179

Query  684   NGEFPSWVSASDRRLLEASanavaanvvvaKDGSGKYKTVAEAVASAPDNGKTRYVIYIK  863
             NG+ PSWV   DR+LL+A   +V A V   +DG+G +  V +AV +APD    RYVIYIK
Sbjct  180   NGQIPSWVKTKDRKLLQADGVSVDAIVA--QDGTGNFTNVTDAVLAAPDYSMRRYVIYIK  237

Query  864   KGTYKENVEIGKKKTNVMLIGDGLSATIITGSLNYVDGATTFNSATVAAVGDGFIAQDLR  1043
             +GTY+ENVEI KKK N+M+IGDG+ ATII+G+ ++VDG TTF SAT A  G GFIA+D+ 
Sbjct  238   RGTYRENVEIKKKKWNLMMIGDGMDATIISGNRSFVDGWTTFRSATFAVSGRGFIARDIT  297

Query  1044  IQNTAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYAHSQRQFYRDCYITGTVDFIFGN  1223
              +NTAGPEKHQAVALR  +D SV  RC I  YQDTLY H+ RQFYRDC I+GTVDFIFG+
Sbjct  298   FENTAGPEKHQAVALRSDSDLSVFYRCNIRGYQDTLYTHTMRQFYRDCKISGTVDFIFGD  357

Query  1224  AAAVIQNSQVVARKPMAAQKNMVTAQGRTDPNQNTGTSIQNCNVSPSSDLGPVK-GTIQT  1400
             A  V QN Q++A+K +  QKN +TAQGR DPN+ TG SIQ CN++  SDL      +  T
Sbjct  358   ATVVFQNCQILAKKGLPNQKNSITAQGRKDPNEPTGISIQFCNITADSDLEAASVNSTPT  417

Query  1401  YLGRPWKEYSRTVFMESNIGDHIDPAGWFPWDGDFALKTLYYGEYMNRGPGAGTSKRVNW  1580
             YLGRPWK YSRTV M+S + + I P GW  W+GDFAL +L+YGEYMN GPGAG   RV W
Sbjct  418   YLGRPWKLYSRTVIMQSFLSNVIRPEGWLEWNGDFALNSLFYGEYMNYGPGAGLGSRVKW  477

Query  1581  PGYHVITDKAEAMKFTVAQLIQGGSWLKNTGVDYT  1685
             PGY V  +  +A  +TVAQ I+G  WL +TGV YT
Sbjct  478   PGYQVFNESTQAKNYTVAQFIEGNLWLPSTGVKYT  512



>gb|KHN08672.1| Putative pectinesterase/pectinesterase inhibitor 40 [Glycine 
soja]
Length=471

 Score =   443 bits (1139),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 221/445 (50%), Positives = 294/445 (66%), Gaps = 14/445 (3%)
 Frame = +3

Query  402   QAAVADCMELLDLSQDKVMDSM--VALGNLSARARTDAHSWLSSVLTNHDTCLDGLSEPA  575
             Q A+ DC++L + +  ++  ++  ++   + ++   D  + LS  +TN  TCLDG +   
Sbjct  26    QRALDDCLKLFEDTNVELKATIDDLSKSTIGSKRHHDLQTMLSGAMTNLYTCLDGFAYSK  85

Query  576   RSIMEPMIKDL--ISRAKsslavlvavaPSTED----------DLRALNGEFPSWVSASD  719
               + + + K L  IS   S+   ++   P  +           +   +   FPSWVS+ D
Sbjct  86    GRVRDRIEKKLLEISHHVSNSLAMLNKVPGVKKLTTSESVVFPEYGNMKKGFPSWVSSKD  145

Query  720   RRLLEASanavaanvvvaKDGSGKYKTVAEAVASAPDNGKTRYVIYIKKGTYKENVEIGK  899
             R+LL+A       +++VAKDG+G + T+ EA+A AP++  TR+VI+IK+G Y ENVE+ +
Sbjct  146   RKLLQAKVKETKFDLLVAKDGTGNFTTIGEALAVAPNSSTTRFVIHIKEGAYFENVEVIR  205

