BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig12803

Length=550
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009793094.1|  PREDICTED: uncharacterized protein LOC104240013  59.7    7e-14   Nicotiana sylvestris
emb|CDP13239.1|  unnamed protein product                              56.2    4e-13   Coffea canephora [robusta coffee]
ref|XP_009607000.1|  PREDICTED: uncharacterized protein LOC104101254  55.5    2e-12   Nicotiana tomentosiformis
ref|XP_006357592.1|  PREDICTED: hepatoma-derived growth factor-re...  56.6    7e-12   Solanum tuberosum [potatoes]
ref|XP_004239138.1|  PREDICTED: hepatoma-derived growth factor-re...  58.2    8e-12   Solanum lycopersicum
ref|XP_003525036.1|  PREDICTED: protein argonaute 2-like              50.1    4e-11   Glycine max [soybeans]
ref|XP_010248678.1|  PREDICTED: uncharacterized protein LOC104591519  50.1    2e-10   Nelumbo nucifera [Indian lotus]
ref|XP_010100369.1|  GDSL esterase/lipase                             48.9    2e-10   
ref|XP_003531329.1|  PREDICTED: protein lingerer-like                 47.8    8e-10   Glycine max [soybeans]
gb|KHN29022.1|  hypothetical protein glysoja_008357                   46.6    2e-09   Glycine soja [wild soybean]
ref|XP_007159695.1|  hypothetical protein PHAVU_002G259400g           45.8    2e-09   Phaseolus vulgaris [French bean]
ref|XP_011464053.1|  PREDICTED: uncharacterized protein LOC101293198  44.7    5e-09   Fragaria vesca subsp. vesca
gb|KHN06545.1|  hypothetical protein glysoja_010889                   44.3    5e-09   Glycine soja [wild soybean]
ref|XP_007225782.1|  hypothetical protein PRUPE_ppa003820mg           44.7    2e-08   Prunus persica
ref|XP_008221989.1|  PREDICTED: protein no-on-transient A             49.3    2e-08   Prunus mume [ume]
emb|CAN66291.1|  hypothetical protein VITISV_027030                   45.8    3e-08   Vitis vinifera
ref|XP_010659396.1|  PREDICTED: uncharacterized protein LOC104881315  45.8    3e-08   Vitis vinifera
ref|XP_010044554.1|  PREDICTED: uncharacterized protein LOC104433489  46.2    4e-08   Eucalyptus grandis [rose gum]
ref|XP_008793733.1|  PREDICTED: uncharacterized protein LOC103709960  42.7    6e-08   
gb|EYU22540.1|  hypothetical protein MIMGU_mgv1a004532mg              55.1    9e-08   Erythranthe guttata [common monkey flower]
ref|XP_011649497.1|  PREDICTED: uncharacterized protein LOC101206526  44.7    1e-07   Cucumis sativus [cucumbers]
ref|XP_011086667.1|  PREDICTED: muscle M-line assembly protein un...  60.5    2e-07   Sesamum indicum [beniseed]
gb|KDO82200.1|  hypothetical protein CISIN_1g009913mg                 41.6    3e-07   Citrus sinensis [apfelsine]
gb|KDO82199.1|  hypothetical protein CISIN_1g009913mg                 41.6    3e-07   Citrus sinensis [apfelsine]
ref|XP_008444377.1|  PREDICTED: uncharacterized protein LOC103487...  44.3    6e-07   Cucumis melo [Oriental melon]
ref|XP_008444378.1|  PREDICTED: uncharacterized protein LOC103487...  44.3    8e-07   
ref|XP_006483963.1|  PREDICTED: uncharacterized protein LOC102618...  41.6    8e-07   
ref|XP_006438236.1|  hypothetical protein CICLE_v10031235mg           41.6    9e-07   Citrus clementina [clementine]
ref|XP_007044834.1|  Eukaryotic translation initiation factor 4B1     45.1    9e-07   
gb|EYU30622.1|  hypothetical protein MIMGU_mgv1a003991mg              53.5    1e-06   Erythranthe guttata [common monkey flower]
ref|XP_002530045.1|  translation initiation factor, putative          48.1    4e-06   
ref|XP_008344431.1|  PREDICTED: uncharacterized protein LOC103407...  38.9    1e-05   Malus domestica [apple tree]
gb|KEH20765.1|  plant-specific eukaryotic initiation factor 4B        45.8    1e-05   Medicago truncatula
ref|XP_009359201.1|  PREDICTED: uncharacterized protein LOC103949...  39.3    2e-05   Pyrus x bretschneideri [bai li]
ref|XP_009359197.1|  PREDICTED: uncharacterized protein LOC103949...  37.4    4e-05   Pyrus x bretschneideri [bai li]
ref|XP_002314589.1|  eukaryotic translation initiation factor 4B ...  47.4    4e-05   Populus trichocarpa [western balsam poplar]
ref|XP_011620651.1|  PREDICTED: uncharacterized protein LOC18426922   40.0    7e-05   Amborella trichopoda
gb|ERM98884.1|  hypothetical protein AMTR_s00114p00018640             39.7    8e-05   Amborella trichopoda
ref|XP_002311758.2|  hypothetical protein POPTR_0008s18930g           50.4    1e-04   Populus trichocarpa [western balsam poplar]
ref|XP_010927536.1|  PREDICTED: uncharacterized protein LOC105049554  40.4    1e-04   Elaeis guineensis
ref|XP_002285504.1|  PREDICTED: uncharacterized protein LOC100242447  48.9    1e-04   Vitis vinifera
emb|CBI16799.3|  unnamed protein product                              48.9    1e-04   Vitis vinifera
emb|CDY16049.1|  BnaC08g40740D                                        37.7    1e-04   Brassica napus [oilseed rape]
ref|XP_008807466.1|  PREDICTED: uncharacterized protein LOC103719826  38.1    2e-04   Phoenix dactylifera
ref|XP_009118039.1|  PREDICTED: keratin, type II cytoskeletal 2 e...  37.7    2e-04   Brassica rapa
ref|XP_009118038.1|  PREDICTED: keratin, type II cytoskeletal 2 e...  37.7    2e-04   Brassica rapa
ref|XP_010556340.1|  PREDICTED: protein SOGA3-like                    37.4    4e-04   Tarenaya hassleriana [spider flower]
ref|XP_011042392.1|  PREDICTED: uncharacterized protein LOC105138089  44.3    5e-04   Populus euphratica
ref|XP_011071155.1|  PREDICTED: uncharacterized protein LOC105156652  35.4    6e-04   Sesamum indicum [beniseed]
ref|XP_010929914.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  36.6    0.001   



>ref|XP_009793094.1| PREDICTED: uncharacterized protein LOC104240013 [Nicotiana sylvestris]
Length=632

 Score = 59.7 bits (143),  Expect(2) = 7e-14, Method: Compositional matrix adjust.
 Identities = 28/44 (64%), Positives = 37/44 (84%), Gaps = 0/44 (0%)
 Frame = -2

Query  231  TDEEKNLKKEIEQLKKEALQDAGEDQAATHDLINQKERELELLI  100
            +  E+NLK+EIEQL+KEA+Q +G+DQ    ++INQKERELELLI
Sbjct  460  SGRERNLKEEIEQLRKEAMQSSGQDQTNLQNVINQKERELELLI  503


 Score = 43.9 bits (102),  Expect(2) = 7e-14, Method: Compositional matrix adjust.
 Identities = 19/31 (61%), Positives = 24/31 (77%), Gaps = 0/31 (0%)
 Frame = -1

Query  100  IRDLDDKVRFAEKTTESPGSGSNRVSSFAER  8
            IRDLDDKVRF++K  + PGSGS R +  +ER
Sbjct  503  IRDLDDKVRFSQKPIQRPGSGSGRAAGLSER  533


 Score = 69.7 bits (169),  Expect(2) = 2e-13, Method: Compositional matrix adjust.
 Identities = 34/50 (68%), Positives = 42/50 (84%), Gaps = 0/50 (0%)
 Frame = -2

Query  249  KCFRPETDEEKNLKKEIEQLKKEALQDAGEDQAATHDLINQKERELELLI  100
            +  RPET+EEKNLK+EIEQL+KEA+Q +G DQ    ++INQKERELELLI
Sbjct  393  RVDRPETEEEKNLKEEIEQLRKEAMQSSGHDQTNLRNVINQKERELELLI  442


 Score = 32.3 bits (72),  Expect(2) = 2e-13, Method: Compositional matrix adjust.
 Identities = 17/30 (57%), Positives = 19/30 (63%), Gaps = 3/30 (10%)
 Frame = -1

