BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig12787

Length=1981
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

dbj|BAI47577.1|  lycopene beta cyclase                                  978   0.0      Ipomoea sp. Kenyan
ref|XP_009616408.1|  PREDICTED: lycopene beta cyclase, chloroplastic    866   0.0      Nicotiana tomentosiformis
ref|XP_006364433.1|  PREDICTED: lycopene beta cyclase, chloroplas...    865   0.0      Solanum tuberosum [potatoes]
gb|AIX87498.1|  lycopene beta-cyclase                                   862   0.0      Lycium barbarum [Duke of Argyll's teatree]
ref|NP_001234226.1|  lycopene beta cyclase, chloroplastic               862   0.0      Solanum lycopersicum
sp|Q43578.1|LCYB_TOBAC  RecName: Full=Lycopene beta cyclase, chlo...    860   0.0      Nicotiana tabacum [American tobacco]
ref|XP_009793443.1|  PREDICTED: lycopene beta cyclase, chloroplastic    860   0.0      Nicotiana sylvestris
sp|Q43415.1|LCYB_CAPAN  RecName: Full=Lycopene beta cyclase, chlo...    860   0.0      Capsicum annuum
gb|ADH04271.1|  lycopene beta-cyclase                                   859   0.0      Capsicum annuum
gb|AIX87522.1|  lycopene beta-cyclase                                   858   0.0      Lycium ruthenicum
ref|XP_010312096.1|  PREDICTED: lycopene beta cyclase, chloroplastic    858   0.0      Solanum lycopersicum
ref|XP_006351264.1|  PREDICTED: lycopene beta cyclase, chloroplas...    853   0.0      Solanum tuberosum [potatoes]
ref|XP_002275769.1|  PREDICTED: lycopene beta cyclase, chloroplastic    851   0.0      Vitis vinifera
emb|CAN69313.1|  hypothetical protein VITISV_011073                     849   0.0      Vitis vinifera
gb|AFP28799.1|  lycopene beta-cyclase 2                                 848   0.0      Vitis vinifera
ref|XP_002308903.1|  Lycopene beta cyclase family protein               847   0.0      
ref|XP_008240729.1|  PREDICTED: lycopene beta cyclase, chloroplas...    846   0.0      Prunus mume [ume]
ref|XP_007202046.1|  hypothetical protein PRUPE_ppa004528mg             846   0.0      Prunus persica
ref|XP_002323260.1|  Lycopene beta cyclase family protein               843   0.0      
ref|XP_012085981.1|  PREDICTED: lycopene beta cyclase, chloroplas...    840   0.0      Jatropha curcas
ref|XP_011033131.1|  PREDICTED: lycopene beta cyclase, chloroplas...    840   0.0      Populus euphratica
ref|XP_011467335.1|  PREDICTED: lycopene beta cyclase, chloroplastic    836   0.0      Fragaria vesca subsp. vesca
gb|AJB84622.1|  lycopene beta cyclase                                   833   0.0      Camellia sinensis [black tea]
emb|CDP12863.1|  unnamed protein product                                834   0.0      Coffea canephora [robusta coffee]
gb|ABB52071.1|  putative lycopene beta cyclase                          833   0.0      Daucus carota subsp. sativus
ref|XP_011027292.1|  PREDICTED: lycopene beta cyclase, chloroplas...    831   0.0      Populus euphratica
gb|ABF69942.1|  lycopene beta-cyclase allozyme 2                        829   0.0      Citrus sinensis [apfelsine]
gb|AAM21152.1|  lycopene beta-cyclase                                   829   0.0      Citrus sinensis [apfelsine]
gb|AAR89632.1|  lycopene-beta-cyclase                                   828   0.0      Citrus maxima [buntan]
gb|AAU05146.1|  lycopene beta-cyclase                                   828   0.0      Citrus sinensis [apfelsine]
gb|AAU05145.1|  lycopene beta-cyclase                                   828   0.0      Citrus sinensis [apfelsine]
gb|ACR25158.1|  lycopene beta-cyclase                                   827   0.0      Diospyros kaki [Japanese persimmon]
ref|XP_010273228.1|  PREDICTED: lycopene beta cyclase, chloroplas...    827   0.0      Nelumbo nucifera [Indian lotus]
ref|XP_006421272.1|  hypothetical protein CICLE_v10004730mg             828   0.0      
gb|AAN86060.1|  lycopene cyclase                                        827   0.0      Citrus unshiu [satsuma mandarin]
ref|XP_002531498.1|  Lycopene beta cyclase, chloroplast precursor...    827   0.0      Ricinus communis
gb|AAD38049.2|  lycopene cyclase                                        827   0.0      Citrus x paradisi [grapefruit]
gb|AEQ29514.1|  lycopene beta cyclase                                   826   0.0      Citrus x paradisi [grapefruit]
gb|AAF44700.2|AF240787_1  lycopene beta-cyclase                         826   0.0      Citrus sinensis [apfelsine]
gb|AAU14144.1|  lycopene beta-cyclase                                   826   0.0      Citrus sinensis [apfelsine]
gb|AEQ29513.1|  lycopene beta cyclase                                   825   0.0      Citrus sinensis [apfelsine]
ref|XP_003554132.1|  PREDICTED: lycopene beta cyclase, chloroplas...    825   0.0      Glycine max [soybeans]
gb|ACP19704.1|  lycopene beta-cyclase 2                                 825   0.0      Citrus sinensis [apfelsine]
gb|AEQ29511.1|  lycopene beta cyclase                                   825   0.0      Citrus sinensis [apfelsine]
gb|AAK07430.1|AF321534_1  lycopene beta-cyclase                         824   0.0      Adonis aestivalis var. palaestina
gb|AIT98182.1|  lycopene beta-cyclase                                   824   0.0      Medicago sativa [alfalfa]
gb|ABB72443.1|  lycopene beta-cyclase                                   825   0.0      Citrus sinensis [apfelsine]
gb|AEQ29510.1|  lycopene beta cyclase                                   823   0.0      Citrus sinensis [apfelsine]
ref|XP_009341957.1|  PREDICTED: lycopene beta cyclase, chloroplas...    823   0.0      Pyrus x bretschneideri [bai li]
ref|XP_003625025.1|  Lycopene beta-cyclase                              822   0.0      
ref|XP_007162104.1|  hypothetical protein PHAVU_001G124400g             823   0.0      Phaseolus vulgaris [French bean]
gb|AEQ29517.1|  lycopene beta cyclase                                   822   0.0      Citrus x paradisi [grapefruit]
gb|ABD91578.1|  lycopene beta-cyclase                                   822   0.0      Carica papaya [mamon]
ref|NP_001275849.1|  lycopene beta-cyclase 1                            821   0.0      Citrus sinensis [apfelsine]
gb|AEQ29512.1|  lycopene beta cyclase                                   820   0.0      Citrus sinensis [apfelsine]
ref|XP_011075396.1|  PREDICTED: lycopene beta cyclase, chloroplas...    820   0.0      Sesamum indicum [beniseed]
dbj|BAA88839.1|  phytoene cyclase                                       820   0.0      Gentiana lutea
gb|AEQ29515.1|  lycopene beta cyclase                                   819   0.0      Citrus x paradisi [grapefruit]
ref|XP_010104376.1|  Lycopene beta cyclase                              818   0.0      Morus notabilis
gb|ABK57115.1|  lycopene beta-cyclase 2                                 818   0.0      Gentiana lutea
gb|AFP43698.1|  lycopene beta-cyclase                                   816   0.0      Eriobotrya japonica [loquat]
ref|XP_007028557.1|  Lycopene cyclase                                   815   0.0      
ref|XP_008392386.1|  PREDICTED: lycopene beta cyclase, chloroplas...    815   0.0      Malus domestica [apple tree]
ref|XP_006576788.1|  PREDICTED: lycopene beta cyclase, chloroplas...    815   0.0      Glycine max [soybeans]
gb|KHN30373.1|  Lycopene beta cyclase, chloroplastic                    815   0.0      Glycine soja [wild soybean]
ref|XP_010056269.1|  PREDICTED: lycopene beta cyclase, chloroplas...    815   0.0      
dbj|BAA88840.1|  Lycopen cyclase 2                                      815   0.0      Gentiana lutea
gb|AAW88382.1|  lycopene beta-cyclase                                   814   0.0      Lycium barbarum [Duke of Argyll's teatree]
gb|EYU18654.1|  hypothetical protein MIMGU_mgv1a004941mg                813   0.0      Erythranthe guttata [common monkey flower]
gb|ACM24791.1|  lycopene beta-cyclase                                   812   0.0      Carica papaya [mamon]
gb|KHN43081.1|  Lycopene beta cyclase, chloroplastic                    812   0.0      Glycine soja [wild soybean]
gb|KCW90069.1|  hypothetical protein EUGRSUZ_A02265                     800   0.0      Eucalyptus grandis [rose gum]
ref|XP_004493413.1|  PREDICTED: lycopene beta cyclase, chloroplas...    800   0.0      Cicer arietinum [garbanzo]
ref|XP_009418101.1|  PREDICTED: lycopene beta cyclase, chloroplas...    796   0.0      Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB78495.1|  hypothetical protein B456_013G002400                    795   0.0      Gossypium raimondii
emb|CAD70565.1|  lycopene cyclase                                       793   0.0      Bixa orellana [achiote]
ref|XP_010672975.1|  PREDICTED: lycopene beta cyclase, chloroplastic    790   0.0      Beta vulgaris subsp. vulgaris [field beet]
gb|ADW08476.1|  lycopene beta-cyclase                                   790   0.0      Lilium lancifolium [true tiger lily]
ref|XP_006297408.1|  hypothetical protein CARUB_v10013432mg             790   0.0      
dbj|BAE78471.1|  lycopene beta cyclase                                  788   0.0      Taraxacum officinale [dandelion]
ref|XP_010486621.1|  PREDICTED: lycopene beta cyclase, chloroplas...    787   0.0      Camelina sativa [gold-of-pleasure]
ref|XP_008811265.1|  PREDICTED: lycopene beta cyclase, chloroplastic    783   0.0      Phoenix dactylifera
ref|XP_002884784.1|  lycopene cyclase                                   783   0.0      Arabidopsis lyrata subsp. lyrata
ref|XP_010464692.1|  PREDICTED: lycopene beta cyclase, chloroplas...    782   0.0      Camelina sativa [gold-of-pleasure]
ref|NP_187634.1|  lycopene beta cyclase                                 782   0.0      Arabidopsis thaliana [mouse-ear cress]
gb|ACT78995.1|  lycopene beta cyclase                                   782   0.0      Narcissus pseudonarcissus
gb|AAA81880.1|  lycopene cyclase                                        781   0.0      Arabidopsis thaliana [mouse-ear cress]
gb|ADT89710.1|  chloroplast lycopene beta-cyclase                       781   0.0      Brassica napus [oilseed rape]
ref|XP_006407592.1|  hypothetical protein EUTSA_v10020573mg             780   0.0      Eutrema salsugineum [saltwater cress]
ref|XP_009146860.1|  PREDICTED: lycopene beta cyclase, chloroplastic    778   0.0      Brassica rapa
gb|AAG10429.1|  beta cyclase                                            778   0.0      Tagetes erecta [big marigold]
ref|XP_010942591.1|  PREDICTED: lycopene beta cyclase, chloroplas...    777   0.0      Elaeis guineensis
dbj|BAE79544.1|  lycopene beta-cyclase                                  777   0.0      Chrysanthemum x morifolium [florist's chrysanthemum]
gb|ADH59741.1|  lycopene beta-cyclase                                   776   0.0      Brassica napus [oilseed rape]
ref|XP_010481540.1|  PREDICTED: lycopene beta cyclase, chloroplas...    773   0.0      Camelina sativa [gold-of-pleasure]
gb|KFK38411.1|  hypothetical protein AALP_AA3G109800                    773   0.0      Arabis alpina [alpine rockcress]
gb|ACM68702.1|  lycopene beta-cyclase                                   772   0.0      Brassica rapa subsp. pekinensis [bai cai]
sp|Q40424.1|LCYB_NARPS  RecName: Full=Lycopene beta cyclase, chlo...    771   0.0      Narcissus pseudonarcissus
gb|ADX60450.1|  lycopene beta-cyclase                                   770   0.0      Phaseolus vulgaris [French bean]
ref|XP_010558132.1|  PREDICTED: lycopene beta cyclase, chloroplas...    769   0.0      Tarenaya hassleriana [spider flower]
gb|AGH28089.1|  lycopene beta-cyclase                                   766   0.0      Solanum lycopersicum
ref|XP_004150761.1|  PREDICTED: lycopene beta cyclase, chloroplastic    768   0.0      Cucumis sativus [cucumbers]
gb|AEN94902.1|  lycopene beta cyclase                                   765   0.0      Cucurbita moschata [ayote]
gb|AGH28087.1|  lycopene beta-cyclase                                   763   0.0      Solanum lycopersicum
emb|CDY00914.1|  BnaC05g42860D                                          765   0.0      
gb|KDO50124.1|  hypothetical protein CISIN_1g014377mg                   761   0.0      Citrus sinensis [apfelsine]
gb|ABM90918.1|  lycopene beta-cyclase                                   764   0.0      Citrullus lanatus [wild melon]
gb|AGN48016.1|  lycopene beta cyclase                                   762   0.0      Cucumis melo [Oriental melon]
ref|XP_008457615.1|  PREDICTED: lycopene beta cyclase, chloroplastic    762   0.0      
gb|ABM90917.1|  lycopene beta-cyclase                                   762   0.0      Citrullus lanatus [wild melon]
gb|AAL92175.1|AF489520_1  beta-lycopene cyclase                         760   0.0      Sandersonia aurantiaca [Chinese-lantern lily]
gb|AFH53820.1|  lycopene beta-cyclase                                   757   0.0      Narcissus tazetta subsp. chinensis
gb|ADD14031.1|  lycopene beta cyclase                                   756   0.0      Cucumis melo [Oriental melon]
gb|AFH53819.1|  lycopene beta-cyclase                                   753   0.0      Narcissus tazetta subsp. chinensis
gb|AAX19899.1|  lycopene cyclase                                        753   0.0      Salicornia europaea [chicken-claws]
ref|XP_006839161.1|  PREDICTED: lycopene beta cyclase, chloroplas...    748   0.0      Amborella trichopoda
ref|XP_010552967.1|  PREDICTED: lycopene beta cyclase, chloroplas...    739   0.0      Tarenaya hassleriana [spider flower]
gb|AGU91432.1|  lycopene beta-cyclase                                   728   0.0      Chrysanthemum boreale
gb|EPS69984.1|  lycopene beta-cyclase                                   727   0.0      Genlisea aurea
dbj|BAE43559.1|  putative lycopene beta cyclase                         721   0.0      Taxodium distichum var. imbricarium [pond-cypress]
dbj|BAE43542.1|  putative lycopene beta cyclase                         721   0.0      Cryptomeria japonica
dbj|BAE43526.1|  putative lycopene beta cyclase                         721   0.0      Cryptomeria japonica
dbj|BAD02730.1|  putative lycopene beta cyclase                         721   0.0      Cryptomeria japonica
dbj|BAE43517.1|  putative lycopene beta cyclase                         721   0.0      Cryptomeria japonica
dbj|BAE43541.1|  putative lycopene beta cyclase                         721   0.0      Cryptomeria japonica
dbj|BAD02727.1|  putative lycopene beta cyclase                         721   0.0      Cryptomeria japonica
dbj|BAD02754.1|  putative lycopene beta cyclase                         720   0.0      Cryptomeria japonica
dbj|BAE43519.1|  putative lycopene beta cyclase                         720   0.0      Cryptomeria japonica
dbj|BAD02729.1|  putative lycopene beta cyclase                         720   0.0      Cryptomeria japonica
dbj|BAE43521.1|  putative lycopene beta cyclase                         720   0.0      Cryptomeria japonica
dbj|BAE43544.1|  putative lycopene beta cyclase                         720   0.0      Cryptomeria japonica
dbj|BAD02739.1|  putative lycopene beta cyclase                         720   0.0      Cryptomeria japonica
dbj|BAD02742.1|  putative lycopene beta cyclase                         720   0.0      Cryptomeria japonica
gb|ADN65329.1|  lycopene beta-cyclase                                   715   0.0      Manihot esculenta [manioc]
dbj|BAE43533.1|  putative lycopene beta cyclase                         720   0.0      Cryptomeria japonica
dbj|BAE43549.1|  putative lycopene beta cyclase                         719   0.0      Taxodium distichum var. distichum
dbj|BAE43558.1|  putative lycopene beta cyclase                         719   0.0      Taxodium distichum var. imbricarium [pond-cypress]
dbj|BAC82352.1|  putative lycopene beta cyclase                         718   0.0      Taxodium distichum [bald cypress]
dbj|BAE43546.1|  putative lycopene beta cyclase                         718   0.0      Taxodium distichum var. distichum
dbj|BAE43557.1|  putative lycopene beta cyclase                         718   0.0      Taxodium distichum var. imbricarium [pond-cypress]
dbj|BAE43525.1|  putative lycopene beta cyclase                         717   0.0      Cryptomeria japonica
dbj|BAD02731.1|  putative lycopene beta cyclase                         717   0.0      Cryptomeria japonica
dbj|BAE43537.1|  putative lycopene beta cyclase                         717   0.0      Cryptomeria japonica
gb|AAM45381.1|  beta cyclase                                            713   0.0      Tagetes erecta [big marigold]
dbj|BAE43553.2|  putative lycopene beta cyclase                         717   0.0      Taxodium distichum var. imbricarium [pond-cypress]
dbj|BAE43513.1|  putative lycopene beta cyclase                         717   0.0      Cryptomeria japonica
dbj|BAE43536.1|  putative lycopene beta cyclase                         717   0.0      Cryptomeria japonica
dbj|BAE43560.1|  putative lycopene beta cyclase                         717   0.0      Taxodium distichum var. imbricarium [pond-cypress]
dbj|BAE43556.1|  putative lycopene beta cyclase                         716   0.0      Taxodium distichum var. imbricarium [pond-cypress]
dbj|BAE43547.1|  putative lycopene beta cyclase                         716   0.0      Taxodium distichum var. distichum
dbj|BAE43554.1|  putative lycopene beta cyclase                         716   0.0      Taxodium distichum var. imbricarium [pond-cypress]
dbj|BAE43548.1|  putative lycopene beta cyclase                         716   0.0      Taxodium distichum var. distichum
dbj|BAE43555.1|  putative lycopene beta cyclase                         716   0.0      Taxodium distichum var. imbricarium [pond-cypress]
dbj|BAE43551.1|  putative lycopene beta cyclase                         716   0.0      Taxodium distichum var. distichum
dbj|BAE43550.1|  putative lycopene beta cyclase                         716   0.0      Taxodium distichum var. distichum
dbj|BAE43527.1|  putative lycopene beta cyclase                         716   0.0      Cryptomeria japonica
dbj|BAE43522.1|  putative lycopene beta cyclase                         715   0.0      Cryptomeria japonica
dbj|BAE43552.1|  putative lycopene beta cyclase                         713   0.0      Taxodium distichum var. distichum
ref|XP_012085982.1|  PREDICTED: lycopene beta cyclase, chloroplas...    692   0.0      
gb|ADA82242.1|  lycopene beta cyclase                                   690   0.0      Crocus sativus [saffron crocus]
gb|AFA35121.1|  lycopene beta-cyclase                                   673   0.0      Triticum aestivum [Canadian hard winter wheat]
dbj|BAH10590.1|  lycopene beta-cyclase                                  668   0.0      Lilium hybrid division I
dbj|BAJ90170.1|  predicted protein                                      666   0.0      Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAD16478.1|  putative lycopene beta-cyclase                         661   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_010233950.1|  PREDICTED: lycopene beta cyclase, chloroplastic    661   0.0      Brachypodium distachyon [annual false brome]
ref|XP_002453448.1|  hypothetical protein SORBIDRAFT_04g006120          659   0.0      Sorghum bicolor [broomcorn]
ref|NP_001078131.1|  lycopene beta cyclase                              654   0.0      Arabidopsis thaliana [mouse-ear cress]
gb|AFW70557.1|  pink scutellum1                                         657   0.0      
ref|NP_001169155.1|  uncharacterized protein LOC100383002               657   0.0      Zea mays [maize]
gb|AAQ02668.1|  lycopene cyclase                                        661   0.0      Setaria italica
ref|XP_006648400.1|  PREDICTED: lycopene beta cyclase, chloroplas...    654   0.0      
ref|XP_004951617.1|  PREDICTED: lycopene beta cyclase, chloroplas...    654   0.0      Setaria italica
sp|D9IL23.1|LCYB_ONCHC  RecName: Full=Lycopene beta cyclase, chlo...    649   0.0      Oncidium hybrid cultivar
ref|XP_002971295.1|  hypothetical protein SELMODRAFT_147622             637   0.0      
dbj|BAF49055.1|  lycopene beta-cyclase                                  631   0.0      Prunus mume [ume]
ref|XP_002961511.1|  hypothetical protein SELMODRAFT_266613             634   0.0      
gb|ACI14295.1|  lycopene beta-cyclase                                   619   0.0      Linum usitatissimum
ref|XP_011621797.1|  PREDICTED: lycopene beta cyclase, chloroplas...    608   0.0      Amborella trichopoda
dbj|BAO27799.1|  lycopene beta-cyclase                                  610   0.0      Marchantia polymorpha
gb|EAY84816.1|  hypothetical protein OsI_06183                          582   0.0      Oryza sativa Indica Group [Indian rice]
ref|XP_001762494.1|  predicted protein                                  575   0.0      
ref|XP_001773285.1|  predicted protein                                  572   0.0      
gb|AEQ20869.1|  putative chloroplast lycopene beta-cyclase              557   0.0      Eriobotrya japonica [loquat]
ref|XP_010271593.1|  PREDICTED: capsanthin/capsorubin synthase, c...    546   0.0      Nelumbo nucifera [Indian lotus]
ref|XP_007015766.1|  Lycopene cyclase                                   544   0.0      
ref|XP_012070159.1|  PREDICTED: capsanthin/capsorubin synthase, c...    542   0.0      Jatropha curcas
gb|KDO58141.1|  hypothetical protein CISIN_1g010693mg                   542   0.0      Citrus sinensis [apfelsine]
ref|XP_006424195.1|  hypothetical protein CICLE_v10028245mg             541   0.0      Citrus clementina [clementine]
dbj|BAM66327.1|  LCYb2                                                  540   0.0      Citrus unshiu [satsuma mandarin]
gb|AJT59426.1|  LCY2B                                                   539   0.0      Citrus maxima [buntan]
gb|ACT09103.1|  lycopene beta-cyclase                                   531   0.0      Cucumis sativus [cucumbers]
ref|XP_006487912.1|  PREDICTED: capsanthin/capsorubin synthase, c...    538   0.0      Citrus sinensis [apfelsine]
ref|XP_007205102.1|  hypothetical protein PRUPE_ppa004650mg             538   0.0      Prunus persica
ref|XP_008229097.1|  PREDICTED: capsanthin/capsorubin synthase, c...    537   0.0      Prunus mume [ume]
gb|ACJ66628.1|  lycopene beta-cyclase                                   536   0.0      Actinidia chinensis
gb|KJB35393.1|  hypothetical protein B456_006G113300                    534   2e-180   Gossypium raimondii
gb|ADZ28517.1|  neoxanthin synthase                                     533   3e-180   Camellia nitidissima
ref|XP_004291579.1|  PREDICTED: capsanthin/capsorubin synthase, c...    533   4e-180   Fragaria vesca subsp. vesca
dbj|BAM66329.1|  LCYb2                                                  530   4e-179   Citrus limon [lemon]
gb|ACR61334.1|  lycopene beta-cyclase 2                                 530   8e-179   Carica papaya [mamon]
ref|XP_007150055.1|  hypothetical protein PHAVU_005G122400g             530   1e-178   Phaseolus vulgaris [French bean]
ref|XP_009374976.1|  PREDICTED: capsanthin/capsorubin synthase, c...    529   2e-178   Pyrus x bretschneideri [bai li]
gb|ACX37456.1|  chromoplast lycopene beta-cyclase                       529   2e-178   Citrus x paradisi [grapefruit]
dbj|BAM66328.1|  LCYb2                                                  528   3e-178   Citrus sinensis [apfelsine]
gb|ABB52072.1|  putative capsanthin-capsorubin synthase                 528   3e-178   Daucus carota subsp. sativus
gb|AFR11777.1|  lycopene beta-cyclase                                   528   4e-178   Fragaria x ananassa
ref|XP_009377819.1|  PREDICTED: capsanthin/capsorubin synthase, c...    528   5e-178   Pyrus x bretschneideri [bai li]
ref|XP_010045192.1|  PREDICTED: LOW QUALITY PROTEIN: capsanthin/c...    528   6e-178   
gb|ACJ66629.1|  lycopene beta-cyclase                                   525   9e-178   Actinidia deliciosa [Chinese gooseberry]
gb|EYU26726.1|  hypothetical protein MIMGU_mgv1a027151mg                527   1e-177   Erythranthe guttata [common monkey flower]
ref|XP_002523837.1|  Capsanthin/capsorubin synthase, chloroplast ...    527   1e-177   Ricinus communis
ref|XP_008361015.1|  PREDICTED: capsanthin/capsorubin synthase, c...    525   8e-177   
ref|XP_011088917.1|  PREDICTED: capsanthin/capsorubin synthase, c...    523   4e-176   Sesamum indicum [beniseed]
ref|XP_003541965.1|  PREDICTED: capsanthin/capsorubin synthase, c...    522   9e-176   Glycine max [soybeans]
emb|CDP06888.1|  unnamed protein product                                518   6e-174   Coffea canephora [robusta coffee]
gb|ADX36406.1|  lycopene beta-cyclase                                   517   7e-174   Ficus carica
ref|XP_010912323.1|  PREDICTED: capsanthin/capsorubin synthase, c...    518   1e-173   
gb|AFV50599.1|  lycopene cyclase                                        507   3e-173   Solanum sparsipilum
gb|AGR67391.1|  lycopene beta-cyclase                                   508   4e-173   Citrus reshni [Cleopatra mandarin]
ref|XP_002273862.1|  PREDICTED: capsanthin/capsorubin synthase, c...    514   1e-172   
gb|AAT76051.1|  lycopene cyclase                                        504   2e-172   Citrus clementina [clementine]
gb|AHE41416.1|  lycopene beta-cyclase                                   504   3e-172   Lycium chinense [Chinese boxthorn]
gb|AFP28803.1|  lycopene beta-cyclase 1                                 512   7e-172   Vitis vinifera
ref|XP_008784039.1|  PREDICTED: capsanthin/capsorubin synthase, c...    511   2e-171   Phoenix dactylifera
gb|ACL27573.1|  lycopene beta-cyclase                                   502   3e-171   Cucumis melo [Oriental melon]
ref|XP_002313611.1|  hypothetical protein POPTR_0009s16140g             510   4e-171   
ref|XP_004487485.1|  PREDICTED: capsanthin/capsorubin synthase, c...    508   5e-170   Cicer arietinum [garbanzo]
ref|XP_011006475.1|  PREDICTED: capsanthin/capsorubin synthase, c...    507   1e-169   Populus euphratica
ref|XP_009789371.1|  PREDICTED: neoxanthin synthase, chloroplastic      507   1e-169   Nicotiana sylvestris
sp|Q42435.1|CCS_CAPAN  RecName: Full=Capsanthin/capsorubin syntha...    506   2e-169   Capsicum annuum
ref|XP_011043447.1|  PREDICTED: capsanthin/capsorubin synthase, c...    506   2e-169   Populus euphratica
ref|XP_006384755.1|  hypothetical protein POPTR_0004s20800g             506   2e-169   Populus trichocarpa [western balsam poplar]
sp|Q9M424.1|NXS_SOLTU  RecName: Full=Neoxanthin synthase, chlorop...    505   6e-169   Solanum tuberosum [potatoes]
ref|XP_010102012.1|  Capsanthin/capsorubin synthase                     504   7e-169   Morus notabilis
gb|ADH04285.1|  capsanthin/capsorubin synthase                          504   1e-168   Capsicum annuum
ref|XP_003596842.1|  Capsanthin/capsorubin synthase, chromoplast        504   2e-168   Medicago truncatula
gb|AIQ82719.1|  capsanthin/capsorubin synthase                          503   3e-168   Capsicum annuum
ref|XP_006361083.1|  PREDICTED: neoxanthin synthase, chloroplasti...    503   4e-168   
ref|XP_009609006.1|  PREDICTED: neoxanthin synthase, chloroplastic      502   7e-168   Nicotiana tomentosiformis
gb|AIX87499.1|  chromoplast-specific lycopene beta-cyclase              502   9e-168   Lycium barbarum [Duke of Argyll's teatree]
gb|AIQ82733.1|  capsanthin/capsorubin synthase                          501   1e-167   Capsicum annuum
ref|XP_007207101.1|  hypothetical protein PRUPE_ppa021329mg             499   8e-167   
gb|ADZ24717.1|  lycopene b-cyclase                                      498   4e-166   Solanum pennellii
ref|XP_005648449.1|  beta cyclase                                       495   7e-166   Coccomyxa subellipsoidea C-169
gb|AFN54026.1|  lycopene beta-cyclase 1                                 484   2e-164   Daucus carota subsp. sativus
ref|NP_001234445.1|  chromoplast-specific lycopene beta-cyclase         493   2e-164   
gb|AFN54038.1|  lycopene beta-cyclase 1                                 484   3e-164   Daucus carota subsp. sativus
emb|CBJ19449.1|  lycopene beta-cyclase 1                                482   1e-163   Daucus carota subsp. sativus
gb|AIX87523.1|  chromoplast-specific lycopene beta-cyclase              491   1e-163   Lycium ruthenicum
gb|ADV31551.1|  capsanthin/capsorubin synthase                          490   2e-163   Lilium lancifolium [true tiger lily]
gb|AFN54045.1|  lycopene beta-cyclase 1                                 481   2e-163   Daucus carota subsp. sativus
emb|CAB93342.1|  neoxanthin synthase                                    491   2e-163   Solanum lycopersicum
gb|AFN54003.1|  lycopene beta-cyclase 1                                 480   6e-163   Daucus carota subsp. sativus
gb|AFN54005.1|  lycopene beta-cyclase 1                                 480   6e-163   Daucus carota subsp. sativus
gb|AFN54046.1|  lycopene beta-cyclase 1                                 480   7e-163   Daucus carota subsp. sativus
gb|AFN54006.1|  lycopene beta-cyclase 1                                 478   4e-162   Daucus carota subsp. sativus
ref|XP_008229087.1|  PREDICTED: capsanthin/capsorubin synthase, c...    486   2e-161   Prunus mume [ume]
ref|XP_003596845.1|  Lycopene beta-cyclase                              479   5e-159   Medicago truncatula
gb|AFN54051.1|  lycopene beta-cyclase 1                                 468   3e-158   Chaerophyllum bulbosum
gb|ABJ98753.1|  lycopene beta-cyclase                                   467   8e-158   Citrullus lanatus [wild melon]
emb|CAN64939.1|  hypothetical protein VITISV_021720                     475   1e-157   Vitis vinifera
ref|XP_006851478.1|  PREDICTED: capsanthin/capsorubin synthase, c...    475   9e-157   Amborella trichopoda
gb|AFQ68636.1|  lycopene beta-cyclase                                   458   1e-154   Gardenia jasminoides
emb|CBH31263.1|  chloroplast lycopene beta cyclase precursor            469   2e-154   Chromochloris zofingiensis
dbj|BAD07274.1|  lycopene beta-cyclase                                  450   2e-151   Citrus unshiu [satsuma mandarin]
emb|CBI30083.3|  unnamed protein product                                454   7e-151   Vitis vinifera
dbj|BAD07282.1|  lycopene beta-cyclase                                  448   9e-151   Citrus sinensis [apfelsine]
gb|KHN32864.1|  Capsanthin/capsorubin synthase, chromoplast             452   3e-150   Glycine soja [wild soybean]
emb|CAA54961.1|  putative chromoplastic oxydo-reductase                 454   2e-149   Capsicum annuum
gb|KCW87349.1|  hypothetical protein EUGRSUZ_B03832                     447   8e-149   Eucalyptus grandis [rose gum]
ref|XP_011397795.1|  Lycopene beta cyclase, chloroplastic               446   2e-146   Auxenochlorella protothecoides
ref|NP_001046151.2|  Os02g0190600                                       437   4e-146   
gb|EPS58465.1|  hypothetical protein M569_16348                         445   7e-146   Genlisea aurea
gb|ACV50023.1|  lycopene beta-cyclase 5                                 429   1e-143   Ipomoea batatas [batate]
gb|ADR80671.1|  lycopene beta cyclase                                   425   9e-142   Musa AAB Group [French plantain]
dbj|BAK22388.1|  lycopene beta cyclase                                  424   2e-141   Eustoma exaltatum subsp. russellianum [bluebells]
gb|ADR80664.1|  lycopene beta cyclase                                   424   2e-141   Musa balbisiana [starchy banana]
gb|ADA82241.1|  chromoplast-specific lycopene beta cyclase              431   1e-140   Crocus sativus [saffron crocus]
gb|ADR80665.1|  lycopene beta cyclase                                   419   2e-139   Musa balbisiana [starchy banana]
gb|ADR80669.1|  lycopene beta cyclase                                   417   8e-139   
gb|ADR80666.1|  lycopene beta cyclase                                   415   5e-138   
gb|AAO64977.1|  lycopene beta cyclase                                   428   6e-138   
gb|ADR80667.1|  lycopene beta cyclase                                   415   7e-138   
gb|ADR80668.1|  lycopene beta cyclase                                   413   3e-137   
gb|ADR80670.1|  lycopene beta cyclase                                   411   1e-136   
gb|KIY99782.1|  lycopene beta cyclase                                   419   3e-136   
gb|ACA34344.1|  chloroplast lycopene beta-cyclase                       422   2e-135   
ref|XP_008454352.1|  PREDICTED: capsanthin/capsorubin synthase, c...    419   2e-135   
ref|XP_011652931.1|  PREDICTED: capsanthin/capsorubin synthase, c...    417   1e-134   
gb|AAX54906.1|  putative chloroplast lycopene beta cyclase precursor    419   2e-134   
gb|ADX41685.1|  chloroplast lycopene beta-cyclase enzyme                419   2e-134   
ref|XP_002957303.1|  hypothetical protein VOLCADRAFT_107605             412   1e-131   
gb|KJB35394.1|  hypothetical protein B456_006G113300                    399   3e-130   
gb|KJB35395.1|  hypothetical protein B456_006G113300                    400   3e-129   
gb|AFI39648.1|  lycopene beta cyclase                                   382   2e-125   
gb|ABV01928.1|  lycopene beta-cyclase                                   382   3e-125   
gb|AFI39649.1|  lycopene beta cyclase                                   382   5e-125   
gb|AHL89018.1|  lycopene beta-cyclase 1                                 379   2e-124   
gb|AIN50097.1|  lycopene beta-cyclase                                   378   5e-124   
gb|ABB29852.1|  lycopene beta-cyclase                                   360   4e-117   
ref|XP_001422489.1|  predicted protein                                  362   4e-113   
gb|AFI09271.1|  lycopene beta-cyclase                                   344   4e-110   
ref|XP_003082872.1|  putative chloroplast lycopene beta cyclase p...    364   9e-107   
emb|CEG01997.1|  Lycopene cyclase-type, FAD-binding                     363   2e-106   
gb|EMT22845.1|  Lycopene beta cyclase, chloroplastic                    334   7e-106   
ref|XP_002505608.1|  lycopene beta cyclase                              362   9e-106   
ref|XP_007513412.1|  putative lycopene beta cyclase                     359   1e-104   
gb|AAF18989.1|AF208531_1  lycopene beta-cyclase                         322   1e-102   
gb|AAS48095.1|  beta-lycopene cyclase                                   320   5e-102   
gb|EEE56480.1|  hypothetical protein OsJ_05700                          320   2e-101   
ref|XP_003063722.1|  lycopene beta cyclase                              348   6e-101   
gb|AIY34690.1|  lycopene beta cyclase                                   316   2e-100   
gb|AAW02797.1|  beta-cyclase                                            311   8e-99    
ref|XP_005708098.1|  lycopene beta cyclase                              319   6e-97    
gb|EMS51824.1|  Lycopene beta cyclase, chloroplastic/chromoplastic      306   5e-95    
gb|KHN27635.1|  Capsanthin/capsorubin synthase, chromoplast             308   4e-94    
gb|AET07436.1|  lycopene beta cyclase                                   296   2e-93    
ref|XP_005829077.1|  lycopene beta cyclase                              301   6e-91    
ref|XP_005715292.1|  unnamed protein product                            294   1e-88    
gb|ABR16701.1|  unknown                                                 290   4e-85    
ref|XP_001753898.1|  predicted protein                                  289   7e-85    
gb|AHA36974.1|  lycopene beta-cyclase                                   267   5e-82    
ref|XP_011627261.1|  PREDICTED: lycopene epsilon cyclase, chlorop...    280   7e-82    
ref|XP_005536481.1|  lycopene beta cyclase, chloroplast precursor       278   3e-81    
gb|ABK55739.1|  lycopene beta-cyclase                                   264   6e-81    
ref|XP_001772690.1|  predicted protein                                  278   1e-80    
emb|CCG06343.1|  chloroplast lycopene epsilon cyclase precursor         279   2e-80    
ref|XP_010049451.1|  PREDICTED: lycopene epsilon cyclase, chlorop...    271   2e-78    
gb|AAL69394.1|AF463497_1  lycopene epsilon-cyclase                      270   3e-78    
ref|XP_003533775.1|  PREDICTED: lycopene epsilon cyclase, chlorop...    270   4e-78    
ref|XP_009405144.1|  PREDICTED: lycopene epsilon cyclase, chlorop...    270   5e-78    
ref|XP_009035909.1|  hypothetical protein AURANDRAFT_53100              268   2e-77    
gb|ABK24752.1|  unknown                                                 267   3e-77    
ref|XP_010696541.1|  PREDICTED: lycopene epsilon cyclase, chlorop...    268   4e-77    
ref|XP_006475493.1|  PREDICTED: lycopene epsilon cyclase, chlorop...    265   4e-77    
gb|AAX92679.1|  lycopene epsilon cyclase                                264   5e-77    
gb|KJB54409.1|  hypothetical protein B456_009G032900                    267   8e-77    
ref|WP_041948032.1|  lycopene cyclase                                   263   1e-76    
gb|ADI15537.1|  lycopene cyclase family protein                         263   1e-76    
ref|XP_007012769.1|  Lycopene beta/epsilon cyclase protein              265   2e-76    
ref|XP_006475492.1|  PREDICTED: lycopene epsilon cyclase, chlorop...    265   2e-76    
gb|AJT59425.1|  LCYE                                                    265   2e-76    
gb|AAS48096.1|  epsilon lycopene cyclase                                262   3e-76    
ref|XP_006597824.1|  PREDICTED: lycopene epsilon cyclase, chlorop...    265   3e-76    
emb|CBI27881.3|  unnamed protein product                                262   5e-76    
ref|WP_035984244.1|  lycopene cyclase                                   261   6e-76    
emb|CAJ57430.1|  lycopene beta cyclase                                  250   9e-76    
gb|ERN16434.1|  hypothetical protein AMTR_s00052p00167110               259   1e-75    
sp|D9IL24.1|LCYE_ONCHC  RecName: Full=Lycopene epsilon cyclase, c...    263   1e-75    
ref|XP_002945935.1|  hypothetical protein VOLCADRAFT_54924              264   2e-75    
ref|XP_010938743.1|  PREDICTED: lycopene epsilon cyclase, chlorop...    263   2e-75    
gb|KHN28835.1|  Lycopene epsilon cyclase, chloroplastic                 260   2e-75    
ref|XP_010536870.1|  PREDICTED: lycopene epsilon cyclase, chlorop...    262   3e-75    
ref|XP_002455838.1|  hypothetical protein SORBIDRAFT_03g026020          262   3e-75    
ref|WP_006454809.1|  lycopene cyclase                                   258   4e-75    
dbj|BAO27800.1|  lycopene epsilon-cyclase                               265   6e-75    
gb|KJB54410.1|  hypothetical protein B456_009G032900                    261   1e-74    
ref|XP_010262037.1|  PREDICTED: lycopene epsilon cyclase, chlorop...    261   1e-74    
gb|AID51466.1|  lycopene epsilon cyclase                                261   1e-74    
ref|NP_001146840.1|  lycopene epsilon cyclase1                          261   1e-74    
gb|EAY74664.1|  hypothetical protein OsI_02559                          258   2e-74    
ref|XP_002974344.1|  hypothetical protein SELMODRAFT_101391             260   2e-74    
ref|XP_002990847.1|  hypothetical protein SELMODRAFT_132340             259   3e-74    
ref|XP_012076948.1|  PREDICTED: lycopene epsilon cyclase, chlorop...    259   4e-74    
ref|XP_008459489.1|  PREDICTED: lycopene epsilon cyclase, chlorop...    259   5e-74    
ref|XP_011078026.1|  PREDICTED: lycopene epsilon cyclase, chlorop...    259   7e-74    
gb|ABB52073.1|  putative lycopene epsilon cyclase                       258   9e-74    
gb|EYU28375.1|  hypothetical protein MIMGU_mgv1a004776mg                258   1e-73    
ref|XP_010262036.1|  PREDICTED: lycopene epsilon cyclase, chlorop...    258   1e-73    
ref|XP_003569257.1|  PREDICTED: lycopene epsilon cyclase, chlorop...    258   2e-73    
ref|NP_001043410.1|  Os01g0581300                                       258   2e-73    
ref|XP_004969417.1|  PREDICTED: lycopene epsilon cyclase, chlorop...    258   2e-73    
ref|XP_004141172.1|  PREDICTED: lycopene epsilon cyclase, chlorop...    257   2e-73    
gb|EAZ12455.1|  hypothetical protein OsJ_02352                          257   3e-73    
gb|AFG19394.1|  lycopene epsilon cyclase                                257   3e-73    
ref|NP_001268093.1|  lycopene epsilon cyclase, chloroplastic-like       257   3e-73    
gb|AAB53336.1|  lycopene epsilon cyclase                                257   3e-73    
ref|XP_004513442.1|  PREDICTED: lycopene epsilon cyclase, chlorop...    257   4e-73    
ref|NP_200513.1|  lycopene epsilon cyclase                              256   4e-73    
emb|CDP03135.1|  unnamed protein product                                256   5e-73    
ref|XP_006644312.1|  PREDICTED: lycopene epsilon cyclase, chlorop...    254   5e-73    
gb|ADK74376.1|  lycopene epsilon cyclase                                256   7e-73    
gb|ABC87738.1|  lycopene epsilon cyclase                                251   8e-73    
ref|XP_009361642.1|  PREDICTED: lycopene epsilon cyclase, chlorop...    256   1e-72    
gb|AFG19393.1|  lycopene epsilon cyclase                                256   1e-72    
ref|XP_008812953.1|  PREDICTED: lycopene epsilon cyclase, chlorop...    256   1e-72    
dbj|BAA88845.1|  Lycopene epsilon cyclase                               255   1e-72    
gb|AFR11776.1|  lycopene epsilon cyclase                                255   2e-72    
gb|KFK27261.1|  hypothetical protein AALP_AA8G359000                    255   2e-72    
gb|EPS63769.1|  hypothetical protein M569_11014                         254   2e-72    
ref|XP_006401252.1|  hypothetical protein EUTSA_v10013234mg             254   2e-72    
gb|ACN65121.1|  chloroplast lycopene epsilon-cyclase precursor          254   7e-72    
gb|AAK07431.1|AF321535_1  lycopene epsilon-cyclase                      253   9e-72    
ref|XP_004287582.1|  PREDICTED: lycopene epsilon cyclase, chlorop...    253   1e-71    
ref|WP_017296586.1|  hypothetical protein                               249   2e-71    
gb|AFG19395.1|  lycopene epsilon cyclase                                252   3e-71    
gb|AAK07432.1|AF321536_1  lycopene epsilon-cyclase                      252   3e-71    
ref|XP_011003348.1|  PREDICTED: lycopene epsilon cyclase, chlorop...    252   3e-71    
gb|AIX87500.1|  lycopene epsilon-cyclase                                251   5e-71    
ref|XP_010443368.1|  PREDICTED: lycopene epsilon cyclase, chlorop...    251   5e-71    
ref|XP_008388192.1|  PREDICTED: lycopene epsilon cyclase, chlorop...    251   5e-71    
gb|ACR61335.1|  lycopene beta-cyclase 2                                 243   5e-71    
ref|XP_005850734.1|  hypothetical protein CHLNCDRAFT_19656              251   5e-71    
gb|ACF42350.1|  lycopene epsilon cyclase 3B                             251   6e-71    
gb|ABQ91017.1|  lycopene cyclase (CrtL-type)                            247   6e-71    
gb|ACF42351.1|  lycopene epsilon cyclase 3D                             251   7e-71    
ref|WP_041335414.1|  lycopene cyclase                                   247   7e-71    
gb|AHG55187.1|  lycopene epsilon-cyclase                                250   7e-71    
ref|XP_010483194.1|  PREDICTED: lycopene epsilon cyclase, chlorop...    250   9e-71    
ref|XP_010451740.1|  PREDICTED: lycopene epsilon cyclase, chlorop...    250   9e-71    
ref|XP_001422490.1|  predicted protein                                  248   1e-70    
gb|ABV01925.1|  neoxanthin synthase                                     240   1e-70    
ref|WP_011378296.1|  MULTISPECIES: lycopene beta cyclase                246   2e-70    
ref|XP_009779493.1|  PREDICTED: lycopene epsilon cyclase, chlorop...    249   3e-70    
gb|KHG11373.1|  Lycopene epsilon cyclase, chloroplastic -like pro...    248   3e-70    
emb|CDY38257.1|  BnaA10g11050D                                          249   4e-70    
ref|XP_009132155.1|  PREDICTED: lycopene epsilon cyclase, chlorop...    249   4e-70    
ref|WP_015173044.1|  lycopene cyclase                                   245   5e-70    
gb|ACM68703.1|  lycopene epsilon-cyclase                                248   5e-70    
gb|ADK27327.1|  lycopene epsilon-cyclase 2                              248   5e-70    
ref|XP_002864493.1|  hypothetical protein ARALYDRAFT_918865             248   7e-70    
ref|WP_011244341.1|  lycopene beta cyclase                              244   7e-70    
gb|ADH59742.1|  lycopene epsilon-cyclase                                248   7e-70    
ref|XP_006280298.1|  hypothetical protein CARUB_v10026221mg             248   8e-70    
emb|CDX88602.1|  BnaA03g10470D                                          248   8e-70    
emb|CBN78004.1|  Lycopene beta cyclase, chloroplast precursor           248   9e-70    
gb|AIX87524.1|  lycopene epsilon-cyclase                                247   1e-69    
gb|AFR60851.1|  lycopene-epsilon-cyclase                                247   1e-69    
gb|ACF42349.1|  lycopene epsilon cyclase 3A                             247   1e-69    
ref|XP_009120221.1|  PREDICTED: lycopene epsilon cyclase, chlorop...    247   1e-69    
ref|NP_001234337.1|  lycopene epsilon cyclase, chloroplastic            247   2e-69    
emb|CDY11891.1|  BnaC03g13170D                                          247   2e-69    
gb|ACB28618.1|  lycopene epsilon cyclase                                247   2e-69    
emb|CDY54385.1|  BnaC09g53690D                                          247   2e-69    
dbj|BAK02711.1|  predicted protein                                      247   2e-69    
ref|XP_009622235.1|  PREDICTED: lycopene epsilon cyclase, chlorop...    246   2e-69    
gb|ESA33682.1|  lycopene cyclase                                        243   2e-69    
gb|ADZ48238.1|  lycopene epsilon cyclase                                246   2e-69    
ref|WP_031293851.1|  lycopene cyclase                                   243   3e-69    
tpg|DAA33890.1|  TPA: lycopene epsilon cyclase                          246   3e-69    
gb|AAT46065.1|  chloroplast lycopene epsilon-cyclase precursor          247   5e-69    
ref|XP_010090084.1|  Lycopene epsilon cyclase                           246   5e-69    
ref|XP_002514136.1|  Lycopene epsilon cyclase, chloroplast precur...    245   6e-69    
ref|XP_001696529.1|  lycopene epsilon cyclase                           247   6e-69    
gb|KDO53203.1|  hypothetical protein CISIN_1g011835mg                   244   6e-69    
gb|ADN29989.1|  lycopene epsilon cyclase                                245   7e-69    
ref|XP_006353544.1|  PREDICTED: lycopene epsilon cyclase, chlorop...    245   9e-69    
gb|EWM25354.1|  lycopene beta cyclase                                   251   1e-68    
ref|XP_007203640.1|  hypothetical protein PRUPE_ppa004231mg             244   1e-68    
ref|XP_006597825.1|  PREDICTED: lycopene epsilon cyclase, chlorop...    244   2e-68    
gb|AAK07434.1|AF321538_1  lycopene epsilon-cyclase                      244   2e-68    
ref|XP_008242382.1|  PREDICTED: lycopene epsilon cyclase, chlorop...    243   3e-68    
gb|AAG10428.1|  epsilon cyclase                                         243   4e-68    
ref|XP_003595243.1|  Lycopene epsilon cyclase                           243   5e-68    
gb|AHA58687.1|  lycopene epsilon-cyclase                                242   7e-68    
emb|CAI60777.1|  lycopene cyclase                                       229   8e-68    
ref|WP_012166204.1|  lycopene cyclase                                   238   1e-67    
ref|XP_006381658.1|  hypothetical protein POPTR_0006s14930g             239   7e-67    
ref|XP_011003349.1|  PREDICTED: lycopene epsilon cyclase, chlorop...    237   5e-66    
ref|WP_041548673.1|  lycopene cyclase                                   233   2e-65    
gb|AFY91999.1|  lycopene cyclase family protein                         233   2e-65    
gb|AAM45382.1|  epsilon cyclase                                         235   4e-65    
ref|WP_031294085.1|  lycopene cyclase                                   231   7e-65    
gb|KJB06802.1|  hypothetical protein B456_001G012900                    234   8e-65    
gb|ESA33153.1|  lycopene cyclase                                        231   1e-64    
ref|XP_010656042.1|  PREDICTED: lycopene epsilon cyclase, chlorop...    233   1e-64    
dbj|BAE79549.1|  lycopene epsilon-cyclase                               231   2e-64    
ref|WP_041330813.1|  lycopene cyclase                                   229   4e-64    
gb|ABU58782.1|  lycopene cyclase family protein                         229   4e-64    
gb|ABN09120.1|  NAD-binding site                                        232   4e-64    
gb|AAK07433.1|AF321537_1  lycopene epsilon-cyclase                      227   1e-63    
ref|WP_011132267.1|  lycopene cyclase                                   226   8e-63    
ref|XP_009129704.1|  PREDICTED: lycopene epsilon cyclase, chlorop...    226   2e-62    
ref|WP_025924596.1|  lycopene cyclase                                   224   3e-62    
ref|WP_025935182.1|  lycopene cyclase                                   224   3e-62    
ref|WP_025935948.1|  lycopene cyclase                                   224   3e-62    
ref|WP_025969268.1|  lycopene cyclase                                   224   3e-62    
ref|WP_011376189.1|  lycopene cyclase                                   224   4e-62    
emb|CAJ57431.1|  lycopene beta cyclase                                  213   4e-62    
ref|XP_002287870.1|  predicted protein                                  228   5e-62    
ref|WP_025894667.1|  MULTISPECIES: lycopene cyclase                     223   5e-62    
ref|XP_005713399.1|  unnamed protein product                            230   6e-62    
ref|WP_011820461.1|  lycopene cyclase                                   222   1e-61    
gb|KIZ06110.1|  hypothetical protein MNEG_1848                          225   1e-61    
gb|AEQ20870.1|  chromoplast lycopene beta-cyclase                       214   1e-61    
ref|WP_032526929.1|  lycopene cyclase                                   223   2e-61    
dbj|BAH10592.1|  lycopene epsilon-cyclase                               221   2e-61    
ref|WP_011820013.1|  lycopene cyclase                                   223   2e-61    
ref|WP_032522416.1|  lycopene cyclase                                   222   2e-61    
ref|WP_038651983.1|  lycopene cyclase                                   222   2e-61    
gb|AGN75115.1|  lycopene beta-cyclase 2                                 216   2e-61    
ref|WP_025928264.1|  lycopene cyclase                                   222   2e-61    
ref|XP_005648287.1|  lycopene cyclase family                            225   2e-61    
ref|WP_025924343.1|  lycopene cyclase                                   222   3e-61    
ref|WP_025934965.1|  lycopene cyclase                                   221   3e-61    
ref|WP_025955456.1|  lycopene cyclase                                   221   4e-61    
ref|WP_025930055.1|  lycopene cyclase                                   221   5e-61    
gb|AAF18988.1|AF208530_1  capsanthin-capsorubin synthase                212   5e-61    
ref|WP_032523760.1|  lycopene cyclase                                   221   5e-61    
ref|WP_042850082.1|  lycopene cyclase                                   221   5e-61    



>dbj|BAI47577.1| lycopene beta cyclase [Ipomoea sp. Kenyan]
Length=501

 Score =   978 bits (2529),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 493/501 (98%), Positives = 496/501 (99%), Gaps = 0/501 (0%)
 Frame = -2

Query  1611  MDTLLKTPNELEFLHPHHGFAVKASAFTSLKPQKQEIRIGSWKACRNVGRVKASSSALLE  1432
             MDTLLKTPN+LEFLHPHHGFAVKASAFTSLKPQKQEIRIGSWKACRNVGRVKASSSALLE
Sbjct  1     MDTLLKTPNKLEFLHPHHGFAVKASAFTSLKPQKQEIRIGSWKACRNVGRVKASSSALLE  60

Query  1431  LVPVTKKENLDFELPMFEPSKGIvvdlavvgggpaglavaqqVSQAGLSVCSIDPSPKLI  1252
             LVPVTKKENLDFELPMFEPSKGIVVDLAVVGGGPAGLAVAQQVSQAGLSVCSIDPSPKLI
Sbjct  61    LVPVTKKENLDFELPMFEPSKGIVVDLAVVGGGPAGLAVAQQVSQAGLSVCSIDPSPKLI  120

Query  1251  WPNNYGVWVDEFEAMDLLDCLDTTWSGAMVYIDDRTTKDLDRPYGRVNRKKLKSKMMQKC  1072
             WPNNYGVWVDEFEAMDLLDCLDTTWSGAMVYIDDRTTKDLDRPYGRVNRKKLKSKMMQKC
Sbjct  121   WPNNYGVWVDEFEAMDLLDCLDTTWSGAMVYIDDRTTKDLDRPYGRVNRKKLKSKMMQKC  180

Query  1071  ITNGVKFHQAKVIKVIHEESKSMLICSDGVTIQATVVLDATGFSRCLVQYDKPYNPGYQV  892
             I NGVKFHQAKVIKVIHEESKSMLICSDGVTIQATVVLDATGFSRCLVQY+KPYNPGYQV
Sbjct  181   IANGVKFHQAKVIKVIHEESKSMLICSDGVTIQATVVLDATGFSRCLVQYNKPYNPGYQV  240

Query  891   AYGILAEVEEHPYDLNKMVFMDWRDSHLNSNLELKERNKRIPTFLYAMPFSSTRIFLEET  712
             AYGILAEVE+HPYDLNKMVFMDWRDSHLNSNLELKERNKRIPTFLYAMPFSS RIFLEET
Sbjct  241   AYGILAEVEKHPYDLNKMVFMDWRDSHLNSNLELKERNKRIPTFLYAMPFSSNRIFLEET  300

Query  711   SLVARPGLDMKDIQERMVARLRHLGINVKSIEEDERCVIPMGGPLPVIPQRVVGIGGTAG  532
             SL ARPGLDMKDIQERM ARLRHLGINVKSIEEDERCVIPMGGPLPVIPQRVVGIGGTAG
Sbjct  301   SLGARPGLDMKDIQERMGARLRHLGINVKSIEEDERCVIPMGGPLPVIPQRVVGIGGTAG  360

Query  531   MVHPSTGYMVARTLAAAPVVANAIIQYLGSERSLLGNELSASVWKDLWPIERRRQREFFC  352
             MVHPSTGYMVARTLAAAPVVANAIIQYLGSERSLLGNELSASVWKDLWPIERRRQREFFC
Sbjct  361   MVHPSTGYMVARTLAAAPVVANAIIQYLGSERSLLGNELSASVWKDLWPIERRRQREFFC  420

Query  351   FGMDILLKLDLPATRRFFDAFFDLEPRYWHGFLSSRLFLRELIFFGLSLFSHASNTSRLE  172
             FGMDILLKLDLPATRRFFDAFFDLEPRYWHGFLSSRLFLRELIFFGLSLFSHASNTSRLE
Sbjct  421   FGMDILLKLDLPATRRFFDAFFDLEPRYWHGFLSSRLFLRELIFFGLSLFSHASNTSRLE  480

Query  171   IMTKGTLPLVNMINNLLQDID  109
             IMTKGTLPLVNMINNLLQD D
Sbjct  481   IMTKGTLPLVNMINNLLQDTD  501



>ref|XP_009616408.1| PREDICTED: lycopene beta cyclase, chloroplastic [Nicotiana tomentosiformis]
Length=500

 Score =   866 bits (2237),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 439/504 (87%), Positives = 466/504 (92%), Gaps = 7/504 (1%)
 Frame = -2

Query  1611  MDTLLKTPNELEFLHPHHGFAVKASAFTSLKPQKQEIRIGSWKACRNVGR---VKASSSA  1441
             MDTLLKTPN+LEFLHP HGF+VKAS+F S+KP K     GS K C N G+   VKA SSA
Sbjct  1     MDTLLKTPNKLEFLHPVHGFSVKASSFNSVKPHK----FGSRKICENWGKGVCVKAKSSA  56

Query  1440  LLELVPVTKKENLDFELPMFEPSKGIvvdlavvgggpaglavaqqVSQAGLSVCSIDPSP  1261
             LLELVP TKKENLDFELPM++PSKG+VVDLAVVGGGPAGLAVAQQVS+AGLSV SIDPSP
Sbjct  57    LLELVPETKKENLDFELPMYDPSKGLVVDLAVVGGGPAGLAVAQQVSEAGLSVVSIDPSP  116

Query  1260  KLIWPNNYGVWVDEFEAMDLLDCLDTTWSGAMVYIDDRTTKDLDRPYGRVNRKKLKSKMM  1081
             KLIWPNNYGVWVDEFEAMDLLDCLD TWSG +VYIDD TTKDLDRPYGRVNRK+LKSKMM
Sbjct  117   KLIWPNNYGVWVDEFEAMDLLDCLDATWSGTVVYIDDNTTKDLDRPYGRVNRKQLKSKMM  176

Query  1080  QKCITNGVKFHQAKVIKVIHEESKSMLICSDGVTIQATVVLDATGFSRCLVQYDKPYNPG  901
             QKCI NGVKFH AKVIKVIHEE+KSMLIC+DGVTIQATVVLDATGFSRCLVQYDKPYNPG
Sbjct  177   QKCILNGVKFHHAKVIKVIHEEAKSMLICNDGVTIQATVVLDATGFSRCLVQYDKPYNPG  236

Query  900   YQVAYGILAEVEEHPYDLNKMVFMDWRDSHLNSNLELKERNKRIPTFLYAMPFSSTRIFL  721
             YQVAYGILAEVEEHP+D +KMV MDWRDSHL +N+ELKERN+++PTFLYAMPFSS +IFL
Sbjct  237   YQVAYGILAEVEEHPFDTSKMVLMDWRDSHLGNNMELKERNRKVPTFLYAMPFSSNKIFL  296

Query  720   EETSLVARPGLDMKDIQERMVARLRHLGINVKSIEEDERCVIPMGGPLPVIPQRVVGIGG  541
             EETSLVARPGL M DIQERMVARL HLGI VKSIEEDE CVIPMGGPLPVIPQRVVG GG
Sbjct  297   EETSLVARPGLRMDDIQERMVARLNHLGIKVKSIEEDEHCVIPMGGPLPVIPQRVVGTGG  356

Query  540   TAGMVHPSTGYMVARTLAAAPVVANAIIQYLGSERSLLGNELSASVWKDLWPIERRRQRE  361
             TAG+VHPSTGYMVARTLAAAPVVANAII YLGSE+ LLGNELSA+VWKDLWPIERRRQRE
Sbjct  357   TAGLVHPSTGYMVARTLAAAPVVANAIIHYLGSEKDLLGNELSAAVWKDLWPIERRRQRE  416

Query  360   FFCFGMDILLKLDLPATRRFFDAFFDLEPRYWHGFLSSRLFLRELIFFGLSLFSHASNTS  181
             FFCFGMDILLKLDLPATRRFFDAFFDLEPRYWHGFLSSRL+L ELIFFGLSLFS ASNTS
Sbjct  417   FFCFGMDILLKLDLPATRRFFDAFFDLEPRYWHGFLSSRLYLPELIFFGLSLFSRASNTS  476

Query  180   RLEIMTKGTLPLVNMINNLLQDID  109
             R+EIMTKGTLPLVNMINNLLQD +
Sbjct  477   RIEIMTKGTLPLVNMINNLLQDTE  500



>ref|XP_006364433.1| PREDICTED: lycopene beta cyclase, chloroplastic-like [Solanum 
tuberosum]
Length=500

 Score =   865 bits (2234),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 440/502 (88%), Positives = 464/502 (92%), Gaps = 7/502 (1%)
 Frame = -2

Query  1611  MDTLLKTPNELEFLHPHHGFAVKASAFTSLKPQKQEIRIGSWKACRNVGR---VKASSSA  1441
             MDTLLKTPN LEFL+P HGFAVKAS F+S+KP+    R GS K C  +GR   VKASSSA
Sbjct  1     MDTLLKTPNNLEFLNPLHGFAVKASTFSSVKPK----RFGSRKFCETLGRSVCVKASSSA  56

Query  1440  LLELVPVTKKENLDFELPMFEPSKGIvvdlavvgggpaglavaqqVSQAGLSVCSIDPSP  1261
             LLELVP TKKENLDFELPM++PSKG+VVDLAVVGGGPAGLAVAQQVS+AGLSVCSIDP+P
Sbjct  57    LLELVPETKKENLDFELPMYDPSKGVVVDLAVVGGGPAGLAVAQQVSEAGLSVCSIDPNP  116

Query  1260  KLIWPNNYGVWVDEFEAMDLLDCLDTTWSGAMVYIDDRTTKDLDRPYGRVNRKKLKSKMM  1081
             KLIWPNNYGVWVDEFEAMDLLDCLD TWSGA VYIDD TTKDL+RPYGRVNRK+LKSKMM
Sbjct  117   KLIWPNNYGVWVDEFEAMDLLDCLDATWSGAAVYIDDNTTKDLNRPYGRVNRKQLKSKMM  176

Query  1080  QKCITNGVKFHQAKVIKVIHEESKSMLICSDGVTIQATVVLDATGFSRCLVQYDKPYNPG  901
             QKCI NGVKFHQAKVIKVIHEESKSMLIC+DG+TIQA VVLDATGFSR LVQYDKPYNPG
Sbjct  177   QKCIMNGVKFHQAKVIKVIHEESKSMLICNDGITIQAMVVLDATGFSRSLVQYDKPYNPG  236

Query  900   YQVAYGILAEVEEHPYDLNKMVFMDWRDSHLNSNLELKERNKRIPTFLYAMPFSSTRIFL  721
             YQVAYGILAEVEEHP+D+NKMVFMDWRDSHL +N +LKERN RIPTFLYAMPFSS RIFL
Sbjct  237   YQVAYGILAEVEEHPFDVNKMVFMDWRDSHLKNNADLKERNSRIPTFLYAMPFSSNRIFL  296

Query  720   EETSLVARPGLDMKDIQERMVARLRHLGINVKSIEEDERCVIPMGGPLPVIPQRVVGIGG  541
             EETSLVARPGL ++DIQERMVARL HLGI VKSIEEDE C+IPMGGPLPV+PQRV+GIGG
Sbjct  297   EETSLVARPGLRIEDIQERMVARLNHLGIKVKSIEEDEHCLIPMGGPLPVLPQRVIGIGG  356

Query  540   TAGMVHPSTGYMVARTLAAAPVVANAIIQYLGSERSLLGNELSASVWKDLWPIERRRQRE  361
             TAGMVHPSTGYMVARTLAAAPVVANAIIQYL SERS  GNELS  VWKDLWPIERRRQRE
Sbjct  357   TAGMVHPSTGYMVARTLAAAPVVANAIIQYLSSERSHSGNELSTGVWKDLWPIERRRQRE  416

Query  360   FFCFGMDILLKLDLPATRRFFDAFFDLEPRYWHGFLSSRLFLRELIFFGLSLFSHASNTS  181
             FFCFGMDILLKLDLPATRRFFDAFFDLEPRYWHGFLSSRLFL ELI FGLSLFSHASNT 
Sbjct  417   FFCFGMDILLKLDLPATRRFFDAFFDLEPRYWHGFLSSRLFLPELIVFGLSLFSHASNTC  476

Query  180   RLEIMTKGTLPLVNMINNLLQD  115
             RLEIMTKGT+PLVNMINNLLQD
Sbjct  477   RLEIMTKGTVPLVNMINNLLQD  498



>gb|AIX87498.1| lycopene beta-cyclase [Lycium barbarum]
Length=501

 Score =   862 bits (2228),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 436/503 (87%), Positives = 468/503 (93%), Gaps = 8/503 (2%)
 Frame = -2

Query  1611  MDTLLKTPNELEFLHPHHGFAVKASAFTSLKPQKQEIRIGSWKACRNVGR---VKA-SSS  1444
             MDTLLKTPN LEFL P HGF+VK S FTS+KPQK     GS K+C N G+   V+A +SS
Sbjct  1     MDTLLKTPNNLEFLQPLHGFSVKVSNFTSVKPQK----FGSRKSCENWGKRVCVRARNSS  56

Query  1443  ALLELVPVTKKENLDFELPMFEPSKGIvvdlavvgggpaglavaqqVSQAGLSVCSIDPS  1264
              LLELVP TKKENLDFELPM++P+KG+VVDLAVVGGGPAGLAVAQQVS+AGLSVCSIDPS
Sbjct  57    TLLELVPATKKENLDFELPMYDPTKGLVVDLAVVGGGPAGLAVAQQVSEAGLSVCSIDPS  116

Query  1263  PKLIWPNNYGVWVDEFEAMDLLDCLDTTWSGAMVYIDDRTTKDLDRPYGRVNRKKLKSKM  1084
             PKLIWPNNYGVWVDEFEAMDLLDCLD TWSGA+VY+DD   K+LDRPYGRVNRK+LKSKM
Sbjct  117   PKLIWPNNYGVWVDEFEAMDLLDCLDATWSGAVVYVDDDRMKNLDRPYGRVNRKQLKSKM  176

Query  1083  MQKCITNGVKFHQAKVIKVIHEESKSMLICSDGVTIQATVVLDATGFSRCLVQYDKPYNP  904
             MQKCI NGVKFHQAKVIKVIHEE+KSMLIC+DGVTIQA VVLDATGFSRCLVQYDKPYNP
Sbjct  177   MQKCILNGVKFHQAKVIKVIHEEAKSMLICNDGVTIQAKVVLDATGFSRCLVQYDKPYNP  236

Query  903   GYQVAYGILAEVEEHPYDLNKMVFMDWRDSHLNSNLELKERNKRIPTFLYAMPFSSTRIF  724
             GYQVAYGILAEVEEHP+D +KM+FMDWRDSHLN+N+ELKERN+++PTFLYAMPFSS RIF
Sbjct  237   GYQVAYGILAEVEEHPFDTDKMLFMDWRDSHLNNNMELKERNRKVPTFLYAMPFSSNRIF  296

Query  723   LEETSLVARPGLDMKDIQERMVARLRHLGINVKSIEEDERCVIPMGGPLPVIPQRVVGIG  544
             LEETSLVARPGL M DIQERMVARL HLGI VKSIEEDERCVIPMGGPLPV+PQRVVGIG
Sbjct  297   LEETSLVARPGLRMDDIQERMVARLSHLGIKVKSIEEDERCVIPMGGPLPVLPQRVVGIG  356

Query  543   GTAGMVHPSTGYMVARTLAAAPVVANAIIQYLGSERSLLGNELSASVWKDLWPIERRRQR  364
             GTAGMVHPSTGYMVARTLAAAP+VA AIIQY GSE++ LGNELSASVWKDLWPIERRRQR
Sbjct  357   GTAGMVHPSTGYMVARTLAAAPIVAKAIIQYFGSEKNHLGNELSASVWKDLWPIERRRQR  416

Query  363   EFFCFGMDILLKLDLPATRRFFDAFFDLEPRYWHGFLSSRLFLRELIFFGLSLFSHASNT  184
             EFFCFGMD+LLKLDLPATRRFFDAFFDLEPRYWHGFLSSRLFL EL+FFGLSLFSHASNT
Sbjct  417   EFFCFGMDVLLKLDLPATRRFFDAFFDLEPRYWHGFLSSRLFLPELMFFGLSLFSHASNT  476

Query  183   SRLEIMTKGTLPLVNMINNLLQD  115
             SR+EIMTKGTLPLVNMINNLLQD
Sbjct  477   SRIEIMTKGTLPLVNMINNLLQD  499



>ref|NP_001234226.1| lycopene beta cyclase, chloroplastic [Solanum lycopersicum]
 ref|XP_010319653.1| PREDICTED: lycopene beta cyclase, chloroplastic isoform X1 [Solanum 
lycopersicum]
 sp|Q43503.1|LCYB_SOLLC RecName: Full=Lycopene beta cyclase, chloroplastic; Flags: Precursor 
[Solanum lycopersicum]
 emb|CAA60170.1| lycopene beta-cyclase [Solanum lycopersicum]
 gb|ABR57232.1| beta-lycopene cyclase [Solanum lycopersicum]
Length=500

 Score =   862 bits (2227),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 440/502 (88%), Positives = 459/502 (91%), Gaps = 7/502 (1%)
 Frame = -2

Query  1611  MDTLLKTPNELEFLHPHHGFAVKASAFTSLKPQKQEIRIGSWKACRNVGR---VKASSSA  1441
             MDTLLKTPN LEFL+PHHGFAVKAS F S K        GS K C  +GR   VK SSSA
Sbjct  1     MDTLLKTPNNLEFLNPHHGFAVKASTFRSEKHHN----FGSRKFCETLGRSVCVKGSSSA  56

Query  1440  LLELVPVTKKENLDFELPMFEPSKGIvvdlavvgggpaglavaqqVSQAGLSVCSIDPSP  1261
             LLELVP TKKENLDFELPM++PSKG+VVDLAVVGGGPAGLAVAQQVS+AGLSVCSIDP+P
Sbjct  57    LLELVPETKKENLDFELPMYDPSKGVVVDLAVVGGGPAGLAVAQQVSEAGLSVCSIDPNP  116

Query  1260  KLIWPNNYGVWVDEFEAMDLLDCLDTTWSGAMVYIDDRTTKDLDRPYGRVNRKKLKSKMM  1081
             KLIWPNNYGVWVDEFEAMDLLDCLD TWSGA VYIDD T KDL RPYGRVNRK+LKSKMM
Sbjct  117   KLIWPNNYGVWVDEFEAMDLLDCLDATWSGAAVYIDDNTAKDLHRPYGRVNRKQLKSKMM  176

Query  1080  QKCITNGVKFHQAKVIKVIHEESKSMLICSDGVTIQATVVLDATGFSRCLVQYDKPYNPG  901
             QKCI NGVKFHQAKVIKVIHEESKSMLIC+DG+TIQATVVLDATGFSR LVQYDKPYNPG
Sbjct  177   QKCIMNGVKFHQAKVIKVIHEESKSMLICNDGITIQATVVLDATGFSRSLVQYDKPYNPG  236

Query  900   YQVAYGILAEVEEHPYDLNKMVFMDWRDSHLNSNLELKERNKRIPTFLYAMPFSSTRIFL  721
             YQVAYGILAEVEEHP+D+NKMVFMDWRDSHL +N +LKERN RIPTFLYAMPFSS RIFL
Sbjct  237   YQVAYGILAEVEEHPFDVNKMVFMDWRDSHLKNNTDLKERNSRIPTFLYAMPFSSNRIFL  296

Query  720   EETSLVARPGLDMKDIQERMVARLRHLGINVKSIEEDERCVIPMGGPLPVIPQRVVGIGG  541
             EETSLVARPGL + DIQERMVARL HLGI VKSIEEDE C+IPMGGPLPV+PQRVVGIGG
Sbjct  297   EETSLVARPGLRIDDIQERMVARLNHLGIKVKSIEEDEHCLIPMGGPLPVLPQRVVGIGG  356

Query  540   TAGMVHPSTGYMVARTLAAAPVVANAIIQYLGSERSLLGNELSASVWKDLWPIERRRQRE  361
             TAGMVHPSTGYMVARTLAAAPVVANAIIQYLGSERS  GNELS +VWKDLWPIERRRQRE
Sbjct  357   TAGMVHPSTGYMVARTLAAAPVVANAIIQYLGSERSHSGNELSTAVWKDLWPIERRRQRE  416

Query  360   FFCFGMDILLKLDLPATRRFFDAFFDLEPRYWHGFLSSRLFLRELIFFGLSLFSHASNTS  181
             FFCFGMDILLKLDLPATRRFFDAFFDLEPRYWHGFLSSRLFL ELI FGLSLFSHASNTS
Sbjct  417   FFCFGMDILLKLDLPATRRFFDAFFDLEPRYWHGFLSSRLFLPELIVFGLSLFSHASNTS  476

Query  180   RLEIMTKGTLPLVNMINNLLQD  115
             R EIMTKGT+PLVNMINNLLQD
Sbjct  477   RFEIMTKGTVPLVNMINNLLQD  498



>sp|Q43578.1|LCYB_TOBAC RecName: Full=Lycopene beta cyclase, chloroplastic; Flags: Precursor 
[Nicotiana tabacum]
 emb|CAA57386.1| lycopene cyclase [Nicotiana tabacum]
 gb|AHA58686.1| lycopene beta-cyclase [Nicotiana tabacum]
Length=500

 Score =   860 bits (2223),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 437/504 (87%), Positives = 464/504 (92%), Gaps = 7/504 (1%)
 Frame = -2

Query  1611  MDTLLKTPNELEFLHPHHGFAVKASAFTSLKPQKQEIRIGSWKACRNVGR---VKASSSA  1441
             MDTLLKTPN+LEFLHP HGF+VKAS+F S+KP K     GS K C N G+   VKA SSA
Sbjct  1     MDTLLKTPNKLEFLHPVHGFSVKASSFNSVKPHK----FGSRKICENWGKGVCVKAKSSA  56

Query  1440  LLELVPVTKKENLDFELPMFEPSKGIvvdlavvgggpaglavaqqVSQAGLSVCSIDPSP  1261
             LLELVP TKKENLDFELPM++PSKG+VVDLAVVGGGPAGLAVAQQVS+AGLSV SIDPSP
Sbjct  57    LLELVPETKKENLDFELPMYDPSKGLVVDLAVVGGGPAGLAVAQQVSEAGLSVVSIDPSP  116

Query  1260  KLIWPNNYGVWVDEFEAMDLLDCLDTTWSGAMVYIDDRTTKDLDRPYGRVNRKKLKSKMM  1081
             KLIWPNNYGVWVDEFEAMDLLDCLD TWSG +VYIDD TTKDLDRPYGRVNRK+LKSKMM
Sbjct  117   KLIWPNNYGVWVDEFEAMDLLDCLDATWSGTVVYIDDNTTKDLDRPYGRVNRKQLKSKMM  176

Query  1080  QKCITNGVKFHQAKVIKVIHEESKSMLICSDGVTIQATVVLDATGFSRCLVQYDKPYNPG  901
             QKCI NGVKFH AKVIKVIHEE+KSMLIC+DGVTIQATVVLDATGFSRCLVQYDKPY PG
Sbjct  177   QKCILNGVKFHHAKVIKVIHEEAKSMLICNDGVTIQATVVLDATGFSRCLVQYDKPYKPG  236

Query  900   YQVAYGILAEVEEHPYDLNKMVFMDWRDSHLNSNLELKERNKRIPTFLYAMPFSSTRIFL  721
             YQVAYGILAEVEEHP+D +KMV MDWRDSHL +N+ELKERN+++PTFLYAMPFSS +IFL
Sbjct  237   YQVAYGILAEVEEHPFDTSKMVLMDWRDSHLGNNMELKERNRKVPTFLYAMPFSSNKIFL  296

Query  720   EETSLVARPGLDMKDIQERMVARLRHLGINVKSIEEDERCVIPMGGPLPVIPQRVVGIGG  541
             EETSLVARPGL M DIQERMVARL HLGI VKSIEEDE CVIPMGG LPVIPQRVVG GG
Sbjct  297   EETSLVARPGLRMDDIQERMVARLNHLGIKVKSIEEDEHCVIPMGGSLPVIPQRVVGTGG  356

Query  540   TAGMVHPSTGYMVARTLAAAPVVANAIIQYLGSERSLLGNELSASVWKDLWPIERRRQRE  361
             TAG+VHPSTGYMVARTLAAAPVVANAII YLGSE+ LLGNELSA+VWKDLWPIERRRQRE
Sbjct  357   TAGLVHPSTGYMVARTLAAAPVVANAIIHYLGSEKDLLGNELSAAVWKDLWPIERRRQRE  416

Query  360   FFCFGMDILLKLDLPATRRFFDAFFDLEPRYWHGFLSSRLFLRELIFFGLSLFSHASNTS  181
             FFCFGMDILLKLDLPATRRFFDAFFDLEPRYWHGFLSSRL+L ELIFFGLSLFS ASNTS
Sbjct  417   FFCFGMDILLKLDLPATRRFFDAFFDLEPRYWHGFLSSRLYLPELIFFGLSLFSRASNTS  476

Query  180   RLEIMTKGTLPLVNMINNLLQDID  109
             R+EIMTKGTLPLVNMINNLLQD +
Sbjct  477   RIEIMTKGTLPLVNMINNLLQDTE  500



>ref|XP_009793443.1| PREDICTED: lycopene beta cyclase, chloroplastic [Nicotiana sylvestris]
Length=500

 Score =   860 bits (2222),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 435/504 (86%), Positives = 466/504 (92%), Gaps = 7/504 (1%)
 Frame = -2

Query  1611  MDTLLKTPNELEFLHPHHGFAVKASAFTSLKPQKQEIRIGSWKACRNVGR---VKASSSA  1441
             MDTLLKTPN+LEFLHP HGF+VKAS+F S+KP K     GS K C + G+   VKASSS 
Sbjct  1     MDTLLKTPNKLEFLHPLHGFSVKASSFNSVKPHK----FGSRKFCEDWGKGVCVKASSST  56

Query  1440  LLELVPVTKKENLDFELPMFEPSKGIvvdlavvgggpaglavaqqVSQAGLSVCSIDPSP  1261
             LLELVP TKKENLDFELPM++PSKG+VVDLAVVGGGPAGLAVAQQVS+AGLSV SIDPSP
Sbjct  57    LLELVPETKKENLDFELPMYDPSKGLVVDLAVVGGGPAGLAVAQQVSEAGLSVVSIDPSP  116

Query  1260  KLIWPNNYGVWVDEFEAMDLLDCLDTTWSGAMVYIDDRTTKDLDRPYGRVNRKKLKSKMM  1081
             KLIWPNNYGVWVDEFEAMDLLDCLD TWSG +VYIDD TTKDLDRPYGRVNRK+LKSKMM
Sbjct  117   KLIWPNNYGVWVDEFEAMDLLDCLDATWSGTVVYIDDNTTKDLDRPYGRVNRKQLKSKMM  176

Query  1080  QKCITNGVKFHQAKVIKVIHEESKSMLICSDGVTIQATVVLDATGFSRCLVQYDKPYNPG  901
             QKCI NGVKFH AKVIKVIHEE+KSMLIC+DGVTIQATVVLDATGFSRCLVQYDKPYNPG
Sbjct  177   QKCILNGVKFHHAKVIKVIHEEAKSMLICNDGVTIQATVVLDATGFSRCLVQYDKPYNPG  236

Query  900   YQVAYGILAEVEEHPYDLNKMVFMDWRDSHLNSNLELKERNKRIPTFLYAMPFSSTRIFL  721
             YQVAYGILAEVEEHP+D +KMV MDWRDSHL +N+EL+ERN+++PTFLYAMPFSS  IFL
Sbjct  237   YQVAYGILAEVEEHPFDTSKMVLMDWRDSHLGNNMELRERNRKVPTFLYAMPFSSNSIFL  296

Query  720   EETSLVARPGLDMKDIQERMVARLRHLGINVKSIEEDERCVIPMGGPLPVIPQRVVGIGG  541
             EETSLVARPGL M DIQERMVARL HLGI VKSIEEDE CVIPMGGPLPV+PQRVVG+GG
Sbjct  297   EETSLVARPGLRMDDIQERMVARLNHLGIKVKSIEEDEYCVIPMGGPLPVLPQRVVGVGG  356

Query  540   TAGMVHPSTGYMVARTLAAAPVVANAIIQYLGSERSLLGNELSASVWKDLWPIERRRQRE  361
             TAGMVHPSTGYMVARTLAAAPVVANAIIQYLGSE+ L GNELSA+VWKDLWPIERRRQRE
Sbjct  357   TAGMVHPSTGYMVARTLAAAPVVANAIIQYLGSEKDLFGNELSAAVWKDLWPIERRRQRE  416

Query  360   FFCFGMDILLKLDLPATRRFFDAFFDLEPRYWHGFLSSRLFLRELIFFGLSLFSHASNTS  181
             FFCFGMDILLKLDLPATRRFFDAFFDLEPRYWHGFLSSRL+L ELIFFGLSLF+ ASNTS
Sbjct  417   FFCFGMDILLKLDLPATRRFFDAFFDLEPRYWHGFLSSRLYLPELIFFGLSLFARASNTS  476

Query  180   RLEIMTKGTLPLVNMINNLLQDID  109
             R+EIMTKGTLPLVNMINNL+QD +
Sbjct  477   RIEIMTKGTLPLVNMINNLIQDTE  500



>sp|Q43415.1|LCYB_CAPAN RecName: Full=Lycopene beta cyclase, chloroplastic/chromoplastic; 
Flags: Precursor [Capsicum annuum]
 emb|CAA60119.1| lycopene synthase [Capsicum annuum]
Length=498

 Score =   860 bits (2221),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 441/503 (88%), Positives = 464/503 (92%), Gaps = 11/503 (2%)
 Frame = -2

Query  1611  MDTLLKTPNELEFLHPHHGFAVKASAFTSLKPQKQEIRIGSWKACRNVGR----VKASSS  1444
             MDTLL+TPN LEFLH   GF VK SAF+S+K QK     G+ K C  +G     VKASSS
Sbjct  1     MDTLLRTPNNLEFLH---GFGVKVSAFSSVKSQK----FGAKKFCEGLGSRSVCVKASSS  53

Query  1443  ALLELVPVTKKENLDFELPMFEPSKGIvvdlavvgggpaglavaqqVSQAGLSVCSIDPS  1264
             ALLELVP TKKENLDFELPM++PSKG+VVDLAVVGGGPAGLAVAQQVS+AGLSVCSIDP+
Sbjct  54    ALLELVPETKKENLDFELPMYDPSKGVVVDLAVVGGGPAGLAVAQQVSEAGLSVCSIDPN  113

Query  1263  PKLIWPNNYGVWVDEFEAMDLLDCLDTTWSGAMVYIDDRTTKDLDRPYGRVNRKKLKSKM  1084
             PKLIWPNNYGVWVDEFEAMDLLDCLD TWSGA VYIDD+TTKDL+RPYGRVNRK+LKSKM
Sbjct  114   PKLIWPNNYGVWVDEFEAMDLLDCLDATWSGAAVYIDDKTTKDLNRPYGRVNRKQLKSKM  173

Query  1083  MQKCITNGVKFHQAKVIKVIHEESKSMLICSDGVTIQATVVLDATGFSRCLVQYDKPYNP  904
             MQKCI NGVKFHQAKVIKVIHEESKSMLIC+DG+TIQATVVLDATGFSR LVQYDKPYNP
Sbjct  174   MQKCILNGVKFHQAKVIKVIHEESKSMLICNDGITIQATVVLDATGFSRSLVQYDKPYNP  233

Query  903   GYQVAYGILAEVEEHPYDLNKMVFMDWRDSHLNSNLELKERNKRIPTFLYAMPFSSTRIF  724
             GYQVAYGILAEVEEHP+D+NKMVFMDWRDSHL +N+ELKERN RIPTFLYAMPFSS RIF
Sbjct  234   GYQVAYGILAEVEEHPFDVNKMVFMDWRDSHLKNNVELKERNSRIPTFLYAMPFSSNRIF  293

Query  723   LEETSLVARPGLDMKDIQERMVARLRHLGINVKSIEEDERCVIPMGGPLPVIPQRVVGIG  544
             LEETSLVARPGL M DIQERMVARL HLGI VKSIEEDE CVIPMGGPLPV+PQRVVGIG
Sbjct  294   LEETSLVARPGLGMDDIQERMVARLSHLGIKVKSIEEDEHCVIPMGGPLPVLPQRVVGIG  353

Query  543   GTAGMVHPSTGYMVARTLAAAPVVANAIIQYLGSERSLLGNELSASVWKDLWPIERRRQR  364
             GTAGMVHPSTGYMVARTLAAAPVVANAIIQYL SERS  G+ELSA+VWKDLWPIERRRQR
Sbjct  354   GTAGMVHPSTGYMVARTLAAAPVVANAIIQYLSSERSHSGDELSAAVWKDLWPIERRRQR  413

Query  363   EFFCFGMDILLKLDLPATRRFFDAFFDLEPRYWHGFLSSRLFLRELIFFGLSLFSHASNT  184
             EFFCFGMDILLKLDLPATRRFFDAFFDLEPRYWHGFLSSRLFL ELI FGLSLFSHASNT
Sbjct  414   EFFCFGMDILLKLDLPATRRFFDAFFDLEPRYWHGFLSSRLFLPELIVFGLSLFSHASNT  473

Query  183   SRLEIMTKGTLPLVNMINNLLQD  115
             SRLEIMTKGTLPLV+MINNLLQD
Sbjct  474   SRLEIMTKGTLPLVHMINNLLQD  496



>gb|ADH04271.1| lycopene beta-cyclase [Capsicum annuum]
 gb|ADH04272.1| lycopene beta-cyclase [Capsicum annuum]
 gb|ADH04273.1| lycopene beta-cyclase [Capsicum annuum]
 gb|ADH04274.1| lycopene beta-cyclase [Capsicum annuum]
 gb|ADH04275.1| lycopene beta-cyclase [Capsicum annuum]
 gb|ADH04276.1| lycopene beta-cyclase [Capsicum annuum]
 gb|ADH04277.1| lycopene beta-cyclase [Capsicum annuum]
Length=498

 Score =   859 bits (2220),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 441/503 (88%), Positives = 463/503 (92%), Gaps = 11/503 (2%)
 Frame = -2

Query  1611  MDTLLKTPNELEFLHPHHGFAVKASAFTSLKPQKQEIRIGSWKACRNVGR----VKASSS  1444
             MDTLL+TPN LEFLH   GF VK SAF+S+K QK     G+ K C  +G     VKASSS
Sbjct  1     MDTLLRTPNNLEFLH---GFGVKVSAFSSVKSQK----FGAKKFCEGLGSRSVCVKASSS  53

Query  1443  ALLELVPVTKKENLDFELPMFEPSKGIvvdlavvgggpaglavaqqVSQAGLSVCSIDPS  1264
             ALLELVP TKKENLDFELPM++PSKG+VVDLAVVGGGPAGLAVAQQVS+AGLSVCSIDP+
Sbjct  54    ALLELVPETKKENLDFELPMYDPSKGVVVDLAVVGGGPAGLAVAQQVSEAGLSVCSIDPN  113

Query  1263  PKLIWPNNYGVWVDEFEAMDLLDCLDTTWSGAMVYIDDRTTKDLDRPYGRVNRKKLKSKM  1084
             PKLIWPNNYGVWVDEFEAMDLLDCLD TWSGA VYIDD TTKDL+RPYGRVNRK+LKSKM
Sbjct  114   PKLIWPNNYGVWVDEFEAMDLLDCLDATWSGATVYIDDNTTKDLNRPYGRVNRKQLKSKM  173

Query  1083  MQKCITNGVKFHQAKVIKVIHEESKSMLICSDGVTIQATVVLDATGFSRCLVQYDKPYNP  904
             MQKCI NGVKFHQAKVIKVIHEESKSMLIC+DG+TIQATVVLDATGFSR LVQYDKPYNP
Sbjct  174   MQKCILNGVKFHQAKVIKVIHEESKSMLICNDGITIQATVVLDATGFSRSLVQYDKPYNP  233

Query  903   GYQVAYGILAEVEEHPYDLNKMVFMDWRDSHLNSNLELKERNKRIPTFLYAMPFSSTRIF  724
             GYQVAYGILAEVEEHP+D+NKMVFMDWRDSHL +N+ELKERN RIPTFLYAMPFSS RIF
Sbjct  234   GYQVAYGILAEVEEHPFDVNKMVFMDWRDSHLKNNVELKERNSRIPTFLYAMPFSSNRIF  293

Query  723   LEETSLVARPGLDMKDIQERMVARLRHLGINVKSIEEDERCVIPMGGPLPVIPQRVVGIG  544
             LEETSLVARPGL M DIQERMVARL HLGI VKSIEEDE CVIPMGGPLPV+PQRVVGIG
Sbjct  294   LEETSLVARPGLGMDDIQERMVARLSHLGIKVKSIEEDEHCVIPMGGPLPVLPQRVVGIG  353

Query  543   GTAGMVHPSTGYMVARTLAAAPVVANAIIQYLGSERSLLGNELSASVWKDLWPIERRRQR  364
             GTAGMVHPSTGYMVARTLAAAPVVANAIIQYL SERS  G+ELSA+VWKDLWPIERRRQR
Sbjct  354   GTAGMVHPSTGYMVARTLAAAPVVANAIIQYLSSERSHSGDELSAAVWKDLWPIERRRQR  413

Query  363   EFFCFGMDILLKLDLPATRRFFDAFFDLEPRYWHGFLSSRLFLRELIFFGLSLFSHASNT  184
             EFFCFGMDILLKLDLPATRRFFDAFFDLEPRYWHGFLSSRLFL ELI FGLSLFSHASNT
Sbjct  414   EFFCFGMDILLKLDLPATRRFFDAFFDLEPRYWHGFLSSRLFLPELIVFGLSLFSHASNT  473

Query  183   SRLEIMTKGTLPLVNMINNLLQD  115
             SRLEIMTKGTLPLV+MINNLLQD
Sbjct  474   SRLEIMTKGTLPLVHMINNLLQD  496



>gb|AIX87522.1| lycopene beta-cyclase [Lycium ruthenicum]
Length=501

 Score =   858 bits (2218),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 435/503 (86%), Positives = 467/503 (93%), Gaps = 8/503 (2%)
 Frame = -2

Query  1611  MDTLLKTPNELEFLHPHHGFAVKASAFTSLKPQKQEIRIGSWKACRNVGR---VKA-SSS  1444
             MDTLLKTPN LEFL P HGF+VK S FTS+KPQK     GS K+C N G+   V+A +SS
Sbjct  1     MDTLLKTPNNLEFLQPLHGFSVKVSNFTSVKPQK----FGSRKSCENWGKRVCVRARNSS  56

Query  1443  ALLELVPVTKKENLDFELPMFEPSKGIvvdlavvgggpaglavaqqVSQAGLSVCSIDPS  1264
              LLELVP TKKENLDFELPM++P+KG+VVDLAVVGGGPAGLAVAQQVS+AGLSVCSIDPS
Sbjct  57    TLLELVPETKKENLDFELPMYDPTKGLVVDLAVVGGGPAGLAVAQQVSEAGLSVCSIDPS  116

Query  1263  PKLIWPNNYGVWVDEFEAMDLLDCLDTTWSGAMVYIDDRTTKDLDRPYGRVNRKKLKSKM  1084
             PKLIWPNNYGVWVDEFEAMDLLDCLD  WSGA+VY+DD   K+LDRPYGRVNRK+LKSKM
Sbjct  117   PKLIWPNNYGVWVDEFEAMDLLDCLDAAWSGAVVYVDDDRMKNLDRPYGRVNRKQLKSKM  176

Query  1083  MQKCITNGVKFHQAKVIKVIHEESKSMLICSDGVTIQATVVLDATGFSRCLVQYDKPYNP  904
             MQKCI NGVKFHQAKVIKVIHEE+KSMLIC+DGVTIQA VVLDATGFSRCLVQYDKPYNP
Sbjct  177   MQKCILNGVKFHQAKVIKVIHEEAKSMLICNDGVTIQAKVVLDATGFSRCLVQYDKPYNP  236

Query  903   GYQVAYGILAEVEEHPYDLNKMVFMDWRDSHLNSNLELKERNKRIPTFLYAMPFSSTRIF  724
             GYQVAYGILAEV EHP+D +KM+FMDWRDSHLN+N+ELKERN+++PTFLYAMPFSS RIF
Sbjct  237   GYQVAYGILAEVGEHPFDTDKMLFMDWRDSHLNNNMELKERNRKVPTFLYAMPFSSNRIF  296

Query  723   LEETSLVARPGLDMKDIQERMVARLRHLGINVKSIEEDERCVIPMGGPLPVIPQRVVGIG  544
             LEETSLVARPGL M DIQERMVARL HLGI VKSIEEDERCVIPMGGPLPV+PQRVVGIG
Sbjct  297   LEETSLVARPGLRMDDIQERMVARLSHLGIKVKSIEEDERCVIPMGGPLPVLPQRVVGIG  356

Query  543   GTAGMVHPSTGYMVARTLAAAPVVANAIIQYLGSERSLLGNELSASVWKDLWPIERRRQR  364
             GTAGMVHPSTGYMVARTLAAAP+VA AIIQYLGSE++ LGNELSASVWKDLWPIERRRQR
Sbjct  357   GTAGMVHPSTGYMVARTLAAAPIVAKAIIQYLGSEKNHLGNELSASVWKDLWPIERRRQR  416

Query  363   EFFCFGMDILLKLDLPATRRFFDAFFDLEPRYWHGFLSSRLFLRELIFFGLSLFSHASNT  184
             EFFCFGMD+LLKLDLPATRRFFDAFFDLEPRYWHGFLSSRLFL EL+FFGLSLFSHASNT
Sbjct  417   EFFCFGMDVLLKLDLPATRRFFDAFFDLEPRYWHGFLSSRLFLPELMFFGLSLFSHASNT  476

Query  183   SRLEIMTKGTLPLVNMINNLLQD  115
             SR+EIMTKGTLPLVNMINNLLQD
Sbjct  477   SRIEIMTKGTLPLVNMINNLLQD  499



>ref|XP_010312096.1| PREDICTED: lycopene beta cyclase, chloroplastic [Solanum lycopersicum]
Length=500

 Score =   858 bits (2218),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 434/504 (86%), Positives = 467/504 (93%), Gaps = 7/504 (1%)
 Frame = -2

Query  1611  MDTLLKTPNELEFLHPHHGFAVKASAFTSLKPQKQEIRIGSWKACRNVGR---VKASSSA  1441
             MDTLLKTPN+LEFL P HGFAVK S+F+S+KP    +++G  K C N GR   VKA SS 
Sbjct  1     MDTLLKTPNKLEFLQPFHGFAVKGSSFSSVKP----LKLGFRKFCENWGRGVCVKARSST  56

Query  1440  LLELVPVTKKENLDFELPMFEPSKGIvvdlavvgggpaglavaqqVSQAGLSVCSIDPSP  1261
             LLELVP  KKENLDFELPM++PSKG+VVDLAVVGGGPAGLAVAQQVS+AGLSVCSIDPSP
Sbjct  57    LLELVPEIKKENLDFELPMYDPSKGLVVDLAVVGGGPAGLAVAQQVSEAGLSVCSIDPSP  116

Query  1260  KLIWPNNYGVWVDEFEAMDLLDCLDTTWSGAMVYIDDRTTKDLDRPYGRVNRKKLKSKMM  1081
             KLIWPNNYGVWVDEFEAMDLLDCLD TWSGA+VY+DD  TK+LDRPYGRVNRK+LKSKMM
Sbjct  117   KLIWPNNYGVWVDEFEAMDLLDCLDATWSGAVVYVDDDKTKNLDRPYGRVNRKQLKSKMM  176

Query  1080  QKCITNGVKFHQAKVIKVIHEESKSMLICSDGVTIQATVVLDATGFSRCLVQYDKPYNPG  901
             QKCI NGVKFHQAKVIKVIHEE+KSMLICSDGVTIQATVVLDATGFSRCLVQYDKPYNPG
Sbjct  177   QKCILNGVKFHQAKVIKVIHEEAKSMLICSDGVTIQATVVLDATGFSRCLVQYDKPYNPG  236

Query  900   YQVAYGILAEVEEHPYDLNKMVFMDWRDSHLNSNLELKERNKRIPTFLYAMPFSSTRIFL  721
             YQVAYGILA+VEEHP+D +KM+FMDWRDSHLN+N++LKERN+++PTFLYAMPFSS RIFL
Sbjct  237   YQVAYGILAQVEEHPFDTSKMLFMDWRDSHLNNNVKLKERNRKVPTFLYAMPFSSNRIFL  296

Query  720   EETSLVARPGLDMKDIQERMVARLRHLGINVKSIEEDERCVIPMGGPLPVIPQRVVGIGG  541
             EETSLVARPGL M DIQERMVARL HLGI V SIEEDE+CVIPMGGPLPVIPQRVVGIGG
Sbjct  297   EETSLVARPGLRMDDIQERMVARLSHLGIKVTSIEEDEQCVIPMGGPLPVIPQRVVGIGG  356

Query  540   TAGMVHPSTGYMVARTLAAAPVVANAIIQYLGSERSLLGNELSASVWKDLWPIERRRQRE  361
             TAGMVHPSTGYMVARTLAAAPVVANAI+QYLGS++  LGNELSASVWKDLWPIERRRQRE
Sbjct  357   TAGMVHPSTGYMVARTLAAAPVVANAIVQYLGSDKDHLGNELSASVWKDLWPIERRRQRE  416

Query  360   FFCFGMDILLKLDLPATRRFFDAFFDLEPRYWHGFLSSRLFLRELIFFGLSLFSHASNTS  181
             FFCFGMDILLKLDL ATRRFFDAFFDLEPRYWHGFLSSRLFL EL+FFGLSLFSHASNTS
Sbjct  417   FFCFGMDILLKLDLSATRRFFDAFFDLEPRYWHGFLSSRLFLPELMFFGLSLFSHASNTS  476

Query  180   RLEIMTKGTLPLVNMINNLLQDID  109
             RLEIMTKGT PLV MINNLL+D +
Sbjct  477   RLEIMTKGTFPLVTMINNLLKDTE  500



>ref|XP_006351264.1| PREDICTED: lycopene beta cyclase, chloroplastic-like isoform 
X1 [Solanum tuberosum]
 ref|XP_006351265.1| PREDICTED: lycopene beta cyclase, chloroplastic-like isoform 
X2 [Solanum tuberosum]
 ref|XP_006351266.1| PREDICTED: lycopene beta cyclase, chloroplastic-like isoform 
X3 [Solanum tuberosum]
Length=500

 Score =   853 bits (2203),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 433/504 (86%), Positives = 465/504 (92%), Gaps = 7/504 (1%)
 Frame = -2

Query  1611  MDTLLKTPNELEFLHPHHGFAVKASAFTSLKPQKQEIRIGSWKACRNVGR---VKASSSA  1441
             MD LLKTPN+LEFL P HGF+VK S+F+S+KP    +++G  K C N  R   VKA SS 
Sbjct  1     MDILLKTPNKLEFLQPFHGFSVKGSSFSSVKP----LKLGFRKFCENWRRGVCVKARSST  56

Query  1440  LLELVPVTKKENLDFELPMFEPSKGIvvdlavvgggpaglavaqqVSQAGLSVCSIDPSP  1261
             LLELVP  KKENLDFELPM++PSKG+VVDLAVVGGGPAGLAVAQQVS+AGLSVCSIDPSP
Sbjct  57    LLELVPEIKKENLDFELPMYDPSKGLVVDLAVVGGGPAGLAVAQQVSEAGLSVCSIDPSP  116

Query  1260  KLIWPNNYGVWVDEFEAMDLLDCLDTTWSGAMVYIDDRTTKDLDRPYGRVNRKKLKSKMM  1081
             KLIWPNNYGVWVDEFEAMDLLDCLD TWSGA+VY+DD  TK+LDRPYGRVNRK+LKSKMM
Sbjct  117   KLIWPNNYGVWVDEFEAMDLLDCLDATWSGAVVYVDDDRTKNLDRPYGRVNRKQLKSKMM  176

Query  1080  QKCITNGVKFHQAKVIKVIHEESKSMLICSDGVTIQATVVLDATGFSRCLVQYDKPYNPG  901
             QKCI NGVKFHQAKVIKVIHEE+KSMLICSDGVTIQATVVLDATGFSRCLVQYDKPYNPG
Sbjct  177   QKCILNGVKFHQAKVIKVIHEEAKSMLICSDGVTIQATVVLDATGFSRCLVQYDKPYNPG  236

Query  900   YQVAYGILAEVEEHPYDLNKMVFMDWRDSHLNSNLELKERNKRIPTFLYAMPFSSTRIFL  721
             YQVAYGILAEVEEHP+D +KM+FMDWRDSHLN+N+ELKERN+++PTFLYAMPFSS RIFL
Sbjct  237   YQVAYGILAEVEEHPFDTSKMLFMDWRDSHLNNNMELKERNRKVPTFLYAMPFSSNRIFL  296

Query  720   EETSLVARPGLDMKDIQERMVARLRHLGINVKSIEEDERCVIPMGGPLPVIPQRVVGIGG  541
             EETSLVARPGL M DIQERMVARL HLGI VKSIEEDE CVIPMGGPLPVIPQRVVGIGG
Sbjct  297   EETSLVARPGLRMDDIQERMVARLSHLGIKVKSIEEDEHCVIPMGGPLPVIPQRVVGIGG  356

Query  540   TAGMVHPSTGYMVARTLAAAPVVANAIIQYLGSERSLLGNELSASVWKDLWPIERRRQRE  361
             TAGMVHPSTGYMVARTLAAAPVVANAIIQYLGS++  LGN+LSASVWKDLWPIERRRQRE
Sbjct  357   TAGMVHPSTGYMVARTLAAAPVVANAIIQYLGSDKDHLGNDLSASVWKDLWPIERRRQRE  416

Query  360   FFCFGMDILLKLDLPATRRFFDAFFDLEPRYWHGFLSSRLFLRELIFFGLSLFSHASNTS  181
             FFCFGMDILLKLDL ATRRFFDAFFDLEPRYWHGFLSSRL L EL+FFGLSLFSHASNTS
Sbjct  417   FFCFGMDILLKLDLSATRRFFDAFFDLEPRYWHGFLSSRLLLPELMFFGLSLFSHASNTS  476

Query  180   RLEIMTKGTLPLVNMINNLLQDID  109
             RLEIMTKGT+PLV MINNLL+D +
Sbjct  477   RLEIMTKGTVPLVTMINNLLKDTE  500



>ref|XP_002275769.1| PREDICTED: lycopene beta cyclase, chloroplastic [Vitis vinifera]
Length=504

 Score =   851 bits (2199),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 431/504 (86%), Positives = 462/504 (92%), Gaps = 3/504 (1%)
 Frame = -2

Query  1611  MDTLLKTPNELEFLHPHHGFAVKASAFTSLKPQKQEIRIGSWKACRNVGR---VKASSSA  1441
             MDTLLKT N+LEFLHP HGFA K    T  K Q QE R G  K+    GR   VKASSSA
Sbjct  1     MDTLLKTHNKLEFLHPLHGFAEKLGNLTFPKLQNQEFRFGPKKSNLKWGRNGCVKASSSA  60

Query  1440  LLELVPVTKKENLDFELPMFEPSKGIvvdlavvgggpaglavaqqVSQAGLSVCSIDPSP  1261
             LLELVP TKKENL+FELPM++PSKG+VVDLAVVGGGPAGLAVAQQVS+AGLSVCSIDPSP
Sbjct  61    LLELVPETKKENLEFELPMYDPSKGLVVDLAVVGGGPAGLAVAQQVSEAGLSVCSIDPSP  120

Query  1260  KLIWPNNYGVWVDEFEAMDLLDCLDTTWSGAMVYIDDRTTKDLDRPYGRVNRKKLKSKMM  1081
             KLIWPNNYGVWVDEFEAMDLLDCLDTTWSGA+V+IDD + KDL RPY RVNRK+LKSKMM
Sbjct  121   KLIWPNNYGVWVDEFEAMDLLDCLDTTWSGAVVFIDDHSKKDLGRPYARVNRKQLKSKMM  180

Query  1080  QKCITNGVKFHQAKVIKVIHEESKSMLICSDGVTIQATVVLDATGFSRCLVQYDKPYNPG  901
             QKCI NGVKFHQAKVIKVIHEESKS+LIC+DGVTIQA VVLDATGFSRCLVQYDKPYNPG
Sbjct  181   QKCILNGVKFHQAKVIKVIHEESKSLLICNDGVTIQAAVVLDATGFSRCLVQYDKPYNPG  240

Query  900   YQVAYGILAEVEEHPYDLNKMVFMDWRDSHLNSNLELKERNKRIPTFLYAMPFSSTRIFL  721
             YQVAYGILAEVEEHP+D++KMVFMDWRDSHLN+N+ELK RN RIPTFLYAMPFSS RIFL
Sbjct  241   YQVAYGILAEVEEHPFDVDKMVFMDWRDSHLNNNMELKNRNSRIPTFLYAMPFSSNRIFL  300

Query  720   EETSLVARPGLDMKDIQERMVARLRHLGINVKSIEEDERCVIPMGGPLPVIPQRVVGIGG  541
             EETSLVARPG+ M+DIQERMVARLRHLGI VKSIEEDERC+IPMGGPLPV+PQRVVGIGG
Sbjct  301   EETSLVARPGVPMEDIQERMVARLRHLGIKVKSIEEDERCIIPMGGPLPVLPQRVVGIGG  360

Query  540   TAGMVHPSTGYMVARTLAAAPVVANAIIQYLGSERSLLGNELSASVWKDLWPIERRRQRE  361
             TAGMVHPSTGYMVARTLAAAP+VAN+I+QYLGS+RS  GNELS+ VW+DLWPIERRRQRE
Sbjct  361   TAGMVHPSTGYMVARTLAAAPIVANSIVQYLGSDRSFFGNELSSEVWRDLWPIERRRQRE  420

Query  360   FFCFGMDILLKLDLPATRRFFDAFFDLEPRYWHGFLSSRLFLRELIFFGLSLFSHASNTS  181
             FFCFGMDILLKLDL  TRRFFDAFFDLEPRYWHGFLSSRLFL ELIFFGLSLFSHASNTS
Sbjct  421   FFCFGMDILLKLDLQGTRRFFDAFFDLEPRYWHGFLSSRLFLPELIFFGLSLFSHASNTS  480

Query  180   RLEIMTKGTLPLVNMINNLLQDID  109
             R+EIM KGTLPL+NMINNL+QD D
Sbjct  481   RIEIMAKGTLPLINMINNLIQDKD  504



>emb|CAN69313.1| hypothetical protein VITISV_011073 [Vitis vinifera]
Length=504

 Score =   849 bits (2193),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 432/505 (86%), Positives = 462/505 (91%), Gaps = 5/505 (1%)
 Frame = -2

Query  1611  MDTLLKTPNELEFLHPHHGFAVKASAFTSLKPQKQEIRIGSWKA----CRNVGRVKASSS  1444
             MDTLLKT N+LEFLHP HGFA K    T  K Q QE R G  K+     RN G VKASSS
Sbjct  1     MDTLLKTHNKLEFLHPLHGFAEKLGNLTFPKLQNQEFRFGPKKSNLKWVRN-GCVKASSS  59

Query  1443  ALLELVPVTKKENLDFELPMFEPSKGIvvdlavvgggpaglavaqqVSQAGLSVCSIDPS  1264
             ALLELVP TKKENL+FELPM++PSKG+VVDLAVVGGGPAGLAVAQQVS+AGLSVCSIDPS
Sbjct  60    ALLELVPETKKENLEFELPMYDPSKGLVVDLAVVGGGPAGLAVAQQVSEAGLSVCSIDPS  119

Query  1263  PKLIWPNNYGVWVDEFEAMDLLDCLDTTWSGAMVYIDDRTTKDLDRPYGRVNRKKLKSKM  1084
             PKLIWPNNYGVWVDEFEAMDLLDCLDTTWSGA+V+IDD + KDL RPY RVNRK LKSKM
Sbjct  120   PKLIWPNNYGVWVDEFEAMDLLDCLDTTWSGAVVFIDDHSKKDLGRPYARVNRKLLKSKM  179

Query  1083  MQKCITNGVKFHQAKVIKVIHEESKSMLICSDGVTIQATVVLDATGFSRCLVQYDKPYNP  904
             MQKCI NGVKFHQAKVIKVIHEESKS+LIC+DGVTIQA VVLDATGFSRCLVQYDKPYNP
Sbjct  180   MQKCILNGVKFHQAKVIKVIHEESKSLLICNDGVTIQAAVVLDATGFSRCLVQYDKPYNP  239

Query  903   GYQVAYGILAEVEEHPYDLNKMVFMDWRDSHLNSNLELKERNKRIPTFLYAMPFSSTRIF  724
             GYQVAYGILAEVEEHP+D++KMVFMDWRDSHLN+N+ELK RN RIPTFLYAMPFSS RIF
Sbjct  240   GYQVAYGILAEVEEHPFDVDKMVFMDWRDSHLNNNMELKNRNSRIPTFLYAMPFSSNRIF  299

Query  723   LEETSLVARPGLDMKDIQERMVARLRHLGINVKSIEEDERCVIPMGGPLPVIPQRVVGIG  544
             LEETSLVARPG+ M+DIQERMVARLRHLGI VKSIEEDERC+IPMGGPLPV+PQRVVGIG
Sbjct  300   LEETSLVARPGVPMEDIQERMVARLRHLGIKVKSIEEDERCIIPMGGPLPVLPQRVVGIG  359

Query  543   GTAGMVHPSTGYMVARTLAAAPVVANAIIQYLGSERSLLGNELSASVWKDLWPIERRRQR  364
             GTAGMVHPSTGYMVARTLAAAP+VAN+I+QYLGS+RS  GNELS+ VW+DLWPIERRRQR
Sbjct  360   GTAGMVHPSTGYMVARTLAAAPIVANSIVQYLGSDRSFFGNELSSEVWRDLWPIERRRQR  419

Query  363   EFFCFGMDILLKLDLPATRRFFDAFFDLEPRYWHGFLSSRLFLRELIFFGLSLFSHASNT  184
             EFFCFGMDILLKLDL  TRRFFDAFFDLEPRYWHGFLSSRLFL ELIFFGLSLFSHASNT
Sbjct  420   EFFCFGMDILLKLDLQGTRRFFDAFFDLEPRYWHGFLSSRLFLPELIFFGLSLFSHASNT  479

Query  183   SRLEIMTKGTLPLVNMINNLLQDID  109
             SR+EIM KGTLPL+NMINNL+QD D
Sbjct  480   SRIEIMAKGTLPLINMINNLIQDKD  504



>gb|AFP28799.1| lycopene beta-cyclase 2 [Vitis vinifera]
Length=504

 Score =   848 bits (2192),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 430/504 (85%), Positives = 461/504 (91%), Gaps = 3/504 (1%)
 Frame = -2

Query  1611  MDTLLKTPNELEFLHPHHGFAVKASAFTSLKPQKQEIRIGSWKACRNVGR---VKASSSA  1441
             MDTLLKT N+LEFLHP HGFA K    T  K Q QE R G  K+    GR   VKASSSA
Sbjct  1     MDTLLKTHNKLEFLHPLHGFAEKLGNLTFPKLQNQEFRFGPKKSNLKWGRNGCVKASSSA  60

Query  1440  LLELVPVTKKENLDFELPMFEPSKGIvvdlavvgggpaglavaqqVSQAGLSVCSIDPSP  1261
             LLELVP TKKENL+FELPM++PSKG+VVDLAVVGGGPAGLAVAQQVS+AGLSVCSIDPSP
Sbjct  61    LLELVPETKKENLEFELPMYDPSKGLVVDLAVVGGGPAGLAVAQQVSEAGLSVCSIDPSP  120

Query  1260  KLIWPNNYGVWVDEFEAMDLLDCLDTTWSGAMVYIDDRTTKDLDRPYGRVNRKKLKSKMM  1081
             KLIWPNNYGVWVDEFEAMDLLDCLDTTWSGA+V+IDD + KDL RPY RVNRK+LKSKMM
Sbjct  121   KLIWPNNYGVWVDEFEAMDLLDCLDTTWSGAVVFIDDHSKKDLGRPYARVNRKQLKSKMM  180

Query  1080  QKCITNGVKFHQAKVIKVIHEESKSMLICSDGVTIQATVVLDATGFSRCLVQYDKPYNPG  901
             QKCI NGVKFHQAKVIKVIHEESKS+LIC+DGVTIQA VVLDATGFSRCLVQYDKPYNPG
Sbjct  181   QKCILNGVKFHQAKVIKVIHEESKSLLICNDGVTIQAAVVLDATGFSRCLVQYDKPYNPG  240

Query  900   YQVAYGILAEVEEHPYDLNKMVFMDWRDSHLNSNLELKERNKRIPTFLYAMPFSSTRIFL  721
             YQVAYGILAEVEEHP+D++KMVFMDWRDSHLN+N+ELK RN RIPTFLYAMPFSS RIFL
Sbjct  241   YQVAYGILAEVEEHPFDVDKMVFMDWRDSHLNNNMELKNRNGRIPTFLYAMPFSSNRIFL  300

Query  720   EETSLVARPGLDMKDIQERMVARLRHLGINVKSIEEDERCVIPMGGPLPVIPQRVVGIGG  541
             EETSLVARPG+ M+DIQERMVARLRHLGI VKSIEEDERC+IPMGGPLPV+PQRVVGIGG
Sbjct  301   EETSLVARPGVPMEDIQERMVARLRHLGIKVKSIEEDERCIIPMGGPLPVLPQRVVGIGG  360

Query  540   TAGMVHPSTGYMVARTLAAAPVVANAIIQYLGSERSLLGNELSASVWKDLWPIERRRQRE  361
             TAGMVHPSTGY VARTLAAAP+VAN+I+QYLGS+RS  GNELS+ VW+DLWPIERRRQRE
Sbjct  361   TAGMVHPSTGYTVARTLAAAPIVANSIVQYLGSDRSFFGNELSSEVWRDLWPIERRRQRE  420

Query  360   FFCFGMDILLKLDLPATRRFFDAFFDLEPRYWHGFLSSRLFLRELIFFGLSLFSHASNTS  181
             FFCFGMDILLKLDL  TRRFFDAFFDLEPRYWHGFLSSRLFL ELIFFGLSLFSHASNTS
Sbjct  421   FFCFGMDILLKLDLQGTRRFFDAFFDLEPRYWHGFLSSRLFLPELIFFGLSLFSHASNTS  480

Query  180   RLEIMTKGTLPLVNMINNLLQDID  109
             R+EIM KGTLPL+NMINNL+QD D
Sbjct  481   RIEIMAKGTLPLINMINNLIQDKD  504



>ref|XP_002308903.1| Lycopene beta cyclase family protein [Populus trichocarpa]
 gb|EEE92426.1| Lycopene beta cyclase family protein [Populus trichocarpa]
Length=504

 Score =   847 bits (2188),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 426/502 (85%), Positives = 465/502 (93%), Gaps = 3/502 (1%)
 Frame = -2

Query  1611  MDTLLKTPNELEFLHPHHGFAVKASAFTSLKPQKQEIRIGSWKACRNVGR---VKASSSA  1441
             MDTLLKT N++EFL   HGF+ K S  +S+K Q QE+R G  K    VGR   V+ASSSA
Sbjct  1     MDTLLKTHNKIEFLPQFHGFSEKVSNSSSVKIQIQELRFGPKKFFSKVGRNGCVEASSSA  60

Query  1440  LLELVPVTKKENLDFELPMFEPSKGIvvdlavvgggpaglavaqqVSQAGLSVCSIDPSP  1261
             LLELVP TKKENL+F+LPM++PSKG+VVDLAVVGGGPAGLAVAQQVS+AGLSVCSIDPSP
Sbjct  61    LLELVPETKKENLEFDLPMYDPSKGLVVDLAVVGGGPAGLAVAQQVSEAGLSVCSIDPSP  120

Query  1260  KLIWPNNYGVWVDEFEAMDLLDCLDTTWSGAMVYIDDRTTKDLDRPYGRVNRKKLKSKMM  1081
             +LIWPNNYGVWVDEF+AM LLDCLDTTWSGA+VY++D+T KDLDRPYGRVNRK+LKSKM+
Sbjct  121   QLIWPNNYGVWVDEFDAMGLLDCLDTTWSGAVVYVNDKTKKDLDRPYGRVNRKQLKSKML  180

Query  1080  QKCITNGVKFHQAKVIKVIHEESKSMLICSDGVTIQATVVLDATGFSRCLVQYDKPYNPG  901
             QKCI+NGVKFHQAKVIKVIHEESKS+LIC+DGVTIQA VVLDATGFSRCLVQYDKPYNPG
Sbjct  181   QKCISNGVKFHQAKVIKVIHEESKSLLICNDGVTIQAVVVLDATGFSRCLVQYDKPYNPG  240

Query  900   YQVAYGILAEVEEHPYDLNKMVFMDWRDSHLNSNLELKERNKRIPTFLYAMPFSSTRIFL  721
             YQVAYGILAEVEEHP+D++KMVFMDWRDSHLN+NLELKERN + PTFLYAMPFSS RIFL
Sbjct  241   YQVAYGILAEVEEHPFDVDKMVFMDWRDSHLNNNLELKERNSKTPTFLYAMPFSSDRIFL  300

Query  720   EETSLVARPGLDMKDIQERMVARLRHLGINVKSIEEDERCVIPMGGPLPVIPQRVVGIGG  541
             EETSLVARPG+ MKDIQERMVARLRHLGI VKSIEEDERCVIPMGGPLPV+PQRVVGIGG
Sbjct  301   EETSLVARPGVPMKDIQERMVARLRHLGIKVKSIEEDERCVIPMGGPLPVLPQRVVGIGG  360

Query  540   TAGMVHPSTGYMVARTLAAAPVVANAIIQYLGSERSLLGNELSASVWKDLWPIERRRQRE  361
             TAGMVHPSTGYMVARTLAAAP+VAN+I+QYLGS+RS  G+ELSA VWKDLWP+ERRRQRE
Sbjct  361   TAGMVHPSTGYMVARTLAAAPIVANSIVQYLGSDRSFSGSELSAKVWKDLWPVERRRQRE  420

