BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig12885

Length=677
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|AAP40022.1|  callus-expressing factor                                215   4e-64   Nicotiana tabacum [American tobacco]
gb|ADP37417.1|  ethylene-responsive-element-binding factor 2            215   4e-64   Petunia x hybrida [garden petunia]
ref|XP_009775920.1|  PREDICTED: ethylene-responsive transcription...    214   8e-64   Nicotiana sylvestris
ref|XP_009627746.1|  PREDICTED: ethylene-responsive transcription...    212   6e-63   Nicotiana tomentosiformis
ref|XP_009788612.1|  PREDICTED: ethylene-responsive transcription...    207   7e-61   Nicotiana sylvestris
ref|NP_001234462.1|  JERF3                                              199   1e-58   
ref|XP_009794756.1|  PREDICTED: ethylene-responsive transcription...    199   4e-58   Nicotiana sylvestris
ref|XP_010318410.1|  PREDICTED: JERF3 isoform X3                        199   1e-57   
ref|XP_010318408.1|  PREDICTED: JERF3 isoform X1                        199   1e-57   Solanum lycopersicum
ref|XP_009605490.1|  PREDICTED: ethylene-responsive transcription...    198   2e-57   Nicotiana tomentosiformis
ref|XP_010318409.1|  PREDICTED: JERF3 isoform X2                        198   2e-57   Solanum lycopersicum
ref|XP_006342909.1|  PREDICTED: ethylene-responsive transcription...    197   2e-57   Solanum tuberosum [potatoes]
ref|XP_006342907.1|  PREDICTED: ethylene-responsive transcription...    198   2e-57   Solanum tuberosum [potatoes]
gb|AHA93905.1|  ethylene response factor 5                              198   3e-57   Coffea arabica [arabica coffee]
emb|CDO97803.1|  unnamed protein product                                197   4e-57   Coffea canephora [robusta coffee]
ref|XP_009604966.1|  PREDICTED: ethylene-responsive transcription...    195   4e-56   Nicotiana tomentosiformis
ref|XP_006357425.1|  PREDICTED: ethylene-responsive transcription...    194   4e-56   
gb|EYU21280.1|  hypothetical protein MIMGU_mgv1a008553mg                193   9e-56   Erythranthe guttata [common monkey flower]
ref|NP_001234513.1|  transcription factor JERF1                         191   4e-55   Solanum lycopersicum
ref|XP_011072679.1|  PREDICTED: ethylene-responsive transcription...    191   8e-55   Sesamum indicum [beniseed]
gb|AHB33877.1|  ERF transcription factor 06                             187   4e-54   Coffea arabica [arabica coffee]
gb|ADP37418.1|  ethylene-responsive-element-binding factor 3            188   5e-54   Petunia x hybrida [garden petunia]
emb|CDP15674.1|  unnamed protein product                                186   1e-53   Coffea canephora [robusta coffee]
ref|XP_004252402.1|  PREDICTED: ethylene-responsive transcription...    187   4e-53   Solanum lycopersicum
gb|AAP72289.1|  PF1                                                     186   4e-53   Capsicum annuum
gb|ABD65407.1|  putative ethylene-responsive element binding protein    186   5e-53   Capsicum annuum
ref|NP_001280975.1|  ethylene-responsive transcription factor RAP...    186   1e-52   Malus domestica [apple tree]
gb|AHA93906.1|  ethylene response factor 3                              184   2e-52   Coffea arabica [arabica coffee]
gb|EPS68207.1|  hypothetical protein M569_06565                         183   1e-51   Genlisea aurea
gb|ABB51574.1|  ethylene-responsive element binding protein             176   1e-51   Capsicum annuum
gb|AGE92355.1|  ethylene response factor 1                              182   1e-51   Ipomoea batatas [batate]
ref|XP_011467483.1|  PREDICTED: ethylene-responsive transcription...    182   3e-51   Fragaria vesca subsp. vesca
gb|ADJ67434.1|  ethylene response factor 5                              181   7e-51   Actinidia deliciosa [Chinese gooseberry]
gb|ABP35524.1|  AP2/EREBP-type transcription factor                     179   1e-50   Ipomoea batatas [batate]
gb|EYU45910.1|  hypothetical protein MIMGU_mgv1a009975mg                178   2e-50   Erythranthe guttata [common monkey flower]
ref|NP_001280911.1|  ethylene-responsive transcription factor RAP...    179   2e-50   Malus domestica [apple tree]
ref|XP_012068805.1|  PREDICTED: ethylene-responsive transcription...    179   2e-50   
ref|XP_007139068.1|  hypothetical protein PHAVU_009G262200g             179   2e-50   Phaseolus vulgaris [French bean]
ref|XP_009338318.1|  PREDICTED: ethylene-responsive transcription...    179   4e-50   Pyrus x bretschneideri [bai li]
gb|ACM49847.1|  ethylene responsive transcription factor 2a             178   7e-50   Prunus salicina [Japanese plum]
gb|AFG26329.1|  ethylene response factor ERF4                           178   7e-50   Eriobotrya japonica [loquat]
gb|AFY09702.1|  AP2/ERF super family protein                            178   9e-50   Hevea brasiliensis [jebe]
ref|XP_008228117.1|  PREDICTED: ethylene-responsive transcription...    177   1e-49   Prunus mume [ume]
ref|XP_007024746.1|  Transcription factor JERF1, putative isoform 1     177   1e-49   
ref|XP_007215451.1|  hypothetical protein PRUPE_ppa006366mg             177   2e-49   
ref|XP_008380747.1|  PREDICTED: ethylene-responsive transcription...    176   4e-49   
ref|XP_007215453.1|  hypothetical protein PRUPE_ppa006366mg             177   4e-49   
gb|AAX07458.2|  ethylene-responsive element binding protein ERF2        176   5e-49   Gossypium hirsutum [American cotton]
gb|AAX84670.1|  ethylene response factor                                176   6e-49   Manihot esculenta [manioc]
ref|XP_006362095.1|  PREDICTED: ethylene-responsive transcription...    176   7e-49   Solanum tuberosum [potatoes]
ref|XP_009357901.1|  PREDICTED: ethylene-responsive transcription...    175   1e-48   Pyrus x bretschneideri [bai li]
ref|XP_010273830.1|  PREDICTED: ethylene-responsive transcription...    174   2e-48   Nelumbo nucifera [Indian lotus]
gb|AGE92354.1|  ethylene response factor 2                              172   2e-48   Ipomoea batatas [batate]
ref|XP_006369093.1|  transcription factor EREBP-like family protein     174   3e-48   Populus trichocarpa [western balsam poplar]
ref|XP_009357932.1|  PREDICTED: ethylene-responsive transcription...    174   3e-48   Pyrus x bretschneideri [bai li]
gb|KJB70053.1|  hypothetical protein B456_011G056300                    174   4e-48   Gossypium raimondii
ref|XP_010089706.1|  Ethylene-responsive transcription factor           173   5e-48   Morus notabilis
ref|XP_010261706.1|  PREDICTED: ethylene-responsive transcription...    172   1e-47   Nelumbo nucifera [Indian lotus]
ref|XP_011079396.1|  PREDICTED: ethylene-responsive transcription...    172   1e-47   Sesamum indicum [beniseed]
gb|AFY09701.1|  AP2/ERF super family protein                            172   1e-47   Hevea brasiliensis [jebe]
gb|AGL34963.1|  ethylene-responsive transcription factor 4              172   1e-47   Hevea brasiliensis [jebe]
gb|ACS35626.1|  ethylene signal transcription factor                    172   1e-47   Morus alba
gb|AEQ58798.1|  ethylene response factor                                166   2e-47   Rumex palustris
gb|AEK81532.1|  ethylene response factor                                171   2e-47   Ophiopogon japonicus
ref|XP_009413996.1|  PREDICTED: ethylene-responsive transcription...    170   4e-47   Musa acuminata subsp. malaccensis [pisang utan]
gb|AEF30544.1|  ethylene transcription factor                           170   9e-47   Castanea sativa
emb|CAE54591.1|  ethylene transcription factor                          169   1e-46   Fagus sylvatica
gb|AFP25470.1|  ERF3                                                    169   1e-46   Musa acuminata AAA Group [Cavendish banana]
ref|XP_011036532.1|  PREDICTED: ethylene-responsive transcription...    169   2e-46   Populus euphratica
gb|AGV75741.1|  jasmonic acid and ethylene responsive factor            167   3e-46   Capsicum annuum var. annuum [chilli pepper]
ref|XP_009413994.1|  PREDICTED: ethylene-responsive transcription...    168   3e-46   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009413995.1|  PREDICTED: ethylene-responsive transcription...    168   4e-46   Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB57080.1|  hypothetical protein B456_009G147300                    168   4e-46   Gossypium raimondii
ref|XP_009417534.1|  PREDICTED: ethylene-responsive transcription...    166   2e-45   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002304249.2|  hypothetical protein POPTR_0003s06930g             166   2e-45   
gb|ABK94385.1|  unknown                                                 166   2e-45   Populus trichocarpa [western balsam poplar]
gb|AAX20013.1|  putative ethylene responsive element binding protein    166   2e-45   Gossypium hirsutum [American cotton]
ref|XP_009417533.1|  PREDICTED: ethylene-responsive transcription...    166   3e-45   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010917392.1|  PREDICTED: ethylene-responsive transcription...    166   4e-45   Elaeis guineensis
ref|XP_004144443.1|  PREDICTED: ethylene-responsive transcription...    164   7e-45   Cucumis sativus [cucumbers]
gb|KJB68280.1|  hypothetical protein B456_010G236100                    164   2e-44   Gossypium raimondii
ref|XP_004141728.1|  PREDICTED: ethylene-responsive transcription...    163   3e-44   Cucumis sativus [cucumbers]
ref|XP_010932347.1|  PREDICTED: ethylene-responsive transcription...    163   3e-44   Elaeis guineensis
emb|CAD21849.1|  ethylene responsive element binding protein            162   4e-44   Fagus sylvatica
gb|AAW33881.1|  apetala2/ethylene responsive factor                     162   5e-44   Populus tremula x Populus alba [gray poplar]
ref|XP_008462249.1|  PREDICTED: LOW QUALITY PROTEIN: ethylene-res...    162   9e-44   
ref|XP_009391208.1|  PREDICTED: ethylene-responsive transcription...    162   9e-44   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010552191.1|  PREDICTED: ethylene-responsive transcription...    160   2e-43   Tarenaya hassleriana [spider flower]
ref|XP_010552190.1|  PREDICTED: ethylene-responsive transcription...    160   2e-43   Tarenaya hassleriana [spider flower]
gb|ACI62768.1|  dehydration-responsive element binding protein          160   4e-43   Krascheninnikovia arborescens
ref|XP_006426778.1|  hypothetical protein CICLE_v10025816mg             160   6e-43   Citrus clementina [clementine]
ref|XP_006426779.1|  hypothetical protein CICLE_v10025816mg             160   6e-43   
ref|XP_006465817.1|  PREDICTED: ethylene-responsive transcription...    160   7e-43   Citrus sinensis [apfelsine]
ref|XP_008797374.1|  PREDICTED: ethylene-responsive transcription...    159   8e-43   Phoenix dactylifera
ref|XP_006828662.1|  PREDICTED: ethylene-responsive transcription...    157   8e-43   Amborella trichopoda
gb|AEQ58795.1|  ethylene response factor                                158   2e-42   Rumex acetosa [sour dock]
ref|XP_010534976.1|  PREDICTED: ethylene-responsive transcription...    158   2e-42   Tarenaya hassleriana [spider flower]
ref|XP_008460339.1|  PREDICTED: ethylene-responsive transcription...    158   2e-42   Cucumis melo [Oriental melon]
ref|XP_004510558.1|  PREDICTED: ethylene-responsive transcription...    158   4e-42   
ref|XP_008784363.1|  PREDICTED: ethylene-responsive transcription...    157   6e-42   Phoenix dactylifera
dbj|BAE71206.1|  putative transcription factor EREBP                    157   7e-42   Trifolium pratense [peavine clover]
ref|XP_006598772.1|  PREDICTED: ethylene responsive protein isofo...    157   8e-42   
ref|XP_010029503.1|  PREDICTED: LOW QUALITY PROTEIN: ethylene-res...    156   1e-41   
ref|XP_002533237.1|  Ethylene-responsive transcription factor, pu...    155   2e-41   Ricinus communis
ref|NP_001236578.1|  ethylene responsive protein                        155   2e-41   
gb|AEQ58797.1|  ethylene response factor                                155   3e-41   Rumex palustris
ref|XP_009417991.1|  PREDICTED: ethylene-responsive transcription...    155   5e-41   Musa acuminata subsp. malaccensis [pisang utan]
gb|ACI46677.1|  dehydration-responsive element binding protein          153   2e-40   Galega orientalis
gb|KEH18514.1|  ethylene response factor                                153   2e-40   Medicago truncatula
ref|NP_001238300.1|  EREBP/AP2 transcription factor                     152   2e-40   
ref|XP_003637296.1|  Ethylene-responsive transcription factor           152   5e-40   
ref|XP_007135380.1|  hypothetical protein PHAVU_010G124700g             152   6e-40   Phaseolus vulgaris [French bean]
gb|AFU07640.1|  ethylene-responsive element binding factor 1            151   7e-40   Arachis hypogaea [goober]
ref|XP_009401312.1|  PREDICTED: ethylene-responsive transcription...    151   8e-40   Musa acuminata subsp. malaccensis [pisang utan]
gb|AFK43442.1|  unknown                                                 150   2e-39   Medicago truncatula
ref|XP_003627419.1|  Ethylene-responsive transcription factor           150   2e-39   Medicago truncatula
ref|XP_003528732.1|  PREDICTED: ethylene-responsive transcription...    150   2e-39   
ref|XP_009391708.1|  PREDICTED: ethylene-responsive transcription...    150   2e-39   Musa acuminata subsp. malaccensis [pisang utan]
gb|ABO93372.1|  ethylene-responsive element binding protein             149   6e-39   Medicago falcata [sickle alfalfa]
gb|AEW68339.1|  dehydration-responsive element binding protein          149   7e-39   Atriplex canescens [shadscale]
ref|NP_001057044.1|  Os06g0194000                                       147   2e-38   
gb|EAY99995.1|  hypothetical protein OsI_21998                          147   2e-38   Oryza sativa Indica Group [Indian rice]
gb|AAL67489.1|AF459404_1  AP-2 domain containing protein                141   3e-38   Narcissus pseudonarcissus
ref|XP_009410253.1|  PREDICTED: ethylene-responsive transcription...    145   2e-37   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010685231.1|  PREDICTED: ethylene-responsive transcription...    145   2e-37   Beta vulgaris subsp. vulgaris [field beet]
gb|AGV75742.1|  jasmonic acid and ethylene responsive factor            144   3e-37   Capsicum chinense [bonnet pepper]
ref|XP_006390669.1|  hypothetical protein EUTSA_v10018945mg             140   2e-36   Eutrema salsugineum [saltwater cress]
ref|XP_010259467.1|  PREDICTED: ethylene-responsive transcription...    141   2e-36   Nelumbo nucifera [Indian lotus]
ref|XP_002267008.1|  PREDICTED: ethylene-responsive transcription...    142   3e-36   Vitis vinifera
gb|KCW56427.1|  hypothetical protein EUGRSUZ_I02155                     142   3e-36   Eucalyptus grandis [rose gum]
ref|NP_001148691.1|  LOC100282307                                       140   6e-36   Zea mays [maize]
gb|AAP80852.1|  EREBP transcription factor                              140   1e-35   Triticum aestivum [Canadian hard winter wheat]
ref|XP_009381608.1|  PREDICTED: ethylene-responsive transcription...    139   2e-35   Musa acuminata subsp. malaccensis [pisang utan]
gb|AAX13280.1|  ethylene-responsive element binding protein 1           139   2e-35   Triticum aestivum [Canadian hard winter wheat]
gb|AID46466.1|  ethylene response factor 1 extended form L              139   2e-35   Triticum turgidum subsp. durum
ref|XP_010939857.1|  PREDICTED: ethylene-responsive transcription...    139   2e-35   Elaeis guineensis
ref|XP_008783120.1|  PREDICTED: ethylene-responsive transcription...    139   2e-35   Phoenix dactylifera
gb|AID46465.1|  ethylene response factor 1 extended form P              137   7e-35   Triticum turgidum subsp. durum
ref|XP_010937274.1|  PREDICTED: ethylene-responsive transcription...    137   9e-35   Elaeis guineensis
gb|ADC94859.1|  ERF2 transcription factor                               137   2e-34   Vitis pseudoreticulata
gb|ABB51575.1|  putative ethylene responsive element binding protein    131   3e-34   Capsicum annuum
ref|XP_010654374.1|  PREDICTED: ethylene-responsive transcription...    136   3e-34   Vitis vinifera
ref|NP_001241423.1|  uncharacterized protein LOC100819416               133   1e-33   Glycine max [soybeans]
gb|KHN08668.1|  Ethylene-responsive transcription factor RAP2-3         133   2e-33   Glycine soja [wild soybean]
ref|XP_009389584.1|  PREDICTED: ethylene-responsive transcription...    134   2e-33   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010269613.1|  PREDICTED: ethylene-responsive transcription...    133   2e-33   Nelumbo nucifera [Indian lotus]
gb|ABO09809.1|  EREB                                                    134   2e-33   Saccharum arundinaceum
gb|EMT10240.1|  Ethylene-responsive transcription factor 1              134   3e-33   
gb|AFP49825.1|  ethylene responsive transcription factor 5b             134   4e-33   Triticum aestivum [Canadian hard winter wheat]
gb|ACN58181.1|  putative ethylene responsive element binding protein    134   4e-33   Dasypyrum villosum
gb|KHG05913.1|  Ethylene-responsive transcription factor RAP2-3 -...    130   4e-33   Gossypium arboreum [tree cotton]
ref|XP_008783109.1|  PREDICTED: ethylene-responsive transcription...    131   4e-33   Phoenix dactylifera
ref|NP_001241446.1|  uncharacterized protein LOC100780763               132   4e-33   Glycine max [soybeans]
ref|XP_009404099.1|  PREDICTED: ethylene-responsive transcription...    132   6e-33   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009380143.1|  PREDICTED: ethylene-responsive transcription...    132   8e-33   Musa acuminata subsp. malaccensis [pisang utan]
gb|AFP49824.1|  ethylene responsive transcription factor 5a             132   9e-33   Triticum aestivum [Canadian hard winter wheat]
gb|AAX68525.1|  putative ethylene responsive element binding prot...    130   1e-32   Gossypium hirsutum [American cotton]
ref|XP_006297883.1|  hypothetical protein CARUB_v10013925mg             132   1e-32   Capsella rubella
gb|AFH56410.1|  ethylene response factor 3                              131   2e-32   Diospyros kaki [Japanese persimmon]
ref|XP_010236158.1|  PREDICTED: ethylene-responsive transcription...    131   3e-32   Brachypodium distachyon [annual false brome]
ref|XP_010501805.1|  PREDICTED: ethylene-responsive transcription...    131   3e-32   Camelina sativa [gold-of-pleasure]
ref|XP_008643764.1|  PREDICTED: ethylene response element binding...    129   4e-32   
gb|ACF88275.1|  unknown                                                 130   4e-32   Zea mays [maize]
ref|NP_001150246.1|  ethylene response element binding protein          130   5e-32   Zea mays [maize]
emb|CAD56217.1|  transcription factor EREBP-like protein                130   5e-32   Cicer arietinum [garbanzo]
ref|XP_003578162.1|  PREDICTED: ethylene-responsive transcription...    130   6e-32   Brachypodium distachyon [annual false brome]
gb|ACU23153.1|  unknown                                                 128   7e-32   Glycine max [soybeans]
ref|XP_002454666.1|  hypothetical protein SORBIDRAFT_04g035160          129   8e-32   Sorghum bicolor [broomcorn]
gb|EMS53993.1|  Ethylene-responsive transcription factor 1              129   8e-32   Triticum urartu
dbj|BAJ95634.1|  predicted protein                                      129   9e-32   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMT09007.1|  Ethylene-responsive transcription factor 1              129   9e-32   
gb|AFU07641.1|  ethylene-responsive element binding factor 4            128   1e-31   Arachis hypogaea [goober]
ref|XP_006604931.1|  PREDICTED: ethylene-responsive transcription...    127   1e-31   Glycine max [soybeans]
ref|XP_010487223.1|  PREDICTED: ethylene-responsive transcription...    129   1e-31   Camelina sativa [gold-of-pleasure]
emb|CAD56466.1|  ethylene response element binding protein              129   2e-31   Triticum aestivum [Canadian hard winter wheat]
gb|ACL54595.1|  unknown                                                 129   2e-31   Zea mays [maize]
gb|KDO45751.1|  hypothetical protein CISIN_1g020391mg                   127   2e-31   Citrus sinensis [apfelsine]
ref|XP_010465314.1|  PREDICTED: ethylene-responsive transcription...    129   2e-31   Camelina sativa [gold-of-pleasure]
gb|KDO45752.1|  hypothetical protein CISIN_1g020391mg                   127   2e-31   Citrus sinensis [apfelsine]
ref|XP_002463183.1|  hypothetical protein SORBIDRAFT_02g039300          127   2e-31   Sorghum bicolor [broomcorn]
dbj|BAK03679.1|  predicted protein                                      128   3e-31   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|NP_188299.1|  ethylene-responsive transcription factor RAP2-3       125   3e-31   Arabidopsis thaliana [mouse-ear cress]
gb|ADO21119.1|  ethylene response factor 1                              128   3e-31   Hordeum vulgare [barley]
gb|AEK01082.1|  ethylene responsive element binding protein 1           128   3e-31   Oryza sativa Indica Group [Indian rice]
gb|AEI98839.1|  AP2/EREBP transcription factor                          128   4e-31   Thinopyrum elongatum [tall wheatgrass]
gb|EAY87770.1|  hypothetical protein OsI_09188                          128   4e-31   Oryza sativa Indica Group [Indian rice]
ref|XP_010487543.1|  PREDICTED: ethylene-responsive transcription...    125   4e-31   Camelina sativa [gold-of-pleasure]
ref|NP_001048319.1|  Os02g0782700                                       127   4e-31   
ref|XP_010465699.1|  PREDICTED: ethylene-responsive transcription...    125   6e-31   Camelina sativa [gold-of-pleasure]
gb|AAC24587.1|  AP2 domain containing protein                           125   7e-31   Prunus armeniaca
gb|KHF98297.1|  Ethylene-responsive transcription factor RAP2-12 ...    125   1e-30   Gossypium arboreum [tree cotton]
emb|CAA05084.1|  putative Ckc2                                          124   1e-30   Arabidopsis thaliana [mouse-ear cress]
dbj|BAG50065.1|  transcription factor AP2-EREBP                         125   1e-30   Lotus japonicus
gb|ACD87817.1|  putative ethylene responsive factor                     125   1e-30   Vicia faba [broad bean]
ref|XP_002883025.1|  hypothetical protein ARALYDRAFT_897996             124   1e-30   Arabidopsis lyrata subsp. lyrata
gb|AAT77192.1|  ethylene response factor 1                              125   1e-30   Gossypium barbadense [Egyptian cotton]
ref|XP_009387627.1|  PREDICTED: ethylene-responsive transcription...    126   1e-30   Musa acuminata subsp. malaccensis [pisang utan]
tpg|DAA61618.1|  TPA: putative AP2/EREBP transcription factor sup...    125   2e-30   
gb|AID46464.1|  ethylene response factor 1 short form L                 125   2e-30   Triticum turgidum subsp. durum
ref|XP_002523125.1|  conserved hypothetical protein                     125   2e-30   Ricinus communis
gb|KJB72729.1|  hypothetical protein B456_011G193600                    124   2e-30   Gossypium raimondii
gb|AID46467.1|  ethylene response factor 1                              125   2e-30   Triticum turgidum subsp. durum
ref|XP_010504647.1|  PREDICTED: ethylene-responsive transcription...    123   2e-30   Camelina sativa [gold-of-pleasure]
gb|AEI54703.1|  AP2/EREBP-like protein                                  124   2e-30   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AEI54702.1|  AP2/EREBP-like protein                                  124   2e-30   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009106954.1|  PREDICTED: ethylene-responsive transcription...    125   3e-30   Brassica rapa
dbj|BAC56862.1|  AP2/ERF-domain protein                                 123   3e-30   Solanum tuberosum [potatoes]
gb|AAP32467.1|  ethylene-responsive element binding protein             125   3e-30   Triticum aestivum [Canadian hard winter wheat]
gb|EMS54313.1|  Ethylene-responsive transcription factor 1              125   3e-30   Triticum urartu
emb|CDX82392.1|  BnaA03g34290D                                          123   4e-30   
gb|KHG20734.1|  Ethylene-responsive transcription factor RAP2-12 ...    124   4e-30   Gossypium arboreum [tree cotton]
ref|XP_010479976.1|  PREDICTED: ethylene-responsive transcription...    125   4e-30   Camelina sativa [gold-of-pleasure]
gb|KJB24383.1|  hypothetical protein B456_004G142800                    124   4e-30   Gossypium raimondii
gb|KJB24382.1|  hypothetical protein B456_004G142800                    124   5e-30   Gossypium raimondii
gb|EMT19548.1|  Ethylene-responsive transcription factor 1              123   5e-30   
ref|XP_010227910.1|  PREDICTED: ethylene-responsive transcription...    123   5e-30   
gb|AGU44838.1|  ethylene responsive factor                              123   5e-30   Capsicum chinense [bonnet pepper]
gb|AAZ14085.2|  root abundant factor                                    124   5e-30   Hordeum vulgare [barley]
ref|XP_006298489.1|  hypothetical protein CARUB_v10014563mg             122   6e-30   Capsella rubella
gb|KFK38783.1|  hypothetical protein AALP_AA3G160000                    125   6e-30   Arabis alpina [alpine rockcress]
ref|XP_002891780.1|  hypothetical protein ARALYDRAFT_892441             124   6e-30   Arabidopsis lyrata subsp. lyrata
ref|XP_009135498.1|  PREDICTED: ethylene-responsive transcription...    122   7e-30   Brassica rapa
gb|AAS20427.1|  ethylene-responsive factor-like protein 1               122   7e-30   Capsicum annuum
ref|XP_008800471.1|  PREDICTED: ethylene-responsive transcription...    124   7e-30   Phoenix dactylifera
ref|XP_008800472.1|  PREDICTED: ethylene-responsive transcription...    124   7e-30   Phoenix dactylifera
ref|XP_010107742.1|  Ethylene-responsive transcription factor           122   7e-30   Morus notabilis
emb|CDY54628.1|  BnaCnng27470D                                          122   8e-30   Brassica napus [oilseed rape]
gb|ACL78788.1|  putative ethylene responsive element binding prot...    122   8e-30   Citrus unshiu [satsuma mandarin]
gb|EMS56145.1|  Ethylene-responsive transcription factor 1              123   8e-30   Triticum urartu
ref|XP_006392736.1|  hypothetical protein EUTSA_v10011606mg             124   9e-30   Eutrema salsugineum [saltwater cress]
ref|XP_010939858.1|  PREDICTED: ethylene-responsive transcription...    124   9e-30   Elaeis guineensis
tpg|DAA61617.1|  TPA: putative AP2/EREBP transcription factor sup...    124   1e-29   
ref|NP_001077812.1|  ethylene-responsive transcription factor ERF073    122   1e-29   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001117587.1|  ethylene-responsive transcription factor ERF073    122   1e-29   Arabidopsis thaliana [mouse-ear cress]
gb|EAZ36121.1|  hypothetical protein OsJ_20431                          123   1e-29   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009117065.1|  PREDICTED: ethylene-responsive transcription...    124   1e-29   Brassica rapa
gb|AAM00285.1|AF364176_1  putative EREBP-type transcription factor      124   1e-29   Oryza sativa [red rice]
ref|NP_001063252.1|  Os09g0434500                                       124   1e-29   
gb|KHG20924.1|  Ethylene-responsive transcription factor RAP2-3 -...    122   1e-29   Gossypium arboreum [tree cotton]
gb|EAZ09217.1|  hypothetical protein OsI_31492                          124   1e-29   Oryza sativa Indica Group [Indian rice]
ref|XP_009146390.1|  PREDICTED: ethylene-responsive transcription...    124   1e-29   Brassica rapa
emb|CDX98435.1|  BnaC05g39400D                                          124   1e-29   
ref|XP_007145186.1|  hypothetical protein PHAVU_007G217800g             122   2e-29   Phaseolus vulgaris [French bean]
tpg|DAA40132.1|  TPA: putative AP2/EREBP transcription factor sup...    121   2e-29   
gb|KFK39023.1|  hypothetical protein AALP_AA3G190500                    120   2e-29   Arabis alpina [alpine rockcress]
gb|AAV98700.1|  BTH-induced ERF transcriptional factor 1                124   2e-29   Oryza sativa Indica Group [Indian rice]
gb|AAP32468.1|  ethylene-responsive element binding protein             123   2e-29   Triticum aestivum [Canadian hard winter wheat]
ref|XP_004956913.1|  PREDICTED: ethylene-responsive transcription...    124   2e-29   Setaria italica
emb|CDY39107.1|  BnaA01g29490D                                          123   2e-29   Brassica napus [oilseed rape]
ref|XP_010921624.1|  PREDICTED: ethylene-responsive transcription...    121   2e-29   Elaeis guineensis
ref|XP_006354281.1|  PREDICTED: ethylene-responsive transcription...    121   2e-29   
ref|XP_003564157.1|  PREDICTED: ethylene-responsive transcription...    122   2e-29   Brachypodium distachyon [annual false brome]
ref|NP_001150673.1|  LOC100284306                                       123   2e-29   
gb|KDO87135.1|  hypothetical protein CISIN_1g019887mg                   122   3e-29   Citrus sinensis [apfelsine]
ref|XP_006444410.1|  hypothetical protein CICLE_v10021059mg             122   3e-29   Citrus clementina [clementine]
gb|AEI54694.1|  AP2/EREBP-like protein                                  121   3e-29   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004964608.1|  PREDICTED: ethylene-responsive transcription...    122   3e-29   
ref|XP_004964607.1|  PREDICTED: ethylene-responsive transcription...    122   3e-29   Setaria italica
ref|XP_004964609.1|  PREDICTED: ethylene-responsive transcription...    122   3e-29   
gb|KHG15759.1|  Ethylene-responsive transcription factor RAP2-3 -...    121   3e-29   Gossypium arboreum [tree cotton]
gb|KJB38554.1|  hypothetical protein B456_006G260300                    120   3e-29   Gossypium raimondii
ref|XP_006660653.1|  PREDICTED: ethylene-responsive transcription...    122   4e-29   Oryza brachyantha
gb|AAV51937.1|  AP2/EREBP transcription factor ERF-2                    120   4e-29   Gossypium hirsutum [American cotton]
gb|AAT77191.1|  ethylene response factor 2                              119   4e-29   Gossypium barbadense [Egyptian cotton]
ref|XP_010462298.1|  PREDICTED: ethylene-responsive transcription...    122   4e-29   Camelina sativa [gold-of-pleasure]
gb|ACL78787.1|  putative ethylene responsive element binding prot...    119   4e-29   Citrus unshiu [satsuma mandarin]
emb|CDX95906.1|  BnaC05g36570D                                          120   5e-29   
ref|XP_010524556.1|  PREDICTED: ethylene-responsive transcription...    119   5e-29   Tarenaya hassleriana [spider flower]
ref|XP_012083990.1|  PREDICTED: ethylene-responsive transcription...    119   6e-29   
dbj|BAF75652.1|  transcription factor DcERF2                            120   6e-29   Daucus carota [carrots]
gb|AAF23899.1|AF193803_1  transcription factor EREBP1                   122   6e-29   Oryza sativa [red rice]
ref|XP_008784773.1|  PREDICTED: LOW QUALITY PROTEIN: ethylene-res...    119   7e-29   
gb|KJB27409.1|  hypothetical protein B456_004G051600                    120   8e-29   Gossypium raimondii
ref|XP_006302701.1|  hypothetical protein CARUB_v10020812mg             119   8e-29   Capsella rubella
gb|ADP37419.1|  ethylene-responsive-element-binding factor 4            119   9e-29   Petunia x hybrida [garden petunia]
ref|XP_007051006.1|  Integrase-type DNA-binding superfamily prote...    120   1e-28   
ref|NP_001077718.1|  ethylene-responsive transcription factor RAP...    121   1e-28   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009135371.1|  PREDICTED: ethylene-responsive transcription...    120   1e-28   Brassica rapa
ref|XP_010524555.1|  PREDICTED: ethylene-responsive transcription...    118   1e-28   Tarenaya hassleriana [spider flower]
emb|CDX82492.1|  BnaA03g33290D                                          120   2e-28   
ref|XP_007035662.1|  Ethylene-responsive element binding protein,...    118   2e-28   
ref|NP_001149434.1|  ethylene response factor                           121   2e-28   
gb|EMT10156.1|  Ethylene-responsive transcription factor 1              120   2e-28   
ref|XP_009608570.1|  PREDICTED: ethylene-responsive transcription...    118   2e-28   
emb|CBI36892.3|  unnamed protein product                                118   2e-28   
gb|AHA93902.1|  ethylene response factor 8                              118   2e-28   
ref|NP_001235127.1|  uncharacterized protein LOC100527371               117   2e-28   
ref|XP_002272464.1|  PREDICTED: ethylene-responsive transcription...    119   2e-28   
ref|XP_009135370.1|  PREDICTED: ethylene-responsive transcription...    120   3e-28   
ref|XP_006657959.1|  PREDICTED: ethylene-responsive transcription...    119   3e-28   
emb|CDX97559.1|  BnaA05g25200D                                          120   3e-28   
ref|XP_006648015.1|  PREDICTED: ethylene-responsive transcription...    119   3e-28   
gb|ACM49846.1|  ethylene responsive transcription factor 2b             119   3e-28   
gb|ACN36228.1|  unknown                                                 119   3e-28   
ref|XP_010502010.1|  PREDICTED: ethylene-responsive transcription...    119   4e-28   
gb|AAM65746.1|  AP2 domain containing protein, putative                 119   4e-28   
ref|XP_009146062.1|  PREDICTED: ethylene-responsive transcription...    117   4e-28   
ref|XP_011015854.1|  PREDICTED: ethylene-responsive transcription...    119   4e-28   
gb|KHN30671.1|  Ethylene-responsive transcription factor 1              117   4e-28   
ref|NP_175794.1|  ethylene-responsive transcription factor RAP2-12      119   4e-28   
ref|XP_004495934.1|  PREDICTED: ethylene-responsive transcription...    118   5e-28   
ref|XP_004290817.1|  PREDICTED: ethylene-responsive transcription...    117   6e-28   
ref|XP_011462742.1|  PREDICTED: ethylene-responsive transcription...    117   6e-28   
emb|CDY34977.1|  BnaA01g27570D                                          117   6e-28   
ref|XP_006407104.1|  hypothetical protein EUTSA_v10020945mg             119   6e-28   
ref|XP_011009990.1|  PREDICTED: ethylene-responsive transcription...    118   6e-28   
ref|XP_004290818.1|  PREDICTED: ethylene-responsive transcription...    116   6e-28   
gb|AFP25469.1|  ERF2                                                    117   6e-28   
ref|XP_004495935.1|  PREDICTED: ethylene-responsive transcription...    118   7e-28   
ref|XP_002272426.1|  PREDICTED: ethylene-responsive transcription...    117   7e-28   
emb|CDY28337.1|  BnaC01g35070D                                          116   7e-28   
gb|AJK26921.1|  ethylene response factor protein 1                      118   7e-28   
gb|EMT17653.1|  Ethylene-responsive transcription factor 1              118   7e-28   
ref|XP_006359865.1|  PREDICTED: ethylene-responsive transcription...    117   8e-28   
ref|XP_009114507.1|  PREDICTED: ethylene-responsive transcription...    116   8e-28   
ref|XP_010415981.1|  PREDICTED: ethylene-responsive transcription...    117   8e-28   
gb|EMT32411.1|  Ethylene-responsive transcription factor 1              119   8e-28   
gb|AAS01337.1|  ERF-like transcription factor                           118   8e-28   
emb|CDP17104.1|  unnamed protein product                                118   8e-28   
ref|XP_009378746.1|  PREDICTED: ethylene-responsive transcription...    118   8e-28   
gb|AIA57932.1|  APETALA2-ethylene-responsive element binding prot...    116   9e-28   
ref|XP_004290816.1|  PREDICTED: ethylene-responsive transcription...    117   9e-28   
ref|XP_010541232.1|  PREDICTED: ethylene-responsive transcription...    117   9e-28   
emb|CAN69221.1|  hypothetical protein VITISV_012017                     116   1e-27   
ref|XP_012082821.1|  PREDICTED: ethylene-responsive transcription...    117   1e-27   
ref|XP_002320996.1|  hypothetical protein POPTR_0014s12090g             117   1e-27   
ref|XP_009386485.1|  PREDICTED: ethylene-responsive transcription...    115   1e-27   
gb|AFK41987.1|  unknown                                                 117   1e-27   
ref|XP_003591474.1|  Ethylene responsive transcription factor 2b        117   1e-27   
ref|XP_007200418.1|  hypothetical protein PRUPE_ppa008730mg             117   1e-27   
ref|XP_006841505.1|  PREDICTED: ethylene-responsive transcription...    117   1e-27   
ref|XP_009146063.1|  PREDICTED: ethylene-responsive transcription...    116   1e-27   
emb|CDY65334.1|  BnaAnng20420D                                          118   1e-27   
ref|XP_008807399.1|  PREDICTED: ethylene-responsive transcription...    115   1e-27   
ref|XP_010937273.1|  PREDICTED: ethylene-responsive transcription...    118   1e-27   
gb|ADU76352.1|  ethylene responsive factor                              117   1e-27   
gb|AGC79344.1|  ethylene response factor 10                             117   1e-27   
ref|XP_010269611.1|  PREDICTED: ethylene-responsive transcription...    116   1e-27   
gb|AAR87866.1|  ethylene-binding protein                                116   1e-27   
ref|XP_009387936.1|  PREDICTED: ethylene-responsive transcription...    115   1e-27   
ref|NP_001234308.1|  ethylene response factor 2                         116   1e-27   
ref|XP_004152238.1|  PREDICTED: ethylene-responsive transcription...    116   1e-27   
dbj|BAK04383.1|  predicted protein                                      116   1e-27   
ref|XP_002885024.1|  hypothetical protein ARALYDRAFT_897690             118   2e-27   
ref|XP_011041915.1|  PREDICTED: ethylene-responsive transcription...    117   2e-27   
ref|XP_006305171.1|  hypothetical protein CARUB_v10009538mg             117   2e-27   
ref|XP_011079624.1|  PREDICTED: ethylene-responsive transcription...    115   2e-27   
ref|XP_008454315.1|  PREDICTED: ethylene-responsive transcription...    116   2e-27   
gb|EMT16905.1|  Ethylene-responsive transcription factor 1              118   2e-27   
ref|XP_006828652.1|  PREDICTED: ethylene-responsive transcription...    115   2e-27   
gb|AHZ97883.1|  ethylene-responsive transcription                       116   2e-27   
ref|XP_008386662.1|  PREDICTED: ethylene-responsive transcription...    117   2e-27   
gb|AGL34962.1|  ethylene-responsive transcription factor 3              115   2e-27   
gb|AAX68526.1|  putative ethylene responsive element binding prot...    115   2e-27   
gb|KHN02940.1|  Ethylene-responsive transcription factor RAP2-3         113   2e-27   
ref|NP_001235751.1|  uncharacterized protein LOC100527415               113   2e-27   
ref|XP_010523959.1|  PREDICTED: ethylene-responsive transcription...    116   3e-27   
gb|KFK39991.1|  hypothetical protein AALP_AA3G315900                    113   3e-27   
gb|EYU46754.1|  hypothetical protein MIMGU_mgv1a012435mg                115   3e-27   
ref|XP_002436631.1|  hypothetical protein SORBIDRAFT_10g006260          117   3e-27   
ref|XP_009382524.1|  PREDICTED: ethylene-responsive transcription...    114   3e-27   
ref|XP_011009081.1|  PREDICTED: ethylene-responsive transcription...    115   3e-27   
gb|AHN92190.1|  ERF protein 2                                           116   3e-27   
ref|XP_010069891.1|  PREDICTED: ethylene-responsive transcription...    116   4e-27   
ref|XP_010544992.1|  PREDICTED: ethylene-responsive transcription...    116   4e-27   
dbj|BAK06359.1|  predicted protein                                      116   4e-27   
ref|XP_011015856.1|  PREDICTED: ethylene-responsive transcription...    116   4e-27   
ref|XP_002301490.2|  hypothetical protein POPTR_0002s20270g             115   5e-27   
ref|XP_011009991.1|  PREDICTED: ethylene-responsive transcription...    115   5e-27   
emb|CDX75756.1|  BnaC03g38390D                                          116   5e-27   
ref|XP_007051000.1|  Integrase-type DNA-binding superfamily prote...    115   5e-27   
ref|XP_010684330.1|  PREDICTED: ethylene-responsive transcription...    115   7e-27   
gb|KFK35687.1|  hypothetical protein AALP_AA4G024200                    115   7e-27   
ref|XP_010428119.1|  PREDICTED: ethylene-responsive transcription...    114   7e-27   
gb|KFK41657.1|  hypothetical protein AALP_AA2G155900                    115   8e-27   
ref|NP_001060280.1|  Os07g0617000                                       115   8e-27   
gb|EAZ04715.1|  hypothetical protein OsI_26876                          115   9e-27   
gb|ADJ67433.1|  ethylene response factor 4                              114   1e-26   
ref|XP_010911281.1|  PREDICTED: ethylene-responsive transcription...    114   1e-26   
ref|XP_010914492.1|  PREDICTED: ethylene-responsive transcription...    112   1e-26   
emb|CAC12822.1|  AP2 domain-containing transcription factor             113   1e-26   
ref|XP_004974759.1|  PREDICTED: uncharacterized protein LOC101761413    117   1e-26   
ref|XP_008380866.1|  PREDICTED: LOW QUALITY PROTEIN: ethylene-res...    110   2e-26   
gb|ADP37420.1|  ethylene-responsive-element-binding factor 5            113   2e-26   
emb|CDX68269.1|  BnaA07g23090D                                          112   2e-26   
gb|AEQ58796.1|  ethylene response factor                                112   2e-26   
ref|XP_008235129.1|  PREDICTED: ethylene-responsive transcription...    114   2e-26   
gb|KGN47418.1|  hypothetical protein Csa_6G318160                       112   2e-26   
ref|XP_008789913.1|  PREDICTED: ethylene-responsive transcription...    113   3e-26   
ref|XP_008369034.1|  PREDICTED: ethylene-responsive transcription...    114   3e-26   
ref|XP_008438911.1|  PREDICTED: ethylene-responsive transcription...    112   3e-26   
ref|XP_010471263.1|  PREDICTED: ethylene-responsive transcription...    112   3e-26   
ref|XP_009804847.1|  PREDICTED: ethylene-responsive transcription...    111   3e-26   
emb|CDY51428.1|  BnaA04g27050D                                          111   3e-26   
ref|XP_010497642.1|  PREDICTED: ethylene-responsive transcription...    109   3e-26   
ref|XP_009597158.1|  PREDICTED: ethylene-responsive transcription...    112   3e-26   
ref|NP_182274.1|  ethylene-responsive transcription factor ERF071       110   3e-26   
ref|XP_004153075.2|  PREDICTED: ethylene-responsive transcription...    112   3e-26   
ref|XP_006296358.1|  hypothetical protein CARUB_v10025530mg             110   3e-26   
ref|XP_009391493.1|  PREDICTED: ethylene-responsive transcription...    110   4e-26   
gb|EMT16418.1|  Ethylene-responsive transcription factor 1              114   4e-26   
ref|XP_009370002.1|  PREDICTED: ethylene-responsive transcription...    112   4e-26   
ref|XP_010024730.1|  PREDICTED: ethylene-responsive transcription...    112   4e-26   
gb|ADE41143.1|  AP2 domain class transcription factor                   113   4e-26   
ref|XP_009104861.1|  PREDICTED: ethylene-responsive transcription...    112   4e-26   
ref|XP_011010669.1|  PREDICTED: ethylene-responsive transcription...    112   5e-26   
ref|XP_002315490.1|  AP2 domain transcription factor family protein     112   5e-26   
ref|XP_002444457.1|  hypothetical protein SORBIDRAFT_07g022180          114   5e-26   
emb|CDY50643.1|  BnaC06g24360D                                          111   5e-26   
ref|XP_009118731.1|  PREDICTED: ethylene-responsive transcription...    111   5e-26   
ref|XP_009370001.1|  PREDICTED: ethylene-responsive transcription...    112   6e-26   
ref|NP_001266125.1|  ERF6                                               112   6e-26   
ref|XP_006419498.1|  hypothetical protein CICLE_v10005701mg             111   7e-26   
gb|KEH37187.1|  ethylene response factor                                111   7e-26   
ref|NP_177380.2|  ethylene-responsive transcription factor ERF073       110   7e-26   
gb|AFK36443.1|  unknown                                                 111   7e-26   
ref|XP_008438910.1|  PREDICTED: ethylene-responsive transcription...    110   7e-26   
ref|XP_006489030.1|  PREDICTED: ethylene-responsive transcription...    111   7e-26   
emb|CDY27480.1|  BnaC04g51210D                                          110   8e-26   
ref|XP_002882121.1|  hypothetical protein ARALYDRAFT_483933             109   8e-26   
ref|XP_010506788.1|  PREDICTED: ethylene-responsive transcription...    109   9e-26   
ref|XP_010518456.1|  PREDICTED: ethylene-responsive transcription...    109   9e-26   
gb|AJG06893.1|  ethylene response factor 2                              111   1e-25   
ref|XP_007138947.1|  hypothetical protein PHAVU_009G251600g             110   1e-25   
ref|XP_010109584.1|  Ethylene-responsive transcription factor           111   1e-25   
ref|XP_006841504.1|  PREDICTED: ethylene-responsive transcription...    111   1e-25   
gb|EMS62972.1|  Ethylene-responsive transcription factor 1              112   1e-25   
pir||S49031  cadmium-induced protein - Arabidopsis thaliana             110   1e-25
ref|XP_004985469.1|  PREDICTED: ethylene-responsive transcription...    112   1e-25   
gb|KDO71762.1|  hypothetical protein CISIN_1g025382mg                   110   1e-25   
ref|XP_010507879.1|  PREDICTED: ethylene-responsive transcription...    108   2e-25   
ref|NP_001170645.1|  uncharacterized protein LOC100384698               111   2e-25   
gb|AEQ58799.1|  ethylene response factor                                110   2e-25   
gb|ACF84305.1|  unknown                                                 111   2e-25   
ref|XP_008390617.1|  PREDICTED: ethylene-responsive transcription...    110   3e-25   
gb|ADE41108.1|  AP2 domain class transcription factor                   110   3e-25   
gb|EMT18835.1|  Ethylene-responsive transcription factor 1              112   3e-25   
tpg|DAA48831.1|  TPA: putative AP2/EREBP transcription factor sup...    111   3e-25   
ref|XP_008340780.1|  PREDICTED: ethylene-responsive transcription...    110   3e-25   
ref|XP_003546368.1|  PREDICTED: ethylene-responsive transcription...    109   3e-25   
ref|XP_006380240.1|  AP2 domain transcription factor family protein     109   3e-25   
emb|CDX72909.1|  BnaC06g33570D                                          108   4e-25   
ref|NP_001287809.1|  ethylene-responsive transcription factor RAP...    109   4e-25   
ref|XP_010547004.1|  PREDICTED: ethylene-responsive transcription...    107   4e-25   
ref|XP_003561984.2|  PREDICTED: uncharacterized protein LOC100826410    113   5e-25   
ref|XP_008458405.1|  PREDICTED: ethylene-responsive transcription...    109   5e-25   
gb|ABR92333.1|  putative ethylene-responsive element binding protein    108   5e-25   
gb|EPS67112.1|  ethylene response factor 2                              108   6e-25   
ref|XP_009105895.1|  PREDICTED: ethylene-responsive transcription...    108   8e-25   
ref|XP_010537652.1|  PREDICTED: ethylene-responsive transcription...    109   9e-25   
gb|AAV85777.1|  EREB1 transcription factor                              107   1e-24   
ref|XP_008340779.1|  PREDICTED: ethylene-responsive transcription...    108   1e-24   
ref|XP_010921623.1|  PREDICTED: ethylene-responsive transcription...    107   1e-24   
ref|XP_011091010.1|  PREDICTED: ethylene-responsive transcription...    107   1e-24   
emb|CDO98826.1|  unnamed protein product                                108   1e-24   
ref|NP_001243393.1|  ethylene-responsive transcription factor RAP...    108   1e-24   
gb|AEF59493.1|  putative ethylene responsive element binding protein    108   1e-24   
gb|AHA93903.1|  ethylene response factor 1                              107   1e-24   
emb|CDX96402.1|  BnaA07g30130D                                          107   2e-24   
ref|XP_004959072.1|  PREDICTED: ethylene-responsive transcription...    109   2e-24   
dbj|BAF43419.1|  ethylene response factor                               107   3e-24   
gb|AFW88166.1|  putative AP2/EREBP transcription factor superfami...    109   3e-24   
gb|EMT17811.1|  Ethylene-responsive transcription factor 1              108   3e-24   
ref|XP_002516971.1|  conserved hypothetical protein                     107   3e-24   
ref|NP_001275232.1|  DNA binding protein homolog                        107   4e-24   
ref|XP_010259468.1|  PREDICTED: ethylene-responsive transcription...    107   4e-24   
dbj|BAJ87531.1|  predicted protein                                      106   4e-24   
ref|XP_011622686.1|  PREDICTED: ethylene-responsive transcription...    106   5e-24   
gb|EYU43981.1|  hypothetical protein MIMGU_mgv1a023814mg                107   6e-24   
ref|XP_006649510.1|  PREDICTED: ethylene-responsive transcription...    107   6e-24   
gb|ERM94078.1|  hypothetical protein AMTR_s00010p00098700               107   6e-24   
ref|XP_004134228.1|  PREDICTED: ethylene-responsive transcription...    105   7e-24   
dbj|BAJ98728.1|  predicted protein                                      107   7e-24   
ref|XP_008784774.1|  PREDICTED: ethylene-responsive transcription...    105   1e-23   
ref|NP_850583.1|  ethylene-responsive transcription factor RAP2-2       107   1e-23   
ref|NP_850582.1|  ethylene-responsive transcription factor RAP2-2       107   1e-23   
ref|XP_010938373.1|  PREDICTED: ethylene-responsive transcription...    104   1e-23   
gb|EYU21015.1|  hypothetical protein MIMGU_mgv1a011956mg                105   1e-23   
dbj|BAG50063.1|  transcription factor AP2-EREBP                         105   1e-23   
ref|XP_004985472.1|  PREDICTED: ethylene-responsive transcription...    105   2e-23   
ref|XP_010931685.1|  PREDICTED: ethylene-responsive transcription...    104   2e-23   
ref|XP_008789907.1|  PREDICTED: ethylene-responsive transcription...    104   2e-23   
ref|XP_009391494.1|  PREDICTED: ethylene-responsive transcription...    103   2e-23   
ref|XP_012079573.1|  PREDICTED: ethylene-responsive transcription...    102   4e-23   
gb|KDP31925.1|  hypothetical protein JCGZ_12386                         102   4e-23   
ref|XP_011090449.1|  PREDICTED: ethylene-responsive transcription...    105   4e-23   
gb|AAM62802.1|  DNA-binding protein                                     105   5e-23   
ref|XP_010548976.1|  PREDICTED: ethylene-responsive transcription...    103   5e-23   
ref|XP_001756221.1|  predicted protein                                99.4    5e-23   
gb|KDO57151.1|  hypothetical protein CISIN_1g039390mg                   103   5e-23   
ref|NP_566482.1|  ethylene-responsive transcription factor RAP2-2       105   5e-23   
ref|XP_006427894.1|  hypothetical protein CICLE_v10026032mg             104   6e-23   
ref|XP_010914493.1|  PREDICTED: ethylene-responsive transcription...    102   6e-23   
ref|XP_010096464.1|  Ethylene-responsive transcription factor           104   6e-23   
dbj|BAJ93313.1|  predicted protein                                      104   7e-23   
ref|XP_001753194.1|  predicted protein                                  100   7e-23   
ref|XP_006464540.1|  PREDICTED: ethylene-responsive transcription...    104   7e-23   
ref|XP_006464539.1|  PREDICTED: ethylene-responsive transcription...    104   7e-23   
ref|XP_001753063.1|  predicted protein                                99.0    7e-23   
ref|XP_010667125.1|  PREDICTED: ethylene-responsive transcription...    103   8e-23   



>gb|AAP40022.1| callus-expressing factor [Nicotiana tabacum]
Length=387

 Score =   215 bits (548),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 134/181 (74%), Positives = 145/181 (80%), Gaps = 9/181 (5%)
 Frame = +3

Query  150  MCGGAIISDFKPPSRSSRRLTADLLWGRADLsggkkksnssgshyskPLRSEVVVLDDDF  329
            MCGGAIISD+  PSR+SRRLTA+LLWGR+DLS  +K  N+  S    PLRS+VV LDDDF
Sbjct  1    MCGGAIISDYIAPSRTSRRLTAELLWGRSDLSNKQKNPNNYHSK---PLRSQVVDLDDDF  57