Query  100  IRDLDDKVRFAEKTTESPGSGSNRVSSFAE  11
            IRDLDDKVRF +K    PGS S R  +  E
Sbjct  442  IRDLDDKVRFGQKR---PGSASGRERNLKE  468



>emb|CDP13239.1| unnamed protein product [Coffea canephora]
Length=537

 Score = 56.2 bits (134),  Expect(2) = 4e-13, Method: Compositional matrix adjust.
 Identities = 31/45 (69%), Positives = 38/45 (84%), Gaps = 1/45 (2%)
 Frame = -2

Query  234  ETDEEKNLKKEIEQLKKEALQDAGEDQAATHDLINQKERELELLI  100
            ET+EEKNLK+EIE LKKE+LQ  G+DQ + HD I QKE++LELLI
Sbjct  402  ETEEEKNLKEEIEHLKKESLQKPGDDQ-SLHDQILQKEKDLELLI  445


 Score = 44.3 bits (103),  Expect(2) = 4e-13, Method: Compositional matrix adjust.
 Identities = 20/32 (63%), Positives = 24/32 (75%), Gaps = 0/32 (0%)
 Frame = -1

Query  100  IRDLDDKVRFAEKTTESPGSGSNRVSSFAERP  5
            IR+LDDKVRF  K TE PGSG+ R++   ERP
Sbjct  445  IRELDDKVRFGPKPTERPGSGAGRLTGHPERP  476



>ref|XP_009607000.1| PREDICTED: uncharacterized protein LOC104101254 [Nicotiana tomentosiformis]
Length=632

 Score = 55.5 bits (132),  Expect(2) = 2e-12, Method: Compositional matrix adjust.
 Identities = 27/44 (61%), Positives = 36/44 (82%), Gaps = 0/44 (0%)
 Frame = -2

Query  231  TDEEKNLKKEIEQLKKEALQDAGEDQAATHDLINQKERELELLI  100
            +  EKNLK++IEQL+KEA+Q +G+DQ    ++INQKE ELELLI
Sbjct  460  SGREKNLKEKIEQLRKEAMQSSGQDQTNLQNVINQKEWELELLI  503


 Score = 43.1 bits (100),  Expect(2) = 2e-12, Method: Compositional matrix adjust.
 Identities = 19/31 (61%), Positives = 23/31 (74%), Gaps = 0/31 (0%)
 Frame = -1

Query  100  IRDLDDKVRFAEKTTESPGSGSNRVSSFAER  8
            IRDLDDKVRF++K  + PGSGS R +   ER
Sbjct  503  IRDLDDKVRFSQKPIQRPGSGSGRATGLPER  533


 Score = 65.9 bits (159),  Expect(2) = 6e-12, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 41/50 (82%), Gaps = 0/50 (0%)
 Frame = -2

Query  249  KCFRPETDEEKNLKKEIEQLKKEALQDAGEDQAATHDLINQKERELELLI  100
            +  RP+T+EEKNLK+EIEQL+KEA+Q +G DQ    ++INQKER+LELL 
Sbjct  393  RVDRPDTEEEKNLKEEIEQLRKEAMQSSGHDQTNLQNVINQKERDLELLF  442


 Score = 31.2 bits (69),  Expect(2) = 6e-12, Method: Compositional matrix adjust.
 Identities = 16/31 (52%), Positives = 19/31 (61%), Gaps = 3/31 (10%)
 Frame = -1

Query  100  IRDLDDKVRFAEKTTESPGSGSNRVSSFAER  8
             RDLDDKVRF +K    PGS S R  +  E+
Sbjct  442  FRDLDDKVRFGQK---RPGSASGREKNLKEK  469



>ref|XP_006357592.1| PREDICTED: hepatoma-derived growth factor-related protein 2-like 
[Solanum tuberosum]
Length=569

 Score = 56.6 bits (135),  Expect(2) = 7e-12, Method: Composition-based stats.
 Identities = 29/47 (62%), Positives = 39/47 (83%), Gaps = 0/47 (0%)
 Frame = -2

Query  240  RPETDEEKNLKKEIEQLKKEALQDAGEDQAATHDLINQKERELELLI  100
            RPE +EEKNLK+EIEQL+KEA + + ED+    ++INQKE++LELLI
Sbjct  394  RPEMEEEKNLKEEIEQLRKEATECSEEDKTNLQNVINQKEKDLELLI  440


 Score = 40.0 bits (92),  Expect(2) = 7e-12, Method: Compositional matrix adjust.
 Identities = 18/31 (58%), Positives = 23/31 (74%), Gaps = 0/31 (0%)
 Frame = -1

Query  100  IRDLDDKVRFAEKTTESPGSGSNRVSSFAER  8
            IRDLDDKVRF++K  + PGSGS R +   +R
Sbjct  440  IRDLDDKVRFSQKPIQRPGSGSGRGAGHPDR  470



>ref|XP_004239138.1| PREDICTED: hepatoma-derived growth factor-related protein 2 [Solanum 
lycopersicum]
Length=569

 Score = 58.2 bits (139),  Expect(2) = 8e-12, Method: Composition-based stats.
 Identities = 30/47 (64%), Positives = 40/47 (85%), Gaps = 0/47 (0%)
 Frame = -2

Query  240  RPETDEEKNLKKEIEQLKKEALQDAGEDQAATHDLINQKERELELLI  100
            RPET+EEKNLK+EIEQL+KEA + + ED+    ++INQKE++LELLI
Sbjct  394  RPETEEEKNLKEEIEQLRKEATECSEEDKTNLQNVINQKEKDLELLI  440


 Score = 38.1 bits (87),  Expect(2) = 8e-12, Method: Compositional matrix adjust.
 Identities = 17/31 (55%), Positives = 23/31 (74%), Gaps = 0/31 (0%)
 Frame = -1

Query  100  IRDLDDKVRFAEKTTESPGSGSNRVSSFAER  8
            IR+LDDKVRF++K  + PGSGS R +   +R
Sbjct  440  IRELDDKVRFSQKPIQRPGSGSGRGAGHPDR  470



>ref|XP_003525036.1| PREDICTED: protein argonaute 2-like [Glycine max]
Length=531

 Score = 50.1 bits (118),  Expect(2) = 4e-11, Method: Compositional matrix adjust.
 Identities = 30/59 (51%), Positives = 39/59 (66%), Gaps = 12/59 (20%)
 Frame = -2

Query  240  RPETDEEKNLKKEIEQLKKE------------ALQDAGEDQAATHDLINQKERELELLI  100
            RPET EEK LK+EI+ LKKE            ++ +AG DQ +TH ++ QKE+ELELLI
Sbjct  380  RPETMEEKLLKEEIDNLKKELEKESTINSNKESVDEAGGDQTSTHAILQQKEKELELLI  438


 Score = 43.9 bits (102),  Expect(2) = 4e-11, Method: Compositional matrix adjust.
 Identities = 19/32 (59%), Positives = 25/32 (78%), Gaps = 0/32 (0%)
 Frame = -1

Query  100  IRDLDDKVRFAEKTTESPGSGSNRVSSFAERP  5
            IRDLDDKVRF +K  E PGS + + S+F++RP
Sbjct  438  IRDLDDKVRFGQKAIERPGSSAGKSSTFSDRP  469



>ref|XP_010248678.1| PREDICTED: uncharacterized protein LOC104591519 [Nelumbo nucifera]
Length=535

 Score = 50.1 bits (118),  Expect(2) = 2e-10, Method: Compositional matrix adjust.
 Identities = 22/33 (67%), Positives = 26/33 (79%), Gaps = 0/33 (0%)
 Frame = -1

Query  100  IRDLDDKVRFAEKTTESPGSGSNRVSSFAERPP  2
            IRDLDDK+RF +K  + PGSGS R +SF ERPP
Sbjct  443  IRDLDDKIRFGQKVVDRPGSGSGRSASFPERPP  475


 Score = 42.0 bits (97),  Expect(2) = 2e-10, Method: Compositional matrix adjust.
 Identities = 29/59 (49%), Positives = 38/59 (64%), Gaps = 12/59 (20%)
 Frame = -2

Query  240  RPETDEEKNLKKEIEQLKK-----------EALQDA-GEDQAATHDLINQKERELELLI  100
            RPET+EEK LK+EI+ L+K           E+LQ+A G +Q    +LI  KER+LELLI
Sbjct  385  RPETEEEKMLKEEIDHLRKELEKVAIDANGESLQEASGGEQTTLRELILHKERDLELLI  443



>ref|XP_010100369.1| GDSL esterase/lipase [Morus notabilis]
 gb|EXB82503.1| GDSL esterase/lipase [Morus notabilis]
Length=840

