BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig12926

Length=853
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CDO99489.1|  unnamed protein product                                293   7e-96   Coffea canephora [robusta coffee]
ref|XP_009624698.1|  PREDICTED: uncharacterized protein LOC104115715    290   1e-94   Nicotiana tomentosiformis
ref|XP_011096362.1|  PREDICTED: uncharacterized protein LOC105175576    288   1e-93   Sesamum indicum [beniseed]
ref|XP_009775864.1|  PREDICTED: uncharacterized protein LOC104225708    288   1e-93   Nicotiana sylvestris
ref|XP_006364305.1|  PREDICTED: uncharacterized protein LOC102579399    282   1e-91   Solanum tuberosum [potatoes]
ref|XP_004233838.1|  PREDICTED: uncharacterized protein LOC101249147    280   6e-91   Solanum lycopersicum
ref|XP_002265414.1|  PREDICTED: uncharacterized protein LOC100244781    280   7e-91   Vitis vinifera
ref|XP_002509425.1|  conserved hypothetical protein                     278   3e-90   
ref|XP_011001224.1|  PREDICTED: uncharacterized protein LOC105108575    278   1e-89   Populus euphratica
gb|AFK44846.1|  unknown                                                 277   2e-89   Lotus japonicus
ref|XP_006377414.1|  hypothetical protein POPTR_0011s05700g             278   2e-89   Populus trichocarpa [western balsam poplar]
gb|EYU28015.1|  hypothetical protein MIMGU_mgv1a013603mg                276   3e-89   Erythranthe guttata [common monkey flower]
ref|XP_012091673.1|  PREDICTED: uncharacterized protein LOC105649591    276   3e-89   Jatropha curcas
ref|XP_011027771.1|  PREDICTED: uncharacterized protein LOC105127982    276   8e-89   Populus euphratica
ref|XP_008439807.1|  PREDICTED: uncharacterized protein LOC103484494    274   2e-88   Cucumis melo [Oriental melon]
ref|XP_002305111.2|  hypothetical protein POPTR_0004s04870g             275   2e-88   Populus trichocarpa [western balsam poplar]
ref|XP_007025538.1|  Uncharacterized protein TCM_029803                 273   5e-88   
ref|XP_006467726.1|  PREDICTED: uncharacterized protein LOC102608272    270   6e-87   Citrus sinensis [apfelsine]
ref|XP_006449412.1|  hypothetical protein CICLE_v10016696mg             269   2e-86   Citrus clementina [clementine]
gb|KHN08488.1|  hypothetical protein glysoja_014253                     269   3e-86   Glycine soja [wild soybean]
ref|XP_007148117.1|  hypothetical protein PHAVU_006G181900g             267   9e-86   Phaseolus vulgaris [French bean]
ref|XP_004134946.1|  PREDICTED: uncharacterized protein LOC101202820    267   9e-86   Cucumis sativus [cucumbers]
ref|XP_003593648.1|  hypothetical protein MTR_2g014550                  267   1e-85   Medicago truncatula
ref|XP_009614893.1|  PREDICTED: uncharacterized protein LOC104107719    267   1e-85   
ref|XP_008225153.1|  PREDICTED: uncharacterized protein LOC103324819    266   2e-85   Prunus mume [ume]
ref|XP_007212044.1|  hypothetical protein PRUPE_ppa011352mg             266   3e-85   Prunus persica
ref|XP_010518775.1|  PREDICTED: uncharacterized protein LOC104798405    266   4e-85   Tarenaya hassleriana [spider flower]
ref|XP_010057364.1|  PREDICTED: uncharacterized protein LOC104445239    265   4e-85   Eucalyptus grandis [rose gum]
ref|XP_007159369.1|  hypothetical protein PHAVU_002G232400g             266   5e-85   Phaseolus vulgaris [French bean]
ref|XP_008371416.1|  PREDICTED: uncharacterized protein LOC103434834    265   8e-85   
ref|XP_009800282.1|  PREDICTED: uncharacterized protein LOC104246213    265   1e-84   Nicotiana sylvestris
gb|ACU15779.1|  unknown                                                 265   2e-84   Glycine max [soybeans]
gb|KHN15494.1|  hypothetical protein glysoja_038165                     263   4e-84   Glycine soja [wild soybean]
ref|XP_004486106.1|  PREDICTED: uncharacterized protein LOC101512239    263   5e-84   Cicer arietinum [garbanzo]
emb|CBI30614.3|  unnamed protein product                                265   7e-84   Vitis vinifera
ref|XP_008383697.1|  PREDICTED: uncharacterized protein LOC103446381    263   7e-84   
ref|XP_006361068.1|  PREDICTED: uncharacterized protein LOC102594723    262   1e-83   Solanum tuberosum [potatoes]
ref|XP_003593647.1|  hypothetical protein MTR_2g014520                  262   1e-83   
ref|XP_009344263.1|  PREDICTED: uncharacterized protein LOC103936119    262   1e-83   Pyrus x bretschneideri [bai li]
gb|KJB69553.1|  hypothetical protein B456_011G030300                    261   2e-83   Gossypium raimondii
ref|XP_010111173.1|  hypothetical protein L484_015056                   262   2e-83   Morus notabilis
ref|XP_003541524.1|  PREDICTED: uncharacterized protein LOC100784415    261   3e-83   Glycine max [soybeans]
ref|XP_004248460.1|  PREDICTED: uncharacterized protein LOC101254947    260   4e-83   
ref|XP_002278769.1|  PREDICTED: uncharacterized protein LOC100262407    259   1e-82   
ref|XP_010245585.1|  PREDICTED: uncharacterized protein LOC104589093    258   4e-82   Nelumbo nucifera [Indian lotus]
ref|XP_004505097.1|  PREDICTED: uncharacterized protein LOC101491785    258   5e-82   Cicer arietinum [garbanzo]
gb|KEH30980.1|  transmembrane protein, putative                         257   6e-82   Medicago truncatula
ref|XP_010260334.1|  PREDICTED: uncharacterized protein LOC104599477    257   1e-81   Nelumbo nucifera [Indian lotus]
ref|XP_004293868.1|  PREDICTED: uncharacterized protein LOC101295896    256   2e-81   Fragaria vesca subsp. vesca
ref|XP_010686399.1|  PREDICTED: uncharacterized protein LOC104900624    257   2e-81   
ref|XP_010919356.1|  PREDICTED: uncharacterized protein LOC105043490    254   2e-80   
ref|XP_009131711.1|  PREDICTED: uncharacterized protein LOC103856352    253   7e-80   Brassica rapa
emb|CDX78854.1|  BnaA01g09210D                                          252   1e-79   
emb|CDY60883.1|  BnaC01g40900D                                          250   5e-79   Brassica napus [oilseed rape]
ref|XP_009101549.1|  PREDICTED: uncharacterized protein LOC103827757    251   7e-79   Brassica rapa
emb|CDY70034.1|  BnaAnng32400D                                          250   1e-78   Brassica napus [oilseed rape]
emb|CDX77629.1|  BnaC07g18830D                                          249   2e-78   
ref|XP_002867993.1|  hypothetical protein ARALYDRAFT_914840             248   3e-78   Arabidopsis lyrata subsp. lyrata
ref|XP_006284515.1|  hypothetical protein CARUB_v10005715mg             247   1e-77   Capsella rubella
emb|CDY55785.1|  BnaC03g76810D                                          247   1e-77   Brassica napus [oilseed rape]
ref|XP_006281752.1|  hypothetical protein CARUB_v10027911mg             247   2e-77   Capsella rubella
ref|XP_010494774.1|  PREDICTED: uncharacterized protein LOC104771868    246   2e-77   Camelina sativa [gold-of-pleasure]
ref|XP_010517535.1|  PREDICTED: uncharacterized protein LOC104792959    246   2e-77   Camelina sativa [gold-of-pleasure]
ref|XP_010441629.1|  PREDICTED: uncharacterized protein LOC104724778    246   3e-77   Camelina sativa [gold-of-pleasure]
emb|CDX76524.1|  BnaA08g08760D                                          245   4e-77   
ref|NP_199421.1|  uncharacterized protein                               245   6e-77   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010481500.1|  PREDICTED: uncharacterized protein LOC104760291    245   9e-77   Camelina sativa [gold-of-pleasure]
ref|XP_009395997.1|  PREDICTED: uncharacterized protein LOC103981121    244   1e-76   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_567556.1|  uncharacterized protein                               244   2e-76   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006414104.1|  hypothetical protein EUTSA_v10027225mg             243   2e-76   
emb|CAN65382.1|  hypothetical protein VITISV_028557                     245   2e-76   Vitis vinifera
ref|XP_010924438.1|  PREDICTED: uncharacterized protein LOC105047277    242   6e-76   
ref|XP_009108361.1|  PREDICTED: uncharacterized protein LOC103834060    242   7e-76   Brassica rapa
gb|KFK28517.1|  hypothetical protein AALP_AA7G006800                    239   1e-74   Arabis alpina [alpine rockcress]
ref|XP_006398291.1|  hypothetical protein EUTSA_v10001025mg             239   1e-74   Eutrema salsugineum [saltwater cress]
ref|XP_002865206.1|  hypothetical protein ARALYDRAFT_916829             239   1e-74   Arabidopsis lyrata subsp. lyrata
ref|XP_008798336.1|  PREDICTED: uncharacterized protein LOC103713249    235   3e-73   Phoenix dactylifera
ref|XP_009394826.1|  PREDICTED: uncharacterized protein LOC103980228    235   3e-73   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010904899.1|  PREDICTED: uncharacterized protein LOC105032218    235   4e-73   Elaeis guineensis
ref|XP_008811089.1|  PREDICTED: uncharacterized protein LOC103722318    233   2e-72   Phoenix dactylifera
gb|EPS66984.1|  hypothetical protein M569_07790                         230   2e-71   Genlisea aurea
emb|CDY33452.1|  BnaA06g36210D                                          228   2e-70   Brassica napus [oilseed rape]
ref|XP_009101545.1|  PREDICTED: uncharacterized protein LOC103827755    227   8e-70   Brassica rapa
emb|CDY34571.1|  BnaC03g56710D                                          223   3e-68   Brassica napus [oilseed rape]
emb|CDX77630.1|  BnaC07g18840D                                          221   9e-68   
ref|XP_002275299.1|  PREDICTED: uncharacterized protein LOC100245474    219   7e-67   Vitis vinifera
ref|XP_006584405.1|  PREDICTED: uncharacterized protein LOC100794857    219   7e-67   Glycine max [soybeans]
ref|XP_006655587.1|  PREDICTED: uncharacterized protein LOC102706010    219   1e-66   
ref|XP_003526262.1|  PREDICTED: uncharacterized protein LOC100796945    218   2e-66   Glycine max [soybeans]
ref|XP_006844888.2|  PREDICTED: uncharacterized protein LOC18434762     218   2e-66   
ref|XP_006372758.1|  hypothetical protein POPTR_0017s04770g             216   8e-66   Populus trichocarpa [western balsam poplar]
ref|XP_003567905.1|  PREDICTED: uncharacterized protein LOC100824681    216   1e-65   Brachypodium distachyon [annual false brome]
ref|XP_011649980.1|  PREDICTED: uncharacterized protein LOC105434686    216   2e-65   Cucumis sativus [cucumbers]
gb|ERN06563.1|  hypothetical protein AMTR_s00058p00125960               217   4e-65   Amborella trichopoda
ref|XP_012088410.1|  PREDICTED: uncharacterized protein LOC105647039    214   4e-65   Jatropha curcas
ref|XP_008455952.1|  PREDICTED: uncharacterized protein LOC103496014    214   1e-64   Cucumis melo [Oriental melon]
ref|XP_011043659.1|  PREDICTED: uncharacterized protein LOC105139057    213   1e-64   Populus euphratica
ref|XP_009589871.1|  PREDICTED: uncharacterized protein LOC104087172    213   2e-64   Nicotiana tomentosiformis
ref|XP_004505628.1|  PREDICTED: uncharacterized protein LOC101497875    210   2e-63   Cicer arietinum [garbanzo]
ref|XP_007132680.1|  hypothetical protein PHAVU_011G115500g             210   2e-63   Phaseolus vulgaris [French bean]
ref|XP_003566981.1|  PREDICTED: uncharacterized protein LOC100827369    209   3e-63   Brachypodium distachyon [annual false brome]
gb|AAU10653.1|  unknown protein                                         210   4e-63   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006446706.1|  hypothetical protein CICLE_v10017623mg             209   4e-63   Citrus clementina [clementine]
ref|XP_009785080.1|  PREDICTED: uncharacterized protein LOC104233393    209   7e-63   Nicotiana sylvestris
ref|XP_004252030.1|  PREDICTED: uncharacterized protein LOC101254876    208   2e-62   
ref|XP_003607515.1|  hypothetical protein MTR_4g078870                  207   3e-62   Medicago truncatula
ref|XP_004969493.1|  PREDICTED: uncharacterized protein LOC101760980    206   1e-61   Setaria italica
ref|XP_008656733.1|  PREDICTED: uncharacterized protein LOC103636163    206   1e-61   Zea mays [maize]
gb|AFW83516.1|  hypothetical protein ZEAMMB73_128939                    205   1e-61   
ref|XP_008359069.1|  PREDICTED: uncharacterized protein LOC103422787    206   1e-61   
dbj|BAJ97707.1|  predicted protein                                      206   3e-61   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010686397.1|  PREDICTED: uncharacterized protein LOC104900622    205   3e-61   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009371494.1|  PREDICTED: uncharacterized protein LOC103960740    205   3e-61   Pyrus x bretschneideri [bai li]
ref|XP_006352030.1|  PREDICTED: uncharacterized protein LOC102584291    204   4e-61   Solanum tuberosum [potatoes]
ref|XP_004961228.1|  PREDICTED: uncharacterized protein LOC101778359    204   4e-61   Setaria italica
gb|KJB66781.1|  hypothetical protein B456_010G158000                    204   5e-61   Gossypium raimondii
ref|XP_004305429.2|  PREDICTED: uncharacterized protein LOC101293416    204   6e-61   Fragaria vesca subsp. vesca
gb|EMS57393.1|  hypothetical protein TRIUR3_27181                       203   7e-61   Triticum urartu
ref|XP_008225181.1|  PREDICTED: uncharacterized protein LOC103324847    203   2e-60   Prunus mume [ume]
ref|XP_009413807.1|  PREDICTED: uncharacterized protein LOC103995042    202   2e-60   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007213542.1|  hypothetical protein PRUPE_ppa019527mg             201   4e-60   Prunus persica
gb|ABR17763.1|  unknown                                                 200   2e-59   Picea sitchensis
ref|XP_011100240.1|  PREDICTED: uncharacterized protein LOC105178468    200   3e-59   Sesamum indicum [beniseed]
gb|ABR16877.1|  unknown                                                 200   3e-59   Picea sitchensis
ref|XP_007043697.1|  Galactose-1-phosphate uridylyltransferase, p...    200   3e-59   
gb|EMS59461.1|  hypothetical protein TRIUR3_20370                       199   5e-59   Triticum urartu
ref|XP_010093959.1|  hypothetical protein L484_010525                   198   1e-58   Morus notabilis
ref|XP_009777961.1|  PREDICTED: uncharacterized protein LOC104227416    198   2e-58   Nicotiana sylvestris
ref|XP_008344773.1|  PREDICTED: uncharacterized protein LOC103407659    197   2e-58   
ref|XP_011087688.1|  PREDICTED: uncharacterized protein LOC105169096    197   3e-58   Sesamum indicum [beniseed]
ref|XP_002869724.1|  hypothetical protein ARALYDRAFT_492419             196   4e-58   
ref|XP_009596399.1|  PREDICTED: uncharacterized protein LOC104092490    196   8e-58   Nicotiana tomentosiformis
ref|XP_008783285.1|  PREDICTED: uncharacterized protein LOC103702573    194   1e-57   Phoenix dactylifera
ref|XP_009380594.1|  PREDICTED: uncharacterized protein LOC103968949    195   2e-57   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002517851.1|  conserved hypothetical protein                     194   5e-57   Ricinus communis
ref|XP_010686483.1|  PREDICTED: uncharacterized protein LOC104900690    194   6e-57   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010666457.1|  PREDICTED: uncharacterized protein LOC104883611    193   7e-57   
ref|XP_010657994.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    193   1e-56   
emb|CDP18222.1|  unnamed protein product                                193   1e-56   Coffea canephora [robusta coffee]
ref|XP_010256253.1|  PREDICTED: uncharacterized protein LOC104596698    191   4e-56   
gb|KFK28986.1|  hypothetical protein AALP_AA7G073800                    191   6e-56   Arabis alpina [alpine rockcress]
ref|XP_002867447.1|  predicted protein                                  190   8e-56   Arabidopsis lyrata subsp. lyrata
ref|XP_011088116.1|  PREDICTED: uncharacterized protein LOC105169422    190   9e-56   Sesamum indicum [beniseed]
ref|XP_006282893.1|  hypothetical protein CARUB_v10007137mg             191   9e-56   Capsella rubella
ref|XP_012066657.1|  PREDICTED: uncharacterized protein LOC105629654    190   1e-55   Jatropha curcas
emb|CDY29909.1|  BnaA03g49300D                                          189   2e-55   Brassica napus [oilseed rape]
emb|CDX92877.1|  BnaC07g41350D                                          189   3e-55   
emb|CDY38387.1|  BnaC01g09960D                                          189   3e-55   Brassica napus [oilseed rape]
emb|CDP12432.1|  unnamed protein product                                189   4e-55   Coffea canephora [robusta coffee]
ref|XP_010038679.1|  PREDICTED: uncharacterized protein LOC104427259    189   4e-55   Eucalyptus grandis [rose gum]
emb|CAN73827.1|  hypothetical protein VITISV_003176                     197   4e-55   Vitis vinifera
ref|XP_006349331.1|  PREDICTED: uncharacterized protein LOC102592013    189   5e-55   Solanum tuberosum [potatoes]
ref|XP_007226107.1|  hypothetical protein PRUPE_ppa010943mg             189   5e-55   Prunus persica
gb|EYU22091.1|  hypothetical protein MIMGU_mgv1a013831mg                188   6e-55   Erythranthe guttata [common monkey flower]
ref|NP_001057588.1|  Os06g0352200                                       189   7e-55   
ref|XP_010433789.1|  PREDICTED: uncharacterized protein LOC104717852    188   9e-55   Camelina sativa [gold-of-pleasure]
gb|KJB16181.1|  hypothetical protein B456_002G216600                    188   9e-55   Gossypium raimondii
ref|XP_009109249.1|  PREDICTED: uncharacterized protein LOC103834908    188   1e-54   Brassica rapa
ref|XP_010555098.1|  PREDICTED: uncharacterized protein LOC104824685    187   1e-54   Tarenaya hassleriana [spider flower]
emb|CDY24837.1|  BnaA08g14730D                                          187   2e-54   Brassica napus [oilseed rape]
ref|XP_008810912.1|  PREDICTED: uncharacterized protein LOC103722217    187   2e-54   Phoenix dactylifera
ref|XP_004230455.1|  PREDICTED: uncharacterized protein LOC101268616    187   2e-54   Solanum lycopersicum
ref|NP_001145367.1|  hypothetical protein                               188   2e-54   Zea mays [maize]
emb|CDY34728.1|  BnaA01g32970D                                          187   3e-54   Brassica napus [oilseed rape]
ref|XP_010439058.1|  PREDICTED: uncharacterized protein LOC104722562    187   3e-54   Camelina sativa [gold-of-pleasure]
emb|CDO97610.1|  unnamed protein product                                186   4e-54   Coffea canephora [robusta coffee]
ref|XP_009118017.1|  PREDICTED: uncharacterized protein LOC103843066    186   4e-54   Brassica rapa
ref|XP_002441515.1|  hypothetical protein SORBIDRAFT_09g028420          187   5e-54   Sorghum bicolor [broomcorn]
ref|XP_010911365.1|  PREDICTED: uncharacterized protein LOC105037387    187   6e-54   
ref|XP_010448580.1|  PREDICTED: uncharacterized protein LOC104731025    186   6e-54   Camelina sativa [gold-of-pleasure]
ref|XP_010030168.1|  PREDICTED: uncharacterized protein LOC104419998    186   6e-54   Eucalyptus grandis [rose gum]
ref|XP_008218737.1|  PREDICTED: uncharacterized protein LOC103319023    186   6e-54   Prunus mume [ume]
ref|XP_002526458.1|  conserved hypothetical protein                     186   1e-53   Ricinus communis
emb|CDY08933.1|  BnaC08g11630D                                          185   1e-53   Brassica napus [oilseed rape]
ref|XP_010277272.1|  PREDICTED: uncharacterized protein LOC104611772    186   1e-53   Nelumbo nucifera [Indian lotus]
ref|XP_008656036.1|  PREDICTED: uncharacterized protein LOC103635334    186   1e-53   Zea mays [maize]
emb|CDY35189.1|  BnaA01g08420D                                          184   1e-53   Brassica napus [oilseed rape]
ref|XP_002437096.1|  hypothetical protein SORBIDRAFT_10g021060          187   2e-53   Sorghum bicolor [broomcorn]
ref|XP_010433212.1|  PREDICTED: uncharacterized protein LOC104717...    184   2e-53   Camelina sativa [gold-of-pleasure]
emb|CBI29711.3|  unnamed protein product                                184   6e-53   Vitis vinifera
ref|XP_010534186.1|  PREDICTED: uncharacterized protein LOC104809807    183   8e-53   Tarenaya hassleriana [spider flower]
ref|NP_194162.1|  uncharacterized protein                               182   9e-53   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009380593.1|  PREDICTED: uncharacterized protein LOC103968948    182   1e-52   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006413446.1|  hypothetical protein EUTSA_v10026158mg             182   2e-52   Eutrema salsugineum [saltwater cress]
ref|NP_186892.1|  uncharacterized protein                               181   3e-52   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009129595.1|  PREDICTED: uncharacterized protein LOC103854413    181   3e-52   Brassica rapa
gb|EYU26482.1|  hypothetical protein MIMGU_mgv1a026928mg                180   1e-51   Erythranthe guttata [common monkey flower]
ref|XP_010674193.1|  PREDICTED: uncharacterized protein LOC104890412    179   2e-51   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006408418.1|  hypothetical protein EUTSA_v10021481mg             179   3e-51   Eutrema salsugineum [saltwater cress]
ref|XP_004300087.1|  PREDICTED: uncharacterized protein LOC101310319    178   4e-51   Fragaria vesca subsp. vesca
ref|XP_002882229.1|  hypothetical protein ARALYDRAFT_896211             178   6e-51   
ref|XP_007041237.1|  Uncharacterized protein TCM_006175                 178   8e-51   
ref|XP_008368178.1|  PREDICTED: uncharacterized protein LOC103431786    177   1e-50   Malus domestica [apple tree]
ref|XP_010916779.1|  PREDICTED: uncharacterized protein LOC105041523    176   2e-50   
ref|XP_011047931.1|  PREDICTED: uncharacterized protein LOC105142131    177   2e-50   Populus euphratica
ref|XP_006851260.1|  PREDICTED: uncharacterized protein LOC18441064     176   3e-50   Amborella trichopoda
ref|XP_004972417.1|  PREDICTED: uncharacterized protein LOC101783676    176   4e-50   Setaria italica
emb|CDY03457.1|  BnaC01g16250D                                          176   5e-50   
ref|XP_010463647.1|  PREDICTED: uncharacterized protein LOC104744317    176   5e-50   Camelina sativa [gold-of-pleasure]
ref|XP_009353743.1|  PREDICTED: uncharacterized protein LOC103944978    176   5e-50   Pyrus x bretschneideri [bai li]
gb|AAU44525.1|  hypothetical protein AT4G28485                          175   7e-50   Arabidopsis thaliana [mouse-ear cress]
gb|AAY78804.1|  hypothetical protein At4g28485                          175   7e-50   Arabidopsis thaliana [mouse-ear cress]
gb|KJB77232.1|  hypothetical protein B456_012G126500                    175   8e-50   Gossypium raimondii
ref|XP_009137953.1|  PREDICTED: uncharacterized protein LOC103861987    175   8e-50   Brassica rapa
ref|XP_006389536.1|  hypothetical protein POPTR_0022s00700g             175   1e-49   
ref|XP_009410685.1|  PREDICTED: uncharacterized protein LOC103992624    174   2e-49   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010497147.1|  PREDICTED: uncharacterized protein LOC104774184    174   3e-49   
ref|XP_010417271.1|  PREDICTED: uncharacterized protein LOC104703038    174   4e-49   Camelina sativa [gold-of-pleasure]
ref|XP_006299851.1|  hypothetical protein CARUB_v10016054mg             174   4e-49   Capsella rubella
ref|XP_004965424.1|  PREDICTED: uncharacterized protein LOC101752838    175   4e-49   Setaria italica
ref|XP_006471187.1|  PREDICTED: uncharacterized protein LOC102623401    174   4e-49   Citrus sinensis [apfelsine]
dbj|BAJ95368.1|  predicted protein                                      173   6e-49   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EEE64691.1|  hypothetical protein OsJ_19546                          173   1e-48   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006659030.1|  PREDICTED: uncharacterized protein LOC102709583    172   2e-48   Oryza brachyantha
gb|EMS48436.1|  hypothetical protein TRIUR3_02208                       172   2e-48   Triticum urartu
ref|XP_010070119.1|  PREDICTED: uncharacterized protein LOC104456912    171   2e-48   Eucalyptus grandis [rose gum]
ref|XP_010485487.1|  PREDICTED: uncharacterized protein LOC104763805    171   3e-48   Camelina sativa [gold-of-pleasure]
ref|XP_010447973.1|  PREDICTED: uncharacterized protein LOC104730496    170   4e-48   Camelina sativa [gold-of-pleasure]
emb|CDO97608.1|  unnamed protein product                                166   2e-46   Coffea canephora [robusta coffee]
ref|XP_004491124.1|  PREDICTED: uncharacterized protein LOC101495511    164   2e-45   Cicer arietinum [garbanzo]
ref|XP_006471188.1|  PREDICTED: uncharacterized protein LOC102623701    164   2e-45   Citrus sinensis [apfelsine]
ref|XP_011028335.1|  PREDICTED: uncharacterized protein LOC105128394    162   8e-45   Populus euphratica
ref|XP_006431669.1|  hypothetical protein CICLE_v10003600mg             162   2e-44   Citrus clementina [clementine]
ref|XP_006385029.1|  hypothetical protein POPTR_0004s23220g             160   4e-44   
ref|NP_001175354.1|  Os08g0106501                                       158   4e-43   
gb|EAZ05316.1|  hypothetical protein OsI_27521                          158   5e-43   Oryza sativa Indica Group [Indian rice]
ref|XP_008246531.1|  PREDICTED: uncharacterized protein LOC103344692    154   1e-41   Prunus mume [ume]
ref|XP_010087431.1|  hypothetical protein L484_018458                   152   4e-41   
ref|XP_007207654.1|  hypothetical protein PRUPE_ppa021534mg             151   6e-41   
gb|EMT28510.1|  hypothetical protein F775_11484                         150   7e-41   
gb|EMT03075.1|  hypothetical protein F775_17628                         152   8e-41   
ref|XP_010941734.1|  PREDICTED: uncharacterized protein LOC105059916    150   1e-40   Elaeis guineensis
ref|XP_009335668.1|  PREDICTED: uncharacterized protein LOC103928362    148   1e-39   Pyrus x bretschneideri [bai li]
ref|XP_010111869.1|  hypothetical protein L484_020662                   147   2e-39   Morus notabilis
ref|XP_002444870.1|  hypothetical protein SORBIDRAFT_07g000680          149   2e-39   Sorghum bicolor [broomcorn]
emb|CDO98951.1|  unnamed protein product                                147   3e-39   Coffea canephora [robusta coffee]
ref|XP_008776531.1|  PREDICTED: uncharacterized protein LOC103696625    146   1e-38   Phoenix dactylifera
ref|XP_008361977.1|  PREDICTED: uncharacterized protein LOC103425667    144   3e-38   Malus domestica [apple tree]
ref|XP_008370526.1|  PREDICTED: uncharacterized protein LOC103433991    144   3e-38   
ref|NP_001144303.1|  hypothetical protein                               145   4e-38   Zea mays [maize]
gb|KDO74937.1|  hypothetical protein CISIN_1g0286151mg                  143   5e-38   Citrus sinensis [apfelsine]
ref|XP_009339949.1|  PREDICTED: uncharacterized protein LOC103932125    143   1e-37   Pyrus x bretschneideri [bai li]
ref|XP_010242558.1|  PREDICTED: uncharacterized protein LOC104586881    142   1e-37   Nelumbo nucifera [Indian lotus]
gb|EYU45596.1|  hypothetical protein MIMGU_mgv1a013892mg                143   2e-37   Erythranthe guttata [common monkey flower]
ref|XP_006489209.1|  PREDICTED: uncharacterized protein LOC102626738    142   2e-37   Citrus sinensis [apfelsine]
ref|XP_004305025.1|  PREDICTED: uncharacterized protein LOC101305287    142   2e-37   Fragaria vesca subsp. vesca
ref|XP_003594057.1|  hypothetical protein MTR_2g020850                  142   3e-37   Medicago truncatula
ref|XP_010926631.1|  PREDICTED: uncharacterized protein LOC105048856    142   4e-37   
gb|EMS65326.1|  hypothetical protein TRIUR3_19533                       142   4e-37   Triticum urartu
gb|KJB38487.1|  hypothetical protein B456_006G256300                    140   7e-37   Gossypium raimondii
ref|XP_006845800.1|  PREDICTED: uncharacterized protein LOC18435695     141   8e-37   Amborella trichopoda
ref|XP_009369066.1|  PREDICTED: uncharacterized protein LOC103958523    140   9e-37   Pyrus x bretschneideri [bai li]
ref|XP_012069457.1|  PREDICTED: uncharacterized protein LOC105631865    140   9e-37   Jatropha curcas
ref|XP_010912092.1|  PREDICTED: uncharacterized protein LOC105038102    140   9e-37   Elaeis guineensis
ref|XP_008809149.1|  PREDICTED: uncharacterized protein LOC103720946    140   1e-36   Phoenix dactylifera
ref|XP_008223143.1|  PREDICTED: uncharacterized protein LOC103322962    140   1e-36   Prunus mume [ume]
ref|XP_010046624.1|  PREDICTED: uncharacterized protein LOC104435602    141   1e-36   Eucalyptus grandis [rose gum]
ref|XP_010024460.1|  PREDICTED: uncharacterized protein LOC104414940    140   2e-36   Eucalyptus grandis [rose gum]
ref|XP_006419744.1|  hypothetical protein CICLE_v10005996mg             139   3e-36   Citrus clementina [clementine]
ref|XP_007223510.1|  hypothetical protein PRUPE_ppa011867mg             139   3e-36   Prunus persica
ref|XP_007147832.1|  hypothetical protein PHAVU_006G158800g             139   3e-36   Phaseolus vulgaris [French bean]
pir||T04619  hypothetical protein F20O9.170 - Arabidopsis thaliana      141   4e-36
gb|AFK48704.1|  unknown                                                 139   4e-36   Medicago truncatula
ref|XP_007154200.1|  hypothetical protein PHAVU_003G098400g             139   6e-36   Phaseolus vulgaris [French bean]
gb|EAZ36942.1|  hypothetical protein OsJ_21279                          136   7e-36   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009360650.1|  PREDICTED: uncharacterized protein LOC103951099    140   7e-36   Pyrus x bretschneideri [bai li]
ref|XP_004229478.1|  PREDICTED: uncharacterized protein LOC101268223    137   9e-36   Solanum lycopersicum
ref|XP_011092679.1|  PREDICTED: uncharacterized protein LOC105172799    139   1e-35   Sesamum indicum [beniseed]
ref|XP_004486087.1|  PREDICTED: uncharacterized protein LOC101506121    138   1e-35   Cicer arietinum [garbanzo]
ref|XP_008230772.1|  PREDICTED: uncharacterized protein LOC103330011    139   1e-35   Prunus mume [ume]
ref|XP_007216891.1|  hypothetical protein PRUPE_ppa020648mg             139   1e-35   Prunus persica
ref|XP_006365275.1|  PREDICTED: uncharacterized protein LOC102592775    137   2e-35   Solanum tuberosum [potatoes]
ref|XP_011090899.1|  PREDICTED: uncharacterized protein LOC105171466    137   2e-35   Sesamum indicum [beniseed]
ref|XP_010105680.1|  hypothetical protein L484_011291                   137   2e-35   Morus notabilis
gb|EPS61228.1|  hypothetical protein M569_13571                         136   2e-35   Genlisea aurea
ref|XP_010939799.1|  PREDICTED: uncharacterized protein LOC105058544    137   2e-35   Elaeis guineensis
ref|XP_010548895.1|  PREDICTED: uncharacterized protein LOC104820226    136   2e-35   Tarenaya hassleriana [spider flower]
ref|XP_003572527.1|  PREDICTED: uncharacterized protein LOC100844788    137   3e-35   Brachypodium distachyon [annual false brome]
ref|XP_008795123.1|  PREDICTED: uncharacterized protein LOC103710958    137   3e-35   Phoenix dactylifera
ref|XP_009403823.1|  PREDICTED: uncharacterized protein LOC103987288    137   3e-35   
ref|XP_008223063.1|  PREDICTED: uncharacterized protein LOC103322890    136   3e-35   
ref|XP_002315542.1|  hypothetical protein POPTR_0010s02840g             135   5e-35   
ref|XP_008390773.1|  PREDICTED: uncharacterized protein LOC103453018    136   5e-35   
ref|XP_004491811.1|  PREDICTED: uncharacterized protein LOC101510550    137   5e-35   
ref|XP_002312247.1|  hypothetical protein POPTR_0008s08670g             137   5e-35   
ref|XP_008379358.1|  PREDICTED: uncharacterized protein LOC103442357    137   5e-35   
ref|XP_008353425.1|  PREDICTED: uncharacterized protein LOC103416995    137   5e-35   
ref|XP_004508330.1|  PREDICTED: uncharacterized protein LOC101512884    136   6e-35   
gb|KJB40783.1|  hypothetical protein B456_007G079000                    136   7e-35   
ref|XP_004146729.1|  PREDICTED: uncharacterized protein LOC101222659    136   8e-35   
ref|XP_008460881.1|  PREDICTED: uncharacterized protein LOC103499624    136   9e-35   
ref|XP_006845802.1|  PREDICTED: uncharacterized protein LOC18435697     135   9e-35   
ref|XP_007226108.1|  hypothetical protein PRUPE_ppa010990mg             136   9e-35   
ref|XP_009376318.1|  PREDICTED: uncharacterized protein LOC103965024    136   1e-34   
ref|XP_007032549.1|  Gb:AAC24089.1                                      135   1e-34   
ref|XP_010914345.1|  PREDICTED: uncharacterized protein LOC105039777    135   1e-34   
ref|XP_010024461.1|  PREDICTED: uncharacterized protein LOC104414941    135   1e-34   
ref|XP_009628599.1|  PREDICTED: uncharacterized protein LOC104118916    134   2e-34   
gb|EPS61229.1|  hypothetical protein M569_13572                         134   2e-34   
ref|XP_008802593.1|  PREDICTED: uncharacterized protein LOC103716395    135   2e-34   
ref|XP_003614085.1|  hypothetical protein MTR_5g044580                  135   2e-34   
ref|XP_009381725.1|  PREDICTED: uncharacterized protein LOC103969806    135   2e-34   
ref|XP_007035406.1|  DUF679 domain membrane protein 2                   136   2e-34   
ref|XP_011017214.1|  PREDICTED: uncharacterized protein LOC105120630    136   2e-34   
ref|XP_008223062.1|  PREDICTED: uncharacterized protein LOC103322889    134   2e-34   
ref|XP_010088151.1|  hypothetical protein L484_013595                   135   2e-34   
ref|XP_002315049.1|  hypothetical protein POPTR_0010s17550g             135   2e-34   
ref|XP_010649829.1|  PREDICTED: uncharacterized protein LOC100264790    134   3e-34   
ref|XP_002512325.1|  conserved hypothetical protein                     135   3e-34   
gb|KHN03024.1|  hypothetical protein glysoja_009890                     135   3e-34   
ref|XP_008387881.1|  PREDICTED: uncharacterized protein LOC103450329    134   3e-34   
ref|XP_006406257.1|  hypothetical protein EUTSA_v10021605mg             133   4e-34   
ref|XP_008223061.1|  PREDICTED: uncharacterized protein LOC103322888    133   4e-34   
ref|XP_011467959.1|  PREDICTED: uncharacterized protein LOC101296994    134   5e-34   
ref|XP_009774298.1|  PREDICTED: uncharacterized protein LOC104224365    132   6e-34   
ref|XP_010036244.1|  PREDICTED: uncharacterized protein LOC104425287    133   8e-34   
ref|XP_011013354.1|  PREDICTED: uncharacterized protein LOC105117400    134   9e-34   
emb|CDY44328.1|  BnaC05g30650D                                          132   1e-33   
ref|XP_011023527.1|  PREDICTED: uncharacterized protein LOC105124...    132   1e-33   
ref|XP_011023530.1|  PREDICTED: uncharacterized protein LOC105124...    132   1e-33   
ref|XP_006827264.1|  PREDICTED: uncharacterized protein LOC18422250     132   2e-33   
emb|CDP00855.1|  unnamed protein product                                132   2e-33   
emb|CDY38623.1|  BnaA05g19640D                                          131   2e-33   
ref|XP_011023528.1|  PREDICTED: uncharacterized protein LOC105124...    132   2e-33   
ref|XP_008790315.1|  PREDICTED: uncharacterized protein LOC103707561    132   2e-33   
ref|XP_011023529.1|  PREDICTED: uncharacterized protein LOC105124...    132   2e-33   
ref|XP_010244772.1|  PREDICTED: uncharacterized protein LOC104588512    132   2e-33   
ref|XP_011075510.1|  PREDICTED: uncharacterized protein LOC105159971    132   2e-33   
ref|XP_002876900.1|  hypothetical protein ARALYDRAFT_484296             132   2e-33   
ref|XP_007221659.1|  hypothetical protein PRUPE_ppb009805mg             132   2e-33   
ref|XP_010674991.1|  PREDICTED: uncharacterized protein LOC104891047    132   2e-33   
ref|XP_004508329.1|  PREDICTED: uncharacterized protein LOC101512577    132   3e-33   
ref|XP_010687641.1|  PREDICTED: uncharacterized protein LOC104901738    130   3e-33   
ref|XP_010036256.1|  PREDICTED: uncharacterized protein LOC104425295    132   3e-33   
gb|KCW84360.1|  hypothetical protein EUGRSUZ_B01212                     131   3e-33   
ref|XP_008444039.1|  PREDICTED: uncharacterized protein LOC103487490    132   4e-33   
ref|XP_009352167.1|  PREDICTED: uncharacterized protein LOC103943583    131   4e-33   
ref|XP_009799783.1|  PREDICTED: uncharacterized protein LOC104245803    132   4e-33   
ref|XP_007154201.1|  hypothetical protein PHAVU_003G098500g             131   4e-33   
ref|XP_010683169.1|  PREDICTED: uncharacterized protein LOC104897901    132   5e-33   
gb|KFK39625.1|  hypothetical protein AALP_AA3G268200                    130   5e-33   
ref|XP_003621241.1|  hypothetical protein MTR_7g010890                  131   6e-33   
ref|XP_009774121.1|  PREDICTED: uncharacterized protein LOC104224215    131   8e-33   
ref|XP_009595904.1|  PREDICTED: uncharacterized protein LOC104092105    131   8e-33   
ref|XP_010045885.1|  PREDICTED: uncharacterized protein LOC104434703    130   9e-33   
ref|XP_002278425.1|  PREDICTED: uncharacterized protein LOC100243883    130   9e-33   
ref|XP_009109446.1|  PREDICTED: uncharacterized protein LOC103835095    129   1e-32   
gb|KCW84362.1|  hypothetical protein EUGRSUZ_B01214                     129   1e-32   
emb|CDY37280.1|  BnaA01g25000D                                          129   1e-32   
ref|XP_008781019.1|  PREDICTED: uncharacterized protein LOC103700896    130   1e-32   
ref|XP_006431160.1|  hypothetical protein CICLE_v10013797mg             130   1e-32   
ref|XP_006355155.1|  PREDICTED: uncharacterized protein LOC102591030    130   1e-32   
ref|XP_002455931.1|  hypothetical protein SORBIDRAFT_03g027420          131   1e-32   
ref|XP_002319568.1|  hypothetical protein POPTR_0013s02820g             129   2e-32   
gb|KHN37536.1|  hypothetical protein glysoja_007239                     129   2e-32   
ref|XP_010528343.1|  PREDICTED: uncharacterized protein LOC104805...    130   2e-32   
ref|XP_002522445.1|  conserved hypothetical protein                     130   2e-32   
ref|XP_006471189.1|  PREDICTED: uncharacterized protein LOC102623995    136   2e-32   
ref|NP_001059434.1|  Os07g0407900                                       131   2e-32   
gb|EPS58472.1|  hypothetical protein M569_16342                         129   2e-32   
ref|XP_009145473.1|  PREDICTED: uncharacterized protein LOC103869164    129   2e-32   
gb|KFK26910.1|  hypothetical protein AALP_AA8G309600                    130   2e-32   
ref|XP_010914346.1|  PREDICTED: uncharacterized protein LOC105039778    128   3e-32   
ref|XP_004239396.1|  PREDICTED: uncharacterized protein LOC101263909    129   3e-32   
ref|XP_003553091.1|  PREDICTED: uncharacterized protein LOC100806096    129   3e-32   
gb|EYU40520.1|  hypothetical protein MIMGU_mgv1a023255mg                129   3e-32   
ref|XP_002516830.1|  conserved hypothetical protein                     128   3e-32   
ref|XP_003528659.1|  PREDICTED: uncharacterized protein LOC100819528    129   4e-32   
ref|XP_002312376.1|  hypothetical protein POPTR_0008s11410g             128   4e-32   
ref|XP_009139910.1|  PREDICTED: uncharacterized protein LOC103863904    129   4e-32   
ref|XP_007139518.1|  hypothetical protein PHAVU_008G036500g             129   4e-32   
emb|CDX74441.1|  BnaA04g09480D                                          129   5e-32   
ref|XP_003553088.1|  PREDICTED: uncharacterized protein LOC100802901    128   5e-32   
ref|XP_003542907.1|  PREDICTED: uncharacterized protein LOC100819509    128   5e-32   
ref|XP_012068337.1|  PREDICTED: uncharacterized protein LOC105630948    129   5e-32   
ref|XP_007227278.1|  hypothetical protein PRUPE_ppa017516mg             127   6e-32   
ref|XP_002870771.1|  hypothetical protein ARALYDRAFT_494025             129   7e-32   
ref|XP_006285870.1|  hypothetical protein CARUB_v10007365mg             129   9e-32   
ref|XP_010045883.1|  PREDICTED: uncharacterized protein LOC104434702    127   1e-31   
ref|NP_566687.1|  DUF679 domain membrane protein 2                      127   1e-31   
ref|XP_007139565.1|  hypothetical protein PHAVU_008G040400g             127   1e-31   
ref|XP_007030781.1|  Uncharacterized protein TCM_026517                 128   1e-31   
gb|KJB26479.1|  hypothetical protein B456_004G243900                    127   1e-31   
gb|KFK25288.1|  hypothetical protein AALP_AA8G092900                    128   1e-31   
ref|XP_006405607.1|  hypothetical protein EUTSA_v10027899mg             128   1e-31   
ref|XP_006300191.1|  hypothetical protein CARUB_v10016427mg             126   1e-31   
ref|XP_004296768.1|  PREDICTED: uncharacterized protein LOC101311466    127   1e-31   
ref|XP_010510347.1|  PREDICTED: uncharacterized protein LOC104786603    126   2e-31   
ref|NP_001144876.1|  uncharacterized protein LOC100277972               127   2e-31   
ref|XP_010911374.1|  PREDICTED: uncharacterized protein LOC105037398    127   2e-31   
ref|XP_010528342.1|  PREDICTED: uncharacterized protein LOC104805...    128   2e-31   
ref|XP_010450786.1|  PREDICTED: uncharacterized protein LOC104732887    128   2e-31   
ref|XP_010466402.1|  PREDICTED: uncharacterized protein LOC104746582    126   2e-31   
ref|XP_010435868.1|  PREDICTED: uncharacterized protein LOC104719614    127   2e-31   
ref|XP_008438763.1|  PREDICTED: uncharacterized protein LOC103483776    127   2e-31   
ref|XP_009145474.1|  PREDICTED: uncharacterized protein LOC103869169    126   2e-31   
ref|XP_002885448.1|  hypothetical protein ARALYDRAFT_898603             126   2e-31   
ref|XP_004305023.1|  PREDICTED: uncharacterized protein LOC101304693    127   3e-31   
ref|XP_009387184.1|  PREDICTED: uncharacterized protein LOC103974145    125   4e-31   
emb|CDY38622.1|  BnaA05g19650D                                          126   4e-31   
ref|XP_010041635.1|  PREDICTED: uncharacterized protein LOC104430587    126   4e-31   
ref|XP_004305022.1|  PREDICTED: uncharacterized protein LOC101304116    127   5e-31   
gb|KJB72501.1|  hypothetical protein B456_011G182200                    125   5e-31   
ref|XP_009408744.1|  PREDICTED: uncharacterized protein LOC103991110    125   5e-31   
ref|NP_198781.1|  uncharacterized protein                               126   6e-31   
ref|XP_002982286.1|  hypothetical protein SELMODRAFT_58693              124   6e-31   
gb|ABK28729.1|  unknown                                                 126   6e-31   
ref|XP_009385032.1|  PREDICTED: uncharacterized protein LOC103972420    125   7e-31   
ref|XP_002438110.1|  hypothetical protein SORBIDRAFT_10g008180          125   7e-31   
emb|CDY19288.1|  BnaC01g31920D                                          124   7e-31   
ref|XP_006600330.1|  PREDICTED: uncharacterized protein LOC100786973    125   7e-31   
gb|ACU20612.1|  unknown                                                 125   8e-31   
ref|XP_010042202.1|  PREDICTED: cell wall integrity and stress re...    125   9e-31   
dbj|BAD22062.1|  hypothetical protein                                   125   9e-31   
ref|NP_001031010.1|  uncharacterized protein                            125   1e-30   
ref|XP_002452084.1|  hypothetical protein SORBIDRAFT_04g019010          125   1e-30   
gb|KCW44210.1|  hypothetical protein EUGRSUZ_L02364                     124   1e-30   
ref|XP_008810928.1|  PREDICTED: uncharacterized protein LOC103722231    125   1e-30   
gb|AFG43958.1|  hypothetical protein 0_10415_01                         122   2e-30   
gb|KFK39449.1|  hypothetical protein AALP_AA3G246500                    124   2e-30   
ref|XP_002966216.1|  hypothetical protein SELMODRAFT_68629              123   2e-30   
gb|AFW85238.1|  hypothetical protein ZEAMMB73_186641                    124   2e-30   
gb|EAY85849.1|  hypothetical protein OsI_07211                          124   2e-30   
gb|AFG43944.1|  hypothetical protein 0_10415_01                         122   2e-30   
gb|AFG43950.1|  hypothetical protein 0_10415_01                         122   2e-30   
gb|AFG43952.1|  hypothetical protein 0_10415_01                         122   2e-30   
ref|XP_008675476.1|  PREDICTED: uncharacterized protein LOC103651591    125   2e-30   
ref|XP_006399451.1|  hypothetical protein EUTSA_v10014525mg             124   3e-30   
ref|XP_004971846.1|  PREDICTED: uncharacterized protein LOC101769380    124   3e-30   
gb|AFG43943.1|  hypothetical protein 0_10415_01                         121   4e-30   
ref|XP_010094838.1|  hypothetical protein L484_016419                   123   4e-30   
ref|XP_008657262.1|  PREDICTED: uncharacterized protein LOC103636687    124   4e-30   
gb|AFG43948.1|  hypothetical protein 0_10415_01                         121   4e-30   
ref|XP_004965304.1|  PREDICTED: uncharacterized protein LOC101766221    123   6e-30   
ref|XP_006473226.1|  PREDICTED: uncharacterized protein LOC102608595    122   8e-30   
ref|XP_004134465.2|  PREDICTED: uncharacterized protein LOC101205641    122   9e-30   
gb|KGN57051.1|  hypothetical protein Csa_3G150800                       122   1e-29   
ref|XP_006433197.1|  hypothetical protein CICLE_v10003468mg             123   1e-29   
gb|EMT31472.1|  hypothetical protein F775_13695                         122   1e-29   
ref|XP_009402791.1|  PREDICTED: uncharacterized protein LOC103986498    122   1e-29   
ref|XP_006658493.1|  PREDICTED: uncharacterized protein LOC102714661    123   1e-29   
ref|XP_006434649.1|  hypothetical protein CICLE_v10003661mg             122   1e-29   
ref|NP_001043106.1|  Os01g0388700                                       122   1e-29   
ref|XP_003565771.1|  PREDICTED: uncharacterized protein LOC100831528    122   1e-29   
gb|AEW07742.1|  hypothetical protein 0_10415_01                         119   2e-29   
ref|XP_012075911.1|  PREDICTED: uncharacterized protein LOC105637117    121   2e-29   
ref|XP_002883310.1|  hypothetical protein ARALYDRAFT_898600             121   2e-29   
ref|XP_009131120.1|  PREDICTED: uncharacterized protein LOC103855829    122   2e-29   
ref|XP_004969121.1|  PREDICTED: uncharacterized protein LOC101782846    122   3e-29   
gb|EEC69143.1|  hypothetical protein OsI_38076                          124   3e-29   
gb|AFG43953.1|  hypothetical protein 0_10415_01                         119   3e-29   
gb|EAY90186.1|  hypothetical protein OsI_11750                          120   3e-29   
ref|XP_010553995.1|  PREDICTED: uncharacterized protein LOC104823904    122   3e-29   
gb|EMS63911.1|  hypothetical protein TRIUR3_21547                       121   3e-29   
ref|NP_001050198.1|  Os03g0370400                                       120   3e-29   
ref|XP_006644193.1|  PREDICTED: uncharacterized protein LOC102703432    121   4e-29   
ref|XP_006376329.1|  hypothetical protein POPTR_0013s12060g             120   5e-29   
gb|EMT12942.1|  hypothetical protein F775_20176                         120   5e-29   
emb|CDX81135.1|  BnaC03g03890D                                          121   5e-29   
gb|ABR18305.1|  unknown                                                 119   6e-29   
ref|XP_010236366.1|  PREDICTED: uncharacterized protein LOC100833397    120   7e-29   
dbj|BAJ98080.1|  predicted protein                                      119   7e-29   
emb|CDY38243.1|  BnaC05g17600D                                          117   9e-29   
ref|XP_002533318.1|  conserved hypothetical protein                     119   9e-29   
ref|XP_006650125.1|  PREDICTED: uncharacterized protein LOC102701151    119   9e-29   
ref|XP_010510323.1|  PREDICTED: uncharacterized protein LOC104786586    119   1e-28   
ref|XP_008438760.1|  PREDICTED: uncharacterized protein LOC103483773    118   1e-28   
ref|XP_010488166.1|  PREDICTED: uncharacterized protein LOC104766049    119   2e-28   
ref|XP_004984268.1|  PREDICTED: uncharacterized protein LOC101785245    118   3e-28   
gb|EYU28766.1|  hypothetical protein MIMGU_mgv1a018679mg                119   3e-28   
ref|XP_007035405.1|  DUF679 domain membrane protein 2, putative         117   4e-28   
ref|XP_010673303.1|  PREDICTED: uncharacterized protein LOC104889685    118   4e-28   
ref|XP_010024463.1|  PREDICTED: uncharacterized protein LOC104414942    117   5e-28   
gb|KGN57049.1|  hypothetical protein Csa_3G150780                       117   5e-28   
gb|AFW88282.1|  hypothetical protein ZEAMMB73_902531                    117   5e-28   
ref|XP_003609548.1|  hypothetical protein MTR_4g118470                  117   7e-28   
ref|XP_006298556.1|  hypothetical protein CARUB_v10014640mg             117   9e-28   
ref|XP_009375292.1|  PREDICTED: uncharacterized protein LOC103964125    117   9e-28   
ref|XP_010466400.1|  PREDICTED: uncharacterized protein LOC104746580    117   1e-27   
ref|XP_010256248.1|  PREDICTED: uncharacterized protein LOC104596693    117   1e-27   
gb|EMT14009.1|  hypothetical protein F775_32425                         117   1e-27   
ref|NP_001143575.1|  uncharacterized protein LOC100276273               116   1e-27   
ref|XP_003609549.1|  hypothetical protein MTR_4g118480                  116   2e-27   
ref|XP_009760516.1|  PREDICTED: uncharacterized protein LOC104212855    116   2e-27   
ref|XP_010524524.1|  PREDICTED: uncharacterized protein LOC104802567    116   2e-27   
ref|XP_007199022.1|  hypothetical protein PRUPE_ppa017716mg             116   2e-27   
gb|EEC70698.1|  hypothetical protein OsI_02061                          116   3e-27   
ref|XP_006599999.1|  PREDICTED: uncharacterized protein LOC102667772    115   3e-27   
gb|EMT29931.1|  hypothetical protein F775_19617                         116   4e-27   
ref|XP_010279209.1|  PREDICTED: uncharacterized protein LOC104613182    115   4e-27   
ref|NP_188789.2|  DUF679 domain membrane protein 1                      115   4e-27   
ref|XP_003557899.1|  PREDICTED: uncharacterized protein LOC100830766    115   4e-27   
ref|XP_009339764.1|  PREDICTED: uncharacterized protein LOC103931959    114   4e-27   
ref|XP_002457653.1|  hypothetical protein SORBIDRAFT_03g011250          115   5e-27   
ref|NP_001043108.1|  Os01g0389700                                       115   5e-27   
gb|EAY74176.1|  hypothetical protein OsI_02060                          115   7e-27   
gb|EAY74055.1|  hypothetical protein OsI_01943                          117   8e-27   
dbj|BAD89480.1|  hypothetical protein                                   117   8e-27   
ref|XP_003565769.2|  PREDICTED: uncharacterized protein LOC100830611    116   9e-27   
ref|XP_004952503.1|  PREDICTED: uncharacterized protein LOC101754505    114   9e-27   



>emb|CDO99489.1| unnamed protein product [Coffea canephora]
Length=207

 Score =   293 bits (750),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 142/210 (68%), Positives = 169/210 (80%), Gaps = 4/210 (2%)
 Frame = +3

Query  42   MDIHVGDEELSHNNVVVSEKVPLLVPDEVEKNLVQKAISQTFQSAAHLANLLPTGAVLAF  221
            ++I V +E    +  +  E+ PLLVP EVEK LVQKAISQTFQS AHLANLLPTG+VLAF
Sbjct  2    VEIKVENES---SRDLAEERAPLLVP-EVEKTLVQKAISQTFQSTAHLANLLPTGSVLAF  57

Query  222  QLLSPIFSNQGDCDAVSRFLTASLVAMCGLSCFLLSFTDSFKDQKGNVCYGVATVKGLWV  401
            QLLSPIF+NQG+CDAVSR +TA L+A+CGLSCFL SFTDSFKDQKGN+CYG AT+ GLWV
Sbjct  58   QLLSPIFTNQGECDAVSRSMTAVLIALCGLSCFLFSFTDSFKDQKGNLCYGFATLHGLWV  117

Query  402  IDGSASLPPELAAKYKVKFIDFVHAVMSVLVFGAIALFDQNVVSCFXPXPXXEXXXILPX  581
            IDGSA++PPELAA Y++KFIDF+HA MS+LVF A+ALF+QNVV+CF P P  E   +L  
Sbjct  118  IDGSATIPPELAATYRLKFIDFMHAFMSILVFAAVALFNQNVVNCFYPMPSDEAKELLTA  177

Query  582  VPVGXGXVCXXLFVVFPPXXXGIGFPXTXD  671
            +PVG G +C  LFVVFP    GIGFP T +
Sbjct  178  MPVGIGVICSMLFVVFPTKRHGIGFPLTAN  207



>ref|XP_009624698.1| PREDICTED: uncharacterized protein LOC104115715 [Nicotiana tomentosiformis]
Length=211

 Score =   290 bits (742),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 141/214 (66%), Positives = 171/214 (80%), Gaps = 7/214 (3%)
 Frame = +3

Query  42   MDIHVGDEELSHNNVVVSEKVPLLVPD----EVEKNLVQKAISQTFQSAAHLANLLPTGA  209
            M+I V + E S N  +  EK PLL+ +    EVEKNL+Q+AISQTF+S AHLANLLPTG+
Sbjct  1    MEIKV-ENETSRN--LDEEKAPLLLENSPLPEVEKNLIQQAISQTFKSTAHLANLLPTGS  57

Query  210  VLAFQLLSPIFSNQGDCDAVSRFLTASLVAMCGLSCFLLSFTDSFKDQKGNVCYGVATVK  389
            VLAFQLLSPIF+NQG+CD V R LTA+LVA+CGLSCFLLSFTDSFKDQKGNVCYG+AT++
Sbjct  58   VLAFQLLSPIFTNQGECDVVGRSLTAALVALCGLSCFLLSFTDSFKDQKGNVCYGIATLR  117

Query  390  GLWVIDGSASLPPELAAKYKVKFIDFVHAVMSVLVFGAIALFDQNVVSCFXPXPXXEXXX  569
            GLW+IDGSA+ PPE+AA YK+K IDF+HA+MS+LVF A+ALFDQNVV+CF P P  +   
Sbjct  118  GLWIIDGSATPPPEIAANYKLKLIDFMHAIMSILVFAAVALFDQNVVNCFYPTPSYQTQE  177

Query  570  ILPXVPVGXGXVCXXLFVVFPPXXXGIGFPXTXD  671
            +L  +PV  G +C  LFVVFP    GIGFP T +
Sbjct  178  LLTALPVAIGVICSMLFVVFPTQRHGIGFPLTAN  211



>ref|XP_011096362.1| PREDICTED: uncharacterized protein LOC105175576 [Sesamum indicum]
Length=238

 Score =   288 bits (738),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 141/211 (67%), Positives = 166/211 (79%), Gaps = 4/211 (2%)
 Frame = +3

Query  42   MDIHVGDEELSHNNVVVSEKVPLLVPD---EVEKNLVQKAISQTFQSAAHLANLLPTGAV  212
            M+I V ++  S   +   + VPLLV     EVE+NL+Q+AISQTF+S AHLANLLPTG+V
Sbjct  27   MEIKVENDNESSQEIC-EQDVPLLVNKNLPEVERNLIQQAISQTFESTAHLANLLPTGSV  85

Query  213  LAFQLLSPIFSNQGDCDAVSRFLTASLVAMCGLSCFLLSFTDSFKDQKGNVCYGVATVKG  392
            LAFQLLSPIF+NQG+CD VSR LTA LVA+CGLSC LLSFTDSFKDQKGN+CYG AT +G
Sbjct  86   LAFQLLSPIFTNQGECDTVSRSLTAGLVALCGLSCILLSFTDSFKDQKGNICYGFATFRG  145

Query  393  LWVIDGSASLPPELAAKYKVKFIDFVHAVMSVLVFGAIALFDQNVVSCFXPXPXXEXXXI  572
            LW+IDGS +LPPE+AAKYK+KFIDFVHA+MS+LVF AIALFD+NVV+CF P P      +
Sbjct  146  LWIIDGSVTLPPEIAAKYKLKFIDFVHALMSILVFAAIALFDENVVNCFYPAPSAGTKEV  205

Query  573  LPXVPVGXGXVCXXLFVVFPPXXXGIGFPXT  665
            L  +PVG G  C  LFVVFP    GIGFP T
Sbjct  206  LTALPVGIGVACSMLFVVFPTKRHGIGFPVT  236



>ref|XP_009775864.1| PREDICTED: uncharacterized protein LOC104225708 [Nicotiana sylvestris]
Length=211

 Score =   288 bits (736),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 138/214 (64%), Positives = 172/214 (80%), Gaps = 7/214 (3%)
 Frame = +3

Query  42   MDIHVGDEELSHNNVVVSEKVPLLVPD----EVEKNLVQKAISQTFQSAAHLANLLPTGA  209
            M++ V ++E S N  +  EK PLL+ +    EVEKN++Q+AIS+TF+S AHLANLLPTG+
Sbjct  1    MEVKV-EKETSRN--LDEEKAPLLLENSALPEVEKNMIQQAISKTFKSTAHLANLLPTGS  57

Query  210  VLAFQLLSPIFSNQGDCDAVSRFLTASLVAMCGLSCFLLSFTDSFKDQKGNVCYGVATVK  389
            VLAFQLLSPIF+NQG+CD + R LTA+LVA+CGLSCFLLSFTDSFKDQKGNVCYG AT++
Sbjct  58   VLAFQLLSPIFTNQGECDVIGRSLTAALVALCGLSCFLLSFTDSFKDQKGNVCYGFATLR  117