Query  330  EADFQDFKDHSYS---QVDAKPFAFSASHRP---GFssgpdsdsskdadnsskrkrkNQY  491
            EADFQDFKD S     QVD KPFAFSAS      G  S    DS KDAD SSKRKRKNQY
Sbjct  58   EADFQDFKDFSDDEDVQVDVKPFAFSASKNSNVEGSKSVKTDDSDKDADRSSKRKRKNQY  117

Query  492  RGIRQRPWGKWAAEIRDPSKGVRVWLGTFDTAEEAARAYDIEARRIRGKKAKVNFPDDAP  671
            RGIRQRPWGKWAAEIRDP KGVRVWLGTF+TAEEAARAYD+EARRIRG KAKVNFPD+AP
Sbjct  118  RGIRQRPWGKWAAEIRDPRKGVRVWLGTFNTAEEAARAYDVEARRIRGNKAKVNFPDEAP  177

Query  672  L  674
            +
Sbjct  178  V  178



>gb|ADP37417.1| ethylene-responsive-element-binding factor 2 [Petunia x hybrida]
Length=378

 Score =   215 bits (547),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 129/176 (73%), Positives = 146/176 (83%), Gaps = 5/176 (3%)
 Frame = +3

Query  150  MCGGAIISDFKPPSRSSRRLTADLLWGRADLsggkkksnssgshyskPLRSEVVVLDDDF  329
            MCGGAIISD+ PP+R+SRRLTA+LLWGR+DLS   K  ++  S    PLRS++V LDDDF
Sbjct  1    MCGGAIISDYIPPNRTSRRLTAELLWGRSDLSKKSKNPSNYHSK---PLRSQIVDLDDDF  57

Query  330  EADFQDFKDHSYSQVDAKPFAFSA-SHRPGFssgpdsdsskdadnsskrkrkNQYRGIRQ  506
            EADFQ+FKD S  + D KPFAFSA     G  S   +DS KDAD+SSKRKRKNQYRGIRQ
Sbjct  58   EADFQEFKDFSDDE-DVKPFAFSAPKQSTGSKSVKSADSEKDADSSSKRKRKNQYRGIRQ  116

Query  507  RPWGKWAAEIRDPSKGVRVWLGTFDTAEEAARAYDIEARRIRGKKAKVNFPDDAPL  674
            RPWGKWAAEIRDPSKGVRVWLGTF+TAEEAARAYD+EARRIRG KAKVNFPD+AP+
Sbjct  117  RPWGKWAAEIRDPSKGVRVWLGTFNTAEEAARAYDVEARRIRGNKAKVNFPDEAPV  172



>ref|XP_009775920.1| PREDICTED: ethylene-responsive transcription factor RAP2-12-like 
[Nicotiana sylvestris]
Length=387

 Score =   214 bits (546),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 133/181 (73%), Positives = 145/181 (80%), Gaps = 9/181 (5%)
 Frame = +3

Query  150  MCGGAIISDFKPPSRSSRRLTADLLWGRADLsggkkksnssgshyskPLRSEVVVLDDDF  329
            MCGGAIISD+  P+R+SRRLTA+LLWGR+DLS  +K  N+  S    PLRS+VV LDDDF
Sbjct  1    MCGGAIISDYIAPTRTSRRLTAELLWGRSDLSNKQKNPNNYHSK---PLRSQVVDLDDDF  57

Query  330  EADFQDFKDHSYS---QVDAKPFAFSASHRP---GFssgpdsdsskdadnsskrkrkNQY  491
            EADFQDFKD S     QVD KPFAFSAS      G  S    DS KDAD SSKRKRKNQY
Sbjct  58   EADFQDFKDFSDDEDVQVDVKPFAFSASKNSNVEGSKSVKTDDSDKDADRSSKRKRKNQY  117

Query  492  RGIRQRPWGKWAAEIRDPSKGVRVWLGTFDTAEEAARAYDIEARRIRGKKAKVNFPDDAP  671
            RGIRQRPWGKWAAEIRDP KGVRVWLGTF+TAEEAARAYD+EARRIRG KAKVNFPD+AP
Sbjct  118  RGIRQRPWGKWAAEIRDPRKGVRVWLGTFNTAEEAARAYDVEARRIRGNKAKVNFPDEAP  177

Query  672  L  674
            +
Sbjct  178  V  178



>ref|XP_009627746.1| PREDICTED: ethylene-responsive transcription factor RAP2-12-like 
[Nicotiana tomentosiformis]
Length=382

 Score =   212 bits (540),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 132/181 (73%), Positives = 144/181 (80%), Gaps = 9/181 (5%)
 Frame = +3

Query  150  MCGGAIISDFKPPSRSSRRLTADLLWGRADLsggkkksnssgshyskPLRSEVVVLDDDF  329
            MCGGAIISD   PSR+SRRLTA+LLWGR+DLS  +K  N+  S    PLRS+VV LDDDF
Sbjct  1    MCGGAIISDDIAPSRTSRRLTAELLWGRSDLSKKQKNLNNYHSK---PLRSQVVDLDDDF  57

Query  330  EADFQDFKDHSYSQ---VDAKPFAFSASHRP---GFssgpdsdsskdadnsskrkrkNQY  491
            EADFQDFKD S  +   VD KPFAFSAS      G  +    DS KDAD SSKRKRKNQY
Sbjct  58   EADFQDFKDFSDDEDVEVDVKPFAFSASKNSTVEGSKTVKTVDSDKDADRSSKRKRKNQY  117

Query  492  RGIRQRPWGKWAAEIRDPSKGVRVWLGTFDTAEEAARAYDIEARRIRGKKAKVNFPDDAP  671
            RGIRQRPWGKWAAEIRDP KGVRVWLGTF+TAEEAARAYD+EARRIRG KAKVNFPD+AP
Sbjct  118  RGIRQRPWGKWAAEIRDPRKGVRVWLGTFNTAEEAARAYDVEARRIRGNKAKVNFPDEAP  177

Query  672  L  674
            +
Sbjct  178  V  178



>ref|XP_009788612.1| PREDICTED: ethylene-responsive transcription factor RAP2-12-like 
[Nicotiana sylvestris]
Length=385

 Score =   207 bits (526),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 131/185 (71%), Positives = 140/185 (76%), Gaps = 13/185 (7%)
 Frame = +3

Query  150  MCGGAIISDFKPPSRSSRRLTADLLWGRADLsggkkksnssgshyskPLRSEVVVLDDDF  329
            MCGGAIISD  PP RSSRRLTADLLWG +DL+  K   N   S    PLRSEVV LD DF
Sbjct  1    MCGGAIISDCIPPLRSSRRLTADLLWGCSDLNQKKNPFNYQYSK---PLRSEVVDLDYDF  57

Query  330  EADFQDFKDHSYSQVDA------KPFAFSASHRPGFssgpdsdss----kdadnsskrkr  479
            EADFQDFKD S    D+      KPFAFSA  + G S G  S  S    K+ + SSKRKR
Sbjct  58   EADFQDFKDCSDDDEDSYKVDGLKPFAFSAPEQSGASVGSKSLKSVDLDKEVEKSSKRKR  117

Query  480  kNQYRGIRQRPWGKWAAEIRDPSKGVRVWLGTFDTAEEAARAYDIEARRIRGKKAKVNFP  659
            KNQYRGIRQRPWGKWAAEIRDP KGVRVWLGTF+TAEEAARAYDIEARRIRGKKAKVNFP
Sbjct  118  KNQYRGIRQRPWGKWAAEIRDPQKGVRVWLGTFNTAEEAARAYDIEARRIRGKKAKVNFP  177

Query  660  DDAPL  674
            D+AP+
Sbjct  178  DEAPV  182



>ref|NP_001234462.1| JERF3 [Solanum lycopersicum]
 gb|AAQ91334.1| JERF3 [Solanum lycopersicum]
 gb|ACF74903.1| JERF3 [Solanum lycopersicum]
Length=327

 Score =   199 bits (506),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 128/180 (71%), Positives = 137/180 (76%), Gaps = 10/180 (6%)
 Frame = +3

Query  150  MCGGAIISDFKPPSRSSRRLTADLLWGRADLsggkkksnssgshyskPLRSEVVVLDDDF  329
            MCGG+IISD+  PSR+SRRLTA+ LWGR DL   +K  N+  S     LRSEVV   DDF
Sbjct  1    MCGGSIISDYIDPSRTSRRLTAEFLWGRFDLGKKQKNPNNYHSKAKH-LRSEVV---DDF  56

Query  330  EADFQDFK---DHSYSQVDAKPFAFSAS-HRPGFssgpd--sdsskdadnsskrkrkNQY  491
            EADFQDFK   D    QVD KPFAFSAS H  G  S     SD    AD SSKRKRKNQY
Sbjct  57   EADFQDFKELSDDEDVQVDVKPFAFSASKHSTGSKSLKTVDSDKDAAADKSSKRKRKNQY  116

Query  492  RGIRQRPWGKWAAEIRDPSKGVRVWLGTFDTAEEAARAYDIEARRIRGKKAKVNFPDDAP  671
            RGIRQRPWGKWAAEIRDP KGVRVWLGTF+TAEEAA+AYDIEARRIRGKKAKVNFPD+AP
Sbjct  117  RGIRQRPWGKWAAEIRDPRKGVRVWLGTFNTAEEAAKAYDIEARRIRGKKAKVNFPDEAP  176



>ref|XP_009794756.1| PREDICTED: ethylene-responsive transcription factor RAP2-12-like 
[Nicotiana sylvestris]
Length=375

 Score =   199 bits (507),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 121/176 (69%), Positives = 139/176 (79%), Gaps = 8/176 (5%)
 Frame = +3

Query  150  MCGGAIISDFKPPSRSSRRLTADLLWGRADLsggkkksnssgshyskPLRSEVVVLDDDF  329
            MCGGAI+SD  PPSR+SRRLTADLLWG +DLS  KK  ++  S     LRS+   LDD+F
Sbjct  1    MCGGAILSDLVPPSRTSRRLTADLLWGTSDLSKKKKNPSNYHSKT---LRSKFFELDDEF  57

Query  330  EADFQDFKDHSYSQVDAKPFAFSASHRPGFssgpdsdsskdadnsskrkrkNQYRGIRQR  509
            EADFQDFKD++    + K FAF      G  S    DSS +AD SSKRKRKNQYRGIRQR
Sbjct  58   EADFQDFKDYADDVDEVKAFAFH-----GSKSVKSDDSSCNADKSSKRKRKNQYRGIRQR  112

Query  510  PWGKWAAEIRDPSKGVRVWLGTFDTAEEAARAYDIEARRIRGKKAKVNFPDDAPLT  677
            PWGKWAAEIRDP+KG+RVWLGTF++AEEAARAYDIEARRIRGKKAKVNFPD+AP++
Sbjct  113  PWGKWAAEIRDPTKGIRVWLGTFNSAEEAARAYDIEARRIRGKKAKVNFPDEAPVS  168



>ref|XP_010318410.1| PREDICTED: JERF3 isoform X3 [Solanum lycopersicum]
Length=386

 Score =   199 bits (505),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 128/180 (71%), Positives = 137/180 (76%), Gaps = 10/180 (6%)
 Frame = +3

Query  150  MCGGAIISDFKPPSRSSRRLTADLLWGRADLsggkkksnssgshyskPLRSEVVVLDDDF  329
            MCGG+IISD+  PSR+SRRLTA+ LWGR DL   +K  N+  S     LRSEVV   DDF
Sbjct  1    MCGGSIISDYIDPSRTSRRLTAEFLWGRFDLGKKQKNPNNYHSKAKH-LRSEVV---DDF  56

Query  330  EADFQDFK---DHSYSQVDAKPFAFSAS-HRPGFssgpd--sdsskdadnsskrkrkNQY  491
            EADFQDFK   D    QVD KPFAFSAS H  G  S     SD    AD SSKRKRKNQY
Sbjct  57   EADFQDFKELSDDEDVQVDVKPFAFSASKHSTGSKSLKTVDSDKDAAADKSSKRKRKNQY  116

Query  492  RGIRQRPWGKWAAEIRDPSKGVRVWLGTFDTAEEAARAYDIEARRIRGKKAKVNFPDDAP  671
            RGIRQRPWGKWAAEIRDP KGVRVWLGTF+TAEEAA+AYDIEARRIRGKKAKVNFPD+AP
Sbjct  117  RGIRQRPWGKWAAEIRDPRKGVRVWLGTFNTAEEAAKAYDIEARRIRGKKAKVNFPDEAP  176



>ref|XP_010318408.1| PREDICTED: JERF3 isoform X1 [Solanum lycopersicum]
Length=397

 Score =   199 bits (505),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 128/180 (71%), Positives = 137/180 (76%), Gaps = 10/180 (6%)
 Frame = +3

Query  150  MCGGAIISDFKPPSRSSRRLTADLLWGRADLsggkkksnssgshyskPLRSEVVVLDDDF  329
            MCGG+IISD+  PSR+SRRLTA+ LWGR DL   +K  N+  S     LRSEVV   DDF
Sbjct  1    MCGGSIISDYIDPSRTSRRLTAEFLWGRFDLGKKQKNPNNYHSKAKH-LRSEVV---DDF  56

Query  330  EADFQDFK---DHSYSQVDAKPFAFSAS-HRPGFssgpd--sdsskdadnsskrkrkNQY  491
            EADFQDFK   D    QVD KPFAFSAS H  G  S     SD    AD SSKRKRKNQY
Sbjct  57   EADFQDFKELSDDEDVQVDVKPFAFSASKHSTGSKSLKTVDSDKDAAADKSSKRKRKNQY  116

Query  492  RGIRQRPWGKWAAEIRDPSKGVRVWLGTFDTAEEAARAYDIEARRIRGKKAKVNFPDDAP  671
            RGIRQRPWGKWAAEIRDP KGVRVWLGTF+TAEEAA+AYDIEARRIRGKKAKVNFPD+AP
Sbjct  117  RGIRQRPWGKWAAEIRDPRKGVRVWLGTFNTAEEAAKAYDIEARRIRGKKAKVNFPDEAP  176



>ref|XP_009605490.1| PREDICTED: ethylene-responsive transcription factor RAP2-12-like 
[Nicotiana tomentosiformis]
Length=375

 Score =   198 bits (503),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 121/176 (69%), Positives = 139/176 (79%), Gaps = 8/176 (5%)
 Frame = +3

Query  150  MCGGAIISDFKPPSRSSRRLTADLLWGRADLsggkkksnssgshyskPLRSEVVVLDDDF  329
            MCGGAI+SD  PPSR+SRRLTADLLWG +DLS  KK  ++  S    PLRS++  LDD+F
Sbjct  1    MCGGAILSDLVPPSRTSRRLTADLLWGTSDLSKKKKNPSNYHSK---PLRSKLFDLDDEF  57

Query  330  EADFQDFKDHSYSQVDAKPFAFSASHRPGFssgpdsdsskdadnsskrkrkNQYRGIRQR  509
            EADFQDFKD++    + K FA       G  S    DSS DAD SSKRKRKNQYRGIRQR
Sbjct  58   EADFQDFKDYADDVDEVKAFALH-----GSKSVKSDDSSCDADKSSKRKRKNQYRGIRQR  112

Query  510  PWGKWAAEIRDPSKGVRVWLGTFDTAEEAARAYDIEARRIRGKKAKVNFPDDAPLT  677
            PWGKWAAEIRDP+KG+RVWLGTF++AEEAARAYD EARRIRGKKAKVNFPD+AP++
Sbjct  113  PWGKWAAEIRDPTKGIRVWLGTFNSAEEAARAYDNEARRIRGKKAKVNFPDEAPVS  168



>ref|XP_010318409.1| PREDICTED: JERF3 isoform X2 [Solanum lycopersicum]
Length=387

 Score =   198 bits (503),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 124/177 (70%), Positives = 134/177 (76%), Gaps = 14/177 (8%)
 Frame = +3

Query  150  MCGGAIISDFKPPSRSSRRLTADLLWGRADLsggkkksnssgshyskPLRSEVVVLDDDF  329
            MCGG+IISD+  PSR+SRRLTA+ LWGR DL   +K  N+  S     LRSEVV   DDF
Sbjct  1    MCGGSIISDYIDPSRTSRRLTAEFLWGRFDLGKKQKNPNNYHSKAKH-LRSEVV---DDF  56

Query  330  EADFQDFK---DHSYSQVDAKPFAFSASHRPGFssgpdsdsskdadnsskrkrkNQYRGI  500
            EADFQDFK   D    QVD KPFAFSAS          +D    AD SSKRKRKNQYRGI
Sbjct  57   EADFQDFKELSDDEDVQVDVKPFAFSASKH-------STDKDAAADKSSKRKRKNQYRGI  109

Query  501  RQRPWGKWAAEIRDPSKGVRVWLGTFDTAEEAARAYDIEARRIRGKKAKVNFPDDAP  671
            RQRPWGKWAAEIRDP KGVRVWLGTF+TAEEAA+AYDIEARRIRGKKAKVNFPD+AP
Sbjct  110  RQRPWGKWAAEIRDPRKGVRVWLGTFNTAEEAAKAYDIEARRIRGKKAKVNFPDEAP  166



>ref|XP_006342909.1| PREDICTED: ethylene-responsive transcription factor RAP2-12-like 
isoform X3 [Solanum tuberosum]
Length=379

 Score =   197 bits (502),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 124/179 (69%), Positives = 138/179 (77%), Gaps = 11/179 (6%)
 Frame = +3

Query  150  MCGGAIISDFKPPSRSSRRLTADLLWGRADLsggkkksnssgshyskPLRSEVVVLDDDF  329
            MCGG+IISD+  P+R+SRRLTA+LLWGR DLS  +K  N+  S +   LRSEVV   DDF
Sbjct  1    MCGGSIISDYIDPNRTSRRLTAELLWGRFDLSKKQKNPNNYHSKH---LRSEVV---DDF  54

Query  330  EADFQDFK---DHSYSQVDAKPFAFSASHRPGFssgpds--dsskdadnsskrkrkNQYR  494
            EADFQDFK   D    +VD KPFAFSAS +   S    +       AD SSKRKRKNQYR
Sbjct  55   EADFQDFKELSDDEDVEVDVKPFAFSASKQSTGSKSSKTVDSDKDAADKSSKRKRKNQYR  114

Query  495  GIRQRPWGKWAAEIRDPSKGVRVWLGTFDTAEEAARAYDIEARRIRGKKAKVNFPDDAP  671
            GIRQRPWGKWAAEIRDP KGVRVWLGTF+TAEEAARAYDIEAR+IRGKKAKVNFPD+AP
Sbjct  115  GIRQRPWGKWAAEIRDPRKGVRVWLGTFNTAEEAARAYDIEARKIRGKKAKVNFPDEAP  173



>ref|XP_006342907.1| PREDICTED: ethylene-responsive transcription factor RAP2-12-like 
isoform X1 [Solanum tuberosum]
 ref|XP_006342908.1| PREDICTED: ethylene-responsive transcription factor RAP2-12-like 
isoform X2 [Solanum tuberosum]
Length=390

 Score =   198 bits (503),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 124/179 (69%), Positives = 138/179 (77%), Gaps = 11/179 (6%)
 Frame = +3

Query  150  MCGGAIISDFKPPSRSSRRLTADLLWGRADLsggkkksnssgshyskPLRSEVVVLDDDF  329
            MCGG+IISD+  P+R+SRRLTA+LLWGR DLS  +K  N+  S +   LRSEVV   DDF
Sbjct  1    MCGGSIISDYIDPNRTSRRLTAELLWGRFDLSKKQKNPNNYHSKH---LRSEVV---DDF  54

Query  330  EADFQDFK---DHSYSQVDAKPFAFSASHRPGFssgpds--dsskdadnsskrkrkNQYR  494
            EADFQDFK   D    +VD KPFAFSAS +   S    +       AD SSKRKRKNQYR
Sbjct  55   EADFQDFKELSDDEDVEVDVKPFAFSASKQSTGSKSSKTVDSDKDAADKSSKRKRKNQYR  114

Query  495  GIRQRPWGKWAAEIRDPSKGVRVWLGTFDTAEEAARAYDIEARRIRGKKAKVNFPDDAP  671
            GIRQRPWGKWAAEIRDP KGVRVWLGTF+TAEEAARAYDIEAR+IRGKKAKVNFPD+AP
Sbjct  115  GIRQRPWGKWAAEIRDPRKGVRVWLGTFNTAEEAARAYDIEARKIRGKKAKVNFPDEAP  173



>gb|AHA93905.1| ethylene response factor 5 [Coffea arabica]
Length=404

 Score =   198 bits (503),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 128/191 (67%), Positives = 138/191 (72%), Gaps = 18/191 (9%)
 Frame = +3

Query  150  MCGGAIISDFKPPSRSSRRLTADLLWGR-ADL--------sggkkksnssgshyskPLRS  302
            MCGGAIISDF PPSRSSRRLTADLLWG  AD            K    ++   YSKPLRS
Sbjct  1    MCGGAIISDFIPPSRSSRRLTADLLWGTGADFPGTKKDINKKKKNNKKNTSDLYSKPLRS  60

Query  303  EVVVLDDDFEADFQDFKDHSYSQV----DAKPFAFSASHRP-----GFssgpdsdsskda  455
            EVV LDD+FE DFQ+F DHS  +     D KPF FSAS        G   G  SDSS ++
Sbjct  61   EVVDLDDEFETDFQEFNDHSDDEAEELEDVKPFGFSASKHSAIPPRGTKYGKSSDSSDES  120

Query  456  dnsskrkrkNQYRGIRQRPWGKWAAEIRDPSKGVRVWLGTFDTAEEAARAYDIEARRIRG  635
            +  SKRKRKNQYRGIRQRPWGKWAAEIRDP KGVRVWLGTF+TAEEAARAYD EARRIRG
Sbjct  121  EKYSKRKRKNQYRGIRQRPWGKWAAEIRDPRKGVRVWLGTFNTAEEAARAYDTEARRIRG  180

Query  636  KKAKVNFPDDA  668
            KKAKVNFPD+ 
Sbjct  181  KKAKVNFPDET  191



>emb|CDO97803.1| unnamed protein product [Coffea canephora]
Length=404

 Score =   197 bits (502),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 128/191 (67%), Positives = 139/191 (73%), Gaps = 18/191 (9%)
 Frame = +3

Query  150  MCGGAIISDFKPPSRSSRRLTADLLWGR-ADL--------sggkkksnssgshyskPLRS  302
            MCGGAIISDF PPSRSSRRLTADLLWG  AD            K    ++   YSKPLRS
Sbjct  1    MCGGAIISDFIPPSRSSRRLTADLLWGTGADFPGTKKDINKKKKNNKKNTSDLYSKPLRS  60

Query  303  EVVVLDDDFEADFQDFKDHSYSQV----DAKPFAFSASHRP-----GFssgpdsdsskda  455
            EVV LDD+FE DFQ+F DHS  +     D KPF FSAS        G   G  SDSS+++
Sbjct  61   EVVDLDDEFETDFQEFNDHSDDEAEELEDVKPFGFSASKHSAIPPRGTKYGKSSDSSEES  120

Query  456  dnsskrkrkNQYRGIRQRPWGKWAAEIRDPSKGVRVWLGTFDTAEEAARAYDIEARRIRG  635
            +  SKRKRKNQYRGIRQRPWGKWAAEIRDP KGVRVWLGTF+TAEEAARAYD EARRIRG
Sbjct  121  EKYSKRKRKNQYRGIRQRPWGKWAAEIRDPRKGVRVWLGTFNTAEEAARAYDTEARRIRG  180

Query  636  KKAKVNFPDDA  668
            KKAKVNFPD+ 
Sbjct  181  KKAKVNFPDET  191



>ref|XP_009604966.1| PREDICTED: ethylene-responsive transcription factor RAP2-2-like 
[Nicotiana tomentosiformis]
Length=395

 Score =   195 bits (495),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 118/188 (63%), Positives = 128/188 (68%), Gaps = 16/188 (9%)
 Frame = +3

Query  150  MCGGAIISDFKPPSRSSRRLTADLLWGRADLsggkkksnssgshyskPLRSEVVVLD-DD  326
            MCGGAIISD  PP RSSRRLTADLLWG +DL+  K   N   S    PLRSEV  LD DD
Sbjct  1    MCGGAIISDCIPPPRSSRRLTADLLWGCSDLNQKKNPFNYQYSK---PLRSEVADLDYDD  57

Query  327  FEADFQDFKDHSYSQVDA------KPFA-FSASHRPGFssgpdsdsskdadnsskrkrk-  482
            FEADFQ FKD +    DA      K FA FSAS + G +            +    K   
Sbjct  58   FEADFQVFKDCTDDDEDAYKVDGLKSFAAFSASEQSGGTCDGSKSLKSVDSDKEVEKSSK  117

Query  483  ----NQYRGIRQRPWGKWAAEIRDPSKGVRVWLGTFDTAEEAARAYDIEARRIRGKKAKV  650
                NQYRGIRQRPWGKWAAEIRDP KGVRVWLGTF+TAEEAARAYD+EARRIRGKKAKV
Sbjct  118  RKRKNQYRGIRQRPWGKWAAEIRDPQKGVRVWLGTFNTAEEAARAYDVEARRIRGKKAKV  177

Query  651  NFPDDAPL  674
            NFPD+AP+
Sbjct  178  NFPDEAPV  185



>ref|XP_006357425.1| PREDICTED: ethylene-responsive transcription factor RAP2-12-like 
[Solanum tuberosum]
 gb|AGW43027.1| ethylene responsive factor 1 [Solanum tuberosum]
Length=372

 Score =   194 bits (493),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 118/176 (67%), Positives = 135/176 (77%), Gaps = 11/176 (6%)
 Frame = +3

Query  150  MCGGAIISDFKPPSRSSRRLTADLLWGRADLsggkkksnssgshyskPLRSEVVVLDDDF  329
            MCGGAIISD  PPSR SRRLTAD LWG +DL+  KK  ++  S    PLRS+ + L+D+F
Sbjct  1    MCGGAIISDLVPPSRISRRLTADFLWGASDLNNKKKNPSNYHSK---PLRSKFIDLEDEF  57

Query  330  EADFQDFKDHSYSQVDAKPFAFSASHRPGFssgpdsdsskdadnsskrkrkNQYRGIRQR  509
            EADFQ FKD+S    D K F        G  S    DS+ DAD SSKRKRKNQYRGIRQR
Sbjct  58   EADFQHFKDYSDDDEDVKAF--------GSKSVRSVDSNCDADRSSKRKRKNQYRGIRQR  109

Query  510  PWGKWAAEIRDPSKGVRVWLGTFDTAEEAARAYDIEARRIRGKKAKVNFPDDAPLT  677
            PWGKWAAEIRDP KG+RVWLGTF++AEEAARAYD+EARRIRGKKAKVNFPD+AP++
Sbjct  110  PWGKWAAEIRDPRKGIRVWLGTFNSAEEAARAYDVEARRIRGKKAKVNFPDEAPVS  165



>gb|EYU21280.1| hypothetical protein MIMGU_mgv1a008553mg [Erythranthe guttata]
Length=370

 Score =   193 bits (491),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 128/184 (70%), Positives = 141/184 (77%), Gaps = 13/184 (7%)
 Frame = +3

Query  150  MCGGAIISDF-KPPSRSSRRLTADLLWGR--ADLsggkkksnssgshyskPLRSEVVV-L  317
            MCGGAIISDF  P SR+SRRLTADLLWG   ADL+  KK   S  S    PLRS+ +V L
Sbjct  1    MCGGAIISDFVAPASRTSRRLTADLLWGSGSADLNKRKKNPVSYHSK---PLRSKPIVDL  57

Query  318  DDDFEADFQDFKDHS--YSQVDAK-PFAFSASHRP---GFssgpdsdsskdadnsskrkr  479
            DDDFEADFQ FKD+S    +V+ K PFA SAS      G  +   +DS  +AD SSKRKR
Sbjct  58   DDDFEADFQHFKDYSDDEGEVNVKTPFALSASENSDFKGMKATESADSDDEADKSSKRKR  117

Query  480  kNQYRGIRQRPWGKWAAEIRDPSKGVRVWLGTFDTAEEAARAYDIEARRIRGKKAKVNFP  659
            KNQYRGIRQRPWGKWAAEIRDPSKGVRVWLGTF+TAEEAARAYD EARRIRG KAKVNFP
Sbjct  118  KNQYRGIRQRPWGKWAAEIRDPSKGVRVWLGTFNTAEEAARAYDTEARRIRGSKAKVNFP  177

Query  660  DDAP  671
            ++AP
Sbjct  178  EEAP  181



>ref|NP_001234513.1| transcription factor JERF1 [Solanum lycopersicum]
 gb|AAK95687.1| transcription factor JERF1 [Solanum lycopersicum]
Length=372

 Score =   191 bits (486),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 118/176 (67%), Positives = 135/176 (77%), Gaps = 11/176 (6%)
 Frame = +3

Query  150  MCGGAIISDFKPPSRSSRRLTADLLWGRADLsggkkksnssgshyskPLRSEVVVLDDDF  329
            MCGGAIISD  PPSR SRRLTAD LWG +DL+  KK  ++  S    PLRS+ + L+D+F
Sbjct  1    MCGGAIISDLVPPSRISRRLTADFLWGTSDLNKKKKNPSNYHSK---PLRSKFIDLEDEF  57

Query  330  EADFQDFKDHSYSQVDAKPFAFSASHRPGFssgpdsdsskdadnsskrkrkNQYRGIRQR  509
            EADFQ FKD+S    D K F    S R G       DS+ +AD SSKRKRKNQYRGIRQR
Sbjct  58   EADFQHFKDNSDDDDDVKAFG-PKSVRSG-------DSNCEADRSSKRKRKNQYRGIRQR  109

Query  510  PWGKWAAEIRDPSKGVRVWLGTFDTAEEAARAYDIEARRIRGKKAKVNFPDDAPLT  677
            PWGKWAAEIRDP KG+RVWLGTF++AEEAARAYD EARRIRGKKAKVNFPD+AP++
Sbjct  110  PWGKWAAEIRDPRKGIRVWLGTFNSAEEAARAYDAEARRIRGKKAKVNFPDEAPVS  165



>ref|XP_011072679.1| PREDICTED: ethylene-responsive transcription factor RAP2-12-like 
[Sesamum indicum]
Length=393

 Score =   191 bits (486),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 122/182 (67%), Positives = 138/182 (76%), Gaps = 10/182 (5%)
 Frame = +3

Query  150  MCGGAIISDF-KPPSRSSRRLTADLLWGRADLsggkkksnssgshyskPLRSEVVV-LDD  323
            MCGGAIISD   P SRSSRRLTADLLWG   +   KKK+  +      P+RS+ V+ LDD
Sbjct  1    MCGGAIISDIIAPASRSSRRLTADLLWGSGSVDLYKKKNPGNYHSK--PMRSQPVIDLDD  58

Query  324  DFEADFQDFKDHS--YSQVDAK-PFAFSASHRPGFssgpdsdsskd---adnsskrkrkN  485
            DFEADFQ+FKD S    ++D K PF+FSAS  PG      +DS++    A+ SSKRKRKN
Sbjct  59   DFEADFQEFKDFSDDEGEIDVKKPFSFSASKNPGLKGLKSADSAEYDDDAEKSSKRKRKN  118

Query  486  QYRGIRQRPWGKWAAEIRDPSKGVRVWLGTFDTAEEAARAYDIEARRIRGKKAKVNFPDD  665
            QYRGIRQRPWGKWAAEIRDP KGVRVWLGTF+TAEEAARAYD EARRIRGKKAKVNFP+ 
Sbjct  119  QYRGIRQRPWGKWAAEIRDPRKGVRVWLGTFNTAEEAARAYDTEARRIRGKKAKVNFPEY  178

Query  666  AP  671
             P
Sbjct  179  VP  180



>gb|AHB33877.1| ERF transcription factor 06 [Coffea arabica]
Length=303

 Score =   187 bits (475),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 120/187 (64%), Positives = 137/187 (73%), Gaps = 11/187 (6%)
 Frame = +3

Query  150  MCGGAIISDFKPPSRSSRRLTADLLWG---RADL--sggkkksnssgshyskPLRSEVVV  314
            MCGGAIISD+  PSRSS RL+ADLLWG     DL  S   KK  S+ + YSK LRSE++ 
Sbjct  1    MCGGAIISDYIQPSRSSHRLSADLLWGIGGSGDLPDSKDIKKKKSTSNFYSKQLRSEIID  60

Query  315  LDDDFEADFQDFKDHSYSQV-DAKPFAFSASHRP-----GFssgpdsdsskdadnsskrk  476
            LDD+FEADF++F D +  ++ D KPF FSAS        G   G  SDSS ++    KRK
Sbjct  61   LDDEFEADFREFSDQAVEELEDVKPFGFSASKHSAILSRGTKCGNSSDSSDESGKYLKRK  120

Query  477  rkNQYRGIRQRPWGKWAAEIRDPSKGVRVWLGTFDTAEEAARAYDIEARRIRGKKAKVNF  656
            RKN YRGIRQRPWGKWAAEIRDP KGVRVWLGTF+TAE AARAYD EARRIRGKKAK+NF
Sbjct  121  RKNHYRGIRQRPWGKWAAEIRDPRKGVRVWLGTFNTAEAAARAYDTEARRIRGKKAKLNF  180

Query  657  PDDAPLT  677
            PDD  L+
Sbjct  181  PDDTQLS  187



>gb|ADP37418.1| ethylene-responsive-element-binding factor 3 [Petunia x hybrida]
Length=363

 Score =   188 bits (478),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 110/177 (62%), Positives = 127/177 (72%), Gaps = 20/177 (11%)
 Frame = +3

Query  150  MCGGAIISDFKPPSRSSRRLTADLLWGRADLsggkkksnssgshyskPLRSEVVV-LDDD  326
            MCGGAIISD  PPSR+SRRLTADLLWG +DL       +S       PLRS   + LDD+
Sbjct  1    MCGGAIISDLVPPSRTSRRLTADLLWGSSDLKKNPSNYHSK------PLRSSKFIDLDDE  54

Query  327  FEADFQDFKDHSYSQVDAKPFAFSASHRPGFssgpdsdsskdadnsskrkrkNQYRGIRQ  506
            FEADFQDF D      D KPF   +             + ++AD SSKRKR+NQYRGIRQ
Sbjct  55   FEADFQDFSD------DIKPFGSKS-------VKSADANCEEADKSSKRKRRNQYRGIRQ  101

Query  507  RPWGKWAAEIRDPSKGVRVWLGTFDTAEEAARAYDIEARRIRGKKAKVNFPDDAPLT  677
            RPWGKWAAEIRDP KG+RVWLGTF++AEEAARAYD+EARRIRG KAKVNFPD+ P++
Sbjct  102  RPWGKWAAEIRDPRKGIRVWLGTFNSAEEAARAYDVEARRIRGNKAKVNFPDETPVS  158



>emb|CDP15674.1| unnamed protein product [Coffea canephora]
Length=334

 Score =   186 bits (473),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 118/187 (63%), Positives = 137/187 (73%), Gaps = 11/187 (6%)
 Frame = +3

Query  150  MCGGAIISDFKPPSRSSRRLTADLLWG---RADL--sggkkksnssgshyskPLRSEVVV  314
            MCGGAIISD+  PSRSS RL+ADLLWG     DL  S   KK  ++ + Y+K LRSE++ 
Sbjct  1    MCGGAIISDYIQPSRSSHRLSADLLWGIGGSGDLPDSKDIKKKKNTSNFYTKQLRSEIID  60

Query  315  LDDDFEADFQDFKDHSYSQV-DAKPFAFSASHRP-----GFssgpdsdsskdadnsskrk  476
            LDD+FEADF++F D +  ++ D KPF FSAS        G   G  SDSS ++    KRK
Sbjct  61   LDDEFEADFREFSDQAVEELEDVKPFGFSASKHSAILSRGTKCGNSSDSSDESGKYLKRK  120

Query  477  rkNQYRGIRQRPWGKWAAEIRDPSKGVRVWLGTFDTAEEAARAYDIEARRIRGKKAKVNF  656
            RKN YRGIRQRPWGKWAAEIRDP KGVRVWLGTF+TAE AARAYD EARRIRGKKAK+NF
Sbjct  121  RKNHYRGIRQRPWGKWAAEIRDPRKGVRVWLGTFNTAEAAARAYDTEARRIRGKKAKLNF  180

Query  657  PDDAPLT  677
            PDD  L+
Sbjct  181  PDDTQLS  187



>ref|XP_004252402.1| PREDICTED: ethylene-responsive transcription factor RAP2-12 [Solanum 
lycopersicum]
Length=386

 Score =   187 bits (474),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 118/186 (63%), Positives = 131/186 (70%), Gaps = 16/186 (9%)
 Frame = +3

Query  150  MCGGAIISDFKPPSRSSRRLTADLLWGRADLsggkkksnssgshyskP--LRSEVVVLDD  323
            MCGGAIISD+ PPSRSS RLTAD LWG ADL   K+              LRSE V    
Sbjct  1    MCGGAIISDWIPPSRSSSRLTADQLWGCADLQNKKRNKKKRNPSNYHSKRLRSENV----  56

Query  324  DFEADFQDFKDHS-----YSQVDAKPFAFSASHRPGFssgpdsdsskdadnsskrkrk--  482
            DFEADFQDFKD S     YS +D KPFAFSAS   G S+G +S  S DA+   ++  K  
Sbjct  57   DFEADFQDFKDFSDDEEAYS-LDIKPFAFSASELSGTSAGSESLISVDANKEVEKSAKRQ  115

Query  483  --NQYRGIRQRPWGKWAAEIRDPSKGVRVWLGTFDTAEEAARAYDIEARRIRGKKAKVNF  656
              NQYRGIR+RPWGKWAAEIRDP KGVRVW+GTF+TAEEAARAYD EARRIRG KAKVNF
Sbjct  116  RKNQYRGIRKRPWGKWAAEIRDPQKGVRVWIGTFNTAEEAARAYDAEARRIRGNKAKVNF  175

Query  657  PDDAPL  674
            PD+A +
Sbjct  176  PDEASV  181



>gb|AAP72289.1| PF1 [Capsicum annuum]
Length=369

 Score =   186 bits (473),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 120/178 (67%), Positives = 137/178 (77%), Gaps = 13/178 (7%)
 Frame = +3

Query  150  MCGGAIISDFKPPSRSSRRLTADLLWGRADLsggkkksnssgshyskPL-RSEVVVLDDD  326
            MCGGAIISD  PPSR SRRLTA+LLWG +DLS  KK   +  S    PL RS+ + LD++
Sbjct  1    MCGGAIISDLVPPSRISRRLTAELLWGNSDLSKKKKNPGNYYSK---PLNRSKFIDLDEE  57

Query  327  FEADFQDFKDHSYSQVDA-KPFAFSASHRPGFssgpdsdsskdadnsskrkrkNQYRGIR  503
            FEADFQDFKD++   VD  KPF  S S + G       DSS D + SSKRKRKNQYRGIR
Sbjct  58   FEADFQDFKDYADDDVDDVKPFG-SKSVKSG-------DSSCDTEKSSKRKRKNQYRGIR  109

Query  504  QRPWGKWAAEIRDPSKGVRVWLGTFDTAEEAARAYDIEARRIRGKKAKVNFPDDAPLT  677
            QRPWGKWAAEIRDP KG+RVWLGTF++AEEAARAYD+EARRIRGKKAKVNFPD +P +
Sbjct  110  QRPWGKWAAEIRDPRKGIRVWLGTFNSAEEAARAYDVEARRIRGKKAKVNFPDGSPAS  167



>gb|ABD65407.1| putative ethylene-responsive element binding protein [Capsicum 
annuum]
Length=375

 Score =   186 bits (472),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 120/178 (67%), Positives = 137/178 (77%), Gaps = 13/178 (7%)
 Frame = +3

Query  150  MCGGAIISDFKPPSRSSRRLTADLLWGRADLsggkkksnssgshyskPL-RSEVVVLDDD  326
            MCGGAIISD  PPSR SRRLTA+LLWG +DLS  KK   +  S    PL RS+ + LD++
Sbjct  1    MCGGAIISDLVPPSRISRRLTAELLWGNSDLSKKKKNPGNYYSK---PLNRSKFIDLDEE  57

Query  327  FEADFQDFKDHSYSQVDA-KPFAFSASHRPGFssgpdsdsskdadnsskrkrkNQYRGIR  503
            FEADFQDFKD++   VD  KPF  S S + G       DSS D + SSKRKRKNQYRGIR
Sbjct  58   FEADFQDFKDYADDDVDDVKPFG-SKSVKSG-------DSSCDTEKSSKRKRKNQYRGIR  109

Query  504  QRPWGKWAAEIRDPSKGVRVWLGTFDTAEEAARAYDIEARRIRGKKAKVNFPDDAPLT  677
            QRPWGKWAAEIRDP KG+RVWLGTF++AEEAARAYD+EARRIRGKKAKVNFPD +P +
Sbjct  110  QRPWGKWAAEIRDPRKGIRVWLGTFNSAEEAARAYDVEARRIRGKKAKVNFPDGSPAS  167



>ref|NP_001280975.1| ethylene-responsive transcription factor RAP2-12-like [Malus 
domestica]
 gb|ADE41148.1| AP2 domain class transcription factor [Malus domestica]
Length=386

 Score =   186 bits (471),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 119/184 (65%), Positives = 131/184 (71%), Gaps = 18/184 (10%)
 Frame = +3

Query  150  MCGGAIISDFKPPSRSSRRLTADLLWGRADLsggkkksnssgshyskPLRSEVVVLDDDF  329
            MCGGAIISDF  P RS RRLTAD LW   DL         S      PL+SE+V LDDDF
Sbjct  1    MCGGAIISDFIAPVRS-RRLTADYLW--PDLKKPSSGKRLSK-----PLKSEIVDLDDDF  52

Query  330  EADFQDFKDHSY-----SQVDAKPFAFSASHRPGFssgpdsdssk----dadnsskrkrk  482
            EADFQ+FKD S        VD+KP AFSA + P F+ G  +  S      A+ S+KRKRK
Sbjct  53   EADFQEFKDESDVGEDDEMVDSKPSAFSAGN-PSFARGSTAVKSVEFDGQAEKSAKRKRK  111

Query  483  NQYRGIRQRPWGKWAAEIRDPSKGVRVWLGTFDTAEEAARAYDIEARRIRGKKAKVNFPD  662
            NQYRGIRQRPWGKWAAEIRDP KGVRVWLGTF+TAEEAARAYD EARRIRGKKAKVNFP+
Sbjct  112  NQYRGIRQRPWGKWAAEIRDPRKGVRVWLGTFNTAEEAARAYDAEARRIRGKKAKVNFPE  171

Query  663  DAPL  674
            + P 
Sbjct  172  ETPC  175



>gb|AHA93906.1| ethylene response factor 3, partial [Coffea arabica]
Length=387

 Score =   184 bits (468),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 115/187 (61%), Positives = 132/187 (71%), Gaps = 11/187 (6%)
 Frame = +3

Query  150  MCGGAIISDFKPPSRSSRRLTADLLWG---RADLsggkkksnssgshy--skPLRSEVVV  314
            MCGGAIISD+  PSRSS RL+ADLLWG     DL   K       +    SK LRSE++ 
Sbjct  1    MCGGAIISDYIQPSRSSHRLSADLLWGIGGSGDLPDSKDIKKKKSTSNFYSKQLRSEIID  60

Query  315  LDDDFEADFQDFKDHSYSQV-DAKPFAFSASHRP-----GFssgpdsdsskdadnsskrk  476
            LDD+FEADF++F D +  ++ D KPF FSAS        G   G  SDSS ++    KRK
Sbjct  61   LDDEFEADFREFSDQAVEELEDVKPFGFSASKHSAILSRGTKCGNSSDSSDESGKYLKRK  120

Query  477  rkNQYRGIRQRPWGKWAAEIRDPSKGVRVWLGTFDTAEEAARAYDIEARRIRGKKAKVNF  656
            RKN YRGIRQRPWGKWAAEIRDP KGVRVWLGTF+TAE AARAYD EARRIRGKKAK+NF
Sbjct  121  RKNHYRGIRQRPWGKWAAEIRDPRKGVRVWLGTFNTAEAAARAYDTEARRIRGKKAKLNF  180

Query  657  PDDAPLT  677
            PD+  L+
Sbjct  181  PDETQLS  187



>gb|EPS68207.1| hypothetical protein M569_06565 [Genlisea aurea]
Length=402

 Score =   183 bits (465),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 123/182 (68%), Positives = 139/182 (76%), Gaps = 9/182 (5%)
 Frame = +3

Query  150  MCGGAIISDFKPP-SRSSRRLTADLLWGRADLsggkkksnssgshyskPLRSEVVV-LDD  323
            MCGGAIISD  PP S SSRRLTADLLWG  D +   +K  S G++ SKP R+  V+ LD+
Sbjct  1    MCGGAIISDLIPPTSVSSRRLTADLLWG-TDAASHFRKKKSPGNYGSKPARNHPVIDLDE  59

Query  324  DFEADFQDFKDHS--YSQVDAK-PFAF---SASHRPGFssgpdsdsskdadnsskrkrkN  485
            DFEADFQDFKDHS    +++AK PF      +S   G  S   +DS +D D SSKRKRKN
Sbjct  60   DFEADFQDFKDHSDAEDEINAKRPFGLVPPKSSTFTGLRSHDSADSDEDCDKSSKRKRKN  119

Query  486  QYRGIRQRPWGKWAAEIRDPSKGVRVWLGTFDTAEEAARAYDIEARRIRGKKAKVNFPDD  665
            QYRGIRQRPWGKWAAEIRDP KGVRVWLGTF+TAEEAARAYD EAR+IRGKKAKVNFP+D
Sbjct  120  QYRGIRQRPWGKWAAEIRDPRKGVRVWLGTFNTAEEAARAYDEEARKIRGKKAKVNFPED  179

Query  666  AP  671
             P
Sbjct  180  CP  181



>gb|ABB51574.1| ethylene-responsive element binding protein [Capsicum annuum]
Length=167

 Score =   176 bits (446),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 117/176 (66%), Positives = 134/176 (76%), Gaps = 13/176 (7%)
 Frame = +3

Query  156  GGAIISDFKPPSRSSRRLTADLLWGRADLsggkkksnssgshyskPL-RSEVVVLDDDFE  332
            GGAIISD  PPSR SRRLTA+LLWG +DLS  KK   +  S    PL RS+ + LD++FE
Sbjct  1    GGAIISDLVPPSRISRRLTAELLWGNSDLSKKKKNPGNYYSK---PLNRSKFIDLDEEFE  57

Query  333  ADFQDFKDHSYSQVDA-KPFAFSASHRPGFssgpdsdsskdadnsskrkrkNQYRGIRQR  509
            ADFQ FKD++   VD  KPF  S S + G       DSS D + SSKRKRKNQYRGIRQR
Sbjct  58   ADFQAFKDYADDDVDDVKPFG-SKSVKSG-------DSSCDTEKSSKRKRKNQYRGIRQR  109

Query  510  PWGKWAAEIRDPSKGVRVWLGTFDTAEEAARAYDIEARRIRGKKAKVNFPDDAPLT  677
            PWGKWAAEIRDP KG+RVWLGTF++AEEAARAYD+EARRIRGKKAKVNFPD +P +
Sbjct  110  PWGKWAAEIRDPRKGIRVWLGTFNSAEEAARAYDVEARRIRGKKAKVNFPDGSPAS  165



>gb|AGE92355.1| ethylene response factor 1 [Ipomoea batatas]
Length=353

 Score =   182 bits (461),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 105/175 (60%), Positives = 117/175 (67%), Gaps = 12/175 (7%)
 Frame = +3

Query  150  MCGGAIISDFKPPSRSSRRLTADLLWGRADLsggkkksnssgshyskP--LRSEVVVLDD  323
            MCGGAIISD KPP+R+SRRLT++LLWG AD S    K   + +       LRS    LD+
Sbjct  1    MCGGAIISDIKPPARTSRRLTSELLWGSADRSSAGGKKKKNFAGSYYSGGLRSAAFDLDN  60

Query  324  DFEADFQDFKDH---SYSQVDAKPFAFSASHRPGFssgpdsdsskdadnsskrkrkNQYR  494
            + EADFQDF D+      ++D KPF F  S   GFSS                   NQYR
Sbjct  61   ECEADFQDFNDYDDDEGVELDVKPFPFGLSS--GFSSDSKDFDQSMKRKRK-----NQYR  113

Query  495  GIRQRPWGKWAAEIRDPSKGVRVWLGTFDTAEEAARAYDIEARRIRGKKAKVNFP  659
            GIRQRPWGKWAAEIRDPSKGVRVWLGTFDTAEEAARAYD EARRIRG KAK+NFP
Sbjct  114  GIRQRPWGKWAAEIRDPSKGVRVWLGTFDTAEEAARAYDTEARRIRGNKAKLNFP  168



>ref|XP_011467483.1| PREDICTED: ethylene-responsive transcription factor RAP2-12-like 
[Fragaria vesca subsp. vesca]
 ref|XP_011467484.1| PREDICTED: ethylene-responsive transcription factor RAP2-12-like 
[Fragaria vesca subsp. vesca]
 ref|XP_011467485.1| PREDICTED: ethylene-responsive transcription factor RAP2-12-like 
[Fragaria vesca subsp. vesca]
Length=391

 Score =   182 bits (461),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 116/183 (63%), Positives = 129/183 (70%), Gaps = 14/183 (8%)
 Frame = +3

Query  150  MCGGAIISDFKPPSRSSRRLTADLLWGRADLsggkkksnssgshyskPLRSEVVVLDDDF  329
            MCGGAIIS F PP+RS RR+TAD LW   DL         S      PLRSE+  LDDDF
Sbjct  1    MCGGAIISGFIPPTRS-RRVTADFLW--PDLKKSSSGKRFSSGGR--PLRSEIFGLDDDF  55

Query  330  EADFQDFKDHSYSQVD-----AKPFAFSASHRP----GFssgpdsdsskdadnsskrkrk  482
            EADFQ+FKD S    D     +KPFAFSA        G  +    + +  A+ S+KRKRK
Sbjct  56   EADFQEFKDDSDVDDDEDMLDSKPFAFSAGKPSPAARGPKTVKSVECNSQAEKSAKRKRK  115

Query  483  NQYRGIRQRPWGKWAAEIRDPSKGVRVWLGTFDTAEEAARAYDIEARRIRGKKAKVNFPD  662
            NQYRGIRQRPWGKWAAEIRDP KGVRVWLGTF+TAEEAARAYD EARRIRGKKAKVNFP+
Sbjct  116  NQYRGIRQRPWGKWAAEIRDPRKGVRVWLGTFNTAEEAARAYDAEARRIRGKKAKVNFPE  175

Query  663  DAP  671
            +AP
Sbjct  176  EAP  178



>gb|ADJ67434.1| ethylene response factor 5 [Actinidia deliciosa]
Length=382

 Score =   181 bits (458),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 110/178 (62%), Positives = 130/178 (73%), Gaps = 12/178 (7%)
 Frame = +3

Query  150  MCGGAIISDFKPPSRSSRRLTADLLWGRADLsggkkksnssgshyskPLRSEVVVLDDDF  329
            MCGGAIISDF  P+R+ RRL  +LLW             +  +++SKPLRSE+V LDDDF
Sbjct  1    MCGGAIISDFIAPTRN-RRLIENLLW-------PSDVKKNHSNYHSKPLRSEIVDLDDDF  52

Query  330  EADFQDFKDHSYSQ-VDAKPFAFSASHR---PGFssgpdsdsskdadnsskrkrkNQYRG  497
            EADFQDFKD + ++  D K F FSAS      G  S    + +   + ++KRKRKNQYRG
Sbjct  53   EADFQDFKDDTDAEDNDFKSFVFSASKSGVSDGSRSTKSVELNGQTEKTAKRKRKNQYRG  112

Query  498  IRQRPWGKWAAEIRDPSKGVRVWLGTFDTAEEAARAYDIEARRIRGKKAKVNFPDDAP  671
            IRQRPWGKWAAEIRDP KGVRVWLGTF+TAEEAA AYD EAR+IRG+KAKVNFPD+AP
Sbjct  113  IRQRPWGKWAAEIRDPRKGVRVWLGTFNTAEEAAIAYDAEARKIRGRKAKVNFPDEAP  170



>gb|ABP35524.1| AP2/EREBP-type transcription factor [Ipomoea batatas]
Length=353

 Score =   179 bits (454),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 103/175 (59%), Positives = 115/175 (66%), Gaps = 12/175 (7%)
 Frame = +3

Query  150  MCGGAIISDFKPPSRSSRRLTADLLWGRADLsggkkksnssgshyskP--LRSEVVVLDD  323
            MCGGAIISD KPP R+SRRLT++LLWG AD S    K   + +       LRS    LD+
Sbjct  1    MCGGAIISDIKPPVRTSRRLTSELLWGSADRSSAGGKKKKNFAGSYYSGGLRSAAFDLDN  60

Query  324  DFEADFQDFKDH---SYSQVDAKPFAFSASHRPGFssgpdsdsskdadnsskrkrkNQYR  494
            + +ADFQDF D+      ++D KPFAF  S   GF S                   NQYR
Sbjct  61   ELKADFQDFNDYDDDEGVELDVKPFAFGLSS--GFGSKSKDFDQSMKRKRK-----NQYR  113