 Score = 48.9 bits (115),  Expect(2) = 2e-10, Method: Compositional matrix adjust.
 Identities = 21/33 (64%), Positives = 25/33 (76%), Gaps = 0/33 (0%)
 Frame = -1

Query  100  IRDLDDKVRFAEKTTESPGSGSNRVSSFAERPP  2
            IRDLDDKVRF +K  E PGSG+ R  ++ ERPP
Sbjct  378  IRDLDDKVRFGQKAVERPGSGAGRSGNYLERPP  410


 Score = 42.4 bits (98),  Expect(2) = 2e-10, Method: Composition-based stats.
 Identities = 26/54 (48%), Positives = 34/54 (63%), Gaps = 7/54 (13%)
 Frame = -2

Query  240  RPETDEEKNLKKEIEQLKKE-------ALQDAGEDQAATHDLINQKERELELLI  100
            R ET+EEK LK+EIE LKKE       + Q++  DQ +  D + Q+ERE E LI
Sbjct  325  RLETEEEKMLKEEIEYLKKELEKESTESSQESAGDQPSLRDTLLQREREFEKLI  378



>ref|XP_003531329.1| PREDICTED: protein lingerer-like [Glycine max]
Length=551

 Score = 47.8 bits (112),  Expect(2) = 8e-10, Method: Compositional matrix adjust.
 Identities = 29/59 (49%), Positives = 38/59 (64%), Gaps = 12/59 (20%)
 Frame = -2

Query  240  RPETDEEKNLKKEIEQLKKE------------ALQDAGEDQAATHDLINQKERELELLI  100
            RPET EEK LK+EI+ LKKE            ++ +AG DQ + H ++ QKE+ELELLI
Sbjct  400  RPETMEEKLLKEEIDNLKKELEKESTINSNKESVDEAGGDQTSRHAILQQKEKELELLI  458


 Score = 42.0 bits (97),  Expect(2) = 8e-10, Method: Compositional matrix adjust.
 Identities = 18/33 (55%), Positives = 24/33 (73%), Gaps = 0/33 (0%)
 Frame = -1

Query  100  IRDLDDKVRFAEKTTESPGSGSNRVSSFAERPP  2
            I DLD KVRF +K  E PGS + + S+F++RPP
Sbjct  458  IHDLDGKVRFGQKAVERPGSSAGKSSTFSDRPP  490



>gb|KHN29022.1| hypothetical protein glysoja_008357 [Glycine soja]
Length=258

 Score = 46.6 bits (109),  Expect(2) = 2e-09, Method: Compositional matrix adjust.
 Identities = 28/59 (47%), Positives = 38/59 (64%), Gaps = 12/59 (20%)
 Frame = -2

Query  240  RPETDEEKNLKKEIEQLKKE------------ALQDAGEDQAATHDLINQKERELELLI  100
            RPET EE+ LK+EI+ LKKE            ++ +AG DQ + H ++ QKE+ELELLI
Sbjct  107  RPETMEERLLKEEIDNLKKELEKESTINSNKESVDEAGGDQTSRHAILQQKEKELELLI  165


 Score = 42.0 bits (97),  Expect(2) = 2e-09, Method: Compositional matrix adjust.
 Identities = 18/33 (55%), Positives = 24/33 (73%), Gaps = 0/33 (0%)
 Frame = -1

Query  100  IRDLDDKVRFAEKTTESPGSGSNRVSSFAERPP  2
            I DLD KVRF +K  E PGS + + S+F++RPP
Sbjct  165  IHDLDGKVRFGQKAVERPGSSAGKSSTFSDRPP  197



>ref|XP_007159695.1| hypothetical protein PHAVU_002G259400g [Phaseolus vulgaris]
 gb|ESW31689.1| hypothetical protein PHAVU_002G259400g [Phaseolus vulgaris]
Length=559

 Score = 45.8 bits (107),  Expect(2) = 2e-09, Method: Compositional matrix adjust.
 Identities = 19/33 (58%), Positives = 25/33 (76%), Gaps = 0/33 (0%)
 Frame = -1

Query  100  IRDLDDKVRFAEKTTESPGSGSNRVSSFAERPP  2
            +RDLDDKVRF +K  E PGS + R S +++RPP
Sbjct  463  VRDLDDKVRFGQKAVERPGSSAGRSSGYSDRPP  495


 Score = 42.0 bits (97),  Expect(2) = 2e-09, Method: Composition-based stats.
 Identities = 27/57 (47%), Positives = 40/57 (70%), Gaps = 10/57 (18%)
 Frame = -2

Query  240  RPETDEEKNLKKEIEQLKKE--------ALQDAGE--DQAATHDLINQKERELELLI  100
            RPET EEK LK+EI+ LKKE        + +++G+  DQ +T+ ++ QKE+ELELL+
Sbjct  407  RPETMEEKLLKEEIDNLKKELEKESPINSNKESGDEADQTSTNGILQQKEKELELLV  463



>ref|XP_011464053.1| PREDICTED: uncharacterized protein LOC101293198 [Fragaria vesca 
subsp. vesca]
Length=582

 Score = 44.7 bits (104),  Expect(2) = 5e-09, Method: Composition-based stats.
 Identities = 27/57 (47%), Positives = 35/57 (61%), Gaps = 10/57 (18%)
 Frame = -2

Query  240  RPETDEEKNLKKEIEQLKKE----------ALQDAGEDQAATHDLINQKERELELLI  100
            R ET+EE+ LK EI+ LKKE           +Q++   Q   HD++ QKERELELLI
Sbjct  388  RLETEEERRLKDEIDGLKKELKSINNVNSETVQESSATQPRLHDIVAQKERELELLI  444


 Score = 42.4 bits (98),  Expect(2) = 5e-09, Method: Compositional matrix adjust.
 Identities = 20/32 (63%), Positives = 23/32 (72%), Gaps = 0/32 (0%)
 Frame = -1

Query  100  IRDLDDKVRFAEKTTESPGSGSNRVSSFAERP  5
            IRDLDDKVRF +K  + PGSG+ R  S A RP
Sbjct  444  IRDLDDKVRFGQKAIDRPGSGAGRPGSGAGRP  475



>gb|KHN06545.1| hypothetical protein glysoja_010889 [Glycine soja]
Length=148

 Score = 44.3 bits (103),  Expect(2) = 5e-09, Method: Compositional matrix adjust.
 Identities = 19/32 (59%), Positives = 25/32 (78%), Gaps = 0/32 (0%)
 Frame = -1

Query  100 IRDLDDKVRFAEKTTESPGSGSNRVSSFAERP  5
           IRDLDDKVRF +K  E PGS + + S+F++RP
Sbjct  55  IRDLDDKVRFGQKAIERPGSSAGKSSTFSDRP  86


 Score = 42.7 bits (99),  Expect(2) = 5e-09, Method: Compositional matrix adjust.
 Identities = 23/44 (52%), Positives = 32/44 (73%), Gaps = 5/44 (11%)
 Frame = -2

Query  216  NLKKEIEQ-----LKKEALQDAGEDQAATHDLINQKERELELLI  100
            NLKKE+E+       KE++ +AG DQ +TH ++ QKE+ELELLI
Sbjct  12   NLKKELEKESTINSNKESVDEAGGDQTSTHAILQQKEKELELLI  55



>ref|XP_007225782.1| hypothetical protein PRUPE_ppa003820mg [Prunus persica]
 gb|EMJ26981.1| hypothetical protein PRUPE_ppa003820mg [Prunus persica]
Length=546

 Score = 44.7 bits (104),  Expect(2) = 2e-08, Method: Compositional matrix adjust.
 Identities = 27/57 (47%), Positives = 36/57 (63%), Gaps = 12/57 (21%)
 Frame = -2

Query  234  ETDEEKNLKKEIEQLKKE------------ALQDAGEDQAATHDLINQKERELELLI  100
            ET+EE+ LK+EI+ LKKE              Q++G DQA+  D++ QKERELE LI
Sbjct  384  ETEEERKLKEEIDHLKKELEKESPDKTNSETGQESGGDQASLRDIVLQKERELETLI  440


 Score = 40.4 bits (93),  Expect(2) = 2e-08, Method: Compositional matrix adjust.
 Identities = 19/32 (59%), Positives = 22/32 (69%), Gaps = 0/32 (0%)
 Frame = -1

Query  100  IRDLDDKVRFAEKTTESPGSGSNRVSSFAERP  5
            I DLDDKVRF +K  + PGSG+ R  S A RP
Sbjct  440  IHDLDDKVRFGQKAIDRPGSGAGRPGSGAGRP  471



>ref|XP_008221989.1| PREDICTED: protein no-on-transient A [Prunus mume]
Length=477

