BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig12835

Length=805
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|EYU19209.1|  hypothetical protein MIMGU_mgv1a0085351mg               191   2e-56   Erythranthe guttata [common monkey flower]
ref|XP_002522836.1|  fertilization-independent endosperm protein,...    194   5e-56   
ref|XP_009591128.1|  PREDICTED: polycomb group protein FERTILIZAT...    193   3e-55   Nicotiana tomentosiformis
gb|KJB81800.1|  hypothetical protein B456_013G163900                    190   3e-55   Gossypium raimondii
ref|XP_011095327.1|  PREDICTED: polycomb group protein FERTILIZAT...    186   3e-55   Sesamum indicum [beniseed]
ref|XP_011095329.1|  PREDICTED: polycomb group protein FERTILIZAT...    192   5e-55   Sesamum indicum [beniseed]
ref|XP_011095331.1|  PREDICTED: polycomb group protein FERTILIZAT...    192   5e-55   Sesamum indicum [beniseed]
ref|XP_012070730.1|  PREDICTED: polycomb group protein FERTILIZAT...    193   5e-55   Jatropha curcas
ref|XP_011095328.1|  PREDICTED: polycomb group protein FERTILIZAT...    192   5e-55   Sesamum indicum [beniseed]
ref|XP_011095324.1|  PREDICTED: polycomb group protein FERTILIZAT...    187   5e-55   Sesamum indicum [beniseed]
ref|XP_011095326.1|  PREDICTED: polycomb group protein FERTILIZAT...    186   6e-55   Sesamum indicum [beniseed]
ref|XP_011095325.1|  PREDICTED: polycomb group protein FERTILIZAT...    187   6e-55   Sesamum indicum [beniseed]
ref|XP_009769114.1|  PREDICTED: polycomb group protein FERTILIZAT...    192   8e-55   Nicotiana sylvestris
ref|XP_011095323.1|  PREDICTED: polycomb group protein FERTILIZAT...    187   8e-55   Sesamum indicum [beniseed]
ref|XP_007021053.1|  Transducin/WD40 repeat-like superfamily prot...    191   2e-54   
gb|KJB81804.1|  hypothetical protein B456_013G163900                    189   2e-54   Gossypium raimondii
ref|XP_007021051.1|  Transducin/WD40 repeat-like superfamily prot...    191   2e-54   Theobroma cacao [chocolate]
gb|KHG24127.1|  polycomb group fertilization-independent endosper...    190   5e-54   Gossypium arboreum [tree cotton]
gb|KJB81802.1|  hypothetical protein B456_013G163900                    189   8e-54   Gossypium raimondii
ref|XP_002282472.1|  PREDICTED: polycomb group protein FIE2             189   1e-53   Vitis vinifera
gb|KJB81803.1|  hypothetical protein B456_013G163900                    189   1e-53   Gossypium raimondii
emb|CDP05801.1|  unnamed protein product                                189   2e-53   Coffea canephora [robusta coffee]
ref|XP_006452167.1|  hypothetical protein CICLE_v10008697mg             187   3e-53   
ref|NP_001274801.1|  fertilization-independent endosperm protein        188   3e-53   Solanum tuberosum [potatoes]
gb|ABZ85627.2|  fertilization-independent endosperm                     188   3e-53   Pilosella officinarum [mouse-ear hawkweed]
gb|KDO52943.1|  hypothetical protein CISIN_1g016185mg                   187   3e-53   Citrus sinensis [apfelsine]
ref|NP_001234484.1|  fertilization-independent endosperm protein        188   3e-53   
gb|ABZ85630.2|  fertilization-independent endosperm                     188   4e-53   Hieracium piloselloides
gb|EPS69595.1|  fertilization independent endosperm development p...    188   4e-53   Genlisea aurea
ref|XP_006452168.1|  hypothetical protein CICLE_v10008697mg             187   4e-53   Citrus clementina [clementine]
ref|XP_009343081.1|  PREDICTED: polycomb group protein FERTILIZAT...    188   4e-53   Pyrus x bretschneideri [bai li]
ref|XP_006475218.1|  PREDICTED: polycomb group protein FERTILIZAT...    187   5e-53   Citrus sinensis [apfelsine]
ref|NP_001289654.1|  polycomb group protein FERTILIZATION-INDEPEN...    187   6e-53   Eucalyptus grandis [rose gum]
gb|KCW70128.1|  hypothetical protein EUGRSUZ_F03425                     187   7e-53   Eucalyptus grandis [rose gum]
ref|XP_008365658.1|  PREDICTED: polycomb group protein FIE2             187   8e-53   Malus domestica [apple tree]
gb|KDO52941.1|  hypothetical protein CISIN_1g016185mg                   187   9e-53   Citrus sinensis [apfelsine]
ref|XP_009358095.1|  PREDICTED: polycomb group protein FIE2-like        187   1e-52   Pyrus x bretschneideri [bai li]
ref|XP_008355349.1|  PREDICTED: polycomb group protein FIE2-like        187   1e-52   
gb|ABB16356.1|  fertilization-independent endosperm protein             186   1e-52   Solanum commersonii
ref|XP_006370617.1|  FERTILIZATION-INDEPENDENT ENDOSPERM family p...    186   1e-52   Populus trichocarpa [western balsam poplar]
ref|XP_011048289.1|  PREDICTED: polycomb group protein FERTILIZAT...    186   1e-52   Populus euphratica
ref|XP_010267786.1|  PREDICTED: polycomb group protein FIE2             186   2e-52   Nelumbo nucifera [Indian lotus]
ref|XP_009355585.1|  PREDICTED: polycomb group protein FIE2-like        184   8e-52   Pyrus x bretschneideri [bai li]
gb|ACG69840.1|  fertilization-independent endosperm protein             184   1e-51   Malus domestica [apple tree]
gb|KJB81801.1|  hypothetical protein B456_013G163900                    183   2e-51   Gossypium raimondii
ref|XP_007211457.1|  hypothetical protein PRUPE_ppa007346mg             182   6e-51   Prunus persica
ref|XP_004294343.1|  PREDICTED: polycomb group protein FERTILIZAT...    182   9e-51   Fragaria vesca subsp. vesca
ref|XP_008244348.1|  PREDICTED: polycomb group protein FIE2 isofo...    181   9e-51   Prunus mume [ume]
ref|XP_004151960.1|  PREDICTED: polycomb group protein FERTILIZAT...    181   1e-50   Cucumis sativus [cucumbers]
ref|XP_008454560.1|  PREDICTED: polycomb group protein FERTILIZAT...    181   1e-50   Cucumis melo [Oriental melon]
ref|XP_003520223.1|  PREDICTED: polycomb group protein FIE2-like ...    181   2e-50   Glycine max [soybeans]
ref|XP_006588358.1|  PREDICTED: FIE isoform X1                          181   3e-50   Glycine max [soybeans]
ref|XP_004498406.1|  PREDICTED: polycomb group protein FERTILIZAT...    180   4e-50   Cicer arietinum [garbanzo]
ref|XP_007144569.1|  hypothetical protein PHAVU_007G166700g             177   6e-49   Phaseolus vulgaris [French bean]
ref|XP_007149697.1|  hypothetical protein PHAVU_005G091500g             175   3e-48   Phaseolus vulgaris [French bean]
ref|XP_010556028.1|  PREDICTED: polycomb group protein FERTILIZAT...    175   3e-48   Tarenaya hassleriana [spider flower]
gb|AAN85567.1|  fertilization independent endosperm development p...    174   3e-48   Catalpa speciosa [catawba]
ref|XP_006575102.1|  PREDICTED: polycomb group protein FIE2-like ...    174   8e-48   Glycine max [soybeans]
ref|NP_001237614.1|  FIE                                                174   9e-48   Glycine max [soybeans]
gb|ACU21301.1|  unknown                                                 174   1e-47   Glycine max [soybeans]
ref|XP_004498407.1|  PREDICTED: polycomb group protein FERTILIZAT...    173   1e-47   
ref|XP_010694252.1|  PREDICTED: polycomb group protein FERTILIZAT...    171   9e-47   Beta vulgaris subsp. vulgaris [field beet]
gb|KEH40399.1|  fertilization-independent endosperm protein             171   2e-46   Medicago truncatula
gb|AEZ06399.1|  FIE-like protein                                        170   2e-46   Aquilegia coerulea [Rocky Mountain columbine]
ref|XP_009402595.1|  PREDICTED: polycomb group protein FIE2             167   3e-45   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010906361.1|  PREDICTED: polycomb group protein FIE2 isofo...    166   1e-44   Elaeis guineensis
ref|XP_010906358.1|  PREDICTED: polycomb group protein FIE2 isofo...    166   1e-44   Elaeis guineensis
gb|KHN27974.1|  Polycomb group protein FERTILIZATION-INDEPENDENT ...    160   1e-43   Glycine soja [wild soybean]
gb|ERM97869.1|  hypothetical protein AMTR_s00115p00067610               162   2e-43   Amborella trichopoda
gb|AIC33178.1|  fertilization independent endosperm protein             162   2e-43   Elaeis guineensis
ref|XP_011620319.1|  PREDICTED: polycomb group protein FIE2             162   3e-43   Amborella trichopoda
gb|ABK25056.1|  unknown                                                 159   3e-42   Picea sitchensis
ref|XP_003541877.1|  PREDICTED: polycomb group protein FERTILIZAT...    159   6e-42   Glycine max [soybeans]
gb|KFK39391.1|  fertilization-independent endosperm protein             157   3e-41   Arabis alpina [alpine rockcress]
ref|XP_006406354.1|  hypothetical protein EUTSA_v10020971mg             156   3e-41   Eutrema salsugineum [saltwater cress]
ref|XP_009110247.1|  PREDICTED: polycomb group protein FERTILIZAT...    154   2e-40   Brassica rapa
ref|NP_188710.1|  polycomb group protein FERTILIZATION-INDEPENDEN...    151   2e-39   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006297945.1|  hypothetical protein CARUB_v10013987mg             151   3e-39   Capsella rubella
ref|XP_010466273.1|  PREDICTED: polycomb group protein FERTILIZAT...    151   3e-39   Camelina sativa [gold-of-pleasure]
emb|CDY27567.1|  BnaC01g32500D                                          151   4e-39   Brassica napus [oilseed rape]
ref|XP_002966477.1|  hypothetical protein SELMODRAFT_143777             149   2e-38   Selaginella moellendorffii
ref|XP_002982042.1|  hypothetical protein SELMODRAFT_179301             149   2e-38   
ref|XP_006593294.1|  PREDICTED: polycomb group protein FERTILIZAT...    145   3e-38   
ref|XP_010488058.1|  PREDICTED: polycomb group protein FERTILIZAT...    148   3e-38   Camelina sativa [gold-of-pleasure]
ref|XP_002885401.1|  fie                                                148   5e-38   Arabidopsis lyrata subsp. lyrata
ref|XP_006659098.1|  PREDICTED: polycomb group protein FIE2-like        147   1e-37   Oryza brachyantha
gb|EEC82867.1|  hypothetical protein OsI_27737                          145   7e-37   Oryza sativa Indica Group [Indian rice]
gb|KHN36729.1|  Polycomb group protein FERTILIZATION-INDEPENDENT ...    145   1e-36   Glycine soja [wild soybean]
gb|AAS13489.1|  fertilization independent endosperm                     143   4e-36   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001060953.1|  Os08g0137100                                       142   5e-36   
emb|CDY19611.1|  BnaA05g20190D                                          138   3e-34   Brassica napus [oilseed rape]
ref|XP_009145595.1|  PREDICTED: polycomb group protein FERTILIZAT...    138   4e-34   Brassica rapa
ref|XP_010906364.1|  PREDICTED: polycomb group protein FIE2 isofo...    134   2e-33   Elaeis guineensis
emb|CDY56255.1|  BnaCnng29960D                                          135   4e-33   Brassica napus [oilseed rape]
ref|XP_010906363.1|  PREDICTED: polycomb group protein FIE2 isofo...    134   6e-33   Elaeis guineensis
ref|XP_004972907.1|  PREDICTED: polycomb group protein FIE2-like        133   1e-32   Setaria italica
dbj|BAD03075.1|  putative Polycomb group protein FIE2                   134   1e-32   Oryza sativa Japonica Group [Japonica rice]
gb|AAT39467.1|  FIE2                                                    132   2e-32   Zea mays [maize]
ref|XP_003573353.1|  PREDICTED: polycomb group protein FIE2 isofo...    132   3e-32   Brachypodium distachyon [annual false brome]
ref|XP_010234289.1|  PREDICTED: polycomb group protein FIE2 isofo...    132   3e-32   Brachypodium distachyon [annual false brome]
ref|NP_001105182.1|  polycomb group protein FIE2                        132   3e-32   Zea mays [maize]
gb|AAO26660.1|  fertilization-independent endosperm protein 2           132   3e-32   Zea mays [maize]
ref|XP_002443822.1|  hypothetical protein SORBIDRAFT_07g002810          132   4e-32   Sorghum bicolor [broomcorn]
ref|XP_001785863.1|  transcriptional repressor EED/ESC/FIE              132   4e-32   
gb|AFW57437.1|  fertilization independent endosperm2                    132   4e-32   
dbj|BAK02952.1|  predicted protein                                      131   6e-32   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMT06373.1|  hypothetical protein F775_15931                         132   8e-32   
gb|ADU32888.1|  fertilization-independent endosperm protein             131   8e-32   Eulaliopsis binata
ref|XP_006659808.1|  PREDICTED: polycomb group protein FIE2-like        131   1e-31   
emb|CDY19607.1|  BnaA05g20150D                                          129   5e-31   Brassica napus [oilseed rape]
ref|XP_009145589.1|  PREDICTED: polycomb group protein FERTILIZAT...    129   6e-31   Brassica rapa
gb|AAS82596.1|  fertilization-independent endosperm protein             125   2e-29   Sorghum bicolor [broomcorn]
gb|AAO61683.1|  fertilization-independent type 1                        123   5e-29   Zea mays [maize]
gb|AAO61682.1|  fertilization-independent type 1                        123   5e-29   Zea mays [maize]
ref|XP_003571503.1|  PREDICTED: polycomb group protein FIE2-like        122   9e-29   Brachypodium distachyon [annual false brome]
ref|XP_010236415.1|  PREDICTED: polycomb group protein FIE2-like        117   8e-27   
ref|XP_010906362.1|  PREDICTED: polycomb group protein FIE2 isofo...    117   1e-26   
ref|XP_002443823.1|  hypothetical protein SORBIDRAFT_07g002820          116   3e-26   Sorghum bicolor [broomcorn]
gb|AAS82595.1|  fertilization-independent endosperm protein             115   3e-26   Sorghum bicolor [broomcorn]
ref|XP_010062968.1|  PREDICTED: polycomb group protein FIE2 isofo...    112   2e-25   Eucalyptus grandis [rose gum]
ref|XP_008677779.1|  PREDICTED: polycomb group protein FIE1 isofo...    111   1e-24   
gb|AAO26659.1|  fertilization-independent endosperm protein 1           111   1e-24   Zea mays [maize]
ref|NP_001105181.1|  polycomb group protein FIE1                        111   1e-24   Zea mays [maize]
gb|AAO61684.1|  fertilization-independent type 2                        109   6e-24   Zea mays [maize]
emb|CDY06378.1|  BnaC05g31520D                                          104   7e-23   
ref|XP_010230658.1|  PREDICTED: polycomb group protein FIE2-like        104   3e-22   Brachypodium distachyon [annual false brome]
ref|XP_010092822.1|  Polycomb group protein FIE2                        100   5e-21   
ref|XP_007021052.1|  Transducin/WD40 repeat-like superfamily prot...  89.4    2e-17   
gb|AGZ15741.1|  fertilization-independent endosperm-like protein      70.9    1e-12   Prunus persica
dbj|BAG57461.1|  unnamed protein product                              70.1    2e-11   Homo sapiens [man]
ref|XP_005651813.1|  fertilization-independent endosperm protein 2    71.6    6e-11   Coccomyxa subellipsoidea C-169
emb|CCA26227.1|  DNA topoisomerase putative                           72.4    7e-11   Albugo laibachii Nc14
emb|CCA26226.1|  DNA topoisomerase putative                           72.4    7e-11   Albugo laibachii Nc14
emb|CCA26233.1|  DNA topoisomerase putative                           72.4    7e-11   Albugo laibachii Nc14
emb|CCA26229.1|  DNA topoisomerase putative                           72.4    7e-11   Albugo laibachii Nc14
emb|CCA26231.1|  DNA topoisomerase putative                           72.4    7e-11   Albugo laibachii Nc14
emb|CCA26225.1|  DNA topoisomerase putative                           72.4    7e-11   Albugo laibachii Nc14
emb|CCA26230.1|  DNA topoisomerase putative                           72.4    7e-11   Albugo laibachii Nc14
emb|CCA26228.1|  DNA topoisomerase putative                           72.4    7e-11   Albugo laibachii Nc14
emb|CCA26232.1|  DNA topoisomerase putative                           72.4    7e-11   Albugo laibachii Nc14
emb|CCA26234.1|  DNA topoisomerase putative                           72.4    7e-11   Albugo laibachii Nc14
gb|AAR27828.1|  embryonic ectoderm development protein                66.2    3e-10   Bos taurus [bovine]
ref|XP_010767513.1|  PREDICTED: polycomb protein EED                  66.2    8e-10   Notothenia coriiceps [yellowbelly rockcod]
ref|XP_002891626.1|  predicted protein                                67.8    1e-09   Arabidopsis lyrata subsp. lyrata
ref|XP_008479511.1|  PREDICTED: polycomb protein eed-like             65.5    1e-09   
emb|CCI46370.1|  unnamed protein product                              67.4    2e-09   Albugo candida
ref|XP_004619104.1|  PREDICTED: polycomb protein EED                  67.4    2e-09   
ref|XP_002413703.1|  embryonic ectoderm development protein, puta...  67.0    3e-09   Ixodes scapularis [blacklegged tick]
gb|ELU03609.1|  hypothetical protein CAPTEDRAFT_1436                  67.0    3e-09   Capitella teleta
ref|XP_005274430.1|  PREDICTED: polycomb protein EED isoform X4       66.6    3e-09   
ref|XP_010971695.1|  PREDICTED: polycomb protein EED isoform X2       66.6    3e-09   Camelus bactrianus [camel]
ref|XP_004886950.1|  PREDICTED: polycomb protein EED isoform X2       66.6    3e-09   
gb|KFQ50291.1|  Polycomb protein EED                                  66.2    3e-09   Pelecanus crispus
ref|XP_005699520.1|  PREDICTED: polycomb protein EED                  67.4    3e-09   
ref|XP_008261287.1|  PREDICTED: polycomb protein EED isoform X2       66.6    3e-09   Oryctolagus cuniculus [domestic rabbit]
ref|XP_008587361.1|  PREDICTED: polycomb protein EED isoform X1       66.6    3e-09   Galeopterus variegatus [Malayan flying lemur]
ref|XP_008842363.1|  PREDICTED: polycomb protein EED isoform X1       66.6    3e-09   Nannospalax galili
ref|XP_007254895.1|  PREDICTED: polycomb protein eed                  66.6    3e-09   Astyanax mexicanus [blind cave fish]
ref|XP_006229726.1|  PREDICTED: polycomb protein EED isoform X1       66.6    3e-09   Rattus norvegicus [brown rat]
ref|XP_004683325.1|  PREDICTED: polycomb protein EED isoform X1       66.6    3e-09   Condylura cristata
ref|XP_011220767.1|  PREDICTED: polycomb protein EED isoform X3       66.6    3e-09   Ailuropoda melanoleuca
ref|XP_005875687.1|  PREDICTED: polycomb protein EED isoform X3       66.6    3e-09   
ref|XP_005903530.1|  PREDICTED: polycomb protein EED isoform X1       66.6    3e-09   Bos mutus
ref|XP_005323346.1|  PREDICTED: polycomb protein EED isoform X2       66.6    3e-09   
ref|XP_009478383.1|  PREDICTED: polycomb protein EED                  66.6    3e-09   Pelecanus crispus
ref|XP_002917351.2|  PREDICTED: polycomb protein EED isoform X4       66.6    3e-09   Ailuropoda melanoleuca
ref|XP_007448897.1|  PREDICTED: polycomb protein EED isoform X1       66.6    3e-09   Lipotes vexillifer [baiji]
ref|XP_003482629.1|  PREDICTED: polycomb protein EED-like isoform 2   66.6    3e-09   Sus scrofa [pigs]
ref|XP_008562484.1|  PREDICTED: LOW QUALITY PROTEIN: polycomb pro...  66.6    3e-09   Galeopterus variegatus [Malayan flying lemur]
ref|XP_004658325.1|  PREDICTED: polycomb protein EED isoform X1       66.6    3e-09   Jaculus jaculus
ref|XP_004416963.1|  PREDICTED: polycomb protein EED isoform 1        66.6    3e-09   Odobenus rosmarus divergens
ref|XP_009422196.1|  PREDICTED: LOW QUALITY PROTEIN: polycomb pro...  66.6    3e-09   
ref|XP_010971694.1|  PREDICTED: polycomb protein EED isoform X1       66.6    3e-09   Camelus bactrianus [camel]
ref|XP_002754770.1|  PREDICTED: polycomb protein EED isoform X1       66.6    3e-09   Callithrix jacchus [common marmoset]
ref|XP_005995212.1|  PREDICTED: polycomb protein EED isoform X2       66.6    3e-09   Latimeria chalumnae
ref|XP_003780892.1|  PREDICTED: polycomb protein EED isoform 2        66.6    3e-09   
ref|XP_006895325.1|  PREDICTED: polycomb protein EED isoform X2       66.6    3e-09   Elephantulus edwardii [Cape long-eared elephant shrew]
ref|XP_009569572.1|  PREDICTED: polycomb protein EED                  66.6    4e-09   Cuculus canorus
ref|XP_001376767.3|  PREDICTED: polycomb protein EED                  66.6    4e-09   Monodelphis domestica
ref|XP_011543632.1|  PREDICTED: polycomb protein EED isoform X2       66.6    4e-09   Homo sapiens [man]
ref|XP_006865019.1|  PREDICTED: polycomb protein EED isoform X2       66.6    4e-09   Chrysochloris asiatica
ref|XP_004658326.1|  PREDICTED: polycomb protein EED isoform X2       66.6    4e-09   Jaculus jaculus
ref|XP_004385581.1|  PREDICTED: polycomb protein EED                  66.6    4e-09   Trichechus manatus latirostris
ref|XP_006926751.1|  PREDICTED: polycomb protein EED isoform X2       66.6    4e-09   Pteropus alecto
ref|XP_006895324.1|  PREDICTED: polycomb protein EED isoform X1       66.6    4e-09   Elephantulus edwardii [Cape long-eared elephant shrew]
ref|XP_002708701.1|  PREDICTED: polycomb protein EED isoform X1       66.6    4e-09   Oryctolagus cuniculus [domestic rabbit]
ref|XP_005875686.1|  PREDICTED: polycomb protein EED isoform X2       66.6    4e-09   Myotis brandtii
ref|NP_068676.1|  polycomb protein EED                                66.6    4e-09   Mus musculus [mouse]
ref|XP_007944458.1|  PREDICTED: polycomb protein EED isoform X1       66.6    4e-09   Orycteropus afer afer
ref|XP_005875685.1|  PREDICTED: polycomb protein EED isoform X1       66.6    4e-09   Myotis brandtii
ref|XP_010000857.1|  PREDICTED: polycomb protein EED                  66.6    4e-09   Chaetura pelagica
gb|AAD08714.1|  embryonic ectoderm development protein homolog        66.6    4e-09   Homo sapiens [man]
ref|XP_005323345.1|  PREDICTED: polycomb protein EED isoform X1       66.6    4e-09   Ictidomys tridecemlineatus
ref|XP_004632625.1|  PREDICTED: polycomb protein EED isoform X1       66.6    4e-09   Octodon degus
ref|XP_006865018.1|  PREDICTED: polycomb protein EED isoform X1       66.6    4e-09   Chrysochloris asiatica
ref|XP_011543633.1|  PREDICTED: polycomb protein EED isoform X3       66.6    4e-09   Homo sapiens [man]
ref|XP_005995211.1|  PREDICTED: polycomb protein EED isoform X1       66.6    4e-09   Latimeria chalumnae
ref|XP_009516771.1|  hypothetical protein PHYSODRAFT_552795           66.2    4e-09   Phytophthora sojae
gb|AAH47672.1|  EED protein                                           66.6    4e-09   Homo sapiens [man]
ref|XP_003219406.1|  PREDICTED: polycomb protein EED                  66.6    4e-09   Anolis carolinensis [Carolina anole]
ref|XP_004886949.1|  PREDICTED: polycomb protein EED isoform X1       66.6    4e-09   
gb|AAD08815.1|  embryonic ectoderm development protein short isoform  66.2    4e-09   Homo sapiens [man]
ref|XP_008587362.1|  PREDICTED: polycomb protein EED isoform X2       66.6    4e-09   Galeopterus variegatus [Malayan flying lemur]
ref|NP_001035584.1|  polycomb protein EED                             66.6    4e-09   Bos taurus [bovine]
ref|XP_006926753.1|  PREDICTED: polycomb protein EED isoform X4       66.6    4e-09   Pteropus alecto
ref|XP_003780891.1|  PREDICTED: polycomb protein EED isoform 1        66.6    4e-09   Otolemur garnettii
ref|XP_011957004.1|  PREDICTED: polycomb protein EED isoform X1       66.6    4e-09   
gb|EPQ13580.1|  Polycomb protein EED                                  66.6    4e-09   Myotis brandtii
ref|XP_005287587.1|  PREDICTED: polycomb protein EED isoform X1       66.6    4e-09   Chrysemys picta bellii
pdb|3IIY|A  Chain A, Crystal Structure Of Eed In Complex With A T...  66.2    4e-09   synthetic construct
ref|XP_011998930.1|  PREDICTED: polycomb protein EED isoform X2       66.6    4e-09   Ovis aries musimon
ref|XP_007538511.1|  PREDICTED: polycomb protein EED                  66.6    4e-09   Erinaceus europaeus [common hedgehog]
ref|XP_008702661.1|  PREDICTED: polycomb protein EED                  66.6    4e-09   Ursus maritimus [white bear]
ref|XP_006197518.1|  PREDICTED: polycomb protein EED                  66.6    4e-09   Vicugna pacos
ref|XP_009503201.1|  PREDICTED: polycomb protein EED                  66.2    4e-09   Phalacrocorax carbo [common cormorant]
gb|EMP35024.1|  Polycomb protein EED                                  66.2    4e-09   Chelonia mydas [green seaturtle]
ref|XP_010988818.1|  PREDICTED: polycomb protein EED                  66.6    4e-09   Camelus dromedarius [camel]
ref|XP_008842364.1|  PREDICTED: polycomb protein EED isoform X2       66.6    4e-09   Nannospalax galili
ref|XP_005510820.1|  PREDICTED: polycomb protein EED                  66.6    4e-09   
ref|XP_005357621.1|  PREDICTED: polycomb protein EED                  66.6    4e-09   Microtus ochrogaster [prairie voles]
gb|AAC68675.1|  WAIT-1                                                66.6    4e-09   Homo sapiens [man]
ref|XP_005074165.1|  PREDICTED: polycomb protein EED                  66.6    4e-09   
gb|EOA94172.1|  Polycomb protein EED                                  66.6    4e-09   Anas platyrhynchos [duck]
ref|XP_006639249.1|  PREDICTED: polycomb protein eed-like             66.6    4e-09   Lepisosteus oculatus
ref|XP_008910887.1|  hypothetical protein PPTG_15888                  66.2    4e-09   Phytophthora parasitica INRA-310
ref|XP_007060662.1|  PREDICTED: polycomb protein EED isoform X1       66.2    4e-09   Chelonia mydas [green seaturtle]
ref|XP_005417886.1|  PREDICTED: polycomb protein EED                  66.6    4e-09   
sp|Q566T0.2|EED_DANRE  RecName: Full=Polycomb protein eed             66.6    4e-09   Danio rerio [leopard danio]
pdb|4X3E|A  Chain A, Crystal Structure Of Eed In Complex With A T...  66.2    4e-09   Homo sapiens [man]
pdb|3IIW|A  Chain A, Crystal Structure Of Eed In Complex With A T...  66.2    4e-09   synthetic construct
ref|NP_694536.1|  polycomb protein EED isoform b                      66.2    4e-09   
dbj|BAF84809.1|  unnamed protein product                              66.6    4e-09   Homo sapiens [man]
gb|ELK00424.1|  Polycomb protein EED                                  66.2    4e-09   Pteropus alecto
ref|XP_009468693.1|  PREDICTED: polycomb protein EED                  66.6    4e-09   Nipponia nippon
pdb|3JZN|A  Chain A, Structure Of Eed In Apo Form                     66.2    4e-09   Homo sapiens [man]
ref|XP_010851554.1|  PREDICTED: polycomb protein EED                  66.6    4e-09   Bison bison bison
ref|XP_005029805.1|  PREDICTED: polycomb protein EED                  66.2    4e-09   
ref|XP_009321754.1|  PREDICTED: polycomb protein EED                  66.2    4e-09   Pygoscelis adeliae
gb|EMC81828.1|  Polycomb protein EED                                  66.2    4e-09   
ref|XP_003203591.1|  PREDICTED: polycomb protein EED                  66.2    4e-09   Meleagris gallopavo [common turkey]
ref|XP_006259063.1|  PREDICTED: polycomb protein EED                  66.2    4e-09   Alligator mississippiensis
ref|XP_008633186.1|  PREDICTED: polycomb protein EED                  66.2    4e-09   
ref|XP_007079121.1|  PREDICTED: polycomb protein EED                  66.6    4e-09   
ref|XP_009083818.1|  PREDICTED: polycomb protein EED                  66.2    4e-09   
ref|XP_009898462.1|  PREDICTED: polycomb protein EED                  66.2    4e-09   Picoides pubescens
pdb|3JPX|A  Chain A, Eed: A Novel Histone Trimethyllysine Binder ...  66.2    4e-09   Homo sapiens [man]
ref|XP_010574872.1|  PREDICTED: polycomb protein EED                  66.2    4e-09   Haliaeetus leucocephalus
gb|KFO60070.1|  Polycomb protein EED                                  66.2    4e-09   Corvus brachyrhynchos
ref|XP_008947671.1|  PREDICTED: polycomb protein EED                  66.2    4e-09   Merops nubicus
ref|XP_009930885.1|  PREDICTED: polycomb protein EED                  66.2    4e-09   Opisthocomus hoazin [hoatzin]
ref|XP_002189537.1|  PREDICTED: polycomb protein EED                  66.2    4e-09   Taeniopygia guttata
ref|XP_005232282.1|  PREDICTED: polycomb protein EED                  66.2    4e-09   Falco peregrinus [peregrine]
ref|XP_001511506.2|  PREDICTED: polycomb protein EED                  66.2    4e-09   
ref|XP_006033822.1|  PREDICTED: polycomb protein EED                  66.2    4e-09   
ref|XP_004708939.1|  PREDICTED: polycomb protein EED isoform X1       66.2    4e-09   Echinops telfairi [lesser hedgehog tenrec]
ref|NP_001026547.1|  polycomb protein EED                             66.2    4e-09   Gallus gallus [bantam]
ref|XP_006118449.1|  PREDICTED: polycomb protein EED                  66.2    4e-09   
emb|CDQ87073.1|  unnamed protein product                              66.2    4e-09   Oncorhynchus mykiss
ref|XP_005485888.1|  PREDICTED: polycomb protein EED                  66.2    4e-09   
dbj|BAG62829.1|  unnamed protein product                              66.2    4e-09   Homo sapiens [man]
ref|XP_005434758.1|  PREDICTED: polycomb protein EED                  66.2    4e-09   
ref|XP_005038383.1|  PREDICTED: polycomb protein EED                  66.2    4e-09   Ficedula albicollis
ref|XP_009872541.1|  PREDICTED: polycomb protein EED                  66.2    4e-09   Apaloderma vittatum
ref|XP_005516213.1|  PREDICTED: polycomb protein EED isoform X1       66.2    4e-09   Pseudopodoces humilis [Tibetan ground-jay]
ref|XP_004708940.1|  PREDICTED: polycomb protein EED isoform X2       66.2    4e-09   Echinops telfairi [lesser hedgehog tenrec]
ref|XP_007060663.1|  PREDICTED: polycomb protein EED isoform X2       66.2    4e-09   
ref|XP_005287588.1|  PREDICTED: polycomb protein EED isoform X2       66.2    4e-09   
ref|XP_011220766.1|  PREDICTED: polycomb protein EED isoform X2       66.2    4e-09   
ref|NP_001017766.1|  polycomb protein eed                             66.2    4e-09   
ref|XP_005143856.1|  PREDICTED: polycomb protein EED                  66.2    4e-09   Melopsittacus undulatus
ref|XP_010632033.1|  PREDICTED: polycomb protein EED isoform X1       66.2    4e-09   Fukomys damarensis [Damara mole rat]
ref|XP_005612336.1|  PREDICTED: polycomb protein EED                  66.2    5e-09   
ref|XP_010217249.1|  PREDICTED: polycomb protein EED                  66.6    5e-09   Tinamus guttatus
gb|KFM08887.1|  Polycomb protein EED                                  66.2    5e-09   Aptenodytes forsteri
ref|XP_009279606.1|  PREDICTED: polycomb protein EED                  66.2    5e-09   Aptenodytes forsteri
ref|XP_009580429.1|  PREDICTED: polycomb protein EED                  66.2    5e-09   Fulmarus glacialis
gb|AAC23685.1|  embryonic ectoderm development protein                66.2    5e-09   Homo sapiens [man]
ref|XP_010399417.1|  PREDICTED: polycomb protein EED                  66.2    5e-09   
ref|XP_005516214.1|  PREDICTED: polycomb protein EED isoform X2       66.2    5e-09   
ref|XP_009670940.1|  PREDICTED: polycomb protein EED                  66.2    5e-09   
gb|ELR50752.1|  Polycomb protein EED                                  66.2    5e-09   
ref|XP_005983678.1|  PREDICTED: polycomb protein EED                  66.6    5e-09   
gb|AAC53302.1|  embryonic ectoderm development protein                66.2    5e-09   
ref|XP_003764647.1|  PREDICTED: polycomb protein EED                  66.2    5e-09   
ref|XP_006189607.1|  PREDICTED: polycomb protein EED                  66.2    5e-09   
ref|XP_008495001.1|  PREDICTED: polycomb protein EED                  66.2    5e-09   
ref|NP_001098326.1|  polycomb protein EED                             65.9    6e-09   
ref|XP_003459967.1|  PREDICTED: polycomb protein eed-like             65.9    6e-09   
ref|XP_004455305.1|  PREDICTED: polycomb protein EED-like isoform 2   65.9    6e-09   
ref|XP_007553770.1|  PREDICTED: polycomb protein EED                  65.9    7e-09   
ref|XP_005802602.1|  PREDICTED: polycomb protein eed-like             65.9    7e-09   
ref|XP_004562679.1|  PREDICTED: polycomb protein eed-like             65.9    7e-09   
ref|XP_008291769.1|  PREDICTED: polycomb protein EED                  65.9    7e-09   
ref|XP_008422393.1|  PREDICTED: polycomb protein EED                  65.9    7e-09   
ref|XP_010753075.1|  PREDICTED: polycomb protein EED                  65.9    7e-09   
pdb|2QXV|A  Chain A, Structural Basis Of Ezh2 Recognition By Eed      65.5    7e-09   
ref|XP_004455304.1|  PREDICTED: polycomb protein EED-like isoform 1   65.9    7e-09   
ref|XP_004468845.1|  PREDICTED: polycomb protein EED-like             65.9    7e-09   
ref|NP_001017325.1|  polycomb protein eed                             65.5    7e-09   
ref|XP_003966763.1|  PREDICTED: polycomb protein EED                  65.5    7e-09   
ref|XP_007900557.1|  PREDICTED: polycomb protein EED                  65.5    8e-09   
gb|AAK59991.1|  embryonic ectoderm development protein                65.5    8e-09   
sp|Q6AZS2.2|EEDB_XENLA  RecName: Full=Polycomb protein eed-B; Sho...  65.5    8e-09   
ref|NP_001089517.1|  polycomb protein eed-A                           65.5    8e-09   
ref|NP_001082354.1|  polycomb protein eed-B                           65.5    8e-09   
gb|AAN64881.1|AF460180_1  embryonic ectoderm development protein ...  65.5    9e-09   
gb|AAH77511.1|  Eed-a protein                                         65.5    9e-09   
ref|XP_001949768.1|  PREDICTED: polycomb protein EED                  65.5    9e-09   
gb|AFQ90677.1|  embryonic ectoderm development protein                62.4    9e-09   
gb|AFQ90678.1|  embryonic ectoderm development protein                62.4    1e-08   
gb|AGI50961.1|  extra sex combs                                       65.1    1e-08   
ref|XP_010596532.1|  PREDICTED: polycomb protein EED                  65.1    1e-08   
ref|XP_005820691.1|  hypothetical protein GUITHDRAFT_81200            64.7    1e-08   
emb|CDY68274.1|  BnaAnng26700D                                        62.8    2e-08   
ref|XP_010884408.1|  PREDICTED: polycomb protein EED                  64.7    2e-08   
ref|XP_009185338.1|  PREDICTED: LOW QUALITY PROTEIN: polycomb pro...  64.3    2e-08   
ref|XP_008322772.1|  PREDICTED: polycomb protein EED                  63.9    3e-08   
gb|KFV94657.1|  Polycomb protein EED                                  63.9    3e-08   
ref|XP_010420388.1|  PREDICTED: polycomb group protein FERTILIZAT...  63.5    3e-08   
ref|XP_011479497.1|  PREDICTED: polycomb protein EED isoform X1       63.9    3e-08   
gb|ACO12729.1|  Polycomb protein esc                                  63.5    4e-08   
ref|XP_004632626.1|  PREDICTED: polycomb protein EED isoform X2       63.5    4e-08   
ref|XP_010153424.1|  PREDICTED: polycomb protein EED                  63.2    5e-08   
ref|XP_002997317.1|  polycomb protein, putative                       62.8    7e-08   
gb|ACO13046.1|  Polycomb protein esc                                  62.8    7e-08   
ref|XP_001634082.1|  predicted protein                                60.1    8e-08   
ref|XP_005851303.1|  hypothetical protein CHLNCDRAFT_19370            62.4    8e-08   
ref|XP_001648965.1|  AAEL014536-PA                                    62.4    9e-08   
ref|XP_002116946.1|  hypothetical protein TRIADDRAFT_31681            61.6    1e-07   
ref|XP_011395611.1|  Polycomb group protein FIE2                      61.2    2e-07   
ref|XP_008910888.1|  hypothetical protein, variant 1                  61.6    2e-07   
ref|XP_786345.2|  PREDICTED: polycomb protein eed-A                   60.8    3e-07   
ref|XP_008212691.1|  PREDICTED: polycomb protein eed-like             59.7    7e-07   
ref|XP_003063964.1|  polycomb group protein                           59.7    7e-07   
ref|XP_009060147.1|  hypothetical protein LOTGIDRAFT_229029           59.7    7e-07   
gb|AAC05332.1|  extra sex combs                                       59.7    8e-07   
ref|XP_006926750.1|  PREDICTED: polycomb protein EED isoform X1       59.7    8e-07   
ref|XP_006926752.1|  PREDICTED: polycomb protein EED isoform X3       59.7    9e-07   
ref|XP_002128612.1|  PREDICTED: polycomb protein eed-like             59.3    9e-07   
gb|KIZ04250.1|  Polycomb group protein FERTILIZATION-INDEPENDENT ...  59.3    9e-07   
ref|XP_004996458.1|  hypothetical protein PTSG_02945                  58.5    1e-06   
ref|XP_005111344.1|  PREDICTED: polycomb protein eed-like             58.9    1e-06   
ref|XP_001965085.1|  GF23390                                          58.9    1e-06   
ref|XP_011333522.1|  PREDICTED: polycomb protein eed-A-like           58.5    2e-06   
gb|KDR08216.1|  Polycomb protein eed                                  58.5    2e-06   
ref|XP_011308706.1|  PREDICTED: polycomb protein EED-like             58.5    2e-06   
ref|XP_001842089.1|  polycomb protein esc                             58.5    2e-06   
ref|XP_002079146.1|  GD22153                                          58.2    2e-06   
ref|NP_477431.1|  extra sexcombs                                      58.2    2e-06   
ref|XP_002041980.1|  GM26550                                          58.2    2e-06   
ref|XP_003490784.1|  PREDICTED: polycomb protein eed-A-like           58.2    3e-06   
ref|XP_006755960.1|  PREDICTED: polycomb protein eed                  58.2    3e-06   
gb|EFX73235.1|  hypothetical protein DAPPUDRAFT_307962                58.2    3e-06   
ref|XP_001969810.1|  GG10294                                          58.2    3e-06   
ref|XP_008559409.1|  PREDICTED: polycomb protein eed-B                58.2    3e-06   
ref|XP_012059976.1|  PREDICTED: polycomb protein eed-B-like           57.8    3e-06   
ref|XP_003700973.1|  PREDICTED: polycomb protein EED-like             57.8    3e-06   
ref|XP_011506360.1|  PREDICTED: polycomb protein EED-like isoform X1  57.8    3e-06   
gb|AEE62083.1|  unknown                                               57.8    4e-06   
gb|ERL92032.1|  hypothetical protein D910_09354                       57.8    4e-06   
gb|ENN75776.1|  hypothetical protein YQE_07733                        57.8    4e-06   
ref|XP_006824118.1|  PREDICTED: polycomb protein EED-like             57.4    4e-06   
ref|XP_002427573.1|  Polycomb protein esc, putative                   57.4    4e-06   
ref|XP_003393755.1|  PREDICTED: polycomb protein eed-A-like           57.0    5e-06   
ref|XP_008190477.1|  PREDICTED: polycomb protein EED                  57.0    5e-06   
gb|AAR06604.1|  embryonic ectoderm development                        57.0    6e-06   
ref|XP_002088396.1|  GE12654                                          57.0    6e-06   
ref|XP_623808.1|  PREDICTED: polycomb protein EED-like                57.0    7e-06   
ref|XP_003691369.1|  PREDICTED: polycomb protein eed-A-like           56.6    7e-06   
ref|XP_004530249.1|  PREDICTED: polycomb protein esc-like             56.6    8e-06   
ref|XP_011178625.1|  PREDICTED: polycomb protein esc                  56.6    8e-06   
ref|XP_557691.3|  AGAP008550-PA                                       56.2    9e-06   
gb|KFB41480.1|  polycomb protein esc                                  56.2    9e-06   
ref|XP_002599140.1|  hypothetical protein BRAFLDRAFT_122984           56.2    1e-05   
ref|XP_002064873.1|  GK14970                                          56.2    1e-05   
emb|CAG01335.1|  unnamed protein product                              56.6    1e-05   
ref|XP_008910889.1|  hypothetical protein, variant 2                  55.8    1e-05   
ref|XP_011870458.1|  PREDICTED: polycomb protein eed-B-like           56.2    1e-05   
ref|NP_001188366.1|  extra sex combs                                  55.8    1e-05   
ref|XP_011552926.1|  PREDICTED: polycomb protein EED-like             55.8    1e-05   
ref|XP_007021054.1|  Transducin/WD40 repeat-like superfamily prot...  55.5    1e-05   
ref|XP_011553125.1|  PREDICTED: LOW QUALITY PROTEIN: polycomb pro...  55.8    2e-05   
ref|XP_011552905.1|  PREDICTED: polycomb protein eed-A-like           55.8    2e-05   
ref|XP_011162473.1|  PREDICTED: polycomb protein eed-B-like           55.8    2e-05   
gb|EHJ72379.1|  extra sex combs                                       55.5    2e-05   
ref|XP_011057005.1|  PREDICTED: polycomb protein eed-B-like           55.5    2e-05   
ref|XP_011256140.1|  PREDICTED: polycomb protein eed-A-like           55.5    2e-05   
ref|XP_011145479.1|  PREDICTED: polycomb protein eed-A-like isofo...  55.5    2e-05   
ref|XP_011629687.1|  PREDICTED: polycomb protein eed-B-like           55.1    2e-05   
ref|XP_011707650.1|  PREDICTED: polycomb protein eed-like             55.1    3e-05   
dbj|BAB02482.1|  unnamed protein product                              52.4    3e-05   
ref|XP_001993436.1|  GH13070                                          55.1    3e-05   
ref|XP_002157291.1|  PREDICTED: polycomb protein EED-like             55.1    3e-05   
ref|XP_011207625.1|  PREDICTED: polycomb protein esc                  55.1    3e-05   
gb|EUB58911.1|  Polycomb protein EED                                  55.1    3e-05   
emb|CDS18218.1|  polycomb protein EED                                 55.1    3e-05   
gb|ETE61112.1|  Polycomb protein EED                                  54.7    3e-05   
gb|AAC05331.1|  extra sex combs                                       54.7    3e-05   
gb|AGC39037.1|  extra sex combs                                       54.7    3e-05   
ref|XP_002052298.1|  extra sexcombs                                   54.7    4e-05   
sp|Q26458.1|ESC_DROVI  RecName: Full=Polycomb protein esc; AltNam...  54.7    4e-05   
ref|XP_010234290.1|  PREDICTED: polycomb group protein FIE2 isofo...  54.3    4e-05   
ref|XP_002003019.1|  GI17689                                          54.7    4e-05   
emb|CDJ01264.1|  polycomb protein EED                                 54.3    4e-05   
sp|O16023.1|ESC_MUSDO  RecName: Full=Polycomb protein esc; AltNam...  54.3    5e-05   
ref|XP_002002999.1|  GI17683                                          54.3    6e-05   
ref|XP_009009571.1|  hypothetical protein HELRODRAFT_105574           53.9    7e-05   
ref|XP_005190391.1|  PREDICTED: polycomb protein esc                  53.9    7e-05   
gb|ETN65867.1|  embryonic ectoderm development protein                53.5    1e-04   
ref|XP_002052284.1|  GJ17469                                          53.1    1e-04   
ref|XP_011421521.1|  PREDICTED: polycomb protein EED-like             51.2    1e-04   
ref|XP_002088420.1|  GE18559                                          52.8    1e-04   
gb|ELK36130.1|  Polycomb protein EED                                  52.8    1e-04   
ref|XP_002020595.1|  GL15273                                          52.8    2e-04   
ref|XP_002015204.1|  GL18539                                          52.8    2e-04   
ref|XP_001356837.2|  GA18733                                          52.8    2e-04   
ref|XP_001356960.1|  GA13369                                          52.4    2e-04   
ref|XP_003746653.1|  PREDICTED: polycomb protein eed-like             52.4    2e-04   
ref|XP_001993452.1|  GH13063                                          52.4    2e-04   
ref|NP_723702.1|  escl, isoform A                                     52.0    2e-04   
ref|XP_002042000.1|  GM26690                                          52.0    3e-04   
ref|XP_002079167.1|  GD23804                                          52.0    3e-04   
emb|CAJ29461.1|  embryonic ectoderm development protein               51.6    3e-04   
ref|XP_011290322.1|  PREDICTED: polycomb protein esc                  51.6    4e-04   
ref|XP_001969789.1|  GG23752                                          51.6    4e-04   
gb|ERE77960.1|  polycomb protein EED-like protein                     51.2    4e-04   
ref|XP_011424571.1|  PREDICTED: polycomb protein EED-like             50.4    8e-04   