Query  900   KKTNVMLIGDGLSATIITGSLNYVDGATTFNSATVAAVGDGFIAQDLRIQNTAGPEKHQA  1079
             KKTN+M +GDG+  T++ GS N VDG TTF SATVA VG GFIA+ +  +N+AGP+KHQA
Sbjct  206   KKTNLMFVGDGIGKTVVKGSRNVVDGWTTFQSATVAVVGAGFIAKGITFENSAGPDKHQA  265

Query  1080  VALRLGADQSVINRCKIDAYQDTLYAHSQRQFYRDCYITGTVDFIFGNAAAVIQNSQVVA  1259
             VALR GAD S   +C    YQDTLY HS RQFYR+C I GTVDFIFGNAA V QN  + A
Sbjct  266   VALRSGADFSAFYQCSFVGYQDTLYVHSLRQFYRECDIYGTVDFIFGNAAVVFQNCNLYA  325

Query  1260  RKPMAAQKNMVTAQGRTDPNQNTGTSIQNCNVSPSSDLGPVKGTIQTYLGRPWKEYSRTV  1439
             RKP   QKN+ TAQGR DPNQNTG SI NC ++ ++DL PVK + ++YLGRPWK YSRTV
Sbjct  326   RKPNENQKNLFTAQGREDPNQNTGISILNCKIAAAADLIPVKSSFKSYLGRPWKMYSRTV  385

Query  1440  FMESNIGDHIDPAGWFPWDGDFALKTLYYGEYMNRGPGAGTSKRVNWPGYHVITDKAEAM  1619
              ++S + D IDPAGW  W+  FAL TLYYGEYMNRGPGA T+ RV WPGY VI    EA 
Sbjct  386   VLKSFVEDLIDPAGWLEWNETFALDTLYYGEYMNRGPGANTNGRVTWPGYRVINSSTEAT  445

Query  1620  KFTVAQLIQGGSWLKNTGVDYTEGL  1694
             +FTV Q IQG  WL +TG+ +  GL
Sbjct  446   QFTVGQFIQGNDWLNSTGIPFFSGL  470



>ref|XP_010230835.1| PREDICTED: pectinesterase-like [Brachypodium distachyon]
Length=561

 Score =   446 bits (1147),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 237/459 (52%), Positives = 292/459 (64%), Gaps = 29/459 (6%)
 Frame = +3

Query  402   QAAVADCMELLDLSQDKVMDSMVALGNLSARARTDAH--SWLSSVLTNHDTCLDGLS---  566
             + A+ADC+ELL  + D++  +   L   S  A    H  + LS  +TN  TCL G +   
Sbjct  104   RVAIADCIELLGTTMDELQATTSDLQQPSNGATVVDHVMTVLSGAITNQHTCLSGFTYHG  163

Query  567   -------EPARSIMEPMIKDLISRA---------KsslavlvavaPSTEDDLRA------  680
                      AR  MEP I+  ISR          K       + +PS +   R       
Sbjct  164   PRNGGQVSLARPYMEPGIRH-ISRMVSNTLAMAKKMRSTKPNSPSPSVQVQRRQPFTGYG  222

Query  681   -LNGEFPSWVSASDRRLLEASanavaanvvvaKDGSGKYKTVAEAVASAPDNGKTRYVIY  857
              +   FP WV   DRRLL+A+A+ + AN VVAKDGSG Y TV+ AV +AP N K+RYVIY
Sbjct  223   QMVKGFPRWVRPGDRRLLQAAASGITANAVVAKDGSGGYTTVSAAVTAAPANSKSRYVIY  282

Query  858   IKKGTYKENVEIGKKKTNVMLIGDGLSATIITGSLNYVDGATTFNSATVAAVGDGFIAQD  1037
             IK G Y ENVE+GK + N+M IGDG+  T+I  S N VDG TTF SATVA VG+ FIA+D
Sbjct  283   IKAGAYLENVEVGKNQKNLMFIGDGIGKTVIKASRNVVDGYTTFRSATVAVVGNNFIARD  342