 Score = 49.3 bits (116),  Expect(2) = 2e-08, Method: Compositional matrix adjust.
 Identities = 29/59 (49%), Positives = 38/59 (64%), Gaps = 12/59 (20%)
 Frame = -2

Query  240  RPETDEEKNLKKEIEQLKKE------------ALQDAGEDQAATHDLINQKERELELLI  100
            RPET+EE+ LK+EI+ LKKE              Q++G DQA+  D++ QKERELE LI
Sbjct  393  RPETEEERKLKEEIDHLKKELEKESPDKTNSETGQESGGDQASLRDIVLQKERELETLI  451


 Score = 35.8 bits (81),  Expect(2) = 2e-08, Method: Compositional matrix adjust.
 Identities = 15/24 (63%), Positives = 18/24 (75%), Gaps = 0/24 (0%)
 Frame = -1

Query  100  IRDLDDKVRFAEKTTESPGSGSNR  29
            I DLDDKVRF +K  + PGSG+ R
Sbjct  451  IHDLDDKVRFGQKAIDRPGSGAGR  474



>emb|CAN66291.1| hypothetical protein VITISV_027030 [Vitis vinifera]
Length=562

 Score = 45.8 bits (107),  Expect(2) = 3e-08, Method: Composition-based stats.
 Identities = 27/55 (49%), Positives = 36/55 (65%), Gaps = 9/55 (16%)
 Frame = -2

Query  240  RPETDEEKNLKKEIEQLKKE---------ALQDAGEDQAATHDLINQKERELELL  103
            RPET+EEKNL++EI  LK+E         +++ +GEDQ +  DLI  KER LE L
Sbjct  415  RPETEEEKNLREEIWDLKRELQKESEKRQSMKGSGEDQISLQDLILSKERNLEQL  469


 Score = 38.5 bits (88),  Expect(2) = 3e-08, Method: Compositional matrix adjust.
 Identities = 18/31 (58%), Positives = 21/31 (68%), Gaps = 0/31 (0%)
 Frame = -1

Query  94   DLDDKVRFAEKTTESPGSGSNRVSSFAERPP  2
            DLDDKVRF  K  E PGSG+ R +  +ER P
Sbjct  472  DLDDKVRFGRKVMEKPGSGAFRGAIISERLP  502



>ref|XP_010659396.1| PREDICTED: uncharacterized protein LOC104881315 [Vitis vinifera]
Length=522

 Score = 45.8 bits (107),  Expect(2) = 3e-08, Method: Compositional matrix adjust.
 Identities = 27/55 (49%), Positives = 36/55 (65%), Gaps = 9/55 (16%)
 Frame = -2

Query  240  RPETDEEKNLKKEIEQLKKE---------ALQDAGEDQAATHDLINQKERELELL  103
            RPET+EEKNL++EI  LK+E         +++ +GEDQ +  DLI  KER LE L
Sbjct  375  RPETEEEKNLREEIWDLKRELQKESEKRQSMKGSGEDQISLQDLILSKERNLEQL  429


 Score = 38.1 bits (87),  Expect(2) = 3e-08, Method: Compositional matrix adjust.
 Identities = 18/31 (58%), Positives = 21/31 (68%), Gaps = 0/31 (0%)
 Frame = -1

Query  94   DLDDKVRFAEKTTESPGSGSNRVSSFAERPP  2
            DLDDKVRF  K  E PGSG+ R +  +ER P
Sbjct  432  DLDDKVRFGRKVMEKPGSGAFRGAIISERLP  462



>ref|XP_010044554.1| PREDICTED: uncharacterized protein LOC104433489 [Eucalyptus grandis]
 gb|KCW86640.1| hypothetical protein EUGRSUZ_B03270 [Eucalyptus grandis]
Length=527

 Score = 46.2 bits (108),  Expect(2) = 4e-08, Method: Compositional matrix adjust.
 Identities = 20/33 (61%), Positives = 25/33 (76%), Gaps = 0/33 (0%)
 Frame = -1

Query  100  IRDLDDKVRFAEKTTESPGSGSNRVSSFAERPP  2
             RDLDDKVRF +K+ + PGSG  R  SF++RPP
Sbjct  435  TRDLDDKVRFGQKSVDRPGSGYGRSGSFSDRPP  467


 Score = 37.7 bits (86),  Expect(2) = 4e-08, Method: Compositional matrix adjust.
 Identities = 28/59 (47%), Positives = 35/59 (59%), Gaps = 12/59 (20%)
 Frame = -2

Query  240  RPETDEEKNLKKEIEQLKKE-----AL-------QDAGEDQAATHDLINQKERELELLI  100
            RP+T++EK LK+EIE LKKE     AL       Q +  DQ +  D I+ KERELE L 
Sbjct  377  RPQTEQEKMLKEEIENLKKEMEKELALKANNEHSQGSEADQPSLSDAISLKERELEALT  435



>ref|XP_008793733.1| PREDICTED: uncharacterized protein LOC103709960 [Phoenix dactylifera]
Length=552

 Score = 42.7 bits (99),  Expect(2) = 6e-08, Method: Composition-based stats.
 Identities = 26/58 (45%), Positives = 36/58 (62%), Gaps = 11/58 (19%)
 Frame = -2

Query  240  RPETDEEKNLKKEIEQLKKE-----------ALQDAGEDQAATHDLINQKERELELLI  100
            RPET EEK LK+EI  LKKE           ++Q + E+  + HD I ++E++LELLI
Sbjct  391  RPETAEEKLLKEEINHLKKELKETEGNLGGDSVQTSAEEITSLHDQIIRREKDLELLI  448


 Score = 40.4 bits (93),  Expect(2) = 6e-08, Method: Compositional matrix adjust.
 Identities = 19/35 (54%), Positives = 26/35 (74%), Gaps = 2/35 (6%)
 Frame = -1

Query  100  IRDLDDKVRFAEKTTES--PGSGSNRVSSFAERPP  2
            IR+LDDKVRF ++ T    PGSGS R++ F++R P
Sbjct  448  IRELDDKVRFGQRATSDIRPGSGSGRIAVFSDRQP  482



>gb|EYU22540.1| hypothetical protein MIMGU_mgv1a004532mg [Erythranthe guttata]
Length=522

 Score = 55.1 bits (131),  Expect(2) = 9e-08, Method: Compositional matrix adjust.
 Identities = 28/47 (60%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -2

Query  240  RPETDEEKNLKKEIEQLKKEALQDAGEDQAATHDLINQKERELELLI  100
            RPET+EEKNLK+EIE LK E  Q +GE+Q +  DLI QK++ LE+L+
Sbjct  352  RPETEEEKNLKEEIEHLKNELQQKSGEEQTSVQDLILQKQQHLEVLV  398


 Score = 27.3 bits (59),  Expect(2) = 9e-08, Method: Compositional matrix adjust.
 Identities = 17/42 (40%), Positives = 21/42 (50%), Gaps = 8/42 (19%)
 Frame = -1

Query  106  VDIRDLDDKVRFAEKTTE--------SPGSGSNRVSSFAERP  5
            V +  LDDKVR+++K  E         PGS     S F ERP
Sbjct  396  VLVHQLDDKVRYSQKIFERQNSRPPSRPGSHDGPRSGFPERP  437



>ref|XP_011649497.1| PREDICTED: uncharacterized protein LOC101206526 [Cucumis sativus]
 gb|KGN62328.1| hypothetical protein Csa_2G349620 [Cucumis sativus]
Length=531

 Score = 44.7 bits (104),  Expect(2) = 1e-07, Method: Compositional matrix adjust.
 Identities = 20/32 (63%), Positives = 24/32 (75%), Gaps = 0/32 (0%)
 Frame = -1

Query  100  IRDLDDKVRFAEKTTESPGSGSNRVSSFAERP  5
            + DLDDKVRF +K TE PGSG+ R + F ERP
Sbjct  428  VLDLDDKVRFGKKATERPGSGAGRAAVFPERP  459


 Score = 37.0 bits (84),  Expect(2) = 1e-07, Method: Compositional matrix adjust.
 Identities = 24/59 (41%), Positives = 35/59 (59%), Gaps = 12/59 (20%)
 Frame = -2

Query  240  RPETDEEKNLKKEIEQLK------------KEALQDAGEDQAATHDLINQKERELELLI  100
            RPET+EEK LK+EI+ L+            KE++Q++  +     D IN+KE ELE L+
Sbjct  370  RPETEEEKMLKEEIDVLRKELEEGLSLNANKESVQESAGEMQNLRDRINKKEHELETLV  428



>ref|XP_011086667.1| PREDICTED: muscle M-line assembly protein unc-89-like [Sesamum 
indicum]
Length=613

 Score = 60.5 bits (145),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 31/47 (66%), Positives = 40/47 (85%), Gaps = 0/47 (0%)
 Frame = -2