>gb|EYU19209.1| hypothetical protein MIMGU_mgv1a0085351mg, partial [Erythranthe 
guttata]
 gb|EYU19210.1| hypothetical protein MIMGU_mgv1a0085351mg, partial [Erythranthe 
guttata]
Length=205

 Score =   191 bits (486),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 89/98 (91%), Positives = 93/98 (95%), Gaps = 0/98 (0%)
 Frame = +3

Query  510  MAKTSIGCEPVVGSLMPSKKKEYRVTNRLQEGKRPLYAVVFNFIDSRYFNVFATAGGNRV  689
            MAK  +GCEPVVGSL PSKK+EYRVTNRLQEGKRP+YAVVFNFIDSRYFN FATAGGNRV
Sbjct  1    MAKVPLGCEPVVGSLTPSKKREYRVTNRLQEGKRPIYAVVFNFIDSRYFNAFATAGGNRV  60

Query  690  TVYQCLEGGVIAVLQSYIDEDKDESFYTVSWACSIDGT  803
            TVYQCLEGGVIAVLQSYIDEDKDESFYTVSWAC+ DGT
Sbjct  61   TVYQCLEGGVIAVLQSYIDEDKDESFYTVSWACNTDGT  98



>ref|XP_002522836.1| fertilization-independent endosperm protein, putative [Ricinus 
communis]
 gb|EEF39534.1| fertilization-independent endosperm protein, putative [Ricinus 
communis]
Length=344

 Score =   194 bits (494),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 91/98 (93%), Positives = 95/98 (97%), Gaps = 0/98 (0%)
 Frame = +3

Query  510  MAKTSIGCEPVVGSLMPSKKKEYRVTNRLQEGKRPLYAVVFNFIDSRYFNVFATAGGNRV  689
            MAK ++GCEPVVGSL PSKKKEYRVTNRLQEGKRPLYAVVFNFIDSRYFNVFAT GGNRV
Sbjct  1    MAKIALGCEPVVGSLTPSKKKEYRVTNRLQEGKRPLYAVVFNFIDSRYFNVFATVGGNRV  60

Query  690  TVYQCLEGGVIAVLQSYIDEDKDESFYTVSWACSIDGT  803
            TVYQCLEGGVIAVLQSY+DEDKDESFYTVSWAC+IDGT
Sbjct  61   TVYQCLEGGVIAVLQSYVDEDKDESFYTVSWACNIDGT  98



>ref|XP_009591128.1| PREDICTED: polycomb group protein FERTILIZATION-INDEPENDENT ENDOSPERM 
[Nicotiana tomentosiformis]
 gb|ABY84674.1| fertilization-independent endosperm protein [Nicotiana tabacum]
Length=370

 Score =   193 bits (491),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 91/98 (93%), Positives = 94/98 (96%), Gaps = 0/98 (0%)
 Frame = +3

Query  510  MAKTSIGCEPVVGSLMPSKKKEYRVTNRLQEGKRPLYAVVFNFIDSRYFNVFATAGGNRV  689
            MA+  IGCEPVVGSL PSKKKEYRVTNRLQEGKRPLYAVVFNFIDSRYFNVFAT GGNRV
Sbjct  1    MARIPIGCEPVVGSLTPSKKKEYRVTNRLQEGKRPLYAVVFNFIDSRYFNVFATVGGNRV  60

Query  690  TVYQCLEGGVIAVLQSYIDEDKDESFYTVSWACSIDGT  803
            TVYQCLEGGVIAVLQSYIDEDKDESFYTVSWAC+IDG+
Sbjct  61   TVYQCLEGGVIAVLQSYIDEDKDESFYTVSWACNIDGS  98



>gb|KJB81800.1| hypothetical protein B456_013G163900 [Gossypium raimondii]
Length=267

 Score =   190 bits (483),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 91/98 (93%), Positives = 93/98 (95%), Gaps = 0/98 (0%)
 Frame = +3

Query  510  MAKTSIGCEPVVGSLMPSKKKEYRVTNRLQEGKRPLYAVVFNFIDSRYFNVFATAGGNRV  689
            MAKT IG EPVVGSL  SKKKEYRVTNRLQEGKRPLYAVVFNFIDSRYFNVFAT GGNRV
Sbjct  1    MAKTPIGLEPVVGSLSSSKKKEYRVTNRLQEGKRPLYAVVFNFIDSRYFNVFATVGGNRV  60

Query  690  TVYQCLEGGVIAVLQSYIDEDKDESFYTVSWACSIDGT  803
            TVYQCLEGGVIAVLQSY+DEDKDESFYTVSWAC+IDGT
Sbjct  61   TVYQCLEGGVIAVLQSYVDEDKDESFYTVSWACNIDGT  98



>ref|XP_011095327.1| PREDICTED: polycomb group protein FERTILIZATION-INDEPENDENT ENDOSPERM-like 
isoform X5 [Sesamum indicum]
Length=154

 Score =   186 bits (473),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 86/98 (88%), Positives = 92/98 (94%), Gaps = 0/98 (0%)
 Frame = +3

Query  510  MAKTSIGCEPVVGSLMPSKKKEYRVTNRLQEGKRPLYAVVFNFIDSRYFNVFATAGGNRV  689
            MAK  +GCEPVVGSL PS+K+EYR TNRLQEGKRP+YAVVFNFIDSRYFN FAT GGNRV
Sbjct  1    MAKIPLGCEPVVGSLTPSQKREYRATNRLQEGKRPIYAVVFNFIDSRYFNAFATTGGNRV  60

Query  690  TVYQCLEGGVIAVLQSYIDEDKDESFYTVSWACSIDGT  803
            TVYQC+EGGVIAVLQSYIDEDKDESFYTVSWAC+IDGT
Sbjct  61   TVYQCVEGGVIAVLQSYIDEDKDESFYTVSWACNIDGT  98



>ref|XP_011095329.1| PREDICTED: polycomb group protein FERTILIZATION-INDEPENDENT ENDOSPERM-like 
isoform X2 [Sesamum indicum]
Length=343

 Score =   192 bits (488),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 90/98 (92%), Positives = 94/98 (96%), Gaps = 0/98 (0%)
 Frame = +3

Query  510  MAKTSIGCEPVVGSLMPSKKKEYRVTNRLQEGKRPLYAVVFNFIDSRYFNVFATAGGNRV  689
            MAK  +GCEPVVGSL PSKK+EYRVTNRLQEGKRP+YAVVFNFIDSRYFN FATAGGNRV
Sbjct  1    MAKIPLGCEPVVGSLTPSKKREYRVTNRLQEGKRPIYAVVFNFIDSRYFNAFATAGGNRV  60

Query  690  TVYQCLEGGVIAVLQSYIDEDKDESFYTVSWACSIDGT  803
            TVYQCLEGGVIAVLQSYIDEDKDESFYTVSWAC+IDGT
Sbjct  61   TVYQCLEGGVIAVLQSYIDEDKDESFYTVSWACNIDGT  98



>ref|XP_011095331.1| PREDICTED: polycomb group protein FERTILIZATION-INDEPENDENT ENDOSPERM-like 
isoform X3 [Sesamum indicum]
Length=339

 Score =   192 bits (487),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 90/98 (92%), Positives = 94/98 (96%), Gaps = 0/98 (0%)
 Frame = +3

Query  510  MAKTSIGCEPVVGSLMPSKKKEYRVTNRLQEGKRPLYAVVFNFIDSRYFNVFATAGGNRV  689
            MAK  +GCEPVVGSL PSKK+EYRVTNRLQEGKRP+YAVVFNFIDSRYFN FATAGGNRV
Sbjct  1    MAKIPLGCEPVVGSLTPSKKREYRVTNRLQEGKRPIYAVVFNFIDSRYFNAFATAGGNRV  60

Query  690  TVYQCLEGGVIAVLQSYIDEDKDESFYTVSWACSIDGT  803
            TVYQCLEGGVIAVLQSYIDEDKDESFYTVSWAC+IDGT
Sbjct  61   TVYQCLEGGVIAVLQSYIDEDKDESFYTVSWACNIDGT  98



>ref|XP_012070730.1| PREDICTED: polycomb group protein FERTILIZATION-INDEPENDENT ENDOSPERM 
[Jatropha curcas]
 gb|KDP39048.1| hypothetical protein JCGZ_00805 [Jatropha curcas]
Length=372

 Score =   193 bits (490),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 90/98 (92%), Positives = 94/98 (96%), Gaps = 0/98 (0%)
 Frame = +3

Query  510  MAKTSIGCEPVVGSLMPSKKKEYRVTNRLQEGKRPLYAVVFNFIDSRYFNVFATAGGNRV  689
            MAK ++GCEPVVGSL PSKKKEYRVTNRLQEGKRPLYAVVFNFID RYFNVFAT GGNRV
Sbjct  1    MAKIALGCEPVVGSLTPSKKKEYRVTNRLQEGKRPLYAVVFNFIDCRYFNVFATVGGNRV  60

Query  690  TVYQCLEGGVIAVLQSYIDEDKDESFYTVSWACSIDGT  803
            TVYQCLEGGVIAVLQSY+DEDKDESFYTVSWAC+IDGT
Sbjct  61   TVYQCLEGGVIAVLQSYVDEDKDESFYTVSWACNIDGT  98



>ref|XP_011095328.1| PREDICTED: polycomb group protein FERTILIZATION-INDEPENDENT ENDOSPERM-like 
isoform X1 [Sesamum indicum]
Length=370

 Score =   192 bits (489),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 90/98 (92%), Positives = 94/98 (96%), Gaps = 0/98 (0%)
 Frame = +3

Query  510  MAKTSIGCEPVVGSLMPSKKKEYRVTNRLQEGKRPLYAVVFNFIDSRYFNVFATAGGNRV  689
            MAK  +GCEPVVGSL PSKK+EYRVTNRLQEGKRP+YAVVFNFIDSRYFN FATAGGNRV
Sbjct  1    MAKIPLGCEPVVGSLTPSKKREYRVTNRLQEGKRPIYAVVFNFIDSRYFNAFATAGGNRV  60

Query  690  TVYQCLEGGVIAVLQSYIDEDKDESFYTVSWACSIDGT  803
            TVYQCLEGGVIAVLQSYIDEDKDESFYTVSWAC+IDGT
Sbjct  61   TVYQCLEGGVIAVLQSYIDEDKDESFYTVSWACNIDGT  98



>ref|XP_011095324.1| PREDICTED: polycomb group protein FERTILIZATION-INDEPENDENT ENDOSPERM-like 
isoform X2 [Sesamum indicum]
Length=199

 Score =   187 bits (476),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 86/98 (88%), Positives = 92/98 (94%), Gaps = 0/98 (0%)
 Frame = +3

Query  510  MAKTSIGCEPVVGSLMPSKKKEYRVTNRLQEGKRPLYAVVFNFIDSRYFNVFATAGGNRV  689
            MAK  +GCEPVVGSL PS+K+EYR TNRLQEGKRP+YAVVFNFIDSRYFN FAT GGNRV
Sbjct  1    MAKIPLGCEPVVGSLTPSQKREYRATNRLQEGKRPIYAVVFNFIDSRYFNAFATTGGNRV  60

Query  690  TVYQCLEGGVIAVLQSYIDEDKDESFYTVSWACSIDGT  803
            TVYQC+EGGVIAVLQSYIDEDKDESFYTVSWAC+IDGT
Sbjct  61   TVYQCVEGGVIAVLQSYIDEDKDESFYTVSWACNIDGT  98



>ref|XP_011095326.1| PREDICTED: polycomb group protein FERTILIZATION-INDEPENDENT ENDOSPERM-like 
isoform X4 [Sesamum indicum]
Length=175

 Score =   186 bits (473),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 86/98 (88%), Positives = 92/98 (94%), Gaps = 0/98 (0%)
 Frame = +3

Query  510  MAKTSIGCEPVVGSLMPSKKKEYRVTNRLQEGKRPLYAVVFNFIDSRYFNVFATAGGNRV  689
            MAK  +GCEPVVGSL PS+K+EYR TNRLQEGKRP+YAVVFNFIDSRYFN FAT GGNRV
Sbjct  1    MAKIPLGCEPVVGSLTPSQKREYRATNRLQEGKRPIYAVVFNFIDSRYFNAFATTGGNRV  60

Query  690  TVYQCLEGGVIAVLQSYIDEDKDESFYTVSWACSIDGT  803
            TVYQC+EGGVIAVLQSYIDEDKDESFYTVSWAC+IDGT
Sbjct  61   TVYQCVEGGVIAVLQSYIDEDKDESFYTVSWACNIDGT  98



>ref|XP_011095325.1| PREDICTED: polycomb group protein FERTILIZATION-INDEPENDENT ENDOSPERM-like 
isoform X3 [Sesamum indicum]
Length=198

 Score =   187 bits (475),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 86/98 (88%), Positives = 92/98 (94%), Gaps = 0/98 (0%)
 Frame = +3

Query  510  MAKTSIGCEPVVGSLMPSKKKEYRVTNRLQEGKRPLYAVVFNFIDSRYFNVFATAGGNRV  689
            MAK  +GCEPVVGSL PS+K+EYR TNRLQEGKRP+YAVVFNFIDSRYFN FAT GGNRV
Sbjct  1    MAKIPLGCEPVVGSLTPSQKREYRATNRLQEGKRPIYAVVFNFIDSRYFNAFATTGGNRV  60

Query  690  TVYQCLEGGVIAVLQSYIDEDKDESFYTVSWACSIDGT  803
            TVYQC+EGGVIAVLQSYIDEDKDESFYTVSWAC+IDGT
Sbjct  61   TVYQCVEGGVIAVLQSYIDEDKDESFYTVSWACNIDGT  98



>ref|XP_009769114.1| PREDICTED: polycomb group protein FERTILIZATION-INDEPENDENT ENDOSPERM 
[Nicotiana sylvestris]
 gb|AFV15391.1| fertilization independent endosperm 1 protein [Nicotiana benthamiana]
Length=370

 Score =   192 bits (488),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 90/98 (92%), Positives = 94/98 (96%), Gaps = 0/98 (0%)
 Frame = +3

Query  510  MAKTSIGCEPVVGSLMPSKKKEYRVTNRLQEGKRPLYAVVFNFIDSRYFNVFATAGGNRV  689
            MA+  IGCEPVVGSL PSKKK+YRVTNRLQEGKRPLYAVVFNFIDSRYFNVFAT GGNRV
Sbjct  1    MARIPIGCEPVVGSLTPSKKKDYRVTNRLQEGKRPLYAVVFNFIDSRYFNVFATVGGNRV  60

Query  690  TVYQCLEGGVIAVLQSYIDEDKDESFYTVSWACSIDGT  803
            TVYQCLEGGVIAVLQSYIDEDKDESFYTVSWAC+IDG+
Sbjct  61   TVYQCLEGGVIAVLQSYIDEDKDESFYTVSWACNIDGS  98



>ref|XP_011095323.1| PREDICTED: polycomb group protein FERTILIZATION-INDEPENDENT ENDOSPERM-like 
isoform X1 [Sesamum indicum]
Length=202

 Score =   187 bits (475),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 86/98 (88%), Positives = 92/98 (94%), Gaps = 0/98 (0%)
 Frame = +3

Query  510  MAKTSIGCEPVVGSLMPSKKKEYRVTNRLQEGKRPLYAVVFNFIDSRYFNVFATAGGNRV  689
            MAK  +GCEPVVGSL PS+K+EYR TNRLQEGKRP+YAVVFNFIDSRYFN FAT GGNRV
Sbjct  1    MAKIPLGCEPVVGSLTPSQKREYRATNRLQEGKRPIYAVVFNFIDSRYFNAFATTGGNRV  60

Query  690  TVYQCLEGGVIAVLQSYIDEDKDESFYTVSWACSIDGT  803
            TVYQC+EGGVIAVLQSYIDEDKDESFYTVSWAC+IDGT
Sbjct  61   TVYQCVEGGVIAVLQSYIDEDKDESFYTVSWACNIDGT  98



>ref|XP_007021053.1| Transducin/WD40 repeat-like superfamily protein isoform 3 [Theobroma 
cacao]
 gb|EOY12578.1| Transducin/WD40 repeat-like superfamily protein isoform 3 [Theobroma 
cacao]
Length=350

 Score =   191 bits (484),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 89/98 (91%), Positives = 94/98 (96%), Gaps = 0/98 (0%)
 Frame = +3

Query  510  MAKTSIGCEPVVGSLMPSKKKEYRVTNRLQEGKRPLYAVVFNFIDSRYFNVFATAGGNRV  689
            MAKT IG EPVVGSL PSKK+EYRVTNRLQEGKRPLYAVVFNFIDSRYFNVFAT GGNRV
Sbjct  1    MAKTPIGLEPVVGSLTPSKKREYRVTNRLQEGKRPLYAVVFNFIDSRYFNVFATVGGNRV  60

Query  690  TVYQCLEGGVIAVLQSYIDEDKDESFYTVSWACSIDGT  803
            TVYQCL+GGVIAVLQSY+DEDKDESFYT+SWAC+IDGT
Sbjct  61   TVYQCLDGGVIAVLQSYVDEDKDESFYTISWACNIDGT  98



>gb|KJB81804.1| hypothetical protein B456_013G163900 [Gossypium raimondii]
Length=310

 Score =   189 bits (481),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 91/98 (93%), Positives = 93/98 (95%), Gaps = 0/98 (0%)
 Frame = +3

Query  510  MAKTSIGCEPVVGSLMPSKKKEYRVTNRLQEGKRPLYAVVFNFIDSRYFNVFATAGGNRV  689
            MAKT IG EPVVGSL  SKKKEYRVTNRLQEGKRPLYAVVFNFIDSRYFNVFAT GGNRV
Sbjct  1    MAKTPIGLEPVVGSLSSSKKKEYRVTNRLQEGKRPLYAVVFNFIDSRYFNVFATVGGNRV  60

Query  690  TVYQCLEGGVIAVLQSYIDEDKDESFYTVSWACSIDGT  803
            TVYQCLEGGVIAVLQSY+DEDKDESFYTVSWAC+IDGT
Sbjct  61   TVYQCLEGGVIAVLQSYVDEDKDESFYTVSWACNIDGT  98



>ref|XP_007021051.1| Transducin/WD40 repeat-like superfamily protein isoform 1 [Theobroma 
cacao]
 gb|EOY12576.1| Transducin/WD40 repeat-like superfamily protein isoform 1 [Theobroma 
cacao]
Length=370

 Score =   191 bits (485),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 89/98 (91%), Positives = 94/98 (96%), Gaps = 0/98 (0%)
 Frame = +3

Query  510  MAKTSIGCEPVVGSLMPSKKKEYRVTNRLQEGKRPLYAVVFNFIDSRYFNVFATAGGNRV  689
            MAKT IG EPVVGSL PSKK+EYRVTNRLQEGKRPLYAVVFNFIDSRYFNVFAT GGNRV
Sbjct  1    MAKTPIGLEPVVGSLTPSKKREYRVTNRLQEGKRPLYAVVFNFIDSRYFNVFATVGGNRV  60

Query  690  TVYQCLEGGVIAVLQSYIDEDKDESFYTVSWACSIDGT  803
            TVYQCL+GGVIAVLQSY+DEDKDESFYT+SWAC+IDGT
Sbjct  61   TVYQCLDGGVIAVLQSYVDEDKDESFYTISWACNIDGT  98



>gb|KHG24127.1| polycomb group fertilization-independent endosperm -like protein 
[Gossypium arboreum]
 gb|KJB81798.1| hypothetical protein B456_013G163900 [Gossypium raimondii]
 gb|KJB81799.1| hypothetical protein B456_013G163900 [Gossypium raimondii]
 gb|KJB81805.1| hypothetical protein B456_013G163900 [Gossypium raimondii]
Length=370

 Score =   190 bits (483),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 91/98 (93%), Positives = 93/98 (95%), Gaps = 0/98 (0%)
 Frame = +3

Query  510  MAKTSIGCEPVVGSLMPSKKKEYRVTNRLQEGKRPLYAVVFNFIDSRYFNVFATAGGNRV  689
            MAKT IG EPVVGSL  SKKKEYRVTNRLQEGKRPLYAVVFNFIDSRYFNVFAT GGNRV
Sbjct  1    MAKTPIGLEPVVGSLSSSKKKEYRVTNRLQEGKRPLYAVVFNFIDSRYFNVFATVGGNRV  60

Query  690  TVYQCLEGGVIAVLQSYIDEDKDESFYTVSWACSIDGT  803
            TVYQCLEGGVIAVLQSY+DEDKDESFYTVSWAC+IDGT
Sbjct  61   TVYQCLEGGVIAVLQSYVDEDKDESFYTVSWACNIDGT  98



>gb|KJB81802.1| hypothetical protein B456_013G163900 [Gossypium raimondii]
Length=366

 Score =   189 bits (481),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 91/98 (93%), Positives = 93/98 (95%), Gaps = 0/98 (0%)
 Frame = +3

Query  510  MAKTSIGCEPVVGSLMPSKKKEYRVTNRLQEGKRPLYAVVFNFIDSRYFNVFATAGGNRV  689
            MAKT IG EPVVGSL  SKKKEYRVTNRLQEGKRPLYAVVFNFIDSRYFNVFAT GGNRV
Sbjct  1    MAKTPIGLEPVVGSLSSSKKKEYRVTNRLQEGKRPLYAVVFNFIDSRYFNVFATVGGNRV  60

Query  690  TVYQCLEGGVIAVLQSYIDEDKDESFYTVSWACSIDGT  803
            TVYQCLEGGVIAVLQSY+DEDKDESFYTVSWAC+IDGT
Sbjct  61   TVYQCLEGGVIAVLQSYVDEDKDESFYTVSWACNIDGT  98



>ref|XP_002282472.1| PREDICTED: polycomb group protein FIE2 [Vitis vinifera]
 emb|CBI20511.3| unnamed protein product [Vitis vinifera]
Length=370

 Score =   189 bits (480),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 87/97 (90%), Positives = 93/97 (96%), Gaps = 0/97 (0%)
 Frame = +3

Query  510  MAKTSIGCEPVVGSLMPSKKKEYRVTNRLQEGKRPLYAVVFNFIDSRYFNVFATAGGNRV  689
            MAK ++GCEPVVGSL PSKK++YRVTNRLQEGKRP+YAV FNFIDSRYFNVFAT GGNRV
Sbjct  1    MAKITLGCEPVVGSLTPSKKRDYRVTNRLQEGKRPIYAVAFNFIDSRYFNVFATVGGNRV  60

Query  690  TVYQCLEGGVIAVLQSYIDEDKDESFYTVSWACSIDG  800
            TVYQCLEGGVIAVLQSYIDEDKDESFYT+SWACSIDG
Sbjct  61   TVYQCLEGGVIAVLQSYIDEDKDESFYTLSWACSIDG  97



>gb|KJB81803.1| hypothetical protein B456_013G163900 [Gossypium raimondii]
Length=392

 Score =   189 bits (481),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 91/98 (93%), Positives = 93/98 (95%), Gaps = 0/98 (0%)
 Frame = +3

Query  510  MAKTSIGCEPVVGSLMPSKKKEYRVTNRLQEGKRPLYAVVFNFIDSRYFNVFATAGGNRV  689
            MAKT IG EPVVGSL  SKKKEYRVTNRLQEGKRPLYAVVFNFIDSRYFNVFAT GGNRV
Sbjct  1    MAKTPIGLEPVVGSLSSSKKKEYRVTNRLQEGKRPLYAVVFNFIDSRYFNVFATVGGNRV  60

Query  690  TVYQCLEGGVIAVLQSYIDEDKDESFYTVSWACSIDGT  803
            TVYQCLEGGVIAVLQSY+DEDKDESFYTVSWAC+IDGT
Sbjct  61   TVYQCLEGGVIAVLQSYVDEDKDESFYTVSWACNIDGT  98



>emb|CDP05801.1| unnamed protein product [Coffea canephora]
Length=370

 Score =   189 bits (479),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 89/98 (91%), Positives = 92/98 (94%), Gaps = 0/98 (0%)
 Frame = +3

Query  510  MAKTSIGCEPVVGSLMPSKKKEYRVTNRLQEGKRPLYAVVFNFIDSRYFNVFATAGGNRV  689
            MAK ++GCEPVVGSL  SKKKEYRVTNRLQEGKRPLYAV FNFIDSRYFNVFAT GGNRV
Sbjct  1    MAKIALGCEPVVGSLTSSKKKEYRVTNRLQEGKRPLYAVAFNFIDSRYFNVFATVGGNRV  60

Query  690  TVYQCLEGGVIAVLQSYIDEDKDESFYTVSWACSIDGT  803
            TVYQCLEGGVIAVLQSYIDEDKDESFYTVSWAC+IDG 
Sbjct  61   TVYQCLEGGVIAVLQSYIDEDKDESFYTVSWACNIDGA  98



>ref|XP_006452167.1| hypothetical protein CICLE_v10008697mg [Citrus clementina]
 gb|ESR65407.1| hypothetical protein CICLE_v10008697mg [Citrus clementina]
Length=342

 Score =   187 bits (475),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 85/97 (88%), Positives = 94/97 (97%), Gaps = 0/97 (0%)
 Frame = +3

Query  510  MAKTSIGCEPVVGSLMPSKKKEYRVTNRLQEGKRPLYAVVFNFIDSRYFNVFATAGGNRV  689
            MA+T+IGCEP+VGSL PSKK+EYRVTN+LQEGKRPLYAVVFNFIDSRYFNVFAT GGNRV
Sbjct  1    MARTAIGCEPLVGSLTPSKKREYRVTNKLQEGKRPLYAVVFNFIDSRYFNVFATVGGNRV  60

Query  690  TVYQCLEGGVIAVLQSYIDEDKDESFYTVSWACSIDG  800
            TVYQCLEGGVIA LQSY+DEDK+ESFYTVSWAC++DG
Sbjct  61   TVYQCLEGGVIAALQSYVDEDKEESFYTVSWACNVDG  97



>ref|NP_001274801.1| fertilization-independent endosperm protein [Solanum tuberosum]
 gb|ABB16357.1| fertilization-independent endosperm protein [Solanum tuberosum]
Length=372

 Score =   188 bits (477),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 87/97 (90%), Positives = 92/97 (95%), Gaps = 0/97 (0%)
 Frame = +3

Query  513  AKTSIGCEPVVGSLMPSKKKEYRVTNRLQEGKRPLYAVVFNFIDSRYFNVFATAGGNRVT  692
            A+  +GCEPVVGSL PS+KKEYRVTNRLQEGKRPLY VVFNFIDSRYFNVFAT GGNRVT
Sbjct  3    ARVPLGCEPVVGSLTPSRKKEYRVTNRLQEGKRPLYGVVFNFIDSRYFNVFATVGGNRVT  62

Query  693  VYQCLEGGVIAVLQSYIDEDKDESFYTVSWACSIDGT  803
            VYQCLEGGVIAVLQSYIDEDKDESFYTVSWAC+IDG+
Sbjct  63   VYQCLEGGVIAVLQSYIDEDKDESFYTVSWACNIDGS  99



>gb|ABZ85627.2| fertilization-independent endosperm, partial [Pilosella officinarum]
Length=370

 Score =   188 bits (477),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 86/98 (88%), Positives = 93/98 (95%), Gaps = 0/98 (0%)
 Frame = +3

Query  510  MAKTSIGCEPVVGSLMPSKKKEYRVTNRLQEGKRPLYAVVFNFIDSRYFNVFATAGGNRV  689
            MAK ++GCEPV+GSL PSKK++YRVTNRLQEGKRP+YAVVFNFIDSRY+NVFAT GGNRV
Sbjct  1    MAKITLGCEPVIGSLTPSKKRDYRVTNRLQEGKRPIYAVVFNFIDSRYYNVFATVGGNRV  60

Query  690  TVYQCLEGGVIAVLQSYIDEDKDESFYTVSWACSIDGT  803
            TVYQCLEGGVIAVLQSYIDEDKDESFYTVSWAC  DGT
Sbjct  61   TVYQCLEGGVIAVLQSYIDEDKDESFYTVSWACDADGT  98



>gb|KDO52943.1| hypothetical protein CISIN_1g016185mg [Citrus sinensis]
Length=346

 Score =   187 bits (475),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 85/97 (88%), Positives = 94/97 (97%), Gaps = 0/97 (0%)
 Frame = +3

Query  510  MAKTSIGCEPVVGSLMPSKKKEYRVTNRLQEGKRPLYAVVFNFIDSRYFNVFATAGGNRV  689
            MA+T+IGCEP+VGSL PSKK+EYRVTN+LQEGKRPLYAVVFNFIDSRYFNVFAT GGNRV
Sbjct  1    MARTAIGCEPLVGSLTPSKKREYRVTNKLQEGKRPLYAVVFNFIDSRYFNVFATVGGNRV  60