Query  495  GIRQRPWGKWAAEIRDPSKGVRVWLGTFDTAEEAARAYDIEARRIRGKKAKVNFP  659
            GIRQRPWGKWAAEIRDPSKGVRVWLGTFDTAEEAA AYD EARRIRG KAK+NFP
Sbjct  114  GIRQRPWGKWAAEIRDPSKGVRVWLGTFDTAEEAAGAYDTEARRIRGNKAKLNFP  168



>gb|EYU45910.1| hypothetical protein MIMGU_mgv1a009975mg [Erythranthe guttata]
Length=325

 Score =   178 bits (451),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 109/180 (61%), Positives = 136/180 (76%), Gaps = 9/180 (5%)
 Frame = +3

Query  150  MCGGAIISDFKPPSRSSRRLTADLLWGRADLsggk--kksnssgshyskPL-RSEVVVLD  320
            MCGGAIISD  PP+ SSRRLTADLLWG A  +      K  ++G+++SKPL   +   L 
Sbjct  1    MCGGAIISDVAPPA-SSRRLTADLLWGSAAAAAAADLNKKKNTGNYHSKPLIYQKKFHLY  59

Query  321  DDFEADFQDFKDHSYSQVDAKPFAFSASHRPGFssgpdsdsskdadnsskrkr-kNQYRG  497
            +DFEADFQDF++ + +    K F+FSAS  P F      DS++  +  S +++ KN+YRG
Sbjct  60   EDFEADFQDFQESTVT----KAFSFSASENPDFKGLKSVDSAESHEEKSTKRKRKNEYRG  115

Query  498  IRQRPWGKWAAEIRDPSKGVRVWLGTFDTAEEAARAYDIEARRIRGKKAKVNFPDDAPLT  677
            IRQRPWGKWAAEIRDPSKGVRVWLGTF+TAEEAARAYD EAR+IRGKKAK+NFP+D+PL+
Sbjct  116  IRQRPWGKWAAEIRDPSKGVRVWLGTFNTAEEAARAYDSEARKIRGKKAKLNFPEDSPLS  175



>ref|NP_001280911.1| ethylene-responsive transcription factor RAP2-12-like [Malus 
domestica]
 ref|XP_008340186.1| PREDICTED: ethylene-responsive transcription factor RAP2-12-like 
[Malus domestica]
 gb|ADE41104.1| AP2 domain class transcription factor [Malus domestica]
Length=387

 Score =   179 bits (455),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 116/182 (64%), Positives = 128/182 (70%), Gaps = 15/182 (8%)
 Frame = +3

Query  150  MCGGAIISDFKPPSRSSRRLTADLLWGRADLsggkkksnssgshyskPLRSEVVVLDDDF  329
            MCGGAIISDF  P+  SRRLTAD LW   DL         S      PLRSE+V LDDDF
Sbjct  1    MCGGAIISDFIAPAARSRRLTADYLW--PDLKKPSSGKRFSK-----PLRSEIVDLDDDF  53

Query  330  EADFQDFKDHSYSQVDA-----KPFAFSA---SHRPGFssgpdsdsskdadnsskrkrkN  485
            EADFQ+FKD S    D      KP AFSA   S   G ++    + +  A+ S+KRKRKN
Sbjct  54   EADFQEFKDESDVDEDDEMVDFKPSAFSAGKPSSARGSTAVKSVEFNGQAEKSAKRKRKN  113

Query  486  QYRGIRQRPWGKWAAEIRDPSKGVRVWLGTFDTAEEAARAYDIEARRIRGKKAKVNFPDD  665
            QYRGIRQRPWGKWAAEIRDP KGVRVWLGTF+TAEEAARAYD EARRIRGKKAKVNFP++
Sbjct  114  QYRGIRQRPWGKWAAEIRDPRKGVRVWLGTFNTAEEAARAYDAEARRIRGKKAKVNFPEE  173

Query  666  AP  671
             P
Sbjct  174  TP  175



>ref|XP_012068805.1| PREDICTED: ethylene-responsive transcription factor RAP2-12-like 
[Jatropha curcas]
 ref|XP_012068806.1| PREDICTED: ethylene-responsive transcription factor RAP2-12-like 
[Jatropha curcas]
 gb|AEJ87198.1| ethylene-responsive transcription factor [Jatropha curcas]
 gb|KDP40641.1| hypothetical protein JCGZ_24640 [Jatropha curcas]
Length=385

 Score =   179 bits (455),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 116/192 (60%), Positives = 131/192 (68%), Gaps = 30/192 (16%)
 Frame = +3

Query  150  MCGGAIISDFKPPS---RSSRRLTADLLWGRADLsggkkksnssgshyskPLRSEVVVLD  320
            MCGGAIISDF PP+   RSSRRLTAD LW   DL     K               VV LD
Sbjct  1    MCGGAIISDFIPPAVAGRSSRRLTADFLW--PDLKKPIGKQ----------YSKPVVDLD  48

Query  321  DDFEADFQDFKDHSYS------QVDAKPFAFSASHRP---------GFssgpdsdsskda  455
            +DFEADFQ+FKD S +       +D KPFAFSA+  P         G ++    + +  A
Sbjct  49   NDFEADFQEFKDESDADEEDDVMLDVKPFAFSATASPPARNRSSSRGSAAVKSVEFNGQA  108

Query  456  dnsskrkrkNQYRGIRQRPWGKWAAEIRDPSKGVRVWLGTFDTAEEAARAYDIEARRIRG  635
            + S+KRKRKNQYRGIRQRPWGKWAAEIRDP KGVRVWLGTF+TAEEAARAYD EARRIRG
Sbjct  109  EKSAKRKRKNQYRGIRQRPWGKWAAEIRDPRKGVRVWLGTFNTAEEAARAYDAEARRIRG  168

Query  636  KKAKVNFPDDAP  671
            KKAKVNFP++AP
Sbjct  169  KKAKVNFPEEAP  180



>ref|XP_007139068.1| hypothetical protein PHAVU_009G262200g [Phaseolus vulgaris]
 gb|ESW11062.1| hypothetical protein PHAVU_009G262200g [Phaseolus vulgaris]
Length=355

 Score =   179 bits (453),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 105/179 (59%), Positives = 122/179 (68%), Gaps = 24/179 (13%)
 Frame = +3

Query  150  MCGGAIISDFKPPSRS--SRRLTADLLWGRADLsggkkksnssgshyskPLRSEVVVLDD  323
            MCGGAIISDF P + +  SRR+TAD LW   DL                   S+V+  DD
Sbjct  1    MCGGAIISDFIPAAVTARSRRVTADYLW--LDLKKRA---------------SQVIHSDD  43

Query  324  DFEADFQDFKDHSYSQVD--AKPFAFSASHRPGFssgpdsdsskdadnsskrkrkNQYRG  497
            DFEADF++FKD S S  D   KPFAFSAS RP   S   +  ++ +    ++   NQYRG
Sbjct  44   DFEADFRNFKDDSDSDADHQVKPFAFSASSRPAVKSVAFNGGAEKSAKRKRK---NQYRG  100

Query  498  IRQRPWGKWAAEIRDPSKGVRVWLGTFDTAEEAARAYDIEARRIRGKKAKVNFPDDAPL  674
            IRQRPWGKWAAEIRDP KGVRVWLGTF+TAEEAARAYD EARRIRGKKAKVNFP++A +
Sbjct  101  IRQRPWGKWAAEIRDPRKGVRVWLGTFNTAEEAARAYDAEARRIRGKKAKVNFPEEASV  159



>ref|XP_009338318.1| PREDICTED: ethylene-responsive transcription factor RAP2-12-like 
[Pyrus x bretschneideri]
 ref|XP_009338319.1| PREDICTED: ethylene-responsive transcription factor RAP2-12-like 
[Pyrus x bretschneideri]
Length=386

 Score =   179 bits (454),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 117/182 (64%), Positives = 129/182 (71%), Gaps = 16/182 (9%)
 Frame = +3

Query  150  MCGGAIISDFKPPSRSSRRLTADLLWGRADLsggkkksnssgshyskPLRSEVVVLDDDF  329
            MCGGAIISDF  P RS RRLTAD LW   DL         S      PLRSE+V LDDDF
Sbjct  1    MCGGAIISDFIAPVRS-RRLTADYLW--PDLKNPSSGKRLSK-----PLRSEIVDLDDDF  52

Query  330  EADFQDFKDHSYSQVD-----AKPFAFSA---SHRPGFssgpdsdsskdadnsskrkrkN  485
            EADFQ+FKD S    D     +KP AFSA   S   G ++    + +  A+ S+KRKRKN
Sbjct  53   EADFQEFKDESDVDEDDEMVDSKPSAFSAGKPSSARGSTAVKSVEFNGQAEKSAKRKRKN  112

Query  486  QYRGIRQRPWGKWAAEIRDPSKGVRVWLGTFDTAEEAARAYDIEARRIRGKKAKVNFPDD  665
            QYRGIRQRPWGKWAAEIRDP KGVRVWLGTF+TAEEAARAYD EARRIRGKKAKVNFP++
Sbjct  113  QYRGIRQRPWGKWAAEIRDPRKGVRVWLGTFNTAEEAARAYDAEARRIRGKKAKVNFPEE  172

Query  666  AP  671
             P
Sbjct  173  TP  174



>gb|ACM49847.1| ethylene responsive transcription factor 2a [Prunus salicina]
Length=381

 Score =   178 bits (451),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 116/182 (64%), Positives = 128/182 (70%), Gaps = 17/182 (9%)
 Frame = +3

Query  150  MCGGAIISDFKPPSRSSRRLTADLLWGRADLsggkkksnssgshyskPLRSEVVVLDDDF  329
            MCGGAIISDF  P+RS  RLTAD LW   DL         S      PLR E+V L DDF
Sbjct  1    MCGGAIISDFIAPTRS--RLTADYLW--PDLKKPSSGKRFSK-----PLRPEIVGLGDDF  51

Query  330  EADFQDFKDHSYS-----QVDAKPFAFSA---SHRPGFssgpdsdsskdadnsskrkrkN  485
            EADFQ+FKD S        V+AKP AFSA   S   G ++    + +  A+ S+KRKRKN
Sbjct  52   EADFQEFKDESDVDEDDEMVEAKPSAFSAGKPSSARGSTTVKSVEFNGQAEKSAKRKRKN  111

Query  486  QYRGIRQRPWGKWAAEIRDPSKGVRVWLGTFDTAEEAARAYDIEARRIRGKKAKVNFPDD  665
            QYRGIRQRPWGKWAAEIRDP KGVRVWLGTF+TAEEAARAYD EARRIRGKKAKVNFPD+
Sbjct  112  QYRGIRQRPWGKWAAEIRDPRKGVRVWLGTFNTAEEAARAYDSEARRIRGKKAKVNFPDE  171

Query  666  AP  671
             P
Sbjct  172  TP  173



>gb|AFG26329.1| ethylene response factor ERF4 [Eriobotrya japonica]
Length=385

 Score =   178 bits (451),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 117/182 (64%), Positives = 129/182 (71%), Gaps = 16/182 (9%)
 Frame = +3

Query  150  MCGGAIISDFKPPSRSSRRLTADLLWGRADLsggkkksnssgshyskPLRSEVVVLDDDF  329
            MCGGAIISDF  P RS RRLTAD LW   DL         S      PLRSE+V LDDDF
Sbjct  1    MCGGAIISDFIAPVRS-RRLTADYLW--PDLKKPSSGKRLSK-----PLRSEIVDLDDDF  52

Query  330  EADFQDFKDHSYSQVD-----AKPFAFSA---SHRPGFssgpdsdsskdadnsskrkrkN  485
            EADFQ+FKD S    D     +KP AFSA   S   G ++    + +  A+ S+KRKRKN
Sbjct  53   EADFQEFKDESDVDEDDEMVDSKPSAFSAGKPSSARGSTAVKSVEFNGQAEKSAKRKRKN  112

Query  486  QYRGIRQRPWGKWAAEIRDPSKGVRVWLGTFDTAEEAARAYDIEARRIRGKKAKVNFPDD  665
            QYRGIRQRPWGKWAAEIRDP KGVRVWLGTF+TAEEAARAYD EARRIRGKKAKVNFP++
Sbjct  113  QYRGIRQRPWGKWAAEIRDPRKGVRVWLGTFNTAEEAARAYDAEARRIRGKKAKVNFPEE  172

Query  666  AP  671
             P
Sbjct  173  TP  174



>gb|AFY09702.1| AP2/ERF super family protein [Hevea brasiliensis]
Length=383

 Score =   178 bits (451),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 117/192 (61%), Positives = 130/192 (68%), Gaps = 29/192 (15%)
 Frame = +3

Query  150  MCGGAIISDFKPPS---RSSRRLTADLLWGRADLsggkkksnssgshyskPLRSEVVVLD  320
            MCGGAII DF PP+   RSSRRLTAD LW   DL     K  S         +  VV LD
Sbjct  1    MCGGAIIPDFIPPTVAGRSSRRLTADFLW--PDLKKAIGKQYS---------KPVVVDLD  49

Query  321  DDFEADFQDFKDHSYSQ------VDAKPFAFSASHRP---------GFssgpdsdsskda  455
            DDFEADFQ+FKD S         +D KPFAF A+  P         G ++    + +  A
Sbjct  50   DDFEADFQEFKDESDVDEEDDVLLDVKPFAFFATASPPARNSSLSRGSTAVKSVEFNGQA  109

Query  456  dnsskrkrkNQYRGIRQRPWGKWAAEIRDPSKGVRVWLGTFDTAEEAARAYDIEARRIRG  635
            + S+KRKRKNQYRGIRQRPWGKWAAEIRDP KGVRVWLGTF+TAEEAARAYD EARRIRG
Sbjct  110  EKSAKRKRKNQYRGIRQRPWGKWAAEIRDPRKGVRVWLGTFNTAEEAARAYDAEARRIRG  169

Query  636  KKAKVNFPDDAP  671
            KKAKVNFPD+AP
Sbjct  170  KKAKVNFPDEAP  181



>ref|XP_008228117.1| PREDICTED: ethylene-responsive transcription factor RAP2-12-like 
[Prunus mume]
Length=381

 Score =   177 bits (450),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 116/182 (64%), Positives = 128/182 (70%), Gaps = 17/182 (9%)
 Frame = +3

Query  150  MCGGAIISDFKPPSRSSRRLTADLLWGRADLsggkkksnssgshyskPLRSEVVVLDDDF  329
            MCGGAIISDF  P+RS  RLTAD LW   DL         S      PLR E+V L DDF
Sbjct  1    MCGGAIISDFIAPTRS--RLTADYLW--PDLKKPSSGKRFSK-----PLRPEIVDLGDDF  51

Query  330  EADFQDFKDHSYS-----QVDAKPFAFSA---SHRPGFssgpdsdsskdadnsskrkrkN  485
            EADFQ+FKD S        V+AKP AFSA   S   G ++    + +  A+ S+KRKRKN
Sbjct  52   EADFQEFKDESDVDEDDEMVEAKPSAFSAGKPSSARGSTTVKSVEFNGQAEKSAKRKRKN  111

Query  486  QYRGIRQRPWGKWAAEIRDPSKGVRVWLGTFDTAEEAARAYDIEARRIRGKKAKVNFPDD  665
            QYRGIRQRPWGKWAAEIRDP KGVRVWLGTF+TAEEAARAYD EARRIRGKKAKVNFPD+
Sbjct  112  QYRGIRQRPWGKWAAEIRDPRKGVRVWLGTFNTAEEAARAYDSEARRIRGKKAKVNFPDE  171

Query  666  AP  671
             P
Sbjct  172  TP  173



>ref|XP_007024746.1| Transcription factor JERF1, putative isoform 1 [Theobroma cacao]
 ref|XP_007024747.1| Transcription factor JERF1, putative isoform 1 [Theobroma cacao]
 ref|XP_007024748.1| Transcription factor JERF1, putative isoform 1 [Theobroma cacao]
 ref|XP_007024749.1| Transcription factor JERF1, putative isoform 1 [Theobroma cacao]
 gb|EOY27368.1| Transcription factor JERF1, putative isoform 1 [Theobroma cacao]
 gb|EOY27369.1| Transcription factor JERF1, putative isoform 1 [Theobroma cacao]
 gb|EOY27370.1| Transcription factor JERF1, putative isoform 1 [Theobroma cacao]
 gb|EOY27371.1| Transcription factor JERF1, putative isoform 1 [Theobroma cacao]
Length=393

 Score =   177 bits (450),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 115/192 (60%), Positives = 129/192 (67%), Gaps = 24/192 (13%)
 Frame = +3

Query  150  MCGGAIISDFKPPSRSSRRLTADLLWGRADLsggkkksnssgshyskPLRSEVVVLDDDF  329
            MCGGAIISD  PP+R+ RRLTAD LW   DL+    K  S            V+ LDDDF
Sbjct  1    MCGGAIISDLIPPTRT-RRLTADYLW--PDLTKSGSKKRSGKR-----YSKPVIDLDDDF  52

Query  330  EADFQDFKDHSYSQVDA----------KPFAFSASHRP------GFssgpdsdsskdadn  461
            EADFQ+FKD      D           KPFA SA+ +P      G +S    + +  A+ 
Sbjct  53   EADFQEFKDEETDADDFDDVDDVLADVKPFALSATKKPASAASGGSNSVKSVEFNGQAEK  112

Query  462  sskrkrkNQYRGIRQRPWGKWAAEIRDPSKGVRVWLGTFDTAEEAARAYDIEARRIRGKK  641
            S+KRKRKNQYRGIRQRPWGKWAAEIRDP KGVRVWLGTF+TAEEAARAYD EARRIRGKK
Sbjct  113  SAKRKRKNQYRGIRQRPWGKWAAEIRDPRKGVRVWLGTFNTAEEAARAYDAEARRIRGKK  172

Query  642  AKVNFPDDAPLT  677
            AKVNFPD+AP T
Sbjct  173  AKVNFPDEAPRT  184



>ref|XP_007215451.1| hypothetical protein PRUPE_ppa006366mg [Prunus persica]
 ref|XP_007215452.1| hypothetical protein PRUPE_ppa006366mg [Prunus persica]
 gb|ADU76351.1| ethylene responsive factor, partial [Prunus persica]
 gb|EMJ16650.1| hypothetical protein PRUPE_ppa006366mg [Prunus persica]
 gb|EMJ16651.1| hypothetical protein PRUPE_ppa006366mg [Prunus persica]
Length=382

 Score =   177 bits (448),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 115/182 (63%), Positives = 128/182 (70%), Gaps = 17/182 (9%)
 Frame = +3

Query  150  MCGGAIISDFKPPSRSSRRLTADLLWGRADLsggkkksnssgshyskPLRSEVVVLDDDF  329
            MCGGAIISDF  P+RS  RLTAD LW   DL         S      PLR E++ LD DF
Sbjct  1    MCGGAIISDFIAPTRS--RLTADYLW--PDLKKPSSDKRFSK-----PLRPEIIDLDHDF  51

Query  330  EADFQDFKDHSYS-----QVDAKPFAFSA---SHRPGFssgpdsdsskdadnsskrkrkN  485
            EADFQ+FKD S        V+AKP AFSA   S   G ++    + +  A+ S+KRKRKN
Sbjct  52   EADFQEFKDESDVDEDDEMVEAKPSAFSAGKPSSARGSTTVKLVEFNGQAEKSAKRKRKN  111

Query  486  QYRGIRQRPWGKWAAEIRDPSKGVRVWLGTFDTAEEAARAYDIEARRIRGKKAKVNFPDD  665
            QYRGIRQRPWGKWAAEIRDP KGVRVWLGTF+TAEEAARAYD EARRIRGKKAKVNFPD+
Sbjct  112  QYRGIRQRPWGKWAAEIRDPRKGVRVWLGTFNTAEEAARAYDSEARRIRGKKAKVNFPDE  171

Query  666  AP  671
             P
Sbjct  172  TP  173



>ref|XP_008380747.1| PREDICTED: ethylene-responsive transcription factor RAP2-12-like 
[Malus domestica]
Length=386

 Score =   176 bits (447),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 118/184 (64%), Positives = 129/184 (70%), Gaps = 18/184 (10%)
 Frame = +3

Query  150  MCGGAIISDFKPPSRSSRRLTADLLWGRADLsggkkksnssgshyskPLRSEVVVLDDDF  329
            MCGGAIISDF  P RS RRLTAD LW   DL         S      PL+SE+V LDDDF
Sbjct  1    MCGGAIISDFIAPVRS-RRLTADYLW--PDLKKPSSGKRLSK-----PLKSEIVDLDDDF  52

Query  330  EADFQDFKDHSYSQVDA-----KPFAFSASHRPGFssgpdsdssk----dadnsskrkrk  482
            EADFQ+FKD S    D      KP AFSA + P F+ G  +  S      A+ S+KRKRK
Sbjct  53   EADFQEFKDESDVDEDDEMVDXKPSAFSAGN-PSFARGSTAVKSVEFDGQAEKSAKRKRK  111

Query  483  NQYRGIRQRPWGKWAAEIRDPSKGVRVWLGTFDTAEEAARAYDIEARRIRGKKAKVNFPD  662
            NQYRGIRQRPWGKWAAEIRDP KGVRVWLGTF+TAEEAARAYD EARRIRGKKAKVNFP+
Sbjct  112  NQYRGIRQRPWGKWAAEIRDPRKGVRVWLGTFNTAEEAARAYDAEARRIRGKKAKVNFPE  171

Query  663  DAPL  674
            + P 
Sbjct  172  ETPC  175



>ref|XP_007215453.1| hypothetical protein PRUPE_ppa006366mg [Prunus persica]
 gb|EMJ16652.1| hypothetical protein PRUPE_ppa006366mg [Prunus persica]
Length=415

 Score =   177 bits (448),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 115/182 (63%), Positives = 128/182 (70%), Gaps = 17/182 (9%)
 Frame = +3

Query  150  MCGGAIISDFKPPSRSSRRLTADLLWGRADLsggkkksnssgshyskPLRSEVVVLDDDF  329
            MCGGAIISDF  P+RS  RLTAD LW   DL         S      PLR E++ LD DF
Sbjct  1    MCGGAIISDFIAPTRS--RLTADYLW--PDLKKPSSDKRFSK-----PLRPEIIDLDHDF  51

Query  330  EADFQDFKDHSYS-----QVDAKPFAFSA---SHRPGFssgpdsdsskdadnsskrkrkN  485
            EADFQ+FKD S        V+AKP AFSA   S   G ++    + +  A+ S+KRKRKN
Sbjct  52   EADFQEFKDESDVDEDDEMVEAKPSAFSAGKPSSARGSTTVKLVEFNGQAEKSAKRKRKN  111

Query  486  QYRGIRQRPWGKWAAEIRDPSKGVRVWLGTFDTAEEAARAYDIEARRIRGKKAKVNFPDD  665
            QYRGIRQRPWGKWAAEIRDP KGVRVWLGTF+TAEEAARAYD EARRIRGKKAKVNFPD+
Sbjct  112  QYRGIRQRPWGKWAAEIRDPRKGVRVWLGTFNTAEEAARAYDSEARRIRGKKAKVNFPDE  171

Query  666  AP  671
             P
Sbjct  172  TP  173



>gb|AAX07458.2| ethylene-responsive element binding protein ERF2 [Gossypium hirsutum]
Length=390

 Score =   176 bits (446),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 113/191 (59%), Positives = 125/191 (65%), Gaps = 23/191 (12%)
 Frame = +3

Query  150  MCGGAIISDFKPPSRSSRRLTADLLWGRADLsggkkksnssgshyskPLRSEVVVLDDDF  329
            MCGGAIISDF PPSRS RRLTAD LW   DL     K  S            V+ L DDF
Sbjct  1    MCGGAIISDFIPPSRS-RRLTADFLW--PDLKKSGLKKGSGKR-----YSKPVIDLGDDF  52

Query  330  EADFQDFKDHS---------YSQVDAKPFAFSASHRP------GFssgpdsdsskdadns  464
            E DFQ+FKD               D KPFAF+A+ +P      G +S      +  A+  
Sbjct  53   ETDFQEFKDEESDIDDYDVDDVLADVKPFAFNATKKPASAVSHGSNSEKSMQFNGQAEKC  112

Query  465  skrkrkNQYRGIRQRPWGKWAAEIRDPSKGVRVWLGTFDTAEEAARAYDIEARRIRGKKA  644
            +KRKRKNQYRGIRQRPWGKWAAEIRDP KGVRVWLGTF+TAEEAARAYD EARRIRGKKA
Sbjct  113  AKRKRKNQYRGIRQRPWGKWAAEIRDPRKGVRVWLGTFNTAEEAARAYDAEARRIRGKKA  172

Query  645  KVNFPDDAPLT  677
            KVNFP++ P T
Sbjct  173  KVNFPNETPRT  183



>gb|AAX84670.1| ethylene response factor [Manihot esculenta]
Length=381

 Score =   176 bits (445),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 115/192 (60%), Positives = 128/192 (67%), Gaps = 34/192 (18%)
 Frame = +3

Query  150  MCGGAIISDFKPPS---RSSRRLTADLLWGRADLsggkkksnssgshyskPLRSEVVVLD  320
            MCGGAIISDF P +   RSSRRLTAD LW   DL                P+   V  LD
Sbjct  1    MCGGAIISDFIPATAAGRSSRRLTADFLW--PDLKK--------------PIGKIVGDLD  44

Query  321  DDFEADFQDFKDHSYSQ------VDAKPFAFSASHRP---------GFssgpdsdsskda  455
            DDFEADFQ+FKD S          D KPF+FSA+  P         G ++    + +  A
Sbjct  45   DDFEADFQEFKDESDVDEEDDVLFDVKPFSFSATASPPPRNRSPSRGSTAVKSVEFNGLA  104

Query  456  dnsskrkrkNQYRGIRQRPWGKWAAEIRDPSKGVRVWLGTFDTAEEAARAYDIEARRIRG  635
            + S+KRKRKNQYRGIRQRPWGKWAAEIRDP KGVRVWLGTF+TAEEAARAYD EARRIRG
Sbjct  105  EKSAKRKRKNQYRGIRQRPWGKWAAEIRDPRKGVRVWLGTFNTAEEAARAYDAEARRIRG  164

Query  636  KKAKVNFPDDAP  671
            KKAKVNFPD+AP
Sbjct  165  KKAKVNFPDEAP  176



>ref|XP_006362095.1| PREDICTED: ethylene-responsive transcription factor RAP2-12-like 
isoform X1 [Solanum tuberosum]
 ref|XP_006362096.1| PREDICTED: ethylene-responsive transcription factor RAP2-12-like 
isoform X2 [Solanum tuberosum]
Length=388

 Score =   176 bits (445),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 111/182 (61%), Positives = 128/182 (70%), Gaps = 7/182 (4%)
 Frame = +3

Query  150  MCGGAIISDFKPPSRSSRRLTADLLWGRADLsggkkksnssgshyskPLRSEVVVLDDDF  329
            MCGGAIISD  PP RSS RLTAD LWG +D+   KKK+ +   + S      +   + DF
Sbjct  1    MCGGAIISDRIPPPRSSSRLTADQLWGCSDVQNKKKKNKNKKRNPSNYHSKSLRFENVDF  60

Query  330  EADFQDFKDHSYSQ----VDAKPFAFSASHRPGFssgpdsdsskdadnsskrkr---kNQ  488
            EADF DFKD S  +    +D KPFAFSAS   G S+G +S  S DA    K  +   KNQ
Sbjct  61   EADFLDFKDFSDDEEAYCLDIKPFAFSASELYGTSAGSESLISVDAKEVEKSSKRQRKNQ  120

Query  489  YRGIRQRPWGKWAAEIRDPSKGVRVWLGTFDTAEEAARAYDIEARRIRGKKAKVNFPDDA  668
            YRGIR+RPWGKWAAEIRDP KGVRVW+GTF+TAEEAARAYD EARRIRG KAKVNFPD+A
Sbjct  121  YRGIRKRPWGKWAAEIRDPQKGVRVWIGTFNTAEEAARAYDAEARRIRGNKAKVNFPDEA  180

Query  669  PL  674
             +
Sbjct  181  SV  182



>ref|XP_009357901.1| PREDICTED: ethylene-responsive transcription factor RAP2-12-like 
[Pyrus x bretschneideri]
Length=386

 Score =   175 bits (443),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 111/182 (61%), Positives = 123/182 (68%), Gaps = 16/182 (9%)
 Frame = +3

Query  150  MCGGAIISDFKPPSRSSRRLTADLLWGRADLsggkkksnssgshyskPLRSEVVVLDDDF  329
            MCGGAIISDF  P+  SRRLTAD LW   DL         S      PLRS +V LDDDF
Sbjct  1    MCGGAIISDFIAPAARSRRLTADYLW--PDLKKPSSGKRFSK-----PLRSVIVDLDDDF  53

Query  330  EADFQDFKDHSYSQVD-----AKPFAFSASHRPGFssgpdsdsskdadnsskrkr---kN  485
            EADFQ+FKD S    D     +KP AFSA  +P  + G    S +    + K  +   KN
Sbjct  54   EADFQEFKDESDVDEDDEMVDSKPSAFSAG-KPSSARGSAVKSVEFNGQAEKSAKRKRKN  112

Query  486  QYRGIRQRPWGKWAAEIRDPSKGVRVWLGTFDTAEEAARAYDIEARRIRGKKAKVNFPDD  665
            QYRGIRQRPWGKWAAEIRDP KGVRVWLGTF+TAEEAARAYD EARRIRGKKAKVNFP++
Sbjct  113  QYRGIRQRPWGKWAAEIRDPRKGVRVWLGTFNTAEEAARAYDAEARRIRGKKAKVNFPEE  172

Query  666  AP  671
             P
Sbjct  173  TP  174



>ref|XP_010273830.1| PREDICTED: ethylene-responsive transcription factor RAP2-12-like 
[Nelumbo nucifera]
Length=372

 Score =   174 bits (441),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 113/181 (62%), Positives = 130/181 (72%), Gaps = 15/181 (8%)
 Frame = +3

Query  150  MCGGAIISDFKPPSRSSRRLTADLLWGRADLsggkkksnssgshyskPLRSEVVVLDDDF  329
            MCGGAIISDF P SR+ RR+TAD LW   DL         S      P RSE+  L++DF
Sbjct  1    MCGGAIISDFIPTSRT-RRVTADYLW--PDLKNTTSGDYYSK-----PRRSEIDDLEEDF  52

Query  330  EADFQDFKDHSYSQV-DAKPFAFSASHRPGFssgpdsdsskd----adnsskrkrkNQYR  494
            EADFQ+FKD S  +  D KP   ++  +PG S G  +  S +    A+ S+KRKRKNQYR
Sbjct  53   EADFQEFKDESEEEEEDIKPILLNS--KPGLSRGSTTVKSVEVSGPAEKSAKRKRKNQYR  110

Query  495  GIRQRPWGKWAAEIRDPSKGVRVWLGTFDTAEEAARAYDIEARRIRGKKAKVNFPDDAPL  674
            GIRQRPWGKWAAEIRDP KGVRVWLGTF+TAEEAARAYD EARRIRGKKAKVNFP++AP 
Sbjct  111  GIRQRPWGKWAAEIRDPRKGVRVWLGTFNTAEEAARAYDAEARRIRGKKAKVNFPEEAPQ  170

Query  675  T  677
            T
Sbjct  171  T  171



>gb|AGE92354.1| ethylene response factor 2 [Ipomoea batatas]
Length=314

 Score =   172 bits (437),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 108/175 (62%), Positives = 118/175 (67%), Gaps = 12/175 (7%)
 Frame = +3

Query  150  MCGGAIISDFKPPSRSSRRLTADLLWGRADLsggkkksnss--gshyskPLRSEVVVLDD  323
            MCGGAIISD KPP R+SRRLT++LLWG AD S    K   +  GS+YS  LRS    LD+
Sbjct  1    MCGGAIISDIKPPVRTSRRLTSELLWGSADRSSAGGKKKKNFAGSYYSGALRSAAFDLDN  60

Query  324  DFEADFQDFKDHSYSQVDA---KPFAFSASHRPGFssgpdsdsskdadnsskrkrkNQYR  494
            +FEADFQDF D+   +V     KPF F  S   GFSS                   NQYR
Sbjct  61   EFEADFQDFNDYDDDEVVDVDVKPFVFGLSC--GFSSDSKDFDQSIKRKRK-----NQYR  113

Query  495  GIRQRPWGKWAAEIRDPSKGVRVWLGTFDTAEEAARAYDIEARRIRGKKAKVNFP  659
            GI QRPWGKWA EIRDPSKGVRVWLGTFDTAEEAARAYD EARRIRG KAK+NFP
Sbjct  114  GIGQRPWGKWATEIRDPSKGVRVWLGTFDTAEEAARAYDTEARRIRGNKAKLNFP  168



>ref|XP_006369093.1| transcription factor EREBP-like family protein [Populus trichocarpa]
 gb|ERP65662.1| transcription factor EREBP-like family protein [Populus trichocarpa]
Length=378

 Score =   174 bits (440),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 115/188 (61%), Positives = 129/188 (69%), Gaps = 23/188 (12%)
 Frame = +3

Query  150  MCGGAIISDFKPPS---RSSRRLTADLLWGRADLsggkkksnssgshyskPLRSEVVVLD  320
            MCGGAIISDF PP+   RSSRR      W          K       YSKP+   V+ LD
Sbjct  1    MCGGAIISDFIPPTTTARSSRRFAEGFEW-------FGMKKPLDNKKYSKPV---VINLD  50

Query  321  DDFEADFQDFKDHSYSQ------VDAKPFAFSASH----RPGFssgpdsdsskdadnssk  470
            DDFEADFQ+FKD S         VDAKPF+FSA+     +   +    ++ S  A+ S+K
Sbjct  51   DDFEADFQEFKDESDVDENYDVFVDAKPFSFSATASAPAKKRSAPVKSAEFSGQAEKSAK  110

Query  471  rkrkNQYRGIRQRPWGKWAAEIRDPSKGVRVWLGTFDTAEEAARAYDIEARRIRGKKAKV  650
            RKRKNQYRGIRQRPWGKWAAEIRDP KGVRVWLGTF+TAEEAARAYD EARRIRGKKAKV
Sbjct  111  RKRKNQYRGIRQRPWGKWAAEIRDPRKGVRVWLGTFNTAEEAARAYDAEARRIRGKKAKV  170

Query  651  NFPDDAPL  674
            NFPD+APL
Sbjct  171  NFPDEAPL  178



>ref|XP_009357932.1| PREDICTED: ethylene-responsive transcription factor RAP2-12-like 
[Pyrus x bretschneideri]
Length=386

 Score =   174 bits (440),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 110/182 (60%), Positives = 123/182 (68%), Gaps = 16/182 (9%)
 Frame = +3

Query  150  MCGGAIISDFKPPSRSSRRLTADLLWGRADLsggkkksnssgshyskPLRSEVVVLDDDF  329
            MCGGAIISDF  P+  SRRLTAD LW   DL         S      PLRS +V LDDDF
Sbjct  1    MCGGAIISDFIAPAARSRRLTADYLW--PDLKKPSSGKRFSK-----PLRSVIVDLDDDF  53

Query  330  EADFQDFKDHSYSQVD-----AKPFAFSASHRPGFssgpdsdsskdadnsskrkr---kN  485
            EADFQ+FKD S    D     +KP AFS + +P  + G    S +    + K  +   KN
Sbjct  54   EADFQEFKDESDVDEDDEMVDSKPSAFS-TGKPSSARGSAVKSVEFNGQAEKSAKRKRKN  112

Query  486  QYRGIRQRPWGKWAAEIRDPSKGVRVWLGTFDTAEEAARAYDIEARRIRGKKAKVNFPDD  665
            QYRGIRQRPWGKWAAEIRDP KGVRVWLGTF+TAEEAARAYD EARRIRGKKAKVNFP++
Sbjct  113  QYRGIRQRPWGKWAAEIRDPRKGVRVWLGTFNTAEEAARAYDAEARRIRGKKAKVNFPEE  172

Query  666  AP  671
             P
Sbjct  173  TP  174



>gb|KJB70053.1| hypothetical protein B456_011G056300 [Gossypium raimondii]
 gb|KJB70054.1| hypothetical protein B456_011G056300 [Gossypium raimondii]
 gb|KJB70055.1| hypothetical protein B456_011G056300 [Gossypium raimondii]
 gb|KJB70056.1| hypothetical protein B456_011G056300 [Gossypium raimondii]
Length=390

 Score =   174 bits (440),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 113/191 (59%), Positives = 122/191 (64%), Gaps = 23/191 (12%)
 Frame = +3

Query  150  MCGGAIISDFKPPSRSSRRLTADLLWGRADLsggkkksnssgshyskPLRSEVVVLDDDF  329
            MCGGAIISDF PPSRS RRLTAD LW   DL     K  S            V+ L DDF
Sbjct  1    MCGGAIISDFIPPSRS-RRLTADFLW--PDLKKSGLKKGSGKR-----YSKPVIDLGDDF  52

Query  330  EADFQDFKDHS---------YSQVDAKPFAFSASHRP------GFssgpdsdsskdadns  464
            E DFQ+FKD               D KPFAF+A  +P      G +S         A+  
Sbjct  53   ETDFQEFKDEESDIDDYDVDDVLADVKPFAFNARTKPASAVSHGSNSEKSMQFDGQAEKC  112

Query  465  skrkrkNQYRGIRQRPWGKWAAEIRDPSKGVRVWLGTFDTAEEAARAYDIEARRIRGKKA  644
             KRKRKNQYRGIRQRPWGKWAAEIRDP KGVRVWLGTF+TAEEAARAYD EARRIRGKKA
Sbjct  113  GKRKRKNQYRGIRQRPWGKWAAEIRDPRKGVRVWLGTFNTAEEAARAYDAEARRIRGKKA  172

Query  645  KVNFPDDAPLT  677
            KVNFP++ P T
Sbjct  173  KVNFPNETPRT  183



>ref|XP_010089706.1| Ethylene-responsive transcription factor [Morus notabilis]
 gb|EXB38256.1| Ethylene-responsive transcription factor [Morus notabilis]
Length=388

 Score =   173 bits (439),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 115/182 (63%), Positives = 127/182 (70%), Gaps = 16/182 (9%)
 Frame = +3

Query  150  MCGGAIISDFKPPSRSSRRLTADLLWGRADLsggkkksnssgshyskPLRSEVVVLDDDF  329
            MCGGAIISDF    RSSR LTAD LW   DL         S      P+RS +V +DDDF
Sbjct  1    MCGGAIISDFISTPRSSR-LTADYLW--PDLKKSGSGKRFSK-----PVRSVIVDIDDDF  52

Query  330  EADFQDFKDHSYSQVDA-----KPFAFSA---SHRPGFssgpdsdsskdadnsskrkrkN  485
            EADFQ FKD S    D      KPFAFSA   +   G ++   ++S   A+ S+KRKRKN
Sbjct  53   EADFQGFKDDSDVDDDDEVIDVKPFAFSARKPTSSRGSTTVKYTESDGQAEKSAKRKRKN  112

Query  486  QYRGIRQRPWGKWAAEIRDPSKGVRVWLGTFDTAEEAARAYDIEARRIRGKKAKVNFPDD  665
            QYRGIRQRPWGKWAAEIRDP KGVRVWLGTF+TAEEAARAYD EARRIRGKKAKVNFPD+
Sbjct  113  QYRGIRQRPWGKWAAEIRDPRKGVRVWLGTFNTAEEAARAYDAEARRIRGKKAKVNFPDE  172

Query  666  AP  671
             P
Sbjct  173  TP  174



>ref|XP_010261706.1| PREDICTED: ethylene-responsive transcription factor RAP2-12 [Nelumbo 
nucifera]
 ref|XP_010261707.1| PREDICTED: ethylene-responsive transcription factor RAP2-12 [Nelumbo 
nucifera]
Length=376

 Score =   172 bits (436),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 111/178 (62%), Positives = 124/178 (70%), Gaps = 14/178 (8%)
 Frame = +3

Query  150  MCGGAIISDFKPPSRSSRRLTADLLWGRADLsggkkksnssgshyskPLRSEVVVLDDDF  329
            MCGGAIISDF P +RS RRLTAD LW   DL        S       PLR  VV +DDDF
Sbjct  1    MCGGAIISDFIPTNRS-RRLTADYLW--PDLKQNSANYYSK------PLRPAVVDVDDDF  51

Query  330  EADFQDFKDHSYSQVD--AKPFAFSASH---RPGFssgpdsdsskdadnsskrkrkNQYR  494
            EADFQ+FKD    +     KPF  ++     R G ++      S  A+ S+KRKRKNQYR
Sbjct  52   EADFQEFKDEIDEEEGEDVKPFTLASKSGFSRGGSTTLKPVQFSGPAEKSAKRKRKNQYR  111

Query  495  GIRQRPWGKWAAEIRDPSKGVRVWLGTFDTAEEAARAYDIEARRIRGKKAKVNFPDDA  668
            GIRQRPWGKWAAEIRDP KGVRVWLGTF+TAEEAARAYD EARRIRGKKAKVNFP++A
Sbjct  112  GIRQRPWGKWAAEIRDPRKGVRVWLGTFNTAEEAARAYDAEARRIRGKKAKVNFPEEA  169



>ref|XP_011079396.1| PREDICTED: ethylene-responsive transcription factor RAP2-12-like 
[Sesamum indicum]
 ref|XP_011079401.1| PREDICTED: ethylene-responsive transcription factor RAP2-12-like 
[Sesamum indicum]
Length=391

 Score =   172 bits (437),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 115/182 (63%), Positives = 136/182 (75%), Gaps = 10/182 (5%)
 Frame = +3

Query  150  MCGGAIISDFKPP-SRSSRRLTADLLWGRADLsggkkksnssgshyskPLRSEVVVLDDD  326
            MCGGAIISDF PP SRSSRRLTADLLWG    +G   K+ + G+++SKPL S+ ++  DD
Sbjct  1    MCGGAIISDFPPPASRSSRRLTADLLWGTG--AGYLNKNKNPGNYHSKPLSSKSIIDFDD  58

Query  327  FEA----DFQDFKDHSYSQVDAKPFAFSASHRPG---FssgpdsdsskdadnsskrkrkN  485
                   +F+D+ D        KPFAFSA+  PG     S   ++S +DA+ SSKRKRKN
Sbjct  59   DFEADFQEFEDYSDDEGEIHVKKPFAFSATKAPGPKGLKSVDSAESDEDAEKSSKRKRKN  118

Query  486  QYRGIRQRPWGKWAAEIRDPSKGVRVWLGTFDTAEEAARAYDIEARRIRGKKAKVNFPDD  665
            QYRGIRQRPWGKWAAEIRDP KGVRVWLGTF+TAEEAA+AYD  AR+IRGKKAKVNFP+D
Sbjct  119  QYRGIRQRPWGKWAAEIRDPRKGVRVWLGTFNTAEEAAKAYDTAARKIRGKKAKVNFPED  178

Query  666  AP  671
            AP
Sbjct  179  AP  180



>gb|AFY09701.1| AP2/ERF super family protein [Hevea brasiliensis]
Length=385

 Score =   172 bits (436),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 116/191 (61%), Positives = 128/191 (67%), Gaps = 28/191 (15%)
 Frame = +3

Query  150  MCGGAIISDFKPPS---RSSRRLTADLLWGRADLsggkkksnssgshyskPLRSEVVVLD  320
            MCGGAIISDF PP+   RS RRLTAD LW   DL     K  S         +  V  LD
Sbjct  1    MCGGAIISDFIPPTAAGRSPRRLTADFLW--PDLKKPIGKQYS---------KPVVGDLD  49

Query  321  DDFEADFQDFKDHSYSQ------VDAKPFAFSASHRPG--------Fssgpdsdsskdad  458
            DDFEADFQ+FKD S         +D KPFAFSA+  P          S+    + +  A+
Sbjct  50   DDFEADFQEFKDESDVDEEDDVLLDVKPFAFSATASPPPCNRSLSRGSAAKSVEFNGQAE  109

Query  459  nsskrkrkNQYRGIRQRPWGKWAAEIRDPSKGVRVWLGTFDTAEEAARAYDIEARRIRGK  638
             S+KRKRKN YRGIRQRPWGKWAAEIRDP KGVRVWLGTF+TAEEAARAYD EARRIRGK
Sbjct  110  KSAKRKRKNLYRGIRQRPWGKWAAEIRDPRKGVRVWLGTFNTAEEAARAYDAEARRIRGK  169

Query  639  KAKVNFPDDAP  671
            KAKVNFPD+AP
Sbjct  170  KAKVNFPDEAP  180



>gb|AGL34963.1| ethylene-responsive transcription factor 4 [Hevea brasiliensis]
Length=385

 Score =   172 bits (436),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 116/191 (61%), Positives = 128/191 (67%), Gaps = 28/191 (15%)
 Frame = +3

Query  150  MCGGAIISDFKPPS---RSSRRLTADLLWGRADLsggkkksnssgshyskPLRSEVVVLD  320
            MCGGAIISDF PP+   RS RRLTAD LW   DL     K  S         +  V  LD
Sbjct  1    MCGGAIISDFIPPTAAGRSPRRLTADFLW--PDLKKPIGKQYS---------KPVVGDLD  49

Query  321  DDFEADFQDFKDHSYSQ------VDAKPFAFSASHRPG--------Fssgpdsdsskdad  458
            DDFEADFQ+FKD S         +D KPFAFSA+  P          S+    + +  A+
Sbjct  50   DDFEADFQEFKDESDVDEEDDVLLDVKPFAFSATASPPPCNRSLSRGSAAKSVEFNGQAE  109

Query  459  nsskrkrkNQYRGIRQRPWGKWAAEIRDPSKGVRVWLGTFDTAEEAARAYDIEARRIRGK  638
             S+KRKRKN YRGIRQRPWGKWAAEIRDP KGVRVWLGTF+TAEEAARAYD EARRIRGK
Sbjct  110  KSAKRKRKNLYRGIRQRPWGKWAAEIRDPRKGVRVWLGTFNTAEEAARAYDAEARRIRGK  169

Query  639  KAKVNFPDDAP  671
            KAKVNFPD+AP
Sbjct  170  KAKVNFPDEAP  180



>gb|ACS35626.1| ethylene signal transcription factor [Morus alba]
Length=388

 Score =   172 bits (436),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 113/182 (62%), Positives = 126/182 (69%), Gaps = 16/182 (9%)
 Frame = +3

Query  150  MCGGAIISDFKPPSRSSRRLTADLLWGRADLsggkkksnssgshyskPLRSEVVVLDDDF  329
            MCGGAIISDF    RS+R LTAD LW   DL                P+RS +V +DDDF
Sbjct  1    MCGGAIISDFISTPRSTR-LTADYLW--PDLKKSGSGKRFCK-----PVRSVIVDIDDDF  52

Query  330  EADFQDFKDHSYSQVDA-----KPFAFSA---SHRPGFssgpdsdsskdadnsskrkrkN  485
            EADFQ FKD S    D      KPFAFSA   +   G ++   ++S   A+ S+KRKRKN
Sbjct  53   EADFQGFKDDSDVDNDDDVIDVKPFAFSAREPTFSRGSTTVKYTESDGQAEKSAKRKRKN  112

Query  486  QYRGIRQRPWGKWAAEIRDPSKGVRVWLGTFDTAEEAARAYDIEARRIRGKKAKVNFPDD  665
            QYRGIRQRPWGKWAAEIRDP KGVRVWLGTF+TAEEAARAYD EARRIRGKKAKVNFPD+
Sbjct  113  QYRGIRQRPWGKWAAEIRDPRKGVRVWLGTFNTAEEAARAYDAEARRIRGKKAKVNFPDE  172

Query  666  AP  671
             P
Sbjct  173  TP  174



>gb|AEQ58798.1| ethylene response factor, partial [Rumex palustris]
Length=192

 Score =   166 bits (421),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 115/185 (62%), Positives = 131/185 (71%), Gaps = 12/185 (6%)
 Frame = +3

Query  150  MCGGAIISDFKPPSRSSRRLTADLLWGRADLsggkkksnssgshyskPLRSEVV-VLDD-  323
            MCGGAIISDF  P++ SRRL A  LW  + L+G  KK   S   YSKP RSEV+ V+ D 
Sbjct  1    MCGGAIISDF-IPAKGSRRLVASDLW--SGLAGEGKKKKRSSGGYSKPARSEVIDVVKDE  57

Query  324  -DFEADFQDFKDHSYSQV--DAKPFAF---SASHRPGFssgpdsdsskdadnsskrkrkN  485
             DFEADF DF D    +V  D KPF+F   +  +          + +   + S+KRKRKN
Sbjct  58   YDFEADFVDFVDECDDEVFGDVKPFSFRPVNTFNSSSTQGPKPVEFTGQTEKSAKRKRKN  117

Query  486  QYRGIRQRPWGKWAAEIRDPSKGVRVWLGTFDTAEEAARAYDIEARRIRGKKAKVNFPDD  665
            QYRGIRQRPWGKWAAEIRDP KGVRVWLGTFDTAEEAARAYD EARRIRGKKAKVNFP+D
Sbjct  118  QYRGIRQRPWGKWAAEIRDPKKGVRVWLGTFDTAEEAARAYDSEARRIRGKKAKVNFPED  177

Query  666  -APLT  677
             AP+T
Sbjct  178  SAPVT  182



>gb|AEK81532.1| ethylene response factor [Ophiopogon japonicus]
Length=348

 Score =   171 bits (432),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 113/179 (63%), Positives = 122/179 (68%), Gaps = 14/179 (8%)
 Frame = +3

Query  150  MCGGAIISDFKPPSRSSRRLTADLLWGRADLsggkkksnssgshyskPLRSEVVVLDDDF  329
            MCGGAIISDF PP+RS R+LTAD LW   +L  G    + S          EV   DDDF
Sbjct  1    MCGGAIISDFIPPARS-RKLTADYLW--PNLKKGGNAKSLSSKKKKTKSSFEV---DDDF  54

Query  330  EADFQDFKDHSYSQ---VDAKPFAF---SASHRPGFssgpdsdsskdadnsskrkrkNQY  491
            EADF +FKD S  +    D KPF F   SA  R G  S        D   S+KRKRKNQY
Sbjct  55   EADFNEFKDESEEESEVADVKPFEFGAKSALSREG--SSALRPIEVDGPRSAKRKRKNQY  112

Query  492  RGIRQRPWGKWAAEIRDPSKGVRVWLGTFDTAEEAARAYDIEARRIRGKKAKVNFPDDA  668
            RGIRQRPWGKWAAEIRDP KGVRVWLGTF+TAEEAARAYD EARRIRGKKAKVNFPD+A
Sbjct  113  RGIRQRPWGKWAAEIRDPRKGVRVWLGTFNTAEEAARAYDAEARRIRGKKAKVNFPDEA  171



>ref|XP_009413996.1| PREDICTED: ethylene-responsive transcription factor 1-like isoform 
X3 [Musa acuminata subsp. malaccensis]
Length=361

 Score =   170 bits (431),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 105/179 (59%), Positives = 117/179 (65%), Gaps = 26/179 (15%)
 Frame = +3

Query  150  MCGGAIISDFKPPSRSSRRLTADLLWGRADLsggkkksnssgshyskPLRSEVVVLDDDF  329
            MCGGAIISD  P +RS+RR+TAD LW   DL  G               R  V V +DDF
Sbjct  1    MCGGAIISDLIPATRSARRVTADYLW--PDLKKGGASGAKKKRRSGN--RRAVEVTEDDF  56

Query  330  EADFQDFKDHSYS-----QVDAKPFAFSASHRPGFssgpdsdsskdadnsskrkrkNQYR  494
            EADF +F   S       +V+ KP AF++  R                 S+KRKRKNQYR
Sbjct  57   EADFLEFDYESMDSEVEDEVEDKPLAFASKAR-----------------STKRKRKNQYR  99

Query  495  GIRQRPWGKWAAEIRDPSKGVRVWLGTFDTAEEAARAYDIEARRIRGKKAKVNFPDDAP  671
            GIRQRPWGKWAAEIRDP KGVRVWLGTF+TAEEAARAYD EARRIRGKKAKVNFPD+AP
Sbjct  100  GIRQRPWGKWAAEIRDPRKGVRVWLGTFNTAEEAARAYDTEARRIRGKKAKVNFPDEAP  158



>gb|AEF30544.1| ethylene transcription factor [Castanea sativa]
Length=379

 Score =   170 bits (430),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 108/183 (59%), Positives = 118/183 (64%), Gaps = 21/183 (11%)
 Frame = +3

Query  150  MCGGAIISDFKPPSRSSRRLTADLLWGRADLsggkkksnssgshyskPLRSEVVVLDDDF  329
            MCGGAIISDF  P    RRLTAD LWG           +       +     VV +DDDF
Sbjct  1    MCGGAIISDFIAPV-GPRRLTADFLWG-----------DRKKPTSGRRFSKPVVDIDDDF  48

Query  330  EADFQDFKDHSYSQV---------DAKPFAFSASHRPGFssgpdsdsskdadnsskrkrk  482
            E DFQ FKD   S +         D KPFAFSA    G       + +  A+ S+KRKRK
Sbjct  49   EQDFQGFKDDDESDIDEEEEVLVQDVKPFAFSAPRSSGSKPVKSVEFNGQAEKSAKRKRK  108