Query  390  GLWVIDGSASLPPELAAKYKVKFIDFVHAVMSVLVFGAIALFDQNVVSCFXPXPXXEXXX  569
            GLW+IDGSA+ PPE+AA YK+KFIDF+HA+MS+LVF A+ALFDQNVV+CF P P  +   
Sbjct  118  GLWIIDGSAAPPPEIAANYKLKFIDFMHAIMSILVFAAVALFDQNVVNCFYPTPSYQTQE  177

Query  570  ILPXVPVGXGXVCXXLFVVFPPXXXGIGFPXTXD  671
            +L  +PV  G +C  LFVVFP    GIGFP T +
Sbjct  178  LLTALPVAIGVICSMLFVVFPTQRHGIGFPLTSN  211



>ref|XP_006364305.1| PREDICTED: uncharacterized protein LOC102579399 [Solanum tuberosum]
Length=209

 Score =   282 bits (722),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 142/211 (67%), Positives = 164/211 (78%), Gaps = 6/211 (3%)
 Frame = +3

Query  42   MDIHVGDEELSHNNVVVSEKVPLLVPDE---VEKNLVQKAISQTFQSAAHLANLLPTGAV  212
            M+I V + E+  N  +  EK PLL   E   VEKNL+Q+AISQTF+S AHLANLLPTG+V
Sbjct  1    MEIKV-ENEIPRN--LDEEKAPLLENSELPEVEKNLIQQAISQTFKSTAHLANLLPTGSV  57

Query  213  LAFQLLSPIFSNQGDCDAVSRFLTASLVAMCGLSCFLLSFTDSFKDQKGNVCYGVATVKG  392
            LAFQ LSPIF+NQG CD V R LTA+LVA+CGLSCFLLSFTDSFKDQKGNVCYG AT  G
Sbjct  58   LAFQFLSPIFTNQGQCDVVGRSLTAALVALCGLSCFLLSFTDSFKDQKGNVCYGFATTCG  117

Query  393  LWVIDGSASLPPELAAKYKVKFIDFVHAVMSVLVFGAIALFDQNVVSCFXPXPXXEXXXI  572
            LW+IDGSA+LP E AAKYK+KFIDF+HA+MS+LVF A+ALFDQNVV+CF P P  E   +
Sbjct  118  LWIIDGSATLPLEAAAKYKLKFIDFMHAIMSILVFAAVALFDQNVVNCFYPTPSYETQEL  177

Query  573  LPXVPVGXGXVCXXLFVVFPPXXXGIGFPXT  665
            L  +PV  G +C  LFVVFP    GIGFP T
Sbjct  178  LTALPVAIGVICSMLFVVFPTQRHGIGFPLT  208



>ref|XP_004233838.1| PREDICTED: uncharacterized protein LOC101249147 [Solanum lycopersicum]
Length=209

 Score =   280 bits (717),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 140/211 (66%), Positives = 164/211 (78%), Gaps = 6/211 (3%)
 Frame = +3

Query  42   MDIHVGDEELSHNNVVVSEKVPLLVPDE---VEKNLVQKAISQTFQSAAHLANLLPTGAV  212
            M+I V D ++  N  +  EKVPLL   E   VEKNL+Q+AIS TF+S AHLANLLPTG+V
Sbjct  1    MEIKV-DNQIPRN--LDDEKVPLLESSELPEVEKNLIQQAISHTFKSTAHLANLLPTGSV  57

Query  213  LAFQLLSPIFSNQGDCDAVSRFLTASLVAMCGLSCFLLSFTDSFKDQKGNVCYGVATVKG  392
            LAFQ LSPIF+NQG CD V R LTA LVA+CGLSCFLL+FTDSFKDQKGN+CYG AT +G
Sbjct  58   LAFQFLSPIFTNQGQCDVVGRSLTAGLVALCGLSCFLLNFTDSFKDQKGNICYGFATTRG  117

Query  393  LWVIDGSASLPPELAAKYKVKFIDFVHAVMSVLVFGAIALFDQNVVSCFXPXPXXEXXXI  572
            LW+IDGSA+ P E+AAKYK+KFIDF+HA+MS+LVF A+ALFDQNVVSCF P P  E   +
Sbjct  118  LWIIDGSATPPLEVAAKYKLKFIDFMHAIMSILVFAAVALFDQNVVSCFYPTPSYETQEL  177

Query  573  LPXVPVGXGXVCXXLFVVFPPXXXGIGFPXT  665
            L  +PV  G +C  LFVVFP    GIGFP T
Sbjct  178  LTALPVAIGVICSMLFVVFPTQRHGIGFPLT  208



>ref|XP_002265414.1| PREDICTED: uncharacterized protein LOC100244781 [Vitis vinifera]
 emb|CBI35259.3| unnamed protein product [Vitis vinifera]
Length=211

 Score =   280 bits (717),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 137/214 (64%), Positives = 163/214 (76%), Gaps = 7/214 (3%)
 Frame = +3

Query  42   MDIHVGDEELSHNNVVVSEKVPLL----VPDEVEKNLVQKAISQTFQSAAHLANLLPTGA  209
            M+I V DEE    N    +KVPLL    +P   EK L+QKAISQTFQS AHLANLLPTG 
Sbjct  1    MEIKVEDEEFQIPN---GQKVPLLQDMAMPRAEEKTLIQKAISQTFQSTAHLANLLPTGT  57

Query  210  VLAFQLLSPIFSNQGDCDAVSRFLTASLVAMCGLSCFLLSFTDSFKDQKGNVCYGVATVK  389
            VLAFQ+LSPIFSNQGDCD VSRF+TA+LVA+CG+SCFL  FTDS +D+  NVCYG+AT +
Sbjct  58   VLAFQILSPIFSNQGDCDPVSRFMTAALVALCGVSCFLACFTDSIRDKDRNVCYGLATFR  117

Query  390  GLWVIDGSASLPPELAAKYKVKFIDFVHAVMSVLVFGAIALFDQNVVSCFXPXPXXEXXX  569
            GLWVIDGSA++ PELAAKY+++FIDF+HA MS+LVF AI LFD+NVV CF P P  E   
Sbjct  118  GLWVIDGSATITPELAAKYQLRFIDFMHAFMSILVFAAITLFDENVVQCFYPTPSDETKE  177

Query  570  ILPXVPVGXGXVCXXLFVVFPPXXXGIGFPXTXD  671
            +L  +PVG G +C  LFVVFP    GIGFP + +
Sbjct  178  LLAALPVGIGVICSMLFVVFPTQRHGIGFPLSAN  211



>ref|XP_002509425.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF50812.1| conserved hypothetical protein [Ricinus communis]
Length=206

 Score =   278 bits (712),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 131/195 (67%), Positives = 157/195 (81%), Gaps = 4/195 (2%)
 Frame = +3

Query  93   SEKVPLL----VPDEVEKNLVQKAISQTFQSAAHLANLLPTGAVLAFQLLSPIFSNQGDC  260
            +EK+PLL    +P+  EKNL+QKAISQTF+S AHLANLLPTG VLAFQLLSPIFSNQG+C
Sbjct  10   NEKLPLLRDFPIPNTEEKNLIQKAISQTFKSTAHLANLLPTGTVLAFQLLSPIFSNQGNC  69

Query  261  DAVSRFLTASLVAMCGLSCFLLSFTDSFKDQKGNVCYGVATVKGLWVIDGSASLPPELAA  440
            D VSRF+TA LV++CGLSCFL SFTDS +D+ GNV YG ATV GLW+IDGS ++ PE+A 
Sbjct  70   DPVSRFMTAGLVSLCGLSCFLSSFTDSVRDENGNVSYGFATVHGLWIIDGSTTISPEIAT  129

Query  441  KYKVKFIDFVHAVMSVLVFGAIALFDQNVVSCFXPXPXXEXXXILPXVPVGXGXVCXXLF  620
            KY++KFIDF+HA+MS+LVF AIALFDQNVV+CF P P  E   +L  +PVG G +C  LF
Sbjct  130  KYRLKFIDFMHAIMSILVFSAIALFDQNVVACFYPTPSAETQELLTTLPVGIGMICSMLF  189

Query  621  VVFPPXXXGIGFPXT  665
            VVFP    GIGFP +
Sbjct  190  VVFPTQRHGIGFPIS  204



>ref|XP_011001224.1| PREDICTED: uncharacterized protein LOC105108575 [Populus euphratica]
Length=233

 Score =   278 bits (711),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 137/225 (61%), Positives = 173/225 (77%), Gaps = 10/225 (4%)
 Frame = +3

Query  9    RNDKEIVRF*EMDIHVGDEELSHNNVVVSEKVPLL----VPDEVEKNLVQKAISQTFQSA  176
            R +KE++    M+I V     S N     EK+PLL    +P+E + NLVQKAISQTF+S 
Sbjct  15   RREKELL---AMEIKVDSHHDSLN--ADEEKLPLLKGVAMPNE-DTNLVQKAISQTFKST  68

Query  177  AHLANLLPTGAVLAFQLLSPIFSNQGDCDAVSRFLTASLVAMCGLSCFLLSFTDSFKDQK  356
            AHLANLLPTG VLAFQLLSPIFSNQG+CD+V+R +TA LV +CGLSCFL SF+DSF+D+K
Sbjct  69   AHLANLLPTGTVLAFQLLSPIFSNQGNCDSVTRSMTAGLVLLCGLSCFLSSFSDSFRDKK  128

Query  357  GNVCYGVATVKGLWVIDGSASLPPELAAKYKVKFIDFVHAVMSVLVFGAIALFDQNVVSC  536
            GNVCYG+AT +GLWVIDGSA++PPE+AA Y+++FIDF+HA+MS+LVF AI+LFDQN+V C
Sbjct  129  GNVCYGLATFRGLWVIDGSATIPPEIAANYRLRFIDFMHALMSILVFAAISLFDQNLVDC  188

Query  537  FXPXPXXEXXXILPXVPVGXGXVCXXLFVVFPPXXXGIGFPXTXD  671
            F P P  +   +L  +PVG G +C  LFVVFP    GIGFP + +
Sbjct  189  FYPSPSTKAQEVLTALPVGIGALCSMLFVVFPTKRHGIGFPLSAN  233



>gb|AFK44846.1| unknown [Lotus japonicus]
Length=212

 Score =   277 bits (708),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 139/214 (65%), Positives = 164/214 (77%), Gaps = 6/214 (3%)
 Frame = +3

Query  42   MDIHVGDEELSHNNVVVSEKVPLLVPDEV---EKNLVQKAISQTFQSAAHLANLLPTGAV  212
            MDI    EE+  +  +  +K+PLL   EV   E+NLVQKAISQTFQS A LANLLPTG V
Sbjct  1    MDIK---EEMDDSKNLDEQKLPLLRNAEVPEAERNLVQKAISQTFQSTAQLANLLPTGTV  57

Query  213  LAFQLLSPIFSNQGDCDAVSRFLTASLVAMCGLSCFLLSFTDSFKDQKGNVCYGVATVKG  392
            LAFQLLSPIFSN G+CD+VSR +TASLVA+CG +CFLL FTDSF+D KGN+C+G AT +G
Sbjct  58   LAFQLLSPIFSNVGNCDSVSRLMTASLVAICGAACFLLCFTDSFRDSKGNICHGFATFRG  117

Query  393  LWVIDGSASLPPELAAKYKVKFIDFVHAVMSVLVFGAIALFDQNVVSCFXPXPXXEXXXI  572
            LWVIDGS +L PELAAKY+++FIDF+HAVMSVLVF AIALFDQNVV+CF P P  +   I
Sbjct  118  LWVIDGSNTLSPELAAKYRLRFIDFLHAVMSVLVFAAIALFDQNVVNCFFPEPSKKTQEI  177

Query  573  LPXVPVGXGXVCXXLFVVFPPXXXGIGFPXTXDN  674
            L  +PVG G +C  LFVVFP    GIGF  +  N
Sbjct  178  LTALPVGIGVLCSMLFVVFPTQRHGIGFSLSQIN  211



>ref|XP_006377414.1| hypothetical protein POPTR_0011s05700g [Populus trichocarpa]
 gb|ERP55211.1| hypothetical protein POPTR_0011s05700g [Populus trichocarpa]
Length=233

 Score =   278 bits (710),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 137/225 (61%), Positives = 173/225 (77%), Gaps = 10/225 (4%)
 Frame = +3

Query  9    RNDKEIVRF*EMDIHVGDEELSHNNVVVSEKVPLL----VPDEVEKNLVQKAISQTFQSA  176
            R +KE++    M+I V     S N     EK+PLL    +P+E + NLVQKAISQTF+S 
Sbjct  15   RREKELL---AMEIKVDSHHDSLN--AGEEKLPLLKGVAMPNE-DTNLVQKAISQTFKST  68

Query  177  AHLANLLPTGAVLAFQLLSPIFSNQGDCDAVSRFLTASLVAMCGLSCFLLSFTDSFKDQK  356
            A+LANLLPTG VLAFQLLSPIFSNQG+CD+V+R +TA LV +CGLSCFL SF+DSF+D+K
Sbjct  69   AYLANLLPTGTVLAFQLLSPIFSNQGNCDSVTRSMTAGLVVLCGLSCFLSSFSDSFRDKK  128

Query  357  GNVCYGVATVKGLWVIDGSASLPPELAAKYKVKFIDFVHAVMSVLVFGAIALFDQNVVSC  536
            GNVCYG+AT +GLWVIDGSA++PPE+AA Y+++FIDF+HA+MS+LVF AIALFDQNVV C
Sbjct  129  GNVCYGLATFRGLWVIDGSATIPPEVAANYRLRFIDFMHALMSILVFAAIALFDQNVVDC  188

Query  537  FXPXPXXEXXXILPXVPVGXGXVCXXLFVVFPPXXXGIGFPXTXD  671
            F P P  +   +L  +PVG G +C  LF+VFP    GIGFP + +
Sbjct  189  FYPSPSTKAQEVLTALPVGIGALCSMLFIVFPTKRHGIGFPLSAN  233



>gb|EYU28015.1| hypothetical protein MIMGU_mgv1a013603mg [Erythranthe guttata]
Length=215

 Score =   276 bits (707),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 137/213 (64%), Positives = 162/213 (76%), Gaps = 5/213 (2%)
 Frame = +3

Query  42   MDIHVGDEEL--SHNNVVVSEKVPLLVPD---EVEKNLVQKAISQTFQSAAHLANLLPTG  206
            M I V +E    S   +   E+VPLL      EV++N +Q+AIS+TF S AHLANLLPTG
Sbjct  1    MQIKVENENANGSSQEICEEEEVPLLAYKGIPEVQRNPIQQAISETFASTAHLANLLPTG  60

Query  207  AVLAFQLLSPIFSNQGDCDAVSRFLTASLVAMCGLSCFLLSFTDSFKDQKGNVCYGVATV  386
            +VLAFQLLSPIFSNQG CD+VSRFLT  LVA+CGLSC LLSFTDSF DQKGN+ YG AT 
Sbjct  61   SVLAFQLLSPIFSNQGQCDSVSRFLTGGLVALCGLSCILLSFTDSFNDQKGNIYYGFATF  120

Query  387  KGLWVIDGSASLPPELAAKYKVKFIDFVHAVMSVLVFGAIALFDQNVVSCFXPXPXXEXX  566
            +GLW+IDGSA+LPPE++AKYK+KFIDFVH++MS+LVF AIALFD+NVV+CF P P     
Sbjct  121  RGLWIIDGSATLPPEVSAKYKLKFIDFVHSLMSILVFAAIALFDENVVNCFYPEPSTGVK  180

Query  567  XILPXVPVGXGXVCXXLFVVFPPXXXGIGFPXT  665
             +L  +PVG G  C  LFVVFP    GIGFP T
Sbjct  181  EVLTAMPVGIGVTCSMLFVVFPTKRHGIGFPVT  213



>ref|XP_012091673.1| PREDICTED: uncharacterized protein LOC105649591 [Jatropha curcas]
 gb|KDP21013.1| hypothetical protein JCGZ_21484 [Jatropha curcas]
Length=210

 Score =   276 bits (707),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 132/212 (62%), Positives = 166/212 (78%), Gaps = 8/212 (4%)
 Frame = +3

Query  42   MDIHVGDEELSHNNVVVSEKVPLL----VPDEVEKNLVQKAISQTFQSAAHLANLLPTGA  209
            M+I V    + + N    +KVPLL    +P+   K+L+QKAIS+TF+S AHLANLLPTG 
Sbjct  1    MEIKV----VENGNKSNEQKVPLLQDLPIPNPEGKSLIQKAISETFKSTAHLANLLPTGT  56

Query  210  VLAFQLLSPIFSNQGDCDAVSRFLTASLVAMCGLSCFLLSFTDSFKDQKGNVCYGVATVK  389
            VLAF LLSP+FSNQG+CD+VSRF+TA++V +CGLSCFL SFTDSF+D+ GNVCYG AT +
Sbjct  57   VLAFNLLSPVFSNQGNCDSVSRFMTAAVVTLCGLSCFLSSFTDSFRDKNGNVCYGFATFR  116

Query  390  GLWVIDGSASLPPELAAKYKVKFIDFVHAVMSVLVFGAIALFDQNVVSCFXPXPXXEXXX  569
            GLW+IDGSA+L PELA KY+++FIDF+HA+MS+LVFGA+ALFDQNVV+CF P P  E   
Sbjct  117  GLWIIDGSATLSPELADKYRLRFIDFIHALMSILVFGAVALFDQNVVACFYPKPSTEALE  176

Query  570  ILPXVPVGXGXVCXXLFVVFPPXXXGIGFPXT  665
            +L  +PVG G +C  LFVVFP    GIGFP +
Sbjct  177  VLTALPVGIGVICSMLFVVFPTQRHGIGFPLS  208



>ref|XP_011027771.1| PREDICTED: uncharacterized protein LOC105127982 [Populus euphratica]
Length=234

 Score =   276 bits (706),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 138/226 (61%), Positives = 170/226 (75%), Gaps = 11/226 (5%)
 Frame = +3

Query  9    RNDKEIVRF*EMDIHVGDEELS-HNNVVVSEKVPLL----VPDEVEKNLVQKAISQTFQS  173
            R +KE+     M+I V     S H N    EK+PLL    +P+E E+NL+QKAISQTF+S
Sbjct  15   REEKELP---VMEIKVESHHDSLHTN---EEKLPLLKGVAMPNEDEQNLIQKAISQTFKS  68

Query  174  AAHLANLLPTGAVLAFQLLSPIFSNQGDCDAVSRFLTASLVAMCGLSCFLLSFTDSFKDQ  353
             AHLANLLPTG +LAFQLL PIFSNQG+CD+VSR +TA LVA+CGLSCFL SFTDSF+D+
Sbjct  69   TAHLANLLPTGTILAFQLLLPIFSNQGNCDSVSRSMTAGLVALCGLSCFLSSFTDSFRDK  128

Query  354  KGNVCYGVATVKGLWVIDGSASLPPELAAKYKVKFIDFVHAVMSVLVFGAIALFDQNVVS  533
             GNVCYG AT +GLWVIDGSA++PPE+AA Y+++FIDF+HA+MS+LVF AIALFDQNVV 
Sbjct  129  NGNVCYGFATFRGLWVIDGSATIPPEVAANYRLQFIDFMHALMSILVFAAIALFDQNVVD  188

Query  534  CFXPXPXXEXXXILPXVPVGXGXVCXXLFVVFPPXXXGIGFPXTXD  671
            CF P P  +   +L  +PVG G     LF+VFP    GIGFP + +
Sbjct  189  CFYPSPSTKAQEVLTALPVGIGVFTSMLFLVFPTRRHGIGFPLSAN  234



>ref|XP_008439807.1| PREDICTED: uncharacterized protein LOC103484494 [Cucumis melo]
Length=212

 Score =   274 bits (701),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 131/215 (61%), Positives = 160/215 (74%), Gaps = 8/215 (4%)
 Frame = +3

Query  42   MDIHVGDEELSHNNVVVSEKVPLL-----VPDEVEKNLVQKAISQTFQSAAHLANLLPTG  206
            M+I   DEE       + +K PLL     +P   EK L+QKAISQTF+S A+LANLLPTG
Sbjct  1    MEIKTADEETQSR---IDQKQPLLRETTFIPSRDEKTLIQKAISQTFRSTANLANLLPTG  57

Query  207  AVLAFQLLSPIFSNQGDCDAVSRFLTASLVAMCGLSCFLLSFTDSFKDQKGNVCYGVATV  386
             VLAFQLLSPIF+NQG+CD++SR+LTA LVA+CGLSCFL SFTDSF+D +GNV YG AT 
Sbjct  58   TVLAFQLLSPIFTNQGNCDSISRYLTAGLVALCGLSCFLQSFTDSFRDSQGNVSYGFATF  117

Query  387  KGLWVIDGSASLPPELAAKYKVKFIDFVHAVMSVLVFGAIALFDQNVVSCFXPXPXXEXX  566
            +GLWVIDGS  LPP +AAKY+++FIDF+HA MS+LVF A+ALFD+NVV+CF P P  +  
Sbjct  118  RGLWVIDGSVELPPTVAAKYRLRFIDFLHAFMSILVFSAVALFDENVVNCFYPTPSDQAE  177

Query  567  XILPXVPVGXGXVCXXLFVVFPPXXXGIGFPXTXD  671
             IL  +PV  G  C  LFVVFP    GIGFP + +
Sbjct  178  EILTSLPVAIGVFCSMLFVVFPTKRHGIGFPVSAN  212



>ref|XP_002305111.2| hypothetical protein POPTR_0004s04870g [Populus trichocarpa]
 gb|EEE85622.2| hypothetical protein POPTR_0004s04870g [Populus trichocarpa]
Length=234

 Score =   275 bits (703),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 138/226 (61%), Positives = 170/226 (75%), Gaps = 11/226 (5%)
 Frame = +3

Query  9    RNDKEIVRF*EMDIHVGDEELS-HNNVVVSEKVPLL----VPDEVEKNLVQKAISQTFQS  173
            R +KE+     M+I V     S H N    EK+PLL    +P+E E+NL+QKAISQTF+S
Sbjct  15   RKEKELP---VMEIKVESHHDSLHTN---EEKLPLLKGVAMPNEDEQNLIQKAISQTFKS  68

Query  174  AAHLANLLPTGAVLAFQLLSPIFSNQGDCDAVSRFLTASLVAMCGLSCFLLSFTDSFKDQ  353
             AHLANLLPTG +LAFQLL PIFSNQG+CD+VSR +TA LVA+CGLSCFL SFTDSF+D+
Sbjct  69   TAHLANLLPTGTILAFQLLLPIFSNQGNCDSVSRSMTAGLVALCGLSCFLSSFTDSFRDK  128

Query  354  KGNVCYGVATVKGLWVIDGSASLPPELAAKYKVKFIDFVHAVMSVLVFGAIALFDQNVVS  533
             GNVCYG AT +GLWVIDGSA++PPE+AA Y+++FIDF+HA+MS+LVF AIALFDQNVV 
Sbjct  129  NGNVCYGFATFRGLWVIDGSATIPPEVAANYRLQFIDFMHALMSILVFAAIALFDQNVVD  188

Query  534  CFXPXPXXEXXXILPXVPVGXGXVCXXLFVVFPPXXXGIGFPXTXD  671
            CF P P  +   +L  +PVG G     LF+VFP    GIGFP + +
Sbjct  189  CFYPSPSTKEEEVLTALPVGIGVFTSMLFLVFPTRRHGIGFPLSAN  234



>ref|XP_007025538.1| Uncharacterized protein TCM_029803 [Theobroma cacao]
 gb|EOY28160.1| Uncharacterized protein TCM_029803 [Theobroma cacao]
Length=211

 Score =   273 bits (698),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 136/215 (63%), Positives = 162/215 (75%), Gaps = 9/215 (4%)
 Frame = +3

Query  42   MDIHV-GDEELSHNNVVVSEKVPLL----VPDEVEKNLVQKAISQTFQSAAHLANLLPTG  206
            M+I + G+E   H      +KVPLL    V +  +KN VQKAISQTFQS AHLANLLPTG
Sbjct  1    MEIMIQGEESPEHGE----QKVPLLQSLTVSETEKKNPVQKAISQTFQSTAHLANLLPTG  56

Query  207  AVLAFQLLSPIFSNQGDCDAVSRFLTASLVAMCGLSCFLLSFTDSFKDQKGNVCYGVATV  386
             VLAFQLLSPIF+NQG+CD+VSR +TA L+ +CGLSCFL+SFTDSF+D+ G VCYG AT 
Sbjct  57   TVLAFQLLSPIFTNQGNCDSVSRSMTAGLILLCGLSCFLMSFTDSFRDKNGTVCYGFATF  116

Query  387  KGLWVIDGSASLPPELAAKYKVKFIDFVHAVMSVLVFGAIALFDQNVVSCFXPXPXXEXX  566
             GLWVIDGS +LPPELAAKY++ FIDF+HA MS+LVF A+ALFD NVVSCF P P  +  
Sbjct  117  YGLWVIDGSITLPPELAAKYRLHFIDFMHAFMSILVFAAVALFDHNVVSCFYPTPSDQAQ  176

Query  567  XILPXVPVGXGXVCXXLFVVFPPXXXGIGFPXTXD  671
             IL  +PVG G +C  LFVVFP    GIGFP + +
Sbjct  177  EILTALPVGIGVLCSMLFVVFPTTRHGIGFPLSAN  211



>ref|XP_006467726.1| PREDICTED: uncharacterized protein LOC102608272 [Citrus sinensis]
Length=210

 Score =   270 bits (691),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 126/200 (63%), Positives = 157/200 (79%), Gaps = 4/200 (2%)
 Frame = +3

Query  78   NNVVVSEKVPLL----VPDEVEKNLVQKAISQTFQSAAHLANLLPTGAVLAFQLLSPIFS  245
            +N V  + +PLL    +P+   K L+Q+AISQTFQS AHLANLLPTG VLAFQLL+PIFS
Sbjct  9    SNHVHEQNLPLLQDKDLPEIERKTLIQRAISQTFQSTAHLANLLPTGTVLAFQLLAPIFS  68

Query  246  NQGDCDAVSRFLTASLVAMCGLSCFLLSFTDSFKDQKGNVCYGVATVKGLWVIDGSASLP  425
            NQG+CD VSR +TA L+A+C LSCFL+SFTDSF+D+ GNV YG AT++GLW+IDGSA++ 
Sbjct  69   NQGNCDPVSRSMTAGLLALCSLSCFLMSFTDSFRDKNGNVFYGFATIRGLWIIDGSATIS  128

Query  426  PELAAKYKVKFIDFVHAVMSVLVFGAIALFDQNVVSCFXPXPXXEXXXILPXVPVGXGXV  605
            PE AAKY+++FIDFVHA MS+LVF A+ALFDQNVV+CF P P  E   +L  +PVG G +
Sbjct  129  PEFAAKYRIRFIDFVHAFMSILVFAAVALFDQNVVNCFYPLPSQEAQEVLTSLPVGIGVI  188

Query  606  CXXLFVVFPPXXXGIGFPXT  665
            C  LF+VFP    GIGFP +
Sbjct  189  CSMLFIVFPTQRNGIGFPLS  208



>ref|XP_006449412.1| hypothetical protein CICLE_v10016696mg [Citrus clementina]
 gb|ESR62652.1| hypothetical protein CICLE_v10016696mg [Citrus clementina]
Length=210

 Score =   269 bits (688),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 126/200 (63%), Positives = 157/200 (79%), Gaps = 4/200 (2%)
 Frame = +3

Query  78   NNVVVSEKVPLL----VPDEVEKNLVQKAISQTFQSAAHLANLLPTGAVLAFQLLSPIFS  245
            +N V  + +PLL    +P+   K L+Q+AISQTFQS AHLANLLPTG VLAFQLL+PIFS
Sbjct  9    SNHVHEQNLPLLQDKDLPEIERKTLIQRAISQTFQSTAHLANLLPTGTVLAFQLLAPIFS  68

Query  246  NQGDCDAVSRFLTASLVAMCGLSCFLLSFTDSFKDQKGNVCYGVATVKGLWVIDGSASLP  425
            NQG+CD VSR +TA L+A+C LSCFL+SFTDSF+D+ GNV YG A+++GLW+IDGSA++ 
Sbjct  69   NQGNCDPVSRSMTAGLLALCSLSCFLMSFTDSFRDKNGNVFYGFASIRGLWIIDGSATIS  128

Query  426  PELAAKYKVKFIDFVHAVMSVLVFGAIALFDQNVVSCFXPXPXXEXXXILPXVPVGXGXV  605
            PE AAKY+++FIDFVHA MS+LVF A+ALFDQNVV+CF P P  E   IL  +PVG G +
Sbjct  129  PEFAAKYRMRFIDFVHAFMSILVFAAVALFDQNVVNCFYPLPSQEAQEILTSLPVGIGVI  188

Query  606  CXXLFVVFPPXXXGIGFPXT  665
            C  LF+VFP    GIGFP +
Sbjct  189  CSMLFIVFPTQRNGIGFPLS  208



>gb|KHN08488.1| hypothetical protein glysoja_014253 [Glycine soja]
Length=211

 Score =   269 bits (687),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 130/213 (61%), Positives = 160/213 (75%), Gaps = 5/213 (2%)
 Frame = +3

Query  42   MDIHVGDEELSHNNVVVSEKVPLLVPDEV---EKNLVQKAISQTFQSAAHLANLLPTGAV  212
            MDI +  ++    N    E++PLL   EV   E+NL+QKAISQTFQS AHL NLLPTG V
Sbjct  1    MDIKIESDD--SQNEENEERLPLLRNSEVPEAERNLIQKAISQTFQSTAHLGNLLPTGTV  58

Query  213  LAFQLLSPIFSNQGDCDAVSRFLTASLVAMCGLSCFLLSFTDSFKDQKGNVCYGVATVKG  392
            LAFQLLSPIF+N G+CD+VS+ +TA+LV++CG SCF+   TDSF+D KG++CYG AT++G
Sbjct  59   LAFQLLSPIFTNVGNCDSVSKAMTAALVSLCGASCFMSCLTDSFRDSKGSICYGFATLRG  118

Query  393  LWVIDGSASLPPELAAKYKVKFIDFVHAVMSVLVFGAIALFDQNVVSCFXPXPXXEXXXI  572
            LWVIDGS +LPP+LAAKY++K IDF+HAVMSVLVF AIALFDQNVV+CF P P  E   I
Sbjct  119  LWVIDGSTTLPPQLAAKYRLKLIDFMHAVMSVLVFAAIALFDQNVVNCFFPAPSTETQEI  178

Query  573  LPXVPVGXGXVCXXLFVVFPPXXXGIGFPXTXD  671
            L  +PVG G +    FV FP    GIGFP + D
Sbjct  179  LTALPVGIGVLGSMFFVAFPTQRHGIGFPLSTD  211



>ref|XP_007148117.1| hypothetical protein PHAVU_006G181900g [Phaseolus vulgaris]
 gb|ESW20111.1| hypothetical protein PHAVU_006G181900g [Phaseolus vulgaris]
Length=211

 Score =   267 bits (683),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 131/213 (62%), Positives = 160/213 (75%), Gaps = 5/213 (2%)
 Frame = +3

Query  42   MDIHVGDEELSHNNVVVSEKVPLLVPDEV---EKNLVQKAISQTFQSAAHLANLLPTGAV  212
            MDI +  ++    N    E+VPL+   EV   E+NL+QKAISQTFQS AHLANLLPTG V
Sbjct  1    MDIKIESDD--SRNEEDEERVPLMRNSEVPEAERNLIQKAISQTFQSTAHLANLLPTGTV  58

Query  213  LAFQLLSPIFSNQGDCDAVSRFLTASLVAMCGLSCFLLSFTDSFKDQKGNVCYGVATVKG  392
            LAFQLLSPIF+N G+CD+V++ +TA+LV++C  SCFLL  TDSF+D KGN+CYG AT++G
Sbjct  59   LAFQLLSPIFTNVGNCDSVTKAMTAALVSLCAASCFLLCLTDSFRDNKGNICYGFATLRG  118

Query  393  LWVIDGSASLPPELAAKYKVKFIDFVHAVMSVLVFGAIALFDQNVVSCFXPXPXXEXXXI  572
            LWVIDGS +LPP+LAAKY +KFID +HAVMSVLVF AIALFDQNVV+CF P P  E   I
Sbjct  119  LWVIDGSTTLPPQLAAKYCLKFIDILHAVMSVLVFAAIALFDQNVVNCFFPAPSTEIQEI  178

Query  573  LPXVPVGXGXVCXXLFVVFPPXXXGIGFPXTXD  671
            L  +PVG G +    FV FP    GIGFP + +
Sbjct  179  LTALPVGIGVLGSMFFVAFPTQRHGIGFPLSTN  211



>ref|XP_004134946.1| PREDICTED: uncharacterized protein LOC101202820 [Cucumis sativus]
 gb|KGN49258.1| hypothetical protein Csa_6G518135 [Cucumis sativus]
Length=212

 Score =   267 bits (683),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 127/215 (59%), Positives = 158/215 (73%), Gaps = 8/215 (4%)
 Frame = +3

Query  42   MDIHVGDEELSHNNVVVSEKVPLL-----VPDEVEKNLVQKAISQTFQSAAHLANLLPTG  206
            M+I   DEE   +   + +K PLL     +P   EK L+QKAISQTF+S A+LANLLPTG
Sbjct  1    MEIKTADEETQSH---IDQKRPLLRETMIIPSRDEKTLIQKAISQTFRSTANLANLLPTG  57

Query  207  AVLAFQLLSPIFSNQGDCDAVSRFLTASLVAMCGLSCFLLSFTDSFKDQKGNVCYGVATV  386
             VLAFQLLSPIF+NQG+CD++SR+LTA LVA+CGLSCF  SFTDSF+D +GNV YG AT 
Sbjct  58   TVLAFQLLSPIFTNQGNCDSISRYLTAGLVALCGLSCFFQSFTDSFRDSQGNVSYGFATF  117

Query  387  KGLWVIDGSASLPPELAAKYKVKFIDFVHAVMSVLVFGAIALFDQNVVSCFXPXPXXEXX  566
            +GLWVIDGS  LPP +AA Y+++FIDF+HA MS+LVF A+ALFD++VV+CF P P  +  
Sbjct  118  RGLWVIDGSVELPPTVAASYRLRFIDFLHAFMSILVFSAVALFDEDVVNCFYPTPSDQAE  177

Query  567  XILPXVPVGXGXVCXXLFVVFPPXXXGIGFPXTXD  671
             IL  +PV  G  C  LFV FP    GIGFP + +
Sbjct  178  EILTSLPVAIGVFCSMLFVAFPTRRHGIGFPVSAN  212



>ref|XP_003593648.1| hypothetical protein MTR_2g014550 [Medicago truncatula]
 gb|ABN08714.1| Protein of unknown function DUF679 [Medicago truncatula]
 gb|AES63899.1| transmembrane protein, putative [Medicago truncatula]
Length=210

 Score =   267 bits (683),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 132/211 (63%), Positives = 160/211 (76%), Gaps = 6/211 (3%)
 Frame = +3

Query  42   MDIHVGDEELSHNNVVVSEKVPLLVPDEV---EKNLVQKAISQTFQSAAHLANLLPTGAV  212
            MDI++  ++ S N+    +KVPLL   EV   E++LVQKAIS TFQS AHLANLLPTG V
Sbjct  1    MDINLEIDDDSKND---EQKVPLLRNAEVPEAERSLVQKAISSTFQSTAHLANLLPTGTV  57

Query  213  LAFQLLSPIFSNQGDCDAVSRFLTASLVAMCGLSCFLLSFTDSFKDQKGNVCYGVATVKG  392
            LAFQLLSPIF+N G+CD+V + +T+ LV +CG SCFLL+FTDS +D KGN+CYG AT KG
Sbjct  58   LAFQLLSPIFTNVGNCDSVCKSMTSVLVTLCGASCFLLNFTDSIRDSKGNICYGFATFKG  117

Query  393  LWVIDGSASLPPELAAKYKVKFIDFVHAVMSVLVFGAIALFDQNVVSCFXPXPXXEXXXI  572
            LWVIDGS  LPP++AAKY++KFIDF+HA+MS+LVF AIALFDQNVV+CF P P  E   I
Sbjct  118  LWVIDGSTKLPPQVAAKYRIKFIDFMHAMMSILVFAAIALFDQNVVNCFFPEPSKEIQEI  177

Query  573  LPXVPVGXGXVCXXLFVVFPPXXXGIGFPXT  665
            L  +PV  G  C  LFV FP    GIGFP +
Sbjct  178  LTALPVAIGVFCSMLFVAFPTERHGIGFPLS  208



>ref|XP_009614893.1| PREDICTED: uncharacterized protein LOC104107719 [Nicotiana tomentosiformis]
Length=211

 Score =   267 bits (682),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 126/210 (60%), Positives = 161/210 (77%), Gaps = 7/210 (3%)
 Frame = +3

Query  42   MDIHVGDEELSHNNVVVSEKVPLL----VPDEVEKNLVQKAISQTFQSAAHLANLLPTGA  209
            M+I V +E  +  N+   EK PLL    +P EV+KNL+QKAI+QTFQS AHLANLLPTG+
Sbjct  1    MEIKVENE--TSQNLDNEEKSPLLENLALP-EVQKNLIQKAITQTFQSTAHLANLLPTGS  57

Query  210  VLAFQLLSPIFSNQGDCDAVSRFLTASLVAMCGLSCFLLSFTDSFKDQKGNVCYGVATVK  389
            VLAFQLLSPIF+NQG+CD + + LT +LV +CGLSCF+LSFTDSF D+KG +CYG AT++
Sbjct  58   VLAFQLLSPIFTNQGECDKIGKSLTVALVTLCGLSCFILSFTDSFTDKKGKICYGFATIR  117

Query  390  GLWVIDGSASLPPELAAKYKVKFIDFVHAVMSVLVFGAIALFDQNVVSCFXPXPXXEXXX  569
            GLW+IDGSA +P ++A KY+++FIDF+HA MS+LVF A+A FDQNVV+CF P P  +   
Sbjct  118  GLWIIDGSAKIPHQIARKYRLRFIDFMHAFMSILVFAAVAFFDQNVVNCFYPRPSDQIEE  177

Query  570  ILPXVPVGXGXVCXXLFVVFPPXXXGIGFP  659
            +L  +PV  G +C   FVVFP    GIGFP
Sbjct  178  LLTALPVAIGVICSMFFVVFPTQRHGIGFP  207



>ref|XP_008225153.1| PREDICTED: uncharacterized protein LOC103324819 [Prunus mume]
Length=214

 Score =   266 bits (681),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 130/215 (60%), Positives = 162/215 (75%), Gaps = 6/215 (3%)
 Frame = +3

Query  42   MDIHVGDEELSHNNVVVSEKVPLL--VPD---EVEKNLVQKAISQTFQSAAHLANLLPTG  206
            M+I +  EE  H      +K+PLL  +P    E E+ L+QKAI QTFQS AHLANLLPTG
Sbjct  1    MEIKIQAEESRHWPED-EQKLPLLQDMPKSITEEERTLIQKAIRQTFQSTAHLANLLPTG  59

Query  207  AVLAFQLLSPIFSNQGDCDAVSRFLTASLVAMCGLSCFLLSFTDSFKDQKGNVCYGVATV  386
             VLAFQLL+PIFSNQG+CD+VSR +TA LVA+CG SCFLLSFTDS++D+ GNVCYG AT 
Sbjct  60   TVLAFQLLAPIFSNQGNCDSVSRSMTAGLVALCGASCFLLSFTDSYRDKNGNVCYGFATF  119

Query  387  KGLWVIDGSASLPPELAAKYKVKFIDFVHAVMSVLVFGAIALFDQNVVSCFXPXPXXEXX  566
            +GLW+IDGS +L PE+ A ++++FIDF+HA MS+LVF A+ALFDQNVV+CF P P  +  
Sbjct  120  RGLWIIDGSTTLSPEVDANFQLRFIDFLHAFMSILVFAAVALFDQNVVNCFYPTPSDKAQ  179

Query  567  XILPXVPVGXGXVCXXLFVVFPPXXXGIGFPXTXD  671
             IL  +PVG G +C  LFVVFP    GIGFP + +
Sbjct  180  EILTALPVGIGVICSMLFVVFPTKRHGIGFPLSVN  214



>ref|XP_007212044.1| hypothetical protein PRUPE_ppa011352mg [Prunus persica]
 gb|EMJ13243.1| hypothetical protein PRUPE_ppa011352mg [Prunus persica]
Length=214

 Score =   266 bits (680),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 130/215 (60%), Positives = 162/215 (75%), Gaps = 6/215 (3%)
 Frame = +3

Query  42   MDIHVGDEELSHNNVVVSEKVPLL--VPD---EVEKNLVQKAISQTFQSAAHLANLLPTG  206
            M+I +  EE  H      +K+PLL  +P    E E+ L+QKAI QTFQS AHLANLLPTG
Sbjct  1    MEIKIQAEESRHWPDD-EQKLPLLQDMPKSVTEEERTLIQKAIRQTFQSTAHLANLLPTG  59

Query  207  AVLAFQLLSPIFSNQGDCDAVSRFLTASLVAMCGLSCFLLSFTDSFKDQKGNVCYGVATV  386
             VLAFQLL+PIFSNQG+CD+VSR +TA LVA+CG SCFLLSFTDS++D+ GNVCYG AT 
Sbjct  60   TVLAFQLLAPIFSNQGNCDSVSRSMTAGLVALCGASCFLLSFTDSYRDKNGNVCYGFATF  119

Query  387  KGLWVIDGSASLPPELAAKYKVKFIDFVHAVMSVLVFGAIALFDQNVVSCFXPXPXXEXX  566
            +GLW+IDGS +L PE+ A ++++FIDF+HA MS+LVF A+ALFDQNVV+CF P P  +  
Sbjct  120  RGLWIIDGSTTLSPEVDANFQLRFIDFLHAFMSILVFAAVALFDQNVVNCFYPTPSDKAQ  179

Query  567  XILPXVPVGXGXVCXXLFVVFPPXXXGIGFPXTXD  671
             IL  +PVG G +C  LFVVFP    GIGFP + +
Sbjct  180  EILTALPVGIGVICSMLFVVFPTKRHGIGFPLSVN  214



>ref|XP_010518775.1| PREDICTED: uncharacterized protein LOC104798405 [Tarenaya hassleriana]
Length=213

 Score =   266 bits (679),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 125/215 (58%), Positives = 159/215 (74%), Gaps = 7/215 (3%)
 Frame = +3

Query  39   EMDIHVGDEELSHNNVVVSEKVPLL----VPDEVEKNLVQKAISQTFQSAAHLANLLPTG  206
            E+ + VG+ +      V  ++VPLL    +P+   KN VQKAISQTFQ+ AHLANLLPTG
Sbjct  2    EIKVEVGNPDAPQ---VDEQRVPLLQDRDLPEIERKNWVQKAISQTFQTTAHLANLLPTG  58

Query  207  AVLAFQLLSPIFSNQGDCDAVSRFLTASLVAMCGLSCFLLSFTDSFKDQKGNVCYGVATV  386
             VLAFQLLSPIF+N G+CD VSR +TASLVA+CG SCF+LSFTDSF+D+ GNVCYG AT+
Sbjct  59   TVLAFQLLSPIFTNGGNCDGVSRIMTASLVAICGFSCFILSFTDSFRDKNGNVCYGFATI  118

Query  387  KGLWVIDGSASLPPELAAKYKVKFIDFVHAVMSVLVFGAIALFDQNVVSCFXPXPXXEXX  566
            +GLW+IDGS +LPPE++ +Y ++ +DF HA+MSVLVFG++ LFDQNVV+CF P P  E  
Sbjct  119  RGLWIIDGSGTLPPEVSKRYSLRCMDFTHAIMSVLVFGSVVLFDQNVVNCFFPAPSTEAM  178

Query  567  XILPXVPVGXGXVCXXLFVVFPPXXXGIGFPXTXD  671
             +L  +PV  G  C  LF  FP    GIGFP + +
Sbjct  179  EVLTALPVATGVFCSMLFATFPTTRHGIGFPLSAN  213



>ref|XP_010057364.1| PREDICTED: uncharacterized protein LOC104445239 [Eucalyptus grandis]
Length=205

 Score =   265 bits (678),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 129/209 (62%), Positives = 157/209 (75%), Gaps = 7/209 (3%)
 Frame = +3

Query  42   MDIHVGDEELSHNNVVVSEKVPLLVPDEVEK-NLVQKAISQTFQSAAHLANLLPTGAVLA  218
            M+I V DE  + + +      PLL  ++ ++ NL+QKA+ QTF+S AHLANLLPTG VLA
Sbjct  1    MEIKVRDESSTEHTL------PLLKDEDADRRNLIQKAMRQTFESTAHLANLLPTGTVLA  54

Query  219  FQLLSPIFSNQGDCDAVSRFLTASLVAMCGLSCFLLSFTDSFKDQKGNVCYGVATVKGLW  398
            FQLLSPIFSNQG CD  SR +TA LV +CGLS FLLSFTDSF+D+KG+VCYG AT  GLW
Sbjct  55   FQLLSPIFSNQGHCDPASRAMTAGLVLLCGLSSFLLSFTDSFRDEKGDVCYGFATPHGLW  114

Query  399  VIDGSASLPPELAAKYKVKFIDFVHAVMSVLVFGAIALFDQNVVSCFXPXPXXEXXXILP  578
            VIDG  +LPPEL  +Y+++FIDF HA+MSVLVFGA+ALFD+NVVSCF P P  E   +L 
Sbjct  115  VIDGLDTLPPELKDQYRLRFIDFAHAIMSVLVFGAVALFDENVVSCFYPAPSDETREVLT  174

Query  579  XVPVGXGXVCXXLFVVFPPXXXGIGFPXT  665
             +PVG G +C  LFVVFP    GIGFP +
Sbjct  175  ALPVGIGAICTMLFVVFPTKRHGIGFPLS  203



>ref|XP_007159369.1| hypothetical protein PHAVU_002G232400g [Phaseolus vulgaris]
 gb|ESW31363.1| hypothetical protein PHAVU_002G232400g [Phaseolus vulgaris]
Length=214

 Score =   266 bits (679),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 130/212 (61%), Positives = 161/212 (76%), Gaps = 4/212 (2%)
 Frame = +3

Query  42   MDIHVGDEELSHN-NVVVSEKVPLLVPDEV---EKNLVQKAISQTFQSAAHLANLLPTGA  209
            MD  + +E   +N +    +K+PLL   EV   +++L+Q+AISQTFQS AHLANLLPTG 
Sbjct  1    MDAIIKEELYMYNSDNHGQQKLPLLHNMEVPEPDRSLIQRAISQTFQSTAHLANLLPTGT  60

Query  210  VLAFQLLSPIFSNQGDCDAVSRFLTASLVAMCGLSCFLLSFTDSFKDQKGNVCYGVATVK  389
            VL+FQLLSPI +NQG+CD+V +F+TA+LVA+CG SCF   FTDSF+D KGNVCYG+AT K
Sbjct  61   VLSFQLLSPIVTNQGNCDSVCKFMTATLVALCGASCFFQCFTDSFRDDKGNVCYGLATFK  120

Query  390  GLWVIDGSASLPPELAAKYKVKFIDFVHAVMSVLVFGAIALFDQNVVSCFXPXPXXEXXX  569
            GLWVIDGS SLPPEL AK++++FIDF+HAVMS+LVF A+ALFDQNVV+CF P P  E   
Sbjct  121  GLWVIDGSTSLPPELGAKFRMRFIDFIHAVMSILVFAAVALFDQNVVNCFFPSPSTEARE  180

Query  570  ILPXVPVGXGXVCXXLFVVFPPXXXGIGFPXT  665
            IL  +PV  G  C  LFV FP    GIGFP +
Sbjct  181  ILTVLPVAIGIFCSMLFVAFPTQRHGIGFPLS  212



>ref|XP_008371416.1| PREDICTED: uncharacterized protein LOC103434834 [Malus domestica]
Length=214

 Score =   265 bits (677),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 130/213 (61%), Positives = 160/213 (75%), Gaps = 6/213 (3%)
 Frame = +3

Query  42   MDIHVGDEELSHNNVVVSEKVPLL-----VPDEVEKNLVQKAISQTFQSAAHLANLLPTG  206
            M+I V  EE  H +    +K+PLL        E E+ L+QKAI QTFQS AHLANLLPTG
Sbjct  1    MEIKVEAEESRHLHDG-EQKLPLLQDAPKSATEEERTLIQKAIRQTFQSTAHLANLLPTG  59

Query  207  AVLAFQLLSPIFSNQGDCDAVSRFLTASLVAMCGLSCFLLSFTDSFKDQKGNVCYGVATV  386
             VLAFQLL+PIF+N G+CD+VSR +TA LVA+CG S FLLSFTDSF+D+ GNVCYG AT 
Sbjct  60   TVLAFQLLAPIFTNLGNCDSVSRSMTAGLVALCGASSFLLSFTDSFRDKNGNVCYGFATF  119

Query  387  KGLWVIDGSASLPPELAAKYKVKFIDFVHAVMSVLVFGAIALFDQNVVSCFXPXPXXEXX  566
            KGLW+IDGSA++ PE+AA ++++FIDF+HA MS+LVF A+ALFDQNVV+CF P P  E  
Sbjct  120  KGLWIIDGSANISPEVAANFRLQFIDFLHAFMSILVFAAVALFDQNVVNCFYPTPSDEAQ  179

Query  567  XILPXVPVGXGXVCXXLFVVFPPXXXGIGFPXT  665
             +L  +PVG G +C  LFVVFP    GIGFP +
Sbjct  180  EVLTALPVGIGVICSMLFVVFPTKRHGIGFPLS  212



>ref|XP_009800282.1| PREDICTED: uncharacterized protein LOC104246213 [Nicotiana sylvestris]
Length=211

 Score =   265 bits (676),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 125/207 (60%), Positives = 158/207 (76%), Gaps = 1/207 (0%)
 Frame = +3

Query  42   MDIHVGDEELSH-NNVVVSEKVPLLVPDEVEKNLVQKAISQTFQSAAHLANLLPTGAVLA  218
            M+I V +E   + +NV  S  +  L   EVEKNL+QKAI+QTFQS AHLANLLPTG+VLA
Sbjct  1    MEIKVENETYQNLDNVENSLLLENLALPEVEKNLIQKAITQTFQSTAHLANLLPTGSVLA  60

Query  219  FQLLSPIFSNQGDCDAVSRFLTASLVAMCGLSCFLLSFTDSFKDQKGNVCYGVATVKGLW  398
            FQLLSPIF+NQG+CD + + LT +LV +CGLSCF+LSFTDSF D+KG +CYG AT++GLW
Sbjct  61   FQLLSPIFTNQGECDKIGKSLTVALVTLCGLSCFILSFTDSFTDKKGKICYGFATIRGLW  120

Query  399  VIDGSASLPPELAAKYKVKFIDFVHAVMSVLVFGAIALFDQNVVSCFXPXPXXEXXXILP  578
            +IDGSA +P ++A KYK+KFIDF+HA MS+LVF A+A FDQNVV+CF P P  +   ++ 
Sbjct  121  IIDGSAKIPHQIARKYKLKFIDFMHAFMSMLVFAAVAFFDQNVVNCFYPRPSDQIEELVN  180

Query  579  XVPVGXGXVCXXLFVVFPPXXXGIGFP  659
             +PV  G +C   FVVFP    GIGFP
Sbjct  181  ALPVAIGVICSMFFVVFPTQRHGIGFP  207



>gb|ACU15779.1| unknown [Glycine max]
Length=226

 Score =   265 bits (676),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 128/209 (61%), Positives = 158/209 (76%), Gaps = 5/209 (2%)
 Frame = +3

Query  42   MDIHVGDEELSHNNVVVSEKVPLLVPDEV---EKNLVQKAISQTFQSAAHLANLLPTGAV  212
            MDI +  ++    N    E++PLL   EV   E+NL+QKAISQTFQS AHL NLLPTG V
Sbjct  1    MDIKIESDD--SQNEENEERIPLLRNSEVPEAERNLIQKAISQTFQSTAHLGNLLPTGTV  58

Query  213  LAFQLLSPIFSNQGDCDAVSRFLTASLVAMCGLSCFLLSFTDSFKDQKGNVCYGVATVKG  392
            LAFQLLSPIF+N G+CD+VS+ +TA+LV++CG SCF+   TDSF+D KG++CYG AT++G
Sbjct  59   LAFQLLSPIFTNVGNCDSVSKAMTAALVSLCGASCFMSCLTDSFRDSKGSICYGFATLRG  118

Query  393  LWVIDGSASLPPELAAKYKVKFIDFVHAVMSVLVFGAIALFDQNVVSCFXPXPXXEXXXI  572
            LWVIDGS +LPP+LAAKY++K IDF+HAVMSVLVF AIALFD+NVV+CF P P  E   I
Sbjct  119  LWVIDGSTTLPPQLAAKYRLKLIDFMHAVMSVLVFAAIALFDRNVVNCFFPAPSTETQEI  178

Query  573  LPXVPVGXGXVCXXLFVVFPPXXXGIGFP  659
            L  +PVG G +    FV FP    GIGFP
Sbjct  179  LTALPVGIGVLGSMFFVAFPTQRHGIGFP  207



>gb|KHN15494.1| hypothetical protein glysoja_038165 [Glycine soja]
Length=219

 Score =   263 bits (673),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 125/214 (58%), Positives = 163/214 (76%), Gaps = 9/214 (4%)
 Frame = +3

Query  39   EMDIHVGDEELSHNNVVVSEKVPLL----VPDE-VEKNLVQKAISQTFQSAAHLANLLPT  203
            + D ++ +   +H+     +K+PLL    VPD+  +++L+Q+A+SQTFQS AHLANLLPT
Sbjct  8    DHDQYMYNNSKNHDE----QKLPLLHIMEVPDDDAQRSLIQRAMSQTFQSTAHLANLLPT  63

Query  204  GAVLAFQLLSPIFSNQGDCDAVSRFLTASLVAMCGLSCFLLSFTDSFKDQKGNVCYGVAT  383
            G VL+FQLLSPI +NQG CD+V +F+T++LVA+CG+SCFL  FTDSF+D KGNVCYG+AT
Sbjct  64   GTVLSFQLLSPIVTNQGICDSVCKFMTSTLVALCGVSCFLQCFTDSFRDDKGNVCYGLAT  123

Query  384  VKGLWVIDGSASLPPELAAKYKVKFIDFVHAVMSVLVFGAIALFDQNVVSCFXPXPXXEX  563
             +G+WVIDGS ++PPEL AKY+++ IDF+HAVMS+LVF A+ALFDQNVVSCF P P  E 
Sbjct  124  FRGMWVIDGSTTIPPELGAKYRLRLIDFLHAVMSILVFAAVALFDQNVVSCFFPSPSNET  183

Query  564  XXILPXVPVGXGXVCXXLFVVFPPXXXGIGFPXT  665
              IL  +PV  G  C  LFV FP    GIGFP +
Sbjct  184  REILTVLPVAIGIFCSMLFVAFPTQRHGIGFPLS  217



>ref|XP_004486106.1| PREDICTED: uncharacterized protein LOC101512239 [Cicer arietinum]
Length=211

 Score =   263 bits (671),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 130/214 (61%), Positives = 163/214 (76%), Gaps = 7/214 (3%)
 Frame = +3

Query  42   MDIHVGDEELSHNNVVVSEKVPLL----VPDEVEKNLVQKAISQTFQSAAHLANLLPTGA  209
            MDI++  ++ + NN    +K+PLL    VP E E+ L+QKAISQTFQS AHLANLLPTG 
Sbjct  1    MDINLEIDDDTKNND--EQKLPLLRNVEVP-EAERTLIQKAISQTFQSTAHLANLLPTGT  57

Query  210  VLAFQLLSPIFSNQGDCDAVSRFLTASLVAMCGLSCFLLSFTDSFKDQKGNVCYGVATVK  389
            VLAFQLLSPIF+N G+CD+VS+ +T++L+ +CG+ CFL+ FTDSF+D KGN+CYG AT K
Sbjct  58   VLAFQLLSPIFTNVGNCDSVSKSMTSALLTICGVWCFLVCFTDSFRDSKGNICYGFATFK  117

Query  390  GLWVIDGSASLPPELAAKYKVKFIDFVHAVMSVLVFGAIALFDQNVVSCFXPXPXXEXXX  569
            GLWVIDGS  LPP++A KY ++ ID +HAVMS+LVF AIALFDQNVV+CF P P  E   
Sbjct  118  GLWVIDGSTKLPPQVAGKYCLRLIDLMHAVMSILVFAAIALFDQNVVNCFFPEPSHEIQE  177

Query  570  ILPXVPVGXGXVCXXLFVVFPPXXXGIGFPXTXD  671
            IL  +PVG G +C  LFVVFP    GIGFP + +
Sbjct  178  ILTALPVGIGVLCSMLFVVFPTERHGIGFPLSTN  211



>emb|CBI30614.3| unnamed protein product [Vitis vinifera]
Length=275

 Score =   265 bits (677),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 131/225 (58%), Positives = 162/225 (72%), Gaps = 7/225 (3%)
 Frame = +3

Query  9    RNDKEIVRF*EMDIHVGDEELSHNNVVVSEKVPLL----VPDEVEKNLVQKAISQTFQSA  176
            R  +E  RF  M+  V DEE  H N    +KV LL     P   ++  +Q AISQTFQS 
Sbjct  54   RKKEENKRFRAMEFKVEDEESWHLN---DQKVALLQDMPRPQTGQRTPIQMAISQTFQST  110

Query  177  AHLANLLPTGAVLAFQLLSPIFSNQGDCDAVSRFLTASLVAMCGLSCFLLSFTDSFKDQK  356
            AHLANLLPTG VLAFQ LSP+ +N+G+CD VSRF+T+SL+A+CG+SCFL  FTDSF+D  
Sbjct  111  AHLANLLPTGTVLAFQFLSPVLTNKGECDPVSRFMTSSLLALCGMSCFLQCFTDSFRDNN  170

Query  357  GNVCYGVATVKGLWVIDGSASLPPELAAKYKVKFIDFVHAVMSVLVFGAIALFDQNVVSC  536
            GNV  G AT +GLW+IDGSA+LPPELAA+Y+++FIDF+HA MS+LVF AIALFD+NVV+C
Sbjct  171  GNVYSGFATFQGLWIIDGSATLPPELAAEYQLRFIDFIHAFMSILVFAAIALFDENVVNC  230

Query  537  FXPXPXXEXXXILPXVPVGXGXVCXXLFVVFPPXXXGIGFPXTXD  671
            F P P  E   +L  +PVG G  C  LFVVFP    GIGFP + +
Sbjct  231  FYPTPSDETKELLTSLPVGIGVFCSMLFVVFPTRRHGIGFPLSAN  275



>ref|XP_008383697.1| PREDICTED: uncharacterized protein LOC103446381 [Malus domestica]
Length=214

 Score =   263 bits (671),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 127/216 (59%), Positives = 158/216 (73%), Gaps = 14/216 (6%)
 Frame = +3

Query  39   EMDIHVGDEELSHNNVVVSEKVPLLVP-----DEVEKNLVQKAISQTFQSAAHLANLLPT  203
            E   H+ DE+         +K+PLL        E ++ L+QKAI QTFQS AHLANLLPT
Sbjct  8    EASRHLHDED---------QKLPLLQDAPKSVTEEQRTLIQKAIRQTFQSMAHLANLLPT  58

Query  204  GAVLAFQLLSPIFSNQGDCDAVSRFLTASLVAMCGLSCFLLSFTDSFKDQKGNVCYGVAT  383
            G VLAFQLL+PIF+NQG+CD+VSR +TA LVA+CG SCFLLSFTDS +D KGNVCYG AT
Sbjct  59   GTVLAFQLLAPIFTNQGNCDSVSRSMTAGLVALCGASCFLLSFTDSLRDNKGNVCYGFAT  118

Query  384  VKGLWVIDGSASLPPELAAKYKVKFIDFVHAVMSVLVFGAIALFDQNVVSCFXPXPXXEX  563
             KGLW+IDGSA++  E+AA + ++FIDF+HA MS+LVF A+ALFDQNVV+CF P P  E 
Sbjct  119  FKGLWIIDGSANISTEVAANFHLQFIDFLHAFMSILVFTAVALFDQNVVNCFYPMPSDEA  178