Query  690  TVYQCLEGGVIAVLQSYIDEDKDESFYTVSWACSIDG  800
            TVYQCLEGGVIA LQSY+DEDK+ESFYTVSWAC++DG
Sbjct  61   TVYQCLEGGVIAALQSYVDEDKEESFYTVSWACNVDG  97



>ref|NP_001234484.1| fertilization-independent endosperm protein [Solanum lycopersicum]
 gb|ABY84676.1| fertilization-independent endosperm protein [Solanum lycopersicum]
Length=372

 Score =   188 bits (477),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 87/97 (90%), Positives = 92/97 (95%), Gaps = 0/97 (0%)
 Frame = +3

Query  513  AKTSIGCEPVVGSLMPSKKKEYRVTNRLQEGKRPLYAVVFNFIDSRYFNVFATAGGNRVT  692
            A+  +GCEPVVGSL PS+KKEYRVTNRLQEGKRPLY VVFNFIDSRYFNVFAT GGNRVT
Sbjct  3    ARVPLGCEPVVGSLTPSRKKEYRVTNRLQEGKRPLYGVVFNFIDSRYFNVFATVGGNRVT  62

Query  693  VYQCLEGGVIAVLQSYIDEDKDESFYTVSWACSIDGT  803
            VYQCLEGGVIAVLQSYIDEDKDESFYTVSWAC+IDG+
Sbjct  63   VYQCLEGGVIAVLQSYIDEDKDESFYTVSWACNIDGS  99



>gb|ABZ85630.2| fertilization-independent endosperm [Hieracium piloselloides]
Length=370

 Score =   188 bits (477),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 86/98 (88%), Positives = 93/98 (95%), Gaps = 0/98 (0%)
 Frame = +3

Query  510  MAKTSIGCEPVVGSLMPSKKKEYRVTNRLQEGKRPLYAVVFNFIDSRYFNVFATAGGNRV  689
            MAK ++GCEPV+GSL PSKK++YRVTNRLQEGKRP+YAVVFNFIDSRY+NVFAT GGNRV
Sbjct  1    MAKITLGCEPVIGSLTPSKKRDYRVTNRLQEGKRPIYAVVFNFIDSRYYNVFATVGGNRV  60

Query  690  TVYQCLEGGVIAVLQSYIDEDKDESFYTVSWACSIDGT  803
            TVYQCLEGGVIAVLQSYIDEDKDESFYTVSWAC  DGT
Sbjct  61   TVYQCLEGGVIAVLQSYIDEDKDESFYTVSWACDADGT  98



>gb|EPS69595.1| fertilization independent endosperm development protein [Genlisea 
aurea]
Length=370

 Score =   188 bits (477),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 87/98 (89%), Positives = 93/98 (95%), Gaps = 0/98 (0%)
 Frame = +3

Query  510  MAKTSIGCEPVVGSLMPSKKKEYRVTNRLQEGKRPLYAVVFNFIDSRYFNVFATAGGNRV  689
            M+K  +GCEPVVGSL PS+K EY+VTNRLQEGKRP+YAVVFNFIDSRYFN FATAGGNRV
Sbjct  1    MSKIPLGCEPVVGSLTPSRKLEYKVTNRLQEGKRPIYAVVFNFIDSRYFNAFATAGGNRV  60

Query  690  TVYQCLEGGVIAVLQSYIDEDKDESFYTVSWACSIDGT  803
            TVYQCLEGGVIAVLQSYIDEDKDESFYTVSWAC+IDGT
Sbjct  61   TVYQCLEGGVIAVLQSYIDEDKDESFYTVSWACNIDGT  98



>ref|XP_006452168.1| hypothetical protein CICLE_v10008697mg [Citrus clementina]
 ref|XP_006452169.1| hypothetical protein CICLE_v10008697mg [Citrus clementina]
 gb|ESR65408.1| hypothetical protein CICLE_v10008697mg [Citrus clementina]
 gb|ESR65409.1| hypothetical protein CICLE_v10008697mg [Citrus clementina]
Length=369

 Score =   187 bits (476),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 85/97 (88%), Positives = 94/97 (97%), Gaps = 0/97 (0%)
 Frame = +3

Query  510  MAKTSIGCEPVVGSLMPSKKKEYRVTNRLQEGKRPLYAVVFNFIDSRYFNVFATAGGNRV  689
            MA+T+IGCEP+VGSL PSKK+EYRVTN+LQEGKRPLYAVVFNFIDSRYFNVFAT GGNRV
Sbjct  1    MARTAIGCEPLVGSLTPSKKREYRVTNKLQEGKRPLYAVVFNFIDSRYFNVFATVGGNRV  60

Query  690  TVYQCLEGGVIAVLQSYIDEDKDESFYTVSWACSIDG  800
            TVYQCLEGGVIA LQSY+DEDK+ESFYTVSWAC++DG
Sbjct  61   TVYQCLEGGVIAALQSYVDEDKEESFYTVSWACNVDG  97



>ref|XP_009343081.1| PREDICTED: polycomb group protein FERTILIZATION-INDEPENDENT ENDOSPERM-like 
[Pyrus x bretschneideri]
 ref|XP_009343082.1| PREDICTED: polycomb group protein FERTILIZATION-INDEPENDENT ENDOSPERM-like 
[Pyrus x bretschneideri]
Length=371

 Score =   188 bits (477),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 88/97 (91%), Positives = 93/97 (96%), Gaps = 0/97 (0%)
 Frame = +3

Query  513  AKTSIGCEPVVGSLMPSKKKEYRVTNRLQEGKRPLYAVVFNFIDSRYFNVFATAGGNRVT  692
            AK ++G EPVVGSL PSKKKEYRVTNRLQEGKRPLYA+VFNFIDSRYFNVFAT GGNRVT
Sbjct  3    AKVALGSEPVVGSLAPSKKKEYRVTNRLQEGKRPLYAIVFNFIDSRYFNVFATVGGNRVT  62

Query  693  VYQCLEGGVIAVLQSYIDEDKDESFYTVSWACSIDGT  803
            VYQCLEGGVIAVLQSYIDEDKDESFYTVSWAC+IDG+
Sbjct  63   VYQCLEGGVIAVLQSYIDEDKDESFYTVSWACNIDGS  99



>ref|XP_006475218.1| PREDICTED: polycomb group protein FERTILIZATION-INDEPENDENT ENDOSPERM-like 
isoform X1 [Citrus sinensis]
 gb|KDO52939.1| hypothetical protein CISIN_1g016185mg [Citrus sinensis]
 gb|KDO52940.1| hypothetical protein CISIN_1g016185mg [Citrus sinensis]
Length=369

 Score =   187 bits (476),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 85/97 (88%), Positives = 94/97 (97%), Gaps = 0/97 (0%)
 Frame = +3

Query  510  MAKTSIGCEPVVGSLMPSKKKEYRVTNRLQEGKRPLYAVVFNFIDSRYFNVFATAGGNRV  689
            MA+T+IGCEP+VGSL PSKK+EYRVTN+LQEGKRPLYAVVFNFIDSRYFNVFAT GGNRV
Sbjct  1    MARTAIGCEPLVGSLTPSKKREYRVTNKLQEGKRPLYAVVFNFIDSRYFNVFATVGGNRV  60

Query  690  TVYQCLEGGVIAVLQSYIDEDKDESFYTVSWACSIDG  800
            TVYQCLEGGVIA LQSY+DEDK+ESFYTVSWAC++DG
Sbjct  61   TVYQCLEGGVIAALQSYVDEDKEESFYTVSWACNVDG  97



>ref|NP_001289654.1| polycomb group protein FERTILIZATION-INDEPENDENT ENDOSPERM [Eucalyptus 
grandis]
 gb|AAN85568.1| fertilization independent endosperm development protein [Eucalyptus 
grandis]
Length=372

 Score =   187 bits (475),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 88/98 (90%), Positives = 92/98 (94%), Gaps = 0/98 (0%)
 Frame = +3

Query  510  MAKTSIGCEPVVGSLMPSKKKEYRVTNRLQEGKRPLYAVVFNFIDSRYFNVFATAGGNRV  689
            MAK + GCEPV G+L PSKK+EYRVTNRLQEGKRPLYAVVFNFIDSRYFNVFAT GGNRV
Sbjct  1    MAKIAPGCEPVAGTLTPSKKREYRVTNRLQEGKRPLYAVVFNFIDSRYFNVFATVGGNRV  60

Query  690  TVYQCLEGGVIAVLQSYIDEDKDESFYTVSWACSIDGT  803
            TVYQCLEGGVIAVLQSYIDEDKDESFYTVSWAC+ID T
Sbjct  61   TVYQCLEGGVIAVLQSYIDEDKDESFYTVSWACNIDRT  98



>gb|KCW70128.1| hypothetical protein EUGRSUZ_F03425 [Eucalyptus grandis]
Length=372

 Score =   187 bits (475),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 88/98 (90%), Positives = 92/98 (94%), Gaps = 0/98 (0%)
 Frame = +3

Query  510  MAKTSIGCEPVVGSLMPSKKKEYRVTNRLQEGKRPLYAVVFNFIDSRYFNVFATAGGNRV  689
            MAK + GCEPV G+L PSKK+EYRVTNRLQEGKRPLYAVVFNFIDSRYFNVFAT GGNRV
Sbjct  1    MAKIAPGCEPVAGTLTPSKKREYRVTNRLQEGKRPLYAVVFNFIDSRYFNVFATVGGNRV  60

Query  690  TVYQCLEGGVIAVLQSYIDEDKDESFYTVSWACSIDGT  803
            TVYQCLEGGVIAVLQSYIDEDKDESFYTVSWAC+ID T
Sbjct  61   TVYQCLEGGVIAVLQSYIDEDKDESFYTVSWACNIDRT  98



>ref|XP_008365658.1| PREDICTED: polycomb group protein FIE2 [Malus domestica]
 ref|XP_008365665.1| PREDICTED: polycomb group protein FIE2 [Malus domestica]
 ref|XP_008365672.1| PREDICTED: polycomb group protein FIE2 [Malus domestica]
Length=371

 Score =   187 bits (474),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 88/97 (91%), Positives = 93/97 (96%), Gaps = 0/97 (0%)
 Frame = +3

Query  513  AKTSIGCEPVVGSLMPSKKKEYRVTNRLQEGKRPLYAVVFNFIDSRYFNVFATAGGNRVT  692
            AK ++G EPVVGSL PSKKKEYRVTNRLQEGKRPLYA+VFNFIDSRYFNVFAT GGNRVT
Sbjct  3    AKFALGSEPVVGSLAPSKKKEYRVTNRLQEGKRPLYAIVFNFIDSRYFNVFATVGGNRVT  62

Query  693  VYQCLEGGVIAVLQSYIDEDKDESFYTVSWACSIDGT  803
            VYQCLEGGVIAVLQSYIDEDKDESFYTVSWAC+IDG+
Sbjct  63   VYQCLEGGVIAVLQSYIDEDKDESFYTVSWACNIDGS  99



>gb|KDO52941.1| hypothetical protein CISIN_1g016185mg [Citrus sinensis]
Length=394

 Score =   187 bits (476),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 85/97 (88%), Positives = 94/97 (97%), Gaps = 0/97 (0%)
 Frame = +3

Query  510  MAKTSIGCEPVVGSLMPSKKKEYRVTNRLQEGKRPLYAVVFNFIDSRYFNVFATAGGNRV  689
            MA+T+IGCEP+VGSL PSKK+EYRVTN+LQEGKRPLYAVVFNFIDSRYFNVFAT GGNRV
Sbjct  1    MARTAIGCEPLVGSLTPSKKREYRVTNKLQEGKRPLYAVVFNFIDSRYFNVFATVGGNRV  60

Query  690  TVYQCLEGGVIAVLQSYIDEDKDESFYTVSWACSIDG  800
            TVYQCLEGGVIA LQSY+DEDK+ESFYTVSWAC++DG
Sbjct  61   TVYQCLEGGVIAALQSYVDEDKEESFYTVSWACNVDG  97



>ref|XP_009358095.1| PREDICTED: polycomb group protein FIE2-like [Pyrus x bretschneideri]
Length=371

 Score =   187 bits (474),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 88/97 (91%), Positives = 93/97 (96%), Gaps = 0/97 (0%)
 Frame = +3

Query  513  AKTSIGCEPVVGSLMPSKKKEYRVTNRLQEGKRPLYAVVFNFIDSRYFNVFATAGGNRVT  692
            AK ++G EPVVGSL PSKKKEYRVTNRLQEGKRPLYA+VFNFIDSRYFNVFAT GGNRVT
Sbjct  3    AKFALGSEPVVGSLAPSKKKEYRVTNRLQEGKRPLYAIVFNFIDSRYFNVFATVGGNRVT  62

Query  693  VYQCLEGGVIAVLQSYIDEDKDESFYTVSWACSIDGT  803
            VYQCLEGGVIAVLQSYIDEDKDESFYTVSWAC+IDG+
Sbjct  63   VYQCLEGGVIAVLQSYIDEDKDESFYTVSWACNIDGS  99



>ref|XP_008355349.1| PREDICTED: polycomb group protein FIE2-like [Malus domestica]
Length=371

 Score =   187 bits (474),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 88/97 (91%), Positives = 93/97 (96%), Gaps = 0/97 (0%)
 Frame = +3

Query  513  AKTSIGCEPVVGSLMPSKKKEYRVTNRLQEGKRPLYAVVFNFIDSRYFNVFATAGGNRVT  692
            AK ++G EPVVGSL PSKKKEYRVTNRLQEGKRPLYA+VFNFIDSRYFNVFAT GGNRVT
Sbjct  3    AKFALGSEPVVGSLAPSKKKEYRVTNRLQEGKRPLYAIVFNFIDSRYFNVFATVGGNRVT  62

Query  693  VYQCLEGGVIAVLQSYIDEDKDESFYTVSWACSIDGT  803
            VYQCLEGGVIAVLQSYIDEDKDESFYTVSWAC+IDG+
Sbjct  63   VYQCLEGGVIAVLQSYIDEDKDESFYTVSWACNIDGS  99



>gb|ABB16356.1| fertilization-independent endosperm protein [Solanum commersonii]
Length=372

 Score =   186 bits (473),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 86/97 (89%), Positives = 91/97 (94%), Gaps = 0/97 (0%)
 Frame = +3

Query  513  AKTSIGCEPVVGSLMPSKKKEYRVTNRLQEGKRPLYAVVFNFIDSRYFNVFATAGGNRVT  692
            A+  +GCEPVVGSL PS+KKEYRVTNRLQEGKRPLY VVFNFIDSRYFNVFAT GGNRVT
Sbjct  3    ARVPLGCEPVVGSLTPSRKKEYRVTNRLQEGKRPLYGVVFNFIDSRYFNVFATVGGNRVT  62

Query  693  VYQCLEGGVIAVLQSYIDEDKDESFYTVSWACSIDGT  803
            VYQCLEGGVIAVLQSYIDEDKDESFYT SWAC+IDG+
Sbjct  63   VYQCLEGGVIAVLQSYIDEDKDESFYTASWACNIDGS  99



>ref|XP_006370617.1| FERTILIZATION-INDEPENDENT ENDOSPERM family protein [Populus trichocarpa]
 gb|ERP67186.1| FERTILIZATION-INDEPENDENT ENDOSPERM family protein [Populus trichocarpa]
Length=371

 Score =   186 bits (473),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 86/97 (89%), Positives = 93/97 (96%), Gaps = 0/97 (0%)
 Frame = +3

Query  510  MAKTSIGCEPVVGSLMPSKKKEYRVTNRLQEGKRPLYAVVFNFIDSRYFNVFATAGGNRV  689
            MAK ++GCEPVVGSL PSKK+EYR+TNRLQEGKRPLYAVVFNFIDSRYFNVFAT GGNRV
Sbjct  1    MAKIALGCEPVVGSLTPSKKREYRLTNRLQEGKRPLYAVVFNFIDSRYFNVFATVGGNRV  60

Query  690  TVYQCLEGGVIAVLQSYIDEDKDESFYTVSWACSIDG  800
            TVYQCL+ GVIAVLQSY+DEDKDESFYTVSWAC+IDG
Sbjct  61   TVYQCLDEGVIAVLQSYVDEDKDESFYTVSWACNIDG  97



>ref|XP_011048289.1| PREDICTED: polycomb group protein FERTILIZATION-INDEPENDENT ENDOSPERM 
[Populus euphratica]
Length=371

 Score =   186 bits (473),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 86/97 (89%), Positives = 93/97 (96%), Gaps = 0/97 (0%)
 Frame = +3

Query  510  MAKTSIGCEPVVGSLMPSKKKEYRVTNRLQEGKRPLYAVVFNFIDSRYFNVFATAGGNRV  689
            MAK ++GCEPVVGSL PSKK+EYR+TNRLQEGKRPLYAVVFNFIDSRYFNVFAT GGNRV
Sbjct  1    MAKIALGCEPVVGSLTPSKKREYRLTNRLQEGKRPLYAVVFNFIDSRYFNVFATVGGNRV  60

Query  690  TVYQCLEGGVIAVLQSYIDEDKDESFYTVSWACSIDG  800
            TVYQCL+ GVIAVLQSY+DEDKDESFYTVSWAC+IDG
Sbjct  61   TVYQCLDEGVIAVLQSYVDEDKDESFYTVSWACNIDG  97



>ref|XP_010267786.1| PREDICTED: polycomb group protein FIE2 [Nelumbo nucifera]
 ref|XP_010267787.1| PREDICTED: polycomb group protein FIE2 [Nelumbo nucifera]
 ref|XP_010267788.1| PREDICTED: polycomb group protein FIE2 [Nelumbo nucifera]
Length=370

 Score =   186 bits (472),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 84/98 (86%), Positives = 93/98 (95%), Gaps = 0/98 (0%)
 Frame = +3

Query  510  MAKTSIGCEPVVGSLMPSKKKEYRVTNRLQEGKRPLYAVVFNFIDSRYFNVFATAGGNRV  689
            MAKT+IGCEP VGSL PSKK+EY+VTNR+QEGKRPLYAV FNFID+RY+NVFAT GGNRV
Sbjct  1    MAKTAIGCEPTVGSLAPSKKREYKVTNRIQEGKRPLYAVAFNFIDARYYNVFATVGGNRV  60

Query  690  TVYQCLEGGVIAVLQSYIDEDKDESFYTVSWACSIDGT  803
            TVYQCLEGGVIA LQSY+DEDKDESFYT+SWAC+IDGT
Sbjct  61   TVYQCLEGGVIAALQSYVDEDKDESFYTLSWACNIDGT  98



>ref|XP_009355585.1| PREDICTED: polycomb group protein FIE2-like [Pyrus x bretschneideri]
Length=371

 Score =   184 bits (468),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 87/97 (90%), Positives = 92/97 (95%), Gaps = 0/97 (0%)
 Frame = +3

Query  513  AKTSIGCEPVVGSLMPSKKKEYRVTNRLQEGKRPLYAVVFNFIDSRYFNVFATAGGNRVT  692
            AK ++G EPVVGSL PSKKKEYRVTNRLQEGKRPLYA+VFNFIDSRYFNVFAT GGNRVT
Sbjct  3    AKFALGSEPVVGSLAPSKKKEYRVTNRLQEGKRPLYAIVFNFIDSRYFNVFATVGGNRVT  62

Query  693  VYQCLEGGVIAVLQSYIDEDKDESFYTVSWACSIDGT  803
            VYQCLEGGVIAVLQSYIDEDKDESFYTVSWAC+ DG+
Sbjct  63   VYQCLEGGVIAVLQSYIDEDKDESFYTVSWACNSDGS  99



>gb|ACG69840.1| fertilization-independent endosperm protein [Malus domestica]
Length=371

 Score =   184 bits (467),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 87/97 (90%), Positives = 92/97 (95%), Gaps = 0/97 (0%)
 Frame = +3

Query  513  AKTSIGCEPVVGSLMPSKKKEYRVTNRLQEGKRPLYAVVFNFIDSRYFNVFATAGGNRVT  692
            AK ++G EPVVGSL PSKKKEYRVTNRLQEGKRPLYA+VFNFIDSRYFNVFAT GGNRVT
Sbjct  3    AKFALGSEPVVGSLAPSKKKEYRVTNRLQEGKRPLYAIVFNFIDSRYFNVFATVGGNRVT  62

Query  693  VYQCLEGGVIAVLQSYIDEDKDESFYTVSWACSIDGT  803
            VYQCLEGGVIAVLQSYIDEDKDESFYTVSWAC+ DG+
Sbjct  63   VYQCLEGGVIAVLQSYIDEDKDESFYTVSWACNSDGS  99



>gb|KJB81801.1| hypothetical protein B456_013G163900 [Gossypium raimondii]
Length=369

 Score =   183 bits (465),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 90/98 (92%), Positives = 92/98 (94%), Gaps = 1/98 (1%)
 Frame = +3

Query  510  MAKTSIGCEPVVGSLMPSKKKEYRVTNRLQEGKRPLYAVVFNFIDSRYFNVFATAGGNRV  689
            MAKT IG EPVVGSL  SKKKEYRVTNRLQEGKRPLYAVVFNFIDSRYFNVFAT GGNRV
Sbjct  1    MAKTPIGLEPVVGSLSSSKKKEYRVTNRLQEGKRPLYAVVFNFIDSRYFNVFATVGGNRV  60

Query  690  TVYQCLEGGVIAVLQSYIDEDKDESFYTVSWACSIDGT  803
            TVYQCLEGGVIAVLQSY+DED DESFYTVSWAC+IDGT
Sbjct  61   TVYQCLEGGVIAVLQSYVDED-DESFYTVSWACNIDGT  97



>ref|XP_007211457.1| hypothetical protein PRUPE_ppa007346mg [Prunus persica]
 gb|EMJ12656.1| hypothetical protein PRUPE_ppa007346mg [Prunus persica]
Length=371

 Score =   182 bits (462),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 85/97 (88%), Positives = 90/97 (93%), Gaps = 0/97 (0%)
 Frame = +3

Query  513  AKTSIGCEPVVGSLMPSKKKEYRVTNRLQEGKRPLYAVVFNFIDSRYFNVFATAGGNRVT  692
            AK ++G EPV GSL PSKK+EYRVTNRLQEGKRPLYA+VFNFIDSRYFNVFAT GGNRVT
Sbjct  3    AKFALGSEPVAGSLAPSKKREYRVTNRLQEGKRPLYAIVFNFIDSRYFNVFATVGGNRVT  62

Query  693  VYQCLEGGVIAVLQSYIDEDKDESFYTVSWACSIDGT  803
            VYQCLEGGVIAVLQSYIDEDKDESFYT SWAC+IDG 
Sbjct  63   VYQCLEGGVIAVLQSYIDEDKDESFYTASWACNIDGN  99



>ref|XP_004294343.1| PREDICTED: polycomb group protein FERTILIZATION-INDEPENDENT ENDOSPERM 
[Fragaria vesca subsp. vesca]
Length=370

 Score =   182 bits (461),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 85/98 (87%), Positives = 93/98 (95%), Gaps = 0/98 (0%)
 Frame = +3

Query  510  MAKTSIGCEPVVGSLMPSKKKEYRVTNRLQEGKRPLYAVVFNFIDSRYFNVFATAGGNRV  689
            MAK ++G EPVVGSL  SKK+EYRVTNRLQEGK+P+YAVVFNFIDSRYFNVFAT GGNRV
Sbjct  1    MAKFALGSEPVVGSLSSSKKREYRVTNRLQEGKKPIYAVVFNFIDSRYFNVFATVGGNRV  60

Query  690  TVYQCLEGGVIAVLQSYIDEDKDESFYTVSWACSIDGT  803
            TVY+CLEGGVIAVLQSYIDEDKDESFYTVSWAC++DGT
Sbjct  61   TVYECLEGGVIAVLQSYIDEDKDESFYTVSWACNVDGT  98



>ref|XP_008244348.1| PREDICTED: polycomb group protein FIE2 isoform X1 [Prunus mume]
Length=371

 Score =   181 bits (460),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 84/97 (87%), Positives = 90/97 (93%), Gaps = 0/97 (0%)
 Frame = +3

Query  513  AKTSIGCEPVVGSLMPSKKKEYRVTNRLQEGKRPLYAVVFNFIDSRYFNVFATAGGNRVT  692
            AK ++G EPV GSL PSKK+EYRVTNRLQEGKRPLYA+VFNFIDSRYFNVFAT GGNRVT
Sbjct  3    AKFALGSEPVAGSLAPSKKREYRVTNRLQEGKRPLYAIVFNFIDSRYFNVFATVGGNRVT  62

Query  693  VYQCLEGGVIAVLQSYIDEDKDESFYTVSWACSIDGT  803
            VYQCLEGGVIAVLQSYIDEDKDESFYT SWAC++DG 
Sbjct  63   VYQCLEGGVIAVLQSYIDEDKDESFYTASWACNVDGN  99



>ref|XP_004151960.1| PREDICTED: polycomb group protein FERTILIZATION-INDEPENDENT ENDOSPERM 
[Cucumis sativus]
 gb|KGN57969.1| hypothetical protein Csa_3G416130 [Cucumis sativus]
Length=370

 Score =   181 bits (460),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 85/98 (87%), Positives = 92/98 (94%), Gaps = 0/98 (0%)
 Frame = +3

Query  510  MAKTSIGCEPVVGSLMPSKKKEYRVTNRLQEGKRPLYAVVFNFIDSRYFNVFATAGGNRV  689
            MAK ++G EPVVG L PSKKKEYRVTNRLQEGKRPLYAVVFNFIDSRYFNVFAT GGNR+
Sbjct  1    MAKYALGSEPVVGLLTPSKKKEYRVTNRLQEGKRPLYAVVFNFIDSRYFNVFATVGGNRI  60

Query  690  TVYQCLEGGVIAVLQSYIDEDKDESFYTVSWACSIDGT  803
            TVYQCLEGGVIAVLQSY+DEDKDESFYTVSWA ++DG+
Sbjct  61   TVYQCLEGGVIAVLQSYVDEDKDESFYTVSWAYNVDGS  98



>ref|XP_008454560.1| PREDICTED: polycomb group protein FERTILIZATION-INDEPENDENT ENDOSPERM 
[Cucumis melo]
Length=370

 Score =   181 bits (460),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 85/98 (87%), Positives = 92/98 (94%), Gaps = 0/98 (0%)
 Frame = +3

Query  510  MAKTSIGCEPVVGSLMPSKKKEYRVTNRLQEGKRPLYAVVFNFIDSRYFNVFATAGGNRV  689
            MAK ++G EPVVG L PSKKKEYRVTNRLQEGKRPLYAVVFNFIDSRYFNVFAT GGNR+
Sbjct  1    MAKYALGSEPVVGLLTPSKKKEYRVTNRLQEGKRPLYAVVFNFIDSRYFNVFATVGGNRI  60

Query  690  TVYQCLEGGVIAVLQSYIDEDKDESFYTVSWACSIDGT  803
            TVYQCLEGGVIAVLQSY+DEDKDESFYTVSWA ++DG+
Sbjct  61   TVYQCLEGGVIAVLQSYVDEDKDESFYTVSWAYNVDGS  98



>ref|XP_003520223.1| PREDICTED: polycomb group protein FIE2-like isoform X1 [Glycine 
max]
 gb|KHN46598.1| Polycomb group protein FIE2 [Glycine soja]
Length=381

 Score =   181 bits (458),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 83/93 (89%), Positives = 90/93 (97%), Gaps = 0/93 (0%)
 Frame = +3

Query  525  IGCEPVVGSLMPSKKKEYRVTNRLQEGKRPLYAVVFNFIDSRYFNVFATAGGNRVTVYQC  704
            +GC+PVVGSL  SKK+EYRVTNRLQEGKRPLYAV+FNFIDSRYFNVFAT GGNRVTVYQC
Sbjct  15   LGCDPVVGSLTCSKKREYRVTNRLQEGKRPLYAVIFNFIDSRYFNVFATVGGNRVTVYQC  74

Query  705  LEGGVIAVLQSYIDEDKDESFYTVSWACSIDGT  803
            LEGGVIAVLQSY+DEDKDESFYTVSWAC++DGT
Sbjct  75   LEGGVIAVLQSYVDEDKDESFYTVSWACNVDGT  107



>ref|XP_006588358.1| PREDICTED: FIE isoform X1 [Glycine max]
 gb|KHN03754.1| Polycomb group protein FIE2 [Glycine soja]
Length=382

 Score =   181 bits (458),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 83/93 (89%), Positives = 90/93 (97%), Gaps = 0/93 (0%)
 Frame = +3

Query  525  IGCEPVVGSLMPSKKKEYRVTNRLQEGKRPLYAVVFNFIDSRYFNVFATAGGNRVTVYQC  704
            +GC+PVVGSL  SKK+EYRVTNRLQEGKRPLYAV+FNFIDSRYFNVFAT GGNRVTVYQC
Sbjct  16   LGCDPVVGSLACSKKREYRVTNRLQEGKRPLYAVIFNFIDSRYFNVFATVGGNRVTVYQC  75

Query  705  LEGGVIAVLQSYIDEDKDESFYTVSWACSIDGT  803
            LEGGVIAVLQSY+DEDKDESFYTVSWAC++DGT
Sbjct  76   LEGGVIAVLQSYVDEDKDESFYTVSWACNVDGT  108



>ref|XP_004498406.1| PREDICTED: polycomb group protein FERTILIZATION-INDEPENDENT ENDOSPERM-like 
isoform X1 [Cicer arietinum]
Length=373

 Score =   180 bits (456),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 83/94 (88%), Positives = 91/94 (97%), Gaps = 0/94 (0%)
 Frame = +3

Query  522  SIGCEPVVGSLMPSKKKEYRVTNRLQEGKRPLYAVVFNFIDSRYFNVFATAGGNRVTVYQ  701
            S+G EPV+G+L PSKKKEYRVTNRLQEGKRPLYA+VFNFIDSRYF+VFAT GGNRVTVYQ
Sbjct  6    SLGSEPVIGNLNPSKKKEYRVTNRLQEGKRPLYAIVFNFIDSRYFSVFATVGGNRVTVYQ  65

Query  702  CLEGGVIAVLQSYIDEDKDESFYTVSWACSIDGT  803
            CLEGGVIAVLQSY+DEDK+ESFYTVSWAC+IDGT
Sbjct  66   CLEGGVIAVLQSYVDEDKEESFYTVSWACNIDGT  99



>ref|XP_007144569.1| hypothetical protein PHAVU_007G166700g [Phaseolus vulgaris]
 ref|XP_007144570.1| hypothetical protein PHAVU_007G166700g [Phaseolus vulgaris]
 gb|ESW16563.1| hypothetical protein PHAVU_007G166700g [Phaseolus vulgaris]
 gb|ESW16564.1| hypothetical protein PHAVU_007G166700g [Phaseolus vulgaris]
Length=377

 Score =   177 bits (449),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 82/92 (89%), Positives = 88/92 (96%), Gaps = 0/92 (0%)
 Frame = +3

Query  525  IGCEPVVGSLMPSKKKEYRVTNRLQEGKRPLYAVVFNFIDSRYFNVFATAGGNRVTVYQC  704
            +GC+PVVGSL  SKK+EYRVTNRLQEGKRPLYAVVFNFIDSRYFNVFAT GGNRVTVYQC
Sbjct  11   LGCDPVVGSLTASKKREYRVTNRLQEGKRPLYAVVFNFIDSRYFNVFATVGGNRVTVYQC  70

Query  705  LEGGVIAVLQSYIDEDKDESFYTVSWACSIDG  800
            LE GVIAVLQSY+DEDKDESFYTVSWAC++DG
Sbjct  71   LEEGVIAVLQSYVDEDKDESFYTVSWACNVDG  102



>ref|XP_007149697.1| hypothetical protein PHAVU_005G091500g [Phaseolus vulgaris]
 gb|ESW21691.1| hypothetical protein PHAVU_005G091500g [Phaseolus vulgaris]
Length=379

 Score =   175 bits (444),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 79/93 (85%), Positives = 87/93 (94%), Gaps = 0/93 (0%)
 Frame = +3

Query  525  IGCEPVVGSLMPSKKKEYRVTNRLQEGKRPLYAVVFNFIDSRYFNVFATAGGNRVTVYQC  704
            +GCEPVVGSL P+KK+EYRVTNRLQEGKRP+YAVVFNF+DSRY NVF T GGNR+TVYQC
Sbjct  13   LGCEPVVGSLAPAKKREYRVTNRLQEGKRPIYAVVFNFLDSRYLNVFVTVGGNRITVYQC  72

Query  705  LEGGVIAVLQSYIDEDKDESFYTVSWACSIDGT  803
            LEGGVIAVLQSY+DEDKDESFYTV WACS DG+
Sbjct  73   LEGGVIAVLQSYVDEDKDESFYTVGWACSDDGS  105



>ref|XP_010556028.1| PREDICTED: polycomb group protein FERTILIZATION-INDEPENDENT ENDOSPERM 
isoform X1 [Tarenaya hassleriana]
Length=369

 Score =   175 bits (443),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 82/98 (84%), Positives = 88/98 (90%), Gaps = 0/98 (0%)
 Frame = +3

Query  510  MAKTSIGCEPVVGSLMPSKKKEYRVTNRLQEGKRPLYAVVFNFIDSRYFNVFATAGGNRV  689
            MAK ++G E VVGSL PSKK++YRVTNRLQEGKRPLYAVVFNFIDSR+FNVFAT GGNRV
Sbjct  1    MAKPAVGNESVVGSLTPSKKRDYRVTNRLQEGKRPLYAVVFNFIDSRFFNVFATVGGNRV  60

Query  690  TVYQCLEGGVIAVLQSYIDEDKDESFYTVSWACSIDGT  803
            TVYQCLEGG IA LQSY+DEDKDESFYTVSWAC I G 
Sbjct  61   TVYQCLEGGAIAALQSYVDEDKDESFYTVSWACGIGGN  98



>gb|AAN85567.1| fertilization independent endosperm development protein [Catalpa 
speciosa]
Length=360

 Score =   174 bits (442),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 82/88 (93%), Positives = 86/88 (98%), Gaps = 0/88 (0%)
 Frame = +3

Query  540  VVGSLMPSKKKEYRVTNRLQEGKRPLYAVVFNFIDSRYFNVFATAGGNRVTVYQCLEGGV  719
            +VGSL PSKK+EYRVTNRLQEGKRP+YAVVFNFIDSRYFN FATAGGNRVTVYQCLEGGV
Sbjct  1    MVGSLTPSKKREYRVTNRLQEGKRPIYAVVFNFIDSRYFNAFATAGGNRVTVYQCLEGGV  60

Query  720  IAVLQSYIDEDKDESFYTVSWACSIDGT  803
            IAVLQSYIDEDKDESFYTVSWAC+IDGT
Sbjct  61   IAVLQSYIDEDKDESFYTVSWACNIDGT  88



>ref|XP_006575102.1| PREDICTED: polycomb group protein FIE2-like isoform X2 [Glycine 
max]
Length=380

 Score =   174 bits (441),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 82/93 (88%), Positives = 89/93 (96%), Gaps = 1/93 (1%)
 Frame = +3

Query  525  IGCEPVVGSLMPSKKKEYRVTNRLQEGKRPLYAVVFNFIDSRYFNVFATAGGNRVTVYQC  704
            +GC+PVVGSL  SKK+EYRVTNRLQEGKRPLYAV+FNFIDSRYFNVFAT GGNRVTVYQC
Sbjct  15   LGCDPVVGSLTCSKKREYRVTNRLQEGKRPLYAVIFNFIDSRYFNVFATVGGNRVTVYQC  74

Query  705  LEGGVIAVLQSYIDEDKDESFYTVSWACSIDGT  803
            LEGGVIAVLQSY+DED DESFYTVSWAC++DGT
Sbjct  75   LEGGVIAVLQSYVDED-DESFYTVSWACNVDGT  106



>ref|NP_001237614.1| FIE [Glycine max]
 gb|ABW23440.1| FIE [Glycine max]
Length=381

 Score =   174 bits (441),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 82/93 (88%), Positives = 89/93 (96%), Gaps = 1/93 (1%)
 Frame = +3

Query  525  IGCEPVVGSLMPSKKKEYRVTNRLQEGKRPLYAVVFNFIDSRYFNVFATAGGNRVTVYQC  704
            +GC+PVVGSL  SKK+EYRVTNRLQEGKRPLYAV+FNFIDSRYFNVFAT GGNRVTVYQC
Sbjct  16   LGCDPVVGSLACSKKREYRVTNRLQEGKRPLYAVIFNFIDSRYFNVFATVGGNRVTVYQC  75

Query  705  LEGGVIAVLQSYIDEDKDESFYTVSWACSIDGT  803
            LEGGVIAVLQSY+DED DESFYTVSWAC++DGT
Sbjct  76   LEGGVIAVLQSYVDED-DESFYTVSWACNVDGT  107



>gb|ACU21301.1| unknown [Glycine max]
Length=381

 Score =   174 bits (440),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 82/93 (88%), Positives = 89/93 (96%), Gaps = 1/93 (1%)
 Frame = +3

Query  525  IGCEPVVGSLMPSKKKEYRVTNRLQEGKRPLYAVVFNFIDSRYFNVFATAGGNRVTVYQC  704
            +GC+PVVGSL  SKK+EYRVTNRLQEGKRPLYAV+FNFIDSRYFNVFAT GGNRVTVYQC
Sbjct  16   LGCDPVVGSLACSKKREYRVTNRLQEGKRPLYAVIFNFIDSRYFNVFATVGGNRVTVYQC  75

Query  705  LEGGVIAVLQSYIDEDKDESFYTVSWACSIDGT  803
            LEGGVIAVLQSY+DED DESFYTVSWAC++DGT
Sbjct  76   LEGGVIAVLQSYVDED-DESFYTVSWACNVDGT  107



>ref|XP_004498407.1| PREDICTED: polycomb group protein FERTILIZATION-INDEPENDENT ENDOSPERM-like 
isoform X2 [Cicer arietinum]
Length=372

 Score =   173 bits (439),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 82/94 (87%), Positives = 90/94 (96%), Gaps = 1/94 (1%)
 Frame = +3