Query  360   FFCFGMDILLKLDLPATRRFFDAFFDLEPRYWHGFLSSRLFLRELIFFGLSLFSHASNTS  181
             FFCFGMDILLKLDLPATRRFFDAFFDLEP YWHGFLSSRLFL EL+ FGLSLFSHASNTS
Sbjct  421   FFCFGMDILLKLDLPATRRFFDAFFDLEPHYWHGFLSSRLFLPELVLFGLSLFSHASNTS  480

Query  180   RLEIMTKGTLPLVNMINNLLQD  115
             RLEIM KGTLPLVNM NNL+QD
Sbjct  481   RLEIMAKGTLPLVNMTNNLIQD  502



>ref|XP_008240729.1| PREDICTED: lycopene beta cyclase, chloroplastic/chromoplastic 
[Prunus mume]
Length=504

 Score =   846 bits (2186),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 427/504 (85%), Positives = 463/504 (92%), Gaps = 3/504 (1%)
 Frame = -2

Query  1611  MDTLLKTPNELEFLHPHHGFAVKASAFTSLKPQKQEIRIGSWKACRNVGR---VKASSSA  1441
             MDTLLKT N+LEFLHP HGF+ K S   S K Q QE+R G  K+   + R   VKASSSA
Sbjct  1     MDTLLKTHNKLEFLHPLHGFSEKVSNLNSSKLQNQELRCGLRKSHMKLSRTGLVKASSSA  60

Query  1440  LLELVPVTKKENLDFELPMFEPSKGIvvdlavvgggpaglavaqqVSQAGLSVCSIDPSP  1261
             LLELVP TKKE+LDFELPM++PSKG+VVDLAVVGGGPAGLAVAQQVS AGLSVCSIDPSP
Sbjct  61    LLELVPETKKESLDFELPMYDPSKGLVVDLAVVGGGPAGLAVAQQVSAAGLSVCSIDPSP  120

Query  1260  KLIWPNNYGVWVDEFEAMDLLDCLDTTWSGAMVYIDDRTTKDLDRPYGRVNRKKLKSKMM  1081
             KLIWPNNYGVWVDEFEAMDLLDCLDTTWSGA+V+ID++T KDLDRPYGRVNRK+LKSKM+
Sbjct  121   KLIWPNNYGVWVDEFEAMDLLDCLDTTWSGAVVFIDEQTKKDLDRPYGRVNRKQLKSKML  180

Query  1080  QKCITNGVKFHQAKVIKVIHEESKSMLICSDGVTIQATVVLDATGFSRCLVQYDKPYNPG  901
             QKCI+NGVKFHQAKV KVIHEE KS+LIC+DGVTIQA VVLDATGFSRCLVQYDKPYNPG
Sbjct  181   QKCISNGVKFHQAKVNKVIHEEEKSLLICNDGVTIQAAVVLDATGFSRCLVQYDKPYNPG  240

Query  900   YQVAYGILAEVEEHPYDLNKMVFMDWRDSHLNSNLELKERNKRIPTFLYAMPFSSTRIFL  721
             YQVAYGILAEVEEHP+D++KMVFMDWRDSHLN+N+ELKERN RIPTFLYAMPFSS RIFL
Sbjct  241   YQVAYGILAEVEEHPFDVDKMVFMDWRDSHLNNNIELKERNARIPTFLYAMPFSSNRIFL  300

Query  720   EETSLVARPGLDMKDIQERMVARLRHLGINVKSIEEDERCVIPMGGPLPVIPQRVVGIGG  541
             EETSLVARPG+ MKDIQ+RMVARLRHLGI +KSIEEDE CVIPMGGPLPV+PQRVVGIGG
Sbjct  301   EETSLVARPGVPMKDIQDRMVARLRHLGIKIKSIEEDEHCVIPMGGPLPVLPQRVVGIGG  360

Query  540   TAGMVHPSTGYMVARTLAAAPVVANAIIQYLGSERSLLGNELSASVWKDLWPIERRRQRE  361
             TAGMVHPSTGYMVARTLAAAP+VANAI+QYLGS+R L GNELSA VWKDLWPIERRRQRE
Sbjct  361   TAGMVHPSTGYMVARTLAAAPIVANAIVQYLGSDRILSGNELSAEVWKDLWPIERRRQRE  420

Query  360   FFCFGMDILLKLDLPATRRFFDAFFDLEPRYWHGFLSSRLFLRELIFFGLSLFSHASNTS  181
             FFCFGM ILLKLDL +TRRFF+AFFDLEPRYWHGFLSSRLFL +L+FFGLSLFSHASN S
Sbjct  421   FFCFGMAILLKLDLKSTRRFFNAFFDLEPRYWHGFLSSRLFLPDLVFFGLSLFSHASNAS  480

Query  180   RLEIMTKGTLPLVNMINNLLQDID  109
             R+EIM KGTLPLV MINNL+QD D
Sbjct  481   RIEIMAKGTLPLVKMINNLIQDRD  504



>ref|XP_007202046.1| hypothetical protein PRUPE_ppa004528mg [Prunus persica]
 gb|EMJ03245.1| hypothetical protein PRUPE_ppa004528mg [Prunus persica]
Length=504

 Score =   846 bits (2185),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 426/504 (85%), Positives = 463/504 (92%), Gaps = 3/504 (1%)
 Frame = -2

Query  1611  MDTLLKTPNELEFLHPHHGFAVKASAFTSLKPQKQEIRIGSWKACRNVGR---VKASSSA  1441
             MDTLLKT N+LEFLHP HGF+ K S   S K Q QE+R G  K+   + R   +KASSSA
Sbjct  1     MDTLLKTHNKLEFLHPLHGFSEKVSNLNSSKLQNQELRCGLRKSHMKLSRTALIKASSSA  60

Query  1440  LLELVPVTKKENLDFELPMFEPSKGIvvdlavvgggpaglavaqqVSQAGLSVCSIDPSP  1261
             LLELVP TKKE+LDFELPM++PSKG+VVDLAVVGGGPAGLAVAQQVS AGLSVCSIDPSP
Sbjct  61    LLELVPETKKESLDFELPMYDPSKGLVVDLAVVGGGPAGLAVAQQVSAAGLSVCSIDPSP  120

Query  1260  KLIWPNNYGVWVDEFEAMDLLDCLDTTWSGAMVYIDDRTTKDLDRPYGRVNRKKLKSKMM  1081
             KLIWPNNYGVWVDEFEAMDLLDCLDTTWSGA+V+ID++T KDLDRPYGRVNRK+LKSKM+
Sbjct  121   KLIWPNNYGVWVDEFEAMDLLDCLDTTWSGAVVFIDEQTKKDLDRPYGRVNRKQLKSKML  180

Query  1080  QKCITNGVKFHQAKVIKVIHEESKSMLICSDGVTIQATVVLDATGFSRCLVQYDKPYNPG  901
             QKCI+NGVKFHQAKV KVIHEE KS+LIC+DGVTIQA VVLDATGFSRCLVQYDKPYNPG
Sbjct  181   QKCISNGVKFHQAKVNKVIHEEDKSLLICNDGVTIQAAVVLDATGFSRCLVQYDKPYNPG  240

Query  900   YQVAYGILAEVEEHPYDLNKMVFMDWRDSHLNSNLELKERNKRIPTFLYAMPFSSTRIFL  721
             YQVAYGILAEVEEHP+D++KMVFMDWRDSHLN+N+ELKERN RIPTFLYAMPFSS RIFL
Sbjct  241   YQVAYGILAEVEEHPFDVDKMVFMDWRDSHLNNNIELKERNARIPTFLYAMPFSSNRIFL  300

Query  720   EETSLVARPGLDMKDIQERMVARLRHLGINVKSIEEDERCVIPMGGPLPVIPQRVVGIGG  541
             EETSLVARPG+ MKDIQ+RMVARLRHLGI +KSIEEDE CVIPMGGPLPV+PQRVVGIGG
Sbjct  301   EETSLVARPGVPMKDIQDRMVARLRHLGIKIKSIEEDEHCVIPMGGPLPVLPQRVVGIGG  360

Query  540   TAGMVHPSTGYMVARTLAAAPVVANAIIQYLGSERSLLGNELSASVWKDLWPIERRRQRE  361
             TAGMVHPSTGYMVARTLAAAP+VANAI+QYLGS+R L GNELSA VWKDLWPIERRRQRE
Sbjct  361   TAGMVHPSTGYMVARTLAAAPIVANAIVQYLGSDRILSGNELSAEVWKDLWPIERRRQRE  420

Query  360   FFCFGMDILLKLDLPATRRFFDAFFDLEPRYWHGFLSSRLFLRELIFFGLSLFSHASNTS  181
             FFCFGM ILLKLDL +TRRFF+AFFDLEPRYWHGFLSSRLFL +L+FFGLSLFSHASN S
Sbjct  421   FFCFGMAILLKLDLKSTRRFFNAFFDLEPRYWHGFLSSRLFLPDLVFFGLSLFSHASNAS  480

Query  180   RLEIMTKGTLPLVNMINNLLQDID  109
             R+EIM KGTLPLV MINNL+QD D
Sbjct  481   RIEIMAKGTLPLVKMINNLIQDRD  504



>ref|XP_002323260.1| Lycopene beta cyclase family protein [Populus trichocarpa]
 gb|EEF05021.1| Lycopene beta cyclase family protein [Populus trichocarpa]
Length=504

 Score =   843 bits (2177),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 424/502 (84%), Positives = 464/502 (92%), Gaps = 3/502 (1%)
 Frame = -2

Query  1611  MDTLLKTPNELEFLHPHHGFAVKASAFTSLKPQKQEIRIGSWKACRNVGR---VKASSSA  1441
             MDTLLKT N+LEFL   HGF+ K S  +S+K Q Q+ R G  K     GR   VKASS+A
Sbjct  1     MDTLLKTHNKLEFLPQSHGFSEKLSNLSSIKIQSQQFRFGHKKFRSKRGRNGCVKASSNA  60

Query  1440  LLELVPVTKKENLDFELPMFEPSKGIvvdlavvgggpaglavaqqVSQAGLSVCSIDPSP  1261
             LLELVP TKKENL+F+LPM++ SKG+VVDLAVVGGGPAGLAVAQQVS+AGLSVCSIDPSP
Sbjct  61    LLELVPETKKENLEFDLPMYDLSKGLVVDLAVVGGGPAGLAVAQQVSEAGLSVCSIDPSP  120

Query  1260  KLIWPNNYGVWVDEFEAMDLLDCLDTTWSGAMVYIDDRTTKDLDRPYGRVNRKKLKSKMM  1081
             KLIWPNNYGVWVDEFEAMD+LDCLDTTWSGA+VY+DD+T KDLDRPYGRVNR++LKSKM+
Sbjct  121   KLIWPNNYGVWVDEFEAMDMLDCLDTTWSGAVVYVDDKTKKDLDRPYGRVNRRQLKSKML  180

Query  1080  QKCITNGVKFHQAKVIKVIHEESKSMLICSDGVTIQATVVLDATGFSRCLVQYDKPYNPG  901
             QKCI+NGVKFHQ KVIKVIHEESKS+LIC+DGVTIQA+VVLDATGFSRCLVQYDKPY+PG
Sbjct  181   QKCISNGVKFHQTKVIKVIHEESKSLLICNDGVTIQASVVLDATGFSRCLVQYDKPYDPG  240

Query  900   YQVAYGILAEVEEHPYDLNKMVFMDWRDSHLNSNLELKERNKRIPTFLYAMPFSSTRIFL  721
             YQVAYGILAEVEEHP+D++KMVFMDWRDSHLN+NLELKE N +IPTFLYAMPFSS RIFL
Sbjct  241   YQVAYGILAEVEEHPFDVDKMVFMDWRDSHLNNNLELKESNSKIPTFLYAMPFSSDRIFL  300

Query  720   EETSLVARPGLDMKDIQERMVARLRHLGINVKSIEEDERCVIPMGGPLPVIPQRVVGIGG  541
             EETSLVARPG+ MKDIQERMVARLRHLGI VKSIEEDERCVIPMGGPLPV+PQRVVGIGG
Sbjct  301   EETSLVARPGVPMKDIQERMVARLRHLGIKVKSIEEDERCVIPMGGPLPVLPQRVVGIGG  360

Query  540   TAGMVHPSTGYMVARTLAAAPVVANAIIQYLGSERSLLGNELSASVWKDLWPIERRRQRE  361
             TAGMVHPSTGYMVARTLAAAP+VAN+I+QYLGS+RS  G+ELSA VWKDLWPIERRRQRE
Sbjct  361   TAGMVHPSTGYMVARTLAAAPIVANSIVQYLGSDRSFSGSELSAKVWKDLWPIERRRQRE  420

Query  360   FFCFGMDILLKLDLPATRRFFDAFFDLEPRYWHGFLSSRLFLRELIFFGLSLFSHASNTS  181
             FFCFGMD+LLKLDLPATRRFFDAFF+LEPRYWHGFLSSRLFL EL+ FGLSLFSHASN S
Sbjct  421   FFCFGMDVLLKLDLPATRRFFDAFFNLEPRYWHGFLSSRLFLPELVLFGLSLFSHASNPS  480

Query  180   RLEIMTKGTLPLVNMINNLLQD  115
             RLEIM KGTLPLVNMINNL+QD
Sbjct  481   RLEIMAKGTLPLVNMINNLIQD  502



>ref|XP_012085981.1| PREDICTED: lycopene beta cyclase, chloroplastic/chromoplastic 
isoform X1 [Jatropha curcas]
 gb|KDP26226.1| hypothetical protein JCGZ_22472 [Jatropha curcas]
Length=504

 Score =   840 bits (2171),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 422/502 (84%), Positives = 464/502 (92%), Gaps = 3/502 (1%)
 Frame = -2

Query  1611  MDTLLKTPNELEFLHPHHGFAVKASAFTSLKPQKQEIRIGSWKACRNVGR---VKASSSA  1441
             MDTLLKT N+LEFL   HGF+ K S  +S+K Q  E+R    K+ R  GR   VKA+S A
Sbjct  1     MDTLLKTHNKLEFLPQLHGFSYKVSNLSSIKLQNPELRFSPKKSYRKTGRTGCVKAASGA  60

Query  1440  LLELVPVTKKENLDFELPMFEPSKGIvvdlavvgggpaglavaqqVSQAGLSVCSIDPSP  1261
             LLELVP  KKENL+F+LP+++PSKG++VDLAVVGGGPAGLAVAQQVS+AGLSVCSIDPSP
Sbjct  61    LLELVPEIKKENLEFDLPIYDPSKGLLVDLAVVGGGPAGLAVAQQVSEAGLSVCSIDPSP  120

Query  1260  KLIWPNNYGVWVDEFEAMDLLDCLDTTWSGAMVYIDDRTTKDLDRPYGRVNRKKLKSKMM  1081
             KLIWPNNYGVWVDEFEAMDLLDCLDTTWSGA+VYIDD+T KDL RPYGRVNRK+LKSKM+
Sbjct  121   KLIWPNNYGVWVDEFEAMDLLDCLDTTWSGAVVYIDDKTKKDLGRPYGRVNRKQLKSKML  180

Query  1080  QKCITNGVKFHQAKVIKVIHEESKSMLICSDGVTIQATVVLDATGFSRCLVQYDKPYNPG  901
             QKCI+NGVKFHQAKVIKVIHEESKS+LIC+DGVTIQATVVLDATGFSRCLVQYDKPYNPG
Sbjct  181   QKCISNGVKFHQAKVIKVIHEESKSLLICNDGVTIQATVVLDATGFSRCLVQYDKPYNPG  240

Query  900   YQVAYGILAEVEEHPYDLNKMVFMDWRDSHLNSNLELKERNKRIPTFLYAMPFSSTRIFL  721
             YQVAYGILAEVEEHP+D++KMVFMDWRDSHL++NLELKERN +IPTFLYAMPFSS RIFL
Sbjct  241   YQVAYGILAEVEEHPFDVDKMVFMDWRDSHLDNNLELKERNSKIPTFLYAMPFSSERIFL  300

Query  720   EETSLVARPGLDMKDIQERMVARLRHLGINVKSIEEDERCVIPMGGPLPVIPQRVVGIGG  541
             EETSLVARPG+ M+DIQERMVARL+HLGI VKSIEEDE CVIPMGGPLPV+PQR+VGIGG
Sbjct  301   EETSLVARPGVRMEDIQERMVARLKHLGIKVKSIEEDEHCVIPMGGPLPVLPQRIVGIGG  360

Query  540   TAGMVHPSTGYMVARTLAAAPVVANAIIQYLGSERSLLGNELSASVWKDLWPIERRRQRE  361
             TAGMVHPSTGYMVARTLAAAP+VAN+I+QYLGS RSL GNELSA VWKDLWPI+RRRQRE
Sbjct  361   TAGMVHPSTGYMVARTLAAAPIVANSIVQYLGSGRSLSGNELSAEVWKDLWPIQRRRQRE  420

Query  360   FFCFGMDILLKLDLPATRRFFDAFFDLEPRYWHGFLSSRLFLRELIFFGLSLFSHASNTS  181
             FFCFGMDILLKLDL ATRRFF+AFFDLEP YWHGFLSSRLFL EL+FFGLSLFSHASNTS
Sbjct  421   FFCFGMDILLKLDLQATRRFFNAFFDLEPHYWHGFLSSRLFLPELLFFGLSLFSHASNTS  480

Query  180   RLEIMTKGTLPLVNMINNLLQD  115
             RLEIM KGT+PLVNMINNL++D
Sbjct  481   RLEIMAKGTVPLVNMINNLIRD  502



>ref|XP_011033131.1| PREDICTED: lycopene beta cyclase, chloroplastic/chromoplastic-like 
[Populus euphratica]
 ref|XP_011033134.1| PREDICTED: lycopene beta cyclase, chloroplastic/chromoplastic-like 
[Populus euphratica]
Length=504

 Score =   840 bits (2169),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 422/502 (84%), Positives = 464/502 (92%), Gaps = 3/502 (1%)
 Frame = -2

Query  1611  MDTLLKTPNELEFLHPHHGFAVKASAFTSLKPQKQEIRIGSWKACRNVGR---VKASSSA  1441
             MDTLLKT N+LEFL   HGF+ K S  +S+K Q Q++R G  K     GR   VKASS+A
Sbjct  1     MDTLLKTHNKLEFLPQSHGFSEKLSNLSSIKIQSQQLRFGHKKFRSKRGRNGCVKASSNA  60

Query  1440  LLELVPVTKKENLDFELPMFEPSKGIvvdlavvgggpaglavaqqVSQAGLSVCSIDPSP  1261
             LLELVP TKKENL+F+LPM++ SKG+VVDLAVVGGGPAGLAVAQQVS+AGLSVCSIDPSP
Sbjct  61    LLELVPETKKENLEFDLPMYDLSKGLVVDLAVVGGGPAGLAVAQQVSEAGLSVCSIDPSP  120

Query  1260  KLIWPNNYGVWVDEFEAMDLLDCLDTTWSGAMVYIDDRTTKDLDRPYGRVNRKKLKSKMM  1081
             KLIWPNNYGVWVDEFEAMD+LDCLDTTWSGA+VY+D+ T KDLDRPYGRVNR++LKSKM+
Sbjct  121   KLIWPNNYGVWVDEFEAMDMLDCLDTTWSGAVVYVDENTKKDLDRPYGRVNRRQLKSKML  180

Query  1080  QKCITNGVKFHQAKVIKVIHEESKSMLICSDGVTIQATVVLDATGFSRCLVQYDKPYNPG  901
             QKCI+NGVKFHQ KVIKVIHEESKS+LIC+DGVTIQA+VVLDATGFSRC VQYDKPY+PG
Sbjct  181   QKCISNGVKFHQTKVIKVIHEESKSLLICNDGVTIQASVVLDATGFSRCFVQYDKPYDPG  240

Query  900   YQVAYGILAEVEEHPYDLNKMVFMDWRDSHLNSNLELKERNKRIPTFLYAMPFSSTRIFL  721
             YQVAYGILAEVEEHP+D++KMVFMDWRDSHLN+NLELKE N +IPTFLYAMPFSS RIFL
Sbjct  241   YQVAYGILAEVEEHPFDVDKMVFMDWRDSHLNNNLELKESNSKIPTFLYAMPFSSDRIFL  300

Query  720   EETSLVARPGLDMKDIQERMVARLRHLGINVKSIEEDERCVIPMGGPLPVIPQRVVGIGG  541
             EETSLVARPG+ MKDIQERMVARLRHLGI VKSIEEDERCVIPMGGPLPV+PQRVVGIGG
Sbjct  301   EETSLVARPGVPMKDIQERMVARLRHLGIKVKSIEEDERCVIPMGGPLPVLPQRVVGIGG  360

Query  540   TAGMVHPSTGYMVARTLAAAPVVANAIIQYLGSERSLLGNELSASVWKDLWPIERRRQRE  361
             TAGMVHPSTGYMVARTLAAAP+VAN+I+QYLGS+RS  G+ELSA+VWKDLWPIERRRQRE
Sbjct  361   TAGMVHPSTGYMVARTLAAAPIVANSIVQYLGSDRSFSGSELSANVWKDLWPIERRRQRE  420

Query  360   FFCFGMDILLKLDLPATRRFFDAFFDLEPRYWHGFLSSRLFLRELIFFGLSLFSHASNTS  181
             FFCFGMD+LLKLDLPATRRFFDAFF+LEPRYWHGFLSSRLFL EL+ FGLSLFSHASN S
Sbjct  421   FFCFGMDVLLKLDLPATRRFFDAFFNLEPRYWHGFLSSRLFLPELVLFGLSLFSHASNPS  480

Query  180   RLEIMTKGTLPLVNMINNLLQD  115
             RLEIM KGTLPLVNMINNL+QD
Sbjct  481   RLEIMAKGTLPLVNMINNLIQD  502



>ref|XP_011467335.1| PREDICTED: lycopene beta cyclase, chloroplastic [Fragaria vesca 
subsp. vesca]
Length=497

 Score =   836 bits (2160),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 423/501 (84%), Positives = 461/501 (92%), Gaps = 4/501 (1%)
 Frame = -2

Query  1611  MDTLLKTPNELEFLHPHHGFAVKASAFTSLKPQKQEIRIGSWKACRNVGRVKASSSALLE  1432
             MDTLLKT N+LEFLHP HG + K S + S    KQE+R G  K+CR  GRVKA SSALLE
Sbjct  1     MDTLLKTHNKLEFLHPLHGLSEKVSNWNS---SKQELRCGLRKSCR-TGRVKARSSALLE  56

Query  1431  LVPVTKKENLDFELPMFEPSKGIvvdlavvgggpaglavaqqVSQAGLSVCSIDPSPKLI  1252
             LVP TKKENL+FELP+++PSKG+VVDLAVVGGGPAGLAVAQQVS+AGLSVCSIDPSPKLI
Sbjct  57    LVPETKKENLEFELPLYDPSKGLVVDLAVVGGGPAGLAVAQQVSEAGLSVCSIDPSPKLI  116

Query  1251  WPNNYGVWVDEFEAMDLLDCLDTTWSGAMVYIDDRTTKDLDRPYGRVNRKKLKSKMMQKC  1072
             WPNNYGVWVDEFEAMDLLDCLDTTWSGA+V+ID+ + KDLDRPYGRVNRK+LKSKM+QKC
Sbjct  117   WPNNYGVWVDEFEAMDLLDCLDTTWSGAVVFIDEHSKKDLDRPYGRVNRKQLKSKMLQKC  176

Query  1071  ITNGVKFHQAKVIKVIHEESKSMLICSDGVTIQATVVLDATGFSRCLVQYDKPYNPGYQV  892
             I+NGVKFHQAKV  VIHEE KS+L+CSDGVTIQATVVLDATGFSRCLVQYDKPYNPGYQV
Sbjct  177   ISNGVKFHQAKVNNVIHEEDKSLLVCSDGVTIQATVVLDATGFSRCLVQYDKPYNPGYQV  236

Query  891   AYGILAEVEEHPYDLNKMVFMDWRDSHLNSNLELKERNKRIPTFLYAMPFSSTRIFLEET  712
             AYGILAEVEEHP+D++KMVFMDWRDSHL ++ +LKERN +IPTFLYAMPFSS RIFLEET
Sbjct  237   AYGILAEVEEHPFDVDKMVFMDWRDSHLRNSPQLKERNSKIPTFLYAMPFSSNRIFLEET  296

Query  711   SLVARPGLDMKDIQERMVARLRHLGINVKSIEEDERCVIPMGGPLPVIPQRVVGIGGTAG  532
             SLVARPGL MKDIQERMVARL+HLGI VKSIEEDE CVIPMGGPLPV+PQRVVGIGGTAG
Sbjct  297   SLVARPGLPMKDIQERMVARLKHLGIKVKSIEEDEHCVIPMGGPLPVLPQRVVGIGGTAG  356

Query  531   MVHPSTGYMVARTLAAAPVVANAIIQYLGSERSLLGNELSASVWKDLWPIERRRQREFFC  352
             MVHPSTGYMVARTLAAAP+VANAI+QYLGS RS+ GNELSA VWKDLWPI+RRRQREFFC
Sbjct  357   MVHPSTGYMVARTLAAAPIVANAIVQYLGSGRSISGNELSAEVWKDLWPIQRRRQREFFC  416

Query  351   FGMDILLKLDLPATRRFFDAFFDLEPRYWHGFLSSRLFLRELIFFGLSLFSHASNTSRLE  172
             FGM ILLKLDL ATRRFF+AFFDLEPRYWHGFLSSRLFL +L+FFGLSLFSHASN SRLE
Sbjct  417   FGMSILLKLDLNATRRFFNAFFDLEPRYWHGFLSSRLFLPDLLFFGLSLFSHASNASRLE  476

Query  171   IMTKGTLPLVNMINNLLQDID  109
             IM KGT+PLV MINNL+QD D
Sbjct  477   IMGKGTIPLVKMINNLIQDRD  497



>gb|AJB84622.1| lycopene beta cyclase [Camellia sinensis]
Length=504

 Score =   833 bits (2153),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 419/502 (83%), Positives = 458/502 (91%), Gaps = 3/502 (1%)
 Frame = -2

Query  1611  MDTLLKTPNELEFLHPHHGFAVKASAFTSLKPQKQEIRIGSWKACRNVGR---VKASSSA  1441
             MDTLLK  N+LEFLHP HGF  K  + +  KP  QE R G  K    +G+   +KA SSA
Sbjct  1     MDTLLKIHNKLEFLHPLHGFVEKGCSLSPSKPHNQEFRFGPKKPHLKLGKNGSLKARSSA  60

Query  1440  LLELVPVTKKENLDFELPMFEPSKGIvvdlavvgggpaglavaqqVSQAGLSVCSIDPSP  1261
             LLELVP TKKENLDFELP+++PSKG+VVDLAVVGGGPAGLAVAQQVS+AGLSVCSIDPSP
Sbjct  61    LLELVPETKKENLDFELPLYDPSKGLVVDLAVVGGGPAGLAVAQQVSEAGLSVCSIDPSP  120

Query  1260  KLIWPNNYGVWVDEFEAMDLLDCLDTTWSGAMVYIDDRTTKDLDRPYGRVNRKKLKSKMM  1081
             KLIWPNNYGVWVDEFEAMDLLDCLDTTWSGA+V++DD +TK+LDRPYGRVNR++LKSKMM
Sbjct  121   KLIWPNNYGVWVDEFEAMDLLDCLDTTWSGAVVFVDDHSTKNLDRPYGRVNRRQLKSKMM  180

Query  1080  QKCITNGVKFHQAKVIKVIHEESKSMLICSDGVTIQATVVLDATGFSRCLVQYDKPYNPG  901
             QKCI NGVKFHQAKVIKVIHEESKS+LIC+DGVT+QA VVLDATGFSRCLVQYDKPYNPG
Sbjct  181   QKCILNGVKFHQAKVIKVIHEESKSLLICNDGVTVQAAVVLDATGFSRCLVQYDKPYNPG  240

Query  900   YQVAYGILAEVEEHPYDLNKMVFMDWRDSHLNSNLELKERNKRIPTFLYAMPFSSTRIFL  721
             YQVAYGILAEVEEHP+D+NKMVFMDWRDSHLN+N+ELKERN +IPTFLYAMPFSS +IFL
Sbjct  241   YQVAYGILAEVEEHPFDVNKMVFMDWRDSHLNNNMELKERNSKIPTFLYAMPFSSKQIFL  300

Query  720   EETSLVARPGLDMKDIQERMVARLRHLGINVKSIEEDERCVIPMGGPLPVIPQRVVGIGG  541
             EETSLVARPGL M+ IQERMVARLRHLGI VKSIEEDERCVIPMGGPLPV+PQRVVGIGG
Sbjct  301   EETSLVARPGLPMEHIQERMVARLRHLGIKVKSIEEDERCVIPMGGPLPVLPQRVVGIGG  360

Query  540   TAGMVHPSTGYMVARTLAAAPVVANAIIQYLGSERSLLGNELSASVWKDLWPIERRRQRE  361
             TAGMVHPSTGYMVARTLAAAP+VA++I++YLGSE SL GN LSA VW++LWPIERRRQRE
Sbjct  361   TAGMVHPSTGYMVARTLAAAPIVADSIVRYLGSETSLSGNNLSAEVWRNLWPIERRRQRE  420

Query  360   FFCFGMDILLKLDLPATRRFFDAFFDLEPRYWHGFLSSRLFLRELIFFGLSLFSHASNTS  181
             FFCFGMDILLKLDL  TRRFFDAFFDLEP YWHGFLSSRLFL ELIFFGLSLFSHASNTS
Sbjct  421   FFCFGMDILLKLDLQGTRRFFDAFFDLEPHYWHGFLSSRLFLPELIFFGLSLFSHASNTS  480

Query  180   RLEIMTKGTLPLVNMINNLLQD  115
             R+EIM KGT PL+ MINNL+QD
Sbjct  481   RIEIMAKGTPPLLRMINNLVQD  502



>emb|CDP12863.1| unnamed protein product [Coffea canephora]
Length=508

 Score =   834 bits (2154),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 425/507 (84%), Positives = 463/507 (91%), Gaps = 9/507 (2%)
 Frame = -2

Query  1611  MDTLLKTPNELEFLHPHHGFAVKASAFTSLKPQ-KQEI-RIGSWKAC------RNVGRVK  1456
             M  LLKTPN+L F+ P  GFA K SA +SLKPQ  QE  + G  K+C      RN G +K
Sbjct  1     MGILLKTPNKLHFVSPLCGFADKVSALSSLKPQISQEFSKFGCKKSCFRGGSGRN-GWIK  59

Query  1455  ASSSALLELVPVTKKENLDFELPMFEPSKGIvvdlavvgggpaglavaqqVSQAGLSVCS  1276
             ASSSA+LELVP TKKENL+FELP+++PSKG+VVDLAVVGGGPAGLAVAQQVS+AGLSVCS
Sbjct  60    ASSSAILELVPETKKENLEFELPLYDPSKGLVVDLAVVGGGPAGLAVAQQVSEAGLSVCS  119

Query  1275  IDPSPKLIWPNNYGVWVDEFEAMDLLDCLDTTWSGAMVYIDDRTTKDLDRPYGRVNRKKL  1096
             IDPSPKLIWPNNYGVWVDEFEAMDLLDCLD TWSGA+VYIDD+ TKDLDRPYGRVNRK L
Sbjct  120   IDPSPKLIWPNNYGVWVDEFEAMDLLDCLDATWSGAVVYIDDQNTKDLDRPYGRVNRKLL  179

Query  1095  KSKMMQKCITNGVKFHQAKVIKVIHEESKSMLICSDGVTIQATVVLDATGFSRCLVQYDK  916
             KSKMMQKCI NGVKFHQAKV+KVIHEESKS+LIC+DGVTIQA  VLDATGF+RCLVQYDK
Sbjct  180   KSKMMQKCIVNGVKFHQAKVVKVIHEESKSLLICNDGVTIQAAAVLDATGFARCLVQYDK  239

Query  915   PYNPGYQVAYGILAEVEEHPYDLNKMVFMDWRDSHLNSNLELKERNKRIPTFLYAMPFSS  736
             PYNPGYQVAYGILAEVEEHP+D+NKMVFMDWRDSHLN+NL LKERN+RIPTFLYAMPFSS
Sbjct  240   PYNPGYQVAYGILAEVEEHPFDVNKMVFMDWRDSHLNNNLVLKERNRRIPTFLYAMPFSS  299

Query  735   TRIFLEETSLVARPGLDMKDIQERMVARLRHLGINVKSIEEDERCVIPMGGPLPVIPQRV  556
              RIFLEETSLVARPG+ M+DIQERMVARLRHLGI VKSIEEDERCVIPMGGPLPVIPQRV
Sbjct  300   DRIFLEETSLVARPGVPMEDIQERMVARLRHLGIKVKSIEEDERCVIPMGGPLPVIPQRV  359

Query  555   VGIGGTAGMVHPSTGYMVARTLAAAPVVANAIIQYLGSERSLLGNELSASVWKDLWPIER  376
             VGIGGTAGMVHPSTGYMVARTLAAAP+VANA+++YLGS+++ +  ++S+ VWKDLWPIER
Sbjct  360   VGIGGTAGMVHPSTGYMVARTLAAAPIVANAVVRYLGSDKTPVAADISSEVWKDLWPIER  419

Query  375   RRQREFFCFGMDILLKLDLPATRRFFDAFFDLEPRYWHGFLSSRLFLRELIFFGLSLFSH  196
             RRQREFFCFGMDILLKLDL ATRRFFD FF+LEPRYWHGFLSSRLFL EL+ FGLSLFSH
Sbjct  420   RRQREFFCFGMDILLKLDLDATRRFFDTFFNLEPRYWHGFLSSRLFLPELVLFGLSLFSH  479

Query  195   ASNTSRLEIMTKGTLPLVNMINNLLQD  115
             ASNTSR EIMTKGTLPLVNMINNLLQD
Sbjct  480   ASNTSRFEIMTKGTLPLVNMINNLLQD  506



>gb|ABB52071.1| putative lycopene beta cyclase [Daucus carota subsp. sativus]
Length=508

 Score =   833 bits (2153),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 420/505 (83%), Positives = 461/505 (91%), Gaps = 4/505 (1%)
 Frame = -2

Query  1617  RVMDTLLKTPNELEFLHPHHGFAVKASAFTSLKPQKQEIRIGSWKACRNVGR---VKASS  1447
             +VMDTLLKT N+LEF +P HGF  K    + LK + QE+R GS ++  N G+   VKASS
Sbjct  2     KVMDTLLKTHNKLEFFNPIHGFPDKVGTLSCLKFRNQELRFGSRRSNVNWGKNGSVKASS  61

Query  1446  SALLELVPVTKKENLDFELPMFEPSKGIvvdlavvgggpaglavaqqVSQAGLSVCSIDP  1267
             SALLELV  TKKENL+F+LP+++PS G+VVDLAVVGGGPAGLAVAQQVS+AGL+V SIDP
Sbjct  62    SALLELVQETKKENLEFDLPLYDPSNGLVVDLAVVGGGPAGLAVAQQVSEAGLAVVSIDP  121

Query  1266  SPKLIWPNNYGVWVDEFEAMDLLDCLDTTWSGAMVYIDDRTTKDLDRPYGRVNRKKLKSK  1087
             SPKLIWPNNYGVWVDEFEAMDLLDCLDTTWS A+VYIDD+TTK+L RPYGRVNRK+LKSK
Sbjct  122   SPKLIWPNNYGVWVDEFEAMDLLDCLDTTWSSAIVYIDDQTTKELGRPYGRVNRKQLKSK  181

Query  1086  MMQKCITNGVKFHQAKVIKVIHEESKSMLICSDGVTIQATVVLDATGFSRCLVQYDKPYN  907
             MMQKCI+NGVKFHQAKV+KV+HEE+KS+LIC DGVTIQA VVLDATGFSRCLVQYDKPYN
Sbjct  182   MMQKCISNGVKFHQAKVVKVVHEEAKSLLICDDGVTIQAAVVLDATGFSRCLVQYDKPYN  241

Query  906   PGYQVAYGILAEVEEHPYDLNKMVFMDWRDSHLNSNLELKERNKRIPTFLYAMPFSSTRI  727
             PGYQVAYGI+AEVEEHP+D+NKM+FMDWRDSHLN N ELKERN +IPTFLYAMPFSS RI
Sbjct  242   PGYQVAYGIVAEVEEHPFDVNKMIFMDWRDSHLNGNTELKERNSKIPTFLYAMPFSSDRI  301

Query  726   FLEETSLVARPGLDMKDIQERMVARLRHLGINVKSIEEDERCVIPMGGPLPVIPQRVVGI  547
             FLEETSLVARPGL M DIQERMVARLRHLGI VKSIEEDERCVIPMGGPLPV+PQRVVGI
Sbjct  302   FLEETSLVARPGLAMGDIQERMVARLRHLGIKVKSIEEDERCVIPMGGPLPVLPQRVVGI  361

Query  546   GGTAGMVHPSTGYMVARTLAAAPVVANAIIQYL-GSERSLLGNELSASVWKDLWPIERRR  370
             GGTAGMVHPSTGYMVARTLAAAPVVANAI+QYL GS++  LGNELSA VWKDLWPIERRR
Sbjct  362   GGTAGMVHPSTGYMVARTLAAAPVVANAIVQYLGGSKKGALGNELSAEVWKDLWPIERRR  421

Query  369   QREFFCFGMDILLKLDLPATRRFFDAFFDLEPRYWHGFLSSRLFLRELIFFGLSLFSHAS  190
             QREFFCFGMDILLKLDLP TRRFF AFFDLEPRYWHGFLSSRLFL EL FFGLSLFS+AS
Sbjct  422   QREFFCFGMDILLKLDLPGTRRFFSAFFDLEPRYWHGFLSSRLFLPELFFFGLSLFSNAS  481

Query  189   NTSRLEIMTKGTLPLVNMINNLLQD  115
             NTSR+EIM KGT+PLVNM+NNL++D
Sbjct  482   NTSRIEIMAKGTVPLVNMVNNLIKD  506



>ref|XP_011027292.1| PREDICTED: lycopene beta cyclase, chloroplastic/chromoplastic-like 
[Populus euphratica]
Length=504

 Score =   831 bits (2146),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 422/502 (84%), Positives = 457/502 (91%), Gaps = 3/502 (1%)
 Frame = -2

Query  1611  MDTLLKTPNELEFLHPHHGFAVKASAFTSLKPQKQEIRIGSWKACRNVGR---VKASSSA  1441
             MDTLLKT N++ FL   HGF  K S  +SLK Q QE+  G  K     GR   V+ASSSA
Sbjct  1     MDTLLKTHNKIAFLSQFHGFLEKVSNSSSLKIQIQELGFGPKKFFSKGGRNGCVEASSSA  60

Query  1440  LLELVPVTKKENLDFELPMFEPSKGIvvdlavvgggpaglavaqqVSQAGLSVCSIDPSP  1261
             LLELVP TKKENL+F+LPM++PSKG+VVDLAVVGGGPAGLAVAQQVS+AGLSV SIDPSP
Sbjct  61    LLELVPETKKENLEFDLPMYDPSKGLVVDLAVVGGGPAGLAVAQQVSEAGLSVISIDPSP  120

Query  1260  KLIWPNNYGVWVDEFEAMDLLDCLDTTWSGAMVYIDDRTTKDLDRPYGRVNRKKLKSKMM  1081
             +LIWPNNYGVWVDEF+AMDLLDCLDTTWSGA+VY++D+T K LDRPYGRVNRK LKSKM+
Sbjct  121   QLIWPNNYGVWVDEFDAMDLLDCLDTTWSGAVVYVNDKTKKGLDRPYGRVNRKLLKSKML  180

Query  1080  QKCITNGVKFHQAKVIKVIHEESKSMLICSDGVTIQATVVLDATGFSRCLVQYDKPYNPG  901
             QKCI+NGVKFHQAKVIKVIHEESKS+LIC+DGVTIQA VVLDATGFSRCLVQYDKPYNPG
Sbjct  181   QKCISNGVKFHQAKVIKVIHEESKSLLICNDGVTIQAVVVLDATGFSRCLVQYDKPYNPG  240

Query  900   YQVAYGILAEVEEHPYDLNKMVFMDWRDSHLNSNLELKERNKRIPTFLYAMPFSSTRIFL  721
             YQVAYGILAEVEEHP+D++KMVFMDWRDSHLN+NLELKERN + PTFLYAMPFSS RIFL
Sbjct  241   YQVAYGILAEVEEHPFDVDKMVFMDWRDSHLNNNLELKERNSKTPTFLYAMPFSSDRIFL  300

Query  720   EETSLVARPGLDMKDIQERMVARLRHLGINVKSIEEDERCVIPMGGPLPVIPQRVVGIGG  541
             EETSLVARPG+ MKDIQERMVARLRHLGI VKSIEEDERCVIPMGGPLPV+PQRVVGIGG
Sbjct  301   EETSLVARPGVPMKDIQERMVARLRHLGIKVKSIEEDERCVIPMGGPLPVLPQRVVGIGG  360

Query  540   TAGMVHPSTGYMVARTLAAAPVVANAIIQYLGSERSLLGNELSASVWKDLWPIERRRQRE  361
             TAGMVHPSTGYMVARTLAAAP+VAN+I+QYLGS+RS  G+ELSA VWKDLWPIERRRQRE
Sbjct  361   TAGMVHPSTGYMVARTLAAAPIVANSIVQYLGSDRSFSGSELSAKVWKDLWPIERRRQRE  420

Query  360   FFCFGMDILLKLDLPATRRFFDAFFDLEPRYWHGFLSSRLFLRELIFFGLSLFSHASNTS  181
             FFCFGMDILL LDLPATRRFFDAFFDLEP YWHGFLSSRLFL EL+ FGLSLFS ASNTS
Sbjct  421   FFCFGMDILLTLDLPATRRFFDAFFDLEPHYWHGFLSSRLFLPELVLFGLSLFSRASNTS  480

Query  180   RLEIMTKGTLPLVNMINNLLQD  115
             RLEIM KGTLPLVNM NNL+QD
Sbjct  481   RLEIMAKGTLPLVNMANNLIQD  502



>gb|ABF69942.1| lycopene beta-cyclase allozyme 2 [Citrus sinensis]
 gb|ABF69944.1| lycopene beta-cyclase allozyme 2 [Citrus sinensis]
 gb|AEQ29516.1| lycopene beta cyclase [Citrus x paradisi]
Length=504

 Score =   829 bits (2142),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 429/504 (85%), Positives = 464/504 (92%), Gaps = 3/504 (1%)
 Frame = -2

Query  1611  MDTLLKTPNELEFLHPHHGFAVKASAFTSLKPQKQEIRIGSWKACRNVGR---VKASSSA  1441
             MDTLLKT N+LEFL   HG   K+S+ +SLK Q QE+R G  K+ +   R   +KASSSA
Sbjct  1     MDTLLKTHNKLEFLPQVHGALEKSSSLSSLKIQNQELRFGLKKSRQKRNRSCFIKASSSA  60

Query  1440  LLELVPVTKKENLDFELPMFEPSKGIvvdlavvgggpaglavaqqVSQAGLSVCSIDPSP  1261
             LLELVP TKKENL+FELPM++PSKG+VVDLAVVGGGPAGLAVAQQVS+AGLSVCSIDPSP
Sbjct  61    LLELVPETKKENLEFELPMYDPSKGLVVDLAVVGGGPAGLAVAQQVSEAGLSVCSIDPSP  120

Query  1260  KLIWPNNYGVWVDEFEAMDLLDCLDTTWSGAMVYIDDRTTKDLDRPYGRVNRKKLKSKMM  1081
             KLIWPNNYGVWVDEFEAMDLLDCLDTTWSGA+V+IDD T KDL+RPYGRVNRK LKSKM+
Sbjct  121   KLIWPNNYGVWVDEFEAMDLLDCLDTTWSGAVVHIDDNTKKDLNRPYGRVNRKLLKSKML  180

Query  1080  QKCITNGVKFHQAKVIKVIHEESKSMLICSDGVTIQATVVLDATGFSRCLVQYDKPYNPG  901
             QKCITNGVKFHQAKVIKVIHEESKS+LIC+DGVTIQA VVLDATGFSRCLVQYDKPYNPG
Sbjct  181   QKCITNGVKFHQAKVIKVIHEESKSLLICNDGVTIQAAVVLDATGFSRCLVQYDKPYNPG  240

Query  900   YQVAYGILAEVEEHPYDLNKMVFMDWRDSHLNSNLELKERNKRIPTFLYAMPFSSTRIFL  721
             YQVAYGILAEVEEHP+DL+KMVFMDWRDSHLN+N ELKE N +IPTFLYAMPFSS RIFL
Sbjct  241   YQVAYGILAEVEEHPFDLDKMVFMDWRDSHLNNNSELKEANSKIPTFLYAMPFSSNRIFL  300

Query  720   EETSLVARPGLDMKDIQERMVARLRHLGINVKSIEEDERCVIPMGGPLPVIPQRVVGIGG  541
             EETSLVARPG+ MKDIQERMVARL+HLGI VKSIEEDE CVIPMGGPLPV+PQRVVGIGG
Sbjct  301   EETSLVARPGVPMKDIQERMVARLKHLGIKVKSIEEDEHCVIPMGGPLPVLPQRVVGIGG  360

Query  540   TAGMVHPSTGYMVARTLAAAPVVANAIIQYLGSERSLLGNELSASVWKDLWPIERRRQRE  361
             TAGMVHPSTGYMVARTLAAAP+VANAI++ L S+RS+ G++LSA VWKDLWPIERRRQRE
Sbjct  361   TAGMVHPSTGYMVARTLAAAPIVANAIVRSLSSDRSISGHKLSAEVWKDLWPIERRRQRE  420

Query  360   FFCFGMDILLKLDLPATRRFFDAFFDLEPRYWHGFLSSRLFLRELIFFGLSLFSHASNTS  181
             FFCFGMDILLKLDLPATRRFFDAFFDLEPRYWHGFLSSRLFL EL+ FGLSLFSHASNTS
Sbjct  421   FFCFGMDILLKLDLPATRRFFDAFFDLEPRYWHGFLSSRLFLPELLVFGLSLFSHASNTS  480

Query  180   RLEIMTKGTLPLVNMINNLLQDID  109
             RLEIM KGTLPLVNMINNL+QD D
Sbjct  481   RLEIMAKGTLPLVNMINNLVQDTD  504



>gb|AAM21152.1| lycopene beta-cyclase [Citrus sinensis]
Length=504

 Score =   829 bits (2141),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 428/504 (85%), Positives = 464/504 (92%), Gaps = 3/504 (1%)
 Frame = -2

Query  1611  MDTLLKTPNELEFLHPHHGFAVKASAFTSLKPQKQEIRIGSWKACRNVGR---VKASSSA  1441
             MDTLLKT N+LEFL   HG   K+S+ +SLK Q QE++ G  K+ +   R   +KASSSA
Sbjct  1     MDTLLKTHNKLEFLPQVHGALEKSSSLSSLKIQNQELKFGLKKSRQKRNRSCFIKASSSA  60

Query  1440  LLELVPVTKKENLDFELPMFEPSKGIvvdlavvgggpaglavaqqVSQAGLSVCSIDPSP  1261
             LLELVP TKKENL+FELPM++PSKG+VVDLAVVGGGPAGLAVAQQVS+AGLSVCSIDPSP
Sbjct  61    LLELVPETKKENLEFELPMYDPSKGLVVDLAVVGGGPAGLAVAQQVSEAGLSVCSIDPSP  120

Query  1260  KLIWPNNYGVWVDEFEAMDLLDCLDTTWSGAMVYIDDRTTKDLDRPYGRVNRKKLKSKMM  1081
             KLIWPNNYGVWVDEFEAMDLLDCLDTTWSGA+V+IDD T KDLDRPYGRVNRK LKSKM+
Sbjct  121   KLIWPNNYGVWVDEFEAMDLLDCLDTTWSGAVVHIDDNTKKDLDRPYGRVNRKLLKSKML  180

Query  1080  QKCITNGVKFHQAKVIKVIHEESKSMLICSDGVTIQATVVLDATGFSRCLVQYDKPYNPG  901
             QKCITNGVKFHQAKVIKVIHEESKS+LIC+DGVTIQA VVLDATGFSRCLVQYDKPYNPG
Sbjct  181   QKCITNGVKFHQAKVIKVIHEESKSLLICNDGVTIQAAVVLDATGFSRCLVQYDKPYNPG  240

Query  900   YQVAYGILAEVEEHPYDLNKMVFMDWRDSHLNSNLELKERNKRIPTFLYAMPFSSTRIFL  721
             YQVAYGILAEVEEHP+DL+KMVFMDWRDSHLN+N ELKE N +IPTFLYAMPFSS RIFL
Sbjct  241   YQVAYGILAEVEEHPFDLDKMVFMDWRDSHLNNNSELKEANSKIPTFLYAMPFSSNRIFL  300

Query  720   EETSLVARPGLDMKDIQERMVARLRHLGINVKSIEEDERCVIPMGGPLPVIPQRVVGIGG  541
             EETSLVARPG+ MKDIQERMVARL+HLGI V+SIEEDE CVIPMGGPLPV+PQRVVGIGG
Sbjct  301   EETSLVARPGVPMKDIQERMVARLKHLGIKVRSIEEDEHCVIPMGGPLPVLPQRVVGIGG  360

Query  540   TAGMVHPSTGYMVARTLAAAPVVANAIIQYLGSERSLLGNELSASVWKDLWPIERRRQRE  361
             TAGMVHPSTGYMVARTLAAAP+VANAI++ L S+RS+ G++LSA VWKDLWPIERRRQRE
Sbjct  361   TAGMVHPSTGYMVARTLAAAPIVANAIVRSLSSDRSISGHKLSAEVWKDLWPIERRRQRE  420

Query  360   FFCFGMDILLKLDLPATRRFFDAFFDLEPRYWHGFLSSRLFLRELIFFGLSLFSHASNTS  181
             FFCFGMDILLKLDLPATRRFFDAFFDLEPRYWHGFLSSRLFL EL+ FGLSLFSHASNTS
Sbjct  421   FFCFGMDILLKLDLPATRRFFDAFFDLEPRYWHGFLSSRLFLPELLVFGLSLFSHASNTS  480

Query  180   RLEIMTKGTLPLVNMINNLLQDID  109
             RLEIM KGTLPLVNMINNL+QD D
Sbjct  481   RLEIMAKGTLPLVNMINNLVQDTD  504



>gb|AAR89632.1| lycopene-beta-cyclase [Citrus maxima]
Length=504

 Score =   828 bits (2140),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 430/504 (85%), Positives = 465/504 (92%), Gaps = 3/504 (1%)
 Frame = -2

Query  1611  MDTLLKTPNELEFLHPHHGFAVKASAFTSLKPQKQEIRIGSWKA--CRNVG-RVKASSSA  1441
             MDT+LKT N+LEFL   HG   K+S+ +SLK Q QE+R G  K+   RN+   +KASSSA
Sbjct  1     MDTVLKTHNKLEFLPQVHGALEKSSSLSSLKIQNQELRFGLKKSRQKRNMSCFIKASSSA  60

Query  1440  LLELVPVTKKENLDFELPMFEPSKGIvvdlavvgggpaglavaqqVSQAGLSVCSIDPSP  1261
             LLELVP TKKENL+FELPM++PSKG+VVDLAVVGGGPAGLAVAQQVS+AGLSVCSIDPSP
Sbjct  61    LLELVPETKKENLEFELPMYDPSKGLVVDLAVVGGGPAGLAVAQQVSEAGLSVCSIDPSP  120

Query  1260  KLIWPNNYGVWVDEFEAMDLLDCLDTTWSGAMVYIDDRTTKDLDRPYGRVNRKKLKSKMM  1081
             KLIWPNNYGVWVDEFEAMDLLDCLDTTWSGA+V+IDD T KDLDRPYGRVNRK LKSKM+
Sbjct  121   KLIWPNNYGVWVDEFEAMDLLDCLDTTWSGAVVHIDDNTKKDLDRPYGRVNRKLLKSKML  180

Query  1080  QKCITNGVKFHQAKVIKVIHEESKSMLICSDGVTIQATVVLDATGFSRCLVQYDKPYNPG  901
             QKCITNGVKFHQAKVIKVIHEESKS+LIC+DGVTIQA VVLDATGFSRCLVQYDKPYNPG
Sbjct  181   QKCITNGVKFHQAKVIKVIHEESKSLLICNDGVTIQAAVVLDATGFSRCLVQYDKPYNPG  240

Query  900   YQVAYGILAEVEEHPYDLNKMVFMDWRDSHLNSNLELKERNKRIPTFLYAMPFSSTRIFL  721
             YQVAYGILAEVEEHP+DL+KMVFMDWRDSHLN+N ELKE N +IPTFLYAMPFSS RIFL
Sbjct  241   YQVAYGILAEVEEHPFDLDKMVFMDWRDSHLNNNSELKEANSKIPTFLYAMPFSSNRIFL  300

Query  720   EETSLVARPGLDMKDIQERMVARLRHLGINVKSIEEDERCVIPMGGPLPVIPQRVVGIGG  541
             EETSLVARPG+ MKDIQERMVARL+HLGI VKSIEEDE CVIPMGGPLPV+PQRVVGIGG
Sbjct  301   EETSLVARPGVPMKDIQERMVARLKHLGIKVKSIEEDEHCVIPMGGPLPVLPQRVVGIGG  360

Query  540   TAGMVHPSTGYMVARTLAAAPVVANAIIQYLGSERSLLGNELSASVWKDLWPIERRRQRE  361
             TAGMVHPSTGYMVARTLAAAP+VANAI++ L S+RS+ G++LSA VWKDLWPIERRRQRE
Sbjct  361   TAGMVHPSTGYMVARTLAAAPIVANAIVRSLSSDRSISGHKLSAEVWKDLWPIERRRQRE  420

Query  360   FFCFGMDILLKLDLPATRRFFDAFFDLEPRYWHGFLSSRLFLRELIFFGLSLFSHASNTS  181
             FFCFGMDILLKLDLPATRRFFDAFFDLEPRYWHGFLSSRLFL EL+ FGLSLFSHASNTS
Sbjct  421   FFCFGMDILLKLDLPATRRFFDAFFDLEPRYWHGFLSSRLFLPELLVFGLSLFSHASNTS  480

Query  180   RLEIMTKGTLPLVNMINNLLQDID  109
             RLEIM KGTLPLVNMINNL+QD D
Sbjct  481   RLEIMAKGTLPLVNMINNLVQDTD  504



>gb|AAU05146.1| lycopene beta-cyclase [Citrus sinensis]
Length=504

 Score =   828 bits (2139),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 429/504 (85%), Positives = 463/504 (92%), Gaps = 3/504 (1%)
 Frame = -2

Query  1611  MDTLLKTPNELEFLHPHHGFAVKASAFTSLKPQKQEIRIGSWKACRNVGR---VKASSSA  1441
             MDTLLKT N+LEFL   HG   K+S+ +SLK Q QE+R G  K+ +   R   +KASSSA
Sbjct  1     MDTLLKTHNKLEFLPQVHGALEKSSSLSSLKIQNQELRFGLKKSRQKRNRSCFIKASSSA  60

Query  1440  LLELVPVTKKENLDFELPMFEPSKGIvvdlavvgggpaglavaqqVSQAGLSVCSIDPSP  1261
             LLELVP TKKENL+FELPM++PSKG+VVDLAVVGGGPAGLAVAQQVS+AGLSVCSIDPSP
Sbjct  61    LLELVPETKKENLEFELPMYDPSKGLVVDLAVVGGGPAGLAVAQQVSEAGLSVCSIDPSP  120

Query  1260  KLIWPNNYGVWVDEFEAMDLLDCLDTTWSGAMVYIDDRTTKDLDRPYGRVNRKKLKSKMM  1081
             KLIWPNNYGVWVDEFEAMDLLDCLDTTWSGA+V+IDD T KDL+RPYGRVNRK LKSKM+
Sbjct  121   KLIWPNNYGVWVDEFEAMDLLDCLDTTWSGAVVHIDDNTKKDLNRPYGRVNRKLLKSKML  180

Query  1080  QKCITNGVKFHQAKVIKVIHEESKSMLICSDGVTIQATVVLDATGFSRCLVQYDKPYNPG  901
             QKCITNGVKFHQAKVIKVIHEESKS+LIC+DGVTIQA VVLDATGFSRCLVQYDKPYNPG
Sbjct  181   QKCITNGVKFHQAKVIKVIHEESKSLLICNDGVTIQAAVVLDATGFSRCLVQYDKPYNPG  240

Query  900   YQVAYGILAEVEEHPYDLNKMVFMDWRDSHLNSNLELKERNKRIPTFLYAMPFSSTRIFL  721
             YQVAYGILAEVEEHP+DL+KMVFMDWRDSHLN+N ELKE N +IPTFLYAMPFSS RIFL
Sbjct  241   YQVAYGILAEVEEHPFDLDKMVFMDWRDSHLNNNSELKEANSKIPTFLYAMPFSSNRIFL  300

Query  720   EETSLVARPGLDMKDIQERMVARLRHLGINVKSIEEDERCVIPMGGPLPVIPQRVVGIGG  541
             EETSLVARPG+ MKDIQERMVARL HLGI VKSIEEDE CVIPMGGPLPV+PQRVVGIGG
Sbjct  301   EETSLVARPGVPMKDIQERMVARLEHLGIKVKSIEEDEHCVIPMGGPLPVLPQRVVGIGG  360

Query  540   TAGMVHPSTGYMVARTLAAAPVVANAIIQYLGSERSLLGNELSASVWKDLWPIERRRQRE  361
             TAGMVHPSTGYMVARTLAAAP+VANAI++ L S+RS+ G++LSA VWKDLWPIERRRQRE
Sbjct  361   TAGMVHPSTGYMVARTLAAAPIVANAIVRSLNSDRSISGHKLSAEVWKDLWPIERRRQRE  420

Query  360   FFCFGMDILLKLDLPATRRFFDAFFDLEPRYWHGFLSSRLFLRELIFFGLSLFSHASNTS  181
             FFCFGMDILLKLDLPATRRFFDAFFDLEPRYWHGFLSSRLFL EL+ FGLSLFSHASNTS
Sbjct  421   FFCFGMDILLKLDLPATRRFFDAFFDLEPRYWHGFLSSRLFLPELLVFGLSLFSHASNTS  480

Query  180   RLEIMTKGTLPLVNMINNLLQDID  109
             RLEIM KGTLPLVNMINNL+QD D
Sbjct  481   RLEIMAKGTLPLVNMINNLVQDTD  504



>gb|AAU05145.1| lycopene beta-cyclase [Citrus sinensis]
Length=504

 Score =   828 bits (2138),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 428/504 (85%), Positives = 462/504 (92%), Gaps = 3/504 (1%)
 Frame = -2

Query  1611  MDTLLKTPNELEFLHPHHGFAVKASAFTSLKPQKQEIRIGSWKACRNVGR---VKASSSA  1441
             MDTLLKT N+LEFL   HG   K+S+ +SLK Q QE+R G  K+ +   R   +KASSSA
Sbjct  1     MDTLLKTHNKLEFLPQVHGALEKSSSLSSLKIQNQELRFGLKKSRQKRNRSCFIKASSSA  60

Query  1440  LLELVPVTKKENLDFELPMFEPSKGIvvdlavvgggpaglavaqqVSQAGLSVCSIDPSP  1261
             LLELVP TKKENL+FELPM++PSKG+VVDLAVVGGGPAGLAVAQQVS AGLSVCSIDPSP
Sbjct  61    LLELVPETKKENLEFELPMYDPSKGLVVDLAVVGGGPAGLAVAQQVSAAGLSVCSIDPSP  120

Query  1260  KLIWPNNYGVWVDEFEAMDLLDCLDTTWSGAMVYIDDRTTKDLDRPYGRVNRKKLKSKMM  1081
             KLIWPNNYGVWVDEFEAMDLLDCLDTTWSGA+V+IDD T KDLDRPYGRVNRK LKSKM+
Sbjct  121   KLIWPNNYGVWVDEFEAMDLLDCLDTTWSGAVVHIDDNTKKDLDRPYGRVNRKLLKSKML  180

Query  1080  QKCITNGVKFHQAKVIKVIHEESKSMLICSDGVTIQATVVLDATGFSRCLVQYDKPYNPG  901
             QKCITNGVKFHQAKVIKVIHEESKS+LIC+DGVTIQA VVLDATGFSRCLVQYDKPYNPG
Sbjct  181   QKCITNGVKFHQAKVIKVIHEESKSLLICNDGVTIQAAVVLDATGFSRCLVQYDKPYNPG  240

Query  900   YQVAYGILAEVEEHPYDLNKMVFMDWRDSHLNSNLELKERNKRIPTFLYAMPFSSTRIFL  721
             YQVAYGILAEVEEHP+DL+KMVFMDWRDSHLN+N ELKE N +IPTFLYAMPFSS RIFL
Sbjct  241   YQVAYGILAEVEEHPFDLDKMVFMDWRDSHLNNNSELKEANSKIPTFLYAMPFSSNRIFL  300

Query  720   EETSLVARPGLDMKDIQERMVARLRHLGINVKSIEEDERCVIPMGGPLPVIPQRVVGIGG  541
             EETSLVARPG+ MKDIQERMVARL+HLGI V+ IEEDE CVIPMGGPLPV+PQRVVGIGG
Sbjct  301   EETSLVARPGVPMKDIQERMVARLKHLGIKVRGIEEDEHCVIPMGGPLPVLPQRVVGIGG  360

Query  540   TAGMVHPSTGYMVARTLAAAPVVANAIIQYLGSERSLLGNELSASVWKDLWPIERRRQRE  361
             TAGMVHPSTGYMVARTLAAAP+VANAI++ L S+RS+ G++LSA VWKDLWPIERRRQRE
Sbjct  361   TAGMVHPSTGYMVARTLAAAPIVANAIVRSLNSDRSISGHKLSAEVWKDLWPIERRRQRE  420

Query  360   FFCFGMDILLKLDLPATRRFFDAFFDLEPRYWHGFLSSRLFLRELIFFGLSLFSHASNTS  181
             FFCFGMDILLKLDLPATRRFFDAFFDLEPRYWHGFLSSRLFL EL+ FGLSLFSHASNTS
Sbjct  421   FFCFGMDILLKLDLPATRRFFDAFFDLEPRYWHGFLSSRLFLPELLVFGLSLFSHASNTS  480

Query  180   RLEIMTKGTLPLVNMINNLLQDID  109
             RLEIM KGTLPLVNMINNL+QD D
Sbjct  481   RLEIMAKGTLPLVNMINNLVQDTD  504



>gb|ACR25158.1| lycopene beta-cyclase [Diospyros kaki]
Length=504

 Score =   827 bits (2137),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 418/502 (83%), Positives = 457/502 (91%), Gaps = 3/502 (1%)
 Frame = -2

Query  1611  MDTLLKTPNELEFLHPHHGFAVKASAFTSLKPQKQEIRIGSWK---ACRNVGRVKASSSA  1441
             MDTLLKT N+LEFLHP HGF  +AS  + LK Q QE R G  K     R  G VKASS+A
Sbjct  1     MDTLLKTHNKLEFLHPLHGFVDRASTSSHLKLQSQEPRFGPRKPNLKWRKNGSVKASSAA  60

Query  1440  LLELVPVTKKENLDFELPMFEPSKGIvvdlavvgggpaglavaqqVSQAGLSVCSIDPSP  1261
             LLELVP TKKENLDFELP+++PSK +VVDLAVVGGGPAGLAVAQQVS+AGLSVCSIDPSP
Sbjct  61    LLELVPATKKENLDFELPLYDPSKDLVVDLAVVGGGPAGLAVAQQVSEAGLSVCSIDPSP  120

Query  1260  KLIWPNNYGVWVDEFEAMDLLDCLDTTWSGAMVYIDDRTTKDLDRPYGRVNRKKLKSKMM  1081
             K+IWPNNYGVWVDEFEAMDLLDCLDTTWSGA+VYIDD++TKDL+RPYGRVNRK+LKSKMM
Sbjct  121   KVIWPNNYGVWVDEFEAMDLLDCLDTTWSGAVVYIDDQSTKDLNRPYGRVNRKQLKSKMM  180

Query  1080  QKCITNGVKFHQAKVIKVIHEESKSMLICSDGVTIQATVVLDATGFSRCLVQYDKPYNPG  901
              KCI NGVKFHQAKVIKVIHEE+KS+LIC+DG+T+QA+VVLDATGFSRCLVQYDKPYNPG
Sbjct  181   HKCILNGVKFHQAKVIKVIHEETKSLLICNDGITVQASVVLDATGFSRCLVQYDKPYNPG  240

Query  900   YQVAYGILAEVEEHPYDLNKMVFMDWRDSHLNSNLELKERNKRIPTFLYAMPFSSTRIFL  721
             YQVAYGILAEVEEHP+D++KMVFMDWRDSHL +N +LKERN RIPTFLYAMPFSS RIFL
Sbjct  241   YQVAYGILAEVEEHPFDVDKMVFMDWRDSHLKNNTQLKERNSRIPTFLYAMPFSSDRIFL  300

Query  720   EETSLVARPGLDMKDIQERMVARLRHLGINVKSIEEDERCVIPMGGPLPVIPQRVVGIGG  541
             EETSLVARPG+ ++DIQERMVARLRHLGI VKSIEEDE CVIPMGGPLPV+PQRV GIGG
Sbjct  301   EETSLVARPGVPVEDIQERMVARLRHLGIKVKSIEEDEHCVIPMGGPLPVLPQRVAGIGG  360

Query  540   TAGMVHPSTGYMVARTLAAAPVVANAIIQYLGSERSLLGNELSASVWKDLWPIERRRQRE  361
             TAGMVHPSTGYMVARTLAAAP+VAN+I+QYLGS R L GN LS+ VWKDLWPI+RRRQRE
Sbjct  361   TAGMVHPSTGYMVARTLAAAPIVANSIVQYLGSGRHLSGNGLSSLVWKDLWPIQRRRQRE  420

Query  360   FFCFGMDILLKLDLPATRRFFDAFFDLEPRYWHGFLSSRLFLRELIFFGLSLFSHASNTS  181
             FFCFGMDILLKLDL ATRRFFDAFFDLEPRYWHGFLSSRLFL + + FGLSLFSHASNTS
Sbjct  421   FFCFGMDILLKLDLQATRRFFDAFFDLEPRYWHGFLSSRLFLPDPLLFGLSLFSHASNTS  480

Query  180   RLEIMTKGTLPLVNMINNLLQD  115
             RLEIM KGT+PLV MINNL+ D
Sbjct  481   RLEIMAKGTVPLVKMINNLVYD  502



>ref|XP_010273228.1| PREDICTED: lycopene beta cyclase, chloroplastic/chromoplastic 
[Nelumbo nucifera]
Length=504

 Score =   827 bits (2137),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 415/505 (82%), Positives = 465/505 (92%), Gaps = 5/505 (1%)
 Frame = -2

Query  1611  MDTLLKTPNELEFLHPHHGFAVKASAFTSLKPQKQEIRIGSWKA----CRNVGRVKASSS  1444
             M TLL+T  +LE+LHP HG A K +  +S K Q+Q++ + S +A    CRN G ++AS+S
Sbjct  1     MGTLLRTHYKLEYLHPLHGVAQKQNPLSSSKLQRQDVELRSRRAHRKWCRN-GCIRASNS  59

Query  1443  ALLELVPVTKKENLDFELPMFEPSKGIvvdlavvgggpaglavaqqVSQAGLSVCSIDPS  1264
             ALLELVP TKKENL+FELPM++PSKG+VVDLAVVGGGPAGLAVAQQVS+AGLSVCSIDPS
Sbjct  60    ALLELVPETKKENLEFELPMYDPSKGVVVDLAVVGGGPAGLAVAQQVSEAGLSVCSIDPS  119

Query  1263  PKLIWPNNYGVWVDEFEAMDLLDCLDTTWSGAMVYIDDRTTKDLDRPYGRVNRKKLKSKM  1084
             P++IWPNNYGVWVDEFEAMDLLDCLDTTW GA+V+IDD++ K LDRPYGRVNRK+LKSKM
Sbjct  120   PRVIWPNNYGVWVDEFEAMDLLDCLDTTWPGAVVFIDDQSRKYLDRPYGRVNRKQLKSKM  179

Query  1083  MQKCITNGVKFHQAKVIKVIHEESKSMLICSDGVTIQATVVLDATGFSRCLVQYDKPYNP  904
             MQKCI+NGVKF+QAKVIKVIHEESKS+LIC+DGV IQAT+VLDATGFSRCLVQYDKPYNP
Sbjct  180   MQKCISNGVKFYQAKVIKVIHEESKSLLICNDGVIIQATIVLDATGFSRCLVQYDKPYNP  239

Query  903   GYQVAYGILAEVEEHPYDLNKMVFMDWRDSHLNSNLELKERNKRIPTFLYAMPFSSTRIF  724
             GYQVAYGILAEVEEHP+DL+KMVFMDWRDSHLN   ELKE+N ++PTFLYAMPFSS RIF
Sbjct  240   GYQVAYGILAEVEEHPFDLDKMVFMDWRDSHLNDKKELKEKNSQVPTFLYAMPFSSKRIF  299

Query  723   LEETSLVARPGLDMKDIQERMVARLRHLGINVKSIEEDERCVIPMGGPLPVIPQRVVGIG  544
             LEETSLVARPG+ M+DIQERMVARL+HLGI VKSIEEDERCVIPMGGPLPV+PQRVVGIG
Sbjct  300   LEETSLVARPGVAMEDIQERMVARLKHLGIKVKSIEEDERCVIPMGGPLPVLPQRVVGIG  359

Query  543   GTAGMVHPSTGYMVARTLAAAPVVANAIIQYLGSERSLLGNELSASVWKDLWPIERRRQR  364
             GTAGMVHPSTGYMVARTLAAAP+VA +I+QY+GSE+ +LGN+LSA VWKDLWPIERRRQR
Sbjct  360   GTAGMVHPSTGYMVARTLAAAPIVAKSIVQYIGSEQGILGNDLSAEVWKDLWPIERRRQR  419

Query  363   EFFCFGMDILLKLDLPATRRFFDAFFDLEPRYWHGFLSSRLFLRELIFFGLSLFSHASNT  184
             EFFCFGMDILLKLDL +TRRFFDAFFDLEP YWHGFLSSRLFL ELIFFGLSLFSHASNT
Sbjct  420   EFFCFGMDILLKLDLQSTRRFFDAFFDLEPHYWHGFLSSRLFLPELIFFGLSLFSHASNT  479

Query  183   SRLEIMTKGTLPLVNMINNLLQDID  109
             SR+EIM KGTLPLVNMI+NL+QD D
Sbjct  480   SRIEIMAKGTLPLVNMISNLVQDRD  504



>ref|XP_006421272.1| hypothetical protein CICLE_v10004730mg [Citrus clementina]
 gb|ESR34512.1| hypothetical protein CICLE_v10004730mg [Citrus clementina]
Length=524

 Score =   828 bits (2138),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 429/506 (85%), Positives = 466/506 (92%), Gaps = 3/506 (1%)
 Frame = -2

Query  1617  RVMDTLLKTPNELEFLHPHHGFAVKASAFTSLKPQKQEIRIGSWKA--CRNVG-RVKASS  1447
             + MDT+LKT N+LEFL   HG   K+S+ +SLK Q QE+R G  K+   RN+   +KASS
Sbjct  19    KAMDTVLKTHNKLEFLPQVHGALEKSSSLSSLKIQNQELRFGLKKSRQKRNMSCFIKASS  78

Query  1446  SALLELVPVTKKENLDFELPMFEPSKGIvvdlavvgggpaglavaqqVSQAGLSVCSIDP  1267
             SALLELVP TKKENL+FELPM++PSKG+VVDLAVVGGGPAGLAVAQQVS+AGLSVCSIDP
Sbjct  79    SALLELVPETKKENLEFELPMYDPSKGLVVDLAVVGGGPAGLAVAQQVSEAGLSVCSIDP  138

Query  1266  SPKLIWPNNYGVWVDEFEAMDLLDCLDTTWSGAMVYIDDRTTKDLDRPYGRVNRKKLKSK  1087
             SPKLIWPNNYGVWVDEFEAMDLLDCLDTTWSGA+V+IDD T KDLDRPYGRVNRK LKSK
Sbjct  139   SPKLIWPNNYGVWVDEFEAMDLLDCLDTTWSGAVVHIDDNTKKDLDRPYGRVNRKLLKSK  198

Query  1086  MMQKCITNGVKFHQAKVIKVIHEESKSMLICSDGVTIQATVVLDATGFSRCLVQYDKPYN  907
             M+QKCITNGVKFHQAKVIKVIHEESKS+LIC+DGVTIQA VVLDATGFSRCLVQYDKPYN
Sbjct  199   MLQKCITNGVKFHQAKVIKVIHEESKSLLICNDGVTIQAAVVLDATGFSRCLVQYDKPYN  258

Query  906   PGYQVAYGILAEVEEHPYDLNKMVFMDWRDSHLNSNLELKERNKRIPTFLYAMPFSSTRI  727
             PGYQVAYGILAEVEEHP+DL+KMVFMDWRDSHLN+N ELKE N +IPTFLYAMPFSS RI
Sbjct  259   PGYQVAYGILAEVEEHPFDLDKMVFMDWRDSHLNNNSELKEANSKIPTFLYAMPFSSNRI  318

Query  726   FLEETSLVARPGLDMKDIQERMVARLRHLGINVKSIEEDERCVIPMGGPLPVIPQRVVGI  547
             FLEETSLVARPG+ MKDIQERMVARL+HLGI V+SIEEDE CVIPMGGPLPV+PQRVVGI
Sbjct  319   FLEETSLVARPGVPMKDIQERMVARLKHLGIKVRSIEEDEHCVIPMGGPLPVLPQRVVGI  378

Query  546   GGTAGMVHPSTGYMVARTLAAAPVVANAIIQYLGSERSLLGNELSASVWKDLWPIERRRQ  367
             GGTAGMVHPSTGYMVARTLAAAP+VANAI++ L S+RS+ G++LSA VWKDLWPIERRRQ
Sbjct  379   GGTAGMVHPSTGYMVARTLAAAPIVANAIVRSLSSDRSISGHKLSAEVWKDLWPIERRRQ  438

Query  366   REFFCFGMDILLKLDLPATRRFFDAFFDLEPRYWHGFLSSRLFLRELIFFGLSLFSHASN  187
             REFFCFGMDILLKLDLPATRRFFDAFFDLEPRYWHGFLSSRLFL EL+ FGLSLFSHASN
Sbjct  439   REFFCFGMDILLKLDLPATRRFFDAFFDLEPRYWHGFLSSRLFLPELLVFGLSLFSHASN  498

Query  186   TSRLEIMTKGTLPLVNMINNLLQDID  109
             TSRLEIM KGTLPLVNMINNL+QD D
Sbjct  499   TSRLEIMAKGTLPLVNMINNLVQDTD  524



>gb|AAN86060.1| lycopene cyclase [Citrus unshiu]
 gb|ABF69941.1| lycopene beta-cyclase allozyme 1 [Citrus sinensis]
 gb|ABF69943.1| lycopene beta-cyclase allozyme 1 [Citrus sinensis]
Length=504

 Score =   827 bits (2135),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 429/504 (85%), Positives = 465/504 (92%), Gaps = 3/504 (1%)
 Frame = -2

Query  1611  MDTLLKTPNELEFLHPHHGFAVKASAFTSLKPQKQEIRIGSWKA--CRNVG-RVKASSSA  1441
             MDT+LKT N+LEFL   HG   K+S+ +SLK Q QE+R G  K+   RN+   +KASSSA
Sbjct  1     MDTVLKTHNKLEFLPQVHGALEKSSSLSSLKIQNQELRFGLKKSRQKRNMSCFIKASSSA  60

Query  1440  LLELVPVTKKENLDFELPMFEPSKGIvvdlavvgggpaglavaqqVSQAGLSVCSIDPSP  1261
             LLELVP TKKENL+FELPM++PSKG+VVDLAVVGGGPAGLAVAQQVS+AGLSVCSIDPSP
Sbjct  61    LLELVPETKKENLEFELPMYDPSKGLVVDLAVVGGGPAGLAVAQQVSEAGLSVCSIDPSP  120

Query  1260  KLIWPNNYGVWVDEFEAMDLLDCLDTTWSGAMVYIDDRTTKDLDRPYGRVNRKKLKSKMM  1081
             KLIWPNNYGVWVDEFEAMDLLDCLDTTWSGA+V+IDD T KDLDRPYGRVNRK LKSKM+
Sbjct  121   KLIWPNNYGVWVDEFEAMDLLDCLDTTWSGAVVHIDDNTKKDLDRPYGRVNRKLLKSKML  180

Query  1080  QKCITNGVKFHQAKVIKVIHEESKSMLICSDGVTIQATVVLDATGFSRCLVQYDKPYNPG  901
             QKCITNGVKFHQAKVIKVIHEESKS+LIC+DGVTIQA VVLDATGFSRCLVQYDKPYNPG
Sbjct  181   QKCITNGVKFHQAKVIKVIHEESKSLLICNDGVTIQAAVVLDATGFSRCLVQYDKPYNPG  240

Query  900   YQVAYGILAEVEEHPYDLNKMVFMDWRDSHLNSNLELKERNKRIPTFLYAMPFSSTRIFL  721
             YQVAYGILAEVEEHP+DL+KMVFMDWRDSHLN+N ELKE N +IPTFLYAMPFSS RIFL
Sbjct  241   YQVAYGILAEVEEHPFDLDKMVFMDWRDSHLNNNSELKEANSKIPTFLYAMPFSSNRIFL  300

Query  720   EETSLVARPGLDMKDIQERMVARLRHLGINVKSIEEDERCVIPMGGPLPVIPQRVVGIGG  541
             EETSLVARPG+ MKDIQERMVARL+HLGI V+SIEEDE CVIPMGGPLPV+PQRVVGIGG
Sbjct  301   EETSLVARPGVPMKDIQERMVARLKHLGIKVRSIEEDEHCVIPMGGPLPVLPQRVVGIGG  360

Query  540   TAGMVHPSTGYMVARTLAAAPVVANAIIQYLGSERSLLGNELSASVWKDLWPIERRRQRE  361
             TAGMVHPSTGYMVARTLAAAP+VANAI++ L S+RS+ G++LSA VWKDLWPIERRRQRE
Sbjct  361   TAGMVHPSTGYMVARTLAAAPIVANAIVRSLSSDRSISGHKLSAEVWKDLWPIERRRQRE  420

Query  360   FFCFGMDILLKLDLPATRRFFDAFFDLEPRYWHGFLSSRLFLRELIFFGLSLFSHASNTS  181
             FFCFGMDILLKLDLPATRRFFDAFFDLEPRYWHGFLSSRLFL EL+ FGLSLFSHASNTS
Sbjct  421   FFCFGMDILLKLDLPATRRFFDAFFDLEPRYWHGFLSSRLFLPELLVFGLSLFSHASNTS  480

Query  180   RLEIMTKGTLPLVNMINNLLQDID  109
             RLEIM KGTLPLVNMINNL+QD D
Sbjct  481   RLEIMAKGTLPLVNMINNLVQDTD  504



>ref|XP_002531498.1| Lycopene beta cyclase, chloroplast precursor, putative [Ricinus 
communis]
 gb|EEF30885.1| Lycopene beta cyclase, chloroplast precursor, putative [Ricinus 
communis]
Length=514

 Score =   827 bits (2135),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 425/513 (83%), Positives = 459/513 (89%), Gaps = 15/513 (3%)
 Frame = -2

Query  1611  MDTLLKTPNELEFLHPHHGFAVKASAFTS----------LKPQKQEIRIGSWKA----CR  1474
             MDTLL+T N+LEFL   HGF+ K S F            +K Q  E+R  S K     CR
Sbjct  1     MDTLLRTHNKLEFLPQLHGFSEKVSIFEPKKEKISNSNFIKYQNSEVRFCSKKTYPKRCR  60

Query  1473  NVGRVKASSSALLELVPVTKKENLDFELPMFEPSKGIvvdlavvgggpaglavaqqVSQA  1294
             N G VKASS ALLELVP TKKENL+FELPM++ SKG VVDLAVVGGGPAGLAVAQQVS+A
Sbjct  61    N-GCVKASSGALLELVPETKKENLEFELPMYDSSKGGVVDLAVVGGGPAGLAVAQQVSEA  119

Query  1293  GLSVCSIDPSPKLIWPNNYGVWVDEFEAMDLLDCLDTTWSGAMVYIDDRTTKDLDRPYGR  1114
             GLSVCSIDPSPKLIWPNNYGVWVDEFEAMDLLDCLDTTWSGA+VYIDD++ KDL RPYGR
Sbjct  120   GLSVCSIDPSPKLIWPNNYGVWVDEFEAMDLLDCLDTTWSGAVVYIDDKSKKDLGRPYGR  179

Query  1113  VNRKKLKSKMMQKCITNGVKFHQAKVIKVIHEESKSMLICSDGVTIQATVVLDATGFSRC  934
             VNRK+LKSKM+QKCI+NGVKFHQAKVIKVIHEESKS+LIC+DGVTIQA VVLDATGFSRC
Sbjct  180   VNRKQLKSKMLQKCISNGVKFHQAKVIKVIHEESKSLLICNDGVTIQAAVVLDATGFSRC  239

Query  933   LVQYDKPYNPGYQVAYGILAEVEEHPYDLNKMVFMDWRDSHLNSNLELKERNKRIPTFLY  754
             LVQYDKPYNPGYQVAYGILAEVE+HP+D++KM+FMDWRDSHL +N EL++RN +IPTFLY
Sbjct  240   LVQYDKPYNPGYQVAYGILAEVEDHPFDVDKMLFMDWRDSHLKNNPELQKRNSKIPTFLY  299

Query  753   AMPFSSTRIFLEETSLVARPGLDMKDIQERMVARLRHLGINVKSIEEDERCVIPMGGPLP  574
             AMPFSS RIFLEETSLVARPG+ M+DIQERMVARL+HLGI VKSIEEDE CVIPMGGPLP
Sbjct  300   AMPFSSERIFLEETSLVARPGVRMEDIQERMVARLKHLGIKVKSIEEDEHCVIPMGGPLP  359

Query  573   VIPQRVVGIGGTAGMVHPSTGYMVARTLAAAPVVANAIIQYLGSERSLLGNELSASVWKD  394
             V+PQRVVGIGGTAGMVHPSTGYMVARTLAAAPVVAN+I+QYLGS RSL G ELSA VWKD
Sbjct  360   VLPQRVVGIGGTAGMVHPSTGYMVARTLAAAPVVANSIVQYLGSSRSLSGTELSAEVWKD  419

Query  393   LWPIERRRQREFFCFGMDILLKLDLPATRRFFDAFFDLEPRYWHGFLSSRLFLRELIFFG  214
             LWPIERRRQREFFCFGMDILLKLDL ATRRFFDAFFDLEP YWHGFLSSRLFL ELIFFG
Sbjct  420   LWPIERRRQREFFCFGMDILLKLDLQATRRFFDAFFDLEPHYWHGFLSSRLFLPELIFFG  479

Query  213   LSLFSHASNTSRLEIMTKGTLPLVNMINNLLQD  115
             LSLFSHASNTSRLEIM KGTLPLVNM+NNL+QD
Sbjct  480   LSLFSHASNTSRLEIMAKGTLPLVNMVNNLIQD  512



>gb|AAD38049.2| lycopene cyclase [Citrus x paradisi]
Length=524

 Score =   827 bits (2136),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 427/506 (84%), Positives = 464/506 (92%), Gaps = 3/506 (1%)
 Frame = -2

Query  1617  RVMDTLLKTPNELEFLHPHHGFAVKASAFTSLKPQKQEIRIGSWKACRNVGR---VKASS  1447
             + MDTLLKT N+LEFL   HG   K+S+ +SLK Q QE+R G  K+ +   R   +KASS
Sbjct  19    KAMDTLLKTHNKLEFLPQVHGALEKSSSLSSLKIQNQELRFGLKKSRQKRNRSCFIKASS  78

Query  1446  SALLELVPVTKKENLDFELPMFEPSKGIvvdlavvgggpaglavaqqVSQAGLSVCSIDP  1267
             SALLELVP TKKENL+FELPM++PSKG+VVDLAVVGGGPAGLAVAQQVS AGLSVCSIDP
Sbjct  79    SALLELVPETKKENLEFELPMYDPSKGLVVDLAVVGGGPAGLAVAQQVSGAGLSVCSIDP  138

Query  1266  SPKLIWPNNYGVWVDEFEAMDLLDCLDTTWSGAMVYIDDRTTKDLDRPYGRVNRKKLKSK  1087
             SPKLIWPNNYGVWVDEFEAMDLLDCLDTTWSGA+V+IDD T KDL+RPYGRVNRK LKSK
Sbjct  139   SPKLIWPNNYGVWVDEFEAMDLLDCLDTTWSGAVVHIDDNTKKDLNRPYGRVNRKLLKSK  198

Query  1086  MMQKCITNGVKFHQAKVIKVIHEESKSMLICSDGVTIQATVVLDATGFSRCLVQYDKPYN  907
             M+QKCITNGVKFHQAKVIKVIHEESKS+LIC+DGVTIQA VVLDATGFSRCLVQYDKPYN
Sbjct  199   MLQKCITNGVKFHQAKVIKVIHEESKSLLICNDGVTIQAAVVLDATGFSRCLVQYDKPYN  258

Query  906   PGYQVAYGILAEVEEHPYDLNKMVFMDWRDSHLNSNLELKERNKRIPTFLYAMPFSSTRI  727
             PGYQVAYGILAEVE+HP+DL+KMVFMDWRDSHLN+N +LKE N +IPTFLYAMPFSS RI
Sbjct  259   PGYQVAYGILAEVEQHPFDLDKMVFMDWRDSHLNNNSQLKEANSKIPTFLYAMPFSSNRI  318

Query  726   FLEETSLVARPGLDMKDIQERMVARLRHLGINVKSIEEDERCVIPMGGPLPVIPQRVVGI  547
             FLEETSLVARPG+ MKDIQERMVARL+HLGI VKSIEEDE CVIPMGGPLPV+PQRVVGI
Sbjct  319   FLEETSLVARPGVPMKDIQERMVARLKHLGIKVKSIEEDEHCVIPMGGPLPVLPQRVVGI  378

Query  546   GGTAGMVHPSTGYMVARTLAAAPVVANAIIQYLGSERSLLGNELSASVWKDLWPIERRRQ  367
             GGTAGMVHPSTGYMVARTLAAAP+VANAI++ L S+RS+ G++LSA VWKDLWPIERRRQ
Sbjct  379   GGTAGMVHPSTGYMVARTLAAAPIVANAIVRSLSSDRSISGHKLSAEVWKDLWPIERRRQ  438

Query  366   REFFCFGMDILLKLDLPATRRFFDAFFDLEPRYWHGFLSSRLFLRELIFFGLSLFSHASN  187
             REFFCFGMDILLKLDLPATRRFFDAFFDLEPRYWHGFLSSRLFL EL+ FGLSLFSHASN
Sbjct  439   REFFCFGMDILLKLDLPATRRFFDAFFDLEPRYWHGFLSSRLFLPELLVFGLSLFSHASN  498

Query  186   TSRLEIMTKGTLPLVNMINNLLQDID  109
             TSRLEIM KGTLPLVNMINNL+QD D
Sbjct  499   TSRLEIMAKGTLPLVNMINNLVQDTD  524



>gb|AEQ29514.1| lycopene beta cyclase [Citrus x paradisi]
 gb|AJT59424.1| LCYB [Citrus maxima]
Length=504

 Score =   826 bits (2133),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 427/504 (85%), Positives = 463/504 (92%), Gaps = 3/504 (1%)
 Frame = -2

Query  1611  MDTLLKTPNELEFLHPHHGFAVKASAFTSLKPQKQEIRIGSWKACRNVGR---VKASSSA  1441
             MDTLLKT N+LEFL   HG   K+S+ +SLK Q QE+R G  K+ +   R   +KASSSA
Sbjct  1     MDTLLKTHNKLEFLPQVHGALEKSSSLSSLKIQNQELRFGLKKSRQKRNRSCFIKASSSA  60

Query  1440  LLELVPVTKKENLDFELPMFEPSKGIvvdlavvgggpaglavaqqVSQAGLSVCSIDPSP  1261
             LLELVP TKKENL+FELPM++PSKG+VVDLAVVGGGPAGLAVAQQVS AGLSVCSIDPSP
Sbjct  61    LLELVPETKKENLEFELPMYDPSKGLVVDLAVVGGGPAGLAVAQQVSGAGLSVCSIDPSP  120

Query  1260  KLIWPNNYGVWVDEFEAMDLLDCLDTTWSGAMVYIDDRTTKDLDRPYGRVNRKKLKSKMM  1081
             KLIWPNNYGVWVDEFEAMDLLDCLDTTWSGA+V+IDD T KDL+RPYGRVNRK LKSKM+
Sbjct  121   KLIWPNNYGVWVDEFEAMDLLDCLDTTWSGAVVHIDDNTKKDLNRPYGRVNRKLLKSKML  180

Query  1080  QKCITNGVKFHQAKVIKVIHEESKSMLICSDGVTIQATVVLDATGFSRCLVQYDKPYNPG  901
             QKCITNGVKFHQAKVIKVIHEESKS+LIC+DGVTIQA VVLDATGFSRCLVQYDKPYNPG
Sbjct  181   QKCITNGVKFHQAKVIKVIHEESKSLLICNDGVTIQAAVVLDATGFSRCLVQYDKPYNPG  240

Query  900   YQVAYGILAEVEEHPYDLNKMVFMDWRDSHLNSNLELKERNKRIPTFLYAMPFSSTRIFL  721
             YQVAYGILAEVE+HP+DL+KMVFMDWRDSHLN+N +LKE N +IPTFLYAMPFSS RIFL
Sbjct  241   YQVAYGILAEVEQHPFDLDKMVFMDWRDSHLNNNSQLKEANSKIPTFLYAMPFSSNRIFL  300

Query  720   EETSLVARPGLDMKDIQERMVARLRHLGINVKSIEEDERCVIPMGGPLPVIPQRVVGIGG  541
             EETSLVARPG+ MKDIQERMVARL+HLGI VKSIEEDE CVIPMGGPLPV+PQRVVGIGG
Sbjct  301   EETSLVARPGVPMKDIQERMVARLKHLGIKVKSIEEDEHCVIPMGGPLPVLPQRVVGIGG  360

Query  540   TAGMVHPSTGYMVARTLAAAPVVANAIIQYLGSERSLLGNELSASVWKDLWPIERRRQRE  361
             TAGMVHPSTGYMVARTLAAAP+VANAI++ L S+RS+ G++LSA VWKDLWPIERRRQRE
Sbjct  361   TAGMVHPSTGYMVARTLAAAPIVANAIVRSLSSDRSISGHKLSAEVWKDLWPIERRRQRE  420

Query  360   FFCFGMDILLKLDLPATRRFFDAFFDLEPRYWHGFLSSRLFLRELIFFGLSLFSHASNTS  181
             FFCFGMDILLKLDLPATRRFFDAFFDLEPRYWHGFLSSRLFL EL+ FGLSLFSHASNTS
Sbjct  421   FFCFGMDILLKLDLPATRRFFDAFFDLEPRYWHGFLSSRLFLPELLVFGLSLFSHASNTS  480

Query  180   RLEIMTKGTLPLVNMINNLLQDID  109
             RLEIM KGTLPLVNMINNL+QD D
Sbjct  481   RLEIMAKGTLPLVNMINNLVQDTD  504



>gb|AAF44700.2|AF240787_1 lycopene beta-cyclase [Citrus sinensis]
Length=504

 Score =   826 bits (2133),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 429/504 (85%), Positives = 465/504 (92%), Gaps = 3/504 (1%)
 Frame = -2

Query  1611  MDTLLKTPNELEFLHPHHGFAVKASAFTSLKPQKQEIRIGSWKA--CRNVG-RVKASSSA  1441
             MDT+LKT N+LEFL   HG   K+S+ +SLK Q QE+R G  K+   RN+   +KASSSA
Sbjct  1     MDTVLKTHNKLEFLPQVHGALEKSSSLSSLKIQNQELRFGLKKSRQKRNMSCFIKASSSA  60

Query  1440  LLELVPVTKKENLDFELPMFEPSKGIvvdlavvgggpaglavaqqVSQAGLSVCSIDPSP  1261
             LLELVP TKKENL+FELPM++PSKG+VVDLAVVGGGPAGLAVAQQVS+AGLSVCSIDPSP
Sbjct  61    LLELVPETKKENLEFELPMYDPSKGLVVDLAVVGGGPAGLAVAQQVSEAGLSVCSIDPSP  120

Query  1260  KLIWPNNYGVWVDEFEAMDLLDCLDTTWSGAMVYIDDRTTKDLDRPYGRVNRKKLKSKMM  1081
             KLIWPNNYGVWVDEFEAMDLLDCLDTTWSGA+V+IDD T KDLDRPYGRVNRK LKSKM+
Sbjct  121   KLIWPNNYGVWVDEFEAMDLLDCLDTTWSGAVVHIDDDTKKDLDRPYGRVNRKLLKSKML  180

Query  1080  QKCITNGVKFHQAKVIKVIHEESKSMLICSDGVTIQATVVLDATGFSRCLVQYDKPYNPG  901
             QKCITNGVKFHQAKVIKVIHEESKS+LIC+DGVTIQA VVLDATGFSRCLVQYDKPYNPG
Sbjct  181   QKCITNGVKFHQAKVIKVIHEESKSLLICNDGVTIQAAVVLDATGFSRCLVQYDKPYNPG  240

Query  900   YQVAYGILAEVEEHPYDLNKMVFMDWRDSHLNSNLELKERNKRIPTFLYAMPFSSTRIFL  721
             YQVAYGILAEVEEHP+DL+KMVFMDWRDSHLN+N ELKE N +IPTFLYAMPFSS RIFL
Sbjct  241   YQVAYGILAEVEEHPFDLDKMVFMDWRDSHLNNNSELKEANSKIPTFLYAMPFSSNRIFL  300

Query  720   EETSLVARPGLDMKDIQERMVARLRHLGINVKSIEEDERCVIPMGGPLPVIPQRVVGIGG  541
             EETSLVARPG+ MKDIQERMVARL+HLGI V+SIEEDE CVIPMGGPLPV+PQRVVGIGG
Sbjct  301   EETSLVARPGVPMKDIQERMVARLKHLGIKVRSIEEDEHCVIPMGGPLPVLPQRVVGIGG  360

Query  540   TAGMVHPSTGYMVARTLAAAPVVANAIIQYLGSERSLLGNELSASVWKDLWPIERRRQRE  361
             TAGMVHPSTGYMVARTLAAAP+VANAI++ L S+RS+ G++LSA VWKDLWPIERRRQRE
Sbjct  361   TAGMVHPSTGYMVARTLAAAPIVANAIVRSLSSDRSISGHKLSAEVWKDLWPIERRRQRE  420

Query  360   FFCFGMDILLKLDLPATRRFFDAFFDLEPRYWHGFLSSRLFLRELIFFGLSLFSHASNTS  181
             FFCFGMDILLKLDLPATRRFFDAFFDLEPRYWHGFLSSRLFL EL+ FGLSLFSHASNTS
Sbjct  421   FFCFGMDILLKLDLPATRRFFDAFFDLEPRYWHGFLSSRLFLPELLVFGLSLFSHASNTS  480

Query  180   RLEIMTKGTLPLVNMINNLLQDID  109
             RLEIM KGTLPLVNMINNL+QD D
Sbjct  481   RLEIMAKGTLPLVNMINNLVQDTD  504



>gb|AAU14144.1| lycopene beta-cyclase [Citrus sinensis]
Length=504

 Score =   826 bits (2133),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 428/504 (85%), Positives = 465/504 (92%), Gaps = 3/504 (1%)
 Frame = -2

Query  1611  MDTLLKTPNELEFLHPHHGFAVKASAFTSLKPQKQEIRIGSWKA--CRNVG-RVKASSSA  1441
             MDT+LKT N+LEFL   HG   K+S+ +SLK Q QE+R G  K+   RN+   +KASSSA
Sbjct  1     MDTVLKTHNKLEFLPQVHGALEKSSSLSSLKIQNQELRFGLKKSRQKRNMSCFIKASSSA  60

Query  1440  LLELVPVTKKENLDFELPMFEPSKGIvvdlavvgggpaglavaqqVSQAGLSVCSIDPSP  1261
             LLELVP TKKENL+FELPM++PSKG+VVDLAVVGGGPAGLAVAQQVS+AGLSVCSIDPSP
Sbjct  61    LLELVPETKKENLEFELPMYDPSKGLVVDLAVVGGGPAGLAVAQQVSEAGLSVCSIDPSP  120

Query  1260  KLIWPNNYGVWVDEFEAMDLLDCLDTTWSGAMVYIDDRTTKDLDRPYGRVNRKKLKSKMM  1081
             KLIWPNNYGVWVDEFEAMDLLDCLDTTWSGA+V+IDD T KDL+RPYGRVNRK LKSKM+
Sbjct  121   KLIWPNNYGVWVDEFEAMDLLDCLDTTWSGAVVHIDDNTKKDLNRPYGRVNRKLLKSKML  180

Query  1080  QKCITNGVKFHQAKVIKVIHEESKSMLICSDGVTIQATVVLDATGFSRCLVQYDKPYNPG  901
             QKCITNGVKFHQAKVIKVIHEESKS+LIC+DGVTIQA VVLDATGFSRCLVQYDKPYNPG
Sbjct  181   QKCITNGVKFHQAKVIKVIHEESKSLLICNDGVTIQAAVVLDATGFSRCLVQYDKPYNPG  240

Query  900   YQVAYGILAEVEEHPYDLNKMVFMDWRDSHLNSNLELKERNKRIPTFLYAMPFSSTRIFL  721
             YQVAYGILAEVEEHP+DL+KMVFMDWRDSHLN+N ELKE N +IPTFLYAMPFSS RIFL
Sbjct  241   YQVAYGILAEVEEHPFDLDKMVFMDWRDSHLNNNSELKEANSKIPTFLYAMPFSSNRIFL  300

Query  720   EETSLVARPGLDMKDIQERMVARLRHLGINVKSIEEDERCVIPMGGPLPVIPQRVVGIGG  541
             EETSLVARPG+ MKDIQERMVARL+HLGI V+SIEEDE CVIPMGGPLPV+PQRVVGIGG
Sbjct  301   EETSLVARPGVPMKDIQERMVARLKHLGIKVRSIEEDEHCVIPMGGPLPVLPQRVVGIGG  360

Query  540   TAGMVHPSTGYMVARTLAAAPVVANAIIQYLGSERSLLGNELSASVWKDLWPIERRRQRE  361
             TAGMVHPSTGYMVARTLAAAP+VANAI++ L S+RS+ G++LSA VWKDLWPIERRRQRE
Sbjct  361   TAGMVHPSTGYMVARTLAAAPIVANAIVRSLSSDRSISGHKLSAEVWKDLWPIERRRQRE  420

Query  360   FFCFGMDILLKLDLPATRRFFDAFFDLEPRYWHGFLSSRLFLRELIFFGLSLFSHASNTS  181
             FFCFGMDILLKLDLPATRRFFDAFFDLEPRYWHGFLSSRLFL EL+ FGLSLFSHASNTS
Sbjct  421   FFCFGMDILLKLDLPATRRFFDAFFDLEPRYWHGFLSSRLFLPELLVFGLSLFSHASNTS  480

Query  180   RLEIMTKGTLPLVNMINNLLQDID  109
             RLEIM KGTLPLVNMINNL+QD D
Sbjct  481   RLEIMAKGTLPLVNMINNLVQDTD  504



>gb|AEQ29513.1| lycopene beta cyclase [Citrus sinensis]
Length=504

 Score =   825 bits (2132),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 427/504 (85%), Positives = 462/504 (92%), Gaps = 3/504 (1%)
 Frame = -2

Query  1611  MDTLLKTPNELEFLHPHHGFAVKASAFTSLKPQKQEIRIGSWKACRNVGR---VKASSSA  1441
             MDTLLKT N+LEFL   HG   K+S+ +SLK Q QE+R G  K+ +   R   +KASSSA
Sbjct  1     MDTLLKTHNKLEFLPQVHGALEKSSSLSSLKIQNQELRFGLKKSRQKRNRSCFIKASSSA  60

Query  1440  LLELVPVTKKENLDFELPMFEPSKGIvvdlavvgggpaglavaqqVSQAGLSVCSIDPSP  1261
             LLELVP TKKENL+FELPM++PSKG+VVDLAVVGGGPAGLAVAQQVS+AGLSVCSIDPSP
Sbjct  61    LLELVPETKKENLEFELPMYDPSKGLVVDLAVVGGGPAGLAVAQQVSEAGLSVCSIDPSP  120

Query  1260  KLIWPNNYGVWVDEFEAMDLLDCLDTTWSGAMVYIDDRTTKDLDRPYGRVNRKKLKSKMM  1081
             KLIWPNNYGVWVDEFEAMDLLDCLDTTWSGA+V+IDD T KDL+RPYGRVNRK LKSKM+
Sbjct  121   KLIWPNNYGVWVDEFEAMDLLDCLDTTWSGAVVHIDDNTKKDLNRPYGRVNRKLLKSKML  180

Query  1080  QKCITNGVKFHQAKVIKVIHEESKSMLICSDGVTIQATVVLDATGFSRCLVQYDKPYNPG  901
             QKCITNGVKFHQAKVIKVIHEESKS+LIC+DGVTIQA VVLDATGFSRCLVQY KPYNPG
Sbjct  181   QKCITNGVKFHQAKVIKVIHEESKSLLICNDGVTIQAAVVLDATGFSRCLVQYGKPYNPG  240

Query  900   YQVAYGILAEVEEHPYDLNKMVFMDWRDSHLNSNLELKERNKRIPTFLYAMPFSSTRIFL  721
             YQVAYGILAE EEHP+DL+KMVFMDWRDSHLN+N ELKE N +IPTFLYAMPFSS RIFL
Sbjct  241   YQVAYGILAEAEEHPFDLDKMVFMDWRDSHLNNNSELKEANSKIPTFLYAMPFSSNRIFL  300

Query  720   EETSLVARPGLDMKDIQERMVARLRHLGINVKSIEEDERCVIPMGGPLPVIPQRVVGIGG  541
             EETSLVARPG+ MKDIQERMVARL+HLGI VKSIEEDE CVIPMGGPLPV+PQRVVGIGG
Sbjct  301   EETSLVARPGVPMKDIQERMVARLKHLGIKVKSIEEDEHCVIPMGGPLPVLPQRVVGIGG  360

Query  540   TAGMVHPSTGYMVARTLAAAPVVANAIIQYLGSERSLLGNELSASVWKDLWPIERRRQRE  361
             TAGMVHPSTGYMVARTLAAAP+VANAI++ L S+RS+ G++LSA VWKDLWPIERRRQRE
Sbjct  361   TAGMVHPSTGYMVARTLAAAPIVANAIVRSLSSDRSISGHKLSAEVWKDLWPIERRRQRE  420

Query  360   FFCFGMDILLKLDLPATRRFFDAFFDLEPRYWHGFLSSRLFLRELIFFGLSLFSHASNTS  181
             FFCFGMDILLKLDLPATRRFFDAFFDLEPRYWHGFLSSRLFL EL+ FGLSLFSHASNTS
Sbjct  421   FFCFGMDILLKLDLPATRRFFDAFFDLEPRYWHGFLSSRLFLPELLVFGLSLFSHASNTS  480

Query  180   RLEIMTKGTLPLVNMINNLLQDID  109
             RLEIM KGTLPLVNMINNL+QD D
Sbjct  481   RLEIMAKGTLPLVNMINNLVQDTD  504



>ref|XP_003554132.1| PREDICTED: lycopene beta cyclase, chloroplastic-like isoform 
2 [Glycine max]
 gb|KHN14904.1| Lycopene beta cyclase, chloroplastic [Glycine soja]
Length=507

 Score =   825 bits (2132),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 416/507 (82%), Positives = 461/507 (91%), Gaps = 9/507 (2%)
 Frame = -2

Query  1611  MDTLLKTPNELEFLHPHHGFAVKASAFTSLKPQKQEIRIGS------WKACRNVGRVKAS  1450
             MDTLLKTPN+LEFLHP HG++ K S   S + Q Q+ R GS      W  C   G ++AS
Sbjct  4     MDTLLKTPNKLEFLHPLHGYSEKFSNSCSSRVQNQDFRFGSKKPIVRWGKC---GNLRAS  60

Query  1449  SSALLELVPVTKKENLDFELPMFEPSKGIvvdlavvgggpaglavaqqVSQAGLSVCSID  1270
             SSALLELVP  KKENLDFELP+++ SKG VVDLAVVGGGPAGLAVAQQVS+AGLSVC+ID
Sbjct  61    SSALLELVPEFKKENLDFELPLYDSSKGAVVDLAVVGGGPAGLAVAQQVSEAGLSVCAID  120

Query  1269  PSPKLIWPNNYGVWVDEFEAMDLLDCLDTTWSGAMVYIDDRTTKDLDRPYGRVNRKKLKS  1090
             P+P+LIWPNNYGVWVDEFEAMDLLDCLDTTWSGA+V+IDD+T KDLDRPYGRVNRK LKS
Sbjct  121   PNPRLIWPNNYGVWVDEFEAMDLLDCLDTTWSGAVVFIDDKTKKDLDRPYGRVNRKLLKS  180

Query  1089  KMMQKCITNGVKFHQAKVIKVIHEESKSMLICSDGVTIQATVVLDATGFSRCLVQYDKPY  910
             KM+QKCI+NGVKFHQAKVIKVIHEE+KS+LIC+DGVTIQATVVLDATGFSRCLVQYDK Y
Sbjct  181   KMLQKCISNGVKFHQAKVIKVIHEETKSLLICNDGVTIQATVVLDATGFSRCLVQYDKLY  240

Query  909   NPGYQVAYGILAEVEEHPYDLNKMVFMDWRDSHLNSNLELKERNKRIPTFLYAMPFSSTR  730
             NPGYQVAYGILAEV+EHP+D++KM+FMDWRDSHLN+++ELK+RN RIPTFLYAMPFSST+
Sbjct  241   NPGYQVAYGILAEVDEHPFDVDKMLFMDWRDSHLNNDMELKQRNCRIPTFLYAMPFSSTK  300

Query  729   IFLEETSLVARPGLDMKDIQERMVARLRHLGINVKSIEEDERCVIPMGGPLPVIPQRVVG  550
             IFLEETSLVARPGL M DIQERMVARL+HLGI VKSIEEDE+CVIPMGGPLPV+PQRVVG
Sbjct  301   IFLEETSLVARPGLRMDDIQERMVARLKHLGIRVKSIEEDEQCVIPMGGPLPVLPQRVVG  360

Query  549   IGGTAGMVHPSTGYMVARTLAAAPVVANAIIQYLGSERSLLGNELSASVWKDLWPIERRR  370
             IGGTAGMVHPSTGYMVARTLAAAP+VAN+I+Q LGS+R   G E SA VWKDLWPI+RRR
Sbjct  361   IGGTAGMVHPSTGYMVARTLAAAPIVANSIVQCLGSDRGFSGGETSAQVWKDLWPIQRRR  420

Query  369   QREFFCFGMDILLKLDLPATRRFFDAFFDLEPRYWHGFLSSRLFLRELIFFGLSLFSHAS  190
             QREFFCFGMDILLKLDLP TRRFFDAFFDLEP YWHGFLSSRLFL ELIFFGLSLFS+AS
Sbjct  421   QREFFCFGMDILLKLDLPGTRRFFDAFFDLEPHYWHGFLSSRLFLPELIFFGLSLFSYAS  480

Query  189   NTSRLEIMTKGTLPLVNMINNLLQDID  109
             NTSR+EIM KGTLPLVNMINNL++D +
Sbjct  481   NTSRIEIMAKGTLPLVNMINNLVKDTE  507



>gb|ACP19704.1| lycopene beta-cyclase 2 [Citrus sinensis]
Length=504

 Score =   825 bits (2131),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 425/504 (84%), Positives = 462/504 (92%), Gaps = 3/504 (1%)
 Frame = -2

Query  1611  MDTLLKTPNELEFLHPHHGFAVKASAFTSLKPQKQEIRIGSWKACRNVGR---VKASSSA  1441
             MDTLLKT N+LEFL   HG   ++S+ +SLK Q QE+R+G  K+ +   R   +KASSSA
Sbjct  1     MDTLLKTHNKLEFLPQVHGALEESSSLSSLKIQNQELRLGLKKSRQKRNRSCFIKASSSA  60

Query  1440  LLELVPVTKKENLDFELPMFEPSKGIvvdlavvgggpaglavaqqVSQAGLSVCSIDPSP  1261
             LLELVP TKKENL+FELPM++PSKG+VVDLAVVGGGPAGLAVAQQVS+AGLSVCSIDPSP
Sbjct  61    LLELVPETKKENLEFELPMYDPSKGLVVDLAVVGGGPAGLAVAQQVSEAGLSVCSIDPSP  120

Query  1260  KLIWPNNYGVWVDEFEAMDLLDCLDTTWSGAMVYIDDRTTKDLDRPYGRVNRKKLKSKMM  1081
             KLIWPNNYGVWVDEFEAMDLLDCLDTTWSGA+V+IDD T KDL+RPYGRVNRK LKSKM+
Sbjct  121   KLIWPNNYGVWVDEFEAMDLLDCLDTTWSGAVVHIDDNTKKDLNRPYGRVNRKLLKSKML  180

Query  1080  QKCITNGVKFHQAKVIKVIHEESKSMLICSDGVTIQATVVLDATGFSRCLVQYDKPYNPG  901
             QKCITNGVKFHQAKVIKVIHEESKS+LIC+DGVTIQA VVLDATGFSRCLVQYDKPYNPG
Sbjct  181   QKCITNGVKFHQAKVIKVIHEESKSLLICNDGVTIQAAVVLDATGFSRCLVQYDKPYNPG  240

Query  900   YQVAYGILAEVEEHPYDLNKMVFMDWRDSHLNSNLELKERNKRIPTFLYAMPFSSTRIFL  721
             YQVAYGILAEVEEHP+DL+KMVFMDWRDSHLN+N ELKE N +IPTFLYAMPFSS RIFL
Sbjct  241   YQVAYGILAEVEEHPFDLDKMVFMDWRDSHLNNNSELKEANSKIPTFLYAMPFSSNRIFL  300

Query  720   EETSLVARPGLDMKDIQERMVARLRHLGINVKSIEEDERCVIPMGGPLPVIPQRVVGIGG  541
             EETSLVARPG+ MKDIQERMVARL+HLGI VKSIEEDE CVIPMGGPLPV+PQRVVGIGG
Sbjct  301   EETSLVARPGVPMKDIQERMVARLKHLGIKVKSIEEDEHCVIPMGGPLPVLPQRVVGIGG  360

Query  540   TAGMVHPSTGYMVARTLAAAPVVANAIIQYLGSERSLLGNELSASVWKDLWPIERRRQRE  361
             TAGMVHPSTGYMVARTLAAAP+VANAI++ L S+RS+ G++LSA VWKDLWPIERRRQRE
Sbjct  361   TAGMVHPSTGYMVARTLAAAPIVANAIVRSLSSDRSISGHKLSAEVWKDLWPIERRRQRE  420

Query  360   FFCFGMDILLKLDLPATRRFFDAFFDLEPRYWHGFLSSRLFLRELIFFGLSLFSHASNTS  181
             FFCFGMDILLKLDLPATRRFFDAFF LEPRYWHGFLSSRLFL EL+ F LSLFSHA NTS
Sbjct  421   FFCFGMDILLKLDLPATRRFFDAFFGLEPRYWHGFLSSRLFLPELLVFELSLFSHAPNTS  480

Query  180   RLEIMTKGTLPLVNMINNLLQDID  109
             RLEIM KGTLPLVNMINNL+QD D
Sbjct  481   RLEIMAKGTLPLVNMINNLVQDTD  504



>gb|AEQ29511.1| lycopene beta cyclase [Citrus sinensis]
Length=504

 Score =   825 bits (2130),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 427/504 (85%), Positives = 462/504 (92%), Gaps = 3/504 (1%)
 Frame = -2

Query  1611  MDTLLKTPNELEFLHPHHGFAVKASAFTSLKPQKQEIRIGSWKACRNVGR---VKASSSA  1441
             MDTLLKT N+LEFL   HG   K+S+ +SLK Q QE+R G  K+ +   R   +KASSSA
Sbjct  1     MDTLLKTHNKLEFLPQVHGALEKSSSLSSLKIQNQELRFGLKKSRQKRNRSCFIKASSSA  60

Query  1440  LLELVPVTKKENLDFELPMFEPSKGIvvdlavvgggpaglavaqqVSQAGLSVCSIDPSP  1261
             LLELVP TKKENL+FELPM++PSKG+VVDLAVVGGGPAGLAVAQQVS+AGLSVCSIDPSP
Sbjct  61    LLELVPETKKENLEFELPMYDPSKGLVVDLAVVGGGPAGLAVAQQVSEAGLSVCSIDPSP  120

Query  1260  KLIWPNNYGVWVDEFEAMDLLDCLDTTWSGAMVYIDDRTTKDLDRPYGRVNRKKLKSKMM  1081
             KLIWPNNYGVWVDEFEAMDLLDCLDTTWSGA+V+IDD T KDL+RPYGRVNRK LKSKM+
Sbjct  121   KLIWPNNYGVWVDEFEAMDLLDCLDTTWSGAVVHIDDNTKKDLNRPYGRVNRKLLKSKML  180

Query  1080  QKCITNGVKFHQAKVIKVIHEESKSMLICSDGVTIQATVVLDATGFSRCLVQYDKPYNPG  901
             QKCITNGVKFHQAKVIKVIHEESKS+LIC+DGVTIQA VVLDATGFSRCLVQYDKPYNPG
Sbjct  181   QKCITNGVKFHQAKVIKVIHEESKSLLICNDGVTIQAAVVLDATGFSRCLVQYDKPYNPG  240

Query  900   YQVAYGILAEVEEHPYDLNKMVFMDWRDSHLNSNLELKERNKRIPTFLYAMPFSSTRIFL  721
             YQVAYGILAEVEEHP+DL+KMVFMDWRDSHLN+N ELKE N +IPTFLYAMPFSS RIFL
Sbjct  241   YQVAYGILAEVEEHPFDLDKMVFMDWRDSHLNNNSELKEANSKIPTFLYAMPFSSNRIFL  300

Query  720   EETSLVARPGLDMKDIQERMVARLRHLGINVKSIEEDERCVIPMGGPLPVIPQRVVGIGG  541
             EETSLVARPG+  KDIQERMVARL+HLGI V SIEEDE CVIPMGGPLPV+PQRVVGIGG
Sbjct  301   EETSLVARPGVPXKDIQERMVARLKHLGIKVXSIEEDEHCVIPMGGPLPVLPQRVVGIGG  360

Query  540   TAGMVHPSTGYMVARTLAAAPVVANAIIQYLGSERSLLGNELSASVWKDLWPIERRRQRE  361
             TAGMVHPSTGYMVARTLAAAP+VANAI++ L S+RS+ G++LSA VWKDLWPIERRRQRE
Sbjct  361   TAGMVHPSTGYMVARTLAAAPIVANAIVRSLSSDRSISGHKLSAEVWKDLWPIERRRQRE  420

Query  360   FFCFGMDILLKLDLPATRRFFDAFFDLEPRYWHGFLSSRLFLRELIFFGLSLFSHASNTS  181
             FFCFGMDILLKLDLPATRRFFDAFFDLEPRYWHGFLSSRLFL EL+ FGLSLFSHASNTS
Sbjct  421   FFCFGMDILLKLDLPATRRFFDAFFDLEPRYWHGFLSSRLFLPELLVFGLSLFSHASNTS  480

Query  180   RLEIMTKGTLPLVNMINNLLQDID  109
             RLEIM KGTLPLVNMINNL+QD D
Sbjct  481   RLEIMAKGTLPLVNMINNLVQDTD  504



>gb|AAK07430.1|AF321534_1 lycopene beta-cyclase [Adonis aestivalis var. palaestina]
Length=502

 Score =   824 bits (2129),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 416/503 (83%), Positives = 455/503 (90%), Gaps = 3/503 (1%)
 Frame = -2

Query  1611  MDTLLKTPNELEFLHPHHGFAVKASAFTSLKPQKQEIRIGSWK--ACRNVGRVKASSSAL  1438
             MDTLL+T N+LE L   HGFA K    ++ K Q Q  RI S     CRN G VKA  SAL
Sbjct  1     MDTLLRTHNKLELLPTLHGFAEKQHLVSTSKLQNQVFRIASRNIHPCRN-GTVKARGSAL  59

Query  1437  LELVPVTKKENLDFELPMFEPSKGIvvdlavvgggpaglavaqqVSQAGLSVCSIDPSPK  1258
             LELVP TKKENL+F+LP ++PS+GIVVDLAVVGGGPAGLA+AQQVS+AGL VCSIDPSPK
Sbjct  60    LELVPETKKENLEFDLPAYDPSRGIVVDLAVVGGGPAGLAIAQQVSEAGLLVCSIDPSPK  119

Query  1257  LIWPNNYGVWVDEFEAMDLLDCLDTTWSGAMVYIDDRTTKDLDRPYGRVNRKKLKSKMMQ  1078
             LIWPNNYGVWVDEFEAMDLLDCLDTTWSGA+VY DD + K LDRPYGRVNRK+LKSKM+Q
Sbjct  120   LIWPNNYGVWVDEFEAMDLLDCLDTTWSGAVVYTDDNSKKYLDRPYGRVNRKQLKSKMLQ  179

Query  1077  KCITNGVKFHQAKVIKVIHEESKSMLICSDGVTIQATVVLDATGFSRCLVQYDKPYNPGY  898
             KC+TNGVKFHQAKVIKVIHEESKS+LIC+DG+TI ATVVLDATGFSRCLVQYDKPYNPGY
Sbjct  180   KCVTNGVKFHQAKVIKVIHEESKSLLICNDGITINATVVLDATGFSRCLVQYDKPYNPGY  239

Query  897   QVAYGILAEVEEHPYDLNKMVFMDWRDSHLNSNLELKERNKRIPTFLYAMPFSSTRIFLE  718
             QVAYGI+AEVEEHP+DL+KM+FMDWRDSHLN  LELK++N++IPTFLYAMPFSST+IFLE
Sbjct  240   QVAYGIMAEVEEHPFDLDKMLFMDWRDSHLNEKLELKDKNRKIPTFLYAMPFSSTKIFLE  299