Query  483  NQYRGIRQRPWGKWAAEIRDPSKGVRVWLGTFDTAEEAARAYDIEARRIRGKKAKVNFPD  662
            NQYRGIRQRPWGKWAAEIRDP KGVRVWLGTF+TAEEAARAYD EARRIRGKKAKVNFPD
Sbjct  109  NQYRGIRQRPWGKWAAEIRDPRKGVRVWLGTFNTAEEAARAYDAEARRIRGKKAKVNFPD  168

Query  663  DAP  671
            + P
Sbjct  169  ETP  171



>emb|CAE54591.1| ethylene transcription factor [Fagus sylvatica]
Length=378

 Score =   169 bits (429),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 108/182 (59%), Positives = 119/182 (65%), Gaps = 20/182 (11%)
 Frame = +3

Query  150  MCGGAIISDFKPPSRSSRRLTADLLWGRADLsggkkksnssgshyskPLRSEVVVLDDDF  329
            MCGGAIISDF  P+  SRRLTAD LWG           +       K     VV LDD+F
Sbjct  1    MCGGAIISDFIAPT-GSRRLTADYLWG-----------DRKKPISGKRFSKPVVDLDDEF  48

Query  330  EADFQDFKDHSYSQV--------DAKPFAFSASHRPGFssgpdsdsskdadnsskrkrkN  485
            E DFQ FKD   S +        D KPF FSA    G       + +  A+ S+KRKRKN
Sbjct  49   ELDFQGFKDEEESDIDEEEVLVQDVKPFTFSAPPSSGSKPVKSVEFNGQAEKSAKRKRKN  108

Query  486  QYRGIRQRPWGKWAAEIRDPSKGVRVWLGTFDTAEEAARAYDIEARRIRGKKAKVNFPDD  665
            QYRGIRQRPWGKWAAEIRDP KGVRVWLGTF+TAE+AARAYD EARRIRGKKAKVNFPD+
Sbjct  109  QYRGIRQRPWGKWAAEIRDPRKGVRVWLGTFNTAEKAARAYDAEARRIRGKKAKVNFPDE  168

Query  666  AP  671
             P
Sbjct  169  TP  170



>gb|AFP25470.1| ERF3 [Musa acuminata AAA Group]
Length=371

 Score =   169 bits (428),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 104/183 (57%), Positives = 123/183 (67%), Gaps = 12/183 (7%)
 Frame = +3

Query  150  MCGGAIISDFKPPSRSSRRLTADLLWGRADLsggkkksnssgshyskPLRSEVVVLDDDF  329
            MCGGAIISDF P +RS+RR+TAD LW   DL  G     +     S   R+ V  ++DDF
Sbjct  1    MCGGAIISDFIPATRSARRVTADYLW--PDLRTGVANGATKKQKKSGHRRA-VEEVEDDF  57

Query  330  EADFQDFKDHSYSQVDA-------KPFAFSASHRPGFssgpdsdsskdadnsskrkrkNQ  488
            E DF +F+  +             KPFAF+    P   +      +  A  S+K++RKNQ
Sbjct  58   ETDFLEFEYEALESEVEDEVETVEKPFAFACKDGP--VALKPVKFNGSAARSAKKERKNQ  115

Query  489  YRGIRQRPWGKWAAEIRDPSKGVRVWLGTFDTAEEAARAYDIEARRIRGKKAKVNFPDDA  668
            YRGIRQRPWGKWAAEIRDP KGVRVWLGTF+TAEEAARAYD EARRIRGKKAKVNFPD+A
Sbjct  116  YRGIRQRPWGKWAAEIRDPRKGVRVWLGTFNTAEEAARAYDAEARRIRGKKAKVNFPDEA  175

Query  669  PLT  677
            PL+
Sbjct  176  PLS  178



>ref|XP_011036532.1| PREDICTED: ethylene-responsive transcription factor RAP2-12-like 
[Populus euphratica]
 ref|XP_011036533.1| PREDICTED: ethylene-responsive transcription factor RAP2-12-like 
[Populus euphratica]
Length=379

 Score =   169 bits (428),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 112/193 (58%), Positives = 127/193 (66%), Gaps = 29/193 (15%)
 Frame = +3

Query  150  MCGGAIISDFKPPS---RSSRRLTADLLWGRADLsggkkksnssgshyskPLRSEVVVLD  320
            MCGGAIISDF  P+   RSSRRLT+   W                   +K L+  V   +
Sbjct  1    MCGGAIISDFIAPTTTARSSRRLTSGFEW-----------LGLKKPFNNKHLKPVVADPE  49

Query  321  DDFEADFQDFKDHSYSQ------VDAKPFAFSASHRP---------GFssgpdsdsskda  455
            DDFEADFQ+FKD S +        DAKPFAFSAS            G ++   + SS  A
Sbjct  50   DDFEADFQEFKDESDADEDYDVFADAKPFAFSASASEPAKKRGLPRGSTAVKSAGSSGLA  109

Query  456  dnsskrkrkNQYRGIRQRPWGKWAAEIRDPSKGVRVWLGTFDTAEEAARAYDIEARRIRG  635
            + S+KRKRKNQ+RGIRQRPWGKWAAEIRDP KGVRVWLGTF+TAEEAARAYD EARRIRG
Sbjct  110  EKSAKRKRKNQFRGIRQRPWGKWAAEIRDPRKGVRVWLGTFNTAEEAARAYDSEARRIRG  169

Query  636  KKAKVNFPDDAPL  674
            KKAKVNFPD+AP 
Sbjct  170  KKAKVNFPDEAPC  182



>gb|AGV75741.1| jasmonic acid and ethylene responsive factor [Capsicum annuum 
var. annuum]
Length=309

 Score =   167 bits (422),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 116/185 (63%), Positives = 130/185 (70%), Gaps = 14/185 (8%)
 Frame = +3

Query  150  MCGGAIISDFKPPSRSSRRLTADLLWGRADLsggkkksnssgsh-yskPLRSEVVVLDDD  326
            MCGGAIISD+ PP RSSR+LT+DLLW  +DL+   ++      +   K LRSEVV    D
Sbjct  1    MCGGAIISDWIPPPRSSRQLTSDLLWDFSDLNNNNEEKKKKKKNGSCKTLRSEVV----D  56

Query  327  FEADFQDFKDHSYS-----QVDAKPFAFSASH----RPGFssgpdsdsskdadnsskrkr  479
            F ADFQDF D           D KP  F AS      PG  S    DS+K+ + SSKRKR
Sbjct  57   FAADFQDFNDCFDDDFKDYSFDVKPLVFHASQLSQPAPGSKSLNSVDSNKEIEKSSKRKR  116

Query  480  kNQYRGIRQRPWGKWAAEIRDPSKGVRVWLGTFDTAEEAARAYDIEARRIRGKKAKVNFP  659
            KNQYRGIRQRPWGKWAAEIRDP KGVRVWLGTF TAEEAARAYD+EARRIRG KAKVNFP
Sbjct  117  KNQYRGIRQRPWGKWAAEIRDPQKGVRVWLGTFSTAEEAARAYDVEARRIRGNKAKVNFP  176

Query  660  DDAPL  674
            D+AP+
Sbjct  177  DEAPV  181



>ref|XP_009413994.1| PREDICTED: ethylene-responsive transcription factor 1-like isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=374

 Score =   168 bits (426),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 105/179 (59%), Positives = 120/179 (67%), Gaps = 13/179 (7%)
 Frame = +3

Query  150  MCGGAIISDFKPPSRSSRRLTADLLWGRADLsggkkksnssgshyskPLRSEVVVLDDDF  329
            MCGGAIISD  P +RS+RR+TAD LW   DL  G               R  V V +DDF
Sbjct  1    MCGGAIISDLIPATRSARRVTADYLW--PDLKKGGASGAKKKRRSGN--RRAVEVTEDDF  56

Query  330  EADFQDFKDHSYS-----QVDAKPFAFSASHRPGFssgpdsdsskdadnsskrkrkNQYR  494
            EADF +F   S       +V+ KP AF++       +    + +  A  S+KRKRKNQYR
Sbjct  57   EADFLEFDYESMDSEVEDEVEDKPLAFASKA----VTLKSVEFNGPAARSTKRKRKNQYR  112

Query  495  GIRQRPWGKWAAEIRDPSKGVRVWLGTFDTAEEAARAYDIEARRIRGKKAKVNFPDDAP  671
            GIRQRPWGKWAAEIRDP KGVRVWLGTF+TAEEAARAYD EARRIRGKKAKVNFPD+AP
Sbjct  113  GIRQRPWGKWAAEIRDPRKGVRVWLGTFNTAEEAARAYDTEARRIRGKKAKVNFPDEAP  171



>ref|XP_009413995.1| PREDICTED: ethylene-responsive transcription factor 1-like isoform 
X2 [Musa acuminata subsp. malaccensis]
Length=373

 Score =   168 bits (425),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 105/179 (59%), Positives = 120/179 (67%), Gaps = 14/179 (8%)
 Frame = +3

Query  150  MCGGAIISDFKPPSRSSRRLTADLLWGRADLsggkkksnssgshyskPLRSEVVVLDDDF  329
            MCGGAIISD  P +RS+RR+TAD LW   DL  G               R  V V +DDF
Sbjct  1    MCGGAIISDLIPATRSARRVTADYLW--PDLKKGGASGAKKKRRSGN--RRAVEVTEDDF  56

Query  330  EADFQDFKDHSYS-----QVDAKPFAFSASHRPGFssgpdsdsskdadnsskrkrkNQYR  494
            EADF +F   S       +V+ KP AF++       +    + +  A  S+KRKRKNQYR
Sbjct  57   EADFLEFDYESMDSEVEDEVEDKPLAFASK-----VTLKSVEFNGPAARSTKRKRKNQYR  111

Query  495  GIRQRPWGKWAAEIRDPSKGVRVWLGTFDTAEEAARAYDIEARRIRGKKAKVNFPDDAP  671
            GIRQRPWGKWAAEIRDP KGVRVWLGTF+TAEEAARAYD EARRIRGKKAKVNFPD+AP
Sbjct  112  GIRQRPWGKWAAEIRDPRKGVRVWLGTFNTAEEAARAYDTEARRIRGKKAKVNFPDEAP  170



>gb|KJB57080.1| hypothetical protein B456_009G147300 [Gossypium raimondii]
Length=378

 Score =   168 bits (425),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 112/185 (61%), Positives = 123/185 (66%), Gaps = 22/185 (12%)
 Frame = +3

Query  150  MCGGAIISDFKPPSRSSRRLTADLLWGRADLsggkkksnssgshyskPLRSEVVVLDDDF  329
            MCGGAIISDF  P RS RRLTAD LW   DL   + K  SS            +   D+F
Sbjct  1    MCGGAIISDFIAPVRS-RRLTADYLW--PDLRKSQSKKASSNR-----YSKPAIDFTDNF  52

Query  330  EADFQDFKDHSYS---------QVDAKPFAFSASHRPGFssgpdsdsskdadnsskrkrk  482
            EADFQDFKD               DAKPFAFSA+ +        + S   A+ S+KRKRK
Sbjct  53   EADFQDFKDDKSDIEDYDVDDVLADAKPFAFSAAKK-----ASSTVSHAQAEKSAKRKRK  107

Query  483  NQYRGIRQRPWGKWAAEIRDPSKGVRVWLGTFDTAEEAARAYDIEARRIRGKKAKVNFPD  662
            +QYRGIRQRPWGKWAAEIRDP KGVRVWLGTF+TAEEAARAYD EARRIRGKKAKVNFPD
Sbjct  108  SQYRGIRQRPWGKWAAEIRDPRKGVRVWLGTFNTAEEAARAYDSEARRIRGKKAKVNFPD  167

Query  663  DAPLT  677
            + P T
Sbjct  168  EMPRT  172



>ref|XP_009417534.1| PREDICTED: ethylene-responsive transcription factor 1-like isoform 
X2 [Musa acuminata subsp. malaccensis]
Length=378

 Score =   166 bits (421),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 103/181 (57%), Positives = 121/181 (67%), Gaps = 12/181 (7%)
 Frame = +3

Query  150  MCGGAIISDFKPPSRSSRRLTADLLWGRADLsggkkksnssgshyskPLRSEVVVLDDDF  329
            MCGGAIISDF P +RS+RR+TAD LW   DL  G     +     S   R+ V  ++DDF
Sbjct  1    MCGGAIISDFIPATRSARRVTADYLW--PDLRTGGANGATKKQKKSGHRRA-VEEVEDDF  57

Query  330  EADFQDFKDHSYSQVDA-------KPFAFSASHRPGFssgpdsdsskdadnsskrkrkNQ  488
            E DF +F+  +             KPFAF+    P   +      +  A  S+K++RKNQ
Sbjct  58   ETDFLEFEYEALESEVEDEVEIVEKPFAFACKDGP--VALKPVKFNGSAARSAKKERKNQ  115

Query  489  YRGIRQRPWGKWAAEIRDPSKGVRVWLGTFDTAEEAARAYDIEARRIRGKKAKVNFPDDA  668
            YRGIRQRPWGKWAAEIRDP KGVRVWLGTF+TAEEAARAYD EARRIRGKKAKVNFPD+A
Sbjct  116  YRGIRQRPWGKWAAEIRDPRKGVRVWLGTFNTAEEAARAYDAEARRIRGKKAKVNFPDEA  175

Query  669  P  671
            P
Sbjct  176  P  176



>ref|XP_002304249.2| hypothetical protein POPTR_0003s06930g [Populus trichocarpa]
 ref|XP_006385529.1| hypothetical protein POPTR_0003s06930g [Populus trichocarpa]
 ref|XP_006385530.1| transcription factor EREBP-like family protein [Populus trichocarpa]
 ref|XP_006385531.1| hypothetical protein POPTR_0003s06930g [Populus trichocarpa]
 ref|XP_006385532.1| hypothetical protein POPTR_0003s06930g [Populus trichocarpa]
 gb|EEE79228.2| hypothetical protein POPTR_0003s06930g [Populus trichocarpa]
 gb|ERP63326.1| hypothetical protein POPTR_0003s06930g [Populus trichocarpa]
 gb|ERP63327.1| transcription factor EREBP-like family protein [Populus trichocarpa]
 gb|ERP63328.1| hypothetical protein POPTR_0003s06930g [Populus trichocarpa]
 gb|ERP63329.1| hypothetical protein POPTR_0003s06930g [Populus trichocarpa]
Length=380

 Score =   166 bits (421),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 112/193 (58%), Positives = 126/193 (65%), Gaps = 29/193 (15%)
 Frame = +3

Query  150  MCGGAIISDFKPPS---RSSRRLTADLLWGRADLsggkkksnssgshyskPLRSEVVVLD  320
            MCGGAIISDF  P+   RSSRRLT+   W                   +K L+  V   +
Sbjct  1    MCGGAIISDFIAPTTTARSSRRLTSGFEW-----------LELKKPFNNKHLKPVVADPE  49

Query  321  DDFEADFQDFKDHSYSQ------VDAKPFAFSAS-HRP--------GFssgpdsdsskda  455
            DDFEADFQ+FKD S          DAKPFAFSAS   P        G ++   +  S  A
Sbjct  50   DDFEADFQEFKDESDVDEDYDVFADAKPFAFSASVSEPAQKRGLPRGSTAVKSAGFSGPA  109

Query  456  dnsskrkrkNQYRGIRQRPWGKWAAEIRDPSKGVRVWLGTFDTAEEAARAYDIEARRIRG  635
            + S+KRKRKNQ+RGIRQRPWGKWAAEIRDP KGVRVWLGTF+TAEEAARAYD EARRIRG
Sbjct  110  EKSAKRKRKNQFRGIRQRPWGKWAAEIRDPRKGVRVWLGTFNTAEEAARAYDSEARRIRG  169

Query  636  KKAKVNFPDDAPL  674
            KKAKVNFPD+AP 
Sbjct  170  KKAKVNFPDEAPC  182



>gb|ABK94385.1| unknown [Populus trichocarpa]
Length=379

 Score =   166 bits (421),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 112/193 (58%), Positives = 126/193 (65%), Gaps = 29/193 (15%)
 Frame = +3

Query  150  MCGGAIISDFKPPS---RSSRRLTADLLWGRADLsggkkksnssgshyskPLRSEVVVLD  320
            MCGGAIISDF  P+   RSSRRLT+   W                   +K L+  V   +
Sbjct  1    MCGGAIISDFIAPTTTARSSRRLTSGFEW-----------LELKKPFNNKHLKPVVADPE  49

Query  321  DDFEADFQDFKDHSYSQ------VDAKPFAFSAS-HRP--------GFssgpdsdsskda  455
            DDFEADFQ+FKD S          DAKPFAFSAS   P        G ++   +  S  A
Sbjct  50   DDFEADFQEFKDESDVDEDYDVFADAKPFAFSASVSEPAQKRGLPRGSTAVKSAGFSGPA  109

Query  456  dnsskrkrkNQYRGIRQRPWGKWAAEIRDPSKGVRVWLGTFDTAEEAARAYDIEARRIRG  635
            + S+KRKRKNQ+RGIRQRPWGKWAAEIRDP KGVRVWLGTF+TAEEAARAYD EARRIRG
Sbjct  110  EKSAKRKRKNQFRGIRQRPWGKWAAEIRDPRKGVRVWLGTFNTAEEAARAYDSEARRIRG  169

Query  636  KKAKVNFPDDAPL  674
            KKAKVNFPD+AP 
Sbjct  170  KKAKVNFPDEAPC  182



>gb|AAX20013.1| putative ethylene responsive element binding protein [Gossypium 
hirsutum]
Length=396

 Score =   166 bits (421),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 114/193 (59%), Positives = 126/193 (65%), Gaps = 24/193 (12%)
 Frame = +3

Query  150  MCGGAIISDFKPPSRSSRRLTADLLWGRADLsggkkksnssgshyskPLRSEVVVLDDDF  329
            MCGGAIISDF PP+RS R +TA+ LW   DL     K  S   H  KP     V  +DDF
Sbjct  1    MCGGAIISDFIPPARS-RLVTANYLW--PDLKKSGSKKRSGRKHSKKP----AVGFEDDF  53

Query  330  EADFQDFKDHSYSQVDA-----------KPFAFSASHRP------GFssgpdsdsskdad  458
            EADFQ FKD      D            K FAFSA+ +P      G +S    + S  A+
Sbjct  54   EADFQVFKDEDSDVDDFNDDVDDVLADVKSFAFSATKKPSPAVSHGSNSIKSVEFSGQAE  113

Query  459  nsskrkrkNQYRGIRQRPWGKWAAEIRDPSKGVRVWLGTFDTAEEAARAYDIEARRIRGK  638
             S+KRKRKNQYRGIRQRPWGKWAAEIRDP KGVRVWLGTF+TAEEAARAYD EA RIRGK
Sbjct  114  KSAKRKRKNQYRGIRQRPWGKWAAEIRDPRKGVRVWLGTFNTAEEAARAYDAEALRIRGK  173

Query  639  KAKVNFPDDAPLT  677
            KAKVNFPD+ P T
Sbjct  174  KAKVNFPDETPRT  186



>ref|XP_009417533.1| PREDICTED: ethylene-responsive transcription factor 1-like isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=379

 Score =   166 bits (419),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 104/181 (57%), Positives = 121/181 (67%), Gaps = 11/181 (6%)
 Frame = +3

Query  150  MCGGAIISDFKPPSRSSRRLTADLLWGRADLsggkkksnssgshyskPLRSEVVVLDDDF  329
            MCGGAIISDF P +RS+RR+TAD LW   DL  G     +     S   R+ V  ++DDF
Sbjct  1    MCGGAIISDFIPATRSARRVTADYLW--PDLRTGGANGATKKQKKSGHRRA-VEEVEDDF  57

Query  330  EADFQDFKDHSYSQVDA-------KPFAFSASHRPGFssgpdsdsskdadnsskrkrkNQ  488
            E DF +F+  +             KPFAF A    G  +      +  A  S+K++RKNQ
Sbjct  58   ETDFLEFEYEALESEVEDEVEIVEKPFAF-ACKADGPVALKPVKFNGSAARSAKKERKNQ  116

Query  489  YRGIRQRPWGKWAAEIRDPSKGVRVWLGTFDTAEEAARAYDIEARRIRGKKAKVNFPDDA  668
            YRGIRQRPWGKWAAEIRDP KGVRVWLGTF+TAEEAARAYD EARRIRGKKAKVNFPD+A
Sbjct  117  YRGIRQRPWGKWAAEIRDPRKGVRVWLGTFNTAEEAARAYDAEARRIRGKKAKVNFPDEA  176

Query  669  P  671
            P
Sbjct  177  P  177



>ref|XP_010917392.1| PREDICTED: ethylene-responsive transcription factor 1-like [Elaeis 
guineensis]
Length=386

 Score =   166 bits (419),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 109/184 (59%), Positives = 119/184 (65%), Gaps = 20/184 (11%)
 Frame = +3

Query  150  MCGGAIISDFKPPSRSSRRLTADLLWGRADLsggkkksnssgshyskPLRSEVVVLDDDF  329
            MCGGAIISDF P  RS +R+TAD  W   DL     K  S G       R  VV +DDDF
Sbjct  1    MCGGAIISDFIPSGRS-QRVTADRPW--PDLKKAGAKKKSRGK------RQPVVRIDDDF  51

Query  330  EADFQDFKDHSYSQ--------VDAKPFAF---SASHRPGFssgpdsdsskdadnsskrk  476
            EADFQ+F D S           VD KPFAF   +   R G +     +       S KRK
Sbjct  52   EADFQEFNDESSDSEVDAEAELVDVKPFAFPPRTPFSRDGSTILKPVEYDGTLSKSGKRK  111

Query  477  rkNQYRGIRQRPWGKWAAEIRDPSKGVRVWLGTFDTAEEAARAYDIEARRIRGKKAKVNF  656
            RKNQYRGIRQRPWGKWAAEIRDP KGVRVWLGTF+TAEEAARAYD EAR+IRGKKAKVNF
Sbjct  112  RKNQYRGIRQRPWGKWAAEIRDPRKGVRVWLGTFNTAEEAARAYDAEARKIRGKKAKVNF  171

Query  657  PDDA  668
            PD+ 
Sbjct  172  PDEV  175



>ref|XP_004144443.1| PREDICTED: ethylene-responsive transcription factor RAP2-12 [Cucumis 
sativus]
 ref|XP_011651721.1| PREDICTED: ethylene-responsive transcription factor RAP2-12 [Cucumis 
sativus]
 gb|KGN58469.1| hypothetical protein Csa_3G646560 [Cucumis sativus]
Length=370

 Score =   164 bits (416),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 109/185 (59%), Positives = 124/185 (67%), Gaps = 19/185 (10%)
 Frame = +3

Query  150  MCGGAIISDFKPPSRSSRRLTADLLWGRADLsggkkksnssgshyskPLRSEVVVLDDDF  329
            MCGGAIISDF PPSRS+R +TAD LW         KK  S      + LRS +  +DD F
Sbjct  1    MCGGAIISDFIPPSRSNR-VTADHLW------PNLKKPKSGKHSSPRSLRSRIFDVDD-F  52

Query  330  EADFQDFKDHSYSQ-----VDAKPFAFS-----ASHRPGFssgpdsdsskdadnsskrkr  479
            EADF+DFKD S  +      D KPF FS      S   G S+    + ++ A  S+  KR
Sbjct  53   EADFRDFKDESDVEDEDGFSDIKPFLFSTPNSACSSTRGSSATKSVEFNEQAAKSANTKR  112

Query  480  kNQYRGIRQRPWGKWAAEIRDPSKGVRVWLGTFDTAEEAARAYDIEARRIRGKKAKVNFP  659
            KNQYRGIRQRPWGKWAAEIRDP KG RVWLGTF+TAEEAARAYD EARRIRG KA+VNFP
Sbjct  113  KNQYRGIRQRPWGKWAAEIRDPRKGARVWLGTFNTAEEAARAYDAEARRIRGNKARVNFP  172

Query  660  DDAPL  674
            D+ PL
Sbjct  173  DE-PL  176



>gb|KJB68280.1| hypothetical protein B456_010G236100 [Gossypium raimondii]
Length=396

 Score =   164 bits (415),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 113/193 (59%), Positives = 126/193 (65%), Gaps = 24/193 (12%)
 Frame = +3

Query  150  MCGGAIISDFKPPSRSSRRLTADLLWGRADLsggkkksnssgshyskPLRSEVVVLDDDF  329
            MCGGAIISDF PP+RS R +TA+ LW   DL     K  S   H  KP     V  +DDF
Sbjct  1    MCGGAIISDFIPPARS-RLVTANYLW--PDLKKSGSKKRSGRKHSKKP----AVGFEDDF  53

Query  330  EADFQDFKDHSYSQVDA-----------KPFAFSASHRP------GFssgpdsdsskdad  458
            EADFQ FKD      D            K FAFSA+ +P      G +S    + +  A+
Sbjct  54   EADFQVFKDEDSDVDDFDDDVDDVLADVKSFAFSATEKPSPAVSHGSNSIKSVEFNGQAE  113

Query  459  nsskrkrkNQYRGIRQRPWGKWAAEIRDPSKGVRVWLGTFDTAEEAARAYDIEARRIRGK  638
             S+KRKRKNQYRGIRQRPWGKWAAEIRDP KGVRVWLGTF+TAEEAARAYD EA RIRGK
Sbjct  114  KSAKRKRKNQYRGIRQRPWGKWAAEIRDPRKGVRVWLGTFNTAEEAARAYDAEALRIRGK  173

Query  639  KAKVNFPDDAPLT  677
            KAKVNFPD+ P T
Sbjct  174  KAKVNFPDETPRT  186



>ref|XP_004141728.1| PREDICTED: ethylene-responsive transcription factor RAP2-12-like 
[Cucumis sativus]
 gb|KGN45449.1| hypothetical protein Csa_7G448110 [Cucumis sativus]
Length=389

 Score =   163 bits (413),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 111/185 (60%), Positives = 130/185 (70%), Gaps = 17/185 (9%)
 Frame = +3

Query  150  MCGGAIISDFKPPSRSSRRLTADLLWGRADLsggkkksnssgshyskPLRSEVVVLDDDF  329
            MCGGAIIS F PP RS RR+T + LW          K  + G+  SKP++S+++ +DDDF
Sbjct  1    MCGGAIISGFIPPIRS-RRVTGEHLW-------PNLKQPAFGNQLSKPVKSDIIDIDDDF  52

Query  330  EADFQDFKDHSYSQ------VDAKPFAFSASHR---PGFssgpdsdsskdadnsskrkrk  482
            E DFQ FKD S  +      +D KP AFSA+     P   +    + S  A+ S+KRKRK
Sbjct  53   ETDFQHFKDDSDLEFDVEELLDTKPLAFSAAGDHPVPSARASKSVEFSGQAEKSAKRKRK  112

Query  483  NQYRGIRQRPWGKWAAEIRDPSKGVRVWLGTFDTAEEAARAYDIEARRIRGKKAKVNFPD  662
            NQYRGIRQRPWGKWAAEIRDP KGVRVWLGTF+TAEEAARAYD EARRIRGKKAKVNFPD
Sbjct  113  NQYRGIRQRPWGKWAAEIRDPRKGVRVWLGTFNTAEEAARAYDAEARRIRGKKAKVNFPD  172

Query  663  DAPLT  677
            + P T
Sbjct  173  ETPRT  177



>ref|XP_010932347.1| PREDICTED: ethylene-responsive transcription factor 1-like [Elaeis 
guineensis]
Length=386

 Score =   163 bits (413),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 105/183 (57%), Positives = 121/183 (66%), Gaps = 18/183 (10%)
 Frame = +3

Query  150  MCGGAIISDFKPPSRSSRRLTADLLWGRADLsggkkksnssgshyskPLRSEVVVLDDDF  329
            MCGGAIISDF PP RS RR+TAD  W   DL  G +   S G       +  V + DDDF
Sbjct  1    MCGGAIISDFIPPGRSWRRVTADCPW--PDLKKGVEAKKSRGKR-----QPPVGIDDDDF  53

Query  330  EADFQDFKDHSYSQ--------VDAKPFAFSAS---HRPGFssgpdsdsskdadnsskrk  476
            E DFQ+F D S           +D KPFA+ +     R   ++   ++       S+KRK
Sbjct  54   ETDFQEFNDESPESEVDDEAELIDVKPFAYPSKTPFSRDRSTTLKPAEYDGPVARSAKRK  113

Query  477  rkNQYRGIRQRPWGKWAAEIRDPSKGVRVWLGTFDTAEEAARAYDIEARRIRGKKAKVNF  656
            RKNQYRGIRQRPWGKWAAEIRDP KGVRVWLGTF+TAEEAARAYD EAR+IRGKKAKVNF
Sbjct  114  RKNQYRGIRQRPWGKWAAEIRDPRKGVRVWLGTFNTAEEAARAYDAEARKIRGKKAKVNF  173

Query  657  PDD  665
            PD+
Sbjct  174  PDE  176



>emb|CAD21849.1| ethylene responsive element binding protein [Fagus sylvatica]
Length=375

 Score =   162 bits (411),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 106/183 (58%), Positives = 117/183 (64%), Gaps = 20/183 (11%)
 Frame = +3

Query  150  MCGGAIISDFKPPSRSSRRLTADLLWGRADLsggkkksnssgshyskPLRSEVVVLDDDF  329
            MCGGAIISDF  P+  SRRLTAD LWG           +       K     VV LDD+F
Sbjct  1    MCGGAIISDFIAPT-GSRRLTADYLWG-----------DRKKPISGKRFSKPVVDLDDEF  48

Query  330  EADFQDFKDHSYSQV--------DAKPFAFSASHRPGFssgpdsdsskdadnsskrkrkN  485
            E DFQ FKD   S +        D KPF FSA    G       + +  A+ S+KRKRKN
Sbjct  49   ELDFQGFKDEEESDIDEEEVLVQDVKPFTFSAPPSSGSKPVKSVEFNGQAEKSAKRKRKN  108

Query  486  QYRGIRQRPWGKWAAEIRDPSKGVRVWLGTFDTAEEAARAYDIEARRIRGKKAKVNFPDD  665
            QYRGIRQRPWGKWAAEIRDP KGVRVWLGTF+TAEEAARAYD EARRIRGKK+K NFP  
Sbjct  109  QYRGIRQRPWGKWAAEIRDPRKGVRVWLGTFNTAEEAARAYDAEARRIRGKKSKGNFPMR  168

Query  666  APL  674
             P+
Sbjct  169  LPV  171



>gb|AAW33881.1| apetala2/ethylene responsive factor [Populus tremula x Populus 
alba]
Length=380

 Score =   162 bits (411),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 110/193 (57%), Positives = 123/193 (64%), Gaps = 29/193 (15%)
 Frame = +3

Query  150  MCGGAIISDFKPPS---RSSRRLTADLLWGRADLsggkkksnssgshyskPLRSEVVVLD  320
            MCGGAIIS F  P+   RSSRRLT+   W                   +K L+  V   +
Sbjct  1    MCGGAIISGFIAPTTTARSSRRLTSGFEW-----------LEPKKPFNNKHLKPVVADPE  49

Query  321  DDFEADFQDFKDHSYSQ------VDAKPFAFSASHRP---------GFssgpdsdsskda  455
            DDFEAD Q+FKD S          DAKPFAFSAS            G ++   +  S  A
Sbjct  50   DDFEADLQEFKDESDVDEDYDVFADAKPFAFSASASEPAKKRGLPRGSTAVKSAGFSGLA  109

Query  456  dnsskrkrkNQYRGIRQRPWGKWAAEIRDPSKGVRVWLGTFDTAEEAARAYDIEARRIRG  635
             NS+KRKRKNQ+RGIRQRPWGKWAAEIRDP KGVRVWLGTF+TAEEAARAYD EARRIRG
Sbjct  110  KNSAKRKRKNQFRGIRQRPWGKWAAEIRDPRKGVRVWLGTFNTAEEAARAYDSEARRIRG  169

Query  636  KKAKVNFPDDAPL  674
            KKAKVNFPD+AP 
Sbjct  170  KKAKVNFPDEAPC  182



>ref|XP_008462249.1| PREDICTED: LOW QUALITY PROTEIN: ethylene-responsive transcription 
factor RAP2-12-like [Cucumis melo]
Length=388

 Score =   162 bits (410),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 107/185 (58%), Positives = 128/185 (69%), Gaps = 17/185 (9%)
 Frame = +3

Query  150  MCGGAIISDFKPPSRSSRRLTADLLWGRADLsggkkksnssgshyskPLRSEVVVLDDDF  329
            MCGGAIIS F PP+RS RR+T + LW          K  + G+  SKP++S+++ +DDDF
Sbjct  1    MCGGAIISGFIPPTRS-RRVTGEHLW-------PNLKKPAFGNQLSKPVKSDIIDIDDDF  52

Query  330  EADFQDFKDHSYSQ------VDAKPFAFSASHRPGFssgpdsdsskdadnsskrkr---k  482
            E DF+ FKD S  +      +D KP AFSA+  P   S   S S + +  + K  +   K
Sbjct  53   ETDFKHFKDDSDLEFDVEELLDTKPLAFSAAGNPPVPSARASKSVEFSGQAEKSAKRKRK  112

Query  483  NQYRGIRQRPWGKWAAEIRDPSKGVRVWLGTFDTAEEAARAYDIEARRIRGKKAKVNFPD  662
            NQYRGIRQRPWGKWAAEIRDP KGVRVWLGTF+TAEEAARAYD EARRIRGKKAKVNFP 
Sbjct  113  NQYRGIRQRPWGKWAAEIRDPRKGVRVWLGTFNTAEEAARAYDAEARRIRGKKAKVNFPY  172

Query  663  DAPLT  677
            +AP T
Sbjct  173  EAPRT  177



>ref|XP_009391208.1| PREDICTED: ethylene-responsive transcription factor 1-like [Musa 
acuminata subsp. malaccensis]
Length=379

 Score =   162 bits (409),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 103/183 (56%), Positives = 125/183 (68%), Gaps = 13/183 (7%)
 Frame = +3

Query  150  MCGGAIISDFKPPSRSSRRLTADLLWGRADLsggkkksnssgshyskPLRSEVVVLDDDF  329
            MCGGAIISDF P  R  RR+TAD LW        +  +N   +  S   R  V   +DDF
Sbjct  1    MCGGAIISDFIPTVRPERRVTADYLW----RGLKRGGANGVKTKKSNGHRRAVKDTEDDF  56

Query  330  EADFQDFKDHSY-SQVDAK------PFAFSASHRPGFssgpdsdsskdadnsskrkrkNQ  488
            EADFQ+F+  S  S+V+ +      PFA +++ R    +    + +  A  S+K+KRKNQ
Sbjct  57   EADFQEFEYESMVSEVEDEVEHVDTPFALASTDRQ--VTLKPVEFNGPAARSAKKKRKNQ  114

Query  489  YRGIRQRPWGKWAAEIRDPSKGVRVWLGTFDTAEEAARAYDIEARRIRGKKAKVNFPDDA  668
            YRGIRQRPWGKWAAEIRDP KGVRVWLGTF+TAEEAARAYD EAR+IRGKKAKVNFPD+A
Sbjct  115  YRGIRQRPWGKWAAEIRDPRKGVRVWLGTFNTAEEAARAYDAEARKIRGKKAKVNFPDEA  174

Query  669  PLT  677
            P +
Sbjct  175  PTS  177



>ref|XP_010552191.1| PREDICTED: ethylene-responsive transcription factor RAP2-12-like 
isoform X2 [Tarenaya hassleriana]
Length=352

 Score =   160 bits (405),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 109/192 (57%), Positives = 123/192 (64%), Gaps = 29/192 (15%)
 Frame = +3

Query  150  MCGGAIISDFKPPSRSSRRLTADLLWGRADLsggkkksnssgshyskPLRSEVVVLDDDF  329
            MCGGAIISDF PP+RS RR   D +W  ADL    KKS           RS    LDD+F
Sbjct  1    MCGGAIISDFIPPARS-RRGANDNIW--ADLKKNAKKSARK--------RSAFFDLDDEF  49

Query  330  EADFQDFKDHSYSQ-----------VDAKPFAFSASHRP------GFssgpdsds-skda  455
            EADFQ FK+ S               D KP  F+ S +P      GF+    +   +  A
Sbjct  50   EADFQGFKNDSSVDFEDDFEADDVFADVKPPVFATSPKPAAAESDGFAPAKKAPEFNGQA  109

Query  456  dnsskrkrkNQYRGIRQRPWGKWAAEIRDPSKGVRVWLGTFDTAEEAARAYDIEARRIRG  635
            + S+ RKRKNQYRGIRQRPWGKWAAEIRDP KGVRVWLGTF+TAEEAARAYD EARRIRG
Sbjct  110  EKSATRKRKNQYRGIRQRPWGKWAAEIRDPRKGVRVWLGTFNTAEEAARAYDDEARRIRG  169

Query  636  KKAKVNFPDDAP  671
            KKAKVNFP++ P
Sbjct  170  KKAKVNFPEETP  181



>ref|XP_010552190.1| PREDICTED: ethylene-responsive transcription factor RAP2-12-like 
isoform X1 [Tarenaya hassleriana]
Length=378

 Score =   160 bits (406),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 109/192 (57%), Positives = 123/192 (64%), Gaps = 29/192 (15%)
 Frame = +3

Query  150  MCGGAIISDFKPPSRSSRRLTADLLWGRADLsggkkksnssgshyskPLRSEVVVLDDDF  329
            MCGGAIISDF PP+RS RR   D +W  ADL    KKS           RS    LDD+F
Sbjct  1    MCGGAIISDFIPPARS-RRGANDNIW--ADLKKNAKKSARK--------RSAFFDLDDEF  49

Query  330  EADFQDFKDHSYSQ-----------VDAKPFAFSASHRP------GFssgpdsds-skda  455
            EADFQ FK+ S               D KP  F+ S +P      GF+    +   +  A
Sbjct  50   EADFQGFKNDSSVDFEDDFEADDVFADVKPPVFATSPKPAAAESDGFAPAKKAPEFNGQA  109

Query  456  dnsskrkrkNQYRGIRQRPWGKWAAEIRDPSKGVRVWLGTFDTAEEAARAYDIEARRIRG  635
            + S+ RKRKNQYRGIRQRPWGKWAAEIRDP KGVRVWLGTF+TAEEAARAYD EARRIRG
Sbjct  110  EKSATRKRKNQYRGIRQRPWGKWAAEIRDPRKGVRVWLGTFNTAEEAARAYDDEARRIRG  169

Query  636  KKAKVNFPDDAP  671
            KKAKVNFP++ P
Sbjct  170  KKAKVNFPEETP  181



>gb|ACI62768.1| dehydration-responsive element binding protein [Krascheninnikovia 
arborescens]
Length=372

 Score =   160 bits (404),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 103/182 (57%), Positives = 121/182 (66%), Gaps = 22/182 (12%)
 Frame = +3

Query  150  MCGGAIISDFKPPSRSSRRLTADLLWGRADLsggkkksnssgshyskPLRSEVVVLDDD-  326
            MCGGA+ISDF P  RS  RLTAD LW   DL   +             LRS    +DDD 
Sbjct  1    MCGGAVISDFIPTGRS-HRLTADYLW--PDLKSKR-------------LRSVDNDVDDDE  44

Query  327  -FEADFQDFKDHSYSQVDA----KPFAFSASHRPGFssgpdsdsskdadnsskrkrkNQY  491
             FEADF DFKD S   +      KP +F+  +    +     + +  A+ ++KRKRKNQY
Sbjct  45   AFEADFLDFKDESDDDISISPTFKPSSFAPFNPKSTTGLKPVEFNSQAEKTAKRKRKNQY  104

Query  492  RGIRQRPWGKWAAEIRDPSKGVRVWLGTFDTAEEAARAYDIEARRIRGKKAKVNFPDDAP  671
            RGIRQRPWGKWAAEIRDP KGVRVWLGTF+TAEEAARAYD EARRIRG KAKVNFP++AP
Sbjct  105  RGIRQRPWGKWAAEIRDPRKGVRVWLGTFNTAEEAARAYDAEARRIRGDKAKVNFPEEAP  164

Query  672  LT  677
            ++
Sbjct  165  VS  166



>ref|XP_006426778.1| hypothetical protein CICLE_v10025816mg [Citrus clementina]
 ref|XP_006426782.1| hypothetical protein CICLE_v10025816mg [Citrus clementina]
 gb|ESR40018.1| hypothetical protein CICLE_v10025816mg [Citrus clementina]
 gb|ESR40022.1| hypothetical protein CICLE_v10025816mg [Citrus clementina]
Length=386

 Score =   160 bits (404),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 101/190 (53%), Positives = 115/190 (61%), Gaps = 35/190 (18%)
 Frame = +3

Query  150  MCGGAIISDFKPPSRSSR--RLTADLLWGRADLsggkkksnssgshyskPLRSEVVVLDD  323
            MCGGAIIS + PP+   R  +LTA+ LW     S  K              +    ++DD
Sbjct  1    MCGGAIISGYIPPTVPGRPKKLTAEYLWPELKRSSNK--------------KYSKPIVDD  46

Query  324  DFEADFQDFKDHS--------------YSQVDAKPFAFSASHRPGFssgpdsdsskdadn  461
            DFEADFQ FKD                    D KPF FSA  +            + A  
Sbjct  47   DFEADFQGFKDDEEESDIDGDVDVDADLMMADIKPFTFSAGRK-----SHAVKHVEQAKK  101

Query  462  sskrkrkNQYRGIRQRPWGKWAAEIRDPSKGVRVWLGTFDTAEEAARAYDIEARRIRGKK  641
            S++RKRKNQYRGIRQRPWGKWAAEIRDP+KGVRVWLGTF+TAEEAARAYD EARRIRGKK
Sbjct  102  STERKRKNQYRGIRQRPWGKWAAEIRDPTKGVRVWLGTFNTAEEAARAYDAEARRIRGKK  161

Query  642  AKVNFPDDAP  671
            AKVNFPD+ P
Sbjct  162  AKVNFPDETP  171



>ref|XP_006426779.1| hypothetical protein CICLE_v10025816mg [Citrus clementina]
 ref|XP_006426780.1| hypothetical protein CICLE_v10025816mg [Citrus clementina]
 ref|XP_006426781.1| hypothetical protein CICLE_v10025816mg [Citrus clementina]
 gb|ESR40019.1| hypothetical protein CICLE_v10025816mg [Citrus clementina]
 gb|ESR40020.1| hypothetical protein CICLE_v10025816mg [Citrus clementina]
 gb|ESR40021.1| hypothetical protein CICLE_v10025816mg [Citrus clementina]
Length=389

 Score =   160 bits (404),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 101/190 (53%), Positives = 115/190 (61%), Gaps = 32/190 (17%)
 Frame = +3

Query  150  MCGGAIISDFKPPSRSSR--RLTADLLWGRADLsggkkksnssgshyskPLRSEVVVLDD  323
            MCGGAIIS + PP+   R  +LTA+ LW     S  K              +    ++DD
Sbjct  1    MCGGAIISGYIPPTVPGRPKKLTAEYLWPELKRSSNK--------------KYSKPIVDD  46

Query  324  DFEADFQDFKDHS--------------YSQVDAKPFAFSASHRPGFssgpdsdsskdadn  461
            DFEADFQ FKD                    D KPF FSA  +            + A  
Sbjct  47   DFEADFQGFKDDEEESDIDGDVDVDADLMMADIKPFTFSAGRKS--HGSTAVKHVEQAKK  104

Query  462  sskrkrkNQYRGIRQRPWGKWAAEIRDPSKGVRVWLGTFDTAEEAARAYDIEARRIRGKK  641
            S++RKRKNQYRGIRQRPWGKWAAEIRDP+KGVRVWLGTF+TAEEAARAYD EARRIRGKK
Sbjct  105  STERKRKNQYRGIRQRPWGKWAAEIRDPTKGVRVWLGTFNTAEEAARAYDAEARRIRGKK  164

Query  642  AKVNFPDDAP  671
            AKVNFPD+ P
Sbjct  165  AKVNFPDETP  174



>ref|XP_006465817.1| PREDICTED: ethylene-responsive transcription factor RAP2-12-like 
isoform X1 [Citrus sinensis]
 ref|XP_006465818.1| PREDICTED: ethylene-responsive transcription factor RAP2-12-like 
isoform X2 [Citrus sinensis]
 ref|XP_006465819.1| PREDICTED: ethylene-responsive transcription factor RAP2-12-like 
isoform X3 [Citrus sinensis]
 ref|XP_006465820.1| PREDICTED: ethylene-responsive transcription factor RAP2-12-like 
isoform X4 [Citrus sinensis]
Length=389

 Score =   160 bits (404),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 101/190 (53%), Positives = 115/190 (61%), Gaps = 32/190 (17%)
 Frame = +3

Query  150  MCGGAIISDFKPPSRSSR--RLTADLLWGRADLsggkkksnssgshyskPLRSEVVVLDD  323
            MCGGAIIS + PP+   R  +LTA+ LW     S  K              +    ++DD
Sbjct  1    MCGGAIISGYIPPTVPGRPKKLTAEYLWPELKRSSNK--------------KYSKPIVDD  46

Query  324  DFEADFQDFKDHS--------------YSQVDAKPFAFSASHRPGFssgpdsdsskdadn  461
            DFEADFQ FKD                    D KPF FSA  +            + A  
Sbjct  47   DFEADFQGFKDDEEESDIDGDVDVDADLMMADIKPFTFSAGRKS--HGSTAVKHVEQAKK  104

Query  462  sskrkrkNQYRGIRQRPWGKWAAEIRDPSKGVRVWLGTFDTAEEAARAYDIEARRIRGKK  641
            S++RKRKNQYRGIRQRPWGKWAAEIRDP+KGVRVWLGTF+TAEEAARAYD EARRIRGKK
Sbjct  105  STERKRKNQYRGIRQRPWGKWAAEIRDPTKGVRVWLGTFNTAEEAARAYDAEARRIRGKK  164

Query  642  AKVNFPDDAP  671
            AKVNFPD+ P
Sbjct  165  AKVNFPDETP  174



>ref|XP_008797374.1| PREDICTED: ethylene-responsive transcription factor 1-like [Phoenix 
dactylifera]
Length=380

 Score =   159 bits (403),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 105/184 (57%), Positives = 116/184 (63%), Gaps = 20/184 (11%)
 Frame = +3

Query  150  MCGGAIISDFKPPSRSSRRLTADLLWGRADLsggkkksnssgshyskPLRSEVVVLDDDF  329
            MCGGAIISDF P  RS RR+TAD LW   DL     +  S G       R   V +DDDF
Sbjct  1    MCGGAIISDFIPTERS-RRVTADHLW--PDLKKAGAQKKSGGK------RQPAVGIDDDF  51

Query  330  EADFQDFKDHSYSQ--------VDAKPFAFSASH---RPGFssgpdsdsskdadnsskrk  476
            EADFQ+F D S           +D KPFA        R G +             S+ RK
Sbjct  52   EADFQEFNDESSESEEDDQAELIDVKPFAVPPKTPFPRDGSTILKPVGYDGPIAKSANRK  111

Query  477  rkNQYRGIRQRPWGKWAAEIRDPSKGVRVWLGTFDTAEEAARAYDIEARRIRGKKAKVNF  656
            RKNQYRGIRQRPWGKWAAEIRDP KGVRVWLGTF+TAEEAARAYD EAR+IRGKKAKVNF
Sbjct  112  RKNQYRGIRQRPWGKWAAEIRDPRKGVRVWLGTFNTAEEAARAYDAEARKIRGKKAKVNF  171

Query  657  PDDA  668
            P++ 
Sbjct  172  PNEV  175



>ref|XP_006828662.1| PREDICTED: ethylene-responsive transcription factor ERF073 [Amborella 
trichopoda]
 gb|ERM96078.1| hypothetical protein AMTR_s00129p00119770 [Amborella trichopoda]
Length=303

 Score =   157 bits (398),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 99/176 (56%), Positives = 118/176 (67%), Gaps = 29/176 (16%)
 Frame = +3

Query  150  MCGGAIISDFKPPSRSSRRLTADLLWGRADLsggkkksnssgshyskPLRSEVVVLDDDF  329
            MCGGAIISDF P +RS RR+T + +                        +S  + +DDDF
Sbjct  1    MCGGAIISDFIPTNRS-RRITRNQI------------------------KSPFIDIDDDF  35

Query  330  EADFQDFKDHS-YSQVDAKPFAF---SASHRPGFssgpdsdsskdadnsskrkrkNQYRG  497
            EADFQ+FKD S   + D KPFAF     + + G+   P+  +S   + S+KRKRKN +RG
Sbjct  36   EADFQEFKDESDEGEEDIKPFAFPKGGITEQGGYLKVPELKTSSLPERSAKRKRKNVFRG  95

Query  498  IRQRPWGKWAAEIRDPSKGVRVWLGTFDTAEEAARAYDIEARRIRGKKAKVNFPDD  665
            IRQRPWGKWAAEIRDP KGVRVWLGTF+TAEEAARAYD EARRIRG KAKVNFP+D
Sbjct  96   IRQRPWGKWAAEIRDPGKGVRVWLGTFNTAEEAARAYDAEARRIRGPKAKVNFPND  151



>gb|AEQ58795.1| ethylene response factor [Rumex acetosa]
Length=364

 Score =   158 bits (400),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 102/184 (55%), Positives = 122/184 (66%), Gaps = 15/184 (8%)
 Frame = +3

Query  150  MCGGAIISDFKPPSRSSRRLTADLLWGRADLsggkkksnssgshyskPLRSEVV-VLDD-  323
            MCGGAIISDF  P+++S RLTA  LW       G     +     SKP RS V  V +D 
Sbjct  1    MCGGAIISDF-IPAKASGRLTATELWS------GISGEVTKKKGLSKPARSHVSDVFNDY  53

Query  324  -DFEADFQDFKDHSYSQV--DAKPFAFSASHRPGFssgpdsdsskdadnsskrkr---kN  485
             +FEADF +FKD S  +   D KPFA    +   F+S   S +++    + K  +   KN
Sbjct  54   VNFEADFLEFKDESDGEEMEDVKPFAAKGFNPISFNSSQGSKATEFNSQAEKSAKRKRKN  113

Query  486  QYRGIRQRPWGKWAAEIRDPSKGVRVWLGTFDTAEEAARAYDIEARRIRGKKAKVNFPDD  665
            QYRGIRQRPWGKWAAEIRDP KGVRVWLGTF+TAEEAARAYD EARRIRG KAKVNFP++
Sbjct  114  QYRGIRQRPWGKWAAEIRDPRKGVRVWLGTFNTAEEAARAYDAEARRIRGNKAKVNFPEN  173

Query  666  APLT  677
             P++
Sbjct  174  FPVS  177



>ref|XP_010534976.1| PREDICTED: ethylene-responsive transcription factor RAP2-12 [Tarenaya 
hassleriana]
Length=378

 Score =   158 bits (400),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 108/197 (55%), Positives = 124/197 (63%), Gaps = 33/197 (17%)
 Frame = +3

Query  150  MCGGAIISDFKPPSRSSRRLTADLLWGRADLsggkkksnssgshyskPLRSEVVVLDDDF  329
            MCGGAIISDF PP +S  R  +D +W  +DL    K    +        RS+   L+++F
Sbjct  1    MCGGAIISDFIPPPKS-HRGASDYVW--SDLKKNAKSLKKNSKK-----RSDFFDLENEF  52

Query  330  EADFQDFKD-------------HSYSQVDAKPFAFSASHRPGFssgpdsdssk-------  449
            EADFQ FKD             H +S  D KPF F+A  +P   S  DSD S        
Sbjct  53   EADFQGFKDDSSIDFEDDFNADHVFS--DVKPFVFAAPPKPAVRSAADSDGSAPSKKGPE  110

Query  450  ---dadnsskrkrkNQYRGIRQRPWGKWAAEIRDPSKGVRVWLGTFDTAEEAARAYDIEA  620
                 + S KRKRKNQYRGIRQRPWGKWAAEIRDP KGVRVWLGTF+TAEEAARAYD EA
Sbjct  111  FNGQTEKSVKRKRKNQYRGIRQRPWGKWAAEIRDPRKGVRVWLGTFNTAEEAARAYDAEA  170

Query  621  RRIRGKKAKVNFPDDAP  671
            RRIRGKKAKVNFP++ P
Sbjct  171  RRIRGKKAKVNFPEETP  187



>ref|XP_008460339.1| PREDICTED: ethylene-responsive transcription factor RAP2-12 [Cucumis 
melo]
 ref|XP_008460340.1| PREDICTED: ethylene-responsive transcription factor RAP2-12 [Cucumis 
melo]
Length=370

 Score =   158 bits (400),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 108/185 (58%), Positives = 123/185 (66%), Gaps = 19/185 (10%)
 Frame = +3

Query  150  MCGGAIISDFKPPSRSSRRLTADLLWGRADLsggkkksnssgshyskPLRSEVVVLDDDF  329
            MCGGAIISDF PPS  S R+TAD LW         KK  S      + LRS +  +DD F
Sbjct  1    MCGGAIISDFIPPS-CSNRVTADHLW------PNLKKPKSGKHSSPRSLRSRIFDVDD-F  52

Query  330  EADFQDFKDHSYSQV-----DAKPFAFS-----ASHRPGFssgpdsdsskdadnsskrkr  479
            EADF+DFKD S  +      D KPF FS      S   G S+    + ++ A+ S+  KR
Sbjct  53   EADFRDFKDESDVEDEDDFSDIKPFLFSTPNSACSSTRGSSATKSLEFNEQAEKSANTKR  112