Query  1038  LRIQNTAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYAHSQRQFYRDCYITGTVDFIF  1217
             L I+N+AGP KHQAVALR+GAD S   RC    YQDTLY HS RQF+RDC + GTVDF+F
Sbjct  343   LTIENSAGPSKHQAVALRVGADLSAFYRCSFVGYQDTLYVHSLRQFFRDCDVYGTVDFVF  402

Query  1218  GNAAAVIQNSQVVARKPMAAQKNMVTAQGRTDPNQNTGTSIQNCNVSPSSDLGPVKGTIQ  1397
             GN+A V+Q   + AR+P+A Q N  TAQGRTDPNQNTG S+Q C VS +SDL  V+ + +
Sbjct  403   GNSAVVLQGCSLYARRPLAGQSNTYTAQGRTDPNQNTGISVQRCKVSAASDLAAVQSSFR  462

Query  1398  TYLGRPWKEYSRTVFMESNIGDHIDPAGWFPWDGDFALKTLYYGEYMNRGPGAGTSKRVN  1577
             TYLGRPW++YSRTVFMES +   ++PAGW  W+G+FAL TLYYGEY N G GA TS RV 
Sbjct  463   TYLGRPWQQYSRTVFMESQMDSVVNPAGWLEWNGNFALDTLYYGEYQNTGAGAATSNRVK  522

Query  1578  WPGYHVITDKAEAMKFTVAQLIQGGSWLKNTGVDYTEGL  1694
             W GY VIT  +EA  FTV   I G  WL  T V ++ GL
Sbjct  523   WKGYRVITSASEASAFTVGSFIDGDVWLPRTSVPFSTGL  561



>ref|XP_010271372.1| PREDICTED: pectinesterase-like [Nelumbo nucifera]
Length=526

 Score =   444 bits (1143),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 232/446 (52%), Positives = 305/446 (68%), Gaps = 18/446 (4%)
 Frame = +3

Query  390   DRKVQAAVADCMELLDLSQDKVMDSMVALGNLSARARTDAHSWLSSVLTNHDTCLDG---  560
             D KV+ A ADC+EL     D V     +LG+ +  + +D+ +WLS+ LTN  TC +G   
Sbjct  88    DEKVKMAWADCVELY---ADTVSQLNRSLGSKNPLSWSDSQTWLSAALTNEQTCRNGFMD  144

Query  561   --LSEPARSI------MEPMIKDLISRAKsslavlvavaPSTEDDLRALNGEFPSWVSAS  716
               LS    S+         M+ + ++  K++ +   ++      + R L+  FP+WVSA+
Sbjct  145   LNLSHRLSSLPSMLSNFSKMVSNSLAINKAAASSSASLLGRQGGNRRLLSDGFPAWVSAA  204

Query  717   DRRLLEASanavaanvvvaKDGSGKYKTVAEAVASAPDNGKTRYVIYIKKGTYKENVEIG  896
             DR+LL++S  A  A+VVVA DGSG YKT++EAVA+A   G +R++IY+K+G YKENVEI 
Sbjct  205   DRKLLQSSGAASQADVVVAADGSGNYKTISEAVAAASGGG-SRFIIYVKRGVYKENVEI-  262

Query  897   KKKTNVMLIGDGLSATIITGSLNYVDGATTFNSATVAAVGDGFIAQDLRIQNTAGPEKHQ  1076
              + +N+MLIGDG+ ATI++ S N   G+TTF SATVA  G GFIA+D+  +N+AGP+ HQ
Sbjct  263   -RASNIMLIGDGIDATIVSSSRNVQQGSTTFRSATVAVSGGGFIARDMTFENSAGPQNHQ  321

Query  1077  AVALRLGADQSVINRCKIDAYQDTLYAHSQRQFYRDCYITGTVDFIFGNAAAVIQNSQVV  1256
             AVALR G+D SV+  C    YQDTLY HSQRQFYRDC I GT DFI GNAAAV QN  + 
Sbjct  322   AVALRSGSDLSVLYGCSFKGYQDTLYVHSQRQFYRDCDIYGTQDFICGNAAAVFQNCNIY  381