Query  522  SIGCEPVVGSLMPSKKKEYRVTNRLQEGKRPLYAVVFNFIDSRYFNVFATAGGNRVTVYQ  701
            S+G EPV+G+L PSKKKEYRVTNRLQEGKRPLYA+VFNFIDSRYF+VFAT GGNRVTVYQ
Sbjct  6    SLGSEPVIGNLNPSKKKEYRVTNRLQEGKRPLYAIVFNFIDSRYFSVFATVGGNRVTVYQ  65

Query  702  CLEGGVIAVLQSYIDEDKDESFYTVSWACSIDGT  803
            CLEGGVIAVLQSY+DED +ESFYTVSWAC+IDGT
Sbjct  66   CLEGGVIAVLQSYVDED-EESFYTVSWACNIDGT  98



>ref|XP_010694252.1| PREDICTED: polycomb group protein FERTILIZATION-INDEPENDENT ENDOSPERM 
[Beta vulgaris subsp. vulgaris]
Length=370

 Score =   171 bits (433),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 79/98 (81%), Positives = 88/98 (90%), Gaps = 0/98 (0%)
 Frame = +3

Query  510  MAKTSIGCEPVVGSLMPSKKKEYRVTNRLQEGKRPLYAVVFNFIDSRYFNVFATAGGNRV  689
            MAK  +GCEPVVGSL   KKK+Y+VTNRLQEGKRP+YAVVFNFIDSR++NVFAT GG+RV
Sbjct  1    MAKVPVGCEPVVGSLTTPKKKDYKVTNRLQEGKRPIYAVVFNFIDSRFYNVFATVGGHRV  60

Query  690  TVYQCLEGGVIAVLQSYIDEDKDESFYTVSWACSIDGT  803
            TVY+CLEGG IAVLQSY DEDK+ESFYTVSWAC ID T
Sbjct  61   TVYRCLEGGTIAVLQSYTDEDKEESFYTVSWACDIDRT  98



>gb|KEH40399.1| fertilization-independent endosperm protein [Medicago truncatula]
Length=372

 Score =   171 bits (432),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 78/93 (84%), Positives = 88/93 (95%), Gaps = 0/93 (0%)
 Frame = +3

Query  522  SIGCEPVVGSLMPSKKKEYRVTNRLQEGKRPLYAVVFNFIDSRYFNVFATAGGNRVTVYQ  701
            S+G EPVVG+L  S+KKEYRVTNRLQEGKRPLYAVVFNFIDSRYFNVFAT GGNRVT+YQ
Sbjct  6    SLGTEPVVGNLNSSRKKEYRVTNRLQEGKRPLYAVVFNFIDSRYFNVFATVGGNRVTIYQ  65

Query  702  CLEGGVIAVLQSYIDEDKDESFYTVSWACSIDG  800
            CL+GGVIAVLQS++D+DKDESFYTVSWAC+ +G
Sbjct  66   CLQGGVIAVLQSFVDDDKDESFYTVSWACNTNG  98



>gb|AEZ06399.1| FIE-like protein [Aquilegia coerulea]
Length=369

 Score =   170 bits (430),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 77/99 (78%), Positives = 91/99 (92%), Gaps = 2/99 (2%)
 Frame = +3

Query  510  MAKTSIGCEPVVGSLM--PSKKKEYRVTNRLQEGKRPLYAVVFNFIDSRYFNVFATAGGN  683
            MAKT++GCEPV+GSL    S KK+YR+TNRLQ+GKRPLYAVVFNF+DSRYFNVFATAGG+
Sbjct  1    MAKTTLGCEPVIGSLTLSTSNKKDYRITNRLQDGKRPLYAVVFNFVDSRYFNVFATAGGH  60

Query  684  RVTVYQCLEGGVIAVLQSYIDEDKDESFYTVSWACSIDG  800
            RVTVY CL+ GVIAVLQSY+DEDKDESFYT++WAC+ +G
Sbjct  61   RVTVYHCLDNGVIAVLQSYVDEDKDESFYTLTWACNAEG  99



>ref|XP_009402595.1| PREDICTED: polycomb group protein FIE2 [Musa acuminata subsp. 
malaccensis]
Length=368

 Score =   167 bits (422),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 70/98 (71%), Positives = 89/98 (91%), Gaps = 0/98 (0%)
 Frame = +3

Query  510  MAKTSIGCEPVVGSLMPSKKKEYRVTNRLQEGKRPLYAVVFNFIDSRYFNVFATAGGNRV  689
            MAK+ +GCEP VGSL  ++K+EY+V+NR+ EGKRPLYA+ FNFID+RY+++FAT GGNRV
Sbjct  1    MAKSGLGCEPAVGSLTAARKREYKVSNRVHEGKRPLYAIAFNFIDARYYDIFATVGGNRV  60

Query  690  TVYQCLEGGVIAVLQSYIDEDKDESFYTVSWACSIDGT  803
            TVY+CLEGG++AVLQ+Y+DEDKDESFYT+SWAC  DGT
Sbjct  61   TVYRCLEGGLVAVLQAYVDEDKDESFYTLSWACDTDGT  98



>ref|XP_010906361.1| PREDICTED: polycomb group protein FIE2 isoform X2 [Elaeis guineensis]
Length=389

 Score =   166 bits (419),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 75/99 (76%), Positives = 89/99 (90%), Gaps = 1/99 (1%)
 Frame = +3

Query  510  MAKT-SIGCEPVVGSLMPSKKKEYRVTNRLQEGKRPLYAVVFNFIDSRYFNVFATAGGNR  686
            MAKT  +GCE  VGSL P+KKKEY+V+NRL EGKRPLYA+ FNFID+RY++VFAT GGNR
Sbjct  20   MAKTGQLGCEAAVGSLTPAKKKEYKVSNRLHEGKRPLYAISFNFIDARYYDVFATVGGNR  79

Query  687  VTVYQCLEGGVIAVLQSYIDEDKDESFYTVSWACSIDGT  803
            VTVY+CLE G+IAVLQ+Y+DEDKDESFYT+SWAC +DGT
Sbjct  80   VTVYRCLEQGLIAVLQAYVDEDKDESFYTLSWACDLDGT  118



>ref|XP_010906358.1| PREDICTED: polycomb group protein FIE2 isoform X1 [Elaeis guineensis]
 ref|XP_010906359.1| PREDICTED: polycomb group protein FIE2 isoform X1 [Elaeis guineensis]
Length=390

 Score =   166 bits (419),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 75/99 (76%), Positives = 89/99 (90%), Gaps = 1/99 (1%)
 Frame = +3

Query  510  MAKT-SIGCEPVVGSLMPSKKKEYRVTNRLQEGKRPLYAVVFNFIDSRYFNVFATAGGNR  686
            MAKT  +GCE  VGSL P+KKKEY+V+NRL EGKRPLYA+ FNFID+RY++VFAT GGNR
Sbjct  20   MAKTGQLGCEAAVGSLTPAKKKEYKVSNRLHEGKRPLYAISFNFIDARYYDVFATVGGNR  79

Query  687  VTVYQCLEGGVIAVLQSYIDEDKDESFYTVSWACSIDGT  803
            VTVY+CLE G+IAVLQ+Y+DEDKDESFYT+SWAC +DGT
Sbjct  80   VTVYRCLEQGLIAVLQAYVDEDKDESFYTLSWACDLDGT  118



>gb|KHN27974.1| Polycomb group protein FERTILIZATION-INDEPENDENT ENDOSPERM, partial 
[Glycine soja]
Length=273

 Score =   160 bits (405),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 72/89 (81%), Positives = 83/89 (93%), Gaps = 0/89 (0%)
 Frame = +3

Query  537  PVVGSLMPSKKKEYRVTNRLQEGKRPLYAVVFNFIDSRYFNVFATAGGNRVTVYQCLEGG  716
            PVVGSL+P+KKK+YRVTNRLQEGKRPLYA+VFN +DSRY +VFAT GGNRVTVYQCL+ G
Sbjct  1    PVVGSLIPAKKKDYRVTNRLQEGKRPLYAIVFNVLDSRYLDVFATVGGNRVTVYQCLKEG  60

Query  717  VIAVLQSYIDEDKDESFYTVSWACSIDGT  803
            VIAVLQSY+DED DESFYTV WAC+++GT
Sbjct  61   VIAVLQSYVDEDNDESFYTVGWACNVNGT  89



>gb|ERM97869.1| hypothetical protein AMTR_s00115p00067610 [Amborella trichopoda]
Length=348

 Score =   162 bits (409),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 73/101 (72%), Positives = 90/101 (89%), Gaps = 3/101 (3%)
 Frame = +3

Query  510  MAKT-SIGCEPVVGSLMPS--KKKEYRVTNRLQEGKRPLYAVVFNFIDSRYFNVFATAGG  680
            MA++  +GCEP VG L  S  K+KEY+VTNRLQEGKRPLYA+ FNFID+RY+N+F+T GG
Sbjct  1    MARSGQLGCEPAVGLLTCSSKKRKEYKVTNRLQEGKRPLYAIAFNFIDARYYNIFSTVGG  60

Query  681  NRVTVYQCLEGGVIAVLQSYIDEDKDESFYTVSWACSIDGT  803
            NRVT+YQCL+GGV+AVLQ+Y+DEDKDESFYT+SWAC +DGT
Sbjct  61   NRVTIYQCLDGGVVAVLQAYVDEDKDESFYTLSWACDLDGT  101



>gb|AIC33178.1| fertilization independent endosperm protein [Elaeis guineensis]
Length=370

 Score =   162 bits (410),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 73/99 (74%), Positives = 88/99 (89%), Gaps = 1/99 (1%)
 Frame = +3

Query  510  MAKT-SIGCEPVVGSLMPSKKKEYRVTNRLQEGKRPLYAVVFNFIDSRYFNVFATAGGNR  686
            MAKT  +GCE  VGSL P+KKKE++V+NRL E KRPLYA+ FNFID+RY++VFAT GGNR
Sbjct  1    MAKTGQLGCEAAVGSLTPAKKKEHKVSNRLHESKRPLYAISFNFIDARYYDVFATVGGNR  60

Query  687  VTVYQCLEGGVIAVLQSYIDEDKDESFYTVSWACSIDGT  803
            VTVY+CLE G+IAVLQ+Y+DEDKDESFYT+SWAC +DGT
Sbjct  61   VTVYRCLEQGLIAVLQAYVDEDKDESFYTLSWACDLDGT  99



>ref|XP_011620319.1| PREDICTED: polycomb group protein FIE2 [Amborella trichopoda]
Length=371

 Score =   162 bits (409),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 73/101 (72%), Positives = 90/101 (89%), Gaps = 3/101 (3%)
 Frame = +3

Query  510  MAKT-SIGCEPVVGSLMPS--KKKEYRVTNRLQEGKRPLYAVVFNFIDSRYFNVFATAGG  680
            MA++  +GCEP VG L  S  K+KEY+VTNRLQEGKRPLYA+ FNFID+RY+N+F+T GG
Sbjct  1    MARSGQLGCEPAVGLLTCSSKKRKEYKVTNRLQEGKRPLYAIAFNFIDARYYNIFSTVGG  60

Query  681  NRVTVYQCLEGGVIAVLQSYIDEDKDESFYTVSWACSIDGT  803
            NRVT+YQCL+GGV+AVLQ+Y+DEDKDESFYT+SWAC +DGT
Sbjct  61   NRVTIYQCLDGGVVAVLQAYVDEDKDESFYTLSWACDLDGT  101



>gb|ABK25056.1| unknown [Picea sitchensis]
Length=369

 Score =   159 bits (402),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 70/99 (71%), Positives = 88/99 (89%), Gaps = 1/99 (1%)
 Frame = +3

Query  510  MAKTSIGCEPVVGSLMPSKKK-EYRVTNRLQEGKRPLYAVVFNFIDSRYFNVFATAGGNR  686
            MA+  +G +  +GS++ SKKK EYRVTNR QEGKRPLYA+ FNFID+RY N+FATAGGNR
Sbjct  1    MARKGLGTDAAIGSIVSSKKKKEYRVTNRFQEGKRPLYAIAFNFIDARYHNIFATAGGNR  60

Query  687  VTVYQCLEGGVIAVLQSYIDEDKDESFYTVSWACSIDGT  803
            VT+YQCLEGGVI+VLQ+Y+DEDK+ESFYT+SWAC ++G+
Sbjct  61   VTIYQCLEGGVISVLQAYVDEDKEESFYTLSWACDVNGS  99



>ref|XP_003541877.1| PREDICTED: polycomb group protein FERTILIZATION-INDEPENDENT ENDOSPERM-like 
[Glycine max]
Length=385

 Score =   159 bits (401),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 71/93 (76%), Positives = 85/93 (91%), Gaps = 0/93 (0%)
 Frame = +3

Query  525  IGCEPVVGSLMPSKKKEYRVTNRLQEGKRPLYAVVFNFIDSRYFNVFATAGGNRVTVYQC  704
            +GC+PVVGSL+P+KKK+Y+VTNRLQEGKRPLYA+VFN ID RY ++FAT GGN+VTVYQC
Sbjct  14   LGCDPVVGSLIPAKKKDYKVTNRLQEGKRPLYAIVFNTIDFRYRDIFATVGGNKVTVYQC  73

Query  705  LEGGVIAVLQSYIDEDKDESFYTVSWACSIDGT  803
            L+ G IAVLQSY DEDK+ESFYTV WAC++DGT
Sbjct  74   LDEGDIAVLQSYADEDKNESFYTVGWACNVDGT  106



>gb|KFK39391.1| fertilization-independent endosperm protein [Arabis alpina]
Length=369

 Score =   157 bits (396),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 68/97 (70%), Positives = 85/97 (88%), Gaps = 0/97 (0%)
 Frame = +3

Query  510  MAKTSIGCEPVVGSLMPSKKKEYRVTNRLQEGKRPLYAVVFNFIDSRYFNVFATAGGNRV  689
            M+K ++G E +VGSL+PS KK Y+VTNR+QEGK+PLYA+VFNF+D+R+F VFA AGGNR+
Sbjct  1    MSKVALGHESLVGSLLPSNKKSYKVTNRIQEGKKPLYALVFNFLDARFFTVFAVAGGNRI  60

Query  690  TVYQCLEGGVIAVLQSYIDEDKDESFYTVSWACSIDG  800
            T+Y CLE G I+ LQSY DEDKDESFYTVSWACS++G
Sbjct  61   TLYNCLEDGAISALQSYSDEDKDESFYTVSWACSVNG  97



>ref|XP_006406354.1| hypothetical protein EUTSA_v10020971mg [Eutrema salsugineum]
 gb|ESQ47807.1| hypothetical protein EUTSA_v10020971mg [Eutrema salsugineum]
Length=369

 Score =   156 bits (395),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 69/97 (71%), Positives = 84/97 (87%), Gaps = 0/97 (0%)
 Frame = +3

Query  510  MAKTSIGCEPVVGSLMPSKKKEYRVTNRLQEGKRPLYAVVFNFIDSRYFNVFATAGGNRV  689
            M+K S+G E +VGSL PS KK Y+VTNR+QEGK+PLYAVVFNF+D+R+FNVF TAGGNR+
Sbjct  1    MSKISLGNESLVGSLTPSNKKSYKVTNRIQEGKKPLYAVVFNFLDARFFNVFVTAGGNRI  60

Query  690  TVYQCLEGGVIAVLQSYIDEDKDESFYTVSWACSIDG  800
            T+Y CLE G I+ LQSY DEDK+ESFYTVSWAC ++G
Sbjct  61   TLYNCLEDGAISALQSYADEDKEESFYTVSWACGVNG  97



>ref|XP_009110247.1| PREDICTED: polycomb group protein FERTILIZATION-INDEPENDENT ENDOSPERM 
[Brassica rapa]
 emb|CDY53612.1| BnaA01g25550D [Brassica napus]
Length=369

 Score =   154 bits (389),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 68/97 (70%), Positives = 83/97 (86%), Gaps = 0/97 (0%)
 Frame = +3

Query  510  MAKTSIGCEPVVGSLMPSKKKEYRVTNRLQEGKRPLYAVVFNFIDSRYFNVFATAGGNRV  689
            M+K ++G E +VGSL PS KK Y+VTNR+QEGK+PLYAVVFNF+DSR+FNVF TAGGN++
Sbjct  1    MSKIALGNESLVGSLTPSNKKSYKVTNRIQEGKKPLYAVVFNFLDSRFFNVFVTAGGNKI  60

Query  690  TVYQCLEGGVIAVLQSYIDEDKDESFYTVSWACSIDG  800
            T+Y CLE G I+ LQSY DEDK+ESFYTVSWAC + G
Sbjct  61   TLYNCLEDGAISALQSYSDEDKEESFYTVSWACGVKG  97



>ref|NP_188710.1| polycomb group protein FERTILIZATION-INDEPENDENT ENDOSPERM [Arabidopsis 
thaliana]
 sp|Q9LT47.2|FIE_ARATH RecName: Full=Polycomb group protein FERTILIZATION-INDEPENDENT 
ENDOSPERM; AltName: Full=Protein FERTILIZATION-INDEPENDENT 
SEED 3 [Arabidopsis thaliana]
 gb|AAD23584.1| fertilization-independent endosperm protein [Arabidopsis thaliana]
 dbj|BAC41793.1| putative fertilization-independent endosperm protein [Arabidopsis 
thaliana]
 gb|AAO63390.1| At3g20730 [Arabidopsis thaliana]
 gb|AEE76418.1| polycomb group protein FERTILIZATION-INDEPENDENT ENDOSPERM [Arabidopsis 
thaliana]
Length=369

 Score =   151 bits (382),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 66/97 (68%), Positives = 83/97 (86%), Gaps = 0/97 (0%)
 Frame = +3

Query  510  MAKTSIGCEPVVGSLMPSKKKEYRVTNRLQEGKRPLYAVVFNFIDSRYFNVFATAGGNRV  689
            M+K ++G E +VGSL PS KK Y+VTNR+QEGK+PLYAVVFNF+D+R+F+VF TAGGNR+
Sbjct  1    MSKITLGNESIVGSLTPSNKKSYKVTNRIQEGKKPLYAVVFNFLDARFFDVFVTAGGNRI  60

Query  690  TVYQCLEGGVIAVLQSYIDEDKDESFYTVSWACSIDG  800
            T+Y CL  G I+ LQSY DEDK+ESFYTVSWAC ++G
Sbjct  61   TLYNCLGDGAISALQSYADEDKEESFYTVSWACGVNG  97



>ref|XP_006297945.1| hypothetical protein CARUB_v10013987mg [Capsella rubella]
 gb|EOA30843.1| hypothetical protein CARUB_v10013987mg [Capsella rubella]
Length=369

 Score =   151 bits (382),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 67/97 (69%), Positives = 81/97 (84%), Gaps = 0/97 (0%)
 Frame = +3

Query  510  MAKTSIGCEPVVGSLMPSKKKEYRVTNRLQEGKRPLYAVVFNFIDSRYFNVFATAGGNRV  689
            M+K  +G E +VGSL PS K  Y+VTNR+QEGK+PLYAVVFNF+DSR+F VF TAGGNR+
Sbjct  1    MSKIVLGNESLVGSLTPSNKNSYKVTNRIQEGKKPLYAVVFNFLDSRFFTVFVTAGGNRI  60

Query  690  TVYQCLEGGVIAVLQSYIDEDKDESFYTVSWACSIDG  800
            T+Y CLE G I+ LQSY DEDK+ESFYTVSWAC ++G
Sbjct  61   TLYNCLEDGAISALQSYTDEDKEESFYTVSWACGVNG  97



>ref|XP_010466273.1| PREDICTED: polycomb group protein FERTILIZATION-INDEPENDENT ENDOSPERM 
[Camelina sativa]
Length=369

 Score =   151 bits (381),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 67/98 (68%), Positives = 83/98 (85%), Gaps = 0/98 (0%)
 Frame = +3

Query  510  MAKTSIGCEPVVGSLMPSKKKEYRVTNRLQEGKRPLYAVVFNFIDSRYFNVFATAGGNRV  689
            M+K  +G E +VGSL PS K  Y+VTNR+QEGK+PLYAVVFNF+DSR+F+VF TAGGNR+
Sbjct  1    MSKIVLGNESLVGSLNPSNKNTYKVTNRIQEGKKPLYAVVFNFLDSRFFSVFVTAGGNRI  60

Query  690  TVYQCLEGGVIAVLQSYIDEDKDESFYTVSWACSIDGT  803
            T+Y CLE G I+ LQSY DEDK+ESFYTVSWAC ++G+
Sbjct  61   TLYNCLEDGAISALQSYTDEDKEESFYTVSWACGVNGS  98



>emb|CDY27567.1| BnaC01g32500D [Brassica napus]
Length=369

 Score =   151 bits (381),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 67/97 (69%), Positives = 82/97 (85%), Gaps = 0/97 (0%)
 Frame = +3

Query  510  MAKTSIGCEPVVGSLMPSKKKEYRVTNRLQEGKRPLYAVVFNFIDSRYFNVFATAGGNRV  689
            M+K ++G E +VGSL PS KK Y+VTNR+QEGK+PLYAVVFNF+DSR+FNVF TAGGN++
Sbjct  1    MSKIALGNESLVGSLTPSNKKSYKVTNRIQEGKKPLYAVVFNFLDSRFFNVFVTAGGNKI  60

Query  690  TVYQCLEGGVIAVLQSYIDEDKDESFYTVSWACSIDG  800
            T+Y CLE G I+ LQSY DEDK+ SFYTVSWAC + G
Sbjct  61   TLYNCLEDGAISALQSYSDEDKEVSFYTVSWACGVKG  97



>ref|XP_002966477.1| hypothetical protein SELMODRAFT_143777 [Selaginella moellendorffii]
 gb|EFJ32504.1| hypothetical protein SELMODRAFT_143777 [Selaginella moellendorffii]
Length=373

 Score =   149 bits (375),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 67/93 (72%), Positives = 79/93 (85%), Gaps = 1/93 (1%)
 Frame = +3

Query  525  IGCEPVVGSLMPSKKK-EYRVTNRLQEGKRPLYAVVFNFIDSRYFNVFATAGGNRVTVYQ  701
            +G  PVVG    SKKK EY++TNRLQEGKRPLYA+ FNF+D RY N FA+AGGNR+TVYQ
Sbjct  10   LGLAPVVGVATASKKKREYKLTNRLQEGKRPLYAIAFNFLDMRYHNTFASAGGNRITVYQ  69

Query  702  CLEGGVIAVLQSYIDEDKDESFYTVSWACSIDG  800
            CLEGG +AVLQ+Y+DEDKDESFYTV+WAC + G
Sbjct  70   CLEGGAVAVLQAYVDEDKDESFYTVTWACDLSG  102



>ref|XP_002982042.1| hypothetical protein SELMODRAFT_179301 [Selaginella moellendorffii]
 gb|EFJ16710.1| hypothetical protein SELMODRAFT_179301 [Selaginella moellendorffii]
Length=373

 Score =   149 bits (375),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 67/93 (72%), Positives = 79/93 (85%), Gaps = 1/93 (1%)
 Frame = +3

Query  525  IGCEPVVGSLMPSKKK-EYRVTNRLQEGKRPLYAVVFNFIDSRYFNVFATAGGNRVTVYQ  701
            +G  PVVG    SKKK EY++TNRLQEGKRPLYA+ FNF+D RY N FA+AGGNR+TVYQ
Sbjct  10   LGLAPVVGVATASKKKREYKLTNRLQEGKRPLYAIAFNFLDMRYHNTFASAGGNRITVYQ  69

Query  702  CLEGGVIAVLQSYIDEDKDESFYTVSWACSIDG  800
            CLEGG +AVLQ+Y+DEDKDESFYTV+WAC + G
Sbjct  70   CLEGGAVAVLQAYVDEDKDESFYTVTWACDLSG  102



>ref|XP_006593294.1| PREDICTED: polycomb group protein FERTILIZATION-INDEPENDENT ENDOSPERM-like 
[Glycine max]
Length=242

 Score =   145 bits (366),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 66/83 (80%), Positives = 75/83 (90%), Gaps = 0/83 (0%)
 Frame = +3

Query  555  MPSKKKEYRVTNRLQEGKRPLYAVVFNFIDSRYFNVFATAGGNRVTVYQCLEGGVIAVLQ  734
            M   KK+YRVTNRLQEGKRPLYA+VFN +DSRY +VFAT GGNRVTVYQCL+ GVIAVLQ
Sbjct  1    MVGLKKDYRVTNRLQEGKRPLYAIVFNVLDSRYLDVFATVGGNRVTVYQCLKEGVIAVLQ  60

Query  735  SYIDEDKDESFYTVSWACSIDGT  803
            SY+DEDKDESFYTV WAC+++GT
Sbjct  61   SYVDEDKDESFYTVGWACNVNGT  83



>ref|XP_010488058.1| PREDICTED: polycomb group protein FERTILIZATION-INDEPENDENT ENDOSPERM-like 
isoform X1 [Camelina sativa]
Length=369

 Score =   148 bits (374),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 66/97 (68%), Positives = 80/97 (82%), Gaps = 0/97 (0%)
 Frame = +3

Query  510  MAKTSIGCEPVVGSLMPSKKKEYRVTNRLQEGKRPLYAVVFNFIDSRYFNVFATAGGNRV  689
            M+K   G E +VGSL PS K  Y+VTNR+QEGK+PLYAVVFNF+DSR+F+VF T GGNR+
Sbjct  1    MSKIVFGNESLVGSLNPSNKNTYKVTNRIQEGKKPLYAVVFNFLDSRFFSVFVTGGGNRI  60

Query  690  TVYQCLEGGVIAVLQSYIDEDKDESFYTVSWACSIDG  800
            T+Y CLE G I+ LQSY DEDK+ESFYTVSWAC ++G
Sbjct  61   TLYNCLEDGAISALQSYTDEDKEESFYTVSWACGVNG  97



>ref|XP_002885401.1| fie [Arabidopsis lyrata subsp. lyrata]
 gb|EFH61660.1| fie [Arabidopsis lyrata subsp. lyrata]
Length=369

 Score =   148 bits (373),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 65/97 (67%), Positives = 82/97 (85%), Gaps = 0/97 (0%)
 Frame = +3

Query  510  MAKTSIGCEPVVGSLMPSKKKEYRVTNRLQEGKRPLYAVVFNFIDSRYFNVFATAGGNRV  689
            M+K ++G E +VGSL PS KK Y+VTNR+QE K+PLYAVVFNF+D+R+F+VF TAGGNR+
Sbjct  1    MSKITLGNESIVGSLTPSNKKSYKVTNRIQEVKKPLYAVVFNFLDARFFDVFVTAGGNRI  60

Query  690  TVYQCLEGGVIAVLQSYIDEDKDESFYTVSWACSIDG  800
            T+Y CL  G I+ LQSY DEDK+ESFYTVSWAC ++G
Sbjct  61   TLYNCLGDGAISALQSYADEDKEESFYTVSWACGVNG  97



>ref|XP_006659098.1| PREDICTED: polycomb group protein FIE2-like [Oryza brachyantha]
Length=378

 Score =   147 bits (371),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 63/93 (68%), Positives = 78/93 (84%), Gaps = 0/93 (0%)
 Frame = +3

Query  525  IGCEPVVGSLMPSKKKEYRVTNRLQEGKRPLYAVVFNFIDSRYFNVFATAGGNRVTVYQC  704
            +GCE  VGSL PS+K+EY+  N+L EGKRPLYA+ FNF+D RY++VFAT GGNRVT Y C
Sbjct  10   LGCEAAVGSLQPSRKREYKACNKLTEGKRPLYAIGFNFLDVRYYDVFATVGGNRVTTYSC  69

Query  705  LEGGVIAVLQSYIDEDKDESFYTVSWACSIDGT  803
            L+ G  A+LQ+Y+DEDKDESFYT+SWAC +DGT
Sbjct  70   LKDGNFAILQAYVDEDKDESFYTLSWACDLDGT  102



>gb|EEC82867.1| hypothetical protein OsI_27737 [Oryza sativa Indica Group]
Length=376

 Score =   145 bits (365),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 63/93 (68%), Positives = 76/93 (82%), Gaps = 0/93 (0%)
 Frame = +3

Query  525  IGCEPVVGSLMPSKKKEYRVTNRLQEGKRPLYAVVFNFIDSRYFNVFATAGGNRVTVYQC  704
            +GCE  VG L PS+K+EY+  N+L EGKRPLYA+ FNF+D RY+ VFAT GGNRVT Y C
Sbjct  10   LGCEAAVGLLAPSRKREYKACNKLTEGKRPLYAIGFNFLDVRYYEVFATVGGNRVTTYSC  69

Query  705  LEGGVIAVLQSYIDEDKDESFYTVSWACSIDGT  803
            L+ G  A+LQ+YIDEDKDESFYT+SWAC +DGT
Sbjct  70   LKDGNFAILQAYIDEDKDESFYTLSWACDLDGT  102



>gb|KHN36729.1| Polycomb group protein FERTILIZATION-INDEPENDENT ENDOSPERM [Glycine 
soja]
Length=404

 Score =   145 bits (365),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 71/117 (61%), Positives = 85/117 (73%), Gaps = 24/117 (21%)
 Frame = +3

Query  525  IGCEPVVGSLMPSKKKEYRVTNRLQEGKRPLYAVVFNFIDSRYFNVFATAGGNR------  686
            +GC+PVVGSL+P+KKK+Y+VTNRLQEGKRPLYA+VFN ID RY ++FAT GGN+      
Sbjct  14   LGCDPVVGSLIPAKKKDYKVTNRLQEGKRPLYAIVFNTIDFRYRDIFATVGGNKPLSILF  73

Query  687  ------------------VTVYQCLEGGVIAVLQSYIDEDKDESFYTVSWACSIDGT  803
                              VTVYQCL+ G IAVLQSY DEDK+ESFYTV WAC++DGT
Sbjct  74   VGGGGADPRLATWSIGSSVTVYQCLDEGDIAVLQSYADEDKNESFYTVGWACNVDGT  130



>gb|AAS13489.1| fertilization independent endosperm [Oryza sativa Japonica Group]
Length=376

 Score =   143 bits (360),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 62/93 (67%), Positives = 75/93 (81%), Gaps = 0/93 (0%)
 Frame = +3

Query  525  IGCEPVVGSLMPSKKKEYRVTNRLQEGKRPLYAVVFNFIDSRYFNVFATAGGNRVTVYQC  704
            +GCE  VG L PS+K+EY+  N+L EGKRPLYA+ FNF+D  Y+ VFAT GGNRVT Y C
Sbjct  10   LGCEAAVGLLAPSRKREYKACNKLTEGKRPLYAIGFNFLDVHYYEVFATVGGNRVTTYSC  69

Query  705  LEGGVIAVLQSYIDEDKDESFYTVSWACSIDGT  803
            L+ G  A+LQ+YIDEDKDESFYT+SWAC +DGT
Sbjct  70   LKDGNFAILQAYIDEDKDESFYTLSWACDLDGT  102



>ref|NP_001060953.1| Os08g0137100 [Oryza sativa Japonica Group]
 dbj|BAD03073.1| putative Polycomb group protein FIE2 [Oryza sativa Japonica Group]
 dbj|BAF22867.1| Os08g0137100 [Oryza sativa Japonica Group]
 dbj|BAG99405.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE68010.1| hypothetical protein OsJ_25971 [Oryza sativa Japonica Group]
Length=376

 Score =   142 bits (359),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 62/93 (67%), Positives = 75/93 (81%), Gaps = 0/93 (0%)
 Frame = +3

Query  525  IGCEPVVGSLMPSKKKEYRVTNRLQEGKRPLYAVVFNFIDSRYFNVFATAGGNRVTVYQC  704
            +GCE  VG L PS+K+EY+  N+L EGKRPLYA+ FNF+D  Y+ VFAT GGNRVT Y C
Sbjct  10   LGCEAAVGLLAPSRKREYKACNKLTEGKRPLYAIGFNFLDFHYYEVFATVGGNRVTTYSC  69

Query  705  LEGGVIAVLQSYIDEDKDESFYTVSWACSIDGT  803
            L+ G  A+LQ+YIDEDKDESFYT+SWAC +DGT
Sbjct  70   LKDGNFAILQAYIDEDKDESFYTLSWACDLDGT  102



>emb|CDY19611.1| BnaA05g20190D [Brassica napus]
Length=380

 Score =   138 bits (347),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 61/97 (63%), Positives = 78/97 (80%), Gaps = 0/97 (0%)
 Frame = +3

Query  510  MAKTSIGCEPVVGSLMPSKKKEYRVTNRLQEGKRPLYAVVFNFIDSRYFNVFATAGGNRV  689
            M+K ++G E +VGSL PS KK Y++TNR+QEGK PLY+VVFN ID+R+FN F +AGGN +
Sbjct  1    MSKIALGNESLVGSLTPSNKKSYKLTNRIQEGKIPLYSVVFNSIDARFFNCFVSAGGNGI  60

Query  690  TVYQCLEGGVIAVLQSYIDEDKDESFYTVSWACSIDG  800
             +Y CLE G I+ L SY DEDK+ESFYTVSWAC ++G
Sbjct  61   NLYNCLEDGGISSLHSYTDEDKEESFYTVSWACGVEG  97



>ref|XP_009145595.1| PREDICTED: polycomb group protein FERTILIZATION-INDEPENDENT ENDOSPERM-like 
[Brassica rapa]
Length=398

 Score =   138 bits (347),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 61/97 (63%), Positives = 78/97 (80%), Gaps = 0/97 (0%)
 Frame = +3

Query  510  MAKTSIGCEPVVGSLMPSKKKEYRVTNRLQEGKRPLYAVVFNFIDSRYFNVFATAGGNRV  689
            M+K ++G E +VGSL PS KK Y++TNR+QEGK PLY+VVFN ID+R+FN F +AGGN +
Sbjct  19   MSKIALGNESLVGSLTPSNKKSYKLTNRIQEGKIPLYSVVFNSIDARFFNCFVSAGGNGI  78

Query  690  TVYQCLEGGVIAVLQSYIDEDKDESFYTVSWACSIDG  800
             +Y CLE G I+ L SY DEDK+ESFYTVSWAC ++G
Sbjct  79   NLYNCLEDGGISSLHSYTDEDKEESFYTVSWACGVEG  115



>ref|XP_010906364.1| PREDICTED: polycomb group protein FIE2 isoform X5 [Elaeis guineensis]
Length=321

 Score =   134 bits (338),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 64/86 (74%), Positives = 76/86 (88%), Gaps = 2/86 (2%)
 Frame = +3

Query  510  MAKT-SIGCEPVVGSLMPSKKKEYRVTNRLQEGKRPLYAVVFNFIDSRYFNVFATAGGNR  686
            MAKT  +GCE  VGSL P+KKKEY+V+NRL EGKRPLYA+ FNFID+RY++VFAT GGNR
Sbjct  20   MAKTGQLGCEAAVGSLTPAKKKEYKVSNRLHEGKRPLYAISFNFIDARYYDVFATVGGNR  79

Query  687  VTVYQCLEGGVIAVLQSYIDEDKDES  764
            VTVY+CLE G+IAVLQ+Y+DED DES
Sbjct  80   VTVYRCLEQGLIAVLQAYVDED-DES  104



>emb|CDY56255.1| BnaCnng29960D [Brassica napus]
Length=393

 Score =   135 bits (340),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 59/97 (61%), Positives = 77/97 (79%), Gaps = 0/97 (0%)
 Frame = +3

Query  510  MAKTSIGCEPVVGSLMPSKKKEYRVTNRLQEGKRPLYAVVFNFIDSRYFNVFATAGGNRV  689
            M+K ++G E +VGSL PS KK Y++TNR+QEG+ PLY+VVFN ID+R+FN F +AGGN +
Sbjct  20   MSKIALGNESLVGSLTPSNKKSYKLTNRIQEGRIPLYSVVFNSIDARFFNCFVSAGGNGI  79

Query  690  TVYQCLEGGVIAVLQSYIDEDKDESFYTVSWACSIDG  800
             +Y CLE G I+ L SY DED +ESFYTVSWAC ++G
Sbjct  80   NLYNCLEDGGISSLHSYTDEDNEESFYTVSWACGVEG  116



>ref|XP_010906363.1| PREDICTED: polycomb group protein FIE2 isoform X4 [Elaeis guineensis]
Length=348

 Score =   134 bits (336),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 61/82 (74%), Positives = 73/82 (89%), Gaps = 1/82 (1%)
 Frame = +3

Query  510  MAKT-SIGCEPVVGSLMPSKKKEYRVTNRLQEGKRPLYAVVFNFIDSRYFNVFATAGGNR  686
            MAKT  +GCE  VGSL P+KKKEY+V+NRL EGKRPLYA+ FNFID+RY++VFAT GGNR
Sbjct  20   MAKTGQLGCEAAVGSLTPAKKKEYKVSNRLHEGKRPLYAISFNFIDARYYDVFATVGGNR  79

Query  687  VTVYQCLEGGVIAVLQSYIDED  752
            VTVY+CLE G+IAVLQ+Y+DED
Sbjct  80   VTVYRCLEQGLIAVLQAYVDED  101



>ref|XP_004972907.1| PREDICTED: polycomb group protein FIE2-like [Setaria italica]
Length=379

 Score =   133 bits (335),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 60/94 (64%), Positives = 77/94 (82%), Gaps = 1/94 (1%)
 Frame = +3

Query  525  IGCEPVVGSLMPSKKKEYRVTNRLQEGKRPLYAVVFNFIDSRYFNVFATAGGNRVTVYQC  704
            +GCE   GSL+PS+K+EY+   +  EGKRPLYA+ FNF+D+RY++VFAT GGNRVT Y+C
Sbjct  10   LGCEAAEGSLVPSRKREYKPCGKHTEGKRPLYAIGFNFMDARYYDVFATVGGNRVTTYRC  69

Query  705  LEGGVIAVLQSYIDEDKDESFYTVSWA-CSIDGT  803
            LE G  AVLQ+Y+DEDKDESFYT+SWA   +DG+
Sbjct  70   LENGSFAVLQAYVDEDKDESFYTLSWARDHVDGS  103



>dbj|BAD03075.1| putative Polycomb group protein FIE2 [Oryza sativa Japonica Group]
 gb|EAZ41450.1| hypothetical protein OsJ_25973 [Oryza sativa Japonica Group]
 dbj|BAH01221.1| unnamed protein product [Oryza sativa Japonica Group]
Length=466