Query  480  kNQYRGIRQRPWGKWAAEIRDPSKGVRVWLGTFDTAEEAARAYDIEARRIRGKKAKVNFP  659
            KNQYRGIRQRPWGKWAAEIRDP KG RVWLGTF+TAEEAARAYD EARRIRG KA+VNFP
Sbjct  113  KNQYRGIRQRPWGKWAAEIRDPRKGARVWLGTFNTAEEAARAYDAEARRIRGNKARVNFP  172

Query  660  DDAPL  674
            D+ PL
Sbjct  173  DE-PL  176



>ref|XP_004510558.1| PREDICTED: ethylene-responsive transcription factor RAP2-12-like 
isoform X1 [Cicer arietinum]
 ref|XP_004510559.1| PREDICTED: ethylene-responsive transcription factor RAP2-12-like 
isoform X2 [Cicer arietinum]
Length=393

 Score =   158 bits (399),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 99/201 (49%), Positives = 120/201 (60%), Gaps = 41/201 (20%)
 Frame = +3

Query  150  MCGGAIISDFKPPSRS---SRRLTADLLWGRADLsggkkksnssgshyskPLRSEVVVLD  320
            MCGGAIISDF P + +   SRR+TAD+LW            N       KP      +LD
Sbjct  1    MCGGAIISDFIPAAAAVGGSRRVTADILW-----------PNLRKQGSRKPF-----LLD  44

Query  321  DDFEADFQDFKDHSYSQ-------------VDAKPFAFSASHRPGFssgpdsdsskdadn  461
            DDFEA F++FKD S                V  K F FS+++   F +     ++  + +
Sbjct  45   DDFEAGFREFKDDSDFDEDEEDDDDDEGLLVGGKGFTFSSNNTKSFKTFSRGSTAAKSVS  104

Query  462  sskrkrk---------NQYRGIRQRPWGKWAAEIRDPSKGVRVWLGTFDTAEEAARAYDI  614
                ++          NQYRGIRQRPWGKWAAEIRDP KGVRVWLGTF+TAEEAARAYD 
Sbjct  105  PKSNEQAEKECKRKRKNQYRGIRQRPWGKWAAEIRDPRKGVRVWLGTFNTAEEAARAYDA  164

Query  615  EARRIRGKKAKVNFPDDAPLT  677
            EARRIRGKKAKVNFP++AP+T
Sbjct  165  EARRIRGKKAKVNFPEEAPVT  185



>ref|XP_008784363.1| PREDICTED: ethylene-responsive transcription factor 1-like [Phoenix 
dactylifera]
Length=385

 Score =   157 bits (397),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 107/183 (58%), Positives = 119/183 (65%), Gaps = 22/183 (12%)
 Frame = +3

Query  150  MCGGAIISDFKPPSRSSRRLTADLLWGRADLsggkkksnssgshyskPLRSEVVVLDDDF  329
            MCGGAIISD+ P +R S+R+TAD LW   DL  G     S G       R E    DDDF
Sbjct  1    MCGGAIISDYIPTAR-SQRVTADYLW--PDLKKGGAAKKSKG------KRQE--FQDDDF  49

Query  330  EADFQDFKDHSYSQ--------VDAKPFAF---SASHRPGFssgpdsdsskdadnsskrk  476
            EADFQ+F D S           VD KPFA    +   R G +     +       S+KRK
Sbjct  50   EADFQEFHDESSESEGDDEPELVDVKPFACPPKTPFSRDGSTILKHEEYDGPVAKSAKRK  109

Query  477  rkNQYRGIRQRPWGKWAAEIRDPSKGVRVWLGTFDTAEEAARAYDIEARRIRGKKAKVNF  656
            RKNQYRGIRQRPWGKWAAEIRDP KGVRVWLGTF+TAEEAARAYD EAR+IRGKKAKVNF
Sbjct  110  RKNQYRGIRQRPWGKWAAEIRDPRKGVRVWLGTFNTAEEAARAYDAEARKIRGKKAKVNF  169

Query  657  PDD  665
            PD+
Sbjct  170  PDE  172



>dbj|BAE71206.1| putative transcription factor EREBP [Trifolium pratense]
Length=385

 Score =   157 bits (397),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 106/198 (54%), Positives = 122/198 (62%), Gaps = 39/198 (20%)
 Frame = +3

Query  150  MCGGAIISDFKPPSRS---SRRLTADLLWGRADLsggkkksnssgshyskPLRSEVVVLD  320
            MCGGAIISDF P + +   SRR+TAD+LW   +L                  +    +LD
Sbjct  1    MCGGAIISDFIPAAAAVGGSRRVTADILW--PNLRKTGS-------------KKSSFLLD  45

Query  321  DDFEADFQDFKDHSYSQ------------VDAKPFAFSASHR---------PGFssgpds  437
            DDFEA F+ FKD S               V  K F F+AS+             +    S
Sbjct  46   DDFEAGFRQFKDDSDFDEDEDEDDDEGLLVGVKGFTFAASNNKSSRNFSRGSAGAKSVAS  105

Query  438  dsskdadnsskrkrkNQYRGIRQRPWGKWAAEIRDPSKGVRVWLGTFDTAEEAARAYDIE  617
             S++ A+  SKRKRKNQYRGIRQRPWGKWAAEIRDP KGVRVWLGTF+TAEEAARAYD E
Sbjct  106  KSNEQAEKESKRKRKNQYRGIRQRPWGKWAAEIRDPRKGVRVWLGTFNTAEEAARAYDAE  165

Query  618  ARRIRGKKAKVNFPDDAP  671
            ARRIRGKKAKVNFPD+AP
Sbjct  166  ARRIRGKKAKVNFPDEAP  183



>ref|XP_006598772.1| PREDICTED: ethylene responsive protein isoform X1 [Glycine max]
 ref|XP_006598773.1| PREDICTED: ethylene responsive protein isoform X2 [Glycine max]
Length=382

 Score =   157 bits (396),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 107/191 (56%), Positives = 122/191 (64%), Gaps = 37/191 (19%)
 Frame = +3

Query  150  MCGGAIISDFKP--PSRSSRRLTADLLWGRADLsggkkksnssgshyskPLRSEVVVLDD  323
            MCGGAIISDF P  P+  +RR+TAD+LW             S    +SKPL      LDD
Sbjct  1    MCGGAIISDFIPAGPASGARRVTADILW------------PSLRKRFSKPL------LDD  42

Query  324  DFEADFQDFKDHSYSQ------------VDAKPFAFS-----ASHRPGFssgpdsdsskd  452
            DFEA F++FKD S  +            +  KPF FS     A+ +P        +S   
Sbjct  43   DFEAGFREFKDDSEIEDVDDEDDEDEEELKKKPFGFSRSSNKAASKPLSRGSATVESKGQ  102

Query  453  adnsskrkrkNQYRGIRQRPWGKWAAEIRDPSKGVRVWLGTFDTAEEAARAYDIEARRIR  632
            A+  +KRKRKNQYRGIRQRPWGKWAAEIRDP KGVRVWLGTF TAEEAARAYD EARRIR
Sbjct  103  AEKCAKRKRKNQYRGIRQRPWGKWAAEIRDPRKGVRVWLGTFSTAEEAARAYDAEARRIR  162

Query  633  GKKAKVNFPDD  665
            GKKAKVNFPD+
Sbjct  163  GKKAKVNFPDE  173



>ref|XP_010029503.1| PREDICTED: LOW QUALITY PROTEIN: ethylene-responsive transcription 
factor RAP2-12 [Eucalyptus grandis]
Length=383

 Score =   156 bits (395),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 114/184 (62%), Positives = 126/184 (68%), Gaps = 25/184 (14%)
 Frame = +3

Query  150  MCGGAIISDFKPPSRSSRRLTADLLWGRADLsggkkksnssgshyskPLRSEVVVLDDD-  326
            MCGGAIISDF      SRRLT+D LW   DL     K +        P RSEVV + DD 
Sbjct  1    MCGGAIISDF-----XSRRLTSDFLW--PDLKRSAGKQSRR------PARSEVVDVVDDD  47

Query  327  FEADFQDFKDHSYSQVDA--------KPFAFSAS---HRPGFssgpdsdsskdadnsskr  473
            FEADFQ FKD S  + D         KPFAFSA+   +  G S+    + +  A+ S+KR
Sbjct  48   FEADFQGFKDESDVEDDFDDEVEVDVKPFAFSAAEPRYSKGSSTTKSVEYNGQAEKSAKR  107

Query  474  krkNQYRGIRQRPWGKWAAEIRDPSKGVRVWLGTFDTAEEAARAYDIEARRIRGKKAKVN  653
            KRKNQYRGIRQRPWGKWAAEIRDP KGVRVWLGTF+TAEEAARAYD EARRIRGKKAKVN
Sbjct  108  KRKNQYRGIRQRPWGKWAAEIRDPRKGVRVWLGTFNTAEEAARAYDAEARRIRGKKAKVN  167

Query  654  FPDD  665
            FPDD
Sbjct  168  FPDD  171



>ref|XP_002533237.1| Ethylene-responsive transcription factor, putative [Ricinus communis]
 gb|EEF29138.1| Ethylene-responsive transcription factor, putative [Ricinus communis]
Length=383

 Score =   155 bits (393),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 117/194 (60%), Positives = 128/194 (66%), Gaps = 30/194 (15%)
 Frame = +3

Query  150  MCGGAIISDFKPPS----RSSRRLTADLLWGRADLsggkkksnssgshyskPLRSEVVVL  317
            MCGGAIISD+ PP+     SSRRLTAD LW   DL     K  S            VV L
Sbjct  1    MCGGAIISDYIPPTISGRSSSRRLTADFLW--PDLKKPVGKQYSKP--------VVVVDL  50

Query  318  DDDFEADFQDFKDHSYSQVDA------KPFAFSAS-----HRP-----GFssgpdsdssk  449
            DDDFEADFQ+FKD S  + D       KPF  SAS     HR      G +     + + 
Sbjct  51   DDDFEADFQEFKDESDVEEDEDVVLDVKPFGVSASALSPPHRKSAVSRGPTPVKTVEFNG  110

Query  450  dadnsskrkrkNQYRGIRQRPWGKWAAEIRDPSKGVRVWLGTFDTAEEAARAYDIEARRI  629
             A+ S+KRKRKNQYRGIRQRPWGKWAAEIRDP KGVRVWLGTF+TAEEAARAYD EARRI
Sbjct  111  QAEKSAKRKRKNQYRGIRQRPWGKWAAEIRDPRKGVRVWLGTFNTAEEAARAYDAEARRI  170

Query  630  RGKKAKVNFPDDAP  671
            RGKKAKVNFPD+AP
Sbjct  171  RGKKAKVNFPDEAP  184



>ref|NP_001236578.1| ethylene responsive protein [Glycine max]
 gb|AAQ10777.1| ethylene responsive protein [Glycine max]
Length=384

 Score =   155 bits (393),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 108/194 (56%), Positives = 125/194 (64%), Gaps = 40/194 (21%)
 Frame = +3

Query  150  MCGGAIISDFKP--PSRSSRRLTADLLWGRADLsggkkksnssgshyskPLRSEVVVLDD  323
            MCGGAIISDF P  P+  +RR+TAD+LW             S    +SKPL      LDD
Sbjct  1    MCGGAIISDFIPAGPASGARRVTADILW------------PSLRKRFSKPL------LDD  42

Query  324  DFEADFQDFKDHSYSQ------------VDAKPFAFS-----ASHRP---GFssgpdsds  443
            DFEA F++FKD S  +            +  KPF FS     A+ +P   G ++    +S
Sbjct  43   DFEAGFREFKDDSEIEDVDDEDDEDEEELKKKPFGFSRSSNKAASKPLSRGATTVKSVES  102

Query  444  skdadnsskrkrkNQYRGIRQRPWGKWAAEIRDPSKGVRVWLGTFDTAEEAARAYDIEAR  623
               A+  +KRKRKNQYRGIRQRPWGKWAAEIRDP KGVRVWLGTF TAEEAARAYD EAR
Sbjct  103  KGQAEKCAKRKRKNQYRGIRQRPWGKWAAEIRDPRKGVRVWLGTFSTAEEAARAYDAEAR  162

Query  624  RIRGKKAKVNFPDD  665
            RIRGKKAKVNFPD+
Sbjct  163  RIRGKKAKVNFPDE  176



>gb|AEQ58797.1| ethylene response factor [Rumex palustris]
Length=367

 Score =   155 bits (391),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 103/184 (56%), Positives = 119/184 (65%), Gaps = 15/184 (8%)
 Frame = +3

Query  150  MCGGAIISDFKPPSRSSRRLTADLLWGRADLsggkkksnssgshyskPLRSEVV-VLDD-  323
            MCGGAIISDF P ++ S RLTA  LW       G     +    +SKP RS +  V +D 
Sbjct  1    MCGGAIISDFIP-TKGSGRLTAGELW------SGIPSEVTRQKGFSKPARSHMSDVFNDY  53

Query  324  -DFEADFQDFKDHSYSQV--DAKPFAFSASHRPGFssgpdsdsskdadnsskrkr---kN  485
             +FEADF +FKD S  +   D KPFA    +   FSS     S++    + K  +   KN
Sbjct  54   VNFEADFLEFKDESDGEELEDVKPFAVKGLNPFNFSSSQGLKSAEFTSQAEKSAKRKRKN  113

Query  486  QYRGIRQRPWGKWAAEIRDPSKGVRVWLGTFDTAEEAARAYDIEARRIRGKKAKVNFPDD  665
            QYRGIRQRPWGKWAAEIRDP KGVRVWLGTF+TAEEAARAYD EARRIRG KAKVNFP D
Sbjct  114  QYRGIRQRPWGKWAAEIRDPRKGVRVWLGTFNTAEEAARAYDAEARRIRGNKAKVNFPVD  173

Query  666  APLT  677
             P +
Sbjct  174  IPAS  177



>ref|XP_009417991.1| PREDICTED: ethylene-responsive transcription factor 1-like [Musa 
acuminata subsp. malaccensis]
Length=383

 Score =   155 bits (391),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 105/183 (57%), Positives = 117/183 (64%), Gaps = 18/183 (10%)
 Frame = +3

Query  150  MCGGAIISDFKPPSRSSRRLTADLLWGRADLsggkkksnssgshyskPLRSEVVVLDDDF  329
            MCGGAI+SDF P +RS R   ADLLW      G KKK  S         R  V   +DDF
Sbjct  1    MCGGAIVSDFIPTARSRRVTDADLLWPNLKKGGSKKKRGSR--------RCAVEETEDDF  52

Query  330  EADFQDFKDHSYSQ--------VDAKPFAFSASHRPGFssgpdsdsskdadnsskrkrkN  485
            EADFQ+F + S           VD +  AF    + G  +         A   +KRKRKN
Sbjct  53   EADFQEFDNESGESEENDEAELVDVQFSAFPP--KDGEMTFKPVGFDGPAMRCAKRKRKN  110

Query  486  QYRGIRQRPWGKWAAEIRDPSKGVRVWLGTFDTAEEAARAYDIEARRIRGKKAKVNFPDD  665
            QYRGIRQRPWGKWAAEIRDP KGVRVWLGTF+TAEEAARAYD EARRIRGKKAKVNFPD+
Sbjct  111  QYRGIRQRPWGKWAAEIRDPRKGVRVWLGTFNTAEEAARAYDAEARRIRGKKAKVNFPDE  170

Query  666  APL  674
            AP+
Sbjct  171  API  173



>gb|ACI46677.1| dehydration-responsive element binding protein [Galega orientalis]
Length=364

 Score =   153 bits (386),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 104/191 (54%), Positives = 123/191 (64%), Gaps = 32/191 (17%)
 Frame = +3

Query  150  MCGGAIISDFKPPSRS---SRRLTADLLWGRADLsggkkksnssgshyskPLRSEVVVLD  320
            MCGGAIISDF P + +   SRR+TAD+LW                 +  KP   +  +LD
Sbjct  1    MCGGAIISDFIPAAAALGGSRRVTADILW----------------PNLRKPGTRKSFLLD  44

Query  321  DDFEADFQDFKDHSYSQV------DAKPFAFSASHR-------PGFssgpdsdsskdadn  461
            DDFEA F++FKD S          + K F F +S         P  +      S++ A+ 
Sbjct  45   DDFEAGFREFKDDSDFDDDEDEDDNVKGFTFGSSKSSKSFSKGPAAAKSVVPKSNEQAEK  104

Query  462  sskrkrkNQYRGIRQRPWGKWAAEIRDPSKGVRVWLGTFDTAEEAARAYDIEARRIRGKK  641
             SKRKRKNQYRGIRQRPWGKWAAEIRDP KGVRVWLGTF+TAEEAARAYD EARRIRGKK
Sbjct  105  ESKRKRKNQYRGIRQRPWGKWAAEIRDPRKGVRVWLGTFNTAEEAARAYDAEARRIRGKK  164

Query  642  AKVNFPDDAPL  674
            AKVNFP++AP+
Sbjct  165  AKVNFPEEAPV  175



>gb|KEH18514.1| ethylene response factor [Medicago truncatula]
Length=381

 Score =   153 bits (386),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 103/199 (52%), Positives = 124/199 (62%), Gaps = 39/199 (20%)
 Frame = +3

Query  150  MCGGAIISDFKPPSRS---SRRLTADLLWGRADLsggkkksnssgshyskPLRSEVVVLD  320
            MCGGAIISDF P + +   SRR+TAD+LW                +   KP   +  +LD
Sbjct  1    MCGGAIISDFIPAAAAVGGSRRVTADILW---------------PNLRRKPSSRKPFLLD  45

Query  321  DDFEADFQDFKDHSYSQ------------VDAKPFAFSASH---------RPGFssgpds  437
            DDFEA F++FKD S               V  K F F+++          R   +     
Sbjct  46   DDFEAGFREFKDDSDFDEDEDEDDDEGLLVGVKGFTFASNKNNKSSKSFVRSSAAKSVAL  105

Query  438  dsskdadnsskrkrkNQYRGIRQRPWGKWAAEIRDPSKGVRVWLGTFDTAEEAARAYDIE  617
            +S++ A+  SKRKRKNQYRGIRQRPWGKWAAEIRDP KGVRVWLGTF+TAEEAARAYD E
Sbjct  106  NSNQQAEKDSKRKRKNQYRGIRQRPWGKWAAEIRDPRKGVRVWLGTFNTAEEAARAYDAE  165

Query  618  ARRIRGKKAKVNFPDDAPL  674
            ARRIRG KAKVNFP++AP+
Sbjct  166  ARRIRGNKAKVNFPEEAPV  184



>ref|NP_001238300.1| EREBP/AP2 transcription factor [Glycine max]
 gb|ACD47129.1| EREBP/AP2 transcription factor [Glycine max]
Length=345

 Score =   152 bits (384),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 107/183 (58%), Positives = 117/183 (64%), Gaps = 29/183 (16%)
 Frame = +3

Query  150  MCGGAIISDFKPPSR--SSRRLTADLLWGRADLsggkkksnssgshyskPLRSEVVVLDD  323
            MCGGAIISDF P +    SRRLTAD LW                      L+     LD 
Sbjct  1    MCGGAIISDFIPAAAIAGSRRLTADYLW--------------------PDLKKRKSDLDV  40

Query  324  DFEADFQDFKDHSYSQV-----DAKPFAFSASHRPGFssgpdsdsskdadnsskrkrkNQ  488
            DFEADF+DFKD S           KPFAF+AS R   ++         A+ S+ RKRKNQ
Sbjct  41   DFEADFRDFKDDSDIDDDDDDHQVKPFAFAASSRLS-TAAKSVAFQGRAEISANRKRKNQ  99

Query  489  YRGIRQRPWGKWAAEIRDPSKGVRVWLGTFDTAEEAARAYDIEARRIRGKKAKVNFPDDA  668
            YRGIRQRPWGKWAAEIRDP KGVRVWLGTF+TAEEAARAYD EARRIRGKKAKVNFP +A
Sbjct  100  YRGIRQRPWGKWAAEIRDPRKGVRVWLGTFNTAEEAARAYDAEARRIRGKKAKVNFP-EA  158

Query  669  PLT  677
            P T
Sbjct  159  PGT  161



>ref|XP_003637296.1| Ethylene-responsive transcription factor [Medicago truncatula]
 gb|KEH39665.1| ethylene response factor [Medicago truncatula]
Length=367

 Score =   152 bits (383),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 100/193 (52%), Positives = 117/193 (61%), Gaps = 35/193 (18%)
 Frame = +3

Query  150  MCGGAIISDFKPPSR---SSRRLTADLLWGRADLsggkkksnssgshyskPLRSEVVVLD  320
            MCGGAIISDF   +     SRR+TAD+LW            N   S   KP       LD
Sbjct  1    MCGGAIISDFISTAAVVGGSRRVTADMLW-----------PNLRKSSSRKPF-----FLD  44

Query  321  DDFEADFQDFKDHSYSQ-------VDAKPFAFSASHRPGFssgpdsdsskdadnsskrkr  479
            +DFEA+F++FKD S          V AK F F +++    +S     S+     S   ++
Sbjct  45   NDFEAEFREFKDDSDLDDDDEGLLVGAKCFTFGSTNNKSSNSFVRGSSAAKVVASKSNEQ  104

Query  480  ---------kNQYRGIRQRPWGKWAAEIRDPSKGVRVWLGTFDTAEEAARAYDIEARRIR  632
                     KNQYRGIRQRPWGKWAAEIRDP KGVRVWLGTF+TAEEAARAYD EARRIR
Sbjct  105  GEKELKRKRKNQYRGIRQRPWGKWAAEIRDPRKGVRVWLGTFNTAEEAARAYDAEARRIR  164

Query  633  GKKAKVNFPDDAP  671
            GKKAKVNFP++AP
Sbjct  165  GKKAKVNFPEEAP  177



>ref|XP_007135380.1| hypothetical protein PHAVU_010G124700g [Phaseolus vulgaris]
 gb|ESW07374.1| hypothetical protein PHAVU_010G124700g [Phaseolus vulgaris]
Length=384

 Score =   152 bits (383),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 109/193 (56%), Positives = 122/193 (63%), Gaps = 39/193 (20%)
 Frame = +3

Query  150  MCGGAIISDFKP--PSRSSRRLTADLLWGRADLsggkkksnssgshyskPLRSEVVVLDD  323
            MCGGAIISDF P  P+  SRR+TAD+LW             +    +SKPL      LDD
Sbjct  1    MCGGAIISDFIPAGPAGRSRRVTADILW------------PNLRKRFSKPL------LDD  42

Query  324  DFEADFQDFKDHSYSQVDA-------------KPFAF------SASHRPGFssgpdsdss  446
            DFEA F++FKD S  + D              KPF F      S S     S+    +S 
Sbjct  43   DFEAGFREFKDDSEIEDDDDEDEEDLMVIGVKKPFGFTRPNKTSKSLSRASSTVNSVESK  102

Query  447  kdadnsskrkrkNQYRGIRQRPWGKWAAEIRDPSKGVRVWLGTFDTAEEAARAYDIEARR  626
              A+ S+KRKRKNQYRGIRQRPWGKWAAEIRDP KGVRVWLGTF TAEEAARAYD EARR
Sbjct  103  GQAEESAKRKRKNQYRGIRQRPWGKWAAEIRDPRKGVRVWLGTFSTAEEAARAYDTEARR  162

Query  627  IRGKKAKVNFPDD  665
            IRGKKAKVNFPD+
Sbjct  163  IRGKKAKVNFPDE  175



>gb|AFU07640.1| ethylene-responsive element binding factor 1 [Arachis hypogaea]
Length=375

 Score =   151 bits (382),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 103/187 (55%), Positives = 118/187 (63%), Gaps = 21/187 (11%)
 Frame = +3

Query  150  MCGGAIISDFKPPSRS----SRRLTADLLWGRADLsggkkksnssgshyskPLRSEVVVL  317
            MCGGAIISDF P + +    SRRLTA+ LW   DL  G               ++ V+ L
Sbjct  1    MCGGAIISDFIPAAAAVTARSRRLTAEYLW--PDLKKGSSGKRVP--------KAAVIDL  50

Query  318  DDDFEADFQDFKDHSYSQVDAKPFAFSASHRPGFs-------sgpdsdsskdadnsskrk  476
            DDDFEADF++FKD S   +D                      +G        ++ S+KRK
Sbjct  51   DDDFEADFREFKDDSDIDIDDDEDDAKPFAFAAAKAPKSISRAGKSVAVKAQSEKSAKRK  110

Query  477  rkNQYRGIRQRPWGKWAAEIRDPSKGVRVWLGTFDTAEEAARAYDIEARRIRGKKAKVNF  656
            RKNQYRGIRQRPWGKWAAEIRDP KGVRVWLGTF TAEEAARAYD EARRIRGKKAKVNF
Sbjct  111  RKNQYRGIRQRPWGKWAAEIRDPRKGVRVWLGTFSTAEEAARAYDAEARRIRGKKAKVNF  170

Query  657  PDDAPLT  677
            P++AP T
Sbjct  171  PEEAPRT  177



>ref|XP_009401312.1| PREDICTED: ethylene-responsive transcription factor 1-like [Musa 
acuminata subsp. malaccensis]
Length=384

 Score =   151 bits (382),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 105/182 (58%), Positives = 117/182 (64%), Gaps = 14/182 (8%)
 Frame = +3

Query  150  MCGGAIISDFKPPSRSSRRLTADLLWGRADLsggkkksnssgshyskPLRSEVVVLDDDF  329
            MCGGAIISDF P +RS R ++ D+LW   DL  G KK         +  R  V   +DDF
Sbjct  1    MCGGAIISDFVPAARSWRLVSEDVLW--PDLKNGSKKKKKKKKKDGR--RRAVEEAEDDF  56

Query  330  EADFQDFK--------DHSYSQVDAKPFAFSASHRPGFssgpdsdsskdadnsskrkrkN  485
            +A FQ+F         D     VD K  AF     P   S    +S   A  S KRKRKN
Sbjct  57   DALFQEFNEEYGRSKNDEEVELVDHKHCAFPPKGGP--ISSRPIESDGPAARSPKRKRKN  114

Query  486  QYRGIRQRPWGKWAAEIRDPSKGVRVWLGTFDTAEEAARAYDIEARRIRGKKAKVNFPDD  665
            QYRGIRQRPWGKWAAEIRDP KGVRVWLGTF+TAEEAARAYD+EAR IRGKKAKVNFPD+
Sbjct  115  QYRGIRQRPWGKWAAEIRDPRKGVRVWLGTFNTAEEAARAYDVEARSIRGKKAKVNFPDE  174

Query  666  AP  671
            AP
Sbjct  175  AP  176



>gb|AFK43442.1| unknown [Medicago truncatula]
Length=382

 Score =   150 bits (380),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 102/200 (51%), Positives = 123/200 (62%), Gaps = 40/200 (20%)
 Frame = +3

Query  150  MCGGAIISDFKPPSRS---SRRLTADLLWGRADLsggkkksnssgshyskPLRSEVVVLD  320
            MCGGAIISDF P + +   SRR+TAD+LW                +   KP   +  +LD
Sbjct  1    MCGGAIISDFIPAAAAVGGSRRVTADILW---------------PNLRRKPSSRKPFLLD  45

Query  321  DDFEADFQDFKDHSYSQ------------VDAKPFAFSASHR----------PGFssgpd  434
            DDFEA F++FKD S               V  K F F+++               +    
Sbjct  46   DDFEAGFREFKDDSDFDEDEDEDDDEGLLVGVKGFTFASNKNNKSSKSFVRGSSAAKSVA  105

Query  435  sdsskdadnsskrkrkNQYRGIRQRPWGKWAAEIRDPSKGVRVWLGTFDTAEEAARAYDI  614
             +S++ A+  SKRKRKNQYRGIRQRPWGKWAAEIRDP KGVRVWLGTF+TAEEAARAYD 
Sbjct  106  LNSNQQAEKDSKRKRKNQYRGIRQRPWGKWAAEIRDPRKGVRVWLGTFNTAEEAARAYDA  165

Query  615  EARRIRGKKAKVNFPDDAPL  674
            EARRIRG KAKVNFP++AP+
Sbjct  166  EARRIRGNKAKVNFPEEAPV  185



>ref|XP_003627419.1| Ethylene-responsive transcription factor [Medicago truncatula]
 gb|AET01895.1| ethylene response factor [Medicago truncatula]
 gb|KEH18513.1| ethylene response factor [Medicago truncatula]
Length=382

 Score =   150 bits (380),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 102/200 (51%), Positives = 123/200 (62%), Gaps = 40/200 (20%)
 Frame = +3

Query  150  MCGGAIISDFKPPSRS---SRRLTADLLWGRADLsggkkksnssgshyskPLRSEVVVLD  320
            MCGGAIISDF P + +   SRR+TAD+LW                +   KP   +  +LD
Sbjct  1    MCGGAIISDFIPAAAAVGGSRRVTADILW---------------PNLRRKPSSRKPFLLD  45

Query  321  DDFEADFQDFKDHSYSQ------------VDAKPFAFSASHR----------PGFssgpd  434
            DDFEA F++FKD S               V  K F F+++               +    
Sbjct  46   DDFEAGFREFKDDSDFDEDEDEDDDEGLLVGVKGFTFASNKNNKSSKSFVRGSSAAKSVA  105

Query  435  sdsskdadnsskrkrkNQYRGIRQRPWGKWAAEIRDPSKGVRVWLGTFDTAEEAARAYDI  614
             +S++ A+  SKRKRKNQYRGIRQRPWGKWAAEIRDP KGVRVWLGTF+TAEEAARAYD 
Sbjct  106  LNSNQQAEKDSKRKRKNQYRGIRQRPWGKWAAEIRDPRKGVRVWLGTFNTAEEAARAYDA  165

Query  615  EARRIRGKKAKVNFPDDAPL  674
            EARRIRG KAKVNFP++AP+
Sbjct  166  EARRIRGNKAKVNFPEEAPV  185



>ref|XP_003528732.1| PREDICTED: ethylene-responsive transcription factor RAP2-12 [Glycine 
max]
 gb|AEQ55266.1| ethylene-responsive transcription factor 7 [Glycine max]
Length=392

 Score =   150 bits (380),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 103/195 (53%), Positives = 122/195 (63%), Gaps = 41/195 (21%)
 Frame = +3

Query  150  MCGGAIISDFKP--PSRSSRRLTADLLWGRADLsggkkksnssgshyskPLRSEVVVLDD  323
            MCGGAIISDF P  P+  ++R+TAD+LW   +L                  R    +LDD
Sbjct  1    MCGGAIISDFIPAGPAGGAQRVTADILW--PNLRK----------------RFSKSLLDD  42

Query  324  DFEADFQDFKDHSYSQVDA-------------KPFAFS-----ASHRP---GFssgpdsd  440
            DFEA F++F+D S  +                KPF FS     A+ +P   G ++    +
Sbjct  43   DFEAGFREFEDDSEIEDVDDEDDEEEEELKKKKPFGFSRSNNKAASKPLSRGATTVKSVE  102

Query  441  sskdadnsskrkrkNQYRGIRQRPWGKWAAEIRDPSKGVRVWLGTFDTAEEAARAYDIEA  620
            S   A+  +KRKRKNQYRGIRQRPWGKWAAEIRDP KGVRVWLGTF TAEEAARAYD EA
Sbjct  103  SKGQAEKCAKRKRKNQYRGIRQRPWGKWAAEIRDPRKGVRVWLGTFSTAEEAARAYDAEA  162

Query  621  RRIRGKKAKVNFPDD  665
            RRIRGKKAKVNFPD+
Sbjct  163  RRIRGKKAKVNFPDE  177



>ref|XP_009391708.1| PREDICTED: ethylene-responsive transcription factor 1-like [Musa 
acuminata subsp. malaccensis]
Length=376

 Score =   150 bits (379),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 102/182 (56%), Positives = 116/182 (64%), Gaps = 18/182 (10%)
 Frame = +3

Query  150  MCGGAIISDFKPPSRSSRRLTADLLWGRADLsggkkksnssgshyskPLRSEVVVLDDDF  329
            MCGGAIISDF P +RS     ADLLW     +   KK  S         R      +DDF
Sbjct  1    MCGGAIISDFIPAARSRLVTDADLLWPNPKKAKSTKKKGSR--------RRLAQETEDDF  52

Query  330  EADFQDFKDHSYSQ--------VDAKPFAFSASHRPGFssgpdsdsskdadnsskrkrkN  485
            EADF++F D S           VD K  AF+   + G  +    +    A  S+KRKRKN
Sbjct  53   EADFREFNDESGESEEDDVVEIVDVKLPAFAP--KDGQIALGPVEFDGPAARSAKRKRKN  110

Query  486  QYRGIRQRPWGKWAAEIRDPSKGVRVWLGTFDTAEEAARAYDIEARRIRGKKAKVNFPDD  665
            Q+RGIRQRPWGKWAAEIRDP KGVRVWLGTF+TAEEAARAYD EARRIRGKKAKVNFP++
Sbjct  111  QFRGIRQRPWGKWAAEIRDPRKGVRVWLGTFNTAEEAARAYDAEARRIRGKKAKVNFPEE  170

Query  666  AP  671
            AP
Sbjct  171  AP  172



>gb|ABO93372.1| ethylene-responsive element binding protein [Medicago falcata]
Length=382

 Score =   149 bits (376),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 105/205 (51%), Positives = 124/205 (60%), Gaps = 50/205 (24%)
 Frame = +3

Query  150  MCGGAIISDFKPPSRS---SRRLTADLLWGRADLsggkkksnssgshyskPLRSEVVVLD  320
            MCGGAIIS F P + +   SRR+TAD+LW                +   KP   +  +LD
Sbjct  1    MCGGAIISGFIPAAAAVGGSRRVTADILW---------------PNLRRKPSSRKPFLLD  45

Query  321  DDFEADFQDFKDHSYSQ------------VDAKPFAF---------------SASHRPGF  419
            DDFEA F++FKD S               V  K F F               S++ +P  
Sbjct  46   DDFEAGFREFKDDSDFDEDEDEDDDEGLLVGVKGFTFGSNKNNKSSKSFVRGSSAAKP--  103

Query  420  ssgpdsdsskdadnsskrkrkNQYRGIRQRPWGKWAAEIRDPSKGVRVWLGTFDTAEEAA  599
                  +S+K A+  SKRKRKNQYRGIRQRPWGKWAAEIRDP KGVRVWLGTF+TAEEAA
Sbjct  104  ---VALNSNKLAEKDSKRKRKNQYRGIRQRPWGKWAAEIRDPRKGVRVWLGTFNTAEEAA  160

Query  600  RAYDIEARRIRGKKAKVNFPDDAPL  674
            RAYD EARRIRGKKAKVNFP++AP+
Sbjct  161  RAYDAEARRIRGKKAKVNFPEEAPV  185



>gb|AEW68339.1| dehydration-responsive element binding protein [Atriplex canescens]
Length=387

 Score =   149 bits (376),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 103/188 (55%), Positives = 124/188 (66%), Gaps = 19/188 (10%)
 Frame = +3

Query  150  MCGGAIISDFKPPSRSSRRLTADLLWGRADLsggkkksnssgshyskPLRSEVVVL----  317
            MCGGA+ISD+ P  RS  RL  D LW   DL   KK S+        PLRSE + +    
Sbjct  1    MCGGAVISDYIPAGRS-HRLNPDYLW--PDLKSFKKGSSGYSK----PLRSETLKVVDED  53

Query  318  ----DDDFEADFQDFKDHSYSQV----DAKPFAFSASHRPGFssgpdsdsskdadnsskr  473
                D  FEADF +FKD S   +    + KPF+F  S     +     + +  A+ ++KR
Sbjct  54   DDAADQAFEADFLEFKDESDDDISIIPNFKPFSFGLSKHKSSNGLKPVEFNSQAEKTAKR  113

Query  474  krkNQYRGIRQRPWGKWAAEIRDPSKGVRVWLGTFDTAEEAARAYDIEARRIRGKKAKVN  653
            KRKNQYRGIRQRPWGKWAAEIRDP KGVRVWLGTF+TAEEAARAYD EARRIRG+KAKVN
Sbjct  114  KRKNQYRGIRQRPWGKWAAEIRDPRKGVRVWLGTFNTAEEAARAYDAEARRIRGEKAKVN  173

Query  654  FPDDAPLT  677
            FP++ P++
Sbjct  174  FPEETPVS  181



>ref|NP_001057044.1| Os06g0194000 [Oryza sativa Japonica Group]
 gb|AAF05606.1|AF190770_1 EREBP-like protein [Oryza sativa Japonica Group]
 dbj|BAD35280.1| EREBP-like protein [Oryza sativa Japonica Group]
 dbj|BAD35637.1| EREBP-like protein [Oryza sativa Japonica Group]
 gb|ABH04236.1| ethylene-responsive factor 15 [Oryza sativa Indica Group]
 dbj|BAF18958.1| Os06g0194000 [Oryza sativa Japonica Group]
 gb|ACF60475.1| EREBP transcription factor [Oryza sativa Japonica Group]
 dbj|BAG91626.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG87556.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|ACU78067.1| putative ethylene responsive element binding factor [Oryza sativa 
Japonica Group]
Length=362

 Score =   147 bits (371),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 99/183 (54%), Positives = 120/183 (66%), Gaps = 15/183 (8%)
 Frame = +3

Query  150  MCGGAIISDFKPPSRSSRRLTADLLWGRADLsggkkksnssgshyskPLRSEVVVLDDDF  329
            MCGGAI+SD  PP R   R+TA  LW        +++   +      PLR E    +DDF
Sbjct  1    MCGGAILSDLIPPPR---RVTAGDLWLEK-TKKQQQQKKKNKGARRLPLRQEE---EDDF  53

Query  330  EADFQDFK-DHSYSQVD-----AKPFAF--SASHRPGFssgpdsdsskdadnsskrkrkN  485
            EADF++F+ D    +V+     AKP A   S   + G  +   + +   A  S+KRKRKN
Sbjct  54   EADFEEFEVDSGEWEVESDADEAKPLAAPRSGFAKGGLKNTTVAGADGPAARSAKRKRKN  113

Query  486  QYRGIRQRPWGKWAAEIRDPSKGVRVWLGTFDTAEEAARAYDIEARRIRGKKAKVNFPDD  665
            Q+RGIRQRPWGKWAAEIRDP KGVRVWLGTF++ EEAARAYD EARRIRGKKAKVNFPD 
Sbjct  114  QFRGIRQRPWGKWAAEIRDPRKGVRVWLGTFNSPEEAARAYDAEARRIRGKKAKVNFPDG  173

Query  666  APL  674
            AP+
Sbjct  174  APV  176



>gb|EAY99995.1| hypothetical protein OsI_21998 [Oryza sativa Indica Group]
Length=362

 Score =   147 bits (371),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 99/183 (54%), Positives = 120/183 (66%), Gaps = 15/183 (8%)
 Frame = +3

Query  150  MCGGAIISDFKPPSRSSRRLTADLLWGRADLsggkkksnssgshyskPLRSEVVVLDDDF  329
            MCGGAI+SD  PP R   R+TA  LW        +++   +      PLR E    +DDF
Sbjct  1    MCGGAILSDLIPPPR---RVTAGDLWLEK-TKKQQQQKKKNKGARRLPLRQEE---EDDF  53

Query  330  EADFQDFK-DHSYSQVD-----AKPFAF--SASHRPGFssgpdsdsskdadnsskrkrkN  485
            EADF++F+ D    +V+     AKP A   S   + G  +   + +   A  S+KRKRKN
Sbjct  54   EADFEEFEVDSGEWEVESDADEAKPLAAPRSGFAKGGLKNTTVAGADGPAARSAKRKRKN  113

Query  486  QYRGIRQRPWGKWAAEIRDPSKGVRVWLGTFDTAEEAARAYDIEARRIRGKKAKVNFPDD  665
            Q+RGIRQRPWGKWAAEIRDP KGVRVWLGTF++ EEAARAYD EARRIRGKKAKVNFPD 
Sbjct  114  QFRGIRQRPWGKWAAEIRDPRKGVRVWLGTFNSPEEAARAYDAEARRIRGKKAKVNFPDG  173

Query  666  APL  674
            AP+
Sbjct  174  APV  176



>gb|AAL67489.1|AF459404_1 AP-2 domain containing protein [Narcissus pseudonarcissus]
Length=153

 Score =   141 bits (355),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 97/169 (57%), Positives = 110/169 (65%), Gaps = 23/169 (14%)
 Frame = +3

Query  150  MCGGAIISDFKPPSRSSRRLTADLLWGRADLsggkkksnssgshyskPLRSEVVVLDDDF  329
            MCGGAIISDF PPSRS R+LTAD LW   +                   + +    +DDF
Sbjct  1    MCGGAIISDFIPPSRS-RKLTADYLWPNLNKGKD---------------KKKSFGFEDDF  44

Query  330  EADFQDFKDHSYSQ----VDAKPFAFSAS---HRPGFssgpdsdsskdadnsskrkrkNQ  488
            EADF +F+D S       VD KPF F A     R G +     + +  A+ SSKRKRKNQ
Sbjct  45   EADFNEFEDESEEGESEAVDVKPFKFGAKAGFSREGSTYLKPIELNGAAERSSKRKRKNQ  104

Query  489  YRGIRQRPWGKWAAEIRDPSKGVRVWLGTFDTAEEAARAYDIEARRIRG  635
            YRGIRQRPWGKWAAEIRDP+KGVRVWLGTF+TAEEAARAYD EARRIRG
Sbjct  105  YRGIRQRPWGKWAAEIRDPNKGVRVWLGTFNTAEEAARAYDDEARRIRG  153



>ref|XP_009410253.1| PREDICTED: ethylene-responsive transcription factor 1-like [Musa 
acuminata subsp. malaccensis]
Length=363

 Score =   145 bits (365),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 96/176 (55%), Positives = 113/176 (64%), Gaps = 9/176 (5%)
 Frame = +3

Query  150  MCGGAIISDFKPPSRSSRRLTADLLW----GRADLsggkkksnssgshyskPLRSEVVVL  317
            MCGGAIISD+ P      R+T D LW        +  G+KK     S   + L +E    
Sbjct  1    MCGGAIISDYIPAGAGPLRVTTDCLWPDPNNGCGMKAGEKKKKRRRSGRGRRLPAEET--  58

Query  318  DDDFEADFQDFK-DHSYSQVDAKPFAFSASHRPGFssgpdsdsskdadnsskrkrkNQYR  494
            DDDFEADFQ+F+ D        + FA ++  +P       S+    A  S+KR RKNQYR
Sbjct  59   DDDFEADFQEFEEDGEVDLFHIESFALTSEDKP--VPTRPSEVDVPASRSAKRYRKNQYR  116

Query  495  GIRQRPWGKWAAEIRDPSKGVRVWLGTFDTAEEAARAYDIEARRIRGKKAKVNFPD  662
            GIR RPWGKWAAEIRDP KGVRVWLGTF+TAEEAARAYD EAR+IRGKKAK+NFPD
Sbjct  117  GIRWRPWGKWAAEIRDPRKGVRVWLGTFNTAEEAARAYDAEARKIRGKKAKLNFPD  172



>ref|XP_010685231.1| PREDICTED: ethylene-responsive transcription factor RAP2-2-like 
[Beta vulgaris subsp. vulgaris]
 ref|XP_010685232.1| PREDICTED: ethylene-responsive transcription factor RAP2-2-like 
[Beta vulgaris subsp. vulgaris]
 ref|XP_010685233.1| PREDICTED: ethylene-responsive transcription factor RAP2-2-like 
[Beta vulgaris subsp. vulgaris]
Length=390

 Score =   145 bits (365),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 103/182 (57%), Positives = 124/182 (68%), Gaps = 14/182 (8%)
 Frame = +3

Query  150  MCGGAIISDFKPPSRSSRRLTADLLWGRADLsggkkksnssgshyskPLRSEVVVLDDDF  329
            MCGGA+ISDF P  RS  +LTAD LW   DL+G   K  +SG     PLRS ++ +DDD 
Sbjct  1    MCGGAVISDFIPTGRS-HKLTADYLW--PDLNGAGAKKVNSGYSK--PLRSGIINVDDDD  55

Query  330  EADFQ-----DFKDHSYSQV----DAKPFAFSASHRPGFssgpdsdsskdadnsskrkrk  482
            + +       +FKD S   +    D KPF+F        S     + +  A+ S+KRKRK
Sbjct  56   DDEAFEADFLEFKDESDEDISVTEDFKPFSFGVFKSKLSSGLKPVEFNSPAEKSAKRKRK  115

Query  483  NQYRGIRQRPWGKWAAEIRDPSKGVRVWLGTFDTAEEAARAYDIEARRIRGKKAKVNFPD  662
            NQYRGIRQRPWGKWAAEIRDP KGVRVWLGTF+TAEEAARAYD EAR+IRG+KAKVNFP+
Sbjct  116  NQYRGIRQRPWGKWAAEIRDPRKGVRVWLGTFNTAEEAARAYDAEARKIRGEKAKVNFPE  175

Query  663  DA  668
            +A
Sbjct  176  EA  177



>gb|AGV75742.1| jasmonic acid and ethylene responsive factor, partial [Capsicum 
chinense]
Length=349

 Score =   144 bits (362),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 91/131 (69%), Positives = 105/131 (80%), Gaps = 10/131 (8%)
 Frame = +3

Query  291  PL-RSEVVVLDDDFEADFQDFKDHSYSQVDA-KPFAFSASHRPGFssgpdsdsskdadns  464
            PL RS+ + LD++FEADFQDFKD++   VD  KPF  S S + G       DSS D + S
Sbjct  19   PLNRSKFIDLDEEFEADFQDFKDYADDDVDDVKPFG-SKSVKSG-------DSSCDTEKS  70

Query  465  skrkrkNQYRGIRQRPWGKWAAEIRDPSKGVRVWLGTFDTAEEAARAYDIEARRIRGKKA  644
            SKRKRKNQYRGIRQRPWGKWAAEIRDP KG+RVWLGTF++AEEAARAYD+EARRIRGKKA
Sbjct  71   SKRKRKNQYRGIRQRPWGKWAAEIRDPRKGIRVWLGTFNSAEEAARAYDVEARRIRGKKA  130

Query  645  KVNFPDDAPLT  677
            KVNFPD +P +
Sbjct  131  KVNFPDGSPAS  141



>ref|XP_006390669.1| hypothetical protein EUTSA_v10018945mg [Eutrema salsugineum]
 gb|ESQ27955.1| hypothetical protein EUTSA_v10018945mg [Eutrema salsugineum]
Length=294

 Score =   140 bits (354),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 87/176 (49%), Positives = 112/176 (64%), Gaps = 24/176 (14%)
 Frame = +3

Query  150  MCGGAIISDFKPPSRSSRRLTADLLWGRADLsggkkksnssgshyskPLRSEVVVLD-DD  326
            MCGGAII+D+  PSRS R  TADL               +  +  S   R +VV L  DD
Sbjct  1    MCGGAIIADYIAPSRSGRS-TADL-------------GKNVRAGNSSWRRDDVVDLTFDD  46

Query  327  FEADFQDFK---DHSYSQVDAKPFAFSASHRPGFssgpdsdsskdadnsskrkrkNQYRG  497
            FE DFQDF+   D +     AKP  FS++ +P         +        ++K+ ++YRG
Sbjct  47   FEGDFQDFESENDETGKFSPAKPLVFSSTRKPA------GSNRSINGEDERKKKSSRYRG  100

Query  498  IRQRPWGKWAAEIRDPSKGVRVWLGTFDTAEEAARAYDIEARRIRGKKAKVNFPDD  665
            IR+RPWG+WAAEIRDP KGVRVWLGTF+TAE+AARAYD+EA+RIRG KAK+NFP++
Sbjct  101  IRRRPWGRWAAEIRDPIKGVRVWLGTFNTAEDAARAYDLEAKRIRGAKAKLNFPNE  156



>ref|XP_010259467.1| PREDICTED: ethylene-responsive transcription factor RAP2-12-like 
[Nelumbo nucifera]
Length=314

 Score =   141 bits (355),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 88/172 (51%), Positives = 103/172 (60%), Gaps = 40/172 (23%)
 Frame = +3

Query  150  MCGGAIISDFKPPSRSSRRLTADLLWGRADLsggkkksnssgshyskPLRSEVVVLDDDF  329
            MCGGAII++F P +RS RR+TA  LW                        S     +DDF
Sbjct  1    MCGGAIIAEFIPRNRS-RRVTASDLW----------------------PNSPFANFNDDF  37

Query  330  EADFQDFKDHSYSQVDAKPFAFSASHRPGFssgpdsdsskdadnsskrkrkNQYRGIRQR  509
            E+DF+ F +   ++  A P   S+    G                 KRKRKN YRGIRQR
Sbjct  38   ESDFRRFSEEENTKKRASPSGDSSGENNG-----------------KRKRKNLYRGIRQR  80

Query  510  PWGKWAAEIRDPSKGVRVWLGTFDTAEEAARAYDIEARRIRGKKAKVNFPDD  665
            PWGKWAAEIRDP KGVRVWLGTF+TAEEAARAYD EAR+IRGKKAKVNFP++
Sbjct  81   PWGKWAAEIRDPRKGVRVWLGTFNTAEEAARAYDREARKIRGKKAKVNFPNE  132



>ref|XP_002267008.1| PREDICTED: ethylene-responsive transcription factor RAP2-12-like 
isoform X1 [Vitis vinifera]
Length=379

 Score =   142 bits (357),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 97/176 (55%), Positives = 116/176 (66%), Gaps = 6/176 (3%)
 Frame = +3

Query  150  MCGGAIISDFKPPSRSSRRLTADLLWGRADLsggkkksnssgshyskPLRSEVVVLDDDF  329
            MCGGAIISDF P SR  RR+  D       L      ++ S S +S+ +  +     +  
Sbjct  1    MCGGAIISDFIPASR-CRRVDEDYF---PALKKRTSGNHCSKSLWSEAVEDDDDDDFEAD  56

Query  330  EADFQDFKDHSYSQVDAKPFAFSASHRPGFssgpdsdsskdadnsskrkrkNQYRGIRQR  509
               F+D  D     +  KP AFSA+   G++     + +  A+ S+KRKRKNQYRGIRQR
Sbjct  57   FLGFKDDSDDEEDDI--KPSAFSAAKPHGYTGIKSVEFNGQAEKSAKRKRKNQYRGIRQR  114

Query  510  PWGKWAAEIRDPSKGVRVWLGTFDTAEEAARAYDIEARRIRGKKAKVNFPDDAPLT  677
            PWGKWAAEIRDP KGVRVWLGTF+TAEEAARAYD EARRIRGKKAKVNFPD+ PLT
Sbjct  115  PWGKWAAEIRDPRKGVRVWLGTFNTAEEAARAYDAEARRIRGKKAKVNFPDETPLT  170



>gb|KCW56427.1| hypothetical protein EUGRSUZ_I02155, partial [Eucalyptus grandis]
Length=383

 Score =   142 bits (357),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 105/169 (62%), Positives = 117/169 (69%), Gaps = 20/169 (12%)
 Frame = +3

Query  195  SSRRLTADLLWGRADLsggkkksnssgshyskPLRSEVVVLDDD-FEADFQDFKDHSYSQ  371
            SSRRLT+D LW   DL     K +        P RSEVV + DD FEADFQ FKD S  +
Sbjct  11   SSRRLTSDFLW--PDLKRSAGKQSRR------PARSEVVDVVDDDFEADFQGFKDESDVE  62

Query  372  VDA--------KPFAFSAS---HRPGFssgpdsdsskdadnsskrkrkNQYRGIRQRPWG  518
             D         KPFAFSA+   +  G S+    + +  A+ S+KRKRKNQYRGIRQRPWG
Sbjct  63   DDFDDEVEVDVKPFAFSAAEPRYSKGSSTTKSVEYNGQAEKSAKRKRKNQYRGIRQRPWG  122

Query  519  KWAAEIRDPSKGVRVWLGTFDTAEEAARAYDIEARRIRGKKAKVNFPDD  665
            KWAAEIRDP KGVRVWLGTF+TAEEAARAYD EARRIRGKKAKVNFPDD
Sbjct  123  KWAAEIRDPRKGVRVWLGTFNTAEEAARAYDAEARRIRGKKAKVNFPDD  171



>ref|NP_001148691.1| LOC100282307 [Zea mays]
 gb|ACF88213.1| unknown [Zea mays]
 gb|ACG32553.1| ethylene response element binding protein [Zea mays]
 gb|ACR38463.1| unknown [Zea mays]
 gb|AFW64248.1| putative AP2/EREBP transcription factor superfamily protein isoform 
1 [Zea mays]
 gb|AFW64249.1| putative AP2/EREBP transcription factor superfamily protein isoform 
2 [Zea mays]
 gb|AIB05081.1| AP2-EREBP transcription factor, partial [Zea mays]
Length=361

 Score =   140 bits (354),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 92/184 (50%), Positives = 112/184 (61%), Gaps = 24/184 (13%)
 Frame = +3

Query  150  MCGGAIISDFKPPSRSSRRLTADLLWGRADLsggkkksnssgshyskPLRSEVVVLDDDF  329
            MCGGAI+++ + P+   RRLT   +W +                 +   RS     D+DF
Sbjct  1    MCGGAILAELREPA--PRRLTERDIWQQ---------KKKPKRGGAGGRRSFAAEDDEDF  49