Query  564  XXILPXVPVGXGXVCXXLFVVFPPXXXGIGFPXTXD  671
              +L  +PVG G +C  LFVVFP    G+GFP + +
Sbjct  179  QEVLTALPVGIGVICSMLFVVFPTKRHGMGFPLSAN  214



>ref|XP_006361068.1| PREDICTED: uncharacterized protein LOC102594723 [Solanum tuberosum]
Length=205

 Score =   262 bits (669),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 119/182 (65%), Positives = 146/182 (80%), Gaps = 0/182 (0%)
 Frame = +3

Query  126  VEKNLVQKAISQTFQSAAHLANLLPTGAVLAFQLLSPIFSNQGDCDAVSRFLTASLVAMC  305
            VEKN++QKAISQTFQS +HLANLLPTG+VLAFQLLSPIF+NQG+CD + + LT SLV +C
Sbjct  24   VEKNIIQKAISQTFQSTSHLANLLPTGSVLAFQLLSPIFTNQGNCDKICKILTISLVTLC  83

Query  306  GLSCFLLSFTDSFKDQKGNVCYGVATVKGLWVIDGSASLPPELAAKYKVKFIDFVHAVMS  485
            GLSCF+LSFTDSFKD+KG + YG AT++GLW+IDGS  +P ++A KYK+KFIDF+H  MS
Sbjct  84   GLSCFILSFTDSFKDKKGKIIYGFATIRGLWIIDGSIRIPNQIARKYKLKFIDFLHGFMS  143

Query  486  VLVFGAIALFDQNVVSCFXPXPXXEXXXILPXVPVGXGXVCXXLFVVFPPXXXGIGFPXT  665
            +LVF AIALFDQNVV+CF P P  E   +L  +P+G G +C   FVVFP    GIGFP T
Sbjct  144  MLVFAAIALFDQNVVNCFYPKPSDEIEELLVALPIGVGVICSMFFVVFPTKRHGIGFPLT  203

Query  666  XD  671
             +
Sbjct  204  SN  205



>ref|XP_003593647.1| hypothetical protein MTR_2g014520 [Medicago truncatula]
 gb|ABN08709.1| Protein of unknown function DUF679 [Medicago truncatula]
 gb|AES63898.1| transmembrane protein, putative [Medicago truncatula]
Length=207

 Score =   262 bits (669),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 126/194 (65%), Positives = 150/194 (77%), Gaps = 3/194 (2%)
 Frame = +3

Query  93   SEKVPLLVPDEV---EKNLVQKAISQTFQSAAHLANLLPTGAVLAFQLLSPIFSNQGDCD  263
              KVPLL+  EV   ++NL+Q AIS TFQS AHLANLLPTG VLA QLLSPIF+N G CD
Sbjct  12   EHKVPLLLNAEVPEAKRNLIQTAISLTFQSTAHLANLLPTGTVLALQLLSPIFTNIGSCD  71

Query  264  AVSRFLTASLVAMCGLSCFLLSFTDSFKDQKGNVCYGVATVKGLWVIDGSASLPPELAAK  443
            +VS+++TA+LV +CG SCFLLSFTDSF+D KGN+ YG AT KGLWVIDGS  LPP++AAK
Sbjct  72   SVSKWMTAALVTLCGASCFLLSFTDSFRDSKGNIIYGFATFKGLWVIDGSTKLPPQVAAK  131

Query  444  YKVKFIDFVHAVMSVLVFGAIALFDQNVVSCFXPXPXXEXXXILPXVPVGXGXVCXXLFV  623
            Y+++FIDF+HAVMS+LVF AIALFD+NVV+CF P P  E   IL  +PV  G  C  LFV
Sbjct  132  YRIRFIDFMHAVMSILVFAAIALFDRNVVNCFFPEPSKEIQEILTALPVAIGDFCSMLFV  191

Query  624  VFPPXXXGIGFPXT  665
             FP    GIGFP +
Sbjct  192  TFPTERHGIGFPLS  205



>ref|XP_009344263.1| PREDICTED: uncharacterized protein LOC103936119 [Pyrus x bretschneideri]
Length=214

 Score =   262 bits (669),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 128/213 (60%), Positives = 160/213 (75%), Gaps = 6/213 (3%)
 Frame = +3

Query  42   MDIHVGDEELSHNNVVVSEKVPLLVP-----DEVEKNLVQKAISQTFQSAAHLANLLPTG  206
            M+I V  E+  H +    +K+PLL        E E+ L+QKAI QTFQS AHLANLLPTG
Sbjct  1    MEIKVEAEKSRHLHDG-EQKLPLLQDATKSVTEEERTLIQKAIRQTFQSTAHLANLLPTG  59

Query  207  AVLAFQLLSPIFSNQGDCDAVSRFLTASLVAMCGLSCFLLSFTDSFKDQKGNVCYGVATV  386
             VLAFQLL+PIF+N G+CD+VSR +TA LVA+CG S FLLSFTDS +D+ GNVCYG+AT 
Sbjct  60   TVLAFQLLAPIFTNLGNCDSVSRSMTAGLVALCGASSFLLSFTDSVRDKNGNVCYGLATF  119

Query  387  KGLWVIDGSASLPPELAAKYKVKFIDFVHAVMSVLVFGAIALFDQNVVSCFXPXPXXEXX  566
            KGLW+IDGSA++ PE+AA ++++FIDF+HA MS+LVF A+ALFDQNVV+CF P P  E  
Sbjct  120  KGLWIIDGSANISPEVAANFRLQFIDFLHAFMSILVFAAVALFDQNVVNCFYPTPSDEAQ  179

Query  567  XILPXVPVGXGXVCXXLFVVFPPXXXGIGFPXT  665
             +L  +PVG G +C  LFVVFP    GIGFP +
Sbjct  180  EVLTALPVGIGVICSMLFVVFPTKRHGIGFPLS  212



>gb|KJB69553.1| hypothetical protein B456_011G030300 [Gossypium raimondii]
Length=209

 Score =   261 bits (668),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 128/212 (60%), Positives = 158/212 (75%), Gaps = 5/212 (2%)
 Frame = +3

Query  42   MDI--HVGDEELSHNNVVVSEKVPLLVPDEVEKNLVQKAISQTFQSAAHLANLLPTGAVL  215
            MDI      ++ SH +++    V   +P    K L+Q AISQTFQS AHLANLLPTG VL
Sbjct  1    MDIKFQANADDESHEHLLQDLAV---LPAPERKTLIQIAISQTFQSTAHLANLLPTGTVL  57

Query  216  AFQLLSPIFSNQGDCDAVSRFLTASLVAMCGLSCFLLSFTDSFKDQKGNVCYGVATVKGL  395
            AFQLLSPIF+NQGDCD+V R +TA L+ +CGLSCF  SFTDSF+D+ GNVCYG+AT+ GL
Sbjct  58   AFQLLSPIFTNQGDCDSVCRSMTAGLILLCGLSCFFTSFTDSFRDKDGNVCYGLATLNGL  117

Query  396  WVIDGSASLPPELAAKYKVKFIDFVHAVMSVLVFGAIALFDQNVVSCFXPXPXXEXXXIL  575
            WVIDGSA+LPPE AAKY+++FIDFVHA +S+LVF A+ALFDQNVV+CF P P  +   +L
Sbjct  118  WVIDGSATLPPESAAKYRLRFIDFVHAFLSILVFAAVALFDQNVVNCFYPAPSRQAQEML  177

Query  576  PXVPVGXGXVCXXLFVVFPPXXXGIGFPXTXD  671
              +PVG G +   LFVVFP    GIGFP + +
Sbjct  178  TALPVGIGVLGSMLFVVFPTTRHGIGFPLSAN  209



>ref|XP_010111173.1| hypothetical protein L484_015056 [Morus notabilis]
 gb|EXC30564.1| hypothetical protein L484_015056 [Morus notabilis]
Length=224

 Score =   262 bits (669),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 132/223 (59%), Positives = 157/223 (70%), Gaps = 12/223 (5%)
 Frame = +3

Query  39   EMDIHVGDEELSHNNVVVSE--KVPLLVPDEV----------EKNLVQKAISQTFQSAAH  182
            E+ +     ++   N V  +  K+PLL+ D+           +K LVQKAISQTFQS AH
Sbjct  2    EIKVESSKSQIHRQNHVKEQNTKIPLLIKDDHVPKEQSEPVDQKTLVQKAISQTFQSTAH  61

Query  183  LANLLPTGAVLAFQLLSPIFSNQGDCDAVSRFLTASLVAMCGLSCFLLSFTDSFKDQKGN  362
            LANLLPTG VLAFQLL+PIFSN G CD VSR +TA LV +CG S FL+SFTDSF+D+ GN
Sbjct  62   LANLLPTGTVLAFQLLAPIFSNLGQCDPVSRLMTAGLVVLCGASAFLVSFTDSFRDKNGN  121

Query  363  VCYGVATVKGLWVIDGSASLPPELAAKYKVKFIDFVHAVMSVLVFGAIALFDQNVVSCFX  542
            VCYGVAT+ GLWVIDGSA LP E A KY+++FID VHA MSV +F AIALFDQNVVSCF 
Sbjct  122  VCYGVATLTGLWVIDGSAKLPNEEADKYRLRFIDLVHAFMSVFLFLAIALFDQNVVSCFY  181

Query  543  PXPXXEXXXILPXVPVGXGXVCXXLFVVFPPXXXGIGFPXTXD  671
            P P  E   +L  +PVG G +C  LFVVFP    GIGFP + +
Sbjct  182  PTPSDEAQEVLTALPVGIGVMCSLLFVVFPTKRHGIGFPLSAN  224



>ref|XP_003541524.1| PREDICTED: uncharacterized protein LOC100784415 [Glycine max]
 gb|KHN09964.1| hypothetical protein glysoja_026864 [Glycine soja]
Length=217

 Score =   261 bits (667),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 126/215 (59%), Positives = 158/215 (73%), Gaps = 7/215 (3%)
 Frame = +3

Query  42   MDIHVGDEELSHNNVVV--SEKVPLL-----VPDEVEKNLVQKAISQTFQSAAHLANLLP  200
            MD+ V ++   +NN      +K+PLL     VPD+ +++L+Q+A+SQ FQS AHLANLLP
Sbjct  1    MDVIVQEDMYMYNNSKNHDEQKLPLLHNIMEVPDDAKRSLIQRAMSQAFQSTAHLANLLP  60

Query  201  TGAVLAFQLLSPIFSNQGDCDAVSRFLTASLVAMCGLSCFLLSFTDSFKDQKGNVCYGVA  380
            TG VL+FQ LSPI +NQG+CD V +F+T+ LVA+CG SCFL  FTDSF+D KGNVCYG+A
Sbjct  61   TGTVLSFQFLSPIVTNQGNCDLVCKFMTSMLVALCGASCFLQCFTDSFRDDKGNVCYGLA  120

Query  381  TVKGLWVIDGSASLPPELAAKYKVKFIDFVHAVMSVLVFGAIALFDQNVVSCFXPXPXXE  560
            T +G+WVIDGS ++ PEL AKY++K IDFVHAVMS+LVF A+ LFDQNVVSCF P P  E
Sbjct  121  TFRGMWVIDGSTTISPELGAKYRLKPIDFVHAVMSILVFAAVVLFDQNVVSCFFPSPSNE  180

Query  561  XXXILPXVPVGXGXVCXXLFVVFPPXXXGIGFPXT  665
               IL  +PV  G  C  LFV FP    GIGFP +
Sbjct  181  AREILTVLPVAIGAFCSMLFVAFPTQRHGIGFPLS  215



>ref|XP_004248460.1| PREDICTED: uncharacterized protein LOC101254947 [Solanum lycopersicum]
Length=205

 Score =   260 bits (665),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 124/214 (58%), Positives = 157/214 (73%), Gaps = 13/214 (6%)
 Frame = +3

Query  42   MDIHVGDEELSHNNVVVSEKVPLLVPD----EVEKNLVQKAISQTFQSAAHLANLLPTGA  209
            M+I V  +E         +K PLL  +    +VEKN++QKAISQTFQS +HLANLLPTG+
Sbjct  1    MEIKVVQQE---------KKSPLLEENLELPQVEKNIIQKAISQTFQSTSHLANLLPTGS  51

Query  210  VLAFQLLSPIFSNQGDCDAVSRFLTASLVAMCGLSCFLLSFTDSFKDQKGNVCYGVATVK  389
            VLAFQLLSPIF+NQG+CD + + LT +LV +CGLSCF+LSFTDSFKD+KG + YG AT++
Sbjct  52   VLAFQLLSPIFTNQGNCDKICKILTIALVTLCGLSCFILSFTDSFKDKKGKISYGFATIR  111

Query  390  GLWVIDGSASLPPELAAKYKVKFIDFVHAVMSVLVFGAIALFDQNVVSCFXPXPXXEXXX  569
            GLW+IDGS  +P ++A +YK+KFIDF+H  MS+LVF  IALFDQNVV CF P P  E   
Sbjct  112  GLWIIDGSIRIPNQIARRYKLKFIDFLHGFMSMLVFATIALFDQNVVKCFYPKPSDEIEE  171

Query  570  ILPXVPVGXGXVCXXLFVVFPPXXXGIGFPXTXD  671
            +L  +P+G G +C   FVVFP    GIGFP T +
Sbjct  172  LLVALPIGVGVICSIFFVVFPTKRHGIGFPLTSN  205



>ref|XP_002278769.1| PREDICTED: uncharacterized protein LOC100262407 [Vitis vinifera]
Length=211

 Score =   259 bits (663),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 127/214 (59%), Positives = 157/214 (73%), Gaps = 7/214 (3%)
 Frame = +3

Query  42   MDIHVGDEELSHNNVVVSEKVPLL----VPDEVEKNLVQKAISQTFQSAAHLANLLPTGA  209
            M+  V DEE  H N    +KV LL     P   ++  +Q AISQTFQS AHLANLLPTG 
Sbjct  1    MEFKVEDEESWHLN---DQKVALLQDMPRPQTGQRTPIQMAISQTFQSTAHLANLLPTGT  57

Query  210  VLAFQLLSPIFSNQGDCDAVSRFLTASLVAMCGLSCFLLSFTDSFKDQKGNVCYGVATVK  389
            VLAFQ LSP+ +N+G+CD VSRF+T+SL+A+CG+SCFL  FTDSF+D  GNV  G AT +
Sbjct  58   VLAFQFLSPVLTNKGECDPVSRFMTSSLLALCGMSCFLQCFTDSFRDNNGNVYSGFATFQ  117

Query  390  GLWVIDGSASLPPELAAKYKVKFIDFVHAVMSVLVFGAIALFDQNVVSCFXPXPXXEXXX  569
            GLW+IDGSA+LPPELAA+Y+++FIDF+HA MS+LVF AIALFD+NVV+CF P P  E   
Sbjct  118  GLWIIDGSATLPPELAAEYQLRFIDFIHAFMSILVFAAIALFDENVVNCFYPTPSDETKE  177

Query  570  ILPXVPVGXGXVCXXLFVVFPPXXXGIGFPXTXD  671
            +L  +PVG G  C  LFVVFP    GIGFP + +
Sbjct  178  LLTSLPVGIGVFCSMLFVVFPTRRHGIGFPLSAN  211



>ref|XP_010245585.1| PREDICTED: uncharacterized protein LOC104589093 [Nelumbo nucifera]
Length=224

 Score =   258 bits (660),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 120/189 (63%), Positives = 145/189 (77%), Gaps = 0/189 (0%)
 Frame = +3

Query  93   SEKVPLLVPDEVEKNLVQKAISQTFQSAAHLANLLPTGAVLAFQLLSPIFSNQGDCDAVS  272
            SE+     PD  +K L+QKAISQTF+S AHLANLLPTG VLAFQLL+PI +NQG CD V 
Sbjct  32   SEQNSKTTPDNEQKTLIQKAISQTFKSTAHLANLLPTGTVLAFQLLAPILTNQGQCDIVG  91

Query  273  RFLTASLVAMCGLSCFLLSFTDSFKDQKGNVCYGVATVKGLWVIDGSASLPPELAAKYKV  452
            R++T+SLVA+CG SC LLSFTDSF+D  G+V YG+AT +GLWVIDGS ++ PE+AA Y++
Sbjct  92   RYMTSSLVALCGFSCLLLSFTDSFRDGNGDVRYGIATFRGLWVIDGSCTISPEMAAGYRI  151

Query  453  KFIDFVHAVMSVLVFGAIALFDQNVVSCFXPXPXXEXXXILPXVPVGXGXVCXXLFVVFP  632
            KFIDF+HA MS+LVF A+ALFDQNVV CF P P  E   +L  +PV  G +C  LFVVFP
Sbjct  152  KFIDFMHAFMSILVFAAVALFDQNVVDCFYPAPSDETKELLTVLPVEIGVICSMLFVVFP  211

Query  633  PXXXGIGFP  659
                GIGFP
Sbjct  212  TKRHGIGFP  220



>ref|XP_004505097.1| PREDICTED: uncharacterized protein LOC101491785 [Cicer arietinum]
Length=211

 Score =   258 bits (659),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 118/183 (64%), Positives = 145/183 (79%), Gaps = 0/183 (0%)
 Frame = +3

Query  123  EVEKNLVQKAISQTFQSAAHLANLLPTGAVLAFQLLSPIFSNQGDCDAVSRFLTASLVAM  302
            E E++L+ +AI+QT +S AHLANLLPTG VL+FQLLSPIF+N+G+CD VS+F+T SL+++
Sbjct  29   EAERSLIHRAINQTCKSTAHLANLLPTGTVLSFQLLSPIFTNKGECDQVSKFMTLSLLSL  88

Query  303  CGLSCFLLSFTDSFKDQKGNVCYGVATVKGLWVIDGSASLPPELAAKYKVKFIDFVHAVM  482
            CG SCFLL FTDS +D KGN+CYG AT KGLWVIDGSA+L PE+ AKYK++FIDF+HAVM
Sbjct  89   CGASCFLLCFTDSLRDNKGNICYGFATFKGLWVIDGSATLSPEIDAKYKLRFIDFMHAVM  148

Query  483  SVLVFGAIALFDQNVVSCFXPXPXXEXXXILPXVPVGXGXVCXXLFVVFPPXXXGIGFPX  662
            S+LVF AIA+FDQNVV CF P P  E   IL  +PVG G  C  LFV FP    GIGFP 
Sbjct  149  SILVFSAIAMFDQNVVKCFFPSPSYEFREILTALPVGIGVFCSMLFVAFPTQRHGIGFPL  208

Query  663  TXD  671
            + +
Sbjct  209  STN  211



>gb|KEH30980.1| transmembrane protein, putative [Medicago truncatula]
Length=206

 Score =   257 bits (657),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 120/201 (60%), Positives = 151/201 (75%), Gaps = 3/201 (1%)
 Frame = +3

Query  78   NNVVVSEKVPLLVPDEV---EKNLVQKAISQTFQSAAHLANLLPTGAVLAFQLLSPIFSN  248
            +N+   +K+P L   E+   ++NL  +AI+QT +S AHLANLLPTG VL+FQLLSPIF+N
Sbjct  6    SNLYDEQKLPFLHNMEIVEPQRNLFHRAINQTCKSTAHLANLLPTGTVLSFQLLSPIFTN  65

Query  249  QGDCDAVSRFLTASLVAMCGLSCFLLSFTDSFKDQKGNVCYGVATVKGLWVIDGSASLPP  428
            QG CD V++ +T SL+ +CG SCFLL FTDSFKD KGN+CYG AT KGLW+IDGSA+LP 
Sbjct  66   QGKCDHVTQLMTLSLLTLCGASCFLLCFTDSFKDNKGNICYGFATFKGLWIIDGSATLPH  125

Query  429  ELAAKYKVKFIDFVHAVMSVLVFGAIALFDQNVVSCFXPXPXXEXXXILPXVPVGXGXVC  608
            EL AKY+++FIDF+HA+MS+LVF AIA+FD NVV+CF P P  E   IL  +PVG G  C
Sbjct  126  ELDAKYQLRFIDFMHAIMSILVFSAIAMFDHNVVNCFFPSPSYEMRQILTALPVGIGVFC  185

Query  609  XXLFVVFPPXXXGIGFPXTXD  671
              LFV FP    GIGFP + +
Sbjct  186  SMLFVAFPTHRHGIGFPLSTN  206



>ref|XP_010260334.1| PREDICTED: uncharacterized protein LOC104599477 [Nelumbo nucifera]
Length=223

 Score =   257 bits (657),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 125/222 (56%), Positives = 156/222 (70%), Gaps = 19/222 (9%)
 Frame = +3

Query  42   MDIHVGDEELSHNNVVVSEKVPLL----------------VPDEVEKNLVQKAISQTFQS  173
            M+I V D E  H N    +  PLL                +P   ++ ++QKA+SQTF+S
Sbjct  1    MEIKVEDAESQHLN---EQCRPLLEDTKVTDVTDTEQNREIPQMEQETVIQKALSQTFKS  57

Query  174  AAHLANLLPTGAVLAFQLLSPIFSNQGDCDAVSRFLTASLVAMCGLSCFLLSFTDSFKDQ  353
             AHLANLLPTG VLAFQLL+PIF+NQG CD +SR +TA  +A+CGLSCFLLSFTDS +D 
Sbjct  58   TAHLANLLPTGTVLAFQLLAPIFTNQGQCDTISRSMTACFLALCGLSCFLLSFTDSIRDG  117

Query  354  KGNVCYGVATVKGLWVIDGSASLPPELAAKYKVKFIDFVHAVMSVLVFGAIALFDQNVVS  533
            +G V YG+AT +GLWVIDGS ++  ELAA+Y++KFIDF+HA MS+LVF A+ALFDQNVV+
Sbjct  118  RGKVRYGIATFRGLWVIDGSCTVSSELAARYRIKFIDFIHAFMSILVFAAVALFDQNVVN  177

Query  534  CFXPXPXXEXXXILPXVPVGXGXVCXXLFVVFPPXXXGIGFP  659
            CF P P  E   +L  +PVG G +C  LFVVFP    GIGFP
Sbjct  178  CFYPAPSKEMKELLIKLPVGIGAICSMLFVVFPTTRHGIGFP  219



>ref|XP_004293868.1| PREDICTED: uncharacterized protein LOC101295896 [Fragaria vesca 
subsp. vesca]
Length=212

 Score =   256 bits (655),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 127/213 (60%), Positives = 157/213 (74%), Gaps = 8/213 (4%)
 Frame = +3

Query  42   MDIHVGDEELSHNNVVVSEKVPLL----VPD-EVEKNLVQKAISQTFQSAAHLANLLPTG  206
            M I V   E   +N    +K PLL     P+ E ++ L+Q+A++QTFQS AHLANLLPTG
Sbjct  1    MKIRV---EAKESNPDGEQKHPLLHDTLSPEIEEKRTLIQRAMNQTFQSTAHLANLLPTG  57

Query  207  AVLAFQLLSPIFSNQGDCDAVSRFLTASLVAMCGLSCFLLSFTDSFKDQKGNVCYGVATV  386
             VLAFQLL+PIF+NQG CD+VSR +TA LV +CG SCFLLSFTDS++D KGNVCYG AT 
Sbjct  58   TVLAFQLLAPIFTNQGVCDSVSRVMTAGLVGLCGASCFLLSFTDSYRDNKGNVCYGFATF  117

Query  387  KGLWVIDGSASLPPELAAKYKVKFIDFVHAVMSVLVFGAIALFDQNVVSCFXPXPXXEXX  566
            KGLW+IDGS +L PE+AA +++KFIDF+HA MS+LVF AIAL+DQNVV+CF P P  +  
Sbjct  118  KGLWIIDGSTALAPEVAANFRLKFIDFLHAFMSILVFAAIALYDQNVVNCFDPAPSDKAQ  177

Query  567  XILPXVPVGXGXVCXXLFVVFPPXXXGIGFPXT  665
             +L  +PV  G  C  LFVVFP    GIGFP +
Sbjct  178  EVLTSLPVAIGVFCSMLFVVFPTKRHGIGFPLS  210



>ref|XP_010686399.1| PREDICTED: uncharacterized protein LOC104900624 [Beta vulgaris 
subsp. vulgaris]
Length=232

 Score =   257 bits (656),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 122/195 (63%), Positives = 149/195 (76%), Gaps = 2/195 (1%)
 Frame = +3

Query  93   SEKVPLL--VPDEVEKNLVQKAISQTFQSAAHLANLLPTGAVLAFQLLSPIFSNQGDCDA  266
             +K+PLL   PD V++N +Q+AISQTFQS AHLA LLPTG V+AFQLL+PIF+NQG+CD+
Sbjct  38   EQKLPLLQDTPDTVDRNPIQQAISQTFQSTAHLAKLLPTGTVMAFQLLAPIFTNQGECDS  97

Query  267  VSRFLTASLVAMCGLSCFLLSFTDSFKDQKGNVCYGVATVKGLWVIDGSASLPPELAAKY  446
            VS+ +T+ L+A+CGLS FLLSFTD FKD  G + YG AT KGLWVIDG A+LPPELAAKY
Sbjct  98   VSQTMTSILIALCGLSSFLLSFTDCFKDDDGKIYYGFATFKGLWVIDGLATLPPELAAKY  157

Query  447  KVKFIDFVHAVMSVLVFGAIALFDQNVVSCFXPXPXXEXXXILPXVPVGXGXVCXXLFVV  626
            +++FIDF+HA MSV VF AIALFD+N V C  P P  E   IL  +P+G G +   LFVV
Sbjct  158  RLRFIDFLHAFMSVFVFAAIALFDKNTVQCLYPTPSKETQEILTALPIGIGVLSSMLFVV  217

Query  627  FPPXXXGIGFPXTXD  671
            FP    GIGFP T +
Sbjct  218  FPTQRHGIGFPLTSN  232



>ref|XP_010919356.1| PREDICTED: uncharacterized protein LOC105043490 [Elaeis guineensis]
Length=234

 Score =   254 bits (650),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 118/180 (66%), Positives = 141/180 (78%), Gaps = 0/180 (0%)
 Frame = +3

Query  120  DEVEKNLVQKAISQTFQSAAHLANLLPTGAVLAFQLLSPIFSNQGDCDAVSRFLTASLVA  299
            D+  + L+QKAISQTF+S AHLANLLPTG VLAFQLLSPIF+N+G CD +SRF+T +LVA
Sbjct  51   DDDRRILIQKAISQTFRSTAHLANLLPTGTVLAFQLLSPIFTNEGHCDPMSRFMTTALVA  110

Query  300  MCGLSCFLLSFTDSFKDQKGNVCYGVATVKGLWVIDGSASLPPELAAKYKVKFIDFVHAV  479
            +CGLSCF  SFTDSF+D  G V YG+AT +GLWVIDG+A LPPE+A  Y++KFIDFVHA 
Sbjct  111  LCGLSCFFQSFTDSFRDGSGEVRYGLATFRGLWVIDGTAPLPPEIAINYRIKFIDFVHAF  170

Query  480  MSVLVFGAIALFDQNVVSCFXPXPXXEXXXILPXVPVGXGXVCXXLFVVFPPXXXGIGFP  659
            MS+LVFGA+ALFDQ+VVSCF P P  E   +L  +P+G G     LFV FP    GIGFP
Sbjct  171  MSILVFGAVALFDQSVVSCFYPTPSEEMKQVLTSLPIGIGVFGSMLFVTFPTTRHGIGFP  230



>ref|XP_009131711.1| PREDICTED: uncharacterized protein LOC103856352 [Brassica rapa]
Length=224

 Score =   253 bits (645),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 124/214 (58%), Positives = 150/214 (70%), Gaps = 6/214 (3%)
 Frame = +3

Query  33   F*EMDIHVGDEELSHNNVVVSEKVPLL-----VPDEVEKNLVQKAISQTFQSAAHLANLL  197
            F +M+I+V D +   N     EK PLL      PD      +QKAI QTFQ+ AHLANLL
Sbjct  7    FKDMEINVVDRDHQGNAQEEIEK-PLLEEDKDFPDIERTTWIQKAIGQTFQTTAHLANLL  65

Query  198  PTGAVLAFQLLSPIFSNQGDCDAVSRFLTASLVAMCGLSCFLLSFTDSFKDQKGNVCYGV  377
            PTG VLAFQLLSPIFSN G CD VS+ +T+ LVA+CG SCF+LSFTDS+KD+ G +CYG 
Sbjct  66   PTGTVLAFQLLSPIFSNGGQCDVVSKIMTSVLVAVCGFSCFILSFTDSYKDKNGTICYGF  125

Query  378  ATVKGLWVIDGSASLPPELAAKYKVKFIDFVHAVMSVLVFGAIALFDQNVVSCFXPXPXX  557
            AT+ G W+IDGSA+LP EL+ KYK++FIDF HA MS+LVFGA+ LFD+N V+CF P P  
Sbjct  126  ATIHGFWIIDGSATLPQELSKKYKLRFIDFAHAFMSLLVFGAVGLFDRNTVNCFFPAPSA  185

Query  558  EXXXILPXVPVGXGXVCXXLFVVFPPXXXGIGFP  659
            E   +L  +PVG G  C  LF  FP    GIGFP
Sbjct  186  EALEVLTALPVGVGVFCSMLFATFPTTRNGIGFP  219



>emb|CDX78854.1| BnaA01g09210D [Brassica napus]
Length=224

 Score =   252 bits (644),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 124/214 (58%), Positives = 150/214 (70%), Gaps = 6/214 (3%)
 Frame = +3

Query  33   F*EMDIHVGDEELSHNNVVVSEKVPLL-----VPDEVEKNLVQKAISQTFQSAAHLANLL  197
            F +M+I+V D +   N     EK PLL      PD      +QKAI QTFQ+ AHLANLL
Sbjct  7    FKDMEINVVDRDHQGNAQEEIEK-PLLEEDKDFPDIERTTWIQKAIGQTFQTTAHLANLL  65

Query  198  PTGAVLAFQLLSPIFSNQGDCDAVSRFLTASLVAMCGLSCFLLSFTDSFKDQKGNVCYGV  377
            PTG VLAFQLLSPIFSN G CD VS+ +T+ LVA+CG SCF+LSFTDS+KD+ G +CYG 
Sbjct  66   PTGTVLAFQLLSPIFSNGGQCDVVSKIMTSVLVAVCGFSCFILSFTDSYKDKNGTICYGF  125

Query  378  ATVKGLWVIDGSASLPPELAAKYKVKFIDFVHAVMSVLVFGAIALFDQNVVSCFXPXPXX  557
            AT+ G W+IDGSA+LP EL+ KYK++FIDF HA MS+LVFGA+ LFD+N V+CF P P  
Sbjct  126  ATIHGFWIIDGSATLPQELSKKYKLRFIDFAHAFMSLLVFGAVVLFDRNTVNCFFPAPSA  185

Query  558  EXXXILPXVPVGXGXVCXXLFVVFPPXXXGIGFP  659
            E   +L  +PVG G  C  LF  FP    GIGFP
Sbjct  186  EALEVLTALPVGVGVFCSMLFATFPTTRNGIGFP  219



>emb|CDY60883.1| BnaC01g40900D [Brassica napus]
Length=224

 Score =   250 bits (639),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 125/215 (58%), Positives = 150/215 (70%), Gaps = 8/215 (4%)
 Frame = +3

Query  33   F*EMDIHVGDEELSHNNVVVSE-KVPLL-----VPDEVEKNLVQKAISQTFQSAAHLANL  194
            F +M+I+V DE+  H      E + PLL      PD      +QKAI QTFQ+ AHLANL
Sbjct  7    FKDMEINVVDED--HQGSAQEEIEKPLLEEDKDFPDIERTTWIQKAIGQTFQTTAHLANL  64

Query  195  LPTGAVLAFQLLSPIFSNQGDCDAVSRFLTASLVAMCGLSCFLLSFTDSFKDQKGNVCYG  374
            LPTG VLAFQLLSPIFSN G CD VS  +T+ LVA+CG SCF+LSFTDS+KD+ G +CYG
Sbjct  65   LPTGTVLAFQLLSPIFSNGGQCDLVSEIMTSVLVAICGFSCFILSFTDSYKDKNGTICYG  124

Query  375  VATVKGLWVIDGSASLPPELAAKYKVKFIDFVHAVMSVLVFGAIALFDQNVVSCFXPXPX  554
             ATV G W+IDGSA+LP EL+ KYK++FIDF HA MS+LVFGA+ LFD+N V+CF P P 
Sbjct  125  FATVHGFWIIDGSATLPQELSKKYKLRFIDFAHAFMSLLVFGAVVLFDRNTVNCFFPAPS  184

Query  555  XEXXXILPXVPVGXGXVCXXLFVVFPPXXXGIGFP  659
             E   +L  +PVG G  C  LF  FP    GIGFP
Sbjct  185  AEALEVLTALPVGVGVFCSMLFASFPTTRNGIGFP  219



>ref|XP_009101549.1| PREDICTED: uncharacterized protein LOC103827757 [Brassica rapa]
Length=241

 Score =   251 bits (640),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 118/204 (58%), Positives = 142/204 (70%), Gaps = 11/204 (5%)
 Frame = +3

Query  78   NNVVVSEKVPLLVPDEV----------EKN-LVQKAISQTFQSAAHLANLLPTGAVLAFQ  224
              V+  EKVPLL  D++          E+N  +QKAI QTFQ+ +HLANLLPTG VLA+Q
Sbjct  33   RRVIQEEKVPLLEDDKILIQTREFPAIERNTWIQKAIGQTFQTTSHLANLLPTGTVLAYQ  92

Query  225  LLSPIFSNQGDCDAVSRFLTASLVAMCGLSCFLLSFTDSFKDQKGNVCYGVATVKGLWVI  404
            +LSPIF+N G C   SRF+TA+LV +CG SCF+LSFTDS+KD  GN CYG AT  G W+I
Sbjct  93   ILSPIFTNAGSCSLASRFMTATLVFICGFSCFILSFTDSYKDLNGNSCYGFATFNGFWII  152

Query  405  DGSASLPPELAAKYKVKFIDFVHAVMSVLVFGAIALFDQNVVSCFXPXPXXEXXXILPXV  584
            DGSA+LPPE A  YK++FIDF HA+MS LVFGA+ +FDQN V CF P P  E   IL  +
Sbjct  153  DGSATLPPERARTYKLRFIDFAHAIMSFLVFGAVVMFDQNAVKCFIPVPSAEEAEILTAL  212

Query  585  PVGXGXVCXXLFVVFPPXXXGIGF  656
            PVG G  C  LF +FP    GIGF
Sbjct  213  PVGIGVFCSMLFAIFPTTRHGIGF  236



>emb|CDY70034.1| BnaAnng32400D [Brassica napus]
Length=241

 Score =   250 bits (639),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 117/204 (57%), Positives = 142/204 (70%), Gaps = 11/204 (5%)
 Frame = +3

Query  78   NNVVVSEKVPLLVPDEV----------EKN-LVQKAISQTFQSAAHLANLLPTGAVLAFQ  224
              ++  EKVPLL  D++          E+N  +QKAI QTFQ+ +HLANLLPTG VLA+Q
Sbjct  33   RRMIQEEKVPLLEDDKILIQTREFPAIERNTWIQKAIGQTFQTTSHLANLLPTGTVLAYQ  92

Query  225  LLSPIFSNQGDCDAVSRFLTASLVAMCGLSCFLLSFTDSFKDQKGNVCYGVATVKGLWVI  404
            +LSPIF+N G C   SRF+TA+LV +CG SCF+LSFTDS+KD  GN CYG AT  G W+I
Sbjct  93   ILSPIFTNAGSCSLASRFMTATLVFICGFSCFILSFTDSYKDLNGNSCYGFATFNGFWII  152

Query  405  DGSASLPPELAAKYKVKFIDFVHAVMSVLVFGAIALFDQNVVSCFXPXPXXEXXXILPXV  584
            DGSA+LPPE A  YK++FIDF HA+MS LVFGA+ +FDQN V CF P P  E   IL  +
Sbjct  153  DGSATLPPERARTYKLRFIDFAHAIMSFLVFGAVVMFDQNAVKCFIPVPSAEEAEILTAL  212

Query  585  PVGXGXVCXXLFVVFPPXXXGIGF  656
            PVG G  C  LF +FP    GIGF
Sbjct  213  PVGIGVFCSMLFAIFPTTRHGIGF  236



>emb|CDX77629.1| BnaC07g18830D [Brassica napus]
Length=241

 Score =   249 bits (637),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 117/204 (57%), Positives = 141/204 (69%), Gaps = 11/204 (5%)
 Frame = +3

Query  78   NNVVVSEKVPLLVPDEV----------EKN-LVQKAISQTFQSAAHLANLLPTGAVLAFQ  224
              ++  EKVPLL  D++          E+N  +QKAI QTFQ+ +HLANLLPTG VLA+Q
Sbjct  33   RRMIQEEKVPLLEDDKILIQTREFPAIERNTWIQKAIGQTFQTTSHLANLLPTGTVLAYQ  92

Query  225  LLSPIFSNQGDCDAVSRFLTASLVAMCGLSCFLLSFTDSFKDQKGNVCYGVATVKGLWVI  404
            +LSPIF+N G C   SRF+TA+LV +CG SCF+LSFTDS+KD  GN CYG AT  G W+I
Sbjct  93   ILSPIFTNAGSCSLASRFMTATLVFICGFSCFILSFTDSYKDLNGNSCYGFATFNGFWII  152

Query  405  DGSASLPPELAAKYKVKFIDFVHAVMSVLVFGAIALFDQNVVSCFXPXPXXEXXXILPXV  584
            DGSA+LPPE A  YK++FIDF HA+MS LVFGA+ +FDQN V CF P P  E   IL  +
Sbjct  153  DGSATLPPERATTYKLRFIDFAHAIMSFLVFGAVVMFDQNAVKCFIPVPSAEEAEILTAL  212

Query  585  PVGXGXVCXXLFVVFPPXXXGIGF  656
            PVG G  C  LF  FP    GIGF
Sbjct  213  PVGIGVFCSMLFATFPTTRHGIGF  236



>ref|XP_002867993.1| hypothetical protein ARALYDRAFT_914840 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH44252.1| hypothetical protein ARALYDRAFT_914840 [Arabidopsis lyrata subsp. 
lyrata]
Length=213

 Score =   248 bits (634),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 117/211 (55%), Positives = 147/211 (70%), Gaps = 7/211 (3%)
 Frame = +3

Query  42   MDIHVGDEELSHNNVVVSEKVPLL-----VPDEVEKNLVQKAISQTFQSAAHLANLLPTG  206
            M+I V ++        ++   PLL      PD      +QKAI QTFQ+ AHLANLLPTG
Sbjct  1    MEIKVDEDHQKSTKEDITR--PLLEEDKNFPDIERTTWIQKAIGQTFQTTAHLANLLPTG  58

Query  207  AVLAFQLLSPIFSNQGDCDAVSRFLTASLVAMCGLSCFLLSFTDSFKDQKGNVCYGVATV  386
             VLAFQLLSPIFSN G CD VS+ +T++LVA+CG SCF+LSFTDS+KD+ G +CYG+AT+
Sbjct  59   TVLAFQLLSPIFSNGGQCDLVSKIMTSTLVAICGFSCFILSFTDSYKDKNGTICYGLATI  118

Query  387  KGLWVIDGSASLPPELAAKYKVKFIDFVHAVMSVLVFGAIALFDQNVVSCFXPXPXXEXX  566
             G W+IDGS +LP EL+ +YK++FIDFVHA MS+ VFGA+ LFD+N V+CF P P  E  
Sbjct  119  HGFWIIDGSTTLPQELSKRYKLRFIDFVHAFMSLFVFGAVVLFDRNAVNCFFPAPSAEAL  178

Query  567  XILPXVPVGXGXVCXXLFVVFPPXXXGIGFP  659
             +L  +PVG G  C  LF  FP    GIGFP
Sbjct  179  EVLTALPVGVGVFCSMLFATFPTTRNGIGFP  209



>ref|XP_006284515.1| hypothetical protein CARUB_v10005715mg [Capsella rubella]
 gb|EOA17413.1| hypothetical protein CARUB_v10005715mg [Capsella rubella]
Length=214

 Score =   247 bits (630),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 119/211 (56%), Positives = 144/211 (68%), Gaps = 6/211 (3%)
 Frame = +3

Query  42   MDIHVGDEELSHNNVVVSEKVPLL-----VPDEVEKNLVQKAISQTFQSAAHLANLLPTG  206
            M+I V DE+   +      K PLL      PD      +QKAI QTFQ+ AHLANLLPTG
Sbjct  1    MEIKV-DEDHQKSTKEEEIKKPLLEQDKDFPDIERTTWIQKAIGQTFQTTAHLANLLPTG  59

Query  207  AVLAFQLLSPIFSNQGDCDAVSRFLTASLVAMCGLSCFLLSFTDSFKDQKGNVCYGVATV  386
             VLAFQLLSPIFSN G CD VS+ +T++LVA+CG SCF+ SFTDS+KD+ G +CYG AT 
Sbjct  60   TVLAFQLLSPIFSNGGQCDLVSKIMTSTLVAICGFSCFIYSFTDSYKDKNGTICYGFATF  119

Query  387  KGLWVIDGSASLPPELAAKYKVKFIDFVHAVMSVLVFGAIALFDQNVVSCFXPXPXXEXX  566
             G W+IDGS +LP EL+ +YK++FIDFVHA MS  VFGA+ LFD+N V+CF P P  E  
Sbjct  120  HGFWIIDGSTTLPQELSKRYKLRFIDFVHAFMSFFVFGAVVLFDRNAVNCFFPAPSAEAL  179

Query  567  XILPXVPVGXGXVCXXLFVVFPPXXXGIGFP  659
             +L  +PVG G  C  LF  FP    GIGFP
Sbjct  180  EVLTALPVGVGVFCSMLFATFPTTRNGIGFP  210



>emb|CDY55785.1| BnaC03g76810D [Brassica napus]
 emb|CDX76523.1| BnaA08g08770D [Brassica napus]
Length=214

 Score =   247 bits (630),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 119/207 (57%), Positives = 143/207 (69%), Gaps = 8/207 (4%)
 Frame = +3

Query  54   VGDEELSHNNVVVSEKVPLL-----VPDEVEKNLVQKAISQTFQSAAHLANLLPTGAVLA  218
            V D +LS    +   + PLL      PD      +QKAI QTFQ+ AHLANLLPTG VLA
Sbjct  6    VEDHQLSTKEDI---ETPLLEENKDFPDVERTTWIQKAIGQTFQTTAHLANLLPTGTVLA  62

Query  219  FQLLSPIFSNQGDCDAVSRFLTASLVAMCGLSCFLLSFTDSFKDQKGNVCYGVATVKGLW  398
            FQLLSPIFSN G CD   + +T+SLVA+CG SCF+LSFTDS+KD+ G +CYG AT+ G W
Sbjct  63   FQLLSPIFSNGGQCDLACKIMTSSLVAICGFSCFILSFTDSYKDKNGTICYGFATIHGFW  122

Query  399  VIDGSASLPPELAAKYKVKFIDFVHAVMSVLVFGAIALFDQNVVSCFXPXPXXEXXXILP  578
            +IDGSA+LP ELA  YK++FIDF HA MS+LVFGA+ LFD+N V+CF P P  E   +L 
Sbjct  123  IIDGSATLPQELAKNYKLRFIDFAHAFMSLLVFGAVVLFDRNTVNCFYPAPSAEELEVLT  182

Query  579  XVPVGXGXVCXXLFVVFPPXXXGIGFP  659
             +PVG G  C  LF  FP    GIGFP
Sbjct  183  ALPVGVGVFCSMLFATFPTTRNGIGFP  209



>ref|XP_006281752.1| hypothetical protein CARUB_v10027911mg [Capsella rubella]
 gb|EOA14650.1| hypothetical protein CARUB_v10027911mg [Capsella rubella]
Length=224

 Score =   247 bits (630),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 121/223 (54%), Positives = 149/223 (67%), Gaps = 16/223 (7%)
 Frame = +3

Query  42   MDIHVGDEELSHN---NVVVSEKVPLL------------VPDEVEKNLVQKAISQTFQSA  176
            M+I V DEE   N   +++  E VPLL             PD      +QKAI QTFQ+ 
Sbjct  1    MEIKV-DEEAGFNGAHSMINEETVPLLEDEDPVQVLNRDFPDIERNTWIQKAIGQTFQTT  59

Query  177  AHLANLLPTGAVLAFQLLSPIFSNQGDCDAVSRFLTASLVAMCGLSCFLLSFTDSFKDQK  356
            AHLANLLPTG VLA+Q+LSPIF+N G+C   SR +TASLV++CG SCF+L+FTDS+KD  
Sbjct  60   AHLANLLPTGTVLAYQILSPIFTNAGNCSLASRIMTASLVSICGFSCFILNFTDSYKDLN  119

Query  357  GNVCYGVATVKGLWVIDGSASLPPELAAKYKVKFIDFVHAVMSVLVFGAIALFDQNVVSC  536
            GNVCYG AT+ G W+IDGSA+LP E +  YK++FIDF+HA+MS LVFGA+ LFDQN V C
Sbjct  120  GNVCYGFATINGFWIIDGSATLPQERSKSYKLRFIDFLHAIMSFLVFGAVVLFDQNAVKC  179

Query  537  FXPXPXXEXXXILPXVPVGXGXVCXXLFVVFPPXXXGIGFPXT  665
            F P P  E   +L  +PV  G  C  LF  FP    GIGFP +
Sbjct  180  FFPEPSAEAAELLTALPVAVGVFCSMLFATFPTTRHGIGFPLS  222



>ref|XP_010494774.1| PREDICTED: uncharacterized protein LOC104771868 [Camelina sativa]
Length=224

 Score =   246 bits (629),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 122/221 (55%), Positives = 144/221 (65%), Gaps = 16/221 (7%)
 Frame = +3

Query  42   MDIHVGDEELSHN---NVVVSEKVPLL------------VPDEVEKNLVQKAISQTFQSA  176
            M+I V DEE   N    ++  E VPLL             PD      +QKAI QTFQ+ 
Sbjct  1    MEIKV-DEEAGFNGAHRMIKDETVPLLEDEDQTEVRKRDFPDIERNTWIQKAIGQTFQTT  59

Query  177  AHLANLLPTGAVLAFQLLSPIFSNQGDCDAVSRFLTASLVAMCGLSCFLLSFTDSFKDQK  356
            AHLANLLPTG VLAFQ+LSPIF+N G C   SR +TASLV++CG SC +LSFTDS+KD  
Sbjct  60   AHLANLLPTGTVLAFQILSPIFTNAGHCSLTSRIMTASLVSICGFSCLILSFTDSYKDLN  119

Query  357  GNVCYGVATVKGLWVIDGSASLPPELAAKYKVKFIDFVHAVMSVLVFGAIALFDQNVVSC  536
            GNVCYG AT+ G W+IDGSA+LP E +  YK++FIDF HA+MS LVFGA+ LFDQN V C
Sbjct  120  GNVCYGFATINGFWIIDGSATLPQERSKSYKLRFIDFAHAIMSFLVFGAVVLFDQNAVKC  179

Query  537  FXPXPXXEXXXILPXVPVGXGXVCXXLFVVFPPXXXGIGFP  659
            F P P  E   +L  +PV  G  C  LF  FP    GIGFP
Sbjct  180  FFPEPSAEAAELLTALPVAVGVFCSMLFATFPTTRHGIGFP  220



>ref|XP_010517535.1| PREDICTED: uncharacterized protein LOC104792959 [Camelina sativa]
 ref|XP_010434538.1| PREDICTED: uncharacterized protein LOC104718476 [Camelina sativa]
Length=213

 Score =   246 bits (627),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 118/211 (56%), Positives = 144/211 (68%), Gaps = 7/211 (3%)
 Frame = +3

Query  42   MDIHVGDEELSHNNVVVSEKVPLL-----VPDEVEKNLVQKAISQTFQSAAHLANLLPTG  206
            M+I V ++        +  K PLL      PD      +QKAI QTFQ+ AHLANLLPTG
Sbjct  1    MEIKVDEDHQRSTKEDI--KKPLLEQDKDFPDIERTTWIQKAIGQTFQTTAHLANLLPTG  58

Query  207  AVLAFQLLSPIFSNQGDCDAVSRFLTASLVAMCGLSCFLLSFTDSFKDQKGNVCYGVATV  386
             VLAFQLLSPIFSN G CD VS+ +T++LVA+CG SCF+LSFTDS+KD+ G +CYG AT 
Sbjct  59   TVLAFQLLSPIFSNGGQCDLVSKIMTSTLVAICGFSCFILSFTDSYKDKNGTICYGFATF  118

Query  387  KGLWVIDGSASLPPELAAKYKVKFIDFVHAVMSVLVFGAIALFDQNVVSCFXPXPXXEXX  566
             G W+IDGS +LP EL+ +YK++FIDFVHA MS  VFGA+ LFD+N V+CF P P  E  
Sbjct  119  HGFWIIDGSTTLPQELSKRYKLRFIDFVHAFMSFFVFGAVVLFDRNAVNCFFPAPSAEAL  178

Query  567  XILPXVPVGXGXVCXXLFVVFPPXXXGIGFP  659
             +L  +PVG G  C  LF  FP    GIGFP
Sbjct  179  EVLTALPVGVGVFCSMLFATFPTTRNGIGFP  209



>ref|XP_010441629.1| PREDICTED: uncharacterized protein LOC104724778 [Camelina sativa]
Length=224

 Score =   246 bits (628),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 122/221 (55%), Positives = 144/221 (65%), Gaps = 16/221 (7%)
 Frame = +3

Query  42   MDIHVGDEELSHN---NVVVSEKVPLL------------VPDEVEKNLVQKAISQTFQSA  176
            M+I V DEE   N    ++  E VPLL             PD      +QKAI QTFQ+ 
Sbjct  1    MEIKV-DEEAGFNGAHRMIKDETVPLLEDEDRTEVRNRDFPDIERNTWIQKAIGQTFQTT  59

Query  177  AHLANLLPTGAVLAFQLLSPIFSNQGDCDAVSRFLTASLVAMCGLSCFLLSFTDSFKDQK  356
            AHLANLLPTG VLAFQ+LSPIF+N G C   SR +TASLV++CG SC +LSFTDS+KD  
Sbjct  60   AHLANLLPTGTVLAFQILSPIFTNAGHCSLASRIMTASLVSICGFSCLILSFTDSYKDLN  119

Query  357  GNVCYGVATVKGLWVIDGSASLPPELAAKYKVKFIDFVHAVMSVLVFGAIALFDQNVVSC  536
            GNVCYG AT+ G W+IDGSA+LP E +  YK++FIDF HA+MS LVFGA+ LFDQN V C
Sbjct  120  GNVCYGFATINGFWIIDGSATLPQERSKSYKLRFIDFAHAIMSFLVFGAVVLFDQNAVKC  179

Query  537  FXPXPXXEXXXILPXVPVGXGXVCXXLFVVFPPXXXGIGFP  659
            F P P  E   +L  +PV  G  C  LF  FP    GIGFP
Sbjct  180  FFPEPSAEAAELLTALPVAVGVFCSMLFATFPTTRHGIGFP  220



>emb|CDX76524.1| BnaA08g08760D [Brassica napus]
Length=214

 Score =   245 bits (626),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 121/207 (58%), Positives = 144/207 (70%), Gaps = 8/207 (4%)
 Frame = +3

Query  54   VGDEELSHNNVVVSEKVPLL-----VPDEVEKNLVQKAISQTFQSAAHLANLLPTGAVLA  218
            V D +LS    +  EK PLL      PD      +QKAI QTFQ+ AHLANLLPTG VLA
Sbjct  6    VEDHQLSTKEDI--EK-PLLEENKGFPDVERTTWIQKAIGQTFQTTAHLANLLPTGTVLA  62

Query  219  FQLLSPIFSNQGDCDAVSRFLTASLVAMCGLSCFLLSFTDSFKDQKGNVCYGVATVKGLW  398
            FQLLSPIFSN G CD   + +T+SLVA+CG SCF+LSFTDS+KD+ G +CYG AT+ G W
Sbjct  63   FQLLSPIFSNGGQCDLACKIMTSSLVAICGFSCFILSFTDSYKDKNGTICYGFATIHGFW  122

Query  399  VIDGSASLPPELAAKYKVKFIDFVHAVMSVLVFGAIALFDQNVVSCFXPXPXXEXXXILP  578
            +IDGSA+LP ELA  YK++FIDF HA MS+LVFGA+ LFD+N V+CF P P  E   +L 
Sbjct  123  IIDGSATLPQELAKNYKLRFIDFAHAFMSLLVFGAVVLFDRNTVNCFYPAPSAEELEVLT  182

Query  579  XVPVGXGXVCXXLFVVFPPXXXGIGFP  659
             +PVG G  C  LF  FP    GIGFP
Sbjct  183  ALPVGVGVFCSMLFATFPTTRNGIGFP  209



>ref|NP_199421.1| uncharacterized protein [Arabidopsis thaliana]
 dbj|BAB08254.1| unnamed protein product [Arabidopsis thaliana]
 gb|AED95336.1| uncharacterized protein AT5G46090 [Arabidopsis thaliana]
Length=214

 Score =   245 bits (625),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 119/214 (56%), Positives = 150/214 (70%), Gaps = 12/214 (6%)
 Frame = +3

Query  42   MDIHVGDEELSHNNVVVSEKVPLL--------VPDEVEKNLVQKAISQTFQSAAHLANLL  197
            M+I+V +E      ++  E VPLL        +PD     ++QKAI +TFQ+ A+LANLL
Sbjct  1    MEINVDEEA----GIIKEETVPLLDDQNRNRDLPDIERNTMMQKAIGKTFQTTANLANLL  56

Query  198  PTGAVLAFQLLSPIFSNQGDCDAVSRFLTASLVAMCGLSCFLLSFTDSFKDQKGNVCYGV  377
            PTG VLAFQ+LSPI +N G CD  SRF+TA LV++CG SCF+LSFTDS+KD  G+VCYG 
Sbjct  57   PTGTVLAFQILSPICTNVGRCDLTSRFMTALLVSICGFSCFILSFTDSYKDLNGSVCYGF  116

Query  378  ATVKGLWVIDGSASLPPELAAKYKVKFIDFVHAVMSVLVFGAIALFDQNVVSCFXPXPXX  557
            AT+ G W+IDGSA+LP EL+  YK++FIDFVHA+MS LVFGA+ LFDQNVV+CF P P  
Sbjct  117  ATIHGFWIIDGSATLPQELSKSYKLRFIDFVHAIMSFLVFGAVVLFDQNVVNCFYPEPSA  176

Query  558  EXXXILPXVPVGXGXVCXXLFVVFPPXXXGIGFP  659
            E   +L  +PV  G  C  +F  FP    GIGFP
Sbjct  177  EVVELLTTLPVAVGVFCSMVFAKFPTTRHGIGFP  210



>ref|XP_010481500.1| PREDICTED: uncharacterized protein LOC104760291 [Camelina sativa]
Length=224

 Score =   245 bits (625),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 121/221 (55%), Positives = 143/221 (65%), Gaps = 16/221 (7%)
 Frame = +3

Query  42   MDIHVGDEELSHN---NVVVSEKVPLL------------VPDEVEKNLVQKAISQTFQSA  176
            M+I V DEE   N    ++  E VPLL             PD      +QKAI QTFQ+ 
Sbjct  1    MEIKV-DEEAGFNGAHRMIKDETVPLLEDEDRTEVRNRDFPDIERNTWIQKAIGQTFQTT  59

Query  177  AHLANLLPTGAVLAFQLLSPIFSNQGDCDAVSRFLTASLVAMCGLSCFLLSFTDSFKDQK  356
            AHLANLLPTG VL FQ+LSPIF+N G C   SR +TASLV++CG SC +LSFTDS+KD  
Sbjct  60   AHLANLLPTGTVLTFQILSPIFTNAGHCSLASRIMTASLVSICGFSCLILSFTDSYKDLN  119

Query  357  GNVCYGVATVKGLWVIDGSASLPPELAAKYKVKFIDFVHAVMSVLVFGAIALFDQNVVSC  536
            GNVCYG AT+ G W+IDGSA+LP E +  YK++FIDF HA+MS LVFGA+ LFDQN V C
Sbjct  120  GNVCYGFATINGFWIIDGSATLPQERSKSYKLRFIDFAHAIMSFLVFGAVVLFDQNAVKC  179

Query  537  FXPXPXXEXXXILPXVPVGXGXVCXXLFVVFPPXXXGIGFP  659
            F P P  E   +L  +PV  G  C  LF  FP    GIGFP
Sbjct  180  FFPEPSAEAAELLTALPVAVGVFCSMLFATFPTTRHGIGFP  220



>ref|XP_009395997.1| PREDICTED: uncharacterized protein LOC103981121 [Musa acuminata 
subsp. malaccensis]
Length=208

 Score =   244 bits (622),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 120/194 (62%), Positives = 144/194 (74%), Gaps = 3/194 (2%)
 Frame = +3

Query  93   SEKVPLLVPDEV---EKNLVQKAISQTFQSAAHLANLLPTGAVLAFQLLSPIFSNQGDCD  263
             +K PLL PD     +  LVQKAISQTF+S AHLA LLPTG VLAFQLLSPIF++ G C 
Sbjct  13   QQKQPLLAPDSAGDDQATLVQKAISQTFKSTAHLAKLLPTGTVLAFQLLSPIFTDGGHCM  72

Query  264  AVSRFLTASLVAMCGLSCFLLSFTDSFKDQKGNVCYGVATVKGLWVIDGSASLPPELAAK  443
            AV+R +T  LVA+CGLSCF+LSFTDSF+D  G V YG+AT +GLWVIDG+  LPP +AA+
Sbjct  73   AVNRLMTECLVAICGLSCFVLSFTDSFRDGNGTVRYGLATFRGLWVIDGTKPLPPAIAAR  132

Query  444  YKVKFIDFVHAVMSVLVFGAIALFDQNVVSCFXPXPXXEXXXILPXVPVGXGXVCXXLFV  623
            Y++KFID  HA++SVLVF A+ALFDQNVVSCF P P  E   +L  +PVG G +   LFV
Sbjct  133  YRIKFIDLAHALVSVLVFAAVALFDQNVVSCFFPMPSEETKQVLTCLPVGIGVIGSILFV  192

Query  624  VFPPXXXGIGFPXT  665
             FP    GIGFP +
Sbjct  193  TFPTTRHGIGFPLS  206



>ref|NP_567556.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AAM66991.1| unknown [Arabidopsis thaliana]
 dbj|BAF00698.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE84044.1| uncharacterized protein AT4G18425 [Arabidopsis thaliana]
Length=213

 Score =   244 bits (622),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 110/181 (61%), Positives = 135/181 (75%), Gaps = 0/181 (0%)
 Frame = +3

Query  117  PDEVEKNLVQKAISQTFQSAAHLANLLPTGAVLAFQLLSPIFSNQGDCDAVSRFLTASLV  296
            PD      +QKAI QTFQ+ AHLANLLPTG VLAFQLLSPIFSN G CD VS+ +T++LV
Sbjct  29   PDIERTTWIQKAIGQTFQTTAHLANLLPTGTVLAFQLLSPIFSNGGQCDLVSKIMTSTLV  88

Query  297  AMCGLSCFLLSFTDSFKDQKGNVCYGVATVKGLWVIDGSASLPPELAAKYKVKFIDFVHA  476
            A+CG SCF+LSFTDS+KD+ G +CYG+AT+ G W+IDGS +LP EL+ +YK++FIDFVHA
Sbjct  89   AICGFSCFILSFTDSYKDKNGTICYGLATIHGFWIIDGSTTLPQELSKRYKLRFIDFVHA  148

Query  477  VMSVLVFGAIALFDQNVVSCFXPXPXXEXXXILPXVPVGXGXVCXXLFVVFPPXXXGIGF  656
             MS+ VFGA+ LFD+N V+CF P P  E   +L  +PVG G     LF  FP    GIGF
Sbjct  149  FMSLFVFGAVVLFDRNAVNCFFPSPSAEALEVLTALPVGVGVFSSMLFATFPTTRNGIGF  208

Query  657  P  659
            P
Sbjct  209  P  209



>ref|XP_006414104.1| hypothetical protein EUTSA_v10027225mg [Eutrema salsugineum]
 gb|ESQ55557.1| hypothetical protein EUTSA_v10027225mg [Eutrema salsugineum]
Length=214

 Score =   243 bits (621),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 118/213 (55%), Positives = 146/213 (69%), Gaps = 10/213 (5%)
 Frame = +3

Query  42   MDIHVGDEELSHNNVVVSEKV--PLL-----VPDEVEKNLVQKAISQTFQSAAHLANLLP  200
            M+I V ++   H+     E++  PLL      PD      +QKAI QTFQ+ AHLANLLP
Sbjct  1    MEIKVVED---HDQRSTKEEIEKPLLGEDKDFPDIERTTWIQKAIGQTFQTTAHLANLLP  57