Query  240  RPETDEEKNLKKEIEQLKKEALQDAGEDQAATHDLINQKERELELLI  100
            RPET+EEKNLK+EIE LKKE L  +G+D+ + HDLI+Q+E ELELL+
Sbjct  372  RPETEEEKNLKEEIEHLKKELLLKSGDDKTSIHDLIHQREGELELLV  418



>gb|KDO82200.1| hypothetical protein CISIN_1g009913mg [Citrus sinensis]
Length=515

 Score = 41.6 bits (96),  Expect(2) = 3e-07, Method: Compositional matrix adjust.
 Identities = 20/33 (61%), Positives = 23/33 (70%), Gaps = 1/33 (3%)
 Frame = -1

Query  100  IRDLDDKVRFAEKTTESPGSGSNRVSSFAERPP  2
            +RDLD KVRF  K  E PGSG+ R + F ERPP
Sbjct  432  VRDLDSKVRFGPKA-ERPGSGAGRAAGFLERPP  463


 Score = 39.3 bits (90),  Expect(2) = 3e-07, Method: Compositional matrix adjust.
 Identities = 20/38 (53%), Positives = 30/38 (79%), Gaps = 1/38 (3%)
 Frame = -2

Query  213  LKKEIEQLKKEALQDAGEDQAATHDLINQKERELELLI  100
            LKKE+E L +E+LQ++G +Q   HD+I  KE+ELE+L+
Sbjct  396  LKKELE-LNRESLQESGGEQPNLHDIILSKEQELEMLV  432



>gb|KDO82199.1| hypothetical protein CISIN_1g009913mg [Citrus sinensis]
Length=522

 Score = 41.6 bits (96),  Expect(2) = 3e-07, Method: Compositional matrix adjust.
 Identities = 20/33 (61%), Positives = 23/33 (70%), Gaps = 1/33 (3%)
 Frame = -1

Query  100  IRDLDDKVRFAEKTTESPGSGSNRVSSFAERPP  2
            +RDLD KVRF  K  E PGSG+ R + F ERPP
Sbjct  432  VRDLDSKVRFGPKA-ERPGSGAGRAAGFLERPP  463


 Score = 39.3 bits (90),  Expect(2) = 3e-07, Method: Compositional matrix adjust.
 Identities = 20/38 (53%), Positives = 30/38 (79%), Gaps = 1/38 (3%)
 Frame = -2

Query  213  LKKEIEQLKKEALQDAGEDQAATHDLINQKERELELLI  100
            LKKE+E L +E+LQ++G +Q   HD+I  KE+ELE+L+
Sbjct  396  LKKELE-LNRESLQESGGEQPNLHDIILSKEQELEMLV  432



>ref|XP_008444377.1| PREDICTED: uncharacterized protein LOC103487724 isoform X1 [Cucumis 
melo]
Length=563

 Score = 44.3 bits (103),  Expect(2) = 6e-07, Method: Compositional matrix adjust.
 Identities = 20/32 (63%), Positives = 24/32 (75%), Gaps = 0/32 (0%)
 Frame = -1

Query  100  IRDLDDKVRFAEKTTESPGSGSNRVSSFAERP  5
            I DLDDKVRF +K T+ PGSG+ R + F ERP
Sbjct  432  ILDLDDKVRFGKKATDRPGSGAGRAAVFPERP  463


 Score = 35.4 bits (80),  Expect(2) = 6e-07, Method: Compositional matrix adjust.
 Identities = 24/59 (41%), Positives = 35/59 (59%), Gaps = 12/59 (20%)
 Frame = -2

Query  240  RPETDEEKNLKKEIEQLK------------KEALQDAGEDQAATHDLINQKERELELLI  100
            RPET+EEK LK+EI+ L+            KE++Q++  +     + IN+KE ELE LI
Sbjct  374  RPETEEEKMLKEEIDVLRKELEEGLSLNANKESVQESAGEMQNLRERINKKEHELETLI  432



>ref|XP_008444378.1| PREDICTED: uncharacterized protein LOC103487724 isoform X2 [Cucumis 
melo]
Length=549

 Score = 44.3 bits (103),  Expect(2) = 8e-07, Method: Compositional matrix adjust.
 Identities = 20/32 (63%), Positives = 24/32 (75%), Gaps = 0/32 (0%)
 Frame = -1

Query  100  IRDLDDKVRFAEKTTESPGSGSNRVSSFAERP  5
            I DLDDKVRF +K T+ PGSG+ R + F ERP
Sbjct  432  ILDLDDKVRFGKKATDRPGSGAGRAAVFPERP  463


 Score = 35.4 bits (80),  Expect(2) = 8e-07, Method: Compositional matrix adjust.
 Identities = 24/59 (41%), Positives = 35/59 (59%), Gaps = 12/59 (20%)
 Frame = -2

Query  240  RPETDEEKNLKKEIEQLK------------KEALQDAGEDQAATHDLINQKERELELLI  100
            RPET+EEK LK+EI+ L+            KE++Q++  +     + IN+KE ELE LI
Sbjct  374  RPETEEEKMLKEEIDVLRKELEEGLSLNANKESVQESAGEMQNLRERINKKEHELETLI  432



>ref|XP_006483963.1| PREDICTED: uncharacterized protein LOC102618826 isoform X2 [Citrus 
sinensis]
Length=515

 Score = 41.6 bits (96),  Expect(2) = 8e-07, Method: Compositional matrix adjust.
 Identities = 20/33 (61%), Positives = 23/33 (70%), Gaps = 1/33 (3%)
 Frame = -1

Query  100  IRDLDDKVRFAEKTTESPGSGSNRVSSFAERPP  2
            +RDLD KVRF  K  E PGSG+ R + F ERPP
Sbjct  432  VRDLDSKVRFGPKA-ERPGSGAGRAAGFLERPP  463


 Score = 37.7 bits (86),  Expect(2) = 8e-07, Method: Compositional matrix adjust.
 Identities = 19/38 (50%), Positives = 30/38 (79%), Gaps = 1/38 (3%)
 Frame = -2

Query  213  LKKEIEQLKKEALQDAGEDQAATHDLINQKERELELLI  100
            LKKE+E + +E+LQ++G +Q + HD I  KE+ELE+L+
Sbjct  396  LKKELE-INRESLQESGGEQPSLHDNILSKEQELEMLV  432



>ref|XP_006438236.1| hypothetical protein CICLE_v10031235mg [Citrus clementina]
 ref|XP_006483962.1| PREDICTED: uncharacterized protein LOC102618826 isoform X1 [Citrus 
sinensis]
 gb|ESR51476.1| hypothetical protein CICLE_v10031235mg [Citrus clementina]
Length=522

 Score = 41.6 bits (96),  Expect(2) = 9e-07, Method: Compositional matrix adjust.
 Identities = 20/33 (61%), Positives = 23/33 (70%), Gaps = 1/33 (3%)
 Frame = -1

Query  100  IRDLDDKVRFAEKTTESPGSGSNRVSSFAERPP  2
            +RDLD KVRF  K  E PGSG+ R + F ERPP
Sbjct  432  VRDLDSKVRFGPKA-ERPGSGAGRAAGFLERPP  463


 Score = 37.7 bits (86),  Expect(2) = 9e-07, Method: Compositional matrix adjust.
 Identities = 19/38 (50%), Positives = 30/38 (79%), Gaps = 1/38 (3%)
 Frame = -2

Query  213  LKKEIEQLKKEALQDAGEDQAATHDLINQKERELELLI  100
            LKKE+E + +E+LQ++G +Q + HD I  KE+ELE+L+
Sbjct  396  LKKELE-INRESLQESGGEQPSLHDNILSKEQELEMLV  432



>ref|XP_007044834.1| Eukaryotic translation initiation factor 4B1 [Theobroma cacao]
 gb|EOY00666.1| Eukaryotic translation initiation factor 4B1 [Theobroma cacao]
Length=524

 Score = 45.1 bits (105),  Expect(2) = 9e-07, Method: Compositional matrix adjust.
 Identities = 19/32 (59%), Positives = 24/32 (75%), Gaps = 0/32 (0%)
 Frame = -1

Query  100  IRDLDDKVRFAEKTTESPGSGSNRVSSFAERP  5
            IRDLD+KVRF +K  E PGSG+ R+ S  +RP
Sbjct  431  IRDLDNKVRFGQKAVERPGSGAGRIGSLPDRP  462


 Score = 34.3 bits (77),  Expect(2) = 9e-07, Method: Compositional matrix adjust.
 Identities = 20/39 (51%), Positives = 26/39 (67%), Gaps = 1/39 (3%)
 Frame = -2