Query  330  EADFQDFKDHSYSQ------------VDAKPFAFSAS-HRPGFssgpdsdsskdadnssk  470
            EADF+DF+  S               ++ KPFA  ++  R G S+   +     A   +K
Sbjct  50   EADFEDFEADSGDSDLELGEGADDDVIEIKPFAAKSTFSRDGLSTMTTAGYDAPAARLAK  109

Query  471  rkrkNQYRGIRQRPWGKWAAEIRDPSKGVRVWLGTFDTAEEAARAYDIEARRIRGKKAKV  650
            RKRKNQYRGIRQRPWGKWAAEIRDP KGVRVWLGTF++ EEAARAYD EARRIRGKKAKV
Sbjct  110  RKRKNQYRGIRQRPWGKWAAEIRDPQKGVRVWLGTFNSPEEAARAYDAEARRIRGKKAKV  169

Query  651  NFPD  662
            NFPD
Sbjct  170  NFPD  173



>gb|AAP80852.1| EREBP transcription factor [Triticum aestivum]
Length=355

 Score =   140 bits (352),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 94/181 (52%), Positives = 116/181 (64%), Gaps = 13/181 (7%)
 Frame = +3

Query  150  MCGGAIISDFKPPSRSSRRLTADLLWGRADLsggkkksnssgshyskPLRSEVVVLDD-D  326
            MCGGAI+SD  PP R   R T   +W RAD     +   ++G     P         D +
Sbjct  1    MCGGAILSDIIPPPR---RATGGNVW-RADKKRRARPDAAAGRPRRAPEEEFQEEEGDAE  56

Query  327  FEADFQDFKD-HSYSQVDAKPFAFSASHRPGFssgpdsdssk----dadnsskrkrkNQY  491
            FEADF+ F +    S  +AKPF      R GFS      ++      A  S+ RKRKNQ+
Sbjct  57   FEADFEGFVEAEEESDGEAKPFPV---RRSGFSGDGLKATAAGDDDCASGSAXRKRKNQF  113

Query  492  RGIRQRPWGKWAAEIRDPSKGVRVWLGTFDTAEEAARAYDIEARRIRGKKAKVNFPDDAP  671
            RGIR+RPWGKWAAEIRDP KGVRVWLGT+++AEEAARAYD+EARRIRGKKA+VNFP++AP
Sbjct  114  RGIRRRPWGKWAAEIRDPRKGVRVWLGTYNSAEEAARAYDVEARRIRGKKAEVNFPEEAP  173

Query  672  L  674
            +
Sbjct  174  M  174



>ref|XP_009381608.1| PREDICTED: ethylene-responsive transcription factor 1-like [Musa 
acuminata subsp. malaccensis]
Length=376

 Score =   139 bits (351),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 94/179 (53%), Positives = 108/179 (60%), Gaps = 11/179 (6%)
 Frame = +3

Query  150  MCGGAIISDFKPPSRSSRRLTADLLWGRADLsggkkksnssgshys-----kPLRSEVVV  314
            MCGGAIIS+  P    SRR TA   + R D                      P R+ +  
Sbjct  1    MCGGAIISNIIPAGPRSRRRTAG--YQRPDPKNEFGVKEWEKPKEKRWTIRGPRRA-LEK  57

Query  315  LDDDFEADFQDFK-DHSYSQVDAKPFAFSASHRPGFssgpdsdsskdadnsskrkrkNQY  491
             DDDFEADF  F+ D        KPFAF +  +P       S   K +  S+ + RKN+Y
Sbjct  58   KDDDFEADFMQFEEDEEADLFHFKPFAFDSRDKP--VPLRPSVIDKPSSKSATKNRKNRY  115

Query  492  RGIRQRPWGKWAAEIRDPSKGVRVWLGTFDTAEEAARAYDIEARRIRGKKAKVNFPDDA  668
            RGIR+RPWGKWAAEIRDP KGVRVWLGTF+TAEEAARAYD EAR+IRGKKAKVNFPD A
Sbjct  116  RGIRRRPWGKWAAEIRDPCKGVRVWLGTFNTAEEAARAYDAEARKIRGKKAKVNFPDAA  174



>gb|AAX13280.1| ethylene-responsive element binding protein 1 [Triticum aestivum]
Length=355

 Score =   139 bits (350),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 95/181 (52%), Positives = 117/181 (65%), Gaps = 13/181 (7%)
 Frame = +3

Query  150  MCGGAIISDFKPPSRSSRRLTADLLWGRADLsggkkksnssgshyskPLRSEVVVLDD-D  326
            MCGGAI+SD  PP R   R T   +W RAD     +   ++G     P         D +
Sbjct  1    MCGGAILSDIIPPPR---RATGGNVW-RADKKRRARPDAAAGRPRRVPEEEFQEEEGDAE  56

Query  327  FEADFQDFKD-HSYSQVDAKPFAFSASHRPGFssgpdsdssk----dadnsskrkrkNQY  491
            FEADF+ F +    S  +AKPF      R GFS      ++      A  S+KRKRK+Q+
Sbjct  57   FEADFEGFVEAEEESDGEAKPFPV---RRTGFSGDGLKATAAGDDDCASGSAKRKRKSQF  113

Query  492  RGIRQRPWGKWAAEIRDPSKGVRVWLGTFDTAEEAARAYDIEARRIRGKKAKVNFPDDAP  671
            RGIR+RPWGKWAAEIRDP KGVRVWLGT+++AEEAARAYD+EARRIRGKKAKVNFP++AP
Sbjct  114  RGIRRRPWGKWAAEIRDPRKGVRVWLGTYNSAEEAARAYDVEARRIRGKKAKVNFPEEAP  173

Query  672  L  674
            +
Sbjct  174  M  174



>gb|AID46466.1| ethylene response factor 1 extended form L [Triticum turgidum 
subsp. durum]
Length=355

 Score =   139 bits (350),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 95/181 (52%), Positives = 117/181 (65%), Gaps = 13/181 (7%)
 Frame = +3

Query  150  MCGGAIISDFKPPSRSSRRLTADLLWGRADLsggkkksnssgshyskPLRSEVVVLDD-D  326
            MCGGAI+SD  PP R   R T   +W RAD     +   ++G     P         D +
Sbjct  1    MCGGAILSDIIPPPR---RATGGNVW-RADKKRRARPDAAAGRPRRVPEEEFQEEEGDAE  56

Query  327  FEADFQDFKD-HSYSQVDAKPFAFSASHRPGFssgpdsdssk----dadnsskrkrkNQY  491
            FEADF+ F +    S  +AKPF      R GFS      ++      A  S+KRKRK+Q+
Sbjct  57   FEADFEGFVEAEEESDGEAKPFPV---RRTGFSGDGLKATAAGDDDCASGSAKRKRKSQF  113

Query  492  RGIRQRPWGKWAAEIRDPSKGVRVWLGTFDTAEEAARAYDIEARRIRGKKAKVNFPDDAP  671
            RGIR+RPWGKWAAEIRDP KGVRVWLGT+++AEEAARAYD+EARRIRGKKAKVNFP++AP
Sbjct  114  RGIRRRPWGKWAAEIRDPRKGVRVWLGTYNSAEEAARAYDVEARRIRGKKAKVNFPEEAP  173

Query  672  L  674
            +
Sbjct  174  M  174



>ref|XP_010939857.1| PREDICTED: ethylene-responsive transcription factor 1-like isoform 
X1 [Elaeis guineensis]
Length=364

 Score =   139 bits (350),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 107/176 (61%), Positives = 121/176 (69%), Gaps = 14/176 (8%)
 Frame = +3

Query  150  MCGGAIISDFKPPSRSSRRLTADLLWGRADLsggkkksnssgshyskPLRSEVVVLDDDF  329
            MCGGAIISDF  P  +SRRLTAD  W               G    K  + EVV  DDDF
Sbjct  1    MCGGAIISDFMLPPTASRRLTADYRW---------PGLKKGGGRKKKGRKHEVVEFDDDF  51

Query  330  EADFQDFKDHSYSQVD---AKPFAFS--ASHRPGFssgpdsdsskdadnsskrkrkNQYR  494
            EADF+DFKD S    +    KPFAF+  A+   G ++    + +  A  S+KRKRKNQYR
Sbjct  52   EADFEDFKDESEEDEEEVDVKPFAFASKATFSRGSTTPKSVEFNGSAARSAKRKRKNQYR  111

Query  495  GIRQRPWGKWAAEIRDPSKGVRVWLGTFDTAEEAARAYDIEARRIRGKKAKVNFPD  662
            GIRQRPWGKWAAEIRDP KGVRVWLGTF+TAEEAARAYD+EARRIRGKKAKVNFP+
Sbjct  112  GIRQRPWGKWAAEIRDPRKGVRVWLGTFNTAEEAARAYDVEARRIRGKKAKVNFPE  167



>ref|XP_008783120.1| PREDICTED: ethylene-responsive transcription factor 1-like [Phoenix 
dactylifera]
Length=374

 Score =   139 bits (350),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 111/178 (62%), Positives = 122/178 (69%), Gaps = 17/178 (10%)
 Frame = +3

Query  150  MCGGAIISDFKPPSRSSRRLTADLLWGRADLsggkkksnssgshyskPLRSEVVVLDDDF  329
            MCGGAIISDF      SRRLTAD LW      GG KK            + EVV +DDDF
Sbjct  1    MCGGAIISDFILQPAGSRRLTADYLWPHLKKGGGSKKGR----------KHEVVEIDDDF  50

Query  330  EADFQDFKDHSYSQVDAK----PFAFSAS---HRPGFssgpdsdsskdadnsskrkrkNQ  488
            EADF+DFKD S    +A+    PFAF+A     R G  +    +    A  S+KRKRKNQ
Sbjct  51   EADFEDFKDESEEDEEAEIDVEPFAFTAKAPFSREGSITLKSEELCGPAAKSAKRKRKNQ  110

Query  489  YRGIRQRPWGKWAAEIRDPSKGVRVWLGTFDTAEEAARAYDIEARRIRGKKAKVNFPD  662
            YRGIRQRPWGKWAAEIRDP KGVRVWLGTFDTAEEAARAYD+EARRIRGKKAKVNFP+
Sbjct  111  YRGIRQRPWGKWAAEIRDPRKGVRVWLGTFDTAEEAARAYDVEARRIRGKKAKVNFPE  168



>gb|AID46465.1| ethylene response factor 1 extended form P [Triticum turgidum 
subsp. durum]
Length=355

 Score =   137 bits (346),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 90/180 (50%), Positives = 113/180 (63%), Gaps = 11/180 (6%)
 Frame = +3

Query  150  MCGGAIISDFKPPSRSSRRLTADLLWGRADLsggkkksnssgshyskPLRSEVVVLDDDF  329
            MCGGAI+SD  PP R   R T   +W        +  + +           +    D +F
Sbjct  1    MCGGAILSDIIPPPR---RATGGNVWRADKKKRARADAAAGRPRRVPEEEFQEEEGDAEF  57

Query  330  EADFQDFKD-HSYSQVDAKPFAFSASHRPGFssgpdsdssk----dadnsskrkrkNQYR  494
            EADF+ F +    S  +AKPF      R GFS      ++      A  S+KRKRK+Q+R
Sbjct  58   EADFEGFVEAEEESDGEAKPFPV---RRTGFSGDGLKATAAGDDDCASGSAKRKRKSQFR  114

Query  495  GIRQRPWGKWAAEIRDPSKGVRVWLGTFDTAEEAARAYDIEARRIRGKKAKVNFPDDAPL  674
            GIR+RPWGKWAAEIRDP KGVRVWLGT+++AEEAARAYD+EARRIRGKKAKVNFP++AP+
Sbjct  115  GIRRRPWGKWAAEIRDPRKGVRVWLGTYNSAEEAARAYDVEARRIRGKKAKVNFPEEAPM  174



>ref|XP_010937274.1| PREDICTED: ethylene-responsive transcription factor 1-like [Elaeis 
guineensis]
Length=369

 Score =   137 bits (346),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 106/178 (60%), Positives = 120/178 (67%), Gaps = 15/178 (8%)
 Frame = +3

Query  150  MCGGAIISDFKPPSRSSRRLTADLLWGRADLsggkkksnssgshyskPLRSEVVVLDDDF  329
            MCGGAIISDF P   SSRR  AD +W   +  GG               + EVV +DDDF
Sbjct  1    MCGGAIISDFIPTPVSSRRPIADYIWPHLNKGGGGGGKKGR--------KHEVVEIDDDF  52

Query  330  EADFQDFKDHSYSQVD----AKPFAFSAS---HRPGFssgpdsdsskdadnsskrkrkNQ  488
            EADF+DFKD S    +     KPFAF+A       G  +    + +  A  S+KRKRKNQ
Sbjct  53   EADFEDFKDESEEDEEEEIDVKPFAFTAKAPFSGEGSITLKSGEFNGPAARSAKRKRKNQ  112

Query  489  YRGIRQRPWGKWAAEIRDPSKGVRVWLGTFDTAEEAARAYDIEARRIRGKKAKVNFPD  662
            YRGIRQRPWGKWAAEIRDP KGVRVWLGTF+TAEEAARAYD+EARRIRGKKAKVNFP+
Sbjct  113  YRGIRQRPWGKWAAEIRDPRKGVRVWLGTFNTAEEAARAYDVEARRIRGKKAKVNFPE  170



>gb|ADC94859.1| ERF2 transcription factor [Vitis pseudoreticulata]
Length=376

 Score =   137 bits (344),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 98/176 (56%), Positives = 114/176 (65%), Gaps = 9/176 (5%)
 Frame = +3

Query  150  MCGGAIISDFKPPSRSSRRLTADLLWGRADLsggkkksnssgshyskPLRSEVVVLDDDF  329
            MCGGAIISDF P SR  RRL  D       L      ++ S S +S+ +  +     +  
Sbjct  1    MCGGAIISDFIPASR-CRRLDEDYF---PALKKRTSGNHCSKSLWSEAVEDDDDDDFEAD  56

Query  330  EADFQDFKDHSYSQVDAKPFAFSASHRPGFssgpdsdsskdadnsskrkrkNQYRGIRQR  509
               F+D  D     +  KP AFSA+   G       + +  A+ S+KRKRKNQYRGIRQR
Sbjct  57   FLGFKDDSDDEEDDI--KPSAFSAAKPHGI---KSVEFNGQAEKSAKRKRKNQYRGIRQR  111

Query  510  PWGKWAAEIRDPSKGVRVWLGTFDTAEEAARAYDIEARRIRGKKAKVNFPDDAPLT  677
            PWGKWAAEIRDP KGVRVWLGTF+TAEEAARAYD EARRIRGKKAKVNFPD+ PLT
Sbjct  112  PWGKWAAEIRDPRKGVRVWLGTFNTAEEAARAYDAEARRIRGKKAKVNFPDETPLT  167



>gb|ABB51575.1| putative ethylene responsive element binding protein [Capsicum 
annuum]
Length=153

 Score =   131 bits (329),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 77/104 (74%), Positives = 83/104 (80%), Gaps = 4/104 (4%)
 Frame = +3

Query  375  DAKPFAFSASH----RPGFssgpdsdsskdadnsskrkrkNQYRGIRQRPWGKWAAEIRD  542
            D KP  F AS      PG  S    DS+K+ + SSKRKRKNQYRGIRQRPWGKWAAEIRD
Sbjct  49   DVKPLVFHASQLSQPAPGSKSLNSVDSNKEIEKSSKRKRKNQYRGIRQRPWGKWAAEIRD  108

Query  543  PSKGVRVWLGTFDTAEEAARAYDIEARRIRGKKAKVNFPDDAPL  674
            P KGVRVWLGTF TAEEAARAYD+EARRIRG KAKVNFPD+AP+
Sbjct  109  PQKGVRVWLGTFSTAEEAARAYDVEARRIRGNKAKVNFPDEAPV  152



>ref|XP_010654374.1| PREDICTED: ethylene-responsive transcription factor RAP2-12-like 
isoform X2 [Vitis vinifera]
Length=376

 Score =   136 bits (343),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 97/176 (55%), Positives = 114/176 (65%), Gaps = 9/176 (5%)
 Frame = +3

Query  150  MCGGAIISDFKPPSRSSRRLTADLLWGRADLsggkkksnssgshyskPLRSEVVVLDDDF  329
            MCGGAIISDF P SR  RR+  D       L      ++ S S +S+ +  +     +  
Sbjct  1    MCGGAIISDFIPASR-CRRVDEDYF---PALKKRTSGNHCSKSLWSEAVEDDDDDDFEAD  56

Query  330  EADFQDFKDHSYSQVDAKPFAFSASHRPGFssgpdsdsskdadnsskrkrkNQYRGIRQR  509
               F+D  D     +  KP AFSA+   G       + +  A+ S+KRKRKNQYRGIRQR
Sbjct  57   FLGFKDDSDDEEDDI--KPSAFSAAKPHGI---KSVEFNGQAEKSAKRKRKNQYRGIRQR  111

Query  510  PWGKWAAEIRDPSKGVRVWLGTFDTAEEAARAYDIEARRIRGKKAKVNFPDDAPLT  677
            PWGKWAAEIRDP KGVRVWLGTF+TAEEAARAYD EARRIRGKKAKVNFPD+ PLT
Sbjct  112  PWGKWAAEIRDPRKGVRVWLGTFNTAEEAARAYDAEARRIRGKKAKVNFPDETPLT  167



>ref|NP_001241423.1| uncharacterized protein LOC100819416 [Glycine max]
 gb|ADJ57587.1| ERF protein [Glycine max]
Length=300

 Score =   133 bits (334),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 87/172 (51%), Positives = 100/172 (58%), Gaps = 39/172 (23%)
 Frame = +3

Query  150  MCGGAIISDFKPPSRSSRRLTADLLWGRADLsggkkksnssgshyskPLRSEVVVLDDDF  329
            MCGGAII+DF P  R  RRLTA  LW  +                           DDDF
Sbjct  1    MCGGAIIADFIP-RRGGRRLTASELWPNS------------------------FAKDDDF  35

Query  330  EADFQDFKDHSYSQVDAKPFAFSASHRPGFssgpdsdsskdadnsskrkrkNQYRGIRQR  509
            + D+     H  +Q   +P     S  P         S +  +   KR+RKN YRGIRQR
Sbjct  36   DLDY----SHIATQ---QPSTLKRSQPP-------KVSEQVENKPVKRQRKNLYRGIRQR  81

Query  510  PWGKWAAEIRDPSKGVRVWLGTFDTAEEAARAYDIEARRIRGKKAKVNFPDD  665
            PWGKWAAEIRDP KGVRVWLGTF+TAEEAARAYD EAR+IRGKKAKVNFP++
Sbjct  82   PWGKWAAEIRDPRKGVRVWLGTFNTAEEAARAYDREARKIRGKKAKVNFPNE  133



>gb|KHN08668.1| Ethylene-responsive transcription factor RAP2-3 [Glycine soja]
Length=300

 Score =   133 bits (334),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 87/172 (51%), Positives = 100/172 (58%), Gaps = 39/172 (23%)
 Frame = +3

Query  150  MCGGAIISDFKPPSRSSRRLTADLLWGRADLsggkkksnssgshyskPLRSEVVVLDDDF  329
            MCGGAII+DF P  R  RRLTA  LW  +                           DDDF
Sbjct  1    MCGGAIIADFIP-RRGGRRLTASELWPNS------------------------FAKDDDF  35

Query  330  EADFQDFKDHSYSQVDAKPFAFSASHRPGFssgpdsdsskdadnsskrkrkNQYRGIRQR  509
            + D+     H  +Q   +P     S  P         S +  +   KR+RKN YRGIRQR
Sbjct  36   DLDY----SHIATQ---QPSTLKRSQPP-------KVSEQVENKPVKRQRKNLYRGIRQR  81

Query  510  PWGKWAAEIRDPSKGVRVWLGTFDTAEEAARAYDIEARRIRGKKAKVNFPDD  665
            PWGKWAAEIRDP KGVRVWLGTF+TAEEAARAYD EAR+IRGKKAKVNFP++
Sbjct  82   PWGKWAAEIRDPRKGVRVWLGTFNTAEEAARAYDREARKIRGKKAKVNFPNE  133



>ref|XP_009389584.1| PREDICTED: ethylene-responsive transcription factor 1-like [Musa 
acuminata subsp. malaccensis]
Length=354

 Score =   134 bits (336),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 97/187 (52%), Positives = 112/187 (60%), Gaps = 37/187 (20%)
 Frame = +3

Query  150  MCGGAIISDFKPPSRSSRRLTADLLW--GRADLsggkkksnssgshyskPLRSEVVVLDD  323
            MCGGAIIS+F P + +SRR+TA+  W  GR                     +   V  +D
Sbjct  1    MCGGAIISEFIPAA-ASRRVTAENPWPGGRKRWG-----------------KQRRVEAED  42

Query  324  DFEADFQDFKDHSYSQ----------VDAKPFAFSASHRPGFssgpdsdssk-----dad  458
            DFEADFQ+F D S             V  K F F +  +P FS    +            
Sbjct  43   DFEADFQEFDDESSEDEFDDEEEIDEVGVKCFGFGS--KPCFSRERSTTLKSGDFSGSEV  100

Query  459  nsskrkrkNQYRGIRQRPWGKWAAEIRDPSKGVRVWLGTFDTAEEAARAYDIEARRIRGK  638
             S+KRKRKNQ+RGIRQRPWGKWAAEIRDP KGVRVWLGTF++AEEAARAYD EARRIRGK
Sbjct  101  QSAKRKRKNQFRGIRQRPWGKWAAEIRDPHKGVRVWLGTFNSAEEAARAYDAEARRIRGK  160

Query  639  KAKVNFP  659
            KAKVNFP
Sbjct  161  KAKVNFP  167



>ref|XP_010269613.1| PREDICTED: ethylene-responsive transcription factor RAP2-2-like 
[Nelumbo nucifera]
Length=328

 Score =   133 bits (335),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 88/172 (51%), Positives = 103/172 (60%), Gaps = 37/172 (22%)
 Frame = +3

Query  150  MCGGAIISDFKPPSRSSRRLTADLLWGRADLsggkkksnssgshyskPLRSEVVVLDDDF  329
            MCGGAII+DF P +R+ RR+TA  LW                        S     DDDF
Sbjct  1    MCGGAIIADFIPRNRN-RRVTARDLW----------------------PNSPFAKTDDDF  37

Query  330  EADFQDFKDHSYSQVDAKPFAFSASHRPGFssgpdsdsskdadnsskrkrkNQYRGIRQR  509
            E+DF+ F     ++    P               D+      +N+ KRKRKN YRGIRQR
Sbjct  38   ESDFRRFSQEEETKKLPSP--------------ADAGDGAAGENNGKRKRKNLYRGIRQR  83

Query  510  PWGKWAAEIRDPSKGVRVWLGTFDTAEEAARAYDIEARRIRGKKAKVNFPDD  665
            PWGKWAAEIRDP KGVRVWLGTF+TAEEAARAYD EAR+IRGKKAKVNFP++
Sbjct  84   PWGKWAAEIRDPRKGVRVWLGTFNTAEEAARAYDREARKIRGKKAKVNFPNE  135



>gb|ABO09809.1| EREB [Saccharum arundinaceum]
Length=383

 Score =   134 bits (337),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 95/200 (48%), Positives = 113/200 (57%), Gaps = 48/200 (24%)
 Frame = +3

Query  150  MCGGAIISDFKPPS------------RSSRRLTADLLWGRADLsggkkksnssgshyskP  293
            MCGGAI+S F PPS            +  RR+TADLLW      G  +            
Sbjct  1    MCGGAILSGFIPPSGVAAAAAAKKKQQQQRRVTADLLWPGPGKKGAPQ------------  48

Query  294  LRSEVVVLDDDFEADFQDFK-------DHSYSQVDAKPFAFSASHRP---------GFss  425
                    ++DFEADF++F+       D    ++ A   A  A             G  +
Sbjct  49   --------EEDFEADFREFERGLSEGGDDEVQELPAPQPARFAFAAAPKAPRPEVDGVMT  100

Query  426  gpdsdsskdadnsskrkrkNQYRGIRQRPWGKWAAEIRDPSKGVRVWLGTFDTAEEAARA  605
              D+   +   NS KR RKNQYRGIRQRPWGKWAAEIRDPSKGVRVWLGT++TAEEAARA
Sbjct  101  PKDAYGDRPTANSIKRNRKNQYRGIRQRPWGKWAAEIRDPSKGVRVWLGTYNTAEEAARA  160

Query  606  YDIEARRIRGKKAKVNFPDD  665
            YD EAR+IRGKKAKVNFPD+
Sbjct  161  YDAEARKIRGKKAKVNFPDE  180



>gb|EMT10240.1| Ethylene-responsive transcription factor 1 [Aegilops tauschii]
Length=398

 Score =   134 bits (337),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 92/192 (48%), Positives = 116/192 (60%), Gaps = 21/192 (11%)
 Frame = +3

Query  150  MCGGAIISDFKPPSRSSRRLTADLLWGRADLsggkkksnssgshyskPLRSEVVVLDDDF  329
            MCGGAI+ D K P+  +R++TA +LW   +            +   +     +   D DF
Sbjct  1    MCGGAILKDLKVPA-PTRKVTAAVLWPEKNKPKRADGVARRLAGLGRRGGLGLDDGDVDF  59

Query  330  EADFQDF------------------KDHSYSQVDAKP-FAFSAS-HRPGFssgpdsdssk  449
            EADF++F                  KD     V+ KP FA   S  +   S+   +    
Sbjct  60   EADFEEFEADSGDSDVELGRAGVAGKDGHDVVVEIKPLFAVKRSLSQDDLSTMTTAGFDG  119

Query  450  dadnsskrkrkNQYRGIRQRPWGKWAAEIRDPSKGVRVWLGTFDTAEEAARAYDIEARRI  629
             A  S+KRKRKN++RGIRQRPWGKWAAEIRDPSKGVRVWLGTF++AEEAARAYD+EARRI
Sbjct  120  PAQRSAKRKRKNEFRGIRQRPWGKWAAEIRDPSKGVRVWLGTFNSAEEAARAYDVEARRI  179

Query  630  RGKKAKVNFPDD  665
            RGKKAKVNFP++
Sbjct  180  RGKKAKVNFPEE  191



>gb|AFP49825.1| ethylene responsive transcription factor 5b [Triticum aestivum]
Length=383

 Score =   134 bits (336),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 92/203 (45%), Positives = 109/203 (54%), Gaps = 50/203 (25%)
 Frame = +3

Query  150  MCGGAIISDFKPPSRSS----------------RRLTADLLWGRADLsggkkksnssgsh  281
            MCGGAI++ F PPS ++                R +TAD LW                  
Sbjct  1    MCGGAILAGFIPPSAAAAAAKAAAAKKQQQQQQRSVTADSLW------------------  42

Query  282  yskPLRSEVVVLDDDFEADFQDFK------DHSYSQVDAKPFAFSASHRPGFssgp----  431
               P   +    ++DFEADF+DF+      D +  +V   P     +             
Sbjct  43   ---PGLRKKPAEEEDFEADFRDFERDSNDDDDAVEEVPPPPATAGFAFAAAAEVALPAPT  99

Query  432  ---dsdsskdadnsskrkrkNQYRGIRQRPWGKWAAEIRDPSKGVRVWLGTFDTAEEAAR  602
                      A  S KR RKNQYRGIRQRPWGKWAAEIRDPSKGVRVWLGT+DTAEEAAR
Sbjct  100  RLDAIQHDGPAAKSVKRVRKNQYRGIRQRPWGKWAAEIRDPSKGVRVWLGTYDTAEEAAR  159

Query  603  AYDIEARRIRGKKAKVNFPDDAP  671
            AYD EAR+IRGKKAKVNFP++AP
Sbjct  160  AYDAEARKIRGKKAKVNFPEEAP  182



>gb|ACN58181.1| putative ethylene responsive element binding protein [Dasypyrum 
villosum]
Length=394

 Score =   134 bits (336),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 85/200 (43%), Positives = 105/200 (53%), Gaps = 37/200 (19%)
 Frame = +3

Query  150  MCGGAIISDFKPPSRSSRRLTADLLWGRADLsggkkksnssgshyskPLRSEVVVLDDDF  329
            MCGGAI+   K P+  +R++T   LW                +   +     +   D+DF
Sbjct  1    MCGGAILKGLKAPA-VTRKVTEAALWPEKKKPKPAGGLARRLAGLRRRGGLGLDDGDEDF  59

Query  330  EADFQDF------------------KDHSYSQVDAKPFA----------FSASHRPGFss  425
            EADF++F                  KD     V+ KPFA           S     GF  
Sbjct  60   EADFEEFEADSGDSDLELGRGGVAEKDGDDEVVEIKPFAAVKRSLSQDDLSTMTTAGFDC  119

Query  426  gpdsdsskdadnsskrkrkNQYRGIRQRPWGKWAAEIRDPSKGVRVWLGTFDTAEEAARA  605
                 + +           NQ+RGIRQRPWGKWAAEIRDPSKGVRVWLGTF++AEEAARA
Sbjct  120  LAQRSAKRKRK--------NQFRGIRQRPWGKWAAEIRDPSKGVRVWLGTFNSAEEAARA  171

Query  606  YDIEARRIRGKKAKVNFPDD  665
            YD+EARRIRGKKAKVNFP++
Sbjct  172  YDVEARRIRGKKAKVNFPEE  191



>gb|KHG05913.1| Ethylene-responsive transcription factor RAP2-3 -like protein 
[Gossypium arboreum]
Length=256

 Score =   130 bits (328),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 82/178 (46%), Positives = 103/178 (58%), Gaps = 27/178 (15%)
 Frame = +3

Query  150  MCGGAIISDFKPPSRSSRRLTADLLWGRADLsggkkksnssgshyskPLRSEVVVLDDDF  329
            MCGGAIISDF    R  R+LTA+ LW                        SE+    D  
Sbjct  1    MCGGAIISDFIAVKRG-RKLTAEDLW------------------------SELDTFSDLL  35

Query  330  EADFQDFKDHSYSQVDAKPFAFSASH--RPGFssgpdsdsskdadnsskrkrkNQYRGIR  503
              D+ + KD S++Q D       A +  +    +   +   ++ +  ++R RKN YRGIR
Sbjct  36   GLDYGNGKDSSFTQFDNTKAGSKAKNLEKVANETTQKTSRGREKEGKTQRTRKNIYRGIR  95

Query  504  QRPWGKWAAEIRDPSKGVRVWLGTFDTAEEAARAYDIEARRIRGKKAKVNFPDDAPLT  677
            QRPWGKWAAEIRDP KGVRVWLGT++TAEEAARAYD  A+RIRG+KAK+NFP    LT
Sbjct  96   QRPWGKWAAEIRDPHKGVRVWLGTYNTAEEAARAYDEAAKRIRGEKAKLNFPQTPHLT  153



>ref|XP_008783109.1| PREDICTED: ethylene-responsive transcription factor 1-like [Phoenix 
dactylifera]
Length=277

 Score =   131 bits (330),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 100/177 (56%), Positives = 119/177 (67%), Gaps = 25/177 (14%)
 Frame = +3

Query  150  MCGGAIISDFKPPSRSSRRLTADLLWGRADLsggkkksnssgshyskPLRSEVVVLDDDF  329
            MCGGAIISDFKP    +RRLTAD L    D+  G+              + EVV ++DDF
Sbjct  1    MCGGAIISDFKPVG--TRRLTADYLL--PDVKKGR--------------KHEVVKIEDDF  42

Query  330  EADFQDFKDHSYSQ--VDAKPFAFSASHRP---GFssgpdsdsskdadnsskrkrkN-QY  491
            EADF++F+D S  +  +D KPF F  S  P   G S+   S       + S ++++N QY
Sbjct  43   EADFEEFEDESEEEEEIDVKPFVF-GSKVPFSRGLSTNLASVDFGGFVSKSAKRKRNSQY  101

Query  492  RGIRQRPWGKWAAEIRDPSKGVRVWLGTFDTAEEAARAYDIEARRIRGKKAKVNFPD  662
            RGIRQRPWGKW AEIRDP KGVRVWLGTF TAEEAARAYD+EARRIRGKKAKVNFP+
Sbjct  102  RGIRQRPWGKWTAEIRDPYKGVRVWLGTFGTAEEAARAYDVEARRIRGKKAKVNFPE  158



>ref|NP_001241446.1| uncharacterized protein LOC100780763 [Glycine max]
 gb|ACU22984.1| unknown [Glycine max]
Length=304

 Score =   132 bits (331),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 83/172 (48%), Positives = 96/172 (56%), Gaps = 39/172 (23%)
 Frame = +3

Query  150  MCGGAIISDFKPPSRSSRRLTADLLWGRADLsggkkksnssgshyskPLRSEVVVLDDDF  329
            MCGGAII+DF P  R  RRLTA  LW  +                           D DF
Sbjct  1    MCGGAIIADFIP-RRGGRRLTASELWPNS------------------------FGKDGDF  35

Query  330  EADFQDFKDHSYSQVDAKPFAFSASHRPGFssgpdsdsskdadnsskrkrkNQYRGIRQR  509
            + D+    D   S +   P   ++                  +   KR+RKN YRGIRQR
Sbjct  36   DFDYSHIADQQRSTLKMSPPPKASEQ--------------VENKPVKRQRKNLYRGIRQR  81

Query  510  PWGKWAAEIRDPSKGVRVWLGTFDTAEEAARAYDIEARRIRGKKAKVNFPDD  665
            PWGKWAAEIRDP KGVRVWLGTF+TAEEAARAYD EAR+IRGKKAKVNFP++
Sbjct  82   PWGKWAAEIRDPRKGVRVWLGTFNTAEEAARAYDREARKIRGKKAKVNFPNE  133



>ref|XP_009404099.1| PREDICTED: ethylene-responsive transcription factor 1 [Musa acuminata 
subsp. malaccensis]
Length=370

 Score =   132 bits (333),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 93/177 (53%), Positives = 108/177 (61%), Gaps = 13/177 (7%)
 Frame = +3

Query  150  MCGGAIISDFKPPSRSSRRLTADLLW-GRADLsggkkksnssgshyskPLRSEVVVLDDD  326
            MCGGAIISDF P   +SRR+TA+ LW GR       +              ++    +D+
Sbjct  1    MCGGAIISDFIP---ASRRVTAEQLWVGR----EKGELKKGRHWDDDDDFEADFRDFNDE  53

Query  327  FEADFQDFKDHSYSQVDAKPFAFSAS---HRPGFssgpdsdsskdadnsskrkrkNQYRG  497
             E D  D  +    + DA  F F +     R G  S         A  S+KRKRKNQYRG
Sbjct  54   AEEDEFDGGETEAGEFDAVHFGFGSKAPFTREG--SAKSVRFDGSAAKSAKRKRKNQYRG  111

Query  498  IRQRPWGKWAAEIRDPSKGVRVWLGTFDTAEEAARAYDIEARRIRGKKAKVNFPDDA  668
            IRQRPWGKWAAEIRDP KG+RVWLGTF+TAEEAARAYD EARRIRG+KAKVNFP  A
Sbjct  112  IRQRPWGKWAAEIRDPRKGIRVWLGTFNTAEEAARAYDAEARRIRGRKAKVNFPTAA  168



>ref|XP_009380143.1| PREDICTED: ethylene-responsive transcription factor 1-like [Musa 
acuminata subsp. malaccensis]
Length=355

 Score =   132 bits (332),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 94/176 (53%), Positives = 111/176 (63%), Gaps = 8/176 (5%)
 Frame = +3

Query  150  MCGGAIISDFKP-PSRSSRRLTADLLWGRADLsggkkksnssgshyskPLRSEVVVLDDD  326
            MCGGAIISDF P  + +S+R+ A+ LW    L  GK+ +         P   +       
Sbjct  1    MCGGAIISDFIPLATAASQRVMAEHLW--PGLEKGKQTTRRRRRGVEVPDDDDDDDD---  55

Query  327  FEADFQDFKDHS-YSQVDAKPFAF-SASHRPGFssgpdsdsskdadnsskrkrkNQYRGI  500
            FEADFQ+F D +   + DA  F F S +  P   S         A  SSKRKRKN+Y GI
Sbjct  56   FEADFQEFSDETQVDEFDAVHFGFGSEAPFPRDGSPKSVYLDGPAIKSSKRKRKNRYIGI  115

Query  501  RQRPWGKWAAEIRDPSKGVRVWLGTFDTAEEAARAYDIEARRIRGKKAKVNFPDDA  668
            RQRPWGKWAAEIRDP+KG+RVWLGTF+TAEEAARAYD EA R+RGK AKVNFP  A
Sbjct  116  RQRPWGKWAAEIRDPNKGIRVWLGTFNTAEEAARAYDAEAHRLRGKNAKVNFPTGA  171



>gb|AFP49824.1| ethylene responsive transcription factor 5a [Triticum aestivum]
Length=386

 Score =   132 bits (333),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 92/206 (45%), Positives = 109/206 (53%), Gaps = 53/206 (26%)
 Frame = +3

Query  150  MCGGAIISDFKPPSRSS-------------------RRLTADLLWGRADLsggkkksnss  272
            MCGGAI++ F PPS ++                   R +TAD LW               
Sbjct  1    MCGGAILAGFIPPSAAAAAAKAAAAKKQQQQQQQQQRSVTADSLW---------------  45

Query  273  gshyskPLRSEVVVLDDDFEADFQDFK------DHSYSQVDAKPFAFSASHRPGFssgp-  431
                  P   +    ++DFEADF+DF+      D +  +V   P     +          
Sbjct  46   ------PGLRKKPAEEEDFEADFRDFERDSNDDDDAVEEVPPPPATAGFAFAAAAEVALP  99

Query  432  ------dsdsskdadnsskrkrkNQYRGIRQRPWGKWAAEIRDPSKGVRVWLGTFDTAEE  593
                         A  S KR RKNQYRGIRQRPWGKWAAEIRDPSKGVRVWLGT+DTAEE
Sbjct  100  APTRLDAIQHDGPAAKSVKRVRKNQYRGIRQRPWGKWAAEIRDPSKGVRVWLGTYDTAEE  159

Query  594  AARAYDIEARRIRGKKAKVNFPDDAP  671
            AARAYD EAR+IRGKKAKVNFP++AP
Sbjct  160  AARAYDAEARKIRGKKAKVNFPEEAP  185



>gb|AAX68525.1| putative ethylene responsive element binding protein 2 [Gossypium 
hirsutum]
Length=256

 Score =   130 bits (326),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 81/178 (46%), Positives = 103/178 (58%), Gaps = 27/178 (15%)
 Frame = +3

Query  150  MCGGAIISDFKPPSRSSRRLTADLLWGRADLsggkkksnssgshyskPLRSEVVVLDDDF  329
            MCGGAIISDF    R  R+LTA+ LW                        SE+    D  
Sbjct  1    MCGGAIISDFIAVKRG-RKLTAEDLW------------------------SELDTFSDLL  35

Query  330  EADFQDFKDHSYSQVDAKPFAFSASH--RPGFssgpdsdsskdadnsskrkrkNQYRGIR  503
              D+ + K+ S++Q D       A +  +    +   +   ++ +  ++R RKN YRGIR
Sbjct  36   GLDYGNGKESSFTQSDNTKAGSKAKNLEKVANETTQKTSRGREKEGKTQRTRKNIYRGIR  95

Query  504  QRPWGKWAAEIRDPSKGVRVWLGTFDTAEEAARAYDIEARRIRGKKAKVNFPDDAPLT  677
            QRPWGKWAAEIRDP KGVRVWLGT++TAEEAARAYD  A+RIRG+KAK+NFP    LT
Sbjct  96   QRPWGKWAAEIRDPHKGVRVWLGTYNTAEEAARAYDEAAKRIRGEKAKLNFPQTPHLT  153



>ref|XP_006297883.1| hypothetical protein CARUB_v10013925mg [Capsella rubella]
 gb|EOA30781.1| hypothetical protein CARUB_v10013925mg [Capsella rubella]
Length=385

 Score =   132 bits (332),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 102/189 (54%), Positives = 120/189 (63%), Gaps = 26/189 (14%)
 Frame = +3

Query  150  MCGGAIISDFKPPSRSSRRLTADLLWGRADLsggkkksnssgshyskPLRSEVVVLDDDF  329
            MCGGAIISDF PP RS RR+T++ +W   DL    K S    +      RS+   LD++F
Sbjct  1    MCGGAIISDFIPPPRS-RRVTSEFIW--PDLKNKGKVSKKRSTK-----RSDFFDLDEEF  52

Query  330  EADFQDFKDHSYSQVD------AKPFAFSASHRP-----------GFssgpdsdsskdad  458
            EADFQ FKD S  + D       KPF F+A+ +P           GF+S   +  S    
Sbjct  53   EADFQGFKDESSFECDDDVYANVKPFVFNATTKPVASPASAFVSTGFTSAKKTVESDGQA  112

Query  459  nsskrkr-kNQYRGIRQRPWGKWAAEIRDPSKGVRVWLGTFDTAEEAARAYDIEARRIRG  635
              S +++ KNQYRGIRQRPWGKWAAEIRDP KG R WLGTFDTAEEAARAYD  ARRIRG
Sbjct  113  EKSSKRKRKNQYRGIRQRPWGKWAAEIRDPRKGSREWLGTFDTAEEAARAYDAAARRIRG  172

Query  636  KKAKVNFPD  662
             KAKVNFP+
Sbjct  173  SKAKVNFPE  181



>gb|AFH56410.1| ethylene response factor 3, partial [Diospyros kaki]
Length=328

 Score =   131 bits (329),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 75/103 (73%), Positives = 83/103 (81%), Gaps = 3/103 (3%)
 Frame = +3

Query  372  VDAKPFAFSASHRP---GFssgpdsdsskdadnsskrkrkNQYRGIRQRPWGKWAAEIRD  542
            V+ KPFAFSA+      G  S    +    A+ S+KRKRKNQYRGIRQRPWGKWAAEIRD
Sbjct  13   VNVKPFAFSATKSGLTRGSRSAKSVEVGGQAEKSAKRKRKNQYRGIRQRPWGKWAAEIRD  72

Query  543  PSKGVRVWLGTFDTAEEAARAYDIEARRIRGKKAKVNFPDDAP  671
            P KGVRVWLGTF+TAEEAARAYD EAR+IRGKKAKVNFPD+AP
Sbjct  73   PRKGVRVWLGTFNTAEEAARAYDAEARKIRGKKAKVNFPDEAP  115



>ref|XP_010236158.1| PREDICTED: ethylene-responsive transcription factor 1-like [Brachypodium 
distachyon]
Length=394

 Score =   131 bits (330),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 92/192 (48%), Positives = 110/192 (57%), Gaps = 44/192 (23%)
 Frame = +3

Query  150  MCGGAIISDFKPPSRSSRRLTADLLWGRADLsggkkksnssgshyskPLRSEVV--VLDD  323
            MCGGAI++D K P   SRRL   LLW                     P + +V     +D
Sbjct  1    MCGGAILTDLKRPPAVSRRLAEGLLW---------------------PEKKKVCWKGEED  39

Query  324  DFEADFQDFK--------------DHSYSQVDAKPF----AFSASHRPGFssgpdsdssk  449
            DFEADF  F+                    V+ KP     AF+       S+   +    
Sbjct  40   DFEADFGGFEVVDEDLEFGGEEEEAGDDDVVEIKPPPVKRAFTGDD---LSTMTSAAFDG  96

Query  450  dadnsskrkrkNQYRGIRQRPWGKWAAEIRDPSKGVRVWLGTFDTAEEAARAYDIEARRI  629
             A+ S+KRKRKNQ+RGIRQRPWGKWAAEIRDP+KGVRVWLGTF++AEEAARAYD EARRI
Sbjct  97   PAERSAKRKRKNQFRGIRQRPWGKWAAEIRDPNKGVRVWLGTFNSAEEAARAYDAEARRI  156

Query  630  RGKKAKVNFPDD  665
            RG KAKVNFP++
Sbjct  157  RGNKAKVNFPEE  168



>ref|XP_010501805.1| PREDICTED: ethylene-responsive transcription factor RAP2-2-like 
[Camelina sativa]
Length=387

 Score =   131 bits (329),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 108/191 (57%), Positives = 123/191 (64%), Gaps = 26/191 (14%)
 Frame = +3

Query  150  MCGGAIISDFKPPSRSSRRLTADLLWGRADLsggkkksnssgshyskPLRSEVVVLDDDF  329
            MCGGAIISDF PP RS RR+T++ +W   DL    K S    +      RS+   LDD+F
Sbjct  1    MCGGAIISDFIPPPRS-RRVTSEFIW--PDLKNKGKASKKRSTKK----RSDFFDLDDEF  53

Query  330  EADFQDFKDHSYSQVD-------AKPFAFSASHRP------------GFssgpdsdsskd  452
            EADFQ FKD S    D       AKPF F+A+ +P              S+    +S   
Sbjct  54   EADFQGFKDDSSFDCDVDDVFGNAKPFVFAATTKPVPSPASAFVSSGSTSAKKIVESDGQ  113

Query  453  adnsskrkrkNQYRGIRQRPWGKWAAEIRDPSKGVRVWLGTFDTAEEAARAYDIEARRIR  632
            A+ SSKRKRKNQYRGIRQRPWGKWAAEIRDP KG R WLGTFDTAEEAARAYD  ARRIR
Sbjct  114  AEKSSKRKRKNQYRGIRQRPWGKWAAEIRDPRKGSREWLGTFDTAEEAARAYDAAARRIR  173

Query  633  GKKAKVNFPDD  665
            G KAKVNFP++
Sbjct  174  GSKAKVNFPEE  184



>ref|XP_008643764.1| PREDICTED: ethylene response element binding protein isoform 
X1 [Zea mays]
Length=310

 Score =   129 bits (325),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 89/183 (49%), Positives = 106/183 (58%), Gaps = 27/183 (15%)
 Frame = +3

Query  150  MCGGAIISDFKPPSRSSRRLTADLLWGRADLsggkkksnssgshyskPLRSEVVVLDDDF  329
            MCGGAI+++ + P+   RRLT   +W +                            D+DF
Sbjct  1    MCGGAILANLREPA--PRRLTERDIWQQKKKLKRGGGGGRRSFAAED---------DEDF  49

Query  330  EADFQDFKDHSYSQ------------VDAKPFAFSASHRPGFssgpdsdsskdadnsskr  473
            EADF+ F+  S               V+ KPF    + +  FSS   S  +     S+KR
Sbjct  50   EADFEVFEADSSDSDLELREGTDDDVVEIKPF----TAKRTFSSDGLSTMTSAVARSAKR  105

Query  474  krkNQYRGIRQRPWGKWAAEIRDPSKGVRVWLGTFDTAEEAARAYDIEARRIRGKKAKVN  653
            KRKN YRGIRQRPWGKWAAEIRDP KGVRVWLGTF++ EEAARAYD EARRIRGKKAKVN
Sbjct  106  KRKNLYRGIRQRPWGKWAAEIRDPQKGVRVWLGTFNSPEEAARAYDAEARRIRGKKAKVN  165

Query  654  FPD  662
            FPD
Sbjct  166  FPD  168



>gb|ACF88275.1| unknown [Zea mays]
 gb|AFW73781.1| putative AP2/EREBP transcription factor superfamily protein [Zea 
mays]
 gb|AIB05082.1| AP2-EREBP transcription factor, partial [Zea mays]
Length=363

 Score =   130 bits (327),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 89/183 (49%), Positives = 106/183 (58%), Gaps = 27/183 (15%)
 Frame = +3

Query  150  MCGGAIISDFKPPSRSSRRLTADLLWGRADLsggkkksnssgshyskPLRSEVVVLDDDF  329
            MCGGAI+++ + P+   RRLT   +W +                            D+DF
Sbjct  1    MCGGAILANLREPA--PRRLTERDIWQQKKKLKRGGGGGRRSFAAED---------DEDF  49

Query  330  EADFQDFKDHSYSQ------------VDAKPFAFSASHRPGFssgpdsdsskdadnsskr  473
            EADF+ F+  S               V+ KPF    + +  FSS   S  +     S+KR
Sbjct  50   EADFEVFEADSSDSDLELREGTDDDVVEIKPF----TAKRTFSSDGLSTMTSAVARSAKR  105

Query  474  krkNQYRGIRQRPWGKWAAEIRDPSKGVRVWLGTFDTAEEAARAYDIEARRIRGKKAKVN  653
            KRKN YRGIRQRPWGKWAAEIRDP KGVRVWLGTF++ EEAARAYD EARRIRGKKAKVN
Sbjct  106  KRKNLYRGIRQRPWGKWAAEIRDPQKGVRVWLGTFNSPEEAARAYDAEARRIRGKKAKVN  165

Query  654  FPD  662
            FPD
Sbjct  166  FPD  168



>ref|NP_001150246.1| ethylene response element binding protein [Zea mays]
 gb|ACG38354.1| ethylene response element binding protein [Zea mays]
Length=363

 Score =   130 bits (327),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 89/183 (49%), Positives = 106/183 (58%), Gaps = 27/183 (15%)
 Frame = +3

Query  150  MCGGAIISDFKPPSRSSRRLTADLLWGRADLsggkkksnssgshyskPLRSEVVVLDDDF  329
            MCGGAI+++ + P+   RRLT   +W +                            D+DF
Sbjct  1    MCGGAILANLREPA--PRRLTERDIWQQKKKLKRGGGGGRRSFAAED---------DEDF  49

Query  330  EADFQDFKDHSYSQ------------VDAKPFAFSASHRPGFssgpdsdsskdadnsskr  473
            EADF+ F+  S               V+ KPF    + +  FSS   S  +     S+KR
Sbjct  50   EADFEVFEADSSDSDLELREGTDDDVVEIKPF----TAKRTFSSDGLSTMTSAVARSAKR  105

Query  474  krkNQYRGIRQRPWGKWAAEIRDPSKGVRVWLGTFDTAEEAARAYDIEARRIRGKKAKVN  653
            KRKN YRGIRQRPWGKWAAEIRDP KGVRVWLGTF++ EEAARAYD EARRIRGKKAKVN
Sbjct  106  KRKNLYRGIRQRPWGKWAAEIRDPQKGVRVWLGTFNSPEEAARAYDAEARRIRGKKAKVN  165

Query  654  FPD  662
            FPD
Sbjct  166  FPD  168



>emb|CAD56217.1| transcription factor EREBP-like protein [Cicer arietinum]
Length=344

 Score =   130 bits (326),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 59/65 (91%), Positives = 63/65 (97%), Gaps = 0/65 (0%)
 Frame = +3

Query  483  NQYRGIRQRPWGKWAAEIRDPSKGVRVWLGTFDTAEEAARAYDIEARRIRGKKAKVNFPD  662
            NQYRGIRQRPWGKWAAEIRDP KGVRVWLGTF+TAEEAARAYD EARRIRGKKAKVNFP+
Sbjct  72   NQYRGIRQRPWGKWAAEIRDPRKGVRVWLGTFNTAEEAARAYDAEARRIRGKKAKVNFPE  131

Query  663  DAPLT  677
            +AP+T
Sbjct  132  EAPVT  136



>ref|XP_003578162.1| PREDICTED: ethylene-responsive transcription factor 1-like [Brachypodium 
distachyon]
Length=401

 Score =   130 bits (327),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 90/211 (43%), Positives = 110/211 (52%), Gaps = 54/211 (26%)
 Frame = +3

Query  150  MCGGAIISDFKPPSRSSR------------RLTADLLWGRADLsggkkksnssgshyskP  293
            MCGGAI+S F PPS ++             R+ AD LW                    K 
Sbjct  1    MCGGAILSGFIPPSAAAAAAAAKKKKQQQQRVMADALW---------------PGLQRKA  45

Query  294  LRSEVVVLDDDFEADFQDFKDHSYSQVDAKP----------------FAFSASHRPGFss  425
             ++EV    +DFEADF++F+  S  +                     FAF+A        
Sbjct  46   PQAEV----EDFEADFREFERDSSEEDAGGDDDDVVEVVPPPPAKAGFAFAAVAEGALPP  101

Query  426  gpdsdsskdadnsskrkr-------kNQYRGIRQRPWGKWAAEIRDPSKGVRVWLGTFDT  584
              D+ +   +               KNQYRGIRQRPWGKWAAEIRDPSKGVRVWLGT++T
Sbjct  102  TVDAVTIPKSVEHDGSGTGPVKRNRKNQYRGIRQRPWGKWAAEIRDPSKGVRVWLGTYNT  161

Query  585  AEEAARAYDIEARRIRGKKAKVNFPDDAPLT  677
            AEEAARAYD EAR+IRGKKAKVNFPD+ P +
Sbjct  162  AEEAARAYDAEARKIRGKKAKVNFPDEEPTS  192



>gb|ACU23153.1| unknown [Glycine max]
Length=285

 Score =   128 bits (322),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 59/65 (91%), Positives = 62/65 (95%), Gaps = 0/65 (0%)
 Frame = +3

Query  483  NQYRGIRQRPWGKWAAEIRDPSKGVRVWLGTFDTAEEAARAYDIEARRIRGKKAKVNFPD  662
            NQYRGIRQRPWGKWAAEIRDP KGVRVWLGTF+TAEEAARAYD EARRIRGKKAKVNFP+
Sbjct  40   NQYRGIRQRPWGKWAAEIRDPRKGVRVWLGTFNTAEEAARAYDAEARRIRGKKAKVNFPE  99

Query  663  DAPLT  677
            +AP T
Sbjct  100  EAPGT  104



>ref|XP_002454666.1| hypothetical protein SORBIDRAFT_04g035160 [Sorghum bicolor]
 gb|EES07642.1| hypothetical protein SORBIDRAFT_04g035160 [Sorghum bicolor]
Length=368