 Score =   134 bits (338),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 56/92 (61%), Positives = 77/92 (84%), Gaps = 0/92 (0%)
 Frame = +3

Query  525  IGCEPVVGSLMPSKKKEYRVTNRLQEGKRPLYAVVFNFIDSRYFNVFATAGGNRVTVYQC  704
            +GCE  VGSL PS+++EY+VTN+  EG+RP+YA+VFNF+D RY+++FATA G R++ Y+C
Sbjct  92   LGCEAAVGSLTPSREREYKVTNKHTEGRRPVYAIVFNFLDVRYYDIFATACGPRLSTYRC  151

Query  705  LEGGVIAVLQSYIDEDKDESFYTVSWACSIDG  800
            L  G  A+LQSY+D+D +ESF+TVSWAC IDG
Sbjct  152  LMNGKFALLQSYLDDDMNESFFTVSWACDIDG  183



>gb|AAT39467.1| FIE2 [Zea mays]
 gb|AFW57436.1| fertilization independent endosperm2 [Zea mays]
Length=358

 Score =   132 bits (333),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 59/94 (63%), Positives = 77/94 (82%), Gaps = 1/94 (1%)
 Frame = +3

Query  525  IGCEPVVGSLMPSKKKEYRVTNRLQEGKRPLYAVVFNFIDSRYFNVFATAGGNRVTVYQC  704
            +GCE   GSL+PS+K+EY+   +  EGKRPLYA+ FNF+D+RY++VFAT GGNRVT Y+C
Sbjct  10   LGCEAAEGSLVPSRKREYKPCGKHTEGKRPLYAIGFNFMDARYYDVFATVGGNRVTTYRC  69

Query  705  LEGGVIAVLQSYIDEDKDESFYTVSWA-CSIDGT  803
            LE G  A+LQ+Y+DEDKDESFYT+SWA   +DG+
Sbjct  70   LENGSFALLQAYVDEDKDESFYTLSWARDHVDGS  103



>ref|XP_003573353.1| PREDICTED: polycomb group protein FIE2 isoform X2 [Brachypodium 
distachyon]
Length=378

 Score =   132 bits (333),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 57/93 (61%), Positives = 78/93 (84%), Gaps = 0/93 (0%)
 Frame = +3

Query  525  IGCEPVVGSLMPSKKKEYRVTNRLQEGKRPLYAVVFNFIDSRYFNVFATAGGNRVTVYQC  704
            +GCE  VGSL PS+++EY++ ++  EGKRPLYA+ FNFID+RY++VFAT GGNRVT Y+ 
Sbjct  10   LGCEAAVGSLTPSRQREYKLCSKHAEGKRPLYAIGFNFIDARYYDVFATVGGNRVTTYRG  69

Query  705  LEGGVIAVLQSYIDEDKDESFYTVSWACSIDGT  803
            L  G +A+LQ+Y+DEDK+ESFYT+SWA  +DG+
Sbjct  70   LPDGNLALLQAYVDEDKEESFYTLSWASDLDGS  102



>ref|XP_010234289.1| PREDICTED: polycomb group protein FIE2 isoform X1 [Brachypodium 
distachyon]
Length=379

 Score =   132 bits (333),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 57/93 (61%), Positives = 78/93 (84%), Gaps = 0/93 (0%)
 Frame = +3

Query  525  IGCEPVVGSLMPSKKKEYRVTNRLQEGKRPLYAVVFNFIDSRYFNVFATAGGNRVTVYQC  704
            +GCE  VGSL PS+++EY++ ++  EGKRPLYA+ FNFID+RY++VFAT GGNRVT Y+ 
Sbjct  10   LGCEAAVGSLTPSRQREYKLCSKHAEGKRPLYAIGFNFIDARYYDVFATVGGNRVTTYRG  69

Query  705  LEGGVIAVLQSYIDEDKDESFYTVSWACSIDGT  803
            L  G +A+LQ+Y+DEDK+ESFYT+SWA  +DG+
Sbjct  70   LPDGNLALLQAYVDEDKEESFYTLSWASDLDGS  102



>ref|NP_001105182.1| polycomb group protein FIE2 [Zea mays]
 sp|Q8VZY6.1|FIE2_MAIZE RecName: Full=Polycomb group protein FIE2; AltName: Full=Protein 
FERTILIZATION-INDEPENDENT ENDOSPERM 2 [Zea mays]
 gb|AAL35974.1| fertilization-independent endosperm protein [Zea mays]
 gb|AAO26658.1| fertilization-independent endosperm protein 2 [Zea mays]
 gb|ACN27011.1| unknown [Zea mays]
 gb|AFW57438.1| fertilization independent endosperm2 isoform 1 [Zea mays]
 gb|AFW57439.1| fertilization independent endosperm2 isoform 2 [Zea mays]
 gb|AFW57440.1| fertilization independent endosperm2 isoform 3 [Zea mays]
Length=379

 Score =   132 bits (333),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 59/94 (63%), Positives = 77/94 (82%), Gaps = 1/94 (1%)
 Frame = +3

Query  525  IGCEPVVGSLMPSKKKEYRVTNRLQEGKRPLYAVVFNFIDSRYFNVFATAGGNRVTVYQC  704
            +GCE   GSL+PS+K+EY+   +  EGKRPLYA+ FNF+D+RY++VFAT GGNRVT Y+C
Sbjct  10   LGCEAAEGSLVPSRKREYKPCGKHTEGKRPLYAIGFNFMDARYYDVFATVGGNRVTTYRC  69

Query  705  LEGGVIAVLQSYIDEDKDESFYTVSWA-CSIDGT  803
            LE G  A+LQ+Y+DEDKDESFYT+SWA   +DG+
Sbjct  70   LENGSFALLQAYVDEDKDESFYTLSWARDHVDGS  103



>gb|AAO26660.1| fertilization-independent endosperm protein 2 [Zea mays]
Length=379

 Score =   132 bits (333),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 59/94 (63%), Positives = 77/94 (82%), Gaps = 1/94 (1%)
 Frame = +3

Query  525  IGCEPVVGSLMPSKKKEYRVTNRLQEGKRPLYAVVFNFIDSRYFNVFATAGGNRVTVYQC  704
            +GCE   GSL+PS+K+EY+   +  EGKRPLYA+ FNF+D+RY++VFAT GGNRVT Y+C
Sbjct  10   LGCEAAEGSLVPSRKREYKPCGKHTEGKRPLYAIGFNFMDARYYDVFATVGGNRVTTYRC  69

Query  705  LEGGVIAVLQSYIDEDKDESFYTVSWA-CSIDGT  803
            LE G  A+LQ+Y+DEDKDESFYT+SWA   +DG+
Sbjct  70   LENGSFALLQAYVDEDKDESFYTLSWARDHVDGS  103



>ref|XP_002443822.1| hypothetical protein SORBIDRAFT_07g002810 [Sorghum bicolor]
 gb|EES13317.1| hypothetical protein SORBIDRAFT_07g002810 [Sorghum bicolor]
Length=379

 Score =   132 bits (332),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 59/94 (63%), Positives = 77/94 (82%), Gaps = 1/94 (1%)
 Frame = +3

Query  525  IGCEPVVGSLMPSKKKEYRVTNRLQEGKRPLYAVVFNFIDSRYFNVFATAGGNRVTVYQC  704
            +GCE   GSL+PS+K+EY+   +  EGKRPLYA+ FNF+D+RY++VFAT GGNR+T Y+C
Sbjct  10   LGCEAAEGSLVPSRKREYKPCGKHTEGKRPLYAIGFNFMDARYYDVFATVGGNRLTTYRC  69

Query  705  LEGGVIAVLQSYIDEDKDESFYTVSWA-CSIDGT  803
            LE G  A+LQ+YIDEDKDESFYT+SWA   +DG+
Sbjct  70   LENGSFALLQAYIDEDKDESFYTLSWARDHVDGS  103



>ref|XP_001785863.1| transcriptional repressor EED/ESC/FIE [Physcomitrella patens]
 gb|EDQ49326.1| transcriptional repressor EED/ESC/FIE [Physcomitrella patens]
Length=362

 Score =   132 bits (331),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 62/90 (69%), Positives = 76/90 (84%), Gaps = 3/90 (3%)
 Frame = +3

Query  543  VGSLMPSKKK--EYRVTNRLQEGKRPLYAVVFNFIDSRYFNVFATAGGNRVTVYQCL-EG  713
            +G L+P KK+  EY+VTNRLQEGKRPLYA+ FN IDSR+++VFA+AGGNRVTVYQCL EG
Sbjct  1    MGDLVPDKKRSREYKVTNRLQEGKRPLYAICFNLIDSRFYHVFASAGGNRVTVYQCLPEG  60

Query  714  GVIAVLQSYIDEDKDESFYTVSWACSIDGT  803
            G +AVL +++DEDK+E FYTVSWA   DG 
Sbjct  61   GAVAVLLAFVDEDKEEEFYTVSWAVGRDGN  90



>gb|AFW57437.1| fertilization independent endosperm2 [Zea mays]
Length=401

 Score =   132 bits (332),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 59/94 (63%), Positives = 77/94 (82%), Gaps = 1/94 (1%)
 Frame = +3

Query  525  IGCEPVVGSLMPSKKKEYRVTNRLQEGKRPLYAVVFNFIDSRYFNVFATAGGNRVTVYQC  704
            +GCE   GSL+PS+K+EY+   +  EGKRPLYA+ FNF+D+RY++VFAT GGNRVT Y+C
Sbjct  10   LGCEAAEGSLVPSRKREYKPCGKHTEGKRPLYAIGFNFMDARYYDVFATVGGNRVTTYRC  69

Query  705  LEGGVIAVLQSYIDEDKDESFYTVSWAC-SIDGT  803
            LE G  A+LQ+Y+DEDKDESFYT+SWA   +DG+
Sbjct  70   LENGSFALLQAYVDEDKDESFYTLSWARDHVDGS  103



>dbj|BAK02952.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=378

 Score =   131 bits (330),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 58/93 (62%), Positives = 75/93 (81%), Gaps = 0/93 (0%)
 Frame = +3

Query  525  IGCEPVVGSLMPSKKKEYRVTNRLQEGKRPLYAVVFNFIDSRYFNVFATAGGNRVTVYQC  704
            +GCE  VGSL PS+ +EY++ ++  EGKRPLYA+ FNFID+RY++VFAT GGNRVT Y+ 
Sbjct  10   LGCEAAVGSLTPSRSREYKLCSKHTEGKRPLYAIGFNFIDARYYDVFATVGGNRVTTYRG  69

Query  705  LEGGVIAVLQSYIDEDKDESFYTVSWACSIDGT  803
            L  G +AVLQ+YID D  +SFYT+SWAC +DGT
Sbjct  70   LPDGNLAVLQAYIDGDNAQSFYTLSWACDLDGT  102



>gb|EMT06373.1| hypothetical protein F775_15931 [Aegilops tauschii]
Length=485

 Score =   132 bits (332),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 58/93 (62%), Positives = 75/93 (81%), Gaps = 0/93 (0%)
 Frame = +3

Query  525  IGCEPVVGSLMPSKKKEYRVTNRLQEGKRPLYAVVFNFIDSRYFNVFATAGGNRVTVYQC  704
            +GCE  VGSL PS+ +EY++ ++  EGKRPLYA+ FNFID+RY++VFAT GGNRVT Y+ 
Sbjct  117  LGCEAAVGSLAPSRSREYKLCSKHTEGKRPLYAIGFNFIDARYYDVFATVGGNRVTTYRG  176

Query  705  LEGGVIAVLQSYIDEDKDESFYTVSWACSIDGT  803
            L  G +AVLQ+YID D  +SFYT+SWAC +DGT
Sbjct  177  LPDGNLAVLQAYIDADDAQSFYTLSWACDLDGT  209



>gb|ADU32888.1| fertilization-independent endosperm protein [Eulaliopsis binata]
 gb|ADU32892.1| fertilization-independent endosperm protein [Eulaliopsis binata]
Length=379

 Score =   131 bits (329),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 59/94 (63%), Positives = 76/94 (81%), Gaps = 1/94 (1%)
 Frame = +3

Query  525  IGCEPVVGSLMPSKKKEYRVTNRLQEGKRPLYAVVFNFIDSRYFNVFATAGGNRVTVYQC  704
            +GCE   GSL+PS+K+EY+   +  EGKRPLYA+ +NF+D RY++VFAT GGNRVT Y+C
Sbjct  10   LGCEAAEGSLVPSRKREYKPCGKHTEGKRPLYAIGYNFMDPRYYDVFATVGGNRVTTYRC  69

Query  705  LEGGVIAVLQSYIDEDKDESFYTVSWA-CSIDGT  803
            LE G  A+LQ+YIDEDKDESFYT+SWA   +DG+
Sbjct  70   LENGSFALLQAYIDEDKDESFYTLSWARDHVDGS  103



>ref|XP_006659808.1| PREDICTED: polycomb group protein FIE2-like [Oryza brachyantha]
Length=465

 Score =   131 bits (330),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 55/92 (60%), Positives = 76/92 (83%), Gaps = 0/92 (0%)
 Frame = +3

Query  525  IGCEPVVGSLMPSKKKEYRVTNRLQEGKRPLYAVVFNFIDSRYFNVFATAGGNRVTVYQC  704
            +GCE VVGSL PS+++EY+ TN+  EGKRP+YA+VFNF+D RY++VFATA G R++ Y+C
Sbjct  87   LGCEEVVGSLTPSEEREYKATNKHTEGKRPVYAIVFNFLDVRYYDVFATACGPRLSTYRC  146

Query  705  LEGGVIAVLQSYIDEDKDESFYTVSWACSIDG  800
            L  G  A+LQ Y+D++ +ESF+TVSWAC +DG
Sbjct  147  LMNGNFALLQGYLDDNNNESFFTVSWACDVDG  178



>emb|CDY19607.1| BnaA05g20150D [Brassica napus]
Length=394

 Score =   129 bits (324),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 55/98 (56%), Positives = 75/98 (77%), Gaps = 0/98 (0%)
 Frame = +3

Query  510  MAKTSIGCEPVVGSLMPSKKKEYRVTNRLQEGKRPLYAVVFNFIDSRYFNVFATAGGNRV  689
            M+K ++G E +VGSL PS KK Y++TN++QEGK PLY+V FNFID+RYF  F +AGGN +
Sbjct  1    MSKITLGNESLVGSLTPSNKKSYKLTNKIQEGKTPLYSVAFNFIDARYFTCFVSAGGNGI  60

Query  690  TVYQCLEGGVIAVLQSYIDEDKDESFYTVSWACSIDGT  803
             +Y CLE G I++L ++ DEDK+E F T SWAC ++G 
Sbjct  61   NLYNCLEDGSISLLYAFADEDKEEEFNTASWACGVEGN  98



>ref|XP_009145589.1| PREDICTED: polycomb group protein FERTILIZATION-INDEPENDENT ENDOSPERM-like 
[Brassica rapa]
Length=394

 Score =   129 bits (324),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 55/97 (57%), Positives = 75/97 (77%), Gaps = 0/97 (0%)
 Frame = +3

Query  510  MAKTSIGCEPVVGSLMPSKKKEYRVTNRLQEGKRPLYAVVFNFIDSRYFNVFATAGGNRV  689
            M+K ++G E +VGSL PS KK Y++TN++QEGK PLY+V FNFID+RYF  F +AGGN +
Sbjct  1    MSKITLGNESLVGSLTPSNKKSYKLTNKIQEGKTPLYSVAFNFIDARYFTCFVSAGGNGI  60

Query  690  TVYQCLEGGVIAVLQSYIDEDKDESFYTVSWACSIDG  800
             +Y CLE G I++L ++ DEDK+E F T SWAC ++G
Sbjct  61   NLYNCLEDGSISLLYAFADEDKEEEFNTASWACRVEG  97



>gb|AAS82596.1| fertilization-independent endosperm protein [Sorghum bicolor]
Length=474

 Score =   125 bits (314),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 60/104 (58%), Positives = 77/104 (74%), Gaps = 11/104 (11%)
 Frame = +3

Query  525  IGCEPVVGSLMPSKKKEYRVTNRLQEGKRPLYAVVFNFIDSRYFNVFATAGGNRV-----  689
            +GCE   GSL+PS+K+EY+   +  EGKRPLYA+ FNF+D+RY++VFAT GGNRV     
Sbjct  127  LGCEAAEGSLVPSRKREYKPCGKHTEGKRPLYAIGFNFMDARYYDVFATVGGNRVWGVLV  186

Query  690  -----TVYQCLEGGVIAVLQSYIDEDKDESFYTVSWAC-SIDGT  803
                 T Y+CLE G  A+LQ+YIDEDKDESFYT+SWA   +DG+
Sbjct  187  DTGKLTTYRCLENGSFALLQAYIDEDKDESFYTLSWARDHVDGS  230



>gb|AAO61683.1| fertilization-independent type 1 [Zea mays]
Length=380

 Score =   123 bits (309),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 55/87 (63%), Positives = 72/87 (83%), Gaps = 1/87 (1%)
 Frame = +3

Query  546  GSLMPSKKKEYRVTNRLQEGKRPLYAVVFNFIDSRYFNVFATAGGNRVTVYQCLEGGVIA  725
             SL+PS+K+EY+   +  EGKRPLYA+ FNF+D+RY++VFAT GGNRVT Y+CLE G  A
Sbjct  18   ASLVPSRKREYKPCGKHTEGKRPLYAIGFNFMDARYYDVFATVGGNRVTTYRCLENGSFA  77

Query  726  VLQSYIDEDKDESFYTVSWA-CSIDGT  803
            +LQ+Y+DEDKDESFYT+SWA   +DG+
Sbjct  78   LLQAYVDEDKDESFYTLSWARDHVDGS  104



>gb|AAO61682.1| fertilization-independent type 1 [Zea mays]
Length=380

 Score =   123 bits (309),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 55/87 (63%), Positives = 72/87 (83%), Gaps = 1/87 (1%)
 Frame = +3

Query  546  GSLMPSKKKEYRVTNRLQEGKRPLYAVVFNFIDSRYFNVFATAGGNRVTVYQCLEGGVIA  725
             SL+PS+K+EY+   +  EGKRPLYA+ FNF+D+RY++VFAT GGNRVT Y+CLE G  A
Sbjct  18   ASLVPSRKREYKPCGKHTEGKRPLYAIGFNFMDARYYDVFATVGGNRVTTYRCLENGSFA  77

Query  726  VLQSYIDEDKDESFYTVSWA-CSIDGT  803
            +LQ+Y+DEDKDESFYT+SWA   +DG+
Sbjct  78   LLQAYVDEDKDESFYTLSWARDHVDGS  104



>ref|XP_003571503.1| PREDICTED: polycomb group protein FIE2-like [Brachypodium distachyon]
Length=380

 Score =   122 bits (307),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 55/96 (57%), Positives = 74/96 (77%), Gaps = 0/96 (0%)
 Frame = +3

Query  516  KTSIGCEPVVGSLMPSKKKEYRVTNRLQEGKRPLYAVVFNFIDSRYFNVFATAGGNRVTV  695
            K  +G E  VGSL PS ++EY++  +  EGK P+YA+ FNF+D+RY NVFAT GGNRVT 
Sbjct  8    KKGLGHEAAVGSLTPSGQREYKLRGKRNEGKCPVYAIGFNFLDARYHNVFATCGGNRVTT  67

Query  696  YQCLEGGVIAVLQSYIDEDKDESFYTVSWACSIDGT  803
            Y+ L  G +AVL++Y+DEDK+ES+YT+SWA  +DGT
Sbjct  68   YRGLPDGKLAVLEAYVDEDKEESYYTLSWAADLDGT  103



>ref|XP_010236415.1| PREDICTED: polycomb group protein FIE2-like, partial [Brachypodium 
distachyon]
Length=404

 Score =   117 bits (293),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 51/93 (55%), Positives = 70/93 (75%), Gaps = 0/93 (0%)
 Frame = +3

Query  525  IGCEPVVGSLMPSKKKEYRVTNRLQEGKRPLYAVVFNFIDSRYFNVFATAGGNRVTVYQC  704
            +GCEP VG L P+ ++EY+ + +L EG  PLYA+ FNFI   + +VFAT G NRVT+Y  
Sbjct  41   LGCEPAVGLLRPNHQREYKFSRKLTEGNCPLYAIGFNFIHPHHKDVFATVGDNRVTIYNG  100

Query  705  LEGGVIAVLQSYIDEDKDESFYTVSWACSIDGT  803
            L+ G +A LQ+YIDEDKDE F+T+SWA ++DG+
Sbjct  101  LQDGNLAPLQAYIDEDKDEKFFTLSWASNLDGS  133



>ref|XP_010906362.1| PREDICTED: polycomb group protein FIE2 isoform X3 [Elaeis guineensis]
Length=368

 Score =   117 bits (292),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 58/99 (59%), Positives = 68/99 (69%), Gaps = 23/99 (23%)
 Frame = +3

Query  510  MAKT-SIGCEPVVGSLMPSKKKEYRVTNRLQEGKRPLYAVVFNFIDSRYFNVFATAGGNR  686
            MAKT  +GCE  VGSL P+KKKEY+V+NRL EGKRPLYA+ FNFID+RY++VFAT GGNR
Sbjct  20   MAKTGQLGCEAAVGSLTPAKKKEYKVSNRLHEGKRPLYAISFNFIDARYYDVFATVGGNR  79

Query  687  VTVYQCLEGGVIAVLQSYIDEDKDESFYTVSWACSIDGT  803
                                  KDESFYT+SWAC +DGT
Sbjct  80   ----------------------KDESFYTLSWACDLDGT  96



>ref|XP_002443823.1| hypothetical protein SORBIDRAFT_07g002820 [Sorghum bicolor]
 gb|EES13318.1| hypothetical protein SORBIDRAFT_07g002820 [Sorghum bicolor]
Length=449

 Score =   116 bits (290),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 50/91 (55%), Positives = 68/91 (75%), Gaps = 0/91 (0%)
 Frame = +3

Query  510  MAKTSIGCEPVVGSLMPSKKKEYRVTNRLQEGKRPLYAVVFNFIDSRYFNVFATAGGNRV  689
            + +  +GCE V G L+PS+K+EY+   +   G  P+YA+ FNF+D RY++VFATA  N V
Sbjct  62   VPQQGLGCEVVEGLLVPSRKREYKSNGKYTVGNHPIYAIGFNFMDVRYYDVFATASSNSV  121

Query  690  TVYQCLEGGVIAVLQSYIDEDKDESFYTVSW  782
            TVY+CLE G   +LQ+Y+DEDKDESFYT+SW
Sbjct  122  TVYRCLENGSFGLLQAYVDEDKDESFYTLSW  152



>gb|AAS82595.1| fertilization-independent endosperm protein [Sorghum bicolor]
Length=447

 Score =   115 bits (289),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 50/91 (55%), Positives = 68/91 (75%), Gaps = 0/91 (0%)
 Frame = +3

Query  510  MAKTSIGCEPVVGSLMPSKKKEYRVTNRLQEGKRPLYAVVFNFIDSRYFNVFATAGGNRV  689
            + +  +GCE V G L+PS+K+EY+   +   G  P+YA+ FNF+D RY++VFATA  N V
Sbjct  62   VPQQGLGCEVVEGLLVPSRKREYKSNGKYTVGNHPIYAIGFNFMDVRYYDVFATASSNSV  121

Query  690  TVYQCLEGGVIAVLQSYIDEDKDESFYTVSW  782
            TVY+CLE G   +LQ+Y+DEDKDESFYT+SW
Sbjct  122  TVYRCLENGSFGLLQAYVDEDKDESFYTLSW  152



>ref|XP_010062968.1| PREDICTED: polycomb group protein FIE2 isoform X2 [Eucalyptus 
grandis]
Length=309

 Score =   112 bits (280),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 51/59 (86%), Positives = 54/59 (92%), Gaps = 0/59 (0%)
 Frame = +3

Query  510  MAKTSIGCEPVVGSLMPSKKKEYRVTNRLQEGKRPLYAVVFNFIDSRYFNVFATAGGNR  686
            MAK + GCEPV G+L PSKK+EYRVTNRLQEGKRPLYAVVFNFIDSRYFNVFAT GGNR
Sbjct  1    MAKIAPGCEPVAGTLTPSKKREYRVTNRLQEGKRPLYAVVFNFIDSRYFNVFATVGGNR  59



>ref|XP_008677779.1| PREDICTED: polycomb group protein FIE1 isoform X1 [Zea mays]
Length=430

 Score =   111 bits (277),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 48/91 (53%), Positives = 67/91 (74%), Gaps = 0/91 (0%)
 Frame = +3

Query  510  MAKTSIGCEPVVGSLMPSKKKEYRVTNRLQEGKRPLYAVVFNFIDSRYFNVFATAGGNRV  689
            + +  +GCE V G L+PS+K+EY+  ++   G  P+YA+ FNFID RY++VFA A  N V
Sbjct  63   VPRQGLGCEVVEGLLVPSRKREYKPNSKYTVGNHPIYAIGFNFIDMRYYDVFAIASCNSV  122

Query  690  TVYQCLEGGVIAVLQSYIDEDKDESFYTVSW  782
             +Y+CLE G   +LQ+Y+DEDKDESFYT+SW
Sbjct  123  IIYRCLENGGFGLLQNYVDEDKDESFYTLSW  153



>gb|AAO26659.1| fertilization-independent endosperm protein 1 [Zea mays]
Length=457

 Score =   111 bits (278),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 48/91 (53%), Positives = 67/91 (74%), Gaps = 0/91 (0%)
 Frame = +3

Query  510  MAKTSIGCEPVVGSLMPSKKKEYRVTNRLQEGKRPLYAVVFNFIDSRYFNVFATAGGNRV  689
            + +  +GCE V G L+PS+K+EY+  ++   G  P+YA+ FNFID RY++VFA A  N V
Sbjct  63   VPRQGLGCEVVEGLLVPSRKREYKPNSKYTVGNHPIYAIGFNFIDMRYYDVFAIASCNSV  122

Query  690  TVYQCLEGGVIAVLQSYIDEDKDESFYTVSW  782
             +Y+CLE G   +LQ+Y+DEDKDESFYT+SW
Sbjct  123  IIYRCLENGGFGLLQNYVDEDKDESFYTLSW  153



>ref|NP_001105181.1| polycomb group protein FIE1 [Zea mays]
 sp|Q8VZY7.1|FIE1_MAIZE RecName: Full=Polycomb group protein FIE1; AltName: Full=Protein 
FERTILIZATION-INDEPENDENT ENDOSPERM 1 [Zea mays]
 gb|AAL35973.1| fertilization-independent endosperm protein [Zea mays]
 gb|AAT39462.1| FIE1 [Zea mays]
 gb|ACN26908.1| unknown [Zea mays]
 gb|AFW61275.1| fertilization independent endosperm1 [Zea mays]
Length=461

 Score =   111 bits (277),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 48/91 (53%), Positives = 67/91 (74%), Gaps = 0/91 (0%)
 Frame = +3

Query  510  MAKTSIGCEPVVGSLMPSKKKEYRVTNRLQEGKRPLYAVVFNFIDSRYFNVFATAGGNRV  689
            + +  +GCE V G L+PS+K+EY+  ++   G  P+YA+ FNFID RY++VFA A  N V
Sbjct  63   VPRQGLGCEVVEGLLVPSRKREYKPNSKYTVGNHPIYAIGFNFIDMRYYDVFAIASCNSV  122

Query  690  TVYQCLEGGVIAVLQSYIDEDKDESFYTVSW  782
             +Y+CLE G   +LQ+Y+DEDKDESFYT+SW
Sbjct  123  IIYRCLENGGFGLLQNYVDEDKDESFYTLSW  153



>gb|AAO61684.1| fertilization-independent type 2 [Zea mays]
Length=461

 Score =   109 bits (273),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 48/91 (53%), Positives = 66/91 (73%), Gaps = 0/91 (0%)
 Frame = +3

Query  510  MAKTSIGCEPVVGSLMPSKKKEYRVTNRLQEGKRPLYAVVFNFIDSRYFNVFATAGGNRV  689
            + +  +GCE V G L+PS K+EY+  ++   G  P+YA+ FNFID RY++VFA A  N V
Sbjct  63   VPRQGLGCEVVEGLLVPSWKREYKPNSKYTVGNHPIYAIGFNFIDMRYYDVFAIASCNSV  122

Query  690  TVYQCLEGGVIAVLQSYIDEDKDESFYTVSW  782
             +Y+CLE G   +LQ+Y+DEDKDESFYT+SW
Sbjct  123  IIYRCLENGGFGLLQNYVDEDKDESFYTLSW  153



>emb|CDY06378.1| BnaC05g31520D [Brassica napus]
Length=269

 Score =   104 bits (260),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 46/84 (55%), Positives = 64/84 (76%), Gaps = 0/84 (0%)
 Frame = +3

Query  510  MAKTSIGCEPVVGSLMPSKKKEYRVTNRLQEGKRPLYAVVFNFIDSRYFNVFATAGGNRV  689
            M+K ++G + +VGSL PS KK Y++TN++QEGK PLY+V FNFID+R+F  F +AGGN +
Sbjct  1    MSKITLGNKSLVGSLTPSNKKLYKLTNKIQEGKIPLYSVAFNFIDARFFTCFVSAGGNGI  60

Query  690  TVYQCLEGGVIAVLQSYIDEDKDE  761
             +Y CLE G I  L ++ DEDK+E
Sbjct  61   NLYNCLEDGSIFSLYAFADEDKEE  84



>ref|XP_010230658.1| PREDICTED: polycomb group protein FIE2-like [Brachypodium distachyon]
Length=402

 Score =   104 bits (259),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 46/81 (57%), Positives = 62/81 (77%), Gaps = 0/81 (0%)
 Frame = +3

Query  561  SKKKEYRVTNRLQEGKRPLYAVVFNFIDSRYFNVFATAGGNRVTVYQCLEGGVIAVLQSY  740
            S ++EY++  +  EG  PLYA+ FNFIDSRY+NVFAT G NRVT+Y+ L  G +A+LQ+Y
Sbjct  33   SHQQEYKLRMKHTEGNYPLYAISFNFIDSRYYNVFATVGTNRVTIYRGLPDGNLALLQAY  92

Query  741  IDEDKDESFYTVSWACSIDGT  803
             DEDKDE F+T+SWA  + G+
Sbjct  93   NDEDKDEEFFTLSWAADLVGS  113



>ref|XP_010092822.1| Polycomb group protein FIE2 [Morus notabilis]
 gb|EXB52562.1| Polycomb group protein FIE2 [Morus notabilis]
Length=406

 Score =   100 bits (250),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 46/54 (85%), Positives = 51/54 (94%), Gaps = 0/54 (0%)
 Frame = +3

Query  510  MAKTSIGCEPVVGSLMPSKKKEYRVTNRLQEGKRPLYAVVFNFIDSRYFNVFAT  671
            MAK ++G EPVVGSL PSKK+EY+VTNRLQEGKRPLYAVVFNFIDSR+FNVFAT
Sbjct  1    MAKFALGSEPVVGSLTPSKKREYKVTNRLQEGKRPLYAVVFNFIDSRFFNVFAT  54


 Score = 79.0 bits (193),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 36/39 (92%), Positives = 38/39 (97%), Gaps = 0/39 (0%)
 Frame = +3

Query  687  VTVYQCLEGGVIAVLQSYIDEDKDESFYTVSWACSIDGT  803
            VTVYQCLEGGVIAVLQSYIDEDKDESFYTVSWAC+ DG+
Sbjct  127  VTVYQCLEGGVIAVLQSYIDEDKDESFYTVSWACNNDGS  165



>ref|XP_007021052.1| Transducin/WD40 repeat-like superfamily protein isoform 2, partial 
[Theobroma cacao]
 gb|EOY12577.1| Transducin/WD40 repeat-like superfamily protein isoform 2, partial 
[Theobroma cacao]
Length=312

 Score = 89.4 bits (220),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 39/43 (91%), Positives = 43/43 (100%), Gaps = 0/43 (0%)
 Frame = +3

Query  675  GGNRVTVYQCLEGGVIAVLQSYIDEDKDESFYTVSWACSIDGT  803
            GGNRVTVYQCL+GGVIAVLQSY+DEDKDESFYT+SWAC+IDGT
Sbjct  2    GGNRVTVYQCLDGGVIAVLQSYVDEDKDESFYTISWACNIDGT  44



>gb|AGZ15741.1| fertilization-independent endosperm-like protein, partial [Prunus 
persica]
Length=39

 Score = 70.9 bits (172),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 31/39 (79%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = +3

Query  510  MAKTSIGCEPVVGSLMPSKKKEYRVTNRLQEGKRPLYAV  626
            MAK ++G EPV GSL PSKK+EYRVTNRLQEGKRPLYA+
Sbjct  1    MAKFALGSEPVAGSLAPSKKREYRVTNRLQEGKRPLYAI  39



>dbj|BAG57461.1| unnamed protein product [Homo sapiens]
Length=156

 Score = 70.1 bits (170),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 35/76 (46%), Positives = 47/76 (62%), Gaps = 2/76 (3%)
 Frame = +3

Query  567  KKEYRVTNRLQEG-KRPLYAVVFNFIDSRYFN-VFATAGGNRVTVYQCLEGGVIAVLQSY  740
            K  ++  N L+E   +PL+ V FN+        VFAT G NRVT+Y+C   G I +LQSY
Sbjct  79   KYSFKCVNSLKEDHNQPLFGVQFNWHSKEGDPLVFATVGSNRVTLYECHSQGEIRLLQSY  138

Query  741  IDEDKDESFYTVSWAC  788
            +D D DE+FYT +W C
Sbjct  139  VDADADENFYTCAWKC  154



>ref|XP_005651813.1| fertilization-independent endosperm protein 2, partial [Coccomyxa 
subellipsoidea C-169]
 gb|EIE27269.1| fertilization-independent endosperm protein 2, partial [Coccomyxa 
subellipsoidea C-169]
Length=365

 Score = 71.6 bits (174),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 31/67 (46%), Positives = 42/67 (63%), Gaps = 0/67 (0%)
 Frame = +3

Query  597  QEGKRPLYAVVFNFIDSRYFNVFATAGGNRVTVYQCLEGGVIAVLQSYIDEDKDESFYTV  776
            +E  +P+Y V FNF      NVFA+ G N  T+Y+CLEGG + +LQ+YIDED  E F+  
Sbjct  1    EEHGQPIYCVSFNFYREGCQNVFASCGSNGATIYRCLEGGAVEILQAYIDEDVQEEFFAC  60

Query  777  SWACSID  797
             W+   D
Sbjct  61   KWSVDPD  67



>emb|CCA26227.1| DNA topoisomerase putative [Albugo laibachii Nc14]
Length=2412

 Score = 72.4 bits (176),  Expect = 7e-11, Method: Composition-based stats.
 Identities = 37/91 (41%), Positives = 56/91 (62%), Gaps = 2/91 (2%)
 Frame = +3

Query  534   EPVVGSLMPS-KKKEYRVTNRLQEGK-RPLYAVVFNFIDSRYFNVFATAGGNRVTVYQCL  707
             +PV  S+  + +KK Y+ T+ ++E   + LY V F  +   Y  VFA AGGNR+TVY+CL
Sbjct  1008  KPVSCSIASNLRKKPYKFTSYVKEDHGKALYCVSFCHVAETYDQVFAAAGGNRITVYECL  1067

Query  708   EGGVIAVLQSYIDEDKDESFYTVSWACSIDG  800
               G + VLQ Y D D++E F+ ++W   + G
Sbjct  1068  PDGGLDVLQVYSDGDQEEQFFIIAWTIDMLG  1098



>emb|CCA26226.1| DNA topoisomerase putative [Albugo laibachii Nc14]
Length=2414

 Score = 72.4 bits (176),  Expect = 7e-11, Method: Composition-based stats.
 Identities = 37/91 (41%), Positives = 56/91 (62%), Gaps = 2/91 (2%)
 Frame = +3

Query  534   EPVVGSLMPS-KKKEYRVTNRLQEGK-RPLYAVVFNFIDSRYFNVFATAGGNRVTVYQCL  707
             +PV  S+  + +KK Y+ T+ ++E   + LY V F  +   Y  VFA AGGNR+TVY+CL
Sbjct  1010  KPVSCSIASNLRKKPYKFTSYVKEDHGKALYCVSFCHVAETYDQVFAAAGGNRITVYECL  1069

Query  708   EGGVIAVLQSYIDEDKDESFYTVSWACSIDG  800
               G + VLQ Y D D++E F+ ++W   + G
Sbjct  1070  PDGGLDVLQVYSDGDQEEQFFIIAWTIDMLG  1100



>emb|CCA26233.1| DNA topoisomerase putative [Albugo laibachii Nc14]
Length=2385

 Score = 72.4 bits (176),  Expect = 7e-11, Method: Composition-based stats.
 Identities = 37/91 (41%), Positives = 56/91 (62%), Gaps = 2/91 (2%)
 Frame = +3

Query  534   EPVVGSLMPS-KKKEYRVTNRLQEGK-RPLYAVVFNFIDSRYFNVFATAGGNRVTVYQCL  707
             +PV  S+  + +KK Y+ T+ ++E   + LY V F  +   Y  VFA AGGNR+TVY+CL
Sbjct  1008  KPVSCSIASNLRKKPYKFTSYVKEDHGKALYCVSFCHVAETYDQVFAAAGGNRITVYECL  1067

Query  708   EGGVIAVLQSYIDEDKDESFYTVSWACSIDG  800
               G + VLQ Y D D++E F+ ++W   + G
Sbjct  1068  PDGGLDVLQVYSDGDQEEQFFIIAWTIDMLG  1098



>emb|CCA26229.1| DNA topoisomerase putative [Albugo laibachii Nc14]
Length=2387

 Score = 72.4 bits (176),  Expect = 7e-11, Method: Composition-based stats.
 Identities = 37/91 (41%), Positives = 56/91 (62%), Gaps = 2/91 (2%)
 Frame = +3