Query  717   ETSLVARPGLDMKDIQERMVARLRHLGINVKSIEEDERCVIPMGGPLPVIPQRVVGIGGT  538
             ETSLVARPGL  +DIQERMVARL+HLGI VKSIEEDERCVIPMGGPLPV+PQRVVGIGGT
Sbjct  300   ETSLVARPGLRFEDIQERMVARLKHLGIKVKSIEEDERCVIPMGGPLPVLPQRVVGIGGT  359

Query  537   AGMVHPSTGYMVARTLAAAPVVANAIIQYLGSERSLLGNELSASVWKDLWPIERRRQREF  358
             AGMVHPSTGYMVARTLAAAPVVA +I+QYLGS+RSL GNELSA VWKDLWPIERRRQREF
Sbjct  360   AGMVHPSTGYMVARTLAAAPVVAKSIVQYLGSDRSLSGNELSAEVWKDLWPIERRRQREF  419

Query  357   FCFGMDILLKLDLPATRRFFDAFFDLEPRYWHGFLSSRLFLRELIFFGLSLFSHASNTSR  178
             FCFGMDILLKLDL  TRRFFDAFFDLEP YWHGFLSSRLFL EL+FFGLSLFSHASN SR
Sbjct  420   FCFGMDILLKLDLQGTRRFFDAFFDLEPHYWHGFLSSRLFLPELLFFGLSLFSHASNASR  479

Query  177   LEIMTKGTLPLVNMINNLLQDID  109
             +EIM KGT+PLVNM+NNL+QD D
Sbjct  480   IEIMAKGTVPLVNMMNNLIQDTD  502



>gb|AIT98182.1| lycopene beta-cyclase [Medicago sativa]
Length=498

 Score =   824 bits (2128),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 415/500 (83%), Positives = 461/500 (92%), Gaps = 5/500 (1%)
 Frame = -2

Query  1611  MDTLLKTPNELEFLHPHHGFAVKASAFT-SLKPQKQEIRIGSWKACRNVGRVKASSSALL  1435
             MDTLLKTPN+L+FLHP HG++ K S F+ S K Q   +R GS K       ++ASSSALL
Sbjct  1     MDTLLKTPNKLQFLHPLHGYSEKLSHFSASDKLQNHVVRFGSKKK----PVLRASSSALL  56

Query  1434  ELVPVTKKENLDFELPMFEPSKGIvvdlavvgggpaglavaqqVSQAGLSVCSIDPSPKL  1255
             ELVP  KKENLDFELP+++ +KG VVDL VVGGGPAGLAVAQQVS+AGLSVC+IDP+P+L
Sbjct  57    ELVPEFKKENLDFELPLYDSTKGTVVDLVVVGGGPAGLAVAQQVSEAGLSVCAIDPNPRL  116

Query  1254  IWPNNYGVWVDEFEAMDLLDCLDTTWSGAMVYIDDRTTKDLDRPYGRVNRKKLKSKMMQK  1075
             IWPNNYGVWVDEFEAMDLLDCLD TWSGA+VYIDD+T KDLDRPYGRVNRK LKSKM+QK
Sbjct  117   IWPNNYGVWVDEFEAMDLLDCLDKTWSGAVVYIDDKTKKDLDRPYGRVNRKLLKSKMLQK  176

Query  1074  CITNGVKFHQAKVIKVIHEESKSMLICSDGVTIQATVVLDATGFSRCLVQYDKPYNPGYQ  895
             CI+NGVKFHQAKVIKVIHEESKSMLIC+DGVT+QATVVLDATGFSRCLVQYDKPYNPGYQ
Sbjct  177   CISNGVKFHQAKVIKVIHEESKSMLICNDGVTVQATVVLDATGFSRCLVQYDKPYNPGYQ  236

Query  894   VAYGILAEVEEHPYDLNKMVFMDWRDSHLNSNLELKERNKRIPTFLYAMPFSSTRIFLEE  715
             VAYGILAEVEEHP+D++KM+FMDWRDSHL ++L+LKERN +IPTFLYAMPFSST+IFLEE
Sbjct  237   VAYGILAEVEEHPFDVDKMLFMDWRDSHLENDLKLKERNSKIPTFLYAMPFSSTKIFLEE  296

Query  714   TSLVARPGLDMKDIQERMVARLRHLGINVKSIEEDERCVIPMGGPLPVIPQRVVGIGGTA  535
             TSLVARPGL M DIQ+RMVARL+HLGINVKSIEEDE+CVIPMGGPLPV+PQRVVGIGGTA
Sbjct  297   TSLVARPGLRMDDIQDRMVARLKHLGINVKSIEEDEQCVIPMGGPLPVLPQRVVGIGGTA  356

Query  534   GMVHPSTGYMVARTLAAAPVVANAIIQYLGSERSLLGNELSASVWKDLWPIERRRQREFF  355
             GMVHPSTGYMVARTLAAAP+VANAI+QYLGS+R LLG+E+SA VWKDLWPIERRRQREFF
Sbjct  357   GMVHPSTGYMVARTLAAAPIVANAIVQYLGSDRGLLGDEVSARVWKDLWPIERRRQREFF  416

Query  354   CFGMDILLKLDLPATRRFFDAFFDLEPRYWHGFLSSRLFLRELIFFGLSLFSHASNTSRL  175
             CFGMD+LLKLDLP TRRFFDAFF+LEP YWHGFLSSRL+L EL  FGLSLFS+ASNTSRL
Sbjct  417   CFGMDVLLKLDLPGTRRFFDAFFNLEPHYWHGFLSSRLYLPELFTFGLSLFSYASNTSRL  476

Query  174   EIMTKGTLPLVNMINNLLQD  115
             EIM KGTLPLVNM+NNL+QD
Sbjct  477   EIMAKGTLPLVNMVNNLIQD  496



>gb|ABB72443.1| lycopene beta-cyclase [Citrus sinensis]
Length=524

 Score =   825 bits (2131),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 428/506 (85%), Positives = 465/506 (92%), Gaps = 3/506 (1%)
 Frame = -2

Query  1617  RVMDTLLKTPNELEFLHPHHGFAVKASAFTSLKPQKQEIRIGSWKA--CRNVG-RVKASS  1447
             + MDT+LKT N+LEFL   HG   K+S+ +SLK Q QE+R G  K+   RN+   +KASS
Sbjct  19    KAMDTVLKTHNKLEFLPQVHGALEKSSSLSSLKIQNQELRFGLKKSRQKRNMSCFIKASS  78

Query  1446  SALLELVPVTKKENLDFELPMFEPSKGIvvdlavvgggpaglavaqqVSQAGLSVCSIDP  1267
             SALLELVP TKKENL+FELPM++PSKG+VVDLAVVGGGPAGLAVAQQVS+AGLSVCSIDP
Sbjct  79    SALLELVPETKKENLEFELPMYDPSKGLVVDLAVVGGGPAGLAVAQQVSEAGLSVCSIDP  138

Query  1266  SPKLIWPNNYGVWVDEFEAMDLLDCLDTTWSGAMVYIDDRTTKDLDRPYGRVNRKKLKSK  1087
             SPKLIWPNNYGVWVDEFEAMDLLDCLDTTWSGA+V+IDD T KDLDRPYGRVNRK LKSK
Sbjct  139   SPKLIWPNNYGVWVDEFEAMDLLDCLDTTWSGAVVHIDDNTKKDLDRPYGRVNRKLLKSK  198

Query  1086  MMQKCITNGVKFHQAKVIKVIHEESKSMLICSDGVTIQATVVLDATGFSRCLVQYDKPYN  907
             M+QKCITNGVKFHQAKVIKVIHEESKS+LIC+DGVTIQA VVLDATGFSRCLVQYDKPYN
Sbjct  199   MLQKCITNGVKFHQAKVIKVIHEESKSLLICNDGVTIQAAVVLDATGFSRCLVQYDKPYN  258

Query  906   PGYQVAYGILAEVEEHPYDLNKMVFMDWRDSHLNSNLELKERNKRIPTFLYAMPFSSTRI  727
             PGYQVAYGILAEVEEHP+DL+KMVFMDWRDSHLN+N ELKE N +IPTFLYAMPFSS RI
Sbjct  259   PGYQVAYGILAEVEEHPFDLDKMVFMDWRDSHLNNNSELKEANSKIPTFLYAMPFSSNRI  318

Query  726   FLEETSLVARPGLDMKDIQERMVARLRHLGINVKSIEEDERCVIPMGGPLPVIPQRVVGI  547
             FLEETSLVARPG+ MKDIQERMVARL+HLGI V+SIEEDE CVIPMGGPLPV+PQRVVGI
Sbjct  319   FLEETSLVARPGVPMKDIQERMVARLKHLGIKVRSIEEDEHCVIPMGGPLPVLPQRVVGI  378

Query  546   GGTAGMVHPSTGYMVARTLAAAPVVANAIIQYLGSERSLLGNELSASVWKDLWPIERRRQ  367
             GGTAGMVHPSTGYMVARTLAAAP+VANAI++ L S+RS+ G++LSA VWKDLWPIERRRQ
Sbjct  379   GGTAGMVHPSTGYMVARTLAAAPIVANAIVRSLSSDRSISGHKLSAEVWKDLWPIERRRQ  438

Query  366   REFFCFGMDILLKLDLPATRRFFDAFFDLEPRYWHGFLSSRLFLRELIFFGLSLFSHASN  187
              EFFCFGMDILLKLDLPATRRFFDAFFDLEPRYWHGFLSSRLFL EL+ FGLSLFSHASN
Sbjct  439   GEFFCFGMDILLKLDLPATRRFFDAFFDLEPRYWHGFLSSRLFLPELLVFGLSLFSHASN  498

Query  186   TSRLEIMTKGTLPLVNMINNLLQDID  109
             TSRLEIM KGTLPLVNMINNL+QD D
Sbjct  499   TSRLEIMAKGTLPLVNMINNLVQDTD  524



>gb|AEQ29510.1| lycopene beta cyclase [Citrus sinensis]
Length=504

 Score =   823 bits (2126),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 426/504 (85%), Positives = 463/504 (92%), Gaps = 3/504 (1%)
 Frame = -2

Query  1611  MDTLLKTPNELEFLHPHHGFAVKASAFTSLKPQKQEIRIGSWKACRNVGR---VKASSSA  1441
             MDTLLKT N+LEFL   HG   K+S+ +SLK Q QE+R G  K+ +   R   +KASSSA
Sbjct  1     MDTLLKTHNKLEFLPQVHGALEKSSSLSSLKIQNQELRFGLKKSRQKRNRSCFIKASSSA  60

Query  1440  LLELVPVTKKENLDFELPMFEPSKGIvvdlavvgggpaglavaqqVSQAGLSVCSIDPSP  1261
             LLELVP TKKENL+FELPM++PSKG+VVDLAVVGGGPAGLAVAQQVS+AGLSVCSIDPSP
Sbjct  61    LLELVPETKKENLEFELPMYDPSKGLVVDLAVVGGGPAGLAVAQQVSEAGLSVCSIDPSP  120

Query  1260  KLIWPNNYGVWVDEFEAMDLLDCLDTTWSGAMVYIDDRTTKDLDRPYGRVNRKKLKSKMM  1081
             KLIWPNNYGVWVDEFEAMDLLDCLDTTWSGA+V+IDD T KDL+RPYGRVNRK LKSKM+
Sbjct  121   KLIWPNNYGVWVDEFEAMDLLDCLDTTWSGAVVHIDDNTKKDLNRPYGRVNRKLLKSKML  180

Query  1080  QKCITNGVKFHQAKVIKVIHEESKSMLICSDGVTIQATVVLDATGFSRCLVQYDKPYNPG  901
             QKCITNGVKFHQAKVIKVIHEESKS+LIC+DGVTIQA VVLDATGFSRCLVQYDKPYNPG
Sbjct  181   QKCITNGVKFHQAKVIKVIHEESKSLLICNDGVTIQAAVVLDATGFSRCLVQYDKPYNPG  240

Query  900   YQVAYGILAEVEEHPYDLNKMVFMDWRDSHLNSNLELKERNKRIPTFLYAMPFSSTRIFL  721
             Y+VAYGILAEVEEHP+DL+KMVFMDWRD HLN+N ELKE N +IPTFLYAMPFSS RIFL
Sbjct  241   YRVAYGILAEVEEHPFDLDKMVFMDWRDPHLNNNSELKEANSKIPTFLYAMPFSSNRIFL  300

Query  720   EETSLVARPGLDMKDIQERMVARLRHLGINVKSIEEDERCVIPMGGPLPVIPQRVVGIGG  541
             EETSLVARPG+ MKDIQERMVARL+HLGI VKSIEEDE CVIPMGGPLPV+PQRVVGIGG
Sbjct  301   EETSLVARPGVPMKDIQERMVARLKHLGIKVKSIEEDEHCVIPMGGPLPVLPQRVVGIGG  360

Query  540   TAGMVHPSTGYMVARTLAAAPVVANAIIQYLGSERSLLGNELSASVWKDLWPIERRRQRE  361
             TAGMVHPSTGYMVARTLAAAP+VANAI++ L S+RS+ G++LSA VWKDLWPIERRRQRE
Sbjct  361   TAGMVHPSTGYMVARTLAAAPIVANAIVRSLSSDRSISGHKLSAEVWKDLWPIERRRQRE  420

Query  360   FFCFGMDILLKLDLPATRRFFDAFFDLEPRYWHGFLSSRLFLRELIFFGLSLFSHASNTS  181
             FFCFGMDILLKLDLPATRRFFDAFFDLEPRYWHGFLSSRLFL +L+ FGLSLFSHASNTS
Sbjct  421   FFCFGMDILLKLDLPATRRFFDAFFDLEPRYWHGFLSSRLFLPKLLVFGLSLFSHASNTS  480

Query  180   RLEIMTKGTLPLVNMINNLLQDID  109
             RLEIM KGTLPLVNMINNL+QD D
Sbjct  481   RLEIMAKGTLPLVNMINNLVQDTD  504



>ref|XP_009341957.1| PREDICTED: lycopene beta cyclase, chloroplastic/chromoplastic 
[Pyrus x bretschneideri]
Length=504

 Score =   823 bits (2125),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 414/504 (82%), Positives = 462/504 (92%), Gaps = 3/504 (1%)
 Frame = -2

Query  1611  MDTLLKTPNELEFLHPHHGFAVKASAFTSLKPQKQEIRIGSWKACRNVGR---VKASSSA  1441
             MDTLLKT N+L FLHP HGF+ K S+ +S K + +E R G  ++  N+ R   VKASSSA
Sbjct  1     MDTLLKTHNKLAFLHPIHGFSEKLSSSSSSKLRNEEFRYGLRRSRVNLSRGGVVKASSSA  60

Query  1440  LLELVPVTKKENLDFELPMFEPSKGIvvdlavvgggpaglavaqqVSQAGLSVCSIDPSP  1261
             LLELVP TKKE+L+FELP+++PSKG+VVDLAVVGGGPAGLAVAQQVS+AGLSVCSIDPSP
Sbjct  61    LLELVPETKKESLEFELPLYDPSKGLVVDLAVVGGGPAGLAVAQQVSEAGLSVCSIDPSP  120

Query  1260  KLIWPNNYGVWVDEFEAMDLLDCLDTTWSGAMVYIDDRTTKDLDRPYGRVNRKKLKSKMM  1081
             KLIWPNNYGVWVDEFEAMD+LDCLDTTWSGA+VYID+ + KDL+RPYGRVNRK+LKSKM+
Sbjct  121   KLIWPNNYGVWVDEFEAMDMLDCLDTTWSGAVVYIDEESKKDLNRPYGRVNRKQLKSKML  180

Query  1080  QKCITNGVKFHQAKVIKVIHEESKSMLICSDGVTIQATVVLDATGFSRCLVQYDKPYNPG  901
             QKCI+NGVKFHQAKV KVIHEE KS+L C+DGVTIQA+VVLDATGFSRCLVQYDKPYNPG
Sbjct  181   QKCISNGVKFHQAKVTKVIHEEEKSLLTCNDGVTIQASVVLDATGFSRCLVQYDKPYNPG  240

Query  900   YQVAYGILAEVEEHPYDLNKMVFMDWRDSHLNSNLELKERNKRIPTFLYAMPFSSTRIFL  721
             YQVAYGILAEVEEHP+D++KM+FMDWRDSHLN+N+ELKERN RIPTFLYAMPFSS +IFL
Sbjct  241   YQVAYGILAEVEEHPFDVDKMLFMDWRDSHLNNNVELKERNGRIPTFLYAMPFSSNKIFL  300

Query  720   EETSLVARPGLDMKDIQERMVARLRHLGINVKSIEEDERCVIPMGGPLPVIPQRVVGIGG  541
             EETSLVARPGL MKDIQERM ARL+HLGI VKSIEEDE CVIPMGGPLPV+PQRVVGIGG
Sbjct  301   EETSLVARPGLPMKDIQERMAARLKHLGIKVKSIEEDEHCVIPMGGPLPVLPQRVVGIGG  360

Query  540   TAGMVHPSTGYMVARTLAAAPVVANAIIQYLGSERSLLGNELSASVWKDLWPIERRRQRE  361
             TAGMVHPSTGYMVARTLAAAP+VANAI+QYLGS+R+L GNE+SA +WKDLWPI+RRRQRE
Sbjct  361   TAGMVHPSTGYMVARTLAAAPIVANAIVQYLGSDRTLSGNEVSAEIWKDLWPIQRRRQRE  420

Query  360   FFCFGMDILLKLDLPATRRFFDAFFDLEPRYWHGFLSSRLFLRELIFFGLSLFSHASNTS  181
             FFCFGM ILLKLDL  TRRFF+AFFDLEPRYWHGFLSSRLFL +L+FFGLSLFSHASN S
Sbjct  421   FFCFGMAILLKLDLKGTRRFFNAFFDLEPRYWHGFLSSRLFLPDLVFFGLSLFSHASNAS  480

Query  180   RLEIMTKGTLPLVNMINNLLQDID  109
             R+EIM KGT PLV MINNL+QD D
Sbjct  481   RIEIMAKGTPPLVKMINNLIQDRD  504



>ref|XP_003625025.1| Lycopene beta-cyclase [Medicago truncatula]
 gb|ABN07986.1| NAD-binding site [Medicago truncatula]
 gb|AES81243.1| chromoplast lycopene beta-cyclase [Medicago truncatula]
Length=498

 Score =   822 bits (2124),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 414/500 (83%), Positives = 460/500 (92%), Gaps = 5/500 (1%)
 Frame = -2

Query  1611  MDTLLKTPNELEFLHPHHGFAVKASAFT-SLKPQKQEIRIGSWKACRNVGRVKASSSALL  1435
             MDTLLKTPN+L+FLHP HG++ K S F+ S K Q   +R  S K       ++ASSSALL
Sbjct  1     MDTLLKTPNKLQFLHPLHGYSEKLSHFSASDKLQNHVVRFSSKKK----PVLRASSSALL  56

Query  1434  ELVPVTKKENLDFELPMFEPSKGIvvdlavvgggpaglavaqqVSQAGLSVCSIDPSPKL  1255
             ELVP  KKENLDFELP+++ +KG VVDL VVGGGPAGLAVAQQVS+AGLSVC+IDP+P+L
Sbjct  57    ELVPEFKKENLDFELPLYDSTKGTVVDLVVVGGGPAGLAVAQQVSEAGLSVCAIDPNPRL  116

Query  1254  IWPNNYGVWVDEFEAMDLLDCLDTTWSGAMVYIDDRTTKDLDRPYGRVNRKKLKSKMMQK  1075
             IWPNNYGVWVDEFEAMDLLDCLD TWSGA+VYIDD+T KDLDRPYGRVNRK LKSKM+QK
Sbjct  117   IWPNNYGVWVDEFEAMDLLDCLDKTWSGAVVYIDDKTKKDLDRPYGRVNRKLLKSKMLQK  176

Query  1074  CITNGVKFHQAKVIKVIHEESKSMLICSDGVTIQATVVLDATGFSRCLVQYDKPYNPGYQ  895
             CI NGVKFHQAKVIKVIHEESKSMLIC+DGVT+QATVVLDATGFSRCLVQYDKPYNPGYQ
Sbjct  177   CIANGVKFHQAKVIKVIHEESKSMLICNDGVTVQATVVLDATGFSRCLVQYDKPYNPGYQ  236

Query  894   VAYGILAEVEEHPYDLNKMVFMDWRDSHLNSNLELKERNKRIPTFLYAMPFSSTRIFLEE  715
             VAYGILAEVEEHP+D++KM+FMDWRDSHL+++L+LKERN +IPTFLYAMPFSST+IFLEE
Sbjct  237   VAYGILAEVEEHPFDVDKMLFMDWRDSHLDNDLKLKERNSKIPTFLYAMPFSSTKIFLEE  296

Query  714   TSLVARPGLDMKDIQERMVARLRHLGINVKSIEEDERCVIPMGGPLPVIPQRVVGIGGTA  535
             TSLVARPGL M DIQ+RMVARL+HLGINVKSIEEDE+CVIPMGGPLPV+PQRVVGIGGTA
Sbjct  297   TSLVARPGLRMDDIQDRMVARLKHLGINVKSIEEDEQCVIPMGGPLPVLPQRVVGIGGTA  356

Query  534   GMVHPSTGYMVARTLAAAPVVANAIIQYLGSERSLLGNELSASVWKDLWPIERRRQREFF  355
             GMVHPSTGYMVARTLAAAP+VANAI+QYLGS+R LLG+E+SA VWKDLWPIERRRQREFF
Sbjct  357   GMVHPSTGYMVARTLAAAPIVANAIVQYLGSDRGLLGDEVSARVWKDLWPIERRRQREFF  416

Query  354   CFGMDILLKLDLPATRRFFDAFFDLEPRYWHGFLSSRLFLRELIFFGLSLFSHASNTSRL  175
             CFGMD+LLKLDLP TRRFFDAFF+LEP YWHGFLSSRL+L EL  FGLSLFS+ASNTSRL
Sbjct  417   CFGMDVLLKLDLPGTRRFFDAFFNLEPHYWHGFLSSRLYLPELFTFGLSLFSYASNTSRL  476

Query  174   EIMTKGTLPLVNMINNLLQD  115
             EIM KGTLPLVNM+NNL+QD
Sbjct  477   EIMAKGTLPLVNMVNNLIQD  496



>ref|XP_007162104.1| hypothetical protein PHAVU_001G124400g [Phaseolus vulgaris]
 gb|ESW34098.1| hypothetical protein PHAVU_001G124400g [Phaseolus vulgaris]
Length=507

 Score =   823 bits (2125),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 413/508 (81%), Positives = 462/508 (91%), Gaps = 9/508 (2%)
 Frame = -2

Query  1614  VMDTLLKTPNELEFLHPHHGFAVKASAFTSLKPQKQEIRIGS------WKACRNVGRVKA  1453
              MDTLLKTPN+LEFLHP HG++ K S+  S + Q Q+ R GS      W  C   G ++A
Sbjct  3     AMDTLLKTPNKLEFLHPLHGYSEKLSSSGSSRVQNQDFRFGSKKSLVRWGKC---GGLRA  59

Query  1452  SSSALLELVPVTKKENLDFELPMFEPSKGIvvdlavvgggpaglavaqqVSQAGLSVCSI  1273
             S SALLELVP  KKENLDFELP+++ SKG VVDLAVVGGGPAGLAVAQQVS+AGLSVC+I
Sbjct  60    SCSALLELVPEFKKENLDFELPLYDSSKGAVVDLAVVGGGPAGLAVAQQVSEAGLSVCAI  119

Query  1272  DPSPKLIWPNNYGVWVDEFEAMDLLDCLDTTWSGAMVYIDDRTTKDLDRPYGRVNRKKLK  1093
             DP+P+LIWPNNYGVWVDEFEAMDLLDCLDTTWSGA+VYIDD+T KDLDRPYGRVNRK LK
Sbjct  120   DPNPRLIWPNNYGVWVDEFEAMDLLDCLDTTWSGAVVYIDDKTKKDLDRPYGRVNRKLLK  179

Query  1092  SKMMQKCITNGVKFHQAKVIKVIHEESKSMLICSDGVTIQATVVLDATGFSRCLVQYDKP  913
             SKMMQKCI+NGVKFHQAKVIK+IHE++KS+LIC+DGVT+QATVVLDATGFSRCLVQYDKP
Sbjct  180   SKMMQKCISNGVKFHQAKVIKIIHEDTKSLLICNDGVTVQATVVLDATGFSRCLVQYDKP  239

Query  912   YNPGYQVAYGILAEVEEHPYDLNKMVFMDWRDSHLNSNLELKERNKRIPTFLYAMPFSST  733
             YNPGYQVAYGILAEV+EHPYD++KM+FMDWRDSHL+++ ELK+RN RIPTFLYAMPFSST
Sbjct  240   YNPGYQVAYGILAEVDEHPYDVDKMLFMDWRDSHLDNDKELKQRNSRIPTFLYAMPFSST  299

Query  732   RIFLEETSLVARPGLDMKDIQERMVARLRHLGINVKSIEEDERCVIPMGGPLPVIPQRVV  553
             +IFLEETSLVARPGL M+DIQERMVARL+HLGI VKSIEEDE CVIPMGGPLPV+PQRVV
Sbjct  300   KIFLEETSLVARPGLRMEDIQERMVARLKHLGIRVKSIEEDEHCVIPMGGPLPVLPQRVV  359

Query  552   GIGGTAGMVHPSTGYMVARTLAAAPVVANAIIQYLGSERSLLGNELSASVWKDLWPIERR  373
             GIGGTAGMVHPSTGYMVARTLAAAP+VANAI+Q LGS+R L G ++SA VWKDLWPI+RR
Sbjct  360   GIGGTAGMVHPSTGYMVARTLAAAPIVANAIVQSLGSDRGLSGGDISAQVWKDLWPIQRR  419

Query  372   RQREFFCFGMDILLKLDLPATRRFFDAFFDLEPRYWHGFLSSRLFLRELIFFGLSLFSHA  193
             RQREFFCFGMDILLKLDLP TRRFFDAFFDLEP YWHGFLSSRLFL EL+FFGLSLFS+A
Sbjct  420   RQREFFCFGMDILLKLDLPGTRRFFDAFFDLEPHYWHGFLSSRLFLPELLFFGLSLFSYA  479

Query  192   SNTSRLEIMTKGTLPLVNMINNLLQDID  109
             SNTSR+EIM KGTLPL NMI+NL++D +
Sbjct  480   SNTSRIEIMAKGTLPLANMISNLVKDTE  507



>gb|AEQ29517.1| lycopene beta cyclase [Citrus x paradisi]
Length=504

 Score =   822 bits (2123),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 425/504 (84%), Positives = 461/504 (91%), Gaps = 3/504 (1%)
 Frame = -2

Query  1611  MDTLLKTPNELEFLHPHHGFAVKASAFTSLKPQKQEIRIGSWKACRNVGR---VKASSSA  1441
             MDTLLKT N+LEFL   HG   K+S+ +SLK Q QE+R G  K+ +   R   +KASSSA
Sbjct  1     MDTLLKTHNKLEFLPQVHGALEKSSSLSSLKIQNQELRFGLKKSRQKRNRSCFIKASSSA  60

Query  1440  LLELVPVTKKENLDFELPMFEPSKGIvvdlavvgggpaglavaqqVSQAGLSVCSIDPSP  1261
             LLEL P TKKENL+FELPM++PSKG+VVDLAVVGGGPAGLAVAQQVS AGLSVCSIDPSP
Sbjct  61    LLELAPETKKENLEFELPMYDPSKGLVVDLAVVGGGPAGLAVAQQVSGAGLSVCSIDPSP  120

Query  1260  KLIWPNNYGVWVDEFEAMDLLDCLDTTWSGAMVYIDDRTTKDLDRPYGRVNRKKLKSKMM  1081
             KLIWPNNYGVWVDEFEAMDLLDCLDTTWSGA+V+IDD T KDL+RPYGRVNRK LKSKM+
Sbjct  121   KLIWPNNYGVWVDEFEAMDLLDCLDTTWSGAVVHIDDNTKKDLNRPYGRVNRKLLKSKML  180

Query  1080  QKCITNGVKFHQAKVIKVIHEESKSMLICSDGVTIQATVVLDATGFSRCLVQYDKPYNPG  901
             QKCITNGVKFHQAKVIKVIHEESKS+LIC+DGVTIQA VVLDATGFSRCLVQYDKPYNPG
Sbjct  181   QKCITNGVKFHQAKVIKVIHEESKSLLICNDGVTIQAAVVLDATGFSRCLVQYDKPYNPG  240

Query  900   YQVAYGILAEVEEHPYDLNKMVFMDWRDSHLNSNLELKERNKRIPTFLYAMPFSSTRIFL  721
             YQVAYGILAEVE+HP+DL+KMVFMDWRDSHLN+N +LKE N +IPTFLYAMPFSS RIFL
Sbjct  241   YQVAYGILAEVEQHPFDLDKMVFMDWRDSHLNNNSQLKEANSKIPTFLYAMPFSSNRIFL  300

Query  720   EETSLVARPGLDMKDIQERMVARLRHLGINVKSIEEDERCVIPMGGPLPVIPQRVVGIGG  541
             EETSLVARPG+ MKDIQERMVARL+HLGI VKSIE DE CVIPMGGPLPV+PQRVVGIGG
Sbjct  301   EETSLVARPGVPMKDIQERMVARLKHLGIKVKSIEGDEHCVIPMGGPLPVLPQRVVGIGG  360

Query  540   TAGMVHPSTGYMVARTLAAAPVVANAIIQYLGSERSLLGNELSASVWKDLWPIERRRQRE  361
             TAGMVHPSTGYMVARTLAAAP+VANAI++ L S+RS+ G++LSA VWKDLWPIERRRQRE
Sbjct  361   TAGMVHPSTGYMVARTLAAAPIVANAIVRSLSSDRSISGHKLSAEVWKDLWPIERRRQRE  420

Query  360   FFCFGMDILLKLDLPATRRFFDAFFDLEPRYWHGFLSSRLFLRELIFFGLSLFSHASNTS  181
             FFCFGMDILLKLDLPATRRFFDAFFDLEPRYWHGFLSSRLFL EL+ FGLSLFSHASNTS
Sbjct  421   FFCFGMDILLKLDLPATRRFFDAFFDLEPRYWHGFLSSRLFLPELLVFGLSLFSHASNTS  480

Query  180   RLEIMTKGTLPLVNMINNLLQDID  109
             RLEIM KGTLPLVNMINNL+QD D
Sbjct  481   RLEIMAKGTLPLVNMINNLVQDTD  504



>gb|ABD91578.1| lycopene beta-cyclase [Carica papaya]
Length=503

 Score =   822 bits (2122),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 424/505 (84%), Positives = 463/505 (92%), Gaps = 6/505 (1%)
 Frame = -2

Query  1611  MDTLLKTPNELEFLHPHHGFAVKASAFTSLKPQKQEIRIGS----WKACRNVGRVKASSS  1444
             MDTLLKT N+LEFL   HGF+ K+S+ +S + Q  E+R G     WK  R+ G +KAS+S
Sbjct  1     MDTLLKTHNKLEFLPQLHGFSEKSSS-SSSRLQNPELRFGPKKYPWKRGRD-GCLKASNS  58

Query  1443  ALLELVPVTKKENLDFELPMFEPSKGIvvdlavvgggpaglavaqqVSQAGLSVCSIDPS  1264
             ALLELVP TKKE LDFELPM++PSKG+VVDLAVVGGGPAGLAVAQQVSQAGLSVCSIDPS
Sbjct  59    ALLELVPETKKETLDFELPMYDPSKGLVVDLAVVGGGPAGLAVAQQVSQAGLSVCSIDPS  118

Query  1263  PKLIWPNNYGVWVDEFEAMDLLDCLDTTWSGAMVYIDDRTTKDLDRPYGRVNRKKLKSKM  1084
             PKLIWPNNYGVWVDEFEAMDLLDCLDTTWSGA+VYIDD++ KDLDRPYGRVNRK+LKSKM
Sbjct  119   PKLIWPNNYGVWVDEFEAMDLLDCLDTTWSGAVVYIDDKSKKDLDRPYGRVNRKQLKSKM  178

Query  1083  MQKCITNGVKFHQAKVIKVIHEESKSMLICSDGVTIQATVVLDATGFSRCLVQYDKPYNP  904
             +QKCI NGVKFHQAKVIK IHEESKS+LIC+DGVTIQATVVLDATGFSRCLVQYD+PYNP
Sbjct  179   LQKCIANGVKFHQAKVIKAIHEESKSLLICNDGVTIQATVVLDATGFSRCLVQYDRPYNP  238

Query  903   GYQVAYGILAEVEEHPYDLNKMVFMDWRDSHLNSNLELKERNKRIPTFLYAMPFSSTRIF  724
             GYQVAYGILAEVE+HP+D+NKMVFMDWRDSHLNSN ELKERN RIPTFLYAMPFSS RIF
Sbjct  239   GYQVAYGILAEVEKHPFDVNKMVFMDWRDSHLNSNTELKERNSRIPTFLYAMPFSSNRIF  298

Query  723   LEETSLVARPGLDMKDIQERMVARLRHLGINVKSIEEDERCVIPMGGPLPVIPQRVVGIG  544
             LEETSLVARPGL M+DIQERMVARL HLG+ V SIEEDE CVIPMGGPLPV+PQRV+GIG
Sbjct  299   LEETSLVARPGLRMEDIQERMVARLTHLGVKVISIEEDEHCVIPMGGPLPVLPQRVIGIG  358

Query  543   GTAGMVHPSTGYMVARTLAAAPVVANAIIQYLGSERSLLGNELSASVWKDLWPIERRRQR  364
             GTAGMVHPSTGYMVARTLAAAPVVA++I+++L S+ SLLG+ELSA VWKDLWPIERRRQR
Sbjct  359   GTAGMVHPSTGYMVARTLAAAPVVADSIVRFLDSDGSLLGDELSAEVWKDLWPIERRRQR  418

Query  363   EFFCFGMDILLKLDLPATRRFFDAFFDLEPRYWHGFLSSRLFLRELIFFGLSLFSHASNT  184
             EFFCFGMDILLKLDL ATRRFF+AFFDL+P YWHGFLSSRLFL ELIFFGLSLFSHASNT
Sbjct  419   EFFCFGMDILLKLDLQATRRFFNAFFDLKPHYWHGFLSSRLFLPELIFFGLSLFSHASNT  478

Query  183   SRLEIMTKGTLPLVNMINNLLQDID  109
             SR+EIM KGTLPLV MINNL+QD D
Sbjct  479   SRIEIMAKGTLPLVKMINNLIQDRD  503



>ref|NP_001275849.1| lycopene beta-cyclase 1 [Citrus sinensis]
 gb|ACP19703.1| lycopene beta-cyclase 1 [Citrus sinensis]
Length=504

 Score =   821 bits (2120),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 427/504 (85%), Positives = 463/504 (92%), Gaps = 3/504 (1%)
 Frame = -2

Query  1611  MDTLLKTPNELEFLHPHHGFAVKASAFTSLKPQKQEIRIGSWKA--CRNVG-RVKASSSA  1441
             MDT+LKT N+LEFL   HG   K+S+ +SLK Q QE+R G  K+   RN+   +KASSSA
Sbjct  1     MDTVLKTHNKLEFLPQVHGALEKSSSLSSLKIQNQELRFGLKKSRQKRNMSCFIKASSSA  60

Query  1440  LLELVPVTKKENLDFELPMFEPSKGIvvdlavvgggpaglavaqqVSQAGLSVCSIDPSP  1261
             LLELVP TKKENL+FELPM++PSKG+VVDLAVVGGGPAGLAVAQQVS+AGLSVCSIDPSP
Sbjct  61    LLELVPETKKENLEFELPMYDPSKGLVVDLAVVGGGPAGLAVAQQVSEAGLSVCSIDPSP  120

Query  1260  KLIWPNNYGVWVDEFEAMDLLDCLDTTWSGAMVYIDDRTTKDLDRPYGRVNRKKLKSKMM  1081
             KLIWPNNYGVWVDEFEAMDLLDCLDTTWSGA+V+IDD T KDLDRPYGRVNRK LKSKM+
Sbjct  121   KLIWPNNYGVWVDEFEAMDLLDCLDTTWSGAVVHIDDNTKKDLDRPYGRVNRKLLKSKML  180

Query  1080  QKCITNGVKFHQAKVIKVIHEESKSMLICSDGVTIQATVVLDATGFSRCLVQYDKPYNPG  901
             QKCITNGVKFHQAKVIKVIHEESKS+LIC+DGVTIQA VVLDATGFSRCLVQYD PYNPG
Sbjct  181   QKCITNGVKFHQAKVIKVIHEESKSLLICNDGVTIQAAVVLDATGFSRCLVQYDNPYNPG  240

Query  900   YQVAYGILAEVEEHPYDLNKMVFMDWRDSHLNSNLELKERNKRIPTFLYAMPFSSTRIFL  721
             YQVAYGILAEVEEHP+DL+KMVFMDWRDSHLN+N ELKE N +IPTFLYAMPFSS RIFL
Sbjct  241   YQVAYGILAEVEEHPFDLDKMVFMDWRDSHLNNNSELKEANSKIPTFLYAMPFSSNRIFL  300

Query  720   EETSLVARPGLDMKDIQERMVARLRHLGINVKSIEEDERCVIPMGGPLPVIPQRVVGIGG  541
             EETSLVARPG+ MKDIQERMVARL+HLGI V+SIEEDE CVIPMGGPLPV+PQRVVGIGG
Sbjct  301   EETSLVARPGVPMKDIQERMVARLKHLGIKVRSIEEDEHCVIPMGGPLPVLPQRVVGIGG  360

Query  540   TAGMVHPSTGYMVARTLAAAPVVANAIIQYLGSERSLLGNELSASVWKDLWPIERRRQRE  361
             TAGMVHPSTGYMVARTLAAAP+VANAI++ L S+RS+ G++LSA VWKDLWPIERRRQRE
Sbjct  361   TAGMVHPSTGYMVARTLAAAPIVANAIVRSLSSDRSISGHKLSAEVWKDLWPIERRRQRE  420

Query  360   FFCFGMDILLKLDLPATRRFFDAFFDLEPRYWHGFLSSRLFLRELIFFGLSLFSHASNTS  181
             FFCFGMDILLKLDLPATR FFDAFFDLEPRYWHGFLSSRLFL EL+ FGLSLFSHASNTS
Sbjct  421   FFCFGMDILLKLDLPATRWFFDAFFDLEPRYWHGFLSSRLFLPELLVFGLSLFSHASNTS  480

Query  180   RLEIMTKGTLPLVNMINNLLQDID  109
             RLEIM KGTLPLVNMINNL+QD D
Sbjct  481   RLEIMAKGTLPLVNMINNLVQDTD  504



>gb|AEQ29512.1| lycopene beta cyclase [Citrus sinensis]
Length=503

 Score =   820 bits (2119),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 426/503 (85%), Positives = 460/503 (91%), Gaps = 2/503 (0%)
 Frame = -2

Query  1611  MDTLLKTPNELEFLHPHHGFAVKASAFTSLKPQKQEIRIGSWKA--CRNVGRVKASSSAL  1438
             MDTLLKT N+LEFL   HG   K+S+ +SLK Q QE+R G  K+   RN      +SSAL
Sbjct  1     MDTLLKTHNKLEFLPQVHGALEKSSSLSSLKIQNQELRFGLKKSRQKRNRSCFIKASSAL  60

Query  1437  LELVPVTKKENLDFELPMFEPSKGIvvdlavvgggpaglavaqqVSQAGLSVCSIDPSPK  1258
             LELVP TKKENL+FELPM++PSKG+VVDLAVVGGGPAGLAVAQQVS+AGLSVCSIDPSPK
Sbjct  61    LELVPETKKENLEFELPMYDPSKGLVVDLAVVGGGPAGLAVAQQVSEAGLSVCSIDPSPK  120

Query  1257  LIWPNNYGVWVDEFEAMDLLDCLDTTWSGAMVYIDDRTTKDLDRPYGRVNRKKLKSKMMQ  1078
             LIWPNNYGVWVDEFEAMDLLDCLDTTWSGA+V+IDD T KDL+RPYGRVNRK LKSKM+Q
Sbjct  121   LIWPNNYGVWVDEFEAMDLLDCLDTTWSGAVVHIDDNTKKDLNRPYGRVNRKLLKSKMLQ  180

Query  1077  KCITNGVKFHQAKVIKVIHEESKSMLICSDGVTIQATVVLDATGFSRCLVQYDKPYNPGY  898
             KCITNGVKFHQAKVIKVIHEESKS+LIC+DGVTIQA VVLDATGFSRCLVQYDKPYNPGY
Sbjct  181   KCITNGVKFHQAKVIKVIHEESKSLLICNDGVTIQAAVVLDATGFSRCLVQYDKPYNPGY  240

Query  897   QVAYGILAEVEEHPYDLNKMVFMDWRDSHLNSNLELKERNKRIPTFLYAMPFSSTRIFLE  718
             QVAYGILAEVEEHP+DL+KMVFMDWRDSHLN+N ELKE N +IPTFLYAMPFSS RIFLE
Sbjct  241   QVAYGILAEVEEHPFDLDKMVFMDWRDSHLNNNSELKEANSKIPTFLYAMPFSSNRIFLE  300

Query  717   ETSLVARPGLDMKDIQERMVARLRHLGINVKSIEEDERCVIPMGGPLPVIPQRVVGIGGT  538
             ETSLVAR G+ MKDIQERMVARL+HLGI VKSIEEDE CVIPMGGPLPV+PQRVVGIGGT
Sbjct  301   ETSLVARSGVPMKDIQERMVARLKHLGIKVKSIEEDEHCVIPMGGPLPVLPQRVVGIGGT  360

Query  537   AGMVHPSTGYMVARTLAAAPVVANAIIQYLGSERSLLGNELSASVWKDLWPIERRRQREF  358
             AGMVHPSTGYMVARTLAAAP+VANAI++ L S+RS+ G++LSA VWKDLWPIERRRQREF
Sbjct  361   AGMVHPSTGYMVARTLAAAPIVANAIVRSLSSDRSISGHKLSAEVWKDLWPIERRRQREF  420

Query  357   FCFGMDILLKLDLPATRRFFDAFFDLEPRYWHGFLSSRLFLRELIFFGLSLFSHASNTSR  178
             FCFGMDILLKLDLPATRRFFDAFFDLEPRYWHGFLSSRLFL EL+ FGLSLFSHASNTSR
Sbjct  421   FCFGMDILLKLDLPATRRFFDAFFDLEPRYWHGFLSSRLFLPELLVFGLSLFSHASNTSR  480

Query  177   LEIMTKGTLPLVNMINNLLQDID  109
             LEIM KGTLPLVNMINNL+QD D
Sbjct  481   LEIMAKGTLPLVNMINNLVQDTD  503



>ref|XP_011075396.1| PREDICTED: lycopene beta cyclase, chloroplastic/chromoplastic 
[Sesamum indicum]
Length=504

 Score =   820 bits (2118),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 425/502 (85%), Positives = 460/502 (92%), Gaps = 3/502 (1%)
 Frame = -2

Query  1611  MDTLLKTPNELEFLHPHHGFAVKASAFTSLKPQKQEIRIGSWKACRNVGR---VKASSSA  1441
             MDTLLK  N+LEFLHP HGFA K  AF SLK Q  E +    K+   + +   VKASSS 
Sbjct  1     MDTLLKIHNKLEFLHPVHGFADKVGAFGSLKTQNLEPKFHYKKSHIKLSKGFCVKASSST  60

Query  1440  LLELVPVTKKENLDFELPMFEPSKGIvvdlavvgggpaglavaqqVSQAGLSVCSIDPSP  1261
             LLELVP TKKENL+F+LPM++PSK  VVDLAVVGGGPAGLAVAQQVS+AGLSVCSIDPSP
Sbjct  61    LLELVPETKKENLEFDLPMYDPSKNRVVDLAVVGGGPAGLAVAQQVSEAGLSVCSIDPSP  120

Query  1260  KLIWPNNYGVWVDEFEAMDLLDCLDTTWSGAMVYIDDRTTKDLDRPYGRVNRKKLKSKMM  1081
             KLIWPNNYGVWVDEFEAMDLLDCLDTTWSGA+VYIDD+TTKDLDRPYGRVNRK+LKSKMM
Sbjct  121   KLIWPNNYGVWVDEFEAMDLLDCLDTTWSGAVVYIDDKTTKDLDRPYGRVNRKQLKSKMM  180

Query  1080  QKCITNGVKFHQAKVIKVIHEESKSMLICSDGVTIQATVVLDATGFSRCLVQYDKPYNPG  901
             QKCI+NGVKFHQAKV+KVIHEE KS+LIC+DGVTIQA VVLDATGFSRCLVQYDKPYNPG
Sbjct  181   QKCISNGVKFHQAKVVKVIHEELKSLLICNDGVTIQAAVVLDATGFSRCLVQYDKPYNPG  240

Query  900   YQVAYGILAEVEEHPYDLNKMVFMDWRDSHLNSNLELKERNKRIPTFLYAMPFSSTRIFL  721
             YQVAYGILAEVEEHP+D NKMVFMDWRDSHLN+N ELKERN++IPTFLYAMPFSS RIFL
Sbjct  241   YQVAYGILAEVEEHPFDTNKMVFMDWRDSHLNNNKELKERNRKIPTFLYAMPFSSQRIFL  300

Query  720   EETSLVARPGLDMKDIQERMVARLRHLGINVKSIEEDERCVIPMGGPLPVIPQRVVGIGG  541
             EETSLVARPG+ MKDIQERMVARL HLGI VKSIEEDE CVIPMGGPLPV+PQRVVGIGG
Sbjct  301   EETSLVARPGVPMKDIQERMVARLSHLGIKVKSIEEDEHCVIPMGGPLPVLPQRVVGIGG  360

Query  540   TAGMVHPSTGYMVARTLAAAPVVANAIIQYLGSERSLLGNELSASVWKDLWPIERRRQRE  361
             TAGMVHPSTGYMVARTLAAAP+VANAI+QYLGS R +LG++LSA VWKDLWPIERRRQRE
Sbjct  361   TAGMVHPSTGYMVARTLAAAPIVANAIVQYLGSNRGILGDDLSAEVWKDLWPIERRRQRE  420

Query  360   FFCFGMDILLKLDLPATRRFFDAFFDLEPRYWHGFLSSRLFLRELIFFGLSLFSHASNTS  181
             FFCFGMD+LLKLDL +TRRFF+AFFDLEPRYWHGFLSSRLFL +L+ FGLSLFSHASNTS
Sbjct  421   FFCFGMDVLLKLDLHSTRRFFNAFFDLEPRYWHGFLSSRLFLPDLLLFGLSLFSHASNTS  480

Query  180   RLEIMTKGTLPLVNMINNLLQD  115
             RLEIM KGT+PLVNMINNL+QD
Sbjct  481   RLEIMAKGTVPLVNMINNLIQD  502



>dbj|BAA88839.1| phytoene cyclase [Gentiana lutea]
Length=508

 Score =   820 bits (2119),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 416/510 (82%), Positives = 453/510 (89%), Gaps = 15/510 (3%)
 Frame = -2

Query  1611  MDTLLKTPNELEFLHPHHGFAVKASAFTSLKPQKQE----------IRIGSWKA-CRNVG  1465
             MDTL+KTPN+LEFLHP  GF  K   F+ L+   QE          ++ GS K  C   G
Sbjct  1     MDTLVKTPNKLEFLHPLRGFVDKVCTFSCLRSHNQEYNKYFLKKSHLKTGSKKGFCVKAG  60

Query  1464  RVKASSSALLELVPVTKKENLDFELPMFEPSKGIvvdlavvgggpaglavaqqVSQAGLS  1285
                 SSSA+LELVP TKKENL+FELP+F+ SKGIVVDLA+VGGGPAGLAVAQQVS AGLS
Sbjct  61    ----SSSAILELVPETKKENLEFELPLFDHSKGIVVDLAIVGGGPAGLAVAQQVSAAGLS  116

Query  1284  VCSIDPSPKLIWPNNYGVWVDEFEAMDLLDCLDTTWSGAMVYIDDRTTKDLDRPYGRVNR  1105
             VCSIDPSPKLIWPNNYGVWVDEFEAMDLLDCLD TWSGA+V+IDD  +KDL RPYGRVNR
Sbjct  117   VCSIDPSPKLIWPNNYGVWVDEFEAMDLLDCLDATWSGAVVFIDDHKSKDLGRPYGRVNR  176

Query  1104  KKLKSKMMQKCITNGVKFHQAKVIKVIHEESKSMLICSDGVTIQATVVLDATGFSRCLVQ  925
             K+LK KMMQKC +NGVKFHQAKV+KVIHEESKS++IC+DG+TIQA VVLDATGFSRCLVQ
Sbjct  177   KQLKLKMMQKCTSNGVKFHQAKVMKVIHEESKSLVICNDGITIQAAVVLDATGFSRCLVQ  236

Query  924   YDKPYNPGYQVAYGILAEVEEHPYDLNKMVFMDWRDSHLNSNLELKERNKRIPTFLYAMP  745
             YDKPYNPGYQVAYGILAEVEEHP+D+NKMVFMDWRDSHLN+N ELKERN+++PTFLYAMP
Sbjct  237   YDKPYNPGYQVAYGILAEVEEHPFDINKMVFMDWRDSHLNNNTELKERNRKVPTFLYAMP  296

Query  744   FSSTRIFLEETSLVARPGLDMKDIQERMVARLRHLGINVKSIEEDERCVIPMGGPLPVIP  565
             FS  RIFLEETSLVARPGL ++DIQERMVARLRHLGI VKSIEEDERCVIPMGGPLPVIP
Sbjct  297   FSKGRIFLEETSLVARPGLAIEDIQERMVARLRHLGIKVKSIEEDERCVIPMGGPLPVIP  356

Query  564   QRVVGIGGTAGMVHPSTGYMVARTLAAAPVVANAIIQYLGSERSLLGNELSASVWKDLWP  385
             QRVVGIGGTAGMVHPSTGYMVARTLAAAP+VANAI++YLGSE+  LG ELS  VWKDLWP
Sbjct  357   QRVVGIGGTAGMVHPSTGYMVARTLAAAPIVANAIVRYLGSEKRHLGAELSGEVWKDLWP  416

Query  384   IERRRQREFFCFGMDILLKLDLPATRRFFDAFFDLEPRYWHGFLSSRLFLRELIFFGLSL  205
             IERRRQREFFCFGMDILLKLDL A RRFFDAFFDLEPRYWHGFLSSRLFL EL  FGLSL
Sbjct  417   IERRRQREFFCFGMDILLKLDLDALRRFFDAFFDLEPRYWHGFLSSRLFLPELALFGLSL  476

Query  204   FSHASNTSRLEIMTKGTLPLVNMINNLLQD  115
             FSHA+NTSRLEIM+KGTLPL+NMINNLL+D
Sbjct  477   FSHATNTSRLEIMSKGTLPLINMINNLLRD  506



>gb|AEQ29515.1| lycopene beta cyclase [Citrus x paradisi]
Length=504

 Score =   819 bits (2115),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 425/504 (84%), Positives = 461/504 (91%), Gaps = 3/504 (1%)
 Frame = -2

Query  1611  MDTLLKTPNELEFLHPHHGFAVKASAFTSLKPQKQEIRIGSWKACRNVGR---VKASSSA  1441
             MDTLLKT N+LEFL   HG   K+S+ +SLK Q QE+R G  K+ +   R   +KASSSA
Sbjct  1     MDTLLKTHNKLEFLPQVHGALEKSSSLSSLKIQNQELRFGLKKSRQKRNRSCFIKASSSA  60

Query  1440  LLELVPVTKKENLDFELPMFEPSKGIvvdlavvgggpaglavaqqVSQAGLSVCSIDPSP  1261
             LLELVP TKKENL+FELPM++PSKG+VV LAVVGGGPAGLAVAQQVS AGLSVCSIDPSP
Sbjct  61    LLELVPETKKENLEFELPMYDPSKGLVVGLAVVGGGPAGLAVAQQVSGAGLSVCSIDPSP  120

Query  1260  KLIWPNNYGVWVDEFEAMDLLDCLDTTWSGAMVYIDDRTTKDLDRPYGRVNRKKLKSKMM  1081
             KLIWPNNYGVWVDEFEAMDLLDCLDTTWSGA+V+IDD T KDL+RPYGRVNRK LKSKM+
Sbjct  121   KLIWPNNYGVWVDEFEAMDLLDCLDTTWSGAVVHIDDNTKKDLNRPYGRVNRKLLKSKML  180

Query  1080  QKCITNGVKFHQAKVIKVIHEESKSMLICSDGVTIQATVVLDATGFSRCLVQYDKPYNPG  901
             QKCITNGVKFHQAKVIKVIHEESKS+LIC+DGVTIQA VVLDATGFSRCLVQYDKPYNPG
Sbjct  181   QKCITNGVKFHQAKVIKVIHEESKSLLICNDGVTIQAAVVLDATGFSRCLVQYDKPYNPG  240

Query  900   YQVAYGILAEVEEHPYDLNKMVFMDWRDSHLNSNLELKERNKRIPTFLYAMPFSSTRIFL  721
             YQVAYGILAEVE+HP+DL+KMVFMDWRDSHLN+N +LKE N +IPTFLYAMPFSS RIFL
Sbjct  241   YQVAYGILAEVEQHPFDLDKMVFMDWRDSHLNNNSQLKEANSKIPTFLYAMPFSSNRIFL  300

Query  720   EETSLVARPGLDMKDIQERMVARLRHLGINVKSIEEDERCVIPMGGPLPVIPQRVVGIGG  541
             EETSLVARPG+ MKDIQERMVARL+HLGI VKSIEEDE CVIPMGGPLPV+PQRVVGIGG
Sbjct  301   EETSLVARPGVPMKDIQERMVARLKHLGIKVKSIEEDEHCVIPMGGPLPVLPQRVVGIGG  360

Query  540   TAGMVHPSTGYMVARTLAAAPVVANAIIQYLGSERSLLGNELSASVWKDLWPIERRRQRE  361
             TAGMVHPSTGYMVARTLAAAP+VANAI++ L S+RS+ G++LSA VWKDLWPIERRRQRE
Sbjct  361   TAGMVHPSTGYMVARTLAAAPIVANAIVRSLSSDRSISGHKLSAEVWKDLWPIERRRQRE  420

Query  360   FFCFGMDILLKLDLPATRRFFDAFFDLEPRYWHGFLSSRLFLRELIFFGLSLFSHASNTS  181
             FFCFGMDILLKLDLPATRRFF AFFDLEPRYWHGFLSSRLFL EL+ FGLSLFSHASNTS
Sbjct  421   FFCFGMDILLKLDLPATRRFFGAFFDLEPRYWHGFLSSRLFLPELLVFGLSLFSHASNTS  480

Query  180   RLEIMTKGTLPLVNMINNLLQDID  109
             RLEIM KGTLPLVNMINNL+QD D
Sbjct  481   RLEIMAKGTLPLVNMINNLVQDTD  504



>ref|XP_010104376.1| Lycopene beta cyclase [Morus notabilis]
 gb|EXC00005.1| Lycopene beta cyclase [Morus notabilis]
Length=502

 Score =   818 bits (2112),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 419/504 (83%), Positives = 454/504 (90%), Gaps = 5/504 (1%)
 Frame = -2

Query  1611  MDTLLKTPNELEFLHPHHGFAVKASAFTSLKPQKQEIRIGSWKACRNVGR---VKASSSA  1441
             MDTLLKT N+LEFLHP  GF+ K     S   + QE+R G  K     GR   VK SSSA
Sbjct  1     MDTLLKTHNKLEFLHPLRGFSEKVG--NSNPSRLQELRFGLKKPNPKWGRTACVKVSSSA  58

Query  1440  LLELVPVTKKENLDFELPMFEPSKGIvvdlavvgggpaglavaqqVSQAGLSVCSIDPSP  1261
             LLELVP TKKENLDFELP+++PSKG+VVDLAVVGGGPAGLAVAQQVS AGLSVC IDPSP
Sbjct  59    LLELVPETKKENLDFELPLYDPSKGLVVDLAVVGGGPAGLAVAQQVSDAGLSVCLIDPSP  118

Query  1260  KLIWPNNYGVWVDEFEAMDLLDCLDTTWSGAMVYIDDRTTKDLDRPYGRVNRKKLKSKMM  1081
             K+IWPNNYGVWVDEFEAMDLLDCLDTTWSGA+V+ID+++ KDL RPYGRVNRK+LKSK+M
Sbjct  119   KVIWPNNYGVWVDEFEAMDLLDCLDTTWSGAVVFIDEKSKKDLGRPYGRVNRKQLKSKVM  178

Query  1080  QKCITNGVKFHQAKVIKVIHEESKSMLICSDGVTIQATVVLDATGFSRCLVQYDKPYNPG  901
             QKCI+NGVKFHQAKVIKVIHEE+KS+LIC+DGVTIQATVVLDATGFSRC VQYD+PYNPG
Sbjct  179   QKCISNGVKFHQAKVIKVIHEEAKSLLICNDGVTIQATVVLDATGFSRCHVQYDEPYNPG  238

Query  900   YQVAYGILAEVEEHPYDLNKMVFMDWRDSHLNSNLELKERNKRIPTFLYAMPFSSTRIFL  721
             YQVAYGILAEV+EHP+D++KMVFMDWRDSHLN+N E+KERN RIPTFLYAMPFSS RIFL
Sbjct  239   YQVAYGILAEVDEHPFDVDKMVFMDWRDSHLNNNKEIKERNSRIPTFLYAMPFSSNRIFL  298

Query  720   EETSLVARPGLDMKDIQERMVARLRHLGINVKSIEEDERCVIPMGGPLPVIPQRVVGIGG  541
             EETSLVARPGL MKDIQERMVARLRHLGINVKSIEEDE CVIPMGGPLPV+PQRVVGIGG
Sbjct  299   EETSLVARPGLAMKDIQERMVARLRHLGINVKSIEEDEHCVIPMGGPLPVLPQRVVGIGG  358

Query  540   TAGMVHPSTGYMVARTLAAAPVVANAIIQYLGSERSLLGNELSASVWKDLWPIERRRQRE  361
             TAGMVHPSTGYMVARTLAAAP+VAN+I+QYLGS  SL G+ELSA VWKDLWPI+RRRQRE
Sbjct  359   TAGMVHPSTGYMVARTLAAAPIVANSIVQYLGSNGSLSGHELSAEVWKDLWPIQRRRQRE  418

Query  360   FFCFGMDILLKLDLPATRRFFDAFFDLEPRYWHGFLSSRLFLRELIFFGLSLFSHASNTS  181
             FFCFGMDILLKLDL  TRRFFDAFFDLEP YWHGFLSSRLFL ELI FGLSLFSHASNT 
Sbjct  419   FFCFGMDILLKLDLQGTRRFFDAFFDLEPHYWHGFLSSRLFLPELILFGLSLFSHASNTC  478

Query  180   RLEIMTKGTLPLVNMINNLLQDID  109
             R+EIM KGTLPL  MINNL+QD D
Sbjct  479   RVEIMAKGTLPLAKMINNLIQDRD  502



>gb|ABK57115.1| lycopene beta-cyclase 2 [Gentiana lutea]
Length=508

 Score =   818 bits (2112),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 415/510 (81%), Positives = 452/510 (89%), Gaps = 15/510 (3%)
 Frame = -2

Query  1611  MDTLLKTPNELEFLHPHHGFAVKASAFTSLKPQKQE----------IRIGSWKA-CRNVG  1465
             MDTL+KTPN+LEFLHP  GF  K   F+ L+   QE          ++ GS K  C   G
Sbjct  1     MDTLVKTPNKLEFLHPLRGFVDKVCTFSCLRSHNQEYNKYFLKKSHLKTGSKKGFCVKAG  60

Query  1464  RVKASSSALLELVPVTKKENLDFELPMFEPSKGIvvdlavvgggpaglavaqqVSQAGLS  1285
                 SSSA+LELVP TKKENL+FELP+F+ SKGIVVDLA+VGGGPAGLAVAQQVS AGLS
Sbjct  61    ----SSSAILELVPETKKENLEFELPLFDHSKGIVVDLAIVGGGPAGLAVAQQVSAAGLS  116

Query  1284  VCSIDPSPKLIWPNNYGVWVDEFEAMDLLDCLDTTWSGAMVYIDDRTTKDLDRPYGRVNR  1105
             VCSIDPSPKLIWPNNYGVWVDEFEAMDLLDCLD TWSGA+V+IDD  +KDL RPYGRVNR
Sbjct  117   VCSIDPSPKLIWPNNYGVWVDEFEAMDLLDCLDATWSGAVVFIDDHKSKDLGRPYGRVNR  176

Query  1104  KKLKSKMMQKCITNGVKFHQAKVIKVIHEESKSMLICSDGVTIQATVVLDATGFSRCLVQ  925
             K+LK KMMQKC +NGVK HQAKV+KVIHEESKS++IC+DG+TIQA VVLDATGFSRCLVQ
Sbjct  177   KQLKLKMMQKCTSNGVKLHQAKVMKVIHEESKSLVICNDGITIQAAVVLDATGFSRCLVQ  236

Query  924   YDKPYNPGYQVAYGILAEVEEHPYDLNKMVFMDWRDSHLNSNLELKERNKRIPTFLYAMP  745
             YDKPYNPGYQVAYGILAEVEEHP+D+NKMVFMDWRDSHLN+N ELKERN+++PTFLYAMP
Sbjct  237   YDKPYNPGYQVAYGILAEVEEHPFDINKMVFMDWRDSHLNNNTELKERNRKVPTFLYAMP  296

Query  744   FSSTRIFLEETSLVARPGLDMKDIQERMVARLRHLGINVKSIEEDERCVIPMGGPLPVIP  565
             FS  RIFLEETSLVARPGL ++DIQERMVARLRHLGI VKSIEEDERCVIPMGGPLPVIP
Sbjct  297   FSKGRIFLEETSLVARPGLAIEDIQERMVARLRHLGIKVKSIEEDERCVIPMGGPLPVIP  356

Query  564   QRVVGIGGTAGMVHPSTGYMVARTLAAAPVVANAIIQYLGSERSLLGNELSASVWKDLWP  385
             QRVVGIGGTAGMVHPSTGYMVARTLAAAP+VANAI++YLGSE+  LG ELS  VWKDLWP
Sbjct  357   QRVVGIGGTAGMVHPSTGYMVARTLAAAPIVANAIVRYLGSEKRHLGAELSGEVWKDLWP  416

Query  384   IERRRQREFFCFGMDILLKLDLPATRRFFDAFFDLEPRYWHGFLSSRLFLRELIFFGLSL  205
             IERRRQREFFCFGMDILLKLDL A RRFFDAFFDLEPRYWHGFLSSRLFL EL  FGLSL
Sbjct  417   IERRRQREFFCFGMDILLKLDLDALRRFFDAFFDLEPRYWHGFLSSRLFLPELALFGLSL  476

Query  204   FSHASNTSRLEIMTKGTLPLVNMINNLLQD  115
             FSHA+NTSRLEIM+KGTLPL+NMINNLL+D
Sbjct  477   FSHATNTSRLEIMSKGTLPLINMINNLLRD  506



>gb|AFP43698.1| lycopene beta-cyclase [Eriobotrya japonica]
Length=504

 Score =   816 bits (2109),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 415/505 (82%), Positives = 457/505 (90%), Gaps = 5/505 (1%)
 Frame = -2

Query  1611  MDTLLKTPNELEFLHPHHGFAVKASAFTSLKPQKQEIRIG----SWKACRNVGRVKASSS  1444
             MDTLLKT N+L FLHP HGF+ K S+ +S K + +E R G      K  RN G VKASSS
Sbjct  1     MDTLLKTHNKLAFLHPIHGFSEKLSSSSSSKLRNEEFRYGLRRSRVKLSRN-GVVKASSS  59

Query  1443  ALLELVPVTKKENLDFELPMFEPSKGIvvdlavvgggpaglavaqqVSQAGLSVCSIDPS  1264
             ALLELVP TKKE+L+FELP+ +PSKG+VVDLAVVGGGPAGLAVAQQVS+AGLSVCSIDPS
Sbjct  60    ALLELVPETKKESLEFELPLHDPSKGLVVDLAVVGGGPAGLAVAQQVSEAGLSVCSIDPS  119

Query  1263  PKLIWPNNYGVWVDEFEAMDLLDCLDTTWSGAMVYIDDRTTKDLDRPYGRVNRKKLKSKM  1084
             PKLIWPNNYGVWVDEFEAMD+LDCLDTTWSGA+VYID+ + KDL+RPYGRVNRK+LKSKM
Sbjct  120   PKLIWPNNYGVWVDEFEAMDMLDCLDTTWSGAVVYIDEESKKDLNRPYGRVNRKQLKSKM  179

Query  1083  MQKCITNGVKFHQAKVIKVIHEESKSMLICSDGVTIQATVVLDATGFSRCLVQYDKPYNP  904
             +QKCI+NGVKFHQAKV KVIHEE KS+L C+DGVTIQA+VVLDATGFSRCLVQYDKPYNP
Sbjct  180   LQKCISNGVKFHQAKVTKVIHEEEKSLLTCNDGVTIQASVVLDATGFSRCLVQYDKPYNP  239

Query  903   GYQVAYGILAEVEEHPYDLNKMVFMDWRDSHLNSNLELKERNKRIPTFLYAMPFSSTRIF  724
             GYQVAYGILAEVEEHP+D++KM+FMDWRDSHLN+N+ELKERN RIPTFLYAMPFSS RIF
Sbjct  240   GYQVAYGILAEVEEHPFDVDKMLFMDWRDSHLNNNIELKERNGRIPTFLYAMPFSSNRIF  299

Query  723   LEETSLVARPGLDMKDIQERMVARLRHLGINVKSIEEDERCVIPMGGPLPVIPQRVVGIG  544
             LEETSLVARPGL MKDIQERM ARL+HLGI VKSIEEDE C IPMGGPLPV+PQRVVGIG
Sbjct  300   LEETSLVARPGLPMKDIQERMAARLKHLGIKVKSIEEDEHCFIPMGGPLPVLPQRVVGIG  359

Query  543   GTAGMVHPSTGYMVARTLAAAPVVANAIIQYLGSERSLLGNELSASVWKDLWPIERRRQR  364
             GT GMVHPSTGYMVARTLAAAP+VANAI+QYLGS+R+L GNE+SA +WKDLWPI+RRRQR
Sbjct  360   GTVGMVHPSTGYMVARTLAAAPIVANAIVQYLGSDRTLSGNEVSAEIWKDLWPIQRRRQR  419

Query  363   EFFCFGMDILLKLDLPATRRFFDAFFDLEPRYWHGFLSSRLFLRELIFFGLSLFSHASNT  184
             EFFCFGM ILLKLDL  TRRFF+AFFDLEPRYWHGFLSSRLFL  L+FFGLSLFSHASN 
Sbjct  420   EFFCFGMAILLKLDLKGTRRFFNAFFDLEPRYWHGFLSSRLFLPYLVFFGLSLFSHASNA  479

Query  183   SRLEIMTKGTLPLVNMINNLLQDID  109
             SR+EIM KGT PLV MINNL+QD D
Sbjct  480   SRIEIMAKGTPPLVKMINNLIQDRD  504



>ref|XP_007028557.1| Lycopene cyclase [Theobroma cacao]
 gb|EOY09059.1| Lycopene cyclase [Theobroma cacao]
Length=505

 Score =   815 bits (2106),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 414/503 (82%), Positives = 455/503 (90%), Gaps = 4/503 (1%)
 Frame = -2

Query  1611  MDTLLKTPNELEFLHPHHGFAVKASAFTSLKPQKQEIRIGSWKACRNVGR----VKASSS  1444
             MDTLL+T N+LE L   HGF+ KA   +S++ Q QE + G  K+    GR    VKASS+
Sbjct  1     MDTLLRTHNKLELLPQLHGFSEKACNLSSVRVQNQEPKFGPKKSYFKRGRGNTCVKASST  60

Query  1443  ALLELVPVTKKENLDFELPMFEPSKGIvvdlavvgggpaglavaqqVSQAGLSVCSIDPS  1264
             ALLE+VP TKKENL+FELP+++PSKG VVDLAVVGGGPAGLAVAQ+VSQAGLSVCSIDPS
Sbjct  61    ALLEMVPETKKENLEFELPIYDPSKGTVVDLAVVGGGPAGLAVAQRVSQAGLSVCSIDPS  120

Query  1263  PKLIWPNNYGVWVDEFEAMDLLDCLDTTWSGAMVYIDDRTTKDLDRPYGRVNRKKLKSKM  1084
             PKLIWPNNYGVWVDEFEAMDLLDCLDTTWSGA+VYIDD+  KDL RPYGRVNRK+LKSKM
Sbjct  121   PKLIWPNNYGVWVDEFEAMDLLDCLDTTWSGAVVYIDDQKKKDLGRPYGRVNRKQLKSKM  180

Query  1083  MQKCITNGVKFHQAKVIKVIHEESKSMLICSDGVTIQATVVLDATGFSRCLVQYDKPYNP  904
             +QKCI+NGVKFHQAKVIKVIHEESKS+LIC+DGVT+QATVVLDATGFSRCLVQYDKPYNP
Sbjct  181   LQKCISNGVKFHQAKVIKVIHEESKSLLICNDGVTVQATVVLDATGFSRCLVQYDKPYNP  240

Query  903   GYQVAYGILAEVEEHPYDLNKMVFMDWRDSHLNSNLELKERNKRIPTFLYAMPFSSTRIF  724
             GYQ+AYGILAEVEEHP+D++KMVFMDWRDSHL +N EL+ERN +IPTFLYAMPFSS RIF
Sbjct  241   GYQMAYGILAEVEEHPFDVDKMVFMDWRDSHLINNKELRERNSKIPTFLYAMPFSSDRIF  300

Query  723   LEETSLVARPGLDMKDIQERMVARLRHLGINVKSIEEDERCVIPMGGPLPVIPQRVVGIG  544
             LEETSLVARPG+ M DI+ERMVARLRHLGI VKSIEEDE CVIPMGGPLPV+PQRVVGIG
Sbjct  301   LEETSLVARPGVPMNDIKERMVARLRHLGIKVKSIEEDEHCVIPMGGPLPVLPQRVVGIG  360

Query  543   GTAGMVHPSTGYMVARTLAAAPVVANAIIQYLGSERSLLGNELSASVWKDLWPIERRRQR  364
             GTAGMVHPSTGYMVARTLAAAP+VA +I++ L   +S LGN+LSA VW+DLWPIERRRQR
Sbjct  361   GTAGMVHPSTGYMVARTLAAAPIVAESIVRCLDPGKSFLGNKLSAEVWRDLWPIERRRQR  420

Query  363   EFFCFGMDILLKLDLPATRRFFDAFFDLEPRYWHGFLSSRLFLRELIFFGLSLFSHASNT  184
             EFFCFGMDILLKLDLPATRRFFDAFFDLEP YWHGFLSSRLFL ELI FGLSLFSHAS T
Sbjct  421   EFFCFGMDILLKLDLPATRRFFDAFFDLEPHYWHGFLSSRLFLPELIVFGLSLFSHASTT  480

Query  183   SRLEIMTKGTLPLVNMINNLLQD  115
             SRLEIM KGTLPLVNMINNL+QD
Sbjct  481   SRLEIMAKGTLPLVNMINNLVQD  503



>ref|XP_008392386.1| PREDICTED: lycopene beta cyclase, chloroplastic/chromoplastic 
[Malus domestica]
 ref|XP_008392387.1| PREDICTED: lycopene beta cyclase, chloroplastic/chromoplastic 
[Malus domestica]
Length=504

 Score =   815 bits (2105),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 411/504 (82%), Positives = 459/504 (91%), Gaps = 3/504 (1%)
 Frame = -2

Query  1611  MDTLLKTPNELEFLHPHHGFAVKASAFTSLKPQKQEIRIGSWKACRNVGR---VKASSSA  1441
             MDTLLKT N+L FLHP HGF+ K S+ +S K + +E   G  ++   + R   VKASSSA
Sbjct  1     MDTLLKTHNKLAFLHPIHGFSEKLSSSSSSKLRNEEFGYGLRRSRVKLSRGGVVKASSSA  60

Query  1440  LLELVPVTKKENLDFELPMFEPSKGIvvdlavvgggpaglavaqqVSQAGLSVCSIDPSP  1261
             LLELVP  KKE+L+FELP+++PSKG+VVDLAVVGGGPAGLAVAQQVS+AGLSVCSIDPSP
Sbjct  61    LLELVPEIKKESLEFELPLYDPSKGLVVDLAVVGGGPAGLAVAQQVSEAGLSVCSIDPSP  120

Query  1260  KLIWPNNYGVWVDEFEAMDLLDCLDTTWSGAMVYIDDRTTKDLDRPYGRVNRKKLKSKMM  1081
             KLIWPNNYGVWVDEFEAMD+LDCLDTTWSGA+VYID+ + KDL+RPYGRVNRK+LKSKM+
Sbjct  121   KLIWPNNYGVWVDEFEAMDMLDCLDTTWSGAVVYIDEESKKDLNRPYGRVNRKQLKSKML  180

Query  1080  QKCITNGVKFHQAKVIKVIHEESKSMLICSDGVTIQATVVLDATGFSRCLVQYDKPYNPG  901
             QKCI+NGVKFHQAKV KVIHEE KS+L C+DGVTIQA+VVLDATGFSRCLVQYDKPYNPG
Sbjct  181   QKCISNGVKFHQAKVTKVIHEEEKSLLTCNDGVTIQASVVLDATGFSRCLVQYDKPYNPG  240

Query  900   YQVAYGILAEVEEHPYDLNKMVFMDWRDSHLNSNLELKERNKRIPTFLYAMPFSSTRIFL  721
             YQVAYGILAEVEEHP+D++KM+FMDWRDSHLN+N+ELKERN RIPTFLYAMPFSS RIFL
Sbjct  241   YQVAYGILAEVEEHPFDVDKMLFMDWRDSHLNNNIELKERNGRIPTFLYAMPFSSNRIFL  300

Query  720   EETSLVARPGLDMKDIQERMVARLRHLGINVKSIEEDERCVIPMGGPLPVIPQRVVGIGG  541
             EETSLVARPGL MKDIQERM ARL+HLGI VKSIEEDE CVIPMGGPLPV+PQRVVGIGG
Sbjct  301   EETSLVARPGLPMKDIQERMAARLKHLGIKVKSIEEDEHCVIPMGGPLPVLPQRVVGIGG  360

Query  540   TAGMVHPSTGYMVARTLAAAPVVANAIIQYLGSERSLLGNELSASVWKDLWPIERRRQRE  361
             TAGMVHPSTGYMVARTLAAAP+VANAI++YLGS+R+L GNE+SA +WKDLWPI+RRRQRE
Sbjct  361   TAGMVHPSTGYMVARTLAAAPIVANAIVRYLGSDRTLSGNEVSAEIWKDLWPIQRRRQRE  420

Query  360   FFCFGMDILLKLDLPATRRFFDAFFDLEPRYWHGFLSSRLFLRELIFFGLSLFSHASNTS  181
             FFCFGM ILLKLDL  TRRFF+AFFDLEPRYWHGFLSSRLFL +L+FFGLSLFSHASN S
Sbjct  421   FFCFGMAILLKLDLKGTRRFFNAFFDLEPRYWHGFLSSRLFLPDLVFFGLSLFSHASNAS  480

Query  180   RLEIMTKGTLPLVNMINNLLQDID  109
             R+EIM KGT PLV MINNL+QD D
Sbjct  481   RIEIMAKGTPPLVKMINNLIQDRD  504



>ref|XP_006576788.1| PREDICTED: lycopene beta cyclase, chloroplastic-like [Glycine 
max]
Length=507

 Score =   815 bits (2105),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 408/507 (80%), Positives = 459/507 (91%), Gaps = 9/507 (2%)
 Frame = -2

Query  1611  MDTLLKTPNELEFLHPHHGFAVKASAFTSLKPQKQEIRIGS------WKACRNVGRVKAS  1450
             MDTLLKTPN+LEFLHP HG++ K S+  S + Q Q    GS      W  C   G ++AS
Sbjct  4     MDTLLKTPNKLEFLHPLHGYSEKLSSSGSSRVQNQYFGFGSKKPTVRWGKC---GNLRAS  60

Query  1449  SSALLELVPVTKKENLDFELPMFEPSKGIvvdlavvgggpaglavaqqVSQAGLSVCSID  1270
             SSALLELVP  KKENLDFELP+++ SKG +VDLAVVGGGPAGLAVAQQVS+AGLSVC+ID
Sbjct  61    SSALLELVPEFKKENLDFELPLYDSSKGAMVDLAVVGGGPAGLAVAQQVSEAGLSVCAID  120

Query  1269  PSPKLIWPNNYGVWVDEFEAMDLLDCLDTTWSGAMVYIDDRTTKDLDRPYGRVNRKKLKS  1090
             P+P+LIWPNNYGVWVDEFEAMDLLDCLDT WSGA+V+IDD+T KDLDRPYGRVNRK LKS
Sbjct  121   PNPRLIWPNNYGVWVDEFEAMDLLDCLDTIWSGAVVFIDDKTKKDLDRPYGRVNRKLLKS  180

Query  1089  KMMQKCITNGVKFHQAKVIKVIHEESKSMLICSDGVTIQATVVLDATGFSRCLVQYDKPY  910
             KM+QKCI+NGVKFHQAKVIKVIHEE+KS+LIC+DGVT+ ATVVLDATGFSRCLVQYDKPY
Sbjct  181   KMLQKCISNGVKFHQAKVIKVIHEEAKSLLICNDGVTVHATVVLDATGFSRCLVQYDKPY  240

Query  909   NPGYQVAYGILAEVEEHPYDLNKMVFMDWRDSHLNSNLELKERNKRIPTFLYAMPFSSTR  730
             NPGYQVAYGILAEV+EHP+D++KM+FMDWRDSHL++++ELK+RN RIPTFLYAMPFSST+
Sbjct  241   NPGYQVAYGILAEVDEHPFDVDKMLFMDWRDSHLDNDMELKQRNSRIPTFLYAMPFSSTK  300

Query  729   IFLEETSLVARPGLDMKDIQERMVARLRHLGINVKSIEEDERCVIPMGGPLPVIPQRVVG  550
             IFLEETSLVARPGL M DIQERM ARL+HLGI VKSIEEDE CVIPMGGPLPV+PQRVVG
Sbjct  301   IFLEETSLVARPGLRMDDIQERMAARLKHLGIRVKSIEEDEHCVIPMGGPLPVLPQRVVG  360

Query  549   IGGTAGMVHPSTGYMVARTLAAAPVVANAIIQYLGSERSLLGNELSASVWKDLWPIERRR  370
             IGGTAGMVHPSTGYMVARTLAAAP+VAN+I+Q LGS+R   G+E+SA VWKDLWPI+RRR
Sbjct  361   IGGTAGMVHPSTGYMVARTLAAAPIVANSIVQCLGSDRGFSGDEISAQVWKDLWPIQRRR  420

Query  369   QREFFCFGMDILLKLDLPATRRFFDAFFDLEPRYWHGFLSSRLFLRELIFFGLSLFSHAS  190
             QREFFCFGMDILLKLDLP T+RFFDAFFDLEP YWHGFLSSRLFL EL+FFGLSLFS+AS
Sbjct  421   QREFFCFGMDILLKLDLPGTKRFFDAFFDLEPHYWHGFLSSRLFLHELLFFGLSLFSYAS  480

Query  189   NTSRLEIMTKGTLPLVNMINNLLQDID  109
             NTSR+EIM KGTLPLVNMINNL++D +
Sbjct  481   NTSRVEIMAKGTLPLVNMINNLVKDTE  507



>gb|KHN30373.1| Lycopene beta cyclase, chloroplastic [Glycine soja]
Length=504

 Score =   815 bits (2105),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 408/507 (80%), Positives = 459/507 (91%), Gaps = 9/507 (2%)
 Frame = -2

Query  1611  MDTLLKTPNELEFLHPHHGFAVKASAFTSLKPQKQEIRIGS------WKACRNVGRVKAS  1450
             MDTLLKTPN+LEFLHP HG++ K S+  S + Q Q    GS      W  C   G ++AS
Sbjct  1     MDTLLKTPNKLEFLHPLHGYSEKLSSSGSSRVQNQYFGFGSKKPTVRWGKC---GNLRAS  57

Query  1449  SSALLELVPVTKKENLDFELPMFEPSKGIvvdlavvgggpaglavaqqVSQAGLSVCSID  1270
             SSALLELVP  KKENLDFELP+++ SKG +VDLAVVGGGPAGLAVAQQVS+AGLSVC+ID
Sbjct  58    SSALLELVPEFKKENLDFELPLYDSSKGAMVDLAVVGGGPAGLAVAQQVSEAGLSVCAID  117

Query  1269  PSPKLIWPNNYGVWVDEFEAMDLLDCLDTTWSGAMVYIDDRTTKDLDRPYGRVNRKKLKS  1090
             P+P+LIWPNNYGVWVDEFEAMDLLDCLDT WSGA+V+IDD+T KDLDRPYGRVNRK LKS
Sbjct  118   PNPRLIWPNNYGVWVDEFEAMDLLDCLDTIWSGAVVFIDDKTKKDLDRPYGRVNRKLLKS  177

Query  1089  KMMQKCITNGVKFHQAKVIKVIHEESKSMLICSDGVTIQATVVLDATGFSRCLVQYDKPY  910
             KM+QKCI+NGVKFHQAKVIKVIHEE+KS+LIC+DGVT+ ATVVLDATGFSRCLVQYDKPY
Sbjct  178   KMLQKCISNGVKFHQAKVIKVIHEEAKSLLICNDGVTVHATVVLDATGFSRCLVQYDKPY  237

Query  909   NPGYQVAYGILAEVEEHPYDLNKMVFMDWRDSHLNSNLELKERNKRIPTFLYAMPFSSTR  730
             NPGYQVAYGILAEV+EHP+D++KM+FMDWRDSHL++++ELK+RN RIPTFLYAMPFSST+
Sbjct  238   NPGYQVAYGILAEVDEHPFDVDKMLFMDWRDSHLDNDMELKQRNSRIPTFLYAMPFSSTK  297

Query  729   IFLEETSLVARPGLDMKDIQERMVARLRHLGINVKSIEEDERCVIPMGGPLPVIPQRVVG  550
             IFLEETSLVARPGL M DIQERM ARL+HLGI VKSIEEDE CVIPMGGPLPV+PQRVVG
Sbjct  298   IFLEETSLVARPGLRMDDIQERMAARLKHLGIRVKSIEEDEHCVIPMGGPLPVLPQRVVG  357

Query  549   IGGTAGMVHPSTGYMVARTLAAAPVVANAIIQYLGSERSLLGNELSASVWKDLWPIERRR  370
             IGGTAGMVHPSTGYMVARTLAAAP+VAN+I+Q LGS+R   G+E+SA VWKDLWPI+RRR
Sbjct  358   IGGTAGMVHPSTGYMVARTLAAAPIVANSIVQCLGSDRGFSGDEISAQVWKDLWPIQRRR  417

Query  369   QREFFCFGMDILLKLDLPATRRFFDAFFDLEPRYWHGFLSSRLFLRELIFFGLSLFSHAS  190
             QREFFCFGMDILLKLDLP T+RFFDAFFDLEP YWHGFLSSRLFL EL+FFGLSLFS+AS
Sbjct  418   QREFFCFGMDILLKLDLPGTKRFFDAFFDLEPHYWHGFLSSRLFLHELLFFGLSLFSYAS  477

Query  189   NTSRLEIMTKGTLPLVNMINNLLQDID  109
             NTSR+EIM KGTLPLVNMINNL++D +
Sbjct  478   NTSRVEIMAKGTLPLVNMINNLVKDTE  504



>ref|XP_010056269.1| PREDICTED: lycopene beta cyclase, chloroplastic/chromoplastic 
[Eucalyptus grandis]
 gb|KCW90070.1| hypothetical protein EUGRSUZ_A02265 [Eucalyptus grandis]
Length=512

 Score =   815 bits (2105),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 410/503 (82%), Positives = 455/503 (90%), Gaps = 3/503 (1%)
 Frame = -2

Query  1614  VMDTLLKTPNELEFLHPHHGFAVKASAFTSLKPQKQEIRIGSWKACRNVGR---VKASSS  1444
             +MDT+LKT N+  FL P  GF+   S  +S K Q QE+R+ S K     G+   ++ASS+
Sbjct  5     LMDTVLKTHNQHGFLRPVCGFSETVSILSSSKLQNQELRLSSRKGHLRRGKNGCIRASSA  64

Query  1443  ALLELVPVTKKENLDFELPMFEPSKGIvvdlavvgggpaglavaqqVSQAGLSVCSIDPS  1264
             ALLELVP TKKENL+FELPM++PSKG+VVDLAVVGGGPAGLAVAQQVS+AGL+VCSIDPS
Sbjct  65    ALLELVPETKKENLEFELPMYDPSKGLVVDLAVVGGGPAGLAVAQQVSEAGLTVCSIDPS  124

Query  1263  PKLIWPNNYGVWVDEFEAMDLLDCLDTTWSGAMVYIDDRTTKDLDRPYGRVNRKKLKSKM  1084
             PKLIWPNNYGVWVDEFEAMDLLDCLDTTWSGA+V+IDD+  KDL RPYGRVNRK+LKSKM
Sbjct  125   PKLIWPNNYGVWVDEFEAMDLLDCLDTTWSGAVVFIDDQRKKDLGRPYGRVNRKQLKSKM  184

Query  1083  MQKCITNGVKFHQAKVIKVIHEESKSMLICSDGVTIQATVVLDATGFSRCLVQYDKPYNP  904
             +QKCI+NGVKFHQAKVIKVIHEE+KS+LIC+DGVTIQATVVLDATGFSRCLVQYDKPYNP
Sbjct  185   LQKCISNGVKFHQAKVIKVIHEEAKSLLICNDGVTIQATVVLDATGFSRCLVQYDKPYNP  244

Query  903   GYQVAYGILAEVEEHPYDLNKMVFMDWRDSHLNSNLELKERNKRIPTFLYAMPFSSTRIF  724
             GYQVAYGILAEVEEHP+D++KMVFMDWRDSHL  N++LKERN RIPTFLYAMPFSS +IF
Sbjct  245   GYQVAYGILAEVEEHPFDVDKMVFMDWRDSHLKGNMDLKERNSRIPTFLYAMPFSSNKIF  304

Query  723   LEETSLVARPGLDMKDIQERMVARLRHLGINVKSIEEDERCVIPMGGPLPVIPQRVVGIG  544
             LEETSLVARPGL M+DIQ+RMVARL+HLGI VK+IEEDERCVIPMGGPLPVIPQRVVGIG
Sbjct  305   LEETSLVARPGLAMEDIQQRMVARLKHLGIKVKAIEEDERCVIPMGGPLPVIPQRVVGIG  364

Query  543   GTAGMVHPSTGYMVARTLAAAPVVANAIIQYLGSERSLLGNELSASVWKDLWPIERRRQR  364
             GTAGMVHPSTGYMVARTLAAAP+VAN+I+ YLGSE  + GNELSA VWK+LWPIERRRQR
Sbjct  365   GTAGMVHPSTGYMVARTLAAAPIVANSIVSYLGSEGGVSGNELSAKVWKNLWPIERRRQR  424

Query  363   EFFCFGMDILLKLDLPATRRFFDAFFDLEPRYWHGFLSSRLFLRELIFFGLSLFSHASNT  184
             EFFCFGMD+LLKLDL  TRRFF+AFF+LEP YWHGFLSSRLFL ELIFFGLSLFSHASN 
Sbjct  425   EFFCFGMDVLLKLDLTGTRRFFNAFFNLEPHYWHGFLSSRLFLPELIFFGLSLFSHASNM  484

Query  183   SRLEIMTKGTLPLVNMINNLLQD  115
             SR EIM KGTLPLV MI NL+QD
Sbjct  485   SRAEIMAKGTLPLVKMIGNLIQD  507



>dbj|BAA88840.1| Lycopen cyclase 2 [Gentiana lutea]
 gb|ACF21780.1| lycopene beta-cyclase [Gentiana lutea]
Length=508

 Score =   815 bits (2104),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 413/510 (81%), Positives = 454/510 (89%), Gaps = 15/510 (3%)
 Frame = -2

Query  1611  MDTLLKTPNELEFLHPHHGFAVKASAFTSLKPQKQE----------IRIGSWKA-CRNVG  1465
             MDTL+KTPN+LEFLHP  GF  K  +F+ L+   QE          ++ GS K  C   G
Sbjct  1     MDTLVKTPNKLEFLHPLCGFVDKVCSFSCLRSHNQEYNKYFLKKSHLKTGSKKGFCVKAG  60

Query  1464  RVKASSSALLELVPVTKKENLDFELPMFEPSKGIvvdlavvgggpaglavaqqVSQAGLS  1285
                 SSSA+LELVP TK ENL+FELP+F+ SKGIVVDLA+VGGGPAGLAVAQQVS+AGLS
Sbjct  61    ----SSSAILELVPETKMENLEFELPLFDHSKGIVVDLAIVGGGPAGLAVAQQVSEAGLS  116

Query  1284  VCSIDPSPKLIWPNNYGVWVDEFEAMDLLDCLDTTWSGAMVYIDDRTTKDLDRPYGRVNR  1105
             VCSIDPSPKLIWPNNYGVWVDEFEAMDLLDCLD TWSGA+V+IDD  +KDL RPYGRVNR
Sbjct  117   VCSIDPSPKLIWPNNYGVWVDEFEAMDLLDCLDATWSGAVVFIDDHKSKDLGRPYGRVNR  176

Query  1104  KKLKSKMMQKCITNGVKFHQAKVIKVIHEESKSMLICSDGVTIQATVVLDATGFSRCLVQ  925
             K+LKSKMMQKCI+NGVKFH+AKV+KV HEESKS++IC+DGVTIQA VVLDATGFSRCLVQ
Sbjct  177   KQLKSKMMQKCISNGVKFHKAKVVKVTHEESKSLVICNDGVTIQAAVVLDATGFSRCLVQ  236

Query  924   YDKPYNPGYQVAYGILAEVEEHPYDLNKMVFMDWRDSHLNSNLELKERNKRIPTFLYAMP  745
             Y+KPYNPGYQVAYGILAEVEEHP+D+NKMVFMDWRDSHLN+N  LKERN+++PTFLYAMP
Sbjct  237   YNKPYNPGYQVAYGILAEVEEHPFDINKMVFMDWRDSHLNNNTNLKERNRKVPTFLYAMP  296

Query  744   FSSTRIFLEETSLVARPGLDMKDIQERMVARLRHLGINVKSIEEDERCVIPMGGPLPVIP  565
             FS  +IFLEETSLVARPGL ++DIQERMVARLRHLGI VKSIEEDERCVIPMGGPLPVIP
Sbjct  297   FSKDKIFLEETSLVARPGLAIEDIQERMVARLRHLGIKVKSIEEDERCVIPMGGPLPVIP  356

Query  564   QRVVGIGGTAGMVHPSTGYMVARTLAAAPVVANAIIQYLGSERSLLGNELSASVWKDLWP  385
             QRVVGIGGTAGMVHPSTGYMVARTLAAAP+VANAI++YLGSE+  LG ELS  VWKDLWP
Sbjct  357   QRVVGIGGTAGMVHPSTGYMVARTLAAAPIVANAIVRYLGSEKRHLGAELSGEVWKDLWP  416

Query  384   IERRRQREFFCFGMDILLKLDLPATRRFFDAFFDLEPRYWHGFLSSRLFLRELIFFGLSL  205
             IERRRQREFFCFGMDILLKLDL A RRFFDAFFDLEPRYWHGFLSSRLFL EL  FGLSL
Sbjct  417   IERRRQREFFCFGMDILLKLDLDALRRFFDAFFDLEPRYWHGFLSSRLFLPELALFGLSL  476

Query  204   FSHASNTSRLEIMTKGTLPLVNMINNLLQD  115
             FSHA+NTSRLEIM+KGTLPL+NMINNLL+D
Sbjct  477   FSHATNTSRLEIMSKGTLPLINMINNLLRD  506



>gb|AAW88382.1| lycopene beta-cyclase [Lycium barbarum]
Length=508

 Score =   814 bits (2103),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 412/510 (81%), Positives = 453/510 (89%), Gaps = 15/510 (3%)
 Frame = -2

Query  1611  MDTLLKTPNELEFLHPHHGFAVKASAFTSLKPQKQE----------IRIGSWKA-CRNVG  1465
             MDTL+KTPN+LEFLHP  GF  K  +F+ L+   QE          ++ GS K  C   G
Sbjct  1     MDTLVKTPNKLEFLHPLCGFVDKVCSFSCLRSHNQEYNKYFLKKSHLKTGSKKGFCVKAG  60

Query  1464  RVKASSSALLELVPVTKKENLDFELPMFEPSKGIvvdlavvgggpaglavaqqVSQAGLS  1285
                 SSSA+LELVP TK ENL+FELP+F+ SKGIVVDLA+VGGGPAGLAV QQVS+AGLS
Sbjct  61    ----SSSAILELVPETKMENLEFELPLFDHSKGIVVDLAIVGGGPAGLAVVQQVSEAGLS  116

Query  1284  VCSIDPSPKLIWPNNYGVWVDEFEAMDLLDCLDTTWSGAMVYIDDRTTKDLDRPYGRVNR  1105
             VCSIDPSPKLIWPNNYGVWVDEFEAMDLLDCLD TWSGA+V+IDD  +KDL RPYGRVNR
Sbjct  117   VCSIDPSPKLIWPNNYGVWVDEFEAMDLLDCLDATWSGAVVFIDDHKSKDLGRPYGRVNR  176

Query  1104  KKLKSKMMQKCITNGVKFHQAKVIKVIHEESKSMLICSDGVTIQATVVLDATGFSRCLVQ  925
             K+LKSKMMQKCI+NGVKFH+AKV+KV HEESKS++IC+DGVTIQA VVLDATGFSRCLVQ
Sbjct  177   KQLKSKMMQKCISNGVKFHKAKVVKVTHEESKSLVICNDGVTIQAAVVLDATGFSRCLVQ  236

Query  924   YDKPYNPGYQVAYGILAEVEEHPYDLNKMVFMDWRDSHLNSNLELKERNKRIPTFLYAMP  745
             Y+KPYNPGYQVAYGILAEVEEHP+D+NKMVFMDWRDSHLN+N  LKERN+++PTFLYAMP
Sbjct  237   YNKPYNPGYQVAYGILAEVEEHPFDINKMVFMDWRDSHLNNNTNLKERNRKVPTFLYAMP  296

Query  744   FSSTRIFLEETSLVARPGLDMKDIQERMVARLRHLGINVKSIEEDERCVIPMGGPLPVIP  565
             FS  +IFLEETSLVARPGL ++DIQERMVARLRHLGI VKSIEEDERCVIPMGGPLPVIP
Sbjct  297   FSKDKIFLEETSLVARPGLAIEDIQERMVARLRHLGIKVKSIEEDERCVIPMGGPLPVIP  356

Query  564   QRVVGIGGTAGMVHPSTGYMVARTLAAAPVVANAIIQYLGSERSLLGNELSASVWKDLWP  385
             QRVVGIGGTAGMVHPSTGYMVARTLAAAP+VANAI++YLGSE+  LG ELS  VWKDLWP
Sbjct  357   QRVVGIGGTAGMVHPSTGYMVARTLAAAPIVANAIVRYLGSEKRHLGAELSGEVWKDLWP  416

Query  384   IERRRQREFFCFGMDILLKLDLPATRRFFDAFFDLEPRYWHGFLSSRLFLRELIFFGLSL  205
             IERRRQREFFCFGMDILLKLDL A RRFFDAFFDLEPRYWHGFLSSRLFL EL  FGLSL
Sbjct  417   IERRRQREFFCFGMDILLKLDLDALRRFFDAFFDLEPRYWHGFLSSRLFLPELALFGLSL  476

Query  204   FSHASNTSRLEIMTKGTLPLVNMINNLLQD  115
             FSHA+NTSRLEIM+KGTLPL+NMINNLL+D
Sbjct  477   FSHATNTSRLEIMSKGTLPLINMINNLLRD  506



>gb|EYU18654.1| hypothetical protein MIMGU_mgv1a004941mg [Erythranthe guttata]
Length=503

 Score =   813 bits (2099),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 420/502 (84%), Positives = 462/502 (92%), Gaps = 4/502 (1%)
 Frame = -2

Query  1611  MDTLLKTPNELEFLHPHHGFAVKASAFTSLKPQKQEIRIGSWKACRNVGR---VKASSSA  1441
             MDTLLKT N+L+FLHP HGFA K S FTS KPQ  E +  S K    + +   +KASSSA
Sbjct  1     MDTLLKTHNKLQFLHPIHGFADKVSTFTSSKPQTLEPKY-SKKTHIKLNKDFCLKASSSA  59

Query  1440  LLELVPVTKKENLDFELPMFEPSKGIvvdlavvgggpaglavaqqVSQAGLSVCSIDPSP  1261
             LLELVP TKKENL+F+LP+++PSKGIVVDL +VGGGPAGLAVAQQVS AGLSVCSIDPSP
Sbjct  60    LLELVPETKKENLEFDLPLYDPSKGIVVDLVIVGGGPAGLAVAQQVSAAGLSVCSIDPSP  119

Query  1260  KLIWPNNYGVWVDEFEAMDLLDCLDTTWSGAMVYIDDRTTKDLDRPYGRVNRKKLKSKMM  1081
             KLIWPNNYGVWVDEFEAMDLLDCLDTTWSGAMVYI++ +TKDLDRPYGRVNRK+LKSKMM
Sbjct  120   KLIWPNNYGVWVDEFEAMDLLDCLDTTWSGAMVYINENSTKDLDRPYGRVNRKQLKSKMM  179

Query  1080  QKCITNGVKFHQAKVIKVIHEESKSMLICSDGVTIQATVVLDATGFSRCLVQYDKPYNPG  901
             QKCI+NGVKFHQAKV+KVIHEE KS+++C+DGVT+QA+VVLDATGFSRCLV+YDKPYNPG
Sbjct  180   QKCISNGVKFHQAKVVKVIHEEYKSLVMCNDGVTLQASVVLDATGFSRCLVEYDKPYNPG  239

Query  900   YQVAYGILAEVEEHPYDLNKMVFMDWRDSHLNSNLELKERNKRIPTFLYAMPFSSTRIFL  721
             YQVAYGILAEVEEHP+D+NKMVFMDWRDSHL+SN EL+ERNK+IPTFLYAMPFSS RIFL
Sbjct  240   YQVAYGILAEVEEHPFDVNKMVFMDWRDSHLDSNKELQERNKKIPTFLYAMPFSSKRIFL  299

Query  720   EETSLVARPGLDMKDIQERMVARLRHLGINVKSIEEDERCVIPMGGPLPVIPQRVVGIGG  541
             EETSLVARPGL+MK+IQERMVARL HLGI VKSIEEDE CVIPMGGPLPV+PQRVVGIGG
Sbjct  300   EETSLVARPGLNMKEIQERMVARLNHLGIKVKSIEEDEYCVIPMGGPLPVLPQRVVGIGG  359

Query  540   TAGMVHPSTGYMVARTLAAAPVVANAIIQYLGSERSLLGNELSASVWKDLWPIERRRQRE  361
             TAGMVHPSTGYMVARTLAAAP+VA AI++YLGS+R +LGNELSA VWKDLWPIERRRQRE
Sbjct  360   TAGMVHPSTGYMVARTLAAAPIVARAIVEYLGSDRGVLGNELSARVWKDLWPIERRRQRE  419

Query  360   FFCFGMDILLKLDLPATRRFFDAFFDLEPRYWHGFLSSRLFLRELIFFGLSLFSHASNTS  181
             FFCFGMDILLKLDL +TR FFDAFF+LEPRYWHGFLSSRLFL EL+ FGLSLFSHASN  
Sbjct  420   FFCFGMDILLKLDLDSTRSFFDAFFNLEPRYWHGFLSSRLFLPELLLFGLSLFSHASNPI  479

Query  180   RLEIMTKGTLPLVNMINNLLQD  115
             RLEIM KGTLPLVNM+NNLLQD
Sbjct  480   RLEIMAKGTLPLVNMVNNLLQD  501



>gb|ACM24791.1| lycopene beta-cyclase [Carica papaya]
Length=503

 Score =   812 bits (2097),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 419/505 (83%), Positives = 462/505 (91%), Gaps = 6/505 (1%)
 Frame = -2

Query  1611  MDTLLKTPNELEFLHPHHGFAVKASAFTSLKPQKQEIRIGS----WKACRNVGRVKASSS  1444
             MDTLLKT N+LEFL    GF+ K+S+ +S + Q  E+R G     WK  R+ G +KAS+S
Sbjct  1     MDTLLKTHNKLEFLPQLRGFSEKSSS-SSSRLQNPELRFGPKKYPWKRGRD-GCLKASNS  58

Query  1443  ALLELVPVTKKENLDFELPMFEPSKGIvvdlavvgggpaglavaqqVSQAGLSVCSIDPS  1264
             ALLELVP TKKE LDFELPM++PSKG+VVDLAVVGGGPAGLAVAQQVSQAGLSVCSIDPS
Sbjct  59    ALLELVPETKKETLDFELPMYDPSKGLVVDLAVVGGGPAGLAVAQQVSQAGLSVCSIDPS  118

Query  1263  PKLIWPNNYGVWVDEFEAMDLLDCLDTTWSGAMVYIDDRTTKDLDRPYGRVNRKKLKSKM  1084
             PKLIWPNNYGVWVDEFEAMDLLDCLDTTWSGA+VYIDD++ KDLDRPYGRVNRK+LKSKM
Sbjct  119   PKLIWPNNYGVWVDEFEAMDLLDCLDTTWSGAVVYIDDKSKKDLDRPYGRVNRKQLKSKM  178

Query  1083  MQKCITNGVKFHQAKVIKVIHEESKSMLICSDGVTIQATVVLDATGFSRCLVQYDKPYNP  904
             +QKCI NGVKFHQAKVIK IHEES+S+LIC+DGVTIQATVVLDATGFSRCLV+YD+PYNP
Sbjct  179   LQKCIANGVKFHQAKVIKAIHEESESLLICNDGVTIQATVVLDATGFSRCLVRYDRPYNP  238

Query  903   GYQVAYGILAEVEEHPYDLNKMVFMDWRDSHLNSNLELKERNKRIPTFLYAMPFSSTRIF  724
             GYQVAYGILAEVE+HP+D+NKMVFMDWRDSHLNSN+ELKERN RIPTFLYAMPFSS RIF
Sbjct  239   GYQVAYGILAEVEKHPFDVNKMVFMDWRDSHLNSNMELKERNSRIPTFLYAMPFSSNRIF  298

Query  723   LEETSLVARPGLDMKDIQERMVARLRHLGINVKSIEEDERCVIPMGGPLPVIPQRVVGIG  544
             LEETSLVARPGL M+DIQERMVARL HLG+ V SIEEDE CVIPMGGPLPV+PQRV+GIG
Sbjct  299   LEETSLVARPGLRMEDIQERMVARLTHLGVKVISIEEDEHCVIPMGGPLPVLPQRVIGIG  358

Query  543   GTAGMVHPSTGYMVARTLAAAPVVANAIIQYLGSERSLLGNELSASVWKDLWPIERRRQR  364
             GTAG+VHPSTGYMVARTLAAAPVVA++I+++L S+ SLLG+ELSA VWKDLWPIERRRQR
Sbjct  359   GTAGIVHPSTGYMVARTLAAAPVVADSIVRFLDSDGSLLGDELSAEVWKDLWPIERRRQR  418

Query  363   EFFCFGMDILLKLDLPATRRFFDAFFDLEPRYWHGFLSSRLFLRELIFFGLSLFSHASNT  184
             EFFCFGMDILL+LDL ATRRFF AFFDL+P YWHGFLSSRLFL ELIFFGLSLFSHASNT
Sbjct  419   EFFCFGMDILLELDLQATRRFFYAFFDLKPHYWHGFLSSRLFLPELIFFGLSLFSHASNT  478

Query  183   SRLEIMTKGTLPLVNMINNLLQDID  109
             SR+EIM KGTLPLV MINNL+QD D
Sbjct  479   SRIEIMAKGTLPLVKMINNLIQDRD  503



>gb|KHN43081.1| Lycopene beta cyclase, chloroplastic [Glycine soja]
Length=504

 Score =   812 bits (2097),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 408/507 (80%), Positives = 458/507 (90%), Gaps = 9/507 (2%)
 Frame = -2

Query  1611  MDTLLKTPNELEFLHPHHGFAVKASAFTSLKPQKQEIRIGS------WKACRNVGRVKAS  1450
             MDTLLKTPN+LEFLHP HG++ K S+  S + Q Q    GS      W  C   G ++AS
Sbjct  1     MDTLLKTPNKLEFLHPLHGYSEKLSSSGSSRVQNQYFGFGSKKPTVRWGKC---GNLRAS  57

Query  1449  SSALLELVPVTKKENLDFELPMFEPSKGIvvdlavvgggpaglavaqqVSQAGLSVCSID  1270
             SSALLELVP  KKENLDFELP+++ SKG +VDLAVVGGGPAGLAVAQQVS+AGLSVC+ID
Sbjct  58    SSALLELVPEFKKENLDFELPLYDSSKGAMVDLAVVGGGPAGLAVAQQVSEAGLSVCAID  117

Query  1269  PSPKLIWPNNYGVWVDEFEAMDLLDCLDTTWSGAMVYIDDRTTKDLDRPYGRVNRKKLKS  1090
             P+P+LIWPNNYGVWVDEFEAMDLLDCLDT WSGA+V+IDD+T KDLDRPYGRVNRK LKS
Sbjct  118   PNPRLIWPNNYGVWVDEFEAMDLLDCLDTIWSGAVVFIDDKTKKDLDRPYGRVNRKLLKS  177

Query  1089  KMMQKCITNGVKFHQAKVIKVIHEESKSMLICSDGVTIQATVVLDATGFSRCLVQYDKPY  910
             KM+QKCI+NGVKFHQAKVIKVIHEE+KS+LIC+DGVT+ ATVVLDATGFSRCLVQYDK Y
Sbjct  178   KMLQKCISNGVKFHQAKVIKVIHEEAKSLLICNDGVTVHATVVLDATGFSRCLVQYDKLY  237

Query  909   NPGYQVAYGILAEVEEHPYDLNKMVFMDWRDSHLNSNLELKERNKRIPTFLYAMPFSSTR  730
             NPGYQVAYGILAEV+EHP+D++KM+FMDWRDSHL++++ELK+RN RIPTFLYAMPFSST+
Sbjct  238   NPGYQVAYGILAEVDEHPFDVDKMLFMDWRDSHLDNDMELKQRNSRIPTFLYAMPFSSTK  297

Query  729   IFLEETSLVARPGLDMKDIQERMVARLRHLGINVKSIEEDERCVIPMGGPLPVIPQRVVG  550
             IFLEETSLVARPGL M DIQERM ARL+HLGI VKSIEEDE CVIPMGGPLPV+PQRVVG
Sbjct  298   IFLEETSLVARPGLRMDDIQERMAARLKHLGIRVKSIEEDEHCVIPMGGPLPVLPQRVVG  357

Query  549   IGGTAGMVHPSTGYMVARTLAAAPVVANAIIQYLGSERSLLGNELSASVWKDLWPIERRR  370
             IGGTAGMVHPSTGYMVARTLAAAP+VAN+I+Q LGS+R   G+E+SA VWKDLWPI+RRR
Sbjct  358   IGGTAGMVHPSTGYMVARTLAAAPIVANSIVQCLGSDRGFSGDEISAQVWKDLWPIQRRR  417

Query  369   QREFFCFGMDILLKLDLPATRRFFDAFFDLEPRYWHGFLSSRLFLRELIFFGLSLFSHAS  190
             QREFFCFGMDILLKLDLP T+RFFDAFFDLEP YWHGFLSSRLFL ELIFFGLSLFS+AS
Sbjct  418   QREFFCFGMDILLKLDLPGTKRFFDAFFDLEPHYWHGFLSSRLFLPELIFFGLSLFSYAS  477

Query  189   NTSRLEIMTKGTLPLVNMINNLLQDID  109
             NTSR+EIM KGTLPLVNMINNL++D +
Sbjct  478   NTSRIEIMAKGTLPLVNMINNLVKDTE  504



>gb|KCW90069.1| hypothetical protein EUGRSUZ_A02265 [Eucalyptus grandis]
Length=503

 Score =   800 bits (2066),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 403/493 (82%), Positives = 447/493 (91%), Gaps = 3/493 (1%)
 Frame = -2

Query  1614  VMDTLLKTPNELEFLHPHHGFAVKASAFTSLKPQKQEIRIGSWKACRNVGR---VKASSS  1444
             +MDT+LKT N+  FL P  GF+   S  +S K Q QE+R+ S K     G+   ++ASS+
Sbjct  5     LMDTVLKTHNQHGFLRPVCGFSETVSILSSSKLQNQELRLSSRKGHLRRGKNGCIRASSA  64

Query  1443  ALLELVPVTKKENLDFELPMFEPSKGIvvdlavvgggpaglavaqqVSQAGLSVCSIDPS  1264
             ALLELVP TKKENL+FELPM++PSKG+VVDLAVVGGGPAGLAVAQQVS+AGL+VCSIDPS
Sbjct  65    ALLELVPETKKENLEFELPMYDPSKGLVVDLAVVGGGPAGLAVAQQVSEAGLTVCSIDPS  124

Query  1263  PKLIWPNNYGVWVDEFEAMDLLDCLDTTWSGAMVYIDDRTTKDLDRPYGRVNRKKLKSKM  1084
             PKLIWPNNYGVWVDEFEAMDLLDCLDTTWSGA+V+IDD+  KDL RPYGRVNRK+LKSKM
Sbjct  125   PKLIWPNNYGVWVDEFEAMDLLDCLDTTWSGAVVFIDDQRKKDLGRPYGRVNRKQLKSKM  184

Query  1083  MQKCITNGVKFHQAKVIKVIHEESKSMLICSDGVTIQATVVLDATGFSRCLVQYDKPYNP  904
             +QKCI+NGVKFHQAKVIKVIHEE+KS+LIC+DGVTIQATVVLDATGFSRCLVQYDKPYNP
Sbjct  185   LQKCISNGVKFHQAKVIKVIHEEAKSLLICNDGVTIQATVVLDATGFSRCLVQYDKPYNP  244

Query  903   GYQVAYGILAEVEEHPYDLNKMVFMDWRDSHLNSNLELKERNKRIPTFLYAMPFSSTRIF  724
             GYQVAYGILAEVEEHP+D++KMVFMDWRDSHL  N++LKERN RIPTFLYAMPFSS +IF
Sbjct  245   GYQVAYGILAEVEEHPFDVDKMVFMDWRDSHLKGNMDLKERNSRIPTFLYAMPFSSNKIF  304

Query  723   LEETSLVARPGLDMKDIQERMVARLRHLGINVKSIEEDERCVIPMGGPLPVIPQRVVGIG  544
             LEETSLVARPGL M+DIQ+RMVARL+HLGI VK+IEEDERCVIPMGGPLPVIPQRVVGIG
Sbjct  305   LEETSLVARPGLAMEDIQQRMVARLKHLGIKVKAIEEDERCVIPMGGPLPVIPQRVVGIG  364

Query  543   GTAGMVHPSTGYMVARTLAAAPVVANAIIQYLGSERSLLGNELSASVWKDLWPIERRRQR  364
             GTAGMVHPSTGYMVARTLAAAP+VAN+I+ YLGSE  + GNELSA VWK+LWPIERRRQR
Sbjct  365   GTAGMVHPSTGYMVARTLAAAPIVANSIVSYLGSEGGVSGNELSAKVWKNLWPIERRRQR  424

Query  363   EFFCFGMDILLKLDLPATRRFFDAFFDLEPRYWHGFLSSRLFLRELIFFGLSLFSHASNT  184
             EFFCFGMD+LLKLDL  TRRFF+AFF+LEP YWHGFLSSRLFL ELIFFGLSLFSHASN 
Sbjct  425   EFFCFGMDVLLKLDLTGTRRFFNAFFNLEPHYWHGFLSSRLFLPELIFFGLSLFSHASNM  484

Query  183   SRLEIMTKGTLPL  145
             SR EIM KGTLPL
Sbjct  485   SRAEIMAKGTLPL  497



>ref|XP_004493413.1| PREDICTED: lycopene beta cyclase, chloroplastic-like [Cicer arietinum]
Length=510

 Score =   800 bits (2067),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 410/508 (81%), Positives = 464/508 (91%), Gaps = 10/508 (2%)
 Frame = -2

Query  1614  VMDTLLKTPNELEFLHPHHGFAVKASAFTSL--KPQKQEIRIGS------WKACRNVGRV  1459
              MDTLLKTPN+L+FLHP HG++ K S +++   K Q  E+R GS      W  C  V  +
Sbjct  3     TMDTLLKTPNKLQFLHPLHGYSEKLSNYSASYSKLQNHELRFGSKKPFLKWGKC--VCGL  60

Query  1458  KASSSALLELVPVTKKENLDFELPMFEPSKGIvvdlavvgggpaglavaqqVSQAGLSVC  1279
             +ASSSALLELVP  KKENLDFELP+++ SKG VVDLAVVGGGPAGLAVAQQVS+AGLSVC
Sbjct  61    RASSSALLELVPEFKKENLDFELPLYDSSKGTVVDLAVVGGGPAGLAVAQQVSEAGLSVC  120

Query  1278  SIDPSPKLIWPNNYGVWVDEFEAMDLLDCLDTTWSGAMVYIDDRTTKDLDRPYGRVNRKK  1099
             +IDP+P+LIWPNNYGVWVDEFEAMDLLDCLDTTWSGA+VYIDD+T KDLDRPYGRVNRK 
Sbjct  121   AIDPNPRLIWPNNYGVWVDEFEAMDLLDCLDTTWSGAVVYIDDKTKKDLDRPYGRVNRKL  180

Query  1098  LKSKMMQKCITNGVKFHQAKVIKVIHEESKSMLICSDGVTIQATVVLDATGFSRCLVQYD  919
             LKSKM+QKCI NGVKFHQAKVIKVIHE++KS+LIC+DGVT+QATVVLDATGFSRCLVQYD
Sbjct  181   LKSKMLQKCILNGVKFHQAKVIKVIHEDTKSLLICNDGVTVQATVVLDATGFSRCLVQYD  240

Query  918   KPYNPGYQVAYGILAEVEEHPYDLNKMVFMDWRDSHLNSNLELKERNKRIPTFLYAMPFS  739
             KPYNPGYQVAYGILAEV+EHP+D++KM+FMDWRDSHL+++ ELKERN +IPTFLYAMPFS
Sbjct  241   KPYNPGYQVAYGILAEVDEHPFDVDKMLFMDWRDSHLDNDKELKERNSKIPTFLYAMPFS  300

Query  738   STRIFLEETSLVARPGLDMKDIQERMVARLRHLGINVKSIEEDERCVIPMGGPLPVIPQR  559
             ST+IFLEETSLVARPGL M DIQ+RMVARL+HLGINVKSIEEDE CVIPMGGPLPV+PQR
Sbjct  301   STKIFLEETSLVARPGLRMDDIQDRMVARLKHLGINVKSIEEDEHCVIPMGGPLPVLPQR  360

Query  558   VVGIGGTAGMVHPSTGYMVARTLAAAPVVANAIIQYLGSERSLLGNELSASVWKDLWPIE  379
             VVGIGGTAGMVHPSTGYMVARTLAAAP++ANAI++YLGS+R L G+E+SA VWKDLWPI+
Sbjct  361   VVGIGGTAGMVHPSTGYMVARTLAAAPIIANAIVRYLGSDRGLSGDEISAQVWKDLWPIQ  420

Query  378   RRRQREFFCFGMDILLKLDLPATRRFFDAFFDLEPRYWHGFLSSRLFLRELIFFGLSLFS  199
             RRRQREFFCFGMD+LLKLDLP TRRFFDAFF+LEP YWHGFLSSRL+L EL+FFGLSLFS
Sbjct  421   RRRQREFFCFGMDVLLKLDLPGTRRFFDAFFNLEPHYWHGFLSSRLYLPELLFFGLSLFS  480

Query  198   HASNTSRLEIMTKGTLPLVNMINNLLQD  115
             +ASNTSR+EIM KGTLPLVNM+ NL+QD
Sbjct  481   YASNTSRVEIMAKGTLPLVNMVKNLIQD  508



>ref|XP_009418101.1| PREDICTED: lycopene beta cyclase, chloroplastic/chromoplastic-like 
[Musa acuminata subsp. malaccensis]
Length=504

 Score =   796 bits (2055),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 401/502 (80%), Positives = 445/502 (89%), Gaps = 3/502 (1%)
 Frame = -2

Query  1611  MDTLLKTPNELEFLHPHHGFAVKASAFTSLKPQKQEIRIG---SWKACRNVGRVKASSSA  1441
             MDTLL+T + +E LH  +G A + S  ++ K Q  E ++     +K     G V+ASS  
Sbjct  1     MDTLLRTHSRIELLHRGYGVAERHSLSSTPKLQNSENKLSCRRDYKRRPKRGFVRASSCQ  60

Query  1440  LLELVPVTKKENLDFELPMFEPSKGIvvdlavvgggpaglavaqqVSQAGLSVCSIDPSP  1261
             LLELVP  KKENL+F+LP+++PSKG+ +DLAVVGGGPAGLA+AQQVS+AGLSVCSIDPSP
Sbjct  61    LLELVPEIKKENLEFDLPLYDPSKGLTLDLAVVGGGPAGLAIAQQVSEAGLSVCSIDPSP  120

Query  1260  KLIWPNNYGVWVDEFEAMDLLDCLDTTWSGAMVYIDDRTTKDLDRPYGRVNRKKLKSKMM  1081
             KLIWPNNYGVWVDEFEAMDLLDCLD TW GA+VY+DD+  K L RPYGRVNRK+LKSKMM
Sbjct  121   KLIWPNNYGVWVDEFEAMDLLDCLDATWPGAVVYVDDQKKKLLGRPYGRVNRKQLKSKMM  180

Query  1080  QKCITNGVKFHQAKVIKVIHEESKSMLICSDGVTIQATVVLDATGFSRCLVQYDKPYNPG  901
             Q+CI NGV+FHQAKV+KVIHEE+KS LICSDGVTIQA VVLDATGFSRCLVQYDKPYNPG
Sbjct  181   QRCILNGVQFHQAKVVKVIHEETKSFLICSDGVTIQAAVVLDATGFSRCLVQYDKPYNPG  240

Query  900   YQVAYGILAEVEEHPYDLNKMVFMDWRDSHLNSNLELKERNKRIPTFLYAMPFSSTRIFL  721
             YQVAYGILAEVEEHP+DL+KMVFMDWRDSHL    ELKERN RIPTFLYAMPFSSTRIFL
Sbjct  241   YQVAYGILAEVEEHPFDLDKMVFMDWRDSHLKDGTELKERNSRIPTFLYAMPFSSTRIFL  300