Query  1257  ARKPMAAQKNMVTAQGRTDPNQNTGTSIQNCNVSPSSDLGPVKGTIQTYLGRPWKEYSRT  1436
              RKP++ QKN VTAQ RTDPNQNTG SI N  V+ +SDL  V+G+ +TYLGRPW++YSRT
Sbjct  382   VRKPLSGQKNTVTAQARTDPNQNTGISIHNSRVTAASDLRAVQGSFKTYLGRPWQKYSRT  441

Query  1437  VFMESNIGDHIDPAGWFPWDGDFALKTLYYGEYMNRGPGAGTSKRVNWPGYHVITDKAEA  1616
             VFM++++   IDPAGW  W G FAL TLYYGE+MN G GA TS RV WPGY V++ + EA
Sbjct  442   VFMKTSLDSLIDPAGWLEWSGSFALSTLYYGEFMNSGAGASTSGRVTWPGYRVMSSE-EA  500

Query  1617  MKFTVAQLIQGGSWLKNTGVDYTEGL  1694
              +FTV   + GGSW+   GV +T GL
Sbjct  501   GEFTVGSFLGGGSWIAAAGVPFTSGL  526



>ref|XP_003627458.1| Pectinesterase [Medicago truncatula]
 gb|AET01934.1| pectinesterase/pectinesterase inhibitor [Medicago truncatula]
Length=589

 Score =   446 bits (1148),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 236/466 (51%), Positives = 296/466 (64%), Gaps = 29/466 (6%)
 Frame = +3

Query  378   RRINDRKVQAAVADCMELLDLSQDKVMDSMVALGNLSARARTDAH-----SWLSSVLTNH  542
             R+   ++ + A+ DC+E +D + D++ ++   L    ++     H     + +SS +TN 
Sbjct  126   RKSLTKREKIALHDCLETIDETLDELKEAQNDLVLYPSKKTLYQHADDLKTLISSAITNQ  185

Query  543   DTCLDGLS-----EPARSIM-------EPMIKDLISRAKsslavlvavaPSTEDDL----  674
              TCLDG S     +  R ++       E M  + ++  K+     +A    T   L    
Sbjct  186   VTCLDGFSHDDADKEVRKVLQEGQIHVEHMCSNALAMTKNMTDKDIAEFEQTNMVLGSNK  245

Query  675   -RALNGE-----FPSWVSASDRRLLEASanavaanvvvaKDGSGKYKTVAEAVASAPDNG  836
              R L  E     +P W+SA DRRLL+ S       V    DGSG +KTV+EAVA+AP   
Sbjct  246   NRKLLEEENGVGWPEWISAGDRRLLQGSTVKADVVVAA--DGSGNFKTVSEAVAAAPLKS  303

Query  837   KTRYVIYIKKGTYKENVEIGKKKTNVMLIGDGLSATIITGSLNYVDGATTFNSATVAAVG  1016
               RYVI IK G YKENVE+ KKKTN+M +GDG + TIITGS N VDG+TTF+SATVA VG
Sbjct  304   SKRYVIKIKAGVYKENVEVPKKKTNIMFLGDGRTNTIITGSRNVVDGSTTFHSATVAIVG  363

Query  1017  DGFIAQDLRIQNTAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYAHSQRQFYRDCYIT  1196
               F+A+D+  QNTAGP KHQAVALR+GAD S    C I AYQDTLY H+ RQF+ +C+I+
Sbjct  364   GNFLARDITFQNTAGPAKHQAVALRVGADLSAFYNCDIIAYQDTLYVHNNRQFFVNCFIS  423

Query  1197  GTVDFIFGNAAAVIQNSQVVARKPMAAQKNMVTAQGRTDPNQNTGTSIQNCNVSPSSDLG  1376
             GTVDFIFGN+A V QN  + AR+P + QKNMVTAQGR DPNQNTG  IQ C +  + DL 
Sbjct  424   GTVDFIFGNSAVVFQNCDIHARRPNSGQKNMVTAQGRVDPNQNTGIVIQKCRIGATKDLE  483