Query  201  TGAVLAFQLLSPIFSNQGDCDAVSRFLTASLVAMCGLSCFLLSFTDSFKDQKGNVCYGVA  380
            TG VLAFQLLSPIFSN G CD  S+ +T+ LVA+CG SCF+LSFTDS+KD+ G +CYG A
Sbjct  58   TGTVLAFQLLSPIFSNGGQCDLASKIMTSILVAICGFSCFILSFTDSYKDKNGTICYGFA  117

Query  381  TVKGLWVIDGSASLPPELAAKYKVKFIDFVHAVMSVLVFGAIALFDQNVVSCFXPXPXXE  560
            T  G W+IDGS +LP EL+ +YK++FIDF HA MS+LVFGA+ LFD+N V+CF P P  E
Sbjct  118  TFHGFWIIDGSTTLPQELSKRYKLRFIDFAHAFMSLLVFGAVVLFDRNAVNCFFPAPSAE  177

Query  561  XXXILPXVPVGXGXVCXXLFVVFPPXXXGIGFP  659
               +L  +PVG G  C  LF  FP    GIGFP
Sbjct  178  ALEVLTALPVGVGVFCSMLFATFPTTRNGIGFP  210



>emb|CAN65382.1| hypothetical protein VITISV_028557 [Vitis vinifera]
Length=265

 Score =   245 bits (626),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 117/193 (61%), Positives = 145/193 (75%), Gaps = 7/193 (4%)
 Frame = +3

Query  42   MDIHVGDEELSHNNVVVSEKVPLL----VPDEVEKNLVQKAISQTFQSAAHLANLLPTGA  209
            M+  V DEE  H N    +KV LL     P   ++  +Q AISQTFQS AHLANLLPTG 
Sbjct  1    MEFKVEDEESWHLN---DQKVTLLQDMPRPQTGQRTPIQMAISQTFQSTAHLANLLPTGT  57

Query  210  VLAFQLLSPIFSNQGDCDAVSRFLTASLVAMCGLSCFLLSFTDSFKDQKGNVCYGVATVK  389
            VLAFQ LSP+ +N+G+CD VSRF+T+SL+A+CG+SCFL  FTDSF+D  GNV YG AT +
Sbjct  58   VLAFQFLSPVLTNKGECDPVSRFMTSSLLALCGMSCFLQCFTDSFRDNNGNVYYGFATFR  117

Query  390  GLWVIDGSASLPPELAAKYKVKFIDFVHAVMSVLVFGAIALFDQNVVSCFXPXPXXEXXX  569
            GLW+IDGSA+LPPELAA+Y+++FIDF+HA MS+LVF AIALFD+NVV+CF P P  E   
Sbjct  118  GLWIIDGSATLPPELAAEYQLRFIDFIHAFMSILVFAAIALFDENVVNCFYPTPSDETKE  177

Query  570  ILPXVPVGXGXVC  608
            +L  +PVG G  C
Sbjct  178  LLTSLPVGIGVFC  190



>ref|XP_010924438.1| PREDICTED: uncharacterized protein LOC105047277 [Elaeis guineensis]
Length=210

 Score =   242 bits (618),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 118/211 (56%), Positives = 151/211 (72%), Gaps = 6/211 (3%)
 Frame = +3

Query  42   MDIHVGDEELSHNNVVVSEKVPLLVPD---EVEKNLVQKAISQTFQSAAHLANLLPTGAV  212
            M+ + GDEE +H         PLL+P+      K   +KAI +TF+  AHLANLLPTG V
Sbjct  1    MEPNKGDEE-AHRQQQQQ--QPLLIPELSNNDRKTPKRKAIRKTFKKTAHLANLLPTGTV  57

Query  213  LAFQLLSPIFSNQGDCDAVSRFLTASLVAMCGLSCFLLSFTDSFKDQKGNVCYGVATVKG  392
            LAFQLLSPIF+NQG C+A++ ++TA LVA+CGLSCF+ SFTDSF+D+ G V +G+AT +G
Sbjct  58   LAFQLLSPIFTNQGHCNAMNWYMTAGLVALCGLSCFIQSFTDSFRDESGKVRHGLATFRG  117

Query  393  LWVIDGSASLPPELAAKYKVKFIDFVHAVMSVLVFGAIALFDQNVVSCFXPXPXXEXXXI  572
            LWVIDG+A LPPE+A  Y++KFIDFVHA+MS+LVF A+AL DQNVVSC  P P  E   +
Sbjct  118  LWVIDGTAPLPPEVAINYRIKFIDFVHALMSILVFVAVALLDQNVVSCLYPTPSEEMKRV  177

Query  573  LPXVPVGXGXVCXXLFVVFPPXXXGIGFPXT  665
            L  +P+G G +    FV FP    GIGFP +
Sbjct  178  LTSLPIGIGVISSMFFVAFPSTRHGIGFPLS  208



>ref|XP_009108361.1| PREDICTED: uncharacterized protein LOC103834060 [Brassica rapa]
Length=214

 Score =   242 bits (618),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 123/212 (58%), Positives = 144/212 (68%), Gaps = 9/212 (4%)
 Frame = +3

Query  42   MDIHV-GDEELSHNNVVVSEKVPLL-----VPDEVEKNLVQKAISQTFQSAAHLANLLPT  203
            M+I V  D +LS    +  EK PLL      PD      +QKAI QTFQ+ AHLANLLPT
Sbjct  1    MEIKVVEDHQLSTKEDI--EK-PLLEENKGFPDVERTTWIQKAIGQTFQTTAHLANLLPT  57

Query  204  GAVLAFQLLSPIFSNQGDCDAVSRFLTASLVAMCGLSCFLLSFTDSFKDQKGNVCYGVAT  383
            G VLAFQLLSPIFSN G CD   + +T+SLVA+CG SCF+LSFTDS+KD+ G  CYG AT
Sbjct  58   GTVLAFQLLSPIFSNGGQCDLACKIMTSSLVAICGFSCFILSFTDSYKDKNGTFCYGFAT  117

Query  384  VKGLWVIDGSASLPPELAAKYKVKFIDFVHAVMSVLVFGAIALFDQNVVSCFXPXPXXEX  563
            + G W+IDGSA+LP ELA  YK++FIDF HA MS LVFGA+ LFD+N V+CF P P  E 
Sbjct  118  IHGFWIIDGSATLPQELAKNYKLRFIDFAHAFMSFLVFGAVVLFDRNTVNCFYPAPSAEE  177

Query  564  XXILPXVPVGXGXVCXXLFVVFPPXXXGIGFP  659
               L  +PVG G  C  LF  FP    GIGFP
Sbjct  178  LEFLTALPVGVGVFCSMLFATFPTTRNGIGFP  209



>gb|KFK28517.1| hypothetical protein AALP_AA7G006800 [Arabis alpina]
Length=218

 Score =   239 bits (610),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 115/192 (60%), Positives = 138/192 (72%), Gaps = 5/192 (3%)
 Frame = +3

Query  99   KVPLLVPD----EVEKN-LVQKAISQTFQSAAHLANLLPTGAVLAFQLLSPIFSNQGDCD  263
            K PLL  D    ++E+N  +QKAI QTF + AHLANLLPTG VLAFQLLSPIFSN G CD
Sbjct  23   KKPLLGQDKDFPDIERNTWIQKAIGQTFVTTAHLANLLPTGTVLAFQLLSPIFSNGGQCD  82

Query  264  AVSRFLTASLVAMCGLSCFLLSFTDSFKDQKGNVCYGVATVKGLWVIDGSASLPPELAAK  443
              S+ +T+ LV++CG  CF+LSFTDS+KD  G +CYG AT  G W+IDGSA+LP EL+ K
Sbjct  83   LASKIMTSMLVSICGFFCFILSFTDSYKDNNGTICYGFATFNGFWIIDGSATLPQELSKK  142

Query  444  YKVKFIDFVHAVMSVLVFGAIALFDQNVVSCFXPXPXXEXXXILPXVPVGXGXVCXXLFV  623
            YK+KFIDF HA MS+LVFGA+ LFD+N V+CF P P  E   +L  +PVG G  C  LF 
Sbjct  143  YKLKFIDFAHAFMSLLVFGAVVLFDRNAVNCFFPVPSAEALEVLTALPVGVGVFCSMLFA  202

Query  624  VFPPXXXGIGFP  659
             FP    GIGFP
Sbjct  203  TFPTTRNGIGFP  214



>ref|XP_006398291.1| hypothetical protein EUTSA_v10001025mg [Eutrema salsugineum]
 gb|ESQ39744.1| hypothetical protein EUTSA_v10001025mg [Eutrema salsugineum]
Length=210

 Score =   239 bits (609),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 115/206 (56%), Positives = 141/206 (68%), Gaps = 8/206 (4%)
 Frame = +3

Query  60   DEELSHNNVVVSEKVPLLVPDE---VEKN-LVQKAISQTFQSAAHLANLLPTGAVLAFQL  227
            DEE      +  EKVPLL   E   +E+N L+ K I QTF++ AHLANLLPTG VLA+Q+
Sbjct  6    DEEAG----IKEEKVPLLKAQEFPDIERNTLIHKVIGQTFKTTAHLANLLPTGTVLAYQV  61

Query  228  LSPIFSNQGDCDAVSRFLTASLVAMCGLSCFLLSFTDSFKDQKGNVCYGVATVKGLWVID  407
            LSPIF+N G CD  SRF+T  LV +CG SCF+LSFTDS+KD  GNVCYG AT  G W+ID
Sbjct  62   LSPIFTNGGRCDLASRFMTEMLVFICGFSCFILSFTDSYKDLNGNVCYGFATTNGFWIID  121

Query  408  GSASLPPELAAKYKVKFIDFVHAVMSVLVFGAIALFDQNVVSCFXPXPXXEXXXILPXVP  587
            G A LP E +  Y+++FIDF HA+MS LVFGA+ LFDQNVV+CF P P  E   ++  +P
Sbjct  122  GKADLPRESSKSYRLRFIDFAHAIMSFLVFGAVVLFDQNVVNCFFPNPSAEVSELVTSLP  181

Query  588  VGXGXVCXXLFVVFPPXXXGIGFPXT  665
            V  G  C  +F  FP    GIGFP +
Sbjct  182  VAVGVFCSLMFATFPTKRHGIGFPLS  207



>ref|XP_002865206.1| hypothetical protein ARALYDRAFT_916829 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH41465.1| hypothetical protein ARALYDRAFT_916829 [Arabidopsis lyrata subsp. 
lyrata]
Length=219

 Score =   239 bits (610),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 118/215 (55%), Positives = 144/215 (67%), Gaps = 9/215 (4%)
 Frame = +3

Query  42   MDIHVGDEELS-HNNVVVSEKVPLL--------VPDEVEKNLVQKAISQTFQSAAHLANL  194
            M+I V +E  +     +  E VPLL         PD     ++QKAI +TFQ+ A+LANL
Sbjct  1    MEIKVDEEAGTIGARRIKEETVPLLDDRNRNRDFPDIERNTMMQKAIGKTFQTTANLANL  60

Query  195  LPTGAVLAFQLLSPIFSNQGDCDAVSRFLTASLVAMCGLSCFLLSFTDSFKDQKGNVCYG  374
            LPTG VLAFQ+LSPI +N G CD  SR +TA LV++CG SCF+LSFTDS+KD  GNVCYG
Sbjct  61   LPTGTVLAFQILSPICTNAGQCDLASRVMTALLVSICGFSCFILSFTDSYKDLNGNVCYG  120

Query  375  VATVKGLWVIDGSASLPPELAAKYKVKFIDFVHAVMSVLVFGAIALFDQNVVSCFXPXPX  554
             AT+ G W+IDGSA+LP E +  YKV+FIDFVHA+MS LVFGA+ LFDQN V CF P P 
Sbjct  121  FATIHGFWIIDGSATLPQERSKSYKVRFIDFVHAIMSFLVFGAVVLFDQNAVKCFFPEPS  180

Query  555  XEXXXILPXVPVGXGXVCXXLFVVFPPXXXGIGFP  659
             E   +L  +PV  G  C  +F  FP    GIGFP
Sbjct  181  AEVADLLTTLPVAVGVFCSMVFATFPTTRHGIGFP  215



>ref|XP_008798336.1| PREDICTED: uncharacterized protein LOC103713249 [Phoenix dactylifera]
Length=208

 Score =   235 bits (600),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 113/205 (55%), Positives = 145/205 (71%), Gaps = 3/205 (1%)
 Frame = +3

Query  60   DEELSHNNVVVSEKVPLLVP---DEVEKNLVQKAISQTFQSAAHLANLLPTGAVLAFQLL  230
            +E +        ++ PLL+P   +   K   +KAI +TF+S AHLANLLPTG VLAFQLL
Sbjct  2    EENMCDKEAQQQQEEPLLIPKSSNSDRKTPKRKAIRKTFKSTAHLANLLPTGTVLAFQLL  61

Query  231  SPIFSNQGDCDAVSRFLTASLVAMCGLSCFLLSFTDSFKDQKGNVCYGVATVKGLWVIDG  410
            SPIF+NQG C+A S  +TA LVA+CGLSCF+LSFTDSF+D+ G V +G+AT +GLWVIDG
Sbjct  62   SPIFTNQGRCNAKSWNMTAGLVALCGLSCFILSFTDSFRDESGKVRHGLATFRGLWVIDG  121

Query  411  SASLPPELAAKYKVKFIDFVHAVMSVLVFGAIALFDQNVVSCFXPXPXXEXXXILPXVPV  590
            +A LPP++A  Y++K IDFVHA MS+LVF A++L D+NVVSC  P P  E   +L  +P+
Sbjct  122  TAPLPPQVAVNYRIKLIDFVHAFMSILVFVAVSLLDRNVVSCLYPTPSEEMKQVLASLPI  181

Query  591  GXGXVCXXLFVVFPPXXXGIGFPXT  665
            G G     LFV FP    GIGFP +
Sbjct  182  GIGIFGSMLFVAFPTRRHGIGFPLS  206



>ref|XP_009394826.1| PREDICTED: uncharacterized protein LOC103980228 [Musa acuminata 
subsp. malaccensis]
Length=211

 Score =   235 bits (600),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 116/188 (62%), Positives = 136/188 (72%), Gaps = 3/188 (2%)
 Frame = +3

Query  105  PLLVPD---EVEKNLVQKAISQTFQSAAHLANLLPTGAVLAFQLLSPIFSNQGDCDAVSR  275
            PLL PD   + +   VQ+AISQTF+S AHLA LLPTG VLAFQLLSPIF++ G C A +R
Sbjct  20   PLLAPDSSGDDQVTSVQRAISQTFRSTAHLAKLLPTGTVLAFQLLSPIFTDGGHCMAANR  79

Query  276  FLTASLVAMCGLSCFLLSFTDSFKDQKGNVCYGVATVKGLWVIDGSASLPPELAAKYKVK  455
             +TA L A+C LSCF+LSFTDSF+D    V YG+AT KGLWVIDG+A LPP +A  Y++K
Sbjct  80   LMTACLAALCALSCFVLSFTDSFRDGNSTVRYGLATFKGLWVIDGTAPLPPTIAIGYRIK  139

Query  456  FIDFVHAVMSVLVFGAIALFDQNVVSCFXPXPXXEXXXILPXVPVGXGXVCXXLFVVFPP  635
            FIDFVHA MS LVF A+ALFDQNV SCF P P  E   +L  +PV  G +C  LFV FP 
Sbjct  140  FIDFVHAFMSFLVFAAVALFDQNVASCFYPIPSEETKQVLTCLPVAIGVICSMLFVTFPT  199

Query  636  XXXGIGFP  659
               GIGFP
Sbjct  200  TRHGIGFP  207



>ref|XP_010904899.1| PREDICTED: uncharacterized protein LOC105032218 [Elaeis guineensis]
Length=211

 Score =   235 bits (599),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 116/206 (56%), Positives = 146/206 (71%), Gaps = 7/206 (3%)
 Frame = +3

Query  60   DEELSHNNVVVSEKVPLLVP---DEVEKNLVQKAISQTFQSAAHLANLLPTGAVLAFQLL  230
            D E  H+     E+ PLLV    DE    +VQ+AISQTF+SAAHLANLLPTG VLAFQ+L
Sbjct  7    DMEAHHHE---EEQQPLLVSEPSDEDRMTMVQQAISQTFKSAAHLANLLPTGTVLAFQVL  63

Query  231  SPIFSNQGDCDAVSRFLTASLVAMCGLSCFLLSFTDSFKDQKGNVCYGVATVKGLWVIDG  410
            SPI +N G C   +R +TA LVA+CGLSCF+L FTD+F D  G + YG+AT +G+W+IDG
Sbjct  64   SPILTNLGRCTDANRIMTACLVALCGLSCFILCFTDTFHDAAGKIRYGLATFRGIWIIDG  123

Query  411  SASLPPEL-AAKYKVKFIDFVHAVMSVLVFGAIALFDQNVVSCFXPXPXXEXXXILPXVP  587
            +  LPPE+ AA+Y++KFIDFVHA MSVL+F A+ALFD+NVVSCF P P  +   +L  +P
Sbjct  124  TGPLPPEIPAARYRIKFIDFVHAFMSVLIFAAVALFDKNVVSCFYPVPSEDVEQVLTALP  183

Query  588  VGXGXVCXXLFVVFPPXXXGIGFPXT  665
            V  G     +FV FP    GIGFP +
Sbjct  184  VAIGVFGSSVFVAFPTTRQGIGFPVS  209



>ref|XP_008811089.1| PREDICTED: uncharacterized protein LOC103722318 [Phoenix dactylifera]
 ref|XP_008811201.1| PREDICTED: uncharacterized protein LOC103722398 [Phoenix dactylifera]
Length=206

 Score =   233 bits (595),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 115/205 (56%), Positives = 143/205 (70%), Gaps = 6/205 (3%)
 Frame = +3

Query  60   DEELSHNNVVVSEKVPLLVP---DEVEKNLVQKAISQTFQSAAHLANLLPTGAVLAFQLL  230
            D E  H+     E+ PLL     DE    +VQ+AISQTF+S AHLANLLPTG VLAFQ+L
Sbjct  3    DMEAHHHE---EEQQPLLASKPSDEDRMTMVQQAISQTFKSVAHLANLLPTGTVLAFQVL  59

Query  231  SPIFSNQGDCDAVSRFLTASLVAMCGLSCFLLSFTDSFKDQKGNVCYGVATVKGLWVIDG  410
            SPI +N G C   +R +TA LV +CGLSCF+LSFTDSF+D+ G + YG+AT  G+W+IDG
Sbjct  60   SPILTNLGRCTDANRTMTACLVVLCGLSCFVLSFTDSFQDKTGKIRYGLATFGGMWIIDG  119

Query  411  SASLPPELAAKYKVKFIDFVHAVMSVLVFGAIALFDQNVVSCFXPXPXXEXXXILPXVPV  590
            +  LPPE+AA Y VKF+DFVHA MSVL+F A+ALFD+NVVSCF P P  +   +L  +PV
Sbjct  120  AKPLPPEIAANYSVKFVDFVHAFMSVLIFAAVALFDKNVVSCFYPVPSEDMEQVLTALPV  179

Query  591  GXGXVCXXLFVVFPPXXXGIGFPXT  665
              G     +FV FP    GIGFP +
Sbjct  180  AIGVFGSAVFVTFPTTRHGIGFPVS  204



>gb|EPS66984.1| hypothetical protein M569_07790, partial [Genlisea aurea]
Length=196

 Score =   230 bits (587),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 115/195 (59%), Positives = 145/195 (74%), Gaps = 4/195 (2%)
 Frame = +3

Query  93   SEKVPLLVPD--EVEKNLVQKAISQTFQSAAHLANLLPTGAVLAFQLLSPIFSNQGDCDA  266
             E+ PLL  D  E  + LVQ+AIS+TF+S AHLANLLPTG+VLAFQLL PIFSN+G CD 
Sbjct  2    EEEEPLLGNDAEERRRTLVQEAISRTFRSTAHLANLLPTGSVLAFQLLVPIFSNEGRCDR  61

Query  267  VSRFLTASLVAMCGLSCFLLSFTDSFKDQK-GNVCYGVATVKGLWVIDGSASLPPELAA-  440
            V RF+TA++VA+CGLSCFLL FTDS +  + GN CYG AT +GLW+IDGS   PP  AA 
Sbjct  62   VGRFMTAAVVALCGLSCFLLCFTDSVRGGRDGNPCYGFATPRGLWMIDGSPPPPPGAAAE  121

Query  441  KYKVKFIDFVHAVMSVLVFGAIALFDQNVVSCFXPXPXXEXXXILPXVPVGXGXVCXXLF  620
            +Y+++F+DFVHA MS+ VF A+A+FD++ V+CF P P  E   ++  +PVG G VC  +F
Sbjct  122  RYRLRFVDFVHAFMSIAVFAAVAMFDRDTVACFWPEPSGEAREVIAALPVGIGVVCSMMF  181

Query  621  VVFPPXXXGIGFPXT  665
            VVFP    GIGFP T
Sbjct  182  VVFPTKRHGIGFPVT  196



>emb|CDY33452.1| BnaA06g36210D [Brassica napus]
Length=217

 Score =   228 bits (582),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 108/207 (52%), Positives = 136/207 (66%), Gaps = 7/207 (3%)
 Frame = +3

Query  60   DEELSHNNV---VVSEKVPLLVPDE---VEKN-LVQKAISQTFQSAAHLANLLPTGAVLA  218
            DEE   N     +  EK PLL   E   VE+N  + KAI QTFQ+ AHLAN LPTG  LA
Sbjct  6    DEEAGVNGAGGAIKEEKAPLLKAQEFPEVERNNWIHKAIGQTFQTTAHLANHLPTGTALA  65

Query  219  FQLLSPIFSNQGDCDAVSRFLTASLVAMCGLSCFLLSFTDSFKDQKGNVCYGVATVKGLW  398
            +Q+LSP+ +N G CD  SR++T  LV++C  +CF+LSFTDS++D  G VCYG AT  GLW
Sbjct  66   YQVLSPVLTNGGRCDFASRYMTEMLVSICAFTCFILSFTDSYRDLNGTVCYGFATTNGLW  125

Query  399  VIDGSASLPPELAAKYKVKFIDFVHAVMSVLVFGAIALFDQNVVSCFXPXPXXEXXXILP  578
            +IDG A LP E +  Y+++FIDF HA M++LVFGA+ +FD NVVSCF P P  E   +L 
Sbjct  126  IIDGKAVLPKERSKSYRLQFIDFAHAFMTLLVFGAVVMFDHNVVSCFFPKPSAEVAELLT  185

Query  579  XVPVGXGXVCXXLFVVFPPXXXGIGFP  659
             +PV  G  C  +F  FP    GIGFP
Sbjct  186  ALPVAIGVFCSMMFATFPTTRHGIGFP  212



>ref|XP_009101545.1| PREDICTED: uncharacterized protein LOC103827755 [Brassica rapa]
Length=217

 Score =   227 bits (578),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 107/207 (52%), Positives = 136/207 (66%), Gaps = 7/207 (3%)
 Frame = +3

Query  60   DEELSHNNV---VVSEKVPLLVPDE---VEKN-LVQKAISQTFQSAAHLANLLPTGAVLA  218
            DEE   N     +  EK PLL   E   VE+N  + KAI QTFQ+ AHLAN LPTG  LA
Sbjct  6    DEEAGVNGAGGAIKEEKAPLLKAQEFPEVERNNWIHKAIGQTFQTTAHLANHLPTGTALA  65

Query  219  FQLLSPIFSNQGDCDAVSRFLTASLVAMCGLSCFLLSFTDSFKDQKGNVCYGVATVKGLW  398
            +Q+LSP+ +N G CD  SR++T  LV++C  +CF+LSFTDS++D  G VCYG AT  GLW
Sbjct  66   YQVLSPVLTNGGRCDFASRYMTEMLVSICAFTCFILSFTDSYRDLNGTVCYGFATTNGLW  125

Query  399  VIDGSASLPPELAAKYKVKFIDFVHAVMSVLVFGAIALFDQNVVSCFXPXPXXEXXXILP  578
            +IDG A LP E +  Y+++FIDF HA M++LVFGA+ +FD NVV+CF P P  E   +L 
Sbjct  126  IIDGKAVLPKERSKSYRLQFIDFAHAFMTLLVFGAVVMFDHNVVNCFFPKPSAEVAELLT  185

Query  579  XVPVGXGXVCXXLFVVFPPXXXGIGFP  659
             +PV  G  C  +F  FP    GIGFP
Sbjct  186  ALPVAIGVFCSMMFATFPTTRHGIGFP  212



>emb|CDY34571.1| BnaC03g56710D [Brassica napus]
Length=217

 Score =   223 bits (568),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 105/207 (51%), Positives = 135/207 (65%), Gaps = 7/207 (3%)
 Frame = +3

Query  60   DEELSHNNV---VVSEKVPLLVPDE---VEKN-LVQKAISQTFQSAAHLANLLPTGAVLA  218
            DEE   N     +  EK PLL   E   VE+N  + KAI QTF++ AHLAN LPTG  LA
Sbjct  6    DEEAGVNGAGGAIKEEKAPLLKAQEFPEVERNNWIHKAIGQTFKTTAHLANHLPTGTALA  65

Query  219  FQLLSPIFSNQGDCDAVSRFLTASLVAMCGLSCFLLSFTDSFKDQKGNVCYGVATVKGLW  398
            +Q+LSP+ +N G CD  SR++T  LV++C  +CF+LSF+DS++D  G VCYG A   GLW
Sbjct  66   YQVLSPVLTNGGRCDFASRYMTEMLVSICAFTCFILSFSDSYRDLNGTVCYGFAMTNGLW  125

Query  399  VIDGSASLPPELAAKYKVKFIDFVHAVMSVLVFGAIALFDQNVVSCFXPXPXXEXXXILP  578
            +IDG A LP E +  Y+++FIDF HA M++LVFGA+ +FD NVVSCF P P  E   +L 
Sbjct  126  IIDGKAVLPKERSKSYRLQFIDFAHAFMTLLVFGAVVMFDHNVVSCFFPKPSAEVAELLT  185

Query  579  XVPVGXGXVCXXLFVVFPPXXXGIGFP  659
             +PV  G  C  +F  FP    GIGFP
Sbjct  186  ALPVAIGVFCSMMFATFPTTRHGIGFP  212



>emb|CDX77630.1| BnaC07g18840D [Brassica napus]
Length=217

 Score =   221 bits (564),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 104/207 (50%), Positives = 135/207 (65%), Gaps = 7/207 (3%)
 Frame = +3

Query  60   DEELSHNNV---VVSEKVPLLVPDE---VEKN-LVQKAISQTFQSAAHLANLLPTGAVLA  218
            DEE   N     +  EK PLL   E   VE+N  + KAI QTF++ AHLAN LPTG  LA
Sbjct  6    DEEAGVNGAGGAIKEEKAPLLKAQEFPEVERNNWIHKAIGQTFKTTAHLANHLPTGTALA  65

Query  219  FQLLSPIFSNQGDCDAVSRFLTASLVAMCGLSCFLLSFTDSFKDQKGNVCYGVATVKGLW  398
            +Q+LSP+ +N G CD  SR++T  LV++C  +CF+LSF+DS++D  G VCYG A   GLW
Sbjct  66   YQVLSPVLTNGGRCDFASRYMTEMLVSICAFTCFILSFSDSYRDLNGTVCYGFAMTNGLW  125

Query  399  VIDGSASLPPELAAKYKVKFIDFVHAVMSVLVFGAIALFDQNVVSCFXPXPXXEXXXILP  578
            +IDG A LP E +  Y+++FIDF HA M++LVFGA+ +FD NVV+CF P P  E   +L 
Sbjct  126  IIDGKAVLPKERSKSYRLQFIDFAHAFMTLLVFGAVVMFDHNVVNCFFPKPSAEVAELLS  185

Query  579  XVPVGXGXVCXXLFVVFPPXXXGIGFP  659
             +PV  G  C  +F  FP    GIGFP
Sbjct  186  ALPVAIGVFCSMMFATFPTTRHGIGFP  212



>ref|XP_002275299.1| PREDICTED: uncharacterized protein LOC100245474 [Vitis vinifera]
 emb|CBI21903.3| unnamed protein product [Vitis vinifera]
Length=214

 Score =   219 bits (558),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 111/214 (52%), Positives = 147/214 (69%), Gaps = 8/214 (4%)
 Frame = +3

Query  42   MDIHV-GDEELSHNNVVVSEKVPLL----VPDEVEKNLVQKAISQTFQSAAHLANLLPTG  206
            M++ V  DEE+    V+  +  PLL    +P+++ K  +Q+ I +TF+  AHL+NLLPTG
Sbjct  1    MEVKVQTDEEV--QRVIEQQLQPLLEHSPIPEKLMKTPLQRFIRKTFKGTAHLSNLLPTG  58

Query  207  AVLAFQLLSPIFSNQGDC-DAVSRFLTASLVAMCGLSCFLLSFTDSFKDQKGNVCYGVAT  383
             VL FQ+ SPI +N+G C  + +  LT  L+A C  SCF+LSFTDSF+D KG V YG+AT
Sbjct  59   TVLGFQMFSPILTNKGHCLTSATHSLTLGLLAACCASCFILSFTDSFRDAKGKVRYGLAT  118

Query  384  VKGLWVIDGSASLPPELAAKYKVKFIDFVHAVMSVLVFGAIALFDQNVVSCFXPXPXXEX  563
             +GLWVIDGS +L P++AA Y++KFIDFVHA MS++VF A+ALFDQN+V CF P P  E 
Sbjct  119  SRGLWVIDGSVTLAPDVAAGYRLKFIDFVHAFMSIVVFAAVALFDQNIVKCFCPMPSEET  178

Query  564  XXILPXVPVGXGXVCXXLFVVFPPXXXGIGFPXT  665
              +L  VP+  G VC   FVVFP    GIGFP +
Sbjct  179  KKLLVAVPLWTGVVCCLFFVVFPSKRHGIGFPLS  212



>ref|XP_006584405.1| PREDICTED: uncharacterized protein LOC100794857 [Glycine max]
Length=208

 Score =   219 bits (557),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 102/168 (61%), Positives = 138/168 (82%), Gaps = 9/168 (5%)
 Frame = +3

Query  39   EMDIHVGDEELSHNNVVVSEKVPLL----VPDE-VEKNLVQKAISQTFQSAAHLANLLPT  203
            + D ++ +   +H+     +K+PLL    VPD+  +++L+Q+A+SQTFQS AHLANLLPT
Sbjct  8    DHDQYMYNNSKNHD----EQKLPLLHIMEVPDDDAQRSLIQRAMSQTFQSTAHLANLLPT  63

Query  204  GAVLAFQLLSPIFSNQGDCDAVSRFLTASLVAMCGLSCFLLSFTDSFKDQKGNVCYGVAT  383
            G VL+FQLLSPI +NQG CD+V +F+T++LVA+CG+SCFL  FTDSF+D KGNVCYG+AT
Sbjct  64   GTVLSFQLLSPIVTNQGICDSVCKFMTSTLVALCGVSCFLQCFTDSFRDDKGNVCYGLAT  123

Query  384  VKGLWVIDGSASLPPELAAKYKVKFIDFVHAVMSVLVFGAIALFDQNV  527
             +G+WVIDGS ++PPEL AKY+++ IDF+HAVMS+LVF A+ALFDQNV
Sbjct  124  FRGMWVIDGSTTIPPELGAKYRLRLIDFLHAVMSILVFAAVALFDQNV  171



>ref|XP_006655587.1| PREDICTED: uncharacterized protein LOC102706010 [Oryza brachyantha]
Length=231

 Score =   219 bits (558),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 113/221 (51%), Positives = 144/221 (65%), Gaps = 15/221 (7%)
 Frame = +3

Query  39   EMDIHVGDEELSHNNVVVSEKVPLLVPDE-----------VEKNLVQKAISQTFQSAAHL  185
            +++   G +E  H +   S++ PLLV                 + VQ+AISQT+QS AHL
Sbjct  12   DVESRRGGDEHGHGD---SKRRPLLVKRRSAVGGGDDGDGGGMSPVQRAISQTYQSTAHL  68

Query  186  ANLLPTGAVLAFQLLSPIFSNQGDCDAVSRFLTASLVAMCGLSCFLLSFTDSFKD-QKGN  362
            A LLPTG VLAFQLLSPI +NQG C   +R + A+L+A+C LSCF+LSFTDSF+D   G 
Sbjct  69   AKLLPTGTVLAFQLLSPIVTNQGHCVQANRAMAATLIALCALSCFVLSFTDSFRDGATGA  128

Query  363  VCYGVATVKGLWVIDGSASLPPELAAKYKVKFIDFVHAVMSVLVFGAIALFDQNVVSCFX  542
            V YG AT+ GLWVIDG A L P+ AA ++++ +D VHAVMSV+VF A+ALFDQNVVSCF 
Sbjct  129  VRYGFATLGGLWVIDGGAPLDPQAAAGFRIRLLDLVHAVMSVMVFAAVALFDQNVVSCFY  188

Query  543  PXPXXEXXXILPXVPVGXGXVCXXLFVVFPPXXXGIGFPXT  665
            P P      +L  +P+  G V   LFV FP    GIGFP +
Sbjct  189  PVPSEGTRQVLTALPIAIGVVGSMLFVSFPTTRHGIGFPLS  229



>ref|XP_003526262.1| PREDICTED: uncharacterized protein LOC100796945 [Glycine max]
 gb|KHN01096.1| hypothetical protein glysoja_040285 [Glycine soja]
Length=207

 Score =   218 bits (555),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 104/211 (49%), Positives = 141/211 (67%), Gaps = 5/211 (2%)
 Frame = +3

Query  42   MDIHVGDEELSHNNVVVSEKVPLLVPDEVEKNLVQKAISQTFQSAAHLANLLPTGAVLAF  221
            MD+HV  +E    N       PLL+P +  K   Q+ + + F+  +HLA LLPTG VL F
Sbjct  1    MDVHVTTQEPLLENA----PTPLLLPQKTPKTPTQRTMRKAFKGTSHLAKLLPTGTVLIF  56

Query  222  QLLSPIFSNQGDCDAV-SRFLTASLVAMCGLSCFLLSFTDSFKDQKGNVCYGVATVKGLW  398
            Q LSP+F++QG C  + S+ +T  L+ +C +SCFLLSFTDSF+D++G V YGVA++KGLW
Sbjct  57   QTLSPLFTHQGQCQTLTSKTMTTCLLTLCSISCFLLSFTDSFRDERGKVRYGVASLKGLW  116

Query  399  VIDGSASLPPELAAKYKVKFIDFVHAVMSVLVFGAIALFDQNVVSCFXPXPXXEXXXILP  578
            V+D S  +P + A KY+++FIDF HA MS+LVF A+AL D +VVSCF P P  E   +L 
Sbjct  117  VLDASIRVPVDEAEKYRLRFIDFFHAFMSILVFLAVALLDGSVVSCFFPKPSEEAKELLV  176

Query  579  XVPVGXGXVCXXLFVVFPPXXXGIGFPXTXD  671
             +P+G G VC  LFV FP    GIGFP + +
Sbjct  177  TLPIGIGIVCSVLFVAFPSQRHGIGFPLSRN  207



>ref|XP_006844888.2| PREDICTED: uncharacterized protein LOC18434762 [Amborella trichopoda]
Length=213

 Score =   218 bits (555),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 107/211 (51%), Positives = 137/211 (65%), Gaps = 8/211 (4%)
 Frame = +3

Query  63   EELSHNNVVVSEKVPLLVPDEVEK--------NLVQKAISQTFQSAAHLANLLPTGAVLA  218
            E  +H+     ++ PLL   +V          N VQ+AI QTF+S AHLANLLPTG VL 
Sbjct  3    EITAHDEEAQQQQRPLLKDKQVSSPAQGAAPSNPVQRAIDQTFKSTAHLANLLPTGTVLT  62

Query  219  FQLLSPIFSNQGDCDAVSRFLTASLVAMCGLSCFLLSFTDSFKDQKGNVCYGVATVKGLW  398
            FQLL+P+F+  G+CD  +RFLTA LV  C LSC++L FTDSF+   G +CYGVAT  GLW
Sbjct  63   FQLLAPVFTGPGECDQSARFLTAVLVVGCALSCYVLCFTDSFRTSNGRICYGVATKNGLW  122

Query  399  VIDGSASLPPELAAKYKVKFIDFVHAVMSVLVFGAIALFDQNVVSCFXPXPXXEXXXILP  578
            VIDG+ S   +   +YK++F+DFVHA  SVLVF  IAL ++++V CF P P  E   +L 
Sbjct  123  VIDGTVSEASDGGKEYKLRFVDFVHAFGSVLVFMTIALLNEDIVRCFYPSPSKEMAEMLT  182

Query  579  XVPVGXGXVCXXLFVVFPPXXXGIGFPXTXD  671
             VPVG G +C  LFV FP    GIGFP + +
Sbjct  183  RVPVGIGVLCSMLFVAFPTKRHGIGFPLSSN  213



>ref|XP_006372758.1| hypothetical protein POPTR_0017s04770g [Populus trichocarpa]
 gb|ERP50555.1| hypothetical protein POPTR_0017s04770g [Populus trichocarpa]
Length=207

 Score =   216 bits (550),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 108/204 (53%), Positives = 140/204 (69%), Gaps = 7/204 (3%)
 Frame = +3

Query  81   NVVVSEKVPLLVP------DEVEKNLVQKAISQTFQSAAHLANLLPTGAVLAFQLLSPIF  242
            NV+V E   +  P       + EK   QKAI +TF+  AHLA LLPTG+VL FQ+LSPI 
Sbjct  4    NVLVQEGAEIAQPFLENVLQKPEKTPGQKAIRKTFKGTAHLARLLPTGSVLTFQILSPIL  63

Query  243  SNQGDCDAV-SRFLTASLVAMCGLSCFLLSFTDSFKDQKGNVCYGVATVKGLWVIDGSAS  419
            +++G C +V S+ LT+SL+A+CGL+CFLL FTDSF+D +G V YG+ T KGLW+ID +A 
Sbjct  64   THEGQCRSVTSQTLTSSLLAVCGLACFLLCFTDSFRDARGKVRYGMVTFKGLWIIDATAE  123

Query  420  LPPELAAKYKVKFIDFVHAVMSVLVFGAIALFDQNVVSCFXPXPXXEXXXILPXVPVGXG  599
            L PE AAKYK+KFID +HA MS+LVFGA++LFD+NV  CF P P  E   +L  VP   G
Sbjct  124  LSPEEAAKYKLKFIDVLHAFMSILVFGAVSLFDKNVAKCFFPAPSDEAKDLLIVVPATIG  183

Query  600  XVCXXLFVVFPPXXXGIGFPXTXD  671
             +C  LF+ FP    GIG P + +
Sbjct  184  VICSILFLAFPSKRHGIGCPLSRN  207



>ref|XP_003567905.1| PREDICTED: uncharacterized protein LOC100824681 [Brachypodium 
distachyon]
Length=229

 Score =   216 bits (551),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 110/199 (55%), Positives = 137/199 (69%), Gaps = 10/199 (5%)
 Frame = +3

Query  99   KVPLLVPDEVEK-----NLVQKAISQTFQSAAHLANLLPTGAVLAFQLLSPIFSNQGDCD  263
            + PLLV    +      + +QKAISQT+QS AHLA LLPTG VLAFQLLSP+ +NQGDC 
Sbjct  29   RQPLLVKRSADDGGTGMSPMQKAISQTYQSTAHLATLLPTGTVLAFQLLSPLVTNQGDCL  88

Query  264  AVSRFLTASLVAMCGLSCFLLSFTDSFKDQK-----GNVCYGVATVKGLWVIDGSASLPP  428
              +R +  +LV++C LSCF+LSFTDSF+D K     G V YG AT++GLWVIDG A L  
Sbjct  89   PSNRAMAGALVSLCALSCFVLSFTDSFRDDKQTGNNGAVRYGFATLRGLWVIDGGAPLEA  148

Query  429  ELAAKYKVKFIDFVHAVMSVLVFGAIALFDQNVVSCFXPXPXXEXXXILPXVPVGXGXVC  608
              AAKY+V+F+D VHAV+SV+VF A+ALFDQNVV CF P P  +   +L  +P+  G V 
Sbjct  149  SQAAKYRVRFLDLVHAVVSVMVFAAVALFDQNVVGCFCPVPSQDARQVLTVLPIAIGVVG  208

Query  609  XXLFVVFPPXXXGIGFPXT  665
              LFV FP    GIGFP +
Sbjct  209  SMLFVAFPTTRHGIGFPLS  227



>ref|XP_011649980.1| PREDICTED: uncharacterized protein LOC105434686 [Cucumis sativus]
 gb|KGN63201.1| hypothetical protein Csa_2G408960 [Cucumis sativus]
Length=219

 Score =   216 bits (549),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 104/179 (58%), Positives = 128/179 (72%), Gaps = 1/179 (1%)
 Frame = +3

Query  132  KNLVQKAISQTFQSAAHLANLLPTGAVLAFQLLSPIFSNQGDCDA-VSRFLTASLVAMCG  308
            K   QKAI + F+  AHLANLLPTG VL FQ+LSPIF++QG C+  VS+  T  LV +C 
Sbjct  39   KTSAQKAIRKAFKGTAHLANLLPTGTVLGFQILSPIFTHQGHCNTHVSQTTTLGLVLLCA  98

Query  309  LSCFLLSFTDSFKDQKGNVCYGVATVKGLWVIDGSASLPPELAAKYKVKFIDFVHAVMSV  488
            LSCF L FTDSF+D +G V YGV T +GLWVIDGS +LP E AAKY+++FIDF HA  S+
Sbjct  99   LSCFFLLFTDSFRDSRGKVRYGVVTFQGLWVIDGSITLPKEEAAKYRLRFIDFFHAFTSL  158

Query  489  LVFGAIALFDQNVVSCFXPXPXXEXXXILPXVPVGXGXVCXXLFVVFPPXXXGIGFPXT  665
            LVF A+ALFD+NVV CF P P  E   +L  +PVG G +C  LF+VFP    G+GFP +
Sbjct  159  LVFIAVALFDENVVKCFYPTPSDELRELLVVLPVGIGVLCSGLFIVFPTKRHGVGFPLS  217



>gb|ERN06563.1| hypothetical protein AMTR_s00058p00125960 [Amborella trichopoda]
Length=281

 Score =   217 bits (552),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 107/211 (51%), Positives = 137/211 (65%), Gaps = 8/211 (4%)
 Frame = +3

Query  63   EELSHNNVVVSEKVPLLVPDEVEK--------NLVQKAISQTFQSAAHLANLLPTGAVLA  218
            E  +H+     ++ PLL   +V          N VQ+AI QTF+S AHLANLLPTG VL 
Sbjct  71   EITAHDEEAQQQQRPLLKDKQVSSPAQGAAPSNPVQRAIDQTFKSTAHLANLLPTGTVLT  130

Query  219  FQLLSPIFSNQGDCDAVSRFLTASLVAMCGLSCFLLSFTDSFKDQKGNVCYGVATVKGLW  398
            FQLL+P+F+  G+CD  +RFLTA LV  C LSC++L FTDSF+   G +CYGVAT  GLW
Sbjct  131  FQLLAPVFTGPGECDQSARFLTAVLVVGCALSCYVLCFTDSFRTSNGRICYGVATKNGLW  190

Query  399  VIDGSASLPPELAAKYKVKFIDFVHAVMSVLVFGAIALFDQNVVSCFXPXPXXEXXXILP  578
            VIDG+ S   +   +YK++F+DFVHA  SVLVF  IAL ++++V CF P P  E   +L 
Sbjct  191  VIDGTVSEASDGGKEYKLRFVDFVHAFGSVLVFMTIALLNEDIVRCFYPSPSKEMAEMLT  250

Query  579  XVPVGXGXVCXXLFVVFPPXXXGIGFPXTXD  671
             VPVG G +C  LFV FP    GIGFP + +
Sbjct  251  RVPVGIGVLCSMLFVAFPTKRHGIGFPLSSN  281



>ref|XP_012088410.1| PREDICTED: uncharacterized protein LOC105647039 [Jatropha curcas]
Length=210

 Score =   214 bits (546),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 107/211 (51%), Positives = 141/211 (67%), Gaps = 6/211 (3%)
 Frame = +3

Query  42   MDIHVGDEELSHNNVVVSEKVPLLVPDEVEKNLVQKAISQTFQSAAHLANLLPTGAVLAF  221
            M + +  EE       + E +P+    ++ K   QKA+ +TF+  AHLA LLPTG+VLAF
Sbjct  1    MAMKMVSEEFQTQTTPLLENLPI---QKLPKTPAQKAVRKTFKGTAHLAKLLPTGSVLAF  57

Query  222  QLLSPIFSNQGDCDAV-SRFLTASLVAMCGLSCFLLSFTDSFKDQKGNVCYGVATVKGLW  398
            Q+LSPI ++QG C  + S+ LT  L+ +C  SCFLL FTDSF+D++G V YG+AT KGLW
Sbjct  58   QILSPIMTHQGQCRTITSKSLTLGLLTLCSFSCFLLCFTDSFRDERGKVRYGMATFKGLW  117

Query  399  VIDGS--ASLPPELAAKYKVKFIDFVHAVMSVLVFGAIALFDQNVVSCFXPXPXXEXXXI  572
            V+DGS  A L PE AA YK++F D  HA+MS++VFGA+ALFD+NVVSCF P P  E   +
Sbjct  118  VMDGSSPAKLSPEEAANYKLRFFDLFHALMSMVVFGAVALFDKNVVSCFFPTPTEEVQDL  177

Query  573  LPXVPVGXGXVCXXLFVVFPPXXXGIGFPXT  665
            L  VPV  G +C  LF+ FP    GIG P +
Sbjct  178  LVVVPVAIGAICSVLFLAFPSKRHGIGAPLS  208



>ref|XP_008455952.1| PREDICTED: uncharacterized protein LOC103496014 [Cucumis melo]
Length=219

 Score =   214 bits (544),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 104/179 (58%), Positives = 128/179 (72%), Gaps = 1/179 (1%)
 Frame = +3

Query  132  KNLVQKAISQTFQSAAHLANLLPTGAVLAFQLLSPIFSNQGDCDA-VSRFLTASLVAMCG  308
            K   QKAI +TF+  AHLANLLPTG VL FQ+LSPIF++QG C+  VS+  T  LV +C 
Sbjct  39   KTSAQKAIRKTFKGTAHLANLLPTGTVLGFQILSPIFTHQGHCNTHVSQTTTLGLVLVCA  98

Query  309  LSCFLLSFTDSFKDQKGNVCYGVATVKGLWVIDGSASLPPELAAKYKVKFIDFVHAVMSV  488
             SCF L FTDSF+D +G V YGVAT +GLWVIDGS +LP E AAKY+++FIDF HA  S+
Sbjct  99   FSCFFLLFTDSFRDGRGKVRYGVATFQGLWVIDGSVTLPKEEAAKYRLRFIDFFHAFASL  158

Query  489  LVFGAIALFDQNVVSCFXPXPXXEXXXILPXVPVGXGXVCXXLFVVFPPXXXGIGFPXT  665
            LVF A+ALFD+NVV C  P P  E   +L  +PVG G +C  LF+VFP    G+GFP +
Sbjct  159  LVFIAVALFDENVVKCLYPTPSDELRELLVVLPVGIGVLCSCLFIVFPTKRHGVGFPLS  217



>ref|XP_011043659.1| PREDICTED: uncharacterized protein LOC105139057 [Populus euphratica]
Length=207

 Score =   213 bits (542),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 102/182 (56%), Positives = 131/182 (72%), Gaps = 1/182 (1%)
 Frame = +3

Query  129  EKNLVQKAISQTFQSAAHLANLLPTGAVLAFQLLSPIFSNQGDCDAV-SRFLTASLVAMC  305
            EK   QKAI +TF+  AHLA LLPTG+VL FQ+LSPI +++G C +V S+ LT+ L+A+C
Sbjct  26   EKTPGQKAIRKTFKGTAHLARLLPTGSVLTFQILSPILTHEGQCRSVTSQTLTSGLLAVC  85

Query  306  GLSCFLLSFTDSFKDQKGNVCYGVATVKGLWVIDGSASLPPELAAKYKVKFIDFVHAVMS  485
            GL+CFLL FTDSF+D +G V YG+ T KGLW+ID +  L PE AAKYK+KFID +HA MS
Sbjct  86   GLACFLLCFTDSFRDARGKVRYGMVTFKGLWIIDATVELSPEEAAKYKLKFIDVLHAFMS  145

Query  486  VLVFGAIALFDQNVVSCFXPXPXXEXXXILPXVPVGXGXVCXXLFVVFPPXXXGIGFPXT  665
            +LVF A++LFD+NVV CF P P  E   +L  VP   G +C  LF+ FP    GIGFP +
Sbjct  146  ILVFAAVSLFDKNVVKCFFPAPTDEAKDLLIVVPATIGVLCSILFLAFPSKRHGIGFPLS  205

Query  666  XD  671
             +
Sbjct  206  RN  207



>ref|XP_009589871.1| PREDICTED: uncharacterized protein LOC104087172 [Nicotiana tomentosiformis]
Length=216

 Score =   213 bits (542),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 104/208 (50%), Positives = 144/208 (69%), Gaps = 9/208 (4%)
 Frame = +3

Query  63   EELSHNNVVVSE---KVPLLVPDEV----EKNLVQKAISQTFQSAAHLANLLPTGAVLAF  221
            ++L   NVV SE   ++PLL  +E+    +K   QK I +TF+  A LANLLP+G+VLAF
Sbjct  5    KKLGTENVVASENQLEIPLLEDEEIVEKPKKTPAQKVIRKTFKKTAILANLLPSGSVLAF  64

Query  222  QLLSPIFSNQGDC-DAVSRFLTASLVAMCGLSCFLLSFTDSFKDQKGNVCYGVATVKGLW  398
            Q+LSP+ +++G C  ++S  +T  L+  C +SCF L+FTDSF+D++G V YG+AT +GLW
Sbjct  65   QILSPVITHEGQCHSSISHSMTLGLLVFCAISCFFLNFTDSFRDERGKVRYGLATFRGLW  124

Query  399  VIDGSA-SLPPELAAKYKVKFIDFVHAVMSVLVFGAIALFDQNVVSCFXPXPXXEXXXIL  575
            +IDGS  ++PPE A KYK+KF+D  HA++S+LVFGA+A FDQNV+ C  P P  E   IL
Sbjct  125  IIDGSNITIPPEEATKYKLKFLDVFHALLSILVFGAVAAFDQNVIKCLYPSPPPETQEIL  184

Query  576  PXVPVGXGXVCXXLFVVFPPXXXGIGFP  659
              +P+  G +C  LFV FP    GIGFP
Sbjct  185  ATLPMAVGVICTLLFVAFPTTRHGIGFP  212



>ref|XP_004505628.1| PREDICTED: uncharacterized protein LOC101497875 [Cicer arietinum]
Length=201

 Score =   210 bits (534),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 104/213 (49%), Positives = 137/213 (64%), Gaps = 15/213 (7%)
 Frame = +3

Query  42   MDIHVGDEELSHNNVVVSEKVPLL--VPDEVEKNLVQKAISQTFQSAAHLANLLPTGAVL  215
            MDIHV  ++            PLL   P ++ K   QK I +TF+  A+LANLLPTG VL
Sbjct  1    MDIHVDTQQ------------PLLENSPQKIPKTTTQKTIRKTFKGTAYLANLLPTGTVL  48

Query  216  AFQLLSPIFSNQGDCDAV-SRFLTASLVAMCGLSCFLLSFTDSFKDQKGNVCYGVATVKG  392
             FQ LSP  +++G C  + S+ +T  L+  C +SCFLLSFTDS +D++G V YGVAT+ G
Sbjct  49   IFQTLSPALTHKGQCHTITSKIMTIGLLTFCSISCFLLSFTDSIRDERGKVRYGVATLNG  108

Query  393  LWVIDGSASLPPELAAKYKVKFIDFVHAVMSVLVFGAIALFDQNVVSCFXPXPXXEXXXI  572
            +WV+DGS  L  E A KYK++F+D  HA  S+LVFGAIALFDQ+VV+C  P P  E   +
Sbjct  109  IWVMDGSIKLQGEEANKYKLRFLDLFHACGSILVFGAIALFDQSVVTCLAPNPSEEAKEL  168

Query  573  LPXVPVGXGXVCXXLFVVFPPXXXGIGFPXTXD  671
            L  VP+G G +C  LF+ FP    GIGFP + +
Sbjct  169  LAVVPIGIGILCSVLFLAFPTQRHGIGFPLSRN  201



>ref|XP_007132680.1| hypothetical protein PHAVU_011G115500g [Phaseolus vulgaris]
 gb|ESW04674.1| hypothetical protein PHAVU_011G115500g [Phaseolus vulgaris]
Length=202

 Score =   210 bits (534),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 101/198 (51%), Positives = 135/198 (68%), Gaps = 4/198 (2%)
 Frame = +3

Query  90   VSEKVPLL---VPDEVEKNLVQKAISQTFQSAAHLANLLPTGAVLAFQLLSPIFSNQGDC  260
            VS   PLL   +P +  K   QK + + F+  AHL+ LLPTG VL FQ LSP+ ++QG C
Sbjct  5    VSTLQPLLENVLPHKTTKTPAQKTMRKAFKGTAHLSKLLPTGTVLIFQTLSPLLTHQGQC  64

Query  261  DAVS-RFLTASLVAMCGLSCFLLSFTDSFKDQKGNVCYGVATVKGLWVIDGSASLPPELA  437
              ++ + +T  L+ +C +SCFLLSFTDSF+D++G V YGVA++ G+WV+D S  LP + A
Sbjct  65   QTITNKAMTIGLLTLCSISCFLLSFTDSFRDERGKVRYGVASMNGIWVMDASVRLPADEA  124

Query  438  AKYKVKFIDFVHAVMSVLVFGAIALFDQNVVSCFXPXPXXEXXXILPXVPVGXGXVCXXL  617
             KY+++FIDF+HA MS+LVF AIALFD +VVSCF P P  +   +L  +PVG G VC  L
Sbjct  125  EKYRLRFIDFIHAFMSILVFMAIALFDGSVVSCFVPKPSEDAKELLMVLPVGIGLVCSLL  184

Query  618  FVVFPPXXXGIGFPXTXD  671
            FV FP    GIGFP + D
Sbjct  185  FVAFPGQRHGIGFPLSRD  202



>ref|XP_003566981.1| PREDICTED: uncharacterized protein LOC100827369 [Brachypodium 
distachyon]
Length=208

 Score =   209 bits (533),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 96/175 (55%), Positives = 122/175 (70%), Gaps = 0/175 (0%)
 Frame = +3

Query  141  VQKAISQTFQSAAHLANLLPTGAVLAFQLLSPIFSNQGDCDAVSRFLTASLVAMCGLSCF  320
             QKA  +T+QS  HL+ LLPTG VLAFQLL+PIF+  G C   ++ +T  LV +C LSC 
Sbjct  32   TQKAFRRTYQSTEHLSKLLPTGTVLAFQLLAPIFAKHGHCSNANQMMTGGLVVLCALSCV  91

Query  321  LLSFTDSFKDQKGNVCYGVATVKGLWVIDGSASLPPELAAKYKVKFIDFVHAVMSVLVFG  500
            +LSFTDSF+D++G V YG AT KGLWVIDG ASL P  A +YK++F+DFVHA +S ++F 
Sbjct  92   VLSFTDSFRDEQGKVRYGFATFKGLWVIDGGASLDPNAAVEYKIQFLDFVHATVSAMIFV  151

Query  501  AIALFDQNVVSCFXPXPXXEXXXILPXVPVGXGXVCXXLFVVFPPXXXGIGFPXT  665
            AIALFDQNV SCF P P  +   +L  +P+  G +   LFV FP    GIGFP +
Sbjct  152  AIALFDQNVASCFYPIPSEDTKQVLKTLPIAIGVIGSMLFVTFPTTRHGIGFPVS  206



>gb|AAU10653.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAG93162.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC79697.1| hypothetical protein OsI_20986 [Oryza sativa Indica Group]
Length=238

 Score =   210 bits (535),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 105/178 (59%), Positives = 127/178 (71%), Gaps = 3/178 (2%)
 Frame = +3

Query  141  VQKAISQTFQSAAHLANLLPTGAVLAFQLLSPIFSNQGDCD-AVSRFLTASLVAMCGLSC  317
            VQ+AISQT+QS AHLA LLPTG VLAFQLLSPI +NQG CD   +R +  +L+A+C LSC
Sbjct  59   VQRAISQTYQSTAHLAKLLPTGTVLAFQLLSPIVTNQGHCDVEANRAMAGALIALCALSC  118

Query  318  FLLSFTDSFKDQK--GNVCYGVATVKGLWVIDGSASLPPELAAKYKVKFIDFVHAVMSVL  491
            F+LSFTDSF+D    G V YG AT  GLWVIDG A L P+ AA Y+++ +D VHAV+SV+
Sbjct  119  FVLSFTDSFRDAATGGAVRYGFATPAGLWVIDGGAPLDPQAAAAYRLRLLDLVHAVVSVM  178

Query  492  VFGAIALFDQNVVSCFXPXPXXEXXXILPXVPVGXGXVCXXLFVVFPPXXXGIGFPXT  665
            VF A+ALFDQNVVSCF P P      +L  +P+  G V   LFV FP    GIGFP +
Sbjct  179  VFAAVALFDQNVVSCFYPVPSEGTRQVLTALPIAIGVVGSMLFVSFPTTRHGIGFPLS  236



>ref|XP_006446706.1| hypothetical protein CICLE_v10017623mg [Citrus clementina]
 gb|ESR59946.1| hypothetical protein CICLE_v10017623mg [Citrus clementina]
Length=204

 Score =   209 bits (532),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 99/182 (54%), Positives = 127/182 (70%), Gaps = 1/182 (1%)
 Frame = +3

Query  123  EVEKNLVQKAISQTFQSAAHLANLLPTGAVLAFQLLSPIFSNQGDC-DAVSRFLTASLVA  299
            + +K   QKAI +TF+  AHLA LLPTG+VL FQ+LSPI ++QG C    SR +T  L+A
Sbjct  21   KAQKTPAQKAIRKTFKGTAHLARLLPTGSVLTFQILSPILTHQGRCPTHASRVITLGLLA  80

Query  300  MCGLSCFLLSFTDSFKDQKGNVCYGVATVKGLWVIDGSASLPPELAAKYKVKFIDFVHAV  479
            +CG+SCF+L  TDSF+D++G V YG+AT +GLWVID S  L PE  A+Y++KFID  HA 
Sbjct  81   LCGVSCFILRLTDSFRDERGKVRYGLATFRGLWVIDTSLKLAPEEKAQYQLKFIDLFHAF  140

Query  480  MSVLVFGAIALFDQNVVSCFXPXPXXEXXXILPXVPVGXGXVCXXLFVVFPPXXXGIGFP  659
             S+LVF  IALFD+NVV+CF P P  E   +L  VP+G G  C  LFV+FP    GIG P
Sbjct  141  ASILVFATIALFDKNVVNCFFPTPSEETKELLIRVPIGIGIACSILFVLFPSKRHGIGCP  200

Query  660  XT  665
             +
Sbjct  201  LS  202



>ref|XP_009785080.1| PREDICTED: uncharacterized protein LOC104233393 [Nicotiana sylvestris]
Length=216

 Score =   209 bits (531),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 102/209 (49%), Positives = 144/209 (69%), Gaps = 9/209 (4%)
 Frame = +3

Query  66   ELSHNNVVVSE---KVPLL----VPDEVEKNLVQKAISQTFQSAAHLANLLPTGAVLAFQ  224
            +L   NVV SE   ++PLL    + ++ +K   QK I +TF+  A LANLLP+G+VLAFQ
Sbjct  6    KLGTENVVASENQLEIPLLEDELIVEKPKKTPAQKVIRKTFKKTAILANLLPSGSVLAFQ  65

Query  225  LLSPIFSNQGDC-DAVSRFLTASLVAMCGLSCFLLSFTDSFKDQKGNVCYGVATVKGLWV  401
            +LSP+ +++G C  ++S  +T  L+A C +SCF L+FTDSF+D++G V YG+AT +GLW+
Sbjct  66   ILSPVITHEGQCHSSISHSMTLGLLAFCAISCFFLNFTDSFRDERGKVRYGLATFRGLWI  125