Query  216  NLKKEIEQLKKEALQDAGEDQAATHDLINQKERELELLI  100
            NLKKEIE+     ++ AG DQ    D + +KERELE+LI
Sbjct  394  NLKKEIEKESISKVEPAG-DQPTLRDTLLRKERELEILI  431



>gb|EYU30622.1| hypothetical protein MIMGU_mgv1a003991mg [Erythranthe guttata]
Length=551

 Score = 53.5 bits (127),  Expect(2) = 1e-06, Method: Compositional matrix adjust.
 Identities = 30/47 (64%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -2

Query  240  RPETDEEKNLKKEIEQLKKEALQDAGEDQAATHDLINQKERELELLI  100
            R ET+EE+ LK+EIEQLKKE L  + +DQ   +DLI QKERELELL+
Sbjct  362  RSETEEERKLKEEIEQLKKELLLKSDDDQTTINDLILQKERELELLV  408


 Score = 25.0 bits (53),  Expect(2) = 1e-06, Method: Compositional matrix adjust.
 Identities = 15/44 (34%), Positives = 21/44 (48%), Gaps = 11/44 (25%)
 Frame = -1

Query  100  IRDLDDKVRFAEKTTESPGSGS-----------NRVSSFAERPP  2
            +  LDDK+R+ +K  E  GS +           +R  S  ERPP
Sbjct  408  VLQLDDKIRYTQKNFERQGSAAGGAYENPRAALDRPPSQGERPP  451



>ref|XP_002530045.1| translation initiation factor, putative [Ricinus communis]
 gb|EEF32345.1| translation initiation factor, putative [Ricinus communis]
Length=484

 Score = 48.1 bits (113),  Expect(2) = 4e-06, Method: Compositional matrix adjust.
 Identities = 20/33 (61%), Positives = 25/33 (76%), Gaps = 0/33 (0%)
 Frame = -1

Query  100  IRDLDDKVRFAEKTTESPGSGSNRVSSFAERPP  2
            IRD DDKVRF +K  E PGSG+ R ++ +ERPP
Sbjct  399  IRDFDDKVRFGQKAIERPGSGAGRAANLSERPP  431


 Score = 28.9 bits (63),  Expect(2) = 4e-06, Method: Compositional matrix adjust.
 Identities = 29/53 (55%), Positives = 38/53 (72%), Gaps = 6/53 (11%)
 Frame = -2

Query  240  RPETDEEKNLKKEIEQLKKEA------LQDAGEDQAATHDLINQKERELELLI  100
            RPET+EEK LK+EIE LK+EA      LQ  G DQ +  ++I+QKE+ELE +I
Sbjct  347  RPETEEEKLLKEEIEHLKQEAAPKEESLQSHGGDQPSLQEIISQKEKELEQII  399



>ref|XP_008344431.1| PREDICTED: uncharacterized protein LOC103407261 isoform X1 [Malus 
domestica]
Length=545

 Score = 38.9 bits (89),  Expect(2) = 1e-05, Method: Compositional matrix adjust.
 Identities = 18/32 (56%), Positives = 22/32 (69%), Gaps = 0/32 (0%)
 Frame = -1

Query  100  IRDLDDKVRFAEKTTESPGSGSNRVSSFAERP  5
            IR+ DDKVRF +K  + PGSG+ R  S A RP
Sbjct  438  IREFDDKVRFGQKAIDRPGSGAGRPGSGAGRP  469


 Score = 36.6 bits (83),  Expect(2) = 1e-05, Method: Compositional matrix adjust.
 Identities = 20/44 (45%), Positives = 30/44 (68%), Gaps = 5/44 (11%)
 Frame = -2

Query  216  NLKKEIEQ-----LKKEALQDAGEDQAATHDLINQKERELELLI  100
            +LKKE+E+     +  E +Q++G D+ +  D+I QKERELE LI
Sbjct  395  HLKKELEKESTDKVNSETVQESGGDRPSLRDIILQKERELEALI  438



>gb|KEH20765.1| plant-specific eukaryotic initiation factor 4B [Medicago truncatula]
Length=529

 Score = 45.8 bits (107),  Expect(2) = 1e-05, Method: Compositional matrix adjust.
 Identities = 19/33 (58%), Positives = 25/33 (76%), Gaps = 0/33 (0%)
 Frame = -1

Query  100  IRDLDDKVRFAEKTTESPGSGSNRVSSFAERPP  2
            IRDLDDKVRF +K  E PGS + + + F++RPP
Sbjct  436  IRDLDDKVRFGQKAVERPGSSAGKTAGFSDRPP  468


 Score = 29.6 bits (65),  Expect(2) = 1e-05, Method: Compositional matrix adjust.
 Identities = 29/59 (49%), Positives = 36/59 (61%), Gaps = 12/59 (20%)
 Frame = -2

Query  240  RPETDEEKNLKKEIEQLKK------------EALQDAGEDQAATHDLINQKERELELLI  100
            RPET EEK LK+EI+ LKK            E+   +G DQ  TH ++ +KERELELLI
Sbjct  378  RPETIEEKLLKEEIDNLKKQLENESTVNSNEESADGSGGDQTGTHAMLLEKERELELLI  436



>ref|XP_009359201.1| PREDICTED: uncharacterized protein LOC103949810 isoform X4 [Pyrus 
x bretschneideri]
Length=553

 Score = 39.3 bits (90),  Expect(2) = 2e-05, Method: Compositional matrix adjust.
 Identities = 18/32 (56%), Positives = 22/32 (69%), Gaps = 0/32 (0%)
 Frame = -1

Query  100  IRDLDDKVRFAEKTTESPGSGSNRVSSFAERP  5
            IR+ DDKVRF +K  + PGSG+ R  S A RP
Sbjct  439  IREFDDKVRFGQKAIDRPGSGAGRPGSGAGRP  470


 Score = 35.8 bits (81),  Expect(2) = 2e-05, Method: Composition-based stats.
 Identities = 20/44 (45%), Positives = 30/44 (68%), Gaps = 5/44 (11%)
 Frame = -2

Query  216  NLKKEIEQ-----LKKEALQDAGEDQAATHDLINQKERELELLI  100
            +LKKE+E+     +  E +Q++G DQ +  D++ QKERELE LI
Sbjct  396  HLKKELEKESTDKVNSETVQESGGDQPSLRDIVLQKERELEALI  439



>ref|XP_009359197.1| PREDICTED: uncharacterized protein LOC103949810 isoform X1 [Pyrus 
x bretschneideri]
Length=539

 Score = 37.4 bits (85),  Expect(2) = 4e-05, Method: Compositional matrix adjust.
 Identities = 20/44 (45%), Positives = 30/44 (68%), Gaps = 5/44 (11%)
 Frame = -2

Query  216  NLKKEIEQ-----LKKEALQDAGEDQAATHDLINQKERELELLI  100
            +LKKE+E+     +  E +Q++G DQ +  D++ QKERELE LI
Sbjct  396  HLKKELEKESTDKVNSETVQESGGDQPSLRDIVLQKERELEALI  439


 Score = 36.6 bits (83),  Expect(2) = 4e-05, Method: Compositional matrix adjust.
 Identities = 17/31 (55%), Positives = 21/31 (68%), Gaps = 0/31 (0%)
 Frame = -1

Query  100  IRDLDDKVRFAEKTTESPGSGSNRVSSFAER  8
            IR+ DDKVRF +K  + PGSG+ R  S A R
Sbjct  439  IREFDDKVRFGQKAIDRPGSGAGRPGSSAGR  469



>ref|XP_002314589.1| eukaryotic translation initiation factor 4B family protein [Populus 
trichocarpa]
 gb|EEF00760.1| eukaryotic translation initiation factor 4B family protein [Populus 
trichocarpa]
Length=522

 Score = 47.4 bits (111),  Expect(2) = 4e-05, Method: Compositional matrix adjust.
 Identities = 21/33 (64%), Positives = 24/33 (73%), Gaps = 0/33 (0%)
 Frame = -1

Query  100  IRDLDDKVRFAEKTTESPGSGSNRVSSFAERPP  2
            +RDLDDKVRF  K  E PGSG+ R   F+ERPP
Sbjct  431  VRDLDDKVRFGPKAIERPGSGAGRSPGFSERPP  463


 Score = 26.6 bits (57),  Expect(2) = 4e-05, Method: Compositional matrix adjust.
 Identities = 25/57 (44%), Positives = 37/57 (65%), Gaps = 10/57 (18%)
 Frame = -2

Query  240  RPETDEEKNLKKEIEQLK----------KEALQDAGEDQAATHDLINQKERELELLI  100
            RPET+EEK LK++IE LK          +E  Q + +D  +  ++IN+KERELE+L+
Sbjct  375  RPETEEEKLLKEQIEHLKTELEKATKVNQEPQQVSVDDLPSLREMINEKERELEILV  431