Query  534   EPVVGSLMPS-KKKEYRVTNRLQEGK-RPLYAVVFNFIDSRYFNVFATAGGNRVTVYQCL  707
             +PV  S+  + +KK Y+ T+ ++E   + LY V F  +   Y  VFA AGGNR+TVY+CL
Sbjct  1010  KPVSCSIASNLRKKPYKFTSYVKEDHGKALYCVSFCHVAETYDQVFAAAGGNRITVYECL  1069

Query  708   EGGVIAVLQSYIDEDKDESFYTVSWACSIDG  800
               G + VLQ Y D D++E F+ ++W   + G
Sbjct  1070  PDGGLDVLQVYSDGDQEEQFFIIAWTIDMLG  1100



>emb|CCA26231.1| DNA topoisomerase putative [Albugo laibachii Nc14]
Length=2417

 Score = 72.4 bits (176),  Expect = 7e-11, Method: Composition-based stats.
 Identities = 37/91 (41%), Positives = 56/91 (62%), Gaps = 2/91 (2%)
 Frame = +3

Query  534   EPVVGSLMPS-KKKEYRVTNRLQEGK-RPLYAVVFNFIDSRYFNVFATAGGNRVTVYQCL  707
             +PV  S+  + +KK Y+ T+ ++E   + LY V F  +   Y  VFA AGGNR+TVY+CL
Sbjct  1013  KPVSCSIASNLRKKPYKFTSYVKEDHGKALYCVSFCHVAETYDQVFAAAGGNRITVYECL  1072

Query  708   EGGVIAVLQSYIDEDKDESFYTVSWACSIDG  800
               G + VLQ Y D D++E F+ ++W   + G
Sbjct  1073  PDGGLDVLQVYSDGDQEEQFFIIAWTIDMLG  1103



>emb|CCA26225.1| DNA topoisomerase putative [Albugo laibachii Nc14]
Length=2419

 Score = 72.4 bits (176),  Expect = 7e-11, Method: Composition-based stats.
 Identities = 37/91 (41%), Positives = 56/91 (62%), Gaps = 2/91 (2%)
 Frame = +3

Query  534   EPVVGSLMPS-KKKEYRVTNRLQEGK-RPLYAVVFNFIDSRYFNVFATAGGNRVTVYQCL  707
             +PV  S+  + +KK Y+ T+ ++E   + LY V F  +   Y  VFA AGGNR+TVY+CL
Sbjct  1015  KPVSCSIASNLRKKPYKFTSYVKEDHGKALYCVSFCHVAETYDQVFAAAGGNRITVYECL  1074

Query  708   EGGVIAVLQSYIDEDKDESFYTVSWACSIDG  800
               G + VLQ Y D D++E F+ ++W   + G
Sbjct  1075  PDGGLDVLQVYSDGDQEEQFFIIAWTIDMLG  1105



>emb|CCA26230.1| DNA topoisomerase putative [Albugo laibachii Nc14]
Length=2383

 Score = 72.4 bits (176),  Expect = 7e-11, Method: Composition-based stats.
 Identities = 37/91 (41%), Positives = 56/91 (62%), Gaps = 2/91 (2%)
 Frame = +3

Query  534   EPVVGSLMPS-KKKEYRVTNRLQEGK-RPLYAVVFNFIDSRYFNVFATAGGNRVTVYQCL  707
             +PV  S+  + +KK Y+ T+ ++E   + LY V F  +   Y  VFA AGGNR+TVY+CL
Sbjct  979   KPVSCSIASNLRKKPYKFTSYVKEDHGKALYCVSFCHVAETYDQVFAAAGGNRITVYECL  1038

Query  708   EGGVIAVLQSYIDEDKDESFYTVSWACSIDG  800
               G + VLQ Y D D++E F+ ++W   + G
Sbjct  1039  PDGGLDVLQVYSDGDQEEQFFIIAWTIDMLG  1069



>emb|CCA26228.1| DNA topoisomerase putative [Albugo laibachii Nc14]
Length=2390

 Score = 72.4 bits (176),  Expect = 7e-11, Method: Composition-based stats.
 Identities = 37/91 (41%), Positives = 56/91 (62%), Gaps = 2/91 (2%)
 Frame = +3

Query  534   EPVVGSLMPS-KKKEYRVTNRLQEGK-RPLYAVVFNFIDSRYFNVFATAGGNRVTVYQCL  707
             +PV  S+  + +KK Y+ T+ ++E   + LY V F  +   Y  VFA AGGNR+TVY+CL
Sbjct  1013  KPVSCSIASNLRKKPYKFTSYVKEDHGKALYCVSFCHVAETYDQVFAAAGGNRITVYECL  1072

Query  708   EGGVIAVLQSYIDEDKDESFYTVSWACSIDG  800
               G + VLQ Y D D++E F+ ++W   + G
Sbjct  1073  PDGGLDVLQVYSDGDQEEQFFIIAWTIDMLG  1103



>emb|CCA26232.1| DNA topoisomerase putative [Albugo laibachii Nc14]
Length=2392

 Score = 72.4 bits (176),  Expect = 7e-11, Method: Composition-based stats.
 Identities = 37/91 (41%), Positives = 56/91 (62%), Gaps = 2/91 (2%)
 Frame = +3

Query  534   EPVVGSLMPS-KKKEYRVTNRLQEGK-RPLYAVVFNFIDSRYFNVFATAGGNRVTVYQCL  707
             +PV  S+  + +KK Y+ T+ ++E   + LY V F  +   Y  VFA AGGNR+TVY+CL
Sbjct  1015  KPVSCSIASNLRKKPYKFTSYVKEDHGKALYCVSFCHVAETYDQVFAAAGGNRITVYECL  1074

Query  708   EGGVIAVLQSYIDEDKDESFYTVSWACSIDG  800
               G + VLQ Y D D++E F+ ++W   + G
Sbjct  1075  PDGGLDVLQVYSDGDQEEQFFIIAWTIDMLG  1105



>emb|CCA26234.1| DNA topoisomerase putative [Albugo laibachii Nc14]
Length=2356

 Score = 72.4 bits (176),  Expect = 7e-11, Method: Composition-based stats.
 Identities = 37/91 (41%), Positives = 56/91 (62%), Gaps = 2/91 (2%)
 Frame = +3

Query  534   EPVVGSLMPS-KKKEYRVTNRLQEGK-RPLYAVVFNFIDSRYFNVFATAGGNRVTVYQCL  707
             +PV  S+  + +KK Y+ T+ ++E   + LY V F  +   Y  VFA AGGNR+TVY+CL
Sbjct  979   KPVSCSIASNLRKKPYKFTSYVKEDHGKALYCVSFCHVAETYDQVFAAAGGNRITVYECL  1038

Query  708   EGGVIAVLQSYIDEDKDESFYTVSWACSIDG  800
               G + VLQ Y D D++E F+ ++W   + G
Sbjct  1039  PDGGLDVLQVYSDGDQEEQFFIIAWTIDMLG  1069



>gb|AAR27828.1| embryonic ectoderm development protein [Bos taurus]
Length=144

 Score = 66.2 bits (160),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 34/74 (46%), Positives = 46/74 (62%), Gaps = 2/74 (3%)
 Frame = +3

Query  567  KKEYRVTNRLQEGK-RPLYAVVFNFIDSRYFN-VFATAGGNRVTVYQCLEGGVIAVLQSY  740
            K  ++  N L+E   +PL+ V FN+        VFAT G NRVT+Y+C   G I +LQSY
Sbjct  60   KYSFKCVNSLKEDHNQPLFGVQFNWHSKEGDPLVFATVGSNRVTLYECHSQGEIRLLQSY  119

Query  741  IDEDKDESFYTVSW  782
            +D D DE+FYT +W
Sbjct  120  VDADADENFYTCAW  133



>ref|XP_010767513.1| PREDICTED: polycomb protein EED [Notothenia coriiceps]
Length=215

 Score = 66.2 bits (160),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 34/72 (47%), Positives = 48/72 (67%), Gaps = 4/72 (6%)
 Frame = +3

Query  576  YRVTNRLQEGK-RPLYAVVFNFIDSRYFN--VFATAGGNRVTVYQCLEGGVIAVLQSYID  746
            ++  N L+E   +PL+ V FN+  S+  +  VFAT G NRVT+Y+C   G I +LQSY+D
Sbjct  84   FKCVNSLREDHGQPLFGVQFNW-HSKEGDPLVFATVGSNRVTLYECHSQGEIRLLQSYVD  142

Query  747  EDKDESFYTVSW  782
             D DE+FYT +W
Sbjct  143  ADTDENFYTCAW  154



>ref|XP_002891626.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH67885.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=354

 Score = 67.8 bits (164),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 40/90 (44%), Positives = 49/90 (54%), Gaps = 5/90 (6%)
 Frame = +3

Query  528  GCEPVVGSLMPSKKKEYRVTNRLQEGKRPLYAVVFNFIDSRYFNVFATAGGNRVTVYQCL  707
            G E  VGSL PS + EY+    + E  R + AV FN  D  + +  A AGG +VT Y  L
Sbjct  13   GTEASVGSLTPSNRIEYKAVQWIHESCRRMSAVAFNDFD-HFEDYIAVAGGYQVTCYMLL  71

Query  708  EGGVIA----VLQSYIDEDKDESFYTVSWA  785
                 A     + SY DEDK+ESFY VSWA
Sbjct  72   TSDDCAFTKFTMPSYFDEDKNESFYAVSWA  101



>ref|XP_008479511.1| PREDICTED: polycomb protein eed-like, partial [Diaphorina citri]
Length=174

 Score = 65.5 bits (158),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 30/89 (34%), Positives = 52/89 (58%), Gaps = 2/89 (2%)
 Frame = +3

Query  534  EPVVGSLMPSKKKEYRVTNRLQEGKRPLYAVVFN-FIDSRYFNVFATAGGNRVTVYQCLE  710
            +P+ G+      K+   +++   G +PL+   FN  +      +FAT G NRV++Y+C +
Sbjct  80   QPLFGAQFNHLLKDDHCSHKEDHG-QPLFGAQFNHLLKDDQPRIFATVGSNRVSIYECPD  138

Query  711  GGVIAVLQSYIDEDKDESFYTVSWACSID  797
            GG I +LQ Y D D +E+FYT +W+  ++
Sbjct  139  GGSIKLLQCYADPDIEENFYTCAWSMDLE  167



>emb|CCI46370.1| unnamed protein product [Albugo candida]
Length=386

 Score = 67.4 bits (163),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 30/68 (44%), Positives = 43/68 (63%), Gaps = 0/68 (0%)
 Frame = +3

Query  597  QEGKRPLYAVVFNFIDSRYFNVFATAGGNRVTVYQCLEGGVIAVLQSYIDEDKDESFYTV  776
            ++  + LY V F  +   Y  VFA AGGNR+TVY+CL  G + VLQ Y D D++E F+T+
Sbjct  48   EDHGKALYCVSFCHVAEMYDQVFAAAGGNRITVYECLPDGGLDVLQVYCDGDQEEQFFTI  107

Query  777  SWACSIDG  800
            +W   + G
Sbjct  108  AWTIDMLG  115



>ref|XP_004619104.1| PREDICTED: polycomb protein EED [Sorex araneus]
Length=542

 Score = 67.4 bits (163),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 35/74 (47%), Positives = 46/74 (62%), Gaps = 2/74 (3%)
 Frame = +3

Query  567  KKEYRVTNRLQEGK-RPLYAVVFNFIDSRYFN-VFATAGGNRVTVYQCLEGGVIAVLQSY  740
            K  +R  N L+E   +PL+ V FN+        VFAT G NRVT+Y+C   G I +LQSY
Sbjct  180  KYSFRCVNSLKEDHNQPLFGVQFNWHSKEGDPLVFATVGSNRVTLYECHSQGEIRLLQSY  239

Query  741  IDEDKDESFYTVSW  782
            +D D DE+FYT +W
Sbjct  240  VDADADENFYTCAW  253



>ref|XP_002413703.1| embryonic ectoderm development protein, putative [Ixodes scapularis]
 gb|EEC17011.1| embryonic ectoderm development protein, putative [Ixodes scapularis]
Length=444

 Score = 67.0 bits (162),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 31/71 (44%), Positives = 44/71 (62%), Gaps = 1/71 (1%)
 Frame = +3

Query  576  YRVTNRLQEGK-RPLYAVVFNFIDSRYFNVFATAGGNRVTVYQCLEGGVIAVLQSYIDED  752
            Y+ T  ++E   +PL+ V FN        +FA  G NRVT+Y+CLE G I +LQSY D D
Sbjct  79   YKCTTHIKEDHGQPLFGVQFNPHLKDGLYIFAVVGSNRVTLYECLENGSIKLLQSYCDPD  138

Query  753  KDESFYTVSWA  785
             +E+ YT +W+
Sbjct  139  PEENLYTCAWS  149



>gb|ELU03609.1| hypothetical protein CAPTEDRAFT_1436 [Capitella teleta]
Length=376

 Score = 67.0 bits (162),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 35/75 (47%), Positives = 48/75 (64%), Gaps = 2/75 (3%)
 Frame = +3

Query  567  KKEYRVTNRLQEGK-RPLYAVVFNFIDSRYFNV-FATAGGNRVTVYQCLEGGVIAVLQSY  740
            K +Y+ +  L+E   +P++ V FN+       V FAT G NRVTVY+C E G I ++Q+Y
Sbjct  14   KLQYKCSTYLKEDHGQPVFGVQFNYHTKDGDPVLFATVGSNRVTVYECEESGKITLVQAY  73

Query  741  IDEDKDESFYTVSWA  785
            ID D DESFYT +W 
Sbjct  74   IDADADESFYTCAWT  88



>ref|XP_005274430.1| PREDICTED: polycomb protein EED isoform X4 [Homo sapiens]
 ref|XP_007124973.1| PREDICTED: polycomb protein EED isoform X2 [Physeter catodon]
 ref|XP_008956724.1| PREDICTED: polycomb protein EED isoform X2 [Pan paniscus]
 ref|XP_009245193.1| PREDICTED: polycomb protein EED isoform X2 [Pongo abelii]
Length=361

 Score = 66.6 bits (161),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 35/75 (47%), Positives = 49/75 (65%), Gaps = 4/75 (5%)
 Frame = +3

Query  567  KKEYRVTNRLQEGK-RPLYAVVFNFIDSRYFN--VFATAGGNRVTVYQCLEGGVIAVLQS  737
            K  ++  N L+E   +PL+ V FN+  S+  +  VFAT G NRVT+Y+C   G I +LQS
Sbjct  79   KYSFKCVNSLKEDHNQPLFGVQFNW-HSKEGDPLVFATVGSNRVTLYECHSQGEIRLLQS  137

Query  738  YIDEDKDESFYTVSW  782
            Y+D D DE+FYT +W
Sbjct  138  YVDADADENFYTCAW  152



>ref|XP_010971695.1| PREDICTED: polycomb protein EED isoform X2 [Camelus bactrianus]
Length=347

 Score = 66.6 bits (161),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 35/75 (47%), Positives = 49/75 (65%), Gaps = 4/75 (5%)
 Frame = +3

Query  567  KKEYRVTNRLQEGK-RPLYAVVFNFIDSRYFN--VFATAGGNRVTVYQCLEGGVIAVLQS  737
            K  ++  N L+E   +PL+ V FN+  S+  +  VFAT G NRVT+Y+C   G I +LQS
Sbjct  65   KYSFKCVNSLKEDHNQPLFGVQFNW-HSKEGDPLVFATVGSNRVTLYECHSQGEIRLLQS  123

Query  738  YIDEDKDESFYTVSW  782
            Y+D D DE+FYT +W
Sbjct  124  YVDADADENFYTCAW  138



>ref|XP_004886950.1| PREDICTED: polycomb protein EED isoform X2 [Heterocephalus glaber]
 ref|XP_004868288.1| PREDICTED: polycomb protein EED isoform X2 [Heterocephalus glaber]
Length=361

 Score = 66.6 bits (161),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 35/75 (47%), Positives = 49/75 (65%), Gaps = 4/75 (5%)
 Frame = +3

Query  567  KKEYRVTNRLQEGK-RPLYAVVFNFIDSRYFN--VFATAGGNRVTVYQCLEGGVIAVLQS  737
            K  ++  N L+E   +PL+ V FN+  S+  +  VFAT G NRVT+Y+C   G I +LQS
Sbjct  79   KYSFKCVNSLKEDHNQPLFGVQFNW-HSKEGDPLVFATVGSNRVTLYECHSQGEIRLLQS  137

Query  738  YIDEDKDESFYTVSW  782
            Y+D D DE+FYT +W
Sbjct  138  YVDADADENFYTCAW  152



>gb|KFQ50291.1| Polycomb protein EED, partial [Pelecanus crispus]
Length=284

 Score = 66.2 bits (160),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 35/76 (46%), Positives = 49/76 (64%), Gaps = 4/76 (5%)
 Frame = +3

Query  567  KKEYRVTNRLQEGK-RPLYAVVFNFIDSRYFN--VFATAGGNRVTVYQCLEGGVIAVLQS  737
            K  ++  N L+E   +PL+ V FN+  S+  +  VFAT G NRVT+Y+C   G I +LQS
Sbjct  41   KYSFKCVNSLKEDHGQPLFGVQFNW-HSKEGDPLVFATVGSNRVTLYECHSQGEIRLLQS  99

Query  738  YIDEDKDESFYTVSWA  785
            Y+D D DE+FYT +W 
Sbjct  100  YVDADADENFYTCAWT  115



>ref|XP_005699520.1| PREDICTED: polycomb protein EED [Capra hircus]
Length=737

 Score = 67.4 bits (163),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 35/75 (47%), Positives = 49/75 (65%), Gaps = 4/75 (5%)
 Frame = +3

Query  567  KKEYRVTNRLQEGK-RPLYAVVFNFIDSRYFN--VFATAGGNRVTVYQCLEGGVIAVLQS  737
            K  ++  N L+E   +PL+ V FN+  S+  +  VFAT G NRVT+Y+C   G I +LQS
Sbjct  350  KYSFKCVNSLKEDHNQPLFGVQFNW-HSKEGDPLVFATVGSNRVTLYECHSQGEIRLLQS  408

Query  738  YIDEDKDESFYTVSW  782
            Y+D D DE+FYT +W
Sbjct  409  YVDADADENFYTCAW  423



>ref|XP_008261287.1| PREDICTED: polycomb protein EED isoform X2 [Oryctolagus cuniculus]
Length=367

 Score = 66.6 bits (161),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 35/75 (47%), Positives = 49/75 (65%), Gaps = 4/75 (5%)
 Frame = +3

Query  567  KKEYRVTNRLQEGK-RPLYAVVFNFIDSRYFN--VFATAGGNRVTVYQCLEGGVIAVLQS  737
            K  ++  N L+E   +PL+ V FN+  S+  +  VFAT G NRVT+Y+C   G I +LQS
Sbjct  79   KYSFKCVNSLKEDHNQPLFGVQFNW-HSKEGDPLVFATVGSNRVTLYECHSQGEIRLLQS  137

Query  738  YIDEDKDESFYTVSW  782
            Y+D D DE+FYT +W
Sbjct  138  YVDADADENFYTCAW  152



>ref|XP_008587361.1| PREDICTED: polycomb protein EED isoform X1 [Galeopterus variegatus]
Length=367

 Score = 66.6 bits (161),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 35/75 (47%), Positives = 49/75 (65%), Gaps = 4/75 (5%)
 Frame = +3

Query  567  KKEYRVTNRLQEGK-RPLYAVVFNFIDSRYFN--VFATAGGNRVTVYQCLEGGVIAVLQS  737
            K  ++  N L+E   +PL+ V FN+  S+  +  VFAT G NRVT+Y+C   G I +LQS
Sbjct  79   KYSFKCVNSLKEDHNQPLFGVQFNW-HSKEGDPLVFATVGSNRVTLYECHSQGEIRLLQS  137

Query  738  YIDEDKDESFYTVSW  782
            Y+D D DE+FYT +W
Sbjct  138  YVDADADENFYTCAW  152



>ref|XP_008842363.1| PREDICTED: polycomb protein EED isoform X1 [Nannospalax galili]
Length=367

 Score = 66.6 bits (161),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 35/75 (47%), Positives = 49/75 (65%), Gaps = 4/75 (5%)
 Frame = +3

Query  567  KKEYRVTNRLQEGK-RPLYAVVFNFIDSRYFN--VFATAGGNRVTVYQCLEGGVIAVLQS  737
            K  ++  N L+E   +PL+ V FN+  S+  +  VFAT G NRVT+Y+C   G I +LQS
Sbjct  79   KYSFKCVNSLKEDHNQPLFGVQFNW-HSKEGDPLVFATVGSNRVTLYECHSQGEIRLLQS  137

Query  738  YIDEDKDESFYTVSW  782
            Y+D D DE+FYT +W
Sbjct  138  YVDADADENFYTCAW  152



>ref|XP_007254895.1| PREDICTED: polycomb protein eed [Astyanax mexicanus]
Length=441

 Score = 66.6 bits (161),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 35/75 (47%), Positives = 49/75 (65%), Gaps = 4/75 (5%)
 Frame = +3

Query  567  KKEYRVTNRLQEGK-RPLYAVVFNFIDSRYFN--VFATAGGNRVTVYQCLEGGVIAVLQS  737
            K  ++  N L+E   +PL+ V FN+  S+  +  VFAT G NRVT+Y+C   G I +LQS
Sbjct  79   KYSFKCVNSLKEDHGQPLFGVQFNW-HSKEGDPLVFATVGSNRVTLYECHSHGEIRLLQS  137

Query  738  YIDEDKDESFYTVSW  782
            Y+D D DE+FYT +W
Sbjct  138  YVDADADENFYTCAW  152



>ref|XP_006229726.1| PREDICTED: polycomb protein EED isoform X1 [Rattus norvegicus]
 ref|XP_006507404.1| PREDICTED: polycomb protein EED isoform X1 [Mus musculus]
Length=367

 Score = 66.6 bits (161),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 35/75 (47%), Positives = 49/75 (65%), Gaps = 4/75 (5%)
 Frame = +3

Query  567  KKEYRVTNRLQEGK-RPLYAVVFNFIDSRYFN--VFATAGGNRVTVYQCLEGGVIAVLQS  737
            K  ++  N L+E   +PL+ V FN+  S+  +  VFAT G NRVT+Y+C   G I +LQS
Sbjct  79   KYSFKCVNSLKEDHNQPLFGVQFNW-HSKEGDPLVFATVGSNRVTLYECHSQGEIRLLQS  137

Query  738  YIDEDKDESFYTVSW  782
            Y+D D DE+FYT +W
Sbjct  138  YVDADADENFYTCAW  152



>ref|XP_004683325.1| PREDICTED: polycomb protein EED isoform X1 [Condylura cristata]
Length=466

 Score = 66.6 bits (161),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 35/75 (47%), Positives = 49/75 (65%), Gaps = 4/75 (5%)
 Frame = +3

Query  567  KKEYRVTNRLQEGK-RPLYAVVFNFIDSRYFN--VFATAGGNRVTVYQCLEGGVIAVLQS  737
            K  ++  N L+E   +PL+ V FN+  S+  +  VFAT G NRVT+Y+C   G I +LQS
Sbjct  79   KYSFKCVNSLKEDHNQPLFGVQFNW-HSKEGDPLVFATVGSNRVTLYECHSQGEIRLLQS  137

Query  738  YIDEDKDESFYTVSW  782
            Y+D D DE+FYT +W
Sbjct  138  YVDADADENFYTCAW  152



>ref|XP_011220767.1| PREDICTED: polycomb protein EED isoform X3 [Ailuropoda melanoleuca]
Length=438

 Score = 66.6 bits (161),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 35/75 (47%), Positives = 49/75 (65%), Gaps = 4/75 (5%)
 Frame = +3

Query  567  KKEYRVTNRLQEGK-RPLYAVVFNFIDSRYFN--VFATAGGNRVTVYQCLEGGVIAVLQS  737
            K  ++  N L+E   +PL+ V FN+  S+  +  VFAT G NRVT+Y+C   G I +LQS
Sbjct  79   KYSFKCVNSLKEDHNQPLFGVQFNW-HSKEGDPLVFATVGSNRVTLYECHSQGEIRLLQS  137

Query  738  YIDEDKDESFYTVSW  782
            Y+D D DE+FYT +W
Sbjct  138  YVDADADENFYTCAW  152



>ref|XP_005875687.1| PREDICTED: polycomb protein EED isoform X3 [Myotis brandtii]
Length=362

 Score = 66.6 bits (161),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 35/75 (47%), Positives = 49/75 (65%), Gaps = 4/75 (5%)
 Frame = +3

Query  567  KKEYRVTNRLQEGK-RPLYAVVFNFIDSRYFN--VFATAGGNRVTVYQCLEGGVIAVLQS  737
            K  ++  N L+E   +PL+ V FN+  S+  +  VFAT G NRVT+Y+C   G I +LQS
Sbjct  79   KYSFKCVNSLKEDHNQPLFGVQFNW-HSKEGDPLVFATVGSNRVTLYECHSQGEIRLLQS  137

Query  738  YIDEDKDESFYTVSW  782
            Y+D D DE+FYT +W
Sbjct  138  YVDADADENFYTCAW  152



>ref|XP_005903530.1| PREDICTED: polycomb protein EED isoform X1 [Bos mutus]
Length=466

 Score = 66.6 bits (161),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 35/75 (47%), Positives = 49/75 (65%), Gaps = 4/75 (5%)
 Frame = +3

Query  567  KKEYRVTNRLQEGK-RPLYAVVFNFIDSRYFN--VFATAGGNRVTVYQCLEGGVIAVLQS  737
            K  ++  N L+E   +PL+ V FN+  S+  +  VFAT G NRVT+Y+C   G I +LQS
Sbjct  79   KYSFKCVNSLKEDHNQPLFGVQFNW-HSKEGDPLVFATVGSNRVTLYECHSQGEIRLLQS  137

Query  738  YIDEDKDESFYTVSW  782
            Y+D D DE+FYT +W
Sbjct  138  YVDADADENFYTCAW  152



>ref|XP_005323346.1| PREDICTED: polycomb protein EED isoform X2 [Ictidomys tridecemlineatus]
Length=466

 Score = 66.6 bits (161),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 35/75 (47%), Positives = 49/75 (65%), Gaps = 4/75 (5%)
 Frame = +3

Query  567  KKEYRVTNRLQEGK-RPLYAVVFNFIDSRYFN--VFATAGGNRVTVYQCLEGGVIAVLQS  737
            K  ++  N L+E   +PL+ V FN+  S+  +  VFAT G NRVT+Y+C   G I +LQS
Sbjct  79   KYSFKCVNSLKEDHNQPLFGVQFNW-HSKEGDPLVFATVGSNRVTLYECHSQGEIRLLQS  137

Query  738  YIDEDKDESFYTVSW  782
            Y+D D DE+FYT +W
Sbjct  138  YVDADADENFYTCAW  152



>ref|XP_009478383.1| PREDICTED: polycomb protein EED, partial [Pelecanus crispus]
Length=376

 Score = 66.6 bits (161),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 35/75 (47%), Positives = 49/75 (65%), Gaps = 4/75 (5%)
 Frame = +3

Query  567  KKEYRVTNRLQEGK-RPLYAVVFNFIDSRYFN--VFATAGGNRVTVYQCLEGGVIAVLQS  737
            K  ++  N L+E   +PL+ V FN+  S+  +  VFAT G NRVT+Y+C   G I +LQS
Sbjct  133  KYSFKCVNSLKEDHGQPLFGVQFNW-HSKEGDPLVFATVGSNRVTLYECHSQGEIRLLQS  191

Query  738  YIDEDKDESFYTVSW  782
            Y+D D DE+FYT +W
Sbjct  192  YVDADADENFYTCAW  206



>ref|XP_002917351.2| PREDICTED: polycomb protein EED isoform X4 [Ailuropoda melanoleuca]
Length=413

 Score = 66.6 bits (161),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 35/75 (47%), Positives = 49/75 (65%), Gaps = 4/75 (5%)
 Frame = +3

Query  567  KKEYRVTNRLQEGK-RPLYAVVFNFIDSRYFN--VFATAGGNRVTVYQCLEGGVIAVLQS  737
            K  ++  N L+E   +PL+ V FN+  S+  +  VFAT G NRVT+Y+C   G I +LQS
Sbjct  79   KYSFKCVNSLKEDHNQPLFGVQFNW-HSKEGDPLVFATVGSNRVTLYECHSQGEIRLLQS  137

Query  738  YIDEDKDESFYTVSW  782
            Y+D D DE+FYT +W
Sbjct  138  YVDADADENFYTCAW  152



>ref|XP_007448897.1| PREDICTED: polycomb protein EED isoform X1 [Lipotes vexillifer]
Length=466

 Score = 66.6 bits (161),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 35/75 (47%), Positives = 49/75 (65%), Gaps = 4/75 (5%)
 Frame = +3

Query  567  KKEYRVTNRLQEGK-RPLYAVVFNFIDSRYFN--VFATAGGNRVTVYQCLEGGVIAVLQS  737
            K  ++  N L+E   +PL+ V FN+  S+  +  VFAT G NRVT+Y+C   G I +LQS
Sbjct  79   KYSFKCVNSLKEDHNQPLFGVQFNW-HSKEGDPLVFATVGSNRVTLYECHSQGEIRLLQS  137

Query  738  YIDEDKDESFYTVSW  782
            Y+D D DE+FYT +W
Sbjct  138  YVDADADENFYTCAW  152



>ref|XP_003482629.1| PREDICTED: polycomb protein EED-like isoform 2 [Sus scrofa]
Length=466

 Score = 66.6 bits (161),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 35/75 (47%), Positives = 49/75 (65%), Gaps = 4/75 (5%)
 Frame = +3

Query  567  KKEYRVTNRLQEGK-RPLYAVVFNFIDSRYFN--VFATAGGNRVTVYQCLEGGVIAVLQS  737
            K  ++  N L+E   +PL+ V FN+  S+  +  VFAT G NRVT+Y+C   G I +LQS
Sbjct  79   KYSFKCVNSLKEDHNQPLFGVQFNW-HSKEGDPLVFATVGSNRVTLYECHSQGEIRLLQS  137

Query  738  YIDEDKDESFYTVSW  782
            Y+D D DE+FYT +W
Sbjct  138  YVDADADENFYTCAW  152



>ref|XP_008562484.1| PREDICTED: LOW QUALITY PROTEIN: polycomb protein EED-like, partial 
[Galeopterus variegatus]
Length=409

 Score = 66.6 bits (161),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 34/74 (46%), Positives = 46/74 (62%), Gaps = 2/74 (3%)
 Frame = +3

Query  567  KKEYRVTNRLQEGK-RPLYAVVFNFIDSRYFN-VFATAGGNRVTVYQCLEGGVIAVLQSY  740
            K  ++  N L+E   +PL+ V FN+        VFAT G NRVT+Y+C   G I +LQSY
Sbjct  277  KYSFKCVNSLKEDHNQPLFGVQFNWHSKEGDPLVFATVGSNRVTLYECHSQGEIRLLQSY  336

Query  741  IDEDKDESFYTVSW  782
            +D D DE+FYT +W
Sbjct  337  VDADADENFYTCAW  350



>ref|XP_004658325.1| PREDICTED: polycomb protein EED isoform X1 [Jaculus jaculus]
Length=466

 Score = 66.6 bits (161),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 35/75 (47%), Positives = 49/75 (65%), Gaps = 4/75 (5%)
 Frame = +3

Query  567  KKEYRVTNRLQEGK-RPLYAVVFNFIDSRYFN--VFATAGGNRVTVYQCLEGGVIAVLQS  737
            K  ++  N L+E   +PL+ V FN+  S+  +  VFAT G NRVT+Y+C   G I +LQS
Sbjct  79   KYSFKCVNSLKEDHNQPLFGVQFNW-HSKEGDPLVFATVGSNRVTLYECHSQGEIRLLQS  137

Query  738  YIDEDKDESFYTVSW  782
            Y+D D DE+FYT +W
Sbjct  138  YVDADADENFYTCAW  152



>ref|XP_004416963.1| PREDICTED: polycomb protein EED isoform 1 [Odobenus rosmarus 
divergens]
 ref|XP_004763592.1| PREDICTED: polycomb protein EED isoform X1 [Mustela putorius 
furo]
 ref|XP_004796063.1| PREDICTED: polycomb protein EED isoform X1 [Mustela putorius 
furo]
 ref|XP_005633449.1| PREDICTED: polycomb protein EED isoform X7 [Canis lupus familiaris]
 ref|XP_006736272.1| PREDICTED: polycomb protein EED isoform X1 [Leptonychotes weddellii]
 ref|XP_008538561.1| PREDICTED: polycomb protein EED isoform X1 [Equus przewalskii]
 ref|XP_011284847.1| PREDICTED: polycomb protein EED isoform X1 [Felis catus]
Length=466

 Score = 66.6 bits (161),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 35/75 (47%), Positives = 49/75 (65%), Gaps = 4/75 (5%)
 Frame = +3

Query  567  KKEYRVTNRLQEGK-RPLYAVVFNFIDSRYFN--VFATAGGNRVTVYQCLEGGVIAVLQS  737
            K  ++  N L+E   +PL+ V FN+  S+  +  VFAT G NRVT+Y+C   G I +LQS
Sbjct  79   KYSFKCVNSLKEDHNQPLFGVQFNW-HSKEGDPLVFATVGSNRVTLYECHSQGEIRLLQS  137

Query  738  YIDEDKDESFYTVSW  782
            Y+D D DE+FYT +W
Sbjct  138  YVDADADENFYTCAW  152



>ref|XP_009422196.1| PREDICTED: LOW QUALITY PROTEIN: polycomb protein EED [Pan troglodytes]
Length=440

 Score = 66.6 bits (161),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 35/75 (47%), Positives = 49/75 (65%), Gaps = 4/75 (5%)
 Frame = +3

Query  567  KKEYRVTNRLQEGK-RPLYAVVFNFIDSRYFN--VFATAGGNRVTVYQCLEGGVIAVLQS  737
            K  ++  N L+E   +PL+ V FN+  S+  +  VFAT G NRVT+Y+C   G I +LQS
Sbjct  79   KYSFKCVNSLKEDHNQPLFGVQFNW-HSKEGDPLVFATVGSNRVTLYECHSQGEIRLLQS  137

Query  738  YIDEDKDESFYTVSW  782
            Y+D D DE+FYT +W
Sbjct  138  YVDADADENFYTCAW  152



>ref|XP_010971694.1| PREDICTED: polycomb protein EED isoform X1 [Camelus bactrianus]
Length=452

 Score = 66.6 bits (161),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 35/75 (47%), Positives = 49/75 (65%), Gaps = 4/75 (5%)
 Frame = +3

Query  567  KKEYRVTNRLQEGK-RPLYAVVFNFIDSRYFN--VFATAGGNRVTVYQCLEGGVIAVLQS  737
            K  ++  N L+E   +PL+ V FN+  S+  +  VFAT G NRVT+Y+C   G I +LQS
Sbjct  65   KYSFKCVNSLKEDHNQPLFGVQFNW-HSKEGDPLVFATVGSNRVTLYECHSQGEIRLLQS  123

Query  738  YIDEDKDESFYTVSW  782
            Y+D D DE+FYT +W
Sbjct  124  YVDADADENFYTCAW  138



>ref|XP_002754770.1| PREDICTED: polycomb protein EED isoform X1 [Callithrix jacchus]
 ref|XP_003254618.1| PREDICTED: polycomb protein EED isoform 2 [Nomascus leucogenys]
 ref|XP_004051983.1| PREDICTED: polycomb protein EED-like isoform 2 [Gorilla gorilla 
gorilla]
 ref|XP_005579337.1| PREDICTED: polycomb protein EED isoform X1 [Macaca fascicularis]
 ref|XP_008018622.1| PREDICTED: polycomb protein EED isoform X1 [Chlorocebus sabaeus]
 ref|XP_011543631.1| PREDICTED: polycomb protein EED isoform X1 [Homo sapiens]
 ref|XP_011793886.1| PREDICTED: polycomb protein EED isoform X1 [Colobus angolensis 
palliatus]
 ref|XP_011840307.1| PREDICTED: polycomb protein EED isoform X1 [Mandrillus leucophaeus]
 ref|XP_011930981.1| PREDICTED: polycomb protein EED isoform X1 [Cercocebus atys]
 ref|XP_011717624.1| PREDICTED: polycomb protein EED isoform X1 [Macaca nemestrina]
 gb|AAH68995.1| EED protein [Homo sapiens]
 gb|EAW75129.1| embryonic ectoderm development, isoform CRA_a [Homo sapiens]
 gb|ABZ92272.1| embryonic ectoderm development [synthetic construct]
 gb|EHH23301.1| hypothetical protein EGK_06741 [Macaca mulatta]
 gb|EHH56634.1| hypothetical protein EGM_06087 [Macaca fascicularis]
Length=466

 Score = 66.6 bits (161),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 35/75 (47%), Positives = 49/75 (65%), Gaps = 4/75 (5%)
 Frame = +3

Query  567  KKEYRVTNRLQEGK-RPLYAVVFNFIDSRYFN--VFATAGGNRVTVYQCLEGGVIAVLQS  737
            K  ++  N L+E   +PL+ V FN+  S+  +  VFAT G NRVT+Y+C   G I +LQS
Sbjct  79   KYSFKCVNSLKEDHNQPLFGVQFNW-HSKEGDPLVFATVGSNRVTLYECHSQGEIRLLQS  137

Query  738  YIDEDKDESFYTVSW  782
            Y+D D DE+FYT +W
Sbjct  138  YVDADADENFYTCAW  152



>ref|XP_005995212.1| PREDICTED: polycomb protein EED isoform X2 [Latimeria chalumnae]
Length=389

 Score = 66.6 bits (161),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 35/75 (47%), Positives = 49/75 (65%), Gaps = 4/75 (5%)
 Frame = +3

Query  567  KKEYRVTNRLQEGK-RPLYAVVFNFIDSRYFN--VFATAGGNRVTVYQCLEGGVIAVLQS  737
            K  ++  N L+E   +PL+ V FN+  S+  +  VFAT G NRVT+Y+C   G I +LQS
Sbjct  75   KYSFKCVNSLKEDHGQPLFGVQFNW-HSKEGDPLVFATVGSNRVTLYECHSQGEIRLLQS  133