Query  402  IDGSASL-PPELAAKYKVKFIDFVHAVMSVLVFGAIALFDQNVVSCFXPXPXXEXXXILP  578
            IDGS  + PPE A KYK++F+D  HA++S+LVFGA+A FDQNV+ C  P P  E   +L 
Sbjct  126  IDGSNIIIPPEEATKYKLRFLDVFHALLSILVFGAVAAFDQNVIKCLYPSPSPETQEVLA  185

Query  579  XVPVGXGXVCXXLFVVFPPXXXGIGFPXT  665
             +P+  G +C  LFV FP    GIGFP +
Sbjct  186  ILPMAVGVICTLLFVAFPTTRHGIGFPLS  214



>ref|XP_004252030.1| PREDICTED: uncharacterized protein LOC101254876 [Solanum lycopersicum]
Length=225

 Score =   208 bits (529),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 104/214 (49%), Positives = 145/214 (68%), Gaps = 10/214 (5%)
 Frame = +3

Query  48   IHVGDEELSHNNVVVSE---KVPLL----VPDEVEKNLVQKAISQTFQSAAHLANLLPTG  206
            + +  E+L   +VV SE   ++PLL    V D+ +K   QK I +TF+  A L+NLLP+G
Sbjct  12   VAINTEKLETKSVVTSENQLEIPLLEDLQVADKPQKTAAQKVIRKTFKKTAVLSNLLPSG  71

Query  207  AVLAFQLLSPIFSNQGDCDA-VSRFLTASLVAMCGLSCFLLSFTDSFKDQKGNVCYGVAT  383
            +VLAFQ+LSP+ +++G C + +S  +T  L+ +C +SCF L FTDSF+D++G V YG+AT
Sbjct  72   SVLAFQILSPVITHEGQCRSTISHSMTLILLGICAISCFFLCFTDSFRDERGKVRYGLAT  131

Query  384  VKGLWVIDGSASLPPELAAKYKVKFIDFVHAVMSVLVFGAIALFDQNVVSCFXPXPXXEX  563
             +GLW+IDGS+  PPE   KYK+KFIDF HA +S+LVF A+A FDQNV+ C  P P  + 
Sbjct  132  FRGLWIIDGSS--PPEDVEKYKLKFIDFFHAFLSILVFCAVAAFDQNVMKCLYPSPSLDA  189

Query  564  XXILPXVPVGXGXVCXXLFVVFPPXXXGIGFPXT  665
              IL  +P+  G +C  LFVVFP    GIGFP +
Sbjct  190  QEILAILPMVVGVICTFLFVVFPTTRHGIGFPLS  223



>ref|XP_003607515.1| hypothetical protein MTR_4g078870 [Medicago truncatula]
 gb|AES89712.1| DUF679 domain membrane protein [Medicago truncatula]
Length=205

 Score =   207 bits (526),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 100/213 (47%), Positives = 137/213 (64%), Gaps = 11/213 (5%)
 Frame = +3

Query  42   MDIHVGDEELSHNNVVVSEKVPLL--VPDEVEKNLVQKAISQTFQSAAHLANLLPTGAVL  215
            MD+HV        +    ++ PLL   P ++ K   QK I + F+  A+LANLLPTG VL
Sbjct  1    MDVHV--------DTQQQQEQPLLENSPQKIPKTTTQKTIRKAFKGTAYLANLLPTGTVL  52

Query  216  AFQLLSPIFSNQGDCDA-VSRFLTASLVAMCGLSCFLLSFTDSFKDQKGNVCYGVATVKG  392
             FQ LSP  +++G+C    S+ +T   +  C LSCFLLSFTDSF+D++G V YGVAT+ G
Sbjct  53   IFQTLSPALTHRGNCHTQTSKIMTMIFLTFCSLSCFLLSFTDSFRDERGKVRYGVATLNG  112

Query  393  LWVIDGSASLPPELAAKYKVKFIDFVHAVMSVLVFGAIALFDQNVVSCFXPXPXXEXXXI  572
            +W++DG   +P E   KYK++FID  HA  S+LVFGAIA+FDQ+VVSC  P P  E   +
Sbjct  113  IWIMDGRIRIPAEEGVKYKLRFIDLFHACGSILVFGAIAMFDQSVVSCLAPKPSEEAKEL  172

Query  573  LPXVPVGXGXVCXXLFVVFPPXXXGIGFPXTXD  671
            L  +P+G G +C  LF++FP    GIGFP + +
Sbjct  173  LVALPIGIGILCSVLFLLFPTQRHGIGFPLSRN  205



>ref|XP_004969493.1| PREDICTED: uncharacterized protein LOC101760980 [Setaria italica]
Length=207

 Score =   206 bits (523),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 103/200 (52%), Positives = 133/200 (67%), Gaps = 7/200 (4%)
 Frame = +3

Query  60   DEELSHNNVVVSEKVPLLVPDEVEKNL--VQKAISQTFQSAAHLANLLPTGAVLAFQLLS  233
            + EL HN     + +PLL       N+  ++KAI QT+QS  HLA LLP+G VL+FQLL 
Sbjct  7    NAELQHN-----QSLPLLSNRADGNNMSPMRKAIGQTYQSTGHLAKLLPSGTVLSFQLLV  61

Query  234  PIFSNQGDCDAVSRFLTASLVAMCGLSCFLLSFTDSFKDQKGNVCYGVATVKGLWVIDGS  413
            P  + QG C  ++R +T  LV +C LSCF+LSFTDSF+D +G V YG AT KGLWVIDG 
Sbjct  62   PTLAKQGHCGDMNRVMTGGLVVLCALSCFVLSFTDSFRDVEGKVRYGFATFKGLWVIDGG  121

Query  414  ASLPPELAAKYKVKFIDFVHAVMSVLVFGAIALFDQNVVSCFXPXPXXEXXXILPXVPVG  593
            A L P  AA+Y+++F+DFVHA++S ++F AIALFDQNVVSCF P P  +   +L  +PV 
Sbjct  122  APLEPLAAAEYRMRFLDFVHAIVSAMIFVAIALFDQNVVSCFYPIPSEDAKQLLTALPVV  181

Query  594  XGXVCXXLFVVFPPXXXGIG  653
             G +   LFV FP     IG
Sbjct  182  IGVIGSMLFVSFPTTRHSIG  201



>ref|XP_008656733.1| PREDICTED: uncharacterized protein LOC103636163 [Zea mays]
Length=213

 Score =   206 bits (523),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 102/201 (51%), Positives = 134/201 (67%), Gaps = 8/201 (4%)
 Frame = +3

Query  60   DEELSHNNVVVSEKVPLLVPDEVEKNLV---QKAISQTFQSAAHLANLLPTGAVLAFQLL  230
            D EL HN     E+ PLL       N +   QKAI QT+QS AHLA LLP+G VL+FQ+L
Sbjct  12   DAELQHN-----ERRPLLTNRADGNNNMSPMQKAIGQTYQSTAHLAKLLPSGTVLSFQIL  66

Query  231  SPIFSNQGDCDAVSRFLTASLVAMCGLSCFLLSFTDSFKDQKGNVCYGVATVKGLWVIDG  410
            +P  + QG C  ++R +T  LV +C LSC +LSFTDSF+D++G V +G AT +GLWVIDG
Sbjct  67   APTLAKQGHCSDMNRMMTGGLVVLCALSCCVLSFTDSFRDEEGKVRFGFATPRGLWVIDG  126

Query  411  SASLPPELAAKYKVKFIDFVHAVMSVLVFGAIALFDQNVVSCFXPXPXXEXXXILPXVPV  590
             A L P  AA ++++F+DFVHA++S ++F AIALFDQ+VVSCF P P  +   +L  +PV
Sbjct  127  GAPLDPLGAAGFRMRFLDFVHAIVSAMIFVAIALFDQHVVSCFYPTPSEDTKQLLTALPV  186

Query  591  GXGXVCXXLFVVFPPXXXGIG  653
            G G +   LFV FP     IG
Sbjct  187  GIGIIGSMLFVSFPTTRHSIG  207



>gb|AFW83516.1| hypothetical protein ZEAMMB73_128939 [Zea mays]
Length=208

 Score =   205 bits (522),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 102/201 (51%), Positives = 134/201 (67%), Gaps = 8/201 (4%)
 Frame = +3

Query  60   DEELSHNNVVVSEKVPLLVPDEVEKNLV---QKAISQTFQSAAHLANLLPTGAVLAFQLL  230
            D EL HN     E+ PLL       N +   QKAI QT+QS AHLA LLP+G VL+FQ+L
Sbjct  7    DAELQHN-----ERRPLLTNRADGNNNMSPMQKAIGQTYQSTAHLAKLLPSGTVLSFQIL  61

Query  231  SPIFSNQGDCDAVSRFLTASLVAMCGLSCFLLSFTDSFKDQKGNVCYGVATVKGLWVIDG  410
            +P  + QG C  ++R +T  LV +C LSC +LSFTDSF+D++G V +G AT +GLWVIDG
Sbjct  62   APTLAKQGHCSDMNRMMTGGLVVLCALSCCVLSFTDSFRDEEGKVRFGFATPRGLWVIDG  121

Query  411  SASLPPELAAKYKVKFIDFVHAVMSVLVFGAIALFDQNVVSCFXPXPXXEXXXILPXVPV  590
             A L P  AA ++++F+DFVHA++S ++F AIALFDQ+VVSCF P P  +   +L  +PV
Sbjct  122  GAPLDPLGAAGFRMRFLDFVHAIVSAMIFVAIALFDQHVVSCFYPTPSEDTKQLLTALPV  181

Query  591  GXGXVCXXLFVVFPPXXXGIG  653
            G G +   LFV FP     IG
Sbjct  182  GIGIIGSMLFVSFPTTRHSIG  202



>ref|XP_008359069.1| PREDICTED: uncharacterized protein LOC103422787 [Malus domestica]
Length=218

 Score =   206 bits (523),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 99/180 (55%), Positives = 125/180 (69%), Gaps = 2/180 (1%)
 Frame = +3

Query  132  KNLVQKAISQTFQSAAHLANLLPTGAVLAFQLLSPIFSNQGDCDAV-SRFLTASLVAMCG  308
            K   +KAI +TF+   HL+NLLPTG VL FQ+ SP F+ QG C AV ++ +T  L+  C 
Sbjct  37   KTPARKAIRKTFKGTXHLSNLLPTGTVLVFQMFSPAFTRQGKCPAVLNQTMTVLLLTFCS  96

Query  309  LSCFLLSFTDSFKDQKGNVCYGVATVKGLWVIDGSA-SLPPELAAKYKVKFIDFVHAVMS  485
            L+CFL+ FTDS +D++G V YG+AT KGLW++DGS  +L PE A KY+VKF DF HA MS
Sbjct  97   LTCFLMRFTDSLRDERGKVRYGLATSKGLWILDGSKITLAPEEADKYRVKFRDFFHAFMS  156

Query  486  VLVFGAIALFDQNVVSCFXPXPXXEXXXILPXVPVGXGXVCXXLFVVFPPXXXGIGFPXT  665
            VLVF A+A+FDQNVV+CF P P  E   +L   PVG G  C  LFV+FP    GIGFP +
Sbjct  157  VLVFAAVAMFDQNVVNCFYPKPSEEARQLLVAFPVGMGIACSLLFVLFPSRRHGIGFPLS  216



>dbj|BAJ97707.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=251

 Score =   206 bits (524),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 105/175 (60%), Positives = 131/175 (75%), Gaps = 0/175 (0%)
 Frame = +3

Query  141  VQKAISQTFQSAAHLANLLPTGAVLAFQLLSPIFSNQGDCDAVSRFLTASLVAMCGLSCF  320
            +Q+AISQT+QS AHLA LLPTG VLAFQLLSPI ++QG C   +R + A+LVA+CG+SCF
Sbjct  75   MQRAISQTYQSTAHLATLLPTGTVLAFQLLSPIVTDQGHCVRANRAMAAALVALCGISCF  134

Query  321  LLSFTDSFKDQKGNVCYGVATVKGLWVIDGSASLPPELAAKYKVKFIDFVHAVMSVLVFG  500
             LSFTDSF+D KG V YG AT +GLWVIDG A + P+ AA Y+++FIDFVHAV++V+VF 
Sbjct  135  ALSFTDSFRDAKGAVRYGFATRRGLWVIDGGAPIDPQAAATYRLRFIDFVHAVVTVMVFV  194

Query  501  AIALFDQNVVSCFXPXPXXEXXXILPXVPVGXGXVCXXLFVVFPPXXXGIGFPXT  665
            A+ALFD NVVSCF P P  +   +L  +P+  G V   LFV FP    GIGFP +
Sbjct  195  AVALFDHNVVSCFYPVPSEDAAQVLTVLPIAIGVVGSMLFVTFPTTRHGIGFPLS  249



>ref|XP_010686397.1| PREDICTED: uncharacterized protein LOC104900622 [Beta vulgaris 
subsp. vulgaris]
Length=213

 Score =   205 bits (521),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 97/202 (48%), Positives = 134/202 (66%), Gaps = 4/202 (2%)
 Frame = +3

Query  63   EELSHNNVVVSEKVPLLVPDE----VEKNLVQKAISQTFQSAAHLANLLPTGAVLAFQLL  230
            E+ + +   VS + P L  +E    +++N   + +SQT QS  +LANLLPTGA+L F LL
Sbjct  7    EQANQDQEEVSNEEPFLQDEEQDIVLKRNGSHEFLSQTLQSTTNLANLLPTGAILTFHLL  66

Query  231  SPIFSNQGDCDAVSRFLTASLVAMCGLSCFLLSFTDSFKDQKGNVCYGVATVKGLWVIDG  410
             P F++QGDCD V+  +T +L+A+C  + F+L+FTDSFKD+ GNV YG AT  GLW++D 
Sbjct  67   VPAFTDQGDCDYVNHLMTTTLLALCASAVFILNFTDSFKDRCGNVSYGFATFNGLWLVDS  126

Query  411  SASLPPELAAKYKVKFIDFVHAVMSVLVFGAIALFDQNVVSCFXPXPXXEXXXILPXVPV  590
            S SLPP LA++Y+++ +DFVH   SVLVF AIAL + N V C+ P P  +   IL  +PV
Sbjct  127  STSLPPRLASRYRLRVLDFVHGFTSVLVFTAIALSENNTVKCYFPAPSRDLQQILTALPV  186

Query  591  GXGXVCXXLFVVFPPXXXGIGF  656
            G G     LFV+FP    GIG+
Sbjct  187  GIGVASSFLFVLFPTQRHGIGY  208



>ref|XP_009371494.1| PREDICTED: uncharacterized protein LOC103960740 [Pyrus x bretschneideri]
Length=220

 Score =   205 bits (521),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 98/180 (54%), Positives = 126/180 (70%), Gaps = 2/180 (1%)
 Frame = +3

Query  132  KNLVQKAISQTFQSAAHLANLLPTGAVLAFQLLSPIFSNQGDCDAV-SRFLTASLVAMCG  308
            K   +KAI +TF+  AHL+NLLPTG VL FQ+ SP F+ QG C AV ++ +T  L+  C 
Sbjct  39   KTPARKAIRKTFKGTAHLSNLLPTGTVLVFQMFSPAFTRQGKCPAVLNQTMTVLLLTFCS  98

Query  309  LSCFLLSFTDSFKDQKGNVCYGVATVKGLWVIDGSA-SLPPELAAKYKVKFIDFVHAVMS  485
            L+CFL+ FTDS +D++G V YG+AT KGLW++DGS  +L PE A KY+VKF DF HA MS
Sbjct  99   LTCFLMRFTDSLRDERGKVQYGLATSKGLWILDGSKITLAPEEADKYRVKFRDFFHAFMS  158

Query  486  VLVFGAIALFDQNVVSCFXPXPXXEXXXILPXVPVGXGXVCXXLFVVFPPXXXGIGFPXT  665
            VLVF A+A+FD+NVV+CF P P  E   +L   PVG G  C  LF++FP    GIGFP +
Sbjct  159  VLVFAAVAMFDKNVVNCFYPKPSEEARQLLVAFPVGMGIACSLLFLLFPSRRHGIGFPLS  218



>ref|XP_006352030.1| PREDICTED: uncharacterized protein LOC102584291 [Solanum tuberosum]
Length=223

 Score =   204 bits (520),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 103/214 (48%), Positives = 145/214 (68%), Gaps = 10/214 (5%)
 Frame = +3

Query  48   IHVGDEELSHNNVVVSE---KVPLL----VPDEVEKNLVQKAISQTFQSAAHLANLLPTG  206
            + +  E+L   + V SE   ++PLL    + D+ +K   QK I +TF+  A L+NLLP+G
Sbjct  10   VAINTEKLGTESAVTSENQLEIPLLEDLQLVDKPQKTPAQKVIRKTFKKTAILSNLLPSG  69

Query  207  AVLAFQLLSPIFSNQGDC-DAVSRFLTASLVAMCGLSCFLLSFTDSFKDQKGNVCYGVAT  383
            +VLAFQ+LSP+ +++G C  ++S  +T  L+ +C +SCF L FTDSF+D++G V YG+AT
Sbjct  70   SVLAFQILSPVITHEGQCHSSISHSMTLILLGICAISCFFLCFTDSFRDERGKVRYGLAT  129

Query  384  VKGLWVIDGSASLPPELAAKYKVKFIDFVHAVMSVLVFGAIALFDQNVVSCFXPXPXXEX  563
             +GLW+IDGS+  PPE AA YK+KFIDF HA +S+LVF A+A FDQNV+ C  P P  + 
Sbjct  130  FRGLWIIDGSS--PPEDAAIYKMKFIDFFHAFLSILVFCAVAAFDQNVMKCLYPSPSPDA  187

Query  564  XXILPXVPVGXGXVCXXLFVVFPPXXXGIGFPXT  665
              IL  +P+  G +C  LFVVFP    GIGFP +
Sbjct  188  QEILAILPMAVGVICTFLFVVFPTTRHGIGFPLS  221



>ref|XP_004961228.1| PREDICTED: uncharacterized protein LOC101778359 [Setaria italica]
Length=226

 Score =   204 bits (520),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 103/174 (59%), Positives = 129/174 (74%), Gaps = 1/174 (1%)
 Frame = +3

Query  141  VQKAISQTFQSAAHLANLLPTGAVLAFQLLSPIFSNQGDCDAVSRFLTASLVAMCGLSCF  320
            +Q+AISQT+QS AHLA LLPTG VLAFQLLSPI ++QG C   +R +  +L+A+C LSCF
Sbjct  49   IQRAISQTYQSTAHLATLLPTGTVLAFQLLSPIVTDQGHCVRANRAMAGALLALCALSCF  108

Query  321  LLSFTDSFKDQKGNVCYGVATVKGLWVIDGSASLP-PELAAKYKVKFIDFVHAVMSVLVF  497
            +LSFTDSF+D  G V YG AT++GLWVIDG A L  P  AA Y+V+F+D+VHAV+SV++F
Sbjct  109  VLSFTDSFRDATGAVRYGFATLRGLWVIDGGAPLEDPRAAAAYRVRFLDWVHAVVSVMIF  168

Query  498  GAIALFDQNVVSCFXPXPXXEXXXILPXVPVGXGXVCXXLFVVFPPXXXGIGFP  659
             A+ALFDQNVVSCF P P  +   +L  +P+  G V   LFV FP    GIGFP
Sbjct  169  AAVALFDQNVVSCFYPVPSEDARQVLTVLPIAIGVVGSMLFVTFPTTRHGIGFP  222



>gb|KJB66781.1| hypothetical protein B456_010G158000 [Gossypium raimondii]
Length=212

 Score =   204 bits (519),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 112/173 (65%), Positives = 133/173 (77%), Gaps = 7/173 (4%)
 Frame = +3

Query  42   MDIHVGDEELSHNNVVVSEKVPLL-----VPDEVEKNLVQKAISQTFQSAAHLANLLPTG  206
            M+I V +EE SH      EK PLL     +     K L+Q AISQTFQS AHLANLLPTG
Sbjct  1    MEIKVEEEE-SHREQG-EEKQPLLQYLSRLSQTENKTLIQTAISQTFQSTAHLANLLPTG  58

Query  207  AVLAFQLLSPIFSNQGDCDAVSRFLTASLVAMCGLSCFLLSFTDSFKDQKGNVCYGVATV  386
             VLAFQLLSPIF+NQG+CD+  R +TA+L+ +CGLSC L SFTDSF+D+ GNVCYG AT+
Sbjct  59   TVLAFQLLSPIFTNQGNCDSTCRSMTAALLLLCGLSCLLSSFTDSFRDKDGNVCYGFATL  118

Query  387  KGLWVIDGSASLPPELAAKYKVKFIDFVHAVMSVLVFGAIALFDQNVVSCFXP  545
             GLWVIDGS S PPE AAKY+++ IDF+HA MS+LVF A+ALFDQNVV+CF P
Sbjct  119  NGLWVIDGSVSAPPEFAAKYRLRSIDFMHAFMSMLVFAAVALFDQNVVTCFYP  171



>ref|XP_004305429.2| PREDICTED: uncharacterized protein LOC101293416 [Fragaria vesca 
subsp. vesca]
Length=226

 Score =   204 bits (519),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 102/177 (58%), Positives = 124/177 (70%), Gaps = 1/177 (1%)
 Frame = +3

Query  132  KNLVQKAISQTFQSAAHLANLLPTGAVLAFQLLSPIFSNQGDCDAVSRF-LTASLVAMCG  308
            K   QKA+ +TF+  AHLANLLPTG VL FQ+ SP F+ QG C  V+   +T SL+  C 
Sbjct  46   KTPAQKAMRKTFKGTAHLANLLPTGTVLTFQMFSPAFTYQGKCPTVANHTMTISLLIFCS  105

Query  309  LSCFLLSFTDSFKDQKGNVCYGVATVKGLWVIDGSASLPPELAAKYKVKFIDFVHAVMSV  488
            +S FLL FTDS +D++G V YG+AT KGL+V+DGS  +  E  AKYK+ FIDF HA MSV
Sbjct  106  VSSFLLCFTDSIRDERGKVRYGLATFKGLFVLDGSYKIRVEDVAKYKLTFIDFFHAFMSV  165

Query  489  LVFGAIALFDQNVVSCFXPXPXXEXXXILPXVPVGXGXVCXXLFVVFPPXXXGIGFP  659
            LVFGA+ALFDQN+V+CF P P  E   +L  VPVG G VC  LFV+FP    GIGFP
Sbjct  166  LVFGAVALFDQNIVNCFYPQPSEEGKQLLFAVPVGVGVVCSILFVLFPTRRHGIGFP  222



>gb|EMS57393.1| hypothetical protein TRIUR3_27181 [Triticum urartu]
Length=200

 Score =   203 bits (517),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 108/193 (56%), Positives = 137/193 (71%), Gaps = 2/193 (1%)
 Frame = +3

Query  93   SEKVPLLVPDEVEKNL--VQKAISQTFQSAAHLANLLPTGAVLAFQLLSPIFSNQGDCDA  266
            +E +P  V D+    L  +Q+AISQT+QS AHLA LLPTG V+AFQLLSPI ++QG C  
Sbjct  6    NEVLPPAVRDDPGDGLSPMQRAISQTYQSTAHLATLLPTGTVMAFQLLSPIVTDQGHCVR  65

Query  267  VSRFLTASLVAMCGLSCFLLSFTDSFKDQKGNVCYGVATVKGLWVIDGSASLPPELAAKY  446
             +R +  +LVA+CGLSCF LSFTDSF+D KG V YG AT +GLWVIDG A L P+ AA Y
Sbjct  66   ANRAMAGALVALCGLSCFALSFTDSFRDAKGAVRYGFATRRGLWVIDGGAPLDPQAAAAY  125

Query  447  KVKFIDFVHAVMSVLVFGAIALFDQNVVSCFXPXPXXEXXXILPXVPVGXGXVCXXLFVV  626
            +++F+D VHAV++V+VF A+ALFD NVVSCF P P  +   +L  +P+  G V   LFV 
Sbjct  126  RLRFLDLVHAVVTVMVFVAVALFDHNVVSCFYPVPSEDAVQVLTVLPIAIGVVGSMLFVT  185

Query  627  FPPXXXGIGFPXT  665
            FP    GIGFP +
Sbjct  186  FPTTRHGIGFPLS  198



>ref|XP_008225181.1| PREDICTED: uncharacterized protein LOC103324847 [Prunus mume]
Length=227

 Score =   203 bits (516),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 102/204 (50%), Positives = 132/204 (65%), Gaps = 9/204 (4%)
 Frame = +3

Query  60   DEELSHNNVVVSEKVPLLVPDEVEKNLVQKAISQTFQSAAHLANLLPTGAVLAFQLLSPI  239
            ++ L  NN    E  P   P        QKAI +TF+  AHL+NLLPTG VL FQ+ SP 
Sbjct  29   EQPLLENNAASIEPKPPKTP-------AQKAIRKTFKGTAHLSNLLPTGTVLVFQMFSPG  81

Query  240  FSNQGDCDA-VSRFLTASLVAMCGLSCFLLSFTDSFKDQKGNVCYGVATVKGLWVIDGSA  416
            F+ QG C   +++ +T  L+ +C L+CFLL FTDS +D++G V YG+A+ KGLWVIDGS 
Sbjct  82   FTRQGQCPTPINKTMTLGLLIVCSLTCFLLCFTDSLRDERGKVRYGLASFKGLWVIDGSK  141

Query  417  -SLPPELAAKYKVKFIDFVHAVMSVLVFGAIALFDQNVVSCFXPXPXXEXXXILPXVPVG  593
             ++ PE  AKY+++FIDF HA+MS+ VF A+AL DQNVV CF P P  E   +L   PVG
Sbjct  142  VAIAPEEVAKYRLRFIDFFHALMSIFVFAALALVDQNVVKCFYPKPSEEGKQLLAAFPVG  201

Query  594  XGXVCXXLFVVFPPXXXGIGFPXT  665
               VC  LFV+FP    GIGFP +
Sbjct  202  IAVVCSLLFVLFPTKRHGIGFPLS  225



>ref|XP_009413807.1| PREDICTED: uncharacterized protein LOC103995042 [Musa acuminata 
subsp. malaccensis]
Length=204

 Score =   202 bits (514),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 101/198 (51%), Positives = 132/198 (67%), Gaps = 9/198 (5%)
 Frame = +3

Query  96   EKVPLLVPDEVE----KNLVQKAISQTFQSAAHLANLLPTGAVLAFQLLSPIFSNQGDCD  263
            EK PL+  +E       NL+QKA    ++S A LAN LPTG  LAFQ+LSP+ +NQG C 
Sbjct  11   EKQPLIKYEESSVDDPPNLIQKA----YRSTADLANHLPTGTALAFQVLSPVLTNQGRCT  66

Query  264  AVSRFLTASLVAMCGLSCFLLSFTDSFKDQ-KGNVCYGVATVKGLWVIDGSASLPPELAA  440
              +R + + L+A+C LSC+LLSFTDSF+D+  G V YG+AT+KGLWVIDG   LPPELAA
Sbjct  67   DANRVMASCLLALCALSCWLLSFTDSFRDEATGRVRYGLATLKGLWVIDGLKPLPPELAA  126

Query  441  KYKVKFIDFVHAVMSVLVFGAIALFDQNVVSCFXPXPXXEXXXILPXVPVGXGXVCXXLF  620
             Y+++ +D +HA  S+LVF A+AL D+NV SCF P P  +   +L  +PVG G +   L 
Sbjct  127  GYRLRLVDLLHAFTSLLVFAAVALLDKNVASCFYPTPSEDTRQVLSALPVGIGVIGSTLL  186

Query  621  VVFPPXXXGIGFPXTXDN  674
            V FP    GIGFP + D 
Sbjct  187  VAFPTSRHGIGFPLSPDT  204



>ref|XP_007213542.1| hypothetical protein PRUPE_ppa019527mg [Prunus persica]
 gb|EMJ14741.1| hypothetical protein PRUPE_ppa019527mg [Prunus persica]
Length=209

 Score =   201 bits (512),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 101/201 (50%), Positives = 132/201 (66%), Gaps = 10/201 (5%)
 Frame = +3

Query  69   LSHNNVVVSEKVPLLVPDEVEKNLVQKAISQTFQSAAHLANLLPTGAVLAFQLLSPIFSN  248
            L +N   ++ K P        K   QKAI +TF+  AHL+NLLPTG VL FQ+ SP F+ 
Sbjct  15   LENNAASIAPKPP--------KTPAQKAIRKTFKGTAHLSNLLPTGTVLVFQMFSPGFTR  66

Query  249  QGDCDA-VSRFLTASLVAMCGLSCFLLSFTDSFKDQKGNVCYGVATVKGLWVIDGSA-SL  422
            QG C   +++ +T  L+ +C L+CFLL FTDS +D++G V YG+AT KGLWVIDGS   +
Sbjct  67   QGQCPTPINKTMTLGLLIVCSLTCFLLCFTDSLRDERGKVRYGLATFKGLWVIDGSKVPI  126

Query  423  PPELAAKYKVKFIDFVHAVMSVLVFGAIALFDQNVVSCFXPXPXXEXXXILPXVPVGXGX  602
             PE  AKY+++FIDF HA+MS+ VF A+AL DQN+V+CF P P  E   +L   PVG   
Sbjct  127  APEEVAKYRLRFIDFFHALMSIFVFAALALVDQNIVNCFYPKPSEEGKQLLAAFPVGIAV  186

Query  603  VCXXLFVVFPPXXXGIGFPXT  665
            VC  LFV+FP    GIGFP +
Sbjct  187  VCSLLFVLFPTKRHGIGFPLS  207



>gb|ABR17763.1| unknown [Picea sitchensis]
Length=219

 Score =   200 bits (509),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 105/214 (49%), Positives = 133/214 (62%), Gaps = 24/214 (11%)
 Frame = +3

Query  96   EKVPLLVPDEVEKN---------------------LVQKAISQTFQSAAHLANLLPTGAV  212
            EK PLL  +EVEK+                     LVQKA++Q+  S AHLANLLPTG V
Sbjct  9    EKAPLL--EEVEKSDESKQRTEQEPEENEEKAREGLVQKALNQSLASTAHLANLLPTGTV  66

Query  213  LAFQLLSPIFSNQGDCDAVSRFLTASLVAMCGLSCFLLSFTDSFKDQKGNVCYGVATVKG  392
            LAFQ+L PIFSN G CD VS F+   L+ +C LSCF +SFTDSF+   G + YG+AT KG
Sbjct  67   LAFQILCPIFSNSGHCDQVSAFMIECLLVLCALSCFFISFTDSFQGSDGKLHYGLATPKG  126

Query  393  LWVIDGSASLPPELAAKYKVKFIDFVHAVMSVLVFGAIALFDQNVVSCFXPXPXXEXXXI  572
            LW  +  +   P+ A +Y+V+F+DFVHA +SVLVF AIAL + NVV C  P P  +   +
Sbjct  127  LWTFENLSEAIPD-AGRYQVRFLDFVHAFLSVLVFAAIALLNDNVVKCLYPAPDYQTKEV  185

Query  573  LPXVPVGXGXVCXXLFVVFPPXXXGIGFPXTXDN  674
            L  +PVG G  C  LFVVFP    GIG+P +  +
Sbjct  186  LDVLPVGMGVFCSLLFVVFPTTRHGIGYPVSSHH  219



>ref|XP_011100240.1| PREDICTED: uncharacterized protein LOC105178468 [Sesamum indicum]
Length=223

 Score =   200 bits (508),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 100/223 (45%), Positives = 142/223 (64%), Gaps = 17/223 (8%)
 Frame = +3

Query  42   MDIHVGDEELSHNNVVVSEK-------VPLLVPDEVEK------NLVQKAISQTFQSAAH  182
            MDI    EE S N +  S +       VPLL                +K + + F+  AH
Sbjct  1    MDIR--REEESRNGIRESYREPDEGIQVPLLENQPPPAGAKPPKTRARKVVRKAFKGTAH  58

Query  183  LANLLPTGAVLAFQLLSPIFSNQGDCDA-VSRFLTASLVAMCGLSCFLLSFTDSFKDQKG  359
            L+NLLPTG+VLAFQ+LSP+F+++G C + VSR  T  L+  C  SCF L FTDSF+D++G
Sbjct  59   LSNLLPTGSVLAFQVLSPVFTHEGKCKSIVSRSTTLGLLGFCAASCFFLCFTDSFRDERG  118

Query  360  NVCYGVATVKGLWVIDGSA-SLPPELAAKYKVKFIDFVHAVMSVLVFGAIALFDQNVVSC  536
             V YG+AT +GLWVIDGS+ +LPP+ A K++++F+DF HA++S++VF A+A+ D+NV+ C
Sbjct  119  KVRYGLATFRGLWVIDGSSCALPPQEAEKFRLRFVDFFHALLSIVVFAAVAMLDKNVMHC  178

Query  537  FXPXPXXEXXXILPXVPVGXGXVCXXLFVVFPPXXXGIGFPXT  665
            F P P  E   IL  +PV  G +C   F++FP    G+GFP +
Sbjct  179  FYPSPSDETLEILTTLPVAVGVICSLFFLLFPTKRHGVGFPLS  221



>gb|ABR16877.1| unknown [Picea sitchensis]
Length=219

 Score =   200 bits (508),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 105/214 (49%), Positives = 133/214 (62%), Gaps = 24/214 (11%)
 Frame = +3

Query  96   EKVPLLVPDEVEKN---------------------LVQKAISQTFQSAAHLANLLPTGAV  212
            EK PLL  +EVEK+                     LVQKA++Q+  S AHLANLLPTG V
Sbjct  9    EKAPLL--EEVEKSDESKQRTEKESEENEEKTREGLVQKALNQSLASTAHLANLLPTGTV  66

Query  213  LAFQLLSPIFSNQGDCDAVSRFLTASLVAMCGLSCFLLSFTDSFKDQKGNVCYGVATVKG  392
            LAFQ+L PIFSN G CD VS F+T  L+ +C LSCF +SFTDSF+   G + YG+AT KG
Sbjct  67   LAFQILCPIFSNSGHCDQVSAFMTECLLVLCALSCFFISFTDSFQGSDGKLHYGLATPKG  126

Query  393  LWVIDGSASLPPELAAKYKVKFIDFVHAVMSVLVFGAIALFDQNVVSCFXPXPXXEXXXI  572
            LW  +  +   P+ A +Y+V+ +DFVHA +SVLVF AIAL + NVV C  P P  +   +
Sbjct  127  LWTFENLSEAIPD-AGRYQVRILDFVHAFLSVLVFAAIALLNDNVVKCLYPAPDYQTKEV  185

Query  573  LPXVPVGXGXVCXXLFVVFPPXXXGIGFPXTXDN  674
            L  +PVG G  C  LFVVFP    GIG+P +  +
Sbjct  186  LDVLPVGIGVFCSLLFVVFPTTRHGIGYPVSSHH  219



>ref|XP_007043697.1| Galactose-1-phosphate uridylyltransferase, putative [Theobroma 
cacao]
 gb|EOX99528.1| Galactose-1-phosphate uridylyltransferase, putative [Theobroma 
cacao]
Length=240

 Score =   200 bits (509),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 104/224 (46%), Positives = 135/224 (60%), Gaps = 11/224 (5%)
 Frame = +3

Query  33   F*EMDIHVGDEELSHNNVVVSEKV----PLL------VPDEVEKNLVQKAISQTFQSAAH  182
            F  MDI V +E+    N    E+V    P +       P +  K   QK + +TF+  A 
Sbjct  17   FMSMDIKVENEQPLLENEEAGERVQEEQPTIPENATSAPQKQPKTRKQKVMRKTFKGTAV  76

Query  183  LANLLPTGAVLAFQLLSPIFSNQGDCDA-VSRFLTASLVAMCGLSCFLLSFTDSFKDQKG  359
            L+ LLPTG+ L FQLLSP  +NQG C   VS +LT  LV  C + CF LSFTDSF+D++G
Sbjct  77   LSKLLPTGSALTFQLLSPALTNQGQCKTEVSHYLTLGLVGFCAVLCFFLSFTDSFRDERG  136

Query  360  NVCYGVATVKGLWVIDGSASLPPELAAKYKVKFIDFVHAVMSVLVFGAIALFDQNVVSCF  539
             V YGVAT KGLWV+DG   L  E A KY++KFIDF HA++S+++F ++ALFDQNVV CF
Sbjct  137  KVRYGVATFKGLWVMDGPVKLSAEEADKYRLKFIDFFHALVSIMIFTSLALFDQNVVKCF  196

Query  540  XPXPXXEXXXILPXVPVGXGXVCXXLFVVFPPXXXGIGFPXTXD  671
             P P  E   +L  +P   G +   LFV FP    GIG P + +
Sbjct  197  YPTPSEETKELLTVLPASIGAIGSVLFVSFPTKRNGIGNPLSKN  240



>gb|EMS59461.1| hypothetical protein TRIUR3_20370 [Triticum urartu]
Length=218

 Score =   199 bits (506),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 93/175 (53%), Positives = 117/175 (67%), Gaps = 0/175 (0%)
 Frame = +3

Query  141  VQKAISQTFQSAAHLANLLPTGAVLAFQLLSPIFSNQGDCDAVSRFLTASLVAMCGLSCF  320
            VQKAI Q +QS  HLA LLP+G VLAFQLL+P  + QG C  + R +   LV +C LSCF
Sbjct  32   VQKAIRQAYQSTGHLAKLLPSGTVLAFQLLAPTMAKQGHCGDLDRMMMGGLVVLCALSCF  91

Query  321  LLSFTDSFKDQKGNVCYGVATVKGLWVIDGSASLPPELAAKYKVKFIDFVHAVMSVLVFG  500
            +++FTDSF+D+ G V YG AT KGLWVIDG  +L P  A +YK+ F+DF HA +S ++F 
Sbjct  92   VVTFTDSFRDENGKVQYGFATFKGLWVIDGGVTLDPHAAVEYKMTFLDFFHAAVSAVIFV  151

Query  501  AIALFDQNVVSCFXPXPXXEXXXILPXVPVGXGXVCXXLFVVFPPXXXGIGFPXT  665
            AIALFDQNV SCF P P  +   +L  +PV  G +   LFV FP    G GFP +
Sbjct  152  AIALFDQNVASCFYPIPSEDTKQVLTTLPVAIGVIGSMLFVSFPTTRHGFGFPVS  206



>ref|XP_010093959.1| hypothetical protein L484_010525 [Morus notabilis]
 gb|EXB54946.1| hypothetical protein L484_010525 [Morus notabilis]
Length=226

 Score =   198 bits (504),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 98/183 (54%), Positives = 124/183 (68%), Gaps = 3/183 (2%)
 Frame = +3

Query  132  KNLVQKAISQTFQSAAHLANLLPTGAVLAFQLLSPIFSNQGDCDA-VSRFLTASLVAMCG  308
            K   QKA+ +TF+  AHLANLLPTG+VLAFQ+LSP F++QG C + VS+  T  L+A C 
Sbjct  44   KTPAQKAMRKTFKGTAHLANLLPTGSVLAFQILSPAFTHQGQCRSRVSQATTFGLLACCA  103

Query  309  LSCFLLSFTDSFKDQKGNVCYGVATVKGLWVIDGSAS--LPPELAAKYKVKFIDFVHAVM  482
             SCFLL FTDSF+D +G V YGVAT +GLW++DGSA   +  E A  Y++  IDF HA+ 
Sbjct  104  ASCFLLCFTDSFRDARGKVRYGVATFRGLWIVDGSAGAVIAAEEAENYRLMVIDFFHALA  163

Query  483  SVLVFGAIALFDQNVVSCFXPXPXXEXXXILPXVPVGXGXVCXXLFVVFPPXXXGIGFPX  662
            S+LVF A+  FD+NVV CF P P  E   +L  VPVG G +C   FV FP    GIGFP 
Sbjct  164  SLLVFAAVVAFDENVVRCFCPAPSEEVKELLVAVPVGVGVLCSLFFVAFPTRRHGIGFPL  223

Query  663  TXD  671
            + +
Sbjct  224  SRN  226



>ref|XP_009777961.1| PREDICTED: uncharacterized protein LOC104227416 [Nicotiana sylvestris]
Length=233

 Score =   198 bits (504),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 104/193 (54%), Positives = 130/193 (67%), Gaps = 5/193 (3%)
 Frame = +3

Query  111  LVPDEVEKNLVQK-AISQT-FQSAAHLANLLPTGAVLAFQLLSPIFSNQGDCDAVSRFLT  284
            LVPD +E+ LV + +ISQ   ++ A+LANLLPTG +LAFQLL PIF+N G CD  +R +T
Sbjct  40   LVPDSLERPLVPRLSISQRALETTANLANLLPTGTLLAFQLLIPIFTNNGSCDTATRPMT  99

Query  285  ASLVAMCGLSCFLLSFTDSFKDQKGNVCYGVATVKGLWVID---GSASLPPELAAKYKVK  455
              L+A+   SCF+  FTDSFK   G + YG+AT KGLW+ D    +AS  P    KY+V 
Sbjct  100  LILLALLAFSCFIACFTDSFKAPDGQIYYGLATFKGLWIFDYNAATASGVPNELNKYRVG  159

Query  456  FIDFVHAVMSVLVFGAIALFDQNVVSCFXPXPXXEXXXILPXVPVGXGXVCXXLFVVFPP  635
            FID VHAV+SVLVF A+AL D+NVVSC+ P P  E   +L  VP+G G +C  LFVVFP 
Sbjct  160  FIDLVHAVLSVLVFVAVALRDKNVVSCYYPSPNHETKQVLDVVPIGIGVICSLLFVVFPT  219

Query  636  XXXGIGFPXTXDN  674
               GIGFP T D 
Sbjct  220  RRHGIGFPVTPDR  232



>ref|XP_008344773.1| PREDICTED: uncharacterized protein LOC103407659 [Malus domestica]
 ref|XP_008363407.1| PREDICTED: uncharacterized protein LOC103427114 [Malus domestica]
Length=215

 Score =   197 bits (502),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 97/180 (54%), Positives = 126/180 (70%), Gaps = 2/180 (1%)
 Frame = +3

Query  132  KNLVQKAISQTFQSAAHLANLLPTGAVLAFQLLSPIFSNQGDCDAV-SRFLTASLVAMCG  308
            K   QKAI +TF++ AHL+NLLPTG VL FQ+ SP F+ QG C A+ ++ +T  L+  C 
Sbjct  34   KTPAQKAIRKTFKATAHLSNLLPTGTVLVFQMXSPAFTCQGKCPAILNQTVTLLLLTFCS  93

Query  309  LSCFLLSFTDSFKDQKGNVCYGVATVKGLWVIDGSA-SLPPELAAKYKVKFIDFVHAVMS  485
            L+CFLL  TDS +D++G V YG+AT KGLW++DGS  +L PE AAKY++KFIDF HA MS
Sbjct  94   LTCFLLCLTDSLRDERGKVRYGLATFKGLWILDGSKITLSPEEAAKYRLKFIDFFHAFMS  153

Query  486  VLVFGAIALFDQNVVSCFXPXPXXEXXXILPXVPVGXGXVCXXLFVVFPPXXXGIGFPXT  665
            +LVF A+A+ D+NVV+CF P    E   +L    VG G VC  LFV+FP    GIGFP +
Sbjct  154  ILVFAAVAMLDKNVVNCFYPKLSEEARQLLVAFHVGTGIVCSLLFVLFPSRRHGIGFPLS  213



>ref|XP_011087688.1| PREDICTED: uncharacterized protein LOC105169096 [Sesamum indicum]
Length=210

 Score =   197 bits (500),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 103/199 (52%), Positives = 128/199 (64%), Gaps = 5/199 (3%)
 Frame = +3

Query  90   VSEKVPLLVPDEVEKNLVQKAISQTFQSAAHLANLLPTGAVLAFQLLSPIFSNQGDCDAV  269
            V   V LL P        Q A+SQ  +S+AHLANLLPTG +LAFQLL PIF+N G CD  
Sbjct  13   VDNDVDLLPPPPPPPRPSQSALSQALESSAHLANLLPTGTLLAFQLLMPIFTNNGVCDMA  72

Query  270  SRFLTASLVAMCGLSCFLLSFTDSFKDQKGNVCYGVATVKGLWVID----GSASLPPELA  437
            +R +T  L+ +  LSCFL SFTDS K   G V YG AT +G+W+ D     S+ LP EL 
Sbjct  73   TRPMTLGLLFVLALSCFLASFTDSIKASDGQVYYGFATFRGMWLFDYLNAESSGLPAEL-  131

Query  438  AKYKVKFIDFVHAVMSVLVFGAIALFDQNVVSCFXPXPXXEXXXILPXVPVGXGXVCXXL  617
            +KY++ FIDFVHAV+SVLVF A+AL D+NVVSC  P P  E   +L  VP+G G +   +
Sbjct  132  SKYRLGFIDFVHAVLSVLVFAAVALRDKNVVSCLYPSPGHEVQEVLDIVPIGIGLISSLM  191

Query  618  FVVFPPXXXGIGFPXTXDN  674
            FV+FP    GIG+P T D 
Sbjct  192  FVIFPTKRHGIGYPVTRDR  210



>ref|XP_002869724.1| hypothetical protein ARALYDRAFT_492419 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH45983.1| hypothetical protein ARALYDRAFT_492419 [Arabidopsis lyrata subsp. 
lyrata]
Length=213

 Score =   196 bits (499),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 100/207 (48%), Positives = 131/207 (63%), Gaps = 6/207 (3%)
 Frame = +3

Query  63   EELSHNNVVVSEKVPLLVPDEVEKNLVQKAISQTFQSAAHLANLLPTGAVLAFQLLSPIF  242
              L+  N   S++    VP    +     A+SQT  SAA+LANLLPTG +LAF LL P+F
Sbjct  5    SSLTQRNPTSSQEQSESVPQLRRQTSQHAAMSQTLTSAANLANLLPTGTLLAFTLLIPVF  64

Query  243  SNQGDCDAVSRFLTASLVAMCGLSCFLLSFTDSFKDQKGNVCYGVATVKGLWVID----G  410
            ++ G CD  +R LTA L+ +  +SCFL SFTDS K + GNV YG AT KG+W+ D     
Sbjct  65   TSNGSCDYPTRVLTAGLLTLLSISCFLSSFTDSVKAEDGNVYYGFATRKGMWIFDYPDPD  124

Query  411  SASLPPELAAKYKVKFIDFVHAVMSVLVFGAIALFDQNVVSCFXPXPXXEXXXILPXVPV  590
               LP    +KY+++ ID++HAV+SVLVFGA+AL D+N VSCF P P  E   +L  VP+
Sbjct  125  GLGLPD--LSKYRIRIIDWIHAVLSVLVFGAVALRDKNAVSCFYPAPEQETKKVLDIVPM  182

Query  591  GXGXVCXXLFVVFPPXXXGIGFPXTXD  671
            G G +C  LF+VFP    GIG+P T D
Sbjct  183  GVGVICGLLFLVFPARRHGIGYPVTGD  209



>ref|XP_009596399.1| PREDICTED: uncharacterized protein LOC104092490 [Nicotiana tomentosiformis]
Length=233

 Score =   196 bits (499),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 105/208 (50%), Positives = 135/208 (65%), Gaps = 7/208 (3%)
 Frame = +3

Query  69   LSHNNVVVSEKVPLLVPDEVEKNLVQK-AISQT-FQSAAHLANLLPTGAVLAFQLLSPIF  242
            L H +         L+PD  E+ LV + +ISQ   ++ A+LANLLPTG +LAFQLL PIF
Sbjct  26   LLHTDNNNDNNNNNLIPDSSERPLVPRLSISQRALETTANLANLLPTGTLLAFQLLIPIF  85

Query  243  SNQGDCDAVSRFLTASLVAMCGLSCFLLSFTDSFKDQKGNVCYGVATVKGLWVIDGSAS-  419
            +N G CD  +R +T  L+A+   SCF+  FTDSFK   G + YG+AT KGLW+ D +A+ 
Sbjct  86   TNNGSCDTATRPMTLILLALLAFSCFVACFTDSFKAPDGQIYYGLATFKGLWIFDYNAAT  145

Query  420  ---LPPELAAKYKVKFIDFVHAVMSVLVFGAIALFDQNVVSCFXPXPXXEXXXILPXVPV  590
               +P EL  KY+V FID VHA++SVLVF A+AL D+NVVSC+ P P  E   +L  VP+
Sbjct  146  ASGVPSEL-NKYRVGFIDLVHAMLSVLVFVAVALRDKNVVSCYYPSPNQETKQVLDVVPI  204

Query  591  GXGXVCXXLFVVFPPXXXGIGFPXTXDN  674
            G G +C  LFVVFP    GIGFP T D 
Sbjct  205  GIGVICSLLFVVFPTRRHGIGFPVTPDR  232



>ref|XP_008783285.1| PREDICTED: uncharacterized protein LOC103702573 [Phoenix dactylifera]
Length=187

 Score =   194 bits (494),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 99/180 (55%), Positives = 125/180 (69%), Gaps = 4/180 (2%)
 Frame = +3

Query  138  LVQKAISQTFQSAAHLANLLPTGAVLAFQLLSPIFSNQGDCDAVSRFLTASLVAMCGLSC  317
            +V  A+ +TF+S A+LANLLPTG VLAFQ+LSP  +N G C   +R +TASLVA+CGLSC
Sbjct  1    MVNWAMHRTFESTANLANLLPTGTVLAFQILSPTCTNLGRCTGANRAMTASLVALCGLSC  60

Query  318  FLLSFTDSFK---DQKGNVCYGVATVKGLWVIDGSASL-PPELAAKYKVKFIDFVHAVMS  485
            F+L+FTDSF    D +G V YG+AT +GLWV D  ASL PPE+ AKY+++F DFVHA  S
Sbjct  61   FILNFTDSFHSGDDAEGKVRYGLATFRGLWVFDDPASLPPPEMMAKYRIRFRDFVHAFTS  120

Query  486  VLVFGAIALFDQNVVSCFXPXPXXEXXXILPXVPVGXGXVCXXLFVVFPPXXXGIGFPXT  665
            VLVF  + L D+NVVSCF P P      +L  +P+  G +   LFVV P    GIGFP +
Sbjct  121  VLVFMGVVLCDKNVVSCFYPIPSENMEQVLAALPLAIGVLGSALFVVLPTTRHGIGFPLS  180



>ref|XP_009380594.1| PREDICTED: uncharacterized protein LOC103968949 [Musa acuminata 
subsp. malaccensis]
Length=233

 Score =   195 bits (496),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 101/192 (53%), Positives = 127/192 (66%), Gaps = 2/192 (1%)
 Frame = +3

Query  96   EKVPLLVPDEVEK-NLVQKAISQTFQSAAHLANLLPTGAVLAFQLLSPIFSNQGDCDAVS  272
            E  PLL  +  ++   +Q+ ISQT+Q  AHLAN LPTG VLAFQ LSP F+  G C   S
Sbjct  39   EAQPLLNHEAGDRITAIQQVISQTYQGTAHLANHLPTGTVLAFQFLSPAFTTFGRCTESS  98

Query  273  RFLTASLVAMCGLSCFLLSFTDSFKDQ-KGNVCYGVATVKGLWVIDGSASLPPELAAKYK  449
            RF+TA L+A+C LSCFLLSFTDSF D+    V YGVAT +GLWVIDG   + PELA  ++
Sbjct  99   RFMTACLLALCALSCFLLSFTDSFYDEATRRVRYGVATFRGLWVIDGLQPVAPELAVSHR  158

Query  450  VKFIDFVHAVMSVLVFGAIALFDQNVVSCFXPXPXXEXXXILPXVPVGXGXVCXXLFVVF  629
            +  +DF+HA  S++VF A+AL D+NVVSC+ P P      +L  +PVG G +   L V F
Sbjct  159  LGPLDFLHAFTSLVVFAAVALLDKNVVSCYYPMPTDIELQVLTALPVGIGVLGSALLVTF  218

Query  630  PPXXXGIGFPXT  665
            P    GIGFP T
Sbjct  219  PTIRHGIGFPVT  230



>ref|XP_002517851.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF44369.1| conserved hypothetical protein [Ricinus communis]
Length=221

 Score =   194 bits (493),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 103/187 (55%), Positives = 128/187 (68%), Gaps = 2/187 (1%)
 Frame = +3

Query  105  PLLVPDEV-EKNLVQKAISQTFQSAAHLANLLPTGAVLAFQLLSPIFSNQGDCDAVSRF-  278
            PL+VP +   K   QKAI +TF+   HLA LLPTG+VLAFQ+LSPI ++QG C   +   
Sbjct  31   PLIVPTQKPTKTPAQKAIRKTFKGTGHLAKLLPTGSVLAFQILSPILTHQGQCRTTTSMS  90

Query  279  LTASLVAMCGLSCFLLSFTDSFKDQKGNVCYGVATVKGLWVIDGSASLPPELAAKYKVKF  458
            LT +L+  C LSCFLL  TDSF+D++G V YG+AT +GLWV+DGS  L  E A  YK++F
Sbjct  91   LTLALLTTCALSCFLLCLTDSFRDERGKVRYGLATFRGLWVLDGSLKLSAEEAESYKLRF  150

Query  459  IDFVHAVMSVLVFGAIALFDQNVVSCFXPXPXXEXXXILPXVPVGXGXVCXXLFVVFPPX  638
            IDF+HA MS LVFGA+A FD+NVV+CF   P  E   +L  VPVG G VC  LF+ FP  
Sbjct  151  IDFLHAFMSALVFGAVAFFDKNVVNCFCSNPSEEVKDLLVAVPVGVGVVCSILFLRFPTK  210

Query  639  XXGIGFP  659
              GIG P
Sbjct  211  RHGIGTP  217



>ref|XP_010686483.1| PREDICTED: uncharacterized protein LOC104900690 [Beta vulgaris 
subsp. vulgaris]
Length=218

 Score =   194 bits (492),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 97/194 (50%), Positives = 128/194 (66%), Gaps = 7/194 (4%)
 Frame = +3

Query  93   SEKVPLL------VPDEV-EKNLVQKAISQTFQSAAHLANLLPTGAVLAFQLLSPIFSNQ  251
            +E+ P L      +PD V  +N   + +SQT QS   LANLLPTG +L FQLL+P F+NQ
Sbjct  19   AEEEPFLQDKEEPLPDTVITRNEGHEILSQTLQSTRSLANLLPTGTILTFQLLAPAFTNQ  78

Query  252  GDCDAVSRFLTASLVAMCGLSCFLLSFTDSFKDQKGNVCYGVATVKGLWVIDGSASLPPE  431
            GDC+ V+R +  +L+A+C  + FLL+FTDSFKD+ GNV YG AT  GLW++D S +LP  
Sbjct  79   GDCNHVNRVMITTLLALCTSAVFLLNFTDSFKDRCGNVSYGFATFNGLWLVDCSVALPQR  138

Query  432  LAAKYKVKFIDFVHAVMSVLVFGAIALFDQNVVSCFXPXPXXEXXXILPXVPVGXGXVCX  611
            LA+KY+++ +DFVH   SVLVF AIAL + N V C+ P P  +   IL  +PVG G    
Sbjct  139  LASKYRLRALDFVHGFTSVLVFTAIALSENNTVRCYYPSPSRDLQQILIALPVGIGVASS  198

Query  612  XLFVVFPPXXXGIG  653
             LFV+FP    GIG
Sbjct  199  FLFVLFPTQRHGIG  212



>ref|XP_010666457.1| PREDICTED: uncharacterized protein LOC104883611 [Beta vulgaris 
subsp. vulgaris]
Length=213

 Score =   193 bits (491),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 95/213 (45%), Positives = 135/213 (63%), Gaps = 7/213 (3%)
 Frame = +3

Query  42   MDIHVGDEELSHNNVVVSEKVPLLVPDEVE----KNLVQKAISQTFQSAAHLANLLPTGA  209
            MDI + D E     +   +  PLL   + +    K   QKAI +TF+  +HL++LLP+G+
Sbjct  1    MDIKIEDGE--SQEIQEQQIQPLLENQQEQTKPPKTRTQKAIRKTFKGTSHLSSLLPSGS  58

Query  210  VLAFQLLSPIFSNQGDCDAV-SRFLTASLVAMCGLSCFLLSFTDSFKDQKGNVCYGVATV  386
            VL F++ SP+ +NQG C+   ++ +T  L+   GLSCF++ FTDS +D++G V YG+AT 
Sbjct  59   VLIFEMFSPVLTNQGQCETFQTQLITLCLITFVGLSCFIMCFTDSVRDERGKVRYGLATF  118

Query  387  KGLWVIDGSASLPPELAAKYKVKFIDFVHAVMSVLVFGAIALFDQNVVSCFXPXPXXEXX  566
            KG+W+IDGS +L PE AAKY+++ +DF+HA M + VF A+AL DQNVV CF P P  +  
Sbjct  119  KGIWIIDGSVTLSPEQAAKYRIRVLDFLHAFMGIFVFVAVALLDQNVVKCFFPMPSEKTK  178

Query  567  XILPXVPVGXGXVCXXLFVVFPPXXXGIGFPXT  665
              L   PVG G +C  LFV FP    GI  P +
Sbjct  179  ERLVMFPVGVGIICGLLFVCFPSKRNGIVSPLS  211



>ref|XP_010657994.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC100244061 
[Vitis vinifera]
Length=210

 Score =   193 bits (490),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 103/176 (59%), Positives = 125/176 (71%), Gaps = 6/176 (3%)
 Frame = +3

Query  153  ISQTFQSAAHLANLLPTGAVLAFQLLSPIFSNQGDCDAVSRFLTASLVAMCGLSCFLLSF  332
            +SQT  S A+LANLLPTG +LAFQLL+P+F+N G CDAV+R LT  L+ +   SCFL SF
Sbjct  33   LSQTLASTANLANLLPTGTLLAFQLLTPVFTNNGACDAVTRSLTLILLLLLAFSCFLFSF  92

Query  333  TDSFKDQKGNVCYGVATVKGLWVID-----GSASLPPELAAKYKVKFIDFVHAVMSVLVF  497
            TDSFK   G V YG+AT KGLW+ D     GSA+  P+L +KYK +FID VHAV+SVLVF
Sbjct  93   TDSFKTPDGRVFYGIATFKGLWLFDYVDESGSAASLPDL-SKYKFRFIDGVHAVLSVLVF  151

Query  498  GAIALFDQNVVSCFXPXPXXEXXXILPXVPVGXGXVCXXLFVVFPPXXXGIGFPXT  665
             A+A+ D+NVVSCF P P  E   +L  VPVG G +C  LFVVFP    GIG+P T
Sbjct  152  VAVAMRDKNVVSCFYPQPAREVQEVLDIVPVGIGLICSLLFVVFPTTRHGIGYPVT  207



>emb|CDP18222.1| unnamed protein product [Coffea canephora]
Length=223

 Score =   193 bits (491),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 95/178 (53%), Positives = 122/178 (69%), Gaps = 0/178 (0%)
 Frame = +3

Query  141  VQKAISQTFQSAAHLANLLPTGAVLAFQLLSPIFSNQGDCDAVSRFLTASLVAMCGLSCF  320
            +++AI  TF+  A+LA+ LP G VLAF+LLSPI SNQGDCD   + +TA L+A+C LSCF
Sbjct  42   IRQAICSTFKGTAYLASRLPAGTVLAFRLLSPILSNQGDCDVAFKTMTAVLLALCALSCF  101

Query  321  LLSFTDSFKDQKGNVCYGVATVKGLWVIDGSASLPPELAAKYKVKFIDFVHAVMSVLVFG  500
            +LSFTDSFKD KGNV +G AT KG + ID + ++ PE AAK K+  +DF+H  +S+LVF 
Sbjct  102  ILSFTDSFKDGKGNVFFGFATFKGFYPIDRTVTISPEEAAKKKIGPLDFLHGFLSLLVFA  161

Query  501  AIALFDQNVVSCFXPXPXXEXXXILPXVPVGXGXVCXXLFVVFPPXXXGIGFPXTXDN  674
            +IAL D+N+V CF P P  E   I+  +PV  G VC  LFV FP    GIGF    D 
Sbjct  162  SIALLDKNIVDCFYPTPSVEIKEIISVLPVANGVVCSILFVAFPTQRHGIGFGADPDG  219



>ref|XP_010256253.1| PREDICTED: uncharacterized protein LOC104596698 [Nelumbo nucifera]
Length=221

 Score =   191 bits (486),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 98/193 (51%), Positives = 127/193 (66%), Gaps = 1/193 (1%)
 Frame = +3

Query  96   EKVPLLVPDEVEKNLVQKAISQTFQSAAHLANLLPTGAVLAFQLLSPIFSNQGDCDAVSR  275
            +K P+        ++ Q+AISQT  S AHLANLLPTG +LAFQLL P F+N G CD+V+R
Sbjct  30   KKPPIATDSSAYPSISQRAISQTLASTAHLANLLPTGTLLAFQLLVPTFTNNGTCDSVTR  89