>ref|XP_011620651.1| PREDICTED: uncharacterized protein LOC18426922 [Amborella trichopoda]
Length=503

 Score = 40.0 bits (92),  Expect(2) = 7e-05, Method: Compositional matrix adjust.
 Identities = 26/55 (47%), Positives = 34/55 (62%), Gaps = 8/55 (15%)
 Frame = -2

Query  240  RPETDEEKNLKKEIEQLKKEAL--------QDAGEDQAATHDLINQKERELELLI  100
            RPET+EEK LK EI  LKKE          ++A E+     +L+ +KE+ELELLI
Sbjct  361  RPETEEEKLLKDEINNLKKELAKEAELNFGKEASEEHMGLQELVAKKEKELELLI  415


 Score = 32.7 bits (73),  Expect(2) = 7e-05, Method: Compositional matrix adjust.
 Identities = 15/33 (45%), Positives = 22/33 (67%), Gaps = 0/33 (0%)
 Frame = -1

Query  100  IRDLDDKVRFAEKTTESPGSGSNRVSSFAERPP  2
            IR+LDDKVRF ++  E  GS ++   +  +RPP
Sbjct  415  IRELDDKVRFGQRGIERTGSAASGFGTGFDRPP  447



>gb|ERM98884.1| hypothetical protein AMTR_s00114p00018640 [Amborella trichopoda]
Length=254

 Score = 39.7 bits (91),  Expect(2) = 8e-05, Method: Compositional matrix adjust.
 Identities = 26/55 (47%), Positives = 34/55 (62%), Gaps = 8/55 (15%)
 Frame = -2

Query  240  RPETDEEKNLKKEIEQLKKEAL--------QDAGEDQAATHDLINQKERELELLI  100
            RPET+EEK LK EI  LKKE          ++A E+     +L+ +KE+ELELLI
Sbjct  106  RPETEEEKLLKDEINNLKKELAKEAELNFGKEASEEHMGLQELVAKKEKELELLI  160


 Score = 33.1 bits (74),  Expect(2) = 8e-05, Method: Compositional matrix adjust.
 Identities = 15/33 (45%), Positives = 22/33 (67%), Gaps = 0/33 (0%)
 Frame = -1

Query  100  IRDLDDKVRFAEKTTESPGSGSNRVSSFAERPP  2
            IR+LDDKVRF ++  E  GS ++   +  +RPP
Sbjct  160  IRELDDKVRFGQRGIERTGSAASGFGTGFDRPP  192



>ref|XP_002311758.2| hypothetical protein POPTR_0008s18930g [Populus trichocarpa]
 gb|EEE89125.2| hypothetical protein POPTR_0008s18930g [Populus trichocarpa]
Length=535

 Score = 50.4 bits (119),  Expect(2) = 1e-04, Method: Compositional matrix adjust.
 Identities = 22/33 (67%), Positives = 25/33 (76%), Gaps = 0/33 (0%)
 Frame = -1

Query  100  IRDLDDKVRFAEKTTESPGSGSNRVSSFAERPP  2
            +RDLDDKVRF  K  E PGSG+ R S F+ERPP
Sbjct  443  VRDLDDKVRFGSKANERPGSGAGRASGFSERPP  475


 Score = 21.6 bits (44),  Expect(2) = 1e-04, Method: Compositional matrix adjust.
 Identities = 19/59 (32%), Positives = 35/59 (59%), Gaps = 12/59 (20%)
 Frame = -2

Query  240  RPETDE-----------EKNLKKEI-EQLKKEALQDAGEDQAATHDLINQKERELELLI  100
            RPET+E           +K L+KE+  +  +E  + + +D  +  ++I++KERELE+L+
Sbjct  385  RPETEEEKLLKEEIEHLKKGLEKELTTKGNQEPPRGSADDIPSLREMISEKERELEMLV  443



>ref|XP_010927536.1| PREDICTED: uncharacterized protein LOC105049554 [Elaeis guineensis]
Length=549

 Score = 40.4 bits (93),  Expect(2) = 1e-04, Method: Compositional matrix adjust.
 Identities = 30/58 (52%), Positives = 33/58 (57%), Gaps = 11/58 (19%)
 Frame = -2

Query  240  RPETDEEKNLKKEIEQLK-----KEALQDAGEDQAATHDL------INQKERELELLI  100
            RPETDEEK LKKEI  LK      E  Q+    Q +T DL      I  KER+LELLI
Sbjct  397  RPETDEEKMLKKEINHLKALINEAEQSQNGKSAQLSTEDLSSLRERILNKERDLELLI  454


 Score = 31.6 bits (70),  Expect(2) = 1e-04, Method: Compositional matrix adjust.
 Identities = 16/35 (46%), Positives = 22/35 (63%), Gaps = 2/35 (6%)
 Frame = -1

Query  100  IRDLDDKVRFAEKTTES--PGSGSNRVSSFAERPP  2
            I  LDDKVRF ++ T +  PGSG+    + + RPP
Sbjct  454  IHHLDDKVRFGQRATSNIRPGSGAGSSDTSSTRPP  488



>ref|XP_002285504.1| PREDICTED: uncharacterized protein LOC100242447 [Vitis vinifera]
Length=522

 Score = 48.9 bits (115),  Expect(2) = 1e-04, Method: Compositional matrix adjust.
 Identities = 22/33 (67%), Positives = 25/33 (76%), Gaps = 0/33 (0%)
 Frame = -1

Query  100  IRDLDDKVRFAEKTTESPGSGSNRVSSFAERPP  2
            IRDLDDKVRF +K  E PGS + RV+ F ERPP
Sbjct  430  IRDLDDKVRFGQKAIERPGSAAGRVAVFPERPP  462


 Score = 23.1 bits (48),  Expect(2) = 1e-04, Method: Compositional matrix adjust.
 Identities = 27/56 (48%), Positives = 34/56 (61%), Gaps = 9/56 (16%)
 Frame = -2

Query  240  RPETDEEKNLKKEIEQLKKEALQDAGEDQAA---------THDLINQKERELELLI  100
            RP+T+EEK LK+EIEQLKKE   + G  +AA           D I  KE++LE LI
Sbjct  375  RPQTEEEKLLKEEIEQLKKELQNELGNSEAALASGGAQTSLRDEIASKEKDLEQLI  430



>emb|CBI16799.3| unnamed protein product [Vitis vinifera]
Length=417

 Score = 48.9 bits (115),  Expect(2) = 1e-04, Method: Compositional matrix adjust.
 Identities = 22/33 (67%), Positives = 25/33 (76%), Gaps = 0/33 (0%)
 Frame = -1

Query  100  IRDLDDKVRFAEKTTESPGSGSNRVSSFAERPP  2
            IRDLDDKVRF +K  E PGS + RV+ F ERPP
Sbjct  325  IRDLDDKVRFGQKAIERPGSAAGRVAVFPERPP  357


 Score = 23.1 bits (48),  Expect(2) = 1e-04, Method: Compositional matrix adjust.
 Identities = 27/56 (48%), Positives = 34/56 (61%), Gaps = 9/56 (16%)
 Frame = -2

Query  240  RPETDEEKNLKKEIEQLKKEALQDAGEDQAA---------THDLINQKERELELLI  100
            RP+T+EEK LK+EIEQLKKE   + G  +AA           D I  KE++LE LI
Sbjct  270  RPQTEEEKLLKEEIEQLKKELQNELGNSEAALASGGAQTSLRDEIASKEKDLEQLI  325



>emb|CDY16049.1| BnaC08g40740D [Brassica napus]
Length=504

 Score = 37.7 bits (86),  Expect(2) = 1e-04, Method: Compositional matrix adjust.
 Identities = 18/33 (55%), Positives = 25/33 (76%), Gaps = 1/33 (3%)
 Frame = -1

Query  100  IRDLDDKVRFAEKTTESPGSGS-NRVSSFAERP  5
            IR+LDDKVRF  +  E PGSG+ +R  +++ERP
Sbjct  416  IRELDDKVRFRPRAVERPGSGAGSRTGNYSERP  448


 Score = 33.9 bits (76),  Expect(2) = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/63 (37%), Positives = 36/63 (57%), Gaps = 13/63 (21%)
 Frame = -2

Query  249  KCFRPETDEEKNLKKEIEQLK-------------KEALQDAGEDQAATHDLINQKERELE  109
            +  RPET+ E+ LK+EIE+L+             KE+ Q++  +     D+I+ KE+ELE
Sbjct  354  RVDRPETEGERLLKEEIEELRKKLDKEATITADSKESQQESDSNNHNITDIISAKEKELE  413