Query  1377  PVKGTIQTYLGRPWKEYSRTVFMESNIGDHIDPAGWFPWDGDFALKTLYYGEYMNRGPGA  1556
              VKG   TYLGRPWKEYSRTVFM+S+I D IDP GW  W+G+FAL TL Y EY N GPGA
Sbjct  484   GVKGNFPTYLGRPWKEYSRTVFMQSSISDVIDPVGWHEWNGNFALNTLVYREYQNTGPGA  543

Query  1557  GTSKRVNWPGYHVITDKAEAMKFTVAQLIQGGSWLKNTGVDYTEGL  1694
             GTSKRV W G+ VIT  AEA  FT    I G SWL +TG  ++ GL
Sbjct  544   GTSKRVTWKGFKVITSAAEAQSFTPGNFIGGSSWLGSTGFPFSLGL  589



>emb|CDX96216.1| BnaC02g14350D [Brassica napus]
Length=454

 Score =   441 bits (1135),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 223/453 (49%), Positives = 294/453 (65%), Gaps = 24/453 (5%)
 Frame = +3

Query  396   KVQAAVADCMELLDLSQD---KVMDSMVALGNLSARARTDAHSWLSSVLTNHDTCLDGLS  566
             +V++A   C+ELLD S D   + + S+V   + +  + +D  +WLSS +TNHDTC DG  
Sbjct  4     RVRSAYDSCLELLDDSVDALSRALSSVVISSSGNDESHSDVMTWLSSAMTNHDTCTDGF-  62

Query  567   EPARSIMEPMIKD-LISRAKsslavlvavaPSTEDDLRALNG---------------EFP  698
                  +    +KD ++   K    ++         +++ LNG               +FP
Sbjct  63    ---EGVGNGEVKDQVVGAVKGLSEMVSNCLALFSGNVKDLNGVTVVNRKLLGAEETEKFP  119

Query  699   SWVSASDRRLLEASanavaanvvvaKDGSGKYKTVAEAVASAPDNGKTRYVIYIKKGTYK  878
             SW+   DR LL   A A+ A++ V+KDG+G  KT+AEA+  AP+    R+VIY+K G Y+
Sbjct  120   SWLKRGDRELLGTPATAIQADITVSKDGNGTVKTIAEAIKKAPEQSSRRFVIYVKSGRYE  179

Query  879   E-NVEIGKKKTNVMLIGDGLSATIITGSLNYVDGATTFNSATVAAVGDGFIAQDLRIQNT  1055
             E N+++G+KKTN+M IGDG   T+ITG  +  D  TTF++AT AA G GFI +D+  +N 
Sbjct  180   EDNLKVGRKKTNLMFIGDGKGKTVITGGKSIADDLTTFHTATFAATGAGFIVKDITFENY  239

Query  1056  AGPEKHQAVALRLGADQSVINRCKIDAYQDTLYAHSQRQFYRDCYITGTVDFIFGNAAAV  1235
             AGP KHQAVALR+G D +V+ RC I  YQDTLY HS RQF+R+C I GTVDFIFGNAA +
Sbjct  240   AGPSKHQAVALRVGGDHAVVYRCSIIGYQDTLYVHSNRQFFRECDIYGTVDFIFGNAAVI  299

Query  1236  IQNSQVVARKPMAAQKNMVTAQGRTDPNQNTGTSIQNCNVSPSSDLGPVKGTIQTYLGRP  1415
             +Q+  + ARKPM  QK  +TAQ R DPNQNTG SI  C +  ++DL   KG+  TYLGRP
Sbjct  300   LQSCNIYARKPMPQQKITITAQNRKDPNQNTGISIHACKLLATADLEASKGSFPTYLGRP  359

Query  1416  WKEYSRTVFMESNIGDHIDPAGWFPWDGDFALKTLYYGEYMNRGPGAGTSKRVNWPGYHV  1595
             WK Y+R V+M S++ DHI+P GW  W+G FAL TLYYGEYMNRG GAG  +RV WPGYHV
Sbjct  360   WKLYARVVYMMSDMDDHINPRGWLEWNGPFALDTLYYGEYMNRGVGAGIGQRVKWPGYHV  419