Query  276  FLTASLVAMCGLSCFLLSFTDSFKDQKGNVCYGVATVKGLWVIDGSASLPPELAAKYKVK  455
             LT  L+ +  +SC L SFTDSFK   G V +G+AT KG+W+ D + S  P+L   Y+++
Sbjct  90   PLTLILLLVLAVSCSLASFTDSFKAPDGKVYHGIATWKGMWLFDYTGSSVPDL-RNYRLR  148

Query  456  FIDFVHAVMSVLVFGAIALFDQNVVSCFXPXPXXEXXXILPXVPVGXGXVCXXLFVVFPP  635
             IDFVHAV+SV VFG +AL D+N++SCF P P  E   +L  VP+  G  C  LFVVFP 
Sbjct  149  SIDFVHAVLSVFVFGTVALRDKNILSCFYPSPAHETQEVLDIVPLAIGLFCSLLFVVFPT  208

Query  636  XXXGIGFPXTXDN  674
               GIG+P T  N
Sbjct  209  TRHGIGYPVTSGN  221



>gb|KFK28986.1| hypothetical protein AALP_AA7G073800 [Arabis alpina]
Length=212

 Score =   191 bits (485),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 97/206 (47%), Positives = 136/206 (66%), Gaps = 12/206 (6%)
 Frame = +3

Query  90   VSEKVPLLVPDEVE--------KNLVQKAISQTFQSAAHLANLLPTGAVLAFQLLSPIFS  245
            ++++ P+  P++ E         +  Q+A+SQT  SAA+LANLLPTG +LAFQLL P+F+
Sbjct  5    LTQRNPMTTPEQPESPPQLKRQHSTSQRAMSQTLTSAANLANLLPTGTLLAFQLLMPVFT  64

Query  246  NQGDCDAVSRFLTASLVAMCGLSCFLLSFTDSFKDQKGNVCYGVATVKGLWVI---DGSA  416
            + G CD  +R +TA L+ +  +SCFL SFTDS K + GNV YG AT KG+WV    D S 
Sbjct  65   SNGSCDYPTRVMTAVLLTLLSISCFLSSFTDSVKAEDGNVYYGFATRKGMWVFDYPDPSG  124

Query  417  SLPPELAAKYKVKFIDFVHAVMSVLVFGAIALFDQNVVSCFXPXPXXEXXXILPXVPVGX  596
               P+L  KY ++ +D++HAV+SVLVFGA+AL D+N V+CF P P      +L  VP+G 
Sbjct  125  LGLPDL-RKYCIRIVDWIHAVLSVLVFGAVALRDKNAVTCFYPAPEQGTKKVLDIVPMGV  183

Query  597  GXVCXXLFVVFPPXXXGIGFPXTXDN  674
            G +C  LF+VFP    G+G+P T D+
Sbjct  184  GVICGLLFLVFPARRHGVGYPVTGDS  209



>ref|XP_002867447.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH43706.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=200

 Score =   190 bits (483),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 89/181 (49%), Positives = 123/181 (68%), Gaps = 1/181 (1%)
 Frame = +3

Query  132  KNLVQKAISQTFQSAAHLANLLPTGAVLAFQLLSPIFSNQGDCDAV-SRFLTASLVAMCG  308
            K+ V++ + +TF+  AHL+NLLPTG+V++FQ++ P+ ++QG C  + SR+LT  LV++C 
Sbjct  20   KSKVERVVRKTFKGTAHLSNLLPTGSVMSFQIMCPVLTHQGQCPTITSRWLTCFLVSLCA  79

Query  309  LSCFLLSFTDSFKDQKGNVCYGVATVKGLWVIDGSASLPPELAAKYKVKFIDFVHAVMSV  488
            +SCFL SFTDS +D  G V YG+AT  GL VIDGS +L  E   KYK+K +DFVHA+MS+
Sbjct  80   ISCFLFSFTDSIRDPNGKVRYGLATWSGLCVIDGSITLTEEEREKYKLKILDFVHAIMSM  139

Query  489  LVFGAIALFDQNVVSCFXPXPXXEXXXILPXVPVGXGXVCXXLFVVFPPXXXGIGFPXTX  668
            LVF A+++FDQNV  C  P P  E   IL  +P   G +C   F+ FP    GIG P T 
Sbjct  140  LVFFAVSMFDQNVTRCLFPVPSEETKEILTSLPFIIGIICGAFFLAFPTRRHGIGSPLTK  199

Query  669  D  671
            +
Sbjct  200  E  200



>ref|XP_011088116.1| PREDICTED: uncharacterized protein LOC105169422 [Sesamum indicum]
Length=208

 Score =   190 bits (483),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 92/180 (51%), Positives = 120/180 (67%), Gaps = 3/180 (2%)
 Frame = +3

Query  144  QKAISQTFQSAAHLANLLPTGAVLAFQLLSPIFSNQGDCDAVSRFLTASLVAMCGLSCFL  323
            Q  +SQ  +S+AHLANLLPTG +LAFQLL+P+F+N G CD V+R +T  L+ +   SCFL
Sbjct  29   QSMLSQALESSAHLANLLPTGTLLAFQLLTPVFTNNGSCDMVTRNMTLVLLFILAFSCFL  88

Query  324  LSFTDSFKDQKGNVCYGVATVKGLWVIDG---SASLPPELAAKYKVKFIDFVHAVMSVLV  494
             SFTDS K   G V YG AT +G+W+ D    +AS P    +KY+++ +D VHAV+SVLV
Sbjct  89   ASFTDSIKASDGQVYYGFATSRGMWLFDYPTVAASGPAIELSKYRLRLVDLVHAVLSVLV  148

Query  495  FGAIALFDQNVVSCFXPXPXXEXXXILPXVPVGXGXVCXXLFVVFPPXXXGIGFPXTXDN  674
            F A+AL D+NVVSC  P P  E   +L  VP+G G +   LFV+FP    GIG+P T D 
Sbjct  149  FAAVALRDKNVVSCLYPSPGHEVQEVLDIVPMGIGLISSLLFVIFPTKRHGIGYPITRDR  208



>ref|XP_006282893.1| hypothetical protein CARUB_v10007137mg [Capsella rubella]
 gb|EOA15791.1| hypothetical protein CARUB_v10007137mg [Capsella rubella]
Length=219

 Score =   191 bits (484),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 100/197 (51%), Positives = 131/197 (66%), Gaps = 9/197 (5%)
 Frame = +3

Query  93   SEKVPLLVPDEVEKNLVQKAISQTFQSAAHLANLLPTGAVLAFQLLSPIFSNQGDCDAVS  272
            SE VP L     +++  Q+A+SQT  SAA+LANLLPTG +LAF LL P+F++ G CD  +
Sbjct  24   SESVPQL---RRQRSTSQRAMSQTLTSAANLANLLPTGTLLAFTLLIPVFTSNGSCDHAT  80

Query  273  RFLTASLVAMCGLSCFLLSFTDSFKDQKGNVCYGVATVKGLWVID----GSASLPPELAA  440
            R LT  L+ +  +SCFL SFTDS K + GNV YG AT KG+WV D        LP    +
Sbjct  81   RVLTTVLLTLLAISCFLSSFTDSVKAEDGNVYYGFATRKGMWVFDYPDPNGLGLPD--LS  138

Query  441  KYKVKFIDFVHAVMSVLVFGAIALFDQNVVSCFXPXPXXEXXXILPXVPVGXGXVCXXLF  620
            KY+++ +D++HAV+SVLVFGA+AL D+N VSCF P P  E   +L  VP+G G +C  LF
Sbjct  139  KYRIRIVDWIHAVLSVLVFGAVALRDKNAVSCFYPAPEQETKKVLDIVPMGVGVLCGLLF  198

Query  621  VVFPPXXXGIGFPXTXD  671
            +VFP    GIG+P T D
Sbjct  199  LVFPARRHGIGYPVTGD  215



>ref|XP_012066657.1| PREDICTED: uncharacterized protein LOC105629654 [Jatropha curcas]
 gb|KDP42435.1| hypothetical protein JCGZ_00232 [Jatropha curcas]
Length=226

 Score =   190 bits (483),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 98/179 (55%), Positives = 124/179 (69%), Gaps = 2/179 (1%)
 Frame = +3

Query  135  NLVQKAISQTFQSAAHLANLLPTGAVLAFQLLSPIFSNQGDCDAVSRFLTASLVAMCGLS  314
             L Q+AISQT  S A+LANLLPTG +LAFQLL+P+F+  G CD+V++FLT  L+++  +S
Sbjct  45   TLSQRAISQTLTSTANLANLLPTGTLLAFQLLTPVFTKNGACDSVTQFLTFVLLSLLAVS  104

Query  315  CFLLSFTDSFKDQKGNVCYGVATVKGLWVID--GSASLPPELAAKYKVKFIDFVHAVMSV  488
            CFL SFTDS K   G V YG AT KG+++ D     SL  +   KY++KFID VHAV+SV
Sbjct  105  CFLASFTDSIKSTDGQVYYGFATFKGIFLFDCPDPESLGDQDLRKYRIKFIDGVHAVLSV  164

Query  489  LVFGAIALFDQNVVSCFXPXPXXEXXXILPXVPVGXGXVCXXLFVVFPPXXXGIGFPXT  665
            LVF A+AL D+NV+SCF   P  E   +L  VPVG G +C  LFVVFP    GIG+P T
Sbjct  165  LVFVAVALKDKNVLSCFFSMPQQETQEVLDIVPVGIGLICSLLFVVFPTRRHGIGYPVT  223



>emb|CDY29909.1| BnaA03g49300D [Brassica napus]
Length=200

 Score =   189 bits (480),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 91/181 (50%), Positives = 124/181 (69%), Gaps = 1/181 (1%)
 Frame = +3

Query  132  KNLVQKAISQTFQSAAHLANLLPTGAVLAFQLLSPIFSNQGDCDAV-SRFLTASLVAMCG  308
            K+ VQK   + F+  AHL+NLLPTG+V+ FQ++ P+ ++QG C  + SR+LT  LV +C 
Sbjct  20   KSKVQKVARKAFKGTAHLSNLLPTGSVMGFQIMCPVLTHQGQCPTIASRWLTCFLVFVCA  79

Query  309  LSCFLLSFTDSFKDQKGNVCYGVATVKGLWVIDGSASLPPELAAKYKVKFIDFVHAVMSV  488
             SCFLLSFTDSF+D +G V YG+AT  GL V+DG+ +L  E   KYK++FIDF+HA+MS+
Sbjct  80   ASCFLLSFTDSFRDPRGKVRYGLATPSGLMVMDGTITLTEEEKEKYKLRFIDFMHAIMSM  139

Query  489  LVFGAIALFDQNVVSCFXPXPXXEXXXILPXVPVGXGXVCXXLFVVFPPXXXGIGFPXTX  668
            LVF AI++FDQNV+ C  P P  +   +L  +P   G VC   F+VFP    GIG P T 
Sbjct  140  LVFFAISMFDQNVIRCLFPVPSEDTKELLTGLPFIIGVVCGGFFLVFPTRRHGIGSPLTK  199

Query  669  D  671
            +
Sbjct  200  E  200



>emb|CDX92877.1| BnaC07g41350D [Brassica napus]
Length=200

 Score =   189 bits (479),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 90/181 (50%), Positives = 125/181 (69%), Gaps = 1/181 (1%)
 Frame = +3

Query  132  KNLVQKAISQTFQSAAHLANLLPTGAVLAFQLLSPIFSNQGDCDAV-SRFLTASLVAMCG  308
            K+ VQK   + F+  AHL+NLLPTG+V+ FQ++ P+ ++QG C  + SR+LT  LV +C 
Sbjct  20   KSKVQKVARKAFKGTAHLSNLLPTGSVMGFQIMCPVLTHQGQCPTIASRWLTCFLVFVCA  79

Query  309  LSCFLLSFTDSFKDQKGNVCYGVATVKGLWVIDGSASLPPELAAKYKVKFIDFVHAVMSV  488
            +SCFLLSFTDSF+D +G V YG+AT  GL V+DG+ +L  E   KYK++F+DF+HA+MS+
Sbjct  80   VSCFLLSFTDSFRDPRGKVRYGLATPSGLMVMDGTITLTEEEKEKYKLRFLDFMHAIMSM  139

Query  489  LVFGAIALFDQNVVSCFXPXPXXEXXXILPXVPVGXGXVCXXLFVVFPPXXXGIGFPXTX  668
            LVF AI++FDQNV+ C  P P  +   +L  +P   G VC   F+VFP    GIG P T 
Sbjct  140  LVFFAISMFDQNVIRCLFPVPSEDTKELLTGLPFIIGVVCGGFFLVFPTRRHGIGSPLTK  199

Query  669  D  671
            +
Sbjct  200  E  200



>emb|CDY38387.1| BnaC01g09960D [Brassica napus]
Length=200

 Score =   189 bits (479),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 95/200 (48%), Positives = 131/200 (66%), Gaps = 6/200 (3%)
 Frame = +3

Query  90   VSEKVPLLVPDEVE-----KNLVQKAISQTFQSAAHLANLLPTGAVLAFQLLSPIFSNQG  254
            + E  PLL+    E     K+ VQK   + F+  AHL+NLLPTG+V+ FQ++ P+ S+QG
Sbjct  1    MEETQPLLIASLPEAPRKPKSKVQKMARKAFKGTAHLSNLLPTGSVMGFQIMCPVLSHQG  60

Query  255  DCDAV-SRFLTASLVAMCGLSCFLLSFTDSFKDQKGNVCYGVATVKGLWVIDGSASLPPE  431
             C  + SR+LT  LV +C +SCFLLSFTDSF+D +G V YG+AT  GL V++GS +L  E
Sbjct  61   QCPTIASRWLTCFLVFVCAVSCFLLSFTDSFRDPRGKVRYGLATRSGLSVMEGSITLTDE  120

Query  432  LAAKYKVKFIDFVHAVMSVLVFGAIALFDQNVVSCFXPXPXXEXXXILPXVPVGXGXVCX  611
               KYK++F+DFVHA MS+LVF AI++ DQNV+ C  P P  +   +L  +P+  G +C 
Sbjct  121  EKEKYKLRFLDFVHAFMSMLVFFAISMIDQNVIRCLFPVPSEDIKELLTSLPIIIGVICG  180

Query  612  XLFVVFPPXXXGIGFPXTXD  671
              F+VFP    GIG P T +
Sbjct  181  GFFLVFPTRRHGIGSPLTKE  200



>emb|CDP12432.1| unnamed protein product [Coffea canephora]
Length=222

 Score =   189 bits (480),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 103/213 (48%), Positives = 134/213 (63%), Gaps = 8/213 (4%)
 Frame = +3

Query  42   MDIHVG-DEELSHNN------VVVSEKVPLLVPDEVEKN-LVQKAISQTFQSAAHLANLL  197
            MDI V      S NN      ++ S+K P     + ++N L+ +AIS TF+  A+LA  L
Sbjct  1    MDIKVEIPAPQSTNNGDAKTPLLASQKSPSTTTPQTDQNSLIAQAISSTFKGTAYLACRL  60

Query  198  PTGAVLAFQLLSPIFSNQGDCDAVSRFLTASLVAMCGLSCFLLSFTDSFKDQKGNVCYGV  377
            PTG VLAFQLLSPI SNQG CD   + +TA L+++C +SCF+LSFTDSFKD+KG V +G 
Sbjct  61   PTGTVLAFQLLSPILSNQGVCDVAFKTMTAILLSLCAVSCFILSFTDSFKDEKGKVFFGF  120

Query  378  ATVKGLWVIDGSASLPPELAAKYKVKFIDFVHAVMSVLVFGAIALFDQNVVSCFXPXPXX  557
            AT KG + ID + ++ P  AAK K+   DF+ A +S+LVF  IAL D+N+V CF   P  
Sbjct  121  ATFKGFYPIDRTVTISPAEAAKKKIGPFDFLQAFLSMLVFATIALLDKNIVDCFYATPSV  180

Query  558  EXXXILPXVPVGXGXVCXXLFVVFPPXXXGIGF  656
            E   +L  +PV  G VC  LFV FP    GIGF
Sbjct  181  EIKEVLSVLPVANGVVCSMLFVAFPTQRHGIGF  213



>ref|XP_010038679.1| PREDICTED: uncharacterized protein LOC104427259 [Eucalyptus grandis]
 gb|KCW47262.1| hypothetical protein EUGRSUZ_K01059 [Eucalyptus grandis]
Length=209

 Score =   189 bits (479),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 97/184 (53%), Positives = 126/184 (68%), Gaps = 1/184 (1%)
 Frame = +3

Query  117  PDEVEKNLVQKAISQTFQSAAHLANLLPTGAVLAFQLLSPIFSNQGDC-DAVSRFLTASL  293
            P    K   QKA+ +TF+  AHLANLLPTG VLAFQ++SP+ ++QG C  +++  LT +L
Sbjct  24   PRRQPKTPAQKAVRKTFKLTAHLANLLPTGTVLAFQVVSPVLTHQGKCPTSLNHTLTLAL  83

Query  294  VAMCGLSCFLLSFTDSFKDQKGNVCYGVATVKGLWVIDGSASLPPELAAKYKVKFIDFVH  473
            +A+C  SCF LSFTDS +D+ G V +G+AT KGL V+DGS  L PE A +Y+++ +D +H
Sbjct  84   LALCAASCFFLSFTDSIRDECGKVRHGIATFKGLLVLDGSVRLSPEEADRYRIRLLDLLH  143

Query  474  AVMSVLVFGAIALFDQNVVSCFXPXPXXEXXXILPXVPVGXGXVCXXLFVVFPPXXXGIG  653
             VMSVLVF AIALFD NVV CF P P  E   +L  VP+G G  C  +F+ FP    GIG
Sbjct  144  GVMSVLVFAAIALFDPNVVRCFYPSPSEEARRLLMAVPIGVGVACSLVFLAFPTKRHGIG  203

Query  654  FPXT  665
            FP T
Sbjct  204  FPLT  207



>emb|CAN73827.1| hypothetical protein VITISV_003176 [Vitis vinifera]
Length=533

 Score =   197 bits (502),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 99/192 (52%), Positives = 134/192 (70%), Gaps = 8/192 (4%)
 Frame = +3

Query  42   MDIHV-GDEELSHNNVVVSEKVPLL----VPDEVEKNLVQKAISQTFQSAAHLANLLPTG  206
            M++ V  DEE+    V+  +  PLL    +P+++ K  +Q+ I +TF+  AHL+NLLPTG
Sbjct  1    MEVKVQTDEEV--QRVIEQQLQPLLEHSPIPEKLMKTPLQRFIRKTFKGTAHLSNLLPTG  58

Query  207  AVLAFQLLSPIFSNQGDC-DAVSRFLTASLVAMCGLSCFLLSFTDSFKDQKGNVCYGVAT  383
             VL FQ+ SPI +N+G C  + +  LT  L+A C  SCF+LSFTDSF+D KG V YG+AT
Sbjct  59   TVLGFQMFSPILTNKGHCLTSATHSLTLGLLAACCASCFILSFTDSFRDAKGKVRYGLAT  118

Query  384  VKGLWVIDGSASLPPELAAKYKVKFIDFVHAVMSVLVFGAIALFDQNVVSCFXPXPXXEX  563
             +GLWVIDGS +L P++AA Y++KFIDFVHA MS++VF A+ALFDQN+V CF P P  E 
Sbjct  119  SRGLWVIDGSVTLAPDVAAGYRLKFIDFVHAFMSIVVFAAVALFDQNIVKCFCPMPSEET  178

Query  564  XXILPXVPVGXG  599
              +L  VP+  G
Sbjct  179  KKLLVAVPLWTG  190



>ref|XP_006349331.1| PREDICTED: uncharacterized protein LOC102592013 [Solanum tuberosum]
Length=230

 Score =   189 bits (480),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 99/180 (55%), Positives = 122/180 (68%), Gaps = 6/180 (3%)
 Frame = +3

Query  150  AISQT-FQSAAHLANLLPTGAVLAFQLLSPIFSNQGDCDAVSRFLTASLVAMCGLSCFLL  326
            +ISQ   +S AHLANLLPTG +LAFQLL PIF+N G CD  SR +T  L+A+   SCFL 
Sbjct  51   SISQRALESTAHLANLLPTGTLLAFQLLIPIFTNNGTCDTASRPMTLILLALLAFSCFLA  110

Query  327  SFTDSFKDQKGNVCYGVATVKGLWVIDGSAS----LPPELAAKYKVKFIDFVHAVMSVLV  494
             FTDS+K   G + YG+AT KGLW+ D  A+    +P EL  +Y+V FIDFVHAV+SVLV
Sbjct  111  CFTDSYKAPDGQIYYGLATFKGLWIFDYQAASISGVPGEL-NRYRVGFIDFVHAVLSVLV  169

Query  495  FGAIALFDQNVVSCFXPXPXXEXXXILPXVPVGXGXVCXXLFVVFPPXXXGIGFPXTXDN  674
            F A+AL D+NV +CF P P  +   +L  VP+G G +C  LFVVFP    GIGFP T D 
Sbjct  170  FIAVALRDKNVANCFYPTPDHDTKQVLDVVPIGIGVICSLLFVVFPTRRHGIGFPVTPDK  229



>ref|XP_007226107.1| hypothetical protein PRUPE_ppa010943mg [Prunus persica]
 gb|EMJ27306.1| hypothetical protein PRUPE_ppa010943mg [Prunus persica]
Length=229

 Score =   189 bits (480),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 100/186 (54%), Positives = 127/186 (68%), Gaps = 4/186 (2%)
 Frame = +3

Query  117  PDEVEKNLVQKAISQTFQSAAHLANLLPTGAVLAFQLLSPIFSNQGDCDAVSRFLTASLV  296
            P   +  L Q+AISQT  S A+LANLLPTG +LAFQLL+PIF++ G CD+ +R +T  L+
Sbjct  42   PQLPQPTLSQRAISQTLTSTANLANLLPTGTLLAFQLLTPIFTSNGSCDSATRPMTLILL  101

Query  297  AMCGLSCFLLSFTDSFKDQKGNVCYGVATVKGLWVI---DGSASLPPELAAKYKVKFIDF  467
             +  LSCF+ S TDS K   G V YG+AT KGL++    D S S  P+L +KYK++F+D 
Sbjct  102  LLFALSCFIASLTDSVKASDGQVYYGLATTKGLFLFDYPDASGSGLPDL-SKYKIRFMDL  160

Query  468  VHAVMSVLVFGAIALFDQNVVSCFXPXPXXEXXXILPXVPVGXGXVCXXLFVVFPPXXXG  647
            VHAV+SV VFGA+AL D+NVV CF P P  E   +L  VPVG G +C  LFVVFP    G
Sbjct  161  VHAVLSVFVFGAVALRDKNVVGCFYPTPGRETQEVLDIVPVGIGLICSLLFVVFPTKRHG  220

Query  648  IGFPXT  665
            IG+P T
Sbjct  221  IGYPLT  226



>gb|EYU22091.1| hypothetical protein MIMGU_mgv1a013831mg [Erythranthe guttata]
Length=209

 Score =   188 bits (477),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 93/185 (50%), Positives = 128/185 (69%), Gaps = 5/185 (3%)
 Frame = +3

Query  132  KNLVQKAISQTFQSAAHLANLLPTGAVLAFQLLSPIFSNQGDCDA-VSRFLTASLVAMCG  308
            K   QKA+ + F+  AHL+NL PTG+VL FQ+LSP+F+++G C + VS+  T  L+ +C 
Sbjct  25   KTPAQKAVRKAFKGTAHLSNLPPTGSVLTFQILSPVFTHEGKCKSFVSQSTTLFLLGLCS  84

Query  309  LSCFLLSFTDSFKDQKGNVCYGVATVKGLWVIDGSASLPPELAA----KYKVKFIDFVHA  476
            +SCFLL FTDSF+D++G V YG+AT +GLW+IDG     P +A     KY++ F DF HA
Sbjct  85   VSCFLLCFTDSFRDERGKVRYGLATFRGLWIIDGGGPAAPAMAPEEAAKYRLGFGDFFHA  144

Query  477  VMSVLVFGAIALFDQNVVSCFXPXPXXEXXXILPXVPVGXGXVCXXLFVVFPPXXXGIGF  656
            +MSV+VF A+A+FDQNV++CF P P  E   IL  +PV  G +C  LFV+FP    GIGF
Sbjct  145  LMSVMVFAAVAMFDQNVINCFYPEPSEEALEILTALPVTVGVICSILFVIFPTRRHGIGF  204

Query  657  PXTXD  671
            P + +
Sbjct  205  PLSRN  209



>ref|NP_001057588.1| Os06g0352200 [Oryza sativa Japonica Group]
 dbj|BAD36000.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF19502.1| Os06g0352200 [Oryza sativa Japonica Group]
 gb|EAZ00868.1| hypothetical protein OsI_22894 [Oryza sativa Indica Group]
 dbj|BAG92668.1| unnamed protein product [Oryza sativa Japonica Group]
Length=253

 Score =   189 bits (481),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 90/177 (51%), Positives = 120/177 (68%), Gaps = 0/177 (0%)
 Frame = +3

Query  129  EKNLVQKAISQTFQSAAHLANLLPTGAVLAFQLLSPIFSNQGDCDAVSRFLTASLVAMCG  308
            E   +++ I++ F+S A LA  LPTGAVL F++LSP+F+N G C  V+R +TA LV +C 
Sbjct  73   ETTRLERTITRAFRSTAELAKHLPTGAVLVFEVLSPVFTNGGKCQDVNRVMTAWLVGLCA  132

Query  309  LSCFLLSFTDSFKDQKGNVCYGVATVKGLWVIDGSASLPPELAAKYKVKFIDFVHAVMSV  488
             +CF L FTDSF D KG V Y VAT  GLWVIDG+A  PP++AA Y+++FIDF HAV+S+
Sbjct  133  AACFFLCFTDSFHDGKGTVRYVVATRAGLWVIDGTAPPPPDVAATYRLRFIDFFHAVLSL  192

Query  489  LVFGAIALFDQNVVSCFXPXPXXEXXXILPXVPVGXGXVCXXLFVVFPPXXXGIGFP  659
            +VF ++A+FD NV +CF P    +   +L  VP+  G V   LF  FP    GIGFP
Sbjct  193  IVFLSVAMFDHNVGACFYPVMSYDTRQVLTDVPLAGGLVGTMLFATFPSTRHGIGFP  249



>ref|XP_010433789.1| PREDICTED: uncharacterized protein LOC104717852 [Camelina sativa]
Length=219

 Score =   188 bits (477),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 102/216 (47%), Positives = 135/216 (63%), Gaps = 18/216 (8%)
 Frame = +3

Query  63   EELSHNNVVVS---------EKVPLLVPDEVEKNLVQKAISQTFQSAAHLANLLPTGAVL  215
              ++H N ++S         E VP L      ++  Q A+SQT  SAA+LANLLPTG +L
Sbjct  5    SSITHRNPIISQQNGSQEGSESVPKL---RRLRSTSQNAMSQTLTSAANLANLLPTGTLL  61

Query  216  AFQLLSPIFSNQGDCDAVSRFLTASLVAMCGLSCFLLSFTDSFKDQKGNVCYGVATVKGL  395
            AF LL PIF++ G CD  +R LT  L+ +  +SCFL SFTDS K + GNV YG AT KG+
Sbjct  62   AFTLLIPIFTSNGSCDHANRILTTGLLTLLAISCFLSSFTDSVKAEDGNVYYGFATHKGM  121

Query  396  WVID----GSASLPPELAAKYKVKFIDFVHAVMSVLVFGAIALFDQNVVSCFXPXPXXEX  563
            WV D        LP    +KY+++ +D++HAV+SVLVFGA+AL D+N VSCF P P  E 
Sbjct  122  WVFDYPDPNGLGLPD--LSKYRMRIVDWIHAVLSVLVFGAVALRDKNAVSCFYPAPEQET  179

Query  564  XXILPXVPVGXGXVCXXLFVVFPPXXXGIGFPXTXD  671
              +L  +P+G G +C  LF+VFP    GIG+P T D
Sbjct  180  KKVLDIIPMGVGVICSLLFLVFPARRHGIGYPVTGD  215



>gb|KJB16181.1| hypothetical protein B456_002G216600 [Gossypium raimondii]
Length=222

 Score =   188 bits (477),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 98/179 (55%), Positives = 121/179 (68%), Gaps = 2/179 (1%)
 Frame = +3

Query  135  NLVQKAISQTFQSAAHLANLLPTGAVLAFQLLSPIFSNQGDCDAVSRFLTASLVAMCGLS  314
             L Q+AISQT  S A+LANLLPTG +LAFQLL P F+N G CDA +R +T  L+ +  LS
Sbjct  41   TLSQRAISQTLASTANLANLLPTGTLLAFQLLVPTFTNNGSCDAATRSMTLLLLLLLALS  100

Query  315  CFLLSFTDSFKDQKGNVCYGVATVKGLWVIDGSASLPPELA--AKYKVKFIDFVHAVMSV  488
            CFL SFTDS K   G V YG AT KG+++ D   S   +L   +KY++KF+D VHAV+SV
Sbjct  101  CFLASFTDSVKSSDGQVYYGFATFKGMFLFDYPDSKESDLPDLSKYRIKFMDGVHAVLSV  160

Query  489  LVFGAIALFDQNVVSCFXPXPXXEXXXILPXVPVGXGXVCXXLFVVFPPXXXGIGFPXT  665
            LVFG +AL D+NV++CF P P  E   +L   PVG G VC  LFVVFP    GIG+P T
Sbjct  161  LVFGVVALRDKNVLNCFYPTPKHETEEVLNIAPVGVGLVCSLLFVVFPTRRHGIGYPVT  219



>ref|XP_009109249.1| PREDICTED: uncharacterized protein LOC103834908 [Brassica rapa]
Length=219

 Score =   188 bits (477),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 95/184 (52%), Positives = 127/184 (69%), Gaps = 4/184 (2%)
 Frame = +3

Query  129  EKNLVQKAISQTFQSAAHLANLLPTGAVLAFQLLSPIFSNQGDCDAVSRFLTASLVAMCG  308
            +++   +A+SQT  SAA+LANLLPTG +LAFQLL P+F+  G C+  +R LT  L+ +  
Sbjct  33   QRSTSHQAMSQTLTSAANLANLLPTGTLLAFQLLIPVFTTNGSCEYATRVLTLVLLTLLS  92

Query  309  LSCFLLSFTDSFKDQKGNVCYGVATVKGLWVIDG---SASLPPELAAKYKVKFIDFVHAV  479
            +SCFL SFTDS K + GNV YG AT KG+WV D    S    P+L +KYK++F+D++HAV
Sbjct  93   ISCFLSSFTDSVKAEDGNVYYGFATRKGMWVFDYPDPSGLGLPDL-SKYKIRFVDWIHAV  151

Query  480  MSVLVFGAIALFDQNVVSCFXPXPXXEXXXILPXVPVGXGXVCXXLFVVFPPXXXGIGFP  659
            +S+LVFGA+A+ D N VSCF P P  E   +L  VPVG G +C  LF+VFP    G+G+P
Sbjct  152  LSMLVFGAVAMRDNNAVSCFYPAPEQETKKVLDIVPVGVGVICSLLFLVFPTRRHGVGYP  211

Query  660  XTXD  671
             T D
Sbjct  212  VTGD  215



>ref|XP_010555098.1| PREDICTED: uncharacterized protein LOC104824685 [Tarenaya hassleriana]
Length=199

 Score =   187 bits (475),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 89/181 (49%), Positives = 118/181 (65%), Gaps = 1/181 (1%)
 Frame = +3

Query  132  KNLVQKAISQTFQSAAHLANLLPTGAVLAFQLLSPIFSNQGDC-DAVSRFLTASLVAMCG  308
            K+  QK + +TF+    L+ LLPTG+VL FQ+L P+ ++QG C    SR LT  LV +C 
Sbjct  19   KSKAQKVVRKTFKGTTQLSKLLPTGSVLTFQILCPVLTHQGQCPTQASRSLTLFLVFLCA  78

Query  309  LSCFLLSFTDSFKDQKGNVCYGVATVKGLWVIDGSASLPPELAAKYKVKFIDFVHAVMSV  488
             SCFLLSFTDS +DQ G V YG+AT  GLWV+DGS  L    A KY+++F+DF HA MS+
Sbjct  79   FSCFLLSFTDSCRDQFGKVRYGLATATGLWVMDGSVELAGAEAEKYRLRFLDFAHATMSM  138

Query  489  LVFGAIALFDQNVVSCFXPXPXXEXXXILPXVPVGXGXVCXXLFVVFPPXXXGIGFPXTX  668
            LVFGA+ +FD+NVV C  P P  E   +L  +P+  G +C   F+VFP    GIG P + 
Sbjct  139  LVFGAVTMFDKNVVRCLFPVPSEEVKELLMRLPIMVGFICVAFFLVFPTRRHGIGSPLSK  198

Query  669  D  671
            +
Sbjct  199  E  199



>emb|CDY24837.1| BnaA08g14730D [Brassica napus]
Length=219

 Score =   187 bits (476),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 94/184 (51%), Positives = 127/184 (69%), Gaps = 4/184 (2%)
 Frame = +3

Query  129  EKNLVQKAISQTFQSAAHLANLLPTGAVLAFQLLSPIFSNQGDCDAVSRFLTASLVAMCG  308
            +++   +A+SQT  SAA+LANLLPTG +LAFQLL P+F+  G C+  +R LT  L+ +  
Sbjct  33   QRSTSHQAMSQTLTSAANLANLLPTGTLLAFQLLIPVFTTNGSCEYATRVLTLVLLTLLS  92

Query  309  LSCFLLSFTDSFKDQKGNVCYGVATVKGLWVIDG---SASLPPELAAKYKVKFIDFVHAV  479
            +SCFL SFTDS K + GNV YG AT KG+WV D    S    P+L +KY+++F+D++HAV
Sbjct  93   ISCFLSSFTDSVKAEDGNVYYGFATRKGMWVFDYPDPSGLGLPDL-SKYRIRFVDWIHAV  151

Query  480  MSVLVFGAIALFDQNVVSCFXPXPXXEXXXILPXVPVGXGXVCXXLFVVFPPXXXGIGFP  659
            +S+LVFGA+A+ D N VSCF P P  E   +L  VPVG G +C  LF+VFP    G+G+P
Sbjct  152  LSMLVFGAVAMRDNNAVSCFYPAPEQETKKVLDIVPVGVGVICSLLFLVFPTRRHGVGYP  211

Query  660  XTXD  671
             T D
Sbjct  212  VTGD  215



>ref|XP_008810912.1| PREDICTED: uncharacterized protein LOC103722217 [Phoenix dactylifera]
Length=226

 Score =   187 bits (476),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 91/183 (50%), Positives = 128/183 (70%), Gaps = 4/183 (2%)
 Frame = +3

Query  135  NLVQKAISQTFQSAAHLANLLPTGAVLAFQLLSPIFSNQGDCDAVSRFLTASLVAMCGLS  314
            +L ++A++Q   S AHLANLLPTG +LAF LL+P+F+  G CDA +RF+T SL+ +   S
Sbjct  45   SLSRQALAQAITSTAHLANLLPTGTLLAFHLLTPVFTKNGSCDAATRFVTRSLLLLLAAS  104

Query  315  CFLLSFTDSFKDQKGNVCYGVATVKGLWVID---GSASLPPELAAKYKVKFIDFVHAVMS  485
            CFL  FTDSF+   G + +G AT++G+W+ D     +S PP+L +KY+++F+DFVHAV+S
Sbjct  105  CFLACFTDSFRSPDGRLYHGFATLRGMWLFDYPLPPSSAPPDL-SKYRLRFVDFVHAVLS  163

Query  486  VLVFGAIALFDQNVVSCFXPXPXXEXXXILPXVPVGXGXVCXXLFVVFPPXXXGIGFPXT  665
            VLVF ++AL D+NVV CF P P  E   +L  +P+G G +C  LFVVFP    GIG+P  
Sbjct  164  VLVFASVALRDKNVVDCFYPQPKHETKEVLDILPLGVGVICSLLFVVFPTRRRGIGYPVA  223

Query  666  XDN  674
             +N
Sbjct  224  NEN  226



>ref|XP_004230455.1| PREDICTED: uncharacterized protein LOC101268616 [Solanum lycopersicum]
 ref|XP_010314524.1| PREDICTED: uncharacterized protein LOC101268616 [Solanum lycopersicum]
Length=222

 Score =   187 bits (476),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 104/190 (55%), Positives = 129/190 (68%), Gaps = 7/190 (4%)
 Frame = +3

Query  123  EVEKNLVQK-AISQT-FQSAAHLANLLPTGAVLAFQLLSPIFSNQGDCDAVSRFLTASLV  296
            E E+  + + +ISQ   +S AHLANLLPTG +LAFQLL PIF+N G CD  SR LT  L+
Sbjct  33   EAERPAIPRPSISQRALESTAHLANLLPTGTLLAFQLLIPIFTNNGSCDTASRPLTLVLL  92

Query  297  AMCGLSCFLLSFTDSFKDQKGNVCYGVATVKGLWVIDGSAS----LPPELAAKYKVKFID  464
            A+   SCFL  FTDSFK   G + YG+AT KGLW+ D  A+    +P EL ++Y+V FID
Sbjct  93   ALLAFSCFLACFTDSFKAPDGQIYYGLATFKGLWIFDYQAASISGVPGEL-SRYRVGFID  151

Query  465  FVHAVMSVLVFGAIALFDQNVVSCFXPXPXXEXXXILPXVPVGXGXVCXXLFVVFPPXXX  644
            FVHA++SVLVF A+AL D+NVV+CF P P  E   +L  VP+G G +C  LFVVFP    
Sbjct  152  FVHAILSVLVFVAVALRDKNVVNCFYPTPDHETKQVLDVVPIGIGVICSLLFVVFPTRRH  211

Query  645  GIGFPXTXDN  674
            GIGFP T D 
Sbjct  212  GIGFPVTPDK  221



>ref|NP_001145367.1| hypothetical protein [Zea mays]
 gb|ACG47050.1| hypothetical protein [Zea mays]
 gb|AFW86774.1| hypothetical protein ZEAMMB73_868098 [Zea mays]
Length=254

 Score =   188 bits (478),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 90/173 (52%), Positives = 120/173 (69%), Gaps = 0/173 (0%)
 Frame = +3

Query  141  VQKAISQTFQSAAHLANLLPTGAVLAFQLLSPIFSNQGDCDAVSRFLTASLVAMCGLSCF  320
            +++A++Q F+S A LA  LPTGAVLAF++LSP+F+N G CD V+R +T+ LV +C  +CF
Sbjct  78   LERAMAQAFRSTAELAKHLPTGAVLAFEVLSPVFTNGGKCDDVNRVMTSWLVGLCAAACF  137

Query  321  LLSFTDSFKDQKGNVCYGVATVKGLWVIDGSASLPPELAAKYKVKFIDFVHAVMSVLVFG  500
             L FTDSF D KG V Y VAT +GLWVIDG+ + PP  AA+ ++KFIDF HA +SV+VF 
Sbjct  138  FLCFTDSFHDAKGTVRYAVATRRGLWVIDGTPAPPPVEAAEKRIKFIDFFHAFLSVIVFM  197

Query  501  AIALFDQNVVSCFXPXPXXEXXXILPXVPVGXGXVCXXLFVVFPPXXXGIGFP  659
            ++A+FD NV +CF P    +   +L  VP+  G V   LF  FP    GIGFP
Sbjct  198  SVAMFDGNVGACFNPVMSYDTRQVLTAVPLAGGLVGTLLFATFPSTRHGIGFP  250



>emb|CDY34728.1| BnaA01g32970D [Brassica napus]
Length=221

 Score =   187 bits (474),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 93/196 (47%), Positives = 132/196 (67%), Gaps = 6/196 (3%)
 Frame = +3

Query  93   SEKVPLLVPDEVEKNLVQKAISQTFQSAAHLANLLPTGAVLAFQLLSPIFSNQGDCDAVS  272
            S++ PL++  + ++++ Q+A+S T  SAA+L+NLLPTG +LAFQLL+P+F++ G CD  +
Sbjct  25   SDRQPLVL--KRQRSVSQRAMSNTLTSAANLSNLLPTGTLLAFQLLTPVFTSNGVCDHAT  82

Query  273  RFLTASLVAMCGLSCFLLSFTDSFKDQKGNVCYGVATVKGLWVIDG---SASLPPELAAK  443
            RFLTA L+ +   SCF+ SFTDS K   G V YG  T  G+WV+D    S    P+L +K
Sbjct  83   RFLTAGLLFLLAASCFISSFTDSVKTDNGTVYYGFVTFNGMWVVDYADPSGLGLPDL-SK  141

Query  444  YKVKFIDFVHAVMSVLVFGAIALFDQNVVSCFXPXPXXEXXXILPXVPVGXGXVCXXLFV  623
            Y+++F+D++HA +SVLVFGA+AL D+ V  CF P P  E   +L  VPVG G +C  LF 
Sbjct  142  YRMRFVDWIHATLSVLVFGAVALRDKYVTDCFYPSPEEETKHVLDIVPVGIGVICSLLFT  201

Query  624  VFPPXXXGIGFPXTXD  671
            VFP    GIG+  T +
Sbjct  202  VFPTRRLGIGYLVTGN  217



>ref|XP_010439058.1| PREDICTED: uncharacterized protein LOC104722562 [Camelina sativa]
Length=219

 Score =   187 bits (474),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 99/198 (50%), Positives = 128/198 (65%), Gaps = 9/198 (5%)
 Frame = +3

Query  93   SEKVPLLVPDEVEKNLVQKAISQTFQSAAHLANLLPTGAVLAFQLLSPIFSNQGDCDAVS  272
            SE VP L      ++  Q A+SQT  SAA+LANLLPTG +LAF LL P+F++ G CD  S
Sbjct  24   SESVPKL---RRLRSTSQHAMSQTLTSAANLANLLPTGTLLAFTLLIPVFTSNGSCDHAS  80

Query  273  RFLTASLVAMCGLSCFLLSFTDSFKDQKGNVCYGVATVKGLWVID----GSASLPPELAA  440
            R LT  L+ +  +SCFL SFTDS K + GNV YG AT KG+WV D        LP    +
Sbjct  81   RVLTTGLLTLLAISCFLSSFTDSVKAEDGNVYYGFATRKGMWVFDYPDPNGLGLPD--LS  138

Query  441  KYKVKFIDFVHAVMSVLVFGAIALFDQNVVSCFXPXPXXEXXXILPXVPVGXGXVCXXLF  620
            KY+++ +D++HAV+SVLVFGA+A  D+N VSCF P P  E   +L  +P+G G +C  LF
Sbjct  139  KYRMRIVDWIHAVLSVLVFGAVAFRDKNAVSCFYPAPEQETKKVLDIIPMGVGVICSLLF  198

Query  621  VVFPPXXXGIGFPXTXDN  674
            +VFP    GIG+P T D 
Sbjct  199  LVFPARRHGIGYPVTGDR  216



>emb|CDO97610.1| unnamed protein product [Coffea canephora]
Length=223

 Score =   186 bits (473),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 94/193 (49%), Positives = 125/193 (65%), Gaps = 8/193 (4%)
 Frame = +3

Query  117  PDEVEKNLVQKAISQTFQSAAHLANLLPTGAVLAFQLLSPIFSNQGDCDAVSRFLTASLV  296
            P      L Q+A+SQ   S A+LANLLPTG +LAFQLL+P+F+N G CDA +R +T  L+
Sbjct  32   PQRSSSPLSQRALSQALTSTANLANLLPTGTLLAFQLLTPVFTNNGSCDAATRPMTIILL  91

Query  297  AMCGLSCFLLSFTDSFKDQKGNVCYGVATVKGLWVIDGSASLP-------PELAAKYKVK  455
            A+  +SCFL SFTDS K   G V YG AT +G+W+ D   ++        P+L +KY++ 
Sbjct  92   ALLAVSCFLASFTDSVKLSDGQVYYGFATFRGMWLFDARGTIASGSEVGVPDL-SKYRLG  150

Query  456  FIDFVHAVMSVLVFGAIALFDQNVVSCFXPXPXXEXXXILPXVPVGXGXVCXXLFVVFPP  635
            FID+VH+V+SV VF A+AL D+NVV C  P P  E   +L  VP+G G +C  LF+VFP 
Sbjct  151  FIDWVHSVLSVFVFAAVALRDKNVVGCLYPKPDHEVQEVLDIVPIGIGCLCGLLFLVFPT  210

Query  636  XXXGIGFPXTXDN  674
               GIG+P T  N
Sbjct  211  RRHGIGYPVTPGN  223



>ref|XP_009118017.1| PREDICTED: uncharacterized protein LOC103843066 [Brassica rapa]
Length=221

 Score =   186 bits (473),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 93/196 (47%), Positives = 132/196 (67%), Gaps = 6/196 (3%)
 Frame = +3

Query  93   SEKVPLLVPDEVEKNLVQKAISQTFQSAAHLANLLPTGAVLAFQLLSPIFSNQGDCDAVS  272
            S++ PL++  + ++++ Q+A+S T  SAA+L+NLLPTG +LAFQLL+P+F++ G CD  +
Sbjct  25   SDRQPLVL--KRQRSVSQRAMSNTLTSAANLSNLLPTGTLLAFQLLTPVFTSNGVCDHAT  82

Query  273  RFLTASLVAMCGLSCFLLSFTDSFKDQKGNVCYGVATVKGLWVIDG---SASLPPELAAK  443
            RFLTA L+ +   SCF+ SFTDS K   G V YG  T  G+WV+D    S    P+L +K
Sbjct  83   RFLTAGLLFLLAASCFISSFTDSVKADNGTVYYGFVTFNGMWVVDYADPSGLGLPDL-SK  141

Query  444  YKVKFIDFVHAVMSVLVFGAIALFDQNVVSCFXPXPXXEXXXILPXVPVGXGXVCXXLFV  623
            Y+++F+D++HA +SVLVFGA+AL D+ V  CF P P  E   +L  VPVG G +C  LF 
Sbjct  142  YRMRFVDWIHATLSVLVFGAVALRDKYVTDCFYPSPEEETKHVLDIVPVGIGVICSLLFT  201

Query  624  VFPPXXXGIGFPXTXD  671
            VFP    GIG+  T +
Sbjct  202  VFPTRRLGIGYLVTGN  217



>ref|XP_002441515.1| hypothetical protein SORBIDRAFT_09g028420 [Sorghum bicolor]
 gb|EES19945.1| hypothetical protein SORBIDRAFT_09g028420 [Sorghum bicolor]
Length=239

 Score =   187 bits (474),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 109/219 (50%), Positives = 141/219 (64%), Gaps = 13/219 (6%)
 Frame = +3

Query  39   EMDIHVGDEELSHNNVVVSEKVPLLVPDEVEKNL----------VQKAISQTFQSAAHLA  188
            E     GD+  S       ++ PLL  +E  ++L          VQ+AISQT+QS AHLA
Sbjct  18   ESQREQGDDGSSRREQEQEQRRPLL-DEERRRSLAADDGGGMSPVQRAISQTYQSTAHLA  76

Query  189  NLLPTGAVLAFQLLSPIFSNQGDCDAVSRFLTASLVAMCGLSCFLLSFTDSFKD-QKGNV  365
             LLPTG VLAFQLLSP+ + +G C   +R + A+L+A+C LSCF+LSFTDSF+D   G V
Sbjct  77   KLLPTGTVLAFQLLSPVVTAEGHCARANRAMAAALLALCALSCFVLSFTDSFRDAATGAV  136

Query  366  CYGVATVKGLWVIDGSASL-PPELAAKYKVKFIDFVHAVMSVLVFGAIALFDQNVVSCFX  542
             YG AT +GLWVIDG A L  P  AA Y+++F+D VHAV+SV++F A+AL DQNVV+CF 
Sbjct  137  RYGFATSRGLWVIDGGAPLDDPRAAAAYRIRFLDLVHAVVSVMIFAAVALLDQNVVTCFY  196

Query  543  PXPXXEXXXILPXVPVGXGXVCXXLFVVFPPXXXGIGFP  659
            P P  +   +L  +P+  G V   LFV FP    GIGFP
Sbjct  197  PVPSEDARQVLTVLPIAIGVVGSMLFVTFPTTRHGIGFP  235



>ref|XP_010911365.1| PREDICTED: uncharacterized protein LOC105037387 [Elaeis guineensis]
Length=267

 Score =   187 bits (476),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 94/180 (52%), Positives = 126/180 (70%), Gaps = 4/180 (2%)
 Frame = +3

Query  144  QKAISQTFQSAAHLANLLPTGAVLAFQLLSPIFSNQGDCDAVSRFLTASLVAMCGLSCFL  323
            Q AI+Q   S AHL NLLPTG +LAFQLL+P+F+  G CDAV+R +T SL+ +   SCFL
Sbjct  89   QLAIAQALTSTAHLVNLLPTGTLLAFQLLTPVFTKNGSCDAVTRLMTQSLLLLLAASCFL  148

Query  324  LSFTDSFKDQKGNVCYGVATVKGLWVID---GSASLPPELAAKYKVKFIDFVHAVMSVLV  494
              FTDSF+   G + YG+AT++G+W+ D    ++S  PEL+  Y+++FIDFVHAV+SVLV
Sbjct  149  ACFTDSFRLPDGRLYYGLATLRGMWLFDYPPPASSALPELST-YRLRFIDFVHAVLSVLV  207

Query  495  FGAIALFDQNVVSCFXPXPXXEXXXILPXVPVGXGXVCXXLFVVFPPXXXGIGFPXTXDN  674
            F ++AL D+NVV CF P P  E   +L  +P+G G +C  LFVVFP    GIG+P T +N
Sbjct  208  FASVALRDKNVVDCFYPQPKHETKEVLDILPLGVGVICGLLFVVFPTRRHGIGYPDTKEN  267



>ref|XP_010448580.1| PREDICTED: uncharacterized protein LOC104731025 [Camelina sativa]
Length=219

 Score =   186 bits (472),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 98/198 (49%), Positives = 128/198 (65%), Gaps = 9/198 (5%)
 Frame = +3

Query  93   SEKVPLLVPDEVEKNLVQKAISQTFQSAAHLANLLPTGAVLAFQLLSPIFSNQGDCDAVS  272
            SE VP L      ++  Q A+SQT  SAA+LANLLPTG +LAF LL P+F++ G CD  +
Sbjct  24   SESVPKL---RRLRSTSQNAMSQTLTSAANLANLLPTGTLLAFTLLIPVFTSNGSCDHAN  80

Query  273  RFLTASLVAMCGLSCFLLSFTDSFKDQKGNVCYGVATVKGLWVID----GSASLPPELAA  440
            R LT  L+ +  +SCF  SFTDS K + GNV YG AT KG+WV D        LP    +
Sbjct  81   RILTTGLLTLLAISCFFSSFTDSVKAEDGNVYYGFATRKGMWVFDYPDPNGLGLPD--LS  138

Query  441  KYKVKFIDFVHAVMSVLVFGAIALFDQNVVSCFXPXPXXEXXXILPXVPVGXGXVCXXLF  620
            KY+++ +D++HAV+SVLVFGA+AL D+N VSCF P P  E   +L  +P+G G +C  LF
Sbjct  139  KYRMRIVDWIHAVLSVLVFGAVALRDKNAVSCFYPAPEQETKKVLDIIPMGVGVICSLLF  198

Query  621  VVFPPXXXGIGFPXTXDN  674
            +VFP    GIG+P T D 
Sbjct  199  LVFPARRHGIGYPVTGDR  216



>ref|XP_010030168.1| PREDICTED: uncharacterized protein LOC104419998 [Eucalyptus grandis]
 gb|KCW57114.1| hypothetical protein EUGRSUZ_I02761 [Eucalyptus grandis]
Length=225

 Score =   186 bits (472),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 95/180 (53%), Positives = 121/180 (67%), Gaps = 5/180 (3%)
 Frame = +3

Query  144  QKAISQTFQSAAHLANLLPTGAVLAFQLLSPIFSNQGDCDAVSRFLTASLVAMCGLSCFL  323
            Q+AISQT    A+LANLLPTG +LAFQLL P+F+N G CD+ +R LT  L+ +  +SCF+
Sbjct  48   QRAISQTLTGTANLANLLPTGTLLAFQLLMPVFTNNGSCDSATRPLTIILLVLLSVSCFV  107

Query  324  LSFTDSFKDQKGNVCYGVATVKGLWVIDG---SASLPPELAAKYKVKFIDFVHAVMSVLV  494
             SFTDS +   G V YG AT KGL++ D    S SLP    +KYK  FID+VHA++S+LV
Sbjct  108  ASFTDSVRSSDGRVFYGFATAKGLYIFDTTVPSTSLPD--LSKYKRGFIDWVHALLSMLV  165

Query  495  FGAIALFDQNVVSCFXPXPXXEXXXILPXVPVGXGXVCXXLFVVFPPXXXGIGFPXTXDN  674
            FGA+AL D+NVVSC  P    +   +L  VPVG G +C  LFVVFP    GIG+P T + 
Sbjct  166  FGAVALRDKNVVSCLYPAAGHQTQEVLDIVPVGIGLICSLLFVVFPTRRHGIGYPITSEK  225



>ref|XP_008218737.1| PREDICTED: uncharacterized protein LOC103319023 [Prunus mume]
Length=229

 Score =   186 bits (473),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 100/186 (54%), Positives = 126/186 (68%), Gaps = 4/186 (2%)
 Frame = +3

Query  117  PDEVEKNLVQKAISQTFQSAAHLANLLPTGAVLAFQLLSPIFSNQGDCDAVSRFLTASLV  296
            P   +  L Q+AISQT  S A+LANLLPTG +LAFQLL PIF++ G CD+ +R +T  L+
Sbjct  42   PQLPQPTLSQRAISQTLTSTANLANLLPTGTLLAFQLLIPIFTSNGSCDSATRPMTLILL  101

Query  297  AMCGLSCFLLSFTDSFKDQKGNVCYGVATVKGLWVI---DGSASLPPELAAKYKVKFIDF  467
             +  LSCF+ S TDS K   G V YG+AT KGL++    D S S  P+L +KYK++F+D 
Sbjct  102  LLFALSCFVASLTDSVKASDGQVYYGLATTKGLFLFDYPDASCSGLPDL-SKYKIRFMDL  160

Query  468  VHAVMSVLVFGAIALFDQNVVSCFXPXPXXEXXXILPXVPVGXGXVCXXLFVVFPPXXXG  647
            VHAV+SV VFGA+AL D+NVV CF P P  E   +L  VPVG G +C  LFVVFP    G
Sbjct  161  VHAVLSVFVFGAVALRDKNVVGCFYPTPGHETQEVLNIVPVGIGLICSLLFVVFPTKRHG  220

Query  648  IGFPXT  665
            IG+P T
Sbjct  221  IGYPLT  226



>ref|XP_002526458.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF35953.1| conserved hypothetical protein [Ricinus communis]
Length=230

 Score =   186 bits (471),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 98/177 (55%), Positives = 123/177 (69%), Gaps = 3/177 (2%)
 Frame = +3

Query  144  QKAISQTFQSAAHLANLLPTGAVLAFQLLSPIFSNQGDCDAVSRFLTASLVAMCGLSCFL  323
            Q+AISQT  S A+LANLLPTG +LAFQLL+PIF+N G CD+V+R +T  L+A+  +SCFL
Sbjct  51   QRAISQTLTSTANLANLLPTGTLLAFQLLTPIFTNNGACDSVTRPMTLCLLALLAISCFL  110

Query  324  LSFTDSFKDQKG-NVCYGVATVKGLWVIDGSASLPPELA--AKYKVKFIDFVHAVMSVLV  494
             SFTDS K   G  V YG+AT KG+++ D    +   L   +KYK++FID VH+V+SVLV
Sbjct  111  SSFTDSVKSSDGKQVYYGIATFKGIFLFDCPDPVGAGLKDLSKYKIRFIDGVHSVLSVLV  170

Query  495  FGAIALFDQNVVSCFXPXPXXEXXXILPXVPVGXGXVCXXLFVVFPPXXXGIGFPXT  665
            F A AL D+NVVSCF P P  E   +L   PVG G +C  LFVVFP    GIG+P T
Sbjct  171  FIAFALRDKNVVSCFYPMPKHETQEVLNIAPVGIGLICSLLFVVFPTRRHGIGYPVT  227



>emb|CDY08933.1| BnaC08g11630D [Brassica napus]
Length=221

 Score =   185 bits (470),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 93/184 (51%), Positives = 127/184 (69%), Gaps = 4/184 (2%)
 Frame = +3

Query  129  EKNLVQKAISQTFQSAAHLANLLPTGAVLAFQLLSPIFSNQGDCDAVSRFLTASLVAMCG  308
            +++   +A+SQT  SAA+LANLLPTG +LAFQLL P+F+  G C+  +R LT  L+ +  
Sbjct  35   QRSTSHQAMSQTLTSAANLANLLPTGTLLAFQLLIPVFTTNGSCEYATRVLTLVLLTLLS  94

Query  309  LSCFLLSFTDSFKDQKGNVCYGVATVKGLWVIDG---SASLPPELAAKYKVKFIDFVHAV  479
            +SCFL SFTDS K + GNV YG AT KG+WV D    S    P+L +KY+++F+D++HAV
Sbjct  95   ISCFLSSFTDSVKAEDGNVYYGFATRKGMWVFDYPDPSGLGLPDL-SKYRIRFVDWIHAV  153

Query  480  MSVLVFGAIALFDQNVVSCFXPXPXXEXXXILPXVPVGXGXVCXXLFVVFPPXXXGIGFP  659
            +S+LVFGA+A+ D+N VSCF P P  E   +L  VP+G G +C  LF+VFP    G G+P
Sbjct  154  LSMLVFGAVAMRDKNAVSCFYPAPEQETKKVLDIVPIGVGVICGLLFLVFPTRRHGFGYP  213

Query  660  XTXD  671
             T D
Sbjct  214  VTGD  217



>ref|XP_010277272.1| PREDICTED: uncharacterized protein LOC104611772 [Nelumbo nucifera]
Length=229

 Score =   186 bits (471),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 101/194 (52%), Positives = 129/194 (66%), Gaps = 7/194 (4%)
 Frame = +3

Query  105  PLLVPDEVEKNLV-----QKAISQTFQSAAHLANLLPTGAVLAFQLLSPIFSNQGDCDAV  269
            PL++P+    +       Q+AISQT  S AHLANLLPTG +LAFQLL+P F+N G CD+V
Sbjct  26   PLIIPNTATPSSSSPSVSQEAISQTLASTAHLANLLPTGTLLAFQLLTPTFTNNGTCDSV  85

Query  270  SRFLTASLVAMCGLSCFLLSFTDSFKDQKGNVCYGVATVKGLWVID--GSASLPPELAAK  443
            +R  T  L+     SCFL  FTDSFK Q G V +G+AT KG+W+ D  GS++  P+  + 
Sbjct  86   TRPATLILLLALAASCFLACFTDSFKAQDGKVYHGIATRKGMWLFDYAGSSASAPDDLSS  145

Query  444  YKVKFIDFVHAVMSVLVFGAIALFDQNVVSCFXPXPXXEXXXILPXVPVGXGXVCXXLFV  623
            Y++K IDFVHAV+SVLVF A+AL D+N+VSCF P P  E   +L  VPV  G +C  LFV
Sbjct  146  YRIKLIDFVHAVLSVLVFVAVALRDRNIVSCFYPKPKHETQEVLDIVPVAVGLICSLLFV  205

Query  624  VFPPXXXGIGFPXT  665
            VFP    GIG+  T
Sbjct  206  VFPTTRHGIGYHIT  219



>ref|XP_008656036.1| PREDICTED: uncharacterized protein LOC103635334 [Zea mays]
 gb|AFW81116.1| hypothetical protein ZEAMMB73_341777 [Zea mays]
Length=236

 Score =   186 bits (471),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 112/224 (50%), Positives = 138/224 (62%), Gaps = 14/224 (6%)
 Frame = +3

Query  12   NDKEIVRF*EMDIHVGDEELSHNNVVVSEKVPLLVP------DEVEKNLVQKAISQTFQS  173
            ND E  R  E D    D+  S       ++ PLLV       D    + VQ+AISQT+QS
Sbjct  15   NDVESQR--EHD----DDGSSSRREQQEQRRPLLVKRRSLADDGGGMSPVQRAISQTYQS  68

Query  174  AAHLANLLPTGAVLAFQLLSPIFSNQGDCDAVSRFLTASLVAMCGLSCFLLSFTDSFKD-  350
             AHLA LLPTG VLAFQLLSP+ + QG C   +R +  +L+A+C LSCF LSFTDSF+D 
Sbjct  69   TAHLAKLLPTGTVLAFQLLSPVVTAQGHCVRANRAMAGALLALCALSCFALSFTDSFRDA  128