Query  720   EETSLVARPGLDMKDIQERMVARLRHLGINVKSIEEDERCVIPMGGPLPVIPQRVVGIGG  541
             EETSLVARPGL M+DIQERMVARLRHLGI VKSIEEDERCVIPMGGPLPV+PQRVVGIGG
Sbjct  301   EETSLVARPGLQMEDIQERMVARLRHLGIKVKSIEEDERCVIPMGGPLPVLPQRVVGIGG  360

Query  540   TAGMVHPSTGYMVARTLAAAPVVANAIIQYLGSERSLLGNELSASVWKDLWPIERRRQRE  361
             TAGMVHPSTGYMVARTLAAAP++AN+I+Q+LG    LLG+ELS+ VWKDLWPIERRRQRE
Sbjct  361   TAGMVHPSTGYMVARTLAAAPIIANSIVQFLGPNHGLLGSELSSQVWKDLWPIERRRQRE  420

Query  360   FFCFGMDILLKLDLPATRRFFDAFFDLEPRYWHGFLSSRLFLRELIFFGLSLFSHASNTS  181
             FFCFGMDILLKLDL ATRRFFD FF+LEP YWHGFLSSRLFL EL+ FGLSLFSHASNTS
Sbjct  421   FFCFGMDILLKLDLQATRRFFDTFFNLEPHYWHGFLSSRLFLPELVTFGLSLFSHASNTS  480

Query  180   RLEIMTKGTLPLVNMINNLLQD  115
             RLEIM+KGTLPLVNMINNLL++
Sbjct  481   RLEIMSKGTLPLVNMINNLLRE  502



>gb|KJB78495.1| hypothetical protein B456_013G002400 [Gossypium raimondii]
Length=497

 Score =   795 bits (2054),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 409/501 (82%), Positives = 449/501 (90%), Gaps = 8/501 (2%)
 Frame = -2

Query  1611  MDTLLKTPNELEFLHPHHGFAVKASAFTSLKPQKQEIRIGSWKACRNVG--RVKASSSAL  1438
             MDTLL+T ++LEF    HGF+ KA          QE++ G  K     G  +VKASSSAL
Sbjct  1     MDTLLRTHSKLEFSVLLHGFSEKACK------THQEVKFGPKKRRVPNGCVKVKASSSAL  54

Query  1437  LELVPVTKKENLDFELPMFEPSKGIvvdlavvgggpaglavaqqVSQAGLSVCSIDPSPK  1258
             LELVP TKKENL++ELPMF+PSKG VVDLAVVGGGPAGLAVAQQVSQAGLSVCSIDPSPK
Sbjct  55    LELVPETKKENLEYELPMFDPSKGAVVDLAVVGGGPAGLAVAQQVSQAGLSVCSIDPSPK  114

Query  1257  LIWPNNYGVWVDEFEAMDLLDCLDTTWSGAMVYIDDRTTKDLDRPYGRVNRKKLKSKMMQ  1078
             LIWPNNYGVWVDEFEAMDLLDCLDTTWSGA+VYIDD   KDLDRPYGRVNRK+LKSKM+ 
Sbjct  115   LIWPNNYGVWVDEFEAMDLLDCLDTTWSGAVVYIDDGKKKDLDRPYGRVNRKQLKSKMLL  174

Query  1077  KCITNGVKFHQAKVIKVIHEESKSMLICSDGVTIQATVVLDATGFSRCLVQYDKPYNPGY  898
             KCI+NGVKFHQAKVIKVIHEESKS+LIC+DGVT+QATVVLDATGFSRCLVQYDKPYNPGY
Sbjct  175   KCISNGVKFHQAKVIKVIHEESKSLLICNDGVTVQATVVLDATGFSRCLVQYDKPYNPGY  234

Query  897   QVAYGILAEVEEHPYDLNKMVFMDWRDSHLNSNLELKERNKRIPTFLYAMPFSSTRIFLE  718
             Q+AYGILAEVEEHP+D+ KMVFMDWRDSHL+ + ELKERN RIPTFLYAMPFSS RIFLE
Sbjct  235   QMAYGILAEVEEHPFDVEKMVFMDWRDSHLSDSKELKERNSRIPTFLYAMPFSSNRIFLE  294

Query  717   ETSLVARPGLDMKDIQERMVARLRHLGINVKSIEEDERCVIPMGGPLPVIPQRVVGIGGT  538
             ETSLVARPG+ M DI+ERMVARL+HLGI VKSIEEDE CVIPMGGPLPV+PQRVVGIGGT
Sbjct  295   ETSLVARPGVPMDDIKERMVARLKHLGIKVKSIEEDEHCVIPMGGPLPVLPQRVVGIGGT  354

Query  537   AGMVHPSTGYMVARTLAAAPVVANAIIQYLGSERSLLGNELSASVWKDLWPIERRRQREF  358
             AGMVHPSTGYMVARTLAAAP+VA+AI++ L   ++L+G++LS  VW+DLWPI+RRRQREF
Sbjct  355   AGMVHPSTGYMVARTLAAAPIVADAIVRCLDPGKNLMGDKLSTEVWRDLWPIQRRRQREF  414

Query  357   FCFGMDILLKLDLPATRRFFDAFFDLEPRYWHGFLSSRLFLRELIFFGLSLFSHASNTSR  178
             FCFGMDILLKLDLPATRRFFDAFFDLEP YWHGFLSSRLFL ELI FGLSLF HASNTSR
Sbjct  415   FCFGMDILLKLDLPATRRFFDAFFDLEPHYWHGFLSSRLFLPELITFGLSLFYHASNTSR  474

Query  177   LEIMTKGTLPLVNMINNLLQD  115
             LEIM KGT+PLVNMINNL++D
Sbjct  475   LEIMGKGTVPLVNMINNLVKD  495



>emb|CAD70565.1| lycopene cyclase [Bixa orellana]
Length=499

 Score =   793 bits (2048),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 406/506 (80%), Positives = 447/506 (88%), Gaps = 12/506 (2%)
 Frame = -2

Query  1611  MDTLLKTPNELEFLHPHHGFAVKASAFTSLKPQKQEIRIGSWKACRNVGR----VKASSS  1444
             MDTLLKT N+LEFL   HGF  K++ F+++K QK     G+ K+C  +G     VKASSS
Sbjct  1     MDTLLKTNNQLEFLI--HGFNDKSALFSTVKHQK----FGTRKSCEKLGSRSCFVKASSS  54

Query  1443  ALLELVPVTKKENLDFELPMFEPSKGIvvdlavvgggpaglavaqqVSQAGLSVCSIDPS  1264
             ALLELVP TKKENLDFELPM++PS+G+VVDL  VGGGP GLAVAQQVS+AGL VCSIDP 
Sbjct  55    ALLELVPETKKENLDFELPMYDPSRGVVVDLVAVGGGPTGLAVAQQVSEAGLQVCSIDPL  114

Query  1263  PKLIWPNNYGVWVDEFEAMDLLDCLDTTWSGAMVYIDDRTTKDLDRPYGRVNRKKLKSKM  1084
             PKLIWPNNYGVWVDEFEAMDLLDCLD TWSGA VY D+ +TK+LDRPYGRV RK+LKSKM
Sbjct  115   PKLIWPNNYGVWVDEFEAMDLLDCLDATWSGANVYADEESTKELDRPYGRVTRKQLKSKM  174

Query  1083  MQKCITNGVKFHQAKVIKVIHEESKSMLICSDGVTIQATVVLDATGFSRCLVQYDKPYNP  904
             MQKCI NGVKFHQ+KVIKVIHEESK+MLIC+DG TIQA VVLDATGFSR LVQYDKPYNP
Sbjct  175   MQKCIANGVKFHQSKVIKVIHEESKAMLICNDGQTIQAAVVLDATGFSRTLVQYDKPYNP  234

Query  903   GYQVAYGILAEVEEHPYDLNKMVFMDWRDSHLNSNLELKERNKRIPTFLYAMPFSSTRIF  724
             GYQVAYGI+AEVEEHP+DL+KM+FMDWRDSHL  NLELKERN RIPTFLYAMPFSS RIF
Sbjct  235   GYQVAYGIMAEVEEHPFDLDKMLFMDWRDSHLKQNLELKERNSRIPTFLYAMPFSSNRIF  294

Query  723   LEETSLVARPGLDMKDIQERMVARLRHLGINVKSIEEDERCVIPMGGPLPVIPQRVVGIG  544
             LEETSLVARPG+  +DIQERMVARL HLGI VKSIEEDE CVIPMGGPLPV+PQRV+GIG
Sbjct  295   LEETSLVARPGVAPEDIQERMVARLAHLGIKVKSIEEDEHCVIPMGGPLPVLPQRVLGIG  354

Query  543   GTAGMVHPSTGYMVARTLAAAPVVANAIIQYLGSER-SLLGNELSASVWKDLWPIERRRQ  367
             GTAGMVHPSTGYMVARTLAAAP+VAN+I+ Y  S+  S  G++L+A +WK+LWPIERRRQ
Sbjct  355   GTAGMVHPSTGYMVARTLAAAPLVANSIVFYSSSDHNSASGDDLAAQIWKELWPIERRRQ  414

Query  366   REFFCFGMDILLKLDLPATRRFFDAFFDLEPRYWHGFLSSRLFLRELIFFGLSLFSHASN  187
             REFFCFGMDILLKLDL ATRRFFDAFFDLEP YWHGFLSSRLFL EL+ FGLSLFSHASN
Sbjct  415   REFFCFGMDILLKLDLQATRRFFDAFFDLEPHYWHGFLSSRLFLPELV-FGLSLFSHASN  473

Query  186   TSRLEIMTKGTLPLVNMINNLLQDID  109
             TSR+EIM KGT+PLVNMINNLLQD D
Sbjct  474   TSRVEIMAKGTIPLVNMINNLLQDKD  499



>ref|XP_010672975.1| PREDICTED: lycopene beta cyclase, chloroplastic [Beta vulgaris 
subsp. vulgaris]
Length=500

 Score =   790 bits (2041),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 401/501 (80%), Positives = 447/501 (89%), Gaps = 1/501 (0%)
 Frame = -2

Query  1611  MDTLLKTPNELEFLHPHHGFAVKASAFTSLKPQKQEIRIGSWKACRNVGRVKASSSALLE  1432
             M TLLK  N+ EF +P  GF+ K    +  K  +  IR    K C+N G V+ASSS LLE
Sbjct  1     MGTLLKIHNKFEFCNPIQGFSEKWGNLSFSKGHQCCIRKPHKKWCKN-GLVRASSSTLLE  59

Query  1431  LVPVTKKENLDFELPMFEPSKGIvvdlavvgggpaglavaqqVSQAGLSVCSIDPSPKLI  1252
             LVP TKKENLD ELP+++PSK  VVDLAVVGGGPAGLAVAQQVS+AGLSVC+IDP P+LI
Sbjct  60    LVPETKKENLDVELPLYDPSKAKVVDLAVVGGGPAGLAVAQQVSEAGLSVCAIDPFPRLI  119

Query  1251  WPNNYGVWVDEFEAMDLLDCLDTTWSGAMVYIDDRTTKDLDRPYGRVNRKKLKSKMMQKC  1072
             WPNNYGVWVDEFEAMDLLDCLDTTWSGA+VYI++   K+LDRPYGRVNRK LKSKMM KC
Sbjct  120   WPNNYGVWVDEFEAMDLLDCLDTTWSGAVVYINEGLKKNLDRPYGRVNRKLLKSKMMHKC  179

Query  1071  ITNGVKFHQAKVIKVIHEESKSMLICSDGVTIQATVVLDATGFSRCLVQYDKPYNPGYQV  892
             I+NGVKFHQAKVIKVIHEESKS+LIC+DGVTIQA+VVLDATGF+RCLVQYDKPYNPGYQV
Sbjct  180   ISNGVKFHQAKVIKVIHEESKSLLICNDGVTIQASVVLDATGFARCLVQYDKPYNPGYQV  239

Query  891   AYGILAEVEEHPYDLNKMVFMDWRDSHLNSNLELKERNKRIPTFLYAMPFSSTRIFLEET  712
             AYGILAEVE HP+D++KM+FMDWRDSHL+ N+ELKERN +IPTFLYAMPFS+ RIFLEET
Sbjct  240   AYGILAEVESHPFDVDKMLFMDWRDSHLDGNMELKERNSKIPTFLYAMPFSANRIFLEET  299

Query  711   SLVARPGLDMKDIQERMVARLRHLGINVKSIEEDERCVIPMGGPLPVIPQRVVGIGGTAG  532
             SLVARPG+ M+DIQ+RM ARL+HLGI V  IEEDERCVIPMGGPLPV+PQRVVGIGGTAG
Sbjct  300   SLVARPGVRMEDIQQRMEARLKHLGIKVTRIEEDERCVIPMGGPLPVLPQRVVGIGGTAG  359

Query  531   MVHPSTGYMVARTLAAAPVVANAIIQYLGSERSLLGNELSASVWKDLWPIERRRQREFFC  352
             MVHPSTGYMVARTLAAAP VAN+I+QYLGSERS  G+ELSA VW+DLWPIERRRQREFFC
Sbjct  360   MVHPSTGYMVARTLAAAPTVANSIVQYLGSERSDPGSELSAGVWRDLWPIERRRQREFFC  419

Query  351   FGMDILLKLDLPATRRFFDAFFDLEPRYWHGFLSSRLFLRELIFFGLSLFSHASNTSRLE  172
             FGMDILLKLDLP TR+FFDAFFDLEPRYWHGFLSSRL+L ELI FGLSLF+HASN+SRLE
Sbjct  420   FGMDILLKLDLPGTRKFFDAFFDLEPRYWHGFLSSRLYLPELIVFGLSLFAHASNSSRLE  479

Query  171   IMTKGTLPLVNMINNLLQDID  109
             IMTKGT PL+NMINNL++D D
Sbjct  480   IMTKGTFPLINMINNLVKDRD  500



>gb|ADW08476.1| lycopene beta-cyclase [Lilium lancifolium]
Length=500

 Score =   790 bits (2040),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 397/501 (79%), Positives = 445/501 (89%), Gaps = 1/501 (0%)
 Frame = -2

Query  1611  MDTLLKTPNELEFLHPHHGFAVKASAFTSLKPQKQEIRIGSWKACRNVGRVKASSSALLE  1432
             MDT+L+T + LE  HP  GFA + S  +S K  +   R  +W +C+    + A++S LL+
Sbjct  1     MDTILRTHSRLELSHPLRGFADRQSLPSSPKQPRFCGRKPNWTSCKQASAM-ATTSPLLD  59

Query  1431  LVPVTKKENLDFELPMFEPSKGIvvdlavvgggpaglavaqqVSQAGLSVCSIDPSPKLI  1252
             LVP TKKENLDF+LP+++PSKG+ VDLA+VGGGPAGLAVAQQVS+AGLSVCSIDPSPK+I
Sbjct  60    LVPETKKENLDFDLPLYDPSKGLTVDLAIVGGGPAGLAVAQQVSEAGLSVCSIDPSPKVI  119

Query  1251  WPNNYGVWVDEFEAMDLLDCLDTTWSGAMVYIDDRTTKDLDRPYGRVNRKKLKSKMMQKC  1072
             WPNNYGVWVDEFEAM LLDC+DT+WSGA VYID+ + K LDRPY RVNRK+LKSKMMQKC
Sbjct  120   WPNNYGVWVDEFEAMGLLDCIDTSWSGATVYIDEGSKKVLDRPYARVNRKQLKSKMMQKC  179

Query  1071  ITNGVKFHQAKVIKVIHEESKSMLICSDGVTIQATVVLDATGFSRCLVQYDKPYNPGYQV  892
             I NGVKFHQAKVIKV+HEE KS+L+C+DGVTIQATVVLDATGFSRCLVQY+KPYNPGYQV
Sbjct  180   IMNGVKFHQAKVIKVVHEEMKSLLVCNDGVTIQATVVLDATGFSRCLVQYEKPYNPGYQV  239

Query  891   AYGILAEVEEHPYDLNKMVFMDWRDSHLNSNLELKERNKRIPTFLYAMPFSSTRIFLEET  712
             AYGILAEVEEHP+DL+KM+FMDWRDSHL    E+KERN RIPTFLYAMPFSS RIFLEET
Sbjct  240   AYGILAEVEEHPFDLDKMLFMDWRDSHLKDGSEIKERNSRIPTFLYAMPFSSERIFLEET  299

Query  711   SLVARPGLDMKDIQERMVARLRHLGINVKSIEEDERCVIPMGGPLPVIPQRVVGIGGTAG  532
             SLVARPGL M+DIQERMVARL+HLGI VKSIEEDERCVIPMGGPLPV+PQRVVGIGGTAG
Sbjct  300   SLVARPGLRMEDIQERMVARLKHLGIKVKSIEEDERCVIPMGGPLPVLPQRVVGIGGTAG  359

Query  531   MVHPSTGYMVARTLAAAPVVANAIIQYLGSERSLLGNELSASVWKDLWPIERRRQREFFC  352
             MVHPSTGYMVARTLAAAP+VA +I+++LGS+  LLG ELSA VWKDLWPIERRRQREFFC
Sbjct  360   MVHPSTGYMVARTLAAAPIVAKSIVRFLGSDHGLLGRELSAEVWKDLWPIERRRQREFFC  419

Query  351   FGMDILLKLDLPATRRFFDAFFDLEPRYWHGFLSSRLFLRELIFFGLSLFSHASNTSRLE  172
             FGMD+LLKLDL  TR FFDAFFDLEPRYWHGFLSSRLFL EL FFGLSLF +ASNTSRLE
Sbjct  420   FGMDVLLKLDLQGTRGFFDAFFDLEPRYWHGFLSSRLFLPELFFFGLSLFKNASNTSRLE  479

Query  171   IMTKGTLPLVNMINNLLQDID  109
             IM KGT+PLVNM+NNLLQD D
Sbjct  480   IMAKGTVPLVNMLNNLLQDRD  500



>ref|XP_006297408.1| hypothetical protein CARUB_v10013432mg, partial [Capsella rubella]
 gb|EOA30306.1| hypothetical protein CARUB_v10013432mg, partial [Capsella rubella]
Length=533

 Score =   790 bits (2040),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 405/515 (79%), Positives = 447/515 (87%), Gaps = 11/515 (2%)
 Frame = -2

Query  1644  IVFSITVEGRVMDTLLKTPNELEFLHPH-HGFAVKASAFTSLKPQKQEIRIGSWKACRNV  1468
             +VF     G  MDTLLKTPN+LEF  P  HGF        S  P    +R+G  +    +
Sbjct  27    LVFISVFWGNSMDTLLKTPNKLEFFVPQFHGF----ERLGSNNPNPSRVRLGLKRRAIKI  82

Query  1467  GRVKASSSALLELVPVTKKENLDFELPMFEPSKGIvvdlavvgggpaglavaqqVSQAGL  1288
             G    S +ALL+LVP TKKENLDFELPM++ SK  VVDLA+VGGGPAGLAVAQQVS+AGL
Sbjct  83    G----SGAALLDLVPETKKENLDFELPMYDTSKSRVVDLAIVGGGPAGLAVAQQVSEAGL  138

Query  1287  SVCSIDPSPKLIWPNNYGVWVDEFEAMDLLDCLDTTWSGAMVYIDDRTTKDLDRPYGRVN  1108
             SVCSIDPSPKLIWPNNYGVWVDEFEAMDLLDCLDTTWSGA+VYID+   KDL RPYGRVN
Sbjct  139   SVCSIDPSPKLIWPNNYGVWVDEFEAMDLLDCLDTTWSGAVVYIDEGVKKDLSRPYGRVN  198

Query  1107  RKKLKSKMMQKCITNGVKFHQAKVIKVIHEESKSMLICSDGVTIQATVVLDATGFSRCLV  928
             RK+LKSKM+QKCITNGVKFHQ+KV  V+HEE+ S ++CSDGV IQA+VVLDATGFSRCLV
Sbjct  199   RKQLKSKMLQKCITNGVKFHQSKVTNVVHEEANSTVVCSDGVKIQASVVLDATGFSRCLV  258

Query  927   QYDKPYNPGYQVAYGILAEVEEHPYDLNKMVFMDWRDSHLNSNLELKERNKRIPTFLYAM  748
             QYDKPYNPGYQVAYGI+AEV+ HP+D++KMVFMDWRD+HL+S  ELKERN +IPTFLYAM
Sbjct  259   QYDKPYNPGYQVAYGIIAEVDSHPFDVDKMVFMDWRDTHLDSYPELKERNSKIPTFLYAM  318

Query  747   PFSSTRIFLEETSLVARPGLDMKDIQERMVARLRHLGINVKSIEEDERCVIPMGGPLPVI  568
             PFSSTRIFLEETSLVARPGL M+DIQERMVARL+HLGINVK IEEDERCVIPMGGPLPV+
Sbjct  319   PFSSTRIFLEETSLVARPGLRMEDIQERMVARLKHLGINVKRIEEDERCVIPMGGPLPVL  378

Query  567   PQRVVGIGGTAGMVHPSTGYMVARTLAAAPVVANAIIQYLG--SERSLLGNELSASVWKD  394
             PQRVVGIGGTAGMVHPSTGYMVARTLAAAP+VA AI++YLG  S  SL G++LSA VW+D
Sbjct  379   PQRVVGIGGTAGMVHPSTGYMVARTLAAAPIVAKAIVRYLGSPSSSSLRGDQLSAEVWRD  438

Query  393   LWPIERRRQREFFCFGMDILLKLDLPATRRFFDAFFDLEPRYWHGFLSSRLFLRELIFFG  214
             LWPIERRRQREFFCFGMDILLKLDL ATRRFFDAFFDLEP YWHGFLSSRLFL EL+FFG
Sbjct  439   LWPIERRRQREFFCFGMDILLKLDLEATRRFFDAFFDLEPHYWHGFLSSRLFLPELLFFG  498

Query  213   LSLFSHASNTSRLEIMTKGTLPLVNMINNLLQDID  109
             LSLFSHASNTSRLEIMTKGT+PL  MINNL+QD D
Sbjct  499   LSLFSHASNTSRLEIMTKGTVPLAKMINNLVQDRD  533



>dbj|BAE78471.1| lycopene beta cyclase [Taraxacum officinale]
Length=504

 Score =   788 bits (2035),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 398/502 (79%), Positives = 446/502 (89%), Gaps = 3/502 (1%)
 Frame = -2

Query  1611  MDTLLKTPNELEFLHPHHGFAVKASAFTSLKPQKQEIRIGSWKA---CRNVGRVKASSSA  1441
             MDTLL+T +  EFLHP H FA   +  +S KPQ  E R+   K+     + G VKASSSA
Sbjct  1     MDTLLRTHSSFEFLHPLHRFAGNLTNLSSSKPQIHEPRLSPKKSHLKWSHGGCVKASSSA  60

Query  1440  LLELVPVTKKENLDFELPMFEPSKGIvvdlavvgggpaglavaqqVSQAGLSVCSIDPSP  1261
             LLELVP  KKENLDFELP+++PSKG+VVDL VVGGGP+GLAVAQQVS+AGL+VCSIDPSP
Sbjct  61    LLELVPEIKKENLDFELPLYDPSKGVVVDLVVVGGGPSGLAVAQQVSEAGLTVCSIDPSP  120

Query  1260  KLIWPNNYGVWVDEFEAMDLLDCLDTTWSGAMVYIDDRTTKDLDRPYGRVNRKKLKSKMM  1081
             KLIWPNNYGVWVDEFEAMDLLDCLDTTWS A+VYID+ +TK+L RPYGRVNRK+LKSKM+
Sbjct  121   KLIWPNNYGVWVDEFEAMDLLDCLDTTWSSAVVYIDENSTKNLGRPYGRVNRKQLKSKML  180

Query  1080  QKCITNGVKFHQAKVIKVIHEESKSMLICSDGVTIQATVVLDATGFSRCLVQYDKPYNPG  901
             +KCI+NGVKFHQAKVIKVIHEE KS+LIC+DGVTIQAT+VLDATGFSR LVQYDKPYNPG
Sbjct  181   KKCISNGVKFHQAKVIKVIHEELKSLLICNDGVTIQATLVLDATGFSRSLVQYDKPYNPG  240

Query  900   YQVAYGILAEVEEHPYDLNKMVFMDWRDSHLNSNLELKERNKRIPTFLYAMPFSSTRIFL  721
             +QVAYGILAEVEEHP+D++KM+FMDWRDSHL +N E+K+RN +IPTFLYAMPFSS RIFL
Sbjct  241   FQVAYGILAEVEEHPFDVDKMLFMDWRDSHLKNNPEIKDRNSKIPTFLYAMPFSSNRIFL  300

Query  720   EETSLVARPGLDMKDIQERMVARLRHLGINVKSIEEDERCVIPMGGPLPVIPQRVVGIGG  541
             EETSLVARPGL  +DIQERMV RL+HLGI VKSIEEDERCVIPMGGPLPV+PQRV+GIGG
Sbjct  301   EETSLVARPGLKFEDIQERMVCRLKHLGIKVKSIEEDERCVIPMGGPLPVLPQRVLGIGG  360

Query  540   TAGMVHPSTGYMVARTLAAAPVVANAIIQYLGSERSLLGNELSASVWKDLWPIERRRQRE  361
             TAGMVHPSTGYMVARTLAAAP+VA +IIQYL SE++  G +LSA +W+DLWPIERRRQRE
Sbjct  361   TAGMVHPSTGYMVARTLAAAPIVAKSIIQYLNSEKAASGTDLSAEIWRDLWPIERRRQRE  420

Query  360   FFCFGMDILLKLDLPATRRFFDAFFDLEPRYWHGFLSSRLFLRELIFFGLSLFSHASNTS  181
             FFCFGMDILLKLDL  TRRFFDAFFDLEPRYWHGF SSRLFL EL+ FGLSLF HASNT 
Sbjct  421   FFCFGMDILLKLDLEGTRRFFDAFFDLEPRYWHGFSSSRLFLPELLTFGLSLFGHASNTC  480

Query  180   RLEIMTKGTLPLVNMINNLLQD  115
             R+EIM KGTLPL  MINNL+QD
Sbjct  481   RIEIMAKGTLPLATMINNLVQD  502



>ref|XP_010486621.1| PREDICTED: lycopene beta cyclase, chloroplastic isoform X1 [Camelina 
sativa]
 ref|XP_010486622.1| PREDICTED: lycopene beta cyclase, chloroplastic isoform X2 [Camelina 
sativa]
Length=502

 Score =   787 bits (2032),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 400/506 (79%), Positives = 446/506 (88%), Gaps = 9/506 (2%)
 Frame = -2

Query  1611  MDTLLKTPNELEFLHPH-HGFAVKASAFTSLKPQKQEIRIGSWKACRNVGRVKASSS--A  1441
             MDTLLK+PN+LEF  P  HGF      F+S  P    +++G  K    +G   ASS+  A
Sbjct  1     MDTLLKSPNKLEFFVPQFHGF----ERFSSNNPNPSRVKLGLKKRAIRIGSGVASSTSAA  56

Query  1440  LLELVPVTKKENLDFELPMFEPSKGIvvdlavvgggpaglavaqqVSQAGLSVCSIDPSP  1261
             LL+LVP TKKE+LDFELP+++ SK  +VDLA+VGGGPAGLAVAQQVS+AGLSVCSIDPSP
Sbjct  57    LLDLVPETKKESLDFELPLYDTSKSPLVDLAIVGGGPAGLAVAQQVSEAGLSVCSIDPSP  116

Query  1260  KLIWPNNYGVWVDEFEAMDLLDCLDTTWSGAMVYIDDRTTKDLDRPYGRVNRKKLKSKMM  1081
             KLIWPNNYGVWVDEFEAMDLLDCLDTTWSGA+VYI +   KDL RPYGRVNRK+LKSKM+
Sbjct  117   KLIWPNNYGVWVDEFEAMDLLDCLDTTWSGAVVYIGEGVKKDLSRPYGRVNRKQLKSKML  176

Query  1080  QKCITNGVKFHQAKVIKVIHEESKSMLICSDGVTIQATVVLDATGFSRCLVQYDKPYNPG  901
             QKCITNGVKFHQ+KV  V+HEE  S ++CSDGV IQA+VVLDATGFSRCLVQYDKPYNPG
Sbjct  177   QKCITNGVKFHQSKVTNVVHEEENSTVVCSDGVKIQASVVLDATGFSRCLVQYDKPYNPG  236

Query  900   YQVAYGILAEVEEHPYDLNKMVFMDWRDSHLNSNLELKERNKRIPTFLYAMPFSSTRIFL  721
             YQVAYGI+AEV+ HP+D++KMVFMDWRD+HL+S  ELKERN +IPTFLYAMPFSSTRIFL
Sbjct  237   YQVAYGIIAEVDSHPFDVDKMVFMDWRDTHLDSYPELKERNSKIPTFLYAMPFSSTRIFL  296

Query  720   EETSLVARPGLDMKDIQERMVARLRHLGINVKSIEEDERCVIPMGGPLPVIPQRVVGIGG  541
             EETSLVARPGL M+DIQERMVARL+HLGINVK IEEDERCVIPMGGPLPV+PQRVVGIGG
Sbjct  297   EETSLVARPGLRMEDIQERMVARLKHLGINVKRIEEDERCVIPMGGPLPVLPQRVVGIGG  356

Query  540   TAGMVHPSTGYMVARTLAAAPVVANAIIQYLG--SERSLLGNELSASVWKDLWPIERRRQ  367
             TAGMVHPSTGYMVARTLAAAP+VANAI++YLG  S  SL G++LSA VW+DLWPIERRRQ
Sbjct  357   TAGMVHPSTGYMVARTLAAAPIVANAIVRYLGSSSSNSLRGDQLSAEVWRDLWPIERRRQ  416

Query  366   REFFCFGMDILLKLDLPATRRFFDAFFDLEPRYWHGFLSSRLFLRELIFFGLSLFSHASN  187
             REFFCFGMDILLKLDL ATRRFFDAFFDL+P YWHGFLSSRLFL EL+FFGLSLFSHASN
Sbjct  417   REFFCFGMDILLKLDLEATRRFFDAFFDLQPHYWHGFLSSRLFLPELLFFGLSLFSHASN  476

Query  186   TSRLEIMTKGTLPLVNMINNLLQDID  109
             TSRLEIMTKGT+PL  MINNL+QD D
Sbjct  477   TSRLEIMTKGTVPLAKMINNLVQDRD  502



>ref|XP_008811265.1| PREDICTED: lycopene beta cyclase, chloroplastic [Phoenix dactylifera]
Length=504

 Score =   783 bits (2023),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 397/502 (79%), Positives = 441/502 (88%), Gaps = 3/502 (1%)
 Frame = -2

Query  1611  MDTLLKTPNELEFLHPHHGFAVKASAFTSLKPQKQEIRIGSWKACRN---VGRVKASSSA  1441
             MD LL+  + LE LHP HG A +     S K Q+Q+ R    ++ R     G  +A S+A
Sbjct  1     MDALLRIHSRLELLHPVHGLAERQGLSPSRKLQRQDRRASCRRSHRKWAEKGLARAGSNA  60

Query  1440  LLELVPVTKKENLDFELPMFEPSKGIvvdlavvgggpaglavaqqVSQAGLSVCSIDPSP  1261
             LLELVP TKKENL+F+LP+++PSKG+ +DLAVVGGGPAGLAVAQQVS+AGLSVCSIDPSP
Sbjct  61    LLELVPETKKENLEFDLPLYDPSKGLTLDLAVVGGGPAGLAVAQQVSEAGLSVCSIDPSP  120

Query  1260  KLIWPNNYGVWVDEFEAMDLLDCLDTTWSGAMVYIDDRTTKDLDRPYGRVNRKKLKSKMM  1081
             KLIWPNNYGVWVDEFEA+DLLDCLD TW GA+VY+DD   K L RPY RV+RK+LKSKMM
Sbjct  121   KLIWPNNYGVWVDEFEALDLLDCLDATWPGAVVYVDDLKKKLLGRPYARVDRKQLKSKMM  180

Query  1080  QKCITNGVKFHQAKVIKVIHEESKSMLICSDGVTIQATVVLDATGFSRCLVQYDKPYNPG  901
             QKC++NGV+FH AKV+KVIHEESKS+LIC+DGVTIQATVVLDATGFSRCLVQYDK YNPG
Sbjct  181   QKCVSNGVRFHPAKVVKVIHEESKSLLICNDGVTIQATVVLDATGFSRCLVQYDKLYNPG  240

Query  900   YQVAYGILAEVEEHPYDLNKMVFMDWRDSHLNSNLELKERNKRIPTFLYAMPFSSTRIFL  721
             YQVAYGILAEVEEHP+DL+KMVFMDWRDSHL     LKERN R+PTFLYAMPFSST IFL
Sbjct  241   YQVAYGILAEVEEHPFDLDKMVFMDWRDSHLTDGTALKERNCRVPTFLYAMPFSSTGIFL  300

Query  720   EETSLVARPGLDMKDIQERMVARLRHLGINVKSIEEDERCVIPMGGPLPVIPQRVVGIGG  541
             EETSLVARPGL M+DIQERMVARLRHLGI VKSIEEDERCVIPMGGPLPV+PQRVVGIGG
Sbjct  301   EETSLVARPGLRMEDIQERMVARLRHLGIKVKSIEEDERCVIPMGGPLPVLPQRVVGIGG  360

Query  540   TAGMVHPSTGYMVARTLAAAPVVANAIIQYLGSERSLLGNELSASVWKDLWPIERRRQRE  361
             TAGMVHPSTGYMVARTLAAAP+VAN+I+++LGS+  L GNELSA VWK+LWPIERRRQRE
Sbjct  361   TAGMVHPSTGYMVARTLAAAPIVANSIVRFLGSDHDLSGNELSAEVWKNLWPIERRRQRE  420

Query  360   FFCFGMDILLKLDLPATRRFFDAFFDLEPRYWHGFLSSRLFLRELIFFGLSLFSHASNTS  181
             FFCFGMDILLKLDL  TRRFFDAFF+LEP YWHGFLSSRLFL EL+FFGLSLFSHASNTS
Sbjct  421   FFCFGMDILLKLDLQGTRRFFDAFFNLEPHYWHGFLSSRLFLPELVFFGLSLFSHASNTS  480

Query  180   RLEIMTKGTLPLVNMINNLLQD  115
             RLEIM KGT PLVNMI NLL++
Sbjct  481   RLEIMAKGTPPLVNMIKNLLRE  502



>ref|XP_002884784.1| lycopene cyclase [Arabidopsis lyrata subsp. lyrata]
 gb|EFH61043.1| lycopene cyclase [Arabidopsis lyrata subsp. lyrata]
Length=501

 Score =   783 bits (2021),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 398/505 (79%), Positives = 443/505 (88%), Gaps = 8/505 (2%)
 Frame = -2

Query  1611  MDTLLKTPNELEFLHPH-HGFAVKASAFTSLKPQKQEIRIGSWKACRNVGR-VKASSSAL  1438
             MDTLLKTPN+L+F  P  HGF       +S  P    +R+G  K    +G  V + S+AL
Sbjct  1     MDTLLKTPNKLDFFIPQFHGF----ERLSSNNPNPARVRLGLKKRAIKIGSSVASGSAAL  56

Query  1437  LELVPVTKKENLDFELPMFEPSKGIvvdlavvgggpaglavaqqVSQAGLSVCSIDPSPK  1258
             L+LVP TKKENLDFELP+++ SK  VVDLA+VGGGPAGLAVAQQVS+AGLSVCSIDPSPK
Sbjct  57    LDLVPETKKENLDFELPLYDTSKSQVVDLAIVGGGPAGLAVAQQVSEAGLSVCSIDPSPK  116

Query  1257  LIWPNNYGVWVDEFEAMDLLDCLDTTWSGAMVYIDDRTTKDLDRPYGRVNRKKLKSKMMQ  1078
             LIWPNNYGVWVDEFEAMDLLDCLDTTWSGA+VY+D+   KDL RPYGRVNRK+LKSKM+Q
Sbjct  117   LIWPNNYGVWVDEFEAMDLLDCLDTTWSGAVVYVDEGVKKDLSRPYGRVNRKQLKSKMLQ  176

Query  1077  KCITNGVKFHQAKVIKVIHEESKSMLICSDGVTIQATVVLDATGFSRCLVQYDKPYNPGY  898
             KCITNGVKFHQ+KV  V+HEE+ S ++CSDGV IQA+VVLDATGFSRCLVQYDKPYNPGY
Sbjct  177   KCITNGVKFHQSKVTNVVHEEANSTVVCSDGVKIQASVVLDATGFSRCLVQYDKPYNPGY  236

Query  897   QVAYGILAEVEEHPYDLNKMVFMDWRDSHLNSNLELKERNKRIPTFLYAMPFSSTRIFLE  718
             QVAYGI+AEV+ HP+D++KMVFMDWRD HL+S  ELKERN +IPTFLYAMPFSS RIFLE
Sbjct  237   QVAYGIIAEVDGHPFDVDKMVFMDWRDRHLDSYPELKERNSKIPTFLYAMPFSSNRIFLE  296

Query  717   ETSLVARPGLDMKDIQERMVARLRHLGINVKSIEEDERCVIPMGGPLPVIPQRVVGIGGT  538
             ETSLVARPGL M DIQERM ARL+HLGINVK IEEDERCVIPMGGPLPV+PQRVVGIGGT
Sbjct  297   ETSLVARPGLRMDDIQERMAARLKHLGINVKRIEEDERCVIPMGGPLPVLPQRVVGIGGT  356

Query  537   AGMVHPSTGYMVARTLAAAPVVANAIIQYLG--SERSLLGNELSASVWKDLWPIERRRQR  364
             AGMVHPSTGYMVARTLAAAP+VANAI++YLG  S  SL G++LSA VW+DLWPIERRRQR
Sbjct  357   AGMVHPSTGYMVARTLAAAPIVANAIVRYLGSPSSNSLRGDQLSAEVWRDLWPIERRRQR  416

Query  363   EFFCFGMDILLKLDLPATRRFFDAFFDLEPRYWHGFLSSRLFLRELIFFGLSLFSHASNT  184
             EFFCFGMDILLKL+L ATRRFFDAFFDL+P YWHGFLSSRLFL EL+FFGLSLFSHASNT
Sbjct  417   EFFCFGMDILLKLNLDATRRFFDAFFDLQPHYWHGFLSSRLFLPELLFFGLSLFSHASNT  476

Query  183   SRLEIMTKGTLPLVNMINNLLQDID  109
             SRLEIMTKGT+PL  MINNL+QD D
Sbjct  477   SRLEIMTKGTVPLAKMINNLVQDRD  501



>ref|XP_010464692.1| PREDICTED: lycopene beta cyclase, chloroplastic-like [Camelina 
sativa]
Length=505

 Score =   782 bits (2020),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 398/509 (78%), Positives = 443/509 (87%), Gaps = 12/509 (2%)
 Frame = -2

Query  1611  MDTLLKTPNELEFLHPH-HGFAVKASAFTSLKPQKQEIRIGSWKACRNVGR-----VKAS  1450
             MDTLLK+PN+LEF  P  HGF        S  P    +++G  K    +G        ++
Sbjct  1     MDTLLKSPNKLEFFVPQFHGF----DRLGSNNPNPSRVKLGLKKRAIKIGSGVVVAASST  56

Query  1449  SSALLELVPVTKKENLDFELPMFEPSKGIvvdlavvgggpaglavaqqVSQAGLSVCSID  1270
             S+ALL+LVP TKKENLDFELP+++ SK  +VDLA+VGGGPAGLAVAQQVS+AGLSVCSID
Sbjct  57    SAALLDLVPGTKKENLDFELPLYDTSKSPLVDLAIVGGGPAGLAVAQQVSEAGLSVCSID  116

Query  1269  PSPKLIWPNNYGVWVDEFEAMDLLDCLDTTWSGAMVYIDDRTTKDLDRPYGRVNRKKLKS  1090
             PSPKLIWPNNYGVWVDEFEAMDLLDCLDTTWSGA+VYI +   KDL RPYGRVNRK+LKS
Sbjct  117   PSPKLIWPNNYGVWVDEFEAMDLLDCLDTTWSGAVVYIGEGVKKDLSRPYGRVNRKQLKS  176

Query  1089  KMMQKCITNGVKFHQAKVIKVIHEESKSMLICSDGVTIQATVVLDATGFSRCLVQYDKPY  910
             KM+QKCITNGVKFHQ+KV  V+HEE  S ++CSDGV IQA+VVLDATGFSRCLVQYDKPY
Sbjct  177   KMLQKCITNGVKFHQSKVTNVVHEEENSTVVCSDGVKIQASVVLDATGFSRCLVQYDKPY  236

Query  909   NPGYQVAYGILAEVEEHPYDLNKMVFMDWRDSHLNSNLELKERNKRIPTFLYAMPFSSTR  730
             NPGYQVAYGI+AEVE HP+D++KMVFMDWRD+HL+S  ELKERN +IPTFLYAMPFSSTR
Sbjct  237   NPGYQVAYGIIAEVESHPFDVDKMVFMDWRDTHLDSYPELKERNSKIPTFLYAMPFSSTR  296

Query  729   IFLEETSLVARPGLDMKDIQERMVARLRHLGINVKSIEEDERCVIPMGGPLPVIPQRVVG  550
             IFLEETSLVARPGL M+DIQERMVARL+HLGINVK IEEDERCVIPMGGPLPV+PQRVVG
Sbjct  297   IFLEETSLVARPGLRMEDIQERMVARLKHLGINVKRIEEDERCVIPMGGPLPVLPQRVVG  356

Query  549   IGGTAGMVHPSTGYMVARTLAAAPVVANAIIQYLG--SERSLLGNELSASVWKDLWPIER  376
             IGGTAGMVHPSTGYMVARTLAAAP+VA AI++YLG  S  SL G++LSA VW+DLWPIER
Sbjct  357   IGGTAGMVHPSTGYMVARTLAAAPIVAKAIVRYLGSSSSNSLRGDQLSAEVWRDLWPIER  416

Query  375   RRQREFFCFGMDILLKLDLPATRRFFDAFFDLEPRYWHGFLSSRLFLRELIFFGLSLFSH  196
             RRQREFFCFGMDILLKLDL ATRRFFDAFFDL+P YWHGFLSSRLFL EL+FFGLSLFSH
Sbjct  417   RRQREFFCFGMDILLKLDLEATRRFFDAFFDLQPHYWHGFLSSRLFLPELLFFGLSLFSH  476

Query  195   ASNTSRLEIMTKGTLPLVNMINNLLQDID  109
             ASNTSRLEIMTKGT+PL  MINNL+QD D
Sbjct  477   ASNTSRLEIMTKGTVPLAKMINNLVQDRD  505



>ref|NP_187634.1| lycopene beta cyclase [Arabidopsis thaliana]
 sp|Q38933.1|LCYB_ARATH RecName: Full=Lycopene beta cyclase, chloroplastic; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAF02819.1|AC009400_15 lycopene beta cyclase [Arabidopsis thaliana]
 gb|AAF82388.1|AF117256_1 lycopene beta cyclase [Arabidopsis thaliana]
 gb|AAB53337.1| Lycopene beta cyclase [Arabidopsis thaliana]
 gb|AAL24097.1| putative lycopene beta cyclase [Arabidopsis thaliana]
 gb|AAM14335.1| putative lycopene beta cyclase [Arabidopsis thaliana]
 gb|AEE74874.1| lycopene beta cyclase [Arabidopsis thaliana]
Length=501

 Score =   782 bits (2019),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 399/505 (79%), Positives = 443/505 (88%), Gaps = 8/505 (2%)
 Frame = -2

Query  1611  MDTLLKTPNELEFLHPH-HGFAVKASAFTSLKPQKQEIRIGSWK-ACRNVGRVKASSSAL  1438
             MDTLLKTPN+L+F  P  HGF        S  P    +R+G  K A + V  V + S+AL
Sbjct  1     MDTLLKTPNKLDFFIPQFHGF----ERLCSNNPYHSRVRLGVKKRAIKIVSSVVSGSAAL  56

Query  1437  LELVPVTKKENLDFELPMFEPSKGIvvdlavvgggpaglavaqqVSQAGLSVCSIDPSPK  1258
             L+LVP TKKENLDFELP+++ SK  VVDLA+VGGGPAGLAVAQQVS+AGLSVCSIDPSPK
Sbjct  57    LDLVPETKKENLDFELPLYDTSKSQVVDLAIVGGGPAGLAVAQQVSEAGLSVCSIDPSPK  116

Query  1257  LIWPNNYGVWVDEFEAMDLLDCLDTTWSGAMVYIDDRTTKDLDRPYGRVNRKKLKSKMMQ  1078
             LIWPNNYGVWVDEFEAMDLLDCLDTTWSGA+VY+D+   KDL RPYGRVNRK+LKSKM+Q
Sbjct  117   LIWPNNYGVWVDEFEAMDLLDCLDTTWSGAVVYVDEGVKKDLSRPYGRVNRKQLKSKMLQ  176

Query  1077  KCITNGVKFHQAKVIKVIHEESKSMLICSDGVTIQATVVLDATGFSRCLVQYDKPYNPGY  898
             KCITNGVKFHQ+KV  V+HEE+ S ++CSDGV IQA+VVLDATGFSRCLVQYDKPYNPGY
Sbjct  177   KCITNGVKFHQSKVTNVVHEEANSTVVCSDGVKIQASVVLDATGFSRCLVQYDKPYNPGY  236

Query  897   QVAYGILAEVEEHPYDLNKMVFMDWRDSHLNSNLELKERNKRIPTFLYAMPFSSTRIFLE  718
             QVAYGI+AEV+ HP+D++KMVFMDWRD HL+S  ELKERN +IPTFLYAMPFSS RIFLE
Sbjct  237   QVAYGIVAEVDGHPFDVDKMVFMDWRDKHLDSYPELKERNSKIPTFLYAMPFSSNRIFLE  296

Query  717   ETSLVARPGLDMKDIQERMVARLRHLGINVKSIEEDERCVIPMGGPLPVIPQRVVGIGGT  538
             ETSLVARPGL M+DIQERM ARL+HLGINVK IEEDERCVIPMGGPLPV+PQRVVGIGGT
Sbjct  297   ETSLVARPGLRMEDIQERMAARLKHLGINVKRIEEDERCVIPMGGPLPVLPQRVVGIGGT  356

Query  537   AGMVHPSTGYMVARTLAAAPVVANAIIQYLG--SERSLLGNELSASVWKDLWPIERRRQR  364
             AGMVHPSTGYMVARTLAAAP+VANAI++YLG  S  SL G++LSA VW+DLWPIERRRQR
Sbjct  357   AGMVHPSTGYMVARTLAAAPIVANAIVRYLGSPSSNSLRGDQLSAEVWRDLWPIERRRQR  416

Query  363   EFFCFGMDILLKLDLPATRRFFDAFFDLEPRYWHGFLSSRLFLRELIFFGLSLFSHASNT  184
             EFFCFGMDILLKLDL ATRRFFDAFFDL+P YWHGFLSSRLFL EL+ FGLSLFSHASNT
Sbjct  417   EFFCFGMDILLKLDLDATRRFFDAFFDLQPHYWHGFLSSRLFLPELLVFGLSLFSHASNT  476

Query  183   SRLEIMTKGTLPLVNMINNLLQDID  109
             SRLEIMTKGT+PL  MINNL+QD D
Sbjct  477   SRLEIMTKGTVPLAKMINNLVQDRD  501



>gb|ACT78995.1| lycopene beta cyclase [Narcissus pseudonarcissus]
Length=504

 Score =   782 bits (2019),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 396/505 (78%), Positives = 437/505 (87%), Gaps = 5/505 (1%)
 Frame = -2

Query  1611  MDTLLKTPNELEFLHPHHGFAVKASAFTSLKPQKQEIRIGS----WKACRNVGRVKASSS  1444
             MDTLL+T N LE L+P H  A +     S  PQ    +  S     K CRN G +  SS+
Sbjct  1     MDTLLRTHNRLELLYPLHELAKRHFLSPSPNPQNPNFKFFSRKPYQKKCRN-GYIGVSSN  59

Query  1443  ALLELVPVTKKENLDFELPMFEPSKGIvvdlavvgggpaglavaqqVSQAGLSVCSIDPS  1264
              LL+LVP  KKE+L+F+LP+++PSK + +DLAVVGGGPAGLAVAQQVS+AGLSV SIDP+
Sbjct  60    QLLDLVPEIKKEHLEFDLPLYDPSKALTLDLAVVGGGPAGLAVAQQVSEAGLSVVSIDPN  119

Query  1263  PKLIWPNNYGVWVDEFEAMDLLDCLDTTWSGAMVYIDDRTTKDLDRPYGRVNRKKLKSKM  1084
             PKLIWPNNYGVWVDEFE MDLLDCLD TWSGA+VY+DDR+TK+L RPY RVNRK LKSKM
Sbjct  120   PKLIWPNNYGVWVDEFEDMDLLDCLDATWSGAIVYVDDRSTKNLSRPYARVNRKNLKSKM  179

Query  1083  MQKCITNGVKFHQAKVIKVIHEESKSMLICSDGVTIQATVVLDATGFSRCLVQYDKPYNP  904
             M+KC++NGV+FHQA V+K +HEE KS LICSDGVTI A VVLDATGFSRCLVQYDKPYNP
Sbjct  180   MKKCVSNGVRFHQATVVKAMHEEEKSYLICSDGVTIDARVVLDATGFSRCLVQYDKPYNP  239

Query  903   GYQVAYGILAEVEEHPYDLNKMVFMDWRDSHLNSNLELKERNKRIPTFLYAMPFSSTRIF  724
             GYQVAYGILAEVEEHP+D++KMVFMDWRDSHLN   EL ERN +IPTFLYAMPFSS RIF
Sbjct  240   GYQVAYGILAEVEEHPFDVDKMVFMDWRDSHLNGKAELNERNAKIPTFLYAMPFSSNRIF  299

Query  723   LEETSLVARPGLDMKDIQERMVARLRHLGINVKSIEEDERCVIPMGGPLPVIPQRVVGIG  544
             LEETSLVARPGL M+DIQERMVARL HLGI +KSIEEDERCVIPMGGPLPVIPQRVVGIG
Sbjct  300   LEETSLVARPGLKMEDIQERMVARLNHLGIRIKSIEEDERCVIPMGGPLPVIPQRVVGIG  359

Query  543   GTAGMVHPSTGYMVARTLAAAPVVANAIIQYLGSERSLLGNELSASVWKDLWPIERRRQR  364
             GTAGMVHPSTGYMVARTLAAAP+VAN+I+QYL S+  L GN+LSA VWKDLWPIERRRQR
Sbjct  360   GTAGMVHPSTGYMVARTLAAAPIVANSIVQYLVSDSGLSGNDLSADVWKDLWPIERRRQR  419

Query  363   EFFCFGMDILLKLDLPATRRFFDAFFDLEPRYWHGFLSSRLFLRELIFFGLSLFSHASNT  184
             EFFCFGMDILLKLDL  TRRFFDAFFDLEPRYWHGFLSSRLFL EL+ FGLSLFSHASNT
Sbjct  420   EFFCFGMDILLKLDLEGTRRFFDAFFDLEPRYWHGFLSSRLFLPELVPFGLSLFSHASNT  479

Query  183   SRLEIMTKGTLPLVNMINNLLQDID  109
              +LEIM KGTLPLVNMINNL+QD D
Sbjct  480   CKLEIMAKGTLPLVNMINNLVQDRD  504



>gb|AAA81880.1| lycopene cyclase [Arabidopsis thaliana]
Length=501

 Score =   781 bits (2018),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 399/505 (79%), Positives = 443/505 (88%), Gaps = 8/505 (2%)
 Frame = -2

Query  1611  MDTLLKTPNELEFLHPH-HGFAVKASAFTSLKPQKQEIRIGSWK-ACRNVGRVKASSSAL  1438
             MDTLLKTPN+L+F  P  HGF        S  P    +R+G  K A + V  V + S+AL
Sbjct  1     MDTLLKTPNKLDFFIPQFHGF----ERLCSNNPYPSRVRLGVKKRAIKIVSSVVSGSAAL  56

Query  1437  LELVPVTKKENLDFELPMFEPSKGIvvdlavvgggpaglavaqqVSQAGLSVCSIDPSPK  1258
             L+LVP TKKENLDFELP+++ SK  VVDLA+VGGGPAGLAVAQQVS+AGLSVCSIDPSPK
Sbjct  57    LDLVPETKKENLDFELPLYDTSKSQVVDLAIVGGGPAGLAVAQQVSEAGLSVCSIDPSPK  116

Query  1257  LIWPNNYGVWVDEFEAMDLLDCLDTTWSGAMVYIDDRTTKDLDRPYGRVNRKKLKSKMMQ  1078
             LIWPNNYGVWVDEFEAMDLLDCLDTTWSGA+VY+D+   KDL RPYGRVNRK+LKSKM+Q
Sbjct  117   LIWPNNYGVWVDEFEAMDLLDCLDTTWSGAVVYVDEGVKKDLSRPYGRVNRKQLKSKMLQ  176

Query  1077  KCITNGVKFHQAKVIKVIHEESKSMLICSDGVTIQATVVLDATGFSRCLVQYDKPYNPGY  898
             KCITNGVKFHQ+KV  V+HEE+ S ++CSDGV IQA+VVLDATGFSRCLVQYDKPYNPGY
Sbjct  177   KCITNGVKFHQSKVTNVVHEEANSTVVCSDGVKIQASVVLDATGFSRCLVQYDKPYNPGY  236

Query  897   QVAYGILAEVEEHPYDLNKMVFMDWRDSHLNSNLELKERNKRIPTFLYAMPFSSTRIFLE  718
             QVAYGI+AEV+ HP+D++KMVFMDWRD HL+S  ELKERN +IPTFLYAMPFSS RIFLE
Sbjct  237   QVAYGIIAEVDGHPFDVDKMVFMDWRDKHLDSYPELKERNSKIPTFLYAMPFSSNRIFLE  296

Query  717   ETSLVARPGLDMKDIQERMVARLRHLGINVKSIEEDERCVIPMGGPLPVIPQRVVGIGGT  538
             ETSLVARPGL M+DIQERM ARL+HLGINVK IEEDERCVIPMGGPLPV+PQRVVGIGGT
Sbjct  297   ETSLVARPGLRMEDIQERMAARLKHLGINVKRIEEDERCVIPMGGPLPVLPQRVVGIGGT  356

Query  537   AGMVHPSTGYMVARTLAAAPVVANAIIQYLG--SERSLLGNELSASVWKDLWPIERRRQR  364
             AGMVHPSTGYMVARTLAAAP+VANAI++YLG  S  SL G++LSA VW+DLWPIERRRQR
Sbjct  357   AGMVHPSTGYMVARTLAAAPIVANAIVRYLGSPSSNSLRGDQLSAEVWRDLWPIERRRQR  416

Query  363   EFFCFGMDILLKLDLPATRRFFDAFFDLEPRYWHGFLSSRLFLRELIFFGLSLFSHASNT  184
             EFFCFGMDILLKLDL ATRRFFDAFFDL+P YWHGFLSSRLFL EL+ FGLSLFSHASNT
Sbjct  417   EFFCFGMDILLKLDLDATRRFFDAFFDLQPHYWHGFLSSRLFLPELLVFGLSLFSHASNT  476

Query  183   SRLEIMTKGTLPLVNMINNLLQDID  109
             SRLEIMTKGT+PL  MINNL+QD D
Sbjct  477   SRLEIMTKGTVPLAKMINNLVQDRD  501



>gb|ADT89710.1| chloroplast lycopene beta-cyclase [Brassica napus]
 emb|CDY08618.1| BnaA05g28540D [Brassica napus]
Length=493

 Score =   781 bits (2016),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 394/503 (78%), Positives = 442/503 (88%), Gaps = 12/503 (2%)
 Frame = -2

Query  1611  MDTLLKTPNELEFLHPH-HGFAVKASAFTSLKPQKQEIRIGSWKACRNVGR-VKASSSAL  1438
             MDTLL+TPN+LEF  P  HGF         L P    +++G  K    +G  + ++SSAL
Sbjct  1     MDTLLRTPNKLEFFIPQFHGFE-------RLSPNPSRVKLGVKKRAIRIGSSITSASSAL  53

Query  1437  LELVPVTKKENLDFELPMFEPSKGIvvdlavvgggpaglavaqqVSQAGLSVCSIDPSPK  1258
             L+LVP TKKENLDF+LP+++ S    VDLA+VGGGPAGLAVAQQVS+AGLSVCSIDPSPK
Sbjct  54    LDLVPETKKENLDFDLPLYDTSLNKTVDLAIVGGGPAGLAVAQQVSEAGLSVCSIDPSPK  113

Query  1257  LIWPNNYGVWVDEFEAMDLLDCLDTTWSGAMVYIDDRTTKDLDRPYGRVNRKKLKSKMMQ  1078
             LIWPNNYGVWVDEFEAMDLLDCLDTTWSGA+VYI+D   KDL RPYGRVNRK+LKSKM+Q
Sbjct  114   LIWPNNYGVWVDEFEAMDLLDCLDTTWSGAVVYINDGAEKDLSRPYGRVNRKQLKSKMLQ  173

Query  1077  KCITNGVKFHQAKVIKVIHEESKSMLICSDGVTIQATVVLDATGFSRCLVQYDKPYNPGY  898
             KCITNGV+FHQAKV  V+HEE  S ++CSDGV IQA+VVLDATGFSRCLVQYDKPYNPGY
Sbjct  174   KCITNGVRFHQAKVTNVVHEEVNSTVVCSDGVKIQASVVLDATGFSRCLVQYDKPYNPGY  233

Query  897   QVAYGILAEVEEHPYDLNKMVFMDWRDSHLNSNLELKERNKRIPTFLYAMPFSSTRIFLE  718
             QVAYGI+AEV+ HP+D++KMVFMDWRD HL++  E+KERN +IPTFLYAMPFSS RIFLE
Sbjct  234   QVAYGIVAEVDGHPFDVDKMVFMDWRDKHLDAYPEVKERNSKIPTFLYAMPFSSNRIFLE  293

Query  717   ETSLVARPGLDMKDIQERMVARLRHLGINVKSIEEDERCVIPMGGPLPVIPQRVVGIGGT  538
             ETSLVARPGL M+DIQERMVARL+HLGINVK IEEDERCVIPMGGPLPV+PQRVVGIGGT
Sbjct  294   ETSLVARPGLKMEDIQERMVARLKHLGINVKRIEEDERCVIPMGGPLPVLPQRVVGIGGT  353

Query  537   AGMVHPSTGYMVARTLAAAPVVANAIIQYLGSERSLLGNELSASVWKDLWPIERRRQREF  358
             AGMVHPSTGYMVARTLAAAP+VANAI++YLGS +   G+ELSA VW+DLWPIERRRQREF
Sbjct  354   AGMVHPSTGYMVARTLAAAPIVANAIVRYLGSTK---GDELSAEVWRDLWPIERRRQREF  410

Query  357   FCFGMDILLKLDLPATRRFFDAFFDLEPRYWHGFLSSRLFLRELIFFGLSLFSHASNTSR  178
             FCFGMDILLKLDL ATRRFFDAFFDLEPRYWHGFLSSRLFL +L+FFGLSLFSHASNTSR
Sbjct  411   FCFGMDILLKLDLDATRRFFDAFFDLEPRYWHGFLSSRLFLPDLVFFGLSLFSHASNTSR  470

Query  177   LEIMTKGTLPLVNMINNLLQDID  109
             LEIMTKGT+PL  MINNL++D D
Sbjct  471   LEIMTKGTVPLAKMINNLVKDRD  493



>ref|XP_006407592.1| hypothetical protein EUTSA_v10020573mg [Eutrema salsugineum]
 gb|ESQ49045.1| hypothetical protein EUTSA_v10020573mg [Eutrema salsugineum]
Length=500

 Score =   780 bits (2013),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 402/505 (80%), Positives = 446/505 (88%), Gaps = 9/505 (2%)
 Frame = -2

Query  1611  MDTLLKTPNELEFLHPH-HGFAVKASAFTSLKPQKQEIRIGSWKACRNVGRVKASSSALL  1435
             MDTLLKTPN+LEF  P  HGF   A+      P    +++G  K    +G   +SSSALL
Sbjct  1     MDTLLKTPNKLEFFIPQFHGFERLATN----NPNPSRVKLGVKKRAIKIG-SSSSSSALL  55

Query  1434  ELVPVTKKENLDFELPMFEPSKGIvvdlavvgggpaglavaqqVSQAGLSVCSIDPSPKL  1255
             +LVP TKKENLDFELP+++ S   VVDLA+VGGGPAGLAVAQQVS+AGLSVCSIDPSPKL
Sbjct  56    DLVPETKKENLDFELPLYDASVNKVVDLAIVGGGPAGLAVAQQVSEAGLSVCSIDPSPKL  115

Query  1254  IWPNNYGVWVDEFEAMDLLDCLDTTWSGAMVYIDDRTTKDLDRPYGRVNRKKLKSKMMQK  1075
             IWPNNYGVWVDEFEAMDLLDCLDTTWSGA+VYID+   KDL RPYGRVNRK+LKSKM+QK
Sbjct  116   IWPNNYGVWVDEFEAMDLLDCLDTTWSGAVVYIDEGVKKDLSRPYGRVNRKQLKSKMLQK  175

Query  1074  CITNGVKFHQAKVIKVIHEESKSMLICSDGVTIQATVVLDATGFSRCLVQYDKPYNPGYQ  895
             CITNGVKFHQ+KV  VIHEE+ S ++CSDGV IQA+VVLDATGFSRCLVQYDKPYNPGYQ
Sbjct  176   CITNGVKFHQSKVTNVIHEEANSTVVCSDGVKIQASVVLDATGFSRCLVQYDKPYNPGYQ  235

Query  894   VAYGILAEVEEHPYDLNKMVFMDWRDSHLNSNLELKERNKRIPTFLYAMPFSSTRIFLEE  715
             VAYGI+AEV+ HP+D++KMVFMDWRDSHL+S  ELKERN +IPTFLYAMPFSS RIFLEE
Sbjct  236   VAYGIVAEVDGHPFDVDKMVFMDWRDSHLDSYPELKERNSKIPTFLYAMPFSSNRIFLEE  295

Query  714   TSLVARPGLDMKDIQERMVARLRHLGINVKSIEEDERCVIPMGGPLPVIPQRVVGIGGTA  535
             TSLVARPGL M+DIQERMVARL+HLGINVK IEEDERCVIPMGGPLPV+PQRVVGIGGTA
Sbjct  296   TSLVARPGLRMEDIQERMVARLKHLGINVKRIEEDERCVIPMGGPLPVLPQRVVGIGGTA  355

Query  534   GMVHPSTGYMVARTLAAAPVVANAIIQYLG---SERSLLGNELSASVWKDLWPIERRRQR  364
             GMVHPSTGYMVARTLAAAP+VANAI++YLG   S+ SL G++LSA VW+DLWPIERRRQR
Sbjct  356   GMVHPSTGYMVARTLAAAPIVANAIVRYLGGSSSKNSLRGDQLSAEVWRDLWPIERRRQR  415

Query  363   EFFCFGMDILLKLDLPATRRFFDAFFDLEPRYWHGFLSSRLFLRELIFFGLSLFSHASNT  184
             EFFCFGMDILLKLDL ATRRFFDAFFDL+P YWHGFLSSRLFL +L+FFGLSLFSHASNT
Sbjct  416   EFFCFGMDILLKLDLEATRRFFDAFFDLQPHYWHGFLSSRLFLPDLLFFGLSLFSHASNT  475

Query  183   SRLEIMTKGTLPLVNMINNLLQDID  109
             SRLEIMTKGT+PL  MINNL+QD D
Sbjct  476   SRLEIMTKGTVPLAKMINNLVQDRD  500



>ref|XP_009146860.1| PREDICTED: lycopene beta cyclase, chloroplastic [Brassica rapa]
Length=493

 Score =   778 bits (2008),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 393/503 (78%), Positives = 441/503 (88%), Gaps = 12/503 (2%)
 Frame = -2

Query  1611  MDTLLKTPNELEFLHPH-HGFAVKASAFTSLKPQKQEIRIGSWKACRNVGR-VKASSSAL  1438
             MDTLL+TPN+LEF  P  HGF         L P    +++G  K    +G  + ++SSAL
Sbjct  1     MDTLLRTPNKLEFFIPQFHGF-------ERLSPNPSRVKLGVKKRAIRIGSSITSASSAL  53

Query  1437  LELVPVTKKENLDFELPMFEPSKGIvvdlavvgggpaglavaqqVSQAGLSVCSIDPSPK  1258
             L+LVP TKKENLD +LP+++ S    VDLA+VGGGPAGLAVAQQVS+AGLSVCSIDPSPK
Sbjct  54    LDLVPETKKENLDLDLPLYDTSLNKTVDLAIVGGGPAGLAVAQQVSEAGLSVCSIDPSPK  113

Query  1257  LIWPNNYGVWVDEFEAMDLLDCLDTTWSGAMVYIDDRTTKDLDRPYGRVNRKKLKSKMMQ  1078
             LIWPNNYGVWVDEFEAMDLLDCLDTTWSGA+VYI+D   KDL RPYGRVNRK+LKSKM+Q
Sbjct  114   LIWPNNYGVWVDEFEAMDLLDCLDTTWSGAVVYINDGAEKDLSRPYGRVNRKQLKSKMLQ  173

Query  1077  KCITNGVKFHQAKVIKVIHEESKSMLICSDGVTIQATVVLDATGFSRCLVQYDKPYNPGY  898
             KCITNGV+FHQAKV  V+HEE  S ++CSDGV IQA+VVLDATGFSRCLVQYDKPYNPGY
Sbjct  174   KCITNGVRFHQAKVTDVVHEEVNSTVVCSDGVKIQASVVLDATGFSRCLVQYDKPYNPGY  233

Query  897   QVAYGILAEVEEHPYDLNKMVFMDWRDSHLNSNLELKERNKRIPTFLYAMPFSSTRIFLE  718
             QVAYGI+AEV+ HP+D++KMVFMDWRD HL++  E+KERN +IPTFLYAMPFSS RIFLE
Sbjct  234   QVAYGIVAEVDGHPFDVDKMVFMDWRDKHLDAYPEVKERNSKIPTFLYAMPFSSNRIFLE  293

Query  717   ETSLVARPGLDMKDIQERMVARLRHLGINVKSIEEDERCVIPMGGPLPVIPQRVVGIGGT  538
             ETSLVARPGL M+DIQERMVARL+HLGINVK IEEDERCVIPMGGPLPV+PQRVVGIGGT
Sbjct  294   ETSLVARPGLKMEDIQERMVARLKHLGINVKRIEEDERCVIPMGGPLPVLPQRVVGIGGT  353

Query  537   AGMVHPSTGYMVARTLAAAPVVANAIIQYLGSERSLLGNELSASVWKDLWPIERRRQREF  358
             AGMVHPSTGYMVARTLAAAP+VANAI++YLGS +   G+ELSA VW+DLWPIERRRQREF
Sbjct  354   AGMVHPSTGYMVARTLAAAPIVANAIVRYLGSTK---GDELSAEVWRDLWPIERRRQREF  410

Query  357   FCFGMDILLKLDLPATRRFFDAFFDLEPRYWHGFLSSRLFLRELIFFGLSLFSHASNTSR  178
             FCFGMDILLKLDL ATRRFFDAFFDLEPRYWHGFLSSRLFL +L+FFGLSLFSHASNTSR
Sbjct  411   FCFGMDILLKLDLDATRRFFDAFFDLEPRYWHGFLSSRLFLPDLVFFGLSLFSHASNTSR  470

Query  177   LEIMTKGTLPLVNMINNLLQDID  109
             LEIMTKGT+PL  MINNL++D D
Sbjct  471   LEIMTKGTVPLAKMINNLVKDRD  493



>gb|AAG10429.1| beta cyclase [Tagetes erecta]
Length=511

 Score =   778 bits (2008),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 392/509 (77%), Positives = 446/509 (88%), Gaps = 10/509 (2%)
 Frame = -2

Query  1611  MDTLLKTPNELEFLHPHHGFA---VKASAFTSLKPQKQEIRIGSWKACRNVGR---VKAS  1450
             MDT L+T N  EF+HP + FA      +     K Q Q+ R G  K+   +G+   VKAS
Sbjct  1     MDTFLRTYNSFEFVHPSNKFAGNLNNLNQLNQSKSQFQDFRFGPKKSQFKLGQKYCVKAS  60

Query  1449  SSALLELVPVTKKENLDFELPMFEPSKGIvvdlavvgggpaglavaqqVSQAGLSVCSID  1270
             SSALLELVP  KKENLDF+LPM++PS+ +VVDL VVGGGP+GLAVAQQVS+AGL+VCSID
Sbjct  61    SSALLELVPEIKKENLDFDLPMYDPSRNVVVDLVVVGGGPSGLAVAQQVSEAGLTVCSID  120

Query  1269  PSPKLIWPNNYGVWVDEFEAMDLLDCLDTTWSGAMVYIDDRTTKDLDRPYGRVNRKKLKS  1090
             PSPKLIWPNNYGVWVDEFEAMDLLDCLDTTWS A+VYID+++TK L+RPY RVNRK+LK+
Sbjct  121   PSPKLIWPNNYGVWVDEFEAMDLLDCLDTTWSSAVVYIDEKSTKSLNRPYARVNRKQLKT  180

Query  1089  KMMQKCITNGVKFHQAKVIKVIHEESKSMLICSDGVTIQATVVLDATGFSRCLVQYDKPY  910
             KM+QKCI NGVKFHQAKVIKVIHEE KS+LIC+DGVTIQAT+VLDATGFSR LVQYDKPY
Sbjct  181   KMLQKCIANGVKFHQAKVIKVIHEELKSLLICNDGVTIQATLVLDATGFSRSLVQYDKPY  240

Query  909   NPGYQVAYGILAEVEEHPYDLNKMVFMDWRDSHLNSNLELKERNKRIPTFLYAMPFSSTR  730
             NPGYQVAYGILAEVEEHP+D++KM+FMDWRDSHL+ NLE+K RN RIPTFLYAMPFSSTR
Sbjct  241   NPGYQVAYGILAEVEEHPFDVDKMLFMDWRDSHLDQNLEIKARNSRIPTFLYAMPFSSTR  300

Query  729   IFLEETSLVARPGLDMKDIQERMVARLRHLGINVKSIEEDERCVIPMGGPLPVIPQRVVG  550
             IFLEETSLVARPGL M+DIQERM  RL+HLGI VKSIEEDERCVIPMGGPLPV+PQRV+G
Sbjct  301   IFLEETSLVARPGLKMEDIQERMAYRLKHLGIKVKSIEEDERCVIPMGGPLPVLPQRVLG  360

Query  549   IGGTAGMVHPSTGYMVARTLAAAPVVANAIIQYLGSERSLL----GNELSASVWKDLWPI  382
             IGGTAGMVHPSTGYMVARTLAAAP+VA +II+YL +E+S++    G++L+A +W++LWPI
Sbjct  361   IGGTAGMVHPSTGYMVARTLAAAPIVAKSIIRYLNNEKSMVADVTGDDLAAGIWRELWPI  420

Query  381   ERRRQREFFCFGMDILLKLDLPATRRFFDAFFDLEPRYWHGFLSSRLFLRELIFFGLSLF  202
             ERRRQREFFCFGMDILLKLDL  TRRFFDAFFDLEPRYWHGFLSSRLFL EL+ FGLSLF
Sbjct  421   ERRRQREFFCFGMDILLKLDLEGTRRFFDAFFDLEPRYWHGFLSSRLFLPELVTFGLSLF  480

Query  201   SHASNTSRLEIMTKGTLPLVNMINNLLQD  115
              HASNT R+EIM KGTLPL  MI NL++D
Sbjct  481   GHASNTCRVEIMAKGTLPLATMIGNLVRD  509



>ref|XP_010942591.1| PREDICTED: lycopene beta cyclase, chloroplastic/chromoplastic-like 
[Elaeis guineensis]
Length=503

 Score =   777 bits (2006),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 394/502 (78%), Positives = 437/502 (87%), Gaps = 4/502 (1%)
 Frame = -2

Query  1611  MDTLLKTPNELEFLHPHHGFAVKASAFTSLKPQKQEIRIGSWKACRN---VGRVKASSSA  1441
             MDTL +  + L  LHP HG A +     S K Q+Q  R    ++ R     G  +A S+A
Sbjct  1     MDTL-RIYSRLGLLHPVHGLAERHGLSPSQKLQQQVNRASYRRSHRKWSKTGLARAGSNA  59

Query  1440  LLELVPVTKKENLDFELPMFEPSKGIvvdlavvgggpaglavaqqVSQAGLSVCSIDPSP  1261
             LLELVP TKKENL+F+LP+++PSKG+ +DLAVVGGGPAGLAVAQQVS+AGLSVCSIDPSP
Sbjct  60    LLELVPETKKENLEFDLPLYDPSKGLTLDLAVVGGGPAGLAVAQQVSEAGLSVCSIDPSP  119

Query  1260  KLIWPNNYGVWVDEFEAMDLLDCLDTTWSGAMVYIDDRTTKDLDRPYGRVNRKKLKSKMM  1081
             KLIWPNNYGVWVDEFEA+DLLDCLD TW GA+VY+DD   K LDRPY RVNRK+LKSKMM
Sbjct  120   KLIWPNNYGVWVDEFEALDLLDCLDATWPGAVVYVDDLKKKLLDRPYARVNRKQLKSKMM  179

Query  1080  QKCITNGVKFHQAKVIKVIHEESKSMLICSDGVTIQATVVLDATGFSRCLVQYDKPYNPG  901
             QKC++NGV+FH AKV+KVIHEE KS+LIC+DGVTIQATVVLDATGFSRCLVQYDKPYNPG
Sbjct  180   QKCVSNGVRFHPAKVVKVIHEELKSLLICNDGVTIQATVVLDATGFSRCLVQYDKPYNPG  239

Query  900   YQVAYGILAEVEEHPYDLNKMVFMDWRDSHLNSNLELKERNKRIPTFLYAMPFSSTRIFL  721
             YQVAYGILAEVEEHP+DL+KM+FMDWRDSHL    ELKERN RIPTFLYAMPFSST IFL
Sbjct  240   YQVAYGILAEVEEHPFDLDKMLFMDWRDSHLKDGTELKERNSRIPTFLYAMPFSSTEIFL  299

Query  720   EETSLVARPGLDMKDIQERMVARLRHLGINVKSIEEDERCVIPMGGPLPVIPQRVVGIGG  541
             EETSLVARPGL M+DIQERMVARLRHLGI VKSIEEDERCVIPMGGPLPV+PQRVVGIGG
Sbjct  300   EETSLVARPGLQMEDIQERMVARLRHLGIKVKSIEEDERCVIPMGGPLPVLPQRVVGIGG  359

Query  540   TAGMVHPSTGYMVARTLAAAPVVANAIIQYLGSERSLLGNELSASVWKDLWPIERRRQRE  361
             TAG+VHPSTGYMVARTLAA P+VA++I++++GS+  L GNELSA VWK+LWPIERRRQRE
Sbjct  360   TAGLVHPSTGYMVARTLAAVPIVADSIVRFVGSDHGLSGNELSAEVWKNLWPIERRRQRE  419

Query  360   FFCFGMDILLKLDLPATRRFFDAFFDLEPRYWHGFLSSRLFLRELIFFGLSLFSHASNTS  181
             FFCFGMDILLKLDL  TRRFFDAFFDLEP YWHGFLSSRL L EL+ FG SLF HASNTS
Sbjct  420   FFCFGMDILLKLDLQGTRRFFDAFFDLEPHYWHGFLSSRLLLPELVLFGFSLFLHASNTS  479

Query  180   RLEIMTKGTLPLVNMINNLLQD  115
             RLEIM KGTLPLVNMI NLL+D
Sbjct  480   RLEIMAKGTLPLVNMIKNLLRD  501



>dbj|BAE79544.1| lycopene beta-cyclase [Chrysanthemum x morifolium]
Length=498

 Score =   777 bits (2006),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 395/503 (79%), Positives = 442/503 (88%), Gaps = 6/503 (1%)
 Frame = -2

Query  1614  VMDTLLKTPNELEFLHPHHGFAVKASAFTSLKPQKQEIRIGSWKACRNVGRVKAS-SSAL  1438
             +MDTLLK  N  EF+HP   FA   +A +S KP  +       K C     VKAS SSAL
Sbjct  1     MMDTLLKIHNSFEFVHPSKRFAGNVNALSSKKPYFKWGYNNYNKDC-----VKASGSSAL  55

Query  1437  LELVPVTKKENLDFELPMFEPSKGIvvdlavvgggpaglavaqqVSQAGLSVCSIDPSPK  1258
             LELVP  KKENLD ELPM++ +KG+VVDL VVGGGP+GLAVAQQVS+AGL+VCSIDPSPK
Sbjct  56    LELVPEIKKENLDSELPMYDYTKGVVVDLVVVGGGPSGLAVAQQVSEAGLTVCSIDPSPK  115

Query  1257  LIWPNNYGVWVDEFEAMDLLDCLDTTWSGAMVYIDDRTTKDLDRPYGRVNRKKLKSKMMQ  1078
             LIWPNNYGVWVDEFEAMDLLDCLDTTW+ A+VY+D+ +T+ L+RPY RVNRK+LK+KM+Q
Sbjct  116   LIWPNNYGVWVDEFEAMDLLDCLDTTWASAVVYVDENSTRSLNRPYARVNRKQLKTKMLQ  175

Query  1077  KCITNGVKFHQAKVIKVIHEESKSMLICSDGVTIQATVVLDATGFSRCLVQYDKPYNPGY  898
             KCI+NGVKFHQAKVIKV+HEE KS+LIC+DGVTIQAT+VLDATGFSR LVQYDKPYNPGY
Sbjct  176   KCISNGVKFHQAKVIKVVHEEFKSLLICNDGVTIQATLVLDATGFSRSLVQYDKPYNPGY  235

Query  897   QVAYGILAEVEEHPYDLNKMVFMDWRDSHLNSNLELKERNKRIPTFLYAMPFSSTRIFLE  718
             QVAYGILAEVEEHP+D++KM+FMDWRDSHL  N E+KERN +IPTFLYAMPFSS RIFLE
Sbjct  236   QVAYGILAEVEEHPFDVDKMLFMDWRDSHLGKNTEIKERNSKIPTFLYAMPFSSNRIFLE  295

Query  717   ETSLVARPGLDMKDIQERMVARLRHLGINVKSIEEDERCVIPMGGPLPVIPQRVVGIGGT  538
             ETSLVARPGL M+DIQERMV RL+HLGI VKSIEEDERCVIPMGGPLPV+PQRV+GIGGT
Sbjct  296   ETSLVARPGLKMEDIQERMVCRLKHLGIKVKSIEEDERCVIPMGGPLPVLPQRVLGIGGT  355

Query  537   AGMVHPSTGYMVARTLAAAPVVANAIIQYLGSERSLLGNELSASVWKDLWPIERRRQREF  358
             AGMVHPSTGYMVARTLAAAP+VA +IIQYL SE+ L G +LSA VW+DLWPIERRRQREF
Sbjct  356   AGMVHPSTGYMVARTLAAAPIVAKSIIQYLNSEKMLCGTDLSAEVWRDLWPIERRRQREF  415

Query  357   FCFGMDILLKLDLPATRRFFDAFFDLEPRYWHGFLSSRLFLRELIFFGLSLFSHASNTSR  178
             FCFGMDILL+LDL  TRRFFDAFFDLEPRYWHGFLSSRLFL EL+ FGLSLF+HA NTSR
Sbjct  416   FCFGMDILLRLDLEGTRRFFDAFFDLEPRYWHGFLSSRLFLPELLTFGLSLFAHAPNTSR  475

Query  177   LEIMTKGTLPLVNMINNLLQDID  109
             +EIM KGTLPL NMINNL+QD D
Sbjct  476   IEIMAKGTLPLANMINNLVQDRD  498



>gb|ADH59741.1| lycopene beta-cyclase [Brassica napus]
Length=492

 Score =   776 bits (2004),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 396/502 (79%), Positives = 441/502 (88%), Gaps = 11/502 (2%)
 Frame = -2

Query  1611  MDTLLKTPNELEFLHPH-HGFAVKASAFTSLKPQKQEIRIGSWKACRNVGRVKASSSALL  1435
             MDTLL+TPN+LEF  P  HGF         L P    +++G  K    +G    SSSALL
Sbjct  1     MDTLLRTPNKLEFFIPQFHGF-------ERLSPHPSRVKLGLKKRSIRIGSTSTSSSALL  53

Query  1434  ELVPVTKKENLDFELPMFEPSKGIvvdlavvgggpaglavaqqVSQAGLSVCSIDPSPKL  1255
             +LVP TKKENLDF+LP+++ S   VVDLA+VGGGPAGLAVAQQVS+AGLSVCSIDPSPKL
Sbjct  54    DLVPETKKENLDFDLPLYDTSLNKVVDLAIVGGGPAGLAVAQQVSEAGLSVCSIDPSPKL  113

Query  1254  IWPNNYGVWVDEFEAMDLLDCLDTTWSGAMVYIDDRTTKDLDRPYGRVNRKKLKSKMMQK  1075
             IWPNNYGVWVDEFEAMDLLDCLDTTWSGA+VYI+D   KDL RPYGRVNRK+LKSKM+QK
Sbjct  114   IWPNNYGVWVDEFEAMDLLDCLDTTWSGAVVYINDGAEKDLSRPYGRVNRKQLKSKMLQK  173

Query  1074  CITNGVKFHQAKVIKVIHEESKSMLICSDGVTIQATVVLDATGFSRCLVQYDKPYNPGYQ  895
             CITNGV+FHQAKV  V+HEE  S ++CSDGV IQA+VVLDATGFSRCLVQYDKPYNPGYQ
Sbjct  174   CITNGVRFHQAKVTDVVHEEVNSTVVCSDGVEIQASVVLDATGFSRCLVQYDKPYNPGYQ  233

Query  894   VAYGILAEVEEHPYDLNKMVFMDWRDSHLNSNLELKERNKRIPTFLYAMPFSSTRIFLEE  715
             VAYGI+AEV+ HP+D++KMVFMDWRD HL++  E+KERN +IPTFLYAMPFSS RIFLEE
Sbjct  234   VAYGIVAEVDGHPFDVDKMVFMDWRDKHLDAYPEVKERNSKIPTFLYAMPFSSNRIFLEE  293

Query  714   TSLVARPGLDMKDIQERMVARLRHLGINVKSIEEDERCVIPMGGPLPVIPQRVVGIGGTA  535
             TSLVARPGL M+DIQERMVARL+HLGINVK IEEDERCVIPMGGPLPV+PQRVVGIGGTA
Sbjct  294   TSLVARPGLKMEDIQERMVARLKHLGINVKRIEEDERCVIPMGGPLPVLPQRVVGIGGTA  353

Query  534   GMVHPSTGYMVARTLAAAPVVANAIIQYLGSERSLLGNELSASVWKDLWPIERRRQREFF  355
             GMVHPSTGYMVARTLAAAP+VANAI++YLGS +   G+ELSA VW+DLWPIERRRQREFF
Sbjct  354   GMVHPSTGYMVARTLAAAPIVANAIVRYLGSTK---GDELSAEVWRDLWPIERRRQREFF  410

Query  354   CFGMDILLKLDLPATRRFFDAFFDLEPRYWHGFLSSRLFLRELIFFGLSLFSHASNTSRL  175
             CFGMDILLKLDL ATRRFFDAFFDLEPRYWHGFLSSRLFL +L+FFGLSLFSHASNTSRL
Sbjct  411   CFGMDILLKLDLDATRRFFDAFFDLEPRYWHGFLSSRLFLPDLVFFGLSLFSHASNTSRL  470

Query  174   EIMTKGTLPLVNMINNLLQDID  109
             EIMTKGT+PL  MINNL++D D
Sbjct  471   EIMTKGTVPLAKMINNLVKDRD  492



>ref|XP_010481540.1| PREDICTED: lycopene beta cyclase, chloroplastic-like [Camelina 
sativa]
Length=507

 Score =   773 bits (1997),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 399/509 (78%), Positives = 447/509 (88%), Gaps = 10/509 (2%)
 Frame = -2

Query  1611  MDTLLKTPNELEFLHPH-HGFAVKASAF-----TSLKPQKQEIRIGSWKACRNVGRVKAS  1450
             MDTLLK+PN+LEF  P  HGF   +S+        L  +K+ IRIGS           ++
Sbjct  1     MDTLLKSPNKLEFFVPQFHGFERLSSSNPNPSRVKLGLKKRAIRIGS--GVVVSATASST  58

Query  1449  SSALLELVPVTKKENLDFELPMFEPSKGIvvdlavvgggpaglavaqqVSQAGLSVCSID  1270
             S+ALL+LVP TKKE+LDFELP+++ SK  +VDLA+VGGGPAGLAVAQQVS+AGLSVCSID
Sbjct  59    SAALLDLVPETKKESLDFELPLYDTSKSPLVDLAIVGGGPAGLAVAQQVSEAGLSVCSID  118

Query  1269  PSPKLIWPNNYGVWVDEFEAMDLLDCLDTTWSGAMVYIDDRTTKDLDRPYGRVNRKKLKS  1090
             PSPKLIWPNNYGVWVDEFEAMDLLDCLDTTWSGA+VYI +   KDL RPYGRVNRK+LKS
Sbjct  119   PSPKLIWPNNYGVWVDEFEAMDLLDCLDTTWSGAVVYIGEGVKKDLSRPYGRVNRKQLKS  178

Query  1089  KMMQKCITNGVKFHQAKVIKVIHEESKSMLICSDGVTIQATVVLDATGFSRCLVQYDKPY  910
             KM+QKCITNGVKFHQ+KV  V+HEE  S ++CSDGV IQA+VVLDATGFSRCLVQYDKPY
Sbjct  179   KMLQKCITNGVKFHQSKVTNVVHEEENSTVVCSDGVKIQASVVLDATGFSRCLVQYDKPY  238

Query  909   NPGYQVAYGILAEVEEHPYDLNKMVFMDWRDSHLNSNLELKERNKRIPTFLYAMPFSSTR  730
             NPGYQVAYGI+AEV+ HP+D++KMVFMDWRD+HL+S  ELKERN +IPTFLYAMPFSSTR
Sbjct  239   NPGYQVAYGIIAEVDSHPFDVDKMVFMDWRDTHLDSYPELKERNSKIPTFLYAMPFSSTR  298

Query  729   IFLEETSLVARPGLDMKDIQERMVARLRHLGINVKSIEEDERCVIPMGGPLPVIPQRVVG  550
             IFLEETSLVARPGL M+DIQERMVARL+HLGINVK IEEDERCVIPMGGPLPV+PQRVVG
Sbjct  299   IFLEETSLVARPGLRMEDIQERMVARLKHLGINVKRIEEDERCVIPMGGPLPVLPQRVVG  358

Query  549   IGGTAGMVHPSTGYMVARTLAAAPVVANAIIQYLG--SERSLLGNELSASVWKDLWPIER  376
             IGGTAGMVHPSTGYMVARTLAAAP+VANAI++YLG  S  SL G++LSA VW+DLWPIER
Sbjct  359   IGGTAGMVHPSTGYMVARTLAAAPIVANAIVRYLGSSSSNSLRGDQLSAEVWRDLWPIER  418

Query  375   RRQREFFCFGMDILLKLDLPATRRFFDAFFDLEPRYWHGFLSSRLFLRELIFFGLSLFSH  196
             RRQREFFCFGMDILLKLDL ATRRFFDAFFDL+P YWHGFLSSRLFL EL+FFGLSLFSH
Sbjct  419   RRQREFFCFGMDILLKLDLEATRRFFDAFFDLQPHYWHGFLSSRLFLPELLFFGLSLFSH  478

Query  195   ASNTSRLEIMTKGTLPLVNMINNLLQDID  109
             ASNTSRLEIMTKGT+PL  MINNL++D D
Sbjct  479   ASNTSRLEIMTKGTVPLAKMINNLVRDRD  507



>gb|KFK38411.1| hypothetical protein AALP_AA3G109800 [Arabis alpina]
Length=500

 Score =   773 bits (1996),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 396/504 (79%), Positives = 438/504 (87%), Gaps = 7/504 (1%)
 Frame = -2

Query  1611  MDTLLKTPNELEFLHPH-HGFAVKASAFTSLKPQKQEIRIGSWKACRNVGRVKASSSALL  1435
             MDTLLKTPN+LEF  P  HGF       +S       +++G  K    +     SSSALL
Sbjct  1     MDTLLKTPNKLEFFIPQFHGF----DRLSSNNQNPSRVKLGLKKRAIKIVSGVTSSSALL  56

Query  1434  ELVPVTKKENLDFELPMFEPSKGIvvdlavvgggpaglavaqqVSQAGLSVCSIDPSPKL  1255
             +LVP TKKENLDFELP+++ S   VVDLA+VGGGPAGLAVAQQVS+AGLSVCSIDPSPKL
Sbjct  57    DLVPETKKENLDFELPLYDTSMNRVVDLAIVGGGPAGLAVAQQVSEAGLSVCSIDPSPKL  116

Query  1254  IWPNNYGVWVDEFEAMDLLDCLDTTWSGAMVYIDDRTTKDLDRPYGRVNRKKLKSKMMQK  1075
             IWPNNYGVWVDEFEAMDLLDCLDTTWSGA+VYI++   KDL RPYGRVNRK+LKSKM+ K
Sbjct  117   IWPNNYGVWVDEFEAMDLLDCLDTTWSGAVVYINEGVKKDLSRPYGRVNRKQLKSKMLLK  176

Query  1074  CITNGVKFHQAKVIKVIHEESKSMLICSDGVTIQATVVLDATGFSRCLVQYDKPYNPGYQ  895
             CI NGVKFHQ+KV  V+HEE  S ++CSDGV IQA+VVLDATGFSRCLVQYDKPYNPGYQ
Sbjct  177   CIANGVKFHQSKVTNVVHEELNSTVVCSDGVKIQASVVLDATGFSRCLVQYDKPYNPGYQ  236

Query  894   VAYGILAEVEEHPYDLNKMVFMDWRDSHLNSNLELKERNKRIPTFLYAMPFSSTRIFLEE  715
             VAYGI+AEV+ HP+D++KMVFMDWRD HL+S  ELKERN +IPTFLYAMPFSS RIFLEE
Sbjct  237   VAYGIIAEVDGHPFDVDKMVFMDWRDKHLDSYPELKERNSKIPTFLYAMPFSSNRIFLEE  296

Query  714   TSLVARPGLDMKDIQERMVARLRHLGINVKSIEEDERCVIPMGGPLPVIPQRVVGIGGTA  535
             TSLVARPGL M+DIQERMVARL+HLGINVK IEEDERCVIPMGGPLPV+PQRVVGIGGTA
Sbjct  297   TSLVARPGLRMEDIQERMVARLKHLGINVKRIEEDERCVIPMGGPLPVLPQRVVGIGGTA  356

Query  534   GMVHPSTGYMVARTLAAAPVVANAIIQYLG--SERSLLGNELSASVWKDLWPIERRRQRE  361
             GMVHPSTGYMVARTLAAAP+VANAI++YLG  S  SL G++LSA VW+DLWPIERRRQRE
Sbjct  357   GMVHPSTGYMVARTLAAAPIVANAIVRYLGSSSNSSLRGDQLSAEVWRDLWPIERRRQRE  416

Query  360   FFCFGMDILLKLDLPATRRFFDAFFDLEPRYWHGFLSSRLFLRELIFFGLSLFSHASNTS  181
             FFCFGMDILLKLDL ATRRFFDAFFDL+P YWHGFLSSRLFL EL+FFGLSLFSHASNTS
Sbjct  417   FFCFGMDILLKLDLDATRRFFDAFFDLQPHYWHGFLSSRLFLPELLFFGLSLFSHASNTS  476

Query  180   RLEIMTKGTLPLVNMINNLLQDID  109
             RLEIMTKGT+PL  MINNL+QD D
Sbjct  477   RLEIMTKGTVPLAKMINNLVQDRD  500



>gb|ACM68702.1| lycopene beta-cyclase [Brassica rapa subsp. pekinensis]
Length=493

 Score =   772 bits (1993),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 391/503 (78%), Positives = 439/503 (87%), Gaps = 12/503 (2%)
 Frame = -2

Query  1611  MDTLLKTPNELEFLHPH-HGFAVKASAFTSLKPQKQEIRIGSWKACRNVGR-VKASSSAL  1438
             MDTLL+TPN+LEF  P  HGF         L P    +++G  K    +G  + ++SSAL
Sbjct  1     MDTLLRTPNKLEFFIPQFHGFE-------RLSPNPSRVKLGLKKRAIRIGSSITSASSAL  53

Query  1437  LELVPVTKKENLDFELPMFEPSKGIvvdlavvgggpaglavaqqVSQAGLSVCSIDPSPK  1258
             L+LVP TKKENLD +LP+++ S    VDLA+VGGGPAGLAVAQQVS+AGLSV SIDPSPK
Sbjct  54    LDLVPETKKENLDLDLPLYDTSLNKTVDLAIVGGGPAGLAVAQQVSEAGLSVYSIDPSPK  113

Query  1257  LIWPNNYGVWVDEFEAMDLLDCLDTTWSGAMVYIDDRTTKDLDRPYGRVNRKKLKSKMMQ  1078
             LIWPNNYGVWVDEFEAMDLLDCLDTTWSGA+VYI+D   KDL RPYGRVNRK+LKSKM+Q
Sbjct  114   LIWPNNYGVWVDEFEAMDLLDCLDTTWSGAVVYINDGAEKDLSRPYGRVNRKQLKSKMLQ  173

Query  1077  KCITNGVKFHQAKVIKVIHEESKSMLICSDGVTIQATVVLDATGFSRCLVQYDKPYNPGY  898
             KCITNGV+FHQAKV  V+HEE  S ++CSDGV IQA+VVLDATGFSRCLVQYDKPYNPGY
Sbjct  174   KCITNGVRFHQAKVTNVVHEEVNSTVVCSDGVKIQASVVLDATGFSRCLVQYDKPYNPGY  233

Query  897   QVAYGILAEVEEHPYDLNKMVFMDWRDSHLNSNLELKERNKRIPTFLYAMPFSSTRIFLE  718
             QVAYGI+AEV+ HP+D++KMVFMDWRD HL++  E+KERN +IPTFLYAMPFSS RIFLE
Sbjct  234   QVAYGIVAEVDGHPFDVDKMVFMDWRDKHLDAYPEVKERNSKIPTFLYAMPFSSNRIFLE  293

Query  717   ETSLVARPGLDMKDIQERMVARLRHLGINVKSIEEDERCVIPMGGPLPVIPQRVVGIGGT  538
             ETSLVARPGL M+DIQERMVARL+HLGINVK IEEDERCVIPMGGPLPV+PQRVVGIGGT
Sbjct  294   ETSLVARPGLKMEDIQERMVARLKHLGINVKRIEEDERCVIPMGGPLPVLPQRVVGIGGT  353

Query  537   AGMVHPSTGYMVARTLAAAPVVANAIIQYLGSERSLLGNELSASVWKDLWPIERRRQREF  358
             AGMVHPSTGYMVARTLA AP+VANAI++YLGS +   G+ELSA VW+DLWPIERRRQREF
Sbjct  354   AGMVHPSTGYMVARTLAVAPIVANAIVRYLGSTK---GDELSAEVWRDLWPIERRRQREF  410

Query  357   FCFGMDILLKLDLPATRRFFDAFFDLEPRYWHGFLSSRLFLRELIFFGLSLFSHASNTSR  178
             FCFGMDILLKLDL ATRRFFDAFFDLEPRYWHGFLSSRLFL +L+FFGLSLFSHASNTSR
Sbjct  411   FCFGMDILLKLDLDATRRFFDAFFDLEPRYWHGFLSSRLFLPDLVFFGLSLFSHASNTSR  470

Query  177   LEIMTKGTLPLVNMINNLLQDID  109
             LEIMTKGT+PL  MINNL++D D
Sbjct  471   LEIMTKGTVPLAKMINNLVKDRD  493



>sp|Q40424.1|LCYB_NARPS RecName: Full=Lycopene beta cyclase, chloroplastic/chromoplastic; 
Flags: Precursor [Narcissus pseudonarcissus]
 emb|CAA67331.1| lycopene cyclase [Narcissus pseudonarcissus]
Length=503

 Score =   771 bits (1992),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 385/505 (76%), Positives = 428/505 (85%), Gaps = 6/505 (1%)
 Frame = -2

Query  1611  MDTLLKTPNELEFLHPHHGFAVKASAFTSLKPQKQEIRIGS----WKACRNVGRVKASSS  1444
             MDTLL+T N LE L+P H  A +     S  PQ    +  S     K CRN G +  SS+
Sbjct  1     MDTLLRTHNRLELLYPLHELAKRHFLSPSPNPQNPNFKFFSRKPYQKKCRN-GYIGVSSN  59

Query  1443  ALLELVPVTKKENLDFELPMFEPSKGIvvdlavvgggpaglavaqqVSQAGLSVCSIDPS  1264
              LL+LVP  KKE+L+F+LP+++PSK + +DLAVVGGGP   + +  +   GLSV SIDP+
Sbjct  60    QLLDLVPEIKKEHLEFDLPLYDPSKALTLDLAVVGGGPLARSCSTSLG-GGLSVVSIDPN  118

Query  1263  PKLIWPNNYGVWVDEFEAMDLLDCLDTTWSGAMVYIDDRTTKDLDRPYGRVNRKKLKSKM  1084
             PKLIWPNNYGVWVDEFE MDLLDCLD TWSGA+VY+DDR+TK+L RPY RVNRK LKSKM
Sbjct  119   PKLIWPNNYGVWVDEFEDMDLLDCLDATWSGAIVYVDDRSTKNLSRPYARVNRKNLKSKM  178

Query  1083  MQKCITNGVKFHQAKVIKVIHEESKSMLICSDGVTIQATVVLDATGFSRCLVQYDKPYNP  904
             M+KC++NGV+FHQA V+K +HEE KS LICSDGVTI A VVLDATGFSRCLVQYDKPYNP
Sbjct  179   MKKCVSNGVRFHQATVVKAMHEEEKSYLICSDGVTIDARVVLDATGFSRCLVQYDKPYNP  238

Query  903   GYQVAYGILAEVEEHPYDLNKMVFMDWRDSHLNSNLELKERNKRIPTFLYAMPFSSTRIF  724
             GYQVAYGILAEVEEHP+D++KMVFMDWRDSHLN   EL ERN +IPTFLYAMPFSS RIF
Sbjct  239   GYQVAYGILAEVEEHPFDVDKMVFMDWRDSHLNGKAELNERNAKIPTFLYAMPFSSNRIF  298

Query  723   LEETSLVARPGLDMKDIQERMVARLRHLGINVKSIEEDERCVIPMGGPLPVIPQRVVGIG  544
             LEETSLVARPGL M+DIQERMVARL HLGI +KSIEEDERCVIPMGGPLPVIPQRVVGIG
Sbjct  299   LEETSLVARPGLKMEDIQERMVARLNHLGIRIKSIEEDERCVIPMGGPLPVIPQRVVGIG  358

Query  543   GTAGMVHPSTGYMVARTLAAAPVVANAIIQYLGSERSLLGNELSASVWKDLWPIERRRQR  364
             GTAGMVHPSTGYMVARTLAAAP+VAN+I+QYL S+  L GN+LSA VWKDLWPIERRRQR
Sbjct  359   GTAGMVHPSTGYMVARTLAAAPIVANSIVQYLVSDSGLSGNDLSADVWKDLWPIERRRQR  418

Query  363   EFFCFGMDILLKLDLPATRRFFDAFFDLEPRYWHGFLSSRLFLRELIFFGLSLFSHASNT  184
             EFFCFGMDILLKLDL  TRRFFDAFFDLEPRYWHGFLSSRLFL EL+ FGLSLFSHASNT
Sbjct  419   EFFCFGMDILLKLDLEGTRRFFDAFFDLEPRYWHGFLSSRLFLPELVPFGLSLFSHASNT  478

Query  183   SRLEIMTKGTLPLVNMINNLLQDID  109
              +LEIM KGTLPLVNMINNL+QD D
Sbjct  479   CKLEIMAKGTLPLVNMINNLVQDRD  503



>gb|ADX60450.1| lycopene beta-cyclase [Phaseolus vulgaris]
Length=502

 Score =   770 bits (1989),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 400/504 (79%), Positives = 448/504 (89%), Gaps = 9/504 (2%)
 Frame = -2

Query  1602  LLKTPNELEFLHPHHGFAVKASAFTSLKPQKQEIRIGS------WKACRNVGRVKASSSA  1441
             LLKTPN+LEFLHP HG++ K S+  S + Q Q+ R GS      W  C   G ++ASSSA
Sbjct  2     LLKTPNKLEFLHPLHGYSEKLSSSGSSRVQNQDFRFGSKKSLVRWGKC---GGLRASSSA  58

Query  1440  LLELVPVTKKENLDFELPMFEPSKGIvvdlavvgggpaglavaqqVSQAGLSVCSIDPSP  1261
             LLELVP  KKENLDFELP+++ SKG VVDLAVVGGGPAGLAVAQQVS+AGLSVC+IDP+P
Sbjct  59    LLELVPEFKKENLDFELPLYDSSKGAVVDLAVVGGGPAGLAVAQQVSEAGLSVCAIDPNP  118

Query  1260  KLIWPNNYGVWVDEFEAMDLLDCLDTTWSGAMVYIDDRTTKDLDRPYGRVNRKKLKSKMM  1081
             +LIWPNNYGVWVDEFEAMDLLDCLDTTWSGA+VYIDD+T KDLDRPYGRVNRK LKSKMM
Sbjct  119   RLIWPNNYGVWVDEFEAMDLLDCLDTTWSGAVVYIDDKTKKDLDRPYGRVNRKLLKSKMM  178

Query  1080  QKCITNGVKFHQAKVIKVIHEESKSMLICSDGVTIQATVVLDATGFSRCLVQYDKPYNPG  901
             QKCI+NGVKFHQAKVIK+IHE++KS+LIC+DGVT+QATVVLDATGFS CLVQYDKPYNPG
Sbjct  179   QKCISNGVKFHQAKVIKIIHEDTKSLLICNDGVTVQATVVLDATGFSGCLVQYDKPYNPG  238

Query  900   YQVAYGILAEVEEHPYDLNKMVFMDWRDSHLNSNLELKERNKRIPTFLYAMPFSSTRIFL  721
             YQVAYG LAEV+EHPYD++K  F+DWRD HL+++ ELK+RN RIPTFLYAMPFSST+IFL
Sbjct  239   YQVAYGNLAEVDEHPYDVDKRAFLDWRDFHLDNDKELKQRNSRIPTFLYAMPFSSTKIFL  298

Query  720   EETSLVARPGLDMKDIQERMVARLRHLGINVKSIEEDERCVIPMGGPLPVIPQRVVGIGG  541
             EETSLVARPGL M+DIQERMVARL+HLGI VKSIEEDE CVIPMGGPLPV PQRVVGIGG
Sbjct  299   EETSLVARPGLRMEDIQERMVARLKHLGIRVKSIEEDEHCVIPMGGPLPVFPQRVVGIGG  358

Query  540   TAGMVHPSTGYMVARTLAAAPVVANAIIQYLGSERSLLGNELSASVWKDLWPIERRRQRE  361
             TAGMVHPSTGYMVARTLAAAP+VANAI+Q LG +R L G ++ A VWKDLWPI+RRRQRE
Sbjct  359   TAGMVHPSTGYMVARTLAAAPIVANAIVQSLGFDRGLSGGDIFAQVWKDLWPIQRRRQRE  418

Query  360   FFCFGMDILLKLDLPATRRFFDAFFDLEPRYWHGFLSSRLFLRELIFFGLSLFSHASNTS  181
             FFCFGMDILLKLDLP TRRFFDAFFDLEP YWHGFLSSRLF  EL+FFGLSLF +A NT 
Sbjct  419   FFCFGMDILLKLDLPGTRRFFDAFFDLEPHYWHGFLSSRLFFPELLFFGLSLFFYAFNTF  478

Query  180   RLEIMTKGTLPLVNMINNLLQDID  109
             R+EIM KGTLPL NMI+NL++D +
Sbjct  479   RIEIMAKGTLPLANMISNLVKDTE  502



>ref|XP_010558132.1| PREDICTED: lycopene beta cyclase, chloroplastic-like [Tarenaya 
hassleriana]
Length=505

 Score =   769 bits (1985),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 392/506 (77%), Positives = 444/506 (88%), Gaps = 6/506 (1%)
 Frame = -2

Query  1611  MDTLLKTPNELEFLHPHHGFAVKASAFTSLKPQKQEI-----RIGSWKACRNVGRVKASS  1447
             MDTLL++PN+LEF+   HG   K S+   L P + ++      I +      + R ++SS
Sbjct  1     MDTLLRSPNKLEFVSQFHGLE-KCSSSNILNPSRVKLCHKKRGIKTGLGVYALSRSRSSS  59

Query  1446  SALLELVPVTKKENLDFELPMFEPSKGIvvdlavvgggpaglavaqqVSQAGLSVCSIDP  1267
             S LL+LVP TKKENLDFELP+++P K   VDLAVVGGGPAGLAVAQQVS+AGLSVCSIDP
Sbjct  60    STLLDLVPETKKENLDFELPLYDPCKSQAVDLAVVGGGPAGLAVAQQVSEAGLSVCSIDP  119

Query  1266  SPKLIWPNNYGVWVDEFEAMDLLDCLDTTWSGAMVYIDDRTTKDLDRPYGRVNRKKLKSK  1087
             SP+LIWPNNYGVWVDEFEAMDLLDCLDTTWSGA+VY+DD   KDL RPYGRVNRK LKSK
Sbjct  120   SPRLIWPNNYGVWVDEFEAMDLLDCLDTTWSGAVVYVDDHVKKDLGRPYGRVNRKLLKSK  179

Query  1086  MMQKCITNGVKFHQAKVIKVIHEESKSMLICSDGVTIQATVVLDATGFSRCLVQYDKPYN  907
             M+QKCI+NGVKFHQ++V  VIH ES S ++CSDGV IQA VVLDATGFSRCLVQYDKPYN
Sbjct  180   MLQKCISNGVKFHQSRVTNVIHAESNSTVVCSDGVKIQAAVVLDATGFSRCLVQYDKPYN  239

Query  906   PGYQVAYGILAEVEEHPYDLNKMVFMDWRDSHLNSNLELKERNKRIPTFLYAMPFSSTRI  727
             PGYQVAYGILAEV+ HP+D++KM+FMDWRDSHL ++ ELKERN+++PTFLYAMPFSS RI
Sbjct  240   PGYQVAYGILAEVDGHPFDVDKMLFMDWRDSHLENSRELKERNRKLPTFLYAMPFSSNRI  299

Query  726   FLEETSLVARPGLDMKDIQERMVARLRHLGINVKSIEEDERCVIPMGGPLPVIPQRVVGI  547
             FLEETSLVARPGL M+DIQERMVARL+HLGINVK +EEDE CVIPMGGPLPV+PQRVVGI
Sbjct  300   FLEETSLVARPGLRMEDIQERMVARLKHLGINVKRVEEDEYCVIPMGGPLPVLPQRVVGI  359

Query  546   GGTAGMVHPSTGYMVARTLAAAPVVANAIIQYLGSERSLLGNELSASVWKDLWPIERRRQ  367
             GGTAGMVHPSTGYMVARTLAAAP+VANAI++ LGS+++L GN+LSA VW DLWPIERRRQ
Sbjct  360   GGTAGMVHPSTGYMVARTLAAAPIVANAIVRSLGSDKTLRGNKLSAQVWGDLWPIERRRQ  419

Query  366   REFFCFGMDILLKLDLPATRRFFDAFFDLEPRYWHGFLSSRLFLRELIFFGLSLFSHASN  187
             REFFCFGMDILLKLDL ATRRFFDAFFDLEP YWHGFLSSRLFL EL+FFGLSLFSHASN
Sbjct  420   REFFCFGMDILLKLDLDATRRFFDAFFDLEPLYWHGFLSSRLFLPELLFFGLSLFSHASN  479

Query  186   TSRLEIMTKGTLPLVNMINNLLQDID  109
             TSRLEIM+KGT+PLV M+NNL+QD D
Sbjct  480   TSRLEIMSKGTVPLVKMVNNLVQDRD  505



>gb|AGH28089.1| lycopene beta-cyclase, partial [Solanum lycopersicum]
 gb|AGH28090.1| lycopene beta-cyclase, partial [Solanum lycopersicum]
 gb|AGH28091.1| lycopene beta-cyclase, partial [Solanum lycopersicum]
Length=448

 Score =   766 bits (1979),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 391/438 (89%), Positives = 408/438 (93%), Gaps = 3/438 (1%)
 Frame = -2

Query  1494  GSWKACRNVGR---VKASSSALLELVPVTKKENLDFELPMFEPSKGIvvdlavvgggpag  1324
             GS K C  +GR   VK SSSALLELVP TKKENLDFELPM++PSKG+VVDLAVVGGGPAG
Sbjct  11    GSRKFCETLGRSVCVKGSSSALLELVPETKKENLDFELPMYDPSKGVVVDLAVVGGGPAG  70

Query  1323  lavaqqVSQAGLSVCSIDPSPKLIWPNNYGVWVDEFEAMDLLDCLDTTWSGAMVYIDDRT  1144
             LAVAQQVS+AGLSVCSIDP+PKLIWPNNYGVWVDEFEAMDLLDCLD TWSGA VYIDD T
Sbjct  71    LAVAQQVSEAGLSVCSIDPNPKLIWPNNYGVWVDEFEAMDLLDCLDATWSGAAVYIDDNT  130

Query  1143  TKDLDRPYGRVNRKKLKSKMMQKCITNGVKFHQAKVIKVIHEESKSMLICSDGVTIQATV  964
              KDL RPYGRVNRK+LKSKMMQKCI NGVKFHQAKVIKVIHEESKSMLIC+DG+TIQATV
Sbjct  131   AKDLHRPYGRVNRKQLKSKMMQKCIMNGVKFHQAKVIKVIHEESKSMLICNDGITIQATV  190

Query  963   VLDATGFSRCLVQYDKPYNPGYQVAYGILAEVEEHPYDLNKMVFMDWRDSHLNSNLELKE  784
             VLDATGFSR LVQYDKPYNPGYQVAYGILAEVEEHP+D+NKMVFMDWRDSHL +N +LKE
Sbjct  191   VLDATGFSRSLVQYDKPYNPGYQVAYGILAEVEEHPFDVNKMVFMDWRDSHLKNNTDLKE  250

Query  783   RNKRIPTFLYAMPFSSTRIFLEETSLVARPGLDMKDIQERMVARLRHLGINVKSIEEDER  604
             RN RIPTFLYAMPFSS RIFLEETSLVARPGL + DIQERMVARL HLGI VKSIEEDE 
Sbjct  251   RNSRIPTFLYAMPFSSNRIFLEETSLVARPGLRIDDIQERMVARLNHLGIKVKSIEEDEH  310

Query  603   CVIPMGGPLPVIPQRVVGIGGTAGMVHPSTGYMVARTLAAAPVVANAIIQYLGSERSLLG  424
             C+IPMGGPLPV+PQRVVGIGGTAGMVHPSTGYMVARTLAAAPVVANAIIQYLGSERS  G
Sbjct  311   CLIPMGGPLPVLPQRVVGIGGTAGMVHPSTGYMVARTLAAAPVVANAIIQYLGSERSHSG  370

Query  423   NELSASVWKDLWPIERRRQREFFCFGMDILLKLDLPATRRFFDAFFDLEPRYWHGFLSSR  244
             NELS +VWKDLWPIERRRQREFFCFGMDILLKLDLPATRRFFDAFFDLEPRYWHGFLSSR
Sbjct  371   NELSTAVWKDLWPIERRRQREFFCFGMDILLKLDLPATRRFFDAFFDLEPRYWHGFLSSR  430

Query  243   LFLRELIFFGLSLFSHAS  190
             LFL ELI FGLSLFSHAS
Sbjct  431   LFLPELIVFGLSLFSHAS  448



>ref|XP_004150761.1| PREDICTED: lycopene beta cyclase, chloroplastic [Cucumis sativus]
 gb|KGN53976.1| hypothetical protein Csa_4G218350 [Cucumis sativus]
Length=504

 Score =   768 bits (1984),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 400/504 (79%), Positives = 442/504 (88%), Gaps = 3/504 (1%)
 Frame = -2

Query  1611  MDTLLKTPNELEFLHPHHGFAVKASAFTSLKPQKQEIRIGSWKA---CRNVGRVKASSSA  1441
             MDTLLK  N+  FL P HG + K S     K   QE   G  K+    +  G V   SSA
Sbjct  1     MDTLLKINNKYGFLQPLHGVSEKLSGVRGTKFHGQEFGFGQRKSRLKLKKGGCVGVKSSA  60

Query  1440  LLELVPVTKKENLDFELPMFEPSKGIvvdlavvgggpaglavaqqVSQAGLSVCSIDPSP  1261
             LLELVP TKKENL+FELPMF+PSKG+VVDLAVVGGGPAGLAVAQQVS+AGLSVC+IDPSP
Sbjct  61    LLELVPETKKENLEFELPMFDPSKGLVVDLAVVGGGPAGLAVAQQVSEAGLSVCAIDPSP  120

Query  1260  KLIWPNNYGVWVDEFEAMDLLDCLDTTWSGAMVYIDDRTTKDLDRPYGRVNRKKLKSKMM  1081
             KLIWPNNYGVWVDEFEAMDLLDCLDTTWSGA+V+ ++++TKDL RPYGRVNRK+LKSKM+
Sbjct  121   KLIWPNNYGVWVDEFEAMDLLDCLDTTWSGAVVFTNEQSTKDLARPYGRVNRKQLKSKML  180

Query  1080  QKCITNGVKFHQAKVIKVIHEESKSMLICSDGVTIQATVVLDATGFSRCLVQYDKPYNPG  901
             QKCI+NGVKFH+AKVIKVIHEE KS++IC+DGVTIQA +VLDATGFSRCLVQYDKPYNPG
Sbjct  181   QKCISNGVKFHEAKVIKVIHEEFKSLIICNDGVTIQAAIVLDATGFSRCLVQYDKPYNPG  240

Query  900   YQVAYGILAEVEEHPYDLNKMVFMDWRDSHLNSNLELKERNKRIPTFLYAMPFSSTRIFL  721
             YQVAYGILAEVEEHP+D+NKMVFMDWRDSHLN+N+ LK+RN +IPTFLYAMPFSS RIFL
Sbjct  241   YQVAYGILAEVEEHPFDVNKMVFMDWRDSHLNNNMILKDRNSKIPTFLYAMPFSSNRIFL  300

Query  720   EETSLVARPGLDMKDIQERMVARLRHLGINVKSIEEDERCVIPMGGPLPVIPQRVVGIGG  541
             EETSLVARPGL M DIQERM ARL HLGI VKSIEEDE CVIPMGGPLPV+PQRVVGIGG
Sbjct  301   EETSLVARPGLQMSDIQERMEARLNHLGIKVKSIEEDEHCVIPMGGPLPVLPQRVVGIGG  360

Query  540   TAGMVHPSTGYMVARTLAAAPVVANAIIQYLGSERSLLGNELSASVWKDLWPIERRRQRE  361
             TAGMVHPSTGYMVARTLAAAP+VA+AI++ LGS+   +G+ +S+ VWKDLWPIERRRQRE
Sbjct  361   TAGMVHPSTGYMVARTLAAAPIVASAIVRCLGSDGRFMGDAISSEVWKDLWPIERRRQRE  420

Query  360   FFCFGMDILLKLDLPATRRFFDAFFDLEPRYWHGFLSSRLFLRELIFFGLSLFSHASNTS  181
             FFCFGMDILLKLDL  TRRFFDAFFDLEPRYWHGFLSSRLFL EL+ FGLSLFSHASN S
Sbjct  421   FFCFGMDILLKLDLKGTRRFFDAFFDLEPRYWHGFLSSRLFLPELLLFGLSLFSHASNAS  480

Query  180   RLEIMTKGTLPLVNMINNLLQDID  109
             RLEIM KGT  LVNMI NL++D D
Sbjct  481   RLEIMAKGTPSLVNMIGNLVKDRD  504



>gb|AEN94902.1| lycopene beta cyclase [Cucurbita moschata]
Length=497

 Score =   765 bits (1976),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 391/502 (78%), Positives = 436/502 (87%), Gaps = 6/502 (1%)
 Frame = -2

Query  1611  MDTLLKTPNELEFLHPHHGFAVK-ASAFTSLKPQKQEIRIGSWKACRNVGRVKASSSALL  1435
             MDTLLK  N+  FL   HG + K      S K Q +E   G  K     GRVK  +SALL
Sbjct  1     MDTLLKINNKYGFLQQSHGVSEKLRGGVRSTKIQSREFGFGHRK-----GRVKWRNSALL  55

Query  1434  ELVPVTKKENLDFELPMFEPSKGIvvdlavvgggpaglavaqqVSQAGLSVCSIDPSPKL  1255
             ELVP TKKENL+FELPM++PSKG+VVDLAVVGGGPAGLAVAQQVS+AGLSVC+IDPSPKL
Sbjct  56    ELVPETKKENLEFELPMYDPSKGLVVDLAVVGGGPAGLAVAQQVSEAGLSVCAIDPSPKL  115

Query  1254  IWPNNYGVWVDEFEAMDLLDCLDTTWSGAMVYIDDRTTKDLDRPYGRVNRKKLKSKMMQK  1075
             IWPNNYGVWVD+FEAMDLLDCLDTTWSGA+V+ + ++TKDL RPYGRVNRK+LKSK +QK
Sbjct  116   IWPNNYGVWVDKFEAMDLLDCLDTTWSGAVVFTNGQSTKDLGRPYGRVNRKQLKSKFLQK  175

Query  1074  CITNGVKFHQAKVIKVIHEESKSMLICSDGVTIQATVVLDATGFSRCLVQYDKPYNPGYQ  895
             CI NGVKFH+AKV+KVIHEE KS+LIC+DGVTIQA +VLDATGFSRCLV+YD+PYNPGYQ
Sbjct  176   CIANGVKFHEAKVVKVIHEEFKSLLICNDGVTIQAAIVLDATGFSRCLVRYDEPYNPGYQ  235

Query  894   VAYGILAEVEEHPYDLNKMVFMDWRDSHLNSNLELKERNKRIPTFLYAMPFSSTRIFLEE  715
             VAYGILAEVEEHP+D++KMVFMDWRDSHL++N+ LKERN +IPTFLYAMPFSS RIFLEE
Sbjct  236   VAYGILAEVEEHPFDVDKMVFMDWRDSHLDNNMVLKERNSKIPTFLYAMPFSSNRIFLEE  295