Query  1596  ITDKAEAMKFTVAQLIQGGSWLKNTGVDYTEGL  1694
             IT   EA KFTVAQ I G +WL +TGV +  GL
Sbjct  420   ITSTVEASKFTVAQFISGSTWLPSTGVAFFSGL  452



>ref|XP_007154532.1| hypothetical protein PHAVU_003G126500g [Phaseolus vulgaris]
 gb|ESW26526.1| hypothetical protein PHAVU_003G126500g [Phaseolus vulgaris]
Length=513

 Score =   444 bits (1141),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 223/457 (49%), Positives = 297/457 (65%), Gaps = 9/457 (2%)
 Frame = +3

Query  342   IQDAVKLSANVNRRINDRKVQAAVADCMELLDLSQDKVMDSMVALGNLSARART------  503
             I+    + +  ++   D ++  AVADC++LLDLS D +  ++ A  N   R  +      
Sbjct  58    IKQLTSILSRFSKPFADLRLATAVADCLDLLDLSSDVLSWALSASQNPKGRHNSTGELSS  117

Query  504   DAHSWLSSVLTNHDTCLDGLSEPARSIMEPMIKDLISRAKsslavlvavaPSTEDDLRAL  683
             D  +WLS+VL +  TC+DG  E    I++ ++   I    S +  L+A     +D+  A 
Sbjct  118   DLRTWLSAVLAHPQTCMDGF-EGTNGIVKSLVSAGIGEVVSLVEQLLAQVVPVDDEFDAS  176

Query  684   NGEFPSWVSASDRRLLEASanavaanvvvaKDGSGKYKTVAEAVASAPDNGKTRYVIYIK  863
              G+ PSWV   +R+LL++S  +  A V +  DGSG Y T+ +AV +APD    R+VIYIK
Sbjct  177   KGQIPSWVKPRERKLLQSSGVSPDAVVAL--DGSGNYGTIMDAVLAAPDYSMKRFVIYIK  234

Query  864   KGTYKENVEIGKKKTNVMLIGDGLSATIITGSLNYVDGATTFNSATVAAVGDGFIAQDLR  1043
             KG Y ENVEI KKK N+M++GDG+ AT+I+G+ +Y+DG TTF S+T A  G GFIA+D+ 
Sbjct  235   KGVYVENVEIKKKKWNIMMVGDGMDATVISGNRSYIDGWTTFRSSTFAVSGRGFIARDIS  294

Query  1044  IQNTAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYAHSQRQFYRDCYITGTVDFIFGN  1223
              QNTAGPEKHQAVALR  +D SV  RC I  +QD+LY H+ RQF+R+C ITGTVDFIFG+
Sbjct  295   FQNTAGPEKHQAVALRSDSDLSVFYRCGILGFQDSLYTHTMRQFFRECRITGTVDFIFGD  354

Query  1224  AAAVIQNSQVVARKPMAAQKNMVTAQGRTDPNQNTGTSIQNCNVSPSSDLGPVKGTIQTY  1403
             A A+ QN  + A+K +  QKN +TA GR DPN+ TG S Q CNV+  SDL P+  T QTY
Sbjct  355   ATAMFQNCLIQAKKGLPNQKNTITAHGRKDPNEPTGFSFQFCNVTADSDLAPLVSTTQTY  414

Query  1404  LGRPWKEYSRTVFMESNIGDHIDPAGWFPWDGDFALKTLYYGEYMNRGPGAGTSKRVNWP  1583
             LGRPWK YSRTVFM+S + + I   GW  W+GDFAL TLYY EY+N G GAG + RV W 
Sbjct  415   LGRPWKTYSRTVFMQSFMSEVIRSEGWLEWNGDFALDTLYYAEYLNTGAGAGIANRVKWR  474

Query  1584  GYHVITDKAEAMKFTVAQLIQGGSWLKNTGVDYTEGL  1694
             GYH   D ++   FTVA+ I+G  WL +TGV YT   
Sbjct  475   GYHAFNDSSQVSNFTVAKFIEGNLWLPSTGVTYTAAF  511



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 6115829257295