Query  738  YIDEDKDESFYTVSW  782
            Y+D D DE+FYT +W
Sbjct  134  YVDADADENFYTCAW  148



>ref|XP_003780892.1| PREDICTED: polycomb protein EED isoform 2 [Otolemur garnettii]
Length=466

 Score = 66.6 bits (161),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 35/75 (47%), Positives = 49/75 (65%), Gaps = 4/75 (5%)
 Frame = +3

Query  567  KKEYRVTNRLQEGK-RPLYAVVFNFIDSRYFN--VFATAGGNRVTVYQCLEGGVIAVLQS  737
            K  ++  N L+E   +PL+ V FN+  S+  +  VFAT G NRVT+Y+C   G I +LQS
Sbjct  79   KYSFKCVNSLKEDHNQPLFGVQFNW-HSKEGDPLVFATVGSNRVTLYECHSQGEIRLLQS  137

Query  738  YIDEDKDESFYTVSW  782
            Y+D D DE+FYT +W
Sbjct  138  YVDADADENFYTCAW  152



>ref|XP_006895325.1| PREDICTED: polycomb protein EED isoform X2 [Elephantulus edwardii]
Length=441

 Score = 66.6 bits (161),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 35/75 (47%), Positives = 49/75 (65%), Gaps = 4/75 (5%)
 Frame = +3

Query  567  KKEYRVTNRLQEGK-RPLYAVVFNFIDSRYFN--VFATAGGNRVTVYQCLEGGVIAVLQS  737
            K  ++  N L+E   +PL+ V FN+  S+  +  VFAT G NRVT+Y+C   G I +LQS
Sbjct  79   KYSFKCVNSLKEDHNQPLFGVQFNW-HSKEGDPLVFATVGSNRVTLYECHSQGEIRLLQS  137

Query  738  YIDEDKDESFYTVSW  782
            Y+D D DE+FYT +W
Sbjct  138  YVDADADENFYTCAW  152



>ref|XP_009569572.1| PREDICTED: polycomb protein EED [Cuculus canorus]
Length=515

 Score = 66.6 bits (161),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 35/75 (47%), Positives = 49/75 (65%), Gaps = 4/75 (5%)
 Frame = +3

Query  567  KKEYRVTNRLQEGK-RPLYAVVFNFIDSRYFN--VFATAGGNRVTVYQCLEGGVIAVLQS  737
            K  ++  N L+E   +PL+ V FN+  S+  +  VFAT G NRVT+Y+C   G I +LQS
Sbjct  153  KYSFKCVNSLKEDHGQPLFGVQFNW-HSKEGDPLVFATVGSNRVTLYECHSQGEIRLLQS  211

Query  738  YIDEDKDESFYTVSW  782
            Y+D D DE+FYT +W
Sbjct  212  YVDADADENFYTCAW  226



>ref|XP_001376767.3| PREDICTED: polycomb protein EED [Monodelphis domestica]
Length=441

 Score = 66.6 bits (161),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 35/75 (47%), Positives = 49/75 (65%), Gaps = 4/75 (5%)
 Frame = +3

Query  567  KKEYRVTNRLQEGK-RPLYAVVFNFIDSRYFN--VFATAGGNRVTVYQCLEGGVIAVLQS  737
            K  ++  N L+E   +PL+ V FN+  S+  +  VFAT G NRVT+Y+C   G I +LQS
Sbjct  79   KYSFKCVNSLKEDHNQPLFGVQFNW-HSKEGDPLVFATVGSNRVTLYECHSQGEIRLLQS  137

Query  738  YIDEDKDESFYTVSW  782
            Y+D D DE+FYT +W
Sbjct  138  YVDADADENFYTCAW  152



>ref|XP_011543632.1| PREDICTED: polycomb protein EED isoform X2 [Homo sapiens]
Length=428

 Score = 66.6 bits (161),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 35/75 (47%), Positives = 49/75 (65%), Gaps = 4/75 (5%)
 Frame = +3

Query  567  KKEYRVTNRLQEGK-RPLYAVVFNFIDSRYFN--VFATAGGNRVTVYQCLEGGVIAVLQS  737
            K  ++  N L+E   +PL+ V FN+  S+  +  VFAT G NRVT+Y+C   G I +LQS
Sbjct  79   KYSFKCVNSLKEDHNQPLFGVQFNW-HSKEGDPLVFATVGSNRVTLYECHSQGEIRLLQS  137

Query  738  YIDEDKDESFYTVSW  782
            Y+D D DE+FYT +W
Sbjct  138  YVDADADENFYTCAW  152



>ref|XP_006865019.1| PREDICTED: polycomb protein EED isoform X2 [Chrysochloris asiatica]
Length=441

 Score = 66.6 bits (161),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 35/75 (47%), Positives = 49/75 (65%), Gaps = 4/75 (5%)
 Frame = +3

Query  567  KKEYRVTNRLQEGK-RPLYAVVFNFIDSRYFN--VFATAGGNRVTVYQCLEGGVIAVLQS  737
            K  ++  N L+E   +PL+ V FN+  S+  +  VFAT G NRVT+Y+C   G I +LQS
Sbjct  79   KYSFKCVNSLKEDHNQPLFGVQFNW-HSKEGDPLVFATVGSNRVTLYECHSQGEIRLLQS  137

Query  738  YIDEDKDESFYTVSW  782
            Y+D D DE+FYT +W
Sbjct  138  YVDADADENFYTCAW  152



>ref|XP_004658326.1| PREDICTED: polycomb protein EED isoform X2 [Jaculus jaculus]
Length=441

 Score = 66.6 bits (161),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 35/75 (47%), Positives = 49/75 (65%), Gaps = 4/75 (5%)
 Frame = +3

Query  567  KKEYRVTNRLQEGK-RPLYAVVFNFIDSRYFN--VFATAGGNRVTVYQCLEGGVIAVLQS  737
            K  ++  N L+E   +PL+ V FN+  S+  +  VFAT G NRVT+Y+C   G I +LQS
Sbjct  79   KYSFKCVNSLKEDHNQPLFGVQFNW-HSKEGDPLVFATVGSNRVTLYECHSQGEIRLLQS  137

Query  738  YIDEDKDESFYTVSW  782
            Y+D D DE+FYT +W
Sbjct  138  YVDADADENFYTCAW  152



>ref|XP_004385581.1| PREDICTED: polycomb protein EED [Trichechus manatus latirostris]
 ref|XP_007944459.1| PREDICTED: polycomb protein EED isoform X2 [Orycteropus afer 
afer]
Length=441

 Score = 66.6 bits (161),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 35/75 (47%), Positives = 49/75 (65%), Gaps = 4/75 (5%)
 Frame = +3

Query  567  KKEYRVTNRLQEGK-RPLYAVVFNFIDSRYFN--VFATAGGNRVTVYQCLEGGVIAVLQS  737
            K  ++  N L+E   +PL+ V FN+  S+  +  VFAT G NRVT+Y+C   G I +LQS
Sbjct  79   KYSFKCVNSLKEDHNQPLFGVQFNW-HSKEGDPLVFATVGSNRVTLYECHSQGEIRLLQS  137

Query  738  YIDEDKDESFYTVSW  782
            Y+D D DE+FYT +W
Sbjct  138  YVDADADENFYTCAW  152



>ref|XP_006926751.1| PREDICTED: polycomb protein EED isoform X2 [Pteropus alecto]
 ref|XP_011361564.1| PREDICTED: polycomb protein EED isoform X2 [Pteropus vampyrus]
Length=466

 Score = 66.6 bits (161),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 35/75 (47%), Positives = 49/75 (65%), Gaps = 4/75 (5%)
 Frame = +3

Query  567  KKEYRVTNRLQEGK-RPLYAVVFNFIDSRYFN--VFATAGGNRVTVYQCLEGGVIAVLQS  737
            K  ++  N L+E   +PL+ V FN+  S+  +  VFAT G NRVT+Y+C   G I +LQS
Sbjct  79   KYSFKCVNSLKEDHNQPLFGVQFNW-HSKEGDPLVFATVGSNRVTLYECHSQGEIRLLQS  137

Query  738  YIDEDKDESFYTVSW  782
            Y+D D DE+FYT +W
Sbjct  138  YVDADADENFYTCAW  152



>ref|XP_006895324.1| PREDICTED: polycomb protein EED isoform X1 [Elephantulus edwardii]
Length=466

 Score = 66.6 bits (161),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 35/75 (47%), Positives = 49/75 (65%), Gaps = 4/75 (5%)
 Frame = +3

Query  567  KKEYRVTNRLQEGK-RPLYAVVFNFIDSRYFN--VFATAGGNRVTVYQCLEGGVIAVLQS  737
            K  ++  N L+E   +PL+ V FN+  S+  +  VFAT G NRVT+Y+C   G I +LQS
Sbjct  79   KYSFKCVNSLKEDHNQPLFGVQFNW-HSKEGDPLVFATVGSNRVTLYECHSQGEIRLLQS  137

Query  738  YIDEDKDESFYTVSW  782
            Y+D D DE+FYT +W
Sbjct  138  YVDADADENFYTCAW  152



>ref|XP_002708701.1| PREDICTED: polycomb protein EED isoform X1 [Oryctolagus cuniculus]
 ref|XP_004589884.1| PREDICTED: polycomb protein EED [Ochotona princeps]
Length=441

 Score = 66.6 bits (161),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 35/75 (47%), Positives = 49/75 (65%), Gaps = 4/75 (5%)
 Frame = +3

Query  567  KKEYRVTNRLQEGK-RPLYAVVFNFIDSRYFN--VFATAGGNRVTVYQCLEGGVIAVLQS  737
            K  ++  N L+E   +PL+ V FN+  S+  +  VFAT G NRVT+Y+C   G I +LQS
Sbjct  79   KYSFKCVNSLKEDHNQPLFGVQFNW-HSKEGDPLVFATVGSNRVTLYECHSQGEIRLLQS  137

Query  738  YIDEDKDESFYTVSW  782
            Y+D D DE+FYT +W
Sbjct  138  YVDADADENFYTCAW  152



>ref|XP_005875686.1| PREDICTED: polycomb protein EED isoform X2 [Myotis brandtii]
 ref|XP_008151848.1| PREDICTED: polycomb protein EED isoform X2 [Eptesicus fuscus]
Length=441

 Score = 66.6 bits (161),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 35/75 (47%), Positives = 49/75 (65%), Gaps = 4/75 (5%)
 Frame = +3

Query  567  KKEYRVTNRLQEGK-RPLYAVVFNFIDSRYFN--VFATAGGNRVTVYQCLEGGVIAVLQS  737
            K  ++  N L+E   +PL+ V FN+  S+  +  VFAT G NRVT+Y+C   G I +LQS
Sbjct  79   KYSFKCVNSLKEDHNQPLFGVQFNW-HSKEGDPLVFATVGSNRVTLYECHSQGEIRLLQS  137

Query  738  YIDEDKDESFYTVSW  782
            Y+D D DE+FYT +W
Sbjct  138  YVDADADENFYTCAW  152



>ref|NP_068676.1| polycomb protein EED [Mus musculus]
 ref|NP_003788.2| polycomb protein EED isoform a [Homo sapiens]
 ref|NP_001099748.1| polycomb protein EED [Rattus norvegicus]
 ref|NP_001248195.1| embryonic ectoderm development [Macaca mulatta]
 ref|XP_857750.1| PREDICTED: polycomb protein EED isoformX6 [Canis lupus familiaris]
 ref|XP_002754771.1| PREDICTED: polycomb protein EED isoform X2 [Callithrix jacchus]
 ref|XP_002822368.1| PREDICTED: polycomb protein EED isoform X1 [Pongo abelii]
 ref|XP_003254617.1| PREDICTED: polycomb protein EED isoform 1 [Nomascus leucogenys]
 ref|XP_003129781.3| PREDICTED: polycomb protein EED-like isoform 1 [Sus scrofa]
 ref|XP_003833023.1| PREDICTED: polycomb protein EED isoform X1 [Pan paniscus]
 ref|XP_003935115.1| PREDICTED: polycomb protein EED [Saimiri boliviensis boliviensis]
 ref|XP_004051982.1| PREDICTED: polycomb protein EED-like isoform 1 [Gorilla gorilla 
gorilla]
 ref|XP_004271911.1| PREDICTED: polycomb protein EED [Orcinus orca]
 ref|XP_004416964.1| PREDICTED: polycomb protein EED isoform 2 [Odobenus rosmarus 
divergens]
 ref|XP_004434137.1| PREDICTED: polycomb protein EED [Ceratotherium simum simum]
 ref|XP_004683326.1| PREDICTED: polycomb protein EED isoform X2 [Condylura cristata]
 ref|XP_004763593.1| PREDICTED: polycomb protein EED isoform X2 [Mustela putorius 
furo]
 ref|XP_004796064.1| PREDICTED: polycomb protein EED isoform X2 [Mustela putorius 
furo]
 ref|XP_005379801.1| PREDICTED: polycomb protein EED [Chinchilla lanigera]
 ref|XP_005579338.1| PREDICTED: polycomb protein EED isoform X2 [Macaca fascicularis]
 ref|XP_006144987.1| PREDICTED: polycomb protein EED [Tupaia chinensis]
 ref|XP_006736273.1| PREDICTED: polycomb protein EED isoform X2 [Leptonychotes weddellii]
 ref|XP_007124974.1| PREDICTED: polycomb protein EED isoform X3 [Physeter catodon]
 ref|XP_007168556.1| PREDICTED: polycomb protein EED isoform X2 [Balaenoptera acutorostrata 
scammoni]
 ref|XP_007448898.1| PREDICTED: polycomb protein EED isoform X2 [Lipotes vexillifer]
 ref|XP_007646832.1| PREDICTED: polycomb protein EED isoform X1 [Cricetulus griseus]
 ref|XP_007634572.1| PREDICTED: polycomb protein EED isoform X2 [Cricetulus griseus]
 ref|XP_008018623.1| PREDICTED: polycomb protein EED isoform X2 [Chlorocebus sabaeus]
 ref|XP_008069281.1| PREDICTED: polycomb protein EED [Tarsius syrichta]
 ref|XP_008538569.1| PREDICTED: polycomb protein EED isoform X2 [Equus przewalskii]
 ref|XP_010354324.1| PREDICTED: polycomb protein EED [Rhinopithecus roxellana]
 ref|XP_010632034.1| PREDICTED: polycomb protein EED isoform X2 [Fukomys damarensis]
 ref|XP_011284848.1| PREDICTED: polycomb protein EED isoform X2 [Felis catus]
 ref|XP_011793887.1| PREDICTED: polycomb protein EED isoform X2 [Colobus angolensis 
palliatus]
 ref|XP_011840309.1| PREDICTED: polycomb protein EED isoform X2 [Mandrillus leucophaeus]
 ref|XP_011930982.1| PREDICTED: polycomb protein EED isoform X2 [Cercocebus atys]
 ref|XP_011717625.1| PREDICTED: polycomb protein EED isoform X2 [Macaca nemestrina]
 sp|Q921E6.1|EED_MOUSE RecName: Full=Polycomb protein EED [Mus musculus]
 sp|O75530.2|EED_HUMAN RecName: Full=Polycomb protein EED; Short=hEED; AltName: Full=WD 
protein associating with integrin cytoplasmic tails 1; Short=WAIT-1 
[Homo sapiens]
 gb|AAB38319.1| embryonic ectoderm development protein [Mus musculus]
 gb|AAC95144.1| embryonic ectoderm development protein [Homo sapiens]
 gb|AAH12966.1| Embryonic ectoderm development [Mus musculus]
 dbj|BAC36938.1| unnamed protein product [Mus musculus]
 dbj|BAE20916.1| unnamed protein product [Mus musculus]
 dbj|BAE21915.1| unnamed protein product [Mus musculus]
 gb|EAW75130.1| embryonic ectoderm development, isoform CRA_b [Homo sapiens]
 gb|EDL06770.1| embryonic ectoderm development, isoform CRA_a [Mus musculus]
 gb|EDM18565.1| embryonic ectoderm development (predicted) [Rattus norvegicus]
 gb|AAI68872.1| Embryonic ectoderm development [Rattus norvegicus]
 gb|KFO29250.1| Polycomb protein EED [Fukomys damarensis]
Length=441

 Score = 66.6 bits (161),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 35/75 (47%), Positives = 49/75 (65%), Gaps = 4/75 (5%)
 Frame = +3

Query  567  KKEYRVTNRLQEGK-RPLYAVVFNFIDSRYFN--VFATAGGNRVTVYQCLEGGVIAVLQS  737
            K  ++  N L+E   +PL+ V FN+  S+  +  VFAT G NRVT+Y+C   G I +LQS
Sbjct  79   KYSFKCVNSLKEDHNQPLFGVQFNW-HSKEGDPLVFATVGSNRVTLYECHSQGEIRLLQS  137

Query  738  YIDEDKDESFYTVSW  782
            Y+D D DE+FYT +W
Sbjct  138  YVDADADENFYTCAW  152



>ref|XP_007944458.1| PREDICTED: polycomb protein EED isoform X1 [Orycteropus afer 
afer]
Length=466

 Score = 66.6 bits (161),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 35/75 (47%), Positives = 49/75 (65%), Gaps = 4/75 (5%)
 Frame = +3

Query  567  KKEYRVTNRLQEGK-RPLYAVVFNFIDSRYFN--VFATAGGNRVTVYQCLEGGVIAVLQS  737
            K  ++  N L+E   +PL+ V FN+  S+  +  VFAT G NRVT+Y+C   G I +LQS
Sbjct  79   KYSFKCVNSLKEDHNQPLFGVQFNW-HSKEGDPLVFATVGSNRVTLYECHSQGEIRLLQS  137

Query  738  YIDEDKDESFYTVSW  782
            Y+D D DE+FYT +W
Sbjct  138  YVDADADENFYTCAW  152



>ref|XP_005875685.1| PREDICTED: polycomb protein EED isoform X1 [Myotis brandtii]
 ref|XP_008151847.1| PREDICTED: polycomb protein EED isoform X1 [Eptesicus fuscus]
Length=466

 Score = 66.6 bits (161),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 35/75 (47%), Positives = 49/75 (65%), Gaps = 4/75 (5%)
 Frame = +3

Query  567  KKEYRVTNRLQEGK-RPLYAVVFNFIDSRYFN--VFATAGGNRVTVYQCLEGGVIAVLQS  737
            K  ++  N L+E   +PL+ V FN+  S+  +  VFAT G NRVT+Y+C   G I +LQS
Sbjct  79   KYSFKCVNSLKEDHNQPLFGVQFNW-HSKEGDPLVFATVGSNRVTLYECHSQGEIRLLQS  137

Query  738  YIDEDKDESFYTVSW  782
            Y+D D DE+FYT +W
Sbjct  138  YVDADADENFYTCAW  152



>ref|XP_010000857.1| PREDICTED: polycomb protein EED [Chaetura pelagica]
Length=455

 Score = 66.6 bits (161),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 35/75 (47%), Positives = 49/75 (65%), Gaps = 4/75 (5%)
 Frame = +3

Query  567  KKEYRVTNRLQEGK-RPLYAVVFNFIDSRYFN--VFATAGGNRVTVYQCLEGGVIAVLQS  737
            K  ++  N L+E   +PL+ V FN+  S+  +  VFAT G NRVT+Y+C   G I +LQS
Sbjct  93   KYSFKCVNSLKEDHGQPLFGVQFNW-HSKEGDPLVFATVGSNRVTLYECHSQGEIRLLQS  151

Query  738  YIDEDKDESFYTVSW  782
            Y+D D DE+FYT +W
Sbjct  152  YVDADADENFYTCAW  166



>gb|AAD08714.1| embryonic ectoderm development protein homolog [Homo sapiens]
Length=441

 Score = 66.6 bits (161),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 35/75 (47%), Positives = 49/75 (65%), Gaps = 4/75 (5%)
 Frame = +3

Query  567  KKEYRVTNRLQEGK-RPLYAVVFNFIDSRYFN--VFATAGGNRVTVYQCLEGGVIAVLQS  737
            K  ++  N L+E   +PL+ V FN+  S+  +  VFAT G NRVT+Y+C   G I +LQS
Sbjct  79   KYSFKCVNSLKEDHNQPLFGVQFNW-HSKEGDPLVFATVGSNRVTLYECHSQGEIRLLQS  137

Query  738  YIDEDKDESFYTVSW  782
            Y+D D DE+FYT +W
Sbjct  138  YVDADADENFYTCAW  152



>ref|XP_005323345.1| PREDICTED: polycomb protein EED isoform X1 [Ictidomys tridecemlineatus]
Length=441

 Score = 66.6 bits (161),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 35/75 (47%), Positives = 49/75 (65%), Gaps = 4/75 (5%)
 Frame = +3

Query  567  KKEYRVTNRLQEGK-RPLYAVVFNFIDSRYFN--VFATAGGNRVTVYQCLEGGVIAVLQS  737
            K  ++  N L+E   +PL+ V FN+  S+  +  VFAT G NRVT+Y+C   G I +LQS
Sbjct  79   KYSFKCVNSLKEDHNQPLFGVQFNW-HSKEGDPLVFATVGSNRVTLYECHSQGEIRLLQS  137

Query  738  YIDEDKDESFYTVSW  782
            Y+D D DE+FYT +W
Sbjct  138  YVDADADENFYTCAW  152



>ref|XP_004632625.1| PREDICTED: polycomb protein EED isoform X1 [Octodon degus]
Length=441

 Score = 66.6 bits (161),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 35/75 (47%), Positives = 49/75 (65%), Gaps = 4/75 (5%)
 Frame = +3

Query  567  KKEYRVTNRLQEGK-RPLYAVVFNFIDSRYFN--VFATAGGNRVTVYQCLEGGVIAVLQS  737
            K  ++  N L+E   +PL+ V FN+  S+  +  VFAT G NRVT+Y+C   G I +LQS
Sbjct  79   KYSFKCVNSLKEDHNQPLFGVQFNW-HSKEGDPLVFATVGSNRVTLYECHSQGEIRLLQS  137

Query  738  YIDEDKDESFYTVSW  782
            Y+D D DE+FYT +W
Sbjct  138  YVDADADENFYTCAW  152



>ref|XP_006865018.1| PREDICTED: polycomb protein EED isoform X1 [Chrysochloris asiatica]
Length=466

 Score = 66.6 bits (161),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 35/75 (47%), Positives = 49/75 (65%), Gaps = 4/75 (5%)
 Frame = +3

Query  567  KKEYRVTNRLQEGK-RPLYAVVFNFIDSRYFN--VFATAGGNRVTVYQCLEGGVIAVLQS  737
            K  ++  N L+E   +PL+ V FN+  S+  +  VFAT G NRVT+Y+C   G I +LQS
Sbjct  79   KYSFKCVNSLKEDHNQPLFGVQFNW-HSKEGDPLVFATVGSNRVTLYECHSQGEIRLLQS  137

Query  738  YIDEDKDESFYTVSW  782
            Y+D D DE+FYT +W
Sbjct  138  YVDADADENFYTCAW  152



>ref|XP_011543633.1| PREDICTED: polycomb protein EED isoform X3 [Homo sapiens]
Length=415

 Score = 66.6 bits (161),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 35/76 (46%), Positives = 49/76 (64%), Gaps = 4/76 (5%)
 Frame = +3

Query  567  KKEYRVTNRLQEGK-RPLYAVVFNFIDSRYFN--VFATAGGNRVTVYQCLEGGVIAVLQS  737
            K  ++  N L+E   +PL+ V FN+  S+  +  VFAT G NRVT+Y+C   G I +LQS
Sbjct  79   KYSFKCVNSLKEDHNQPLFGVQFNW-HSKEGDPLVFATVGSNRVTLYECHSQGEIRLLQS  137

Query  738  YIDEDKDESFYTVSWA  785
            Y+D D DE+FYT +W 
Sbjct  138  YVDADADENFYTCAWT  153



>ref|XP_005995211.1| PREDICTED: polycomb protein EED isoform X1 [Latimeria chalumnae]
Length=437

 Score = 66.6 bits (161),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 35/75 (47%), Positives = 49/75 (65%), Gaps = 4/75 (5%)
 Frame = +3

Query  567  KKEYRVTNRLQEGK-RPLYAVVFNFIDSRYFN--VFATAGGNRVTVYQCLEGGVIAVLQS  737
            K  ++  N L+E   +PL+ V FN+  S+  +  VFAT G NRVT+Y+C   G I +LQS
Sbjct  75   KYSFKCVNSLKEDHGQPLFGVQFNW-HSKEGDPLVFATVGSNRVTLYECHSQGEIRLLQS  133

Query  738  YIDEDKDESFYTVSW  782
            Y+D D DE+FYT +W
Sbjct  134  YVDADADENFYTCAW  148



>ref|XP_009516771.1| hypothetical protein PHYSODRAFT_552795 [Phytophthora sojae]
 gb|EGZ29496.1| hypothetical protein PHYSODRAFT_552795 [Phytophthora sojae]
Length=388

 Score = 66.2 bits (160),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 35/87 (40%), Positives = 53/87 (61%), Gaps = 2/87 (2%)
 Frame = +3

Query  540  VVGSLMPS-KKKEYRVTNRLQEGK-RPLYAVVFNFIDSRYFNVFATAGGNRVTVYQCLEG  713
            V  SL+P  +KK Y+ ++  +E     LY V F  +   Y  +FA AGGNR+TVY+CLE 
Sbjct  29   VPTSLLPRLRKKGYKFSSYAREDHGNALYCVTFCDVLPIYERMFAVAGGNRLTVYECLEN  88

Query  714  GVIAVLQSYIDEDKDESFYTVSWACSI  794
            G + V+Q Y D D++E ++T +W   +
Sbjct  89   GGLDVIQVYCDGDQEEQYFTAAWTVDV  115



>gb|AAH47672.1| EED protein, partial [Homo sapiens]
Length=427

 Score = 66.6 bits (161),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 35/75 (47%), Positives = 49/75 (65%), Gaps = 4/75 (5%)
 Frame = +3

Query  567  KKEYRVTNRLQEGK-RPLYAVVFNFIDSRYFN--VFATAGGNRVTVYQCLEGGVIAVLQS  737
            K  ++  N L+E   +PL+ V FN+  S+  +  VFAT G NRVT+Y+C   G I +LQS
Sbjct  65   KYSFKCVNSLKEDHNQPLFGVQFNW-HSKEGDPLVFATVGSNRVTLYECHSQGEIRLLQS  123

Query  738  YIDEDKDESFYTVSW  782
            Y+D D DE+FYT +W
Sbjct  124  YVDADADENFYTCAW  138



>ref|XP_003219406.1| PREDICTED: polycomb protein EED [Anolis carolinensis]
Length=460

 Score = 66.6 bits (161),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 35/75 (47%), Positives = 49/75 (65%), Gaps = 4/75 (5%)
 Frame = +3

Query  567  KKEYRVTNRLQEGK-RPLYAVVFNFIDSRYFN--VFATAGGNRVTVYQCLEGGVIAVLQS  737
            K  ++  N L+E   +PL+ V FN+  S+  +  VFAT G NRVT+Y+C   G I +LQS
Sbjct  98   KYSFKCVNSLKEDHGQPLFGVQFNW-HSKEGDPLVFATVGSNRVTLYECHSQGEIRLLQS  156

Query  738  YIDEDKDESFYTVSW  782
            Y+D D DE+FYT +W
Sbjct  157  YVDADADENFYTCAW  171



>ref|XP_004886949.1| PREDICTED: polycomb protein EED isoform X1 [Heterocephalus glaber]
 ref|XP_004868287.1| PREDICTED: polycomb protein EED isoform X1 [Heterocephalus glaber]
 gb|EHB04378.1| Polycomb protein EED [Heterocephalus glaber]
Length=441

 Score = 66.6 bits (161),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 35/75 (47%), Positives = 49/75 (65%), Gaps = 4/75 (5%)
 Frame = +3

Query  567  KKEYRVTNRLQEGK-RPLYAVVFNFIDSRYFN--VFATAGGNRVTVYQCLEGGVIAVLQS  737
            K  ++  N L+E   +PL+ V FN+  S+  +  VFAT G NRVT+Y+C   G I +LQS
Sbjct  79   KYSFKCVNSLKEDHNQPLFGVQFNW-HSKEGDPLVFATVGSNRVTLYECHSQGEIRLLQS  137

Query  738  YIDEDKDESFYTVSW  782
            Y+D D DE+FYT +W
Sbjct  138  YVDADADENFYTCAW  152



>gb|AAD08815.1| embryonic ectoderm development protein short isoform [Homo sapiens]
Length=400

 Score = 66.2 bits (160),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 35/75 (47%), Positives = 49/75 (65%), Gaps = 4/75 (5%)
 Frame = +3

Query  567  KKEYRVTNRLQEGK-RPLYAVVFNFIDSRYFN--VFATAGGNRVTVYQCLEGGVIAVLQS  737
            K  ++  N L+E   +PL+ V FN+  S+  +  VFAT G NRVT+Y+C   G I +LQS
Sbjct  79   KYSFKCVNSLKEDHNQPLFGVQFNW-HSKEGDPLVFATVGSNRVTLYECHSQGEIRLLQS  137

Query  738  YIDEDKDESFYTVSW  782
            Y+D D DE+FYT +W
Sbjct  138  YVDADADENFYTCAW  152



>ref|XP_008587362.1| PREDICTED: polycomb protein EED isoform X2 [Galeopterus variegatus]
Length=441

 Score = 66.6 bits (161),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 35/75 (47%), Positives = 49/75 (65%), Gaps = 4/75 (5%)
 Frame = +3

Query  567  KKEYRVTNRLQEGK-RPLYAVVFNFIDSRYFN--VFATAGGNRVTVYQCLEGGVIAVLQS  737
            K  ++  N L+E   +PL+ V FN+  S+  +  VFAT G NRVT+Y+C   G I +LQS
Sbjct  79   KYSFKCVNSLKEDHNQPLFGVQFNW-HSKEGDPLVFATVGSNRVTLYECHSQGEIRLLQS  137

Query  738  YIDEDKDESFYTVSW  782
            Y+D D DE+FYT +W
Sbjct  138  YVDADADENFYTCAW  152



>ref|NP_001035584.1| polycomb protein EED [Bos taurus]
 ref|XP_005903531.1| PREDICTED: polycomb protein EED isoform X2 [Bos mutus]
 ref|XP_005903532.1| PREDICTED: polycomb protein EED isoform X3 [Bos mutus]
 ref|XP_006067390.1| PREDICTED: polycomb protein EED [Bubalus bubalis]
 sp|Q3SZ25.1|EED_BOVIN RecName: Full=Polycomb protein EED [Bos taurus]
 gb|AAI03218.1| Embryonic ectoderm development [Bos taurus]
 tpg|DAA14056.1| TPA: polycomb protein EED [Bos taurus]
Length=441

 Score = 66.6 bits (161),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 35/75 (47%), Positives = 49/75 (65%), Gaps = 4/75 (5%)
 Frame = +3

Query  567  KKEYRVTNRLQEGK-RPLYAVVFNFIDSRYFN--VFATAGGNRVTVYQCLEGGVIAVLQS  737
            K  ++  N L+E   +PL+ V FN+  S+  +  VFAT G NRVT+Y+C   G I +LQS
Sbjct  79   KYSFKCVNSLKEDHNQPLFGVQFNW-HSKEGDPLVFATVGSNRVTLYECHSQGEIRLLQS  137

Query  738  YIDEDKDESFYTVSW  782
            Y+D D DE+FYT +W
Sbjct  138  YVDADADENFYTCAW  152



>ref|XP_006926753.1| PREDICTED: polycomb protein EED isoform X4 [Pteropus alecto]
 ref|XP_011361566.1| PREDICTED: polycomb protein EED isoform X4 [Pteropus vampyrus]
 ref|XP_011361567.1| PREDICTED: polycomb protein EED isoform X5 [Pteropus vampyrus]
Length=441

 Score = 66.6 bits (161),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 35/75 (47%), Positives = 49/75 (65%), Gaps = 4/75 (5%)
 Frame = +3

Query  567  KKEYRVTNRLQEGK-RPLYAVVFNFIDSRYFN--VFATAGGNRVTVYQCLEGGVIAVLQS  737
            K  ++  N L+E   +PL+ V FN+  S+  +  VFAT G NRVT+Y+C   G I +LQS
Sbjct  79   KYSFKCVNSLKEDHNQPLFGVQFNW-HSKEGDPLVFATVGSNRVTLYECHSQGEIRLLQS  137

Query  738  YIDEDKDESFYTVSW  782
            Y+D D DE+FYT +W
Sbjct  138  YVDADADENFYTCAW  152



>ref|XP_003780891.1| PREDICTED: polycomb protein EED isoform 1 [Otolemur garnettii]
Length=441

 Score = 66.6 bits (161),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 35/75 (47%), Positives = 49/75 (65%), Gaps = 4/75 (5%)
 Frame = +3

Query  567  KKEYRVTNRLQEGK-RPLYAVVFNFIDSRYFN--VFATAGGNRVTVYQCLEGGVIAVLQS  737
            K  ++  N L+E   +PL+ V FN+  S+  +  VFAT G NRVT+Y+C   G I +LQS
Sbjct  79   KYSFKCVNSLKEDHNQPLFGVQFNW-HSKEGDPLVFATVGSNRVTLYECHSQGEIRLLQS  137

Query  738  YIDEDKDESFYTVSW  782
            Y+D D DE+FYT +W
Sbjct  138  YVDADADENFYTCAW  152



>ref|XP_011957004.1| PREDICTED: polycomb protein EED isoform X1 [Ovis aries]
Length=427

 Score = 66.6 bits (161),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 35/75 (47%), Positives = 49/75 (65%), Gaps = 4/75 (5%)
 Frame = +3

Query  567  KKEYRVTNRLQEGK-RPLYAVVFNFIDSRYFN--VFATAGGNRVTVYQCLEGGVIAVLQS  737
            K  ++  N L+E   +PL+ V FN+  S+  +  VFAT G NRVT+Y+C   G I +LQS
Sbjct  65   KYSFKCVNSLKEDHNQPLFGVQFNW-HSKEGDPLVFATVGSNRVTLYECHSQGEIRLLQS  123

Query  738  YIDEDKDESFYTVSW  782
            Y+D D DE+FYT +W
Sbjct  124  YVDADADENFYTCAW  138



>gb|EPQ13580.1| Polycomb protein EED [Myotis brandtii]
Length=427

 Score = 66.6 bits (161),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 35/75 (47%), Positives = 49/75 (65%), Gaps = 4/75 (5%)
 Frame = +3

Query  567  KKEYRVTNRLQEGK-RPLYAVVFNFIDSRYFN--VFATAGGNRVTVYQCLEGGVIAVLQS  737
            K  ++  N L+E   +PL+ V FN+  S+  +  VFAT G NRVT+Y+C   G I +LQS
Sbjct  65   KYSFKCVNSLKEDHNQPLFGVQFNW-HSKEGDPLVFATVGSNRVTLYECHSQGEIRLLQS  123

Query  738  YIDEDKDESFYTVSW  782
            Y+D D DE+FYT +W
Sbjct  124  YVDADADENFYTCAW  138



>ref|XP_005287587.1| PREDICTED: polycomb protein EED isoform X1 [Chrysemys picta bellii]
Length=443

 Score = 66.6 bits (161),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 35/75 (47%), Positives = 49/75 (65%), Gaps = 4/75 (5%)
 Frame = +3

Query  567  KKEYRVTNRLQEGK-RPLYAVVFNFIDSRYFN--VFATAGGNRVTVYQCLEGGVIAVLQS  737
            K  ++  N L+E   +PL+ V FN+  S+  +  VFAT G NRVT+Y+C   G I +LQS
Sbjct  81   KYSFKCVNSLKEDHSQPLFGVQFNW-HSKEGDPLVFATVGSNRVTLYECHSQGEIRLLQS  139

Query  738  YIDEDKDESFYTVSW  782
            Y+D D DE+FYT +W
Sbjct  140  YVDADADENFYTCAW  154



>pdb|3IIY|A Chain A, Crystal Structure Of Eed In Complex With A Trimethylated 
Histone H1k26 Peptide
 pdb|3IJ0|A Chain A, Crystal Structure Of Eed In Complex With A Trimethylated 
Histone H3k9 Peptide
 pdb|3IJ1|A Chain A, Crystal Structure Of Eed In Complex With A Trimethylated 
Histone H4k20 Peptide
 pdb|3IJC|A Chain A, Crystal Structure Of Eed In Complex With Ndsb-195
Length=365

 Score = 66.2 bits (160),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 35/76 (46%), Positives = 49/76 (64%), Gaps = 4/76 (5%)
 Frame = +3

Query  567  KKEYRVTNRLQEGK-RPLYAVVFNFIDSRYFN--VFATAGGNRVTVYQCLEGGVIAVLQS  737
            K  ++  N L+E   +PL+ V FN+  S+  +  VFAT G NRVT+Y+C   G I +LQS
Sbjct  3    KYSFKCVNSLKEDHNQPLFGVQFNW-HSKEGDPLVFATVGSNRVTLYECHSQGEIRLLQS  61

Query  738  YIDEDKDESFYTVSWA  785
            Y+D D DE+FYT +W 
Sbjct  62   YVDADADENFYTCAWT  77



>ref|XP_011998930.1| PREDICTED: polycomb protein EED isoform X2 [Ovis aries musimon]
Length=441

 Score = 66.6 bits (161),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 35/75 (47%), Positives = 49/75 (65%), Gaps = 4/75 (5%)
 Frame = +3

Query  567  KKEYRVTNRLQEGK-RPLYAVVFNFIDSRYFN--VFATAGGNRVTVYQCLEGGVIAVLQS  737
            K  ++  N L+E   +PL+ V FN+  S+  +  VFAT G NRVT+Y+C   G I +LQS
Sbjct  79   KYSFKCVNSLKEDHNQPLFGVQFNW-HSKEGDPLVFATVGSNRVTLYECHSQGEIRLLQS  137