Query  714   TSLVARPGLDMKDIQERMVARLRHLGINVKSIEEDERCVIPMGGPLPVIPQRVVGIGGTA  535
             TSLVARPGL M DIQERM ARL+HLGI VKSIEEDE CVIPMGG LPV+PQRVVGIGGTA
Sbjct  296   TSLVARPGLQMSDIQERMDARLKHLGIKVKSIEEDEHCVIPMGGQLPVLPQRVVGIGGTA  355

Query  534   GMVHPSTGYMVARTLAAAPVVANAIIQYLGSERSLLGNELSASVWKDLWPIERRRQREFF  355
             GMVHPSTGYMVARTLAAAP+VA AI++ LGS+    G+E+S+ VW+DLWPIERRRQREFF
Sbjct  356   GMVHPSTGYMVARTLAAAPIVAGAIVRCLGSDGRFRGDEISSEVWRDLWPIERRRQREFF  415

Query  354   CFGMDILLKLDLPATRRFFDAFFDLEPRYWHGFLSSRLFLRELIFFGLSLFSHASNTSRL  175
             CFGMDILLKLDL  TRR FDAFFDLEP YWHGFLSSRLFL ELI FGLSLFSHASN SR+
Sbjct  416   CFGMDILLKLDLKGTRRLFDAFFDLEPHYWHGFLSSRLFLPELILFGLSLFSHASNASRV  475

Query  174   EIMTKGTLPLVNMINNLLQDID  109
             EIM KGT  LVNMI NL++D D
Sbjct  476   EIMAKGTPSLVNMIGNLVKDRD  497



>gb|AGH28087.1| lycopene beta-cyclase, partial [Solanum lycopersicum]
 gb|AGH28088.1| lycopene beta-cyclase, partial [Solanum lycopersicum]
Length=448

 Score =   763 bits (1970),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 390/438 (89%), Positives = 407/438 (93%), Gaps = 3/438 (1%)
 Frame = -2

Query  1494  GSWKACRNVGR---VKASSSALLELVPVTKKENLDFELPMFEPSKGIvvdlavvgggpag  1324
             GS K C  +GR   VK SSSALLELVP TKKENLDFELPM++PSKG+VVDLAVVGGGPAG
Sbjct  11    GSRKFCETLGRSVCVKGSSSALLELVPETKKENLDFELPMYDPSKGVVVDLAVVGGGPAG  70

Query  1323  lavaqqVSQAGLSVCSIDPSPKLIWPNNYGVWVDEFEAMDLLDCLDTTWSGAMVYIDDRT  1144
             LAVAQQVS+AGLSVCSIDP+PKLIWPNNYGVWVDEFEAMDLLDCLD TWSGA VYIDD T
Sbjct  71    LAVAQQVSEAGLSVCSIDPNPKLIWPNNYGVWVDEFEAMDLLDCLDATWSGAAVYIDDNT  130

Query  1143  TKDLDRPYGRVNRKKLKSKMMQKCITNGVKFHQAKVIKVIHEESKSMLICSDGVTIQATV  964
              KDL RPYGRVNRK+LKSKMMQKCI NGVKFHQAKVIKVIHEESKSMLIC+DG+TIQATV
Sbjct  131   AKDLHRPYGRVNRKQLKSKMMQKCIMNGVKFHQAKVIKVIHEESKSMLICNDGITIQATV  190

Query  963   VLDATGFSRCLVQYDKPYNPGYQVAYGILAEVEEHPYDLNKMVFMDWRDSHLNSNLELKE  784
             VLDATGFSR LVQYDKPYNPGYQVAYGILAEVEEHP+D+NKMVFMDWRDSHL +N +LKE
Sbjct  191   VLDATGFSRSLVQYDKPYNPGYQVAYGILAEVEEHPFDVNKMVFMDWRDSHLKNNTDLKE  250

Query  783   RNKRIPTFLYAMPFSSTRIFLEETSLVARPGLDMKDIQERMVARLRHLGINVKSIEEDER  604
             RN RIPTFLYAMPFSS RIFLEETSLVARPGL + DIQERMVARL HLGI VKSIEEDE 
Sbjct  251   RNSRIPTFLYAMPFSSNRIFLEETSLVARPGLRIDDIQERMVARLNHLGIKVKSIEEDEH  310

Query  603   CVIPMGGPLPVIPQRVVGIGGTAGMVHPSTGYMVARTLAAAPVVANAIIQYLGSERSLLG  424
             C+IPMGGPLPV+PQRVVGIGGTAGMVHPSTGYMVARTLAAAPVVANAIIQYLGSERS  G
Sbjct  311   CLIPMGGPLPVLPQRVVGIGGTAGMVHPSTGYMVARTLAAAPVVANAIIQYLGSERSHSG  370

Query  423   NELSASVWKDLWPIERRRQREFFCFGMDILLKLDLPATRRFFDAFFDLEPRYWHGFLSSR  244
             NELS +VWK LWPIERRRQREFFCFGMDILLKLDLPATRRFFDAFFDLEPRYWHGFLSSR
Sbjct  371   NELSTAVWKYLWPIERRRQREFFCFGMDILLKLDLPATRRFFDAFFDLEPRYWHGFLSSR  430

Query  243   LFLRELIFFGLSLFSHAS  190
             LFL ELI FGLSLFSHAS
Sbjct  431   LFLPELIVFGLSLFSHAS  448



>emb|CDY00914.1| BnaC05g42860D [Brassica napus]
Length=499

 Score =   765 bits (1975),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 395/506 (78%), Positives = 442/506 (87%), Gaps = 12/506 (2%)
 Frame = -2

Query  1611  MDTLLKTPNELEFLHPH-HGFAVKASAFTSLKPQKQEIRIGSWKACRNVGRVKASSS--A  1441
             MDTLL+TPN+LEF  P  HGF         L P    +++G  K    +G    SSS  A
Sbjct  1     MDTLLRTPNKLEFFIPQFHGFE-------RLSPNPSRVKLGVKKRTIRIGSTSTSSSSSA  53

Query  1440  LLELVPVTKKENLDFELPMFEPSKGIvvdlavvgggpaglavaqqVSQAGLSVCSIDPSP  1261
             LL+LVP TKKENLDF+LP+++ S   VVDLA+VGGGPAGLAVAQQVS+AGLSVCSIDPSP
Sbjct  54    LLDLVPETKKENLDFDLPLYDTSLNKVVDLAIVGGGPAGLAVAQQVSEAGLSVCSIDPSP  113

Query  1260  KLIWPNNYGVWVDEFEAMDLLDCLDTTWSGAMVYIDDRTTKDLDRPYGRVNRKKLKSKMM  1081
             KLIWPNNYGVWVDEFEAMDL+DCLDTTWSGA+VYI+D + KDL RPYGRVNRK+LKSKM+
Sbjct  114   KLIWPNNYGVWVDEFEAMDLVDCLDTTWSGAVVYINDGSEKDLSRPYGRVNRKQLKSKML  173

Query  1080  QKCITNGVKFHQAKVIKVIHEESKSMLICSDGVTIQATVVLDATGFSRCLVQYDKPYNPG  901
             QKCITNGV+FHQAKV  V+HEE  S ++CSDGV IQA+VVLDATGFSRCLVQYDKPYNPG
Sbjct  174   QKCITNGVRFHQAKVTDVVHEEVNSTVVCSDGVKIQASVVLDATGFSRCLVQYDKPYNPG  233

Query  900   YQVAYGILAEVEEHPYDLNKMVFMDWRDSHLNSNLELKERNKRIPTFLYAMPFSSTRIFL  721
             YQVAYGI+AEV+ HP+D++KMVFMDWRD HL++  E+KERN +IPTFLYAMPFSS RIFL
Sbjct  234   YQVAYGIVAEVDGHPFDVDKMVFMDWRDKHLDAYPEVKERNSKIPTFLYAMPFSSNRIFL  293

Query  720   EETSLVARPGLDMKDIQERMVARLRHLGINVKSIEEDERCVIPMGGPLPVIPQRVVGIGG  541
             EETSLVARPGL M+DIQERMVARL+HLGINVK IEEDERCVIPMGGPLPV+PQRVVGIGG
Sbjct  294   EETSLVARPGLKMEDIQERMVARLKHLGINVKRIEEDERCVIPMGGPLPVLPQRVVGIGG  353

Query  540   TAGMVHPSTGYMVARTLAAAPVVANAIIQYL--GSERSLLGNELSASVWKDLWPIERRRQ  367
             TAGMVHPSTGYMVARTLAAAP+VANAI++YL  G+   L G+ELSA VW+DLWPIERRRQ
Sbjct  354   TAGMVHPSTGYMVARTLAAAPIVANAIVRYLGGGNNNGLRGDELSAEVWRDLWPIERRRQ  413

Query  366   REFFCFGMDILLKLDLPATRRFFDAFFDLEPRYWHGFLSSRLFLRELIFFGLSLFSHASN  187
             REFFCFGMDILLKLDL ATRRFFDAFFDLEPRYWHGFLSSRLFL +L+FFGLSLFSHASN
Sbjct  414   REFFCFGMDILLKLDLDATRRFFDAFFDLEPRYWHGFLSSRLFLPDLVFFGLSLFSHASN  473

Query  186   TSRLEIMTKGTLPLVNMINNLLQDID  109
             TSRLEIMTKGT+PL  MINNL++D D
Sbjct  474   TSRLEIMTKGTVPLAKMINNLVKDRD  499



>gb|KDO50124.1| hypothetical protein CISIN_1g014377mg [Citrus sinensis]
Length=426

 Score =   761 bits (1965),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 381/426 (89%), Positives = 407/426 (96%), Gaps = 0/426 (0%)
 Frame = -2

Query  1386  MFEPSKGIvvdlavvgggpaglavaqqVSQAGLSVCSIDPSPKLIWPNNYGVWVDEFEAM  1207
             M++PSKG+VVDLAVVGGGPAGLAVAQQVS+AGLSVCSIDPSPKLIWPNNYGVWVDEFEAM
Sbjct  1     MYDPSKGLVVDLAVVGGGPAGLAVAQQVSEAGLSVCSIDPSPKLIWPNNYGVWVDEFEAM  60

Query  1206  DLLDCLDTTWSGAMVYIDDRTTKDLDRPYGRVNRKKLKSKMMQKCITNGVKFHQAKVIKV  1027
             DLLDCLDTTWSGA+V+IDD T KDLDRPYGRVNRK LKSKM+QKCITNGVKFHQAKVIKV
Sbjct  61    DLLDCLDTTWSGAVVHIDDNTKKDLDRPYGRVNRKLLKSKMLQKCITNGVKFHQAKVIKV  120

Query  1026  IHEESKSMLICSDGVTIQATVVLDATGFSRCLVQYDKPYNPGYQVAYGILAEVEEHPYDL  847
             IHEESKS+LIC+DGVTIQA VVLDATGFSRCLVQYDKPYNPGYQVAYGILAEVEEHP+DL
Sbjct  121   IHEESKSLLICNDGVTIQAAVVLDATGFSRCLVQYDKPYNPGYQVAYGILAEVEEHPFDL  180

Query  846   NKMVFMDWRDSHLNSNLELKERNKRIPTFLYAMPFSSTRIFLEETSLVARPGLDMKDIQE  667
             +KMVFMDWRDSHLN+N ELKE N +IPTFLYAMPFSS RIFLEETSLVARPG+ MKDIQE
Sbjct  181   DKMVFMDWRDSHLNNNSELKEANSKIPTFLYAMPFSSNRIFLEETSLVARPGVPMKDIQE  240

Query  666   RMVARLRHLGINVKSIEEDERCVIPMGGPLPVIPQRVVGIGGTAGMVHPSTGYMVARTLA  487
             RMVARL+HLGI V+SIEEDE CVIPMGGPLPV+PQRVVGIGGTAGMVHPSTGYMVARTLA
Sbjct  241   RMVARLKHLGIKVRSIEEDEHCVIPMGGPLPVLPQRVVGIGGTAGMVHPSTGYMVARTLA  300

Query  486   AAPVVANAIIQYLGSERSLLGNELSASVWKDLWPIERRRQREFFCFGMDILLKLDLPATR  307
             AAP+VANAI++ L S+RS+ G++LSA VWKDLWPIERRRQREFFCFGMDILLKLDLPATR
Sbjct  301   AAPIVANAIVRSLSSDRSISGHKLSAEVWKDLWPIERRRQREFFCFGMDILLKLDLPATR  360

Query  306   RFFDAFFDLEPRYWHGFLSSRLFLRELIFFGLSLFSHASNTSRLEIMTKGTLPLVNMINN  127
             RFFDAFFDLEPRYWHGFLSSRLFL EL+ FGLSLFSHASNTSRLEIM KGTLPLVNMINN
Sbjct  361   RFFDAFFDLEPRYWHGFLSSRLFLPELLVFGLSLFSHASNTSRLEIMAKGTLPLVNMINN  420

Query  126   LLQDID  109
             L+QD D
Sbjct  421   LVQDTD  426



>gb|ABM90918.1| lycopene beta-cyclase [Citrullus lanatus]
Length=504

 Score =   764 bits (1972),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 399/504 (79%), Positives = 440/504 (87%), Gaps = 3/504 (1%)
 Frame = -2

Query  1611  MDTLLKTPNELEFLHPHHGFAVKASAFTSLKPQKQEIRIGSWKA---CRNVGRVKASSSA  1441
             MDTLLK  N+  FL P HG + K S   S K Q QE   G  K     R  G +   SS+
Sbjct  1     MDTLLKINNKYGFLQPLHGVSEKVSGVRSTKFQSQEFGFGHRKGRLKWRKGGCLNVRSSS  60

Query  1440  LLELVPVTKKENLDFELPMFEPSKGIvvdlavvgggpaglavaqqVSQAGLSVCSIDPSP  1261
             LLELVP TKKENL+ ELPM++PSKG+VVDLAVVGGGPAGLAVAQQVS+AGLSVC+IDPSP
Sbjct  61    LLELVPETKKENLEVELPMYDPSKGLVVDLAVVGGGPAGLAVAQQVSEAGLSVCAIDPSP  120

Query  1260  KLIWPNNYGVWVDEFEAMDLLDCLDTTWSGAMVYIDDRTTKDLDRPYGRVNRKKLKSKMM  1081
             KLIWPNNYGVWVDEFEAMDLLDCLDTTWSGA+V+ ++++TKDL RPY RVNRK+LKSKM+
Sbjct  121   KLIWPNNYGVWVDEFEAMDLLDCLDTTWSGAVVFTNEQSTKDLARPYARVNRKQLKSKML  180

Query  1080  QKCITNGVKFHQAKVIKVIHEESKSMLICSDGVTIQATVVLDATGFSRCLVQYDKPYNPG  901
             QKCI+NGVKFH+AKVIKVIHEE KS+LIC+DGVTIQA +VLDATGFSRCLVQYDKPYNPG
Sbjct  181   QKCISNGVKFHEAKVIKVIHEEFKSLLICNDGVTIQAAIVLDATGFSRCLVQYDKPYNPG  240

Query  900   YQVAYGILAEVEEHPYDLNKMVFMDWRDSHLNSNLELKERNKRIPTFLYAMPFSSTRIFL  721
             YQVAYGILAEVEEHP+D+NKMVFMDWRDSHLN+N+ LKERN +IPTFLYAMPFSS RIFL
Sbjct  241   YQVAYGILAEVEEHPFDVNKMVFMDWRDSHLNNNMILKERNSKIPTFLYAMPFSSNRIFL  300

Query  720   EETSLVARPGLDMKDIQERMVARLRHLGINVKSIEEDERCVIPMGGPLPVIPQRVVGIGG  541
             EETSLVARPGL M DIQERM  RL+HLGI VKSIEEDE CVIPMGGPLPV+PQRVVGIGG
Sbjct  301   EETSLVARPGLQMSDIQERMEVRLKHLGIKVKSIEEDEHCVIPMGGPLPVLPQRVVGIGG  360

Query  540   TAGMVHPSTGYMVARTLAAAPVVANAIIQYLGSERSLLGNELSASVWKDLWPIERRRQRE  361
             TAGMVHPSTGYMVARTLAAAP+VA+AI++ LGS+    G+ +S+ VWKDLWPIERRRQRE
Sbjct  361   TAGMVHPSTGYMVARTLAAAPIVASAIVRCLGSDGRFRGDAISSEVWKDLWPIERRRQRE  420

Query  360   FFCFGMDILLKLDLPATRRFFDAFFDLEPRYWHGFLSSRLFLRELIFFGLSLFSHASNTS  181
             FFCFGMDILLKLDL  TRRFFDAFFDLEPRYWHGFLSSRLFL EL+ FGLSLFSHASN S
Sbjct  421   FFCFGMDILLKLDLNGTRRFFDAFFDLEPRYWHGFLSSRLFLPELLLFGLSLFSHASNAS  480

Query  180   RLEIMTKGTLPLVNMINNLLQDID  109
             RLEIM KGT  LVNMI NL++D D
Sbjct  481   RLEIMAKGTPSLVNMIGNLVKDRD  504



>gb|AGN48016.1| lycopene beta cyclase [Cucumis melo]
Length=504

 Score =   762 bits (1968),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 399/504 (79%), Positives = 440/504 (87%), Gaps = 3/504 (1%)
 Frame = -2

Query  1611  MDTLLKTPNELEFLHPHHGFAVKASAFTSLKPQKQEIRIGSWKA---CRNVGRVKASSSA  1441
             MDTLLK  N+  FL P HG + K S     K   QE   G  K     R  G V   SSA
Sbjct  1     MDTLLKINNKYGFLKPLHGVSDKLSGVRGTKFHGQEFGFGQRKGRLKLRKGGCVGVRSSA  60

Query  1440  LLELVPVTKKENLDFELPMFEPSKGIvvdlavvgggpaglavaqqVSQAGLSVCSIDPSP  1261
             LLELVP TKKENL+FELPMF+PSKG+VVDL VVGGGPAGLAVAQQVS+AGLSVC+IDPSP
Sbjct  61    LLELVPETKKENLEFELPMFDPSKGLVVDLVVVGGGPAGLAVAQQVSEAGLSVCAIDPSP  120

Query  1260  KLIWPNNYGVWVDEFEAMDLLDCLDTTWSGAMVYIDDRTTKDLDRPYGRVNRKKLKSKMM  1081
             KLIWPNNYGVWVDEFEAMDLLDCLDTTWSGA+V+ ++++TKDL RPYGRVNRK+LKSKM+
Sbjct  121   KLIWPNNYGVWVDEFEAMDLLDCLDTTWSGAVVFTNEQSTKDLSRPYGRVNRKQLKSKML  180

Query  1080  QKCITNGVKFHQAKVIKVIHEESKSMLICSDGVTIQATVVLDATGFSRCLVQYDKPYNPG  901
             QKCI+NGVKFH+AKVIKVIHEE KS++IC+DGVTIQA +VLDATGFSRCLVQYDKPYNPG
Sbjct  181   QKCISNGVKFHEAKVIKVIHEEFKSLIICNDGVTIQAAIVLDATGFSRCLVQYDKPYNPG  240

Query  900   YQVAYGILAEVEEHPYDLNKMVFMDWRDSHLNSNLELKERNKRIPTFLYAMPFSSTRIFL  721
             YQVAYGILAEVEEHP+D+NKMVFMDWRDSHLN+N+ LK+RN +IPTFLYAMPFS+ RIFL
Sbjct  241   YQVAYGILAEVEEHPFDINKMVFMDWRDSHLNNNMILKDRNSKIPTFLYAMPFSTNRIFL  300

Query  720   EETSLVARPGLDMKDIQERMVARLRHLGINVKSIEEDERCVIPMGGPLPVIPQRVVGIGG  541
             EETSLVARPGL M DIQERM ARL+HLGI VKSIEEDE CVIPMGGPLPV+PQRVVGIGG
Sbjct  301   EETSLVARPGLQMSDIQERMEARLKHLGIKVKSIEEDEHCVIPMGGPLPVLPQRVVGIGG  360

Query  540   TAGMVHPSTGYMVARTLAAAPVVANAIIQYLGSERSLLGNELSASVWKDLWPIERRRQRE  361
             TAGMVHPSTGYMVARTLAAAP+VA+AI++ LGS+    G+ +S+ VWKDLWPIERRRQRE
Sbjct  361   TAGMVHPSTGYMVARTLAAAPIVASAIVRCLGSDGRFRGDAISSEVWKDLWPIERRRQRE  420

Query  360   FFCFGMDILLKLDLPATRRFFDAFFDLEPRYWHGFLSSRLFLRELIFFGLSLFSHASNTS  181
             FFCFGMDILLKLDL  TRRFFDAFFDLEPRYWHGFLSSRLFL EL+ FGLSLFSHASN S
Sbjct  421   FFCFGMDILLKLDLKGTRRFFDAFFDLEPRYWHGFLSSRLFLPELLLFGLSLFSHASNAS  480

Query  180   RLEIMTKGTLPLVNMINNLLQDID  109
             RLEIM KGT  LVNMI NL++D D
Sbjct  481   RLEIMAKGTPSLVNMIGNLVKDRD  504



>ref|XP_008457615.1| PREDICTED: lycopene beta cyclase, chloroplastic [Cucumis melo]
 gb|ADN34000.1| lycopene beta cyclase [Cucumis melo subsp. melo]
Length=504

 Score =   762 bits (1967),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 399/504 (79%), Positives = 440/504 (87%), Gaps = 3/504 (1%)
 Frame = -2

Query  1611  MDTLLKTPNELEFLHPHHGFAVKASAFTSLKPQKQEIRIGSWKA---CRNVGRVKASSSA  1441
             MDTLLK  N+  FL P HG + K S     K   QE   G  K     R  G V   +SA
Sbjct  1     MDTLLKINNKYGFLKPLHGVSEKLSGVRGTKFHGQEFGFGQRKGRLKLRKGGCVGVRNSA  60

Query  1440  LLELVPVTKKENLDFELPMFEPSKGIvvdlavvgggpaglavaqqVSQAGLSVCSIDPSP  1261
             LLELVP TKKENL+FELPMF+PSKG+VVDL VVGGGPAGLAVAQQVS+AGLSVC+IDPSP
Sbjct  61    LLELVPETKKENLEFELPMFDPSKGLVVDLVVVGGGPAGLAVAQQVSEAGLSVCAIDPSP  120

Query  1260  KLIWPNNYGVWVDEFEAMDLLDCLDTTWSGAMVYIDDRTTKDLDRPYGRVNRKKLKSKMM  1081
             KLIWPNNYGVWVDEFEAMDLLDCLDTTWSGA+V+ ++++TKDL RPYGRVNRK+LKSKM+
Sbjct  121   KLIWPNNYGVWVDEFEAMDLLDCLDTTWSGAVVFTNEQSTKDLSRPYGRVNRKQLKSKML  180

Query  1080  QKCITNGVKFHQAKVIKVIHEESKSMLICSDGVTIQATVVLDATGFSRCLVQYDKPYNPG  901
             QKCI+NGVKFH+AKVIKVIHEE KS++IC+DGVTIQA +VLDATGFSRCLVQYDKPYNPG
Sbjct  181   QKCISNGVKFHEAKVIKVIHEEFKSLIICNDGVTIQAAIVLDATGFSRCLVQYDKPYNPG  240

Query  900   YQVAYGILAEVEEHPYDLNKMVFMDWRDSHLNSNLELKERNKRIPTFLYAMPFSSTRIFL  721
             YQVAYGILAEVEEHP+D+NKMVFMDWRDSHLN+N+ LK+RN +IPTFLYAMPFSS RIFL
Sbjct  241   YQVAYGILAEVEEHPFDVNKMVFMDWRDSHLNNNMILKDRNSKIPTFLYAMPFSSNRIFL  300

Query  720   EETSLVARPGLDMKDIQERMVARLRHLGINVKSIEEDERCVIPMGGPLPVIPQRVVGIGG  541
             EETSLVARPGL M DIQERM ARL+HLGI VKSIEEDE CVIPMGGPLPV+PQRVVGIGG
Sbjct  301   EETSLVARPGLQMSDIQERMEARLKHLGIKVKSIEEDEHCVIPMGGPLPVLPQRVVGIGG  360

Query  540   TAGMVHPSTGYMVARTLAAAPVVANAIIQYLGSERSLLGNELSASVWKDLWPIERRRQRE  361
             TAGMVHPSTGYMVARTLAAAP+VA+AI++ LGS+    G+ +S+ VWKDLWPIERRRQRE
Sbjct  361   TAGMVHPSTGYMVARTLAAAPIVASAIVRCLGSDGRFRGDAISSEVWKDLWPIERRRQRE  420

Query  360   FFCFGMDILLKLDLPATRRFFDAFFDLEPRYWHGFLSSRLFLRELIFFGLSLFSHASNTS  181
             FFCFGMDILLKLDL  TRRFFDAFFDLEPRYWHGFLSSRLFL EL+ FGLSLFSHASN S
Sbjct  421   FFCFGMDILLKLDLKGTRRFFDAFFDLEPRYWHGFLSSRLFLPELLLFGLSLFSHASNAS  480

Query  180   RLEIMTKGTLPLVNMINNLLQDID  109
             RLEIM KGT  LVNMI NL++D D
Sbjct  481   RLEIMAKGTPSLVNMIGNLVKDRD  504



>gb|ABM90917.1| lycopene beta-cyclase [Citrullus lanatus]
Length=504

 Score =   762 bits (1967),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 398/504 (79%), Positives = 439/504 (87%), Gaps = 3/504 (1%)
 Frame = -2

Query  1611  MDTLLKTPNELEFLHPHHGFAVKASAFTSLKPQKQEIRIGSWKA---CRNVGRVKASSSA  1441
             MDTLLK  N+  FL P HG + K S   S K Q QE   G  K     R  G +   SS+
Sbjct  1     MDTLLKINNKYGFLQPLHGVSEKVSGVRSTKFQSQEFGFGHRKGRLKWRKGGCLNVRSSS  60

Query  1440  LLELVPVTKKENLDFELPMFEPSKGIvvdlavvgggpaglavaqqVSQAGLSVCSIDPSP  1261
             LLELVP TKKENL+ ELPM++PSKG+VVDLAVVGGGPAGLAVAQQVS+AGLSVC+IDPSP
Sbjct  61    LLELVPETKKENLEVELPMYDPSKGLVVDLAVVGGGPAGLAVAQQVSEAGLSVCAIDPSP  120

Query  1260  KLIWPNNYGVWVDEFEAMDLLDCLDTTWSGAMVYIDDRTTKDLDRPYGRVNRKKLKSKMM  1081
             KLIWPNNYGVWVDEFEAMDLLDCLDTTWSGA+V+ ++++TKDL RPY RVNRK+LKSKM+
Sbjct  121   KLIWPNNYGVWVDEFEAMDLLDCLDTTWSGAVVFTNEQSTKDLARPYARVNRKQLKSKML  180

Query  1080  QKCITNGVKFHQAKVIKVIHEESKSMLICSDGVTIQATVVLDATGFSRCLVQYDKPYNPG  901
             QKCI+NGVKFH+AKVIKVIHEE KS+LIC+DGVTIQA +VLDATG SRCLVQYDKPYNPG
Sbjct  181   QKCISNGVKFHEAKVIKVIHEEFKSLLICNDGVTIQAAIVLDATGVSRCLVQYDKPYNPG  240

Query  900   YQVAYGILAEVEEHPYDLNKMVFMDWRDSHLNSNLELKERNKRIPTFLYAMPFSSTRIFL  721
             YQVAYGILAEVEEHP+D+NKMVFMDWRDSHLN+N+ LKERN +IPTFLYAMPFSS RIFL
Sbjct  241   YQVAYGILAEVEEHPFDVNKMVFMDWRDSHLNNNMILKERNSKIPTFLYAMPFSSNRIFL  300

Query  720   EETSLVARPGLDMKDIQERMVARLRHLGINVKSIEEDERCVIPMGGPLPVIPQRVVGIGG  541
             EETSLVARPGL M DIQERM  RL+HLGI VKSIEEDE CVIPMGGPLPV+PQRVVGIGG
Sbjct  301   EETSLVARPGLQMSDIQERMEVRLKHLGIKVKSIEEDEHCVIPMGGPLPVLPQRVVGIGG  360

Query  540   TAGMVHPSTGYMVARTLAAAPVVANAIIQYLGSERSLLGNELSASVWKDLWPIERRRQRE  361
             TAGMVHPSTGYMVARTLAAAP+VA+AI++ LGS+    G+ +S+ VWKDLWPIERRRQRE
Sbjct  361   TAGMVHPSTGYMVARTLAAAPIVASAIVRCLGSDGRFRGDAISSEVWKDLWPIERRRQRE  420

Query  360   FFCFGMDILLKLDLPATRRFFDAFFDLEPRYWHGFLSSRLFLRELIFFGLSLFSHASNTS  181
             FFCFGMDILLKLDL  TRRFFDAFFDLEPRYWHGFLSSRLFL EL+ FGLSLFSHASN S
Sbjct  421   FFCFGMDILLKLDLKGTRRFFDAFFDLEPRYWHGFLSSRLFLPELLLFGLSLFSHASNAS  480

Query  180   RLEIMTKGTLPLVNMINNLLQDID  109
             RLEIM KGT  LVNMI NL++D D
Sbjct  481   RLEIMAKGTPSLVNMIGNLVKDRD  504



>gb|AAL92175.1|AF489520_1 beta-lycopene cyclase [Sandersonia aurantiaca]
Length=495

 Score =   760 bits (1962),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 387/504 (77%), Positives = 429/504 (85%), Gaps = 12/504 (2%)
 Frame = -2

Query  1611  MDTLLKTPNELEFLH---PHHGFAVKASAFTSLKPQKQEIRIGSWKACRNVGRVKASSSA  1441
             MDTLLKT + LE LH     H     A   + +  +K  +   S         V A SSA
Sbjct  1     MDTLLKTHSRLELLHLQSQRHILTSTAKPSSLISAKKPHLMRCS---------VVAKSSA  51

Query  1440  LLELVPVTKKENLDFELPMFEPSKGIvvdlavvgggpaglavaqqVSQAGLSVCSIDPSP  1261
             LLELVP  KKENLD ELP+++PSK + VDLAVVGGGPAGLAVAQQVSQ+GLSVCSIDPSP
Sbjct  52    LLELVPEVKKENLDMELPLYDPSKSLTVDLAVVGGGPAGLAVAQQVSQSGLSVCSIDPSP  111

Query  1260  KLIWPNNYGVWVDEFEAMDLLDCLDTTWSGAMVYIDDRTTKDLDRPYGRVNRKKLKSKMM  1081
             KLIWPNNYGVWVDEFEAMDLLDCLD +W GA+VY+D+ T K LDRPY RVNRK+LKSKMM
Sbjct  112   KLIWPNNYGVWVDEFEAMDLLDCLDASWPGAVVYLDESTKKLLDRPYARVNRKQLKSKMM  171

Query  1080  QKCITNGVKFHQAKVIKVIHEESKSMLICSDGVTIQATVVLDATGFSRCLVQYDKPYNPG  901
              KC+ NGV+FHQAKV+KVIHEE+KS +IC+DGVTIQA VVLDATGFSRCLVQYDKPYNPG
Sbjct  172   HKCVANGVRFHQAKVVKVIHEEAKSNIICNDGVTIQARVVLDATGFSRCLVQYDKPYNPG  231

Query  900   YQVAYGILAEVEEHPYDLNKMVFMDWRDSHLNSNLELKERNKRIPTFLYAMPFSSTRIFL  721
             YQVAYGILA+VEEHP+DL+KMVFMDWRD HL    ++K+RN+RIPTFLYAMPFSS RIFL
Sbjct  232   YQVAYGILAQVEEHPFDLDKMVFMDWRDMHLRDGKDMKDRNRRIPTFLYAMPFSSERIFL  291

Query  720   EETSLVARPGLDMKDIQERMVARLRHLGINVKSIEEDERCVIPMGGPLPVIPQRVVGIGG  541
             EETSLVARPGL M+DIQERMVARLRHLGI VKSI  DERC+IPMGGPLPV+PQRVVGIGG
Sbjct  292   EETSLVARPGLAMEDIQERMVARLRHLGIRVKSIXXDERCIIPMGGPLPVLPQRVVGIGG  351

Query  540   TAGMVHPSTGYMVARTLAAAPVVANAIIQYLGSERSLLGNELSASVWKDLWPIERRRQRE  361
             TAGMVHPSTGYMVARTLAAAP+VA +I++YL S R + G+ +SA VWKDLWPIERRRQRE
Sbjct  352   TAGMVHPSTGYMVARTLAAAPIVAGSIVRYLSSNRGISGDGISARVWKDLWPIERRRQRE  411

Query  360   FFCFGMDILLKLDLPATRRFFDAFFDLEPRYWHGFLSSRLFLRELIFFGLSLFSHASNTS  181
             FFCFGMDILLKLDL  TRRFFDAFFDLEP YWHGFLSSRLFL EL+FFGLSLF HASNT 
Sbjct  412   FFCFGMDILLKLDLQGTRRFFDAFFDLEPHYWHGFLSSRLFLPELVFFGLSLFGHASNTC  471

Query  180   RLEIMTKGTLPLVNMINNLLQDID  109
             RLEIM KG+LPLV+M+NNLLQD D
Sbjct  472   RLEIMAKGSLPLVHMVNNLLQDRD  495



>gb|AFH53820.1| lycopene beta-cyclase [Narcissus tazetta var. chinensis]
Length=504

 Score =   757 bits (1955),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 391/505 (77%), Positives = 433/505 (86%), Gaps = 5/505 (1%)
 Frame = -2

Query  1611  MDTLLKTPNELEFLHPHHGFAVKASAFTSLKPQKQEIRIGS----WKACRNVGRVKASSS  1444
             MDTLL+T N LE L+P    A +        PQ    +  +     K CRN G    SS+
Sbjct  1     MDTLLRTHNRLELLYPLPELAKRHFLSPCPNPQNPNFKFFNRKPYQKKCRN-GYFGVSSN  59

Query  1443  ALLELVPVTKKENLDFELPMFEPSKGIvvdlavvgggpaglavaqqVSQAGLSVCSIDPS  1264
              LL+LVP  KKE+L+F+LP+++PSK + +DLAVVGGGPAGLAVAQQVS++GLSV SIDP+
Sbjct  60    QLLDLVPEIKKEHLEFDLPLYDPSKALTLDLAVVGGGPAGLAVAQQVSESGLSVVSIDPN  119

Query  1263  PKLIWPNNYGVWVDEFEAMDLLDCLDTTWSGAMVYIDDRTTKDLDRPYGRVNRKKLKSKM  1084
             PKLIWPNNYGVWVDEFE MDLLDCLD TWSGA+VY+DD +TK+L RPY RVNRK LKSKM
Sbjct  120   PKLIWPNNYGVWVDEFEDMDLLDCLDATWSGAIVYVDDHSTKNLGRPYARVNRKNLKSKM  179

Query  1083  MQKCITNGVKFHQAKVIKVIHEESKSMLICSDGVTIQATVVLDATGFSRCLVQYDKPYNP  904
             M+KC++NGV+FHQA V+K +HEE KS LICSDGVTI A VVLDATGFSRCLVQYDKPYNP
Sbjct  180   MKKCVSNGVRFHQATVVKAMHEEEKSYLICSDGVTINARVVLDATGFSRCLVQYDKPYNP  239

Query  903   GYQVAYGILAEVEEHPYDLNKMVFMDWRDSHLNSNLELKERNKRIPTFLYAMPFSSTRIF  724
             GYQVAYGILAEVEEHP+D++KMVFMDWRDSHLN   EL ERN +IPTFLYAMPFSS RIF
Sbjct  240   GYQVAYGILAEVEEHPFDVDKMVFMDWRDSHLNGKAELNERNAKIPTFLYAMPFSSNRIF  299

Query  723   LEETSLVARPGLDMKDIQERMVARLRHLGINVKSIEEDERCVIPMGGPLPVIPQRVVGIG  544
             LEETSLVARPGL M+DIQERMVARL HLGI +KSIEEDERCVIPMGGPLPVIPQRVVGIG
Sbjct  300   LEETSLVARPGLKMEDIQERMVARLNHLGIRIKSIEEDERCVIPMGGPLPVIPQRVVGIG  359

Query  543   GTAGMVHPSTGYMVARTLAAAPVVANAIIQYLGSERSLLGNELSASVWKDLWPIERRRQR  364
             GTAGMVHPSTGYMVARTLAAAP+VAN+I++YL S+  L GNELSA VWKDLWPIERRRQR
Sbjct  360   GTAGMVHPSTGYMVARTLAAAPIVANSIVRYLVSDSGLSGNELSADVWKDLWPIERRRQR  419

Query  363   EFFCFGMDILLKLDLPATRRFFDAFFDLEPRYWHGFLSSRLFLRELIFFGLSLFSHASNT  184
             EFFCFGMDILLKLDL  TRRFFDAFFDLEPRYWHGFLSSRLFL EL+ FGLSLFSHASNT
Sbjct  420   EFFCFGMDILLKLDLEGTRRFFDAFFDLEPRYWHGFLSSRLFLPELVPFGLSLFSHASNT  479

Query  183   SRLEIMTKGTLPLVNMINNLLQDID  109
              +LEIM KGTLPLVNMINNL+QD D
Sbjct  480   CKLEIMAKGTLPLVNMINNLVQDRD  504



>gb|ADD14031.1| lycopene beta cyclase [Cucumis melo]
Length=504

 Score =   756 bits (1953),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 396/504 (79%), Positives = 439/504 (87%), Gaps = 3/504 (1%)
 Frame = -2

Query  1611  MDTLLKTPNELEFLHPHHGFAVKASAFTSLKPQKQEIRIGSWKA---CRNVGRVKASSSA  1441
             MDTLLK  N+  FL P HG + K S     K   QE   G  K     R  G V   +SA
Sbjct  1     MDTLLKINNKYGFLKPLHGVSEKLSGVRGTKFHGQEFGFGQRKGRLKLRKGGCVGVRNSA  60

Query  1440  LLELVPVTKKENLDFELPMFEPSKGIvvdlavvgggpaglavaqqVSQAGLSVCSIDPSP  1261
             LLELVP TKKENL+FELPMF+PSKG+VVDL VVGGGPAGLAVAQQVS+AGLSVC+IDPSP
Sbjct  61    LLELVPETKKENLEFELPMFDPSKGLVVDLVVVGGGPAGLAVAQQVSEAGLSVCAIDPSP  120

Query  1260  KLIWPNNYGVWVDEFEAMDLLDCLDTTWSGAMVYIDDRTTKDLDRPYGRVNRKKLKSKMM  1081
             KLIWPNNYGVWVDEFEAMDLLDCLDTTWSGA+V+ ++++TKDL RPYGRVNRK+L+SKM+
Sbjct  121   KLIWPNNYGVWVDEFEAMDLLDCLDTTWSGAVVFTNEQSTKDLSRPYGRVNRKQLESKML  180

Query  1080  QKCITNGVKFHQAKVIKVIHEESKSMLICSDGVTIQATVVLDATGFSRCLVQYDKPYNPG  901
             QKCI+NGVKFH+AKVIKVIHE+ KS++IC+DGVTIQA +VLDATGFSRCLVQYDKPYNPG
Sbjct  181   QKCISNGVKFHEAKVIKVIHEKFKSLIICNDGVTIQAAIVLDATGFSRCLVQYDKPYNPG  240

Query  900   YQVAYGILAEVEEHPYDLNKMVFMDWRDSHLNSNLELKERNKRIPTFLYAMPFSSTRIFL  721
             YQVAYGILAEVEEHP+D+NKMVFMDWRDSHLN+N+ LK+RN +IPTFLYAMPFSS RIFL
Sbjct  241   YQVAYGILAEVEEHPFDVNKMVFMDWRDSHLNNNMILKDRNSKIPTFLYAMPFSSNRIFL  300

Query  720   EETSLVARPGLDMKDIQERMVARLRHLGINVKSIEEDERCVIPMGGPLPVIPQRVVGIGG  541
             EETSLVARPGL M DIQERM ARL+HLGI VKSIEEDE CVIPMGGPLPV+PQRVVGIGG
Sbjct  301   EETSLVARPGLQMSDIQERMEARLKHLGIKVKSIEEDEHCVIPMGGPLPVLPQRVVGIGG  360

Query  540   TAGMVHPSTGYMVARTLAAAPVVANAIIQYLGSERSLLGNELSASVWKDLWPIERRRQRE  361
             TAGMVHPSTGYMVARTLAAAP+VA+AI++ LGS+    G+ +S+ VWKDLWPIERRRQRE
Sbjct  361   TAGMVHPSTGYMVARTLAAAPIVASAIVRCLGSDGRFRGDAISSEVWKDLWPIERRRQRE  420

Query  360   FFCFGMDILLKLDLPATRRFFDAFFDLEPRYWHGFLSSRLFLRELIFFGLSLFSHASNTS  181
             FFCFGMDILLKLDL  TRRFFDAFFDLEPRYWHGF SSRLFL EL+ FGLSLFSHASN S
Sbjct  421   FFCFGMDILLKLDLKGTRRFFDAFFDLEPRYWHGFSSSRLFLPELLLFGLSLFSHASNAS  480

Query  180   RLEIMTKGTLPLVNMINNLLQDID  109
             RLEIM KGT  LVNMI NL++D D
Sbjct  481   RLEIMAKGTPSLVNMIGNLVKDRD  504



>gb|AFH53819.1| lycopene beta-cyclase [Narcissus tazetta var. chinensis]
Length=504

 Score =   753 bits (1944),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 391/513 (76%), Positives = 427/513 (83%), Gaps = 21/513 (4%)
 Frame = -2

Query  1611  MDTLLKTPNEL------------EFLHPHHGFAVKASAFTSLKPQKQEIRIGSWKACRNV  1468
             MDTLL+T N L             FL P          F S KP +        K CRN 
Sbjct  1     MDTLLRTHNRLELLYPLPELAKRHFLSPCPNPQNPIFKFFSRKPYQ--------KKCRN-  51

Query  1467  GRVKASSSALLELVPVTKKENLDFELPMFEPSKGIvvdlavvgggpaglavaqqVSQAGL  1288
             G     S+ LL+LVP  KKE+L+F+LP ++ SK + +DLAVVGGGPAGLAVAQQVS++GL
Sbjct  52    GYFGIRSNQLLDLVPEIKKEHLEFDLPFYDASKALTLDLAVVGGGPAGLAVAQQVSESGL  111

Query  1287  SVCSIDPSPKLIWPNNYGVWVDEFEAMDLLDCLDTTWSGAMVYIDDRTTKDLDRPYGRVN  1108
             SV SIDP+PKLIWPNNYGVWVDEFE MDLLDCLD TWSGA+VY+DDR+TK+L RPY RVN
Sbjct  112   SVVSIDPNPKLIWPNNYGVWVDEFEDMDLLDCLDATWSGAIVYVDDRSTKNLGRPYARVN  171

Query  1107  RKKLKSKMMQKCITNGVKFHQAKVIKVIHEESKSMLICSDGVTIQATVVLDATGFSRCLV  928
             RK LKSKMM+KC++NGV+FHQA V+K +HEE KS LICSDGVTI A VVLDATGFSRCLV
Sbjct  172   RKNLKSKMMKKCVSNGVRFHQATVVKAVHEEEKSYLICSDGVTINARVVLDATGFSRCLV  231

Query  927   QYDKPYNPGYQVAYGILAEVEEHPYDLNKMVFMDWRDSHLNSNLELKERNKRIPTFLYAM  748
             QYDKPYNPGYQVAYGILAEVEEHP+D++KMVFMDWRDSHLN   EL ERN +IPTFLYAM
Sbjct  232   QYDKPYNPGYQVAYGILAEVEEHPFDVDKMVFMDWRDSHLNGKAELNERNAKIPTFLYAM  291

Query  747   PFSSTRIFLEETSLVARPGLDMKDIQERMVARLRHLGINVKSIEEDERCVIPMGGPLPVI  568
             PFSS RIFLEETSLVARPGL M+DIQERMVARL HLGI +KSIEEDERCVIPMGGPLPVI
Sbjct  292   PFSSNRIFLEETSLVARPGLKMEDIQERMVARLNHLGIRIKSIEEDERCVIPMGGPLPVI  351

Query  567   PQRVVGIGGTAGMVHPSTGYMVARTLAAAPVVANAIIQYLGSERSLLGNELSASVWKDLW  388
             PQRVVGIGGTAGMVHPSTGYMVARTLAAAP VAN+I+QYL S+  L GNELSA VWKDLW
Sbjct  352   PQRVVGIGGTAGMVHPSTGYMVARTLAAAPTVANSIVQYLVSDSGLSGNELSADVWKDLW  411

Query  387   PIERRRQREFFCFGMDILLKLDLPATRRFFDAFFDLEPRYWHGFLSSRLFLRELIFFGLS  208
             PIERRRQREFFCFGMDILLKLDL  TRRFFDAFFDLEPRYWHGFLSSRL L EL+ FGLS
Sbjct  412   PIERRRQREFFCFGMDILLKLDLEGTRRFFDAFFDLEPRYWHGFLSSRLLLPELVPFGLS  471

Query  207   LFSHASNTSRLEIMTKGTLPLVNMINNLLQDID  109
             LFSHASNT +LEIM KGTLPLVNMINNL+QD D
Sbjct  472   LFSHASNTCKLEIMAKGTLPLVNMINNLVQDRD  504



>gb|AAX19899.1| lycopene cyclase [Salicornia europaea]
Length=498

 Score =   753 bits (1943),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 385/501 (77%), Positives = 436/501 (87%), Gaps = 3/501 (1%)
 Frame = -2

Query  1611  MDTLLKTPNELEFLHPHHGFAVKASAFTSLKPQKQEIRIGSWKACRNVGRVKASSSALLE  1432
             M TLLK  ++ EF   H  F+ + S  +  K  +  IR    K  +  G V+ SS+ LLE
Sbjct  1     MSTLLKIHHKFEFWS-HVRFSERCSHLSVPKGHQHYIRKPHEKGFKK-GSVRVSST-LLE  57

Query  1431  LVPVTKKENLDFELPMFEPSKGIvvdlavvgggpaglavaqqVSQAGLSVCSIDPSPKLI  1252
             LVP TKKENL+FELP ++ SKG++VDLAVVGGGPAGLAVAQQVS AGLSVC+IDP+PKLI
Sbjct  58    LVPETKKENLEFELPFYDSSKGLLVDLAVVGGGPAGLAVAQQVSNAGLSVCAIDPNPKLI  117

Query  1251  WPNNYGVWVDEFEAMDLLDCLDTTWSGAMVYIDDRTTKDLDRPYGRVNRKKLKSKMMQKC  1072
             WPNNYGVWVDEFEAMDLLDCLDTTWSGA+VYID+   K+LDRPYGRVNRK LKSKMMQKC
Sbjct  118   WPNNYGVWVDEFEAMDLLDCLDTTWSGAVVYIDENLKKNLDRPYGRVNRKLLKSKMMQKC  177

Query  1071  ITNGVKFHQAKVIKVIHEESKSMLICSDGVTIQATVVLDATGFSRCLVQYDKPYNPGYQV  892
             I+ GVKFHQAKV+KV+H ESKS L+C+DGVTIQA+VVLDATGF+RCLVQYDKPYNPGYQV
Sbjct  178   ISTGVKFHQAKVMKVVHGESKSQLMCNDGVTIQASVVLDATGFARCLVQYDKPYNPGYQV  237

Query  891   AYGILAEVEEHPYDLNKMVFMDWRDSHLNSNLELKERNKRIPTFLYAMPFSSTRIFLEET  712
             AYGILAEVE HP+D++KM+FMDWRDSHL  N EL+ RN +IPTFLYAMPFSS RIFLEET
Sbjct  238   AYGILAEVEGHPFDVDKMLFMDWRDSHLVDNKELRGRNSKIPTFLYAMPFSSNRIFLEET  297

Query  711   SLVARPGLDMKDIQERMVARLRHLGINVKSIEEDERCVIPMGGPLPVIPQRVVGIGGTAG  532
             SLVARPG+ M+DIQ+RM ARLRHLGIN+K IEEDERCVIPMGGPLPVIPQRVVGIGGTAG
Sbjct  298   SLVARPGVPMEDIQQRMDARLRHLGINIKRIEEDERCVIPMGGPLPVIPQRVVGIGGTAG  357

Query  531   MVHPSTGYMVARTLAAAPVVANAIIQYLGSERSLLGNELSASVWKDLWPIERRRQREFFC  352
             +VHPSTGYMVARTLAAAP+VA+ I+QYLGS     G+EL   VWK+LWPIERRRQREFFC
Sbjct  358   LVHPSTGYMVARTLAAAPIVASTIVQYLGSGGRQDGSELFEGVWKNLWPIERRRQREFFC  417

Query  351   FGMDILLKLDLPATRRFFDAFFDLEPRYWHGFLSSRLFLRELIFFGLSLFSHASNTSRLE  172
             FGMDILLKLDLP TR+FFDAFFDLEPRYWHGFLSSRL+L ELI FG SLF+HASN+SRLE
Sbjct  418   FGMDILLKLDLPGTRKFFDAFFDLEPRYWHGFLSSRLYLPELIVFGFSLFAHASNSSRLE  477

Query  171   IMTKGTLPLVNMINNLLQDID  109
             IM+KGTLPL+NM+NNL++D D
Sbjct  478   IMSKGTLPLLNMVNNLVKDTD  498



>ref|XP_006839161.1| PREDICTED: lycopene beta cyclase, chloroplastic/chromoplastic 
isoform X1 [Amborella trichopoda]
 gb|ERN01730.1| hypothetical protein AMTR_s00097p00060630 [Amborella trichopoda]
Length=502

 Score =   748 bits (1930),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 389/502 (77%), Positives = 431/502 (86%), Gaps = 5/502 (1%)
 Frame = -2

Query  1611  MDTLLKTPNELEFLHPHHGFAVKA--SAFTSLKPQKQEIRIGSWKACRNVGRVKASSSAL  1438
             MDT++ T    +  +P H  + K   S+  S KP  Q       K     G V+A S AL
Sbjct  1     MDTIISTHRGHQ-SYPFHYLSEKPIFSSLKSEKPASQAHPKQRKKPFYLDGHVRACS-AL  58

Query  1437  LELVPVTKKENLDFELPMFEPS-KGIvvdlavvgggpaglavaqqVSQAGLSVCSIDPSP  1261
             LELVP  KKENL FELP F+PS K IV+DL VVGGGPAGLAVAQ VS+AGLSVCSIDPSP
Sbjct  59    LELVPEIKKENLAFELPKFDPSLKNIVMDLVVVGGGPAGLAVAQLVSEAGLSVCSIDPSP  118

Query  1260  KLIWPNNYGVWVDEFEAMDLLDCLDTTWSGAMVYIDDRTTKDLDRPYGRVNRKKLKSKMM  1081
              L+WPNNYGVWVDEFEAMDLLDCLDTTWSGA+V+IDD  TK LDRPYGRVNR++LKSKMM
Sbjct  119   TLVWPNNYGVWVDEFEAMDLLDCLDTTWSGAVVFIDDTNTKFLDRPYGRVNRRQLKSKMM  178

Query  1080  QKCITNGVKFHQAKVIKVIHEESKSMLICSDGVTIQATVVLDATGFSRCLVQYDKPYNPG  901
             QKCI NGVKFHQAKV KV+HE+S+S+L C+DGVT+ A VVLDATGFSRCLVQYDK YNPG
Sbjct  179   QKCILNGVKFHQAKVYKVVHEDSQSVLFCNDGVTVHAKVVLDATGFSRCLVQYDKLYNPG  238

Query  900   YQVAYGILAEVEEHPYDLNKMVFMDWRDSHLNSNLELKERNKRIPTFLYAMPFSSTRIFL  721
             YQVAYGILAEVE HP+D++KMVFMDWRDSHL+   EL+ERN +IPTFLYAMPFSS RIFL
Sbjct  239   YQVAYGILAEVEGHPFDVDKMVFMDWRDSHLSGQKELRERNNKIPTFLYAMPFSSNRIFL  298

Query  720   EETSLVARPGLDMKDIQERMVARLRHLGINVKSIEEDERCVIPMGGPLPVIPQRVVGIGG  541
             EETSLVARPGL M+DI+ERMVAR +HLGI VKSIEEDERCVIPMGGPLPV+PQRVVGIGG
Sbjct  299   EETSLVARPGLAMEDIKERMVARFKHLGIRVKSIEEDERCVIPMGGPLPVLPQRVVGIGG  358

Query  540   TAGMVHPSTGYMVARTLAAAPVVANAIIQYLGSERSLLGNELSASVWKDLWPIERRRQRE  361
             TAGMVHPSTGYMVARTLAAAPVVANAI +YL SE   +G++LSA VWKDLWPIERR+QRE
Sbjct  359   TAGMVHPSTGYMVARTLAAAPVVANAIAKYLDSEGGGMGDDLSAKVWKDLWPIERRKQRE  418

Query  360   FFCFGMDILLKLDLPATRRFFDAFFDLEPRYWHGFLSSRLFLRELIFFGLSLFSHASNTS  181
             FFCFGMDILLKLDL  TRRFF+AFFDLEPRYWHGFLSSRLFL EL++FGLSLFSHASN+S
Sbjct  419   FFCFGMDILLKLDLVGTRRFFNAFFDLEPRYWHGFLSSRLFLPELLWFGLSLFSHASNSS  478

Query  180   RLEIMTKGTLPLVNMINNLLQD  115
             RLEIM KGTLPLVNMINNL++D
Sbjct  479   RLEIMAKGTLPLVNMINNLIKD  500



>ref|XP_010552967.1| PREDICTED: lycopene beta cyclase, chloroplastic-like [Tarenaya 
hassleriana]
 ref|XP_010552968.1| PREDICTED: lycopene beta cyclase, chloroplastic-like [Tarenaya 
hassleriana]
Length=515

 Score =   739 bits (1907),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 389/511 (76%), Positives = 440/511 (86%), Gaps = 13/511 (3%)
 Frame = -2

Query  1611  MDTLLKTPNELEFLHPHHGF---------AVKASAFTSLKPQKQEIRIGSWKACRNVGRV  1459
             MDTLL++PN+L+F+   HG          +  +S+   L  +++ I+ G      +    
Sbjct  1     MDTLLRSPNKLDFISQSHGLDKWSSSSCSSNLSSSRLKLFHKRRGIKTG---LAVHALSR  57

Query  1458  KASSSALLELVPVTKKENLDFELPMFEPSKGIvvdlavvgggpaglavaqqVSQAGLSVC  1279
              +SSSALL+LVP TKKENLDFELP+++PSKG VVDLAVVGGGPAGLAVAQQVS+AGLSVC
Sbjct  58    SSSSSALLDLVPETKKENLDFELPLYDPSKGKVVDLAVVGGGPAGLAVAQQVSEAGLSVC  117

Query  1278  SIDPSPKLIWPNNYGVWVDEFEAMDLLDCLDTTWSGAMVYIDDRTTKDLDRPYGRVNRKK  1099
             SIDPSPKLIWPNNYGVWVDEFE MDLLDCLDTTWSGA+VYIDD   KDL RPYGRVNRK 
Sbjct  118   SIDPSPKLIWPNNYGVWVDEFEDMDLLDCLDTTWSGAVVYIDDHVKKDLGRPYGRVNRKL  177

Query  1098  LKSKMMQKCITNGVKFHQAKVIKVIHEESKSMLICSDGVTIQATVVLDATGFSRCLVQYD  919
             LKSKM+QKCI NGVKFHQ+KV  VIHEES+S L CSDGV IQA V+LDATGFSRCLVQYD
Sbjct  178   LKSKMLQKCILNGVKFHQSKVTNVIHEESRSTLFCSDGVKIQAQVILDATGFSRCLVQYD  237

Query  918   KPYNPGYQVAYGILAEVEEHPYDLNKMVFMDWRDSHLNSNLELKERNKRIPTFLYAMPFS  739
             KPYNPGYQVAYGI+AEV+ HP+D++KM+FMDWRDSHL ++ ELKERN+R+PTFLYAMPFS
Sbjct  238   KPYNPGYQVAYGIMAEVDGHPFDVDKMLFMDWRDSHLGNSSELKERNRRLPTFLYAMPFS  297

Query  738   STRIFLEETSLVARPGLDMKDIQERMVARLRHLGINVKSIEEDERCVIPMGGPLPVIPQR  559
             S  IFLEETSLVARPGL + DIQERMVARL+HLGI VK +EEDE CVIPMGGPLP++PQR
Sbjct  298   SNHIFLEETSLVARPGLRIDDIQERMVARLKHLGITVKRVEEDEHCVIPMGGPLPILPQR  357

Query  558   VVGIGGTAGMVHPSTGYMVARTLAAAPVVANAIIQYLGSERSLL-GNELSASVWKDLWPI  382
             VVGIGGTAGMVHPSTGYMVARTLAAAP+VANAI++ LGS+++ L G++LSA VW DLWPI
Sbjct  358   VVGIGGTAGMVHPSTGYMVARTLAAAPIVANAIVRSLGSDKTQLRGDKLSAEVWGDLWPI  417

Query  381   ERRRQREFFCFGMDILLKLDLPATRRFFDAFFDLEPRYWHGFLSSRLFLRELIFFGLSLF  202
             ERRRQREFF FGMDILLKLDL ATRRFFDAFFDL+P YWHGFLSSRLFL EL+FFGLSLF
Sbjct  418   ERRRQREFFGFGMDILLKLDLDATRRFFDAFFDLQPHYWHGFLSSRLFLPELLFFGLSLF  477

Query  201   SHASNTSRLEIMTKGTLPLVNMINNLLQDID  109
             SHASN SRLEIM KGT+PLV MINNL+QD D
Sbjct  478   SHASNRSRLEIMAKGTVPLVKMINNLVQDRD  508



>gb|AGU91432.1| lycopene beta-cyclase, partial [Chrysanthemum boreale]
Length=407

 Score =   728 bits (1879),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 337/398 (85%), Positives = 371/398 (93%), Gaps = 0/398 (0%)
 Frame = -2

Query  1302  SQAGLSVCSIDPSPKLIWPNNYGVWVDEFEAMDLLDCLDTTWSGAMVYIDDRTTKDLDRP  1123
             S+AGL+VCSIDPSPKLIWPNNYGVWVDEFEAMDLLDCLDTTW+ A+VYID+ +TK L+RP
Sbjct  10    SEAGLTVCSIDPSPKLIWPNNYGVWVDEFEAMDLLDCLDTTWASAVVYIDENSTKSLNRP  69

Query  1122  YGRVNRKKLKSKMMQKCITNGVKFHQAKVIKVIHEESKSMLICSDGVTIQATVVLDATGF  943
             Y RVNRK+LK+KM+QKCI+NGVKFHQAKVIKV+HEE KS+LIC+DGVTIQAT+VLDATGF
Sbjct  70    YARVNRKQLKTKMLQKCISNGVKFHQAKVIKVVHEEFKSLLICNDGVTIQATLVLDATGF  129

Query  942   SRCLVQYDKPYNPGYQVAYGILAEVEEHPYDLNKMVFMDWRDSHLNSNLELKERNKRIPT  763
             SR LVQYDKPYNPGYQVAYGILAEVEEHP+D++KM+FMDWRDSHL  N E+KERN +IPT
Sbjct  130   SRSLVQYDKPYNPGYQVAYGILAEVEEHPFDVDKMLFMDWRDSHLGKNTEIKERNSKIPT  189

Query  762   FLYAMPFSSTRIFLEETSLVARPGLDMKDIQERMVARLRHLGINVKSIEEDERCVIPMGG  583
             FLYAMPFSS RIFLEETSLVARPGL M+DIQERMV RL+HLGI VKSIEEDERCVIPMGG
Sbjct  190   FLYAMPFSSNRIFLEETSLVARPGLKMEDIQERMVCRLKHLGIKVKSIEEDERCVIPMGG  249

Query  582   PLPVIPQRVVGIGGTAGMVHPSTGYMVARTLAAAPVVANAIIQYLGSERSLLGNELSASV  403
             PLPV+PQRV+GIGGTAGMVHPSTGYMVARTLAAAP+VA +IIQYL SE+ L G +LSA V
Sbjct  250   PLPVLPQRVLGIGGTAGMVHPSTGYMVARTLAAAPIVAKSIIQYLNSEKMLCGTDLSAEV  309

Query  402   WKDLWPIERRRQREFFCFGMDILLKLDLPATRRFFDAFFDLEPRYWHGFLSSRLFLRELI  223
             W+DLWPIERRRQREFFCFGMDILLKLDL  TRRFFDAFFDLEPRYWHGFLSSRLFL EL+
Sbjct  310   WRDLWPIERRRQREFFCFGMDILLKLDLEGTRRFFDAFFDLEPRYWHGFLSSRLFLPELL  369

Query  222   FFGLSLFSHASNTSRLEIMTKGTLPLVNMINNLLQDID  109
              FGLSLF+HASNTSR+EIM KGTLPL NMINNL+QD D
Sbjct  370   TFGLSLFAHASNTSRIEIMAKGTLPLANMINNLVQDRD  407



>gb|EPS69984.1| lycopene beta-cyclase, partial [Genlisea aurea]
Length=447

 Score =   727 bits (1876),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 368/446 (83%), Positives = 404/446 (91%), Gaps = 1/446 (0%)
 Frame = -2

Query  1449  SSALLELVPVTKKENLDFELPMFEPSKGIvvdlavvgggpaglavaqqVSQAGLSVCSID  1270
             S AL E VP TK ENLD +LPM++PS+   VDLAVVGGGPAGLAVAQQVS+AGLSVCSID
Sbjct  1     SIALQEFVPETKNENLDLDLPMYDPSQRRAVDLAVVGGGPAGLAVAQQVSEAGLSVCSID  60

Query  1269  PSPKLIWPNNYGVWVDEFEAMDLLDCLDTTWSGAMVYIDDRTTKDLDRPYGRVNRKKLKS  1090
             PSP LIWPNNYGVWVDEFEAMDLLDCLDTTWSGA V+IDD TTKDL RPYGRVNRK+LKS
Sbjct  61    PSPMLIWPNNYGVWVDEFEAMDLLDCLDTTWSGAQVFIDDTTTKDLSRPYGRVNRKQLKS  120

Query  1089  KMMQKCITNGVKFHQAKVIKVIHEESKSMLICSDGVTIQATVVLDATGFSRCLVQYDKPY  910
             KMMQKCITNGVKFHQAKV+KVIH+E KS LIC+DGVTI+A VVLDATGF+RCLV+YDK Y
Sbjct  121   KMMQKCITNGVKFHQAKVLKVIHQEHKSSLICNDGVTIEAGVVLDATGFARCLVRYDKTY  180

Query  909   NPGYQVAYGILAEVEEHPYDLNKMVFMDWRDSHLNSNLELKERNKRIPTFLYAMPFSSTR  730
             NPGYQVAYGILAEVE HP+D++KMVFMDWRDSHL +N EL ERN+RIPTFLYAMPFSS R
Sbjct  181   NPGYQVAYGILAEVEGHPFDVDKMVFMDWRDSHLKNNKELMERNRRIPTFLYAMPFSSQR  240

Query  729   IFLEETSLVARPGLDMKDIQERMVARLRHLGINVKSIEEDERCVIPMGGPLPVIPQRVVG  550
             IFLEETSLVARPG+DMKDI++RMVARL HLG+ VK+IEEDE CVIPMGGPLPV+PQRV+G
Sbjct  241   IFLEETSLVARPGVDMKDIKDRMVARLNHLGVVVKTIEEDEHCVIPMGGPLPVLPQRVIG  300

Query  549   IGGTAGMVHPSTGYMVARTLAAAPVVANAIIQYLGS-ERSLLGNELSASVWKDLWPIERR  373
             IGGTAGMVHPSTGYMVARTLAAAP+VANAI+ + GS  + + G+E SA VWKDLWPIERR
Sbjct  301   IGGTAGMVHPSTGYMVARTLAAAPIVANAIVDFHGSNNKHIGGDEFSARVWKDLWPIERR  360

Query  372   RQREFFCFGMDILLKLDLPATRRFFDAFFDLEPRYWHGFLSSRLFLRELIFFGLSLFSHA  193
             RQREFFCFGMDILLKLDL ATRRFF+AFFDLEP  WHGFLSSRLFL EL+ FGLSLF HA
Sbjct  361   RQREFFCFGMDILLKLDLLATRRFFNAFFDLEPHLWHGFLSSRLFLPELLGFGLSLFYHA  420

Query  192   SNTSRLEIMTKGTLPLVNMINNLLQD  115
             SN SRLEIM+KGT+PLV MI NLL+D
Sbjct  421   SNASRLEIMSKGTVPLVYMIRNLLKD  446



>dbj|BAE43559.1| putative lycopene beta cyclase [Taxodium distichum var. imbricatum]
Length=525

 Score =   721 bits (1862),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 364/497 (73%), Positives = 424/497 (85%), Gaps = 6/497 (1%)
 Frame = -2

Query  1605  TLLKTPNELEFLHPHHGFAVKASAFTSLKPQKQEIRIGSWKACRNVGRVKASSSALLELV  1426
              +LKT  +L FL+       K S+ +S   + Q ++  + K C     V  ++S LLELV
Sbjct  33    NVLKT--QLNFLNTQLNLFPKISSVSSAISKLQLLQTRAKKTCM----VVRATSTLLELV  86

Query  1425  PVTKKENLDFELPMFEPSKGIvvdlavvgggpaglavaqqVSQAGLSVCSIDPSPKLIWP  1246
             P  KKENL+FELP +EPSK + +DL VVGGGPAGLAVAQQVS+AG+SVC IDP P+ IWP
Sbjct  87    PEAKKENLEFELPKYEPSKQLPMDLVVVGGGPAGLAVAQQVSEAGISVCCIDPCPESIWP  146

Query  1245  NNYGVWVDEFEAMDLLDCLDTTWSGAMVYIDDRTTKDLDRPYGRVNRKKLKSKMMQKCIT  1066
             NNYGVWVDEFEAMDLLDCLDTTWSGA+VY+DD+T K LDRPYGRVNR++LKSKMM+KCI 
Sbjct  147   NNYGVWVDEFEAMDLLDCLDTTWSGAVVYVDDKTKKFLDRPYGRVNRRQLKSKMMRKCIA  206

Query  1065  NGVKFHQAKVIKVIHEESKSMLICSDGVTIQATVVLDATGFSRCLVQYDKPYNPGYQVAY  886
             NGV+FH+AKV +V+HEESKSM++C+DGV +QA+VVLDATGFSRCLV+YDKPY+PGYQVAY
Sbjct  207   NGVQFHRAKVKQVVHEESKSMVLCTDGVALQASVVLDATGFSRCLVEYDKPYDPGYQVAY  266

Query  885   GILAEVEEHPYDLNKMVFMDWRDSHLNSNLELKERNKRIPTFLYAMPFSSTRIFLEETSL  706
             GILAEV+EHP+D++KMVFMDWRD HL S  EL+  N  IPTFLYAMPFS+ RIFLEETSL
Sbjct  267   GILAEVDEHPFDVDKMVFMDWRDDHLISEPELRANNAEIPTFLYAMPFSANRIFLEETSL  326

Query  705   VARPGLDMKDIQERMVARLRHLGINVKSIEEDERCVIPMGGPLPVIPQRVVGIGGTAGMV  526
             VARPG+ M++IQ+RMVARLRHLGI V+SIEEDE+C IPMGGPLPVIPQRVVGIGGTAGMV
Sbjct  327   VARPGVSMEEIQKRMVARLRHLGIKVRSIEEDEKCYIPMGGPLPVIPQRVVGIGGTAGMV  386

Query  525   HPSTGYMVARTLAAAPVVANAIIQYLGSERSLLGNELSASVWKDLWPIERRRQREFFCFG  346
             HPSTGYMVARTLAAAPV+A++I++ L S   L G ELS  VWKDLWP++RRRQREFFCFG
Sbjct  387   HPSTGYMVARTLAAAPVLASSIVKCLNSGNRLHGEELSTEVWKDLWPMDRRRQREFFCFG  446

Query  345   MDILLKLDLPATRRFFDAFFDLEPRYWHGFLSSRLFLRELIFFGLSLFSHASNTSRLEIM  166
             MDILLKLDL  TRRFF+AFFDLEP +W GFLSSRLFL +LIFFGL+LF+HASNTSRLEIM
Sbjct  447   MDILLKLDLKGTRRFFNAFFDLEPYHWQGFLSSRLFLPDLIFFGLALFAHASNTSRLEIM  506

Query  165   TKGTLPLVNMINNLLQD  115
              KGTLPLV MINNL+ D
Sbjct  507   AKGTLPLVKMINNLVAD  523



>dbj|BAE43542.1| putative lycopene beta cyclase [Cryptomeria japonica]
Length=525

 Score =   721 bits (1861),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 363/497 (73%), Positives = 423/497 (85%), Gaps = 6/497 (1%)
 Frame = -2

Query  1605  TLLKTPNELEFLHPHHGFAVKASAFTSLKPQKQEIRIGSWKACRNVGRVKASSSALLELV  1426
              +LKT  +L FL+       K S+  S     Q ++  + K C     V  ++S LLELV
Sbjct  33    NVLKT--QLNFLNTQLNLFPKISSVNSAISNLQLVQTRAKKTCM----VVRATSTLLELV  86

Query  1425  PVTKKENLDFELPMFEPSKGIvvdlavvgggpaglavaqqVSQAGLSVCSIDPSPKLIWP  1246
             P  KKE+L+ ELP +EPSK + +DL VVGGGPAGLAVAQQVS+AG+SVC IDP P+ IWP
Sbjct  87    PEAKKESLEIELPXYEPSKQLPMDLVVVGGGPAGLAVAQQVSEAGISVCCIDPCPESIWP  146

Query  1245  NNYGVWVDEFEAMDLLDCLDTTWSGAMVYIDDRTTKDLDRPYGRVNRKKLKSKMMQKCIT  1066
             NNYGVWVDEFEAMDLLDCLDTTWSGA+VY+DD+T K LDRPYGRVNR++LKSKMM+KCI 
Sbjct  147   NNYGVWVDEFEAMDLLDCLDTTWSGAVVYVDDKTKKFLDRPYGRVNRRQLKSKMMRKCIA  206

Query  1065  NGVKFHQAKVIKVIHEESKSMLICSDGVTIQATVVLDATGFSRCLVQYDKPYNPGYQVAY  886
             NGV+FH+AKV +V+HE SKSM++C+DGV +QA+VVLDATGFSRCLV+YDKPY+PGYQVAY
Sbjct  207   NGVQFHRAKVKQVVHEGSKSMVLCTDGVALQASVVLDATGFSRCLVEYDKPYDPGYQVAY  266

Query  885   GILAEVEEHPYDLNKMVFMDWRDSHLNSNLELKERNKRIPTFLYAMPFSSTRIFLEETSL  706
             GILAEV+EHP+D++KMVFMDWRD HL +  ELK  N +IPTFLYAMPFS+ RIFLEETSL
Sbjct  267   GILAEVDEHPFDVDKMVFMDWRDDHLINEPELKANNAKIPTFLYAMPFSANRIFLEETSL  326

Query  705   VARPGLDMKDIQERMVARLRHLGINVKSIEEDERCVIPMGGPLPVIPQRVVGIGGTAGMV  526
             VARPG+ M++IQ+RMVARLRHLGI V+SIEEDE+C IPMGGPLPVIPQRVVGIGGTAGMV
Sbjct  327   VARPGVSMEEIQKRMVARLRHLGIKVRSIEEDEKCYIPMGGPLPVIPQRVVGIGGTAGMV  386

Query  525   HPSTGYMVARTLAAAPVVANAIIQYLGSERSLLGNELSASVWKDLWPIERRRQREFFCFG  346
             HPSTGYMVARTLAAAPV+A++I++YL SE  L G ELS  VWKDLWP++RRRQREFFCFG
Sbjct  387   HPSTGYMVARTLAAAPVLASSIVKYLNSENRLHGEELSTEVWKDLWPMDRRRQREFFCFG  446

Query  345   MDILLKLDLPATRRFFDAFFDLEPRYWHGFLSSRLFLRELIFFGLSLFSHASNTSRLEIM  166
             MDILLKLDL  TRRFF+AFFDLEP +W GFLSSRLFL +LIFFGL+LF+HASNTSRLEIM
Sbjct  447   MDILLKLDLKGTRRFFNAFFDLEPYHWQGFLSSRLFLPDLIFFGLALFAHASNTSRLEIM  506

Query  165   TKGTLPLVNMINNLLQD  115
              KGTLPLV MINNL+ D
Sbjct  507   AKGTLPLVKMINNLVAD  523



>dbj|BAE43526.1| putative lycopene beta cyclase [Cryptomeria japonica]
Length=525

 Score =   721 bits (1861),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 363/497 (73%), Positives = 423/497 (85%), Gaps = 6/497 (1%)
 Frame = -2

Query  1605  TLLKTPNELEFLHPHHGFAVKASAFTSLKPQKQEIRIGSWKACRNVGRVKASSSALLELV  1426
              +LKT  +L FL+       K S+  S     Q ++  + K C     V  ++S LLELV
Sbjct  33    NVLKT--QLNFLNTQLNLFPKISSVNSAISNLQLVQTRAKKTCM----VVRATSTLLELV  86

Query  1425  PVTKKENLDFELPMFEPSKGIvvdlavvgggpaglavaqqVSQAGLSVCSIDPSPKLIWP  1246
             P  KKE+L+ ELP +EPSK + +DL VVGGGPAGLAVAQQVS+AG+SVC IDP P+ IWP
Sbjct  87    PEAKKESLEIELPXYEPSKQLPMDLVVVGGGPAGLAVAQQVSEAGISVCCIDPCPESIWP  146

Query  1245  NNYGVWVDEFEAMDLLDCLDTTWSGAMVYIDDRTTKDLDRPYGRVNRKKLKSKMMQKCIT  1066
             NNYGVWVDEFEAMDLLDCLDTTWSGA+VY+DD+T K LDRPYGRVNR++LKSKMM+KCI 
Sbjct  147   NNYGVWVDEFEAMDLLDCLDTTWSGAVVYVDDKTKKFLDRPYGRVNRRQLKSKMMRKCIA  206

Query  1065  NGVKFHQAKVIKVIHEESKSMLICSDGVTIQATVVLDATGFSRCLVQYDKPYNPGYQVAY  886
             NGV+FH+AKV +V+HE SKSM++C+DGV +QA+VVLDATGFSRCLV+YDKPY+PGYQVAY
Sbjct  207   NGVQFHRAKVKQVVHEGSKSMVLCTDGVALQASVVLDATGFSRCLVEYDKPYDPGYQVAY  266

Query  885   GILAEVEEHPYDLNKMVFMDWRDSHLNSNLELKERNKRIPTFLYAMPFSSTRIFLEETSL  706
             GILAEV+EHP+D++KMVFMDWRD HL +  ELK  N +IPTFLYAMPFS+ RIFLEETSL
Sbjct  267   GILAEVDEHPFDVDKMVFMDWRDDHLINEPELKANNAKIPTFLYAMPFSANRIFLEETSL  326

Query  705   VARPGLDMKDIQERMVARLRHLGINVKSIEEDERCVIPMGGPLPVIPQRVVGIGGTAGMV  526
             VARPG+ M++IQ+RMVARLRHLGI V+SIEEDE+C IPMGGPLPVIPQRVVGIGGTAGMV
Sbjct  327   VARPGVSMEEIQKRMVARLRHLGIKVRSIEEDEKCYIPMGGPLPVIPQRVVGIGGTAGMV  386

Query  525   HPSTGYMVARTLAAAPVVANAIIQYLGSERSLLGNELSASVWKDLWPIERRRQREFFCFG  346
             HPSTGYMVARTLAAAPV+A++I++YL SE  L G ELS  VWKDLWP++RRRQREFFCFG
Sbjct  387   HPSTGYMVARTLAAAPVLASSIVKYLNSENRLHGEELSTEVWKDLWPMDRRRQREFFCFG  446

Query  345   MDILLKLDLPATRRFFDAFFDLEPRYWHGFLSSRLFLRELIFFGLSLFSHASNTSRLEIM  166
             MDILLKLDL  TRRFF+AFFDLEP +W GFLSSRLFL +LIFFGL+LF+HASNTSRLEIM
Sbjct  447   MDILLKLDLKGTRRFFNAFFDLEPYHWQGFLSSRLFLPDLIFFGLALFAHASNTSRLEIM  506

Query  165   TKGTLPLVNMINNLLQD  115
              KGTLPLV MINNL+ D
Sbjct  507   AKGTLPLVKMINNLVAD  523



>dbj|BAD02730.1| putative lycopene beta cyclase [Cryptomeria japonica]
 dbj|BAD02740.1| putative lycopene beta cyclase [Cryptomeria japonica]
 dbj|BAD02745.1| putative lycopene beta cyclase [Cryptomeria japonica]
 dbj|BAD02751.1| putative lycopene beta cyclase [Cryptomeria japonica]
 dbj|BAD02760.1| putative lycopene beta cyclase [Cryptomeria japonica]
 dbj|BAD02761.1| putative lycopene beta cyclase [Cryptomeria japonica]
 dbj|BAD02763.1| putative lycopene beta cyclase [Cryptomeria japonica]
 dbj|BAD02768.1| putative lycopene beta cyclase [Cryptomeria japonica]
 dbj|BAD02774.1| putative lycopene beta cyclase [Cryptomeria japonica]
Length=525

 Score =   721 bits (1861),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 363/497 (73%), Positives = 424/497 (85%), Gaps = 6/497 (1%)
 Frame = -2

Query  1605  TLLKTPNELEFLHPHHGFAVKASAFTSLKPQKQEIRIGSWKACRNVGRVKASSSALLELV  1426
              +LKT  +L FL+       K S+ +S     Q ++  + K C     V  ++S LLELV
Sbjct  33    NVLKT--QLNFLNTQLNLFPKISSVSSAISNLQLVQTRAKKTCM----VVRATSTLLELV  86

Query  1425  PVTKKENLDFELPMFEPSKGIvvdlavvgggpaglavaqqVSQAGLSVCSIDPSPKLIWP  1246
             P  KKE+L+ ELP +EPSK + +DL VVGGGPAGLAVAQQVS+AG+SVC IDP P+ IWP
Sbjct  87    PEAKKESLEIELPKYEPSKQLPMDLVVVGGGPAGLAVAQQVSEAGISVCCIDPCPESIWP  146

Query  1245  NNYGVWVDEFEAMDLLDCLDTTWSGAMVYIDDRTTKDLDRPYGRVNRKKLKSKMMQKCIT  1066
             NNYGVWVDEFEAMDLLDCLDTTWSGA+VY+DD+T K LDRPYGRVNR++LKSKMM+KCI 
Sbjct  147   NNYGVWVDEFEAMDLLDCLDTTWSGAVVYVDDKTKKFLDRPYGRVNRRQLKSKMMRKCIA  206

Query  1065  NGVKFHQAKVIKVIHEESKSMLICSDGVTIQATVVLDATGFSRCLVQYDKPYNPGYQVAY  886
             NGV+FH+AKV +V+HE SKSM++C+DGV +QA+VVLDATGFSRCLV+YDKPY+PGYQVAY
Sbjct  207   NGVQFHRAKVKQVVHEGSKSMVLCTDGVALQASVVLDATGFSRCLVEYDKPYDPGYQVAY  266

Query  885   GILAEVEEHPYDLNKMVFMDWRDSHLNSNLELKERNKRIPTFLYAMPFSSTRIFLEETSL  706
             GILAEV+EHP+D++KMVFMDWRD HL +  ELK  N +IPTFLYAMPFS+ RIFLEETSL
Sbjct  267   GILAEVDEHPFDVDKMVFMDWRDDHLINEPELKANNAKIPTFLYAMPFSANRIFLEETSL  326

Query  705   VARPGLDMKDIQERMVARLRHLGINVKSIEEDERCVIPMGGPLPVIPQRVVGIGGTAGMV  526
             VARPG+ M++IQ+RMVARLRHLGI V+SIEEDE+C IPMGGPLPVIPQRVVGIGGTAGMV
Sbjct  327   VARPGVSMEEIQKRMVARLRHLGIKVRSIEEDEKCYIPMGGPLPVIPQRVVGIGGTAGMV  386

Query  525   HPSTGYMVARTLAAAPVVANAIIQYLGSERSLLGNELSASVWKDLWPIERRRQREFFCFG  346
             HPSTGYMVARTLAAAPV+A++I++YL SE  L G ELS  VWKDLWP++RRRQREFFCFG
Sbjct  387   HPSTGYMVARTLAAAPVLASSIVKYLNSENRLHGEELSTEVWKDLWPMDRRRQREFFCFG  446

Query  345   MDILLKLDLPATRRFFDAFFDLEPRYWHGFLSSRLFLRELIFFGLSLFSHASNTSRLEIM  166
             MDILLKLDL  TRRFF+AFFDLEP +W GFLSSRLFL +LIFFGL+LF+HASNTSRLEIM
Sbjct  447   MDILLKLDLKGTRRFFNAFFDLEPYHWQGFLSSRLFLPDLIFFGLALFAHASNTSRLEIM  506

Query  165   TKGTLPLVNMINNLLQD  115
              KGTLPLV MINNL+ D
Sbjct  507   AKGTLPLVKMINNLVAD  523



>dbj|BAE43517.1| putative lycopene beta cyclase [Cryptomeria japonica]
Length=525

 Score =   721 bits (1861),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 363/497 (73%), Positives = 423/497 (85%), Gaps = 6/497 (1%)
 Frame = -2

Query  1605  TLLKTPNELEFLHPHHGFAVKASAFTSLKPQKQEIRIGSWKACRNVGRVKASSSALLELV  1426
              +LKT  +L FL+       K S+  S     Q ++  + K C     V  ++S LLELV
Sbjct  33    NVLKT--QLNFLNTQLNLFPKISSVNSAISNLQLVQTRAKKTCM----VVRATSTLLELV  86

Query  1425  PVTKKENLDFELPMFEPSKGIvvdlavvgggpaglavaqqVSQAGLSVCSIDPSPKLIWP  1246
             P  KKE+L+ ELP +EPSK + +DL VVGGGPAGLAVAQQVS+AG+SVC IDP P+ IWP
Sbjct  87    PEAKKESLEIELPKYEPSKQLPMDLVVVGGGPAGLAVAQQVSEAGISVCCIDPCPESIWP  146

Query  1245  NNYGVWVDEFEAMDLLDCLDTTWSGAMVYIDDRTTKDLDRPYGRVNRKKLKSKMMQKCIT  1066
             NNYGVWVDEFEAMDLLDCLDTTWSGA+VY+DD+T K LDRPYGRVNR++LKSKMM+KCI 
Sbjct  147   NNYGVWVDEFEAMDLLDCLDTTWSGAVVYVDDKTKKFLDRPYGRVNRRQLKSKMMRKCIA  206

Query  1065  NGVKFHQAKVIKVIHEESKSMLICSDGVTIQATVVLDATGFSRCLVQYDKPYNPGYQVAY  886
             NGV+FH+AKV +V+HE SKSM++C+DGV +QA+VVLDATGFSRCLV+YDKPY+PGYQVAY
Sbjct  207   NGVQFHRAKVKQVVHEGSKSMVLCTDGVALQASVVLDATGFSRCLVEYDKPYDPGYQVAY  266

Query  885   GILAEVEEHPYDLNKMVFMDWRDSHLNSNLELKERNKRIPTFLYAMPFSSTRIFLEETSL  706
             GILAEV+EHP+D++KMVFMDWRD HL +  ELK  N +IPTFLYAMPFS+ RIFLEETSL
Sbjct  267   GILAEVDEHPFDVDKMVFMDWRDDHLINEPELKANNAKIPTFLYAMPFSANRIFLEETSL  326

Query  705   VARPGLDMKDIQERMVARLRHLGINVKSIEEDERCVIPMGGPLPVIPQRVVGIGGTAGMV  526
             VARPG+ M++IQ+RMVARLRHLGI V+SIEEDE+C IPMGGPLPVIPQRVVGIGGTAGMV
Sbjct  327   VARPGVSMEEIQKRMVARLRHLGIKVRSIEEDEKCYIPMGGPLPVIPQRVVGIGGTAGMV  386

Query  525   HPSTGYMVARTLAAAPVVANAIIQYLGSERSLLGNELSASVWKDLWPIERRRQREFFCFG  346
             HPSTGYMVARTLAAAPV+A++I++YL SE  L G ELS  VWKDLWP++RRRQREFFCFG
Sbjct  387   HPSTGYMVARTLAAAPVLASSIVKYLNSENRLHGEELSTEVWKDLWPMDRRRQREFFCFG  446

Query  345   MDILLKLDLPATRRFFDAFFDLEPRYWHGFLSSRLFLRELIFFGLSLFSHASNTSRLEIM  166
             MDILLKLDL  TRRFF+AFFDLEP +W GFLSSRLFL +LIFFGL+LF+HASNTSRLEIM
Sbjct  447   MDILLKLDLKGTRRFFNAFFDLEPYHWQGFLSSRLFLPDLIFFGLALFAHASNTSRLEIM  506

Query  165   TKGTLPLVNMINNLLQD  115
              KGTLPLV MINNL+ D
Sbjct  507   AKGTLPLVKMINNLVAD  523



>dbj|BAE43541.1| putative lycopene beta cyclase [Cryptomeria japonica]
Length=525

 Score =   721 bits (1860),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 363/497 (73%), Positives = 423/497 (85%), Gaps = 6/497 (1%)
 Frame = -2

Query  1605  TLLKTPNELEFLHPHHGFAVKASAFTSLKPQKQEIRIGSWKACRNVGRVKASSSALLELV  1426
              +LKT  +L FL+       K S+  S     Q ++  + K C     V  ++S LLELV
Sbjct  33    NVLKT--QLNFLNTQLNLFPKISSVXSAISNLQLVQTRAKKTCM----VVRATSTLLELV  86

Query  1425  PVTKKENLDFELPMFEPSKGIvvdlavvgggpaglavaqqVSQAGLSVCSIDPSPKLIWP  1246
             P  KKE+L+ ELP +EPSK + +DL VVGGGPAGLAVAQQVS+AG+SVC IDP P+ IWP
Sbjct  87    PEAKKESLEIELPXYEPSKQLPMDLVVVGGGPAGLAVAQQVSEAGISVCCIDPCPESIWP  146

Query  1245  NNYGVWVDEFEAMDLLDCLDTTWSGAMVYIDDRTTKDLDRPYGRVNRKKLKSKMMQKCIT  1066
             NNYGVWVDEFEAMDLLDCLDTTWSGA+VY+DD+T K LDRPYGRVNR++LKSKMM+KCI 
Sbjct  147   NNYGVWVDEFEAMDLLDCLDTTWSGAVVYVDDKTKKFLDRPYGRVNRRQLKSKMMRKCIA  206

Query  1065  NGVKFHQAKVIKVIHEESKSMLICSDGVTIQATVVLDATGFSRCLVQYDKPYNPGYQVAY  886
             NGV+FH+AKV +V+HE SKSM++C+DGV +QA+VVLDATGFSRCLV+YDKPY+PGYQVAY
Sbjct  207   NGVQFHRAKVKQVVHEGSKSMVLCTDGVALQASVVLDATGFSRCLVEYDKPYDPGYQVAY  266

Query  885   GILAEVEEHPYDLNKMVFMDWRDSHLNSNLELKERNKRIPTFLYAMPFSSTRIFLEETSL  706
             GILAEV+EHP+D++KMVFMDWRD HL +  ELK  N +IPTFLYAMPFS+ RIFLEETSL
Sbjct  267   GILAEVDEHPFDVDKMVFMDWRDDHLINEPELKANNAKIPTFLYAMPFSANRIFLEETSL  326

Query  705   VARPGLDMKDIQERMVARLRHLGINVKSIEEDERCVIPMGGPLPVIPQRVVGIGGTAGMV  526
             VARPG+ M++IQ+RMVARLRHLGI V+SIEEDE+C IPMGGPLPVIPQRVVGIGGTAGMV
Sbjct  327   VARPGVSMEEIQKRMVARLRHLGIKVRSIEEDEKCYIPMGGPLPVIPQRVVGIGGTAGMV  386

Query  525   HPSTGYMVARTLAAAPVVANAIIQYLGSERSLLGNELSASVWKDLWPIERRRQREFFCFG  346
             HPSTGYMVARTLAAAPV+A++I++YL SE  L G ELS  VWKDLWP++RRRQREFFCFG
Sbjct  387   HPSTGYMVARTLAAAPVLASSIVKYLNSENRLHGEELSTEVWKDLWPMDRRRQREFFCFG  446

Query  345   MDILLKLDLPATRRFFDAFFDLEPRYWHGFLSSRLFLRELIFFGLSLFSHASNTSRLEIM  166
             MDILLKLDL  TRRFF+AFFDLEP +W GFLSSRLFL +LIFFGL+LF+HASNTSRLEIM
Sbjct  447   MDILLKLDLKGTRRFFNAFFDLEPYHWQGFLSSRLFLPDLIFFGLALFAHASNTSRLEIM  506

Query  165   TKGTLPLVNMINNLLQD  115
              KGTLPLV MINNL+ D
Sbjct  507   AKGTLPLVKMINNLVAD  523



>dbj|BAD02727.1| putative lycopene beta cyclase [Cryptomeria japonica]
 dbj|BAD02728.1| putative lycopene beta cyclase [Cryptomeria japonica]
 dbj|BAD02747.1| putative lycopene beta cyclase [Cryptomeria japonica]
 dbj|BAD02758.1| putative lycopene beta cyclase [Cryptomeria japonica]
 dbj|BAD02772.1| putative lycopene beta cyclase [Cryptomeria japonica]
 dbj|BAD02773.1| putative lycopene beta cyclase [Cryptomeria japonica]
 dbj|BAE43515.1| putative lycopene beta cyclase [Cryptomeria japonica]
 dbj|BAE43538.1| putative lycopene beta cyclase [Cryptomeria japonica]
Length=525

 Score =   721 bits (1860),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 363/497 (73%), Positives = 423/497 (85%), Gaps = 6/497 (1%)
 Frame = -2

Query  1605  TLLKTPNELEFLHPHHGFAVKASAFTSLKPQKQEIRIGSWKACRNVGRVKASSSALLELV  1426
              +LKT  +L FL+       K S+  S     Q ++  + K C     V  ++S LLELV
Sbjct  33    NVLKT--QLNFLNTQLNLFPKISSVNSAISNLQLVQTRAKKTCM----VVRATSTLLELV  86

Query  1425  PVTKKENLDFELPMFEPSKGIvvdlavvgggpaglavaqqVSQAGLSVCSIDPSPKLIWP  1246
             P  KKE+L+ ELP +EPSK + +DL VVGGGPAGLAVAQQVS+AG+SVC IDP P+ IWP
Sbjct  87    PEAKKESLEIELPKYEPSKQLPMDLVVVGGGPAGLAVAQQVSEAGISVCCIDPCPESIWP  146

Query  1245  NNYGVWVDEFEAMDLLDCLDTTWSGAMVYIDDRTTKDLDRPYGRVNRKKLKSKMMQKCIT  1066
             NNYGVWVDEFEAMDLLDCLDTTWSGA+VY+DD+T K LDRPYGRVNR++LKSKMM+KCI 
Sbjct  147   NNYGVWVDEFEAMDLLDCLDTTWSGAVVYVDDKTKKFLDRPYGRVNRRQLKSKMMRKCIA  206

Query  1065  NGVKFHQAKVIKVIHEESKSMLICSDGVTIQATVVLDATGFSRCLVQYDKPYNPGYQVAY  886
             NGV+FH+AKV +V+HE SKSM++C+DGV +QA+VVLDATGFSRCLV+YDKPY+PGYQVAY
Sbjct  207   NGVQFHRAKVKQVVHEGSKSMVLCTDGVALQASVVLDATGFSRCLVEYDKPYDPGYQVAY  266

Query  885   GILAEVEEHPYDLNKMVFMDWRDSHLNSNLELKERNKRIPTFLYAMPFSSTRIFLEETSL  706
             GILAEV+EHP+D++KMVFMDWRD HL +  ELK  N +IPTFLYAMPFS+ RIFLEETSL
Sbjct  267   GILAEVDEHPFDVDKMVFMDWRDDHLINEPELKANNAKIPTFLYAMPFSANRIFLEETSL  326

Query  705   VARPGLDMKDIQERMVARLRHLGINVKSIEEDERCVIPMGGPLPVIPQRVVGIGGTAGMV  526
             VARPG+ M++IQ+RMVARLRHLGI V+SIEEDE+C IPMGGPLPVIPQRVVGIGGTAGMV
Sbjct  327   VARPGVSMEEIQKRMVARLRHLGIKVRSIEEDEKCYIPMGGPLPVIPQRVVGIGGTAGMV  386

Query  525   HPSTGYMVARTLAAAPVVANAIIQYLGSERSLLGNELSASVWKDLWPIERRRQREFFCFG  346
             HPSTGYMVARTLAAAPV+A++I++YL SE  L G ELS  VWKDLWP++RRRQREFFCFG
Sbjct  387   HPSTGYMVARTLAAAPVLASSIVKYLNSENRLHGEELSTEVWKDLWPMDRRRQREFFCFG  446

Query  345   MDILLKLDLPATRRFFDAFFDLEPRYWHGFLSSRLFLRELIFFGLSLFSHASNTSRLEIM  166
             MDILLKLDL  TRRFF+AFFDLEP +W GFLSSRLFL +LIFFGL+LF+HASNTSRLEIM
Sbjct  447   MDILLKLDLKGTRRFFNAFFDLEPYHWQGFLSSRLFLPDLIFFGLALFAHASNTSRLEIM  506

Query  165   TKGTLPLVNMINNLLQD  115
              KGTLPLV MINNL+ D
Sbjct  507   AKGTLPLVKMINNLVAD  523



>dbj|BAD02754.1| putative lycopene beta cyclase [Cryptomeria japonica]
 dbj|BAD02767.1| putative lycopene beta cyclase [Cryptomeria japonica]
 dbj|BAD02770.1| putative lycopene beta cyclase [Cryptomeria japonica]
Length=525

 Score =   720 bits (1859),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 363/497 (73%), Positives = 423/497 (85%), Gaps = 6/497 (1%)
 Frame = -2

Query  1605  TLLKTPNELEFLHPHHGFAVKASAFTSLKPQKQEIRIGSWKACRNVGRVKASSSALLELV  1426
              +LKT  +L FL+       K S+  S     Q ++  + K C     V  ++S LLELV
Sbjct  33    NVLKT--QLNFLNTQLNLFPKISSVNSAISNLQLVQTRAKKTCM----VVRATSTLLELV  86

Query  1425  PVTKKENLDFELPMFEPSKGIvvdlavvgggpaglavaqqVSQAGLSVCSIDPSPKLIWP  1246
             P  KKE+L+ ELP +EPSK + +DL VVGGGPAGLAVAQQVS+AG+SVC IDP P+ IWP
Sbjct  87    PEAKKESLEIELPRYEPSKQLPMDLVVVGGGPAGLAVAQQVSEAGISVCCIDPCPESIWP  146

Query  1245  NNYGVWVDEFEAMDLLDCLDTTWSGAMVYIDDRTTKDLDRPYGRVNRKKLKSKMMQKCIT  1066
             NNYGVWVDEFEAMDLLDCLDTTWSGA+VY+DD+T K LDRPYGRVNR++LKSKMM+KCI 
Sbjct  147   NNYGVWVDEFEAMDLLDCLDTTWSGAVVYVDDKTKKFLDRPYGRVNRRQLKSKMMRKCIA  206

Query  1065  NGVKFHQAKVIKVIHEESKSMLICSDGVTIQATVVLDATGFSRCLVQYDKPYNPGYQVAY  886
             NGV+FH+AKV +V+HE SKSM++C+DGV +QA+VVLDATGFSRCLV+YDKPY+PGYQVAY
Sbjct  207   NGVQFHRAKVKQVVHEGSKSMVLCTDGVALQASVVLDATGFSRCLVEYDKPYDPGYQVAY  266

Query  885   GILAEVEEHPYDLNKMVFMDWRDSHLNSNLELKERNKRIPTFLYAMPFSSTRIFLEETSL  706
             GILAEV+EHP+D++KMVFMDWRD HL +  ELK  N +IPTFLYAMPFS+ RIFLEETSL
Sbjct  267   GILAEVDEHPFDVDKMVFMDWRDDHLINEPELKANNAKIPTFLYAMPFSANRIFLEETSL  326

Query  705   VARPGLDMKDIQERMVARLRHLGINVKSIEEDERCVIPMGGPLPVIPQRVVGIGGTAGMV  526
             VARPG+ M++IQ+RMVARLRHLGI V+SIEEDE+C IPMGGPLPVIPQRVVGIGGTAGMV
Sbjct  327   VARPGVSMEEIQKRMVARLRHLGIKVRSIEEDEKCYIPMGGPLPVIPQRVVGIGGTAGMV  386

Query  525   HPSTGYMVARTLAAAPVVANAIIQYLGSERSLLGNELSASVWKDLWPIERRRQREFFCFG  346
             HPSTGYMVARTLAAAPV+A++I++YL SE  L G ELS  VWKDLWP++RRRQREFFCFG
Sbjct  387   HPSTGYMVARTLAAAPVLASSIVKYLNSENRLHGEELSTEVWKDLWPMDRRRQREFFCFG  446

Query  345   MDILLKLDLPATRRFFDAFFDLEPRYWHGFLSSRLFLRELIFFGLSLFSHASNTSRLEIM  166
             MDILLKLDL  TRRFF+AFFDLEP +W GFLSSRLFL +LIFFGL+LF+HASNTSRLEIM
Sbjct  447   MDILLKLDLKGTRRFFNAFFDLEPYHWQGFLSSRLFLPDLIFFGLALFAHASNTSRLEIM  506

Query  165   TKGTLPLVNMINNLLQD  115
              KGTLPLV MINNL+ D
Sbjct  507   AKGTLPLVKMINNLVAD  523



>dbj|BAE43519.1| putative lycopene beta cyclase [Cryptomeria japonica]
Length=525

 Score =   720 bits (1859),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 363/497 (73%), Positives = 423/497 (85%), Gaps = 6/497 (1%)
 Frame = -2

Query  1605  TLLKTPNELEFLHPHHGFAVKASAFTSLKPQKQEIRIGSWKACRNVGRVKASSSALLELV  1426
              +LKT  +L FL+       K S+  S     Q ++  + K C     V  ++S LLELV
Sbjct  33    NVLKT--QLNFLNTQLNLFPKISSVNSAISNLQLVQTRAKKTCM----VVRATSTLLELV  86

Query  1425  PVTKKENLDFELPMFEPSKGIvvdlavvgggpaglavaqqVSQAGLSVCSIDPSPKLIWP  1246
             P  KKE+L+ ELP +EPSK + +DL VVGGGPAGLAVAQQVS+AG+SVC IDP P+ IWP
Sbjct  87    PEAKKESLEIELPKYEPSKQLPMDLVVVGGGPAGLAVAQQVSEAGISVCCIDPCPESIWP  146

Query  1245  NNYGVWVDEFEAMDLLDCLDTTWSGAMVYIDDRTTKDLDRPYGRVNRKKLKSKMMQKCIT  1066
             NNYGVWVDEFEAMDLLDCLDTTWSGA+VY+DD+T K LDRPYGRVNR++LKSKMM+KCI 
Sbjct  147   NNYGVWVDEFEAMDLLDCLDTTWSGAVVYVDDKTKKFLDRPYGRVNRRQLKSKMMRKCIA  206

Query  1065  NGVKFHQAKVIKVIHEESKSMLICSDGVTIQATVVLDATGFSRCLVQYDKPYNPGYQVAY  886
             NGV+FH+AKV +V+HE SKSM++C+DGV +QA+VVLDATGFSRCLV+YDKPY+PGYQVAY
Sbjct  207   NGVQFHRAKVKQVVHEGSKSMVLCTDGVALQASVVLDATGFSRCLVEYDKPYDPGYQVAY  266

Query  885   GILAEVEEHPYDLNKMVFMDWRDSHLNSNLELKERNKRIPTFLYAMPFSSTRIFLEETSL  706
             GILAEV+EHP+D++KMVFMDWRD HL +  ELK  N +IPTFLYAMPFS+ RIFLEETSL
Sbjct  267   GILAEVDEHPFDVDKMVFMDWRDDHLINEPELKANNAKIPTFLYAMPFSANRIFLEETSL  326

Query  705   VARPGLDMKDIQERMVARLRHLGINVKSIEEDERCVIPMGGPLPVIPQRVVGIGGTAGMV  526
             VARPG+ M++IQ+RMVARLRHLGI V+SIEEDE+C IPMGGPLPVIPQRVVGIGGTAGMV
Sbjct  327   VARPGVSMEEIQKRMVARLRHLGIKVRSIEEDEKCYIPMGGPLPVIPQRVVGIGGTAGMV  386

Query  525   HPSTGYMVARTLAAAPVVANAIIQYLGSERSLLGNELSASVWKDLWPIERRRQREFFCFG  346
             HPSTGYMVARTLAAAPV+A++I++YL SE  L G ELS  VWKDLWP++RRRQREFFCFG
Sbjct  387   HPSTGYMVARTLAAAPVLASSIVKYLNSENRLHGEELSTEVWKDLWPMDRRRQREFFCFG  446

Query  345   MDILLKLDLPATRRFFDAFFDLEPRYWHGFLSSRLFLRELIFFGLSLFSHASNTSRLEIM  166
             MDILLKLDL  TRRFF+AFFDLEP +W GFLSSRLFL +LIFFGL+LF+HASNTSRLEIM
Sbjct  447   MDILLKLDLKGTRRFFNAFFDLEPYHWQGFLSSRLFLPDLIFFGLALFAHASNTSRLEIM  506

Query  165   TKGTLPLVNMINNLLQD  115
              KGTLPLV MINNL+ D
Sbjct  507   AKGTLPLVKMINNLVAD  523



>dbj|BAD02729.1| putative lycopene beta cyclase [Cryptomeria japonica]
 dbj|BAD02732.1| putative lycopene beta cyclase [Cryptomeria japonica]
 dbj|BAD02736.1| putative lycopene beta cyclase [Cryptomeria japonica]
 dbj|BAD02737.1| putative lycopene beta cyclase [Cryptomeria japonica]
 dbj|BAD02759.1| putative lycopene beta cyclase [Cryptomeria japonica]
 dbj|BAD02766.1| putative lycopene beta cyclase [Cryptomeria japonica]
Length=525

 Score =   720 bits (1859),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 363/497 (73%), Positives = 423/497 (85%), Gaps = 6/497 (1%)
 Frame = -2

Query  1605  TLLKTPNELEFLHPHHGFAVKASAFTSLKPQKQEIRIGSWKACRNVGRVKASSSALLELV  1426
              +LKT  +L FL+       K S+  S     Q ++  + K C     V  ++S LLELV
Sbjct  33    NVLKT--QLNFLNTQLNLFPKISSVNSAISNLQLVQTRAKKTCM----VVRATSTLLELV  86

Query  1425  PVTKKENLDFELPMFEPSKGIvvdlavvgggpaglavaqqVSQAGLSVCSIDPSPKLIWP  1246
             P  KKE+L+ ELP +EPSK + +DL VVGGGPAGLAVAQQVS+AG+SVC IDP P+ IWP
Sbjct  87    PEAKKESLEIELPKYEPSKQLPMDLVVVGGGPAGLAVAQQVSEAGISVCCIDPCPESIWP  146

Query  1245  NNYGVWVDEFEAMDLLDCLDTTWSGAMVYIDDRTTKDLDRPYGRVNRKKLKSKMMQKCIT  1066
             NNYGVWVDEFEAMDLLDCLDTTWSGA+VY+DD+T K LDRPYGRVNR++LKSKMM+KCI 
Sbjct  147   NNYGVWVDEFEAMDLLDCLDTTWSGAVVYVDDKTKKFLDRPYGRVNRRQLKSKMMRKCIA  206

Query  1065  NGVKFHQAKVIKVIHEESKSMLICSDGVTIQATVVLDATGFSRCLVQYDKPYNPGYQVAY  886
             NGV+FH+AKV +V+HE SKSM++C+DGV +QA+VVLDATGFSRCLV+YDKPY+PGYQVAY
Sbjct  207   NGVQFHRAKVKQVVHEGSKSMVLCTDGVALQASVVLDATGFSRCLVEYDKPYDPGYQVAY  266

Query  885   GILAEVEEHPYDLNKMVFMDWRDSHLNSNLELKERNKRIPTFLYAMPFSSTRIFLEETSL  706
             GILAEV+EHP+D++KMVFMDWRD HL +  ELK  N +IPTFLYAMPFS+ RIFLEETSL
Sbjct  267   GILAEVDEHPFDVDKMVFMDWRDDHLINEPELKANNAKIPTFLYAMPFSANRIFLEETSL  326

Query  705   VARPGLDMKDIQERMVARLRHLGINVKSIEEDERCVIPMGGPLPVIPQRVVGIGGTAGMV  526
             VARPG+ M++IQ+RMVARLRHLGI V+SIEEDE+C IPMGGPLPVIPQRVVGIGGTAGMV
Sbjct  327   VARPGVSMEEIQKRMVARLRHLGIKVRSIEEDEKCYIPMGGPLPVIPQRVVGIGGTAGMV  386

Query  525   HPSTGYMVARTLAAAPVVANAIIQYLGSERSLLGNELSASVWKDLWPIERRRQREFFCFG  346
             HPSTGYMVARTLAAAPV+A++I++YL SE  L G ELS  VWKDLWP++RRRQREFFCFG
Sbjct  387   HPSTGYMVARTLAAAPVLASSIVKYLNSENRLHGEELSTEVWKDLWPMDRRRQREFFCFG  446

Query  345   MDILLKLDLPATRRFFDAFFDLEPRYWHGFLSSRLFLRELIFFGLSLFSHASNTSRLEIM  166
             MDILLKLDL  TRRFF+AFFDLEP +W GFLSSRLFL +LIFFGL+LF+HASNTSRLEIM
Sbjct  447   MDILLKLDLKGTRRFFNAFFDLEPYHWQGFLSSRLFLPDLIFFGLALFAHASNTSRLEIM  506

Query  165   TKGTLPLVNMINNLLQD  115
              KGTLPLV MINNL+ D
Sbjct  507   AKGTLPLVKMINNLVAD  523



>dbj|BAE43521.1| putative lycopene beta cyclase [Cryptomeria japonica]
 dbj|BAE43543.1| putative lycopene beta cyclase [Cryptomeria japonica]
Length=525

 Score =   720 bits (1859),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 363/497 (73%), Positives = 423/497 (85%), Gaps = 6/497 (1%)
 Frame = -2

Query  1605  TLLKTPNELEFLHPHHGFAVKASAFTSLKPQKQEIRIGSWKACRNVGRVKASSSALLELV  1426
              +LKT  +L FL+       K S+  S     Q ++  + K C     V  ++S LLELV
Sbjct  33    NVLKT--QLNFLNTQLNLFPKISSVXSAISNLQLVQTRAKKTCM----VVRATSTLLELV  86

Query  1425  PVTKKENLDFELPMFEPSKGIvvdlavvgggpaglavaqqVSQAGLSVCSIDPSPKLIWP  1246
             P  KKE+L+ ELP +EPSK + +DL VVGGGPAGLAVAQQVS+AG+SVC IDP P+ IWP
Sbjct  87    PEAKKESLEIELPKYEPSKQLPMDLVVVGGGPAGLAVAQQVSEAGISVCCIDPCPESIWP  146

Query  1245  NNYGVWVDEFEAMDLLDCLDTTWSGAMVYIDDRTTKDLDRPYGRVNRKKLKSKMMQKCIT  1066
             NNYGVWVDEFEAMDLLDCLDTTWSGA+VY+DD+T K LDRPYGRVNR++LKSKMM+KCI 
Sbjct  147   NNYGVWVDEFEAMDLLDCLDTTWSGAVVYVDDKTKKFLDRPYGRVNRRQLKSKMMRKCIA  206

Query  1065  NGVKFHQAKVIKVIHEESKSMLICSDGVTIQATVVLDATGFSRCLVQYDKPYNPGYQVAY  886
             NGV+FH+AKV +V+HE SKSM++C+DGV +QA+VVLDATGFSRCLV+YDKPY+PGYQVAY
Sbjct  207   NGVQFHRAKVKQVVHEGSKSMVLCTDGVALQASVVLDATGFSRCLVEYDKPYDPGYQVAY  266

Query  885   GILAEVEEHPYDLNKMVFMDWRDSHLNSNLELKERNKRIPTFLYAMPFSSTRIFLEETSL  706
             GILAEV+EHP+D++KMVFMDWRD HL +  ELK  N +IPTFLYAMPFS+ RIFLEETSL
Sbjct  267   GILAEVDEHPFDVDKMVFMDWRDDHLINEPELKANNAKIPTFLYAMPFSANRIFLEETSL  326

Query  705   VARPGLDMKDIQERMVARLRHLGINVKSIEEDERCVIPMGGPLPVIPQRVVGIGGTAGMV  526
             VARPG+ M++IQ+RMVARLRHLGI V+SIEEDE+C IPMGGPLPVIPQRVVGIGGTAGMV
Sbjct  327   VARPGVSMEEIQKRMVARLRHLGIKVRSIEEDEKCYIPMGGPLPVIPQRVVGIGGTAGMV  386

Query  525   HPSTGYMVARTLAAAPVVANAIIQYLGSERSLLGNELSASVWKDLWPIERRRQREFFCFG  346
             HPSTGYMVARTLAAAPV+A++I++YL SE  L G ELS  VWKDLWP++RRRQREFFCFG
Sbjct  387   HPSTGYMVARTLAAAPVLASSIVKYLNSENRLHGEELSTEVWKDLWPMDRRRQREFFCFG  446

Query  345   MDILLKLDLPATRRFFDAFFDLEPRYWHGFLSSRLFLRELIFFGLSLFSHASNTSRLEIM  166
             MDILLKLDL  TRRFF+AFFDLEP +W GFLSSRLFL +LIFFGL+LF+HASNTSRLEIM
Sbjct  447   MDILLKLDLKGTRRFFNAFFDLEPYHWQGFLSSRLFLPDLIFFGLALFAHASNTSRLEIM  506

Query  165   TKGTLPLVNMINNLLQD  115
              KGTLPLV MINNL+ D
Sbjct  507   AKGTLPLVKMINNLVAD  523



>dbj|BAE43544.1| putative lycopene beta cyclase [Cryptomeria japonica]
Length=525

 Score =   720 bits (1859),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 363/497 (73%), Positives = 423/497 (85%), Gaps = 6/497 (1%)
 Frame = -2

Query  1605  TLLKTPNELEFLHPHHGFAVKASAFTSLKPQKQEIRIGSWKACRNVGRVKASSSALLELV  1426
              +LKT  +L FL+       K S+  S     Q ++  + K C     V  ++S LLELV
Sbjct  33    NVLKT--QLNFLNTQLNLFPKISSVXSAISNLQLVQTRAKKTCM----VVRATSTLLELV  86

Query  1425  PVTKKENLDFELPMFEPSKGIvvdlavvgggpaglavaqqVSQAGLSVCSIDPSPKLIWP  1246
             P  KKE+L+ ELP +EPSK + +DL VVGGGPAGLAVAQQVS+AG+SVC IDP P+ IWP
Sbjct  87    PEAKKESLEIELPKYEPSKQLPMDLVVVGGGPAGLAVAQQVSEAGISVCCIDPCPESIWP  146

Query  1245  NNYGVWVDEFEAMDLLDCLDTTWSGAMVYIDDRTTKDLDRPYGRVNRKKLKSKMMQKCIT  1066
             NNYGVWVDEFEAMDLLDCLDTTWSGA+VY+DD+T K LDRPYGRVNR++LKSKMM+KCI 
Sbjct  147   NNYGVWVDEFEAMDLLDCLDTTWSGAVVYVDDKTKKFLDRPYGRVNRRQLKSKMMRKCIA  206

Query  1065  NGVKFHQAKVIKVIHEESKSMLICSDGVTIQATVVLDATGFSRCLVQYDKPYNPGYQVAY  886
             NGV+FH+AKV +V+HE SKSM++C+DGV +QA+VVLDATGFSRCLV+YDKPY+PGYQVAY
Sbjct  207   NGVQFHRAKVKQVVHEGSKSMVLCTDGVALQASVVLDATGFSRCLVEYDKPYDPGYQVAY  266

Query  885   GILAEVEEHPYDLNKMVFMDWRDSHLNSNLELKERNKRIPTFLYAMPFSSTRIFLEETSL  706
             GILAEV+EHP+D++KMVFMDWRD HL +  ELK  N +IPTFLYAMPFS+ RIFLEETSL
Sbjct  267   GILAEVDEHPFDVDKMVFMDWRDDHLINEPELKANNAKIPTFLYAMPFSANRIFLEETSL  326

Query  705   VARPGLDMKDIQERMVARLRHLGINVKSIEEDERCVIPMGGPLPVIPQRVVGIGGTAGMV  526
             VARPG+ M++IQ+RMVARLRHLGI V+SIEEDE+C IPMGGPLPVIPQRVVGIGGTAGMV
Sbjct  327   VARPGVSMEEIQKRMVARLRHLGIKVRSIEEDEKCYIPMGGPLPVIPQRVVGIGGTAGMV  386

Query  525   HPSTGYMVARTLAAAPVVANAIIQYLGSERSLLGNELSASVWKDLWPIERRRQREFFCFG  346
             HPSTGYMVARTLAAAPV+A++I++YL SE  L G ELS  VWKDLWP++RRRQREFFCFG
Sbjct  387   HPSTGYMVARTLAAAPVLASSIVKYLNSENRLHGEELSTEVWKDLWPMDRRRQREFFCFG  446

Query  345   MDILLKLDLPATRRFFDAFFDLEPRYWHGFLSSRLFLRELIFFGLSLFSHASNTSRLEIM  166
             MDILLKLDL  TRRFF+AFFDLEP +W GFLSSRLFL +LIFFGL+LF+HASNTSRLEIM
Sbjct  447   MDILLKLDLKGTRRFFNAFFDLEPYHWQGFLSSRLFLPDLIFFGLALFAHASNTSRLEIM  506

Query  165   TKGTLPLVNMINNLLQD  115
              KGTLPLV MINNL+ D
Sbjct  507   AKGTLPLVKMINNLVAD  523



>dbj|BAD02739.1| putative lycopene beta cyclase [Cryptomeria japonica]
 dbj|BAD02746.1| putative lycopene beta cyclase [Cryptomeria japonica]
 dbj|BAD02748.1| putative lycopene beta cyclase [Cryptomeria japonica]
 dbj|BAD02749.1| putative lycopene beta cyclase [Cryptomeria japonica]
 dbj|BAD02755.1| putative lycopene beta cyclase [Cryptomeria japonica]
 dbj|BAD02756.1| putative lycopene beta cyclase [Cryptomeria japonica]
 dbj|BAD02762.1| putative lycopene beta cyclase [Cryptomeria japonica]
 dbj|BAD02764.1| putative lycopene beta cyclase [Cryptomeria japonica]
 dbj|BAD02765.1| putative lycopene beta cyclase [Cryptomeria japonica]
 dbj|BAD02771.1| putative lycopene beta cyclase [Cryptomeria japonica]
 dbj|BAE43514.1| putative lycopene beta cyclase [Cryptomeria japonica]
Length=525

 Score =   720 bits (1858),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 363/497 (73%), Positives = 423/497 (85%), Gaps = 6/497 (1%)
 Frame = -2

Query  1605  TLLKTPNELEFLHPHHGFAVKASAFTSLKPQKQEIRIGSWKACRNVGRVKASSSALLELV  1426
              +LKT  +L FL+       K S+  S     Q ++  + K C     V  ++S LLELV
Sbjct  33    NVLKT--QLNFLNTQLNLFPKISSVNSAISNLQLVQTRAKKTCM----VVRATSTLLELV  86

Query  1425  PVTKKENLDFELPMFEPSKGIvvdlavvgggpaglavaqqVSQAGLSVCSIDPSPKLIWP  1246
             P  KKE+L+ ELP +EPSK + +DL VVGGGPAGLAVAQQVS+AG+SVC IDP P+ IWP
Sbjct  87    PEAKKESLEIELPKYEPSKQLPMDLVVVGGGPAGLAVAQQVSEAGISVCCIDPCPESIWP  146

Query  1245  NNYGVWVDEFEAMDLLDCLDTTWSGAMVYIDDRTTKDLDRPYGRVNRKKLKSKMMQKCIT  1066
             NNYGVWVDEFEAMDLLDCLDTTWSGA+VY+DD+T K LDRPYGRVNR++LKSKMM+KCI 
Sbjct  147   NNYGVWVDEFEAMDLLDCLDTTWSGAVVYVDDKTKKFLDRPYGRVNRRQLKSKMMRKCIA  206

Query  1065  NGVKFHQAKVIKVIHEESKSMLICSDGVTIQATVVLDATGFSRCLVQYDKPYNPGYQVAY  886
             NGV+FH+AKV +V+HE SKSM++C+DGV +QA+VVLDATGFSRCLV+YDKPY+PGYQVAY
Sbjct  207   NGVQFHRAKVKQVVHEGSKSMVLCTDGVALQASVVLDATGFSRCLVEYDKPYDPGYQVAY  266

Query  885   GILAEVEEHPYDLNKMVFMDWRDSHLNSNLELKERNKRIPTFLYAMPFSSTRIFLEETSL  706
             GILAEV+EHP+D++KMVFMDWRD HL +  ELK  N +IPTFLYAMPFS+ RIFLEETSL
Sbjct  267   GILAEVDEHPFDVDKMVFMDWRDDHLINEPELKANNAKIPTFLYAMPFSANRIFLEETSL  326

Query  705   VARPGLDMKDIQERMVARLRHLGINVKSIEEDERCVIPMGGPLPVIPQRVVGIGGTAGMV  526
             VARPG+ M++IQ+RMVARLRHLGI V+SIEEDE+C IPMGGPLPVIPQRVVGIGGTAGMV
Sbjct  327   VARPGVSMEEIQKRMVARLRHLGIKVRSIEEDEKCYIPMGGPLPVIPQRVVGIGGTAGMV  386

Query  525   HPSTGYMVARTLAAAPVVANAIIQYLGSERSLLGNELSASVWKDLWPIERRRQREFFCFG  346
             HPSTGYMVARTLAAAPV+A++I++YL SE  L G ELS  VWKDLWP++RRRQREFFCFG
Sbjct  387   HPSTGYMVARTLAAAPVLASSIVKYLNSENRLHGEELSTEVWKDLWPMDRRRQREFFCFG  446

Query  345   MDILLKLDLPATRRFFDAFFDLEPRYWHGFLSSRLFLRELIFFGLSLFSHASNTSRLEIM  166
             MDILLKLDL  TRRFF+AFFDLEP +W GFLSSRLFL +LIFFGL+LF+HASNTSRLEIM
Sbjct  447   MDILLKLDLKGTRRFFNAFFDLEPYHWQGFLSSRLFLPDLIFFGLALFAHASNTSRLEIM  506