Query  351  QKGNVCYGVATVKGLWVIDGSA-SLPPELAAKYKVKFIDFVHAVMSVLVFGAIALFDQNV  527
              G V YG AT  G+W IDG A    P  AA Y+V+F+D VHAV+SVL+F A+AL DQN+
Sbjct  129  ATGAVRYGFATPWGIWAIDGGAPPDDPRAAAAYRVRFLDLVHAVVSVLIFAAVALLDQNL  188

Query  528  VSCFXPXPXXEXXXILPXVPVGXGXVCXXLFVVFPPXXXGIGFP  659
            V+CF P P  +   +L  +PV  G V   LFV FP    GIGFP
Sbjct  189  VACFYPVPSEDAKQVLTVLPVAIGVVGSMLFVTFPTTRHGIGFP  232



>emb|CDY35189.1| BnaA01g08420D [Brassica napus]
Length=200

 Score =   184 bits (468),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 93/200 (47%), Positives = 130/200 (65%), Gaps = 6/200 (3%)
 Frame = +3

Query  90   VSEKVPLLVPDEVE-----KNLVQKAISQTFQSAAHLANLLPTGAVLAFQLLSPIFSNQG  254
            + E  PLL+    E     K+ VQK   + F+  AHL+NLLPTG+V+ FQ++ P+ S+QG
Sbjct  1    MEETQPLLIASLPEAPRKPKSKVQKMARKAFKGTAHLSNLLPTGSVMGFQIMCPVLSHQG  60

Query  255  DCDAV-SRFLTASLVAMCGLSCFLLSFTDSFKDQKGNVCYGVATVKGLWVIDGSASLPPE  431
             C  + SR+LT  LV +C +SCFLLSFTDSF+D +G V YG+AT  GL V++G+ +L  E
Sbjct  61   QCPTIASRWLTCFLVFVCAVSCFLLSFTDSFRDPRGKVRYGLATRSGLSVMEGTITLTDE  120

Query  432  LAAKYKVKFIDFVHAVMSVLVFGAIALFDQNVVSCFXPXPXXEXXXILPXVPVGXGXVCX  611
               KYK++F+DFVHA MS+LVF AI++ DQNV+ C  P P  +   +L  +P+  G +C 
Sbjct  121  EKEKYKLRFLDFVHAFMSMLVFFAISMIDQNVIRCLFPVPSEDIKELLTSLPIIIGVICG  180

Query  612  XLFVVFPPXXXGIGFPXTXD  671
              F+V P    GIG P T +
Sbjct  181  GFFLVCPTRRHGIGSPLTKE  200



>ref|XP_002437096.1| hypothetical protein SORBIDRAFT_10g021060 [Sorghum bicolor]
 gb|EER88463.1| hypothetical protein SORBIDRAFT_10g021060 [Sorghum bicolor]
Length=278

 Score =   187 bits (474),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 90/177 (51%), Positives = 119/177 (67%), Gaps = 0/177 (0%)
 Frame = +3

Query  129  EKNLVQKAISQTFQSAAHLANLLPTGAVLAFQLLSPIFSNQGDCDAVSRFLTASLVAMCG  308
            E   +++A+++ F+S A LA  LPTGAVL F++LSP+F+N G CD V+R +TA LV +C 
Sbjct  98   EATRLERAMAKAFRSTAELAKHLPTGAVLVFEVLSPVFTNGGKCDDVNRVMTAWLVGLCA  157

Query  309  LSCFLLSFTDSFKDQKGNVCYGVATVKGLWVIDGSASLPPELAAKYKVKFIDFVHAVMSV  488
              CF L FTDSF D KG V Y VAT +G+WVIDG+    PE AA+ +VKFIDF HA MS+
Sbjct  158  AGCFFLCFTDSFHDAKGTVRYVVATRRGVWVIDGTPPPSPEKAAEKRVKFIDFFHAFMSL  217

Query  489  LVFGAIALFDQNVVSCFXPXPXXEXXXILPXVPVGXGXVCXXLFVVFPPXXXGIGFP  659
            +VF ++A+FD+NV +CF P    +   +L  VP+  G V   LF  FP    GIGFP
Sbjct  218  VVFMSVAMFDRNVGACFNPVMSYDTRQVLTAVPLAGGLVGTLLFATFPSTRHGIGFP  274



>ref|XP_010433212.1| PREDICTED: uncharacterized protein LOC104717355 isoform X1 [Camelina 
sativa]
Length=200

 Score =   184 bits (467),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 87/181 (48%), Positives = 121/181 (67%), Gaps = 1/181 (1%)
 Frame = +3

Query  132  KNLVQKAISQTFQSAAHLANLLPTGAVLAFQLLSPIFSNQGDCDAV-SRFLTASLVAMCG  308
            K+  QK + +TF+  A L+NLLPTG+V++FQ++ P+ ++QG C  + SR+LT  LV +C 
Sbjct  20   KSKAQKVVRKTFKGTAQLSNLLPTGSVMSFQIMCPVLTHQGQCPTITSRWLTCFLVFVCA  79

Query  309  LSCFLLSFTDSFKDQKGNVCYGVATVKGLWVIDGSASLPPELAAKYKVKFIDFVHAVMSV  488
            +SCF+ SFTDS +D  G V YG+AT  GL+V+DGS +L  +   KYK+K +DFVHA+MS+
Sbjct  80   ISCFIFSFTDSIRDPNGKVRYGLATWTGLYVVDGSITLTEDEKEKYKLKILDFVHAIMSM  139

Query  489  LVFGAIALFDQNVVSCFXPXPXXEXXXILPXVPVGXGXVCXXLFVVFPPXXXGIGFPXTX  668
            LVF AI++FDQNV  C  P P  E   IL  +P   G +C   F+ FP    GIG P T 
Sbjct  140  LVFFAISMFDQNVTRCLFPVPSAETREILTSLPFVIGVICGGFFLAFPTRRHGIGSPLTK  199

Query  669  D  671
            +
Sbjct  200  E  200



>emb|CBI29711.3| unnamed protein product [Vitis vinifera]
Length=238

 Score =   184 bits (467),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 98/182 (54%), Positives = 119/182 (65%), Gaps = 24/182 (13%)
 Frame = +3

Query  135  NLVQKAISQTFQSAAHLANLLPTGAVLAFQLLSPIFSNQGDCDAVSRFLTASLVAMCGLS  314
             L Q+A+SQT  S A+LANLLPTG +LAFQLL+P+F+N G CDAV+RF            
Sbjct  73   TLRQRALSQTLASTANLANLLPTGTLLAFQLLTPVFTNNGACDAVTRF------------  120

Query  315  CFLLSFTDSFKDQKGNVCYGVATVKGLWVID-----GSASLPPELAAKYKVKFIDFVHAV  479
                  TDSFK   G V YG+AT KGLW+ D     GSA+  P+L+ KYK +FID VHAV
Sbjct  121  ------TDSFKTPDGRVFYGIATFKGLWLFDYVDESGSAASLPDLS-KYKFRFIDGVHAV  173

Query  480  MSVLVFGAIALFDQNVVSCFXPXPXXEXXXILPXVPVGXGXVCXXLFVVFPPXXXGIGFP  659
            +SVLVF A+A+ D+NVVSCF P P  E   +L  VPVG G +C  LFVVFP    GIG+P
Sbjct  174  LSVLVFVAVAMRDKNVVSCFYPQPAREVQEVLDIVPVGIGLICSLLFVVFPTTRHGIGYP  233

Query  660  XT  665
             T
Sbjct  234  VT  235



>ref|XP_010534186.1| PREDICTED: uncharacterized protein LOC104809807 [Tarenaya hassleriana]
Length=224

 Score =   183 bits (465),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 95/185 (51%), Positives = 126/185 (68%), Gaps = 6/185 (3%)
 Frame = +3

Query  123  EVEKNLVQKAISQTFQSAAHLANLLPTGAVLAFQLLSPIFSNQGDCDAVSRFLTASLVAM  302
            + ++++ Q+A+SQT   AA+LANLLPTG +LAFQLL+P F++ G CD  +R  TA L+A+
Sbjct  34   KRQRSMSQRAMSQTLTMAANLANLLPTGTLLAFQLLTPAFTSNGVCDMTTRACTAVLLAL  93

Query  303  CGLSCFLLSFTDSFKDQKGNVCYGVATVKGLWVID----GSASLPPELAAKYKVKFIDFV  470
              LSCFL SFTDS K   GNV YG  T +G+W+ D      A LP    +KY+++ +D++
Sbjct  94   LALSCFLTSFTDSVKADDGNVYYGFVTRRGMWMFDYPDPSGAGLPD--LSKYRIRAMDWI  151

Query  471  HAVMSVLVFGAIALFDQNVVSCFXPXPXXEXXXILPXVPVGXGXVCXXLFVVFPPXXXGI  650
            HAV+SVLVFGA+AL D NV+SCF P P  +   +L  VP+G G VC  LF VFP    GI
Sbjct  152  HAVLSVLVFGAVALRDNNVLSCFYPSPESQTKEVLDIVPMGVGVVCSLLFSVFPSKRHGI  211

Query  651  GFPXT  665
            GFP T
Sbjct  212  GFPVT  216



>ref|NP_194162.1| uncharacterized protein [Arabidopsis thaliana]
 emb|CAB45066.1| putative protein [Arabidopsis thaliana]
 emb|CAB79341.1| putative protein [Arabidopsis thaliana]
 gb|AAO44044.1| At4g24310 [Arabidopsis thaliana]
 dbj|BAF00043.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE84888.1| uncharacterized protein AT4G24310 [Arabidopsis thaliana]
Length=213

 Score =   182 bits (463),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 98/207 (47%), Positives = 129/207 (62%), Gaps = 6/207 (3%)
 Frame = +3

Query  63   EELSHNNVVVSEKVPLLVPDEVEKNLVQKAISQTFQSAAHLANLLPTGAVLAFQLLSPIF  242
              L+  N   S++    VP    +      +SQT  SAA+LANLLPTG +LAF LL P+F
Sbjct  5    SSLTQRNPTSSQEQSESVPQLRRQTSQHAVMSQTLTSAANLANLLPTGTLLAFTLLIPVF  64

Query  243  SNQGDCDAVSRFLTASLVAMCGLSCFLLSFTDSFKDQKGNVCYGVATVKGLWVID----G  410
            ++ G CD  ++ LT  L+ +  +SCFL SFTDS K + GNV YG AT KG+WV D     
Sbjct  65   TSNGSCDYPTQVLTIVLLTLLSISCFLSSFTDSVKAEDGNVYYGFATRKGMWVFDYPDPD  124

Query  411  SASLPPELAAKYKVKFIDFVHAVMSVLVFGAIALFDQNVVSCFXPXPXXEXXXILPXVPV  590
               LP    +KY+++ ID++HAV+SVLVFGA+AL D+N VSCF P P  E   +L  VP+
Sbjct  125  GLGLPN--LSKYRIRIIDWIHAVLSVLVFGAVALRDKNAVSCFYPAPEQETKKVLDIVPM  182

Query  591  GXGXVCXXLFVVFPPXXXGIGFPXTXD  671
            G G +C  LF+VFP    GIG+P T D
Sbjct  183  GVGVICGMLFLVFPARRHGIGYPVTGD  209



>ref|XP_009380593.1| PREDICTED: uncharacterized protein LOC103968948 [Musa acuminata 
subsp. malaccensis]
Length=211

 Score =   182 bits (462),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 95/197 (48%), Positives = 127/197 (64%), Gaps = 7/197 (4%)
 Frame = +3

Query  96   EKVPLLVPD------EVEKNLVQKAISQTFQSAAHLANLLPTGAVLAFQLLSPIFSNQGD  257
            ++ PLL P       E +   +QK + QT++S A+LA  LPTG VLAFQ+LSPI ++ G 
Sbjct  13   QQQPLLTPRGSSSSAEGQMTSLQKLLGQTYESTANLAKCLPTGTVLAFQVLSPILADAGH  72

Query  258  CDAVSRFLTASLVAMCGLSCFLLSFTDSFKDQK-GNVCYGVATVKGLWVIDGSASLPPEL  434
            C   ++ +TA LVA+ GLSCF+LSFTDSF+D+  G V YGVAT+KGLWVID      PEL
Sbjct  73   CTKANQVMTACLVALFGLSCFILSFTDSFRDETTGRVRYGVATIKGLWVIDSLKPPSPEL  132

Query  435  AAKYKVKFIDFVHAVMSVLVFGAIALFDQNVVSCFXPXPXXEXXXILPXVPVGXGXVCXX  614
            AAKY++K IDF+HA +++LVF A+AL D+NV SCF          +L  +P   G +   
Sbjct  133  AAKYRLKLIDFMHASVTLLVFAAVALSDKNVASCFYHIGSENSKKLLEALPAVIGFIAST  192

Query  615  LFVVFPPXXXGIGFPXT  665
            + V FP    GIG P +
Sbjct  193  VCVAFPSTRHGIGSPVS  209



>ref|XP_006413446.1| hypothetical protein EUTSA_v10026158mg [Eutrema salsugineum]
 gb|ESQ54899.1| hypothetical protein EUTSA_v10026158mg [Eutrema salsugineum]
Length=228

 Score =   182 bits (463),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 98/207 (47%), Positives = 134/207 (65%), Gaps = 8/207 (4%)
 Frame = +3

Query  60   DEELSHNNVVVSEKVPLLVPDEVEKNLVQKAISQTFQSAAHLANLLPTGAVLAFQLLSPI  239
            ++ELS        +  L      +++    A+SQT  SAA+LANLLPTG +LAFQLL P+
Sbjct  23   EQELSEPPFPPPPQTQL----RRQRSTTHPAMSQTLTSAANLANLLPTGTLLAFQLLMPV  78

Query  240  FSNQGDCDAVSRFLTASLVAMCGLSCFLLSFTDSFKDQKGNVCYGVATVKGLWVIDG---  410
            F++ G CD  +R LTA L+ +  +SCFL SFTDS K + GNV YG AT KG+WV D    
Sbjct  79   FTSNGSCDYATRVLTAVLLTLLSISCFLSSFTDSVKAEDGNVYYGFATRKGMWVFDYPDP  138

Query  411  SASLPPELAAKYKVKFIDFVHAVMSVLVFGAIALFDQNVVSCFXPXPXXEXXXILPXVPV  590
            S    P+L +KY+V+ +D++HAV+SVLVFGA+AL D+N V+CF P P      +L  VP+
Sbjct  139  SGLGLPDL-SKYRVRIVDWIHAVLSVLVFGAVALRDKNAVTCFYPAPEQGTKKVLDIVPM  197

Query  591  GXGXVCXXLFVVFPPXXXGIGFPXTXD  671
            G G +C  LF++FP    GIG+P T +
Sbjct  198  GVGVLCGMLFLIFPARRHGIGYPVTGN  224



>ref|NP_186892.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AAF32450.1| hypothetical protein [Arabidopsis thaliana]
 gb|AAT68357.1| hypothetical protein At3g02430 [Arabidopsis thaliana]
 gb|AAT69203.1| hypothetical protein At3g02430 [Arabidopsis thaliana]
 gb|AEE73807.1| uncharacterized protein AT3G02430 [Arabidopsis thaliana]
Length=219

 Score =   181 bits (460),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 89/182 (49%), Positives = 124/182 (68%), Gaps = 4/182 (2%)
 Frame = +3

Query  129  EKNLVQKAISQTFQSAAHLANLLPTGAVLAFQLLSPIFSNQGDCDAVSRFLTASLVAMCG  308
            + ++ Q+A+S T  SAA+L+NLLPTG +LAFQLL+P+F++ G CD  +RFLTA L+ +  
Sbjct  33   QMSMSQRAMSNTLTSAANLSNLLPTGTLLAFQLLTPVFTSNGVCDHATRFLTAVLLFLLA  92

Query  309  LSCFLLSFTDSFKDQKGNVCYGVATVKGLWVIDG---SASLPPELAAKYKVKFIDFVHAV  479
             SCF+ SFTDS K   G + +G  T KG+WV+D    S    P+L AKY+++F+D++HA 
Sbjct  93   ASCFVSSFTDSVKADDGTIYFGFVTFKGMWVVDYPDPSGLGLPDL-AKYRMRFVDWIHAT  151

Query  480  MSVLVFGAIALFDQNVVSCFXPXPXXEXXXILPXVPVGXGXVCXXLFVVFPPXXXGIGFP  659
            +SVLVFGA+AL D+ +  CF P P  E   +L  VPVG G +C  LF+VFP    GIG+ 
Sbjct  152  LSVLVFGAVALRDKYITDCFYPSPEAETKHVLDIVPVGVGVMCSLLFMVFPARRHGIGYL  211

Query  660  XT  665
             T
Sbjct  212  VT  213



>ref|XP_009129595.1| PREDICTED: uncharacterized protein LOC103854413 [Brassica rapa]
Length=200

 Score =   181 bits (458),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 93/200 (47%), Positives = 129/200 (65%), Gaps = 6/200 (3%)
 Frame = +3

Query  90   VSEKVPLLVPDEVE-----KNLVQKAISQTFQSAAHLANLLPTGAVLAFQLLSPIFSNQG  254
            + E  PLL+    E     K+ VQK   + F+  AHL+NLLPTG+V+ FQ++ P+ S+QG
Sbjct  1    MEETQPLLIASLPEAPRKPKSKVQKMARKAFKGTAHLSNLLPTGSVMGFQIMCPVLSHQG  60

Query  255  DCDAV-SRFLTASLVAMCGLSCFLLSFTDSFKDQKGNVCYGVATVKGLWVIDGSASLPPE  431
             C  V SR+LT  LV +  +SCFLLSFTDSF+D +G V YG+AT  GL V++G+ +L  E
Sbjct  61   QCPTVASRWLTCFLVFVRAVSCFLLSFTDSFRDPRGKVRYGLATRSGLSVMEGTITLTDE  120

Query  432  LAAKYKVKFIDFVHAVMSVLVFGAIALFDQNVVSCFXPXPXXEXXXILPXVPVGXGXVCX  611
               KYK++F+DFVHA MS+LVF AI++ DQNV+ C  P P  +   +L  +P+  G +C 
Sbjct  121  EKEKYKLRFLDFVHAFMSMLVFFAISMIDQNVIRCLFPVPSEDIKELLTSLPIIIGVICG  180

Query  612  XLFVVFPPXXXGIGFPXTXD  671
              F+V P    GIG P T +
Sbjct  181  GFFLVCPTRRHGIGSPLTKE  200



>gb|EYU26482.1| hypothetical protein MIMGU_mgv1a026928mg [Erythranthe guttata]
Length=221

 Score =   180 bits (457),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 94/182 (52%), Positives = 122/182 (67%), Gaps = 6/182 (3%)
 Frame = +3

Query  144  QKAISQTFQSAAHLANLLPTGAVLAFQLLSPIFSNQGDCDAVSRFLTASLVAMCGLSCFL  323
            Q A+SQ  +S+AHLANLLPTG +LAFQ+L+PIF+  G CD+ +R +T  L+ +  LSCFL
Sbjct  39   QSALSQALESSAHLANLLPTGTLLAFQILTPIFTKNGSCDSATRPMTLVLLVIFTLSCFL  98

Query  324  LSFTDSFKDQ-KGNVCYGVATVKGLWVID----GSASLPPELAAKYKVKFIDFVHAVMSV  488
             SFTDS K    G V YG+ T KGLW+ D     +A   PEL+ KY++ F+D VHAV+SV
Sbjct  99   ASFTDSVKSSTDGKVYYGLVTPKGLWLFDNPGAAAAGGLPELS-KYRLSFVDVVHAVLSV  157

Query  489  LVFGAIALFDQNVVSCFXPXPXXEXXXILPXVPVGXGXVCXXLFVVFPPXXXGIGFPXTX  668
            LVF A+AL D+N+V CF P P  E   +L  VP+G G +   LFV FP    GIG+P T 
Sbjct  158  LVFVAVALRDKNIVGCFYPMPNQEAQEVLDIVPIGIGFIASLLFVAFPTKRHGIGYPITP  217

Query  669  DN  674
            +N
Sbjct  218  NN  219



>ref|XP_010674193.1| PREDICTED: uncharacterized protein LOC104890412 [Beta vulgaris 
subsp. vulgaris]
Length=223

 Score =   179 bits (455),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 94/201 (47%), Positives = 132/201 (66%), Gaps = 7/201 (3%)
 Frame = +3

Query  63   EELSHNNVVVSEKVPLLVPDEVEKNLVQKAISQTFQSAAHLANLLPTGAVLAFQLLSPIF  242
            +  + NN +  ++ P      ++ ++ Q+A++ T    A+LANLLPTG +LAFQLL+PIF
Sbjct  23   DHQTSNNTISDDRKP---EPPLQPSITQRALTST----ANLANLLPTGTLLAFQLLTPIF  75

Query  243  SNQGDCDAVSRFLTASLVAMCGLSCFLLSFTDSFKDQKGNVCYGVATVKGLWVIDGSASL  422
            +N G CD  +R LT  L+A+ G+SCFL SFTDSF+   G V YG AT+KG+W+ D     
Sbjct  76   TNHGQCDITTRSLTTLLLALLGISCFLASFTDSFRAPDGRVYYGFATLKGIWLFDYYTDT  135

Query  423  PPELAAKYKVKFIDFVHAVMSVLVFGAIALFDQNVVSCFXPXPXXEXXXILPXVPVGXGX  602
                 AKYK++FID VHAV+S++VFG ++L D+NVV+CF P P  E   +L  +P+G G 
Sbjct  136  VEVDLAKYKLRFIDCVHAVLSIIVFGVVSLRDKNVVNCFYPKPTQEVQEVLDILPLGVGV  195

Query  603  VCXXLFVVFPPXXXGIGFPXT  665
            +C  LFV FP    GIG+P T
Sbjct  196  ICSLLFVAFPTRRHGIGYPVT  216



>ref|XP_006408418.1| hypothetical protein EUTSA_v10021481mg [Eutrema salsugineum]
 gb|ESQ49871.1| hypothetical protein EUTSA_v10021481mg [Eutrema salsugineum]
Length=222

 Score =   179 bits (454),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 89/182 (49%), Positives = 123/182 (68%), Gaps = 4/182 (2%)
 Frame = +3

Query  129  EKNLVQKAISQTFQSAAHLANLLPTGAVLAFQLLSPIFSNQGDCDAVSRFLTASLVAMCG  308
            + ++ Q+A+S T  SAA+L+NLLPTG +LAFQLL+P+F++ G CD  +RFLTA L+ +  
Sbjct  36   QMSMSQRAMSNTLTSAANLSNLLPTGTLLAFQLLTPVFTSNGVCDHATRFLTAILLFLLA  95

Query  309  LSCFLLSFTDSFKDQKGNVCYGVATVKGLWVIDG---SASLPPELAAKYKVKFIDFVHAV  479
             SCF+ SFTDS K   G + +G  T KG+WV+D    + S  P+L AKY+++ +D++HA 
Sbjct  96   ASCFVSSFTDSVKADDGTIYFGFVTFKGMWVVDYPDITGSGLPDL-AKYRMRVVDWIHAT  154

Query  480  MSVLVFGAIALFDQNVVSCFXPXPXXEXXXILPXVPVGXGXVCXXLFVVFPPXXXGIGFP  659
            +SVLVFGA+AL D+ V  CF P P  E   +L  VPVG G +C  LF VFP    GIG+ 
Sbjct  155  LSVLVFGAVALRDKYVTDCFCPSPEEETKHVLDIVPVGVGVMCTLLFTVFPARRHGIGYL  214

Query  660  XT  665
             T
Sbjct  215  VT  216



>ref|XP_004300087.1| PREDICTED: uncharacterized protein LOC101310319 [Fragaria vesca 
subsp. vesca]
Length=215

 Score =   178 bits (452),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 99/182 (54%), Positives = 125/182 (69%), Gaps = 2/182 (1%)
 Frame = +3

Query  120  DEVEKNLVQKAISQTFQSAAHLANLLPTGAVLAFQLLSPIFSNQGDCDAVSRFLTASLVA  299
             +V  ++ Q+AISQT    A+LANLLPTG +LA QLL P+F+N G CDA +R +T  L+ 
Sbjct  31   QQVASSMSQRAISQTLTGTANLANLLPTGTLLALQLLVPVFTNNGSCDAATRPMTLFLLL  90

Query  300  MCGLSCFLLSFTDSFKDQKGNVCYGVATVKGLWVIDGSASLPPELA--AKYKVKFIDFVH  473
            +  LSCFL SFTDS K   G VCYG+AT KGL++ D S+S     A   KYK++FID VH
Sbjct  91   LLALSCFLASFTDSVKAPNGQVCYGIATPKGLFLFDSSSSATAAGADLTKYKLRFIDLVH  150

Query  474  AVMSVLVFGAIALFDQNVVSCFXPXPXXEXXXILPXVPVGXGXVCXXLFVVFPPXXXGIG  653
            A++SVLVFGA+AL D+NVV CF P P  E   +L  VP+G G +C  LFVVFP    GIG
Sbjct  151  ALLSVLVFGAVALRDKNVVGCFYPMPAHETQEVLDIVPIGVGLLCSLLFVVFPTTRHGIG  210

Query  654  FP  659
            +P
Sbjct  211  YP  212



>ref|XP_002882229.1| hypothetical protein ARALYDRAFT_896211 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH58488.1| hypothetical protein ARALYDRAFT_896211 [Arabidopsis lyrata subsp. 
lyrata]
Length=219

 Score =   178 bits (452),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 88/182 (48%), Positives = 124/182 (68%), Gaps = 4/182 (2%)
 Frame = +3

Query  129  EKNLVQKAISQTFQSAAHLANLLPTGAVLAFQLLSPIFSNQGDCDAVSRFLTASLVAMCG  308
            + ++ Q+A+S T  SAA+L+NLLPTG +LAFQLL+P+F++ G CD  +RFLTA L+ +  
Sbjct  33   QMSISQRAMSNTLTSAANLSNLLPTGTLLAFQLLTPVFTSNGVCDHATRFLTAVLLFLLA  92

Query  309  LSCFLLSFTDSFKDQKGNVCYGVATVKGLWVIDG---SASLPPELAAKYKVKFIDFVHAV  479
             SCF+ SFTDS K + G + +G  T KG+WV+D    S    P+L AKY+++ +D++HA 
Sbjct  93   ASCFVSSFTDSVKAEDGTIYFGFVTFKGMWVVDYPDPSGLGLPDL-AKYRMRVVDWIHAT  151

Query  480  MSVLVFGAIALFDQNVVSCFXPXPXXEXXXILPXVPVGXGXVCXXLFVVFPPXXXGIGFP  659
            +SVLVFGA+AL D+ +  CF P P  E   +L  VPVG G +C  LF+VFP    GIG+ 
Sbjct  152  LSVLVFGAVALRDKYITDCFCPSPEAETKHVLDIVPVGVGVMCSLLFMVFPARRHGIGYL  211

Query  660  XT  665
             T
Sbjct  212  VT  213



>ref|XP_007041237.1| Uncharacterized protein TCM_006175 [Theobroma cacao]
 gb|EOX97068.1| Uncharacterized protein TCM_006175 [Theobroma cacao]
Length=221

 Score =   178 bits (451),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 102/206 (50%), Positives = 133/206 (65%), Gaps = 6/206 (3%)
 Frame = +3

Query  63   EELSHNNVVVSEKVPLLVPDEVEK--NLVQKAISQTFQSAAHLANLLPTGAVLAFQLLSP  236
            ++ S +    +   P   P    +  +L Q+AISQT  S A+LANLLPTG +LAFQLL P
Sbjct  14   KQASQSRSSTNNHEPGETPRSPSRPPSLSQRAISQTLTSTANLANLLPTGTLLAFQLLMP  73

Query  237  IFSNQGDCDAVSRFLTASLVAMCGLSCFLLSFTDSFKDQKGNVCYGVATVKGLWVI---D  407
            IF+N G CD+ +R +T  L+ +  LSCFL  FTDS K   G V YG AT KG+++    D
Sbjct  74   IFTNNGSCDSATRPMTLVLLLLLALSCFLACFTDSVKSSDGQVYYGFATFKGMFLFDFPD  133

Query  408  GSASLPPELAAKYKVKFIDFVHAVMSVLVFGAIALFDQNVVSCFXPXPXXEXXXILPXVP  587
             + S  P+L +KY++KFID VHAV+SVLVFGA+AL D+NV++CF P P  E   +L   P
Sbjct  134  PTGSTLPDL-SKYRIKFIDGVHAVLSVLVFGAVALRDKNVLNCFYPTPKHETQEVLSIAP  192

Query  588  VGXGXVCXXLFVVFPPXXXGIGFPXT  665
            VG G +C  LFVVFP    GIG+P T
Sbjct  193  VGIGLICSLLFVVFPTRRHGIGYPIT  218



>ref|XP_008368178.1| PREDICTED: uncharacterized protein LOC103431786 [Malus domestica]
Length=220

 Score =   177 bits (449),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 105/193 (54%), Positives = 127/193 (66%), Gaps = 11/193 (6%)
 Frame = +3

Query  117  PDEVEKN-------LVQKAISQTFQSAAHLANLLPTGAVLAFQLLSPIFSNQGDCDAVSR  275
            PDE  K+         Q+AISQT  S A+LANLLPTG +LAFQLL PIF+  G CDA +R
Sbjct  26   PDETPKSPQPPKPTFSQRAISQTLTSTANLANLLPTGTLLAFQLLIPIFTGNGSCDAATR  85

Query  276  FLTASLVAMCGLSCFLLSFTDSFKDQKGNVCYGVATVKGLWVI---DGSASLPPELAAKY  446
             +T  L+ +  LSCFL SFTDS K   G V YG+AT KGL+V    D S S  P+L +KY
Sbjct  86   PMTLILLLLLALSCFLASFTDSVKALDGQVYYGLATTKGLFVFDYPDASGSGLPDL-SKY  144

Query  447  KVKFIDFVHAVMSVLVFGAIALFDQNVVSCFXPXPXXEXXXILPXVPVGXGXVCXXLFVV  626
            K++FID VHAV+SV VFGA+AL D+NV+ CF P P  +   +L   PVG G +C  LFVV
Sbjct  145  KIRFIDLVHAVLSVFVFGAVALRDKNVLGCFYPTPDHQTQEVLDIGPVGIGLICSLLFVV  204

Query  627  FPPXXXGIGFPXT  665
            FP    GIGFP T
Sbjct  205  FPTRRHGIGFPLT  217



>ref|XP_010916779.1| PREDICTED: uncharacterized protein LOC105041523 [Elaeis guineensis]
Length=179

 Score =   176 bits (445),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 92/179 (51%), Positives = 119/179 (66%), Gaps = 6/179 (3%)
 Frame = +3

Query  138  LVQKAISQTFQSAAHLANLLPTGAVLAFQLLSPIFSNQGDCDAVSRFLTASLVAMCGLSC  317
            +VQK + +TF+S A+LANLLPTG VL FQ+LSP  +N G C  V+R  TA LVA+CGLSC
Sbjct  1    MVQKTMQRTFKSTANLANLLPTGTVLTFQVLSPTCTNLGRCTGVNRTATACLVALCGLSC  60

Query  318  FLLSFTDSFKD---QKGNVCYGVATVKGLWVIDGSASLPPELAAKYKVKFIDFVHAVMSV  488
            F+L+FTDSF D    +G V YG+AT +GLWV D +    P+   K+++ F DFVHA MSV
Sbjct  61   FILNFTDSFHDPEAAEGKVHYGLATFRGLWVFDDAVPREPD---KFRIGFRDFVHAFMSV  117

Query  489  LVFGAIALFDQNVVSCFXPXPXXEXXXILPXVPVGXGXVCXXLFVVFPPXXXGIGFPXT  665
            LVF A+ L +++VVSCF P        +L  +PV  G +   LFVV P    GIGFP +
Sbjct  118  LVFMAVVLCEKSVVSCFYPFRSENMEQLLAMLPVAIGVLGSALFVVLPTTRHGIGFPQS  176



>ref|XP_011047931.1| PREDICTED: uncharacterized protein LOC105142131 [Populus euphratica]
Length=232

 Score =   177 bits (449),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 92/177 (52%), Positives = 123/177 (69%), Gaps = 3/177 (2%)
 Frame = +3

Query  144  QKAISQTFQSAAHLANLLPTGAVLAFQLLSPIFSNQGDCDAVSRFLTASLVAMCGLSCFL  323
            Q+AISQT  S A+LANLLPTG +LAFQ+L+PIF+N G CD+ +  +T+ L+A+  +SCFL
Sbjct  53   QRAISQTLTSTANLANLLPTGTLLAFQILTPIFTNNGACDSATAPMTSVLLALLAVSCFL  112

Query  324  LSFTDSFKD-QKGNVCYGVATVKGLWVIDGSASLPPELA--AKYKVKFIDFVHAVMSVLV  494
             SFTDS K    G V YG AT+KG+++ D    +   L+  +K K++FID VHAV+SVLV
Sbjct  113  GSFTDSVKSPTDGQVYYGFATIKGMFLFDCPDPVGSGLSDLSKLKLRFIDVVHAVLSVLV  172

Query  495  FGAIALFDQNVVSCFXPXPXXEXXXILPXVPVGXGXVCXXLFVVFPPXXXGIGFPXT  665
            F A+AL D+NV+SCF P P  E   +L  +PVG G +C  LF+ FP    GIG+P T
Sbjct  173  FVAVALRDKNVLSCFYPMPKHETQEVLDVIPVGIGLICSLLFLAFPTRRHGIGYPVT  229



>ref|XP_006851260.1| PREDICTED: uncharacterized protein LOC18441064 [Amborella trichopoda]
 gb|ERN12841.1| hypothetical protein AMTR_s00180p00057430 [Amborella trichopoda]
Length=221

 Score =   176 bits (447),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 100/204 (49%), Positives = 128/204 (63%), Gaps = 8/204 (4%)
 Frame = +3

Query  75   HNNVVVSEKVPLLVP-DEVEKNLVQKAISQTFQSAAHLANLLPTGAVLAFQLLSPIFSNQ  251
            H+N    EK     P   +  +L Q+A+SQ   S A+LA LLPTG +LAFQLL+PIFSN 
Sbjct  16   HHNHETQEKHKAKEPLISIGPSLSQRALSQALASTANLAKLLPTGTLLAFQLLTPIFSNN  75

Query  252  GDCDAVSRFLTASLVAMCGLSCFLLSFTDSFKDQKGNVCYGVATVKGLWVIDG------S  413
            G CD+ +R LT  L+     SCFL SFTDSF+   G + YG+AT+KG+W+ D       +
Sbjct  76   GACDSTTRSLTQLLLLFLAFSCFLASFTDSFRSNDGQLHYGLATLKGMWLFDAPLERGPT  135

Query  414  ASLPPELAAKYKVKFIDFVHAVMSVLVFGAIALFDQNVVSCFXPXPXXEXXXILPXVPVG  593
              + PEL  KY+++FIDF HAV SVLVFG +AL D+NV SC  P P  E   +L  VP+G
Sbjct  136  QWIAPEL-NKYRLRFIDFAHAVTSVLVFGVVALRDRNVRSCLYPNPDPEEQEVLNIVPIG  194

Query  594  XGXVCXXLFVVFPPXXXGIGFPXT  665
             G +C  LFV FP    GIG+P T
Sbjct  195  VGLICSLLFVAFPTTRHGIGYPVT  218



>ref|XP_004972417.1| PREDICTED: uncharacterized protein LOC101783676 [Setaria italica]
Length=231

 Score =   176 bits (447),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 90/173 (52%), Positives = 111/173 (64%), Gaps = 2/173 (1%)
 Frame = +3

Query  153  ISQTFQSAAHLANLLPTGAVLAFQLLSPIFSNQGDCDAVSRFLTASLVAMCGLSCFLLSF  332
            +SQ   S A+LANLLPTG +LAF LLSP F+N G CDA +  LT  L+A+  LSC L SF
Sbjct  56   LSQALTSTANLANLLPTGTLLAFNLLSPTFTNHGACDATTALLTRGLLAVLALSCVLASF  115

Query  333  TDSFKDQKGNVCYGVATVKGLWVIDGSASLPPEL--AAKYKVKFIDFVHAVMSVLVFGAI  506
            TDS K   G V YGVAT +GLW+ID     PP     A+Y++ F+DFVHA +S  VFG +
Sbjct  116  TDSLKGPDGRVYYGVATPRGLWLIDYPPGAPPPAADTARYRLAFVDFVHAALSAAVFGVV  175

Query  507  ALFDQNVVSCFXPXPXXEXXXILPXVPVGXGXVCXXLFVVFPPXXXGIGFPXT  665
            A  D+NVV CF P P  E   +L  +P+G G +C  LFV FP    GIG+P T
Sbjct  176  AARDKNVVRCFCPAPARETEEVLDILPLGVGVLCSLLFVAFPTRRHGIGYPVT  228



>emb|CDY03457.1| BnaC01g16250D [Brassica napus]
Length=216

 Score =   176 bits (445),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 92/182 (51%), Positives = 125/182 (69%), Gaps = 4/182 (2%)
 Frame = +3

Query  135  NLVQKAISQTFQSAAHLANLLPTGAVLAFQLLSPIFSNQGDCDAVSRFLTASLVAMCGLS  314
            ++ Q A+SQT  S A+LANLLPTG +LAFQ L P+F++ G C+  +R LTA L+ +  +S
Sbjct  32   SISQHAVSQTLTSVANLANLLPTGTLLAFQFLIPVFTSNGSCEYSTRVLTAVLLTLLSIS  91

Query  315  CFLLSFTDSFKDQKGNVCYGVATVKGLWVIDG---SASLPPELAAKYKVKFIDFVHAVMS  485
            CFL SFTDS K + GNV YG AT KG+WV D    S    P+L +KY+++ +D++HAV+S
Sbjct  92   CFLSSFTDSVKAEDGNVYYGFATRKGMWVFDYPDPSGLGLPDL-SKYRIRIVDWIHAVLS  150

Query  486  VLVFGAIALFDQNVVSCFXPXPXXEXXXILPXVPVGXGXVCXXLFVVFPPXXXGIGFPXT  665
            VLVFGA+AL ++N VSCF P P      +L  VP+G G +C  LF+VFP    GIG+P T
Sbjct  151  VLVFGAVALREKNAVSCFYPAPEQGTKKVLDIVPMGVGVICGLLFLVFPARRHGIGYPVT  210

Query  666  XD  671
             +
Sbjct  211  GN  212



>ref|XP_010463647.1| PREDICTED: uncharacterized protein LOC104744317 [Camelina sativa]
Length=220

 Score =   176 bits (446),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 88/182 (48%), Positives = 122/182 (67%), Gaps = 4/182 (2%)
 Frame = +3

Query  129  EKNLVQKAISQTFQSAAHLANLLPTGAVLAFQLLSPIFSNQGDCDAVSRFLTASLVAMCG  308
            + ++ Q+A+S T  SAA+L+NLLPTG +LAFQLL+P+F++ G CD  +R LTA L+ M  
Sbjct  34   QMSMSQRAMSNTLTSAANLSNLLPTGTLLAFQLLTPVFTSNGVCDHATRSLTAVLLYMLA  93

Query  309  LSCFLLSFTDSFKDQKGNVCYGVATVKGLWVIDG---SASLPPELAAKYKVKFIDFVHAV  479
             SCF+ SFTDS K   G + +G  T KG+WV+D    S    P+L +KY+++ +D++HA 
Sbjct  94   ASCFVSSFTDSVKADDGTIYFGFVTFKGMWVVDYPDPSGFGLPDL-SKYRMRVVDWIHAT  152

Query  480  MSVLVFGAIALFDQNVVSCFXPXPXXEXXXILPXVPVGXGXVCXXLFVVFPPXXXGIGFP  659
            +SVLVFGA+AL D+ V  CF P P  E   +L  VPVG G +C  LF+VFP    GIG+ 
Sbjct  153  LSVLVFGAVALRDKYVTDCFCPSPEAETKHVLDIVPVGVGVMCSLLFMVFPTRRHGIGYL  212

Query  660  XT  665
             T
Sbjct  213  VT  214



>ref|XP_009353743.1| PREDICTED: uncharacterized protein LOC103944978 [Pyrus x bretschneideri]
Length=222

 Score =   176 bits (446),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 101/186 (54%), Positives = 123/186 (66%), Gaps = 4/186 (2%)
 Frame = +3

Query  117  PDEVEKNLVQKAISQTFQSAAHLANLLPTGAVLAFQLLSPIFSNQGDCDAVSRFLTASLV  296
            P   +    Q+AISQT  S A+LANLLPTG +LAFQLL PIF+  G CDA +R +T  L+
Sbjct  35   PQPPQPTFSQRAISQTLTSTANLANLLPTGTLLAFQLLIPIFTGNGSCDAATRPMTLILL  94

Query  297  AMCGLSCFLLSFTDSFKDQKGNVCYGVATVKGLWVI---DGSASLPPELAAKYKVKFIDF  467
             +  LSCFL S TDS K   G V YG+AT KGL+V    D S S  P+L +KYK++FID 
Sbjct  95   LLLALSCFLASLTDSIKALDGQVYYGLATTKGLFVFDYPDASGSGLPDL-SKYKIRFIDL  153

Query  468  VHAVMSVLVFGAIALFDQNVVSCFXPXPXXEXXXILPXVPVGXGXVCXXLFVVFPPXXXG  647
            VHAV+SV VFGA+AL D+NV+ CF P P  +   +L   PVG G +C  LFVVFP    G
Sbjct  154  VHAVLSVFVFGAVALRDKNVLGCFYPTPGHQTQEVLDIAPVGIGLICGLLFVVFPTRRHG  213

Query  648  IGFPXT  665
            IGFP T
Sbjct  214  IGFPLT  219



>gb|AAU44525.1| hypothetical protein AT4G28485 [Arabidopsis thaliana]
Length=200

 Score =   175 bits (443),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 87/181 (48%), Positives = 123/181 (68%), Gaps = 1/181 (1%)
 Frame = +3

Query  132  KNLVQKAISQTFQSAAHLANLLPTGAVLAFQLLSPIFSNQGDCDAV-SRFLTASLVAMCG  308
            K+ V++ + +TF+  AHL+NLLPTG+V++FQ++ P+ ++QG C  + SR+LT  LV++C 
Sbjct  20   KSKVERVVRKTFKGTAHLSNLLPTGSVMSFQIMCPVLTHQGQCPTITSRWLTCFLVSLCA  79

Query  309  LSCFLLSFTDSFKDQKGNVCYGVATVKGLWVIDGSASLPPELAAKYKVKFIDFVHAVMSV  488
            +SCFL SFTDS +D  G V YG+AT  GL V+DGS +L  E   KYK+K +DF+HA+MS+
Sbjct  80   ISCFLFSFTDSIRDPNGKVRYGLATWSGLLVMDGSITLTEEEKEKYKLKILDFIHAIMSM  139

Query  489  LVFGAIALFDQNVVSCFXPXPXXEXXXILPXVPVGXGXVCXXLFVVFPPXXXGIGFPXTX  668
            LVF A+++FDQNV  C  P P  E   IL  +P   G +C   F+ FP    GIG P T 
Sbjct  140  LVFFAVSMFDQNVTRCLFPVPSEETKEILTSLPFVIGVICGAFFLAFPTRRHGIGSPLTK  199

Query  669  D  671
            +
Sbjct  200  E  200



>gb|AAY78804.1| hypothetical protein At4g28485 [Arabidopsis thaliana]
Length=200

 Score =   175 bits (443),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 87/181 (48%), Positives = 123/181 (68%), Gaps = 1/181 (1%)
 Frame = +3

Query  132  KNLVQKAISQTFQSAAHLANLLPTGAVLAFQLLSPIFSNQGDCDAV-SRFLTASLVAMCG  308
            K+ V++ + +TF+  AHL+NLLPTG+V++FQ++ P+ ++QG C  + SR+LT  LV++C 
Sbjct  20   KSKVERVVRKTFKGTAHLSNLLPTGSVMSFQIMCPVLTHQGQCPTITSRWLTCFLVSLCA  79

Query  309  LSCFLLSFTDSFKDQKGNVCYGVATVKGLWVIDGSASLPPELAAKYKVKFIDFVHAVMSV  488
            +SCFL SFTDS +D  G V YG+AT  GL V+DGS +L  E   KYK+K +DF+HA+MS+
Sbjct  80   ISCFLFSFTDSIRDPNGKVRYGLATWSGLLVMDGSITLTEEEKEKYKLKILDFIHAIMSM  139

Query  489  LVFGAIALFDQNVVSCFXPXPXXEXXXILPXVPVGXGXVCXXLFVVFPPXXXGIGFPXTX  668
            LVF A+++FDQNV  C  P P  E   IL  +P   G +C   F+ FP    GIG P T 
Sbjct  140  LVFFAVSMFDQNVTRCLFPVPSEETKEILTSLPFVIGVICGAFFLAFPTRRHGIGSPLTQ  199

Query  669  D  671
            +
Sbjct  200  E  200



>gb|KJB77232.1| hypothetical protein B456_012G126500 [Gossypium raimondii]
Length=222

 Score =   175 bits (444),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 94/206 (46%), Positives = 124/206 (60%), Gaps = 3/206 (1%)
 Frame = +3

Query  63   EELSHNNVVVSEKVPLLVPDEVE-KNLVQKAISQTFQSAAHLANLLPTGAVLAFQLLSPI  239
            EE +      + + PLL     + K   QK + +TF+  A L+ LLPTG+ L FQ+LSP+
Sbjct  17   EETAQEESRTTSEFPLLTAIVKQPKTKKQKIVRKTFKGTAVLSKLLPTGSALTFQILSPV  76

Query  240  FSNQGDCDA-VSRFLTASLVAMCGLSCFLLSFTDSFKDQKGNVCYGVATVKGLWVIDGSA  416
             +NQG C   V + L   LVA C   CF LSFTDS +D++G V YGVAT +GLWV+DG  
Sbjct  77   LTNQGQCKTQVCQNLMLGLVAFCASLCFFLSFTDSVRDERGKVRYGVATFRGLWVMDGPV  136

Query  417  SLPPELAAKYKVKFIDFVHAVMSVLVFGAIALFDQNVVSCFXPXPXXEX-XXILPXVPVG  593
             LP E A KYKVK IDF HA++S+++F A+ LFDQNVV CF   P  +    +L  +P  
Sbjct  137  ELPIEEANKYKVKLIDFFHALVSIMIFMALVLFDQNVVDCFGLKPSGDSNALLLMLLPAS  196

Query  594  XGXVCXXLFVVFPPXXXGIGFPXTXD  671
             G +   LFV FP    GIG P + +
Sbjct  197  IGAIGCLLFVSFPSKRHGIGCPLSKN  222



>ref|XP_009137953.1| PREDICTED: uncharacterized protein LOC103861987 [Brassica rapa]
 emb|CDY34278.1| BnaA01g13810D [Brassica napus]
Length=220

 Score =   175 bits (444),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 92/184 (50%), Positives = 125/184 (68%), Gaps = 4/184 (2%)
 Frame = +3

Query  129  EKNLVQKAISQTFQSAAHLANLLPTGAVLAFQLLSPIFSNQGDCDAVSRFLTASLVAMCG  308
            + ++ Q A+SQT  S A+LANLLPTG +LAFQ L P+F++ G C   +R LTA L+ +  
Sbjct  34   QPSISQHAVSQTLTSVANLANLLPTGTLLAFQFLIPVFTSNGSCKYSTRVLTAVLLTLLS  93

Query  309  LSCFLLSFTDSFKDQKGNVCYGVATVKGLWVIDG---SASLPPELAAKYKVKFIDFVHAV  479
            +SCFL SFTDS K + GNV YG AT KG+WV D    S    P+L +KY+++ +D++HAV
Sbjct  94   ISCFLSSFTDSVKAEDGNVYYGFATRKGMWVFDYPDPSGLGLPDL-SKYRIRIVDWIHAV  152

Query  480  MSVLVFGAIALFDQNVVSCFXPXPXXEXXXILPXVPVGXGXVCXXLFVVFPPXXXGIGFP  659
            +SVLVFGA+AL ++N VSCF P P      +L  VP+G G +C  LF+VFP    GIG+P
Sbjct  153  LSVLVFGAVALREKNAVSCFYPAPEQGTKKVLDIVPMGVGVICGLLFLVFPARRHGIGYP  212

Query  660  XTXD  671
             T +
Sbjct  213  VTGN  216



>ref|XP_006389536.1| hypothetical protein POPTR_0022s00700g [Populus trichocarpa]
 gb|ERP48450.1| hypothetical protein POPTR_0022s00700g [Populus trichocarpa]
Length=233

 Score =   175 bits (444),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 91/177 (51%), Positives = 123/177 (69%), Gaps = 3/177 (2%)
 Frame = +3

Query  144  QKAISQTFQSAAHLANLLPTGAVLAFQLLSPIFSNQGDCDAVSRFLTASLVAMCGLSCFL  323
            Q+AISQT  + A+LANLLPTG +LAFQ+L+PIF+N G CD+ +  +T+ L+A+  +SCFL
Sbjct  54   QRAISQTLTNTANLANLLPTGTLLAFQILTPIFTNNGACDSATAPMTSVLLALLAVSCFL  113

Query  324  LSFTDSFKD-QKGNVCYGVATVKGLWVIDGSASLPPELA--AKYKVKFIDFVHAVMSVLV  494
             SFTDS K    G V YG AT+KG+++ D    +   L+  +K K++FID VHAV+SVLV
Sbjct  114  GSFTDSVKSPTDGQVYYGFATLKGMFLFDCPDPVGSGLSDLSKLKLRFIDVVHAVLSVLV  173

Query  495  FGAIALFDQNVVSCFXPXPXXEXXXILPXVPVGXGXVCXXLFVVFPPXXXGIGFPXT  665
            F A+AL D+NV+SCF P P  E   +L  +PVG G +C  LF+ FP    GIG+P T
Sbjct  174  FVAVALRDKNVLSCFYPMPKHETQEVLDVIPVGIGLICSLLFMAFPTRRHGIGYPVT  230



>ref|XP_009410685.1| PREDICTED: uncharacterized protein LOC103992624 [Musa acuminata 
subsp. malaccensis]
Length=218

 Score =   174 bits (442),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 86/179 (48%), Positives = 115/179 (64%), Gaps = 5/179 (3%)
 Frame = +3

Query  144  QKAISQTFQSAAHLANLLPTGAVLAFQLLSPIFSNQGDCDAVSRFLTASLVAMCGLSCFL  323
            Q+AI+Q   S AHLANLLPTG +LAFQLL+P+F+N G CD  +R +T +L+ +   SCFL
Sbjct  37   QQAITQALASTAHLANLLPTGTLLAFQLLTPVFTNNGSCDTATRLMTQALLLLLAASCFL  96

Query  324  LSFTDSFKD-QKGNVCYGVATVKGLWVIDGSASLPPELA----AKYKVKFIDFVHAVMSV  488
              FTDS +    G V YG AT +G+W+ +      P  A    +KY+V+ +D+VHAV+SV
Sbjct  97   ACFTDSIRSAADGRVYYGFATRRGMWLFNYDYVASPSAALPDLSKYRVRAVDWVHAVLSV  156

Query  489  LVFGAIALFDQNVVSCFXPXPXXEXXXILPXVPVGXGXVCXXLFVVFPPXXXGIGFPXT  665
            LVF ++AL D+N VSC  P P  E    L  +P+G G +   LFVVFP    GIG+P T
Sbjct  157  LVFASVALRDRNAVSCLYPRPSRETEEALSVLPLGVGVISSLLFVVFPTRRHGIGYPVT  215



>ref|XP_010497147.1| PREDICTED: uncharacterized protein LOC104774184 [Camelina sativa]
Length=222

 Score =   174 bits (440),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 87/185 (47%), Positives = 123/185 (66%), Gaps = 4/185 (2%)
 Frame = +3

Query  129  EKNLVQKAISQTFQSAAHLANLLPTGAVLAFQLLSPIFSNQGDCDAVSRFLTASLVAMCG  308
            + ++ Q+A+S T  SAA+L+NLLPTG +LAFQLL+P+F++ G CD  +R LTA L+ +  
Sbjct  34   QMSVSQRAMSNTLTSAANLSNLLPTGTLLAFQLLTPVFTSNGVCDHATRSLTAVLLYLLA  93

Query  309  LSCFLLSFTDSFKDQKGNVCYGVATVKGLWVIDG---SASLPPELAAKYKVKFIDFVHAV  479
             SCF+ SFTDS K   G   +G  T KG+WV+D    S    P+L +KY+++ +D++HA 
Sbjct  94   ASCFVSSFTDSVKAHDGTTYFGFVTFKGMWVVDYPDPSGFGLPDL-SKYRMRVVDWIHAT  152

Query  480  MSVLVFGAIALFDQNVVSCFXPXPXXEXXXILPXVPVGXGXVCXXLFVVFPPXXXGIGFP  659
            +SVLVFGA+AL D+ V  CF P P  E   +L  VPVG G +C  LF+VFP    GIG+ 
Sbjct  153  LSVLVFGAVALRDKYVTDCFCPSPEAETKHVLDIVPVGVGVMCSLLFMVFPTRRHGIGYL  212

Query  660  XTXDN  674
             T ++
Sbjct  213  VTGNH  217



>ref|XP_010417271.1| PREDICTED: uncharacterized protein LOC104703038 [Camelina sativa]
Length=220

 Score =   174 bits (440),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 87/182 (48%), Positives = 121/182 (66%), Gaps = 4/182 (2%)
 Frame = +3

Query  129  EKNLVQKAISQTFQSAAHLANLLPTGAVLAFQLLSPIFSNQGDCDAVSRFLTASLVAMCG  308
            + ++ Q+A+S T  SAA+L+NLLPTG +LAFQLL+P+F++ G CD  +R LTA L+ +  
Sbjct  34   QMSVSQRAMSNTLTSAANLSNLLPTGTLLAFQLLTPVFTSNGVCDHATRSLTAVLLYLLA  93

Query  309  LSCFLLSFTDSFKDQKGNVCYGVATVKGLWVIDG---SASLPPELAAKYKVKFIDFVHAV  479
             SCF+ SFTDS K   G   +G  T KG+WV+D    S    P+L +KY+++ +D++HA 
Sbjct  94   ASCFVSSFTDSVKAHDGTTYFGFVTFKGMWVVDYPDPSGFGLPDL-SKYRMRVVDWIHAT  152

Query  480  MSVLVFGAIALFDQNVVSCFXPXPXXEXXXILPXVPVGXGXVCXXLFVVFPPXXXGIGFP  659
            +SVLVFGA+AL D+ V  CF P P  E   +L  VPVG G +C  LF+VFP    GIG+ 
Sbjct  153  LSVLVFGAVALRDKYVTDCFCPSPEAETKHVLDIVPVGVGVMCSLLFMVFPTRRHGIGYL  212

Query  660  XT  665
             T
Sbjct  213  VT  214



>ref|XP_006299851.1| hypothetical protein CARUB_v10016054mg [Capsella rubella]
 gb|EOA32749.1| hypothetical protein CARUB_v10016054mg [Capsella rubella]
Length=219

 Score =   174 bits (440),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 87/182 (48%), Positives = 122/182 (67%), Gaps = 4/182 (2%)
 Frame = +3

Query  129  EKNLVQKAISQTFQSAAHLANLLPTGAVLAFQLLSPIFSNQGDCDAVSRFLTASLVAMCG  308
            + ++ Q+A+S T  SAA+L+NLLPTG +LAFQLL+P+F++ G CD  +RFLTA L+ +  
Sbjct  33   QMSVSQRAMSNTLTSAANLSNLLPTGTLLAFQLLTPVFTSNGVCDHATRFLTAVLLYLLA  92

Query  309  LSCFLLSFTDSFKDQKGNVCYGVATVKGLWVIDG---SASLPPELAAKYKVKFIDFVHAV  479
             SCF+ SFTDS K   G + +G  T KG+WV+D    S    P+L +KY+++ +D++HA 
Sbjct  93   ASCFVSSFTDSVKADDGTIYFGFVTFKGMWVVDYPDPSGLGLPDL-SKYRMRVVDWIHAT  151

Query  480  MSVLVFGAIALFDQNVVSCFXPXPXXEXXXILPXVPVGXGXVCXXLFVVFPPXXXGIGFP  659
            +SVLVFGA+AL D+ V  CF P P  E   +L  VPVG G +   LF+VFP    GIG+ 
Sbjct  152  LSVLVFGAVALRDKYVTDCFCPSPEAETKHVLDIVPVGVGVMSSLLFMVFPTRRHGIGYL  211

Query  660  XT  665
             T
Sbjct  212  VT  213



>ref|XP_004965424.1| PREDICTED: uncharacterized protein LOC101752838 [Setaria italica]
Length=257

 Score =   175 bits (443),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 89/177 (50%), Positives = 117/177 (66%), Gaps = 0/177 (0%)
 Frame = +3

Query  129  EKNLVQKAISQTFQSAAHLANLLPTGAVLAFQLLSPIFSNQGDCDAVSRFLTASLVAMCG  308
            E   +++A++Q FQS A LA  LPTGAVL F++LSP+F+N G C  V+R +TA LV +C 
Sbjct  77   EATRLERAMAQAFQSTAELAKNLPTGAVLVFEVLSPVFTNGGKCQDVNRVMTAWLVGLCA  136

Query  309  LSCFLLSFTDSFKDQKGNVCYGVATVKGLWVIDGSASLPPELAAKYKVKFIDFVHAVMSV  488
             +CF L FTDSF D +G V Y VAT  GLWVIDG+   PPE AA  ++KFIDF HA +S 
Sbjct  137  AACFFLCFTDSFLDARGTVRYAVATYSGLWVIDGTPPPPPEEAAGKRLKFIDFFHAFLSF  196

Query  489  LVFGAIALFDQNVVSCFXPXPXXEXXXILPXVPVGXGXVCXXLFVVFPPXXXGIGFP  659
            +VF ++A+FD+NV +CF P    +   +L  VP+  G V   LF  FP    G+GFP
Sbjct  197  IVFMSVAMFDRNVGACFNPVMSYDKQQVLTAVPLAGGLVGTLLFAAFPSTRHGLGFP  253



>ref|XP_006471187.1| PREDICTED: uncharacterized protein LOC102623401 [Citrus sinensis]
Length=234

 Score =   174 bits (440),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 99/184 (54%), Positives = 124/184 (67%), Gaps = 8/184 (4%)
 Frame = +3

Query  135  NLVQKAISQTFQSAAHLANLLPTGAVLAFQLLSPIFSNQGDCDAVSRFLTASLVAMCGLS  314
            +L ++A+SQT  S A+LANLLPTG +LAFQLL+PIF+N G CDA +R LT  L+ +   S
Sbjct  48   SLSRRALSQTLTSTANLANLLPTGTLLAFQLLTPIFTNNGSCDAATRLLTLLLLLLLAAS  107

Query  315  CFLLSFTDSFKDQK-GNVCYGVATVKGLWVID------GSASLPPELAAKYKVKFIDFVH  473
            CFL SFTDS K    G V YG AT KGL++ D       S    P+L  KY+++FID VH
Sbjct  108  CFLASFTDSVKSSSSGQVYYGFATFKGLFLFDYIQNPNASDHDLPDLN-KYRIRFIDGVH  166

Query  474  AVMSVLVFGAIALFDQNVVSCFXPXPXXEXXXILPXVPVGXGXVCXXLFVVFPPXXXGIG  653
            AV+SVLVF A+AL D+NV+SCF P P  E   +L  VPVG G +C  LFV+FP    GIG
Sbjct  167  AVLSVLVFAAVALRDKNVLSCFFPTPKHETQEVLDIVPVGIGLICSLLFVIFPTRRHGIG  226

Query  654  FPXT  665
            +P T
Sbjct  227  YPIT  230



>dbj|BAJ95368.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=230

 Score =   173 bits (439),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 91/177 (51%), Positives = 113/177 (64%), Gaps = 4/177 (2%)
 Frame = +3

Query  144  QKAISQTFQSAAHLANLLPTGAVLAFQLLSPIFSNQGDCDAVSRFLTASLVAMCGLSCFL  323
            +  + Q   S A LANLLPTG VLAFQLL+P F+N G CDA +  LT  L+A+  LSC L
Sbjct  47   RSTLYQALTSTASLANLLPTGTVLAFQLLAPAFTNHGACDATTALLTRILLAVLALSCLL  106