Query  738  YIDEDKDESFYTVSW  782
            Y+D D DE+FYT +W
Sbjct  138  YVDADADENFYTCAW  152



>ref|XP_007538511.1| PREDICTED: polycomb protein EED [Erinaceus europaeus]
Length=441

 Score = 66.6 bits (161),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 35/75 (47%), Positives = 49/75 (65%), Gaps = 4/75 (5%)
 Frame = +3

Query  567  KKEYRVTNRLQEGK-RPLYAVVFNFIDSRYFN--VFATAGGNRVTVYQCLEGGVIAVLQS  737
            K  ++  N L+E   +PL+ V FN+  S+  +  VFAT G NRVT+Y+C   G I +LQS
Sbjct  79   KYSFKCVNSLKEDHNQPLFGVQFNW-HSKEGDPLVFATVGSNRVTLYECHSQGEIRLLQS  137

Query  738  YIDEDKDESFYTVSW  782
            Y+D D DE+FYT +W
Sbjct  138  YVDADADENFYTCAW  152



>ref|XP_008702661.1| PREDICTED: polycomb protein EED [Ursus maritimus]
Length=434

 Score = 66.6 bits (161),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 35/76 (46%), Positives = 49/76 (64%), Gaps = 4/76 (5%)
 Frame = +3

Query  567  KKEYRVTNRLQEGK-RPLYAVVFNFIDSRYFN--VFATAGGNRVTVYQCLEGGVIAVLQS  737
            K  ++  N L+E   +PL+ V FN+  S+  +  VFAT G NRVT+Y+C   G I +LQS
Sbjct  47   KYSFKCVNSLKEDHNQPLFGVQFNW-HSKEGDPLVFATVGSNRVTLYECHSQGEIRLLQS  105

Query  738  YIDEDKDESFYTVSWA  785
            Y+D D DE+FYT +W 
Sbjct  106  YVDADADENFYTCAWT  121



>ref|XP_006197518.1| PREDICTED: polycomb protein EED [Vicugna pacos]
 ref|XP_010971697.1| PREDICTED: polycomb protein EED isoform X3 [Camelus bactrianus]
Length=427

 Score = 66.6 bits (161),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 35/75 (47%), Positives = 49/75 (65%), Gaps = 4/75 (5%)
 Frame = +3

Query  567  KKEYRVTNRLQEGK-RPLYAVVFNFIDSRYFN--VFATAGGNRVTVYQCLEGGVIAVLQS  737
            K  ++  N L+E   +PL+ V FN+  S+  +  VFAT G NRVT+Y+C   G I +LQS
Sbjct  65   KYSFKCVNSLKEDHNQPLFGVQFNW-HSKEGDPLVFATVGSNRVTLYECHSQGEIRLLQS  123

Query  738  YIDEDKDESFYTVSW  782
            Y+D D DE+FYT +W
Sbjct  124  YVDADADENFYTCAW  138



>ref|XP_009503201.1| PREDICTED: polycomb protein EED [Phalacrocorax carbo]
Length=376

 Score = 66.2 bits (160),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 35/75 (47%), Positives = 49/75 (65%), Gaps = 4/75 (5%)
 Frame = +3

Query  567  KKEYRVTNRLQEGK-RPLYAVVFNFIDSRYFN--VFATAGGNRVTVYQCLEGGVIAVLQS  737
            K  ++  N L+E   +PL+ V FN+  S+  +  VFAT G NRVT+Y+C   G I +LQS
Sbjct  55   KYSFKCVNSLKEDHGQPLFGVQFNW-HSKEGDPLVFATVGSNRVTLYECHSQGEIRLLQS  113

Query  738  YIDEDKDESFYTVSW  782
            Y+D D DE+FYT +W
Sbjct  114  YVDADADENFYTCAW  128



>gb|EMP35024.1| Polycomb protein EED, partial [Chelonia mydas]
Length=403

 Score = 66.2 bits (160),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 35/75 (47%), Positives = 49/75 (65%), Gaps = 4/75 (5%)
 Frame = +3

Query  567  KKEYRVTNRLQEGK-RPLYAVVFNFIDSRYFN--VFATAGGNRVTVYQCLEGGVIAVLQS  737
            K  ++  N L+E   +PL+ V FN+  S+  +  VFAT G NRVT+Y+C   G I +LQS
Sbjct  41   KYSFKCVNSLKEDHSQPLFGVQFNW-HSKEGDPLVFATVGSNRVTLYECHSQGEIRLLQS  99

Query  738  YIDEDKDESFYTVSW  782
            Y+D D DE+FYT +W
Sbjct  100  YVDADADENFYTCAW  114



>ref|XP_010988818.1| PREDICTED: polycomb protein EED [Camelus dromedarius]
Length=441

 Score = 66.6 bits (161),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 35/75 (47%), Positives = 49/75 (65%), Gaps = 4/75 (5%)
 Frame = +3

Query  567  KKEYRVTNRLQEGK-RPLYAVVFNFIDSRYFN--VFATAGGNRVTVYQCLEGGVIAVLQS  737
            K  ++  N L+E   +PL+ V FN+  S+  +  VFAT G NRVT+Y+C   G I +LQS
Sbjct  79   KYSFKCVNSLKEDHNQPLFGVQFNW-HSKEGDPLVFATVGSNRVTLYECHSQGEIRLLQS  137

Query  738  YIDEDKDESFYTVSW  782
            Y+D D DE+FYT +W
Sbjct  138  YVDADADENFYTCAW  152



>ref|XP_008842364.1| PREDICTED: polycomb protein EED isoform X2 [Nannospalax galili]
Length=441

 Score = 66.6 bits (161),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 35/75 (47%), Positives = 49/75 (65%), Gaps = 4/75 (5%)
 Frame = +3

Query  567  KKEYRVTNRLQEGK-RPLYAVVFNFIDSRYFN--VFATAGGNRVTVYQCLEGGVIAVLQS  737
            K  ++  N L+E   +PL+ V FN+  S+  +  VFAT G NRVT+Y+C   G I +LQS
Sbjct  79   KYSFKCVNSLKEDHNQPLFGVQFNW-HSKEGDPLVFATVGSNRVTLYECHSQGEIRLLQS  137

Query  738  YIDEDKDESFYTVSW  782
            Y+D D DE+FYT +W
Sbjct  138  YVDADADENFYTCAW  152



>ref|XP_005510820.1| PREDICTED: polycomb protein EED [Columba livia]
Length=441

 Score = 66.6 bits (161),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 35/76 (46%), Positives = 49/76 (64%), Gaps = 4/76 (5%)
 Frame = +3

Query  567  KKEYRVTNRLQEGK-RPLYAVVFNFIDSRYFN--VFATAGGNRVTVYQCLEGGVIAVLQS  737
            K  ++  N L+E   +PL+ V FN+  S+  +  VFAT G NRVT+Y+C   G I +LQS
Sbjct  79   KYSFKCVNSLKEDHGQPLFGVQFNW-HSKEGDPLVFATVGSNRVTLYECHSQGEIRLLQS  137

Query  738  YIDEDKDESFYTVSWA  785
            Y+D D DE+FYT +W 
Sbjct  138  YVDADADENFYTCAWT  153



>ref|XP_005357621.1| PREDICTED: polycomb protein EED [Microtus ochrogaster]
Length=441

 Score = 66.6 bits (161),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 35/75 (47%), Positives = 49/75 (65%), Gaps = 4/75 (5%)
 Frame = +3

Query  567  KKEYRVTNRLQEGK-RPLYAVVFNFIDSRYFN--VFATAGGNRVTVYQCLEGGVIAVLQS  737
            K  ++  N L+E   +PL+ V FN+  S+  +  VFAT G NRVT+Y+C   G I +LQS
Sbjct  79   KYSFKCVNSLKEDHNQPLFGVQFNW-HSKEGDPLVFATVGSNRVTLYECHSQGEIRLLQS  137

Query  738  YIDEDKDESFYTVSW  782
            Y+D D DE+FYT +W
Sbjct  138  YVDADADENFYTCAW  152



>gb|AAC68675.1| WAIT-1 [Homo sapiens]
Length=427

 Score = 66.6 bits (161),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 35/75 (47%), Positives = 49/75 (65%), Gaps = 4/75 (5%)
 Frame = +3

Query  567  KKEYRVTNRLQEGK-RPLYAVVFNFIDSRYFN--VFATAGGNRVTVYQCLEGGVIAVLQS  737
            K  ++  N L+E   +PL+ V FN+  S+  +  VFAT G NRVT+Y+C   G I +LQS
Sbjct  65   KYSFKCVNSLKEDHNQPLFGVQFNW-HSKEGDPLVFATVGSNRVTLYECHSQGEIRLLQS  123

Query  738  YIDEDKDESFYTVSW  782
            Y+D D DE+FYT +W
Sbjct  124  YVDADADENFYTCAW  138



>ref|XP_005074165.1| PREDICTED: polycomb protein EED [Mesocricetus auratus]
Length=526

 Score = 66.6 bits (161),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 34/74 (46%), Positives = 46/74 (62%), Gaps = 2/74 (3%)
 Frame = +3

Query  567  KKEYRVTNRLQEGK-RPLYAVVFNFIDSRYFN-VFATAGGNRVTVYQCLEGGVIAVLQSY  740
            K  ++  N L+E   +PL+ V FN+        VFAT G NRVT+Y+C   G I +LQSY
Sbjct  244  KYSFKCVNSLKEDHNQPLFGVQFNWHSKEGDPLVFATVGSNRVTLYECHSQGEIRLLQSY  303

Query  741  IDEDKDESFYTVSW  782
            +D D DE+FYT +W
Sbjct  304  VDADADENFYTCAW  317



>gb|EOA94172.1| Polycomb protein EED, partial [Anas platyrhynchos]
Length=428

 Score = 66.6 bits (161),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 35/75 (47%), Positives = 49/75 (65%), Gaps = 4/75 (5%)
 Frame = +3

Query  567  KKEYRVTNRLQEGK-RPLYAVVFNFIDSRYFN--VFATAGGNRVTVYQCLEGGVIAVLQS  737
            K  ++  N L+E   +PL+ V FN+  S+  +  VFAT G NRVT+Y+C   G I +LQS
Sbjct  66   KYSFKCVNSLKEDHGQPLFGVQFNW-HSKEGDPLVFATVGSNRVTLYECHSQGEIRLLQS  124

Query  738  YIDEDKDESFYTVSW  782
            Y+D D DE+FYT +W
Sbjct  125  YVDADADENFYTCAW  139



>ref|XP_006639249.1| PREDICTED: polycomb protein eed-like [Lepisosteus oculatus]
Length=437

 Score = 66.6 bits (161),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 35/75 (47%), Positives = 49/75 (65%), Gaps = 4/75 (5%)
 Frame = +3

Query  567  KKEYRVTNRLQEGK-RPLYAVVFNFIDSRYFN--VFATAGGNRVTVYQCLEGGVIAVLQS  737
            K  ++  N L+E   +PL+ V FN+  S+  +  VFAT G NRVT+Y+C   G I +LQS
Sbjct  75   KYSFKCVNSLKEDHGQPLFGVQFNW-HSKEGDPLVFATVGSNRVTLYECHSQGEIRLLQS  133

Query  738  YIDEDKDESFYTVSW  782
            Y+D D DE+FYT +W
Sbjct  134  YVDADADENFYTCAW  148



>ref|XP_008910887.1| hypothetical protein PPTG_15888 [Phytophthora parasitica INRA-310]
 gb|ETI39207.1| hypothetical protein F443_15162 [Phytophthora parasitica P1569]
 gb|ETK79416.1| hypothetical protein L915_14704 [Phytophthora parasitica]
 gb|ETL32828.1| hypothetical protein L916_14618 [Phytophthora parasitica]
 gb|ETL86126.1| hypothetical protein L917_14417 [Phytophthora parasitica]
 gb|ETM39272.1| hypothetical protein L914_14561 [Phytophthora parasitica]
 gb|ETN03660.1| hypothetical protein PPTG_15888 [Phytophthora parasitica INRA-310]
 gb|ETO67987.1| hypothetical protein F444_15139 [Phytophthora parasitica P1976]
 gb|ETP09120.1| hypothetical protein F441_14971 [Phytophthora parasitica CJ01A1]
 gb|ETP37151.1| hypothetical protein F442_14995 [Phytophthora parasitica P10297]
Length=395

 Score = 66.2 bits (160),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 34/84 (40%), Positives = 52/84 (62%), Gaps = 2/84 (2%)
 Frame = +3

Query  549  SLMPS-KKKEYRVTNRLQEGK-RPLYAVVFNFIDSRYFNVFATAGGNRVTVYQCLEGGVI  722
            SL+P  +KK Y+ ++  +E     LY V F  +   Y  +FA AGGNR+TVY+CLE G +
Sbjct  39   SLLPRLRKKGYKFSSYAREDHGNALYCVTFCDVLPIYERMFAVAGGNRLTVYECLENGGL  98

Query  723  AVLQSYIDEDKDESFYTVSWACSI  794
             V+Q Y D D++E ++T +W   +
Sbjct  99   DVIQVYCDGDQEEQYFTAAWTVDV  122



>ref|XP_007060662.1| PREDICTED: polycomb protein EED isoform X1 [Chelonia mydas]
Length=427

 Score = 66.2 bits (160),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 35/75 (47%), Positives = 49/75 (65%), Gaps = 4/75 (5%)
 Frame = +3

Query  567  KKEYRVTNRLQEGK-RPLYAVVFNFIDSRYFN--VFATAGGNRVTVYQCLEGGVIAVLQS  737
            K  ++  N L+E   +PL+ V FN+  S+  +  VFAT G NRVT+Y+C   G I +LQS
Sbjct  65   KYSFKCVNSLKEDHSQPLFGVQFNW-HSKEGDPLVFATVGSNRVTLYECHSQGEIRLLQS  123

Query  738  YIDEDKDESFYTVSW  782
            Y+D D DE+FYT +W
Sbjct  124  YVDADADENFYTCAW  138



>ref|XP_005417886.1| PREDICTED: polycomb protein EED [Geospiza fortis]
Length=557

 Score = 66.6 bits (161),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 35/75 (47%), Positives = 49/75 (65%), Gaps = 4/75 (5%)
 Frame = +3

Query  567  KKEYRVTNRLQEGK-RPLYAVVFNFIDSRYFN--VFATAGGNRVTVYQCLEGGVIAVLQS  737
            K  ++  N L+E   +PL+ V FN+  S+  +  VFAT G NRVT+Y+C   G I +LQS
Sbjct  195  KYSFKCVNSLKEDHGQPLFGVQFNW-HSKEGDPLVFATVGSNRVTLYECHSQGEIRLLQS  253

Query  738  YIDEDKDESFYTVSW  782
            Y+D D DE+FYT +W
Sbjct  254  YVDADADENFYTCAW  268



>sp|Q566T0.2|EED_DANRE RecName: Full=Polycomb protein eed [Danio rerio]
 gb|AAI53557.1| Eed protein [Danio rerio]
Length=443

 Score = 66.6 bits (161),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 35/75 (47%), Positives = 49/75 (65%), Gaps = 4/75 (5%)
 Frame = +3

Query  567  KKEYRVTNRLQEGK-RPLYAVVFNFIDSRYFN--VFATAGGNRVTVYQCLEGGVIAVLQS  737
            K  ++  N L+E   +PL+ V FN+  S+  +  VFAT G NRVT+Y+C   G I +LQS
Sbjct  81   KYSFKCVNSLKEDHGQPLFGVQFNW-HSKEGDPLVFATVGSNRVTLYECHSQGEIRLLQS  139

Query  738  YIDEDKDESFYTVSW  782
            Y+D D DE+FYT +W
Sbjct  140  YVDADADENFYTCAW  154



>pdb|4X3E|A Chain A, Crystal Structure Of Eed In Complex With A Trimethylated 
Jarid2 Peptide
Length=367

 Score = 66.2 bits (160),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 35/76 (46%), Positives = 49/76 (64%), Gaps = 4/76 (5%)
 Frame = +3

Query  567  KKEYRVTNRLQEGK-RPLYAVVFNFIDSRYFN--VFATAGGNRVTVYQCLEGGVIAVLQS  737
            K  ++  N L+E   +PL+ V FN+  S+  +  VFAT G NRVT+Y+C   G I +LQS
Sbjct  5    KYSFKCVNSLKEDHNQPLFGVQFNW-HSKEGDPLVFATVGSNRVTLYECHSQGEIRLLQS  63

Query  738  YIDEDKDESFYTVSWA  785
            Y+D D DE+FYT +W 
Sbjct  64   YVDADADENFYTCAWT  79



>pdb|3IIW|A Chain A, Crystal Structure Of Eed In Complex With A Trimethylated 
Histone H3k27 Peptide
Length=365

 Score = 66.2 bits (160),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 35/76 (46%), Positives = 49/76 (64%), Gaps = 4/76 (5%)
 Frame = +3

Query  567  KKEYRVTNRLQEGK-RPLYAVVFNFIDSRYFN--VFATAGGNRVTVYQCLEGGVIAVLQS  737
            K  ++  N L+E   +PL+ V FN+  S+  +  VFAT G NRVT+Y+C   G I +LQS
Sbjct  3    KYSFKCVNSLKEDHNQPLFGVQFNW-HSKEGDPLVFATVGSNRVTLYECHSQGEIRLLQS  61

Query  738  YIDEDKDESFYTVSWA  785
            Y+D D DE+FYT +W 
Sbjct  62   YVDADADENFYTCAWT  77



>ref|NP_694536.1| polycomb protein EED isoform b [Homo sapiens]
 ref|XP_011220764.1| PREDICTED: polycomb protein EED isoform X1 [Ailuropoda melanoleuca]
 gb|EAW75131.1| embryonic ectoderm development, isoform CRA_c [Homo sapiens]
 dbj|BAG72536.1| embryonic ectoderm development [synthetic construct]
Length=400

 Score = 66.2 bits (160),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 35/75 (47%), Positives = 49/75 (65%), Gaps = 4/75 (5%)
 Frame = +3

Query  567  KKEYRVTNRLQEGK-RPLYAVVFNFIDSRYFN--VFATAGGNRVTVYQCLEGGVIAVLQS  737
            K  ++  N L+E   +PL+ V FN+  S+  +  VFAT G NRVT+Y+C   G I +LQS
Sbjct  79   KYSFKCVNSLKEDHNQPLFGVQFNW-HSKEGDPLVFATVGSNRVTLYECHSQGEIRLLQS  137

Query  738  YIDEDKDESFYTVSW  782
            Y+D D DE+FYT +W
Sbjct  138  YVDADADENFYTCAW  152



>dbj|BAF84809.1| unnamed protein product [Homo sapiens]
Length=441

 Score = 66.6 bits (161),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 35/75 (47%), Positives = 49/75 (65%), Gaps = 4/75 (5%)
 Frame = +3

Query  567  KKEYRVTNRLQEGK-RPLYAVVFNFIDSRYFN--VFATAGGNRVTVYQCLEGGVIAVLQS  737
            K  ++  N L+E   +PL+ V FN+  S+  +  VFAT G NRVT+Y+C   G I +LQS
Sbjct  79   KYSFKCVNSLKEDHNQPLFGVQFNW-HSKEGDPLVFATVGSNRVTLYECHSQGEIRLLQS  137

Query  738  YIDEDKDESFYTVSW  782
            Y+D D DE+FYT +W
Sbjct  138  YVDADADENFYTCAW  152



>gb|ELK00424.1| Polycomb protein EED [Pteropus alecto]
Length=427

 Score = 66.2 bits (160),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 35/75 (47%), Positives = 49/75 (65%), Gaps = 4/75 (5%)
 Frame = +3

Query  567  KKEYRVTNRLQEGK-RPLYAVVFNFIDSRYFN--VFATAGGNRVTVYQCLEGGVIAVLQS  737
            K  ++  N L+E   +PL+ V FN+  S+  +  VFAT G NRVT+Y+C   G I +LQS
Sbjct  65   KYSFKCVNSLKEDHNQPLFGVQFNW-HSKEGDPLVFATVGSNRVTLYECHSQGEIRLLQS  123

Query  738  YIDEDKDESFYTVSW  782
            Y+D D DE+FYT +W
Sbjct  124  YVDADADENFYTCAW  138



>ref|XP_009468693.1| PREDICTED: polycomb protein EED [Nipponia nippon]
Length=507

 Score = 66.6 bits (161),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 35/75 (47%), Positives = 49/75 (65%), Gaps = 4/75 (5%)
 Frame = +3

Query  567  KKEYRVTNRLQEGK-RPLYAVVFNFIDSRYFN--VFATAGGNRVTVYQCLEGGVIAVLQS  737
            K  ++  N L+E   +PL+ V FN+  S+  +  VFAT G NRVT+Y+C   G I +LQS
Sbjct  145  KYSFKCVNSLKEDHGQPLFGVQFNW-HSKEGDPLVFATVGSNRVTLYECHSQGEIRLLQS  203

Query  738  YIDEDKDESFYTVSW  782
            Y+D D DE+FYT +W
Sbjct  204  YVDADADENFYTCAW  218



>pdb|3JZN|A Chain A, Structure Of Eed In Apo Form
 pdb|3K26|A Chain A, Complex Structure Of Eed And Trimethylated H3k4
 pdb|3K27|A Chain A, Complex Structure Of Eed And Trimethylated H3k9
Length=366

 Score = 66.2 bits (160),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 35/76 (46%), Positives = 49/76 (64%), Gaps = 4/76 (5%)
 Frame = +3

Query  567  KKEYRVTNRLQEGK-RPLYAVVFNFIDSRYFN--VFATAGGNRVTVYQCLEGGVIAVLQS  737
            K  ++  N L+E   +PL+ V FN+  S+  +  VFAT G NRVT+Y+C   G I +LQS
Sbjct  4    KYSFKCVNSLKEDHNQPLFGVQFNW-HSKEGDPLVFATVGSNRVTLYECHSQGEIRLLQS  62

Query  738  YIDEDKDESFYTVSWA  785
            Y+D D DE+FYT +W 
Sbjct  63   YVDADADENFYTCAWT  78



>ref|XP_010851554.1| PREDICTED: polycomb protein EED [Bison bison bison]
Length=746

 Score = 66.6 bits (161),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 34/74 (46%), Positives = 46/74 (62%), Gaps = 2/74 (3%)
 Frame = +3

Query  567  KKEYRVTNRLQEGK-RPLYAVVFNFIDSRYFN-VFATAGGNRVTVYQCLEGGVIAVLQSY  740
            K  ++  N L+E   +PL+ V FN+        VFAT G NRVT+Y+C   G I +LQSY
Sbjct  359  KYSFKCVNSLKEDHNQPLFGVQFNWHSKEGDPLVFATVGSNRVTLYECHSQGEIRLLQSY  418

Query  741  IDEDKDESFYTVSW  782
            +D D DE+FYT +W
Sbjct  419  VDADADENFYTCAW  432



>ref|XP_005029805.1| PREDICTED: polycomb protein EED [Anas platyrhynchos]
Length=427

 Score = 66.2 bits (160),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 35/75 (47%), Positives = 49/75 (65%), Gaps = 4/75 (5%)
 Frame = +3

Query  567  KKEYRVTNRLQEGK-RPLYAVVFNFIDSRYFN--VFATAGGNRVTVYQCLEGGVIAVLQS  737
            K  ++  N L+E   +PL+ V FN+  S+  +  VFAT G NRVT+Y+C   G I +LQS
Sbjct  65   KYSFKCVNSLKEDHGQPLFGVQFNW-HSKEGDPLVFATVGSNRVTLYECHSQGEIRLLQS  123

Query  738  YIDEDKDESFYTVSW  782
            Y+D D DE+FYT +W
Sbjct  124  YVDADADENFYTCAW  138



>ref|XP_009321754.1| PREDICTED: polycomb protein EED [Pygoscelis adeliae]
Length=408

 Score = 66.2 bits (160),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 35/76 (46%), Positives = 49/76 (64%), Gaps = 4/76 (5%)
 Frame = +3

Query  567  KKEYRVTNRLQEGK-RPLYAVVFNFIDSRYFN--VFATAGGNRVTVYQCLEGGVIAVLQS  737
            K  ++  N L+E   +PL+ V FN+  S+  +  VFAT G NRVT+Y+C   G I +LQS
Sbjct  46   KYSFKCVNSLKEDHGQPLFGVQFNW-HSKEGDPLVFATVGSNRVTLYECHSQGEIRLLQS  104

Query  738  YIDEDKDESFYTVSWA  785
            Y+D D DE+FYT +W 
Sbjct  105  YVDADADENFYTCAWT  120



>gb|EMC81828.1| Polycomb protein EED, partial [Columba livia]
Length=422

 Score = 66.2 bits (160),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 35/76 (46%), Positives = 49/76 (64%), Gaps = 4/76 (5%)
 Frame = +3

Query  567  KKEYRVTNRLQEGK-RPLYAVVFNFIDSRYFN--VFATAGGNRVTVYQCLEGGVIAVLQS  737
            K  ++  N L+E   +PL+ V FN+  S+  +  VFAT G NRVT+Y+C   G I +LQS
Sbjct  41   KYSFKCVNSLKEDHGQPLFGVQFNW-HSKEGDPLVFATVGSNRVTLYECHSQGEIRLLQS  99

Query  738  YIDEDKDESFYTVSWA  785
            Y+D D DE+FYT +W 
Sbjct  100  YVDADADENFYTCAWT  115



>ref|XP_003203591.1| PREDICTED: polycomb protein EED [Meleagris gallopavo]
Length=444

 Score = 66.2 bits (160),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 35/75 (47%), Positives = 49/75 (65%), Gaps = 4/75 (5%)
 Frame = +3

Query  567  KKEYRVTNRLQEGK-RPLYAVVFNFIDSRYFN--VFATAGGNRVTVYQCLEGGVIAVLQS  737
            K  ++  N L+E   +PL+ V FN+  S+  +  VFAT G NRVT+Y+C   G I +LQS
Sbjct  82   KYSFKCVNSLKEDHGQPLFGVQFNW-HSKEGDPLVFATVGSNRVTLYECHSQGEIRLLQS  140

Query  738  YIDEDKDESFYTVSW  782
            Y+D D DE+FYT +W
Sbjct  141  YVDADADENFYTCAW  155



>ref|XP_006259063.1| PREDICTED: polycomb protein EED [Alligator mississippiensis]
Length=444

 Score = 66.2 bits (160),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 35/75 (47%), Positives = 49/75 (65%), Gaps = 4/75 (5%)
 Frame = +3

Query  567  KKEYRVTNRLQEGK-RPLYAVVFNFIDSRYFN--VFATAGGNRVTVYQCLEGGVIAVLQS  737
            K  ++  N L+E   +PL+ V FN+  S+  +  VFAT G NRVT+Y+C   G I +LQS
Sbjct  82   KYSFKCVNSLKEDHGQPLFGVQFNW-HSKEGDPLVFATVGSNRVTLYECHSQGEIRLLQS  140

Query  738  YIDEDKDESFYTVSW  782
            Y+D D DE+FYT +W
Sbjct  141  YVDADADENFYTCAW  155



>ref|XP_008633186.1| PREDICTED: polycomb protein EED [Corvus brachyrhynchos]
Length=405

 Score = 66.2 bits (160),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 35/76 (46%), Positives = 49/76 (64%), Gaps = 4/76 (5%)
 Frame = +3

Query  567  KKEYRVTNRLQEGK-RPLYAVVFNFIDSRYFN--VFATAGGNRVTVYQCLEGGVIAVLQS  737
            K  ++  N L+E   +PL+ V FN+  S+  +  VFAT G NRVT+Y+C   G I +LQS
Sbjct  43   KYSFKCVNSLKEDHGQPLFGVQFNW-HSKEGDPLVFATVGSNRVTLYECHSQGEIRLLQS  101

Query  738  YIDEDKDESFYTVSWA  785
            Y+D D DE+FYT +W 
Sbjct  102  YVDADADENFYTCAWT  117



>ref|XP_007079121.1| PREDICTED: polycomb protein EED [Panthera tigris altaica]
Length=506

 Score = 66.6 bits (161),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 35/76 (46%), Positives = 49/76 (64%), Gaps = 4/76 (5%)
 Frame = +3

Query  567  KKEYRVTNRLQEGK-RPLYAVVFNFIDSRYFN--VFATAGGNRVTVYQCLEGGVIAVLQS  737
            K  ++  N L+E   +PL+ V FN+  S+  +  VFAT G NRVT+Y+C   G I +LQS
Sbjct  119  KYSFKCVNSLKEDHNQPLFGVQFNW-HSKEGDPLVFATVGSNRVTLYECHSQGEIRLLQS  177

Query  738  YIDEDKDESFYTVSWA  785
            Y+D D DE+FYT +W 
Sbjct  178  YVDADADENFYTCAWT  193



>ref|XP_009083818.1| PREDICTED: polycomb protein EED [Serinus canaria]
Length=407

 Score = 66.2 bits (160),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 35/76 (46%), Positives = 49/76 (64%), Gaps = 4/76 (5%)
 Frame = +3

Query  567  KKEYRVTNRLQEGK-RPLYAVVFNFIDSRYFN--VFATAGGNRVTVYQCLEGGVIAVLQS  737
            K  ++  N L+E   +PL+ V FN+  S+  +  VFAT G NRVT+Y+C   G I +LQS
Sbjct  45   KYSFKCVNSLKEDHGQPLFGVQFNW-HSKEGDPLVFATVGSNRVTLYECHSQGEIRLLQS  103

Query  738  YIDEDKDESFYTVSWA  785
            Y+D D DE+FYT +W 
Sbjct  104  YVDADADENFYTCAWT  119



>ref|XP_009898462.1| PREDICTED: polycomb protein EED [Picoides pubescens]
Length=421

 Score = 66.2 bits (160),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 35/76 (46%), Positives = 49/76 (64%), Gaps = 4/76 (5%)
 Frame = +3

Query  567  KKEYRVTNRLQEGK-RPLYAVVFNFIDSRYFN--VFATAGGNRVTVYQCLEGGVIAVLQS  737
            K  ++  N L+E   +PL+ V FN+  S+  +  VFAT G NRVT+Y+C   G I +LQS
Sbjct  59   KYSFKCVNSLKEDHGQPLFGVQFNW-HSKEGDPLVFATVGSNRVTLYECHSQGEIRLLQS  117

Query  738  YIDEDKDESFYTVSWA  785
            Y+D D DE+FYT +W 
Sbjct  118  YVDADADENFYTCAWT  133



>pdb|3JPX|A Chain A, Eed: A Novel Histone Trimethyllysine Binder Within The 
Eed-Ezh2 Polycomb Complex
 pdb|3JZG|A Chain A, Structure Of Eed In Complex With H3k27me3
 pdb|3JZH|A Chain A, Eed-H3k79me3
Length=402

 Score = 66.2 bits (160),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 35/76 (46%), Positives = 49/76 (64%), Gaps = 4/76 (5%)
 Frame = +3

Query  567  KKEYRVTNRLQEGK-RPLYAVVFNFIDSRYFN--VFATAGGNRVTVYQCLEGGVIAVLQS  737
            K  ++  N L+E   +PL+ V FN+  S+  +  VFAT G NRVT+Y+C   G I +LQS
Sbjct  40   KYSFKCVNSLKEDHNQPLFGVQFNW-HSKEGDPLVFATVGSNRVTLYECHSQGEIRLLQS  98

Query  738  YIDEDKDESFYTVSWA  785
            Y+D D DE+FYT +W 
Sbjct  99   YVDADADENFYTCAWT  114



>ref|XP_010574872.1| PREDICTED: polycomb protein EED [Haliaeetus leucocephalus]
 ref|XP_011582883.1| PREDICTED: polycomb protein EED [Aquila chrysaetos canadensis]
Length=444

 Score = 66.2 bits (160),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 35/75 (47%), Positives = 49/75 (65%), Gaps = 4/75 (5%)
 Frame = +3

Query  567  KKEYRVTNRLQEGK-RPLYAVVFNFIDSRYFN--VFATAGGNRVTVYQCLEGGVIAVLQS  737
            K  ++  N L+E   +PL+ V FN+  S+  +  VFAT G NRVT+Y+C   G I +LQS
Sbjct  82   KYSFKCVNSLKEDHGQPLFGVQFNW-HSKEGDPLVFATVGSNRVTLYECHSQGEIRLLQS  140

Query  738  YIDEDKDESFYTVSW  782
            Y+D D DE+FYT +W
Sbjct  141  YVDADADENFYTCAW  155



>gb|KFO60070.1| Polycomb protein EED, partial [Corvus brachyrhynchos]
 gb|KFO71436.1| Polycomb protein EED, partial [Cuculus canorus]
Length=403

 Score = 66.2 bits (160),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 35/76 (46%), Positives = 49/76 (64%), Gaps = 4/76 (5%)
 Frame = +3

Query  567  KKEYRVTNRLQEGK-RPLYAVVFNFIDSRYFN--VFATAGGNRVTVYQCLEGGVIAVLQS  737
            K  ++  N L+E   +PL+ V FN+  S+  +  VFAT G NRVT+Y+C   G I +LQS
Sbjct  41   KYSFKCVNSLKEDHGQPLFGVQFNW-HSKEGDPLVFATVGSNRVTLYECHSQGEIRLLQS  99

Query  738  YIDEDKDESFYTVSWA  785
            Y+D D DE+FYT +W 
Sbjct  100  YVDADADENFYTCAWT  115



>ref|XP_008947671.1| PREDICTED: polycomb protein EED, partial [Merops nubicus]
 ref|XP_009071558.1| PREDICTED: polycomb protein EED, partial [Acanthisitta chloris]
 ref|XP_009635418.1| PREDICTED: polycomb protein EED, partial [Egretta garzetta]
 ref|XP_009820717.1| PREDICTED: polycomb protein EED, partial [Gavia stellata]
 ref|XP_009693940.1| PREDICTED: polycomb protein EED, partial [Cariama cristata]
 ref|XP_010014406.1| PREDICTED: polycomb protein EED, partial [Nestor notabilis]
 ref|XP_009990451.1| PREDICTED: polycomb protein EED, partial [Tauraco erythrolophus]
 ref|XP_009966511.1| PREDICTED: polycomb protein EED, partial [Tyto alba]
 ref|XP_010143401.1| PREDICTED: polycomb protein EED, partial [Buceros rhinoceros 
silvestris]
 ref|XP_010116562.1| PREDICTED: polycomb protein EED, partial [Chlamydotis macqueenii]
 ref|XP_010290589.1| PREDICTED: polycomb protein EED, partial [Phaethon lepturus]
 ref|XP_010302813.1| PREDICTED: polycomb protein EED, partial [Balearica regulorum 
gibbericeps]
 gb|KFO05292.1| Polycomb protein EED, partial [Balearica regulorum gibbericeps]
 gb|KFO85685.1| Polycomb protein EED, partial [Buceros rhinoceros silvestris]
 gb|KFP03141.1| Polycomb protein EED, partial [Calypte anna]
 gb|KFP14522.1| Polycomb protein EED, partial [Egretta garzetta]
 gb|KFP40935.1| Polycomb protein EED, partial [Chlamydotis macqueenii]
 gb|KFP62787.1| Polycomb protein EED, partial [Cariama cristata]
 gb|KFP78284.1| Polycomb protein EED, partial [Apaloderma vittatum]
 gb|KFP79027.1| Polycomb protein EED, partial [Acanthisitta chloris]
 gb|KFQ23948.1| Polycomb protein EED, partial [Merops nubicus]
 gb|KFQ41124.1| Polycomb protein EED, partial [Nestor notabilis]
 gb|KFQ68272.1| Polycomb protein EED, partial [Phaethon lepturus]
 gb|KFR02901.1| Polycomb protein EED, partial [Nipponia nippon]
 gb|KFR08365.1| Polycomb protein EED, partial [Opisthocomus hoazin]
 gb|KFU93312.1| Polycomb protein EED, partial [Chaetura pelagica]
 gb|KFV06797.1| Polycomb protein EED, partial [Tauraco erythrolophus]
 gb|KFV40803.1| Polycomb protein EED, partial [Gavia stellata]
 gb|KFV52770.1| Polycomb protein EED, partial [Tyto alba]
 gb|KFV67113.1| Polycomb protein EED, partial [Picoides pubescens]
 gb|KFV80029.1| Polycomb protein EED, partial [Struthio camelus australis]
 gb|KFW66695.1| Polycomb protein EED, partial [Pygoscelis adeliae]
 gb|KFW84699.1| Polycomb protein EED, partial [Manacus vitellinus]
 gb|KGL80238.1| Polycomb protein EED, partial [Tinamus guttatus]
 gb|KGL90221.1| Polycomb protein EED, partial [Charadrius vociferus]
Length=403

 Score = 66.2 bits (160),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 35/76 (46%), Positives = 49/76 (64%), Gaps = 4/76 (5%)
 Frame = +3

Query  567  KKEYRVTNRLQEGK-RPLYAVVFNFIDSRYFN--VFATAGGNRVTVYQCLEGGVIAVLQS  737
            K  ++  N L+E   +PL+ V FN+  S+  +  VFAT G NRVT+Y+C   G I +LQS
Sbjct  41   KYSFKCVNSLKEDHGQPLFGVQFNW-HSKEGDPLVFATVGSNRVTLYECHSQGEIRLLQS  99

Query  738  YIDEDKDESFYTVSWA  785
            Y+D D DE+FYT +W 
Sbjct  100  YVDADADENFYTCAWT  115



>ref|XP_009930885.1| PREDICTED: polycomb protein EED [Opisthocomus hoazin]
Length=406

 Score = 66.2 bits (160),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 35/76 (46%), Positives = 49/76 (64%), Gaps = 4/76 (5%)
 Frame = +3

Query  567  KKEYRVTNRLQEGK-RPLYAVVFNFIDSRYFN--VFATAGGNRVTVYQCLEGGVIAVLQS  737
            K  ++  N L+E   +PL+ V FN+  S+  +  VFAT G NRVT+Y+C   G I +LQS
Sbjct  44   KYSFKCVNSLKEDHGQPLFGVQFNW-HSKEGDPLVFATVGSNRVTLYECHSQGEIRLLQS  102

Query  738  YIDEDKDESFYTVSWA  785
            Y+D D DE+FYT +W 
Sbjct  103  YVDADADENFYTCAWT  118



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1669417592084