Query  165   TKGTLPLVNMINNLLQD  115
              KGTLPLV MINNL+ D
Sbjct  507   AKGTLPLVKMINNLVAD  523



>dbj|BAD02742.1| putative lycopene beta cyclase [Cryptomeria japonica]
Length=525

 Score =   720 bits (1858),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 362/497 (73%), Positives = 423/497 (85%), Gaps = 6/497 (1%)
 Frame = -2

Query  1605  TLLKTPNELEFLHPHHGFAVKASAFTSLKPQKQEIRIGSWKACRNVGRVKASSSALLELV  1426
              +LKT  +L FL+       K S+  S     Q ++  + K C     V  ++S LLELV
Sbjct  33    NVLKT--QLNFLNTQLNLFPKISSVNSAISNLQLVQTRAKKTCM----VVRATSTLLELV  86

Query  1425  PVTKKENLDFELPMFEPSKGIvvdlavvgggpaglavaqqVSQAGLSVCSIDPSPKLIWP  1246
             P  KKE+L+ ELP +EPSK + +DL VVGGGPAGLAVAQQVS+AG+SVC IDP P+ IWP
Sbjct  87    PEAKKESLEIELPKYEPSKQLPMDLVVVGGGPAGLAVAQQVSEAGISVCCIDPCPESIWP  146

Query  1245  NNYGVWVDEFEAMDLLDCLDTTWSGAMVYIDDRTTKDLDRPYGRVNRKKLKSKMMQKCIT  1066
             NNYGVWVDEFEAMDLLDCLDTTWSGA+VY+DD+T K LDRPYGRVNR++LKSKMM+KCI 
Sbjct  147   NNYGVWVDEFEAMDLLDCLDTTWSGAVVYVDDKTKKFLDRPYGRVNRRQLKSKMMRKCIA  206

Query  1065  NGVKFHQAKVIKVIHEESKSMLICSDGVTIQATVVLDATGFSRCLVQYDKPYNPGYQVAY  886
             NGV+FH+AKV +V+HE SKSM++C+DGV +QA+VVLDATGFSRCLV+YDKPY+PGYQVAY
Sbjct  207   NGVQFHRAKVKQVVHEGSKSMVLCTDGVALQASVVLDATGFSRCLVEYDKPYDPGYQVAY  266

Query  885   GILAEVEEHPYDLNKMVFMDWRDSHLNSNLELKERNKRIPTFLYAMPFSSTRIFLEETSL  706
             GILAEV+EHP+D++KMVFMDWRD HL +  ELK  N +IPTFLYAMPFS+ RIFLEETSL
Sbjct  267   GILAEVDEHPFDVDKMVFMDWRDDHLINEPELKANNAKIPTFLYAMPFSANRIFLEETSL  326

Query  705   VARPGLDMKDIQERMVARLRHLGINVKSIEEDERCVIPMGGPLPVIPQRVVGIGGTAGMV  526
             VARPG+ M++IQ+RMVARLRHLGI V+SIEEDE+C IPMGGPLPVIPQRVVGIGGTAGMV
Sbjct  327   VARPGVSMEEIQKRMVARLRHLGIKVRSIEEDEKCYIPMGGPLPVIPQRVVGIGGTAGMV  386

Query  525   HPSTGYMVARTLAAAPVVANAIIQYLGSERSLLGNELSASVWKDLWPIERRRQREFFCFG  346
             HPSTGYMVARTLAAAP++A++I++YL SE  L G ELS  VWKDLWP++RRRQREFFCFG
Sbjct  387   HPSTGYMVARTLAAAPILASSIVKYLNSENRLHGEELSTEVWKDLWPMDRRRQREFFCFG  446

Query  345   MDILLKLDLPATRRFFDAFFDLEPRYWHGFLSSRLFLRELIFFGLSLFSHASNTSRLEIM  166
             MDILLKLDL  TRRFF+AFFDLEP +W GFLSSRLFL +LIFFGL+LF+HASNTSRLEIM
Sbjct  447   MDILLKLDLKGTRRFFNAFFDLEPYHWQGFLSSRLFLPDLIFFGLALFAHASNTSRLEIM  506

Query  165   TKGTLPLVNMINNLLQD  115
              KGTLPLV MINNL+ D
Sbjct  507   AKGTLPLVKMINNLVAD  523



>gb|ADN65329.1| lycopene beta-cyclase [Manihot esculenta]
Length=401

 Score =   715 bits (1845),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 354/400 (89%), Positives = 386/400 (97%), Gaps = 0/400 (0%)
 Frame = -2

Query  1419  TKKENLDFELPMFEPSKGIvvdlavvgggpaglavaqqVSQAGLSVCSIDPSPKLIWPNN  1240
             TKKENL+F+LPM++PSKG+VVDLAVVGGGPAGLAVAQQVS+AGLSVC IDPSPKLIWPNN
Sbjct  2     TKKENLEFDLPMYDPSKGLVVDLAVVGGGPAGLAVAQQVSKAGLSVCLIDPSPKLIWPNN  61

Query  1239  YGVWVDEFEAMDLLDCLDTTWSGAMVYIDDRTTKDLDRPYGRVNRKKLKSKMMQKCITNG  1060
             YGVWVDEFEAMDLLDCLDTTWSGA+VYIDD+T KDL RPYGRVNRK+LKSKM+QKCI+NG
Sbjct  62    YGVWVDEFEAMDLLDCLDTTWSGAVVYIDDKTKKDLGRPYGRVNRKQLKSKMLQKCISNG  121

Query  1059  VKFHQAKVIKVIHEESKSMLICSDGVTIQATVVLDATGFSRCLVQYDKPYNPGYQVAYGI  880
             VKFHQAKV+KVIHEESKS+LIC+DG+TIQA VVLDATGFSRCLVQYDKPYNPGYQVAYGI
Sbjct  122   VKFHQAKVVKVIHEESKSLLICNDGITIQAAVVLDATGFSRCLVQYDKPYNPGYQVAYGI  181

Query  879   LAEVEEHPYDLNKMVFMDWRDSHLNSNLELKERNKRIPTFLYAMPFSSTRIFLEETSLVA  700
             LAEVEEHP+D++KMVFMDWRDSHL++NLE+K+RN +IPTFLYAMPFSS RIFLEETSLVA
Sbjct  182   LAEVEEHPFDIDKMVFMDWRDSHLDNNLEVKQRNSKIPTFLYAMPFSSDRIFLEETSLVA  241

Query  699   RPGLDMKDIQERMVARLRHLGINVKSIEEDERCVIPMGGPLPVIPQRVVGIGGTAGMVHP  520
             RPG+ M+DIQERMVARLRHLGI VKSIEEDERCVIPMGGPLPV+PQRVVGIGGTAGMVHP
Sbjct  242   RPGVPMEDIQERMVARLRHLGIKVKSIEEDERCVIPMGGPLPVLPQRVVGIGGTAGMVHP  301

Query  519   STGYMVARTLAAAPVVANAIIQYLGSERSLLGNELSASVWKDLWPIERRRQREFFCFGMD  340
             STGYMVARTLAAAP+VAN+I+QYLGS RSL GNEL+A VWKDLWPI+RRRQREFFCFGMD
Sbjct  302   STGYMVARTLAAAPIVANSIVQYLGSGRSLSGNELAAEVWKDLWPIQRRRQREFFCFGMD  361

Query  339   ILLKLDLPATRRFFDAFFDLEPRYWHGFLSSRLFLRELIF  220
             ILLKLDL ATRRFFDAFFDLEP YWHGFLSSRLFL EL+F
Sbjct  362   ILLKLDLQATRRFFDAFFDLEPHYWHGFLSSRLFLPELLF  401



>dbj|BAE43533.1| putative lycopene beta cyclase [Cryptomeria japonica]
Length=525

 Score =   720 bits (1858),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 363/497 (73%), Positives = 423/497 (85%), Gaps = 6/497 (1%)
 Frame = -2

Query  1605  TLLKTPNELEFLHPHHGFAVKASAFTSLKPQKQEIRIGSWKACRNVGRVKASSSALLELV  1426
              +LKT  +L FL+       K S+  S     Q ++  + K C     V  ++S LLELV
Sbjct  33    NVLKT--QLNFLNTQLNLFPKISSVXSAISNLQLVQTRAKKTCM----VVRATSTLLELV  86

Query  1425  PVTKKENLDFELPMFEPSKGIvvdlavvgggpaglavaqqVSQAGLSVCSIDPSPKLIWP  1246
             P  KKE+L+ ELP +EPSK + +DL VVGGGPAGLAVAQQVS+AG+SVC IDP P+ IWP
Sbjct  87    PEAKKESLEIELPKYEPSKQLPMDLVVVGGGPAGLAVAQQVSEAGISVCCIDPCPESIWP  146

Query  1245  NNYGVWVDEFEAMDLLDCLDTTWSGAMVYIDDRTTKDLDRPYGRVNRKKLKSKMMQKCIT  1066
             NNYGVWVDEFEAMDLLDCLDTTWSGA+VY+DD+T K LDRPYGRVNR++LKSKMM+KCI 
Sbjct  147   NNYGVWVDEFEAMDLLDCLDTTWSGAVVYVDDKTKKFLDRPYGRVNRRQLKSKMMRKCIA  206

Query  1065  NGVKFHQAKVIKVIHEESKSMLICSDGVTIQATVVLDATGFSRCLVQYDKPYNPGYQVAY  886
             NGV+FH+AKV +V+HE SKSM++C+DGV +QA+VVLDATGFSRCLV+YDKPY+PGYQVAY
Sbjct  207   NGVQFHRAKVKQVVHEGSKSMVLCTDGVALQASVVLDATGFSRCLVEYDKPYDPGYQVAY  266

Query  885   GILAEVEEHPYDLNKMVFMDWRDSHLNSNLELKERNKRIPTFLYAMPFSSTRIFLEETSL  706
             GILAEV+EHP+D++KMVFMDWRD HL +  ELK  N +IPTFLYAMPFS+ RIFLEETSL
Sbjct  267   GILAEVDEHPFDVDKMVFMDWRDDHLINEPELKANNAKIPTFLYAMPFSANRIFLEETSL  326

Query  705   VARPGLDMKDIQERMVARLRHLGINVKSIEEDERCVIPMGGPLPVIPQRVVGIGGTAGMV  526
             VARPG+ M++IQ+RMVARLRHLGI V+SIEEDE+C IPMGGPLPVIPQRVVGIGGTAGMV
Sbjct  327   VARPGVSMEEIQKRMVARLRHLGIKVRSIEEDEKCYIPMGGPLPVIPQRVVGIGGTAGMV  386

Query  525   HPSTGYMVARTLAAAPVVANAIIQYLGSERSLLGNELSASVWKDLWPIERRRQREFFCFG  346
             HPSTGYMVARTLAAAPV+A++I++YL SE  L G ELS  VWKDLWP++RRRQREFFCFG
Sbjct  387   HPSTGYMVARTLAAAPVLASSIVKYLNSENRLHGEELSTEVWKDLWPMDRRRQREFFCFG  446

Query  345   MDILLKLDLPATRRFFDAFFDLEPRYWHGFLSSRLFLRELIFFGLSLFSHASNTSRLEIM  166
             MDILLKLDL  TRRFF+AFFDLEP +W GFLSSRLFL +LIFFGL+LF+HASNTSRLEIM
Sbjct  447   MDILLKLDLKGTRRFFNAFFDLEPYHWQGFLSSRLFLPDLIFFGLALFAHASNTSRLEIM  506

Query  165   TKGTLPLVNMINNLLQD  115
              KGTLPLV MINNL+ D
Sbjct  507   AKGTLPLVKMINNLVAD  523



>dbj|BAE43549.1| putative lycopene beta cyclase [Taxodium distichum var. distichum]
Length=525

 Score =   719 bits (1856),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 363/497 (73%), Positives = 423/497 (85%), Gaps = 6/497 (1%)
 Frame = -2

Query  1605  TLLKTPNELEFLHPHHGFAVKASAFTSLKPQKQEIRIGSWKACRNVGRVKASSSALLELV  1426
              +LKT  +L FL+       K S+ +S   + Q ++  + K C     V  ++S LLELV
Sbjct  33    NVLKT--QLNFLNTQLNLFPKISSVSSAISKLQLLQTRAKKTCM----VVRATSTLLELV  86

Query  1425  PVTKKENLDFELPMFEPSKGIvvdlavvgggpaglavaqqVSQAGLSVCSIDPSPKLIWP  1246
             P  KKENL+FELP +EPSK + +DL VVGGGPAGLAVAQQVS+AG+SVC IDP P+ IWP
Sbjct  87    PEAKKENLEFELPKYEPSKQLPMDLVVVGGGPAGLAVAQQVSEAGISVCCIDPCPESIWP  146

Query  1245  NNYGVWVDEFEAMDLLDCLDTTWSGAMVYIDDRTTKDLDRPYGRVNRKKLKSKMMQKCIT  1066
             NNYGVWVDEFEAMDLLDCLDTTWSGA+VY+DD+T K LDRPYGRVNR++LKSKMM+KCI 
Sbjct  147   NNYGVWVDEFEAMDLLDCLDTTWSGAVVYVDDKTKKFLDRPYGRVNRRQLKSKMMRKCIA  206

Query  1065  NGVKFHQAKVIKVIHEESKSMLICSDGVTIQATVVLDATGFSRCLVQYDKPYNPGYQVAY  886
             NGV+FH+AKV +V+HE SKSM++C+DGV +QA+VVLDATGFSRCLV+YDKPY+PGYQVAY
Sbjct  207   NGVQFHRAKVKQVVHEGSKSMVLCTDGVALQASVVLDATGFSRCLVEYDKPYDPGYQVAY  266

Query  885   GILAEVEEHPYDLNKMVFMDWRDSHLNSNLELKERNKRIPTFLYAMPFSSTRIFLEETSL  706
             GILAEV+EHP+D++KMVFMDWRD HL S  EL+  N  IPTFLYAMPFS+ RIFLEETSL
Sbjct  267   GILAEVDEHPFDVDKMVFMDWRDDHLISEPELRANNAEIPTFLYAMPFSANRIFLEETSL  326

Query  705   VARPGLDMKDIQERMVARLRHLGINVKSIEEDERCVIPMGGPLPVIPQRVVGIGGTAGMV  526
             VARPG+ M++IQ+RMVARLRHLGI V+SIEEDE+C IPMGGPLPVIPQRVVGIGGTAGMV
Sbjct  327   VARPGVSMEEIQKRMVARLRHLGIKVRSIEEDEKCXIPMGGPLPVIPQRVVGIGGTAGMV  386

Query  525   HPSTGYMVARTLAAAPVVANAIIQYLGSERSLLGNELSASVWKDLWPIERRRQREFFCFG  346
             HPSTGYMVARTLAAAPV+A++I++ L S   L G ELS  VWKDLWP++RRRQREFFCFG
Sbjct  387   HPSTGYMVARTLAAAPVLASSIVKCLNSGNRLHGEELSTEVWKDLWPMDRRRQREFFCFG  446

Query  345   MDILLKLDLPATRRFFDAFFDLEPRYWHGFLSSRLFLRELIFFGLSLFSHASNTSRLEIM  166
             MDILLKLDL  TRRFF+AFFDLEP +W GFLSSRLFL +LIFFGL+LF+HASNTSRLEIM
Sbjct  447   MDILLKLDLKGTRRFFNAFFDLEPYHWQGFLSSRLFLPDLIFFGLALFAHASNTSRLEIM  506

Query  165   TKGTLPLVNMINNLLQD  115
              KGTLPLV MINNL+ D
Sbjct  507   AKGTLPLVKMINNLVAD  523



>dbj|BAE43558.1| putative lycopene beta cyclase [Taxodium distichum var. imbricatum]
Length=525

 Score =   719 bits (1855),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 363/497 (73%), Positives = 423/497 (85%), Gaps = 6/497 (1%)
 Frame = -2

Query  1605  TLLKTPNELEFLHPHHGFAVKASAFTSLKPQKQEIRIGSWKACRNVGRVKASSSALLELV  1426
              +LKT  +L FL+       K S+ +S   + Q ++  + K C     V  ++S LLELV
Sbjct  33    NVLKT--QLNFLNTQLNLFPKISSVSSAISKLQLLQTRAKKTCX----VVRATSTLLELV  86

Query  1425  PVTKKENLDFELPMFEPSKGIvvdlavvgggpaglavaqqVSQAGLSVCSIDPSPKLIWP  1246
             P  KKENL+FELP +EPSK + +DL VVGGGPAGLAVAQQVS+AG+SVC IDP P+ IWP
Sbjct  87    PEAKKENLEFELPKYEPSKQLPMDLVVVGGGPAGLAVAQQVSEAGISVCCIDPCPESIWP  146

Query  1245  NNYGVWVDEFEAMDLLDCLDTTWSGAMVYIDDRTTKDLDRPYGRVNRKKLKSKMMQKCIT  1066
             NNYGVWVDEFEAMDLLDCLDTTWSGA+VY+DD+T K LDRPYGRVNR++LKSKMM+KCI 
Sbjct  147   NNYGVWVDEFEAMDLLDCLDTTWSGAVVYVDDKTKKFLDRPYGRVNRRQLKSKMMRKCIA  206

Query  1065  NGVKFHQAKVIKVIHEESKSMLICSDGVTIQATVVLDATGFSRCLVQYDKPYNPGYQVAY  886
             NGV+FH+AKV +V+HE SKSM++C+DGV +QA+VVLDATGFSRCLV+YDKPY+PGYQVAY
Sbjct  207   NGVQFHRAKVKQVVHEGSKSMVLCTDGVALQASVVLDATGFSRCLVEYDKPYDPGYQVAY  266

Query  885   GILAEVEEHPYDLNKMVFMDWRDSHLNSNLELKERNKRIPTFLYAMPFSSTRIFLEETSL  706
             GILAEV+EHP+D++KMVFMDWRD HL S  EL+  N  IPTFLYAMPFS+ RIFLEETSL
Sbjct  267   GILAEVDEHPFDVDKMVFMDWRDDHLISEPELRANNAEIPTFLYAMPFSANRIFLEETSL  326

Query  705   VARPGLDMKDIQERMVARLRHLGINVKSIEEDERCVIPMGGPLPVIPQRVVGIGGTAGMV  526
             VARPG+ M++IQ+RMVARLRHLGI V+SIEEDE+C IPMGGPLPVIPQRVVGIGGTAGMV
Sbjct  327   VARPGVSMEEIQKRMVARLRHLGIKVRSIEEDEKCYIPMGGPLPVIPQRVVGIGGTAGMV  386

Query  525   HPSTGYMVARTLAAAPVVANAIIQYLGSERSLLGNELSASVWKDLWPIERRRQREFFCFG  346
             HPSTGYMVARTLAAAPV+A++I++ L S   L G ELS  VWKDLWP++RRRQREFFCFG
Sbjct  387   HPSTGYMVARTLAAAPVLASSIVKCLNSGNRLHGEELSTEVWKDLWPMDRRRQREFFCFG  446

Query  345   MDILLKLDLPATRRFFDAFFDLEPRYWHGFLSSRLFLRELIFFGLSLFSHASNTSRLEIM  166
             MDILLKLDL  TRRFF+AFFDLEP +W GFLSSRLFL +LIFFGL+LF+HASNTSRLEIM
Sbjct  447   MDILLKLDLKGTRRFFNAFFDLEPYHWQGFLSSRLFLPDLIFFGLALFAHASNTSRLEIM  506

Query  165   TKGTLPLVNMINNLLQD  115
              KGTLPLV MINNL+ D
Sbjct  507   AKGTLPLVKMINNLVAD  523



>dbj|BAC82352.1| putative lycopene beta cyclase [Taxodium distichum]
 dbj|BAE43545.1| putative lycopene beta cyclase [Taxodium distichum var. distichum]
Length=525

 Score =   718 bits (1854),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 363/497 (73%), Positives = 423/497 (85%), Gaps = 6/497 (1%)
 Frame = -2

Query  1605  TLLKTPNELEFLHPHHGFAVKASAFTSLKPQKQEIRIGSWKACRNVGRVKASSSALLELV  1426
              +LKT  +L FL+       K S+ +S   + Q ++  + K C     V  ++S LLELV
Sbjct  33    NVLKT--QLNFLNTQLNLFPKISSVSSAISKLQLLQTRAKKTCM----VVRATSTLLELV  86

Query  1425  PVTKKENLDFELPMFEPSKGIvvdlavvgggpaglavaqqVSQAGLSVCSIDPSPKLIWP  1246
             P  KKENL+FELP +EPSK + +DL VVGGGPAGLAVAQQVS+AG+SVC IDP P+ IWP
Sbjct  87    PEAKKENLEFELPKYEPSKQLPMDLVVVGGGPAGLAVAQQVSEAGISVCCIDPCPESIWP  146

Query  1245  NNYGVWVDEFEAMDLLDCLDTTWSGAMVYIDDRTTKDLDRPYGRVNRKKLKSKMMQKCIT  1066
             NNYGVWVDEFEAMDLLDCLDTTWSGA+VY+DD+T K LDRPYGRVNR++LKSKMM+KCI 
Sbjct  147   NNYGVWVDEFEAMDLLDCLDTTWSGAVVYVDDKTKKFLDRPYGRVNRRQLKSKMMRKCIA  206

Query  1065  NGVKFHQAKVIKVIHEESKSMLICSDGVTIQATVVLDATGFSRCLVQYDKPYNPGYQVAY  886
             NGV+FH+AKV +V+HE SKSM++C+DGV +QA+VVLDATGFSRCLV+YDKPY+PGYQVAY
Sbjct  207   NGVQFHRAKVKQVVHEGSKSMVLCTDGVALQASVVLDATGFSRCLVEYDKPYDPGYQVAY  266

Query  885   GILAEVEEHPYDLNKMVFMDWRDSHLNSNLELKERNKRIPTFLYAMPFSSTRIFLEETSL  706
             GILAEV+EHP+D++KMVFMDWRD HL S  EL+  N  IPTFLYAMPFS+ RIFLEETSL
Sbjct  267   GILAEVDEHPFDVDKMVFMDWRDDHLISEPELRANNAEIPTFLYAMPFSANRIFLEETSL  326

Query  705   VARPGLDMKDIQERMVARLRHLGINVKSIEEDERCVIPMGGPLPVIPQRVVGIGGTAGMV  526
             VARPG+ M++IQ+RMVARLRHLGI V+SIEEDE+C IPMGGPLPVIPQRVVGIGGTAGMV
Sbjct  327   VARPGVSMEEIQKRMVARLRHLGIKVRSIEEDEKCYIPMGGPLPVIPQRVVGIGGTAGMV  386

Query  525   HPSTGYMVARTLAAAPVVANAIIQYLGSERSLLGNELSASVWKDLWPIERRRQREFFCFG  346
             HPSTGYMVARTLAAAPV+A++I++ L S   L G ELS  VWKDLWP++RRRQREFFCFG
Sbjct  387   HPSTGYMVARTLAAAPVLASSIVKCLNSGNRLHGEELSTEVWKDLWPMDRRRQREFFCFG  446

Query  345   MDILLKLDLPATRRFFDAFFDLEPRYWHGFLSSRLFLRELIFFGLSLFSHASNTSRLEIM  166
             MDILLKLDL  TRRFF+AFFDLEP +W GFLSSRLFL +LIFFGL+LF+HASNTSRLEIM
Sbjct  447   MDILLKLDLKGTRRFFNAFFDLEPYHWQGFLSSRLFLPDLIFFGLALFAHASNTSRLEIM  506

Query  165   TKGTLPLVNMINNLLQD  115
              KGTLPLV MINNL+ D
Sbjct  507   AKGTLPLVKMINNLVAD  523



>dbj|BAE43546.1| putative lycopene beta cyclase [Taxodium distichum var. distichum]
Length=525

 Score =   718 bits (1853),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 363/497 (73%), Positives = 423/497 (85%), Gaps = 6/497 (1%)
 Frame = -2

Query  1605  TLLKTPNELEFLHPHHGFAVKASAFTSLKPQKQEIRIGSWKACRNVGRVKASSSALLELV  1426
              +LKT  +L FL+       K S+ +S   + Q ++  + K C     V  ++S LLELV
Sbjct  33    NVLKT--QLNFLNTQLNLFPKISSVSSAISKLQLLQTRAKKTCM----VVRATSTLLELV  86

Query  1425  PVTKKENLDFELPMFEPSKGIvvdlavvgggpaglavaqqVSQAGLSVCSIDPSPKLIWP  1246
             P  KKENL+FELP +EPSK + +DL VVGGGPAGLAVAQQVS+AG+SVC IDP P+ IWP
Sbjct  87    PEAKKENLEFELPKYEPSKQLPMDLVVVGGGPAGLAVAQQVSEAGISVCCIDPCPESIWP  146

Query  1245  NNYGVWVDEFEAMDLLDCLDTTWSGAMVYIDDRTTKDLDRPYGRVNRKKLKSKMMQKCIT  1066
             NNYGVWVDEFEAMDLLDCLDTTWSGA+VY+DD+T K LDRPYGRVNR++LKSKMM+KCI 
Sbjct  147   NNYGVWVDEFEAMDLLDCLDTTWSGAVVYVDDKTKKFLDRPYGRVNRRQLKSKMMRKCIA  206

Query  1065  NGVKFHQAKVIKVIHEESKSMLICSDGVTIQATVVLDATGFSRCLVQYDKPYNPGYQVAY  886
             NGV+FH+AKV +V+HE SKSM++C+DGV +QA+VVLDATGFSRCLV+YDKPY+PGYQVAY
Sbjct  207   NGVQFHRAKVKQVVHEGSKSMVLCTDGVALQASVVLDATGFSRCLVEYDKPYDPGYQVAY  266

Query  885   GILAEVEEHPYDLNKMVFMDWRDSHLNSNLELKERNKRIPTFLYAMPFSSTRIFLEETSL  706
             GILAEV+EHP+D++KMVFMDWRD HL S  EL+  N  IPTFLYAMPFS+ RIFLEETSL
Sbjct  267   GILAEVDEHPFDVDKMVFMDWRDDHLISEPELRANNAEIPTFLYAMPFSAXRIFLEETSL  326

Query  705   VARPGLDMKDIQERMVARLRHLGINVKSIEEDERCVIPMGGPLPVIPQRVVGIGGTAGMV  526
             VARPG+ M++IQ+RMVARLRHLGI V+SIEEDE+C IPMGGPLPVIPQRVVGIGGTAGMV
Sbjct  327   VARPGVSMEEIQKRMVARLRHLGIKVRSIEEDEKCYIPMGGPLPVIPQRVVGIGGTAGMV  386

Query  525   HPSTGYMVARTLAAAPVVANAIIQYLGSERSLLGNELSASVWKDLWPIERRRQREFFCFG  346
             HPSTGYMVARTLAAAPV+A++I++ L S   L G ELS  VWKDLWP++RRRQREFFCFG
Sbjct  387   HPSTGYMVARTLAAAPVLASSIVKCLNSGNRLHGEELSTEVWKDLWPMDRRRQREFFCFG  446

Query  345   MDILLKLDLPATRRFFDAFFDLEPRYWHGFLSSRLFLRELIFFGLSLFSHASNTSRLEIM  166
             MDILLKLDL  TRRFF+AFFDLEP +W GFLSSRLFL +LIFFGL+LF+HASNTSRLEIM
Sbjct  447   MDILLKLDLKXTRRFFNAFFDLEPYHWQGFLSSRLFLPDLIFFGLALFAHASNTSRLEIM  506

Query  165   TKGTLPLVNMINNLLQD  115
              KGTLPLV MINNL+ D
Sbjct  507   AKGTLPLVKMINNLVAD  523



>dbj|BAE43557.1| putative lycopene beta cyclase [Taxodium distichum var. imbricatum]
Length=525

 Score =   718 bits (1853),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 363/497 (73%), Positives = 423/497 (85%), Gaps = 6/497 (1%)
 Frame = -2

Query  1605  TLLKTPNELEFLHPHHGFAVKASAFTSLKPQKQEIRIGSWKACRNVGRVKASSSALLELV  1426
              +LKT  +L FL+       K S+ +S   + Q ++  + K C     V  ++S LLELV
Sbjct  33    NVLKT--QLNFLNTQLNLFPKISSVSSAISKLQLLQXRAKKTCM----VVRATSTLLELV  86

Query  1425  PVTKKENLDFELPMFEPSKGIvvdlavvgggpaglavaqqVSQAGLSVCSIDPSPKLIWP  1246
             P  KKENL+FELP +EPSK + +DL VVGGGPAGLAVAQQVS+AG+SVC IDP P+ IWP
Sbjct  87    PEAKKENLEFELPKYEPSKQLPMDLVVVGGGPAGLAVAQQVSEAGISVCCIDPCPESIWP  146

Query  1245  NNYGVWVDEFEAMDLLDCLDTTWSGAMVYIDDRTTKDLDRPYGRVNRKKLKSKMMQKCIT  1066
             NNYGVWVDEFEAMDLLDCLDTTWSGA+VY+DD+T K LDRPYGRVNR++LKSKMM+KCI 
Sbjct  147   NNYGVWVDEFEAMDLLDCLDTTWSGAVVYVDDKTKKFLDRPYGRVNRRQLKSKMMRKCIA  206

Query  1065  NGVKFHQAKVIKVIHEESKSMLICSDGVTIQATVVLDATGFSRCLVQYDKPYNPGYQVAY  886
             NGV+FH+AKV +V+HE SKSM++C+DGV +QA+VVLDATGFSRCLV+YDKPY+PGYQVAY
Sbjct  207   NGVQFHRAKVKQVVHEGSKSMVLCTDGVALQASVVLDATGFSRCLVEYDKPYDPGYQVAY  266

Query  885   GILAEVEEHPYDLNKMVFMDWRDSHLNSNLELKERNKRIPTFLYAMPFSSTRIFLEETSL  706
             GILAEV+EHP+D++KMVFMDWRD HL S  EL+  N  IPTFLYAMPFS+ RIFLEETSL
Sbjct  267   GILAEVDEHPFDVDKMVFMDWRDDHLISEPELRANNAEIPTFLYAMPFSANRIFLEETSL  326

Query  705   VARPGLDMKDIQERMVARLRHLGINVKSIEEDERCVIPMGGPLPVIPQRVVGIGGTAGMV  526
             VARPG+ M++IQ+RMVARLRHLGI V+SIEEDE+C IPMGGPLPVIPQRVVGIGGTAGMV
Sbjct  327   VARPGVSMEEIQKRMVARLRHLGIKVRSIEEDEKCYIPMGGPLPVIPQRVVGIGGTAGMV  386

Query  525   HPSTGYMVARTLAAAPVVANAIIQYLGSERSLLGNELSASVWKDLWPIERRRQREFFCFG  346
             HPSTGYMVARTLAAAPV+A++I++ L S   L G ELS  VWKDLWP++RRRQREFFCFG
Sbjct  387   HPSTGYMVARTLAAAPVLASSIVKCLNSGNRLHGEELSTEVWKDLWPMDRRRQREFFCFG  446

Query  345   MDILLKLDLPATRRFFDAFFDLEPRYWHGFLSSRLFLRELIFFGLSLFSHASNTSRLEIM  166
             MDILLKLDL  TRRFF+AFFDLEP +W GFLSSRLFL +LIFFGL+LF+HASNTSRLEIM
Sbjct  447   MDILLKLDLKGTRRFFNAFFDLEPYHWQGFLSSRLFLPDLIFFGLALFAHASNTSRLEIM  506

Query  165   TKGTLPLVNMINNLLQD  115
              KGTLPLV MINNL+ D
Sbjct  507   AKGTLPLVKMINNLVAD  523



>dbj|BAE43525.1| putative lycopene beta cyclase [Cryptomeria japonica]
 dbj|BAE43528.1| putative lycopene beta cyclase [Cryptomeria japonica]
Length=525

 Score =   717 bits (1852),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 362/497 (73%), Positives = 423/497 (85%), Gaps = 6/497 (1%)
 Frame = -2

Query  1605  TLLKTPNELEFLHPHHGFAVKASAFTSLKPQKQEIRIGSWKACRNVGRVKASSSALLELV  1426
              +LKT  +L FL+       K S+ +S     Q ++  + K C     V  ++S LLELV
Sbjct  33    NVLKT--QLNFLNTQLNLFPKISSVSSAISNLQLVQTRAKKTCM----VVRATSTLLELV  86

Query  1425  PVTKKENLDFELPMFEPSKGIvvdlavvgggpaglavaqqVSQAGLSVCSIDPSPKLIWP  1246
             P  KKE+L+ ELP +EPSK + +DL VVGGGPAGLAVAQQVS+AG+SVC IDP P+ IWP
Sbjct  87    PEAKKESLEIELPKYEPSKQLPMDLVVVGGGPAGLAVAQQVSEAGISVCCIDPCPESIWP  146

Query  1245  NNYGVWVDEFEAMDLLDCLDTTWSGAMVYIDDRTTKDLDRPYGRVNRKKLKSKMMQKCIT  1066
             NNYGVWVDEFEAMDLLDCLDTTWSGA+VY+DD+T K LDRPYGRVNR++LKSKMM+KCI 
Sbjct  147   NNYGVWVDEFEAMDLLDCLDTTWSGAVVYVDDKTKKFLDRPYGRVNRRQLKSKMMRKCIA  206

Query  1065  NGVKFHQAKVIKVIHEESKSMLICSDGVTIQATVVLDATGFSRCLVQYDKPYNPGYQVAY  886
             NGV+FH+AKV +V+HE SKSM++C+DGV +QA+VVLDATGFSRCLV+YDKPY+PGYQVAY
Sbjct  207   NGVQFHRAKVKQVVHEGSKSMVLCTDGVALQASVVLDATGFSRCLVEYDKPYDPGYQVAY  266

Query  885   GILAEVEEHPYDLNKMVFMDWRDSHLNSNLELKERNKRIPTFLYAMPFSSTRIFLEETSL  706
             GILAEV+EHP+D++KMVFMDWRD  L +  ELK  N +IPTFLYAMPFS+ RIFLEETSL
Sbjct  267   GILAEVDEHPFDVDKMVFMDWRDDXLINEPELKANNAKIPTFLYAMPFSANRIFLEETSL  326

Query  705   VARPGLDMKDIQERMVARLRHLGINVKSIEEDERCVIPMGGPLPVIPQRVVGIGGTAGMV  526
             VARPG+ M++IQ+RMVARLRHLGI V+SIEEDE+C IPMGGPLPVIPQRVVGIGGTAGMV
Sbjct  327   VARPGVSMEEIQKRMVARLRHLGIKVRSIEEDEKCYIPMGGPLPVIPQRVVGIGGTAGMV  386

Query  525   HPSTGYMVARTLAAAPVVANAIIQYLGSERSLLGNELSASVWKDLWPIERRRQREFFCFG  346
             HPSTGYMVARTLAAAPV+A++I++YL SE  L G ELS  VWKDLWP++RRRQREFFCFG
Sbjct  387   HPSTGYMVARTLAAAPVLASSIVKYLNSENRLHGEELSTEVWKDLWPMDRRRQREFFCFG  446

Query  345   MDILLKLDLPATRRFFDAFFDLEPRYWHGFLSSRLFLRELIFFGLSLFSHASNTSRLEIM  166
             MDILLKLDL  TRRFF+AFFDLEP +W GFLSSRLFL +LIFFGL+LF+HASNTSRLEIM
Sbjct  447   MDILLKLDLKGTRRFFNAFFDLEPYHWQGFLSSRLFLPDLIFFGLALFAHASNTSRLEIM  506

Query  165   TKGTLPLVNMINNLLQD  115
              KGTLPLV MINNL+ D
Sbjct  507   AKGTLPLVKMINNLVAD  523



>dbj|BAD02731.1| putative lycopene beta cyclase [Cryptomeria japonica]
 dbj|BAD02733.1| putative lycopene beta cyclase [Cryptomeria japonica]
 dbj|BAD02734.1| putative lycopene beta cyclase [Cryptomeria japonica]
 dbj|BAD02735.1| putative lycopene beta cyclase [Cryptomeria japonica]
 dbj|BAD02738.1| putative lycopene beta cyclase [Cryptomeria japonica]
 dbj|BAD02741.1| putative lycopene beta cyclase [Cryptomeria japonica]
 dbj|BAD02743.1| putative lycopene beta cyclase [Cryptomeria japonica]
 dbj|BAD02744.1| putative lycopene beta cyclase [Cryptomeria japonica]
 dbj|BAD02750.1| putative lycopene beta cyclase [Cryptomeria japonica]
 dbj|BAD02752.1| putative lycopene beta cyclase [Cryptomeria japonica]
 dbj|BAD02753.1| putative lycopene beta cyclase [Cryptomeria japonica]
 dbj|BAD02757.1| putative lycopene beta cyclase [Cryptomeria japonica]
 dbj|BAD02769.1| putative lycopene beta cyclase [Cryptomeria japonica]
 dbj|BAE43531.1| putative lycopene beta cyclase [Cryptomeria japonica]
 dbj|BAE43535.1| putative lycopene beta cyclase [Cryptomeria japonica]
Length=525

 Score =   717 bits (1852),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 362/497 (73%), Positives = 423/497 (85%), Gaps = 6/497 (1%)
 Frame = -2

Query  1605  TLLKTPNELEFLHPHHGFAVKASAFTSLKPQKQEIRIGSWKACRNVGRVKASSSALLELV  1426
              +LKT  +L FL+       K S+ +S     Q ++  + K C     V  ++S LLELV
Sbjct  33    NVLKT--QLNFLNTQLNLFPKISSVSSAISNLQLVQTRAKKTCM----VVRATSTLLELV  86

Query  1425  PVTKKENLDFELPMFEPSKGIvvdlavvgggpaglavaqqVSQAGLSVCSIDPSPKLIWP  1246
             P  KKE+L+ ELP +EPSK + +DL VVGGGPAGLAVAQQVS+AG+SVC IDP P+ IWP
Sbjct  87    PEAKKESLEIELPKYEPSKQLPMDLVVVGGGPAGLAVAQQVSEAGISVCCIDPCPESIWP  146

Query  1245  NNYGVWVDEFEAMDLLDCLDTTWSGAMVYIDDRTTKDLDRPYGRVNRKKLKSKMMQKCIT  1066
             NNYGVWVDEFEAMDLLDCLDTTWSGA+VY+DD+T K LDRPYGRVNR++LKSKMM+KCI 
Sbjct  147   NNYGVWVDEFEAMDLLDCLDTTWSGAVVYVDDKTKKFLDRPYGRVNRRQLKSKMMRKCIA  206

Query  1065  NGVKFHQAKVIKVIHEESKSMLICSDGVTIQATVVLDATGFSRCLVQYDKPYNPGYQVAY  886
             NGV+FH+AKV +V+HE SKSM++C+DGV +QA+VVLDATGFSRCLV+YDKPY+PGYQVAY
Sbjct  207   NGVQFHRAKVKQVVHEGSKSMVLCTDGVALQASVVLDATGFSRCLVEYDKPYDPGYQVAY  266

Query  885   GILAEVEEHPYDLNKMVFMDWRDSHLNSNLELKERNKRIPTFLYAMPFSSTRIFLEETSL  706
             GILAEV+EHP+D++KMVFMDWRD  L +  ELK  N +IPTFLYAMPFS+ RIFLEETSL
Sbjct  267   GILAEVDEHPFDVDKMVFMDWRDDDLINEPELKANNAKIPTFLYAMPFSANRIFLEETSL  326

Query  705   VARPGLDMKDIQERMVARLRHLGINVKSIEEDERCVIPMGGPLPVIPQRVVGIGGTAGMV  526
             VARPG+ M++IQ+RMVARLRHLGI V+SIEEDE+C IPMGGPLPVIPQRVVGIGGTAGMV
Sbjct  327   VARPGVSMEEIQKRMVARLRHLGIKVRSIEEDEKCYIPMGGPLPVIPQRVVGIGGTAGMV  386

Query  525   HPSTGYMVARTLAAAPVVANAIIQYLGSERSLLGNELSASVWKDLWPIERRRQREFFCFG  346
             HPSTGYMVARTLAAAPV+A++I++YL SE  L G ELS  VWKDLWP++RRRQREFFCFG
Sbjct  387   HPSTGYMVARTLAAAPVLASSIVKYLNSENRLHGEELSTEVWKDLWPMDRRRQREFFCFG  446

Query  345   MDILLKLDLPATRRFFDAFFDLEPRYWHGFLSSRLFLRELIFFGLSLFSHASNTSRLEIM  166
             MDILLKLDL  TRRFF+AFFDLEP +W GFLSSRLFL +LIFFGL+LF+HASNTSRLEIM
Sbjct  447   MDILLKLDLKGTRRFFNAFFDLEPYHWQGFLSSRLFLPDLIFFGLALFAHASNTSRLEIM  506

Query  165   TKGTLPLVNMINNLLQD  115
              KGTLPLV MINNL+ D
Sbjct  507   AKGTLPLVKMINNLVAD  523



>dbj|BAE43537.1| putative lycopene beta cyclase [Cryptomeria japonica]
Length=525

 Score =   717 bits (1851),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 362/497 (73%), Positives = 422/497 (85%), Gaps = 6/497 (1%)
 Frame = -2

Query  1605  TLLKTPNELEFLHPHHGFAVKASAFTSLKPQKQEIRIGSWKACRNVGRVKASSSALLELV  1426
              +LKT  +L FL+       K S+  S     Q ++  + K C     V  ++S LLELV
Sbjct  33    NVLKT--QLNFLNTQLNLFPKISSVXSAISNLQLVQTRAKKTCM----VVRATSTLLELV  86

Query  1425  PVTKKENLDFELPMFEPSKGIvvdlavvgggpaglavaqqVSQAGLSVCSIDPSPKLIWP  1246
             P  KKE+L+ ELP +EPSK + +DL VVGGGPAGLAVAQQVS+AG+SVC IDP P+ IWP
Sbjct  87    PEAKKESLEIELPXYEPSKQLPMDLVVVGGGPAGLAVAQQVSEAGISVCCIDPCPESIWP  146

Query  1245  NNYGVWVDEFEAMDLLDCLDTTWSGAMVYIDDRTTKDLDRPYGRVNRKKLKSKMMQKCIT  1066
             NNYGVWVDEFEAMDLLDCLDTTWSGA+VY+DD+T K LDRPYGRVNR++LKSKMM+KCI 
Sbjct  147   NNYGVWVDEFEAMDLLDCLDTTWSGAVVYVDDKTKKFLDRPYGRVNRRQLKSKMMRKCIA  206

Query  1065  NGVKFHQAKVIKVIHEESKSMLICSDGVTIQATVVLDATGFSRCLVQYDKPYNPGYQVAY  886
             NGV+FH+AKV +V+HE SKSM++C+DGV +QA+VVLDATGFSRCLV+YDKPY+PGYQVAY
Sbjct  207   NGVQFHRAKVKQVVHEGSKSMVLCTDGVALQASVVLDATGFSRCLVEYDKPYDPGYQVAY  266

Query  885   GILAEVEEHPYDLNKMVFMDWRDSHLNSNLELKERNKRIPTFLYAMPFSSTRIFLEETSL  706
             GILAEV+EHP+D++KMVFMDWRD  L +  ELK  N +IPTFLYAMPFS+ RIFLEETSL
Sbjct  267   GILAEVDEHPFDVDKMVFMDWRDDXLINEPELKANNAKIPTFLYAMPFSANRIFLEETSL  326

Query  705   VARPGLDMKDIQERMVARLRHLGINVKSIEEDERCVIPMGGPLPVIPQRVVGIGGTAGMV  526
             VARPG+ M++IQ+RMVARLRHLGI V+SIEEDE+C IPMGGPLPVIPQRVVGIGGTAGMV
Sbjct  327   VARPGVSMEEIQKRMVARLRHLGIKVRSIEEDEKCYIPMGGPLPVIPQRVVGIGGTAGMV  386

Query  525   HPSTGYMVARTLAAAPVVANAIIQYLGSERSLLGNELSASVWKDLWPIERRRQREFFCFG  346
             HPSTGYMVARTLAAAPV+A++I++YL SE  L G ELS  VWKDLWP++RRRQREFFCFG
Sbjct  387   HPSTGYMVARTLAAAPVLASSIVKYLNSENRLHGEELSTEVWKDLWPMDRRRQREFFCFG  446

Query  345   MDILLKLDLPATRRFFDAFFDLEPRYWHGFLSSRLFLRELIFFGLSLFSHASNTSRLEIM  166
             MDILLKLDL  TRRFF+AFFDLEP +W GFLSSRLFL +LIFFGL+LF+HASNTSRLEIM
Sbjct  447   MDILLKLDLKGTRRFFNAFFDLEPYHWQGFLSSRLFLPDLIFFGLALFAHASNTSRLEIM  506

Query  165   TKGTLPLVNMINNLLQD  115
              KGTLPLV MINNL+ D
Sbjct  507   AKGTLPLVKMINNLVAD  523



>gb|AAM45381.1| beta cyclase [Tagetes erecta]
Length=430

 Score =   713 bits (1841),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 351/428 (82%), Positives = 396/428 (93%), Gaps = 4/428 (1%)
 Frame = -2

Query  1386  MFEPSKGIvvdlavvgggpaglavaqqVSQAGLSVCSIDPSPKLIWPNNYGVWVDEFEAM  1207
             M++PS+ +VVDL VVGGGP+GLAVAQQVS+AGL+VCSIDPSPKLIWPNNYGVWVDEFEAM
Sbjct  1     MYDPSRNVVVDLVVVGGGPSGLAVAQQVSEAGLTVCSIDPSPKLIWPNNYGVWVDEFEAM  60

Query  1206  DLLDCLDTTWSGAMVYIDDRTTKDLDRPYGRVNRKKLKSKMMQKCITNGVKFHQAKVIKV  1027
             DLLDCLDTTWS A+VYID+++TK L+RPY RVNRK+LK+KM+QKCI NGVKFHQAKVIKV
Sbjct  61    DLLDCLDTTWSSAVVYIDEKSTKSLNRPYARVNRKQLKTKMLQKCIANGVKFHQAKVIKV  120

Query  1026  IHEESKSMLICSDGVTIQATVVLDATGFSRCLVQYDKPYNPGYQVAYGILAEVEEHPYDL  847
             IHEE KS+LIC+DGVTIQAT+VLDATGFSR LVQYDKPYNPGYQVAYGILAEVEEHP+D+
Sbjct  121   IHEELKSLLICNDGVTIQATLVLDATGFSRSLVQYDKPYNPGYQVAYGILAEVEEHPFDV  180

Query  846   NKMVFMDWRDSHLNSNLELKERNKRIPTFLYAMPFSSTRIFLEETSLVARPGLDMKDIQE  667
             +KM+FMDWRDSHL+ NLE+K RN RIPTFLYAMPFSSTRIFLEETSLVARPGL M+DIQE
Sbjct  181   DKMLFMDWRDSHLDQNLEIKARNSRIPTFLYAMPFSSTRIFLEETSLVARPGLKMEDIQE  240

Query  666   RMVARLRHLGINVKSIEEDERCVIPMGGPLPVIPQRVVGIGGTAGMVHPSTGYMVARTLA  487
             RM  RL+HLGI VKSIEEDERCVIPMGGPLPV+PQRV+GIGGTAGMVHPSTGYMVARTLA
Sbjct  241   RMAYRLKHLGIKVKSIEEDERCVIPMGGPLPVLPQRVLGIGGTAGMVHPSTGYMVARTLA  300

Query  486   AAPVVANAIIQYLGSERSLL----GNELSASVWKDLWPIERRRQREFFCFGMDILLKLDL  319
             AAP+VA +II+YL +E+S++    G++L+A +W++LWPIERRRQREFFCFGMDILLKLDL
Sbjct  301   AAPIVAKSIIRYLNNEKSMVADVTGDDLAAGIWRELWPIERRRQREFFCFGMDILLKLDL  360

Query  318   PATRRFFDAFFDLEPRYWHGFLSSRLFLRELIFFGLSLFSHASNTSRLEIMTKGTLPLVN  139
               TRRFFDAFFDLEPRYWHGFLSSRLFL EL+ FGLSLF HASNT R+EIM KGTLPL  
Sbjct  361   EGTRRFFDAFFDLEPRYWHGFLSSRLFLPELVTFGLSLFGHASNTCRVEIMAKGTLPLAT  420

Query  138   MINNLLQD  115
             MI NL++D
Sbjct  421   MIGNLVRD  428



>dbj|BAE43553.2| putative lycopene beta cyclase [Taxodium distichum var. imbricatum]
Length=525

 Score =   717 bits (1850),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 362/497 (73%), Positives = 423/497 (85%), Gaps = 6/497 (1%)
 Frame = -2

Query  1605  TLLKTPNELEFLHPHHGFAVKASAFTSLKPQKQEIRIGSWKACRNVGRVKASSSALLELV  1426
              +LKT  +L FL+       K S+ +S   + Q ++  + K C     V  ++S LLELV
Sbjct  33    NVLKT--QLNFLNTQLNLFPKISSVSSAISKLQJLQTRAKKTCM----VVRATSTLLELV  86

Query  1425  PVTKKENLDFELPMFEPSKGIvvdlavvgggpaglavaqqVSQAGLSVCSIDPSPKLIWP  1246
             P  KKENL+FELP +EPSK + +DL VVGGGPAGLAVAQQVS+AG+SVC IDP P+ IWP
Sbjct  87    PEAKKENLEFELPKYEPSKQLPMDLVVVGGGPAGLAVAQQVSEAGISVCCIDPCPESIWP  146

Query  1245  NNYGVWVDEFEAMDLLDCLDTTWSGAMVYIDDRTTKDLDRPYGRVNRKKLKSKMMQKCIT  1066
             NNYGVWVDEFEAMDLLDCLDTTWSGA+VY+DD+T K LDRPYGRVNR++LKSKMM+KCI 
Sbjct  147   NNYGVWVDEFEAMDLLDCLDTTWSGAVVYVDDKTKKFLDRPYGRVNRRQLKSKMMRKCIA  206

Query  1065  NGVKFHQAKVIKVIHEESKSMLICSDGVTIQATVVLDATGFSRCLVQYDKPYNPGYQVAY  886
             NGV+FH+AKV +V+HE SKSM++C+DGV +QA+VVLDATGFSRCLV+YDKPY+PGYQVAY
Sbjct  207   NGVQFHRAKVKQVVHEGSKSMVLCTDGVALQASVVLDATGFSRCLVEYDKPYDPGYQVAY  266

Query  885   GILAEVEEHPYDLNKMVFMDWRDSHLNSNLELKERNKRIPTFLYAMPFSSTRIFLEETSL  706
             GILAEV+EHP+D++KMVFMDWRD HL S  EL+  N  IPTFLYAMPFS+ RIFLEETSL
Sbjct  267   GILAEVDEHPFDVDKMVFMDWRDDHLISEPELRANNAEIPTFLYAMPFSANRIFLEETSL  326

Query  705   VARPGLDMKDIQERMVARLRHLGINVKSIEEDERCVIPMGGPLPVIPQRVVGIGGTAGMV  526
             VARPG+ M++IQ+RMVARLRHLGI V+SIEEDE+C IPMGGPLPVIPQRVVGIGGTAGMV
Sbjct  327   VARPGVSMEEIQKRMVARLRHLGIKVRSIEEDEKCYIPMGGPLPVIPQRVVGIGGTAGMV  386

Query  525   HPSTGYMVARTLAAAPVVANAIIQYLGSERSLLGNELSASVWKDLWPIERRRQREFFCFG  346
             HPSTGYMVARTLAAAPV+A++I++ L S   L G ELS  VWKDLWP++RRRQREFFCFG
Sbjct  387   HPSTGYMVARTLAAAPVLASSIVKCLNSGNRLHGEELSTEVWKDLWPMDRRRQREFFCFG  446

Query  345   MDILLKLDLPATRRFFDAFFDLEPRYWHGFLSSRLFLRELIFFGLSLFSHASNTSRLEIM  166
             MDILLKLDL  TRRFF+AFFDLEP +W GFLSSRLFL +LIFFGL+LF+HASNTSRLEIM
Sbjct  447   MDILLKLDLKGTRRFFNAFFDLEPYHWQGFLSSRLFLPDLIFFGLALFAHASNTSRLEIM  506

Query  165   TKGTLPLVNMINNLLQD  115
              KGTLPL+ MINNL+ D
Sbjct  507   AKGTLPLMKMINNLVAD  523



>dbj|BAE43513.1| putative lycopene beta cyclase [Cryptomeria japonica]
 dbj|BAE43516.1| putative lycopene beta cyclase [Cryptomeria japonica]
 dbj|BAE43518.1| putative lycopene beta cyclase [Cryptomeria japonica]
 dbj|BAE43520.1| putative lycopene beta cyclase [Cryptomeria japonica]
 dbj|BAE43523.1| putative lycopene beta cyclase [Cryptomeria japonica]
 dbj|BAE43524.1| putative lycopene beta cyclase [Cryptomeria japonica]
 dbj|BAE43529.1| putative lycopene beta cyclase [Cryptomeria japonica]
 dbj|BAE43530.1| putative lycopene beta cyclase [Cryptomeria japonica]
 dbj|BAE43532.1| putative lycopene beta cyclase [Cryptomeria japonica]
 dbj|BAE43534.1| putative lycopene beta cyclase [Cryptomeria japonica]
Length=525

 Score =   717 bits (1850),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 362/497 (73%), Positives = 422/497 (85%), Gaps = 6/497 (1%)
 Frame = -2

Query  1605  TLLKTPNELEFLHPHHGFAVKASAFTSLKPQKQEIRIGSWKACRNVGRVKASSSALLELV  1426
              +LKT  +L FL+       K S+  S     Q ++  + K C     V  ++S LLELV
Sbjct  33    NVLKT--QLNFLNTQLNLFPKISSVXSAISNLQLVQTRAKKTCM----VVRATSTLLELV  86

Query  1425  PVTKKENLDFELPMFEPSKGIvvdlavvgggpaglavaqqVSQAGLSVCSIDPSPKLIWP  1246
             P  KKE+L+ ELP +EPSK + +DL VVGGGPAGLAVAQQVS+AG+SVC IDP P+ IWP
Sbjct  87    PEAKKESLEIELPKYEPSKQLPMDLVVVGGGPAGLAVAQQVSEAGISVCCIDPCPESIWP  146

Query  1245  NNYGVWVDEFEAMDLLDCLDTTWSGAMVYIDDRTTKDLDRPYGRVNRKKLKSKMMQKCIT  1066
             NNYGVWVDEFEAMDLLDCLDTTWSGA+VY+DD+T K LDRPYGRVNR++LKSKMM+KCI 
Sbjct  147   NNYGVWVDEFEAMDLLDCLDTTWSGAVVYVDDKTKKFLDRPYGRVNRRQLKSKMMRKCIA  206

Query  1065  NGVKFHQAKVIKVIHEESKSMLICSDGVTIQATVVLDATGFSRCLVQYDKPYNPGYQVAY  886
             NGV+FH+AKV +V+HE SKSM++C+DGV +QA+VVLDATGFSRCLV+YDKPY+PGYQVAY
Sbjct  207   NGVQFHRAKVKQVVHEGSKSMVLCTDGVALQASVVLDATGFSRCLVEYDKPYDPGYQVAY  266

Query  885   GILAEVEEHPYDLNKMVFMDWRDSHLNSNLELKERNKRIPTFLYAMPFSSTRIFLEETSL  706
             GILAEV+EHP+D++KMVFMDWRD  L +  ELK  N +IPTFLYAMPFS+ RIFLEETSL
Sbjct  267   GILAEVDEHPFDVDKMVFMDWRDDXLINEPELKANNAKIPTFLYAMPFSANRIFLEETSL  326

Query  705   VARPGLDMKDIQERMVARLRHLGINVKSIEEDERCVIPMGGPLPVIPQRVVGIGGTAGMV  526
             VARPG+ M++IQ+RMVARLRHLGI V+SIEEDE+C IPMGGPLPVIPQRVVGIGGTAGMV
Sbjct  327   VARPGVSMEEIQKRMVARLRHLGIKVRSIEEDEKCYIPMGGPLPVIPQRVVGIGGTAGMV  386

Query  525   HPSTGYMVARTLAAAPVVANAIIQYLGSERSLLGNELSASVWKDLWPIERRRQREFFCFG  346
             HPSTGYMVARTLAAAPV+A++I++YL SE  L G ELS  VWKDLWP++RRRQREFFCFG
Sbjct  387   HPSTGYMVARTLAAAPVLASSIVKYLNSENRLHGEELSTEVWKDLWPMDRRRQREFFCFG  446

Query  345   MDILLKLDLPATRRFFDAFFDLEPRYWHGFLSSRLFLRELIFFGLSLFSHASNTSRLEIM  166
             MDILLKLDL  TRRFF+AFFDLEP +W GFLSSRLFL +LIFFGL+LF+HASNTSRLEIM
Sbjct  447   MDILLKLDLKGTRRFFNAFFDLEPYHWQGFLSSRLFLPDLIFFGLALFAHASNTSRLEIM  506

Query  165   TKGTLPLVNMINNLLQD  115
              KGTLPLV MINNL+ D
Sbjct  507   AKGTLPLVKMINNLVAD  523



>dbj|BAE43536.1| putative lycopene beta cyclase [Cryptomeria japonica]
 dbj|BAE43539.1| putative lycopene beta cyclase [Cryptomeria japonica]
 dbj|BAE43540.1| putative lycopene beta cyclase [Cryptomeria japonica]
Length=525

 Score =   717 bits (1850),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 362/497 (73%), Positives = 422/497 (85%), Gaps = 6/497 (1%)
 Frame = -2

Query  1605  TLLKTPNELEFLHPHHGFAVKASAFTSLKPQKQEIRIGSWKACRNVGRVKASSSALLELV  1426
              +LKT  +L FL+       K S+  S     Q ++  + K C     V  ++S LLELV
Sbjct  33    NVLKT--QLNFLNTQLNLFPKISSVXSAISNLQLVQTRAKKTCM----VVRATSTLLELV  86

Query  1425  PVTKKENLDFELPMFEPSKGIvvdlavvgggpaglavaqqVSQAGLSVCSIDPSPKLIWP  1246
             P  KKE+L+ ELP +EPSK + +DL VVGGGPAGLAVAQQVS+AG+SVC IDP P+ IWP
Sbjct  87    PEAKKESLEIELPKYEPSKQLPMDLVVVGGGPAGLAVAQQVSEAGISVCCIDPCPESIWP  146

Query  1245  NNYGVWVDEFEAMDLLDCLDTTWSGAMVYIDDRTTKDLDRPYGRVNRKKLKSKMMQKCIT  1066
             NNYGVWVDEFEAMDLLDCLDTTWSGA+VY+DD+T K LDRPYGRVNR++LKSKMM+KCI 
Sbjct  147   NNYGVWVDEFEAMDLLDCLDTTWSGAVVYVDDKTKKFLDRPYGRVNRRQLKSKMMRKCIA  206

Query  1065  NGVKFHQAKVIKVIHEESKSMLICSDGVTIQATVVLDATGFSRCLVQYDKPYNPGYQVAY  886
             NGV+FH+AKV +V+HE SKSM++C+DGV +QA+VVLDATGFSRCLV+YDKPY+PGYQVAY
Sbjct  207   NGVQFHRAKVKQVVHEGSKSMVLCTDGVALQASVVLDATGFSRCLVEYDKPYDPGYQVAY  266

Query  885   GILAEVEEHPYDLNKMVFMDWRDSHLNSNLELKERNKRIPTFLYAMPFSSTRIFLEETSL  706
             GILAEV+EHP+D++KMVFMDWRD  L +  ELK  N +IPTFLYAMPFS+ RIFLEETSL
Sbjct  267   GILAEVDEHPFDVDKMVFMDWRDDXLINEPELKANNAKIPTFLYAMPFSANRIFLEETSL  326

Query  705   VARPGLDMKDIQERMVARLRHLGINVKSIEEDERCVIPMGGPLPVIPQRVVGIGGTAGMV  526
             VARPG+ M++IQ+RMVARLRHLGI V+SIEEDE+C IPMGGPLPVIPQRVVGIGGTAGMV
Sbjct  327   VARPGVSMEEIQKRMVARLRHLGIKVRSIEEDEKCYIPMGGPLPVIPQRVVGIGGTAGMV  386

Query  525   HPSTGYMVARTLAAAPVVANAIIQYLGSERSLLGNELSASVWKDLWPIERRRQREFFCFG  346
             HPSTGYMVARTLAAAPV+A++I++YL SE  L G ELS  VWKDLWP++RRRQREFFCFG
Sbjct  387   HPSTGYMVARTLAAAPVLASSIVKYLNSENRLHGEELSTEVWKDLWPMDRRRQREFFCFG  446

Query  345   MDILLKLDLPATRRFFDAFFDLEPRYWHGFLSSRLFLRELIFFGLSLFSHASNTSRLEIM  166
             MDILLKLDL  TRRFF+AFFDLEP +W GFLSSRLFL +LIFFGL+LF+HASNTSRLEIM
Sbjct  447   MDILLKLDLKGTRRFFNAFFDLEPYHWQGFLSSRLFLPDLIFFGLALFAHASNTSRLEIM  506

Query  165   TKGTLPLVNMINNLLQD  115
              KGTLPLV MINNL+ D
Sbjct  507   AKGTLPLVKMINNLVAD  523



>dbj|BAE43560.1| putative lycopene beta cyclase [Taxodium distichum var. imbricatum]
Length=525

 Score =   717 bits (1850),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 362/497 (73%), Positives = 423/497 (85%), Gaps = 6/497 (1%)
 Frame = -2

Query  1605  TLLKTPNELEFLHPHHGFAVKASAFTSLKPQKQEIRIGSWKACRNVGRVKASSSALLELV  1426
              +LKT  +L FL+       K S+ +S   + Q ++  + K C     V  ++S LLELV
Sbjct  33    NVLKT--QLNFLNTQLNLFPKISSVSSAISKLQLLQTRAKKTCM----VVRATSTLLELV  86

Query  1425  PVTKKENLDFELPMFEPSKGIvvdlavvgggpaglavaqqVSQAGLSVCSIDPSPKLIWP  1246
             P  KKENL+FELP +EPSK + +DL VVGGGPAGLAVAQQVS+AG+SVC IDP P+ IWP
Sbjct  87    PEAKKENLEFELPKYEPSKQLPMDLVVVGGGPAGLAVAQQVSEAGISVCCIDPCPESIWP  146

Query  1245  NNYGVWVDEFEAMDLLDCLDTTWSGAMVYIDDRTTKDLDRPYGRVNRKKLKSKMMQKCIT  1066
             NNYGVWVDEFEAMDLLDCLDTTWSGA+VY+DD+T K LDRPYGRVNR++LKSKMM+KCI 
Sbjct  147   NNYGVWVDEFEAMDLLDCLDTTWSGAVVYVDDKTKKFLDRPYGRVNRRQLKSKMMRKCIA  206

Query  1065  NGVKFHQAKVIKVIHEESKSMLICSDGVTIQATVVLDATGFSRCLVQYDKPYNPGYQVAY  886
             NGV+FH+AKV +V+HE SKSM++C+DGV +QA+VVLDATGFSRCLV+YDKPY+PGYQVAY
Sbjct  207   NGVQFHRAKVKQVVHEGSKSMVLCTDGVALQASVVLDATGFSRCLVEYDKPYDPGYQVAY  266

Query  885   GILAEVEEHPYDLNKMVFMDWRDSHLNSNLELKERNKRIPTFLYAMPFSSTRIFLEETSL  706
             GILAEV+EHP+D++KMVFMDWRD HL S  EL+  N  IPTFLYAMPFS+ RIFLEETSL
Sbjct  267   GILAEVDEHPFDVDKMVFMDWRDDHLISEPELRANNAEIPTFLYAMPFSANRIFLEETSL  326

Query  705   VARPGLDMKDIQERMVARLRHLGINVKSIEEDERCVIPMGGPLPVIPQRVVGIGGTAGMV  526
             VARPG+ M++IQ+RMVARLRHLGI V+SIEEDE+C IPMGGPLPVIPQRVVGIGGTAGMV
Sbjct  327   VARPGVSMEEIQKRMVARLRHLGIKVRSIEEDEKCYIPMGGPLPVIPQRVVGIGGTAGMV  386

Query  525   HPSTGYMVARTLAAAPVVANAIIQYLGSERSLLGNELSASVWKDLWPIERRRQREFFCFG  346
             HPSTGYMVARTLAAAPV+A++I++ L S   L G ELS  VWKDLWP++RRRQREFFCFG
Sbjct  387   HPSTGYMVARTLAAAPVLASSIVKCLNSGNRLHGEELSTEVWKDLWPMDRRRQREFFCFG  446

Query  345   MDILLKLDLPATRRFFDAFFDLEPRYWHGFLSSRLFLRELIFFGLSLFSHASNTSRLEIM  166
             MDILLKLDL  TRRFF+AFFDLEP +W GFLSSRLFL +LIFFGL+LF+HASNTSRLEIM
Sbjct  447   MDILLKLDLKGTRRFFNAFFDLEPYHWQGFLSSRLFLPDLIFFGLALFAHASNTSRLEIM  506

Query  165   TKGTLPLVNMINNLLQD  115
              KGTLPL+ MINNL+ D
Sbjct  507   AKGTLPLMKMINNLVAD  523



>dbj|BAE43556.1| putative lycopene beta cyclase [Taxodium distichum var. imbricatum]
Length=525

 Score =   716 bits (1849),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 362/497 (73%), Positives = 422/497 (85%), Gaps = 6/497 (1%)
 Frame = -2

Query  1605  TLLKTPNELEFLHPHHGFAVKASAFTSLKPQKQEIRIGSWKACRNVGRVKASSSALLELV  1426
              +LKT  +L FL+       K S+ +S   + Q ++  + K C     V  ++S LLELV
Sbjct  33    NVLKT--QLNFLNTQLNLFPKISSVSSAISKLQLLQTRAKKTCM----VVRATSTLLELV  86

Query  1425  PVTKKENLDFELPMFEPSKGIvvdlavvgggpaglavaqqVSQAGLSVCSIDPSPKLIWP  1246
             P  KKENL+FELP +EPSK + +DL VVGGGPAGLAVAQQVS+AG+SVC IDP P+ IWP
Sbjct  87    PEAKKENLEFELPKYEPSKQLPMDLVVVGGGPAGLAVAQQVSEAGISVCCIDPCPESIWP  146

Query  1245  NNYGVWVDEFEAMDLLDCLDTTWSGAMVYIDDRTTKDLDRPYGRVNRKKLKSKMMQKCIT  1066
             NNYGVWVDEFEAMDLLDCLDTTWSGA+VY+DD+T K LDRPYGRVNR++LKSKMM+KCI 
Sbjct  147   NNYGVWVDEFEAMDLLDCLDTTWSGAVVYVDDKTKKFLDRPYGRVNRRQLKSKMMRKCIA  206

Query  1065  NGVKFHQAKVIKVIHEESKSMLICSDGVTIQATVVLDATGFSRCLVQYDKPYNPGYQVAY  886
             NGV+FH+AKV +V+HE SKSM++C+DGV +QA+VVLDATGFSRCLV+YDKPY+PGYQVAY
Sbjct  207   NGVQFHRAKVKQVVHEGSKSMVLCTDGVALQASVVLDATGFSRCLVEYDKPYDPGYQVAY  266

Query  885   GILAEVEEHPYDLNKMVFMDWRDSHLNSNLELKERNKRIPTFLYAMPFSSTRIFLEETSL  706
             GILAEV+EHP+D++KMVFMDWRD HL S  EL+  N  IPTFLYAMPFS+ RIFLEETSL
Sbjct  267   GILAEVDEHPFDVDKMVFMDWRDDHLISEPELRANNAEIPTFLYAMPFSANRIFLEETSL  326

Query  705   VARPGLDMKDIQERMVARLRHLGINVKSIEEDERCVIPMGGPLPVIPQRVVGIGGTAGMV  526
             VARPG+ M++IQ+RMVARLRHLGI V+SIEEDE+C IPMGGPLPVIPQRVVGIGGTAGMV
Sbjct  327   VARPGVSMEEIQKRMVARLRHLGIKVRSIEEDEKCYIPMGGPLPVIPQRVVGIGGTAGMV  386

Query  525   HPSTGYMVARTLAAAPVVANAIIQYLGSERSLLGNELSASVWKDLWPIERRRQREFFCFG  346
             HPSTGYMVARTLAAAPV+A++I++ L S   L G ELS  VWKDLWP++RRRQREFFCFG
Sbjct  387   HPSTGYMVARTLAAAPVLASSIVKCLNSGNRLHGEELSTEVWKDLWPMDRRRQREFFCFG  446

Query  345   MDILLKLDLPATRRFFDAFFDLEPRYWHGFLSSRLFLRELIFFGLSLFSHASNTSRLEIM  166
             MDILLKLDL  TRRFF+AFFDLEP +W GFLSSRLFL +LIFFGL+LF+HASNTSRLEIM
Sbjct  447   MDILLKLDLKGTRRFFNAFFDLEPYHWQGFLSSRLFLPDLIFFGLALFAHASNTSRLEIM  506

Query  165   TKGTLPLVNMINNLLQD  115
              KGTLPL  MINNL+ D
Sbjct  507   AKGTLPLXKMINNLVAD  523



>dbj|BAE43547.1| putative lycopene beta cyclase [Taxodium distichum var. distichum]
Length=525

 Score =   716 bits (1849),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 362/497 (73%), Positives = 422/497 (85%), Gaps = 6/497 (1%)
 Frame = -2

Query  1605  TLLKTPNELEFLHPHHGFAVKASAFTSLKPQKQEIRIGSWKACRNVGRVKASSSALLELV  1426
              +LKT  +L FL+       K S+ +S   + Q ++  + K C     V  ++S LLELV
Sbjct  33    NVLKT--QLNFLNTQLNLFPKISSVSSAISKLQLLQTRAKKTCM----VVRATSTLLELV  86

Query  1425  PVTKKENLDFELPMFEPSKGIvvdlavvgggpaglavaqqVSQAGLSVCSIDPSPKLIWP  1246
             P  KKENL+FELP +EPSK + +DL VVGGGPAGLAVAQQVS+AG+SVC IDP P+ IWP
Sbjct  87    PEAKKENLEFELPKYEPSKQLPMDLVVVGGGPAGLAVAQQVSEAGISVCCIDPCPESIWP  146

Query  1245  NNYGVWVDEFEAMDLLDCLDTTWSGAMVYIDDRTTKDLDRPYGRVNRKKLKSKMMQKCIT  1066
             NNYGVWVDEFEAMDLLDCLDTTWSGA+VY+DD+T K LDRPYGRVNR++LKSKMM+KCI 
Sbjct  147   NNYGVWVDEFEAMDLLDCLDTTWSGAVVYVDDKTKKFLDRPYGRVNRRQLKSKMMRKCIA  206

Query  1065  NGVKFHQAKVIKVIHEESKSMLICSDGVTIQATVVLDATGFSRCLVQYDKPYNPGYQVAY  886
             NGV+FH+AKV +V+HE SKSM++C+DGV +QA+VVLDATGFSRCLV+YDKPY+PGYQVAY
Sbjct  207   NGVQFHRAKVKQVVHEGSKSMVLCTDGVALQASVVLDATGFSRCLVEYDKPYDPGYQVAY  266

Query  885   GILAEVEEHPYDLNKMVFMDWRDSHLNSNLELKERNKRIPTFLYAMPFSSTRIFLEETSL  706
             GILAEV+EHP+D++KMVFMDWRD HL S  EL+  N  IPTFLYAMPFS+ RIFLEETSL
Sbjct  267   GILAEVDEHPFDVDKMVFMDWRDDHLISEPELRANNAEIPTFLYAMPFSANRIFLEETSL  326

Query  705   VARPGLDMKDIQERMVARLRHLGINVKSIEEDERCVIPMGGPLPVIPQRVVGIGGTAGMV  526
             VARPG+ M++IQ+RMVARLRHLGI V+SIEEDE+C IPMGGPLPVIPQR VGIGGTAGMV
Sbjct  327   VARPGVSMEEIQKRMVARLRHLGIKVRSIEEDEKCYIPMGGPLPVIPQRXVGIGGTAGMV  386

Query  525   HPSTGYMVARTLAAAPVVANAIIQYLGSERSLLGNELSASVWKDLWPIERRRQREFFCFG  346
             HPSTGYMVARTLAAAPV+A++I++ L S   L G ELS  VWKDLWP++RRRQREFFCFG
Sbjct  387   HPSTGYMVARTLAAAPVLASSIVKCLNSGNRLHGEELSTEVWKDLWPMDRRRQREFFCFG  446

Query  345   MDILLKLDLPATRRFFDAFFDLEPRYWHGFLSSRLFLRELIFFGLSLFSHASNTSRLEIM  166
             MDILLKLDL  TRRFF+AFFDLEP +W GFLSSRLFL +LIFFGL+LF+HASNTSRLEIM
Sbjct  447   MDILLKLDLKGTRRFFNAFFDLEPYHWQGFLSSRLFLPDLIFFGLALFAHASNTSRLEIM  506

Query  165   TKGTLPLVNMINNLLQD  115
              KGTLPLV MINNL+ D
Sbjct  507   AKGTLPLVKMINNLVAD  523



>dbj|BAE43554.1| putative lycopene beta cyclase [Taxodium distichum var. imbricatum]
Length=525

 Score =   716 bits (1849),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 362/497 (73%), Positives = 423/497 (85%), Gaps = 6/497 (1%)
 Frame = -2

Query  1605  TLLKTPNELEFLHPHHGFAVKASAFTSLKPQKQEIRIGSWKACRNVGRVKASSSALLELV  1426
              +LKT  +L FL+       K S+ +S   + Q ++  + K C     V  ++S LLELV
Sbjct  33    NVLKT--QLNFLNTQLNLFPKISSVSSAISKLQLLQTRAKKTCM----VVRATSTLLELV  86

Query  1425  PVTKKENLDFELPMFEPSKGIvvdlavvgggpaglavaqqVSQAGLSVCSIDPSPKLIWP  1246
             P  KKENL+FELP +EPSK + +DL VVGGGPAGLAVAQQVS+AG+SVC IDP P+ IWP
Sbjct  87    PEAKKENLEFELPKYEPSKQLPMDLVVVGGGPAGLAVAQQVSEAGISVCCIDPCPESIWP  146

Query  1245  NNYGVWVDEFEAMDLLDCLDTTWSGAMVYIDDRTTKDLDRPYGRVNRKKLKSKMMQKCIT  1066
             NNYGVWVDEFEAMDLLDCLDTTWSGA+VY+DD+T K LDRPYGRVNR++LKSKMM+KCI 
Sbjct  147   NNYGVWVDEFEAMDLLDCLDTTWSGAVVYVDDKTKKFLDRPYGRVNRRQLKSKMMRKCIA  206

Query  1065  NGVKFHQAKVIKVIHEESKSMLICSDGVTIQATVVLDATGFSRCLVQYDKPYNPGYQVAY  886
             NGV+FH+AKV +V+HE SKSM++C+DGV +QA+VVLDATGFSRCLV+YDKPY+PGYQVAY
Sbjct  207   NGVQFHRAKVKQVVHEGSKSMVLCTDGVALQASVVLDATGFSRCLVEYDKPYDPGYQVAY  266

Query  885   GILAEVEEHPYDLNKMVFMDWRDSHLNSNLELKERNKRIPTFLYAMPFSSTRIFLEETSL  706
             GILAEV+EHP+D++KMVFMDWRD HL S  EL+  N  IPTFLYAMPFS+ RIFLEETSL
Sbjct  267   GILAEVDEHPFDVDKMVFMDWRDDHLISEPELRANNAEIPTFLYAMPFSANRIFLEETSL  326

Query  705   VARPGLDMKDIQERMVARLRHLGINVKSIEEDERCVIPMGGPLPVIPQRVVGIGGTAGMV  526
             VARPG+ M++IQ+RMVARLRHLGI V+SIEEDE+C IPMGGPLPVIPQRVVGIGGTAGMV
Sbjct  327   VARPGVSMEEIQKRMVARLRHLGIKVRSIEEDEKCYIPMGGPLPVIPQRVVGIGGTAGMV  386

Query  525   HPSTGYMVARTLAAAPVVANAIIQYLGSERSLLGNELSASVWKDLWPIERRRQREFFCFG  346
             HPSTGYMVARTLAAAPV+A++I++ L S   L G ELS  VWKDLWP++RRRQREFFCFG
Sbjct  387   HPSTGYMVARTLAAAPVLASSIVKCLNSGNRLHGEELSTEVWKDLWPMDRRRQREFFCFG  446

Query  345   MDILLKLDLPATRRFFDAFFDLEPRYWHGFLSSRLFLRELIFFGLSLFSHASNTSRLEIM  166
             MDILLKLDL  TRRFF+AFFDLEP +W GFLSSRLFL +LIFFGL+LF+HASNTSRLEIM
Sbjct  447   MDILLKLDLKGTRRFFNAFFDLEPYHWQGFLSSRLFLPDLIFFGLALFAHASNTSRLEIM  506

Query  165   TKGTLPLVNMINNLLQD  115
              KGTLPL+ MINNL+ D
Sbjct  507   AKGTLPLMKMINNLVAD  523



>dbj|BAE43548.1| putative lycopene beta cyclase [Taxodium distichum var. distichum]
Length=525

 Score =   716 bits (1849),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 362/497 (73%), Positives = 422/497 (85%), Gaps = 6/497 (1%)
 Frame = -2

Query  1605  TLLKTPNELEFLHPHHGFAVKASAFTSLKPQKQEIRIGSWKACRNVGRVKASSSALLELV  1426
              +LKT  +L FL+       K S+ +S   + Q ++  + K C     V  ++S LLELV
Sbjct  33    NVLKT--QLNFLNTQLNLFPKISSVSSAISKLQLLQTRAKKTCM----VVRATSTLLELV  86

Query  1425  PVTKKENLDFELPMFEPSKGIvvdlavvgggpaglavaqqVSQAGLSVCSIDPSPKLIWP  1246
             P  KKENL+FELP +EPSK + +DL VVGGGPAGLAVAQQVS+AG+SVC IDP P+ IWP
Sbjct  87    PEAKKENLEFELPKYEPSKQLPMDLVVVGGGPAGLAVAQQVSEAGISVCCIDPCPESIWP  146

Query  1245  NNYGVWVDEFEAMDLLDCLDTTWSGAMVYIDDRTTKDLDRPYGRVNRKKLKSKMMQKCIT  1066
             NNYGVWVDEFEAMDLLDCLDTTWSGA+VY+DD+T K LDRPYGRVNR++LKSKMM+KCI 
Sbjct  147   NNYGVWVDEFEAMDLLDCLDTTWSGAVVYVDDKTKKFLDRPYGRVNRRQLKSKMMRKCIA  206

Query  1065  NGVKFHQAKVIKVIHEESKSMLICSDGVTIQATVVLDATGFSRCLVQYDKPYNPGYQVAY  886
             NGV+FH+AKV +V+HE SKSM++C+DGV +QA+VVLDATGFSRCLV+YDKPY+PGYQVAY
Sbjct  207   NGVQFHRAKVKQVVHEGSKSMVLCTDGVALQASVVLDATGFSRCLVEYDKPYDPGYQVAY  266

Query  885   GILAEVEEHPYDLNKMVFMDWRDSHLNSNLELKERNKRIPTFLYAMPFSSTRIFLEETSL  706
             GILAEV+EHP+D++K VFMDWRD HL S  EL+  N  IPTFLYAMPFS+ RIFLEETSL
Sbjct  267   GILAEVDEHPFDVDKXVFMDWRDDHLISEPELRANNAEIPTFLYAMPFSANRIFLEETSL  326

Query  705   VARPGLDMKDIQERMVARLRHLGINVKSIEEDERCVIPMGGPLPVIPQRVVGIGGTAGMV  526
             VARPG+ M++IQ+RMVARLRHLGI V+SIEEDE+C IPMGGPLPVIPQRVVGIGGTAGMV
Sbjct  327   VARPGVSMEEIQKRMVARLRHLGIKVRSIEEDEKCYIPMGGPLPVIPQRVVGIGGTAGMV  386

Query  525   HPSTGYMVARTLAAAPVVANAIIQYLGSERSLLGNELSASVWKDLWPIERRRQREFFCFG  346
             HPSTGYMVARTLAAAPV+A++I++ L S   L G ELS  VWKDLWP++RRRQREFFCFG
Sbjct  387   HPSTGYMVARTLAAAPVLASSIVKCLNSGNRLHGEELSTEVWKDLWPMDRRRQREFFCFG  446

Query  345   MDILLKLDLPATRRFFDAFFDLEPRYWHGFLSSRLFLRELIFFGLSLFSHASNTSRLEIM  166
             MDILLKLDL  TRRFF+AFFDLEP +W GFLSSRLFL +LIFFGL+LF+HASNTSRLEIM
Sbjct  447   MDILLKLDLKGTRRFFNAFFDLEPYHWQGFLSSRLFLPDLIFFGLALFAHASNTSRLEIM  506

Query  165   TKGTLPLVNMINNLLQD  115
              KGTLPLV MINNL+ D
Sbjct  507   AKGTLPLVKMINNLVAD  523



>dbj|BAE43555.1| putative lycopene beta cyclase [Taxodium distichum var. imbricatum]
Length=525

 Score =   716 bits (1848),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 361/497 (73%), Positives = 421/497 (85%), Gaps = 6/497 (1%)
 Frame = -2

Query  1605  TLLKTPNELEFLHPHHGFAVKASAFTSLKPQKQEIRIGSWKACRNVGRVKASSSALLELV  1426
              +LKT  +L FL+       K S+ +S   + Q ++  + K C     V  ++S LLELV
Sbjct  33    NVLKT--QLNFLNTQLNLFPKISSVSSAISKLQLLQTRAKKTCM----VVRATSTLLELV  86

Query  1425  PVTKKENLDFELPMFEPSKGIvvdlavvgggpaglavaqqVSQAGLSVCSIDPSPKLIWP  1246
             P  KKENL+FELP +EPSK + + L VVGGGPAGLAVAQQVS+AG+SVC IDP P+ IWP
Sbjct  87    PEAKKENLEFELPKYEPSKQLPMXLVVVGGGPAGLAVAQQVSEAGISVCCIDPCPESIWP  146

Query  1245  NNYGVWVDEFEAMDLLDCLDTTWSGAMVYIDDRTTKDLDRPYGRVNRKKLKSKMMQKCIT  1066
             NNYGVWVDEFEAMDLLDCLDTTWSGA+VY+DD+T K LDRPYGRVNR++LKSKMM+KCI 
Sbjct  147   NNYGVWVDEFEAMDLLDCLDTTWSGAVVYVDDKTKKFLDRPYGRVNRRQLKSKMMRKCIA  206

Query  1065  NGVKFHQAKVIKVIHEESKSMLICSDGVTIQATVVLDATGFSRCLVQYDKPYNPGYQVAY  886
             NGV+FH+AKV +V+HE SKSM++C+DGV +QA+VVLDATGFSRCLV+YDKPY+PGYQVAY
Sbjct  207   NGVQFHRAKVKQVVHEGSKSMVLCTDGVALQASVVLDATGFSRCLVEYDKPYDPGYQVAY  266

Query  885   GILAEVEEHPYDLNKMVFMDWRDSHLNSNLELKERNKRIPTFLYAMPFSSTRIFLEETSL  706
             GILAEV+EHP+D++KMVFMDWRD HL S  EL+  N  IPTFLYAMPFS+ RIFLEETSL
Sbjct  267   GILAEVDEHPFDVDKMVFMDWRDDHLISEPELRANNAEIPTFLYAMPFSANRIFLEETSL  326

Query  705   VARPGLDMKDIQERMVARLRHLGINVKSIEEDERCVIPMGGPLPVIPQRVVGIGGTAGMV  526
             VARPG+ M++IQ+RMVARLRHLGI V+SIEEDE+C IPMGGPLPVIPQRVVGIGGTAGMV
Sbjct  327   VARPGVSMEEIQKRMVARLRHLGIKVRSIEEDEKCYIPMGGPLPVIPQRVVGIGGTAGMV  386

Query  525   HPSTGYMVARTLAAAPVVANAIIQYLGSERSLLGNELSASVWKDLWPIERRRQREFFCFG  346
             HPSTGYMVARTLAAAPV+A++I++ L S   L G ELS  VWKDLWP++RRRQREFFCFG
Sbjct  387   HPSTGYMVARTLAAAPVLASSIVKCLNSGNRLHGEELSTEVWKDLWPMDRRRQREFFCFG  446

Query  345   MDILLKLDLPATRRFFDAFFDLEPRYWHGFLSSRLFLRELIFFGLSLFSHASNTSRLEIM  166
             MDILLKLDL  TRRFF+AFFDLEP +W GFLSSRLFL +LIFFGL+LF+HASNTSRLEIM
Sbjct  447   MDILLKLDLKGTRRFFNAFFDLEPYHWQGFLSSRLFLPDLIFFGLALFAHASNTSRLEIM  506

Query  165   TKGTLPLVNMINNLLQD  115
              KG LPLV MINNL+ D
Sbjct  507   AKGXLPLVKMINNLVAD  523



>dbj|BAE43551.1| putative lycopene beta cyclase [Taxodium distichum var. distichum]
Length=525

 Score =   716 bits (1848),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 362/497 (73%), Positives = 422/497 (85%), Gaps = 6/497 (1%)
 Frame = -2

Query  1605  TLLKTPNELEFLHPHHGFAVKASAFTSLKPQKQEIRIGSWKACRNVGRVKASSSALLELV  1426
              +LKT  +L FL+       K S+ +S   + Q ++  + K C     V  ++S LLELV
Sbjct  33    NVLKT--QLNFLNTQLNLFPKISSVSSAISKLQLLQTRAKKTCM----VVRATSTLLELV  86

Query  1425  PVTKKENLDFELPMFEPSKGIvvdlavvgggpaglavaqqVSQAGLSVCSIDPSPKLIWP  1246
             P  KKENL+FELP +EPSK + +DL VVGGGPAGLAVAQQVS+AG+SVC IDP P+ IWP
Sbjct  87    PEAKKENLEFELPKYEPSKQLPMDLVVVGGGPAGLAVAQQVSEAGISVCCIDPCPESIWP  146

Query  1245  NNYGVWVDEFEAMDLLDCLDTTWSGAMVYIDDRTTKDLDRPYGRVNRKKLKSKMMQKCIT  1066
             NNYGVWVDEFEAMDLLDCLDTTWSGA+VY+DD+T K LDRPYGRVNR++LKSKMM+KCI 
Sbjct  147   NNYGVWVDEFEAMDLLDCLDTTWSGAVVYVDDKTKKFLDRPYGRVNRRQLKSKMMRKCIA  206

Query  1065  NGVKFHQAKVIKVIHEESKSMLICSDGVTIQATVVLDATGFSRCLVQYDKPYNPGYQVAY  886
             NGV+FH+AKV +V+HE SKSM++C+DGV +QA+VVLDATGFSRCLV+YDKPY+PGYQVAY
Sbjct  207   NGVQFHRAKVKQVVHEGSKSMVLCTDGVALQASVVLDATGFSRCLVEYDKPYDPGYQVAY  266

Query  885   GILAEVEEHPYDLNKMVFMDWRDSHLNSNLELKERNKRIPTFLYAMPFSSTRIFLEETSL  706
             GILAEV+EHP+D++KMVFMDWRD HL S  EL+  N  IPTFLYAMPFS+ RIFLEETSL
Sbjct  267   GILAEVDEHPFDVDKMVFMDWRDDHLISEPELRANNAEIPTFLYAMPFSANRIFLEETSL  326

Query  705   VARPGLDMKDIQERMVARLRHLGINVKSIEEDERCVIPMGGPLPVIPQRVVGIGGTAGMV  526
             VARPG+ M++IQ+RMVARLRHLGI V+SIEEDE+C IPMGGPLPVIPQRVVGIGGTAGMV
Sbjct  327   VARPGVSMEEIQKRMVARLRHLGIKVRSIEEDEKCYIPMGGPLPVIPQRVVGIGGTAGMV  386

Query  525   HPSTGYMVARTLAAAPVVANAIIQYLGSERSLLGNELSASVWKDLWPIERRRQREFFCFG  346
             HPSTGYMVARTLAAAPV+A++I++ L S   L G ELS  VWKDLWP++RRRQREFFCFG
Sbjct  387   HPSTGYMVARTLAAAPVLASSIVKCLNSGNRLHGEELSTEVWKDLWPMDRRRQREFFCFG  446

Query  345   MDILLKLDLPATRRFFDAFFDLEPRYWHGFLSSRLFLRELIFFGLSLFSHASNTSRLEIM  166
             MDILLKLDL  TRRFF+AFFDLEP +W GFLSSRLFL +LIFFGL+LF+HASNTSRLEIM
Sbjct  447   MDILLKLDLKGTRRFFNAFFDLEPYHWQGFLSSRLFLPDLIFFGLALFAHASNTSRLEIM  506

Query  165   TKGTLPLVNMINNLLQD  115
              KGTLPL  MINNL+ D
Sbjct  507   XKGTLPLXKMINNLVAD  523



>dbj|BAE43550.1| putative lycopene beta cyclase [Taxodium distichum var. distichum]
Length=525

 Score =   716 bits (1848),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 362/497 (73%), Positives = 422/497 (85%), Gaps = 6/497 (1%)
 Frame = -2

Query  1605  TLLKTPNELEFLHPHHGFAVKASAFTSLKPQKQEIRIGSWKACRNVGRVKASSSALLELV  1426
              +LKT  +L FL+       K S+ +S   + Q ++  + K C     V  ++S LLELV
Sbjct  33    NVLKT--QLNFLNTQLNLFPKISSVSSAISKLQLLQTRAKKTCM----VVRATSTLLELV  86

Query  1425  PVTKKENLDFELPMFEPSKGIvvdlavvgggpaglavaqqVSQAGLSVCSIDPSPKLIWP  1246
             P  KKENL+FELP +EPSK + +DL VVGGGPAGLAVAQQVS+AG+SVC IDP P+ IWP
Sbjct  87    PEAKKENLEFELPKYEPSKQLPMDLVVVGGGPAGLAVAQQVSEAGISVCCIDPCPESIWP  146

Query  1245  NNYGVWVDEFEAMDLLDCLDTTWSGAMVYIDDRTTKDLDRPYGRVNRKKLKSKMMQKCIT  1066
             NNYGVWVDEFEAMDLLDCLDTTWSGA+VY+DD+T K LDRPYGRVNR++LKSKMM+KCI 
Sbjct  147   NNYGVWVDEFEAMDLLDCLDTTWSGAVVYVDDKTKKFLDRPYGRVNRRQLKSKMMRKCIX  206

Query  1065  NGVKFHQAKVIKVIHEESKSMLICSDGVTIQATVVLDATGFSRCLVQYDKPYNPGYQVAY  886
             NGV+FH+AKV +V+HE SKSM++C+DGV +QA+VVLDATGFSRCLV+YD PY+PGYQVAY
Sbjct  207   NGVQFHRAKVKQVVHEGSKSMVLCTDGVALQASVVLDATGFSRCLVEYDXPYDPGYQVAY  266

Query  885   GILAEVEEHPYDLNKMVFMDWRDSHLNSNLELKERNKRIPTFLYAMPFSSTRIFLEETSL  706
             GILAEV+EHP+D++KMVFMDWRD HL S  EL+  N  IPTFLYAMPFS+ RIFLEETSL
Sbjct  267   GILAEVDEHPFDVDKMVFMDWRDDHLISEPELRANNAEIPTFLYAMPFSANRIFLEETSL  326

Query  705   VARPGLDMKDIQERMVARLRHLGINVKSIEEDERCVIPMGGPLPVIPQRVVGIGGTAGMV  526
             VARPG+ M++IQ+RMVARLRHLGI V+SIEEDE+C IPMGGPLPVIPQRVVGIGGTAGMV
Sbjct  327   VARPGVSMEEIQKRMVARLRHLGIKVRSIEEDEKCYIPMGGPLPVIPQRVVGIGGTAGMV  386

Query  525   HPSTGYMVARTLAAAPVVANAIIQYLGSERSLLGNELSASVWKDLWPIERRRQREFFCFG  346
             HPSTGYMVARTLAAAPV+A++I++ L S   L G ELS  VWKDLWP++RRRQREFFCFG
Sbjct  387   HPSTGYMVARTLAAAPVLASSIVKCLNSGNRLHGEELSTEVWKDLWPMDRRRQREFFCFG  446

Query  345   MDILLKLDLPATRRFFDAFFDLEPRYWHGFLSSRLFLRELIFFGLSLFSHASNTSRLEIM  166
             MDILLKLDL  TRRFF+AFFDLEP +W GFLSSRLFL +LIFFGL+LF+HASNTSRLEIM
Sbjct  447   MDILLKLDLKGTRRFFNAFFDLEPYHWQGFLSSRLFLPDLIFFGLALFAHASNTSRLEIM  506

Query  165   TKGTLPLVNMINNLLQD  115
              KGTLPLV MINNL+ D
Sbjct  507   AKGTLPLVKMINNLVAD  523



>dbj|BAE43527.1| putative lycopene beta cyclase [Cryptomeria japonica]
Length=525

 Score =   716 bits (1847),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 361/497 (73%), Positives = 422/497 (85%), Gaps = 6/497 (1%)
 Frame = -2

Query  1605  TLLKTPNELEFLHPHHGFAVKASAFTSLKPQKQEIRIGSWKACRNVGRVKASSSALLELV  1426
              +LKT  +L FL+       K S+ +S     Q ++  + K C     V  ++S LLELV
Sbjct  33    NVLKT--QLNFLNTQLNLFPKISSVSSAISNLQLVQTRAKKTCM----VVRATSTLLELV  86

Query  1425  PVTKKENLDFELPMFEPSKGIvvdlavvgggpaglavaqqVSQAGLSVCSIDPSPKLIWP  1246
             P  KKE+L+ ELP +EPSK + +DL VVGGGPAGLAVAQQVS+AG+SVC IDP P+ IWP
Sbjct  87    PEAKKESLEIELPKYEPSKQLPMDLVVVGGGPAGLAVAQQVSEAGISVCCIDPCPESIWP  146

Query  1245  NNYGVWVDEFEAMDLLDCLDTTWSGAMVYIDDRTTKDLDRPYGRVNRKKLKSKMMQKCIT  1066
             NNYGVWVDEFEAMDLLDCLDTTWSGA+VY+DD+T K LDRPYGRVNR++LKSKMM+KCI 
Sbjct  147   NNYGVWVDEFEAMDLLDCLDTTWSGAVVYVDDKTKKFLDRPYGRVNRRQLKSKMMRKCIA  206

Query  1065  NGVKFHQAKVIKVIHEESKSMLICSDGVTIQATVVLDATGFSRCLVQYDKPYNPGYQVAY  886
             NGV+FH+AKV +V+HE SKSM++C+DGV +QA+VVLDATGFSRCLV+YDKPY+PGYQVAY
Sbjct  207   NGVQFHRAKVKQVVHEGSKSMVLCTDGVALQASVVLDATGFSRCLVEYDKPYDPGYQVAY  266

Query  885   GILAEVEEHPYDLNKMVFMDWRDSHLNSNLELKERNKRIPTFLYAMPFSSTRIFLEETSL  706
             GILAEV+EHP+D++KMVFMDWRD  L +  ELK  N +IPTFLYAMPFS+ RIFLEETSL
Sbjct  267   GILAEVDEHPFDVDKMVFMDWRDDDLINEPELKANNAKIPTFLYAMPFSANRIFLEETSL  326

Query  705   VARPGLDMKDIQERMVARLRHLGINVKSIEEDERCVIPMGGPLPVIPQRVVGIGGTAGMV  526
             VARPG+ M++IQ+RMV RLRHLGI V+SIEEDE+C IPMGGPLPVIPQRVVGIGGTAGMV
Sbjct  327   VARPGVSMEEIQKRMVXRLRHLGIKVRSIEEDEKCYIPMGGPLPVIPQRVVGIGGTAGMV  386

Query  525   HPSTGYMVARTLAAAPVVANAIIQYLGSERSLLGNELSASVWKDLWPIERRRQREFFCFG  346
             HPSTGYMVARTLAAAPV+A++I++YL SE  L G ELS  VWKDLWP++RRRQREFFCFG
Sbjct  387   HPSTGYMVARTLAAAPVLASSIVKYLNSENRLHGEELSTEVWKDLWPMDRRRQREFFCFG  446

Query  345   MDILLKLDLPATRRFFDAFFDLEPRYWHGFLSSRLFLRELIFFGLSLFSHASNTSRLEIM  166
             MDILLKLDL  TRRFF+AFFDLEP +W GFLSSRLFL +LIFFGL+LF+HASNTSRLEIM
Sbjct  447   MDILLKLDLKGTRRFFNAFFDLEPYHWQGFLSSRLFLPDLIFFGLALFAHASNTSRLEIM  506

Query  165   TKGTLPLVNMINNLLQD  115
              KGTLPLV MINNL+ D
Sbjct  507   AKGTLPLVKMINNLVAD  523



>dbj|BAE43522.1| putative lycopene beta cyclase [Cryptomeria japonica]
Length=525

 Score =   715 bits (1845),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 361/497 (73%), Positives = 421/497 (85%), Gaps = 6/497 (1%)
 Frame = -2

Query  1605  TLLKTPNELEFLHPHHGFAVKASAFTSLKPQKQEIRIGSWKACRNVGRVKASSSALLELV  1426
              +LKT  +L FL+       K S+  S     Q ++  + K C     V  ++S LLELV
Sbjct  33    NVLKT--QLNFLNTQLNLFPKISSVXSAISNLQLVQTRAKKTCM----VVRATSTLLELV  86

Query  1425  PVTKKENLDFELPMFEPSKGIvvdlavvgggpaglavaqqVSQAGLSVCSIDPSPKLIWP  1246
             P  KKE+L+ ELP +EPSK + +DL VVGGGPAGLAVAQQVS+AG+SVC IDP P+ IWP
Sbjct  87    PEAKKESLEIELPKYEPSKQLPMDLVVVGGGPAGLAVAQQVSEAGISVCCIDPCPESIWP  146

Query  1245  NNYGVWVDEFEAMDLLDCLDTTWSGAMVYIDDRTTKDLDRPYGRVNRKKLKSKMMQKCIT  1066
             NNYGVWVDEFEAMDLLDCLDTTWSGA+VY+DD+T K LDRPYGRVNR++LKSKMM+KCI 
Sbjct  147   NNYGVWVDEFEAMDLLDCLDTTWSGAVVYVDDKTKKFLDRPYGRVNRRQLKSKMMRKCIA  206

Query  1065  NGVKFHQAKVIKVIHEESKSMLICSDGVTIQATVVLDATGFSRCLVQYDKPYNPGYQVAY  886
             NGV+FH+AKV +V+HE SKSM++C+DGV +QA+VVLDATGFSRCLV+YDKPY+PGYQVAY
Sbjct  207   NGVQFHRAKVKQVVHEGSKSMVLCTDGVALQASVVLDATGFSRCLVEYDKPYDPGYQVAY  266

Query  885   GILAEVEEHPYDLNKMVFMDWRDSHLNSNLELKERNKRIPTFLYAMPFSSTRIFLEETSL  706
             GILAEV+EHP+D++KMVFMDWRD  L +  ELK  N +IPTFLYAMPFS+ RIFLEETSL
Sbjct  267   GILAEVDEHPFDVDKMVFMDWRDDXLINEPELKANNAKIPTFLYAMPFSANRIFLEETSL  326

Query  705   VARPGLDMKDIQERMVARLRHLGINVKSIEEDERCVIPMGGPLPVIPQRVVGIGGTAGMV  526
             VARPG+ M++IQ+RMV RLRHLGI V+SIEEDE+C IPMGGPLPVIPQRVVGIGGTAGMV
Sbjct  327   VARPGVSMEEIQKRMVXRLRHLGIKVRSIEEDEKCYIPMGGPLPVIPQRVVGIGGTAGMV  386

Query  525   HPSTGYMVARTLAAAPVVANAIIQYLGSERSLLGNELSASVWKDLWPIERRRQREFFCFG  346
             HPSTGYMVARTLAAAPV+A++I++YL SE  L G ELS  VWKDLWP++RRRQREFFCFG
Sbjct  387   HPSTGYMVARTLAAAPVLASSIVKYLNSENRLHGEELSTEVWKDLWPMDRRRQREFFCFG  446

Query  345   MDILLKLDLPATRRFFDAFFDLEPRYWHGFLSSRLFLRELIFFGLSLFSHASNTSRLEIM  166
             MDILLKLDL  TRRFF+AFFDLEP +W GFLSSRLFL +LIFFGL+LF+HASNTSRLEIM
Sbjct  447   MDILLKLDLKGTRRFFNAFFDLEPYHWQGFLSSRLFLPDLIFFGLALFAHASNTSRLEIM  506

Query  165   TKGTLPLVNMINNLLQD  115
              KGTLPLV MINNL+ D
Sbjct  507   AKGTLPLVKMINNLVAD  523



>dbj|BAE43552.1| putative lycopene beta cyclase [Taxodium distichum var. distichum]
Length=525

 Score =   713 bits (1841),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 363/497 (73%), Positives = 423/497 (85%), Gaps = 6/497 (1%)
 Frame = -2

Query  1605  TLLKTPNELEFLHPHHGFAVKASAFTSLKPQKQEIRIGSWKACRNVGRVKASSSALLELV  1426
              +LKT  +L FL+       K S+ +S   + Q ++  + K C     V  ++S LLELV
Sbjct  33    NVLKT--QLNFLNTQLNLFPKISSVSSXISKLQLLQTRAKKTCM----VVRATSTLLELV  86

Query  1425  PVTKKENLDFELPMFEPSKGIvvdlavvgggpaglavaqqVSQAGLSVCSIDPSPKLIWP  1246
             P  KKENL+FELP +EPSK + +DL VVGGGPAGLAVAQQVS+AG+SVC IDP P+ IWP
Sbjct  87    PEAKKENLEFELPKYEPSKQLPMDLVVVGGGPAGLAVAQQVSEAGISVCCIDPCPESIWP  146

Query  1245  NNYGVWVDEFEAMDLLDCLDTTWSGAMVYIDDRTTKDLDRPYGRVNRKKLKSKMMQKCIT  1066
             NNYGVWVDEFEAMDLLDCLDTTWSGA+VY+DD+T K LDRPYGRVNR++LKSKMM+KCI 
Sbjct  147   NNYGVWVDEFEAMDLLDCLDTTWSGAVVYVDDKTKKFLDRPYGRVNRRQLKSKMMRKCIA  206

Query  1065  NGVKFHQAKVIKVIHEESKSMLICSDGVTIQATVVLDATGFSRCLVQYDKPYNPGYQVAY  886
             NGV+FH+AKV +V+HE SKSM++C+DGV +QA+VVLDATGFSRCLV+YDKPY+PGYQVAY
Sbjct  207   NGVQFHRAKVKQVVHEGSKSMVLCTDGVALQASVVLDATGFSRCLVEYDKPYDPGYQVAY  266

Query  885   GILAEVEEHPYDLNKMVFMDWRDSHLNSNLELKERNKRIPTFLYAMPFSSTRIFLEETSL  706
             GILAEV+EHP+D++KMVFMDWRD HL S  EL+  N  IPTFLYAMPFS+ RIFLEETSL
Sbjct  267   GILAEVDEHPFDVDKMVFMDWRDDHLISEPELRANNAEIPTFLYAMPFSANRIFLEETSL  326

Query  705   VARPGLDMKDIQERMVARLRHLGINVKSIEEDERCVIPMGGPLPVIPQRVVGIGGTAGMV  526
             VARPG+ M++IQ+RMVARLRHLGI V+SIEEDE+C IPMGGPLPVIPQRVVGIGGTAGMV
Sbjct  327   VARPGVSMEEIQKRMVARLRHLGIKVRSIEEDEKCYIPMGGPLPVIPQRVVGIGGTAGMV  386

Query  525   HPSTGYMVARTLAAAPVVANAIIQYLGSERSLLGNELSASVWKDLWPIERRRQREFFCFG  346
             HPSTGYMVARTLAAAPV+A++I++ L S   L G ELS  VWKDLWP++RRRQREFFCFG
Sbjct  387   HPSTGYMVARTLAAAPVLASSIVKCLNSGNRLHGEELSTEVWKDLWPMDRRRQREFFCFG  446

Query  345   MDILLKLDLPATRRFFDAFFDLEPRYWHGFLSSRLFLRELIFFGLSLFSHASNTSRLEIM  166
             MDILLKLDL  TRRFF+AFFDLEP +W GFLSSRLFL +LIFFGL+LF+HASNTSRLEIM
Sbjct  447   MDILLKLDLKGTRRFFNAFFDLEPYHWQGFLSSRLFLPDLIFFGLALFAHASNTSRLEIM  506

Query  165   TKGTLPLVNMINNLLQD  115
              KGTLPLV MINNL+ D
Sbjct  507   AKGTLPLVKMINNLVAD  523



>ref|XP_012085982.1| PREDICTED: lycopene beta cyclase, chloroplastic/chromoplastic 
isoform X2 [Jatropha curcas]
Length=367

 Score =   692 bits (1785),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/365 (89%), Positives = 351/365 (96%), Gaps = 0/365 (0%)
 Frame = -2

Query  1209  MDLLDCLDTTWSGAMVYIDDRTTKDLDRPYGRVNRKKLKSKMMQKCITNGVKFHQAKVIK  1030
             MDLLDCLDTTWSGA+VYIDD+T KDL RPYGRVNRK+LKSKM+QKCI+NGVKFHQAKVIK
Sbjct  1     MDLLDCLDTTWSGAVVYIDDKTKKDLGRPYGRVNRKQLKSKMLQKCISNGVKFHQAKVIK  60

Query  1029  VIHEESKSMLICSDGVTIQATVVLDATGFSRCLVQYDKPYNPGYQVAYGILAEVEEHPYD  850
             VIHEESKS+LIC+DGVTIQATVVLDATGFSRCLVQYDKPYNPGYQVAYGILAEVEEHP+D
Sbjct  61    VIHEESKSLLICNDGVTIQATVVLDATGFSRCLVQYDKPYNPGYQVAYGILAEVEEHPFD  120

Query  849   LNKMVFMDWRDSHLNSNLELKERNKRIPTFLYAMPFSSTRIFLEETSLVARPGLDMKDIQ  670
             ++KMVFMDWRDSHL++NLELKERN +IPTFLYAMPFSS RIFLEETSLVARPG+ M+DIQ
Sbjct  121   VDKMVFMDWRDSHLDNNLELKERNSKIPTFLYAMPFSSERIFLEETSLVARPGVRMEDIQ  180

Query  669   ERMVARLRHLGINVKSIEEDERCVIPMGGPLPVIPQRVVGIGGTAGMVHPSTGYMVARTL  490
             ERMVARL+HLGI VKSIEEDE CVIPMGGPLPV+PQR+VGIGGTAGMVHPSTGYMVARTL
Sbjct  181   ERMVARLKHLGIKVKSIEEDEHCVIPMGGPLPVLPQRIVGIGGTAGMVHPSTGYMVARTL  240

Query  489   AAAPVVANAIIQYLGSERSLLGNELSASVWKDLWPIERRRQREFFCFGMDILLKLDLPAT  310
             AAAP+VAN+I+QYLGS RSL GNELSA VWKDLWPI+RRRQREFFCFGMDILLKLDL AT
Sbjct  241   AAAPIVANSIVQYLGSGRSLSGNELSAEVWKDLWPIQRRRQREFFCFGMDILLKLDLQAT  300

Query  309   RRFFDAFFDLEPRYWHGFLSSRLFLRELIFFGLSLFSHASNTSRLEIMTKGTLPLVNMIN  130
             RRFF+AFFDLEP YWHGFLSSRLFL EL+FFGLSLFSHASNTSRLEIM KGT+PLVNMIN
Sbjct  301   RRFFNAFFDLEPHYWHGFLSSRLFLPELLFFGLSLFSHASNTSRLEIMAKGTVPLVNMIN  360

Query  129   NLLQD  115
             NL++D
Sbjct  361   NLIRD  365



>gb|ADA82242.1| lycopene beta cyclase [Crocus sativus]
Length=497

 Score =   690 bits (1781),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 354/474 (75%), Positives = 405/474 (85%), Gaps = 7/474 (1%)
 Frame = -2

Query  1611  MDTLLKTPNELEFLHPHHGFAVKASAFTSLKPQKQE---IRIGSWKACRNVGRVKASSSA  1441
             MD LL+T N LE L P H  A   S F S  P++     I+    + C++ G  K S+SA
Sbjct  1     MDPLLRTHNRLELLQPLHKLA--ESHFLSPSPKRPNHIPIKKSHKRWCKD-GSFKVSNSA  57

Query  1440  LLELVPVTKKENLDFELPMFEPSKGIvvdlavvgggpaglavaqqVSQAGLSVCSIDPSP  1261
             LL+LVP TKKE+L+F+LP ++PSK + +DLAVVGGGPAGLAVAQQVS+AGLSV SIDP+P
Sbjct  58    LLDLVPETKKEHLEFDLPSYDPSKALTLDLAVVGGGPAGLAVAQQVSEAGLSVVSIDPNP  117

Query  1260  KLIWPNNYGVWVDEFEAMDLLDCLDTTWSGAMVYIDDRTTKDLDRPYGRVNRKKLKSKMM  1081
              +IWPNNYGVWVDEFEAM LLDCLD +W GA+V++D++  K LDRPY RVNRK LK+KMM
Sbjct  118   NVIWPNNYGVWVDEFEAMGLLDCLDASWLGAVVHVDEKNKKLLDRPYARVNRKNLKTKMM  177

Query  1080  QKCITNGVKFHQAKVIKVIHEESKSMLICSDGVTIQATVVLDATGFSRCLVQYDKPYNPG  901
             QKC+ NGVKFHQAKV+KV+HE+ KS+LIC+DG+TI+ATVVLDATGFSRCLVQYDKPYNPG
Sbjct  178   QKCLANGVKFHQAKVVKVVHEDEKSLLICNDGITIEATVVLDATGFSRCLVQYDKPYNPG  237

Query  900   YQVAYGILAEVEEHPYDLNKMVFMDWRDSHLNSNLELKERNKRIPTFLYAMPFSSTRIFL  721
             YQVAYGILAEVEEHP DL+KMVFMDWRDSHL  N  ++ RN RIPTFLYAMPFSS RIFL
Sbjct  238   YQVAYGILAEVEEHPLDLDKMVFMDWRDSHLKGNGVMQGRNNRIPTFLYAMPFSSNRIFL  297

Query  720   EETSLVARPGLDMKDIQERMVARLRHLGINVKSIEEDERCVIPMGGPLPVIPQRVVGIGG  541
             EETSLVARPGL M+DIQ+RM ARL+HLGI VKSIEEDERCVIPMGGPLPV+PQRVVGIGG
Sbjct  298   EETSLVARPGLGMEDIQQRMEARLKHLGIKVKSIEEDERCVIPMGGPLPVLPQRVVGIGG  357

Query  540   TAGMVHPSTGYMVARTLAAAPVVANAIIQYLGSERSLLGNELSASVWKDLWPIERRRQRE  361
             TAGMVHPSTGYMVARTLA AP+VA++I+++LGS+R L G+ LSA VWKDLWPIERRRQRE
Sbjct  358   TAGMVHPSTGYMVARTLAVAPIVADSIVRFLGSDRGLSGDMLSAEVWKDLWPIERRRQRE  417

Query  360   FFCFGMDILLKLDLPATRRFFDAFFDLEPRYWHGFLSSRLFLRELIFFGLSLFS  199
             FFCFGMDILLKLDL  TRRFFDAFFDLEPRYWHGFLSSRLFL    F+  SLF+
Sbjct  418   FFCFGMDILLKLDLEGTRRFFDAFFDLEPRYWHGFLSSRLFLLSFWFWA-SLFT  470



>gb|AFA35121.1| lycopene beta-cyclase [Triticum aestivum]
Length=484

 Score =   673 bits (1736),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 333/456 (73%), Positives = 385/456 (84%), Gaps = 2/456 (0%)
 Frame = -2

Query  1470  VGRVKASSS-ALLELVPVTKKENLDFELPMFEPSKGIvvdlavvgggpaglavaqqVSQA  1294
             V R  AS+  AL  L P  + E L  +LP ++P++   VDLAVVGGGPAGLAVAQ+V++A
Sbjct  28    VCRATASAGQALRSLAPPPRPELLSLDLPRYDPARSRPVDLAVVGGGPAGLAVAQRVAEA  87

Query  1293  GLSVCSIDPSPKLIWPNNYGVWVDEFEAMDLLDCLDTTWSGAMVYIDDRTTKDLDRPYGR  1114
             GLSV SIDPSP L+WPNNYGVWVDEFEAM L DCLDT W  A V+IDD T+K L RPY R
Sbjct  88    GLSVVSIDPSPSLVWPNNYGVWVDEFEAMGLSDCLDTVWPSASVFIDDHTSKSLHRPYAR  147

Query  1113  VNRKKLKSKMMQKCITNGVKFHQAKVIKVIHEESKSMLICSDGVTIQATVVLDATGFSRC  934
             V R+KLKS MM +CI +GV+FHQAKV KV+H E+ S+LIC DGV + ATVVLDATGFSRC
Sbjct  148   VARRKLKSTMMDRCIAHGVRFHQAKVAKVVHNEASSLLICDDGVAVPATVVLDATGFSRC  207

Query  933   LVQYDKPYNPGYQVAYGILAEVEEHPYDLNKMVFMDWRDSHLNSNLELKERNKRIPTFLY  754
             LVQYDKPYNPGYQVAYGILAEV+EHP+D++KM+FMDWRDSHL     +KERN R+PTFLY
Sbjct  208   LVQYDKPYNPGYQVAYGILAEVDEHPFDIDKMLFMDWRDSHLPEGSAIKERNSRVPTFLY  267

Query  753   AMPFSSTRIFLEETSLVARPGLDMKDIQERMVARLRHLGINVKSIEEDERCVIPMGGPLP  574
             AMPFS TRIFLEETSLVARPGL M DIQERM ARLRHLGI ++S+EEDERCVIPMGGPLP
Sbjct  268   AMPFSPTRIFLEETSLVARPGLSMDDIQERMAARLRHLGIRIRSVEEDERCVIPMGGPLP  327

Query  573   VIPQRVVGIGGTAGMVHPSTGYMVARTLAAAPVVANAIIQYLGSER-SLLGNELSASVWK  397
             V+PQRVVGIGGTAGMVHPSTGYMVARTLA AP+VA++I+++L +    + G+ L+A VWK
Sbjct  328   VLPQRVVGIGGTAGMVHPSTGYMVARTLATAPIVADSIVRFLDTGNGGIAGDALAAEVWK  387

Query  396   DLWPIERRRQREFFCFGMDILLKLDLPATRRFFDAFFDLEPRYWHGFLSSRLFLRELIFF  217
             +LWP +RRRQREFFCFGMD+LLKLDL  TRRFF+AFFDLEP YWHGFLSSRLFL EL+ F
Sbjct  388   ELWPTDRRRQREFFCFGMDVLLKLDLQGTRRFFNAFFDLEPHYWHGFLSSRLFLPELLMF  447

Query  216   GLSLFSHASNTSRLEIMTKGTLPLVNMINNLLQDID  109
             GLSLF+HASNTS+LEIM KGT+PL  M+ NL+QD D
Sbjct  448   GLSLFAHASNTSKLEIMAKGTVPLAKMVGNLIQDKD  483



>dbj|BAH10590.1| lycopene beta-cyclase [Lilium hybrid division I]
Length=370

 Score =   668 bits (1724),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/370 (85%), Positives = 341/370 (92%), Gaps = 0/370 (0%)
 Frame = -2

Query  1218  FEAMDLLDCLDTTWSGAMVYIDDRTTKDLDRPYGRVNRKKLKSKMMQKCITNGVKFHQAK  1039
             FEAM LLDC+DT+WSGA VYID+ + K LDRPY RVNRK+LKSKMMQKCI NGVKFHQAK
Sbjct  1     FEAMGLLDCIDTSWSGATVYIDEGSKKVLDRPYARVNRKQLKSKMMQKCIVNGVKFHQAK  60

Query  1038  VIKVIHEESKSMLICSDGVTIQATVVLDATGFSRCLVQYDKPYNPGYQVAYGILAEVEEH  859
             VIKV+HEE KS+L+C+DGVTIQATVVLDATGFSRCLVQY+KPYNPGYQVAYGILAEVEEH
Sbjct  61    VIKVVHEEMKSLLVCNDGVTIQATVVLDATGFSRCLVQYEKPYNPGYQVAYGILAEVEEH  120

Query  858   PYDLNKMVFMDWRDSHLNSNLELKERNKRIPTFLYAMPFSSTRIFLEETSLVARPGLDMK  679
             P+DL+KM+FMDWRDSHL    E+KERN RIPTFLYAMPFSS RIFLEETSLVARPGL M+
Sbjct  121   PFDLDKMLFMDWRDSHLKDGSEIKERNSRIPTFLYAMPFSSERIFLEETSLVARPGLRME  180

Query  678   DIQERMVARLRHLGINVKSIEEDERCVIPMGGPLPVIPQRVVGIGGTAGMVHPSTGYMVA  499
             DIQERMVARL+HLGI VKSIEEDERCVIPMGGPLPV+PQRVVGIGGTAGMVHPSTGYMVA
Sbjct  181   DIQERMVARLKHLGIKVKSIEEDERCVIPMGGPLPVLPQRVVGIGGTAGMVHPSTGYMVA  240

Query  498   RTLAAAPVVANAIIQYLGSERSLLGNELSASVWKDLWPIERRRQREFFCFGMDILLKLDL  319
             RTLAAAP+VA +I+++LGS+  LLG ELSA VWKDLWPIERRRQREFFCFGMD+LLKLDL
Sbjct  241   RTLAAAPIVAKSIVRFLGSDHGLLGRELSAEVWKDLWPIERRRQREFFCFGMDVLLKLDL  300

Query  318   PATRRFFDAFFDLEPRYWHGFLSSRLFLRELIFFGLSLFSHASNTSRLEIMTKGTLPLVN  139
               TR FFDAFFDLEPRYWHGFLSSRLFL EL FFGLSLF +ASNTSRLEIM KGT+PLVN
Sbjct  301   QGTRGFFDAFFDLEPRYWHGFLSSRLFLPELFFFGLSLFKNASNTSRLEIMAKGTVPLVN  360

Query  138   MINNLLQDID  109
             M+NNLLQD D
Sbjct  361   MLNNLLQDRD  370



>dbj|BAJ90170.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK05130.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=488

 Score =   666 bits (1718),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/456 (71%), Positives = 383/456 (84%), Gaps = 3/456 (1%)
 Frame = -2

Query  1479  CRNVGRVKASSSALLELVPVTKKENLDFELPMFEPSKGIvvdlavvgggpaglavaqqVS  1300
             CR      ++  AL  + P  + E L  +LP ++P++   VDLAVVGGGPAGLAVAQ+V+
Sbjct  32    CRAAS--ASAGQALRSMAPPPRPELLSLDLPRYDPARSRPVDLAVVGGGPAGLAVAQRVA  89