Query  108  LLI  100
             LI
Sbjct  414  SLI  416



>ref|XP_008807466.1| PREDICTED: uncharacterized protein LOC103719826 [Phoenix dactylifera]
Length=552

 Score = 38.1 bits (87),  Expect(2) = 2e-04, Method: Compositional matrix adjust.
 Identities = 27/58 (47%), Positives = 34/58 (59%), Gaps = 11/58 (19%)
 Frame = -2

Query  240  RPETDEEKNLKKEIEQLK-----------KEALQDAGEDQAATHDLINQKERELELLI  100
            RPETDEEK LK+EI  LK            ++ Q + E+ A  H+ I  KER+LELLI
Sbjct  400  RPETDEEKMLKEEISHLKALTKETEENQNGKSAQLSVEELAGLHEQILNKERDLELLI  457


 Score = 33.1 bits (74),  Expect(2) = 2e-04, Method: Compositional matrix adjust.
 Identities = 17/35 (49%), Positives = 22/35 (63%), Gaps = 2/35 (6%)
 Frame = -1

Query  100  IRDLDDKVRFAEKTTE--SPGSGSNRVSSFAERPP  2
            IR LDDKVRF ++ T    P SG+ R  + + RPP
Sbjct  457  IRQLDDKVRFGQRATSIIRPSSGAGRSDTSSTRPP  491



>ref|XP_009118039.1| PREDICTED: keratin, type II cytoskeletal 2 epidermal isoform 
X2 [Brassica rapa]
Length=534

 Score = 37.7 bits (86),  Expect(2) = 2e-04, Method: Compositional matrix adjust.
 Identities = 18/33 (55%), Positives = 25/33 (76%), Gaps = 1/33 (3%)
 Frame = -1

Query  100  IRDLDDKVRFAEKTTESPGSGS-NRVSSFAERP  5
            IR+LDDKVRF  +  E PGSG+ +R  +++ERP
Sbjct  446  IRELDDKVRFRPRAVERPGSGAGSRTGNYSERP  478


 Score = 33.1 bits (74),  Expect(2) = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/60 (38%), Positives = 36/60 (60%), Gaps = 13/60 (22%)
 Frame = -2

Query  240  RPETDEEKNLKKEIEQLK-------------KEALQDAGEDQAATHDLINQKERELELLI  100
            RPET+ E+ LK+EIE+L+             KE+ Q++  +     +LI++KE+ELE LI
Sbjct  387  RPETEGERLLKEEIEELRKKLDKEATITADSKESQQESDTNNHNVPELISEKEKELESLI  446



>ref|XP_009118038.1| PREDICTED: keratin, type II cytoskeletal 2 epidermal isoform 
X1 [Brassica rapa]
Length=548

 Score = 37.7 bits (86),  Expect(2) = 2e-04, Method: Compositional matrix adjust.
 Identities = 18/33 (55%), Positives = 25/33 (76%), Gaps = 1/33 (3%)
 Frame = -1

Query  100  IRDLDDKVRFAEKTTESPGSGS-NRVSSFAERP  5
            IR+LDDKVRF  +  E PGSG+ +R  +++ERP
Sbjct  460  IRELDDKVRFRPRAVERPGSGAGSRTGNYSERP  492


 Score = 33.1 bits (74),  Expect(2) = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/60 (38%), Positives = 36/60 (60%), Gaps = 13/60 (22%)
 Frame = -2

Query  240  RPETDEEKNLKKEIEQLK-------------KEALQDAGEDQAATHDLINQKERELELLI  100
            RPET+ E+ LK+EIE+L+             KE+ Q++  +     +LI++KE+ELE LI
Sbjct  401  RPETEGERLLKEEIEELRKKLDKEATITADSKESQQESDTNNHNVPELISEKEKELESLI  460



>ref|XP_010556340.1| PREDICTED: protein SOGA3-like [Tarenaya hassleriana]
 ref|XP_010556341.1| PREDICTED: protein SOGA3-like [Tarenaya hassleriana]
Length=538

 Score = 37.4 bits (85),  Expect(2) = 4e-04, Method: Compositional matrix adjust.
 Identities = 27/59 (46%), Positives = 40/59 (68%), Gaps = 12/59 (20%)
 Frame = -2

Query  240  RPETDEEKNLKKEIEQLKK------EAL--QDAGEDQAATH----DLINQKERELELLI  100
            RPET+EEK LK+EIE+LKK      EAL  +D+ ++  + H    ++I+QKE++LE L 
Sbjct  386  RPETEEEKMLKEEIEELKKQLEKEPEALSSKDSEQEPESNHSRLPEIISQKEKDLETLT  444


 Score = 32.7 bits (73),  Expect(2) = 4e-04, Method: Compositional matrix adjust.
 Identities = 14/28 (50%), Positives = 19/28 (68%), Gaps = 0/28 (0%)
 Frame = -1

Query  100  IRDLDDKVRFAEKTTESPGSGSNRVSSF  17
             R+LD KVRF +K  E PGS + R ++F
Sbjct  444  TRELDGKVRFRQKAVERPGSNAGRTANF  471



>ref|XP_011042392.1| PREDICTED: uncharacterized protein LOC105138089 [Populus euphratica]
Length=521

 Score = 44.3 bits (103),  Expect(2) = 5e-04, Method: Compositional matrix adjust.
 Identities = 19/33 (58%), Positives = 23/33 (70%), Gaps = 0/33 (0%)
 Frame = -1

Query  100  IRDLDDKVRFAEKTTESPGSGSNRVSSFAERPP  2
            + DLDDK+RF  K  E PGSG+ R   F+ERPP
Sbjct  430  VHDLDDKLRFGPKAIERPGSGAGRSPGFSERPP  462


 Score = 25.8 bits (55),  Expect(2) = 5e-04, Method: Compositional matrix adjust.
 Identities = 25/59 (42%), Positives = 36/59 (61%), Gaps = 12/59 (20%)
 Frame = -2

Query  240  RPETDEEKNLKKEIEQLK------------KEALQDAGEDQAATHDLINQKERELELLI  100
            RPET+EEK LK++IE LK            +E  Q + +D     ++IN+KERELE+L+
Sbjct  372  RPETEEEKLLKEQIEHLKTELEKELTTKVNQEPQQVSVDDLPGLREMINEKERELEILV  430



>ref|XP_011071155.1| PREDICTED: uncharacterized protein LOC105156652 [Sesamum indicum]
Length=619

 Score = 35.4 bits (80),  Expect(2) = 6e-04, Method: Composition-based stats.
 Identities = 27/47 (57%), Positives = 40/47 (85%), Gaps = 0/47 (0%)
 Frame = -2

Query  240  RPETDEEKNLKKEIEQLKKEALQDAGEDQAATHDLINQKERELELLI  100
            RPET+EEK +K+EIE LKKE  Q +GED+++ H+LI ++E++LELL+
Sbjct  394  RPETEEEKKMKEEIEHLKKELPQKSGEDRSSLHNLILKREQDLELLV  440


 Score = 33.9 bits (76),  Expect(2) = 6e-04, Method: Compositional matrix adjust.
 Identities = 14/33 (42%), Positives = 23/33 (70%), Gaps = 0/33 (0%)
 Frame = -1

Query  100  IRDLDDKVRFAEKTTESPGSGSNRVSSFAERPP  2
            +R +DDKVR+++K  E   +G+ R   F++RPP
Sbjct  440  VRQMDDKVRYSQKIFERQSAGAVRGPGFSDRPP  472



>ref|XP_010929914.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC105051271 
[Elaeis guineensis]
Length=549

 Score = 36.6 bits (83),  Expect(2) = 0.001, Method: Compositional matrix adjust.
 Identities = 25/57 (44%), Positives = 34/57 (60%), Gaps = 11/57 (19%)
 Frame = -2

Query  240  RPETDEEKNLKKEIEQLKKE-----------ALQDAGEDQAATHDLINQKERELELL  103
            RPET EEK LK+EI  LKKE           ++Q + E+    HD I ++E++LELL
Sbjct  397  RPETAEEKLLKEEINHLKKELKETEGNLGDKSVQASAEEITNLHDQIFKREKDLELL  453


 Score = 32.3 bits (72),  Expect(2) = 0.001, Method: Compositional matrix adjust.
 Identities = 15/34 (44%), Positives = 23/34 (68%), Gaps = 2/34 (6%)
 Frame = -1

Query  97   RDLDDKVRFAEKTTES--PGSGSNRVSSFAERPP  2
            R+LDDKVRF ++      P SG+ R++ F++R P
Sbjct  455  RELDDKVRFGQRAAGDIRPSSGAGRIAMFSDRQP  488



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 612919574843