 Score =   129 bits (325),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 91/184 (49%), Positives = 107/184 (58%), Gaps = 25/184 (14%)
 Frame = +3

Query  150  MCGGAIISDFKPPSRSSRRLTADLLWGRADLsggkkksnssgshyskPLRSEVVVLDDDF  329
            MCGGAI+ D + P    RR+T   +W +     G      S +              +DF
Sbjct  1    MCGGAILDDLREPEL--RRVTDRDIWQKKKPKRGGGGGRRSFAAEDH----------EDF  48

Query  330  EADFQDFKDHSYSQ------------VDAKPFAFSASHR-PGFssgpdsdsskdadnssk  470
            EADF DF+  S               V+ KPFA   +    G S+   +D       S+K
Sbjct  49   EADFADFEADSGDSDLELGEGADDDVVEIKPFAAKGTFSGDGLSTMTTADYDAPVARSAK  108

Query  471  rkrkNQYRGIRQRPWGKWAAEIRDPSKGVRVWLGTFDTAEEAARAYDIEARRIRGKKAKV  650
            RKRKNQYRGIR+RPWGKWAAEIRDP KGVRVWLGTF++ EEAARAYD EARRIRGKKAKV
Sbjct  109  RKRKNQYRGIRKRPWGKWAAEIRDPQKGVRVWLGTFNSPEEAARAYDAEARRIRGKKAKV  168

Query  651  NFPD  662
            NFPD
Sbjct  169  NFPD  172



>gb|EMS53993.1| Ethylene-responsive transcription factor 1 [Triticum urartu]
Length=310

 Score =   129 bits (323),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 59/63 (94%), Positives = 62/63 (98%), Gaps = 0/63 (0%)
 Frame = +3

Query  483  NQYRGIRQRPWGKWAAEIRDPSKGVRVWLGTFDTAEEAARAYDIEARRIRGKKAKVNFPD  662
            NQYRGIRQRPWGKWAAEIRDPSKGVRVWLGT+DTAEEAARAYD EAR+IRGKKAKVNFP+
Sbjct  45   NQYRGIRQRPWGKWAAEIRDPSKGVRVWLGTYDTAEEAARAYDAEARKIRGKKAKVNFPE  104

Query  663  DAP  671
            DAP
Sbjct  105  DAP  107



>dbj|BAJ95634.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ88279.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=351

 Score =   129 bits (325),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 95/179 (53%), Positives = 113/179 (63%), Gaps = 15/179 (8%)
 Frame = +3

Query  150  MCGGAIISDFKPPSRSSRRLTADLLWGRADLsggkkksnssgshyskPLRSEVVVLDDDF  329
            MCGGAI+SD  PP R   R     LW +AD    +                E    D+DF
Sbjct  1    MCGGAILSDIIPPPR---RAAGGRLW-QADRKKRRAGPRRVPEEE---PEEEAEEGDEDF  53

Query  330  EADFQDFKDHSYSQVDAKPFAFSASHRPGFs----sgpdsdsskdadnsskrkrkNQYRG  497
            EADF+ F D   S  + KPF    + R GFS        +     A  S+KRKRKNQ+RG
Sbjct  54   EADFEGFVDEE-SDGEVKPFP---ARRSGFSGDGLKATAAGEYDCASGSAKRKRKNQFRG  109

Query  498  IRQRPWGKWAAEIRDPSKGVRVWLGTFDTAEEAARAYDIEARRIRGKKAKVNFPDDAPL  674
            IR+RPWGKWAAEIRDP KGVRVWLGT+++AEEAARAYD+EARRIRGKKAKVNFP++AP+
Sbjct  110  IRRRPWGKWAAEIRDPRKGVRVWLGTYNSAEEAARAYDVEARRIRGKKAKVNFPEEAPM  168



>gb|EMT09007.1| Ethylene-responsive transcription factor 1 [Aegilops tauschii]
Length=335

 Score =   129 bits (324),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 59/63 (94%), Positives = 62/63 (98%), Gaps = 0/63 (0%)
 Frame = +3

Query  483  NQYRGIRQRPWGKWAAEIRDPSKGVRVWLGTFDTAEEAARAYDIEARRIRGKKAKVNFPD  662
            NQYRGIRQRPWGKWAAEIRDPSKGVRVWLGT+DTAEEAARAYD EAR+IRGKKAKVNFP+
Sbjct  72   NQYRGIRQRPWGKWAAEIRDPSKGVRVWLGTYDTAEEAARAYDAEARKIRGKKAKVNFPE  131

Query  663  DAP  671
            DAP
Sbjct  132  DAP  134



>gb|AFU07641.1| ethylene-responsive element binding factor 4 [Arachis hypogaea]
Length=306

 Score =   128 bits (322),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 86/172 (50%), Positives = 103/172 (60%), Gaps = 34/172 (20%)
 Frame = +3

Query  150  MCGGAIISDFKPPSRSSRRLTADLLWGRADLsggkkksnssgshyskPLRSEVVVLDDDF  329
            MCGGAII++F P +RS RRLTA  +W                        +  V   DDF
Sbjct  1    MCGGAIIAEFIPRNRS-RRLTASEIWPNT-------------------FSNNQV---DDF  37

Query  330  EADFQDFKDHSYSQVDAKPFAFSASHRPGFssgpdsdsskdadnsskrkrkNQYRGIRQR  509
            + DF      S+  +   P    AS     S        +++   +KR+RKN YRGIRQR
Sbjct  38   DFDF------SHHHLKNTPTLSKAS-----SPSVGEQDQENSKPPAKRQRKNLYRGIRQR  86

Query  510  PWGKWAAEIRDPSKGVRVWLGTFDTAEEAARAYDIEARRIRGKKAKVNFPDD  665
            PWGKWAAEIRDP KGVRVWLGTF+TAEEAARAYD EAR+IRGKKAKVNFP++
Sbjct  87   PWGKWAAEIRDPRKGVRVWLGTFNTAEEAARAYDREARKIRGKKAKVNFPNE  138



>ref|XP_006604931.1| PREDICTED: ethylene-responsive transcription factor RAP2-2-like 
[Glycine max]
 gb|KHN11351.1| Ethylene-responsive transcription factor 1 [Glycine soja]
Length=299

 Score =   127 bits (320),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 59/65 (91%), Positives = 62/65 (95%), Gaps = 0/65 (0%)
 Frame = +3

Query  483  NQYRGIRQRPWGKWAAEIRDPSKGVRVWLGTFDTAEEAARAYDIEARRIRGKKAKVNFPD  662
            NQYRGIRQRPWGKWAAEIRDP KGVRVWLGTF+TAEEAARAYD EARRIRGKKAKVNFP+
Sbjct  54   NQYRGIRQRPWGKWAAEIRDPRKGVRVWLGTFNTAEEAARAYDAEARRIRGKKAKVNFPE  113

Query  663  DAPLT  677
            +AP T
Sbjct  114  EAPGT  118



>ref|XP_010487223.1| PREDICTED: ethylene-responsive transcription factor RAP2-2-like 
[Camelina sativa]
Length=388

 Score =   129 bits (324),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 106/191 (55%), Positives = 121/191 (63%), Gaps = 26/191 (14%)
 Frame = +3

Query  150  MCGGAIISDFKPPSRSSRRLTADLLWGRADLsggkkksnssgshyskPLRSEVVVLDDDF  329
            MCGGAIISDF PP RS RR+T++ +W   DL    K S    +      RS+   LDD+F
Sbjct  1    MCGGAIISDFIPPPRS-RRVTSEFIW--PDLKNKGKASKKRSTKK----RSDFFDLDDEF  53

Query  330  EADFQDFKDHSYSQVDA-------KPFAFSASHRP------------GFssgpdsdsskd  452
            EADFQ FKD S    D        KPF F+A+ +P               +    +S   
Sbjct  54   EADFQGFKDDSSFDCDVDDVFGNVKPFVFAATTKPVASPASAFVSSGSTPAKKIVESDGQ  113

Query  453  adnsskrkrkNQYRGIRQRPWGKWAAEIRDPSKGVRVWLGTFDTAEEAARAYDIEARRIR  632
            A+ SSKRKRKNQYRGIRQRPWGKWAAEIRDP KG R WLGTFDTAEEAARAYD  ARRIR
Sbjct  114  AEKSSKRKRKNQYRGIRQRPWGKWAAEIRDPRKGSREWLGTFDTAEEAARAYDAAARRIR  173

Query  633  GKKAKVNFPDD  665
            G KAKVNFP++
Sbjct  174  GSKAKVNFPEE  184



>emb|CAD56466.1| ethylene response element binding protein [Triticum aestivum]
Length=349

 Score =   129 bits (323),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 95/179 (53%), Positives = 113/179 (63%), Gaps = 15/179 (8%)
 Frame = +3

Query  150  MCGGAIISDFKPPSRSSRRLTADLLWGRADLsggkkksnssgshyskPLRSEVVVLDDDF  329
            MCGGAI+SD  PP R   R     LW +AD    +                E    D+DF
Sbjct  1    MCGGAILSDIIPPPR---RPAGGRLW-QADRKKRRAGPRRVPEEE---PEEEAEEGDEDF  53

Query  330  EADFQDFKDHSYSQVDAKPFAFSASHRPGFs----sgpdsdsskdadnsskrkrkNQYRG  497
            EADF+ F D   S  + KPF    + R GFS        +     A  S+KRKRKNQ+RG
Sbjct  54   EADFEGFVDEE-SDGEVKPFP---ARRSGFSGDGLKATAAGEYDCASGSAKRKRKNQFRG  109

Query  498  IRQRPWGKWAAEIRDPSKGVRVWLGTFDTAEEAARAYDIEARRIRGKKAKVNFPDDAPL  674
            IR+RPWGKWAAEIRDP KGVRVWLGT+++AEEAARAYD+EARRIRGKKAKVNFP++AP+
Sbjct  110  IRRRPWGKWAAEIRDPRKGVRVWLGTYNSAEEAARAYDVEARRIRGKKAKVNFPEEAPM  168



>gb|ACL54595.1| unknown [Zea mays]
Length=448

 Score =   129 bits (325),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 89/183 (49%), Positives = 106/183 (58%), Gaps = 27/183 (15%)
 Frame = +3

Query  150  MCGGAIISDFKPPSRSSRRLTADLLWGRADLsggkkksnssgshyskPLRSEVVVLDDDF  329
            MCGGAI+++ + P+   RRLT   +W +                            D+DF
Sbjct  1    MCGGAILANLREPA--PRRLTERDIWQQKKKLKRGGGGGRRSFAAED---------DEDF  49

Query  330  EADFQDFKDHSYSQ------------VDAKPFAFSASHRPGFssgpdsdsskdadnsskr  473
            EADF+ F+  S               V+ KPF    + +  FSS   S  +     S+KR
Sbjct  50   EADFEVFEADSSDSDLELREGTDDDVVEIKPF----TAKRTFSSDGLSTMTSAVARSAKR  105

Query  474  krkNQYRGIRQRPWGKWAAEIRDPSKGVRVWLGTFDTAEEAARAYDIEARRIRGKKAKVN  653
            KRKN YRGIRQRPWGKWAAEIRDP KGVRVWLGTF++ EEAARAYD EARRIRGKKAKVN
Sbjct  106  KRKNLYRGIRQRPWGKWAAEIRDPQKGVRVWLGTFNSPEEAARAYDAEARRIRGKKAKVN  165

Query  654  FPD  662
            FPD
Sbjct  166  FPD  168



>gb|KDO45751.1| hypothetical protein CISIN_1g020391mg [Citrus sinensis]
Length=319

 Score =   127 bits (320),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 58/63 (92%), Positives = 61/63 (97%), Gaps = 0/63 (0%)
 Frame = +3

Query  483  NQYRGIRQRPWGKWAAEIRDPSKGVRVWLGTFDTAEEAARAYDIEARRIRGKKAKVNFPD  662
            NQYRGIRQRPWGKWAAEIRDP+KGVRVWLGTF+TAEEAARAYD EARRIRGKKAKVNFPD
Sbjct  49   NQYRGIRQRPWGKWAAEIRDPTKGVRVWLGTFNTAEEAARAYDAEARRIRGKKAKVNFPD  108

Query  663  DAP  671
            + P
Sbjct  109  ETP  111



>ref|XP_010465314.1| PREDICTED: ethylene-responsive transcription factor RAP2-2-like 
[Camelina sativa]
Length=382

 Score =   129 bits (323),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 107/192 (56%), Positives = 122/192 (64%), Gaps = 27/192 (14%)
 Frame = +3

Query  150  MCGGAIISDFKPPSRSSRRLTADLLWGRADLsggkkksnssgshyskPLRSEVVVLDDDF  329
            MCGGAIISDF PP RS RR+T++ +W   DL    K      +      RS+   LDD+F
Sbjct  1    MCGGAIISDFIPPPRS-RRVTSEFIW--PDLKNKGKAWKKRSTKK----RSDFFDLDDEF  53

Query  330  EADFQDFKDHSYSQVD-------AKPFAFSASHRP-------------GFssgpdsdssk  449
            EADFQ FKD S    D       AKPF F+A+ +P               S+    +S  
Sbjct  54   EADFQGFKDDSSFDCDVDDVFGNAKPFVFAATTKPVASSPASAFVSSGSASARKIVESDG  113

Query  450  dadnsskrkrkNQYRGIRQRPWGKWAAEIRDPSKGVRVWLGTFDTAEEAARAYDIEARRI  629
             A+ SSKRKRKNQYRGIRQRPWGKWAAEIRDP KG R WLGTFDTAEEAARAYD  ARRI
Sbjct  114  QAEKSSKRKRKNQYRGIRQRPWGKWAAEIRDPRKGSREWLGTFDTAEEAARAYDAAARRI  173

Query  630  RGKKAKVNFPDD  665
            RG KAKVNFP++
Sbjct  174  RGSKAKVNFPEE  185



>gb|KDO45752.1| hypothetical protein CISIN_1g020391mg [Citrus sinensis]
 gb|KDO45753.1| hypothetical protein CISIN_1g020391mg [Citrus sinensis]
 gb|KDO45754.1| hypothetical protein CISIN_1g020391mg [Citrus sinensis]
Length=326

 Score =   127 bits (320),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 58/63 (92%), Positives = 61/63 (97%), Gaps = 0/63 (0%)
 Frame = +3

Query  483  NQYRGIRQRPWGKWAAEIRDPSKGVRVWLGTFDTAEEAARAYDIEARRIRGKKAKVNFPD  662
            NQYRGIRQRPWGKWAAEIRDP+KGVRVWLGTF+TAEEAARAYD EARRIRGKKAKVNFPD
Sbjct  49   NQYRGIRQRPWGKWAAEIRDPTKGVRVWLGTFNTAEEAARAYDAEARRIRGKKAKVNFPD  108

Query  663  DAP  671
            + P
Sbjct  109  ETP  111



>ref|XP_002463183.1| hypothetical protein SORBIDRAFT_02g039300 [Sorghum bicolor]
 gb|EER99704.1| hypothetical protein SORBIDRAFT_02g039300 [Sorghum bicolor]
Length=320

 Score =   127 bits (320),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 88/171 (51%), Positives = 104/171 (61%), Gaps = 15/171 (9%)
 Frame = +3

Query  150  MCGGAIISDFKPPSRSSRRLTADLLWGRADLsggkkksnssgshyskPLRSEVVVLDDDF  329
            MCGGAI+SD   P R  +++TA+ LW  +          SS S  +   +S     +DDF
Sbjct  1    MCGGAILSDLYSPVR--QKVTANHLWTES---------GSSKSGKNWKRKSSWEFGEDDF  49

Query  330  EADFQDFKD-HSYSQVDAKPFAFSASHRPGFssgpdsdsskdadnsskrkrkNQYRGIRQ  506
            EADF+ F+D  S   VD   F          SS     S+      + RKR+ QYRGIR+
Sbjct  50   EADFEGFEDGDSEEDVD---FVHEGQEFQTNSSNLVVGSNVHTAKVASRKRRTQYRGIRR  106

Query  507  RPWGKWAAEIRDPSKGVRVWLGTFDTAEEAARAYDIEARRIRGKKAKVNFP  659
            RPWGKWAAEIRDP KGVRVWLGT+ TAEEAARAYD  A RIRGKKAKVNFP
Sbjct  107  RPWGKWAAEIRDPRKGVRVWLGTYSTAEEAARAYDTAAWRIRGKKAKVNFP  157



>dbj|BAK03679.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=385

 Score =   128 bits (322),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 59/63 (94%), Positives = 62/63 (98%), Gaps = 0/63 (0%)
 Frame = +3

Query  483  NQYRGIRQRPWGKWAAEIRDPSKGVRVWLGTFDTAEEAARAYDIEARRIRGKKAKVNFPD  662
            NQYRGIRQRPWGKWAAEIRDPSKGVRVWLGT+DTAEEAARAYD EAR+IRGKKAKVNFP+
Sbjct  122  NQYRGIRQRPWGKWAAEIRDPSKGVRVWLGTYDTAEEAARAYDAEARKIRGKKAKVNFPE  181

Query  663  DAP  671
            DAP
Sbjct  182  DAP  184



>ref|NP_188299.1| ethylene-responsive transcription factor RAP2-3 [Arabidopsis 
thaliana]
 sp|P42736.2|RAP23_ARATH RecName: Full=Ethylene-responsive transcription factor RAP2-3; 
AltName: Full=Cadmium-induced protein AS30; AltName: Full=Ethylene 
response factor 72; Short=ERF72; AltName: Full=Ethylene-responsive 
element binding protein; Short=AtEBP; AltName: 
Full=Protein RELATED TO APETALA2 3; Short=Related to AP2 
3 [Arabidopsis thaliana]
 gb|AAC49769.1| AP2 domain containing protein RAP2.3 [Arabidopsis thaliana]
 dbj|BAB02769.1| AP2 domain transcription factor RAP2.3 [Arabidopsis thaliana]
 gb|AAK59605.1| putative AP2 domain containing protein RAP2.3 [Arabidopsis thaliana]
 gb|AAL24399.1| AP2 domain transcription factor RAP2.3 [Arabidopsis thaliana]
 gb|AAM65031.1| AP2 domain containing protein RAP2.3 [Arabidopsis thaliana]
 gb|AAN13131.1| putative AP2 domain containing protein RAP2.3 [Arabidopsis thaliana]
 gb|AEE75863.1| ethylene-responsive transcription factor RAP2-3 [Arabidopsis 
thaliana]
Length=248

 Score =   125 bits (315),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 82/175 (47%), Positives = 95/175 (54%), Gaps = 43/175 (25%)
 Frame = +3

Query  150  MCGGAIISDFKP--PSRSSRRLTADLLWGRADLsggkkksnssgshyskPLRSEVVVLDD  323
            MCGGAIISD+ P       R+LTA+ LW   D S                         D
Sbjct  1    MCGGAIISDYAPLVTKAKGRKLTAEELWSELDASAA-----------------------D  37

Query  324  DFEADFQDFKDHSYSQVDAKPFAFSASH--RPGFssgpdsdsskdadnsskrkrkNQYRG  497
            DF   +   K H  +QV+ K  A        PG                 +RKRKN YRG
Sbjct  38   DFWGFYSTSKLHPTNQVNVKEEAVKKEQATEPG----------------KRRKRKNVYRG  81

Query  498  IRQRPWGKWAAEIRDPSKGVRVWLGTFDTAEEAARAYDIEARRIRGKKAKVNFPD  662
            IR+RPWGKWAAEIRDP KGVRVWLGTF+TAEEAA AYD+ A++IRG KAK+NFPD
Sbjct  82   IRKRPWGKWAAEIRDPRKGVRVWLGTFNTAEEAAMAYDVAAKQIRGDKAKLNFPD  136



>gb|ADO21119.1| ethylene response factor 1 [Hordeum vulgare]
Length=359

 Score =   128 bits (321),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 59/63 (94%), Positives = 62/63 (98%), Gaps = 0/63 (0%)
 Frame = +3

Query  483  NQYRGIRQRPWGKWAAEIRDPSKGVRVWLGTFDTAEEAARAYDIEARRIRGKKAKVNFPD  662
            NQYRGIRQRPWGKWAAEIRDPSKGVRVWLGT+DTAEEAARAYD EAR+IRGKKAKVNFP+
Sbjct  122  NQYRGIRQRPWGKWAAEIRDPSKGVRVWLGTYDTAEEAARAYDAEARKIRGKKAKVNFPE  181

Query  663  DAP  671
            DAP
Sbjct  182  DAP  184



>gb|AEK01082.1| ethylene responsive element binding protein 1 [Oryza sativa Indica 
Group]
Length=365

 Score =   128 bits (321),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 91/182 (50%), Positives = 105/182 (58%), Gaps = 7/182 (4%)
 Frame = +3

Query  150  MCGGAIISDFKPPSRSSRRLTADLLW-----GRADLsggkkksnssgshyskPLRSEVVV  314
            MCGGAII   K     SRR T  LLW      R    G +                    
Sbjct  1    MCGGAIIHHLKGHPEGSRRATEGLLWPEKKKPRWGGGGRRHFGGFVEEDDEDFEADFEEF  60

Query  315  LDDDFEADFQDFKDHSYSQVDAKPFAFS-ASHRPGFssgpdsdsskdadnsskrkrkNQY  491
              D  ++D +  ++     V+ KP AF  A  R   S+   +     A  S+KRKRKNQ+
Sbjct  61   EVDSGDSDLELGEEDDDDVVEIKPAAFKRALSRDNLSTITTAGFDGPAAKSAKRKRKNQF  120

Query  492  RGIRQRPWGKWAAEIRDPSKGVRVWLGTFDTAEEAARAYDIEARRIRGKKAKVNFPDDAP  671
            RGIRQRPWGKWAAEIRDP KGVRVWLGTF++AEEAARAYD EARRIRGKKAKVNFP +AP
Sbjct  121  RGIRQRPWGKWAAEIRDPRKGVRVWLGTFNSAEEAARAYDAEARRIRGKKAKVNFP-EAP  179

Query  672  LT  677
             T
Sbjct  180  TT  181



>gb|AEI98839.1| AP2/EREBP transcription factor [Lophopyrum elongatum]
Length=392

 Score =   128 bits (322),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 59/63 (94%), Positives = 62/63 (98%), Gaps = 0/63 (0%)
 Frame = +3

Query  483  NQYRGIRQRPWGKWAAEIRDPSKGVRVWLGTFDTAEEAARAYDIEARRIRGKKAKVNFPD  662
            NQYRGIRQRPWGKWAAEIRDPSKGVRVWLGT+DTAEEAARAYD EAR+IRGKKAKVNFP+
Sbjct  124  NQYRGIRQRPWGKWAAEIRDPSKGVRVWLGTYDTAEEAARAYDAEARKIRGKKAKVNFPE  183

Query  663  DAP  671
            DAP
Sbjct  184  DAP  186



>gb|EAY87770.1| hypothetical protein OsI_09188 [Oryza sativa Indica Group]
Length=365

 Score =   128 bits (321),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 91/182 (50%), Positives = 105/182 (58%), Gaps = 7/182 (4%)
 Frame = +3

Query  150  MCGGAIISDFKPPSRSSRRLTADLLW-----GRADLsggkkksnssgshyskPLRSEVVV  314
            MCGGAII   K     SRR T  LLW      R    G +                    
Sbjct  1    MCGGAIIHHLKGHPEGSRRATEGLLWPEKKKPRWGGGGRRHFGGFVEEDDEDFEADFEEF  60

Query  315  LDDDFEADFQDFKDHSYSQVDAKPFAFS-ASHRPGFssgpdsdsskdadnsskrkrkNQY  491
              D  ++D +  ++     V+ KP AF  A  R   S+   +     A  S+KRKRKNQ+
Sbjct  61   EVDSGDSDLELGEEDDDDVVEIKPAAFKRALSRDNLSTITTAGFDGPAAKSAKRKRKNQF  120

Query  492  RGIRQRPWGKWAAEIRDPSKGVRVWLGTFDTAEEAARAYDIEARRIRGKKAKVNFPDDAP  671
            RGIRQRPWGKWAAEIRDP KGVRVWLGTF++AEEAARAYD EARRIRGKKAKVNFP +AP
Sbjct  121  RGIRQRPWGKWAAEIRDPRKGVRVWLGTFNSAEEAARAYDAEARRIRGKKAKVNFP-EAP  179

Query  672  LT  677
             T
Sbjct  180  TT  181



>ref|XP_010487543.1| PREDICTED: ethylene-responsive transcription factor RAP2-3-like 
[Camelina sativa]
Length=241

 Score =   125 bits (314),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 83/173 (48%), Positives = 94/173 (54%), Gaps = 40/173 (23%)
 Frame = +3

Query  150  MCGGAIISDFKP--PSRSSRRLTADLLWGRADLsggkkksnssgshyskPLRSEVVVLDD  323
            MCGGAIISDF P       R+LTA+ LW   D                       V   D
Sbjct  1    MCGGAIISDFAPLVTKAKGRKLTAEELWSELD-----------------------VSAGD  37

Query  324  DFEADFQDFKDHSYSQVDAKPFAFSASHRPGFssgpdsdsskdadnsskrkrkNQYRGIR  503
            +F       K H  +QV+ K  A  A   P                  +RKRKN YRGIR
Sbjct  38   NFWGFDSTSKFHPTNQVNVKEEA--AKKEPA-------------TTEKRRKRKNVYRGIR  82

Query  504  QRPWGKWAAEIRDPSKGVRVWLGTFDTAEEAARAYDIEARRIRGKKAKVNFPD  662
            +RPWGKWAAEIRDP KGVRVWLGTF+TAEEAA AYD+ A+RIRG KAK+NFPD
Sbjct  83   KRPWGKWAAEIRDPRKGVRVWLGTFNTAEEAAVAYDVAAKRIRGDKAKLNFPD  135



>ref|NP_001048319.1| Os02g0782700 [Oryza sativa Japonica Group]
 sp|Q6K7E6.1|ERF1_ORYSJ RecName: Full=Ethylene-responsive transcription factor 1; AltName: 
Full=Ethylene-responsive element-binding factor 1; Short=EREBP-1; 
Short=OsEREBP1 [Oryza sativa Japonica Group]
 dbj|BAD19536.1| putative transcription factor EREBP1 [Oryza sativa Japonica Group]
 dbj|BAF10233.1| Os02g0782700 [Oryza sativa Japonica Group]
 gb|EAZ24843.1| hypothetical protein OsJ_08625 [Oryza sativa Japonica Group]
 gb|ACF60473.1| EREBP transcription factor [Oryza sativa Japonica Group]
 dbj|BAG88971.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96260.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG99726.1| unnamed protein product [Oryza sativa Japonica Group]
Length=365

 Score =   127 bits (320),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 91/182 (50%), Positives = 105/182 (58%), Gaps = 7/182 (4%)
 Frame = +3

Query  150  MCGGAIISDFKPPSRSSRRLTADLLW-----GRADLsggkkksnssgshyskPLRSEVVV  314
            MCGGAII   K     SRR T  LLW      R    G +                    
Sbjct  1    MCGGAIIHHLKGHPEGSRRATEGLLWPEKKKPRWGGGGRRHFGGFVEEDDEDFEADFEEF  60

Query  315  LDDDFEADFQDFKDHSYSQVDAKPFAFS-ASHRPGFssgpdsdsskdadnsskrkrkNQY  491
              D  ++D +  ++     V+ KP AF  A  R   S+   +     A  S+KRKRKNQ+
Sbjct  61   EVDSGDSDLELGEEDDDDVVEIKPAAFKRALSRDNLSTITTAGFDGPAAKSAKRKRKNQF  120

Query  492  RGIRQRPWGKWAAEIRDPSKGVRVWLGTFDTAEEAARAYDIEARRIRGKKAKVNFPDDAP  671
            RGIRQRPWGKWAAEIRDP KGVRVWLGTF++AEEAARAYD EARRIRGKKAKVNFP +AP
Sbjct  121  RGIRQRPWGKWAAEIRDPRKGVRVWLGTFNSAEEAARAYDAEARRIRGKKAKVNFP-EAP  179

Query  672  LT  677
             T
Sbjct  180  TT  181



>ref|XP_010465699.1| PREDICTED: ethylene-responsive transcription factor RAP2-3-like 
[Camelina sativa]
Length=252

 Score =   125 bits (313),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 83/173 (48%), Positives = 94/173 (54%), Gaps = 40/173 (23%)
 Frame = +3

Query  150  MCGGAIISDFKP--PSRSSRRLTADLLWGRADLsggkkksnssgshyskPLRSEVVVLDD  323
            MCGGAIISDF P       R+LTA+ LW   D                       V   D
Sbjct  1    MCGGAIISDFAPLVTKAKGRKLTAEELWSELD-----------------------VSAGD  37

Query  324  DFEADFQDFKDHSYSQVDAKPFAFSASHRPGFssgpdsdsskdadnsskrkrkNQYRGIR  503
            +F       K H  +QV+ K  A  A   P                  +RKRKN YRGIR
Sbjct  38   NFWGFDSTSKFHPTNQVNVKEEA--AKKEPA-------------TTEKRRKRKNVYRGIR  82

Query  504  QRPWGKWAAEIRDPSKGVRVWLGTFDTAEEAARAYDIEARRIRGKKAKVNFPD  662
            +RPWGKWAAEIRDP KGVRVWLGTF+TAEEAA AYD+ A+RIRG KAK+NFPD
Sbjct  83   KRPWGKWAAEIRDPRKGVRVWLGTFNTAEEAAVAYDVAAKRIRGDKAKLNFPD  135



>gb|AAC24587.1| AP2 domain containing protein [Prunus armeniaca]
Length=280

 Score =   125 bits (315),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 58/63 (92%), Positives = 60/63 (95%), Gaps = 0/63 (0%)
 Frame = +3

Query  483  NQYRGIRQRPWGKWAAEIRDPSKGVRVWLGTFDTAEEAARAYDIEARRIRGKKAKVNFPD  662
            NQYRGIRQRPWGKWAAEIRDP KGVRVWLGTF+TAEEAARAYD EARRIRGKKAKVNFPD
Sbjct  10   NQYRGIRQRPWGKWAAEIRDPRKGVRVWLGTFNTAEEAARAYDSEARRIRGKKAKVNFPD  69

Query  663  DAP  671
            + P
Sbjct  70   ETP  72



>gb|KHF98297.1| Ethylene-responsive transcription factor RAP2-12 -like protein 
[Gossypium arboreum]
Length=296

 Score =   125 bits (314),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 58/65 (89%), Positives = 61/65 (94%), Gaps = 0/65 (0%)
 Frame = +3

Query  483  NQYRGIRQRPWGKWAAEIRDPSKGVRVWLGTFDTAEEAARAYDIEARRIRGKKAKVNFPD  662
            NQYRGIRQRPWGKWAAEIRDP KGVRVWLGTF+TAEEAARAYD EARRIRGKKAKVNFP+
Sbjct  17   NQYRGIRQRPWGKWAAEIRDPRKGVRVWLGTFNTAEEAARAYDAEARRIRGKKAKVNFPN  76

Query  663  DAPLT  677
            + P T
Sbjct  77   ETPRT  81



>emb|CAA05084.1| putative Ckc2 [Arabidopsis thaliana]
Length=246

 Score =   124 bits (311),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 81/176 (46%), Positives = 96/176 (55%), Gaps = 44/176 (25%)
 Frame = +3

Query  150  MCGGAIISDFKP--PSRSSRRLTADLLWGRADLsggkkksnssgshyskPLRSEVVVLDD  323
            MCGGAIISD+ P       R+LTA+ LW   D S                         D
Sbjct  1    MCGGAIISDYAPLVTKAKGRKLTAEELWSELDASAA-----------------------D  37

Query  324  DFEADFQDFKDHSYSQVDAK---PFAFSASHRPGFssgpdsdsskdadnsskrkrkNQYR  494
            DF   +   K H  +QV+ K         +  PG                 +RKRKN YR
Sbjct  38   DFWGFYSTSKLHPTNQVNVKEEEAVKKEQATEPG----------------KRRKRKNVYR  81

Query  495  GIRQRPWGKWAAEIRDPSKGVRVWLGTFDTAEEAARAYDIEARRIRGKKAKVNFPD  662
            GIR+RPWGKWAAEIRDP KGVRVWLGTF+TAEEAA AYD+ A++IRG+KAK+NFPD
Sbjct  82   GIRKRPWGKWAAEIRDPRKGVRVWLGTFNTAEEAAMAYDVAAKQIRGEKAKLNFPD  137



>dbj|BAG50065.1| transcription factor AP2-EREBP [Lotus japonicus]
 gb|AIR71875.1| AP2/ERF [Lotus corniculatus]
Length=317

 Score =   125 bits (315),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 83/172 (48%), Positives = 95/172 (55%), Gaps = 40/172 (23%)
 Frame = +3

Query  150  MCGGAIISDFKPPSRSSRRLTADLLWGRADLsggkkksnssgshyskPLRSEVVVLDDDF  329
            MCGGAII+DF P  R  RRLTA  LW  +                               
Sbjct  1    MCGGAIIADFIP-RRGGRRLTASELWPNS-------------------------------  28

Query  330  EADFQDFKDHSYSQVDAKPFAFSASHRPGFssgpdsdsskdadnsskrkrkNQYRGIRQR  509
                  F   + SQ++  P A     +    S         A+   KR+RKN YRGIRQR
Sbjct  29   ------FGKQNDSQIEKPPIAHQQQQQ--QPSTFKRSQPHIAEKPMKRQRKNLYRGIRQR  80

Query  510  PWGKWAAEIRDPSKGVRVWLGTFDTAEEAARAYDIEARRIRGKKAKVNFPDD  665
            PWGKWAAEIRDP KGVRVWLGTF+TAEEAARAYD EAR+IRGKKAKVNFP++
Sbjct  81   PWGKWAAEIRDPRKGVRVWLGTFNTAEEAARAYDREARKIRGKKAKVNFPNE  132



>gb|ACD87817.1| putative ethylene responsive factor [Vicia faba]
Length=292

 Score =   125 bits (314),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 96/200 (48%), Positives = 116/200 (58%), Gaps = 41/200 (21%)
 Frame = +3

Query  150  MCGGAIISDFKPPSRS---SRRLTADLLWGRADLsggkkksnssgshyskPLRSEVVVLD  320
            MCGG IISDF PP+ +   SRR+TAD+LW            +   +   KP      +LD
Sbjct  1    MCGGTIISDFIPPTAAVGGSRRVTADILW-----------PSLRKNGLKKPF-----LLD  44

Query  321  DDFEADFQDFKDHSYS------------QVDAKPFAFSASHRPGFssgpdsdsskdadns  464
            DDFEA F++FKD S               +  K F+FS+++     +     S+     S
Sbjct  45   DDFEAGFREFKDDSDFDEDEDEEEDEGLMLGVKGFSFSSANNKSSRTFSRGSSAAKPVVS  104

Query  465  skr---------krkNQYRGIRQRPWGKWAAEIRDPSKGVRVWLGTFDTAEEAARAYDIE  617
                        KRKNQYRGIRQRPWGKWAAEIRDP KGVRVWLGTF TAE+AARAYD  
Sbjct  105  KSNEPAEKDSKRKRKNQYRGIRQRPWGKWAAEIRDPRKGVRVWLGTFSTAEQAARAYDAA  164

Query  618  ARRIRGKKAKVNFPDDAPLT  677
            A+RIRG KAK+NFP DAP+ 
Sbjct  165  AKRIRGDKAKLNFP-DAPVC  183



>ref|XP_002883025.1| hypothetical protein ARALYDRAFT_897996 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH59284.1| hypothetical protein ARALYDRAFT_897996 [Arabidopsis lyrata subsp. 
lyrata]
Length=250

 Score =   124 bits (311),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 80/173 (46%), Positives = 96/173 (55%), Gaps = 38/173 (22%)
 Frame = +3

Query  150  MCGGAIISDFKP--PSRSSRRLTADLLWGRADLsggkkksnssgshyskPLRSEVVVLDD  323
            MCGGAIISDF P       R+LTA+ LW   D S                         D
Sbjct  1    MCGGAIISDFTPLVTKAKGRKLTAEELWSELDASAA-----------------------D  37

Query  324  DFEADFQDFKDHSYSQVDAKPFAFSASHRPGFssgpdsdsskdadnsskrkrkNQYRGIR  503
            DF   +   K H  +QV+ +         P        + + +     +RKRKN YRGIR
Sbjct  38   DFWGFYSTSKLHPTNQVNVQ-------EEPA------KEQATEPATEKRRKRKNVYRGIR  84

Query  504  QRPWGKWAAEIRDPSKGVRVWLGTFDTAEEAARAYDIEARRIRGKKAKVNFPD  662
            +RPWGKWAAEIRDP KGVRVWLGTF+TAEEAA AYD+ A++IRG KAK+NFPD
Sbjct  85   KRPWGKWAAEIRDPRKGVRVWLGTFNTAEEAAMAYDVAAKQIRGDKAKLNFPD  137



>gb|AAT77192.1| ethylene response factor 1 [Gossypium barbadense]
Length=319

 Score =   125 bits (315),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 58/65 (89%), Positives = 61/65 (94%), Gaps = 0/65 (0%)
 Frame = +3

Query  483  NQYRGIRQRPWGKWAAEIRDPSKGVRVWLGTFDTAEEAARAYDIEARRIRGKKAKVNFPD  662
            NQYRGIRQRPWGKWAAEIRDP KGVRVWLGTF+TAEEAARAYD EARRIRGKKAKVNFP+
Sbjct  48   NQYRGIRQRPWGKWAAEIRDPRKGVRVWLGTFNTAEEAARAYDAEARRIRGKKAKVNFPN  107

Query  663  DAPLT  677
            + P T
Sbjct  108  ETPRT  112



>ref|XP_009387627.1| PREDICTED: ethylene-responsive transcription factor 1-like [Musa 
acuminata subsp. malaccensis]
Length=374

 Score =   126 bits (317),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 85/182 (47%), Positives = 106/182 (58%), Gaps = 28/182 (15%)
 Frame = +3

Query  150  MCGGAIISDFKPPSRSSRRLTADLLWGRADLsggkkksnssgshyskPLRSEVVVLDDDF  329
            MCGGAIISD  P +  +RR+TA+ LW                    +  + +   +++DF
Sbjct  1    MCGGAIISDLIPAT-VARRVTAEHLW---------------PGGRRRRGKQQRREVEEDF  44

Query  330  EADFQDFKDHS-YSQVDAKPFAFSASHRPGFssgpdsdsskdad-----------nsskr  473
            EADF +F D S   + + +      ++  GF S                       S KR
Sbjct  45   EADFLEFDDESGEDEFEDEFDDEVDANSSGFGSNTSFSREISVTLRSRGFGGPACKSGKR  104

Query  474  krkNQYRGIRQRPWGKWAAEIRDPSKGVRVWLGTFDTAEEAARAYDIEARRIRGKKAKVN  653
            KRK+Q+RGIRQRPWG+WAAEIRDP KGVRVWLGTFD+AE+AARAYD EARRIRG KAKVN
Sbjct  105  KRKSQFRGIRQRPWGRWAAEIRDPCKGVRVWLGTFDSAEQAARAYDAEARRIRGHKAKVN  164

Query  654  FP  659
            FP
Sbjct  165  FP  166



>tpg|DAA61618.1| TPA: putative AP2/EREBP transcription factor superfamily protein 
[Zea mays]
Length=310

 Score =   125 bits (314),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 58/65 (89%), Positives = 62/65 (95%), Gaps = 0/65 (0%)
 Frame = +3

Query  483  NQYRGIRQRPWGKWAAEIRDPSKGVRVWLGTFDTAEEAARAYDIEARRIRGKKAKVNFPD  662
            NQYRGIRQRPWGKWAAEIRDP+KGVRVWLGT++TAEEAARAYD EAR+IRGKKAKVNFPD
Sbjct  21   NQYRGIRQRPWGKWAAEIRDPNKGVRVWLGTYNTAEEAARAYDAEARKIRGKKAKVNFPD  80

Query  663  DAPLT  677
            DA  T
Sbjct  81   DATGT  85



>gb|AID46464.1| ethylene response factor 1 short form L [Triticum turgidum subsp. 
durum]
Length=354

 Score =   125 bits (315),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 90/180 (50%), Positives = 112/180 (62%), Gaps = 12/180 (7%)
 Frame = +3

Query  150  MCGGAIISDFKPPSRSSRRLTADLLWGRADLsggkkksnssgshyskPLRSEVVVLDDDF  329
            MCGGAI+SD  PP R   R T   +W        +  + +     +          D +F
Sbjct  1    MCGGAILSDIIPPPR---RATGGNVWRADKKKRARADAAAGRPRRAP-EEEFEEEGDAEF  56

Query  330  EADFQDFKD-HSYSQVDAKPFAFSASHRPGFssgpdsdssk----dadnsskrkrkNQYR  494
            EADF+ F +    S  + KPF      R GFS      ++      A  S+KRKRKNQ+R
Sbjct  57   EADFEGFVEAEEESDGEGKPFPV---RRSGFSGDGLKATAAGDDDCASGSAKRKRKNQFR  113

Query  495  GIRQRPWGKWAAEIRDPSKGVRVWLGTFDTAEEAARAYDIEARRIRGKKAKVNFPDDAPL  674
            GIR+RPWGKWAAEIRDP KGVRVWLGT+++AEEAARAYD+EARRIRGKKAKVNFP++AP+
Sbjct  114  GIRRRPWGKWAAEIRDPRKGVRVWLGTYNSAEEAARAYDVEARRIRGKKAKVNFPEEAPM  173



>ref|XP_002523125.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF39310.1| conserved hypothetical protein [Ricinus communis]
Length=299

 Score =   125 bits (313),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 79/172 (46%), Positives = 94/172 (55%), Gaps = 35/172 (20%)
 Frame = +3

Query  150  MCGGAIISDFKPPSRSSRRLTADLLWGRADLsggkkksnssgshyskPLRSEVVVLDDDF  329
            MCGGAII++   P R  R +TA  LW   D                             F
Sbjct  1    MCGGAIIANLIHPQRGDRSVTASDLWPNPD----------------------------SF  32

Query  330  EADFQDFKDHSYSQVDAKPFAFSASHRPGFssgpdsdsskdadnsskrkrkNQYRGIRQR  509
             +    F+ H  + ++   F    S          S  ++      KR+RKN YRGIRQR
Sbjct  33   FSKLTPFESHRDTFINPDSFTRKRSQ-------LASGDAQVDKTPVKRQRKNLYRGIRQR  85

Query  510  PWGKWAAEIRDPSKGVRVWLGTFDTAEEAARAYDIEARRIRGKKAKVNFPDD  665
            PWGKWAAEIRDP KGVRVWLGTF+TAEEAARAYD EAR+IRGKKAKVNFP++
Sbjct  86   PWGKWAAEIRDPRKGVRVWLGTFNTAEEAARAYDREARKIRGKKAKVNFPNE  137



>gb|KJB72729.1| hypothetical protein B456_011G193600 [Gossypium raimondii]
Length=255

 Score =   124 bits (310),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 83/178 (47%), Positives = 102/178 (57%), Gaps = 28/178 (16%)
 Frame = +3

Query  150  MCGGAIISDFKPPSRSSRRLTADLLWGRADLsggkkksnssgshyskPLRSEVVVLDDDF  329
            MCGGAIISDF    R  R+LTA+ LW                        SE+    D  
Sbjct  1    MCGGAIISDFIAVKRG-RKLTAEDLW------------------------SELDTFSDLL  35

Query  330  EADFQDFKDHSYSQVDAKPFAFSASHRPGFssgpdsdssk--dadnsskrkrkNQYRGIR  503
              D+ + KD  +SQ D       A +    ++     +S+  + +  ++R RKN YRGIR
Sbjct  36   GLDYGNGKD-PFSQFDNTKAGSKAKNLEKVTNESTQKTSRGREKEGKTQRTRKNIYRGIR  94

Query  504  QRPWGKWAAEIRDPSKGVRVWLGTFDTAEEAARAYDIEARRIRGKKAKVNFPDDAPLT  677
            QRPWGKWAAEIRDP KGVRVWLGT++TAEEAARAYD  A+RIRG KAK+NFP    LT
Sbjct  95   QRPWGKWAAEIRDPHKGVRVWLGTYNTAEEAARAYDEAAKRIRGDKAKLNFPQTPRLT  152



>gb|AID46467.1| ethylene response factor 1 [Triticum turgidum subsp. durum]
 gb|AID46468.1| ethylene response factor 1 short form P [Triticum turgidum subsp. 
durum]
Length=354

 Score =   125 bits (315),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 90/180 (50%), Positives = 112/180 (62%), Gaps = 12/180 (7%)
 Frame = +3

Query  150  MCGGAIISDFKPPSRSSRRLTADLLWGRADLsggkkksnssgshyskPLRSEVVVLDDDF  329
            MCGGAI+SD  PP R   R T   +W        +  + +     +          D +F
Sbjct  1    MCGGAILSDIIPPPR---RATGGNVWRADKKKRARADAAAGRPRRAP-EEEFEEEGDAEF  56

Query  330  EADFQDFKD-HSYSQVDAKPFAFSASHRPGFssgpdsdssk----dadnsskrkrkNQYR  494
            EADF+ F +    S  + KPF      R GFS      ++      A  S+KRKRKNQ+R
Sbjct  57   EADFEGFVEAEEESDGEGKPFPV---RRSGFSGDGLKATAAGDDDCASGSAKRKRKNQFR  113

Query  495  GIRQRPWGKWAAEIRDPSKGVRVWLGTFDTAEEAARAYDIEARRIRGKKAKVNFPDDAPL  674
            GIR+RPWGKWAAEIRDP KGVRVWLGT+++AEEAARAYD+EARRIRGKKAKVNFP++AP+
Sbjct  114  GIRRRPWGKWAAEIRDPRKGVRVWLGTYNSAEEAARAYDVEARRIRGKKAKVNFPEEAPM  173



>ref|XP_010504647.1| PREDICTED: ethylene-responsive transcription factor RAP2-3-like 
[Camelina sativa]
Length=251

 Score =   123 bits (309),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 82/173 (47%), Positives = 93/173 (54%), Gaps = 40/173 (23%)
 Frame = +3

Query  150  MCGGAIISDFKP--PSRSSRRLTADLLWGRADLsggkkksnssgshyskPLRSEVVVLDD  323
            MCGGAIISDF P       R+LTA+ LW   D                       V   D
Sbjct  1    MCGGAIISDFAPLVTKAKGRKLTAEELWSELD-----------------------VSAGD  37

Query  324  DFEADFQDFKDHSYSQVDAKPFAFSASHRPGFssgpdsdsskdadnsskrkrkNQYRGIR  503
            +F       K H  +QV+ K     A   P                  +RKRKN YRGIR
Sbjct  38   NFWGFDSTSKFHPTNQVNVK--EEEAKKEPA-------------TTEKRRKRKNVYRGIR  82

Query  504  QRPWGKWAAEIRDPSKGVRVWLGTFDTAEEAARAYDIEARRIRGKKAKVNFPD  662
            +RPWGKWAAEIRDP KGVRVWLGTF+TAEEAA AYD+ A+RIRG KAK+NFPD
Sbjct  83   KRPWGKWAAEIRDPRKGVRVWLGTFNTAEEAAVAYDVAAKRIRGDKAKLNFPD  135



>gb|AEI54703.1| AP2/EREBP-like protein [Hordeum vulgare subsp. vulgare]
Length=266

 Score =   124 bits (310),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 54/64 (84%), Positives = 63/64 (98%), Gaps = 0/64 (0%)
 Frame = +3

Query  483  NQYRGIRQRPWGKWAAEIRDPSKGVRVWLGTFDTAEEAARAYDIEARRIRGKKAKVNFPD  662
            NQ+RGIR+RPWGKWAAEIRDP KGVRVWLGT+++AEEAARAYD+EARRIRGKKAKVNFP+
Sbjct  20   NQFRGIRRRPWGKWAAEIRDPRKGVRVWLGTYNSAEEAARAYDVEARRIRGKKAKVNFPE  79

Query  663  DAPL  674
            +AP+
Sbjct  80   EAPM  83



>gb|AEI54702.1| AP2/EREBP-like protein [Hordeum vulgare subsp. vulgare]
Length=266

 Score =   124 bits (310),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 54/64 (84%), Positives = 63/64 (98%), Gaps = 0/64 (0%)
 Frame = +3

Query  483  NQYRGIRQRPWGKWAAEIRDPSKGVRVWLGTFDTAEEAARAYDIEARRIRGKKAKVNFPD  662
            NQ+RGIR+RPWGKWAAEIRDP KGVRVWLGT+++AEEAARAYD+EARRIRGKKAKVNFP+
Sbjct  20   NQFRGIRRRPWGKWAAEIRDPRKGVRVWLGTYNSAEEAARAYDVEARRIRGKKAKVNFPE  79

Query  663  DAPL  674
            +AP+
Sbjct  80   EAPM  83



>ref|XP_009106954.1| PREDICTED: ethylene-responsive transcription factor RAP2-12 [Brassica 
rapa]
Length=317

 Score =   125 bits (313),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 102/179 (57%), Positives = 115/179 (64%), Gaps = 22/179 (12%)
 Frame = +3

Query  150  MCGGAIISDFKPPSRSSRRLTADLLWGRADLsggkkksnssgshyskPLRSEVVVLDDDF  329
            MCGGAIISDF PP RS RR+T++ LW   DL    K             RS    LDD+F
Sbjct  1    MCGGAIISDFIPPPRS-RRVTSEFLW--PDLKKSSK------------KRSSFFDLDDEF  45

Query  330  EADFQDFKDHSYSQVD-AKPFAFSASHRPGFssgpdsdsskdadn------sskrkrkNQ  488
            EADFQ FKD S    D AKPF F+ + +P  S+                  S+KRKRK+Q
Sbjct  46   EADFQGFKDDSSIDCDDAKPFVFAGARKPAVSAATADSVIGKKVADGEGERSAKRKRKSQ  105

Query  489  YRGIRQRPWGKWAAEIRDPSKGVRVWLGTFDTAEEAARAYDIEARRIRGKKAKVNFPDD  665
            YRGIRQRPWGKWAAEIRDP +G RVWLGTF TAEEAARAYD  ARRIRG KAKVNFP++
Sbjct  106  YRGIRQRPWGKWAAEIRDPREGSRVWLGTFKTAEEAARAYDAAARRIRGSKAKVNFPEE  164



>dbj|BAC56862.1| AP2/ERF-domain protein [Solanum tuberosum]
Length=264

 Score =   123 bits (309),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 83/174 (48%), Positives = 102/174 (59%), Gaps = 17/174 (10%)
 Frame = +3

Query  150  MCGGAIISDFKPPSRSSRRLTADLLWGRADLsggkkksnssgshyskPLRSEVVVLDDDF  329
            MCGGAIISD++P     R+L+A  LW   D       S+SS S    P  ++  V     
Sbjct  1    MCGGAIISDYEPAGNFYRKLSARDLWAELDPISDYWSSSSSSSTVENPYSAQSPVT----  56

Query  330  EADFQDFKDHSYSQVDAKPFAFSASHRPGFssgpdsdsskdadnsskrkrkNQYRGIRQR  509
                     HS   VD KP    +        G  +   +   ++  R+RKN+YRGIRQR
Sbjct  57   ---------HS---VD-KPKKSDSGKSNQLKKGNKTVKVEKEKSTGPRQRKNKYRGIRQR  103

Query  510  PWGKWAAEIRDPSKGVRVWLGTFDTAEEAARAYDIEARRIRGKKAKVNFPDDAP  671
            PWGKWAAEIRDP KGVRVWLGTF+TAE+AARAYD  A+RIRG KAK+NFP  +P
Sbjct  104  PWGKWAAEIRDPQKGVRVWLGTFNTAEDAARAYDEAAKRIRGNKAKLNFPAPSP  157



>gb|AAP32467.1| ethylene-responsive element binding protein [Triticum aestivum]
Length=332

 Score =   125 bits (313),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 75/124 (60%), Positives = 92/124 (74%), Gaps = 8/124 (6%)
 Frame = +3

Query  318  DDDFEADFQDFKD-HSYSQVDAKPFAFSASHRPGFssgpdsdssk----dadnsskrkrk  482
            D +FEADF+ F +    S  +AKPF      R GFS      ++      A  S+KRKRK
Sbjct  31   DAEFEADFEGFVEAEEESDGEAKPFPV---RRSGFSGDGLKATAAGDDDCASGSAKRKRK  87

Query  483  NQYRGIRQRPWGKWAAEIRDPSKGVRVWLGTFDTAEEAARAYDIEARRIRGKKAKVNFPD  662
            NQ+RG+R+RPWGKWAAEIRDP KGVRVWLGT+++AEEAARAY +EARRIRGKKAKVNFP+
Sbjct  88   NQFRGVRRRPWGKWAAEIRDPRKGVRVWLGTYNSAEEAARAYGVEARRIRGKKAKVNFPE  147

Query  663  DAPL  674
            +AP+
Sbjct  148  EAPM  151



>gb|EMS54313.1| Ethylene-responsive transcription factor 1 [Triticum urartu]
Length=369

 Score =   125 bits (314),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 85/203 (42%), Positives = 101/203 (50%), Gaps = 72/203 (35%)
 Frame = +3