Query  1299  QAGLSVCSIDPSPKLIWPNNYGVWVDEFEAMDLLDCLDTTWSGAMVYIDDRTTKDLDRPY  1120
             +AGLSV SIDPSP L+WPNNYGVWVDEFEAM L DCLDT W  A V+IDD T+K L RPY
Sbjct  90    EAGLSVVSIDPSPGLVWPNNYGVWVDEFEAMGLSDCLDTVWPSASVFIDDHTSKSLHRPY  149

Query  1119  GRVNRKKLKSKMMQKCITNGVKFHQAKVIKVIHEESKSMLICSDGVTIQATVVLDATGFS  940
              RV R+KLKS MM +C+ +GV+FHQAKV+KV+H E+ S+++C DGV + ATVVLDATGFS
Sbjct  150   ARVARRKLKSTMMDRCVAHGVRFHQAKVVKVVHNEASSLIVCDDGVAVPATVVLDATGFS  209

Query  939   RCLVQYDKPYNPGYQVAYGILAEVEEHPYDLNKMVFMDWRDSHLNSNLELKERNKRIPTF  760
             RCLVQYDKPYNPGYQVAYGILAEV+EHP+D++KM+FMDWRDSHL     +K+RN R+PTF
Sbjct  210   RCLVQYDKPYNPGYQVAYGILAEVDEHPFDIDKMLFMDWRDSHLPEGSAIKDRNSRVPTF  269

Query  759   LYAMPFSSTRIFLEETSLVARPGLDMKDIQERMVARLRHLGINVKSIEEDERCVIPMGGP  580
             LYAMPFS TRIFLEETSLVARPGL M DIQERM ARLRHLGI ++S+EEDERCVIPMGGP
Sbjct  270   LYAMPFSPTRIFLEETSLVARPGLSMDDIQERMAARLRHLGIRIRSVEEDERCVIPMGGP  329

Query  579   LPVIPQRVVGIGGTAGMVHPSTGYMVARTLAAAPVVANAIIQYLGSER-SLLGNELSASV  403
             LPV+PQRVVGIGGTAGMVHPSTGYMVARTLA AP+VA++I+++L +    + G+ L+A V
Sbjct  330   LPVLPQRVVGIGGTAGMVHPSTGYMVARTLATAPIVADSIVRFLDTGNGGIAGDALAAQV  389

Query  402   WKDLWPIERRRQREFFCFGMDILLKLDLPATRRFFDAFFDLEPRYWHGFLSSRLFLRELI  223
             WK+LWP +RRRQREFFCFGMD+LLKLDL  TRRFF+AFFDLEP YWHGFLSSRLFL EL+
Sbjct  390   WKELWPTDRRRQREFFCFGMDVLLKLDLQGTRRFFNAFFDLEPHYWHGFLSSRLFLPELL  449

Query  222   FFGLSLFSHASNTSRLEIMTKGTLPLVNMINNLLQD  115
              FGLSLF+HAS TS+LEIM KGT+PL  M+ NL+QD
Sbjct  450   MFGLSLFAHASTTSKLEIMAKGTVPLAKMVGNLIQD  485



>dbj|BAD16478.1| putative lycopene beta-cyclase [Oryza sativa Japonica Group]
Length=489

 Score =   661 bits (1705),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/458 (71%), Positives = 380/458 (83%), Gaps = 4/458 (1%)
 Frame = -2

Query  1470  VGRVKASSSALLELVPVTKKENLDFELPMFEPSKGIvvdlavvgggpaglavaqqVSQAG  1291
             V R  A+  AL  L P ++ E L  +LP ++P++   VDLAVVGGGPAGLAVAQ+V++AG
Sbjct  31    VCRAAAAGEALRSLAPPSRPELLSLDLPRYDPARSTPVDLAVVGGGPAGLAVAQRVAEAG  90

Query  1290  LSVCSIDPSPKLIWPNNYGVWVDEFEAMDLLDCLDTTWSGAMVYI-DDRTTKDLDRPYGR  1114
             LSVC+IDPSP L+WPNNYGVWVDEF+AM L  CLD  W  A V+  DD   K L RPY R
Sbjct  91    LSVCAIDPSPALVWPNNYGVWVDEFDAMGLSHCLDAVWPSATVFTHDDGAAKSLHRPYAR  150

Query  1113  VNRKKLKSKMMQKCITNGVKFHQAKVIKVIHEESKSMLICSDGVTIQATVVLDATGFSRC  934
             V R+KLKS MM +C+ +GV FH+A+V+K +H E+ S+LIC DGV + ATVVLDATGFSRC
Sbjct  151   VARRKLKSTMMDRCVAHGVTFHKARVVKAVHGEASSLLICDDGVAVPATVVLDATGFSRC  210

Query  933   LVQYDKPYNPGYQVAYGILAEVEEHPYDLNKMVFMDWRDSHLNSNLELKERNKRIPTFLY  754
             LVQYDKPY+PGYQVAYGILAEV+ HP+D++KM+FMDWRD+HL    E++ERN+RIPTFLY
Sbjct  211   LVQYDKPYDPGYQVAYGILAEVDGHPFDIDKMLFMDWRDAHLPEGSEIRERNRRIPTFLY  270

Query  753   AMPFSSTRIFLEETSLVARPGLDMKDIQERMVARLRHLGINVKSIEEDERCVIPMGGPLP  574
             AMPFS TRIFLEETSLVARPGL M DIQERM ARLRHLGI V+++EEDERCVIPMGGPLP
Sbjct  271   AMPFSPTRIFLEETSLVARPGLAMDDIQERMAARLRHLGIRVRAVEEDERCVIPMGGPLP  330

Query  573   VIPQRVVGIGGTAGMVHPSTGYMVARTLAAAPVVANAIIQYLGS---ERSLLGNELSASV  403
             V+PQRVVGIGGTAGMVHPSTGYMVARTLA AP+VA+AI+++L +   + +  G+ LSA V
Sbjct  331   VLPQRVVGIGGTAGMVHPSTGYMVARTLATAPIVADAIVRFLDTGSGDSAFAGDALSAEV  390

Query  402   WKDLWPIERRRQREFFCFGMDILLKLDLPATRRFFDAFFDLEPRYWHGFLSSRLFLRELI  223
             W++LWP +RRRQREFFCFGMDILLKLDL  TRRFFDAFFDLEPRYWHGFLSSRLFL EL 
Sbjct  391   WRELWPAQRRRQREFFCFGMDILLKLDLDGTRRFFDAFFDLEPRYWHGFLSSRLFLPELA  450

Query  222   FFGLSLFSHASNTSRLEIMTKGTLPLVNMINNLLQDID  109
              FGLSLF+ ASNTSRLEIM KGT PL  MI NL+QD D
Sbjct  451   MFGLSLFAKASNTSRLEIMAKGTAPLAKMIGNLIQDRD  488



>ref|XP_010233950.1| PREDICTED: lycopene beta cyclase, chloroplastic [Brachypodium 
distachyon]
Length=491

 Score =   661 bits (1705),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/446 (72%), Positives = 380/446 (85%), Gaps = 2/446 (0%)
 Frame = -2

Query  1440  LLELVPVTKKENLDFELPMFEPSKGIvvdlavvgggpaglavaqqVSQAGLSVCSIDPSP  1261
             L  L P  + E L  +LP ++P++   VDLA+VGGGPAGLAVAQ+V++AGLSVCSIDPSP
Sbjct  45    LRSLAPPPRPELLSLDLPRYDPARSRPVDLAIVGGGPAGLAVAQRVAEAGLSVCSIDPSP  104

Query  1260  KLIWPNNYGVWVDEFEAMDLLDCLDTTWSGAMVYIDDRTT-KDLDRPYGRVNRKKLKSKM  1084
              L+WPNNYGVWVDEFEAM L DCLDT W  A V+IDD T  K LDRPY RV R+KLKS M
Sbjct  105   GLVWPNNYGVWVDEFEAMGLADCLDTVWPSASVFIDDATPPKSLDRPYARVARRKLKSTM  164

Query  1083  MQKCITNGVKFHQAKVIKVIHEESKSMLICSDGVTIQATVVLDATGFSRCLVQYDKPYNP  904
             M +C+ +GV+FHQAKV+K +H ++ S+LIC DGV + ATVVLDATGFSRCLVQYDKPYNP
Sbjct  165   MDRCVAHGVRFHQAKVVKAVHNDASSLLICDDGVAVPATVVLDATGFSRCLVQYDKPYNP  224

Query  903   GYQVAYGILAEVEEHPYDLNKMVFMDWRDSHLNSNLELKERNKRIPTFLYAMPFSSTRIF  724
             GYQVAYGILAEV+ HP+D++KM+FMDWRDSHL     ++ERN R+PTFLYAMPFS T+IF
Sbjct  225   GYQVAYGILAEVDGHPFDIDKMLFMDWRDSHLPEGSAVRERNSRVPTFLYAMPFSPTKIF  284

Query  723   LEETSLVARPGLDMKDIQERMVARLRHLGINVKSIEEDERCVIPMGGPLPVIPQRVVGIG  544
             LEETSLVARPGL M DIQERM +RLRHLGI ++S+EEDERCVIPMGGPLPV+PQRVVGIG
Sbjct  285   LEETSLVARPGLAMDDIQERMASRLRHLGIRIRSVEEDERCVIPMGGPLPVLPQRVVGIG  344

Query  543   GTAGMVHPSTGYMVARTLAAAPVVANAIIQYLGSER-SLLGNELSASVWKDLWPIERRRQ  367
             GTAGMVHPSTGYMVARTLA AP+VA++I+++L S   S+ G+ L+A VWK+LWP +RRRQ
Sbjct  345   GTAGMVHPSTGYMVARTLATAPIVADSIVRFLDSGNGSITGDALAAEVWKELWPTDRRRQ  404

Query  366   REFFCFGMDILLKLDLPATRRFFDAFFDLEPRYWHGFLSSRLFLRELIFFGLSLFSHASN  187
             REFFCFGMD+LLKLDL  TRRFF+AFFDLEP YWHGFLSSRL+L EL+ FGLSLF+HASN
Sbjct  405   REFFCFGMDVLLKLDLQGTRRFFNAFFDLEPHYWHGFLSSRLYLPELMMFGLSLFAHASN  464

Query  186   TSRLEIMTKGTLPLVNMINNLLQDID  109
             TS+LEIM KGT+PL  M+ NL+QD D
Sbjct  465   TSKLEIMAKGTVPLAKMVGNLIQDRD  490



>ref|XP_002453448.1| hypothetical protein SORBIDRAFT_04g006120 [Sorghum bicolor]
 gb|EES06424.1| hypothetical protein SORBIDRAFT_04g006120 [Sorghum bicolor]
Length=492

 Score =   659 bits (1701),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/442 (74%), Positives = 372/442 (84%), Gaps = 3/442 (1%)
 Frame = -2

Query  1425  PVTKKENLDFELPMFEPSKGIvvdlavvgggpaglavaqqVSQAGLSVCSIDPSPKLIWP  1246
             P T+ E L  +LP ++P++   VDLAVVGGGPAGLAVAQ+V++AGLSVC+IDPSP ++WP
Sbjct  50    PPTRPELLSLDLPRYDPARARPVDLAVVGGGPAGLAVAQRVAEAGLSVCAIDPSPAVVWP  109

Query  1245  NNYGVWVDEFEAMDLLDCLDTTWSGAMVYIDDRTTKDLDRPYGRVNRKKLKSKMMQKCIT  1066
             NNYGVWVDEFEAM L  CLDT W  A V+I D   K LDRPY RV R+KLKS MM +C+ 
Sbjct  110   NNYGVWVDEFEAMGLSHCLDTVWPSASVFIGDGRAKSLDRPYARVARRKLKSTMMDRCVA  169

Query  1065  NGVKFHQAKVIKVIHEESKSMLICSDGVTIQATVVLDATGFSRCLVQYDKPYNPGYQVAY  886
             NGV FHQAKV K +H ++ S+LIC DGV + A+VVLDATGFSRCLVQYDKPYNPGYQVAY
Sbjct  170   NGVVFHQAKVAKAVHYDASSLLICDDGVAVPASVVLDATGFSRCLVQYDKPYNPGYQVAY  229

Query  885   GILAEVEEHPYDLNKMVFMDWRDSHLNSNLELKERNKRIPTFLYAMPFSSTRIFLEETSL  706
             GILAEV+ HP+D++KM+FMDWRDSHL    E++ERN+RIPTFLYAMPFS TRIFLEETSL
Sbjct  230   GILAEVDGHPFDIDKMLFMDWRDSHLPEGTEIRERNRRIPTFLYAMPFSPTRIFLEETSL  289

Query  705   VARPGLDMKDIQERMVARLRHLGINVKSIEEDERCVIPMGGPLPVIPQRVVGIGGTAGMV  526
             VARPGL M DIQERM ARLRHLGI V+S+EEDERCVIPMGGPLPV+PQRVVGIGGTAGMV
Sbjct  290   VARPGLAMDDIQERMAARLRHLGIRVRSVEEDERCVIPMGGPLPVLPQRVVGIGGTAGMV  349

Query  525   HPSTGYMVARTLAAAPVVANAIIQYLGSER---SLLGNELSASVWKDLWPIERRRQREFF  355
             HPSTGYMVARTLA AP+VA+AI+++L +      L G+ LSA VWK LWP  RRRQREFF
Sbjct  350   HPSTGYMVARTLATAPIVADAIVRFLDTGNGMGGLAGDALSAEVWKQLWPANRRRQREFF  409

Query  354   CFGMDILLKLDLPATRRFFDAFFDLEPRYWHGFLSSRLFLRELIFFGLSLFSHASNTSRL  175
             CFGMDILLKLDL  TRRFFDAFFDLEP YWHGFLSSRLFL EL+ FGL+LF +ASNTSRL
Sbjct  410   CFGMDILLKLDLEGTRRFFDAFFDLEPHYWHGFLSSRLFLPELLMFGLALFGNASNTSRL  469

Query  174   EIMTKGTLPLVNMINNLLQDID  109
             EIM KGT+PL  MI NL+QD D
Sbjct  470   EIMAKGTVPLGKMIGNLIQDRD  491



>ref|NP_001078131.1| lycopene beta cyclase [Arabidopsis thaliana]
 gb|AEE74875.1| lycopene beta cyclase [Arabidopsis thaliana]
Length=369

 Score =   654 bits (1687),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/369 (83%), Positives = 338/369 (92%), Gaps = 2/369 (1%)
 Frame = -2

Query  1209  MDLLDCLDTTWSGAMVYIDDRTTKDLDRPYGRVNRKKLKSKMMQKCITNGVKFHQAKVIK  1030
             MDLLDCLDTTWSGA+VY+D+   KDL RPYGRVNRK+LKSKM+QKCITNGVKFHQ+KV  
Sbjct  1     MDLLDCLDTTWSGAVVYVDEGVKKDLSRPYGRVNRKQLKSKMLQKCITNGVKFHQSKVTN  60

Query  1029  VIHEESKSMLICSDGVTIQATVVLDATGFSRCLVQYDKPYNPGYQVAYGILAEVEEHPYD  850
             V+HEE+ S ++CSDGV IQA+VVLDATGFSRCLVQYDKPYNPGYQVAYGI+AEV+ HP+D
Sbjct  61    VVHEEANSTVVCSDGVKIQASVVLDATGFSRCLVQYDKPYNPGYQVAYGIVAEVDGHPFD  120

Query  849   LNKMVFMDWRDSHLNSNLELKERNKRIPTFLYAMPFSSTRIFLEETSLVARPGLDMKDIQ  670
             ++KMVFMDWRD HL+S  ELKERN +IPTFLYAMPFSS RIFLEETSLVARPGL M+DIQ
Sbjct  121   VDKMVFMDWRDKHLDSYPELKERNSKIPTFLYAMPFSSNRIFLEETSLVARPGLRMEDIQ  180

Query  669   ERMVARLRHLGINVKSIEEDERCVIPMGGPLPVIPQRVVGIGGTAGMVHPSTGYMVARTL  490
             ERM ARL+HLGINVK IEEDERCVIPMGGPLPV+PQRVVGIGGTAGMVHPSTGYMVARTL
Sbjct  181   ERMAARLKHLGINVKRIEEDERCVIPMGGPLPVLPQRVVGIGGTAGMVHPSTGYMVARTL  240

Query  489   AAAPVVANAIIQYLG--SERSLLGNELSASVWKDLWPIERRRQREFFCFGMDILLKLDLP  316
             AAAP+VANAI++YLG  S  SL G++LSA VW+DLWPIERRRQREFFCFGMDILLKLDL 
Sbjct  241   AAAPIVANAIVRYLGSPSSNSLRGDQLSAEVWRDLWPIERRRQREFFCFGMDILLKLDLD  300

Query  315   ATRRFFDAFFDLEPRYWHGFLSSRLFLRELIFFGLSLFSHASNTSRLEIMTKGTLPLVNM  136
             ATRRFFDAFFDL+P YWHGFLSSRLFL EL+ FGLSLFSHASNTSRLEIMTKGT+PL  M
Sbjct  301   ATRRFFDAFFDLQPHYWHGFLSSRLFLPELLVFGLSLFSHASNTSRLEIMTKGTVPLAKM  360

Query  135   INNLLQDID  109
             INNL+QD D
Sbjct  361   INNLVQDRD  369



>gb|AFW70557.1| pink scutellum1 [Zea mays]
Length=459

 Score =   657 bits (1694),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/444 (73%), Positives = 372/444 (84%), Gaps = 5/444 (1%)
 Frame = -2

Query  1425  PVTKKENLDFELPMFEPSKGIvvdlavvgggpaglavaqqVSQAGLSVCSIDPSPKLIWP  1246
             P T+ E L  +LP ++P+    VDLAVVGGGPAGLAVAQ+V++AGLSVC+IDPSP ++WP
Sbjct  15    PPTRPELLSLDLPRYDPAPARPVDLAVVGGGPAGLAVAQRVAEAGLSVCAIDPSPAVVWP  74

Query  1245  NNYGVWVDEFEAMDLLDCLDTTWSGAMVYIDDRTTKDLDRPYGRVNRKKLKSKMMQKCIT  1066
             NNYGVWVDEFEAM L  CLDT W  A V+IDD   K LDRPY RV R+KLKS MM +C+ 
Sbjct  75    NNYGVWVDEFEAMGLSHCLDTVWPSASVFIDDGGAKSLDRPYARVARRKLKSTMMDRCVA  134

Query  1065  NGVKFHQAKVIKVIHEESKSMLICSDGVTIQATVVLDATGFSRCLVQYDKPYNPGYQVAY  886
             NGV FHQAKV K +H ++ S+LIC DGV + A+VVLDATGFSRCLVQYDKPYNPGYQVAY
Sbjct  135   NGVVFHQAKVAKAVHYDASSLLICDDGVAVPASVVLDATGFSRCLVQYDKPYNPGYQVAY  194

Query  885   GILAEVEEHPYDLNKMVFMDWRDSHLNSNLELKERNKRIPTFLYAMPFSSTRIFLEETSL  706
             GILAEV+ HP+D++KM+FMDWRDSHL    E++ERN+RIPTFLYAMPFS TRIFLEETSL
Sbjct  195   GILAEVDAHPFDIDKMLFMDWRDSHLPEGSEIRERNRRIPTFLYAMPFSPTRIFLEETSL  254

Query  705   VARPGLDMKDIQERMVARLRHLGINVKSIEEDERCVIPMGGPLPVIPQRVVGIGGTAGMV  526
             VARPGL M DIQERM ARLRHLGI V+S+EEDERCVIPMGGPLPV+PQRVVGIGGTAGMV
Sbjct  255   VARPGLAMDDIQERMAARLRHLGIRVRSVEEDERCVIPMGGPLPVLPQRVVGIGGTAGMV  314

Query  525   HPSTGYMVARTLAAAPVVANAIIQYLGSER-----SLLGNELSASVWKDLWPIERRRQRE  361
             HPSTGYMVARTLA AP+VA+AI+++L +        L G+ LSA VWK LWP  RRRQRE
Sbjct  315   HPSTGYMVARTLATAPIVADAIVRFLDTGTGNGMGGLAGDALSAEVWKQLWPANRRRQRE  374

Query  360   FFCFGMDILLKLDLPATRRFFDAFFDLEPRYWHGFLSSRLFLRELIFFGLSLFSHASNTS  181
             FFCFGMD+LLKLDL  TRRFFDAFFDLEP YWHGFLSSRLFL EL+ FGL+LF +ASN+S
Sbjct  375   FFCFGMDVLLKLDLEGTRRFFDAFFDLEPHYWHGFLSSRLFLPELLMFGLALFGNASNSS  434

Query  180   RLEIMTKGTLPLVNMINNLLQDID  109
             RLEIM KGT+PL  MI NL+QD D
Sbjct  435   RLEIMAKGTVPLGKMIGNLIQDRD  458



>ref|NP_001169155.1| uncharacterized protein LOC100383002 [Zea mays]
 gb|AAO18661.1| lycopene beta-cyclase [Zea mays]
 gb|ACN31790.1| unknown [Zea mays]
 gb|AFW70558.1| pink scutellum1 [Zea mays]
Length=490

 Score =   657 bits (1696),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/444 (73%), Positives = 372/444 (84%), Gaps = 5/444 (1%)
 Frame = -2

Query  1425  PVTKKENLDFELPMFEPSKGIvvdlavvgggpaglavaqqVSQAGLSVCSIDPSPKLIWP  1246
             P T+ E L  +LP ++P+    VDLAVVGGGPAGLAVAQ+V++AGLSVC+IDPSP ++WP
Sbjct  46    PPTRPELLSLDLPRYDPAPARPVDLAVVGGGPAGLAVAQRVAEAGLSVCAIDPSPAVVWP  105

Query  1245  NNYGVWVDEFEAMDLLDCLDTTWSGAMVYIDDRTTKDLDRPYGRVNRKKLKSKMMQKCIT  1066
             NNYGVWVDEFEAM L  CLDT W  A V+IDD   K LDRPY RV R+KLKS MM +C+ 
Sbjct  106   NNYGVWVDEFEAMGLSHCLDTVWPSASVFIDDGGAKSLDRPYARVARRKLKSTMMDRCVA  165

Query  1065  NGVKFHQAKVIKVIHEESKSMLICSDGVTIQATVVLDATGFSRCLVQYDKPYNPGYQVAY  886
             NGV FHQAKV K +H ++ S+LIC DGV + A+VVLDATGFSRCLVQYDKPYNPGYQVAY
Sbjct  166   NGVVFHQAKVAKAVHYDASSLLICDDGVAVPASVVLDATGFSRCLVQYDKPYNPGYQVAY  225

Query  885   GILAEVEEHPYDLNKMVFMDWRDSHLNSNLELKERNKRIPTFLYAMPFSSTRIFLEETSL  706
             GILAEV+ HP+D++KM+FMDWRDSHL    E++ERN+RIPTFLYAMPFS TRIFLEETSL
Sbjct  226   GILAEVDAHPFDIDKMLFMDWRDSHLPEGSEIRERNRRIPTFLYAMPFSPTRIFLEETSL  285

Query  705   VARPGLDMKDIQERMVARLRHLGINVKSIEEDERCVIPMGGPLPVIPQRVVGIGGTAGMV  526
             VARPGL M DIQERM ARLRHLGI V+S+EEDERCVIPMGGPLPV+PQRVVGIGGTAGMV
Sbjct  286   VARPGLAMDDIQERMAARLRHLGIRVRSVEEDERCVIPMGGPLPVLPQRVVGIGGTAGMV  345

Query  525   HPSTGYMVARTLAAAPVVANAIIQYLGSER-----SLLGNELSASVWKDLWPIERRRQRE  361
             HPSTGYMVARTLA AP+VA+AI+++L +        L G+ LSA VWK LWP  RRRQRE
Sbjct  346   HPSTGYMVARTLATAPIVADAIVRFLDTGTGNGMGGLAGDALSAEVWKQLWPANRRRQRE  405

Query  360   FFCFGMDILLKLDLPATRRFFDAFFDLEPRYWHGFLSSRLFLRELIFFGLSLFSHASNTS  181
             FFCFGMD+LLKLDL  TRRFFDAFFDLEP YWHGFLSSRLFL EL+ FGL+LF +ASN+S
Sbjct  406   FFCFGMDVLLKLDLEGTRRFFDAFFDLEPHYWHGFLSSRLFLPELLMFGLALFGNASNSS  465

Query  180   RLEIMTKGTLPLVNMINNLLQDID  109
             RLEIM KGT+PL  MI NL+QD D
Sbjct  466   RLEIMAKGTVPLGKMIGNLIQDRD  489



>gb|AAQ02668.1| lycopene cyclase [Setaria italica]
Length=594

 Score =   661 bits (1706),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 336/456 (74%), Positives = 383/456 (84%), Gaps = 1/456 (0%)
 Frame = -2

Query  1476  RNVGRVKASSSALLELVPVTKKENLDFELPMFEPSKGIvvdlavvgggpaglavaqqVSQ  1297
             R +G + A++  L++ VP T  E L+ +LP++ PSKG+ ++ +VVGGGP        + +
Sbjct  140   RRIGNLPANTIPLVDKVPDTNNEQLELDLPLYYPSKGLFMERSVVGGGPLAGCSTTSLRR  199

Query  1296  AGLSVCSIDPSPKLIWPNNYGVWVDEFEAMDLLDCLDTTWSGAMVYIDDRTTKDLDRPYG  1117
               L V SI+P PK  WPNNYGVW D+FE MDL DCLD TWSGA+VY DD +TK L RPYG
Sbjct  200   R-LLVGSIEPIPKQFWPNNYGVWDDDFEEMDLYDCLDATWSGAVVYADDGSTKHLQRPYG  258

Query  1116  RVNRKKLKSKMMQKCITNGVKFHQAKVIKVIHEESKSMLICSDGVTIQATVVLDATGFSR  937
             RV R  LKSK+MQKC++NGV FHQA+V+KVIHEE KS+LIC+ G+TI ATV LDATGFSR
Sbjct  259   RVKRNNLKSKVMQKCLSNGVTFHQARVLKVIHEEPKSLLICTHGLTIDATVALDATGFSR  318

Query  936   CLVQYDKPYNPGYQVAYGILAEVEEHPYDLNKMVFMDWRDSHLNSNLELKERNKRIPTFL  757
              LVQ DKPYNPGYQVAYGILAEVEEHP+D++KMVFMDWRDSHLN  ++LKER  ++PTFL
Sbjct  319   RLVQMDKPYNPGYQVAYGILAEVEEHPFDVDKMVFMDWRDSHLNGYVDLKERKDKMPTFL  378

Query  756   YAMPFSSTRIFLEETSLVARPGLDMKDIQERMVARLRHLGINVKSIEEDERCVIPMGGPL  577
             YAMPFSS RIFL+ETS VARPGL ++DIQERMVARL+HLGI VKSIEEDE CVIPMGGPL
Sbjct  379   YAMPFSSNRIFLDETSSVARPGLQLEDIQERMVARLKHLGIKVKSIEEDEPCVIPMGGPL  438

Query  576   PVIPQRVVGIGGTAGMVHPSTGYMVARTLAAAPVVANAIIQYLGSERSLLGNELSASVWK  397
             PV+PQRVVGIGGTAGMVHPSTGYMVARTLAAAP VAN+++QYLGSE SL GNELSA VWK
Sbjct  439   PVMPQRVVGIGGTAGMVHPSTGYMVARTLAAAPEVANSMVQYLGSESSLSGNELSAEVWK  498

Query  396   DLWPIERRRQREFFCFGMDILLKLDLPATRRFFDAFFDLEPRYWHGFLSSRLFLRELIFF  217
             D+WPIERRRQREFFCFGMDILLKLDL ATRRFFDAFFD EPRYWHGFLSS LFL EL+ F
Sbjct  499   DVWPIERRRQREFFCFGMDILLKLDLQATRRFFDAFFDPEPRYWHGFLSSGLFLPELLLF  558

Query  216   GLSLFSHASNTSRLEIMTKGTLPLVNMINNLLQDID  109
             GLSLFSHASNT   EIM KGT+PLVN IN+LL D D
Sbjct  559   GLSLFSHASNTCMFEIMAKGTVPLVNKINHLLHDKD  594



>ref|XP_006648400.1| PREDICTED: lycopene beta cyclase, chloroplastic-like, partial 
[Oryza brachyantha]
Length=423

 Score =   654 bits (1686),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/403 (75%), Positives = 343/403 (85%), Gaps = 5/403 (1%)
 Frame = -2

Query  1302  SQAGLSVCSIDPSPKLIWPNNYGVWVDEFEAMDLLDCLDTTWSGAMVYIDDRTTKDLDRP  1123
             ++AGLSVC+IDPSP L+WPNNYGVWVDEFEAM L  CLD  W  A V++DDR  K LDRP
Sbjct  20    AEAGLSVCAIDPSPALVWPNNYGVWVDEFEAMGLSHCLDAVWPSASVFVDDRRVKSLDRP  79

Query  1122  YGRVNRKKLKSKMMQKCITNGVKFHQAKVIKVIHEESKSMLICSDGVTIQATVVLDATGF  943
             Y RV R+KLKS MM +C+ +GV+FHQAKV+K +H E+ S+LIC DGV + ATVVLDATGF
Sbjct  80    YARVARRKLKSAMMDRCVAHGVRFHQAKVVKAVHNEASSLLICDDGVAVPATVVLDATGF  139

Query  942   SRCLVQYDKPYNPGYQVAYGILAEVEEHPYDLNKMVFMDWRDSHLNSNLELKERNKRIPT  763
             SRCLVQYDKPYNPGYQVAYGILAEV+EHP+D++KM+FMDWRDSHL    E+KERN+RIPT
Sbjct  140   SRCLVQYDKPYNPGYQVAYGILAEVDEHPFDIDKMLFMDWRDSHLPEGSEIKERNRRIPT  199

Query  762   FLYAMPFSSTRIFLEETSLVARPGLDMKDIQERMVARLRHLGINVKSIEEDERCVIPMGG  583
             FLYAMPFS TRIFLEETSLVARPGL M DIQERM ARLRHLGI V+S+EEDERCVIPMGG
Sbjct  200   FLYAMPFSPTRIFLEETSLVARPGLAMDDIQERMAARLRHLGIRVRSVEEDERCVIPMGG  259

Query  582   PLPVIPQRVVGIGGTAGMVHPSTGYMVARTLAAAPVVANAIIQYLGSERSLL-----GNE  418
             PLPV+PQRVVGIGGTAGMVHPSTGYMVARTLA APVVA++I+++L S           + 
Sbjct  260   PLPVLPQRVVGIGGTAGMVHPSTGYMVARTLATAPVVADSIVRFLDSGGGGGDIGSAXDA  319

Query  417   LSASVWKDLWPIERRRQREFFCFGMDILLKLDLPATRRFFDAFFDLEPRYWHGFLSSRLF  238
             LSA VW+ LWP +RRRQREFFCFGMDILLKLDL  TRRFFDAFFDLEP YWHGFLSSRLF
Sbjct  320   LSAEVWRQLWPADRRRQREFFCFGMDILLKLDLVGTRRFFDAFFDLEPHYWHGFLSSRLF  379

Query  237   LRELIFFGLSLFSHASNTSRLEIMTKGTLPLVNMINNLLQDID  109
             L EL+ FGLSLF++ASN SRLEIM KGT+PL  MI NL+QD D
Sbjct  380   LPELLMFGLSLFANASNPSRLEIMAKGTVPLAKMIGNLIQDRD  422



>ref|XP_004951617.1| PREDICTED: lycopene beta cyclase, chloroplastic-like [Setaria 
italica]
Length=495

 Score =   654 bits (1686),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 331/443 (75%), Positives = 372/443 (84%), Gaps = 4/443 (1%)
 Frame = -2

Query  1425  PVTKKENLDFELPMFEPSKGIvvdlavvgggpaglavaqqVSQAGLSVCSIDPSPKLIWP  1246
             P T+ E L  +LP ++PS+   VDLAVVGGGPAGLAVAQ+V++AGLSVC+IDPSP L+WP
Sbjct  52    PPTQPELLSLDLPRYDPSRARPVDLAVVGGGPAGLAVAQRVAEAGLSVCAIDPSPALVWP  111

Query  1245  NNYGVWVDEFEAMDLLDCLDTTWSGAMVYIDDRTT-KDLDRPYGRVNRKKLKSKMMQKCI  1069
             NNYGVWVDEFEAM L  CLDT W  A V+I D  + K LDRPY RV R+KLKS MM +C+
Sbjct  112   NNYGVWVDEFEAMGLSHCLDTVWPSASVFIGDGASPKSLDRPYARVARRKLKSAMMDRCV  171

Query  1068  TNGVKFHQAKVIKVIHEESKSMLICSDGVTIQATVVLDATGFSRCLVQYDKPYNPGYQVA  889
              NGV FHQAKV K +H ++ S+LIC DGV + ATVVLDATGFSRCLVQYDKPYNPGYQVA
Sbjct  172   ANGVVFHQAKVAKAVHHDASSLLICDDGVAVPATVVLDATGFSRCLVQYDKPYNPGYQVA  231

Query  888   YGILAEVEEHPYDLNKMVFMDWRDSHLNSNLELKERNKRIPTFLYAMPFSSTRIFLEETS  709
             YGILAEV+ HP+D++KM+FMDWRDSHL    E+KERN+RIPTFLYAMPFS TRIFLEETS
Sbjct  232   YGILAEVDGHPFDIDKMLFMDWRDSHLPEGSEIKERNRRIPTFLYAMPFSPTRIFLEETS  291

Query  708   LVARPGLDMKDIQERMVARLRHLGINVKSIEEDERCVIPMGGPLPVIPQRVVGIGGTAGM  529
             LVARPGL M DIQERM ARLRHLGI V+S+EEDERCVIPMGGPLPV+PQRVVGIGGTAGM
Sbjct  292   LVARPGLAMDDIQERMAARLRHLGIRVRSVEEDERCVIPMGGPLPVLPQRVVGIGGTAGM  351

Query  528   VHPSTGYMVARTLAAAPVVANAIIQYLG---SERSLLGNELSASVWKDLWPIERRRQREF  358
             VHPSTGYMVARTLA AP+VA+AI+++L        L G+ LSA VWK LWP  RRRQREF
Sbjct  352   VHPSTGYMVARTLATAPIVADAIVRFLDTGGGAAGLTGDALSAEVWKQLWPANRRRQREF  411

Query  357   FCFGMDILLKLDLPATRRFFDAFFDLEPRYWHGFLSSRLFLRELIFFGLSLFSHASNTSR  178
             FCFGMDILLKLDL  TRRFFDAFFDLEP YWHGFLSSRLFL EL+ FGL+LF +ASNTSR
Sbjct  412   FCFGMDILLKLDLEGTRRFFDAFFDLEPHYWHGFLSSRLFLPELLMFGLTLFGNASNTSR  471

Query  177   LEIMTKGTLPLVNMINNLLQDID  109
             LEIM KGT+PL  MI NL+QD D
Sbjct  472   LEIMAKGTVPLGKMIGNLIQDRD  494



>sp|D9IL23.1|LCYB_ONCHC RecName: Full=Lycopene beta cyclase, chloroplastic; Short=OgLCY-B; 
Flags: Precursor [Oncidium hybrid cultivar]
 gb|ADJ67814.1| lycopene beta-cyclase [Oncidium hybrid cultivar]
Length=472

 Score =   649 bits (1674),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/444 (73%), Positives = 375/444 (84%), Gaps = 4/444 (1%)
 Frame = -2

Query  1440  LLELVPVTKKENLDFELPMFEPSKGIvvdlavvgggpaglavaqqVSQAGLSVCSIDPSP  1261
              L+L+P TKKE LDF+LP +       +DLAVVGGGPAGLAVA++VS AGLSVCSIDP P
Sbjct  33    FLQLIPQTKKETLDFDLPRYNTLISPTLDLAVVGGGPAGLAVAKRVSDAGLSVCSIDPYP  92

Query  1260  KLIWPNNYGVWVDEFEAMDLLDCLDTTWSGAMVYIDDRTTKDLDRPYGRVNRKKLKSKMM  1081
              L+WPNNYGVWVDEF AMDLLDC+D +W+ A V+IDD   K L RPY RV+R++LKS+++
Sbjct  93    NLVWPNNYGVWVDEFAAMDLLDCIDASWNSASVFIDDNNRKLLSRPYARVDRRRLKSRLL  152

Query  1080  QKCITNGVKFHQAKVIKVIHEESKSMLICSDGVTIQATVVLDATGFSRCLVQYDKPYNPG  901
                ++NGV+FHQ+KV+ V+HEE+KS+L+CSDG  I A VVLDATGFSRCLVQY +PYNPG
Sbjct  153   NAYLSNGVRFHQSKVLNVVHEEAKSVLLCSDGTRIPAAVVLDATGFSRCLVQYQQPYNPG  212

Query  900   YQVAYGILAEVEEHPYDLNKMVFMDWRDSHLNSNLELKERNKRIPTFLYAMPFSSTRIFL  721
             YQVAYGILAEVEEHP++L++MVFMDWRDSHL    ELK+RN  +PTFLYAMPFSS  IFL
Sbjct  213   YQVAYGILAEVEEHPFELDQMVFMDWRDSHLGFRPELKKRNDGLPTFLYAMPFSSDLIFL  272

Query  720   EETSLVARPGLDMKDIQERMVARLRHLGINVKSIEEDERCVIPMGGPLPVIPQRVVGIGG  541
             EETSLVARPGL ++DIQERM+ RLRHLGI +K IEEDERCVIPMGGPLPV+PQRV+GIGG
Sbjct  273   EETSLVARPGLLIEDIQERMIERLRHLGIRIKRIEEDERCVIPMGGPLPVLPQRVLGIGG  332

Query  540   TAGMVHPSTGYMVARTLAAAPVVANAIIQYLGSERSLLGNELSASVWKDLWPIERRRQRE  361
             TAGMVHPSTGYMVARTLAAAP+VA+AI+ Y+G      G E+SA VWKDLWPIERRRQRE
Sbjct  333   TAGMVHPSTGYMVARTLAAAPIVADAIVGYIGGS----GAEVSARVWKDLWPIERRRQRE  388

Query  360   FFCFGMDILLKLDLPATRRFFDAFFDLEPRYWHGFLSSRLFLRELIFFGLSLFSHASNTS  181
             FFCFGMD+LLKLDL  TRRFFDAFF LE RYWHGFLSSRLFL EL+ FG SLF  AS   
Sbjct  389   FFCFGMDVLLKLDLEGTRRFFDAFFGLEERYWHGFLSSRLFLPELVGFGFSLFGRASAGC  448

Query  180   RLEIMTKGTLPLVNMINNLLQDID  109
             RLEIM KGT+PL+ MI NLL+D++
Sbjct  449   RLEIMAKGTVPLIKMIRNLLKDLE  472



>ref|XP_002971295.1| hypothetical protein SELMODRAFT_147622 [Selaginella moellendorffii]
 gb|EFJ27893.1| hypothetical protein SELMODRAFT_147622 [Selaginella moellendorffii]
Length=450

 Score =   637 bits (1644),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/445 (73%), Positives = 374/445 (84%), Gaps = 5/445 (1%)
 Frame = -2

Query  1440  LLELVPVTKKENLDFELPMFEPSKGIvvdlavvgggpaglavaqqVSQAGLSVCSIDPSP  1261
             LLELVP  KKE+L +ELP+F PS+   +DL VVGGGPAGLAVA +VS AGLSVC IDP P
Sbjct  2     LLELVPERKKESLSYELPLFNPSRKGPLDLVVVGGGPAGLAVAARVSAAGLSVCCIDPCP  61

Query  1260  KLIWPNNYGVWVDEFEAMDLLDCLDTTWSGAMVYIDDRTTKDLDRPYGRVNRKKLKSKMM  1081
               IWPNNYGVWVDEFEA+DLLDCLD TW+ A+VYIDD   K L RPYGRVNRK+LK+KM 
Sbjct  62    LSIWPNNYGVWVDEFEALDLLDCLDHTWASAVVYIDDGVKKFLQRPYGRVNRKRLKAKMT  121

Query  1080  QKCITNGVKFHQAKVIKVIHEESKSMLICSDGVTIQATVVLDATGFSRCLVQYDKPYNPG  901
             ++CI NGV+F   KV  V+H+  KS + C DG  +++ +VLDATGFS+CLVQYD+P+NPG
Sbjct  122   EQCIANGVQFLATKVKNVVHDREKSRVACEDGTCLESALVLDATGFSKCLVQYDQPFNPG  181

Query  900   YQVAYGILAEVEEHPYDLNKMVFMDWRDSHLNSNLELKERNKRIPTFLYAMPFSSTRIFL  721
             YQVAYGI+AEV+ HP+DL+KMVFMDWRDSHL  N E+   NK++PTFLYAMPFSST+IFL
Sbjct  182   YQVAYGIVAEVDSHPFDLDKMVFMDWRDSHLAGNPEMIRGNKKLPTFLYAMPFSSTKIFL  241

Query  720   EETSLVARPGLDMKDIQERMVARLRHLGINVKSIEEDERCVIPMGGPLPVIPQRVVGIGG  541
             EETSLVARPG+ +K+IQ+RM  RLRHLGI+VKSIEEDE CVIPMGG LPVIPQRV+GIGG
Sbjct  242   EETSLVARPGVPLKEIQKRMEVRLRHLGIHVKSIEEDEVCVIPMGGVLPVIPQRVLGIGG  301

Query  540   TAGMVHPSTGYMVARTLAAAPVVANAIIQYLGSER-----SLLGNELSASVWKDLWPIER  376
             TAG+VHPSTGYMVARTLAAAPVVA+AI++ LGS R     +LL ++LSA VW DLWPIER
Sbjct  302   TAGLVHPSTGYMVARTLAAAPVVADAIVRQLGSSRSSSSVTLLPDDLSAEVWADLWPIER  361

Query  375   RRQREFFCFGMDILLKLDLPATRRFFDAFFDLEPRYWHGFLSSRLFLRELIFFGLSLFSH  196
             +RQREFFCFGMDILLKLDL ATRRFF AFFDLEPR W GFLSSRL+L EL+ FGLSLF+H
Sbjct  362   KRQREFFCFGMDILLKLDLYATRRFFSAFFDLEPRLWQGFLSSRLYLPELVAFGLSLFAH  421

Query  195   ASNTSRLEIMTKGTLPLVNMINNLL  121
             A   SRLEIM KGT  LV M+NNL+
Sbjct  422   APAKSRLEIMAKGTPALVTMVNNLI  446



>dbj|BAF49055.1| lycopene beta-cyclase [Prunus mume]
Length=331

 Score =   631 bits (1627),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/331 (89%), Positives = 316/331 (95%), Gaps = 0/331 (0%)
 Frame = -2

Query  1245  NNYGVWVDEFEAMDLLDCLDTTWSGAMVYIDDRTTKDLDRPYGRVNRKKLKSKMMQKCIT  1066
             NNYGVWVDEFEAMDLLDCLDTTWS A+V+ID++T KDLDRPYGRVNRK+LKSKM+QKCI+
Sbjct  1     NNYGVWVDEFEAMDLLDCLDTTWSSAVVFIDEQTKKDLDRPYGRVNRKQLKSKMLQKCIS  60

Query  1065  NGVKFHQAKVIKVIHEESKSMLICSDGVTIQATVVLDATGFSRCLVQYDKPYNPGYQVAY  886
             NGVKFHQAKV KVIHEE KS+LIC+DGVTIQA VVLDATGFSRCLVQYDKPYNPGYQVAY
Sbjct  61    NGVKFHQAKVNKVIHEEEKSLLICNDGVTIQAAVVLDATGFSRCLVQYDKPYNPGYQVAY  120

Query  885   GILAEVEEHPYDLNKMVFMDWRDSHLNSNLELKERNKRIPTFLYAMPFSSTRIFLEETSL  706
             GILAEVEEHP+D++KMVFMDWRDSHLN+N+ELKERN RIPTFLYAMPFSS RIFLEETSL
Sbjct  121   GILAEVEEHPFDVDKMVFMDWRDSHLNNNIELKERNARIPTFLYAMPFSSNRIFLEETSL  180

Query  705   VARPGLDMKDIQERMVARLRHLGINVKSIEEDERCVIPMGGPLPVIPQRVVGIGGTAGMV  526
             VARPG+ MKDIQ+RMVARLRHLGI +KSIEEDE CVIPMGGPLPV+PQRVVGIGGTAGMV
Sbjct  181   VARPGVPMKDIQDRMVARLRHLGIKIKSIEEDEHCVIPMGGPLPVLPQRVVGIGGTAGMV  240

Query  525   HPSTGYMVARTLAAAPVVANAIIQYLGSERSLLGNELSASVWKDLWPIERRRQREFFCFG  346
             HPSTGYMVARTLAAAP+VANAI+QYLGS+R L GNELSA VWKDLWPIERRRQREFFCFG
Sbjct  241   HPSTGYMVARTLAAAPIVANAIVQYLGSDRILSGNELSAEVWKDLWPIERRRQREFFCFG  300

Query  345   MDILLKLDLPATRRFFDAFFDLEPRYWHGFL  253
             M ILLKLDL +TRRFF+AFFDLEPRYWHGFL
Sbjct  301   MAILLKLDLKSTRRFFNAFFDLEPRYWHGFL  331



>ref|XP_002961511.1| hypothetical protein SELMODRAFT_266613 [Selaginella moellendorffii]
 gb|EFJ36771.1| hypothetical protein SELMODRAFT_266613 [Selaginella moellendorffii]
Length=450

 Score =   634 bits (1636),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/445 (72%), Positives = 373/445 (84%), Gaps = 5/445 (1%)
 Frame = -2

Query  1440  LLELVPVTKKENLDFELPMFEPSKGIvvdlavvgggpaglavaqqVSQAGLSVCSIDPSP  1261
             LLELVP  KKE+L +ELP+F PS+   +DL VVGGGPAGLAVA +VS AGLSVC IDP P
Sbjct  2     LLELVPERKKESLSYELPLFNPSRKGPLDLVVVGGGPAGLAVAARVSAAGLSVCCIDPCP  61

Query  1260  KLIWPNNYGVWVDEFEAMDLLDCLDTTWSGAMVYIDDRTTKDLDRPYGRVNRKKLKSKMM  1081
               IWPNNYGVWVDEFEA+DLLDCLD TW+ A+VYIDD   K L RPYGRVNRK+LK+KM 
Sbjct  62    LSIWPNNYGVWVDEFEALDLLDCLDHTWASAVVYIDDGVKKFLQRPYGRVNRKRLKAKMT  121

Query  1080  QKCITNGVKFHQAKVIKVIHEESKSMLICSDGVTIQATVVLDATGFSRCLVQYDKPYNPG  901
             ++CI NGV+F   KV  V+H+  KS + C DG  +++ +VLDATGFS+CLVQYD+P+NPG
Sbjct  122   EQCIANGVQFLATKVKNVVHDREKSRVACEDGTCLESALVLDATGFSKCLVQYDQPFNPG  181

Query  900   YQVAYGILAEVEEHPYDLNKMVFMDWRDSHLNSNLELKERNKRIPTFLYAMPFSSTRIFL  721
             YQVAYGI+AEV+ HP+DL+KMVFMDWRDSHL  N E+   NK++PTFLYAMPFSST+IFL
Sbjct  182   YQVAYGIVAEVDSHPFDLDKMVFMDWRDSHLAGNPEMIRGNKKLPTFLYAMPFSSTKIFL  241

Query  720   EETSLVARPGLDMKDIQERMVARLRHLGINVKSIEEDERCVIPMGGPLPVIPQRVVGIGG  541
             EETSLVARPG+ +K+IQ+RM  RLRHLGI+VKSIEEDE CVIPMGG LPVIPQRV+GIGG
Sbjct  242   EETSLVARPGVPLKEIQKRMEVRLRHLGIHVKSIEEDEVCVIPMGGVLPVIPQRVLGIGG  301

Query  540   TAGMVHPSTGYMVARTLAAAPVVANAIIQYLGSER-----SLLGNELSASVWKDLWPIER  376
             TAG+VHPSTGYMVARTLAAAPVVA+AI++ LGS R     + L ++LSA VW DLWPIER
Sbjct  302   TAGLVHPSTGYMVARTLAAAPVVADAIVRQLGSSRSSSSVTHLPDDLSAEVWADLWPIER  361

Query  375   RRQREFFCFGMDILLKLDLPATRRFFDAFFDLEPRYWHGFLSSRLFLRELIFFGLSLFSH  196
             +RQREFFCFGMDILLKLDL ATRRFF AFFDLEPR W GFLSSRL+L EL+ FGLSLF+H
Sbjct  362   KRQREFFCFGMDILLKLDLYATRRFFSAFFDLEPRLWQGFLSSRLYLPELVAFGLSLFAH  421

Query  195   ASNTSRLEIMTKGTLPLVNMINNLL  121
             A   SRLEIM KGT  LV M+NNL+
Sbjct  422   APAKSRLEIMAKGTPALVTMVNNLI  446



>gb|ACI14295.1| lycopene beta-cyclase [Linum usitatissimum]
Length=329

 Score =   619 bits (1596),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/329 (87%), Positives = 312/329 (95%), Gaps = 0/329 (0%)
 Frame = -2

Query  1248  PNNYGVWVDEFEAMDLLDCLDTTWSGAMVYIDDRTTKDLDRPYGRVNRKKLKSKMMQKCI  1069
             PNNYGVWVDEFEAMDLLDCLDTTWSGA+VYID+++ KDL RPYGRVNRK+LKSKM+QKCI
Sbjct  1     PNNYGVWVDEFEAMDLLDCLDTTWSGAVVYIDEKSKKDLGRPYGRVNRKQLKSKMLQKCI  60

Query  1068  TNGVKFHQAKVIKVIHEESKSMLICSDGVTIQATVVLDATGFSRCLVQYDKPYNPGYQVA  889
              NGV FHQAKV+KVIHEESKS+LIC+DGVTIQA VVLDATGFSRCLVQYDKPYNPGYQVA
Sbjct  61    KNGVLFHQAKVVKVIHEESKSLLICNDGVTIQAAVVLDATGFSRCLVQYDKPYNPGYQVA  120

Query  888   YGILAEVEEHPYDLNKMVFMDWRDSHLNSNLELKERNKRIPTFLYAMPFSSTRIFLEETS  709
             YGILAEVEEHP+D++KM+FMDWRDSHL+ N ELKERN +IPTFLYAMPFS  RIFLEETS
Sbjct  121   YGILAEVEEHPFDVDKMLFMDWRDSHLDGNAELKERNGKIPTFLYAMPFSEDRIFLEETS  180

Query  708   LVARPGLDMKDIQERMVARLRHLGINVKSIEEDERCVIPMGGPLPVIPQRVVGIGGTAGM  529
             LVARPGL M+DIQERMVARLRHLGI VKSIEEDERCVIPMGGPLPV+PQRVVGIGGTAGM
Sbjct  181   LVARPGLRMEDIQERMVARLRHLGIKVKSIEEDERCVIPMGGPLPVLPQRVVGIGGTAGM  240

Query  528   VHPSTGYMVARTLAAAPVVANAIIQYLGSERSLLGNELSASVWKDLWPIERRRQREFFCF  349
             VHPSTGYMVARTLAAAP+VANAI+++LGS + + G++LS  VWKDLWPI+RRRQREFFCF
Sbjct  241   VHPSTGYMVARTLAAAPIVANAIVRFLGSHKGINGDDLSTEVWKDLWPIQRRRQREFFCF  300

Query  348   GMDILLKLDLPATRRFFDAFFDLEPRYWH  262
             GMDILLKLDLPATRRFFDAFFDLEPRYWH
Sbjct  301   GMDILLKLDLPATRRFFDAFFDLEPRYWH  329



>ref|XP_011621797.1| PREDICTED: lycopene beta cyclase, chloroplastic/chromoplastic 
isoform X2 [Amborella trichopoda]
Length=424

 Score =   608 bits (1567),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/426 (76%), Positives = 358/426 (84%), Gaps = 5/426 (1%)
 Frame = -2

Query  1611  MDTLLKTPNELEFLHPHHGFAVKA--SAFTSLKPQKQEIRIGSWKACRNVGRVKASSSAL  1438
             MDT++ T    +  +P H  + K   S+  S KP  Q       K     G V+A S AL
Sbjct  1     MDTIISTHRGHQS-YPFHYLSEKPIFSSLKSEKPASQAHPKQRKKPFYLDGHVRACS-AL  58

Query  1437  LELVPVTKKENLDFELPMFEPS-KGIvvdlavvgggpaglavaqqVSQAGLSVCSIDPSP  1261
             LELVP  KKENL FELP F+PS K IV+DL VVGGGPAGLAVAQ VS+AGLSVCSIDPSP
Sbjct  59    LELVPEIKKENLAFELPKFDPSLKNIVMDLVVVGGGPAGLAVAQLVSEAGLSVCSIDPSP  118

Query  1260  KLIWPNNYGVWVDEFEAMDLLDCLDTTWSGAMVYIDDRTTKDLDRPYGRVNRKKLKSKMM  1081
              L+WPNNYGVWVDEFEAMDLLDCLDTTWSGA+V+IDD  TK LDRPYGRVNR++LKSKMM
Sbjct  119   TLVWPNNYGVWVDEFEAMDLLDCLDTTWSGAVVFIDDTNTKFLDRPYGRVNRRQLKSKMM  178

Query  1080  QKCITNGVKFHQAKVIKVIHEESKSMLICSDGVTIQATVVLDATGFSRCLVQYDKPYNPG  901
             QKCI NGVKFHQAKV KV+HE+S+S+L C+DGVT+ A VVLDATGFSRCLVQYDK YNPG
Sbjct  179   QKCILNGVKFHQAKVYKVVHEDSQSVLFCNDGVTVHAKVVLDATGFSRCLVQYDKLYNPG  238

Query  900   YQVAYGILAEVEEHPYDLNKMVFMDWRDSHLNSNLELKERNKRIPTFLYAMPFSSTRIFL  721
             YQVAYGILAEVE HP+D++KMVFMDWRDSHL+   EL+ERN +IPTFLYAMPFSS RIFL
Sbjct  239   YQVAYGILAEVEGHPFDVDKMVFMDWRDSHLSGQKELRERNNKIPTFLYAMPFSSNRIFL  298

Query  720   EETSLVARPGLDMKDIQERMVARLRHLGINVKSIEEDERCVIPMGGPLPVIPQRVVGIGG  541
             EETSLVARPGL M+DI+ERMVAR +HLGI VKSIEEDERCVIPMGGPLPV+PQRVVGIGG
Sbjct  299   EETSLVARPGLAMEDIKERMVARFKHLGIRVKSIEEDERCVIPMGGPLPVLPQRVVGIGG  358

Query  540   TAGMVHPSTGYMVARTLAAAPVVANAIIQYLGSERSLLGNELSASVWKDLWPIERRRQRE  361
             TAGMVHPSTGYMVARTLAAAPVVANAI +YL SE   +G++LSA VWKDLWPIERR+QRE
Sbjct  359   TAGMVHPSTGYMVARTLAAAPVVANAIAKYLDSEGGGMGDDLSAKVWKDLWPIERRKQRE  418

Query  360   FFCFGM  343
             FFCF M
Sbjct  419   FFCFVM  424



>dbj|BAO27799.1| lycopene beta-cyclase [Marchantia polymorpha]
Length=562

 Score =   610 bits (1573),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/481 (64%), Positives = 374/481 (78%), Gaps = 32/481 (7%)
 Frame = -2

Query  1470  VGRVKASSSALLELVPVTKKENLDFELPMFEPSKGIvvdlavvgggpaglavaqqVSQAG  1291
             V  V+A+   LLE+ P  + + L++E+P+F+P K   VDL VVGGGPAGLAVAQ+VS  G
Sbjct  76    VCSVRAAGGTLLEMKPKVELKKLNYEIPIFDPRKSKAVDLVVVGGGPAGLAVAQRVSGQG  135

Query  1290  LSVCSIDPSPKLIWPNNYGVWVDEFEAMDLLDCLDTTWSGAMVYIDDRTTKDLDRPYGRV  1111
             LSVC IDP P+ +WPNNYGVWVDEFEAMDLLDCLD TW  A+VY+DD   K L RPYGRV
Sbjct  136   LSVCCIDPEPRSVWPNNYGVWVDEFEAMDLLDCLDYTWGSAVVYLDDDVKKLLQRPYGRV  195

Query  1110  NRKKLKSKMMQKCITNGVKFHQAKVIKVIHEESKSMLICSDGVTIQATVVLDATGFSRCL  931
             NR +LKSKM+++CITNGV+F+Q+KV  V H + +S ++C DG  I+  VVLDATG SR L
Sbjct  196   NRTRLKSKMIEQCITNGVQFYQSKVKHVTHSKDRSFVVCDDGFVIETAVVLDATGHSRRL  255

Query  930   VQYDKPYNPGYQVAYGILAEVEEHPYDLNKMVFMDWRDSHLNSNLELKERNKRIPTFLYA  751
             VQYDKP+NPGYQ+AYGI+AEV+ HP+DL+KM+FMDWRDSHLN   ELKE NK++PTFLYA
Sbjct  256   VQYDKPFNPGYQIAYGIVAEVDCHPFDLDKMLFMDWRDSHLNKYPELKESNKKLPTFLYA  315

Query  750   MPFSSTRIFLEETSLVARPGLDMKDIQERMVARLRHLGINVKSIEEDERCVIPMGGPLPV  571
             MPFS T+IFLEETSLVARPG+ ++ IQ+RM ARL+HLGINVKSIEEDE CVIPMGG LPV
Sbjct  316   MPFSPTKIFLEETSLVARPGVPLEVIQQRMEARLKHLGINVKSIEEDEVCVIPMGGVLPV  375

Query  570   IPQRVVGIGGTAGMVHPSTGYMVARTLAAAPVVANAIIQYLGS-----------------  442
             IPQRV+GIGGTAGMVHPSTGYMVARTLAAAP+VA+++++ LG                  
Sbjct  376   IPQRVLGIGGTAGMVHPSTGYMVARTLAAAPIVADSLVKRLGGASHPHISSNTVLGKEAE  435

Query  441   ---------------ERSLLGNELSASVWKDLWPIERRRQREFFCFGMDILLKLDLPATR  307
                             +   G+E++A VW DLWP+ER++QREFFCFGMD+LLKLDL  TR
Sbjct  436   PSSSQDEDIPTPPEPRKGPFGDEVAAGVWADLWPMERQQQREFFCFGMDVLLKLDLVGTR  495

Query  306   RFFDAFFDLEPRYWHGFLSSRLFLRELIFFGLSLFSHASNTSRLEIMTKGTLPLVNMINN  127
             RFFDAFFDL+  +W GFLSSRL+  ELI FG SLF+HA+NT++ EI+ KGT  L+NMI N
Sbjct  496   RFFDAFFDLDEHHWQGFLSSRLYFWELIGFGFSLFTHATNTAKAEIVVKGTPALLNMIKN  555

Query  126   L  124
             L
Sbjct  556   L  556



>gb|EAY84816.1| hypothetical protein OsI_06183 [Oryza sativa Indica Group]
Length=372

 Score =   582 bits (1499),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/371 (73%), Positives = 311/371 (84%), Gaps = 4/371 (1%)
 Frame = -2

Query  1209  MDLLDCLDTTWSGAMVYI-DDRTTKDLDRPYGRVNRKKLKSKMMQKCITNGVKFHQAKVI  1033
             M L  CLD  W  A V+  DD   K L RPY RV R+KLKS MM +C+ +GV FH+A+V+
Sbjct  1     MGLSHCLDAVWPSATVFTHDDGAAKSLHRPYARVARRKLKSTMMDRCVAHGVTFHKARVV  60

Query  1032  KVIHEESKSMLICSDGVTIQATVVLDATGFSRCLVQYDKPYNPGYQVAYGILAEVEEHPY  853
             K +H E+ S+LIC DGV + ATVVLDATGFSRCLVQYDKPY+PGYQVAYGILAEV+ HP+
Sbjct  61    KAVHGEASSLLICDDGVAVPATVVLDATGFSRCLVQYDKPYDPGYQVAYGILAEVDGHPF  120

Query  852   DLNKMVFMDWRDSHLNSNLELKERNKRIPTFLYAMPFSSTRIFLEETSLVARPGLDMKDI  673
             D++KM+FMDWRD+HL    E++ERN+RIPTFLYAMPFS TRIFLEETSLVARPGL M DI
Sbjct  121   DIDKMLFMDWRDAHLPEGSEIRERNRRIPTFLYAMPFSPTRIFLEETSLVARPGLAMDDI  180

Query  672   QERMVARLRHLGINVKSIEEDERCVIPMGGPLPVIPQRVVGIGGTAGMVHPSTGYMVART  493
             QERM ARLRHLGI V+++EEDERCVIPMGGPLPV+PQRVVGIGGTAGMVHPSTGYMVART
Sbjct  181   QERMAARLRHLGIRVRAVEEDERCVIPMGGPLPVLPQRVVGIGGTAGMVHPSTGYMVART  240

Query  492   LAAAPVVANAIIQYLGS---ERSLLGNELSASVWKDLWPIERRRQREFFCFGMDILLKLD  322
             LA AP+VA+AI+++L +   + +  G+ LSA VW++LWP +RRRQREFFCFGMDILLKLD
Sbjct  241   LATAPIVADAIVRFLDTGSGDSAFAGDALSAEVWRELWPAQRRRQREFFCFGMDILLKLD  300

Query  321   LPATRRFFDAFFDLEPRYWHGFLSSRLFLRELIFFGLSLFSHASNTSRLEIMTKGTLPLV  142
             L  TRRFFDAFFDLEPRYWHGFLSSRLFL EL  FGLSLF+ ASNTSRLEIM KGT PL 
Sbjct  301   LDGTRRFFDAFFDLEPRYWHGFLSSRLFLPELAMFGLSLFAKASNTSRLEIMAKGTAPLA  360

Query  141   NMINNLLQDID  109
              MI NL+QD D
Sbjct  361   KMIGNLIQDRD  371



>ref|XP_001762494.1| predicted protein [Physcomitrella patens]
 gb|EDQ72617.1| predicted protein [Physcomitrella patens]
Length=523

 Score =   575 bits (1482),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/444 (67%), Positives = 358/444 (81%), Gaps = 0/444 (0%)
 Frame = -2

Query  1449  SSALLELVPVTKKENLDFELPMFEPSKGIvvdlavvgggpaglavaqqVSQAGLSVCSID  1270
             +S+LLELVP   K+NL++EL  F+  K   VDL VVG GPAGLAVAQ+VS  G+ VC +D
Sbjct  71    ASSLLELVPPHVKKNLNYELLRFDTLKRKAVDLVVVGAGPAGLAVAQRVSGEGVDVCVVD  130

Query  1269  PSPKLIWPNNYGVWVDEFEAMDLLDCLDTTWSGAMVYIDDRTTKDLDRPYGRVNRKKLKS  1090
             P+P+ +WPNNYGVWVDEFE +DLLDCLD TW  A+VY+DD   K L+RPYGRVNR +LKS
Sbjct  131   PAPQSVWPNNYGVWVDEFEDLDLLDCLDYTWGSAVVYLDDARKKTLERPYGRVNRTRLKS  190

Query  1089  KMMQKCITNGVKFHQAKVIKVIHEESKSMLICSDGVTIQATVVLDATGFSRCLVQYDKPY  910
             KM++ CI NGV+FHQAKV  V H  SKS++ C DG  I+A VVLDATG SR LVQYDKP+
Sbjct  191   KMLEACIANGVQFHQAKVKDVDHNVSKSIVTCEDGTMIEAAVVLDATGHSRRLVQYDKPF  250

Query  909   NPGYQVAYGILAEVEEHPYDLNKMVFMDWRDSHLNSNLELKERNKRIPTFLYAMPFSSTR  730
             NPGYQ+AYGI+AEV+ HP+D++KM+FMDWRDSHL+ +  L + N  +PTFLYAMPFS+  
Sbjct  251   NPGYQIAYGIVAEVDSHPFDVDKMLFMDWRDSHLHGDKLLMDGNLELPTFLYAMPFSANH  310

Query  729   IFLEETSLVARPGLDMKDIQERMVARLRHLGINVKSIEEDERCVIPMGGPLPVIPQRVVG  550
             IFLEETSLVARPG+ M  IQ+RM  RL+HLGI+V+SIEEDE+CVIPMGG LPVIPQRV+G
Sbjct  311   IFLEETSLVARPGVPMDVIQKRMELRLKHLGIHVRSIEEDEKCVIPMGGVLPVIPQRVLG  370

Query  549   IGGTAGMVHPSTGYMVARTLAAAPVVANAIIQYLGSERSLLGNELSASVWKDLWPIERRR  370
             IGGTAGMVHPSTGYMVARTLAAAP++A ++I+ LG      G+EL+A VW DLWP+ER++
Sbjct  371   IGGTAGMVHPSTGYMVARTLAAAPLLAESVIKSLGDNAGPSGDELAAGVWADLWPLERQQ  430

Query  369   QREFFCFGMDILLKLDLPATRRFFDAFFDLEPRYWHGFLSSRLFLRELIFFGLSLFSHAS  190
             QR FFCFGM++LLKLDL  TRRFFDAFFDLE   W GFLSSRL+  ELI FGLSLF HA+
Sbjct  431   QRAFFCFGMEVLLKLDLAGTRRFFDAFFDLEAHLWQGFLSSRLYFIELIGFGLSLFKHAT  490

Query  189   NTSRLEIMTKGTLPLVNMINNLLQ  118
             N +R EI+  GT+PL  +I  + Q
Sbjct  491   NHARAEIVASGTVPLAKLILEVAQ  514



>ref|XP_001773285.1| predicted protein [Physcomitrella patens]
 gb|EDQ61975.1| predicted protein [Physcomitrella patens]
Length=456

 Score =   572 bits (1475),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/447 (67%), Positives = 358/447 (80%), Gaps = 3/447 (1%)
 Frame = -2

Query  1449  SSALLELVPVTKKENL-DFELPMFEPSKGIvvdlavvgggpaglavaqqVSQAGLSVCSI  1273
             +SALLELVP      L ++EL  F+ +K   V L VVG GPAGLAVAQ+VS+ G+SVC +
Sbjct  2     ASALLELVPPQMSTKLLNYELLRFDTAKRKAVGLVVVGAGPAGLAVAQRVSKEGVSVCVV  61

Query  1272  DPSPKLIWPNNYGVWVDEFEAMDLLDCLDTTWSGAMVYIDDRTTKDLDRPYGRVNRKKLK  1093
             DP+P+ +WPNNYGVWVDEFE +DLLDCLD TW+ A+VY+DD   K L+RPYGRVNR +LK
Sbjct  62    DPAPQSVWPNNYGVWVDEFEDLDLLDCLDYTWASAVVYLDDEKKKTLERPYGRVNRTRLK  121

Query  1092  SKMMQKCITNGVKFHQAKVIKVIHEESKSMLICSDGVTIQATVVLDATGFSRCLVQYDKP  913
             SKM++ CI NGV+FHQAKV  V H  S+S + C DG  I+A VVLDATG SR LV+YDKP
Sbjct  122   SKMLEACIANGVQFHQAKVKDVNHNLSESSVTCEDGTLIEAAVVLDATGHSRRLVKYDKP  181

Query  912   YNPGYQVAYGILAEVEEHPYDLNKMVFMDWRDSHLNSNLELKERNKRIPTFLYAMPFSST  733
             +NPGYQ+AYGI+AEV+ HP+D++KM+FMDWRDSHL  + EL E N ++PTFLYAMPFS+ 
Sbjct  182   FNPGYQIAYGIVAEVDSHPFDVDKMLFMDWRDSHLRGSRELMEGNLKLPTFLYAMPFSAN  241

Query  732   RIFLEETSLVARPGLDMKDIQERMVARLRHLGINVKSIEEDERCVIPMGGPLPVIPQRVV  553
              IFLEETSLVARPG+ M  IQ+RM  RL+HLGI V+SIEEDE+CVIPMGG LPVIPQRV+
Sbjct  242   HIFLEETSLVARPGVPMDVIQKRMELRLKHLGICVRSIEEDEKCVIPMGGVLPVIPQRVL  301

Query  552   GIGGTAGMVHPSTGYMVARTLAAAPVVANAIIQYLGSERS--LLGNELSASVWKDLWPIE  379
             GIGGTAGMVHPSTGYMVARTLAAAP++A ++IQ LG   +  L  +EL+A VW DLWP+ 
Sbjct  302   GIGGTAGMVHPSTGYMVARTLAAAPMLAESVIQRLGGSATSGLPCDELAAGVWADLWPLN  361

Query  378   RRRQREFFCFGMDILLKLDLPATRRFFDAFFDLEPRYWHGFLSSRLFLRELIFFGLSLFS  199
             R+RQR FFCFGMD+LLKLDL  TRRFFDAFFDLEP +W GFLSSRL+  ELI FGLSLF 
Sbjct  362   RQRQRAFFCFGMDVLLKLDLAGTRRFFDAFFDLEPHHWQGFLSSRLYFMELIGFGLSLFK  421

Query  198   HASNTSRLEIMTKGTLPLVNMINNLLQ  118
             HA+N +R EIM  G +PL  +I  + Q
Sbjct  422   HATNQARAEIMAIGAVPLFRLILEISQ  448



>gb|AEQ20869.1| putative chloroplast lycopene beta-cyclase, partial [Eriobotrya 
japonica]
Length=299

 Score =   557 bits (1436),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 255/299 (85%), Positives = 284/299 (95%), Gaps = 0/299 (0%)
 Frame = -2

Query  1236  GVWVDEFEAMDLLDCLDTTWSGAMVYIDDRTTKDLDRPYGRVNRKKLKSKMMQKCITNGV  1057
             GVWVDEFEAMD+LDCLDTTWSGA+VYID+ + KDL+RPYGRVNRK+LKSKM+QKCI+NGV
Sbjct  1     GVWVDEFEAMDMLDCLDTTWSGAVVYIDEESKKDLNRPYGRVNRKQLKSKMLQKCISNGV  60

Query  1056  KFHQAKVIKVIHEESKSMLICSDGVTIQATVVLDATGFSRCLVQYDKPYNPGYQVAYGIL  877
             KF QA+V KVIHEE KS+L C+DGVTIQA+VVLDATGFSRCLVQYDKPYNPGYQVAYGIL
Sbjct  61    KFRQARVTKVIHEEEKSLLTCNDGVTIQASVVLDATGFSRCLVQYDKPYNPGYQVAYGIL  120

Query  876   AEVEEHPYDLNKMVFMDWRDSHLNSNLELKERNKRIPTFLYAMPFSSTRIFLEETSLVAR  697
              EVEEHP+D+++M+FMDWRDSHLN+N+ELKERN RIPTFLYAMPFSS RIFLEETSLVAR
Sbjct  121   VEVEEHPFDVDEMLFMDWRDSHLNNNIELKERNGRIPTFLYAMPFSSNRIFLEETSLVAR  180

Query  696   PGLDMKDIQERMVARLRHLGINVKSIEEDERCVIPMGGPLPVIPQRVVGIGGTAGMVHPS  517
             PGL MKDIQERM ARL+HLGI VKSIEEDE CVIPMGGPLPV+PQRVVGIGGTAGMVHPS
Sbjct  181   PGLPMKDIQERMAARLKHLGIKVKSIEEDEHCVIPMGGPLPVLPQRVVGIGGTAGMVHPS  240

Query  516   TGYMVARTLAAAPVVANAIIQYLGSERSLLGNELSASVWKDLWPIERRRQREFFCFGMD  340
             TGYMVARTLAAAP+VA+AI+QYLGS+R+L GNE+SA +WKDLWPI+RRRQREFFCFGMD
Sbjct  241   TGYMVARTLAAAPIVADAIVQYLGSDRTLSGNEVSAEIWKDLWPIQRRRQREFFCFGMD  299



>ref|XP_010271593.1| PREDICTED: capsanthin/capsorubin synthase, chromoplast-like [Nelumbo 
nucifera]
Length=491

 Score =   546 bits (1407),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/440 (61%), Positives = 340/440 (77%), Gaps = 0/440 (0%)
 Frame = -2

Query  1443  ALLELVPVTKKENLDFELPMFEPSKGIvvdlavvgggpaglavaqqVSQAGLSVCSIDPS  1264
             + L+L P +K E LD +LP   PS+    D+ ++G GPAGL +A++VS  G+ VC IDPS
Sbjct  47    SFLDLKPESKPEFLDIDLPRHHPSERSQYDVVIIGAGPAGLRLAERVSDHGVQVCCIDPS  106

Query  1263  PKLIWPNNYGVWVDEFEAMDLLDCLDTTWSGAMVYIDDRTTKDLDRPYGRVNRKKLKSKM  1084
             P  +WPNNYGVWVDEFE+M L D LD TW    VY+DDR T+ LDRPYGRV+RK+LK+++
Sbjct  107   PLSMWPNNYGVWVDEFESMGLEDTLDKTWPMTTVYVDDRKTQYLDRPYGRVSRKRLKTRL  166

Query  1083  MQKCITNGVKFHQAKVIKVIHEESKSMLICSDGVTIQATVVLDATGFSRCLVQYDKPYNP  904
             ++ C+++GVKFH+AK +++ H+E  SM+ C DG  ++ ++++DA+GF+   ++YDKP N 
Sbjct  167   IEGCVSHGVKFHEAKALELEHQEFVSMVSCDDGCEVKGSLIVDASGFTSNFIEYDKPRNH  226

Query  903   GYQVAYGILAEVEEHPYDLNKMVFMDWRDSHLNSNLELKERNKRIPTFLYAMPFSSTRIF  724
             GYQ+A+GILAEV++HP+DLNKMV MDWRDSH+ S   ++ RN ++PTFLYAMPFSS  IF
Sbjct  227   GYQIAHGILAEVQDHPFDLNKMVLMDWRDSHMGSEPYMRARNDKVPTFLYAMPFSSNLIF  286

Query  723   LEETSLVARPGLDMKDIQERMVARLRHLGINVKSIEEDERCVIPMGGPLPVIPQRVVGIG  544
             LEETSLV+RP L   +++ RMVARLRHLGI VK + EDE+C+IPMGGPLP IPQRV+ IG
Sbjct  287   LEETSLVSRPVLPYMEVKRRMVARLRHLGIRVKRVFEDEKCLIPMGGPLPRIPQRVMAIG  346

Query  543   GTAGMVHPSTGYMVARTLAAAPVVANAIIQYLGSERSLLGNELSASVWKDLWPIERRRQR  364
             GTAG+VHPSTGYMVART+A APV+A AI++ LGS R + G +L   VW  LWP ERR  R
Sbjct  347   GTAGLVHPSTGYMVARTMALAPVLAEAIVECLGSTRMIRGKQLYQRVWNGLWPTERRCIR  406

Query  363   EFFCFGMDILLKLDLPATRRFFDAFFDLEPRYWHGFLSSRLFLRELIFFGLSLFSHASNT  184
             EF+ FGM+ LLKLDL  TRRFFDAFFDL+P YW GFLSSRL L EL    LSLF HASN 
Sbjct  407   EFYSFGMETLLKLDLNGTRRFFDAFFDLDPYYWQGFLSSRLSLGELALLSLSLFGHASNL  466

Query  183   SRLEIMTKGTLPLVNMINNL  124
             SRL+I+TK  LPL  M+ NL
Sbjct  467   SRLDIVTKCPLPLGRMVANL  486



>ref|XP_007015766.1| Lycopene cyclase [Theobroma cacao]
 gb|EOY33385.1| Lycopene cyclase [Theobroma cacao]
Length=496

 Score =   544 bits (1402),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/480 (58%), Positives = 350/480 (73%), Gaps = 6/480 (1%)
 Frame = -2

Query  1563  HHGFAVKASAFTSLKPQKQEIRIGSWKACRNVGRVKASSSALLELVPVTKKENLDFELPM  1384
             H  F    ++F S KP  +  R    +A   +   K  S   L+L P TK + LDF+L  
Sbjct  18    HLLFPSPTASFPSAKPHLRTSR----RAHHGINSSKFGS--FLDLKPETKPKCLDFDLTW  71

Query  1383  FEPSKGIvvdlavvgggpaglavaqqVSQAGLSVCSIDPSPKLIWPNNYGVWVDEFEAMD  1204
             F PS     D+ ++G GP GL +A+QVS+ G+ VC IDPSP  +WPNNYGVWVDEFE++ 
Sbjct  72    FNPSDRPCFDVIIIGTGPGGLRLAEQVSRYGIKVCCIDPSPLSMWPNNYGVWVDEFESLG  131

Query  1203  LLDCLDTTWSGAMVYIDDRTTKDLDRPYGRVNRKKLKSKMMQKCITNGVKFHQAKVIKVI  1024
             L DCLD TW    VYIDD  TK LDRPYGRV RKKLK+K+++ C++N VKFH+AKV KV 
Sbjct  132   LGDCLDKTWPMTCVYIDDNMTKYLDRPYGRVCRKKLKTKLLENCVSNSVKFHKAKVWKVK  191

Query  1023  HEESKSMLICSDGVTIQATVVLDATGFSRCLVQYDKPYNPGYQVAYGILAEVEEHPYDLN  844
             HEE +S + C DG  ++A++++DA+GF+   ++YDKP N GYQ+A+GILAEV+ HP+DL+
Sbjct  192   HEEFESAIECDDGSELKASLIVDASGFASSFIEYDKPRNHGYQIAHGILAEVDSHPFDLD  251

Query  843   KMVFMDWRDSHLNSNLELKERNKRIPTFLYAMPFSSTRIFLEETSLVARPGLDMKDIQER  664
             KMV MDWRDSHL +   L+  N +IPTFLYAMPF S+ IFLEETSLV+RP L   +I++R
Sbjct  252   KMVLMDWRDSHLGNEPYLRANNSKIPTFLYAMPFDSSLIFLEETSLVSRPVLSYMEIKKR  311

Query  663   MVARLRHLGINVKSIEEDERCVIPMGGPLPVIPQRVVGIGGTAGMVHPSTGYMVARTLAA  484
             MVARLRHLGI VK++ EDE+C+IPMGGPLP IPQ V+ IGG +G+VHPSTGYMVART+A 
Sbjct  312   MVARLRHLGIRVKTVIEDEKCLIPMGGPLPRIPQNVMAIGGISGVVHPSTGYMVARTMAL  371

Query  483   APVVANAIIQYLGSERSLLGNELSASVWKDLWPIERRRQREFFCFGMDILLKLDLPATRR  304
             APVVA AI + LGS R + G  L   VW  LWPIERR  RE+ CFGM+ LLKLDL  TR 
Sbjct  372   APVVAEAIAECLGSTRMIRGRPLYHKVWNGLWPIERRCTREYCCFGMETLLKLDLKGTRG  431

Query  303   FFDAFFDLEPRYWHGFLSSRLFLRELIFFGLSLFSHASNTSRLEIMTKGTLPLVNMINNL  124
             FF AFFDL+P +WHGFLSSRL L EL +   SLF HASN SRL+I++K  +PLV M+ NL
Sbjct  432   FFQAFFDLDPYFWHGFLSSRLSLTELAWLSASLFGHASNPSRLDIVSKCPVPLVRMLGNL  491



>ref|XP_012070159.1| PREDICTED: capsanthin/capsorubin synthase, chromoplast-like [Jatropha 
curcas]
 gb|KDP39845.1| hypothetical protein JCGZ_04190 [Jatropha curcas]
Length=495

 Score =   542 bits (1397),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/501 (56%), Positives = 363/501 (72%), Gaps = 16/501 (3%)
 Frame = -2

Query  1611  MDTLLKTPNELEFLHP----HHGFAVKASAFTSLKP-QKQEIRIGSWKACRNVGRVKASS  1447
             M TLLK  +      P    H    + +S  T++KP +K   RI S K            
Sbjct  1     MGTLLKLFSPPPLTKPSQINHPSSHILSSPKTNIKPSRKSHHRIHSSKY-----------  49

Query  1446  SALLELVPVTKKENLDFELPMFEPSKGIvvdlavvgggpaglavaqqVSQAGLSVCSIDP  1267
                L+L P +K E LDF+L  F+PS     D+ +VG GPAGL +A+QVS+ G+ VC +DP
Sbjct  50    GNFLDLKPESKPELLDFDLSWFDPSCRSSFDVIIVGTGPAGLRLAEQVSRFGIKVCCVDP  109

Query  1266  SPKLIWPNNYGVWVDEFEAMDLLDCLDTTWSGAMVYIDDRTTKDLDRPYGRVNRKKLKSK  1087
             SP  +WPNNYGVWVDEFE++ L+DCLD TWS A V+IDD+ TK LDRPYGRV+R KLK+K
Sbjct  110   SPLCMWPNNYGVWVDEFESLGLIDCLDKTWSMACVFIDDKKTKYLDRPYGRVSRNKLKTK  169

Query  1086  MMQKCITNGVKFHQAKVIKVIHEESKSMLICSDGVTIQATVVLDATGFSRCLVQYDKPYN  907
             +M+ C++N VKFH+AKV K+ H+E +S +IC DG  I+ ++++DA+GF    ++Y KP N
Sbjct  170   LMENCVSNSVKFHKAKVWKIDHQEFQSSVICDDGNEIRGSLIVDASGFGSNFIEYSKPRN  229

Query  906   PGYQVAYGILAEVEEHPYDLNKMVFMDWRDSHLNSNLELKERNKRIPTFLYAMPFSSTRI  727
              GYQ+A+G+LAEV+ HP+DL+KMV MDWRD+H+ +   L+  N +IPTFLYAMPF S  I
Sbjct  230   HGYQIAHGVLAEVDYHPFDLDKMVLMDWRDTHMGNEPYLRSSNSKIPTFLYAMPFDSNLI  289

Query  726   FLEETSLVARPGLDMKDIQERMVARLRHLGINVKSIEEDERCVIPMGGPLPVIPQRVVGI  547
             FLEETSLV+RP L  K+++ RMVARLRHLGI VK + EDE+C+IPMGGPLP+IPQ V+ I
Sbjct  290   FLEETSLVSRPVLSYKEVKTRMVARLRHLGIRVKKVIEDEKCLIPMGGPLPIIPQNVMAI  349

Query  546   GGTAGMVHPSTGYMVARTLAAAPVVANAIIQYLGSERSLLGNELSASVWKDLWPIERRRQ  367
             GG +G+VHPSTGYM+AR++A AP+VANAI++ LGS R + G  L   VW +LWP++RR  
Sbjct  350   GGISGVVHPSTGYMMARSMALAPLVANAIVECLGSTRMIRGRPLYNKVWNELWPLDRRCV  409

Query  366   REFFCFGMDILLKLDLPATRRFFDAFFDLEPRYWHGFLSSRLFLRELIFFGLSLFSHASN  187
             REF+ FGM+ LLKL+L  TR FFDAFFDL+P YW GFLSSRL LREL    LSLF +ASN
Sbjct  410   REFYSFGMETLLKLNLKGTRSFFDAFFDLDPYYWQGFLSSRLSLRELALLSLSLFGNASN  469

Query  186   TSRLEIMTKGTLPLVNMINNL  124
              SR +I+TK  +PLV M+ NL
Sbjct  470   LSRYDIVTKCPVPLVKMMGNL  490



>gb|KDO58141.1| hypothetical protein CISIN_1g010693mg [Citrus sinensis]
Length=503

 Score =   542 bits (1396),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 265/449 (59%), Positives = 331/449 (74%), Gaps = 2/449 (0%)
 Frame = -2

Query  1464  RVKASS-SALLELVPVTKKENLDFELPMFEPSKGIvvdlavvggg-paglavaqqVSQAG  1291
             R++ S     LEL P +  E LDF+LP F PS  I  D+ ++G G        Q  S+  
Sbjct  50    RIRTSKFGNFLELTPESVPEFLDFDLPWFHPSDRIRYDVIIIGTGPAGLRLAEQVSSRHS  109

Query  1290  LSVCSIDPSPKLIWPNNYGVWVDEFEAMDLLDCLDTTWSGAMVYIDDRTTKDLDRPYGRV  1111
             + VC +DPSP   WPNNYGVWVDEFE + L+DCLD TW    V+I+D  TK LDRPYGRV
Sbjct  110   VKVCCVDPSPLSTWPNNYGVWVDEFEDIGLVDCLDKTWPMTCVFINDHKTKYLDRPYGRV  169

Query  1110  NRKKLKSKMMQKCITNGVKFHQAKVIKVIHEESKSMLICSDGVTIQATVVLDATGFSRCL  931
             +R  LK+K+++ C++NGVKFH+AKV  V H+E +S ++C DG  I+A++++DA+GF+   
Sbjct  170   SRNILKTKLLENCVSNGVKFHKAKVWHVNHQEFESSIVCDDGNEIKASLIVDASGFASSF  229

Query  930   VQYDKPYNPGYQVAYGILAEVEEHPYDLNKMVFMDWRDSHLNSNLELKERNKRIPTFLYA  751
             V+YDKP N GYQ+A+GILAEVE HP+DL+KMV MDWRDSHL +   L+  N ++PTFLYA
Sbjct  230   VEYDKPRNHGYQIAHGILAEVESHPFDLDKMVLMDWRDSHLGNEPYLRASNLKLPTFLYA  289

Query  750   MPFSSTRIFLEETSLVARPGLDMKDIQERMVARLRHLGINVKSIEEDERCVIPMGGPLPV  571
             MPF S  +FLEETSLV+RP L  K+++ RM ARLRH+GI VK + EDE+C+IPMGGPLPV
Sbjct  290   MPFDSNLVFLEETSLVSRPVLSYKEVKRRMAARLRHMGIRVKRVIEDEKCLIPMGGPLPV  349

Query  570   IPQRVVGIGGTAGMVHPSTGYMVARTLAAAPVVANAIIQYLGSERSLLGNELSASVWKDL  391
             IPQ V+ IG T+G+VHPSTGYMVART+A AP +A+AI + LGS R + G  L   VW  L
Sbjct  350   IPQSVMAIGSTSGLVHPSTGYMVARTMALAPALADAIAECLGSTRMIRGRPLHQKVWNGL  409

Query  390   WPIERRRQREFFCFGMDILLKLDLPATRRFFDAFFDLEPRYWHGFLSSRLFLRELIFFGL  211
             WPI+RR  REF+ FGM+ LLKLDL  TRRFFDAFFDL P YWHGFLSSRL L EL    L
Sbjct  410   WPIDRRCNREFYSFGMETLLKLDLKGTRRFFDAFFDLNPYYWHGFLSSRLSLAELAGLSL  469

Query  210   SLFSHASNTSRLEIMTKGTLPLVNMINNL  124
             SLF HASN+SRL+I+TK  LPLV M+ NL
Sbjct  470   SLFGHASNSSRLDIVTKCPLPLVKMMGNL  498



>ref|XP_006424195.1| hypothetical protein CICLE_v10028245mg [Citrus clementina]
 sp|Q9SEA0.1|CCS_CITSI RecName: Full=Capsanthin/capsorubin synthase, chromoplast; Flags: 
Precursor [Citrus sinensis]
 gb|AAF18389.1|AF169241_1 capsanthin/capsorubin synthase [Citrus sinensis]
 gb|ACR09634.1| lycopene beta-cyclase [Citrus sinensis]
 gb|ESR37435.1| hypothetical protein CICLE_v10028245mg [Citrus clementina]
Length=503

 Score =   541 bits (1395),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/449 (59%), Positives = 332/449 (74%), Gaps = 2/449 (0%)
 Frame = -2

Query  1464  RVKASS-SALLELVPVTKKENLDFELPMFEPSKGIvvdlavvggg-paglavaqqVSQAG  1291
             R++ S     LEL P +  E LDF+LP F PS  I  D+ ++G G        Q  S+  
Sbjct  50    RIRTSKFGNFLELTPESVPEFLDFDLPWFHPSDRIRYDVIIIGTGPAGLRLAEQVSSRHS  109

Query  1290  LSVCSIDPSPKLIWPNNYGVWVDEFEAMDLLDCLDTTWSGAMVYIDDRTTKDLDRPYGRV  1111
             + VC +DPSP   WPNNYGVWVDEFE + L+DCLD TW    V+I+D  TK LDRPYGRV
Sbjct  110   VKVCCVDPSPLSTWPNNYGVWVDEFEDIGLVDCLDKTWPMTCVFINDHKTKYLDRPYGRV  169

Query  1110  NRKKLKSKMMQKCITNGVKFHQAKVIKVIHEESKSMLICSDGVTIQATVVLDATGFSRCL  931
             +R  LK+K+++ C++NGVKFH+AKV  V H+E +S ++C DG  I+A++++DA+GF+   
Sbjct  170   SRNILKTKLLENCVSNGVKFHKAKVWHVNHQEFESSIVCDDGNEIKASLIVDASGFASSF  229

Query  930   VQYDKPYNPGYQVAYGILAEVEEHPYDLNKMVFMDWRDSHLNSNLELKERNKRIPTFLYA  751
             V+YDKP N GYQ+A+GILAEVE HP+DL+KMV MDWRDSHL +   L+  N ++PTFLYA
Sbjct  230   VEYDKPRNHGYQIAHGILAEVESHPFDLDKMVLMDWRDSHLGNEPYLRASNLKLPTFLYA  289

Query  750   MPFSSTRIFLEETSLVARPGLDMKDIQERMVARLRHLGINVKSIEEDERCVIPMGGPLPV  571
             MPF S  +FLEETSLV+RP L  K+++ RM ARLRH+GI VK + EDE+C+IPMGGPLPV
Sbjct  290   MPFDSNLVFLEETSLVSRPVLSYKEVKSRMAARLRHMGIRVKRVIEDEKCLIPMGGPLPV  349

Query  570   IPQRVVGIGGTAGMVHPSTGYMVARTLAAAPVVANAIIQYLGSERSLLGNELSASVWKDL  391
             IPQ V+ IGGT+G++HP+TGYMVART+A AP +A+AI + LGS R + G  L   VW  L
Sbjct  350   IPQSVMAIGGTSGLIHPATGYMVARTMALAPALADAIAECLGSTRMIRGRPLHQKVWNGL  409

Query  390   WPIERRRQREFFCFGMDILLKLDLPATRRFFDAFFDLEPRYWHGFLSSRLFLRELIFFGL  211
             WPI+RR  REF+ FGM+ LLKLDL  TRRFFDAFFDL P YWHGFLSSRL L EL    L
Sbjct  410   WPIDRRCNREFYSFGMETLLKLDLKGTRRFFDAFFDLNPYYWHGFLSSRLSLAELAGLSL  469

Query  210   SLFSHASNTSRLEIMTKGTLPLVNMINNL  124
             SLF HASN+SRL+I+TK  +PLV M+ NL
Sbjct  470   SLFGHASNSSRLDIVTKCPVPLVKMMGNL  498



>dbj|BAM66327.1| LCYb2, partial [Citrus unshiu]
Length=478

 Score =   540 bits (1391),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 265/451 (59%), Positives = 333/451 (74%), Gaps = 2/451 (0%)
 Frame = -2

Query  1491  SWKACRNVGRVKASS-SALLELVPVTKKENLDFELPMFEPSKGIvvdlavvggg-pagla  1318
             S KA R+  R++ S     LEL P ++ E LDF+LP F PS  I  D+ ++G G      
Sbjct  28    SRKAGRHHRRIRTSKFGNFLELTPESEPELLDFDLPWFHPSDRIRYDVIIIGTGPAGLRL  87

Query  1317  vaqqVSQAGLSVCSIDPSPKLIWPNNYGVWVDEFEAMDLLDCLDTTWSGAMVYIDDRTTK  1138
               Q  S+ G+ VC +DPSP   WPNNYGVWVDEFE + L+DCLD TW    V+I+D  TK
Sbjct  88    AEQVSSRHGIKVCCVDPSPLSTWPNNYGVWVDEFEDIGLVDCLDKTWPMTCVFINDHKTK  147

Query  1137  DLDRPYGRVNRKKLKSKMMQKCITNGVKFHQAKVIKVIHEESKSMLICSDGVTIQATVVL  958
              LDRPYGRV+R  LK+K+++ C++NGVKFH+AKV  V H+E +S ++C DG  I+A++++
Sbjct  148   YLDRPYGRVSRNILKTKLLENCVSNGVKFHKAKVWHVNHQEFESSIVCDDGNEIKASLIV  207

Query  957   DATGFSRCLVQYDKPYNPGYQVAYGILAEVEEHPYDLNKMVFMDWRDSHLNSNLELKERN  778
             DA+GF+   V+YD+P N GYQ+A+GILAEVE HP+DL+KMV MDWRDSHL +   L+  N
Sbjct  208   DASGFASSFVEYDEPRNHGYQIAHGILAEVESHPFDLDKMVLMDWRDSHLGNEPYLRASN  267

Query  777   KRIPTFLYAMPFSSTRIFLEETSLVARPGLDMKDIQERMVARLRHLGINVKSIEEDERCV  598
              ++PTFLYAMPF S  +FLEETSLV+RP L  K+++ RM ARLRH+GI VK + EDE+C+
Sbjct  268   LKLPTFLYAMPFDSNLVFLEETSLVSRPVLSYKEVKRRMAARLRHMGIRVKRVIEDEKCL  327

Query  597   IPMGGPLPVIPQRVVGIGGTAGMVHPSTGYMVARTLAAAPVVANAIIQYLGSERSLLGNE  418
             IPMGGPLPVIPQ V+ IGGT+G+VHPSTGYMVART+A AP +A+AI + LGS R + G  
Sbjct  328   IPMGGPLPVIPQSVMAIGGTSGLVHPSTGYMVARTMALAPALADAIAECLGSTRMIRGRP  387

Query  417   LSASVWKDLWPIERRRQREFFCFGMDILLKLDLPATRRFFDAFFDLEPRYWHGFLSSRLF  238
             L   VW  LWPI+RR  REF+ FGM+ LLKLDL  TRRFFDAFFDL P YWHGFLSSRL 
Sbjct  388   LHQKVWNGLWPIDRRCNREFYSFGMETLLKLDLKGTRRFFDAFFDLNPHYWHGFLSSRLS  447

Query  237   LRELIFFGLSLFSHASNTSRLEIMTKGTLPL  145
             L EL    LSLF HASN+SR +I+TK  LPL
Sbjct  448   LAELAGLSLSLFGHASNSSRFDIVTKCPLPL  478



>gb|AJT59426.1| LCY2B [Citrus maxima]
Length=503

 Score =   539 bits (1389),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/449 (58%), Positives = 331/449 (74%), Gaps = 2/449 (0%)
 Frame = -2

Query  1464  RVKASS-SALLELVPVTKKENLDFELPMFEPSKGIvvdlavvggg-paglavaqqVSQAG  1291
             R++ S     LEL P +  E LDF+LP F PS  I  D+ ++G G        Q  S+  
Sbjct  50    RIRTSKFGNFLELTPESVPEFLDFDLPWFHPSDRIRYDVIIIGTGPAGLRLAEQVSSRHS  109

Query  1290  LSVCSIDPSPKLIWPNNYGVWVDEFEAMDLLDCLDTTWSGAMVYIDDRTTKDLDRPYGRV  1111
             + VC +DPSP   WPNNYGVWVDEFE + L+DCLD TW    V+I+D  TK LDRPYGRV
Sbjct  110   VKVCCVDPSPLSTWPNNYGVWVDEFEDIGLVDCLDKTWPMTCVFINDHKTKYLDRPYGRV  169

Query  1110  NRKKLKSKMMQKCITNGVKFHQAKVIKVIHEESKSMLICSDGVTIQATVVLDATGFSRCL  931
             +R  LK+K+++ C++NGVKFH+AKV  V H+E +S ++C DG  I+A++++DA+GF+   
Sbjct  170   SRNILKTKLLENCVSNGVKFHKAKVWHVNHQEFESSIVCDDGNEIKASLIVDASGFASSF  229

Query  930   VQYDKPYNPGYQVAYGILAEVEEHPYDLNKMVFMDWRDSHLNSNLELKERNKRIPTFLYA  751
             V+YDKP N GYQ+A+GILAEVE HP+DL+KMV MDWRDSHL +   L+  N ++PTFLYA
Sbjct  230   VEYDKPRNHGYQIAHGILAEVESHPFDLDKMVLMDWRDSHLGNEPYLRASNLKLPTFLYA  289

Query  750   MPFSSTRIFLEETSLVARPGLDMKDIQERMVARLRHLGINVKSIEEDERCVIPMGGPLPV  571
             MPF S  +FLEETSLV+RP L  K+++ RM AR RH+GI VK + EDE+C+IPMGGPLPV
Sbjct  290   MPFDSNLVFLEETSLVSRPVLSYKEVKSRMAARSRHMGIRVKRVIEDEKCLIPMGGPLPV  349

Query  570   IPQRVVGIGGTAGMVHPSTGYMVARTLAAAPVVANAIIQYLGSERSLLGNELSASVWKDL  391
             IPQ V+ IGGT+G++HP+TGYMVART+A AP +A+AI + LGS R + G  L   VW  L
Sbjct  350   IPQSVMAIGGTSGLIHPATGYMVARTMALAPALADAIAECLGSTRMIRGRPLHQKVWNGL  409

Query  390   WPIERRRQREFFCFGMDILLKLDLPATRRFFDAFFDLEPRYWHGFLSSRLFLRELIFFGL  211
             WPI+RR  REF+ FGM+ LLKLDL  TRRFFDAFFDL P YWHGFLSSRL L EL    L
Sbjct  410   WPIDRRCNREFYSFGMETLLKLDLKGTRRFFDAFFDLNPYYWHGFLSSRLSLAELAGLSL  469

Query  210   SLFSHASNTSRLEIMTKGTLPLVNMINNL  124
             SLF HASN+SRL+I+TK  +PLV M+ NL
Sbjct  470   SLFGHASNSSRLDIVTKCPVPLVKMMGNL  498



>gb|ACT09103.1| lycopene beta-cyclase [Cucumis sativus]
Length=294

 Score =   531 bits (1368),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 244/294 (83%), Positives = 275/294 (94%), Gaps = 0/294 (0%)
 Frame = -2

Query  1224  DEFEAMDLLDCLDTTWSGAMVYIDDRTTKDLDRPYGRVNRKKLKSKMMQKCITNGVKFHQ  1045
             DEFEAMDLLDCLDTTWSGA+V+ ++++TKDL RPYGRVNRK+LKSKM+QKCI+NGVKFH+
Sbjct  1     DEFEAMDLLDCLDTTWSGAVVFTNEQSTKDLSRPYGRVNRKQLKSKMLQKCISNGVKFHE  60

Query  1044  AKVIKVIHEESKSMLICSDGVTIQATVVLDATGFSRCLVQYDKPYNPGYQVAYGILAEVE  865
             AKVIKVIHEE KS++IC+DGVTIQA +VLDATGFSRCLVQY+KPYNPGYQVAYGILAEVE
Sbjct  61    AKVIKVIHEEFKSLIICNDGVTIQAAIVLDATGFSRCLVQYEKPYNPGYQVAYGILAEVE  120

Query  864   EHPYDLNKMVFMDWRDSHLNSNLELKERNKRIPTFLYAMPFSSTRIFLEETSLVARPGLD  685
             EHP+D+NKMVFMDWRDSHLN+N+ LK+RN +IPTFLYAMPFSS RIFLEETSLVARPGL 
Sbjct  121   EHPFDVNKMVFMDWRDSHLNNNMILKDRNSKIPTFLYAMPFSSNRIFLEETSLVARPGLQ  180

Query  684   MKDIQERMVARLRHLGINVKSIEEDERCVIPMGGPLPVIPQRVVGIGGTAGMVHPSTGYM  505
             M DIQERM ARL+HLGI VKSIEEDE CVIPMGGPLPV+PQRVVGIGGTAGMVHPSTGYM
Sbjct  181   MSDIQERMEARLKHLGIKVKSIEEDEHCVIPMGGPLPVLPQRVVGIGGTAGMVHPSTGYM  240

Query  504   VARTLAAAPVVANAIIQYLGSERSLLGNELSASVWKDLWPIERRRQREFFCFGM  343
             VARTLAAAP+VA+AI++ LGS+    G+ +S+ VWKDLWPIERRRQREFFCFGM
Sbjct  241   VARTLAAAPIVASAIVRCLGSDGRFRGDAISSEVWKDLWPIERRRQREFFCFGM  294



>ref|XP_006487912.1| PREDICTED: capsanthin/capsorubin synthase, chromoplast-like [Citrus 
sinensis]
 gb|ACR09635.1| lycopene beta-cyclase [Citrus x paradisi]
Length=503

 Score =   538 bits (1387),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/449 (59%), Positives = 329/449 (73%), Gaps = 2/449 (0%)
 Frame = -2

Query  1464  RVKASS-SALLELVPVTKKENLDFELPMFEPSKGIvvdlavvggg-paglavaqqVSQAG  1291
             R++ S     LEL P ++ E L F+LP F PS  I  D+ ++G G        Q  S+ G
Sbjct  50    RIRTSKFGNFLELTPESEPEFLVFDLPWFHPSDRIRYDVIIIGTGPAGLRLAEQVSSRHG  109

Query  1290  LSVCSIDPSPKLIWPNNYGVWVDEFEAMDLLDCLDTTWSGAMVYIDDRTTKDLDRPYGRV  1111
             + VC +DPSP   WPNNYGVWVDEFE + L+DCLD TW    V+I+D  TK LDRPYGRV
Sbjct  110   IKVCCVDPSPLSTWPNNYGVWVDEFEDIGLIDCLDKTWPMTCVFINDHKTKYLDRPYGRV  169

Query  1110  NRKKLKSKMMQKCITNGVKFHQAKVIKVIHEESKSMLICSDGVTIQATVVLDATGFSRCL  931
             +R  LK+K+++ C+ NGV+FH+AKV  V H+E +S ++C DG  I+A++++DA+GF+   
Sbjct  170   SRNILKTKLLENCVLNGVRFHKAKVWHVNHQEFESSIVCDDGNEIKASLIVDASGFASSF  229

Query  930   VQYDKPYNPGYQVAYGILAEVEEHPYDLNKMVFMDWRDSHLNSNLELKERNKRIPTFLYA  751
             V YDKP N GYQ+A+GILAEVE HP+DL+KMV MDWRDSHL +   L+  N ++PTFLYA
Sbjct  230   VDYDKPRNHGYQIAHGILAEVESHPFDLDKMVLMDWRDSHLGNEPYLRASNLKLPTFLYA  289

Query  750   MPFSSTRIFLEETSLVARPGLDMKDIQERMVARLRHLGINVKSIEEDERCVIPMGGPLPV  571
             MPF S  +FLEETSLV+RP L  K+++ RM ARLRH+GI VK + EDE+C+IPMGGPLPV
Sbjct  290   MPFDSNLVFLEETSLVSRPVLSYKEVKRRMAARLRHMGIRVKRVIEDEKCLIPMGGPLPV  349

Query  570   IPQRVVGIGGTAGMVHPSTGYMVARTLAAAPVVANAIIQYLGSERSLLGNELSASVWKDL  391
             IPQ V+ IG T+G+VHPSTGYMVART+A AP +A+AI + LGS R + G  L   VW  L
Sbjct  350   IPQSVMAIGSTSGLVHPSTGYMVARTMALAPALADAIAECLGSTRMIRGRPLHQKVWNGL  409

Query  390   WPIERRRQREFFCFGMDILLKLDLPATRRFFDAFFDLEPRYWHGFLSSRLFLRELIFFGL  211
             WPI+RR  REF+ FGM+ LLKLDL  TRRFFDAFFDL P YWHGFLSSRL L EL    L
Sbjct  410   WPIDRRCNREFYSFGMETLLKLDLKGTRRFFDAFFDLNPHYWHGFLSSRLSLAELAGLSL  469

Query  210   SLFSHASNTSRLEIMTKGTLPLVNMINNL  124
             SLF HASN+SR +I+TK  LPLV M+ NL
Sbjct  470   SLFGHASNSSRFDIVTKCPLPLVKMMGNL  498



>ref|XP_007205102.1| hypothetical protein PRUPE_ppa004650mg [Prunus persica]
 gb|EMJ06301.1| hypothetical protein PRUPE_ppa004650mg [Prunus persica]
Length=497

 Score =   538 bits (1385),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/439 (60%), Positives = 340/439 (77%), Gaps = 0/439 (0%)
 Frame = -2

Query  1440  LLELVPVTKKENLDFELPMFEPSKGIvvdlavvgggpaglavaqqVSQAGLSVCSIDPSP  1261
              L+L P +K E  DF+LP F+PS    +D+ ++G GPAGL +A+QVS  G+ VC +DPSP
Sbjct  54    FLDLKPESKPEFFDFDLPKFDPSSRSRLDVIIIGTGPAGLRLAEQVSSYGIKVCCVDPSP  113

Query  1260  KLIWPNNYGVWVDEFEAMDLLDCLDTTWSGAMVYIDDRTTKDLDRPYGRVNRKKLKSKMM  1081
               +WPNNYGVWVDEFE+++L +CLD TW  A V++DD  TK LDRPYGRV+RKKLK+ ++
Sbjct  114   LSMWPNNYGVWVDEFESLNLENCLDKTWPMACVHVDDNKTKYLDRPYGRVSRKKLKTLLL  173

Query  1080  QKCITNGVKFHQAKVIKVIHEESKSMLICSDGVTIQATVVLDATGFSRCLVQYDKPYNPG  901
             ++C++NGV+FH+AKV K+ H+E +S ++C DG  ++A++V+DA+GF+   ++Y+KP N G
Sbjct  174   ERCLSNGVQFHRAKVWKIQHQEFESSILCDDGNELKASLVVDASGFASSFIEYEKPRNHG  233

Query  900   YQVAYGILAEVEEHPYDLNKMVFMDWRDSHLNSNLELKERNKRIPTFLYAMPFSSTRIFL  721
             YQ+A+GILAEVEEHP+DL+KM+ MDWR+SHL +   L+  N + PTFLYAMPF S  +FL
Sbjct  234   YQIAHGILAEVEEHPFDLDKMLLMDWRNSHLGNEPYLRTSNSKFPTFLYAMPFDSNLVFL  293

Query  720   EETSLVARPGLDMKDIQERMVARLRHLGINVKSIEEDERCVIPMGGPLPVIPQRVVGIGG  541
             EETSLV+RP L   ++++RMVARLRHLGI VK I EDE+C+IPMGGPLP IPQ V+ IGG
Sbjct  294   EETSLVSRPVLSYIEVKKRMVARLRHLGIRVKRIIEDEKCLIPMGGPLPRIPQSVMAIGG  353

Query  540   TAGMVHPSTGYMVARTLAAAPVVANAIIQYLGSERSLLGNELSASVWKDLWPIERRRQRE  361
             T+G+VHPSTGYMVART+A AP++A AI + LGS R + G  L    W  LWPIERR  RE
Sbjct  354   TSGVVHPSTGYMVARTMALAPILAEAIAECLGSTRMIRGQPLYHKAWNGLWPIERRCVRE  413

Query  360   FFCFGMDILLKLDLPATRRFFDAFFDLEPRYWHGFLSSRLFLRELIFFGLSLFSHASNTS  181
             F+ FGM+ LLKLDL  +RRFFDAFFDL+P YWHGFLSSRL LREL    LSLF  AS  S
Sbjct  414   FYSFGMETLLKLDLDGSRRFFDAFFDLDPYYWHGFLSSRLSLRELALLSLSLFGRASFPS  473

Query  180   RLEIMTKGTLPLVNMINNL  124
             R +I+TK  LPLV ++ NL
Sbjct  474   RFDIVTKCPLPLVKLMGNL  492



>ref|XP_008229097.1| PREDICTED: capsanthin/capsorubin synthase, chromoplast-like [Prunus 
mume]
Length=497

 Score =   537 bits (1383),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/439 (60%), Positives = 339/439 (77%), Gaps = 0/439 (0%)
 Frame = -2

Query  1440  LLELVPVTKKENLDFELPMFEPSKGIvvdlavvgggpaglavaqqVSQAGLSVCSIDPSP  1261
              L+L P +K E  DF+LP F+PS    +D+ ++G GPAGL +A+QVS  G+ VC +DPSP
Sbjct  54    FLDLKPESKPEFFDFDLPKFDPSSRSRLDVIIIGTGPAGLRLAEQVSSYGIKVCCVDPSP  113

Query  1260  KLIWPNNYGVWVDEFEAMDLLDCLDTTWSGAMVYIDDRTTKDLDRPYGRVNRKKLKSKMM  1081
               +WPNNYGVWVDEFE+++L +CLD TW  A V++DD  TK LDRPYGRV+RKKLK+  +
Sbjct  114   LSMWPNNYGVWVDEFESLNLENCLDKTWPMACVHVDDNKTKYLDRPYGRVSRKKLKTLFL  173

Query  1080  QKCITNGVKFHQAKVIKVIHEESKSMLICSDGVTIQATVVLDATGFSRCLVQYDKPYNPG  901
             ++C++NGV+FH+AKV K+ H+E +S ++C DG  ++A++V+DA+GF+   ++Y+KP N G
Sbjct  174   ERCLSNGVQFHRAKVWKIQHQEFESSILCDDGNELKASLVVDASGFASSFIEYEKPRNHG  233

Query  900   YQVAYGILAEVEEHPYDLNKMVFMDWRDSHLNSNLELKERNKRIPTFLYAMPFSSTRIFL  721
             YQ+A+GILAEVEEHP+DL+KM+ MDWR+SHL +   L+  N + PTFLYAMPF S  +FL
Sbjct  234   YQIAHGILAEVEEHPFDLDKMLLMDWRNSHLGNEPYLRTSNSKFPTFLYAMPFDSNLVFL  293

Query  720   EETSLVARPGLDMKDIQERMVARLRHLGINVKSIEEDERCVIPMGGPLPVIPQRVVGIGG  541
             EETSLV+RP L   ++++RMVARLRHLGI VK I EDE+C+IPMGGPLP IPQ V+ IGG
Sbjct  294   EETSLVSRPVLSYIEVKKRMVARLRHLGIRVKRIIEDEKCLIPMGGPLPRIPQSVMAIGG  353

Query  540   TAGMVHPSTGYMVARTLAAAPVVANAIIQYLGSERSLLGNELSASVWKDLWPIERRRQRE  361
             T+G+VHPSTGYMVART+A AP++A AI + LGS R + G  L    W  LWPIERR  RE
Sbjct  354   TSGVVHPSTGYMVARTMALAPILAEAIAECLGSTRMIRGQPLYHKAWNGLWPIERRCVRE  413

Query  360   FFCFGMDILLKLDLPATRRFFDAFFDLEPRYWHGFLSSRLFLRELIFFGLSLFSHASNTS  181
             F+ FGM+ LLKLDL  +RRFFDAFFDL+P YWHGFLSSRL LREL    LSLF  AS  S
Sbjct  414   FYSFGMETLLKLDLDGSRRFFDAFFDLDPYYWHGFLSSRLSLRELALLSLSLFGRASFPS  473

Query  180   RLEIMTKGTLPLVNMINNL  124
             R +I+TK  LPLV ++ NL
Sbjct  474   RFDIVTKCPLPLVKLMGNL  492



>gb|ACJ66628.1| lycopene beta-cyclase [Actinidia chinensis]
Length=493

 Score =   536 bits (1381),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/469 (58%), Positives = 346/469 (74%), Gaps = 11/469 (2%)
 Frame = -2

Query  1530  TSLKPQKQEIRIGSWKACRNVGRVKASSSALLELVPVTKKENLDFELPMFEPSKGIvvdl  1351
             T   P+K+  +I     C   G         L+L P++K E+LDF+L   +PS     D+
Sbjct  31    TQTTPRKKHHKI----HCSKFGN-------FLDLKPISKPESLDFDLSWVDPSGRSRFDV  79

Query  1350  avvgggpaglavaqqVSQAGLSVCSIDPSPKLIWPNNYGVWVDEFEAMDLLDCLDTTWSG  1171
              ++G GPAGL +A++VS+ G+ VC +DPSP  +WPNNYGVWVDEFE++ L DCLD TW  
Sbjct  80    IIIGTGPAGLRLAERVSRYGIKVCCVDPSPLSMWPNNYGVWVDEFESLGLEDCLDKTWPV  139

Query  1170  AMVYIDDRTTKDLDRPYGRVNRKKLKSKMMQKCITNGVKFHQAKVIKVIHEESKSMLICS  991
             A V I+D  TK LDRPYGRV+RK+LK K+++ C++NGVKFHQAKV KV H+E +S + CS
Sbjct  140   ARVSINDHKTKYLDRPYGRVSRKELKMKLLEGCLSNGVKFHQAKVWKVEHQEFESFVECS  199

Query  990   DGVTIQATVVLDATGFSRCLVQYDKPYNPGYQVAYGILAEVEEHPYDLNKMVFMDWRDSH  811
             DG  ++A +V+DA+GFS    +YDKP N GYQ+A+GILAEV+ HP+DL+KMV MDWRD H
Sbjct  200   DGNELKACLVVDASGFSSSFTEYDKPRNHGYQIAHGILAEVDCHPFDLDKMVLMDWRDFH  259

Query  810   LNSNLELKERNKRIPTFLYAMPFSSTRIFLEETSLVARPGLDMKDIQERMVARLRHLGIN  631
             L S   ++  N R PTFLY MPF S  IFLEETSLV+RP L  +++++RMVARLRHLGI 
Sbjct  260   LGSEPCIRASNSRFPTFLYVMPFDSNLIFLEETSLVSRPVLSYREVKKRMVARLRHLGIR  319

Query  630   VKSIEEDERCVIPMGGPLPVIPQRVVGIGGTAGMVHPSTGYMVARTLAAAPVVANAIIQY  451
             VK+I EDE+C+IPMGGPLP IPQRVV IGG++G+VHPSTGYMVARTLA APV+A+AI + 
Sbjct  320   VKTIIEDEKCLIPMGGPLPRIPQRVVPIGGSSGLVHPSTGYMVARTLAIAPVLADAIAEC  379

Query  450   LGSERSLLGNELSASVWKDLWPIERRRQREFFCFGMDILLKLDLPATRRFFDAFFDLEPR  271
             LGS R + G  L   +W +LWP ERR  RE++ FGM+ LLKLDL  TR FFDAFFDL+P 
Sbjct  380   LGSTRMIRGMPLGHRLWNELWPFERRCVREYYSFGMETLLKLDLKGTRNFFDAFFDLDPH  439

Query  270   YWHGFLSSRLFLRELIFFGLSLFSHASNTSRLEIMTKGTLPLVNMINNL  124
             YW GFLSSRL + EL    LSLF HASN SR +I+TK  +PLV M+ NL
Sbjct  440   YWQGFLSSRLSIGELAMLSLSLFGHASNPSRFDIVTKCPVPLVKMMGNL  488



>gb|KJB35393.1| hypothetical protein B456_006G113300 [Gossypium raimondii]
Length=497

 Score =   534 bits (1376),  Expect = 2e-180, Method: Compositional matrix adjust.
 Identities = 267/439 (61%), Positives = 330/439 (75%), Gaps = 0/439 (0%)
 Frame = -2

Query  1440  LLELVPVTKKENLDFELPMFEPSKGIvvdlavvgggpaglavaqqVSQAGLSVCSIDPSP  1261
              L L P +K   LD +LP F PS     D+ ++G GP GL +A+QVSQ G+ VC +DPSP
Sbjct  54    FLHLKPESKPGCLDSDLPWFNPSDRPCFDVIIIGTGPGGLRLAEQVSQYGIKVCCVDPSP  113

Query  1260  KLIWPNNYGVWVDEFEAMDLLDCLDTTWSGAMVYIDDRTTKDLDRPYGRVNRKKLKSKMM  1081
                WPNNYGVWVDEFE++ L++CLD  W    VYIDD  TK LDRPYGRV+RK LK+K++
Sbjct  114   LSFWPNNYGVWVDEFESLGLVECLDKIWPMTCVYIDDHKTKYLDRPYGRVSRKILKTKLL  173

Query  1080  QKCITNGVKFHQAKVIKVIHEESKSMLICSDGVTIQATVVLDATGFSRCLVQYDKPYNPG  901
             + C++N VKFH+AKV +V HEE +S + C DG  ++A++++DA+GFS   V+YDKP N G
Sbjct  174   ENCVSNSVKFHKAKVWQVKHEEFESTIQCDDGGELKASLIVDASGFSSSFVEYDKPRNYG  233

Query  900   YQVAYGILAEVEEHPYDLNKMVFMDWRDSHLNSNLELKERNKRIPTFLYAMPFSSTRIFL  721
             YQ+A+GILAEV+ HP+DL+KMV MDWRDSHL +   L+  N ++ TFLYAMPF S  IFL
Sbjct  234   YQIAHGILAEVDSHPFDLDKMVLMDWRDSHLGNEPYLRVNNSKLATFLYAMPFDSNLIFL  293

Query  720   EETSLVARPGLDMKDIQERMVARLRHLGINVKSIEEDERCVIPMGGPLPVIPQRVVGIGG  541
             EETSLV+RP L   +I+ RM ARLRHLGI V+ + EDE+C+IPMGGPLP IPQ V+ IGG
Sbjct  294   EETSLVSRPVLSYSEIKRRMEARLRHLGIRVRRVIEDEKCLIPMGGPLPRIPQNVMAIGG  353

Query  540   TAGMVHPSTGYMVARTLAAAPVVANAIIQYLGSERSLLGNELSASVWKDLWPIERRRQRE  361
              +G+VHPSTGYMVART+A AP+VA AI + LGS R + G  L   VW  LWPIERR  RE
Sbjct  354   ISGVVHPSTGYMVARTMALAPLVAEAIAECLGSTRMIRGRPLYHKVWNGLWPIERRLSRE  413

Query  360   FFCFGMDILLKLDLPATRRFFDAFFDLEPRYWHGFLSSRLFLRELIFFGLSLFSHASNTS  181
             F CFGM+ LLKLDL  TR FF+AFFDL+P YWHGFLSSRL L EL  F LSLF HASN+S
Sbjct  414   FCCFGMETLLKLDLVGTRNFFEAFFDLDPYYWHGFLSSRLSLHELASFSLSLFGHASNSS  473

Query  180   RLEIMTKGTLPLVNMINNL  124
             RL+IM+K  +PLV M+ NL
Sbjct  474   RLDIMSKCPVPLVRMLGNL  492



>gb|ADZ28517.1| neoxanthin synthase [Camellia nitidissima]
Length=493

 Score =   533 bits (1374),  Expect = 3e-180, Method: Compositional matrix adjust.
 Identities = 263/439 (60%), Positives = 338/439 (77%), Gaps = 0/439 (0%)
 Frame = -2

Query  1440  LLELVPVTKKENLDFELPMFEPSKGIvvdlavvgggpaglavaqqVSQAGLSVCSIDPSP  1261
              L+L P++K E+LDF+L   +PS     D+ ++G GPAGL +A+QV+  G+ VC +DPSP
Sbjct  50    FLDLKPISKPESLDFDLSWVDPSTRSRFDVIIIGTGPAGLRLAEQVACHGIKVCCVDPSP  109