Query  324  LSFTDSFKDQKGNVCYGVATVKGLWVID--GSASLPPELAAKYKVKFIDFVHAVMSVLVF  497
             SFTDS K   G V YGVAT++GLW++D    A  PP+  A+Y++  ID VHA +SV VF
Sbjct  107  ASFTDSLKGPDGRVYYGVATLRGLWLLDYPPGAPTPPD-TARYRLAPIDAVHAALSVAVF  165

Query  498  GAIALFDQNVVSCFX-PXPXXEXXXILPXVPVGXGXVCXXLFVVFPPXXXGIGFPXT  665
            G +A  D+NVV CF  P P  E   +L  VP+G G +C  LFV FP    GIG+P T
Sbjct  166  GVVAARDKNVVRCFYGPSPARETEEVLDIVPLGVGVLCSLLFVAFPTRRHGIGYPVT  222



>gb|EEE64691.1| hypothetical protein OsJ_19546 [Oryza sativa Japonica Group]
Length=239

 Score =   173 bits (438),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 103/218 (47%), Positives = 122/218 (56%), Gaps = 22/218 (10%)
 Frame = +3

Query  60   DEELSHNNVVVSEKVPLLVPDEVEKNL----------VQKAISQTFQSAAHLANLLPTGA  209
            D+  S  +   +EK PLL                   VQ+AISQT+QS AHLA LLPTG 
Sbjct  22   DDVESRRDGGENEKRPLLEKRSAGDGGGGSGGNGMSPVQRAISQTYQSTAHLAKLLPTGT  81

Query  210  VLAFQLLSPIFSNQGDCDAVSRFLTASLVAMCGLSCFLL-------SFTDSFKDQKGN-V  365
            VLAFQLLSPI +NQG CD    F     +A      F         S T S K  +G  V
Sbjct  82   VLAFQLLSPIVTNQGHCD----FEANRAMAGRAQRRFARFPASSSGSRTASAKPPRGGAV  137

Query  366  CYGVATVKGLWVIDGSASLPPELAAKYKVKFIDFVHAVMSVLVFGAIALFDQNVVSCFXP  545
             YG AT  GLWVIDG A L P+ AA Y+++ +D VHAV+SV+VF A+ALFDQNVVSCF P
Sbjct  138  RYGFATPAGLWVIDGGAPLDPQAAAAYRLRLLDLVHAVVSVMVFAAVALFDQNVVSCFYP  197

Query  546  XPXXEXXXILPXVPVGXGXVCXXLFVVFPPXXXGIGFP  659
             P      +L  +P+  G V   LFV FP    GIGFP
Sbjct  198  VPSEGTRQVLTALPIAIGVVGSMLFVSFPTTRHGIGFP  235



>ref|XP_006659030.1| PREDICTED: uncharacterized protein LOC102709583 [Oryza brachyantha]
Length=219

 Score =   172 bits (435),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 86/173 (50%), Positives = 110/173 (64%), Gaps = 3/173 (2%)
 Frame = +3

Query  156  SQTFQSAAHLANLLPTGAVLAFQLLSPIFSNQGDCDAVSRFLTASLVAMCGLSCFLLSFT  335
            SQ   S A LANLLPTG V+AFQLL+P F+N G CDA +  LTA L+A+  LSC L SFT
Sbjct  44   SQALASTASLANLLPTGTVMAFQLLAPTFTNNGACDATTALLTAGLLAVLALSCVLASFT  103

Query  336  DSFKDQKGNVCYGVATVKGLWVIDGSASLPPEL---AAKYKVKFIDFVHAVMSVLVFGAI  506
            DS +   G V YG+AT +GLW++D  +          ++Y+++ ID VHA +S  VFG +
Sbjct  104  DSLRGPDGRVYYGLATPRGLWLLDYPSGPGAAPPPDTSRYRLRTIDAVHAALSAGVFGVV  163

Query  507  ALFDQNVVSCFXPXPXXEXXXILPXVPVGXGXVCXXLFVVFPPXXXGIGFPXT  665
            A  D+NVV CF P P  E   +L  VP+G G +C  LFVVFP    GIG+P T
Sbjct  164  AARDKNVVGCFWPAPAKETEEVLGIVPLGVGVICSLLFVVFPTTRHGIGYPVT  216



>gb|EMS48436.1| hypothetical protein TRIUR3_02208 [Triticum urartu]
Length=227

 Score =   172 bits (436),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 94/199 (47%), Positives = 120/199 (60%), Gaps = 13/199 (7%)
 Frame = +3

Query  105  PLLVPDEVEKN---------LVQKAISQTFQSAAHLANLLPTGAVLAFQLLSPIFSNQGD  257
            PLL   + EK+           +  + Q   S A LANLLPTG VLAFQLL+P F++ G 
Sbjct  22   PLLQDQQQEKHEAVDPVPPPPPRSTLYQALTSTASLANLLPTGTVLAFQLLAPTFTDHGA  81

Query  258  CDAVSRFLTASLVAMCGLSCFLLSFTDSFKDQKGNVCYGVATVKGLWVID--GSASLPPE  431
            CDA +  LT  L+A+  LSC L SFTDS K   G V YGVAT++GLW++D    A  PP+
Sbjct  82   CDATTALLTRILLAVLALSCLLASFTDSLKGPDGRVYYGVATLRGLWLLDYPPGAPTPPD  141

Query  432  LAAKYKVKFIDFVHAVMSVLVFGAIALFDQNVVSCFX-PXPXXEXXXILPXVPVGXGXVC  608
              ++Y++  ID VHA +SV VFG +A  D+NVV CF  P P  E   +L  VP+G G +C
Sbjct  142  -TSRYRLAPIDAVHAALSVAVFGVVAARDKNVVRCFYGPSPARETEQVLDIVPLGVGVLC  200

Query  609  XXLFVVFPPXXXGIGFPXT  665
              LFV FP    GIG+P T
Sbjct  201  SLLFVAFPTRRHGIGYPVT  219



>ref|XP_010070119.1| PREDICTED: uncharacterized protein LOC104456912 [Eucalyptus grandis]
 gb|KCW89577.1| hypothetical protein EUGRSUZ_A01860 [Eucalyptus grandis]
Length=197

 Score =   171 bits (433),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 89/190 (47%), Positives = 115/190 (61%), Gaps = 2/190 (1%)
 Frame = +3

Query  111  LVPDEVE-KNLVQKAISQTFQSAAHLANLLPTGAVLAFQLLSPIFSNQGDCDA-VSRFLT  284
            L+P + E K   QK + +T +  A L+NLLPTG    F LLSP+F+N+G C + ++  LT
Sbjct  8    LLPVQKEPKTRSQKTLRKTLKGTATLSNLLPTGTTFVFSLLSPVFTNKGQCTSFLTHILT  67

Query  285  ASLVAMCGLSCFLLSFTDSFKDQKGNVCYGVATVKGLWVIDGSASLPPELAAKYKVKFID  464
              L+A+C  +C LL FTDS +D KG V YG AT KGLWVI  S  L    A KYK+K ID
Sbjct  68   ICLLAVCATACSLLCFTDSVRDAKGKVRYGFATTKGLWVIAASLKLSQADADKYKLKAID  127

Query  465  FVHAVMSVLVFGAIALFDQNVVSCFXPXPXXEXXXILPXVPVGXGXVCXXLFVVFPPXXX  644
            + HA MS LVF A+A FDQNV+ CF P        +L  VP+  G VC   F++ P    
Sbjct  128  YWHAFMSALVFMAVAFFDQNVIKCFFPVESELAKGLLEAVPLAVGGVCSIFFLLCPTTRH  187

Query  645  GIGFPXTXDN  674
            GIGFP + + 
Sbjct  188  GIGFPLSREK  197



>ref|XP_010485487.1| PREDICTED: uncharacterized protein LOC104763805 [Camelina sativa]
Length=220

 Score =   171 bits (434),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 85/182 (47%), Positives = 120/182 (66%), Gaps = 4/182 (2%)
 Frame = +3

Query  129  EKNLVQKAISQTFQSAAHLANLLPTGAVLAFQLLSPIFSNQGDCDAVSRFLTASLVAMCG  308
            + ++ Q+ +S T  SAA+L+NLLPTG +LAFQLL+P+F++ G CD  +R LTA L+ +  
Sbjct  34   QMSISQRTMSNTLTSAANLSNLLPTGTLLAFQLLTPVFTSNGVCDHATRSLTAVLLYLLA  93

Query  309  LSCFLLSFTDSFKDQKGNVCYGVATVKGLWVIDG---SASLPPELAAKYKVKFIDFVHAV  479
             SCF+ SFTDS K   G   +G  T KG+W++D    S    P+L +KY+++ +D++HA 
Sbjct  94   ASCFVSSFTDSVKADDGTTYFGFVTFKGMWIVDYPDPSGLGLPDL-SKYRMRVVDWIHAT  152

Query  480  MSVLVFGAIALFDQNVVSCFXPXPXXEXXXILPXVPVGXGXVCXXLFVVFPPXXXGIGFP  659
            +SVLVFGA+AL D+ V  CF P P  E   +L  VPVG G +C  LF+VFP    GIG+ 
Sbjct  153  LSVLVFGAVALRDKYVTDCFCPSPEAETKHVLDIVPVGVGVMCSLLFMVFPTRRHGIGYL  212

Query  660  XT  665
             T
Sbjct  213  VT  214



>ref|XP_010447973.1| PREDICTED: uncharacterized protein LOC104730496 [Camelina sativa]
Length=200

 Score =   170 bits (431),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 86/182 (47%), Positives = 120/182 (66%), Gaps = 1/182 (1%)
 Frame = +3

Query  129  EKNLVQKAISQTFQSAAHLANLLPTGAVLAFQLLSPIFSNQGDCDAV-SRFLTASLVAMC  305
             K+  Q+ + +TF+    L+NLLPTG+V++FQ++ P+ ++QG C  + SR+LT  LV +C
Sbjct  19   HKSKAQRVVRKTFKGTTQLSNLLPTGSVMSFQIMCPVLTHQGQCPTITSRWLTCFLVFVC  78

Query  306  GLSCFLLSFTDSFKDQKGNVCYGVATVKGLWVIDGSASLPPELAAKYKVKFIDFVHAVMS  485
             +SCF+ SFTDS +D  G V YG+AT  GL+V+DGS +L  E   KYK+K +DFVHA+MS
Sbjct  79   AISCFIFSFTDSIRDPNGKVRYGLATWTGLYVVDGSITLTEEEKEKYKLKILDFVHAIMS  138

Query  486  VLVFGAIALFDQNVVSCFXPXPXXEXXXILPXVPVGXGXVCXXLFVVFPPXXXGIGFPXT  665
            +LVF AI++FDQNV  C  P P  E   IL  +P   G +C   F+ FP    GIG P T
Sbjct  139  MLVFFAISMFDQNVTRCLFPVPSAETREILTSLPFVIGVICGGFFLAFPTRRHGIGSPLT  198

Query  666  XD  671
             +
Sbjct  199  KE  200



>emb|CDO97608.1| unnamed protein product [Coffea canephora]
Length=221

 Score =   166 bits (421),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 89/172 (52%), Positives = 115/172 (67%), Gaps = 3/172 (2%)
 Frame = +3

Query  159  QTFQSAAHLANLLPTGAVLAFQLLSPIFSNQGDCDAVSRFLTASLVAMCGLSCFLLSFTD  338
            +  +S AHLANLLPTG +LAFQLL+PI +N G CDA +R +T  L+ + G+SCFL  FTD
Sbjct  47   RALESTAHLANLLPTGTLLAFQLLTPIATNNGSCDAATRPMTLILLLILGVSCFLACFTD  106

Query  339  SFKDQKGNVCYGVATVKGLWVID---GSASLPPELAAKYKVKFIDFVHAVMSVLVFGAIA  509
            SF+   G V YG A+ +GLWV D    SAS  P   +KY++ FID VHAV+SV VF ++A
Sbjct  107  SFRASDGQVYYGFASPRGLWVFDYPAASASGIPGDLSKYRLSFIDVVHAVLSVFVFVSVA  166

Query  510  LFDQNVVSCFXPXPXXEXXXILPXVPVGXGXVCXXLFVVFPPXXXGIGFPXT  665
            L D+NV+SCF P P  E   +L   P+  G +C  LFV+FP    GIG+P T
Sbjct  167  LRDKNVLSCFYPSPSHETEEVLDIFPISIGLICSLLFVIFPTRRHGIGYPVT  218



>ref|XP_004491124.1| PREDICTED: uncharacterized protein LOC101495511 [Cicer arietinum]
Length=213

 Score =   164 bits (414),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 87/162 (54%), Positives = 115/162 (71%), Gaps = 1/162 (1%)
 Frame = +3

Query  174  AAHLANLLPTGAVLAFQLLSPIFSNQGDCDAVSRFLTASLVAMCGLSCFLLSFTDSFKDQ  353
             A+LANLLPTG +LAFQ+L+P+F+N G CD+V+R LT  L+ +  LSCFL SFTD+ K  
Sbjct  46   TANLANLLPTGTLLAFQILTPVFTNNGACDSVTRLLTLLLLILLSLSCFLASFTDTVKAS  105

Query  354  KGNVCYGVATVKGLWVIDGSASLPPELAAKYKVKFIDFVHAVMSVLVFGAIALFDQNVVS  533
             G V +G+AT+KG W+ D S    PEL +KYK++ IDFVHA++SVLVF A+AL D NV+ 
Sbjct  106  DGRVYHGIATLKGFWLFDYSEGTLPEL-SKYKLRLIDFVHALLSVLVFFAVALRDNNVLM  164

Query  534  CFXPXPXXEXXXILPXVPVGXGXVCXXLFVVFPPXXXGIGFP  659
            C+ P P  E   +L  VPVG G +C  LF+VFP    G+G+P
Sbjct  165  CYYPQPRHETKEVLDIVPVGVGFLCSLLFLVFPTTRHGVGYP  206



>ref|XP_006471188.1| PREDICTED: uncharacterized protein LOC102623701 [Citrus sinensis]
Length=217

 Score =   164 bits (414),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 94/173 (54%), Positives = 116/173 (67%), Gaps = 8/173 (5%)
 Frame = +3

Query  168  QSAAHLANLLPTGAVLAFQLLSPIFSNQGDCDAVSRFLTASLVAMCGLSCFLLSFTDSFK  347
            +S A+LANLLPTG +LAFQLL+PIF+N G CDA +R LT  L+ +   SCFL SFTDS K
Sbjct  42   KSTANLANLLPTGTLLAFQLLTPIFTNNGSCDAATRLLTLLLLLLLAASCFLASFTDSVK  101

Query  348  DQK-GNVCYGVATVKGLWVID------GSASLPPELAAKYKVKFIDFVHAVMSVLVFGAI  506
                G V YG AT KGL++ D       S    P+L  KY+++FID VHAV+SVLVF A+
Sbjct  102  SSSSGQVYYGFATFKGLFLFDYIQNPNASDHDLPDLN-KYRIRFIDGVHAVLSVLVFAAV  160

Query  507  ALFDQNVVSCFXPXPXXEXXXILPXVPVGXGXVCXXLFVVFPPXXXGIGFPXT  665
            AL D+NV+SCF P P  E   +L  VPVG G +C  LFV+FP    GIG+P T
Sbjct  161  ALRDKNVLSCFFPTPKHETQEVLDIVPVGIGLICSLLFVIFPTRRHGIGYPIT  213



>ref|XP_011028335.1| PREDICTED: uncharacterized protein LOC105128394 [Populus euphratica]
Length=231

 Score =   162 bits (411),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 95/183 (52%), Positives = 123/183 (67%), Gaps = 13/183 (7%)
 Frame = +3

Query  135  NLVQKAISQTFQSAAHLANLLPTGAVLAFQLLSPIFSNQGDCDAVSRFLTASLVAMCGLS  314
             L Q+AISQT  S A+LANLLPTG +LAFQLL+P F+N G CD+ +R +T  L+A+  LS
Sbjct  49   TLSQRAISQTLTSTANLANLLPTGTLLAFQLLTPFFTNNGACDSATRPMTLILLALLALS  108

Query  315  CFLLSFTDSFKD-QKGNVCYGVATVKGLWVIDGSASLPPELAA-------KYKVKFIDFV  470
            CFL SFTDS +    G V YG+A+ KG+++ D      P+ AA       K+K++FID V
Sbjct  109  CFLASFTDSVRSPTDGRVYYGLASFKGMYLFDC-----PDPAASGLVDLSKFKMRFIDVV  163

Query  471  HAVMSVLVFGAIALFDQNVVSCFXPXPXXEXXXILPXVPVGXGXVCXXLFVVFPPXXXGI  650
            HAV+SVLVF ++AL D+NV+SCF P P  E   +L  VPVG G +C  LFVVFP    G 
Sbjct  164  HAVLSVLVFISVALRDKNVLSCFYPMPKHETQEVLSIVPVGVGLICSLLFVVFPTRRHGS  223

Query  651  GFP  659
            G+P
Sbjct  224  GYP  226



>ref|XP_006431669.1| hypothetical protein CICLE_v10003600mg [Citrus clementina]
 gb|ESR44909.1| hypothetical protein CICLE_v10003600mg [Citrus clementina]
 gb|KDO39056.1| hypothetical protein CISIN_1g048572mg [Citrus sinensis]
Length=234

 Score =   162 bits (410),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 96/181 (53%), Positives = 119/181 (66%), Gaps = 8/181 (4%)
 Frame = +3

Query  144  QKAISQTFQSAAHLANLLPTGAVLAFQLLSPIFSNQGDCDAVSRFLTASLVAMCGLSCFL  323
            ++A+SQT  S A+LANLLPTG +LAFQLL+PIF+N G CDA +  LT  L+ +   SC L
Sbjct  51   RRALSQTLTSTANLANLLPTGTLLAFQLLTPIFTNNGSCDAATGPLTLLLLLLLAASCLL  110

Query  324  LSFTDSFKDQK-GNVCYGVATVKGLWVID------GSASLPPELAAKYKVKFIDFVHAVM  482
             SFTDS K    G V YG AT KGL++ D       S    P+L  KY+++FID VHAV 
Sbjct  111  ASFTDSVKSSSSGQVYYGFATFKGLFLFDYIQNPNASDHDLPDLI-KYRIRFIDGVHAVS  169

Query  483  SVLVFGAIALFDQNVVSCFXPXPXXEXXXILPXVPVGXGXVCXXLFVVFPPXXXGIGFPX  662
            SVLVF A+AL D+NV+SCF P P  E   +L  VPVG G +C  LFV+FP    GIG+P 
Sbjct  170  SVLVFAAVALRDKNVLSCFFPTPKHETQEVLDIVPVGIGLICSLLFVIFPTRRHGIGYPI  229

Query  663  T  665
            T
Sbjct  230  T  230



>ref|XP_006385029.1| hypothetical protein POPTR_0004s23220g [Populus trichocarpa]
 gb|ERP62826.1| hypothetical protein POPTR_0004s23220g [Populus trichocarpa]
Length=231

 Score =   160 bits (406),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 94/183 (51%), Positives = 123/183 (67%), Gaps = 13/183 (7%)
 Frame = +3

Query  135  NLVQKAISQTFQSAAHLANLLPTGAVLAFQLLSPIFSNQGDCDAVSRFLTASLVAMCGLS  314
             L Q+AISQT  S A+LANLLPTG +LAFQLL+P F+N G CD+ +R +T  L+A+  LS
Sbjct  49   TLSQRAISQTLTSTANLANLLPTGTLLAFQLLTPFFTNNGACDSATRPMTLILLALLALS  108

Query  315  CFLLSFTDSFKD-QKGNVCYGVATVKGLWVIDGSASLPPELAA-------KYKVKFIDFV  470
            CFL SFTDS +    G V YG+A+ KG+++ D      P+ AA       K+K+ FID V
Sbjct  109  CFLASFTDSVRSPTDGRVYYGLASFKGMYLFDC-----PDPAASGLVDLSKFKMGFIDVV  163

Query  471  HAVMSVLVFGAIALFDQNVVSCFXPXPXXEXXXILPXVPVGXGXVCXXLFVVFPPXXXGI  650
            HAV+SVLVF ++AL ++NV+SCF P P  E   +L  VP+G G +C  LFVVFP    GI
Sbjct  164  HAVLSVLVFISVALREKNVLSCFYPMPKHETQEVLSIVPIGVGLICSLLFVVFPTRRHGI  223

Query  651  GFP  659
            G+P
Sbjct  224  GYP  226



>ref|NP_001175354.1| Os08g0106501 [Oryza sativa Japonica Group]
 dbj|BAD08943.1| hypothetical protein [Oryza sativa Japonica Group]
 dbj|BAD09382.1| hypothetical protein [Oryza sativa Japonica Group]
 gb|EAZ41248.1| hypothetical protein OsJ_25756 [Oryza sativa Japonica Group]
 dbj|BAH01702.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAH94082.1| Os08g0106501 [Oryza sativa Japonica Group]
Length=224

 Score =   158 bits (399),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 88/178 (49%), Positives = 117/178 (66%), Gaps = 4/178 (2%)
 Frame = +3

Query  153  ISQTFQSAAHLANLLPTGAVLAFQLLSPIFSNQGDCDAVSRFLTASLVAMCGLSCFLLSF  332
            +SQ   S A LANLLPTG V+AFQLL+P F+N G CDA +  LTA+L+A+  LSC L SF
Sbjct  43   LSQALASTASLANLLPTGTVMAFQLLAPTFTNNGACDATTSLLTAALLALLALSCVLASF  102

Query  333  TDSFKDQKGNVCYGVATVKGLWVID----GSASLPPELAAKYKVKFIDFVHAVMSVLVFG  500
            TDS +   G V YG+AT +GLW++D    G+ + P    ++Y+++ ID VHA++SV VFG
Sbjct  103  TDSVRGPDGRVYYGLATPRGLWLLDYPPAGAGAPPQPDTSRYRMRAIDGVHALLSVGVFG  162

Query  501  AIALFDQNVVSCFXPXPXXEXXXILPXVPVGXGXVCXXLFVVFPPXXXGIGFPXTXDN  674
             +A  D+NVV CF P P      +L  VP+G G +C  LFVVFP    GIG+P T + 
Sbjct  163  VVAARDKNVVGCFWPSPAKGTEEVLGIVPLGVGVMCSLLFVVFPTTRHGIGYPVTNNT  220



>gb|EAZ05316.1| hypothetical protein OsI_27521 [Oryza sativa Indica Group]
Length=224

 Score =   158 bits (399),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 88/178 (49%), Positives = 117/178 (66%), Gaps = 4/178 (2%)
 Frame = +3

Query  153  ISQTFQSAAHLANLLPTGAVLAFQLLSPIFSNQGDCDAVSRFLTASLVAMCGLSCFLLSF  332
            +SQ   S A LANLLPTG V+AFQLL+P F+N G CDA +  LTA+L+A+  LSC L SF
Sbjct  43   LSQALASTASLANLLPTGTVMAFQLLAPTFTNNGACDATTSLLTAALLALLALSCVLASF  102

Query  333  TDSFKDQKGNVCYGVATVKGLWVID----GSASLPPELAAKYKVKFIDFVHAVMSVLVFG  500
            TDS +   G V YG+AT +GLW++D    G+ + P    ++Y+++ ID VHA++SV VFG
Sbjct  103  TDSVRGPDGRVYYGLATPRGLWLLDYPPAGAGAPPQPDTSRYRLRAIDGVHALLSVGVFG  162

Query  501  AIALFDQNVVSCFXPXPXXEXXXILPXVPVGXGXVCXXLFVVFPPXXXGIGFPXTXDN  674
             +A  D+NVV CF P P      +L  VP+G G +C  LFVVFP    GIG+P T + 
Sbjct  163  VVAARDKNVVGCFWPSPAKGTEEVLGIVPLGVGVMCSLLFVVFPTTRHGIGYPVTNNT  220



>ref|XP_008246531.1| PREDICTED: uncharacterized protein LOC103344692 [Prunus mume]
Length=205

 Score =   154 bits (388),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 84/184 (46%), Positives = 111/184 (60%), Gaps = 5/184 (3%)
 Frame = +3

Query  117  PDEVEKNLVQKAISQTFQSAAHLANLLPTGAVLAFQLLSPIFSNQGDCDAVSRFLTASLV  296
            P  + K      + QT  SAA+LANLLPTG VLAFQ L+P FSN G C   ++FLTAS++
Sbjct  16   PSTMVKGGSNYPVHQTLASAANLANLLPTGTVLAFQTLTPTFSNNGSCQLSNKFLTASII  75

Query  297  AMCGLSCFLLSFTDSFKDQ--KGNVCYGVATVKGLWVIDGS--ASLPPELAAKYKVKFID  464
              C L CFL SFTDSFKD    G + YG+AT KGL++ + S   ++  +L  KYK+KF+D
Sbjct  76   IFCALLCFLSSFTDSFKDNGTDGKLYYGIATFKGLYIFNYSKLENINTDL-EKYKIKFLD  134

Query  465  FVHAVMSVLVFGAIALFDQNVVSCFXPXPXXEXXXILPXVPVGXGXVCXXLFVVFPPXXX  644
            FVHA MS+ VF   AL + +V SCF          +   +P+G G +    F +FP    
Sbjct  135  FVHAFMSLFVFLIFALSNSHVQSCFLTGVGINYSELAMNLPLGAGILSSFFFTIFPTARR  194

Query  645  GIGF  656
            GIG+
Sbjct  195  GIGY  198



>ref|XP_010087431.1| hypothetical protein L484_018458 [Morus notabilis]
 gb|EXB29041.1| hypothetical protein L484_018458 [Morus notabilis]
Length=203

 Score =   152 bits (384),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 92/176 (52%), Positives = 115/176 (65%), Gaps = 11/176 (6%)
 Frame = +3

Query  144  QKAISQTFQSAAHLANLLPTGAVLAFQLLSPIFSNQGDCDAVSRFLTASLVAMCGLSCFL  323
            Q+ ISQT  SAA+LANLLPTG +LAFQLL+PIF+N G CD V+R L+  L+ +   SCFL
Sbjct  34   QRGISQTLTSAANLANLLPTGTLLAFQLLTPIFTNNGACDPVTRTLSFLLLLLLSFSCFL  93

Query  324  LSFTDSFKDQKGN--VCYGVATVKGLWVIDGSASLPPELAAKYKVKFIDFVHAVMSVLVF  497
             SFTDS K   G   V +           D + S  P+L+ K++++FID+VHAV+SVLVF
Sbjct  94   ASFTDSMKASDGQRAVLFDYP--------DPTGSDLPDLS-KFRIRFIDWVHAVLSVLVF  144

Query  498  GAIALFDQNVVSCFXPXPXXEXXXILPXVPVGXGXVCXXLFVVFPPXXXGIGFPXT  665
            G +AL D+NVV CF P P      +L  VPVG G VC  LFVVFP    GIG+P T
Sbjct  145  GVVALRDKNVVGCFYPQPGHTVQEVLDIVPVGVGLVCSLLFVVFPTRRHGIGYPVT  200



>ref|XP_007207654.1| hypothetical protein PRUPE_ppa021534mg [Prunus persica]
 gb|EMJ08853.1| hypothetical protein PRUPE_ppa021534mg [Prunus persica]
Length=187

 Score =   151 bits (381),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 82/172 (48%), Positives = 107/172 (62%), Gaps = 5/172 (3%)
 Frame = +3

Query  153  ISQTFQSAAHLANLLPTGAVLAFQLLSPIFSNQGDCDAVSRFLTASLVAMCGLSCFLLSF  332
            + QT  SAA+LANLLPTG VLAFQ L P FSN G C   ++FLTAS++  C L CFL SF
Sbjct  10   VHQTIASAANLANLLPTGTVLAFQTLIPTFSNNGSCQLSNKFLTASVIIFCALLCFLSSF  69

Query  333  TDSFKDQ--KGNVCYGVATVKGLWVIDGS--ASLPPELAAKYKVKFIDFVHAVMSVLVFG  500
            TDSFKD    G + YG+AT KGL++ + S   ++  +L  KYK+KF+DFVHA MS+ VF 
Sbjct  70   TDSFKDNDTDGKLYYGIATFKGLYIFNYSKLENINTDL-EKYKIKFLDFVHAFMSLFVFL  128

Query  501  AIALFDQNVVSCFXPXPXXEXXXILPXVPVGXGXVCXXLFVVFPPXXXGIGF  656
              AL + +V SCF          +   +P+G G +    F +FP    GIG+
Sbjct  129  IFALSNSHVQSCFLSGVGINYSELAMNLPLGAGILSSCFFTIFPTARRGIGY  180



>gb|EMT28510.1| hypothetical protein F775_11484 [Aegilops tauschii]
Length=181

 Score =   150 bits (380),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 90/208 (43%), Positives = 109/208 (52%), Gaps = 49/208 (24%)
 Frame = +3

Query  57   GDEELSHNNVVVSEKVPLL-----VPDEVEKNL--VQKAISQTFQSAAHLANLLPTGAVL  215
            G E+  H    V E+ PLL     V D+    L  +Q+AISQT+QS AHLA LLPTG V+
Sbjct  12   GREDEVHG---VDEERPLLARPPAVRDDPGDGLSPMQRAISQTYQSTAHLATLLPTGTVM  68

Query  216  AFQLLSPIFSNQGDCDAVSRFLTASLVAMCGLSCFLLSFTDSFKDQKGNVCYGVATVKGL  395
            AFQL SPI ++QG C   +R +  +LVA+CGLSCF LSFTDSF+D KG V YG AT    
Sbjct  69   AFQLRSPIVTDQGHCVRANRAMAGALVALCGLSCFALSFTDSFRDAKGAVRYGFAT----  124

Query  396  WVIDGSASLPPELAAKYKVKFIDFVHAVMSVLVFGAIALFDQNVVSCFXPXPXXEXXXIL  575
                                                +ALFD NVVSCF P P  +   +L
Sbjct  125  -----------------------------------RVALFDHNVVSCFYPVPSEDAAQVL  149

Query  576  PXVPVGXGXVCXXLFVVFPPXXXGIGFP  659
              +P+  G V   LFV FP    GIGFP
Sbjct  150  TVLPIAIGVVGSMLFVTFPTTRHGIGFP  177



>gb|EMT03075.1| hypothetical protein F775_17628 [Aegilops tauschii]
Length=219

 Score =   152 bits (383),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 80/191 (42%), Positives = 110/191 (58%), Gaps = 3/191 (2%)
 Frame = +3

Query  90   VSEKVPLLVPDEVEKNLVQKAISQTFQSAAHLANLLPTGAVLAFQLLSPIFSNQGDCDAV  269
             +++ PLL  +   +      + +   S A LA  LPTGAVLAF+ LSP F+  G C A 
Sbjct  26   AAQQAPLLG-NADGRTQTTTVVGKALSSTADLAKHLPTGAVLAFEFLSPPFTADGSCTAA  84

Query  270  SRFLTASLVAMCGLSCFLLSFTDSFKDQKGNVCYGVATVKG-LWVIDGSASLPPELAAKY  446
            +R LT  L+  C LSCFLL FTDS++D+ G V YG  T  G L +IDG+  +PP    +Y
Sbjct  85   NRALTGCLIGACALSCFLLCFTDSYRDETGTVRYGFVTPSGRLRLIDGAQQMPPR-DERY  143

Query  447  KVKFIDFVHAVMSVLVFGAIALFDQNVVSCFXPXPXXEXXXILPXVPVGXGXVCXXLFVV  626
            +++  D +H V+S +VF A+A+ D NVV+CF P        +L  VP+  G     LF +
Sbjct  144  RLRARDVLHGVLSFVVFLAVAMVDSNVVACFYPVESATTRQLLAAVPMSAGAAGSFLFAM  203

Query  627  FPPXXXGIGFP  659
            FP    GIGFP
Sbjct  204  FPSTRRGIGFP  214



>ref|XP_010941734.1| PREDICTED: uncharacterized protein LOC105059916 [Elaeis guineensis]
Length=198

 Score =   150 bits (380),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 73/169 (43%), Positives = 107/169 (63%), Gaps = 1/169 (1%)
 Frame = +3

Query  159  QTFQSAAHLANLLPTGAVLAFQLLSPIFSNQGDCDAVSRFLTASLVAMCGLSCFLLSFTD  338
            +TFQ   +L  +LP+G V  FQ L+P+ +N+G C  V+++LT +L+ +CG+SCF  SFTD
Sbjct  23   KTFQGLGNLIKILPSGTVFLFQFLNPLLTNKGSCHTVNKYLTGALLIVCGISCFFSSFTD  82

Query  339  SFKDQKGNVCYGVATVKGLWVIDGSASLPPELAAKYKVKFIDFVHAVMSVLVFGAIALFD  518
            S+    G V YGVAT  GL    GS S   +L +K+K++F DFVHA +++ VF  IAL +
Sbjct  83   SYVGSNGKVYYGVATKDGLKAFSGSDSSKKDL-SKHKLRFSDFVHAFLALAVFAVIALLN  141

Query  519  QNVVSCFXPXPXXEXXXILPXVPVGXGXVCXXLFVVFPPXXXGIGFPXT  665
             N+VSCF P    +   ++  +PV  G +   +F+VFP    GIG+P T
Sbjct  142  SNIVSCFYPSFESDEKKLIMALPVVIGGISSFVFMVFPSTRHGIGYPST  190



>ref|XP_009335668.1| PREDICTED: uncharacterized protein LOC103928362 [Pyrus x bretschneideri]
Length=203

 Score =   148 bits (374),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 79/178 (44%), Positives = 107/178 (60%), Gaps = 5/178 (3%)
 Frame = +3

Query  129  EKNLVQKAISQTFQSAAHLANLLPTGAVLAFQLLSPIFSNQGDCDAVSRFLTASLVAMCG  308
            + +L Q ++ QT  SAA+LANLLPT  VLAF  L P FSN G C   +++LT  +V  C 
Sbjct  21   KHSLNQYSVHQTLASAANLANLLPTSTVLAFHTLIPTFSNNGSCQLFNKYLTTCVVTFCA  80

Query  309  LSCFLLSFTDSFKDQKGNVCYGVATVKGLWVIDGSAS--LPPELAAKYKVKFIDFVHAVM  482
            L CFL SF+DSF D    + YG+AT KG+++ + S +  +  +L  KYK+KFIDFVHA M
Sbjct  81   LLCFLSSFSDSFMDNDRKLYYGIATFKGMYIFNCSNAEGMDRDL-KKYKIKFIDFVHAFM  139

Query  483  SVLVFGAIALFDQNVVSCFXPXPXXEXXXILPXVPVGXGXVCXXLFVVFPPXXXGIGF  656
            S+ VF   AL + NV SCF          +   +P+G G +   LF +FP    GIG+
Sbjct  140  SLFVFLVFALSNSNVQSCFFYEAGISELTM--NLPLGAGILSSFLFTIFPTTRRGIGY  195



>ref|XP_010111869.1| hypothetical protein L484_020662 [Morus notabilis]
 gb|EXC31834.1| hypothetical protein L484_020662 [Morus notabilis]
Length=196

 Score =   147 bits (372),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 76/180 (42%), Positives = 109/180 (61%), Gaps = 5/180 (3%)
 Frame = +3

Query  132  KNLVQKAISQTFQSAAHLANLLPTGAVLAFQLLSPIFSNQGDCDAVSRFLTASLVAMCGL  311
            KN     + QT  SAA+LANLLPTG VLAFQ  +P FSN G C   +++LTA L+A+C  
Sbjct  10   KNAPNHPVHQTLASAANLANLLPTGTVLAFQTFAPSFSNNGVCHLSNKYLTAILIAVCAT  69

Query  312  SCFLLSFTDSFKDQKGNVCYGVATVKGLWVID-----GSASLPPELAAKYKVKFIDFVHA  476
             CFL SFTD+F D  G + YG+AT +GL++ +     G+     +   ++K++F+DFVHA
Sbjct  70   FCFLSSFTDTFVDSTGKLHYGIATFRGLYIFNFDSECGNDQCGKKDLERFKLRFVDFVHA  129

Query  477  VMSVLVFGAIALFDQNVVSCFXPXPXXEXXXILPXVPVGXGXVCXXLFVVFPPXXXGIGF  656
             +S+L+F   AL D +V SC+      E   +   +P+G G +   LF +FP    GIG+
Sbjct  130  FVSLLLFLIFALGDSDVQSCYFSEVGTEWNSLFMNLPLGSGALSTFLFTIFPTTRRGIGY  189



>ref|XP_002444870.1| hypothetical protein SORBIDRAFT_07g000680 [Sorghum bicolor]
 gb|EES14365.1| hypothetical protein SORBIDRAFT_07g000680 [Sorghum bicolor]
Length=250

 Score =   149 bits (376),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 83/179 (46%), Positives = 109/179 (61%), Gaps = 6/179 (3%)
 Frame = +3

Query  141  VQKAISQTFQSAAHLANLLPTGAVLAFQLLSPIFSNQGDCDAVSRFLTASLVAMCGLSCF  320
               A+SQ   S A+LANLLPTG +LAF LL+P F+N G CDA +  LT  L+A+  L+  
Sbjct  60   TSSALSQALASTANLANLLPTGTLLAFNLLAPTFTNHGACDATTSLLTRCLLAVLALASA  119

Query  321  LLSFTDSFKD-QKGNVCYGVATVKGLWVIDGSASLPP----ELAAKYKVKFIDFVHAVMS  485
            L  FTDS K    G+V YGVAT  GLW+ID     PP      + +Y++ FIDFVHA +S
Sbjct  120  LACFTDSLKSPHDGHVYYGVATRTGLWLIDYPPDAPPLPTTTASCRYRLAFIDFVHAALS  179

Query  486  VLVFGAIALFDQNVVSCF-XPXPXXEXXXILPXVPVGXGXVCXXLFVVFPPXXXGIGFP  659
              VFG +A  D++VV+C   P P  E   ++  +P+G G +C  LFV FP    GIG+P
Sbjct  180  AAVFGVVAARDRDVVACLCGPTPRRETKELIDVLPLGVGVLCSLLFVAFPTRRHGIGYP  238



>emb|CDO98951.1| unnamed protein product [Coffea canephora]
Length=210

 Score =   147 bits (372),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 69/167 (41%), Positives = 101/167 (60%), Gaps = 2/167 (1%)
 Frame = +3

Query  159  QTFQSAAHLANLLPTGAVLAFQLLSPIFSNQGDCDAVSRFLTASLVAMCGLSCFLLSFTD  338
            +TF    +L  LLPTG V  +Q L+PI +N G C   ++++++ L A+CG+SCFL +FTD
Sbjct  22   KTFTGVGNLIRLLPTGTVFLYQFLNPILTNNGSCSNTNKYVSSVLFALCGISCFLSTFTD  81

Query  339  SFKDQKGNVCYGVATVKGLWVIDGSASLPPELAAKYKVKFIDFVHAVMSVLVFGAIALFD  518
            S+KD +GN+ YG+AT KG W   G++S        Y+++  DFVHA +S++VF  ++L D
Sbjct  82   SYKDDQGNIHYGIATFKGFWPTSGASSSVD--FKSYRLQIGDFVHATLSLIVFSVLSLLD  139

Query  519  QNVVSCFXPXPXXEXXXILPXVPVGXGXVCXXLFVVFPPXXXGIGFP  659
             N V CF P        +L  +P   G V   +FV FP    GIG+P
Sbjct  140  NNTVECFYPSFESTQKALLKGLPPVIGSVAAAVFVAFPNKRHGIGYP  186



>ref|XP_008776531.1| PREDICTED: uncharacterized protein LOC103696625 [Phoenix dactylifera]
Length=224

 Score =   146 bits (369),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 76/176 (43%), Positives = 105/176 (60%), Gaps = 5/176 (3%)
 Frame = +3

Query  153  ISQTFQSAAHLANLLPTGAVLAFQLLSPIFSNQGDCDAVSRFLTASLVAMCGLSCFLLSF  332
            I +T  +AA+LA LLPTG VLAFQ LSP FSN G C A ++++T SL+ +C +SC   SF
Sbjct  44   IDKTLSTAANLAQLLPTGTVLAFQALSPSFSNHGICYASNKYITLSLLLICTISCIFFSF  103

Query  333  TDSFKDQKGNVCYGVATVKGLWVI-----DGSASLPPELAAKYKVKFIDFVHAVMSVLVF  497
            TDSFK   G + YG+AT K   V      DG  S   E   +++++++D+VHA  SVLVF
Sbjct  104  TDSFKGTNGKLYYGMATCKSFIVFNYQPSDGDRSKVLEDLLRFRIRWLDYVHAFFSVLVF  163

Query  498  GAIALFDQNVVSCFXPXPXXEXXXILPXVPVGXGXVCXXLFVVFPPXXXGIGFPXT  665
             A+   D N+  CF P        IL  +P+G G +   +F++FP    GIG+  T
Sbjct  164  LALTFSDTNIQHCFFPDSGSNSKQILQNLPLGAGFLSSMVFLIFPTTRQGIGYSDT  219



>ref|XP_008361977.1| PREDICTED: uncharacterized protein LOC103425667 [Malus domestica]
Length=191

 Score =   144 bits (363),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 74/172 (43%), Positives = 103/172 (60%), Gaps = 3/172 (2%)
 Frame = +3

Query  159  QTFQSAAHLANLLPTGAVLAFQLLSPIFSNQGDCDAVSRFLTASLVAMCGLSCFLLSFTD  338
            +TF  A +L  LLPTG V  FQ L+P+ +N GDC A++++L+A L+ +CG SC   SFTD
Sbjct  21   RTFTGAGNLIKLLPTGTVFLFQFLNPVLTNNGDCTALNKYLSAILIVLCGFSCCFASFTD  80

Query  339  SFKDQKGNVCYGVATVKGLWVIDGSASLPPELAAKYKVKFIDFVHAVMSVLVFGAIALFD  518
            S+    G   YGVAT KGLW    S S+  +L+A YK++  DFVHA  SV+VF  ++L D
Sbjct  81   SYTGSDGQTHYGVATCKGLWPSTNSNSV--DLSA-YKLRIGDFVHAFFSVIVFAVLSLLD  137

Query  519  QNVVSCFXPXPXXEXXXILPXVPVGXGXVCXXLFVVFPPXXXGIGFPXTXDN  674
             N V C+ P        +L  +P   G +   +FVVFP    GIG+P +  +
Sbjct  138  TNTVRCYYPGFESTEKTLLQVLPPVIGTIAGTVFVVFPNNRHGIGYPASSSD  189



>ref|XP_008370526.1| PREDICTED: uncharacterized protein LOC103433991 [Malus domestica]
Length=203

 Score =   144 bits (364),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 77/178 (43%), Positives = 104/178 (58%), Gaps = 3/178 (2%)
 Frame = +3

Query  126  VEKNLVQKAISQTFQSAAHLANLLPTGAVLAFQLLSPIFSNQGDCDAVSRFLTASLVAMC  305
            ++ +L Q A+ QT  SAA+L NLLPT  VLAF  L P  SN G C   +++LT  ++  C
Sbjct  20   LKHSLNQYAVHQTLASAANLTNLLPTSTVLAFHTLIPTXSNNGSCQLFNKYLTTCVITFC  79

Query  306  GLSCFLLSFTDSFKDQKGNVCYGVATVKGLWVIDGSASLPPELAAK-YKVKFIDFVHAVM  482
             L CFL SFTDSF D    + YG+AT KG+++ + S +   +   K YK+KFIDFVHA M
Sbjct  80   ALLCFLSSFTDSFMDNDRKLYYGIATFKGMYIFNCSNAEDMDRDLKNYKIKFIDFVHAFM  139

Query  483  SVLVFGAIALFDQNVVSCFXPXPXXEXXXILPXVPVGXGXVCXXLFVVFPPXXXGIGF  656
            S+ VF   AL + NV SCF          +   +P+G G +   LF +FP    GIG+
Sbjct  140  SLFVFLVFALCNFNVQSCFFSEAGIXELTM--NLPLGAGILSSFLFTIFPTTRRGIGY  195



>ref|NP_001144303.1| hypothetical protein [Zea mays]
 gb|ACG39406.1| hypothetical protein [Zea mays]
 gb|ACN28415.1| unknown [Zea mays]
 gb|AFW74215.1| hypothetical protein ZEAMMB73_018283 [Zea mays]
Length=235

 Score =   145 bits (366),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 84/176 (48%), Positives = 108/176 (61%), Gaps = 5/176 (3%)
 Frame = +3

Query  147  KAISQTFQSAAHLANLLPTGAVLAFQLLSPIFSNQGDCDAVSRFLTASLVAMCGLSCFLL  326
             A+SQ   S A+LANLLPTG +LAF LL+P F+N G CDA +  LT  L+A+  L+  L 
Sbjct  46   SALSQALSSTANLANLLPTGTLLAFNLLAPTFTNHGACDATTSLLTRGLLALLALASALA  105

Query  327  SFTDSFKD-QKGNVCYGVATVKGLWVID---GSASLPPELAAKYKVKFIDFVHAVMSVLV  494
             FTDS K    G V YGVAT  GLW+ID   G+  LP     +Y++ FIDFVHA +S  V
Sbjct  106  CFTDSLKSPHDGRVYYGVATRTGLWLIDYPPGAPPLPEGATGRYRLAFIDFVHAALSAAV  165

Query  495  FGAIALFDQNVVSC-FXPXPXXEXXXILPXVPVGXGXVCXXLFVVFPPXXXGIGFP  659
            FG +A  D++VV C + P P      +L  +P+G G +C  LFV FP    GIG+P
Sbjct  166  FGVVAARDRDVVVCLYGPTPDRATQDLLDVLPLGVGVLCSLLFVAFPTTRHGIGYP  221



>gb|KDO74937.1| hypothetical protein CISIN_1g0286151mg, partial [Citrus sinensis]
Length=183

 Score =   143 bits (361),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 73/182 (40%), Positives = 107/182 (59%), Gaps = 4/182 (2%)
 Frame = +3

Query  138  LVQKAISQTFQSAAHLANLL---PTGAVLAFQLLSPIFSNQGDCDAVSRFLTASLVAMCG  308
            +V K  S+T ++ + L NLL   PTG V  +Q L+P+ +N G C  V+++LT+ L+ +CG
Sbjct  1    MVAKDNSKTGKTLSGLGNLLRLLPTGTVFVYQFLNPVLTNNGKCSTVNKYLTSFLIGLCG  60

Query  309  LSCFLLSFTDSFKDQKGNVCYGVATVKGLWVIDGSASLPPELAAKYKVKFIDFVHAVMSV  488
            LSC    FTDS+K   G   YG+AT+KGLW    S S   +L++ YK++  DF HA  S+
Sbjct  61   LSCGFSCFTDSYKGSDGITHYGIATLKGLWPSSRSDSASVDLSS-YKIRVADFAHAFFSI  119

Query  489  LVFGAIALFDQNVVSCFXPXPXXEXXXILPXVPVGXGXVCXXLFVVFPPXXXGIGFPXTX  668
            +VF  ++L D N V CF P        +L  +P   G V   +FV+FP    GIG+P + 
Sbjct  120  IVFAVVSLLDGNTVQCFYPSFESTQKALLMVLPPAIGAVSSVIFVLFPNKRHGIGYPASS  179

Query  669  DN  674
            D+
Sbjct  180  DS  181



>ref|XP_009339949.1| PREDICTED: uncharacterized protein LOC103932125 [Pyrus x bretschneideri]
Length=199

 Score =   143 bits (360),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 74/170 (44%), Positives = 102/170 (60%), Gaps = 3/170 (2%)
 Frame = +3

Query  150  AISQTFQSAAHLANLLPTGAVLAFQLLSPIFSNQGDCDAVSRFLTASLVAMCGLSCFLLS  329
            A  +TF  A +L  LLPTG V  FQ L+P+ +N G+C A++++L+A L+ +CGLSC   S
Sbjct  18   AKDRTFTGAGNLIKLLPTGTVFLFQFLNPVLTNNGNCTALNKYLSAILIVLCGLSCCFAS  77

Query  330  FTDSFKDQKGNVCYGVATVKGLWVIDGSASLPPELAAKYKVKFIDFVHAVMSVLVFGAIA  509
            FTDS+    G   YGVAT KGLW    S S+  +L+A YK++  DFVHA  SV+VF  ++
Sbjct  78   FTDSYTGSDGKTHYGVATCKGLWPSTNSNSV--DLSA-YKLRIGDFVHAFFSVIVFAVLS  134

Query  510  LFDQNVVSCFXPXPXXEXXXILPXVPVGXGXVCXXLFVVFPPXXXGIGFP  659
            L D N V C+ P        +L  +P   G +   +FV FP    GIG+P
Sbjct  135  LLDTNTVRCYYPGFESTEKTLLQVLPPIIGTIAGTVFVAFPNTRHGIGYP  184



>ref|XP_010242558.1| PREDICTED: uncharacterized protein LOC104586881 [Nelumbo nucifera]
Length=186

 Score =   142 bits (359),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 72/174 (41%), Positives = 103/174 (59%), Gaps = 4/174 (2%)
 Frame = +3

Query  144  QKAISQTFQSAAHLANLLPTGAVLAFQLLSPIFSNQGDCDAVSRFLTASLVAMCGLSCFL  323
            Q   S+ F    +L  LLPTG V  FQ LSP+ +N G+C+  +++LT  L+ +CG+SC +
Sbjct  14   QAVTSKAFTGVGNLIKLLPTGTVFLFQFLSPVLTNNGECNTSNKYLTGILLVVCGISCCV  73

Query  324  LSFTDSFKDQKGNVCYGVATVKGLWVIDGSASLPPELAAKYKVKFIDFVHAVMSVLVFGA  503
            LSFTDS+ D KGN  YG+AT  G+W    S+S    L + +K++  DFVHA  S++VF  
Sbjct  74   LSFTDSYTDSKGNTKYGIATTSGMW---PSSSDSVNL-SDHKLQLRDFVHAFFSLIVFMV  129

Query  504  IALFDQNVVSCFXPXPXXEXXXILPXVPVGXGXVCXXLFVVFPPXXXGIGFPXT  665
            + L D NVV C+ P    +   +L  +P   G +    FV+FP    GIG+P T
Sbjct  130  VVLLDPNVVQCYYPSFKSDQELLLKILPPIIGALSSSTFVIFPSKRNGIGYPQT  183



>gb|EYU45596.1| hypothetical protein MIMGU_mgv1a013892mg [Erythranthe guttata]
Length=207

 Score =   143 bits (360),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 71/173 (41%), Positives = 98/173 (57%), Gaps = 1/173 (1%)
 Frame = +3

Query  141  VQKAISQTFQSAAHLANLLPTGAVLAFQLLSPIFSNQGDCDAVSRFLTASLVAMCGLSCF  320
            VQ     T     +L  LLPTG V  FQ L+P+ +N G C  V+++LT+ L+A+ G  CF
Sbjct  20   VQNLTQTTLTGVGNLIKLLPTGTVFLFQFLNPLLTNNGKCHVVNKYLTSFLIAISGFLCF  79

Query  321  LLSFTDSFKDQKGNVCYGVATVKGLWVIDGSASLPPELAAKYKVKFIDFVHAVMSVLVFG  500
              SFTDS+ D +GN  YG+ T  GLW+I  S+S   +  + Y+++  DFVHA  S++VF 
Sbjct  80   FASFTDSYTDSQGNTHYGIVTATGLWLITPSSSTDKQDFSTYRLRLGDFVHAFFSLIVFA  139

Query  501  AIALFDQNVVSCFXPXPXXEXXXILPXVPVGXGXVCXXLFVVFPPXXXGIGFP  659
             +AL D N V CF P        +L  VP   G V   +FV+FP    G G+P
Sbjct  140  VVALLDPNSVECFYPS-FKSTEKVLMAVPPVIGVVSSAIFVLFPNNRHGFGYP  191



>ref|XP_006489209.1| PREDICTED: uncharacterized protein LOC102626738 [Citrus sinensis]
Length=186

 Score =   142 bits (358),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 70/167 (42%), Positives = 98/167 (59%), Gaps = 1/167 (1%)
 Frame = +3

Query  159  QTFQSAAHLANLLPTGAVLAFQLLSPIFSNQGDCDAVSRFLTASLVAMCGLSCFLLSFTD  338
            +T     +L  LLPTG V  +Q L+P+ SN G C  V+++LT+ L+ +CGLSC    FTD
Sbjct  11   KTLSGLGNLLRLLPTGTVFVYQFLNPVLSNNGKCSTVNKYLTSFLIGLCGLSCGFSCFTD  70

Query  339  SFKDQKGNVCYGVATVKGLWVIDGSASLPPELAAKYKVKFIDFVHAVMSVLVFGAIALFD  518
            S+K   G   YG+AT+KGLW    SAS   +L++ YK++  DF HA  S++VF  ++L D
Sbjct  71   SYKGSDGITHYGIATLKGLWPSSRSASASVDLSS-YKIRVGDFAHAFFSIIVFAVVSLLD  129

Query  519  QNVVSCFXPXPXXEXXXILPXVPVGXGXVCXXLFVVFPPXXXGIGFP  659
             N V CF P        +L  +P   G V   +FV+FP    GIG+P
Sbjct  130  GNTVQCFYPSFESTQKALLMVLPPAIGAVSSVIFVLFPNKRHGIGYP  176



>ref|XP_004305025.1| PREDICTED: uncharacterized protein LOC101305287 [Fragaria vesca 
subsp. vesca]
Length=214

 Score =   142 bits (359),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 77/174 (44%), Positives = 108/174 (62%), Gaps = 7/174 (4%)
 Frame = +3

Query  153  ISQTFQSAAHLANLLPTGAVLAFQLLSPIFSNQGDCDAVS-RFLTASLVAMCGLSCFLLS  329
            +  T   AA+LANLLPTG VLAFQ L+P FSN G C  +S +FLT+S++ +C + CFL S
Sbjct  29   VHDTLAIAANLANLLPTGTVLAFQTLTPSFSNNGCCQQLSNKFLTSSVIIICAVFCFLSS  88

Query  330  FTDSF--KDQKGNVCYGVATVKGLWVIDGSASLPPELAA---KYKVKFIDFVHAVMSVLV  494
            FTDSF   D  G + YG+AT KG+++ + +  +  ++     KY++KFIDFVHA +S+LV
Sbjct  89   FTDSFIDNDNGGKLYYGIATFKGMYIFNNN-DMEEDMNKYLKKYRIKFIDFVHAFISLLV  147

Query  495  FGAIALFDQNVVSCFXPXPXXEXXXILPXVPVGXGXVCXXLFVVFPPXXXGIGF  656
            F   AL + NV SCF          +   +P+G G +   LF +FP    GIG+
Sbjct  148  FLIFALTNSNVQSCFFSGVGINISELAMKLPLGAGVLSTFLFTIFPTTRRGIGY  201



>ref|XP_003594057.1| hypothetical protein MTR_2g020850 [Medicago truncatula]
 gb|AES64308.1| transmembrane protein, putative [Medicago truncatula]
Length=198

 Score =   142 bits (357),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 70/171 (41%), Positives = 101/171 (59%), Gaps = 3/171 (2%)
 Frame = +3

Query  159  QTFQSAAHLANLLPTGAVLAFQLLSPIFSNQGDCDAVSRFLTASLVAMCGLSCFLLSFTD  338
            +TF    +L  LLPTG V  FQ LSP+ +N G C  ++++L+  L+ +CG +C   SFTD
Sbjct  22   KTFSGVGNLVKLLPTGTVFLFQYLSPVVTNNGHCSTINKYLSGILLVICGFNCAFTSFTD  81

Query  339  SFKDQKGNVCYGVATVKGLWVIDGSASLPPELAAKYKVKFIDFVHAVMSVLVFGAIALFD  518
            S+    G   YG+ T+ GLW   GS S+  +L+A YK++F DFVHA +SV+VF  + L D
Sbjct  82   SYTGSDGQRHYGIVTMNGLWPSPGSDSV--DLSA-YKLRFGDFVHAFLSVIVFAVLGLLD  138

Query  519  QNVVSCFXPXPXXEXXXILPXVPVGXGXVCXXLFVVFPPXXXGIGFPXTXD  671
             NVV CF P        ++  +P   G V   +F++FP    GIG+P + D
Sbjct  139  TNVVHCFYPKFESSEKILMQVLPPVIGVVSGAVFMIFPSYRHGIGYPTSSD  189



>ref|XP_010926631.1| PREDICTED: uncharacterized protein LOC105048856 [Elaeis guineensis]
Length=206

 Score =   142 bits (357),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 70/175 (40%), Positives = 96/175 (55%), Gaps = 0/175 (0%)
 Frame = +3

Query  129  EKNLVQKAISQTFQSAAHLANLLPTGAVLAFQLLSPIFSNQGDCDAVSRFLTASLVAMCG  308
             + +V K++ +T    + L N LPTG +L F++L P  S  G C  VS  +   L+ +C 
Sbjct  28   RRKVVAKSLQKTLSKTSMLVNFLPTGTLLTFEMLLPSISGDGSCSPVSTTMIHVLLGLCT  87

Query  309  LSCFLLSFTDSFKDQKGNVCYGVATVKGLWVIDGSASLPPELAAKYKVKFIDFVHAVMSV  488
            LSCF   FTDSF    G VCYG+ T +GL V      +      +Y++ F+D VHAVM+V
Sbjct  88   LSCFFFHFTDSFHGPDGKVCYGIVTPRGLAVFKSGLGVEVPKDDRYRMGFVDLVHAVMAV  147

Query  489  LVFGAIALFDQNVVSCFXPXPXXEXXXILPXVPVGXGXVCXXLFVVFPPXXXGIG  653
            +VF AIAL D  V +C  P    E   ++   P+  G VC  LF+VFP    GIG
Sbjct  148  MVFSAIALSDHRVTNCLFPGRAKEMDEVMQSFPLMVGVVCSGLFLVFPTTRYGIG  202



>gb|EMS65326.1| hypothetical protein TRIUR3_19533 [Triticum urartu]
Length=207

 Score =   142 bits (357),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 76/191 (40%), Positives = 105/191 (55%), Gaps = 3/191 (2%)
 Frame = +3

Query  90   VSEKVPLLVPDEVEKNLVQKAISQTFQSAAHLANLLPTGAVLAFQLLSPIFSNQGDCDAV  269
             +++ PLL   +  +      + +   S A LA  LPTGAVLAF+ L P F   G C A 
Sbjct  14   AAQQAPLLGNGD-GRTQTTTVLGKALSSTADLAKHLPTGAVLAFEFLPPTFPADGTCPAA  72

Query  270  SRFLTASLVAMCGLSCFLLSFTDSFKDQKGNVCYGVATVKG-LWVIDGSASLPPELAAKY  446
            +R L   L+  C LSCFLL FTDS++D+ G   YG     G L +IDG+  +PP    +Y
Sbjct  73   NRALPGCLIGACALSCFLLCFTDSYRDETGTARYGFVPPSGRLRLIDGAQQMPPR-DERY  131

Query  447  KVKFIDFVHAVMSVLVFGAIALFDQNVVSCFXPXPXXEXXXILPXVPVGXGXVCXXLFVV  626
            +++  D +H V+S +VF A+A+ D NVV+CF P        +L  VP+  G     LF +
Sbjct  132  RLRARDVLHGVLSFVVFLAVAMVDSNVVACFYPVESATTRQLLAAVPMSAGAAGSFLFAM  191

Query  627  FPPXXXGIGFP  659
            FP    GIGFP
Sbjct  192  FPSTRRGIGFP  202



>gb|KJB38487.1| hypothetical protein B456_006G256300 [Gossypium raimondii]
Length=188

 Score =   140 bits (354),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 75/172 (44%), Positives = 101/172 (59%), Gaps = 4/172 (2%)
 Frame = +3

Query  159  QTFQSAAHLANLLPTGAVLAFQLLSPIFSNQGDCDAVSRFLTASLVAMCGLSCFLLSFTD  338
            +TF S  +L  LLPTG V  FQ L+P+ +N G C  V++ LT++L+ +CG SC    FTD
Sbjct  19   KTFTSLGNLIKLLPTGTVFIFQFLNPVLTNYGHCSPVNKVLTSTLIGLCGFSCAFSCFTD  78

Query  339  SFKDQKGNVCYGVATVKGLWVIDGSASLPPELAAKYKVKFIDFVHAVMSVLVFGAIALFD  518
            S+K   G V YG+ TV GLW   GS S   +L +KYK++  DFVHA  SV+VF  ++L D
Sbjct  79   SYKGGDGLVHYGIVTVNGLWPSSGSDS---DL-SKYKLRIGDFVHAFFSVIVFAVLSLLD  134

Query  519  QNVVSCFXPXPXXEXXXILPXVPVGXGXVCXXLFVVFPPXXXGIGFPXTXDN  674
             N V CF P        +L  +P   G V    F+VFP    GIG+P + D+
Sbjct  135  SNTVQCFYPSFEATEKVLLMVLPPVIGAVSGLAFMVFPNTRHGIGYPSSTDS  186



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1867489308488