Query  150  MCGGAIISDFKPPSRSSRRLTADLLWGRADLsggkkksnssgshyskPLRSEVVVLDD--  323
            MCGGAI+ D K P+ + R        GR                           LDD  
Sbjct  1    MCGGAILKDLKVPAPARR-------GGRG--------------------------LDDGE  27

Query  324  -DFEADFQDF------------------KDHSYSQVDAKPFA----------FSASHRPG  416
             DF+ADF++F                  KD     V+ KPFA           S     G
Sbjct  28   EDFQADFEEFEADSGDSDVELGRAGVAGKDGDDEVVEIKPFAAVKRSLSQDDLSTMTTAG  87

Query  417  FssgpdsdsskdadnsskrkrkNQYRGIRQRPWGKWAAEIRDPSKGVRVWLGTFDTAEEA  596
            F       + +           N++RGIRQRPWGKWAAEIRDPSKGVRVWLGTF++AEEA
Sbjct  88   FDGPAQRSAKRKRK--------NEFRGIRQRPWGKWAAEIRDPSKGVRVWLGTFNSAEEA  139

Query  597  ARAYDIEARRIRGKKAKVNFPDD  665
            ARAYD+EARRIRGKKAKVNFP++
Sbjct  140  ARAYDVEARRIRGKKAKVNFPEE  162



>emb|CDX82392.1| BnaA03g34290D [Brassica napus]
Length=245

 Score =   123 bits (308),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 80/174 (46%), Positives = 94/174 (54%), Gaps = 39/174 (22%)
 Frame = +3

Query  150  MCGGAIISDFKPPSRSS--RRLTADLLWGRADLsggkkksnssgshyskPLRSEVVVLDD  323
            MCGGA+ISDF P    +  R+LTA+ LW   D S                         D
Sbjct  1    MCGGAVISDFAPSVTKAKGRKLTAEELWSELDASAC-----------------------D  37

Query  324  DFEADFQDFKDHSY-SQVDAKPFAFSASHRPGFssgpdsdsskdadnsskrkrkNQYRGI  500
            DF      FK HS   QV  K  A +    P                  +++RKN YRGI
Sbjct  38   DFWGFDSTFKLHSTKQQVTLKDEAANKEKEPA-------------ATEKRKERKNVYRGI  84

Query  501  RQRPWGKWAAEIRDPSKGVRVWLGTFDTAEEAARAYDIEARRIRGKKAKVNFPD  662
            R+RPWGKWA+EIRDP KG RVWLGTF+TAEEAA AYD+ A+RIRG KAK+NFPD
Sbjct  85   RKRPWGKWASEIRDPEKGARVWLGTFNTAEEAAMAYDVAAKRIRGDKAKLNFPD  138



>gb|KHG20734.1| Ethylene-responsive transcription factor RAP2-12 -like protein 
[Gossypium arboreum]
Length=335

 Score =   124 bits (312),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 58/65 (89%), Positives = 60/65 (92%), Gaps = 0/65 (0%)
 Frame = +3

Query  483  NQYRGIRQRPWGKWAAEIRDPSKGVRVWLGTFDTAEEAARAYDIEARRIRGKKAKVNFPD  662
            NQYRGIRQRPWGKWAAEIRDP KGVRVWLGTF+TAEEAARAYD EA RIRGKKAKVNFPD
Sbjct  61   NQYRGIRQRPWGKWAAEIRDPRKGVRVWLGTFNTAEEAARAYDAEALRIRGKKAKVNFPD  120

Query  663  DAPLT  677
            + P T
Sbjct  121  ETPRT  125



>ref|XP_010479976.1| PREDICTED: ethylene-responsive transcription factor RAP2-12-like 
[Camelina sativa]
 ref|XP_010479977.1| PREDICTED: ethylene-responsive transcription factor RAP2-12-like 
[Camelina sativa]
Length=361

 Score =   125 bits (313),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 100/194 (52%), Positives = 114/194 (59%), Gaps = 28/194 (14%)
 Frame = +3

Query  150  MCGGAIISDFKPPSRSSRRLTADLLWGRADLsggkkksnssgshyskPLRSEVVVLDDDF  329
            MCGGAIISDF PP R SRR+T++ +W   DL    K +  S        RS    LDD+F
Sbjct  1    MCGGAIISDFIPPPR-SRRVTSEFIW--PDLKKSAKAAKKSSK-----KRSNFFDLDDEF  52

Query  330  EADFQDFKDHSYSQ--------------VDAKPFAFSASHRPGFssgpdsdsskdadnss  467
            EADFQ FKD S                  D KPF F A+ +P  SS   +   K      
Sbjct  53   EADFQGFKDDSSIDCDDDDDFDIGGDVFADVKPFVFGATPKPAVSSAATAAEGKKGAGGE  112

Query  468  krkrk------NQYRGIRQRPWGKWAAEIRDPSKGVRVWLGTFDTAEEAARAYDIEARRI  629
              ++       NQYRGIRQRPWGKWAAEIRDP +G R+WLGTF TAEEAARAYD  ARRI
Sbjct  113  AAEKSGKRKRKNQYRGIRQRPWGKWAAEIRDPREGARIWLGTFKTAEEAARAYDAAARRI  172

Query  630  RGKKAKVNFPDDAP  671
            RG KAKVNFP+D P
Sbjct  173  RGSKAKVNFPEDNP  186



>gb|KJB24383.1| hypothetical protein B456_004G142800 [Gossypium raimondii]
Length=293

 Score =   124 bits (310),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 82/172 (48%), Positives = 97/172 (56%), Gaps = 38/172 (22%)
 Frame = +3

Query  150  MCGGAIISDFKPPSRSSRRLTADLLWGRADLsggkkksnssgshyskPLRSEVVVLDDDF  329
            MCGGAIIS+F P  +  RR+TA  +W                        S  V ++   
Sbjct  1    MCGGAIISEFIP-RKGGRRVTAADIW----------------------PNSPFVKING--  35

Query  330  EADFQDFKDHSYSQVDAKPFAFSASHRPGFssgpdsdsskdadnsskrkrkNQYRGIRQR  509
               F  ++DHS        F  S    P           +  +   KR+RKN YRGIRQR
Sbjct  36   ---FCSYRDHSVCH-----FKRSQPEPP-----SSLAGDEQVEKKPKRQRKNLYRGIRQR  82

Query  510  PWGKWAAEIRDPSKGVRVWLGTFDTAEEAARAYDIEARRIRGKKAKVNFPDD  665
            PWGKWAAEIRDP KGVRVWLGTF+TAEEAARAYD EAR+IRGKKAKVNFP++
Sbjct  83   PWGKWAAEIRDPRKGVRVWLGTFNTAEEAARAYDREARKIRGKKAKVNFPNE  134



>gb|KJB24382.1| hypothetical protein B456_004G142800 [Gossypium raimondii]
Length=292

 Score =   124 bits (310),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 83/172 (48%), Positives = 98/172 (57%), Gaps = 39/172 (23%)
 Frame = +3

Query  150  MCGGAIISDFKPPSRSSRRLTADLLWGRADLsggkkksnssgshyskPLRSEVVVLDDDF  329
            MCGGAIIS+F P  +  RR+TA  +W                        S  V ++   
Sbjct  1    MCGGAIISEFIP-RKGGRRVTAADIW----------------------PNSPFVKING--  35

Query  330  EADFQDFKDHSYSQVDAKPFAFSASHRPGFssgpdsdsskdadnsskrkrkNQYRGIRQR  509
               F  ++DHS        F  S    P       S   +  +   KR+RKN YRGIRQR
Sbjct  36   ---FCSYRDHSVCH-----FKRSQPEPP------SSLGDEQVEKKPKRQRKNLYRGIRQR  81

Query  510  PWGKWAAEIRDPSKGVRVWLGTFDTAEEAARAYDIEARRIRGKKAKVNFPDD  665
            PWGKWAAEIRDP KGVRVWLGTF+TAEEAARAYD EAR+IRGKKAKVNFP++
Sbjct  82   PWGKWAAEIRDPRKGVRVWLGTFNTAEEAARAYDREARKIRGKKAKVNFPNE  133



>gb|EMT19548.1| Ethylene-responsive transcription factor 1 [Aegilops tauschii]
Length=288

 Score =   123 bits (309),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 54/64 (84%), Positives = 63/64 (98%), Gaps = 0/64 (0%)
 Frame = +3

Query  483  NQYRGIRQRPWGKWAAEIRDPSKGVRVWLGTFDTAEEAARAYDIEARRIRGKKAKVNFPD  662
            NQ+RGIR+RPWGKWAAEIRDP KGVRVWLGT+++AEEAARAYD+EARRIRGKKAKVNFP+
Sbjct  44   NQFRGIRRRPWGKWAAEIRDPRKGVRVWLGTYNSAEEAARAYDVEARRIRGKKAKVNFPE  103

Query  663  DAPL  674
            +AP+
Sbjct  104  EAPM  107



>ref|XP_010227910.1| PREDICTED: ethylene-responsive transcription factor 1-like isoform 
X2 [Brachypodium distachyon]
Length=287

 Score =   123 bits (309),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 55/65 (85%), Positives = 63/65 (97%), Gaps = 0/65 (0%)
 Frame = +3

Query  483  NQYRGIRQRPWGKWAAEIRDPSKGVRVWLGTFDTAEEAARAYDIEARRIRGKKAKVNFPD  662
            NQ+RGIR+RPWGKWAAEIRDP KGVRVWLGT+++AEEAARAYD EARRIRGKKAKVNFP+
Sbjct  45   NQFRGIRRRPWGKWAAEIRDPRKGVRVWLGTYNSAEEAARAYDAEARRIRGKKAKVNFPE  104

Query  663  DAPLT  677
            +AP+T
Sbjct  105  EAPVT  109



>gb|AGU44838.1| ethylene responsive factor [Capsicum chinense]
Length=264

 Score =   123 bits (308),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 80/172 (47%), Positives = 98/172 (57%), Gaps = 39/172 (23%)
 Frame = +3

Query  150  MCGGAIISDFKPPSRSSRRLTADLLWGRADLsggkkksnssgshyskPLRSEVVVLDDDF  329
            MCGGAI++D  P  R  RRL++  LW                            +  DDF
Sbjct  1    MCGGAILADIIP--RRDRRLSSTDLWS---------------------------ICSDDF  31

Query  330  EADFQDFKDHSYSQVDAKPFAFSASHRPGFssgpdsdsskdadnsskrkrkNQYRGIRQR  509
                  + + S+S    KPF+              S  ++    + KR+RKN YRGIRQR
Sbjct  32   ------WPNSSFS----KPFSTQNVSPAKPKRTQPSAGNEQIQKAKKRQRKNLYRGIRQR  81

Query  510  PWGKWAAEIRDPSKGVRVWLGTFDTAEEAARAYDIEARRIRGKKAKVNFPDD  665
            PWGKWAAEIRDP KGVRVWLGTF+TAEEAARAYD EAR+IRG+KAKVNFP++
Sbjct  82   PWGKWAAEIRDPRKGVRVWLGTFNTAEEAARAYDKEARKIRGEKAKVNFPNE  133



>gb|AAZ14085.2| root abundant factor [Hordeum vulgare]
 gb|AAZ14086.2| root abundant factor [Hordeum vulgare]
Length=328

 Score =   124 bits (311),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 90/177 (51%), Positives = 108/177 (61%), Gaps = 12/177 (7%)
 Frame = +3

Query  150  MCGGAIISDFKPPS--RSSRRLTADLLWGRADLsggkkksnssgshyskPLRSEVVVLDD  323
            MCGGAI++   PPS  R S++  A    GRA  +  KK   S   H S P        DD
Sbjct  1    MCGGAILAQLIPPSAGRPSKQAAA---GGRAPPTSSKKGGVSKSRHSSTPDAD-----DD  52

Query  324  DFEADFQDFKDH--SYSQVDAKPFAFSASHRPGFssgpdsdsskdadnsskrkrkNQYRG  497
             FEA F+DF DH    ++ D        + +P FS  P  D  + A  +S++KR     G
Sbjct  53   VFEAAFEDFDDHFDLRAEEDGGDDHVVFASKPAFSPRPAYDGGRAAHAASRKKRTGHLHG  112

Query  498  IRQRPWGKWAAEIRDPSKGVRVWLGTFDTAEEAARAYDIEARRIRGKKAKVNFPDDA  668
            IRQRPWGKWAAEIRDP KG RVWLGTFDTA++AARAYD+ ARR+RG KAKVNFPD A
Sbjct  113  IRQRPWGKWAAEIRDPHKGTRVWLGTFDTADDAARAYDVAARRLRGSKAKVNFPDAA  169



>ref|XP_006298489.1| hypothetical protein CARUB_v10014563mg [Capsella rubella]
 gb|EOA31387.1| hypothetical protein CARUB_v10014563mg [Capsella rubella]
Length=226

 Score =   122 bits (305),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 80/173 (46%), Positives = 92/173 (53%), Gaps = 39/173 (23%)
 Frame = +3

Query  150  MCGGAIISDFKP--PSRSSRRLTADLLWGRADLsggkkksnssgshyskPLRSEVVVLDD  323
            MCGGAIISDF P       R+LTA+ LW   D                       V   D
Sbjct  1    MCGGAIISDFAPLVTKAKGRKLTAEELWSELD-----------------------VSAGD  37

Query  324  DFEADFQDFKDHSYSQVDAKPFAFSASHRPGFssgpdsdsskdadnsskrkrkNQYRGIR  503
            +F         H  +Q + K  A      P              +   +RKRKN YRGIR
Sbjct  38   NFWGFDSTSNLHPTNQGNVKEEAAGKKKEP--------------ETEKRRKRKNVYRGIR  83

Query  504  QRPWGKWAAEIRDPSKGVRVWLGTFDTAEEAARAYDIEARRIRGKKAKVNFPD  662
            +RPWGKWAAEIRDP KGVRVWLGTF+TAEEAA AYD+ A+RIRG KAK+NFPD
Sbjct  84   KRPWGKWAAEIRDPRKGVRVWLGTFNTAEEAAVAYDVAAKRIRGDKAKLNFPD  136



>gb|KFK38783.1| hypothetical protein AALP_AA3G160000 [Arabis alpina]
Length=391

 Score =   125 bits (313),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 104/192 (54%), Positives = 119/192 (62%), Gaps = 29/192 (15%)
 Frame = +3

Query  150  MCGGAIISDFKPPSRSSRRLTADLLWGRADLsggkkksnssgshyskPLRSEVVVLDDDF  329
            MCGGAIISDF PP+ SSRR+T++ +W   DL    KK  +         RS    LDD+F
Sbjct  1    MCGGAIISDFIPPAPSSRRVTSEFIW--PDLRKASKKRFNKK-------RSNFFDLDDEF  51

Query  330  EADFQDFKDHSYSQVDA--------KPFAFSASHRP------------GFssgpdsdssk  449
            EADFQ FKD   S            KPF F+ + +P              S+     S  
Sbjct  52   EADFQGFKDDDSSFDCDDDFDVDDVKPFVFTGATKPVASPATAFASNGSVSAKKIIVSDG  111

Query  450  dadnsskrkrkNQYRGIRQRPWGKWAAEIRDPSKGVRVWLGTFDTAEEAARAYDIEARRI  629
             A+ S+KRKRKNQYRGIRQRPWGKWAAEIRDP KG R WLGTFDTAEEAARAYD  ARRI
Sbjct  112  QAEKSAKRKRKNQYRGIRQRPWGKWAAEIRDPRKGSREWLGTFDTAEEAARAYDAAARRI  171

Query  630  RGKKAKVNFPDD  665
            RG KAKVNFP++
Sbjct  172  RGSKAKVNFPEE  183



>ref|XP_002891780.1| hypothetical protein ARALYDRAFT_892441 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH68039.1| hypothetical protein ARALYDRAFT_892441 [Arabidopsis lyrata subsp. 
lyrata]
Length=345

 Score =   124 bits (311),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 101/186 (54%), Positives = 116/186 (62%), Gaps = 27/186 (15%)
 Frame = +3

Query  150  MCGGAIISDFKPPSRSSRRLTADLLWGRADLsggkkksnssgshyskPLRSEVVVLDDDF  329
            MCGGAIISDF PP RS RR+T++ +W   DL    KK            RS V   D +F
Sbjct  1    MCGGAIISDFIPPPRS-RRVTSEFIW--PDLKKSSKK------------RSNVFDFDAEF  45

Query  330  EADFQDFKDHSYSQ-----------VDAKPFAFSASHRPGFssgp-dsdsskdadnsskr  473
            EADFQ FKD S               D KPF F+++ +P             +A+ S KR
Sbjct  46   EADFQGFKDDSSIDCDDDFDVGDVFADVKPFVFTSTPKPAVEGSAFGKKVDGEAERSGKR  105

Query  474  krkNQYRGIRQRPWGKWAAEIRDPSKGVRVWLGTFDTAEEAARAYDIEARRIRGKKAKVN  653
            KRKNQYRGIRQRPWGKWAAEIRDP +G R+WLGTF TAEEAARAYD  ARRIRG KAKVN
Sbjct  106  KRKNQYRGIRQRPWGKWAAEIRDPREGARIWLGTFKTAEEAARAYDAAARRIRGSKAKVN  165

Query  654  FPDDAP  671
            FP++ P
Sbjct  166  FPEENP  171



>ref|XP_009135498.1| PREDICTED: ethylene-responsive transcription factor RAP2-3-like 
[Brassica rapa]
Length=245

 Score =   122 bits (306),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 80/174 (46%), Positives = 94/174 (54%), Gaps = 39/174 (22%)
 Frame = +3

Query  150  MCGGAIISDFKPPSR--SSRRLTADLLWGRADLsggkkksnssgshyskPLRSEVVVLDD  323
            MCGGA+ISDF P       R+LTA+ LW   D S                         D
Sbjct  1    MCGGAVISDFAPSVTRAKGRKLTAEELWSELDASAC-----------------------D  37

Query  324  DFEADFQDFKDHSY-SQVDAKPFAFSASHRPGFssgpdsdsskdadnsskrkrkNQYRGI  500
            DF +    FK HS   QV  K  A +    P                  +++RKN YRGI
Sbjct  38   DFWSFDPTFKLHSTKQQVTLKDEAANKEKEPA-------------ATEKRKERKNVYRGI  84

Query  501  RQRPWGKWAAEIRDPSKGVRVWLGTFDTAEEAARAYDIEARRIRGKKAKVNFPD  662
            R+RPWGKWA+EIRDP KG RVWLGTF+TAEEAA AYD+ A+RIRG KAK+NFPD
Sbjct  85   RKRPWGKWASEIRDPEKGARVWLGTFNTAEEAAMAYDVAAKRIRGDKAKLNFPD  138



>gb|AAS20427.1| ethylene-responsive factor-like protein 1 [Capsicum annuum]
 gb|AGU44837.1| ethylene responsive factor [Capsicum annuum]
Length=264

 Score =   122 bits (307),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 80/172 (47%), Positives = 98/172 (57%), Gaps = 39/172 (23%)
 Frame = +3

Query  150  MCGGAIISDFKPPSRSSRRLTADLLWGRADLsggkkksnssgshyskPLRSEVVVLDDDF  329
            MCGGAI++D  P  R  RRL++  LW                            +  DDF
Sbjct  1    MCGGAILADIIP--RRDRRLSSTDLWS---------------------------ICSDDF  31

Query  330  EADFQDFKDHSYSQVDAKPFAFSASHRPGFssgpdsdsskdadnsskrkrkNQYRGIRQR  509
                  + + S+S    KPF+              S  ++    + KR+RKN YRGIRQR
Sbjct  32   ------WPNSSFS----KPFSTQNVSPAKPKRTQPSAGNEQIQKAKKRQRKNLYRGIRQR  81

Query  510  PWGKWAAEIRDPSKGVRVWLGTFDTAEEAARAYDIEARRIRGKKAKVNFPDD  665
            PWGKWAAEIRDP KGVRVWLGTF+TAEEAARAYD EAR+IRG+KAKVNFP++
Sbjct  82   PWGKWAAEIRDPRKGVRVWLGTFNTAEEAARAYDKEARKIRGEKAKVNFPNE  133



>ref|XP_008800471.1| PREDICTED: ethylene-responsive transcription factor 1-like isoform 
X1 [Phoenix dactylifera]
Length=350

 Score =   124 bits (311),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 56/60 (93%), Positives = 59/60 (98%), Gaps = 0/60 (0%)
 Frame = +3

Query  483  NQYRGIRQRPWGKWAAEIRDPSKGVRVWLGTFDTAEEAARAYDIEARRIRGKKAKVNFPD  662
            NQYRGIRQRPWGKWAAEIRDP KGVRVWLGTF+TAEEAARAYD+EARRIRGKKAKVNFP+
Sbjct  112  NQYRGIRQRPWGKWAAEIRDPHKGVRVWLGTFNTAEEAARAYDVEARRIRGKKAKVNFPE  171



>ref|XP_008800472.1| PREDICTED: ethylene-responsive transcription factor 1-like isoform 
X2 [Phoenix dactylifera]
Length=335

 Score =   124 bits (310),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 56/60 (93%), Positives = 59/60 (98%), Gaps = 0/60 (0%)
 Frame = +3

Query  483  NQYRGIRQRPWGKWAAEIRDPSKGVRVWLGTFDTAEEAARAYDIEARRIRGKKAKVNFPD  662
            NQYRGIRQRPWGKWAAEIRDP KGVRVWLGTF+TAEEAARAYD+EARRIRGKKAKVNFP+
Sbjct  97   NQYRGIRQRPWGKWAAEIRDPHKGVRVWLGTFNTAEEAARAYDVEARRIRGKKAKVNFPE  156



>ref|XP_010107742.1| Ethylene-responsive transcription factor [Morus notabilis]
 gb|EXC16835.1| Ethylene-responsive transcription factor [Morus notabilis]
Length=275

 Score =   122 bits (307),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 77/172 (45%), Positives = 96/172 (56%), Gaps = 34/172 (20%)
 Frame = +3

Query  150  MCGGAIISDFKPPSRSSRRLTADLLWGRADLsggkkksnssgshyskPLRSEVVVLDDDF  329
            MCGGA+I+   P +R  RR+ +  +W                     P      +  + F
Sbjct  1    MCGGAVIAGLIPRNRG-RRVNSSDIW---------------------PSSPFAKLSHNSF  38

Query  330  EADFQDFKDHSYSQVDAKPFAFSASHRPGFssgpdsdsskdadnsskrkrkNQYRGIRQR  509
            E++F    +H     +  P   S     G          + ++   KR RKN YRGIRQR
Sbjct  39   ESNFCHLINHEVE--NHVPLKRSVPSSEG----------EQSEKPVKRVRKNLYRGIRQR  86

Query  510  PWGKWAAEIRDPSKGVRVWLGTFDTAEEAARAYDIEARRIRGKKAKVNFPDD  665
            PWGKWAAEIRDP KGVRVWLGTF+TAEEAARAYD EAR+IRGKKAKVNFP++
Sbjct  87   PWGKWAAEIRDPRKGVRVWLGTFNTAEEAARAYDREARKIRGKKAKVNFPNE  138



>emb|CDY54628.1| BnaCnng27470D [Brassica napus]
Length=245

 Score =   122 bits (305),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 80/174 (46%), Positives = 93/174 (53%), Gaps = 39/174 (22%)
 Frame = +3

Query  150  MCGGAIISDFKPPSR--SSRRLTADLLWGRADLsggkkksnssgshyskPLRSEVVVLDD  323
            MCGGA+ISDF P       R+LTA+ LW   D S                         D
Sbjct  1    MCGGAVISDFAPSVTRAKGRKLTAEELWSELDASAC-----------------------D  37

Query  324  DFEADFQDFKDHSYS-QVDAKPFAFSASHRPGFssgpdsdsskdadnsskrkrkNQYRGI  500
            DF      FK HS   QV  K  A +    P                  +++RKN YRGI
Sbjct  38   DFWGFDSTFKLHSSKRQVTLKDEAANKEKEPA-------------ATEKRKERKNVYRGI  84

Query  501  RQRPWGKWAAEIRDPSKGVRVWLGTFDTAEEAARAYDIEARRIRGKKAKVNFPD  662
            R+RPWGKWA+EIRDP KG RVWLGTF+TAEEAA AYD+ A+RIRG KAK+NFPD
Sbjct  85   RKRPWGKWASEIRDPEKGARVWLGTFNTAEEAAMAYDVAAKRIRGDKAKLNFPD  138



>gb|ACL78788.1| putative ethylene responsive element binding protein 3 [Citrus 
unshiu]
Length=272

 Score =   122 bits (307),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 84/172 (49%), Positives = 100/172 (58%), Gaps = 30/172 (17%)
 Frame = +3

Query  150  MCGGAIISDFKPPSRSSRRLTADLLWGRADLsggkkksnssgshyskPLRSEVVVLDDDF  329
            MCGG+I+ DF P      R+TA  LW  +  +  K+                   L  +F
Sbjct  1    MCGGSILGDFFP-RHGGSRVTASDLWPNSPFAATKQ-------------------LPHNF  40

Query  330  EADFQDFKDHSYSQVDAKPFAFSASHRPGFssgpdsdsskdadnsskrkrkNQYRGIRQR  509
            E+    F D   S    K        RP   S  +S S+   +   KR+RKN YRGIRQR
Sbjct  41   ES--TPFSDEHQSLAKIK--------RPQPPSYLNSCSASGDEKKPKRQRKNLYRGIRQR  90

Query  510  PWGKWAAEIRDPSKGVRVWLGTFDTAEEAARAYDIEARRIRGKKAKVNFPDD  665
            PWGKWAAEIRDP KGVRVWLGTF+TAEEAARAYD EAR+IRGKKAKVNFP++
Sbjct  91   PWGKWAAEIRDPRKGVRVWLGTFNTAEEAARAYDKEARKIRGKKAKVNFPNE  142



>gb|EMS56145.1| Ethylene-responsive transcription factor 1 [Triticum urartu]
Length=313

 Score =   123 bits (309),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 54/64 (84%), Positives = 63/64 (98%), Gaps = 0/64 (0%)
 Frame = +3

Query  483  NQYRGIRQRPWGKWAAEIRDPSKGVRVWLGTFDTAEEAARAYDIEARRIRGKKAKVNFPD  662
            NQ+RGIR+RPWGKWAAEIRDP KGVRVWLGT+++AEEAARAYD+EARRIRGKKAKVNFP+
Sbjct  69   NQFRGIRRRPWGKWAAEIRDPRKGVRVWLGTYNSAEEAARAYDVEARRIRGKKAKVNFPE  128

Query  663  DAPL  674
            +AP+
Sbjct  129  EAPM  132



>ref|XP_006392736.1| hypothetical protein EUTSA_v10011606mg [Eutrema salsugineum]
 ref|XP_006392737.1| hypothetical protein EUTSA_v10011606mg [Eutrema salsugineum]
 ref|XP_006392738.1| hypothetical protein EUTSA_v10011606mg [Eutrema salsugineum]
 dbj|BAJ34297.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ30022.1| hypothetical protein EUTSA_v10011606mg [Eutrema salsugineum]
 gb|ESQ30023.1| hypothetical protein EUTSA_v10011606mg [Eutrema salsugineum]
 gb|ESQ30024.1| hypothetical protein EUTSA_v10011606mg [Eutrema salsugineum]
Length=359

 Score =   124 bits (311),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 107/195 (55%), Positives = 120/195 (62%), Gaps = 27/195 (14%)
 Frame = +3

Query  150  MCGGAIISDFKPPSRSSRRLTADLLWGRADLsggkkksnssgshyskPLRSEVVVLDDDF  329
            MCGGAIISDF PP RS RR+T++ +W   DL    K    S        RS    LDD+F
Sbjct  1    MCGGAIISDFIPPPRS-RRVTSEFIW--PDLKKNVKGLKRSSKK-----RSNFFDLDDEF  52

Query  330  EADFQDFKDHSYSQVDA-----------KPFAFSASHRPGFssgpdsds--------skd  452
            EADFQ FKD S    D            KPF F+AS +P  SS     +           
Sbjct  53   EADFQGFKDDSSIDCDDDFDVDDVFADVKPFVFTASPKPVVSSAASDSAFGKKVADFKGQ  112

Query  453  adnsskrkrkNQYRGIRQRPWGKWAAEIRDPSKGVRVWLGTFDTAEEAARAYDIEARRIR  632
            A+ SSKRKRKNQYRGIRQRPWGKWAAEIRDP +G R+WLGTF TAEEAARAYD  ARRIR
Sbjct  113  AEKSSKRKRKNQYRGIRQRPWGKWAAEIRDPREGARIWLGTFKTAEEAARAYDAAARRIR  172

Query  633  GKKAKVNFPDDAPLT  677
            G KAKVNFP++ P  
Sbjct  173  GSKAKVNFPEENPTV  187



>ref|XP_010939858.1| PREDICTED: ethylene-responsive transcription factor 1-like isoform 
X2 [Elaeis guineensis]
Length=350

 Score =   124 bits (310),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 56/60 (93%), Positives = 59/60 (98%), Gaps = 0/60 (0%)
 Frame = +3

Query  483  NQYRGIRQRPWGKWAAEIRDPSKGVRVWLGTFDTAEEAARAYDIEARRIRGKKAKVNFPD  662
            NQYRGIRQRPWGKWAAEIRDP KGVRVWLGTF+TAEEAARAYD+EARRIRGKKAKVNFP+
Sbjct  94   NQYRGIRQRPWGKWAAEIRDPRKGVRVWLGTFNTAEEAARAYDVEARRIRGKKAKVNFPE  153



>tpg|DAA61617.1| TPA: putative AP2/EREBP transcription factor superfamily protein 
[Zea mays]
Length=418

 Score =   124 bits (312),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 58/65 (89%), Positives = 62/65 (95%), Gaps = 0/65 (0%)
 Frame = +3

Query  483  NQYRGIRQRPWGKWAAEIRDPSKGVRVWLGTFDTAEEAARAYDIEARRIRGKKAKVNFPD  662
            NQYRGIRQRPWGKWAAEIRDP+KGVRVWLGT++TAEEAARAYD EAR+IRGKKAKVNFPD
Sbjct  129  NQYRGIRQRPWGKWAAEIRDPNKGVRVWLGTYNTAEEAARAYDAEARKIRGKKAKVNFPD  188

Query  663  DAPLT  677
            DA  T
Sbjct  189  DATGT  193



>ref|NP_001077812.1| ethylene-responsive transcription factor ERF073 [Arabidopsis 
thaliana]
 gb|AAG52589.1|AC016529_20 putative AP2 domain transcription factor; 71325-70452 [Arabidopsis 
thaliana]
 gb|AEE35311.1| ethylene-responsive transcription factor ERF073 [Arabidopsis 
thaliana]
Length=262

 Score =   122 bits (305),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 73/174 (42%), Positives = 106/174 (61%), Gaps = 40/174 (23%)
 Frame = +3

Query  150  MCGGAIISDFKPPSRSSRRLTADLLWGRADLsggkkksnssgshyskPLRSEVVVLDDDF  329
            MCGGA+ISD+  P + +R  +    W                       RS  V     F
Sbjct  1    MCGGAVISDYIAPEKIARS-SGKSSW-----------------------RSNGV-----F  31

Query  330  EADFQDFKDHSYSQVDA-KPFAFSASHRPGFssgpdsdsskdadnsskrkrkNQYRGIRQ  506
            +    DF D ++ ++++ +PF FS++H+           +  + +  K+K+ ++Y+GIR+
Sbjct  32   DCSIYDF-DGNFDELESDEPFVFSSTHK---------HHASGSASDGKKKQSSRYKGIRR  81

Query  507  RPWGKWAAEIRDPSKGVRVWLGTFDTAEEAARAYDIEARRIRGKKAKVNFPDDA  668
            RPWG+WAAEIRDP KGVRVWLGTF+TAEEAARAYD+EA+RIRG KAK+NFP+++
Sbjct  82   RPWGRWAAEIRDPIKGVRVWLGTFNTAEEAARAYDLEAKRIRGAKAKLNFPNES  135



>ref|NP_001117587.1| ethylene-responsive transcription factor ERF073 [Arabidopsis 
thaliana]
 gb|AEE35312.1| ethylene-responsive transcription factor ERF073 [Arabidopsis 
thaliana]
Length=260

 Score =   122 bits (305),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 73/174 (42%), Positives = 105/174 (60%), Gaps = 42/174 (24%)
 Frame = +3

Query  150  MCGGAIISDFKPPSRSSRRLTADLLWGRADLsggkkksnssgshyskPLRSEVVVLDDDF  329
            MCGGA+ISD+  P + +R  +    W                       RS  V     F
Sbjct  1    MCGGAVISDYIAPEKIARS-SGKSSW-----------------------RSNGV-----F  31

Query  330  EADFQDFKDHSYSQVDA-KPFAFSASHRPGFssgpdsdsskdadnsskrkrkNQYRGIRQ  506
            +    DF D ++ ++++ +PF FS++H+              + +  K+K+ ++Y+GIR+
Sbjct  32   DCSIYDF-DGNFDELESDEPFVFSSTHK-----------HHASASDGKKKQSSRYKGIRR  79

Query  507  RPWGKWAAEIRDPSKGVRVWLGTFDTAEEAARAYDIEARRIRGKKAKVNFPDDA  668
            RPWG+WAAEIRDP KGVRVWLGTF+TAEEAARAYD+EA+RIRG KAK+NFP+++
Sbjct  80   RPWGRWAAEIRDPIKGVRVWLGTFNTAEEAARAYDLEAKRIRGAKAKLNFPNES  133



>gb|EAZ36121.1| hypothetical protein OsJ_20431 [Oryza sativa Japonica Group]
Length=312

 Score =   123 bits (308),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 56/64 (88%), Positives = 60/64 (94%), Gaps = 0/64 (0%)
 Frame = +3

Query  483  NQYRGIRQRPWGKWAAEIRDPSKGVRVWLGTFDTAEEAARAYDIEARRIRGKKAKVNFPD  662
            NQ+RGIRQRPWGKWAAEIRDP KGVRVWLGTF++ EEAARAYD EARRIRGKKAKVNFPD
Sbjct  63   NQFRGIRQRPWGKWAAEIRDPRKGVRVWLGTFNSPEEAARAYDAEARRIRGKKAKVNFPD  122

Query  663  DAPL  674
             AP+
Sbjct  123  GAPV  126



>ref|XP_009117065.1| PREDICTED: ethylene-responsive transcription factor RAP2-2-like 
[Brassica rapa]
 ref|XP_009117071.1| PREDICTED: ethylene-responsive transcription factor RAP2-2-like 
[Brassica rapa]
Length=365

 Score =   124 bits (310),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 105/194 (54%), Positives = 122/194 (63%), Gaps = 32/194 (16%)
 Frame = +3

Query  150  MCGGAIISDFKPPSRSSRRLTADLLWGRADLsggkkksnssgshyskPLRSEVVVLDDDF  329
            MCGGAIISDF PP  SSRR+T++ LW   DL   K K++          RS+   LDD+F
Sbjct  1    MCGGAIISDFIPPP-SSRRVTSEFLW--PDLKKNKGKASKK--------RSDFFDLDDEF  49

Query  330  EADFQDFKDHSYSQ------------VDAKPFAFSASHRP---------GFssgpdsdss  446
            EADFQ F+D   S                KPF F+A+ +P           S     +S 
Sbjct  50   EADFQGFEDDDASFDCEDDDEDDDVFAKVKPFVFTATTKPVASPPTATGSVSGKKIIESG  109

Query  447  kdadnsskrkrkNQYRGIRQRPWGKWAAEIRDPSKGVRVWLGTFDTAEEAARAYDIEARR  626
              A+ S+KRKRKNQYRGIRQRPWGKWAAEIRDP KG R WLGTFDTAEEAARAYD  ARR
Sbjct  110  GQAEKSAKRKRKNQYRGIRQRPWGKWAAEIRDPRKGSREWLGTFDTAEEAARAYDAAARR  169

Query  627  IRGKKAKVNFPDDA  668
            IRG KAKVNFP+++
Sbjct  170  IRGSKAKVNFPEES  183



>gb|AAM00285.1|AF364176_1 putative EREBP-type transcription factor [Oryza sativa]
 gb|ABD73014.1| putative EREBP transcription factor [Oryza sativa Japonica Group]
 gb|ACF60474.1| EREBP transcription factor [Oryza sativa Japonica Group]
Length=396

 Score =   124 bits (310),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 56/61 (92%), Positives = 60/61 (98%), Gaps = 0/61 (0%)
 Frame = +3

Query  483  NQYRGIRQRPWGKWAAEIRDPSKGVRVWLGTFDTAEEAARAYDIEARRIRGKKAKVNFPD  662
            NQYRGIRQRPWGKWAAEIRDPSKGVRVWLGT++TAEEAARAYD EAR+IRGKKAKVNFPD
Sbjct  134  NQYRGIRQRPWGKWAAEIRDPSKGVRVWLGTYNTAEEAARAYDAEARKIRGKKAKVNFPD  193

Query  663  D  665
            +
Sbjct  194  E  194



>ref|NP_001063252.1| Os09g0434500 [Oryza sativa Japonica Group]
 dbj|BAD33565.1| putative transcription factor EREBP1 [Oryza sativa Japonica Group]
 dbj|BAF25166.1| Os09g0434500 [Oryza sativa Japonica Group]
 gb|EAZ44843.1| hypothetical protein OsJ_29481 [Oryza sativa Japonica Group]
 dbj|BAG96801.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96905.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG99367.1| unnamed protein product [Oryza sativa Japonica Group]
Length=396

 Score =   124 bits (310),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 56/61 (92%), Positives = 60/61 (98%), Gaps = 0/61 (0%)
 Frame = +3

Query  483  NQYRGIRQRPWGKWAAEIRDPSKGVRVWLGTFDTAEEAARAYDIEARRIRGKKAKVNFPD  662
            NQYRGIRQRPWGKWAAEIRDPSKGVRVWLGT++TAEEAARAYD EAR+IRGKKAKVNFPD
Sbjct  134  NQYRGIRQRPWGKWAAEIRDPSKGVRVWLGTYNTAEEAARAYDAEARKIRGKKAKVNFPD  193

Query  663  D  665
            +
Sbjct  194  E  194



>gb|KHG20924.1| Ethylene-responsive transcription factor RAP2-3 -like protein 
[Gossypium arboreum]
Length=292

 Score =   122 bits (306),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 84/172 (49%), Positives = 97/172 (56%), Gaps = 39/172 (23%)
 Frame = +3

Query  150  MCGGAIISDFKPPSRSSRRLTADLLWGRADLsggkkksnssgshyskPLRSEVVVLDDDF  329
            MCGGAIIS+F P  +  RR+TA  LW                        S  V ++   
Sbjct  1    MCGGAIISEFIP-RKGGRRVTAADLW----------------------PNSPFVKING--  35

Query  330  EADFQDFKDHSYSQVDAKPFAFSASHRPGFssgpdsdsskdadnsskrkrkNQYRGIRQR  509
               F   +DHS        F  S    P       S   +  +   KR+RKN YRGIRQR
Sbjct  36   ---FCSNRDHSVCH-----FKRSQPEPP------SSLVDEQVEKKPKRQRKNLYRGIRQR  81

Query  510  PWGKWAAEIRDPSKGVRVWLGTFDTAEEAARAYDIEARRIRGKKAKVNFPDD  665
            PWGKWAAEIRDP KGVRVWLGTF+TAEEAARAYD EAR+IRGKKAKVNFP++
Sbjct  82   PWGKWAAEIRDPRKGVRVWLGTFNTAEEAARAYDREARKIRGKKAKVNFPNE  133



>gb|EAZ09217.1| hypothetical protein OsI_31492 [Oryza sativa Indica Group]
Length=399

 Score =   124 bits (310),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 56/61 (92%), Positives = 60/61 (98%), Gaps = 0/61 (0%)
 Frame = +3

Query  483  NQYRGIRQRPWGKWAAEIRDPSKGVRVWLGTFDTAEEAARAYDIEARRIRGKKAKVNFPD  662
            NQYRGIRQRPWGKWAAEIRDPSKGVRVWLGT++TAEEAARAYD EAR+IRGKKAKVNFPD
Sbjct  137  NQYRGIRQRPWGKWAAEIRDPSKGVRVWLGTYNTAEEAARAYDAEARKIRGKKAKVNFPD  196

Query  663  D  665
            +
Sbjct  197  E  197



>ref|XP_009146390.1| PREDICTED: ethylene-responsive transcription factor RAP2-2 [Brassica 
rapa]
Length=379

 Score =   124 bits (310),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 106/196 (54%), Positives = 120/196 (61%), Gaps = 35/196 (18%)
 Frame = +3

Query  150  MCGGAIISDFKPPSRSSRRLTADLLWGRADLsggkkksnssgshyskPLRSEVVVLDDDF  329
            MCGGAIIS+F PPSRS RR+T++ LW   DL    K S           RS  + LDD+F
Sbjct  1    MCGGAIISEFIPPSRS-RRVTSEHLW--PDLKNKGKASKK--------KRSGFIDLDDEF  49

Query  330  EADFQDFKDHS------------YSQVDAKPFAFSASHRP------------GFssgpds  437
            EADFQ FKD +                D KPF F+A  +P              S     
Sbjct  50   EADFQGFKDDASFDCEDEFDVDDDVFADVKPFVFAAGAKPVASPPAAFASTGSVSGKKTI  109

Query  438  dsskdadnsskrkrkNQYRGIRQRPWGKWAAEIRDPSKGVRVWLGTFDTAEEAARAYDIE  617
            +S   A+ S+KRKRKNQYRGIRQRPWGKWAAEIRDP KG R WLGTFDTAEEAARAYD  
Sbjct  110  ESGGQAEKSAKRKRKNQYRGIRQRPWGKWAAEIRDPRKGSREWLGTFDTAEEAARAYDAA  169

Query  618  ARRIRGKKAKVNFPDD  665
            ARRIRG KAKVNFP++
Sbjct  170  ARRIRGNKAKVNFPEE  185



>emb|CDX98435.1| BnaC05g39400D [Brassica napus]
Length=379

 Score =   124 bits (310),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 107/198 (54%), Positives = 121/198 (61%), Gaps = 36/198 (18%)
 Frame = +3

Query  150  MCGGAIISDFKPPSRSSRRLTADLLWGRADLsggkkksnssgshyskPLRSEVVVLDDDF  329
            MCGGAIISDF PPSRS RR+T++ LW   DL    K S           RS+ + LDD+F
Sbjct  1    MCGGAIISDFIPPSRS-RRVTSEYLW--PDLKNKGKASKKKK-------RSDFLDLDDEF  50

Query  330  EADFQDFKDHS------------YSQVDAKPFAFSASHRP--------------GFssgp  431
            EADFQ FKD +                D KPF F+A  +P                S   
Sbjct  51   EADFQGFKDGASFDCEDEFDVDDDVFADVKPFVFAAGAKPVASPPAAFASASAGSVSGKK  110

Query  432  dsdsskdadnsskrkrkNQYRGIRQRPWGKWAAEIRDPSKGVRVWLGTFDTAEEAARAYD  611
              +S   A+ S+KRKRKNQYRGIRQRPWGKWAAEIRDP KG R WLGTFDTAEEAARAYD
Sbjct  111  TIESGGQAEKSAKRKRKNQYRGIRQRPWGKWAAEIRDPRKGSREWLGTFDTAEEAARAYD  170

Query  612  IEARRIRGKKAKVNFPDD  665
              ARRIRG KAKVNFP++
Sbjct  171  AAARRIRGNKAKVNFPEE  188



>ref|XP_007145186.1| hypothetical protein PHAVU_007G217800g [Phaseolus vulgaris]
 ref|XP_007145187.1| hypothetical protein PHAVU_007G217800g [Phaseolus vulgaris]
 gb|ESW17180.1| hypothetical protein PHAVU_007G217800g [Phaseolus vulgaris]
 gb|ESW17181.1| hypothetical protein PHAVU_007G217800g [Phaseolus vulgaris]
Length=299

 Score =   122 bits (306),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 81/172 (47%), Positives = 93/172 (54%), Gaps = 40/172 (23%)
 Frame = +3

Query  150  MCGGAIISDFKPPSRSSRRLTADLLWGRADLsggkkksnssgshyskPLRSEVVVLDDDF  329
            MCGGAII+DF P  R  R + A  LW  +                           DDDF
Sbjct  1    MCGGAIIADFIP--RRGRCVAASELWPNS------------------------FGKDDDF  34

Query  330  EADFQDFKDHSYSQVDAKPFAFSASHRPGFssgpdsdsskdadnsskrkrkNQYRGIRQR  509
               + +           +P     +  P         S K      KR+RKN YRGIRQR
Sbjct  35   AFGYSNIAKQ-------EPSTLKTAQPP-------KVSEKVETKPMKRQRKNLYRGIRQR  80

Query  510  PWGKWAAEIRDPSKGVRVWLGTFDTAEEAARAYDIEARRIRGKKAKVNFPDD  665
            PWGKWAAEIRDP KGVRVWLGTF+TAEEAARAYD EAR+IRGKKAKVNFP++
Sbjct  81   PWGKWAAEIRDPRKGVRVWLGTFNTAEEAARAYDREARKIRGKKAKVNFPNE  132



>tpg|DAA40132.1| TPA: putative AP2/EREBP transcription factor superfamily protein 
[Zea mays]
Length=267

 Score =   121 bits (304),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 93/208 (45%), Positives = 114/208 (55%), Gaps = 56/208 (27%)
 Frame = +3

Query  150  MCGGAIISDFKPPS-----------RSSRRLTADLLWGRADLsggkkksnssgshyskPL  296
            MCGGAI+S F PPS           +  RR TADLLW                     P 
Sbjct  1    MCGGAILSGFIPPSGVPAAAAAAKKKQQRRATADLLW-------------------PGPG  41

Query  297  RSEVVVLDDDFEADFQDFK---------DHSYSQVDAKPF------AFSAS---HRPGFs  422
            + +    ++DFEADF++F+         D +  +V   P       AF+A+    R    
Sbjct  42   K-KGAPREEDFEADFREFERGLGEDDDVDGAGDEVQELPLPEPARLAFAAAVGAPRTAVD  100

Query  423  sgpd-------sdsskdadnsskrkrkNQYRGIRQRPWGKWAAEIRDPSKGVRVWLGTFD  581
                         ++     ++KR+RKNQYRGIR+RPWGKWAAEIRDPSKGVRVWLGT+ 
Sbjct  101  GVMTPKDGEGDMPTTATNSAANKRRRKNQYRGIRRRPWGKWAAEIRDPSKGVRVWLGTYS  160

Query  582  TAEEAARAYDIEARRIRGKKAKVNFPDD  665
            TAEEAARAYD EARRIRGKKAKVNF D+
Sbjct  161  TAEEAARAYDAEARRIRGKKAKVNFRDE  188



>gb|KFK39023.1| hypothetical protein AALP_AA3G190500 [Arabis alpina]
Length=231

 Score =   120 bits (302),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 82/173 (47%), Positives = 92/173 (53%), Gaps = 42/173 (24%)
 Frame = +3

Query  150  MCGGAIISDFKP--PSRSSRRLTADLLWGRADLsggkkksnssgshyskPLRSEVVVLDD  323
            MCGGAIISDF P       R+LTA+ LW   D S                         D
Sbjct  1    MCGGAIISDFAPIVTKAKGRKLTAEELWSELDSSAA-----------------------D  37

Query  324  DFEADFQDFKDHSYSQVDAKPFAFSASHRPGFssgpdsdsskdadnsskrkrkNQYRGIR  503
            DF       K  S +QV  K  A  A   P                  +RKRKN YRGIR
Sbjct  38   DFWGFDSSSKRQSTNQVSVKEEA--AEKEP---------------TEKRRKRKNVYRGIR  80

Query  504  QRPWGKWAAEIRDPSKGVRVWLGTFDTAEEAARAYDIEARRIRGKKAKVNFPD  662
            +RPWGKWA+EIRDP KG RVWLGTF+TAEEAA AYD+ A+RIRG KAK+NFPD
Sbjct  81   KRPWGKWASEIRDPGKGTRVWLGTFNTAEEAAMAYDVAAKRIRGDKAKLNFPD  133



>gb|AAV98700.1| BTH-induced ERF transcriptional factor 1 [Oryza sativa Indica 
Group]
Length=399

 Score =   124 bits (310),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 56/61 (92%), Positives = 60/61 (98%), Gaps = 0/61 (0%)
 Frame = +3

Query  483  NQYRGIRQRPWGKWAAEIRDPSKGVRVWLGTFDTAEEAARAYDIEARRIRGKKAKVNFPD  662
            NQYRGIRQRPWGKWAAEIRDPSKGVRVWLGT++TAEEAARAYD EAR+IRGKKAKVNFPD
Sbjct  137  NQYRGIRQRPWGKWAAEIRDPSKGVRVWLGTYNTAEEAARAYDAEARKIRGKKAKVNFPD  196

Query  663  D  665
            +
Sbjct  197  E  197



>gb|AAP32468.1| ethylene-responsive element binding protein [Triticum aestivum]
Length=355

 Score =   123 bits (308),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 88/172 (51%), Positives = 106/172 (62%), Gaps = 13/172 (8%)
 Frame = +3

Query  150  MCGGAIISDFKPPSRSSRRLTADLLWGRADLsggkkksnssgshyskPLRSEVVVLDD-D  326
            MCGGAI+SD  PP R   R T   +W RAD     +   ++G     P         D +
Sbjct  1    MCGGAILSDIIPPPR---RATGGNVW-RADKKRRARPDAAAGRPRRVPEEEFQEEESDAE  56

Query  327  FEADFQDFKD-HSYSQVDAKPFAFSASHRPGFssgpdsdssk----dadnsskrkrkNQY  491
            FEADF+ F +    S  +AKPF      R GFS      ++      A  S+KRKRKNQ+
Sbjct  57   FEADFEGFVEAEEESDGEAKPFPV---RRSGFSGDGLKATAAGDDDCASGSAKRKRKNQF  113

Query  492  RGIRQRPWGKWAAEIRDPSKGVRVWLGTFDTAEEAARAYDIEARRIRGKKAK  647
            RGIR+RPWGKWAAEIRDP KGVR WLGT+++AEEA RAYD+EARRIRGKKAK
Sbjct  114  RGIRRRPWGKWAAEIRDPRKGVRAWLGTYNSAEEAVRAYDVEARRIRGKKAK  165



>ref|XP_004956913.1| PREDICTED: ethylene-responsive transcription factor 1-like [Setaria 
italica]
Length=396

 Score =   124 bits (310),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 56/61 (92%), Positives = 60/61 (98%), Gaps = 0/61 (0%)
 Frame = +3

Query  483  NQYRGIRQRPWGKWAAEIRDPSKGVRVWLGTFDTAEEAARAYDIEARRIRGKKAKVNFPD  662
            NQYRGIRQRPWGKWAAEIRDPSKGVRVWLGT++TAEEAARAYD EAR+IRGKKAKVNFPD
Sbjct  130  NQYRGIRQRPWGKWAAEIRDPSKGVRVWLGTYNTAEEAARAYDAEARKIRGKKAKVNFPD  189

Query  663  D  665
            +
Sbjct  190  E  190



>emb|CDY39107.1| BnaA01g29490D [Brassica napus]
Length=390

 Score =   123 bits (309),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 105/194 (54%), Positives = 122/194 (63%), Gaps = 32/194 (16%)
 Frame = +3

Query  150  MCGGAIISDFKPPSRSSRRLTADLLWGRADLsggkkksnssgshyskPLRSEVVVLDDDF  329
            MCGGAIISDF PP  SSRR+T++ LW   DL   K K++          RS+   LDD+F
Sbjct  1    MCGGAIISDFIPPP-SSRRVTSEFLW--PDLKKNKGKASKK--------RSDFFDLDDEF  49

Query  330  EADFQDFKDHSYSQ------------VDAKPFAFSASHRP---------GFssgpdsdss  446
            EADFQ F+D   S                KPF F+A+ +P           S     +S 
Sbjct  50   EADFQGFEDDDASFDCEDDDEDDDVFAKVKPFVFTATTKPVASPPTATGSVSGKKIIESG  109

Query  447  kdadnsskrkrkNQYRGIRQRPWGKWAAEIRDPSKGVRVWLGTFDTAEEAARAYDIEARR  626
              A+ S+KRKRKNQYRGIRQRPWGKWAAEIRDP KG R WLGTFDTAEEAARAYD  ARR
Sbjct  110  GQAEKSAKRKRKNQYRGIRQRPWGKWAAEIRDPRKGSREWLGTFDTAEEAARAYDAAARR  169

Query  627  IRGKKAKVNFPDDA  668
            IRG KAKVNFP+++
Sbjct  170  IRGSKAKVNFPEES  183



>ref|XP_010921624.1| PREDICTED: ethylene-responsive transcription factor ERF071-like 
[Elaeis guineensis]
Length=248

 Score =   121 bits (303),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 57/64 (89%), Positives = 60/64 (94%), Gaps = 0/64 (0%)
 Frame = +3

Query  483  NQYRGIRQRPWGKWAAEIRDPSKGVRVWLGTFDTAEEAARAYDIEARRIRGKKAKVNFPD  662
            N YRGIRQRPWGKWAAEIRDP KGVRVWLGTF+TAEEAARAYD EARRIRGKKAKVNFP+
Sbjct  59   NLYRGIRQRPWGKWAAEIRDPMKGVRVWLGTFNTAEEAARAYDREARRIRGKKAKVNFPN  118

Query  663  DAPL  674
            + PL
Sbjct  119  EDPL  122



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1133412046677