Query  1260  KLIWPNNYGVWVDEFEAMDLLDCLDTTWSGAMVYIDDRTTKDLDRPYGRVNRKKLKSKMM  1081
               +WPNNYGVWVD FE++ L DCLD TW  A V+I+D  TK LDR YGRV+RKKLK K++
Sbjct  110   LSMWPNNYGVWVDGFESLGLEDCLDKTWPMACVHINDHRTKYLDRAYGRVSRKKLKMKLL  169

Query  1080  QKCITNGVKFHQAKVIKVIHEESKSMLICSDGVTIQATVVLDATGFSRCLVQYDKPYNPG  901
             + C++N VKFHQAKV K  H+E +S ++CSDG  ++A++++DA+GF+   ++YDKP N G
Sbjct  170   EGCVSNNVKFHQAKVWKAEHKEFESSVVCSDGNELKASLIVDASGFASTFIEYDKPRNHG  229

Query  900   YQVAYGILAEVEEHPYDLNKMVFMDWRDSHLNSNLELKERNKRIPTFLYAMPFSSTRIFL  721
             YQ+A+GILAEV+ HP+DL+KM+ MDWRDSHL +  +++ RN  +PTFLYAMPF S  +FL
Sbjct  230   YQIAHGILAEVDCHPFDLDKMLLMDWRDSHLGNEPDIRARNSTLPTFLYAMPFDSNLVFL  289

Query  720   EETSLVARPGLDMKDIQERMVARLRHLGINVKSIEEDERCVIPMGGPLPVIPQRVVGIGG  541
             EETSLV+RP L   ++++RMVARLRHLGI VKS+ E+E+C+IPMGGPLP IPQ V+GIGG
Sbjct  290   EETSLVSRPVLSYMEVKKRMVARLRHLGIKVKSVIEEEKCLIPMGGPLPRIPQSVMGIGG  349

Query  540   TAGMVHPSTGYMVARTLAAAPVVANAIIQYLGSERSLLGNELSASVWKDLWPIERRRQRE  361
             TAG+VHPSTGYMVARTLA APV+A+ I + LGS R + G  L   VW  LWP+E+R  RE
Sbjct  350   TAGIVHPSTGYMVARTLAVAPVLADVIAECLGSTRMIRGKPLCHRVWNGLWPLEKRCVRE  409

Query  360   FFCFGMDILLKLDLPATRRFFDAFFDLEPRYWHGFLSSRLFLRELIFFGLSLFSHASNTS  181
             ++ FGM+ LLKLDL  TRRFFDAFFDL+P YWHGFLSSRL L EL    LSLF  ASN S
Sbjct  410   YYSFGMETLLKLDLNGTRRFFDAFFDLDPHYWHGFLSSRLSLGELAMLSLSLFGRASNPS  469

Query  180   RLEIMTKGTLPLVNMINNL  124
             R +I+TK   PLV M+ NL
Sbjct  470   RFDIVTKCPAPLVKMMGNL  488



>ref|XP_004291579.1| PREDICTED: capsanthin/capsorubin synthase, chromoplast-like [Fragaria 
vesca subsp. vesca]
Length=498

 Score =   533 bits (1374),  Expect = 4e-180, Method: Compositional matrix adjust.
 Identities = 268/452 (59%), Positives = 340/452 (75%), Gaps = 1/452 (0%)
 Frame = -2

Query  1476  RNVGRVKASSSA-LLELVPVTKKENLDFELPMFEPSKGIvvdlavvgggpaglavaqqVS  1300
             +   RV++S     L+L P +  E LDF+LP  +PS    VD+ ++G GPAGL +A+QVS
Sbjct  42    KRFSRVQSSKYGNFLDLKPESTPEVLDFDLPRLDPSSRSRVDVIIIGTGPAGLRLAEQVS  101

Query  1299  QAGLSVCSIDPSPKLIWPNNYGVWVDEFEAMDLLDCLDTTWSGAMVYIDDRTTKDLDRPY  1120
             Q G+ VC +DPSP  +WPNNYGVWVDEFE+++L  CLD TW  A V+IDD  TK LDRPY
Sbjct  102   QYGIKVCCVDPSPLSMWPNNYGVWVDEFESLELESCLDKTWPMACVHIDDNKTKYLDRPY  161

Query  1119  GRVNRKKLKSKMMQKCITNGVKFHQAKVIKVIHEESKSMLICSDGVTIQATVVLDATGFS  940
             GRV+RKKLK  +M++C++NGVKFH+AKV K+ H+E +S+++C DG  ++A++V+DA+GF+
Sbjct  162   GRVSRKKLKKLLMERCLSNGVKFHKAKVWKIEHKEFESLIVCDDGNELKASLVVDASGFA  221

Query  939   RCLVQYDKPYNPGYQVAYGILAEVEEHPYDLNKMVFMDWRDSHLNSNLELKERNKRIPTF  760
                ++YDKP N GYQ+A+GILAEVE HP+DL+KMV MDWRDSHL +   L+  N R P F
Sbjct  222   SSFIEYDKPRNHGYQIAHGILAEVEGHPFDLDKMVLMDWRDSHLGNEPYLRTGNSRFPAF  281

Query  759   LYAMPFSSTRIFLEETSLVARPGLDMKDIQERMVARLRHLGINVKSIEEDERCVIPMGGP  580
             LYAMPF S  +FLEETSLV+RP L   +I++RMVARLRHLGI VK I E E+CV+PMGGP
Sbjct  282   LYAMPFDSNLVFLEETSLVSRPVLSYMEIKKRMVARLRHLGIRVKRILEVEKCVVPMGGP  341

Query  579   LPVIPQRVVGIGGTAGMVHPSTGYMVARTLAAAPVVANAIIQYLGSERSLLGNELSASVW  400
             LP IPQ V+ IGGT+G+VHPSTGYMVART+A APV+A AI + LGS R + G  L    W
Sbjct  342   LPRIPQSVMAIGGTSGIVHPSTGYMVARTMALAPVLAEAIAECLGSTRMIRGKSLHERAW  401

Query  399   KDLWPIERRRQREFFCFGMDILLKLDLPATRRFFDAFFDLEPRYWHGFLSSRLFLRELIF  220
               LW  ERR  R+++ FGM+ LLKLDL  +RRFFDAFFDL+P YW GFLSSRL LREL  
Sbjct  402   NGLWTTERRCVRQYYSFGMETLLKLDLNGSRRFFDAFFDLDPYYWQGFLSSRLSLRELAL  461

Query  219   FGLSLFSHASNTSRLEIMTKGTLPLVNMINNL  124
               LSLF HAS  SR +I++K  +P V MI+NL
Sbjct  462   LSLSLFGHASFPSRFDIVSKCPVPFVKMISNL  493



>dbj|BAM66329.1| LCYb2, partial [Citrus limon]
Length=479

 Score =   530 bits (1366),  Expect = 4e-179, Method: Compositional matrix adjust.
 Identities = 261/442 (59%), Positives = 324/442 (73%), Gaps = 2/442 (0%)
 Frame = -2

Query  1464  RVKASS-SALLELVPVTKKENLDFELPMFEPSKGIvvdlavvggg-paglavaqqVSQAG  1291
             R++ S     LEL P ++ E L F+LP F PS  I  D+ ++G G        Q  S+ G
Sbjct  38    RIRTSKFGNFLELTPESEPEFLVFDLPWFHPSDRIRYDVIIIGTGPAGLHLAEQVSSRHG  97

Query  1290  LSVCSIDPSPKLIWPNNYGVWVDEFEAMDLLDCLDTTWSGAMVYIDDRTTKDLDRPYGRV  1111
             + VC +DPSP   WPNNYGVWVDEFE + L+DCLD TW    V+I+D  TK LDRPYGRV
Sbjct  98    IRVCCVDPSPLSTWPNNYGVWVDEFEDIGLVDCLDKTWPMTCVFINDHKTKYLDRPYGRV  157

Query  1110  NRKKLKSKMMQKCITNGVKFHQAKVIKVIHEESKSMLICSDGVTIQATVVLDATGFSRCL  931
             +R  LK+K ++ C++NGVKFH+AKV  V H+E +S ++C DG  I+A++++DA+GF+   
Sbjct  158   SRNILKTKFLENCVSNGVKFHKAKVWHVNHQEFESSIVCDDGNEIKASLIVDASGFASSF  217

Query  930   VQYDKPYNPGYQVAYGILAEVEEHPYDLNKMVFMDWRDSHLNSNLELKERNKRIPTFLYA  751
             V YDKP N GYQ+A+GILAEVE HP+DL+KMV MDWRDSHL +   L+  N ++PTFLYA
Sbjct  218   VDYDKPRNHGYQIAHGILAEVESHPFDLDKMVLMDWRDSHLGNEPYLRASNLKLPTFLYA  277

Query  750   MPFSSTRIFLEETSLVARPGLDMKDIQERMVARLRHLGINVKSIEEDERCVIPMGGPLPV  571
             MPF S  +FLEETSLV+RP L  K+++ RM ARLRH+GI VK + EDE+C+IPMGGPLPV
Sbjct  278   MPFDSNLVFLEETSLVSRPVLSYKEVKRRMAARLRHMGIRVKRVIEDEKCLIPMGGPLPV  337

Query  570   IPQRVVGIGGTAGMVHPSTGYMVARTLAAAPVVANAIIQYLGSERSLLGNELSASVWKDL  391
             IPQ V+ IGGT+G+VHPSTGYMVART+A AP +A+AI + LGS R   G  L   VW  L
Sbjct  338   IPQSVMAIGGTSGLVHPSTGYMVARTMALAPALADAIAECLGSTRMNRGRPLHQKVWNGL  397

Query  390   WPIERRRQREFFCFGMDILLKLDLPATRRFFDAFFDLEPRYWHGFLSSRLFLRELIFFGL  211
             WPI+RR  REF+ FGM+ LLKLDL  TRRFFDAFFDL P YWHGFLSSRL L EL    L
Sbjct  398   WPIDRRCIREFYSFGMETLLKLDLKGTRRFFDAFFDLNPHYWHGFLSSRLSLAELAGLSL  457

Query  210   SLFSHASNTSRLEIMTKGTLPL  145
             SLF HASN+SR +I+TK  LPL
Sbjct  458   SLFGHASNSSRFDIVTKCPLPL  479



>gb|ACR61334.1| lycopene beta-cyclase 2 [Carica papaya]
Length=494

 Score =   530 bits (1365),  Expect = 8e-179, Method: Compositional matrix adjust.
 Identities = 263/439 (60%), Positives = 329/439 (75%), Gaps = 0/439 (0%)
 Frame = -2

Query  1440  LLELVPVTKKENLDFELPMFEPSKGIvvdlavvgggpaglavaqqVSQAGLSVCSIDPSP  1261
              L+L P +K + LDF+LP F  S   + D+ V+G GPAG  +A+Q+S  G+ VC +DPSP
Sbjct  51    FLDLNPESKPDFLDFDLPCFHSSDRSLFDVIVIGTGPAGARLAEQLSTRGIKVCCVDPSP  110

Query  1260  KLIWPNNYGVWVDEFEAMDLLDCLDTTWSGAMVYIDDRTTKDLDRPYGRVNRKKLKSKMM  1081
               +WPNNYG WVDE  ++ L DC D  W    V+IDD   K L RPYGRV RKKLK+K++
Sbjct  111   LSMWPNNYGAWVDELHSLGLDDCFDRIWPLCSVFIDDSNIKFLRRPYGRVRRKKLKTKLI  170

Query  1080  QKCITNGVKFHQAKVIKVIHEESKSMLICSDGVTIQATVVLDATGFSRCLVQYDKPYNPG  901
             + C+ NGVKFH+AKV +V H+E +S ++C DG  I+ ++V+DA+GF    ++YDKP N G
Sbjct  171   ENCVVNGVKFHKAKVWRVDHKEFESCVVCDDGNEIRGSLVVDASGFGSTFIEYDKPRNCG  230

Query  900   YQVAYGILAEVEEHPYDLNKMVFMDWRDSHLNSNLELKERNKRIPTFLYAMPFSSTRIFL  721
             YQ+A+GILAEVE HP+DL+KMVFMDWRDSHL +   L+  N R PTFLYAMPF+S  IFL
Sbjct  231   YQIAHGILAEVETHPFDLDKMVFMDWRDSHLGNEPYLRASNSRFPTFLYAMPFASDLIFL  290

Query  720   EETSLVARPGLDMKDIQERMVARLRHLGINVKSIEEDERCVIPMGGPLPVIPQRVVGIGG  541
             EETSLV+RP L   +I+ RMVARLRHLGI VK + EDE+C+IPMGGPLP IPQ V+ IGG
Sbjct  291   EETSLVSRPALSYMEIKRRMVARLRHLGIRVKRVLEDEKCLIPMGGPLPKIPQNVMAIGG  350

Query  540   TAGMVHPSTGYMVARTLAAAPVVANAIIQYLGSERSLLGNELSASVWKDLWPIERRRQRE  361
              +G+VHPSTGYMVARTLA APVVA+AI + LGS R + G  L   VWK+LWPIER+  RE
Sbjct  351   NSGIVHPSTGYMVARTLALAPVVADAIAECLGSTRMIRGRPLHYRVWKELWPIERKYARE  410

Query  360   FFCFGMDILLKLDLPATRRFFDAFFDLEPRYWHGFLSSRLFLRELIFFGLSLFSHASNTS  181
             F+CFGM+ LLKLDL  +RRFFDAFF L+P Y+HGFLSSRL LREL    LSLF  ASN+S
Sbjct  411   FYCFGMETLLKLDLNGSRRFFDAFFGLDPDYYHGFLSSRLSLRELFGLSLSLFIRASNSS  470

Query  180   RLEIMTKGTLPLVNMINNL  124
             R++I+T    PL+ M+ NL
Sbjct  471   RMDIVTNCPAPLIRMVGNL  489



>ref|XP_007150055.1| hypothetical protein PHAVU_005G122400g [Phaseolus vulgaris]
 gb|ESW22049.1| hypothetical protein PHAVU_005G122400g [Phaseolus vulgaris]
Length=499

 Score =   530 bits (1365),  Expect = 1e-178, Method: Compositional matrix adjust.
 Identities = 271/502 (54%), Positives = 353/502 (70%), Gaps = 15/502 (3%)
 Frame = -2

Query  1611  MDTLLKTPNELEFLHPHHGFAVKASAFTSLK----PQKQEIRIGSWKACRNVGRVKASS-  1447
             M T L   ++   L PH      + +F   K    P ++ IR           RV ++S 
Sbjct  1     MGTRLMLSSQTPPLKPHQPLHSNSPSFPLTKIHYTPSRKLIR---------GKRVHSTSR  51

Query  1446  -SALLELVPVTKKENLDFELPMFEPSKGIvvdlavvgggpaglavaqqVSQAGLSVCSID  1270
                 L+L P  + E LDF+LP   PS     D+ ++G GPAG+ +A+QVS  G+ VC +D
Sbjct  52    YGNFLDLKPEHQPEALDFDLPWCHPSDRARFDVIIIGAGPAGVRLAEQVSLYGVKVCCVD  111

Query  1269  PSPKLIWPNNYGVWVDEFEAMDLLDCLDTTWSGAMVYIDDRTTKDLDRPYGRVNRKKLKS  1090
             P P  +WPNNYGVWVDEFE + L DCLD TW  A VY+DD  TK LDR YGRV+R+KLK 
Sbjct  112   PDPLSVWPNNYGVWVDEFENLGLEDCLDKTWPMACVYVDDNKTKYLDRCYGRVSRRKLKE  171

Query  1089  KMMQKCITNGVKFHQAKVIKVIHEESKSMLICSDGVTIQATVVLDATGFSRCLVQYDKPY  910
             ++++ C++NGV+FH+AK  +V H+E +S ++C DGV ++ ++V+DA+GF    ++YDK  
Sbjct  172   RLIEGCVSNGVRFHKAKAWEVKHQEFESSVLCDDGVELKGSLVIDASGFGSRFIEYDKVR  231

Query  909   NPGYQVAYGILAEVEEHPYDLNKMVFMDWRDSHLNSNLELKERNKRIPTFLYAMPFSSTR  730
             N GYQ+A+G+L EVEEHP+DL+KMV MDWRDSHL +   L+  N R PTFLYAMPFSS  
Sbjct  232   NQGYQIAHGVLVEVEEHPFDLDKMVLMDWRDSHLGNEPSLRVSNSRFPTFLYAMPFSSNL  291

Query  729   IFLEETSLVARPGLDMKDIQERMVARLRHLGINVKSIEEDERCVIPMGGPLPVIPQRVVG  550
             IFLEETSLV+RP L   +++ RMVARLRHLGI VK + EDE+C+IPMGGPLP IPQ V+ 
Sbjct  292   IFLEETSLVSRPALSYMEVKRRMVARLRHLGIRVKRVLEDEKCLIPMGGPLPRIPQNVMA  351

Query  549   IGGTAGMVHPSTGYMVARTLAAAPVVANAIIQYLGSERSLLGNELSASVWKDLWPIERRR  370
             IGGT+G+VHPSTGYMVART+A APVVA AI + LGS R + G +L A VW  +WPIE+R 
Sbjct  352   IGGTSGVVHPSTGYMVARTMAVAPVVAFAIAECLGSTRMIRGKQLYAKVWNSMWPIEKRM  411

Query  369   QREFFCFGMDILLKLDLPATRRFFDAFFDLEPRYWHGFLSSRLFLRELIFFGLSLFSHAS  190
              REF+ FGM+ LLKLDL  +R FF+AFFDL+P YW GFLSS+L L+EL++  LSLF HAS
Sbjct  412   VREFYSFGMETLLKLDLNGSRNFFNAFFDLKPYYWQGFLSSKLTLKELVWLSLSLFGHAS  471

Query  189   NTSRLEIMTKGTLPLVNMINNL  124
             N S+ +I TK  +PL  M+ N+
Sbjct  472   NPSKFDITTKCPVPLAKMMGNI  493



>ref|XP_009374976.1| PREDICTED: capsanthin/capsorubin synthase, chromoplast-like [Pyrus 
x bretschneideri]
Length=496

 Score =   529 bits (1363),  Expect = 2e-178, Method: Compositional matrix adjust.
 Identities = 259/439 (59%), Positives = 340/439 (77%), Gaps = 0/439 (0%)
 Frame = -2

Query  1440  LLELVPVTKKENLDFELPMFEPSKGIvvdlavvgggpaglavaqqVSQAGLSVCSIDPSP  1261
              L+L P  K E+L F+L  F+PS    +D+ ++G GPAGL +A+QVS+ G+ VC +DPSP
Sbjct  53    FLDLKPEAKPESLHFDLHQFDPSTRSRLDVIIIGTGPAGLRLAEQVSRYGIKVCCVDPSP  112

Query  1260  KLIWPNNYGVWVDEFEAMDLLDCLDTTWSGAMVYIDDRTTKDLDRPYGRVNRKKLKSKMM  1081
               +WPNNYGVWVDEFE+++L +CLD TW  A V+++D  TK LDRPYGRV+RKKLK+ ++
Sbjct  113   LSMWPNNYGVWVDEFESLNLENCLDKTWPMASVHVNDSKTKYLDRPYGRVSRKKLKTLLL  172

Query  1080  QKCITNGVKFHQAKVIKVIHEESKSMLICSDGVTIQATVVLDATGFSRCLVQYDKPYNPG  901
             ++C++NGV+FH+AKV K+ HEE +S ++C DG  ++A++++DA+GF+   ++Y+KP N G
Sbjct  173   ERCLSNGVQFHKAKVWKIEHEEFESSILCDDGNELKASLIVDASGFASSFIEYEKPRNHG  232

Query  900   YQVAYGILAEVEEHPYDLNKMVFMDWRDSHLNSNLELKERNKRIPTFLYAMPFSSTRIFL  721
             YQ+A+GILAEVEEHP+DL+KM+ MDWRDSHL++   L+  N R PTFLYAMPF S  +FL
Sbjct  233   YQIAHGILAEVEEHPFDLDKMLLMDWRDSHLDNEPYLRTSNSRFPTFLYAMPFDSNLVFL  292

Query  720   EETSLVARPGLDMKDIQERMVARLRHLGINVKSIEEDERCVIPMGGPLPVIPQRVVGIGG  541
             EETSLV+RP L   +I++RMVARLRHLGI VK + E+E+C+IPMGGPLP IPQRV+ IGG
Sbjct  293   EETSLVSRPVLSYMEIKKRMVARLRHLGIRVKRVIENEKCLIPMGGPLPRIPQRVMSIGG  352

Query  540   TAGMVHPSTGYMVARTLAAAPVVANAIIQYLGSERSLLGNELSASVWKDLWPIERRRQRE  361
             T+G+VHPSTGYMVART++ APV+A AI + LGS R + G  L    W  LWPIERR  R+
Sbjct  353   TSGVVHPSTGYMVARTMSLAPVLAEAIAECLGSTRMIRGQPLYHRAWNGLWPIERRCTRD  412

Query  360   FFCFGMDILLKLDLPATRRFFDAFFDLEPRYWHGFLSSRLFLRELIFFGLSLFSHASNTS  181
             F+ FGM+ LLKLDL  +R FFDAFFDL P YW GFLSSRL LREL    LSLF+ AS  S
Sbjct  413   FYSFGMETLLKLDLNGSRSFFDAFFDLNPYYWQGFLSSRLSLRELALLSLSLFTRASAPS  472

Query  180   RLEIMTKGTLPLVNMINNL  124
             R +I+TK  +PLV ++ NL
Sbjct  473   RFDIVTKCPVPLVKLMGNL  491



>gb|ACX37456.1| chromoplast lycopene beta-cyclase [Citrus x paradisi]
Length=503

 Score =   529 bits (1363),  Expect = 2e-178, Method: Compositional matrix adjust.
 Identities = 259/449 (58%), Positives = 326/449 (73%), Gaps = 2/449 (0%)
 Frame = -2

Query  1464  RVKASS-SALLELVPVTKKENLDFELPMFEPSKGIvvdlavvggg-paglavaqqVSQAG  1291
             R++ S     LEL P ++ E L F+LP F PS  I  D+ ++G G        Q  S+ G
Sbjct  50    RIRTSKFGNFLELTPESEPEFLVFDLPWFHPSDRIRYDVIIIGTGPAGLRLAEQVSSRHG  109

Query  1290  LSVCSIDPSPKLIWPNNYGVWVDEFEAMDLLDCLDTTWSGAMVYIDDRTTKDLDRPYGRV  1111
             + VC +DPSP   WPNNYGVWVDEFE + L+DCLD TW    V+I+D  TK LDRPYGRV
Sbjct  110   IKVCCVDPSPLSTWPNNYGVWVDEFEDIGLIDCLDKTWPMTCVFINDHKTKYLDRPYGRV  169

Query  1110  NRKKLKSKMMQKCITNGVKFHQAKVIKVIHEESKSMLICSDGVTIQATVVLDATGFSRCL  931
             +R  LK+K+++ C+ NGV+FH+AKV  V H+E +S ++C DG  I+A++++DA+GF+   
Sbjct  170   SRNILKTKLLENCVLNGVRFHKAKVWHVNHQEFESSIVCDDGNEIKASLIVDASGFASSF  229

Query  930   VQYDKPYNPGYQVAYGILAEVEEHPYDLNKMVFMDWRDSHLNSNLELKERNKRIPTFLYA  751
             V YDKP N GYQ+A+GILAEVE HP+DL+KMV MDWRDSHL +   L+  N ++PTFLYA
Sbjct  230   VDYDKPRNHGYQIAHGILAEVESHPFDLDKMVLMDWRDSHLGNEPYLRASNLKLPTFLYA  289

Query  750   MPFSSTRIFLEETSLVARPGLDMKDIQERMVARLRHLGINVKSIEEDERCVIPMGGPLPV  571
             MPF S  + LE TS V+RP L  K+++ R+ ARLRH+GI VK + EDE+C+IPMGGPLPV
Sbjct  290   MPFDSNLVSLENTSGVSRPVLSYKEVKRRIAARLRHMGIRVKRVIEDEKCLIPMGGPLPV  349

Query  570   IPQRVVGIGGTAGMVHPSTGYMVARTLAAAPVVANAIIQYLGSERSLLGNELSASVWKDL  391
             IPQ V+ IG T+G+VHPSTGYMVART+A AP +A+AI + LGS R + G  L   VW  L
Sbjct  350   IPQSVMAIGSTSGLVHPSTGYMVARTMALAPALADAIAECLGSTRMIRGRPLHQKVWNGL  409

Query  390   WPIERRRQREFFCFGMDILLKLDLPATRRFFDAFFDLEPRYWHGFLSSRLFLRELIFFGL  211
             WPI+RR  REF+ FGM+ LLKLDL  TRRFFDAFFDL P YWHGFLSSRL L EL    L
Sbjct  410   WPIDRRCNREFYSFGMETLLKLDLKGTRRFFDAFFDLNPHYWHGFLSSRLSLAELAGLSL  469

Query  210   SLFSHASNTSRLEIMTKGTLPLVNMINNL  124
             SLF HASN+SR +I+TK  LPLV M+ NL
Sbjct  470   SLFGHASNSSRFDIVTKCPLPLVKMMGNL  498



>dbj|BAM66328.1| LCYb2, partial [Citrus sinensis]
Length=479

 Score =   528 bits (1360),  Expect = 3e-178, Method: Compositional matrix adjust.
 Identities = 258/442 (58%), Positives = 323/442 (73%), Gaps = 2/442 (0%)
 Frame = -2

Query  1464  RVKASS-SALLELVPVTKKENLDFELPMFEPSKGIvvdlavvggg-paglavaqqVSQAG  1291
             R++ S     LEL P ++ E L F+LP F PS  I  D+ ++G G        Q  S+ G
Sbjct  38    RIRTSKFGNFLELTPESEPEFLVFDLPWFHPSDRIRYDVIIIGTGPAGLRLAEQVSSRHG  97

Query  1290  LSVCSIDPSPKLIWPNNYGVWVDEFEAMDLLDCLDTTWSGAMVYIDDRTTKDLDRPYGRV  1111
             + VC +DPSP   WPNNYGVWVDEFE + L+DCLD TW    V+I+D  TK LDRPYGRV
Sbjct  98    IKVCCVDPSPLSTWPNNYGVWVDEFEDIGLIDCLDKTWPMTCVFINDHKTKYLDRPYGRV  157

Query  1110  NRKKLKSKMMQKCITNGVKFHQAKVIKVIHEESKSMLICSDGVTIQATVVLDATGFSRCL  931
             +R  LK+K+++ C+ NGV+FH+AKV  V H+E +S ++C DG  I+A++++DA+GF+   
Sbjct  158   SRNILKTKLLENCVLNGVRFHKAKVWHVNHQEFESSIVCDDGNEIKASLIVDASGFASSF  217

Query  930   VQYDKPYNPGYQVAYGILAEVEEHPYDLNKMVFMDWRDSHLNSNLELKERNKRIPTFLYA  751
             V YDKP N GYQ+A+GILAEVE HP+DL+KMV MDWRDSHL +   L+  N ++PTFLYA
Sbjct  218   VDYDKPRNHGYQIAHGILAEVESHPFDLDKMVLMDWRDSHLGNEPYLRASNLKLPTFLYA  277

Query  750   MPFSSTRIFLEETSLVARPGLDMKDIQERMVARLRHLGINVKSIEEDERCVIPMGGPLPV  571
             MPF S  +FLEETSLV+RP L  K+++ RM ARLRH+GI VK + EDE+C+IPMGGPLPV
Sbjct  278   MPFDSNLVFLEETSLVSRPVLSYKEVKRRMAARLRHMGIRVKRVIEDEKCLIPMGGPLPV  337

Query  570   IPQRVVGIGGTAGMVHPSTGYMVARTLAAAPVVANAIIQYLGSERSLLGNELSASVWKDL  391
             IPQ V+ IG T+G+VHPSTGYMVART+A AP +A+AI + LGS R + G  L   VW  L
Sbjct  338   IPQSVMAIGSTSGLVHPSTGYMVARTMALAPALADAIAECLGSTRMIRGRPLHQKVWNGL  397

Query  390   WPIERRRQREFFCFGMDILLKLDLPATRRFFDAFFDLEPRYWHGFLSSRLFLRELIFFGL  211
             WPI+RR  REF+ FGM+ LLKLDL  TRR FDAFFDL P YWHGFLSSRL L EL    L
Sbjct  398   WPIDRRCNREFYSFGMETLLKLDLKGTRRLFDAFFDLNPHYWHGFLSSRLSLAELAGLSL  457

Query  210   SLFSHASNTSRLEIMTKGTLPL  145
             SLF HASN+SR +I+TK  LPL
Sbjct  458   SLFGHASNSSRFDIVTKCPLPL  479



>gb|ABB52072.1| putative capsanthin-capsorubin synthase [Daucus carota subsp. 
sativus]
Length=492

 Score =   528 bits (1361),  Expect = 3e-178, Method: Compositional matrix adjust.
 Identities = 270/489 (55%), Positives = 353/489 (72%), Gaps = 8/489 (2%)
 Frame = -2

Query  1581  LEFLHP--HHGFAVKASAFTSLKPQKQEIRIGSWKACRNVGRVKASSSA-LLELVPVTKK  1411
             L+F+ P  H   A+  S + +LK    +     +K  +    V+ S     L+L P  + 
Sbjct  4     LKFIRPSSHPLLALHQSNYKALKSPSLK-----YKPKKVTHTVQCSKYGNFLDLKPGKRH  58

Query  1410  ENLDFELPMFEPSKGIvvdlavvgggpaglavaqqVSQAGLSVCSIDPSPKLIWPNNYGV  1231
             E+++F+L  ++PSK    D+ V+G GPAGL +A++V+  G+ VC +DPSP  +WPNNYGV
Sbjct  59    ESMEFDLSWYDPSKRSRFDVIVIGAGPAGLRLAERVAGYGIQVCCVDPSPLCVWPNNYGV  118

Query  1230  WVDEFEAMDLLDCLDTTWSGAMVYIDDRTTKDLDRPYGRVNRKKLKSKMMQKCITNGVKF  1051
             WVDEFEAM   DC D TW  + VYI++  +K L+RPYGRVNR+KLK +++  C++NGV F
Sbjct  119   WVDEFEAMGFQDCFDKTWPMSSVYINEEKSKVLNRPYGRVNREKLKMRLLGGCVSNGVVF  178

Query  1050  HQAKVIKVIHEESKSMLICSDGVTIQATVVLDATGFSRCLVQYDKPYNPGYQVAYGILAE  871
             H+AKV KV H+E +S ++C DG   +A++++DA+GF+   V YDKP N GYQ+A+GILAE
Sbjct  179   HKAKVWKVDHQEFESSILCDDGKEFKASLIVDASGFASTFVDYDKPRNHGYQLAHGILAE  238

Query  870   VEEHPYDLNKMVFMDWRDSHLNSNLELKERNKRIPTFLYAMPFSSTRIFLEETSLVARPG  691
             VE HP++L++MV MDWRDSHL +   L+  N + PTFLYAMPF S  IFLEETSLV+RP 
Sbjct  239   VESHPFELDRMVLMDWRDSHLGNEPALRFANAKSPTFLYAMPFDSNLIFLEETSLVSRPA  298

Query  690   LDMKDIQERMVARLRHLGINVKSIEEDERCVIPMGGPLPVIPQRVVGIGGTAGMVHPSTG  511
             L  K+++ RM ARLRHLGI VKSI EDE+C+IPMGGPLP  PQ VV IGG++G+VHPSTG
Sbjct  299   LSYKEVKLRMAARLRHLGIRVKSIIEDEKCLIPMGGPLPRTPQDVVAIGGSSGIVHPSTG  358

Query  510   YMVARTLAAAPVVANAIIQYLGSERSLLGNELSASVWKDLWPIERRRQREFFCFGMDILL  331
             YMVARTLA APV+A+AI + LGS R + G+ L   VW  LWPIE +  REF+ FGM+ LL
Sbjct  359   YMVARTLALAPVLADAIAECLGSTRMIRGSSLYHRVWNGLWPIESKCTREFYSFGMETLL  418

Query  330   KLDLPATRRFFDAFFDLEPRYWHGFLSSRLFLRELIFFGLSLFSHASNTSRLEIMTKGTL  151
             KLDL  TR FFDAFFDL+P YW GFLSSRL L+EL    LSLF HASN+S+++I+TK   
Sbjct  419   KLDLHGTRNFFDAFFDLDPHYWQGFLSSRLSLKELAMLSLSLFGHASNSSKMDIVTKCPA  478

Query  150   PLVNMINNL  124
             PLV M+ NL
Sbjct  479   PLVKMLGNL  487



>gb|AFR11777.1| lycopene beta-cyclase [Fragaria x ananassa]
Length=498

 Score =   528 bits (1361),  Expect = 4e-178, Method: Compositional matrix adjust.
 Identities = 266/452 (59%), Positives = 339/452 (75%), Gaps = 1/452 (0%)
 Frame = -2

Query  1476  RNVGRVKASSSA-LLELVPVTKKENLDFELPMFEPSKGIvvdlavvgggpaglavaqqVS  1300
             +   RV++S     L+L P +  E LDF+LP  +PS    VD+ ++G GPAGL +A+QVS
Sbjct  42    KRFSRVQSSKYGNFLDLKPESTPEVLDFDLPRLDPSSRSRVDVIIIGTGPAGLRLAEQVS  101

Query  1299  QAGLSVCSIDPSPKLIWPNNYGVWVDEFEAMDLLDCLDTTWSGAMVYIDDRTTKDLDRPY  1120
             Q G+ VC +DPSP  +WPNNYGVWVDEF++++L  CLD TW  A V+IDD  TK LDRPY
Sbjct  102   QYGIKVCCVDPSPLSMWPNNYGVWVDEFQSLELESCLDKTWPMACVHIDDNKTKYLDRPY  161

Query  1119  GRVNRKKLKSKMMQKCITNGVKFHQAKVIKVIHEESKSMLICSDGVTIQATVVLDATGFS  940
             GRV+RKKL+  +M++C++NGVKF +AKV K+ H+E +S+++C DG  ++A++V+DA+GF+
Sbjct  162   GRVSRKKLRKLLMERCLSNGVKFLKAKVWKIEHKEFESLIVCDDGNELKASLVVDASGFA  221

Query  939   RCLVQYDKPYNPGYQVAYGILAEVEEHPYDLNKMVFMDWRDSHLNSNLELKERNKRIPTF  760
                ++YDKP N GYQ+A+GILAEVE HP+DL+KMV MDWRDSHL +   L+  N R PTF
Sbjct  222   SSFIEYDKPRNHGYQIAHGILAEVEGHPFDLDKMVLMDWRDSHLGNEPYLRTGNSRFPTF  281

Query  759   LYAMPFSSTRIFLEETSLVARPGLDMKDIQERMVARLRHLGINVKSIEEDERCVIPMGGP  580
             LYAMPF S  +FLEETSLV+RP L   +I++RMVARLRHLGI VK I E E+CVIPMGGP
Sbjct  282   LYAMPFDSNLVFLEETSLVSRPVLSYMEIKKRMVARLRHLGIRVKRILEVEKCVIPMGGP  341

Query  579   LPVIPQRVVGIGGTAGMVHPSTGYMVARTLAAAPVVANAIIQYLGSERSLLGNELSASVW  400
             LP IPQ V+ IGGT+G+ HPSTGYMVART+A APV+A AI + LGS R + G  L    W
Sbjct  342   LPRIPQSVMAIGGTSGIAHPSTGYMVARTMALAPVLAEAIAECLGSTRMIRGKSLHERAW  401

Query  399   KDLWPIERRRQREFFCFGMDILLKLDLPATRRFFDAFFDLEPRYWHGFLSSRLFLRELIF  220
               LW  ERR  R+++ FGM+ LLKLDL  +RRFFDAFFDL+P YW GFLSSRL LREL  
Sbjct  402   NGLWATERRCVRQYYSFGMETLLKLDLNGSRRFFDAFFDLDPYYWQGFLSSRLSLRELAL  461

Query  219   FGLSLFSHASNTSRLEIMTKGTLPLVNMINNL  124
               LSLF HAS  SR +I++K  +P V MI+NL
Sbjct  462   LSLSLFGHASFPSRFDIVSKCPVPFVKMISNL  493



>ref|XP_009377819.1| PREDICTED: capsanthin/capsorubin synthase, chromoplast-like [Pyrus 
x bretschneideri]
Length=496

 Score =   528 bits (1360),  Expect = 5e-178, Method: Compositional matrix adjust.
 Identities = 258/439 (59%), Positives = 337/439 (77%), Gaps = 0/439 (0%)
 Frame = -2

Query  1440  LLELVPVTKKENLDFELPMFEPSKGIvvdlavvgggpaglavaqqVSQAGLSVCSIDPSP  1261
              L+L P  K E+L F+L  F+PS    +D+ ++G GPAGL +A+Q+S+ G+ VC +DPSP
Sbjct  53    FLDLKPEAKPESLHFDLNQFDPSTRSRLDVIIIGTGPAGLRLAEQLSRYGIKVCCVDPSP  112

Query  1260  KLIWPNNYGVWVDEFEAMDLLDCLDTTWSGAMVYIDDRTTKDLDRPYGRVNRKKLKSKMM  1081
               +WPNNYGVWVDEFE+++L  CLD  W  A V+++D  TK LDRPYGRV+RKKLK+ ++
Sbjct  113   LSMWPNNYGVWVDEFESLNLESCLDKIWPMASVHVNDSKTKFLDRPYGRVSRKKLKTLLL  172

Query  1080  QKCITNGVKFHQAKVIKVIHEESKSMLICSDGVTIQATVVLDATGFSRCLVQYDKPYNPG  901
             ++C++NGV+FH+AKV K+ HEE +S ++C DG  ++A++++DA+GF+   ++Y+KP N G
Sbjct  173   ERCLSNGVQFHRAKVWKIEHEEFESSILCDDGNELKASLIVDASGFASSFIEYEKPRNHG  232

Query  900   YQVAYGILAEVEEHPYDLNKMVFMDWRDSHLNSNLELKERNKRIPTFLYAMPFSSTRIFL  721
             YQ+A+GILAEVEEHP+DL+KM+ MDWRDSHL +   L+  N R PTFLYAMPF S  +FL
Sbjct  233   YQIAHGILAEVEEHPFDLDKMLLMDWRDSHLGNEPYLRTSNSRFPTFLYAMPFDSNLVFL  292

Query  720   EETSLVARPGLDMKDIQERMVARLRHLGINVKSIEEDERCVIPMGGPLPVIPQRVVGIGG  541
             EETSLV+RP L   +I++RMVARLRHLGI VK + E+E+C+IPMGGPLP IPQRV+ IGG
Sbjct  293   EETSLVSRPVLSYMEIKKRMVARLRHLGIRVKRVIEEEKCLIPMGGPLPRIPQRVMAIGG  352

Query  540   TAGMVHPSTGYMVARTLAAAPVVANAIIQYLGSERSLLGNELSASVWKDLWPIERRRQRE  361
             T+G+VHPSTGYMVART+A APV+A AI + LGS R + G  L    W  LWPIERR  R+
Sbjct  353   TSGVVHPSTGYMVARTMALAPVLAEAIAECLGSTRMIRGQPLYHKAWNGLWPIERRCTRD  412

Query  360   FFCFGMDILLKLDLPATRRFFDAFFDLEPRYWHGFLSSRLFLRELIFFGLSLFSHASNTS  181
             F+ FGM+ LLKLDL  +R FFDAFFDL+P YW GFLSSRL LREL    LSLF  AS  S
Sbjct  413   FYSFGMETLLKLDLNGSRSFFDAFFDLDPYYWQGFLSSRLSLRELALLSLSLFGRASAPS  472

Query  180   RLEIMTKGTLPLVNMINNL  124
             R +I+TK  +PLV ++ NL
Sbjct  473   RFDIVTKCPVPLVKLMGNL  491



>ref|XP_010045192.1| PREDICTED: LOW QUALITY PROTEIN: capsanthin/capsorubin synthase, 
chromoplast-like [Eucalyptus grandis]
Length=493

 Score =   528 bits (1359),  Expect = 6e-178, Method: Compositional matrix adjust.
 Identities = 243/393 (62%), Positives = 305/393 (78%), Gaps = 0/393 (0%)
 Frame = -2

Query  1302  SQAGLSVCSIDPSPKLIWPNNYGVWVDEFEAMDLLDCLDTTWSGAMVYIDDRTTKDLDRP  1123
             S+ G+ VC +DPSP  +WPNNYGVWVDEFE + L+DCLD TW  A VYIDD   K LDR 
Sbjct  96    SRRGIRVCCVDPSPLSVWPNNYGVWVDEFEGLGLVDCLDKTWPMACVYIDDGKAKYLDRA  155

Query  1122  YGRVNRKKLKSKMMQKCITNGVKFHQAKVIKVIHEESKSMLICSDGVTIQATVVLDATGF  943
             YGRV R+KLK+++++ C++ GV+FH+AKV K+ HEE +S ++CSDGV ++A++++DA+GF
Sbjct  156   YGRVGREKLKTRLIEGCVSTGVRFHKAKVWKMEHEEFESSVVCSDGVELKASLIVDASGF  215

Query  942   SRCLVQYDKPYNPGYQVAYGILAEVEEHPYDLNKMVFMDWRDSHLNSNLELKERNKRIPT  763
                 ++YDKP N GYQ+A+GILAEV+EHP+DL+KMV MDWRDSHL +   L+  N R+PT
Sbjct  216   GSTFIEYDKPRNHGYQIAHGILAEVDEHPFDLDKMVLMDWRDSHLGNEPYLRANNSRLPT  275

Query  762   FLYAMPFSSTRIFLEETSLVARPGLDMKDIQERMVARLRHLGINVKSIEEDERCVIPMGG  583
             FLYAMPF S+ IFLEETSLV+RP L   D++ RMVARLRHLGI V+ + EDE+C+IPMGG
Sbjct  276   FLYAMPFDSSLIFLEETSLVSRPVLAYSDVKNRMVARLRHLGIRVRRVLEDEKCLIPMGG  335

Query  582   PLPVIPQRVVGIGGTAGMVHPSTGYMVARTLAAAPVVANAIIQYLGSERSLLGNELSASV  403
             PLP IPQ V+ IGGT+G+VHPSTGYMVARTLA APV+A  I + LGS R + G  L   V
Sbjct  336   PLPRIPQSVMAIGGTSGIVHPSTGYMVARTLALAPVLAETIAECLGSTRMIRGRPLHHRV  395

Query  402   WKDLWPIERRRQREFFCFGMDILLKLDLPATRRFFDAFFDLEPRYWHGFLSSRLFLRELI  223
             W  LWP++RR  REF+ FGM+ LLKLDL  TRRFFDAFFDL P YWHGFLSSRL + EL 
Sbjct  396   WNGLWPVDRRCTREFYHFGMETLLKLDLNGTRRFFDAFFDLNPYYWHGFLSSRLSIGELF  455

Query  222   FFGLSLFSHASNTSRLEIMTKGTLPLVNMINNL  124
                LSLF HAS+ S+ +I+TK   PL+ M+ NL
Sbjct  456   MLSLSLFGHASSPSKFDIITKCPAPLIKMVGNL  488



>gb|ACJ66629.1| lycopene beta-cyclase [Actinidia deliciosa]
Length=443

 Score =   525 bits (1353),  Expect = 9e-178, Method: Compositional matrix adjust.
 Identities = 249/393 (63%), Positives = 306/393 (78%), Gaps = 0/393 (0%)
 Frame = -2

Query  1302  SQAGLSVCSIDPSPKLIWPNNYGVWVDEFEAMDLLDCLDTTWSGAMVYIDDRTTKDLDRP  1123
             S+ G+ VC +DPSP  +WPNNYGVWVDEFE++ L DCLD TW  A V I+D  TK LDRP
Sbjct  46    SRYGIKVCCVDPSPLSMWPNNYGVWVDEFESLGLEDCLDKTWPVARVSINDHKTKYLDRP  105

Query  1122  YGRVNRKKLKSKMMQKCITNGVKFHQAKVIKVIHEESKSMLICSDGVTIQATVVLDATGF  943
             YGRV+RK+LK K+++ C++NGVKFHQAKV KV H+E +S + CSDG  ++A +V+DA+GF
Sbjct  106   YGRVSRKELKMKLLEGCLSNGVKFHQAKVWKVEHQEFESFVECSDGNELKACLVVDASGF  165

Query  942   SRCLVQYDKPYNPGYQVAYGILAEVEEHPYDLNKMVFMDWRDSHLNSNLELKERNKRIPT  763
             S    +YDKP N GYQ+A+GILAEV+ HP+DL+KMV MDWRDSHL S   ++  N R PT
Sbjct  166   SSSFTEYDKPRNHGYQIAHGILAEVDCHPFDLDKMVLMDWRDSHLGSEPCIRASNSRFPT  225

Query  762   FLYAMPFSSTRIFLEETSLVARPGLDMKDIQERMVARLRHLGINVKSIEEDERCVIPMGG  583
             FLY MPF S  IFLEETSLV+RP L  +++++RMVARLRHLGI VK+I EDE+C+IPMGG
Sbjct  226   FLYVMPFDSNLIFLEETSLVSRPVLSYREVKKRMVARLRHLGIRVKTIIEDEKCLIPMGG  285

Query  582   PLPVIPQRVVGIGGTAGMVHPSTGYMVARTLAAAPVVANAIIQYLGSERSLLGNELSASV  403
             PLP IPQRVV IGG++G+VHPSTGYMVARTLA APV+A+AI + LGS R + G  L   +
Sbjct  286   PLPRIPQRVVPIGGSSGLVHPSTGYMVARTLAIAPVLADAIAECLGSTRMIRGMPLGHRL  345

Query  402   WKDLWPIERRRQREFFCFGMDILLKLDLPATRRFFDAFFDLEPRYWHGFLSSRLFLRELI  223
             W +LWP ERR  RE++ FGM+ LLKLDL  TR FFDAFFDL+P YW GFLSSRL + EL 
Sbjct  346   WNELWPFERRCVREYYSFGMETLLKLDLKGTRNFFDAFFDLDPHYWQGFLSSRLSIGELA  405

Query  222   FFGLSLFSHASNTSRLEIMTKGTLPLVNMINNL  124
                LSLF HASN SR +I+TK  +PLV M+ NL
Sbjct  406   MLSLSLFGHASNPSRFDIVTKCPVPLVKMMGNL  438



>gb|EYU26726.1| hypothetical protein MIMGU_mgv1a027151mg [Erythranthe guttata]
Length=495

 Score =   527 bits (1357),  Expect = 1e-177, Method: Compositional matrix adjust.
 Identities = 262/452 (58%), Positives = 336/452 (74%), Gaps = 1/452 (0%)
 Frame = -2

Query  1476  RNVGRVKASS-SALLELVPVTKKENLDFELPMFEPSKGIvvdlavvgggpaglavaqqVS  1300
             +N+ RV++SS S  L+L P +K E+LDFE+P F P+     D+ V+G GPAGL +A+QV+
Sbjct  39    KNLQRVQSSSFSTFLDLEPKSKPESLDFEIPFFNPADRHRFDVIVIGAGPAGLRLAEQVA  98

Query  1299  QAGLSVCSIDPSPKLIWPNNYGVWVDEFEAMDLLDCLDTTWSGAMVYIDDRTTKDLDRPY  1120
               G+ VC +DPSP  +WPNNYGVWVDEFE++ L DCLD TW    V+I+D  TK LDR Y
Sbjct  99    GHGIKVCCLDPSPLSMWPNNYGVWVDEFESLGLDDCLDKTWPMTCVHINDNKTKYLDRAY  158

Query  1119  GRVNRKKLKSKMMQKCITNGVKFHQAKVIKVIHEESKSMLICSDGVTIQATVVLDATGFS  940
             GRVNRK LK K++  C TNGVKFH+AKV KV H+E  S + C DG  ++A +++DA+GFS
Sbjct  159   GRVNRKDLKLKLLSDCATNGVKFHKAKVWKVDHDEFVSSISCDDGTELKADLIVDASGFS  218

Query  939   RCLVQYDKPYNPGYQVAYGILAEVEEHPYDLNKMVFMDWRDSHLNSNLELKERNKRIPTF  760
                V+YDKP N GYQ+A+GILAEV+ HP+DL+KM+ MDWRDSHL +   L+  N + PTF
Sbjct  219   SKFVEYDKPRNQGYQIAHGILAEVDRHPFDLDKMLLMDWRDSHLGNEPSLRPHNSKFPTF  278

Query  759   LYAMPFSSTRIFLEETSLVARPGLDMKDIQERMVARLRHLGINVKSIEEDERCVIPMGGP  580
             LYAMPF S  +FLEETSLV+RP L   +I++RMVARLRHLGI V+++ EDE+CVIPMGGP
Sbjct  279   LYAMPFDSNLVFLEETSLVSRPMLSYTEIKKRMVARLRHLGIKVRAVIEDEKCVIPMGGP  338

Query  579   LPVIPQRVVGIGGTAGMVHPSTGYMVARTLAAAPVVANAIIQYLGSERSLLGNELSASVW  400
             LP IPQ V+ IGG +G+VHPSTGY VA+T+A AP +A  I + LGS R + G  L    W
Sbjct  339   LPRIPQNVMAIGGNSGIVHPSTGYTVAQTMALAPFLAETIAECLGSTRMIRGTPLYHKAW  398

Query  399   KDLWPIERRRQREFFCFGMDILLKLDLPATRRFFDAFFDLEPRYWHGFLSSRLFLRELIF  220
               LWP+ERR  RE++ FGM+ LLKLDL  TRRFFDAFF+L+P YWHGFLSSRL + EL  
Sbjct  399   NGLWPLERRCSREYYNFGMETLLKLDLNGTRRFFDAFFELKPHYWHGFLSSRLSVGELFM  458

Query  219   FGLSLFSHASNTSRLEIMTKGTLPLVNMINNL  124
              G+SLF HAS TS+L+++ K   P+  M+ N+
Sbjct  459   MGISLFGHASTTSKLDMVRKCPAPMARMMGNM  490



>ref|XP_002523837.1| Capsanthin/capsorubin synthase, chloroplast precursor, putative 
[Ricinus communis]
 gb|EEF38563.1| Capsanthin/capsorubin synthase, chloroplast precursor, putative 
[Ricinus communis]
Length=495

 Score =   527 bits (1357),  Expect = 1e-177, Method: Compositional matrix adjust.
 Identities = 259/448 (58%), Positives = 342/448 (76%), Gaps = 1/448 (0%)
 Frame = -2

Query  1464  RVKASS-SALLELVPVTKKENLDFELPMFEPSKGIvvdlavvgggpaglavaqqVSQAGL  1288
             R+++S+  + L+L P +K E LDF+L  F+PS     D+ ++G GPAGL +A+QVS+ G+
Sbjct  43    RIRSSNLESFLDLQPESKSELLDFDLSRFDPSSKSRFDVIIIGTGPAGLRLAEQVSRYGI  102

Query  1287  SVCSIDPSPKLIWPNNYGVWVDEFEAMDLLDCLDTTWSGAMVYIDDRTTKDLDRPYGRVN  1108
              VC +DPSP  +WPNNYGVWVDEFE +  +DCL+ TW    V+IDD  TK LDRPYGRV 
Sbjct  103   KVCCVDPSPLSMWPNNYGVWVDEFEDLGFVDCLNKTWPMTCVFIDDHKTKYLDRPYGRVC  162

Query  1107  RKKLKSKMMQKCITNGVKFHQAKVIKVIHEESKSMLICSDGVTIQATVVLDATGFSRCLV  928
             RKKLK+K+M+ C++ GV+FH+AKV +V HEE +S ++C DG  ++A++++DA+GF+   +
Sbjct  163   RKKLKTKLMENCVSKGVQFHKAKVWEVGHEEFESSVVCDDGNELKASLIVDASGFTSTFI  222

Query  927   QYDKPYNPGYQVAYGILAEVEEHPYDLNKMVFMDWRDSHLNSNLELKERNKRIPTFLYAM  748
             +YDKP N GYQ+A+GILAEV+ HP+DL+KMV MDWRDSH+ +   L+  N R PTFLYAM
Sbjct  223   EYDKPRNHGYQIAHGILAEVDCHPFDLDKMVLMDWRDSHMGNEPYLRASNSRFPTFLYAM  282

Query  747   PFSSTRIFLEETSLVARPGLDMKDIQERMVARLRHLGINVKSIEEDERCVIPMGGPLPVI  568
             PF S  IFLEETSLV+RP L   +++ RMVARLRHLGI V+ + EDE+C+IPMGGPLP I
Sbjct  283   PFDSNLIFLEETSLVSRPVLPYMEVKRRMVARLRHLGIRVRRVIEDEKCLIPMGGPLPRI  342

Query  567   PQRVVGIGGTAGMVHPSTGYMVARTLAAAPVVANAIIQYLGSERSLLGNELSASVWKDLW  388
             PQ V+ IGG +G+VHPSTGYMVART+A AP++A+ I + LGS R + G  L   VWK LW
Sbjct  343   PQTVMAIGGNSGVVHPSTGYMVARTMALAPILADVIAECLGSTRMIRGRPLYDRVWKGLW  402

Query  387   PIERRRQREFFCFGMDILLKLDLPATRRFFDAFFDLEPRYWHGFLSSRLFLRELIFFGLS  208
             P++++  RE++ FGM+ LLKLDL  TR FF+AFFDL+P YW GFLSSRL L +L    LS
Sbjct  403   PLDKKCTREYYSFGMETLLKLDLKGTRNFFNAFFDLDPYYWEGFLSSRLSLGQLALLSLS  462

Query  207   LFSHASNTSRLEIMTKGTLPLVNMINNL  124
             LF +ASN+SR +I+TK  LPLV M+NNL
Sbjct  463   LFGNASNSSRFDIVTKCPLPLVRMMNNL  490



>ref|XP_008361015.1| PREDICTED: capsanthin/capsorubin synthase, chromoplast-like [Malus 
domestica]
Length=496

 Score =   525 bits (1352),  Expect = 8e-177, Method: Compositional matrix adjust.
 Identities = 257/439 (59%), Positives = 335/439 (76%), Gaps = 0/439 (0%)
 Frame = -2

Query  1440  LLELVPVTKKENLDFELPMFEPSKGIvvdlavvgggpaglavaqqVSQAGLSVCSIDPSP  1261
              L+L P  K E+L F+L  F+PS    +D+ ++G GPAGL +A+Q+S+ G+ VC +DPSP
Sbjct  53    FLDLKPEAKPESLHFDLHQFDPSTRSRLDVIIIGTGPAGLRLAEQLSRYGIKVCCVDPSP  112

Query  1260  KLIWPNNYGVWVDEFEAMDLLDCLDTTWSGAMVYIDDRTTKDLDRPYGRVNRKKLKSKMM  1081
               +WPNNYGVWVDEFE+++L  CLD  W  A V+++D   K LDRPYGRV+RKKLK+ ++
Sbjct  113   LSMWPNNYGVWVDEFESLNLESCLDKIWPMASVHVNDSKIKFLDRPYGRVSRKKLKTLLL  172

Query  1080  QKCITNGVKFHQAKVIKVIHEESKSMLICSDGVTIQATVVLDATGFSRCLVQYDKPYNPG  901
             ++C+ NGV+FH+AKV K+ HEE +S ++C DG  ++A++++DA+GF+   ++Y+KP N G
Sbjct  173   ERCLXNGVQFHRAKVWKIEHEEFESSILCDDGNELKASLIVDASGFASSFIEYEKPRNHG  232

Query  900   YQVAYGILAEVEEHPYDLNKMVFMDWRDSHLNSNLELKERNKRIPTFLYAMPFSSTRIFL  721
             YQ+A+GILAEVEEHP+DL+KM+ MDWRDSHL +   L+  N R PTFLYAMPF S  +FL
Sbjct  233   YQIAHGILAEVEEHPFDLDKMLLMDWRDSHLGNEPYLRTSNSRFPTFLYAMPFDSNLVFL  292

Query  720   EETSLVARPGLDMKDIQERMVARLRHLGINVKSIEEDERCVIPMGGPLPVIPQRVVGIGG  541
             EETSLV+RP L   +I++RMVARLRHLGI VK + E+E+C+IPMGGPLP IPQRV+ IGG
Sbjct  293   EETSLVSRPVLSYMEIKKRMVARLRHLGIRVKRVIEEEKCLIPMGGPLPRIPQRVMAIGG  352

Query  540   TAGMVHPSTGYMVARTLAAAPVVANAIIQYLGSERSLLGNELSASVWKDLWPIERRRQRE  361
             T+G+VHPSTGYMVART+A APV+A AI + LGS R + G  L    W  LWPIERR  R+
Sbjct  353   TSGVVHPSTGYMVARTMALAPVLAEAIAECLGSTRMIRGQPLYHRAWNGLWPIERRCTRD  412

Query  360   FFCFGMDILLKLDLPATRRFFDAFFDLEPRYWHGFLSSRLFLRELIFFGLSLFSHASNTS  181
             F+ FGM+ LLKLDL  +R FFDAFFDL+P YW GFLSSRL LREL    LSLF  AS  S
Sbjct  413   FYSFGMETLLKLDLNGSRSFFDAFFDLDPYYWQGFLSSRLSLRELALLSLSLFGRASTPS  472

Query  180   RLEIMTKGTLPLVNMINNL  124
             R +I+TK  +PLV ++ NL
Sbjct  473   RFDIVTKCPVPLVKLMGNL  491



>ref|XP_011088917.1| PREDICTED: capsanthin/capsorubin synthase, chromoplast-like [Sesamum 
indicum]
Length=495

 Score =   523 bits (1347),  Expect = 4e-176, Method: Compositional matrix adjust.
 Identities = 257/440 (58%), Positives = 330/440 (75%), Gaps = 0/440 (0%)
 Frame = -2

Query  1443  ALLELVPVTKKENLDFELPMFEPSKGIvvdlavvgggpaglavaqqVSQAGLSVCSIDPS  1264
             + L+L P +K E LDF++P F P+ G   D+ V+G GPAGL +A+QVS  G+ VC +DPS
Sbjct  51    SFLDLEPKSKPEPLDFDVPWFHPADGRRFDVIVIGAGPAGLRLAEQVSGHGIKVCCLDPS  110

Query  1263  PKLIWPNNYGVWVDEFEAMDLLDCLDTTWSGAMVYIDDRTTKDLDRPYGRVNRKKLKSKM  1084
             P  +WPNNYGVW+DEFE++ L DCLD TW    V+I+DR  K LDR YGRV+RK+LK K+
Sbjct  111   PLSMWPNNYGVWIDEFESLGLEDCLDKTWPMTCVFINDRKIKYLDRAYGRVSRKELKLKL  170

Query  1083  MQKCITNGVKFHQAKVIKVIHEESKSMLICSDGVTIQATVVLDATGFSRCLVQYDKPYNP  904
             +  C  NGVKFH+AKV KV HEE +S + C DG  ++A++++DA+GF    V+YDKP NP
Sbjct  171   LSNCAANGVKFHKAKVGKVEHEEFESSIACDDGTELKASLIVDASGFRSSFVEYDKPRNP  230

Query  903   GYQVAYGILAEVEEHPYDLNKMVFMDWRDSHLNSNLELKERNKRIPTFLYAMPFSSTRIF  724
             GYQ+A+GILAEV++HPYDL+KMV MDWRDSHL +   L+  N R+PTF+YAMPF S  +F
Sbjct  231   GYQIAHGILAEVDQHPYDLDKMVLMDWRDSHLGNEPYLRASNSRLPTFMYAMPFDSNLVF  290

Query  723   LEETSLVARPGLDMKDIQERMVARLRHLGINVKSIEEDERCVIPMGGPLPVIPQRVVGIG  544
             LEETSLV+RP L   +I++RMVARLR LGI V+++ EDE+C+IPMGGPLP IPQ ++ IG
Sbjct  291   LEETSLVSRPLLSYTEIKQRMVARLRQLGIRVRTVIEDEKCLIPMGGPLPRIPQSMIAIG  350

Query  543   GTAGMVHPSTGYMVARTLAAAPVVANAIIQYLGSERSLLGNELSASVWKDLWPIERRRQR  364
             G +G+VHPSTGY VA+T+A APVVA AI + LGS R + G+ L    W  LWP+E+R  R
Sbjct  351   GNSGIVHPSTGYTVAQTMAVAPVVAEAIAECLGSTRMIRGSHLYRRAWNALWPVEKRWCR  410

Query  363   EFFCFGMDILLKLDLPATRRFFDAFFDLEPRYWHGFLSSRLFLRELIFFGLSLFSHASNT  184
             EF+ FGM+ LLKLDL  TR FFDAFF+L P  W GFLS+RL   ELI  G+SLF  ASN 
Sbjct  411   EFYNFGMETLLKLDLNGTRSFFDAFFELNPHLWQGFLSARLSYGELIMLGISLFGRASNP  470

Query  183   SRLEIMTKGTLPLVNMINNL  124
             SRL+++TK   PLV M+ N+
Sbjct  471   SRLDMLTKCPAPLVQMVGNI  490



>ref|XP_003541965.1| PREDICTED: capsanthin/capsorubin synthase, chromoplast-like [Glycine 
max]
Length=493

 Score =   522 bits (1345),  Expect = 9e-176, Method: Compositional matrix adjust.
 Identities = 262/455 (58%), Positives = 337/455 (74%), Gaps = 3/455 (1%)
 Frame = -2

Query  1482  ACRNVGRVKASS--SALLELVPVTKKENLDFELPMFEPSKGIvvdlavvgggpaglavaq  1309
             A RN  RV ++S     L+  P  K E+LDF+LP   PS     D+ ++G GPAG  +A+
Sbjct  34    ASRN-KRVHSTSKFGNFLDFKPENKPESLDFDLPWCHPSDRNRFDVIIIGAGPAGTRLAE  92

Query  1308  qVSQAGLSVCSIDPSPKLIWPNNYGVWVDEFEAMDLLDCLDTTWSGAMVYIDDRTTKDLD  1129
             QVS  G+ VC +DP P  +WPNNYGVW DEFE++ L DCLD TW  A VY+DD  TK LD
Sbjct  93    QVSLYGVKVCCVDPDPLSVWPNNYGVWRDEFESLGLEDCLDKTWPMACVYVDDGKTKYLD  152

Query  1128  RPYGRVNRKKLKSKMMQKCITNGVKFHQAKVIKVIHEESKSMLICSDGVTIQATVVLDAT  949
             R YGRV R+KLK +++Q C++NGV+FH+AKV +V H+E +S ++C DGV ++ ++V+DA+
Sbjct  153   RCYGRVGRRKLKERLVQGCVSNGVRFHKAKVWQVQHQEFESKVLCDDGVELKGSLVVDAS  212

Query  948   GFSRCLVQYDKPYNPGYQVAYGILAEVEEHPYDLNKMVFMDWRDSHLNSNLELKERNKRI  769
             GF+   V YDK  + G+Q+A+G+LAEV++HP+DL+KMV MDWRDSHL +   L+  N R 
Sbjct  213   GFASNFVAYDKVRHHGFQIAHGVLAEVDDHPFDLDKMVLMDWRDSHLGNEPYLRASNSRF  272

Query  768   PTFLYAMPFSSTRIFLEETSLVARPGLDMKDIQERMVARLRHLGINVKSIEEDERCVIPM  589
             PTFLYAMPFSS  IFLEETSLV+RP L   +++ RMVARLRHLGI VK + EDE+C+IPM
Sbjct  273   PTFLYAMPFSSNLIFLEETSLVSRPVLSYMEVKRRMVARLRHLGIRVKRVLEDEKCLIPM  332

Query  588   GGPLPVIPQRVVGIGGTAGMVHPSTGYMVARTLAAAPVVANAIIQYLGSERSLLGNELSA  409
             GGPLP IPQ V+ IGGT+G+VHPSTGYMVART+A APVVA AI Q LGS R + G +L  
Sbjct  333   GGPLPRIPQEVMAIGGTSGVVHPSTGYMVARTMAVAPVVAFAITQCLGSTRMIRGKQLHD  392

Query  408   SVWKDLWPIERRRQREFFCFGMDILLKLDLPATRRFFDAFFDLEPRYWHGFLSSRLFLRE  229
              VW  +WPIE R  REF+ FGM+ LLKLDL  +R FFDAFF+L+P YW GFLSSRL L E
Sbjct  393   KVWNSMWPIENRLVREFYSFGMETLLKLDLNGSRSFFDAFFNLKPYYWQGFLSSRLTLNE  452

Query  228   LIFFGLSLFSHASNTSRLEIMTKGTLPLVNMINNL  124
             L++  +SLF HASN SR +I+TK  +P+  M+ N+
Sbjct  453   LLWLSISLFGHASNPSRFDIVTKCPVPMAKMVGNI  487



>emb|CDP06888.1| unnamed protein product [Coffea canephora]
Length=495

 Score =   518 bits (1333),  Expect = 6e-174, Method: Compositional matrix adjust.
 Identities = 272/500 (54%), Positives = 360/500 (72%), Gaps = 14/500 (3%)
 Frame = -2

Query  1611  MDTLLKTPNELEFL--HPHHGFAVKASAFTSLKPQKQEIRIGSWKACRNV-GRVKASS-S  1444
             M+TLL+    L F   HP   ++     F S K +          + RNV  RV++S  +
Sbjct  1     METLLRPSPFLAFSTSHPPMSYSSLNPPFVSPKTKT---------SARNVRNRVRSSKFN  51

Query  1443  ALLELVPVTKKENLDFELPMFEPSKGIvvdlavvgggpaglavaqqVSQAGLSVCSIDPS  1264
             + L+L P  K E LDF++   +PS     DL ++G GPAGL +A+QVS+ G+ VC +DPS
Sbjct  52    SFLDLEPAWKPEPLDFDVSWLDPSDR-RFDLIIIGAGPAGLRLAEQVSRYGIKVCCVDPS  110

Query  1263  PKLIWPNNYGVWVDEFEAMDLLDCLDTTWSGAMVYIDDRTTKDLDRPYGRVNRKKLKSKM  1084
             P  +WPNNYGVWVDEFE++ L DCLD TW    VYI+D  T+ LDR YGRV+RK+LK K+
Sbjct  111   PLSMWPNNYGVWVDEFESLGLDDCLDKTWPMCSVYINDHKTRYLDRAYGRVSRKELKIKL  170

Query  1083  MQKCITNGVKFHQAKVIKVIHEESKSMLICSDGVTIQATVVLDATGFSRCLVQYDKPYNP  904
             +  C++N VKFH+AKV K+ H+E +S ++C+DG  ++A++++DA+G++   ++YD+P N 
Sbjct  171   LSGCVSNHVKFHEAKVWKIEHQEFESSVVCTDGSELKASLIVDASGYASPFIEYDRPRNH  230

Query  903   GYQVAYGILAEVEEHPYDLNKMVFMDWRDSHLNSNLELKERNKRIPTFLYAMPFSSTRIF  724
             G Q+A+GILAEV+ HP+DL+KMV MDWRDSHL S  +L++ N +IPTFLYAMPFSS  IF
Sbjct  231   GCQIAHGILAEVDNHPFDLDKMVLMDWRDSHLGSEPDLRKDNSKIPTFLYAMPFSSNLIF  290

Query  723   LEETSLVARPGLDMKDIQERMVARLRHLGINVKSIEEDERCVIPMGGPLPVIPQRVVGIG  544
             LEETSLVARP L   ++++RMVARLRHLG+ V+S+ E+E+C I MGGPLP IPQ V+ IG
Sbjct  291   LEETSLVARPVLSYMEVKKRMVARLRHLGVKVRSVMEEEKCFILMGGPLPKIPQSVMAIG  350

Query  543   GTAGMVHPSTGYMVARTLAAAPVVANAIIQYLGSERSLLGNELSASVWKDLWPIERRRQR  364
             G +G+VHPS+GYMVART+A APV+A+ I + LGS R + G  L   VWK LWP+ERRR R
Sbjct  351   GNSGIVHPSSGYMVARTMALAPVLADTIAECLGSTRMIRGTPLYDRVWKGLWPVERRRVR  410

Query  363   EFFCFGMDILLKLDLPATRRFFDAFFDLEPRYWHGFLSSRLFLRELIFFGLSLFSHASNT  184
             EF  FGM+ LL+LDL  TRRFFDAFFDL+P +W GF+SS L  REL    LSLF HASN 
Sbjct  411   EFHSFGMETLLQLDLNGTRRFFDAFFDLDPHHWKGFMSSNLSPRELAMLCLSLFGHASNP  470

Query  183   SRLEIMTKGTLPLVNMINNL  124
              RL+++TK   PLV MI N+
Sbjct  471   CRLDMVTKCPGPLVRMIRNM  490



>gb|ADX36406.1| lycopene beta-cyclase [Ficus carica]
Length=495

 Score =   517 bits (1332),  Expect = 7e-174, Method: Compositional matrix adjust.
 Identities = 253/439 (58%), Positives = 334/439 (76%), Gaps = 0/439 (0%)
 Frame = -2

Query  1440  LLELVPVTKKENLDFELPMFEPSKGIvvdlavvgggpaglavaqqVSQAGLSVCSIDPSP  1261
              L L P  K ++L+ +LP++ P     +D+ ++G GPAGL +A+QVS  G+ VC +DP P
Sbjct  52    FLHLRPELKPQSLNLDLPLWAPHDRSPLDVVIIGAGPAGLRLAEQVSGRGIRVCCVDPFP  111

Query  1260  KLIWPNNYGVWVDEFEAMDLLDCLDTTWSGAMVYIDDRTTKDLDRPYGRVNRKKLKSKMM  1081
                WPNNYGVWVDEFE++ L  CLD TW  A V+I+D  TK LDRPYGRVNR++LK +++
Sbjct  112   LSSWPNNYGVWVDEFESLKLETCLDKTWPMACVHINDNKTKYLDRPYGRVNRERLKMELL  171

Query  1080  QKCITNGVKFHQAKVIKVIHEESKSMLICSDGVTIQATVVLDATGFSRCLVQYDKPYNPG  901
             Q+C++NGVKFH+A V ++ H+E  S ++C DG  ++A++V+DA+GF    V+YDKP N G
Sbjct  172   QRCVSNGVKFHKAMVWEIEHQEFDSFVVCDDGNRVKASLVVDASGFGSNFVKYDKPRNHG  231

Query  900   YQVAYGILAEVEEHPYDLNKMVFMDWRDSHLNSNLELKERNKRIPTFLYAMPFSSTRIFL  721
             YQ+A+G+LAEVE HP+DL+KMV MDWRDSHL +   L++ N ++PTFLYAMPF S  +FL
Sbjct  232   YQIAHGVLAEVEGHPFDLDKMVLMDWRDSHLGNEPYLRDGNSKLPTFLYAMPFDSNLVFL  291

Query  720   EETSLVARPGLDMKDIQERMVARLRHLGINVKSIEEDERCVIPMGGPLPVIPQRVVGIGG  541
             EETSLV RP L   ++++RMVARLRHLGI VK + EDE+C+IPMGGPLP IPQ V+ +GG
Sbjct  292   EETSLVGRPVLCYMEVKKRMVARLRHLGIRVKRVLEDEKCLIPMGGPLPKIPQSVMAMGG  351

Query  540   TAGMVHPSTGYMVARTLAAAPVVANAIIQYLGSERSLLGNELSASVWKDLWPIERRRQRE  361
              +G+VHPSTGYM+ART+  A V+A AI++ LGS R + G  L   VW  LWP+ERR +RE
Sbjct  352   NSGVVHPSTGYMLARTMGLASVLAEAIVEGLGSTRMVRGRPLYHRVWNGLWPMERRCERE  411

Query  360   FFCFGMDILLKLDLPATRRFFDAFFDLEPRYWHGFLSSRLFLRELIFFGLSLFSHASNTS  181
             F+ FGMDILLKLDL  TRRFFDAFFDL+P YWHGFLSSRL + E++   LSLF HAS  S
Sbjct  412   FYSFGMDILLKLDLNGTRRFFDAFFDLKPHYWHGFLSSRLTIGEIVLLSLSLFGHASAPS  471

Query  180   RLEIMTKGTLPLVNMINNL  124
             +++I+TK  +PL+ M+ NL
Sbjct  472   KVDIVTKCPVPLLKMMGNL  490



>ref|XP_010912323.1| PREDICTED: capsanthin/capsorubin synthase, chromoplast-like [Elaeis 
guineensis]
Length=519

 Score =   518 bits (1334),  Expect = 1e-173, Method: Compositional matrix adjust.
 Identities = 270/459 (59%), Positives = 336/459 (73%), Gaps = 5/459 (1%)
 Frame = -2

Query  1473  NVGRVKASSSAL---LELVPVTKKENLDFELPMFEPSKGIvvdlavvgggpaglavaqqV  1303
             N   ++A SS L   L+L   +K E L  +L   EPS     D  ++G GPAGL +A+QV
Sbjct  61    NKTTIRARSSGLQSFLDLSCESKPECLAIDLQWHEPSNSSSYDAIILGCGPAGLRLAEQV  120

Query  1302  SQAGLSVCSIDPSPKLIWPNNYGVWVDEFEAMDLLDCLDTTWSGAMVYIDDRTTKDLDRP  1123
             S  G+ VC IDPSP   WPNNYGVWVDEF AM L  CLD  W    ++IDDR TK L RP
Sbjct  121   SSHGVHVCCIDPSPLSAWPNNYGVWVDEFGAMGLEGCLDKVWPMTTIFIDDRKTKYLGRP  180

Query  1122  YGRVNRKKLKSKMMQKCITNGVKFHQAKVIKVIHEESKSMLICSDGVTIQATVVLDATGF  943
             YGRV+RK+LK+++++ C +NGV+FH+AK  KV H+E  S + CSDG  ++A++V++ATGF
Sbjct  181   YGRVSRKRLKTQLLEGCASNGVEFHKAKAWKVEHKEFSSTVSCSDGSELKASMVVNATGF  240

Query  942   SRCLVQYDKPY-NPGYQVAYGILAEVEEHPYDLNKMVFMDWRDSHLNSNLELKERNKRIP  766
             +   ++YD+P  N GYQ+A+GILAEVE HP+D +KMV MDWRDSH+ S   L+ RN ++P
Sbjct  241   TSPFIEYDEPRRNHGYQIAHGILAEVEGHPFDTDKMVLMDWRDSHMGSEPCLRPRNGQLP  300

Query  765   TFLYAMPFSSTRIFLEETSLVARPGLDMKDIQERMVARLRHLGINVKSIEEDERCVIPMG  586
             +FLYAMPF S  IFLEETSLV+RP L   +++ RMVARLRHLGI VK + EDE+C+IPMG
Sbjct  301   SFLYAMPFDSKLIFLEETSLVSRPVLPYVEVKRRMVARLRHLGIKVKRVIEDEKCLIPMG  360

Query  585   GPLPVIPQRVVGIGGTAGMVHPSTGYMVARTLAAAPVVANAIIQYLGSERSLLGNELSAS  406
             G LPVIPQ V+GIGG+ G+VHPSTGYMVARTLA APVVA+A+ + LGS R + G +L   
Sbjct  361   GALPVIPQNVMGIGGSGGLVHPSTGYMVARTLALAPVVADAMAECLGSTRMMRGRQLYGR  420

Query  405   VWKDLWPIERRRQREFFCFGMDILLKLDLPATRRFFDAFFDLEPRYWHGFLSSRLFLREL  226
             VW  LW  ERRR REF+CFGM+ LL+LDL  TRRFFDAFFDL+P YW GFLSSRL L EL
Sbjct  421   VWAALWTGERRRAREFYCFGMETLLRLDLKGTRRFFDAFFDLDPYYWEGFLSSRLSLGEL  480

Query  225   IFFGLSLFSHASNTSRLEIMTKGTLPLVNMINNL-LQDI  112
             I   LSLF HASN S+L+I+TK   PL  +I  L LQ I
Sbjct  481   IALSLSLFGHASNPSKLDIVTKCPGPLARLIGTLALQSI  519



>gb|AFV50599.1| lycopene cyclase, partial [Solanum sparsipilum]
Length=267

 Score =   507 bits (1305),  Expect = 3e-173, Method: Compositional matrix adjust.
 Identities = 238/267 (89%), Positives = 254/267 (95%), Gaps = 0/267 (0%)
 Frame = -2

Query  1218  FEAMDLLDCLDTTWSGAMVYIDDRTTKDLDRPYGRVNRKKLKSKMMQKCITNGVKFHQAK  1039
             FEAMDLLDCLD TWSGA+VY+DD  TK+LDRPYGRVNRK+LKSKMMQKCI NGVKFHQAK
Sbjct  1     FEAMDLLDCLDATWSGAVVYVDDDRTKNLDRPYGRVNRKQLKSKMMQKCILNGVKFHQAK  60

Query  1038  VIKVIHEESKSMLICSDGVTIQATVVLDATGFSRCLVQYDKPYNPGYQVAYGILAEVEEH  859
             VIKVIHEE+KSMLICSDGVTIQATVVLDATGFSRCLVQYDKPYNPGYQVAYGILAEVEEH
Sbjct  61    VIKVIHEEAKSMLICSDGVTIQATVVLDATGFSRCLVQYDKPYNPGYQVAYGILAEVEEH  120

Query  858   PYDLNKMVFMDWRDSHLNSNLELKERNKRIPTFLYAMPFSSTRIFLEETSLVARPGLDMK  679
             P+D +KM+FMDWRDSHLN+N+ELKERN+++PTFLYAMPFSS RIFLEETSLVARPGL M 
Sbjct  121   PFDTSKMLFMDWRDSHLNNNMELKERNRKVPTFLYAMPFSSNRIFLEETSLVARPGLRMD  180

Query  678   DIQERMVARLRHLGINVKSIEEDERCVIPMGGPLPVIPQRVVGIGGTAGMVHPSTGYMVA  499
             DIQERMVARL HLG+ VKSIEEDE CVIPMGGPLPVIPQRVVGIGGTAGMVHPSTGYMVA
Sbjct  181   DIQERMVARLSHLGMKVKSIEEDEHCVIPMGGPLPVIPQRVVGIGGTAGMVHPSTGYMVA  240

Query  498   RTLAAAPVVANAIIQYLGSERSLLGNE  418
             RTLAAAPVVANAIIQYLGS++  LGNE
Sbjct  241   RTLAAAPVVANAIIQYLGSDKDHLGNE  267



>gb|AGR67391.1| lycopene beta-cyclase, partial [Citrus reshni]
Length=313

 Score =   508 bits (1309),  Expect = 4e-173, Method: Compositional matrix adjust.
 Identities = 269/313 (86%), Positives = 290/313 (93%), Gaps = 3/313 (1%)
 Frame = -2

Query  1521  KPQKQEIRIGSWKA--CRNVGR-VKASSSALLELVPVTKKENLDFELPMFEPSKGIvvdl  1351
             K Q QE+R G  K+   RN+   +KASSSALLELVP TKKENL+FELPM++PSKG+VVDL
Sbjct  1     KIQNQELRFGLKKSRQKRNMSCFIKASSSALLELVPETKKENLEFELPMYDPSKGLVVDL  60

Query  1350  avvgggpaglavaqqVSQAGLSVCSIDPSPKLIWPNNYGVWVDEFEAMDLLDCLDTTWSG  1171
             AVVGGGPAGLAVAQQVS+AGLSVCSIDPSPKLIWPNNYGVWVDEFEAMDLLDCLDTTWSG
Sbjct  61    AVVGGGPAGLAVAQQVSEAGLSVCSIDPSPKLIWPNNYGVWVDEFEAMDLLDCLDTTWSG  120

Query  1170  AMVYIDDRTTKDLDRPYGRVNRKKLKSKMMQKCITNGVKFHQAKVIKVIHEESKSMLICS  991
             A+V+IDD T KDLDRPYGRVNRK LKSKM+QKCITNGVKFHQAKVIKVIHEESKS+LIC+
Sbjct  121   AVVHIDDNTKKDLDRPYGRVNRKLLKSKMLQKCITNGVKFHQAKVIKVIHEESKSLLICN  180

Query  990   DGVTIQATVVLDATGFSRCLVQYDKPYNPGYQVAYGILAEVEEHPYDLNKMVFMDWRDSH  811
             DGVTIQA VVLDATGFSRCLVQYDKPYNPGYQVAYGILAEVEEHP+DL+KMVFMDWRDSH
Sbjct  181   DGVTIQAAVVLDATGFSRCLVQYDKPYNPGYQVAYGILAEVEEHPFDLDKMVFMDWRDSH  240

Query  810   LNSNLELKERNKRIPTFLYAMPFSSTRIFLEETSLVARPGLDMKDIQERMVARLRHLGIN  631
             LN+N ELKE N +IPTFLYAMPFSS RIFLEETSLVARPG+ MKDIQERMVARL+HLGI 
Sbjct  241   LNNNSELKEANSKIPTFLYAMPFSSNRIFLEETSLVARPGVPMKDIQERMVARLKHLGIK  300

Query  630   VKSIEEDERCVIP  592
             V+SIEEDE CVIP
Sbjct  301   VRSIEEDEHCVIP  313



>ref|XP_002273862.1| PREDICTED: capsanthin/capsorubin synthase, chromoplast [Vitis 
vinifera]
Length=497

 Score =   514 bits (1324),  Expect = 1e-172, Method: Compositional matrix adjust.
 Identities = 268/472 (57%), Positives = 336/472 (71%), Gaps = 5/472 (1%)
 Frame = -2

Query  1539  SAFTSLKPQKQEIRIGSWKACRNVGRVKASSSALLELVPVTKKENLDFELPMFEPSKGIv  1360
             S F S  P+    R    K C N+   K  S   L+L P ++ E LDF+L   + S    
Sbjct  26    STFPSCLPEN---RYSRGKVCSNIQSSKFDS--FLDLKPESEAELLDFDLRWLDSSCKSC  80

Query  1359  vdlavvgggpaglavaqqVSQAGLSVCSIDPSPKLIWPNNYGVWVDEFEAMDLLDCLDTT  1180
             +D+ ++G GPAGL +A+QVS+ G+ VC IDPSP  +WPNNYGVWVDEFE + L DCLD T
Sbjct  81    LDVIIIGAGPAGLRLAEQVSRYGIHVCCIDPSPLSMWPNNYGVWVDEFEGLGLEDCLDKT  140

Query  1179  WSGAMVYIDDRTTKDLDRPYGRVNRKKLKSKMMQKCITNGVKFHQAKVIKVIHEESKSML  1000
             W    V IDD  TK LDR YGRV+RK+LK K+++ C   GV+FH+AKV KV H+E +S++
Sbjct  141   WPMTCVRIDDHRTKYLDRAYGRVSRKRLKMKLLEICAAYGVQFHKAKVWKVEHQEFESLV  200

Query  999   ICSDGVTIQATVVLDATGFSRCLVQYDKPYNPGYQVAYGILAEVEEHPYDLNKMVFMDWR  820
              C DG  ++A +V+DA+GF+   ++YDKP N GYQ+A+GILAEV+ HP+DL+KM+ MDWR
Sbjct  201   ECDDGSKLRANLVVDASGFASTFIEYDKPRNHGYQIAHGILAEVDSHPFDLDKMLLMDWR  260

Query  819   DSHLNSNLELKERNKRIPTFLYAMPFSSTRIFLEETSLVARPGLDMKDIQERMVARLRHL  640
             DSHL +   ++  N  +PTFLYAMPF+S  IFLEETSLV+RP L  K+++ RMVARLRHL
Sbjct  261   DSHLGNEPYIRAGNSSLPTFLYAMPFNSNLIFLEETSLVSRPMLSYKEVKRRMVARLRHL  320

Query  639   GINVKSIEEDERCVIPMGGPLPVIPQRVVGIGGTAGMVHPSTGYMVARTLAAAPVVANAI  460
             GI V+ + EDE+C+IPMGGPLP IPQ V+ IGGTAG+VHPSTGYMVA+T+A APV+A  I
Sbjct  321   GIRVRRVIEDEKCLIPMGGPLPQIPQSVMAIGGTAGLVHPSTGYMVAKTMALAPVLAETI  380

Query  459   IQYLGSERSLLGNELSASVWKDLWPIERRRQREFFCFGMDILLKLDLPATRRFFDAFFDL  280
              + LGS R + G  L   VW  LWP ERR  REF+ FGM+ LLKLDL  TR FFDAFFDL
Sbjct  381   RECLGSSRMIRGKPLHHRVWNGLWPSERRFTREFYSFGMETLLKLDLNGTRGFFDAFFDL  440

Query  279   EPRYWHGFLSSRLFLRELIFFGLSLFSHASNTSRLEIMTKGTLPLVNMINNL  124
             +P YW GFLSSRL  REL    LSLF  ASN SR +I+TK   PLV M+  L
Sbjct  441   DPYYWQGFLSSRLSPRELALLSLSLFGRASNPSRFDIITKCPAPLVKMMGKL  492



>gb|AAT76051.1| lycopene cyclase, partial [Citrus clementina]
Length=263

 Score =   504 bits (1299),  Expect = 2e-172, Method: Compositional matrix adjust.
 Identities = 237/262 (90%), Positives = 250/262 (95%), Gaps = 0/262 (0%)
 Frame = -2

Query  1293  GLSVCSIDPSPKLIWPNNYGVWVDEFEAMDLLDCLDTTWSGAMVYIDDRTTKDLDRPYGR  1114
             GLSVCSIDPSPKLIWPNNYGVWVDEFEAMDLLDCLDTTWSGA+V+IDD T KDLDRPYGR
Sbjct  1     GLSVCSIDPSPKLIWPNNYGVWVDEFEAMDLLDCLDTTWSGAVVHIDDNTKKDLDRPYGR  60

Query  1113  VNRKKLKSKMMQKCITNGVKFHQAKVIKVIHEESKSMLICSDGVTIQATVVLDATGFSRC  934
             VNRK LKSKM+QKCITNGVKFHQAKVIKVIHEESKS+LIC+DGVTIQA VVLDATGFSRC
Sbjct  61    VNRKLLKSKMLQKCITNGVKFHQAKVIKVIHEESKSLLICNDGVTIQAAVVLDATGFSRC  120

Query  933   LVQYDKPYNPGYQVAYGILAEVEEHPYDLNKMVFMDWRDSHLNSNLELKERNKRIPTFLY  754
             LVQYDKPYNPGYQVAYGILAEVEEHP+DL+KMVFMDWRDSHLN+N ELKE N +IPTFLY
Sbjct  121   LVQYDKPYNPGYQVAYGILAEVEEHPFDLDKMVFMDWRDSHLNNNSELKEANSKIPTFLY  180

Query  753   AMPFSSTRIFLEETSLVARPGLDMKDIQERMVARLRHLGINVKSIEEDERCVIPMGGPLP  574
             AMPFSS RIFLEETSLVARPG+ MKDIQERMVARL+HLGI VKSIEEDE CVIPMGGPLP
Sbjct  181   AMPFSSNRIFLEETSLVARPGVPMKDIQERMVARLKHLGIKVKSIEEDEHCVIPMGGPLP  240

Query  573   VIPQRVVGIGGTAGMVHPSTGY  508
             V+PQRVVGIGG AGMVHPSTG+
Sbjct  241   VLPQRVVGIGGPAGMVHPSTGF  262



>gb|AHE41416.1| lycopene beta-cyclase, partial [Lycium chinense]
Length=261

 Score =   504 bits (1298),  Expect = 3e-172, Method: Compositional matrix adjust.
 Identities = 236/260 (91%), Positives = 251/260 (97%), Gaps = 0/260 (0%)
 Frame = -2

Query  1065  NGVKFHQAKVIKVIHEESKSMLICSDGVTIQATVVLDATGFSRCLVQYDKPYNPGYQVAY  886
             NGVKFHQAKVIKVIHEE+KSMLIC+DGVTIQA VVLDATGFSRCLVQYDKPYNPGYQVAY
Sbjct  2     NGVKFHQAKVIKVIHEEAKSMLICNDGVTIQAKVVLDATGFSRCLVQYDKPYNPGYQVAY  61

Query  885   GILAEVEEHPYDLNKMVFMDWRDSHLNSNLELKERNKRIPTFLYAMPFSSTRIFLEETSL  706
             GILAEVEEHP+D +KM+FMDWRDSHLN+N+ELKERN+++PTFLYAMPFSS RIFLEETSL
Sbjct  62    GILAEVEEHPFDTDKMLFMDWRDSHLNNNMELKERNRKVPTFLYAMPFSSNRIFLEETSL  121

Query  705   VARPGLDMKDIQERMVARLRHLGINVKSIEEDERCVIPMGGPLPVIPQRVVGIGGTAGMV  526
             VARPGL M DIQERMVARL HLGI VKSIEEDERCVIPMGGPLPV+PQRVVGIGGTAGMV
Sbjct  122   VARPGLRMDDIQERMVARLSHLGIKVKSIEEDERCVIPMGGPLPVLPQRVVGIGGTAGMV  181

Query  525   HPSTGYMVARTLAAAPVVANAIIQYLGSERSLLGNELSASVWKDLWPIERRRQREFFCFG  346
             HPSTGYMVARTLAAAP+VA AIIQYLGSE++ LGNELSASVWKDLWPIERRRQREFFCFG
Sbjct  182   HPSTGYMVARTLAAAPIVAKAIIQYLGSEKNHLGNELSASVWKDLWPIERRRQREFFCFG  241

Query  345   MDILLKLDLPATRRFFDAFF  286
             MD+LLKLDLPATRRFFDAFF
Sbjct  242   MDVLLKLDLPATRRFFDAFF  261



>gb|AFP28803.1| lycopene beta-cyclase 1 [Vitis vinifera]
Length=497

 Score =   512 bits (1319),  Expect = 7e-172, Method: Compositional matrix adjust.
 Identities = 267/472 (57%), Positives = 335/472 (71%), Gaps = 5/472 (1%)
 Frame = -2

Query  1539  SAFTSLKPQKQEIRIGSWKACRNVGRVKASSSALLELVPVTKKENLDFELPMFEPSKGIv  1360
             S F S  P+    R    K C N+   K  S   L+L P ++ E LDF+L   + S    
Sbjct  26    STFPSCLPEN---RYSRGKVCSNIQSSKFDS--FLDLKPESEAELLDFDLRWLDSSCKSC  80

Query  1359  vdlavvgggpaglavaqqVSQAGLSVCSIDPSPKLIWPNNYGVWVDEFEAMDLLDCLDTT  1180
             +D+ ++G GPAGL +A+QVS+ G+ VC IDPSP  +WPNNYGVWVDEFE + L DCLD T
Sbjct  81    LDVIIIGAGPAGLRLAEQVSRYGIHVCCIDPSPLSMWPNNYGVWVDEFEGLGLEDCLDKT  140

Query  1179  WSGAMVYIDDRTTKDLDRPYGRVNRKKLKSKMMQKCITNGVKFHQAKVIKVIHEESKSML  1000
             W    V IDD  TK LDR YGRV+RK+LK K+++ C   GV+FH+AKV KV H+E +S++
Sbjct  141   WPMTCVRIDDHRTKYLDRAYGRVSRKRLKMKLLEICAAYGVQFHKAKVWKVEHQEFESLV  200

Query  999   ICSDGVTIQATVVLDATGFSRCLVQYDKPYNPGYQVAYGILAEVEEHPYDLNKMVFMDWR  820
              C DG  ++A +V+DA+GF+   ++YDKP N GYQ+A+GILAEV+ HP+DL+KM+ MDWR
Sbjct  201   ECDDGSKLRANLVVDASGFASTFIEYDKPRNHGYQIAHGILAEVDSHPFDLDKMLLMDWR  260

Query  819   DSHLNSNLELKERNKRIPTFLYAMPFSSTRIFLEETSLVARPGLDMKDIQERMVARLRHL  640
             DSHL +   ++  N  +PTFLYAMPF+S  IFLEETSLV+RP L  K+++ RMVARLRHL
Sbjct  261   DSHLGNEPYIRAGNSSLPTFLYAMPFNSNLIFLEETSLVSRPMLSYKEVKRRMVARLRHL  320

Query  639   GINVKSIEEDERCVIPMGGPLPVIPQRVVGIGGTAGMVHPSTGYMVARTLAAAPVVANAI  460
             GI V+ + EDE+C+IPMGGP P IPQ V+ IGGTAG+VHPSTGYMVA+T+A APV+A  I
Sbjct  321   GIRVRRVIEDEKCLIPMGGPXPQIPQSVMAIGGTAGLVHPSTGYMVAKTMALAPVLAETI  380

Query  459   IQYLGSERSLLGNELSASVWKDLWPIERRRQREFFCFGMDILLKLDLPATRRFFDAFFDL  280
              + LGS R + G  L   VW  LWP ERR  REF+ FGM+ LLKLDL  TR FFDAFFDL
Sbjct  381   RECLGSSRMIRGKPLHHRVWNGLWPSERRFTREFYSFGMETLLKLDLNGTRGFFDAFFDL  440

Query  279   EPRYWHGFLSSRLFLRELIFFGLSLFSHASNTSRLEIMTKGTLPLVNMINNL  124
             +P YW GFLSSRL  REL    LSLF  ASN SR +I+TK   PLV M+  L
Sbjct  441   DPYYWQGFLSSRLSPRELALLSLSLFGRASNPSRFDIITKCPAPLVKMMGKL  492



>ref|XP_008784039.1| PREDICTED: capsanthin/capsorubin synthase, chromoplast-like [Phoenix 
dactylifera]
Length=490

 Score =   511 bits (1316),  Expect = 2e-171, Method: Compositional matrix adjust.
 Identities = 259/450 (58%), Positives = 327/450 (73%), Gaps = 4/450 (1%)
 Frame = -2

Query  1461  VKASSS---ALLELVPVTKKENLDFELPMFEPSKGIvvdlavvgggpaglavaqqVSQAG  1291
             ++A SS   + L+L    K E L  +L   EPS     D  ++G GPAGL +A++ S  G
Sbjct  36    IRARSSKPQSFLDLSHEAKPECLAIDLQWHEPSNSSSYDAVILGSGPAGLRLAERASAHG  95

Query  1290  LSVCSIDPSPKLIWPNNYGVWVDEFEAMDLLDCLDTTWSGAMVYIDDRTTKDLDRPYGRV  1111
             + VC IDPSP   WPNNYGVWVDEFEAM L  CLD  W    V+IDDR TK L RPYGRV
Sbjct  96    IRVCCIDPSPLSAWPNNYGVWVDEFEAMGLEGCLDKVWPMTTVFIDDRNTKHLGRPYGRV  155

Query  1110  NRKKLKSKMMQKCITNGVKFHQAKVIKVIHEESKSMLICSDGVTIQATVVLDATGFSRCL  931
              RK+LK++++Q C +NG KFH+AK  KV H+E  S + CSDG  ++A++V+DATGF+   
Sbjct  156   CRKRLKTQLLQGCASNGAKFHKAKAWKVEHKEFSSAVTCSDGSELKASMVVDATGFTSPF  215

Query  930   VQYDKPY-NPGYQVAYGILAEVEEHPYDLNKMVFMDWRDSHLNSNLELKERNKRIPTFLY  754
             ++++ P  N GYQ+A+GILAEVE HP+D +KMV MDWRDSHL +   L+ RN ++PTFLY
Sbjct  216   IEFEGPVRNHGYQIAHGILAEVEGHPFDTDKMVLMDWRDSHLGNEPWLRPRNDKLPTFLY  275

Query  753   AMPFSSTRIFLEETSLVARPGLDMKDIQERMVARLRHLGINVKSIEEDERCVIPMGGPLP  574
             AMPF S  IFLEETSLV+RP L   +++ RMVARLRHLGI V+ + E ERC+IPMGGPLP
Sbjct  276   AMPFDSKLIFLEETSLVSRPALPYVEVKRRMVARLRHLGIKVERVIEGERCLIPMGGPLP  335

Query  573   VIPQRVVGIGGTAGMVHPSTGYMVARTLAAAPVVANAIIQYLGSERSLLGNELSASVWKD  394
              IP+ ++G GG+AG+VHPSTGYMVARTLA APVVA+A+ + LGS R + G +L   VW  
Sbjct  336   AIPRNLMGFGGSAGLVHPSTGYMVARTLALAPVVADAMAECLGSTRMIRGRQLYRRVWAA  395

Query  393   LWPIERRRQREFFCFGMDILLKLDLPATRRFFDAFFDLEPRYWHGFLSSRLFLRELIFFG  214
             LW  ERRR REF+CFGM+ LL+LDL  TRRFFDAFFDL+P +W GFLSSRL L EL+   
Sbjct  396   LWTGERRRAREFYCFGMETLLRLDLKGTRRFFDAFFDLDPYHWEGFLSSRLSLGELLALS  455

Query  213   LSLFSHASNTSRLEIMTKGTLPLVNMINNL  124
             LSLF HASN S+ +I+TK   PL  ++ +L
Sbjct  456   LSLFGHASNPSKFDIVTKCPAPLARLVVSL  485



>gb|ACL27573.1| lycopene beta-cyclase [Cucumis melo]
Length=281

 Score =   502 bits (1293),  Expect = 3e-171, Method: Compositional matrix adjust.
 Identities = 232/281 (83%), Positives = 262/281 (93%), Gaps = 0/281 (0%)
 Frame = -2

Query  1203  LLDCLDTTWSGAMVYIDDRTTKDLDRPYGRVNRKKLKSKMMQKCITNGVKFHQAKVIKVI  1024
             LLDCLDTTWSGA+V+ ++++TKDL RPYGRVNRK+LKSKM+QKCI+NGVKFH+AKVIKVI
Sbjct  1     LLDCLDTTWSGAVVFTNEQSTKDLSRPYGRVNRKQLKSKMLQKCISNGVKFHEAKVIKVI  60

Query  1023  HEESKSMLICSDGVTIQATVVLDATGFSRCLVQYDKPYNPGYQVAYGILAEVEEHPYDLN  844
             HEE KS++IC+DGVTIQA +VLDATGFSRCLVQYDKPYNPGYQVAYGILAEVEEHP+D+N
Sbjct  61    HEEFKSLIICNDGVTIQAAIVLDATGFSRCLVQYDKPYNPGYQVAYGILAEVEEHPFDVN  120

Query  843   KMVFMDWRDSHLNSNLELKERNKRIPTFLYAMPFSSTRIFLEETSLVARPGLDMKDIQER  664
             KMVFMDWRDSHLN+N+ LK+RN +IPTFLYAMPFSS RIFLEETSLVARPGL M DIQER
Sbjct  121   KMVFMDWRDSHLNNNMILKDRNSKIPTFLYAMPFSSNRIFLEETSLVARPGLQMSDIQER  180

Query  663   MVARLRHLGINVKSIEEDERCVIPMGGPLPVIPQRVVGIGGTAGMVHPSTGYMVARTLAA  484
             M ARL+HLGI VKSIEEDE CVIPMGGPLPV+PQRVVGIGGTAGMVHPSTGYMVARTLAA
Sbjct  181   MEARLKHLGIKVKSIEEDEHCVIPMGGPLPVLPQRVVGIGGTAGMVHPSTGYMVARTLAA  240

Query  483   APVVANAIIQYLGSERSLLGNELSASVWKDLWPIERRRQRE  361
             AP+VA+AI++ LGS+    G+ +S+ VWKDLWPIERRRQRE
Sbjct  241   APIVASAIVRCLGSDGRFRGDAISSEVWKDLWPIERRRQRE  281



>ref|XP_002313611.1| hypothetical protein POPTR_0009s16140g [Populus trichocarpa]
 gb|EEE87566.1| hypothetical protein POPTR_0009s16140g [Populus trichocarpa]
Length=496

 Score =   510 bits (1314),  Expect = 4e-171, Method: Compositional matrix adjust.
 Identities = 270/471 (57%), Positives = 353/471 (75%), Gaps = 7/471 (1%)
 Frame = -2

Query  1533  FTSLKPQKQEIRIGSWKACRNVGRVKASSSALLELVPVTKKENLDFELPMFEPS-KGIvv  1357
             F+S KP     R   +      G   +   + L+L P +K E LDF+L  F+P+ +    
Sbjct  27    FSSPKPHITPSRKSRY------GIQSSKFGSFLDLKPESKPEFLDFDLSWFDPADRPRCF  80

Query  1356  dlavvgggpaglavaqqVSQAGLSVCSIDPSPKLIWPNNYGVWVDEFEAMDLLDCLDTTW  1177
             D+ ++G GPAGL +A+QVS  G+ VC +DPSP  +WPNNYGVWVDEFE++ L+DCLD TW
Sbjct  81    DVIIIGAGPAGLRLAEQVSGYGIKVCCVDPSPLSMWPNNYGVWVDEFESLGLVDCLDKTW  140

Query  1176  SGAMVYIDDRTTKDLDRPYGRVNRKKLKSKMMQKCITNGVKFHQAKVIKVIHEESKSMLI  997
                 V+IDD TTK LDRPYGRV RK++K+K+++ C +NGV+FH+AKV+ + H+E +S ++
Sbjct  141   PMTCVHIDDDTTKYLDRPYGRVGRKEVKTKLLENCASNGVRFHKAKVLNLEHKEFESSIV  200

Query  996   CSDGVTIQATVVLDATGFSRCLVQYDKPYNPGYQVAYGILAEVEEHPYDLNKMVFMDWRD  817
             C DG+ ++A++V+DA+GF+    +YDKP N GYQ+A+GILAEV+ HP+DL+KMV MDWRD
Sbjct  201   CDDGIELKASLVVDASGFASTFTEYDKPRNHGYQIAHGILAEVDCHPFDLDKMVLMDWRD  260

Query  816   SHLNSNLELKERNKRIPTFLYAMPFSSTRIFLEETSLVARPGLDMKDIQERMVARLRHLG  637
             SH+ +   L+  N +IPTFLYAMPF S  +FLEETSLV+RP L   +++ RMVARLRHLG
Sbjct  261   SHMGNEPYLRANNSKIPTFLYAMPFDSNLVFLEETSLVSRPLLSYMEVKNRMVARLRHLG  320

Query  636   INVKSIEEDERCVIPMGGPLPVIPQRVVGIGGTAGMVHPSTGYMVARTLAAAPVVANAII  457
             I VK++ E+E+CVIPMGGP P IPQ V+ IGGT+G+VHPSTGY VART+A AP+VA+AI+
Sbjct  321   IRVKTVIENEKCVIPMGGPRPKIPQSVMAIGGTSGVVHPSTGYTVARTMALAPIVADAIV  380

Query  456   QYLGSERSLLGNELSASVWKDLWPIERRRQREFFCFGMDILLKLDLPATRRFFDAFFDLE  277
             + LGS R + G  L   VW  LWP+ERR  REF+ FGM+ LLKLDL  TRRFFDAFFDL+
Sbjct  381   ECLGSTRMIRGRPLHHRVWNGLWPLERRCTREFYSFGMETLLKLDLNGTRRFFDAFFDLD  440

Query  276   PRYWHGFLSSRLFLRELIFFGLSLFSHASNTSRLEIMTKGTLPLVNMINNL  124
             P YW GFLSSRL LREL+F  LSLFS+ASN SR +I+TK  +PLV M+ NL
Sbjct  441   PYYWQGFLSSRLSLRELLFLSLSLFSNASNPSRFDIVTKCPVPLVKMMGNL  491



>ref|XP_004487485.1| PREDICTED: capsanthin/capsorubin synthase, chromoplast-like [Cicer 
arietinum]
Length=501

 Score =   508 bits (1307),  Expect = 5e-170, Method: Compositional matrix adjust.
 Identities = 259/492 (53%), Positives = 342/492 (70%), Gaps = 19/492 (4%)
 Frame = -2

Query  1593  TPNELEFLHPHHGFAVKASAFTSLKPQKQEIRIGSWKACRNVGRVKASSSALLELVPVTK  1414
             TP+ +  L  H   ++  S  TS K Q    + G++                L+L P  +
Sbjct  21    TPSIIPLLKTHQTISLPTSRKTSSKIQSTS-KFGNF----------------LDLKPEYQ  63

Query  1413  KENLDFELPMFEPSKGIvvdlavvgggpaglavaqqVSQAGLSVCSIDPSPKLIWPNNYG  1234
              E+LDF+LP F+PS     D+ ++G GPAG+ +A+QVS  G+ VC +DP P  IWPNNYG
Sbjct  64    PESLDFDLPWFQPSDRSHFDVIIIGAGPAGIRLAEQVSLYGIKVCCVDPDPLSIWPNNYG  123

Query  1233  VWVDEFEAMDLLDCLDTTWSGAMVYIDDRTTKDLDRPYGRVNRKKLKSKMMQKCITNGVK  1054
             VW+DEFE + L DCLD TW  A +YIDD  TK LDR YGRVNR+KLK K+++ CI NGV+
Sbjct  124   VWLDEFEGLGLQDCLDKTWPMASIYIDDNNTKYLDRSYGRVNRRKLKEKLVKACIFNGVQ  183

Query  1053  FHQAKVIKVIHEESKSMLICSDGVTIQATVVLDATGFSRCLVQYD--KPYNPGYQVAYGI  880
             F++AKV ++ H E +S ++C +G  ++ ++V+DA+GF    ++YD  K  N G Q+A+G+
Sbjct  184   FYKAKVWEIKHHEFESFVVCDNGTKLKGSLVVDASGFGSNFIEYDDHKVRNYGCQIAHGV  243

Query  879   LAEVEEHPYDLNKMVFMDWRDSHLNSNLELKERNKRIPTFLYAMPFSSTRIFLEETSLVA  700
             L EV+ HP+DL+KMV MDWRDSHL +   L+  N ++PTFLYAMPFSS  IFLEETSLV+
Sbjct  244   LVEVDTHPFDLDKMVLMDWRDSHLGNEPYLRNVNSKVPTFLYAMPFSSNLIFLEETSLVS  303

Query  699   RPGLDMKDIQERMVARLRHLGINVKSIEEDERCVIPMGGPLPVIPQRVVGIGGTAGMVHP  520
             RP L   +++ RMVARLRHLGI VK + EDE+C+IPMGGPLP IPQ V+  GG  G+VHP
Sbjct  304   RPVLSYMEVKRRMVARLRHLGIRVKRVLEDEKCLIPMGGPLPRIPQNVMAFGGNCGVVHP  363

Query  519   STGYMVARTLAAAPVVANAIIQYLGSERSLLGNELSASVWKDLWPIERRRQREFFCFGMD  340
             S+GYMVART+A AP+VA +I + LGS R + G +L A VW  +WPIERR  RE + FGM+
Sbjct  364   SSGYMVARTMALAPIVAASINECLGSTRMIRGKQLYAKVWNSMWPIERRFVRECYSFGME  423

Query  339   ILLKLDLPATRRFFDAFFDLEPRYWHGFLSSRLFLRELIFFGLSLFSHASNTSRLEIMTK  160
              LLKLDL  TR FFDAFFDL+P YW GFLSSRL L++     +SLF HASN+SR +I+TK
Sbjct  424   TLLKLDLNETRHFFDAFFDLKPYYWQGFLSSRLNLKDFALLSISLFGHASNSSRFDIVTK  483

Query  159   GTLPLVNMINNL  124
               +P   M+ N+
Sbjct  484   CPVPFAKMMGNM  495



>ref|XP_011006475.1| PREDICTED: capsanthin/capsorubin synthase, chromoplast-like [Populus 
euphratica]
Length=496

 Score =   507 bits (1305),  Expect = 1e-169, Method: Compositional matrix adjust.
 Identities = 266/471 (56%), Positives = 345/471 (73%), Gaps = 7/471 (1%)
 Frame = -2

Query  1533  FTSLKPQKQEIRIGSWKACRNVGRVKASSSALLELVPVTKKENLDFELPMFEPSKGIvvd  1354
             F+S KPQ    R        + G   +   + L+L P++K E+LDF+L  F+P+      
Sbjct  27    FSSRKPQTTASRKS------HSGIQSSKFGSFLDLKPLSKPESLDFDLSWFDPADRYRCF  80

Query  1353  lavvgggp-aglavaqqVSQAGLSVCSIDPSPKLIWPNNYGVWVDEFEAMDLLDCLDTTW  1177
               +V G   AGL +A+QVS+ G+ VC +DPSP  +WPNNYGVWVDEFE++ L+DCLD TW
Sbjct  81    DVIVIGTGPAGLRLAEQVSRYGVKVCCVDPSPLSMWPNNYGVWVDEFESLGLVDCLDKTW  140

Query  1176  SGAMVYIDDRTTKDLDRPYGRVNRKKLKSKMMQKCITNGVKFHQAKVIKVIHEESKSMLI  997
                 VYIDD  TK LDRPYGRV RK  K+K+++ C +NGV+FH+AKV KV HEE +S ++
Sbjct  141   PMTCVYIDDDKTKYLDRPYGRVGRKGFKTKLLENCASNGVRFHKAKVWKVKHEEFESSIL  200

Query  996   CSDGVTIQATVVLDATGFSRCLVQYDKPYNPGYQVAYGILAEVEEHPYDLNKMVFMDWRD  817
             C DG+ ++A++V+DA+GF+    +YDKP N GYQ+A+GILAEV+ HP+DL+KMV MDWRD
Sbjct  201   CDDGIELRASLVVDASGFASTFTEYDKPRNHGYQIAHGILAEVDYHPFDLDKMVLMDWRD  260

Query  816   SHLNSNLELKERNKRIPTFLYAMPFSSTRIFLEETSLVARPGLDMKDIQERMVARLRHLG  637
             SHL +   L+  N ++PTFLYAMPF S  +FLEETSLV++P L   +++ RMVARLRHLG
Sbjct  261   SHLGNEPCLRANNSKLPTFLYAMPFDSNLVFLEETSLVSKPLLSYMEVKNRMVARLRHLG  320

Query  636   INVKSIEEDERCVIPMGGPLPVIPQRVVGIGGTAGMVHPSTGYMVARTLAAAPVVANAII  457
             I VK++ E+E+C+IPMGGPLP IPQ V+ IGGT+G+VHPSTGYMVART+A AP++A AI+
Sbjct  321   IRVKNVIEEEKCLIPMGGPLPQIPQSVMAIGGTSGVVHPSTGYMVARTMALAPILAGAIV  380

Query  456   QYLGSERSLLGNELSASVWKDLWPIERRRQREFFCFGMDILLKLDLPATRRFFDAFFDLE  277
             + LGS R + G  L   VW  LWP+ERR  REF+ FGM+ LLKLDL  TRRFFDAFFDL+
Sbjct  381   ECLGSTRMIRGRPLHHRVWNGLWPLERRCTREFYSFGMETLLKLDLNGTRRFFDAFFDLD  440

Query  276   PRYWHGFLSSRLFLRELIFFGLSLFSHASNTSRLEIMTKGTLPLVNMINNL  124
             P YW GFLSS L L EL+    SLF +ASN SRL+I+TK  +PL  M+ NL
Sbjct  441   PYYWQGFLSSSLSLGELLLLSFSLFRNASNPSRLDIVTKCPVPLARMVGNL  491



>ref|XP_009789371.1| PREDICTED: neoxanthin synthase, chloroplastic [Nicotiana sylvestris]
Length=499

 Score =   507 bits (1305),  Expect = 1e-169, Method: Compositional matrix adjust.
 Identities = 274/503 (54%), Positives = 353/503 (70%), Gaps = 16/503 (3%)
 Frame = -2

Query  1611  MDTLLKT-PNELEFL-HPHHGFAVKASAFTSLKPQKQEIRIGSWKACRNVGRVKASSS--  1444
             M+TLLK  P+ L F   PH       S F  L P  Q          R V R   SSS  
Sbjct  1     METLLKPFPSPLLFTPTPHRSIFQLNSTF--LNPTTQNF-------SRKVHRRNKSSSNK  51

Query  1443  --ALLELVPVTKKENLDFELPMFEPSKG-IvvdlavvgggpaglavaqqVSQAGLSVCSI  1273
               + L+L P +K E+LD ++   +P+ G  + D+ ++G GPAGL +A+QVS+ G+ VC +
Sbjct  52    FCSFLDLAPTSKPESLDVDISWVDPNSGRALFDVIIIGAGPAGLRLAEQVSRYGIKVCCV  111

Query  1272  DPSPKLIWPNNYGVWVDEFEAMDLLDCLDTTWSGAMVYIDDRTTKDLDRPYGRVNRKKLK  1093
             DPSP  +WPNNYGVWVDEFE + L DCLD  W    V+I+D  TK L RPYGRV+RKKLK
Sbjct  112   DPSPLSMWPNNYGVWVDEFEKLGLEDCLDHKWPMTCVHINDNKTKYLGRPYGRVSRKKLK  171

Query  1092  SKMMQKCITNGVKFHQAKVIKVIHEESKSMLICSDGVTIQATVVLDATGFSRCLVQYDKP  913
              K++  C+ NG KF++AKV KV HEE +S ++C DG  I+ ++++DA+GF+   ++YDKP
Sbjct  172   LKLLNSCVDNGGKFYKAKVWKVEHEEFESSVVCDDGRKIRGSLIVDASGFASPFIEYDKP  231

Query  912   YNPGYQVAYGILAEVEEHPYDLNKMVFMDWRDSHLNSNLELKERNKRIPTFLYAMPFSST  733
              N GYQ+A+GILA+V+ HP+DL+KMV MDWRDSHL +   L+  N + PTFLY MPF   
Sbjct  232   RNHGYQIAHGILAQVDNHPFDLDKMVLMDWRDSHLGNEPYLRVNNTKEPTFLYVMPFDRN  291

Query  732   RIFLEETSLVARPGLDMKDIQERMVARLRHLGINVKSIEEDERCVIPMGGPLPVIPQRVV  553
              +FLEETSLV+RP L  ++++ RMVARLRHLGI V S+ EDE+CVIPMGGPLP IPQ V+
Sbjct  292   LVFLEETSLVSRPVLSYREVKNRMVARLRHLGIKVTSVIEDEKCVIPMGGPLPRIPQNVM  351

Query  552   GIGGTAGMVHPSTGYMVARTLAAAPVVANAIIQYLGSERSLLGNELSASVWKDLWPIERR  373
              IGG +G+VHPSTGYMVAR++A APV+A AI + LG+ R + G+ L   VW  LWP+ERR
Sbjct  352   AIGGNSGIVHPSTGYMVARSMALAPVLAEAIAESLGTTRMIRGSPLYHKVWNGLWPLERR  411

Query  372   RQREFFCFGMDILLKLDLPATRRFFDAFFDLEPRYWHGFLSSRLFLRELIFFGLSLFSHA  193
               RE + FGM+ LLKLDL  TRR FDAFFDL+P+YW GFLSSRL ++EL    L LF HA
Sbjct  412   SVRECYSFGMETLLKLDLKGTRRLFDAFFDLDPKYWQGFLSSRLSVKELAMLSLYLFGHA  471

Query  192   SNTSRLEIMTKGTLPLVNMINNL  124
             SN +RL+I+TK  +PLV MI NL
Sbjct  472   SNLARLDIVTKCPVPLVKMIGNL  494



>sp|Q42435.1|CCS_CAPAN RecName: Full=Capsanthin/capsorubin synthase, chromoplast; Flags: 
Precursor [Capsicum annuum]
 emb|CAA54495.1| capsanthin/capsorubin synthase [Capsicum annuum]
 emb|CAA53759.1| capsanthin/capsorubin sythase [Capsicum annuum]
 gb|AIQ82715.1| capsanthin/capsorubin synthase [Capsicum annuum]
 gb|AIQ82716.1| capsanthin/capsorubin synthase [Capsicum annuum]
 gb|AIQ82717.1| capsanthin/capsorubin synthase [Capsicum annuum]
 gb|AIQ82718.1| capsanthin/capsorubin synthase [Capsicum annuum]
Length=498

 Score =   506 bits (1303),  Expect = 2e-169, Method: Compositional matrix adjust.
 Identities = 270/509 (53%), Positives = 356/509 (70%), Gaps = 29/509 (6%)
 Frame = -2

Query  1611  MDTLLK----------TPNELEFLHPHHGFAVKASAFTSLKPQKQEIRIGSWKACRNVGR  1462
             M+TLLK          TPN   F H         S F +   QK   +           R
Sbjct  1     METLLKPFPSPLLSIPTPNMYSFKH--------NSTFPNPTKQKDSRKFHY--------R  44

Query  1461  VKASS--SALLELVPVTKKENLDFELPMFEPS-KGIvvdlavvgggpaglavaqqVSQAG  1291
              K+S+   + L+L P +K E+LD  +   +    G   D+ ++G GPAGL +A+QVS+ G
Sbjct  45    NKSSTHFCSFLDLAPTSKPESLDVNISWVDTDLDGAEFDVIIIGTGPAGLRLAEQVSKYG  104

Query  1290  LSVCSIDPSPKLIWPNNYGVWVDEFEAMDLLDCLDTTWSGAMVYIDDRTTKDLDRPYGRV  1111
             + VC +DPSP  +WPNNYGVWVDEFE + L DCLD  W  + V+I D  TK LDRPYGRV
Sbjct  105   IKVCCVDPSPLSMWPNNYGVWVDEFEKLGLEDCLDHKWPVSCVHISDHKTKYLDRPYGRV  164

Query  1110  NRKKLKSKMMQKCITNGVKFHQAKVIKVIHEESKSMLICSDGVTIQATVVLDATGFSRCL  931
             +RKKLK K++  C+ N VKF++AKV+KV HEE +S ++C DG  I  ++++DA+G++   
Sbjct  165   SRKKLKLKLLNSCVENRVKFYKAKVLKVKHEEFESSIVCDDGRKISGSLIVDASGYASDF  224

Query  930   VQYDKPYNPGYQVAYGILAEVEEHPYDLNKMVFMDWRDSHLNSNLELKERNKRIPTFLYA  751
             ++YDKP N GYQVA+GILAEV+ HP+DL+KM+ MDWRDSHL +   L+ +N + PTFLYA
Sbjct  225   IEYDKPRNHGYQVAHGILAEVDNHPFDLDKMMLMDWRDSHLGNEPYLRVKNTKEPTFLYA  284

Query  750   MPFSSTRIFLEETSLVARPGLDMKDIQERMVARLRHLGINVKSIEEDERCVIPMGGPLPV  571
             MPF    +FLEETSLV+RP L   +++ RMVARLRHLGI V+S+ E+E+CVI MGGPLP 
Sbjct  285   MPFDRNLVFLEETSLVSRPMLSYMEVKRRMVARLRHLGIKVRSVLEEEKCVITMGGPLPR  344

Query  570   IPQRVVGIGGTAGMVHPSTGYMVARTLAAAPVVANAIIQYLGSERSLLGNELSASVWKDL  391
             IPQ V+ IGGT+G+VHPS+GYMVAR++A APV+A AI++ LGS R + G++L   VW  L
Sbjct  345   IPQNVMAIGGTSGIVHPSSGYMVARSMALAPVLAEAIVESLGSTRMIRGSQLYHRVWNGL  404

Query  390   WPIERRRQREFFCFGMDILLKLDLPATRRFFDAFFDLEPRYWHGFLSSRLFLRELIFFGL  211
             WP +RRR RE +CFGM+ LLKLDL  TRR FDAFFD++P+YWHGFLSSRL ++EL    L
Sbjct  405   WPSDRRRVRECYCFGMETLLKLDLEGTRRLFDAFFDVDPKYWHGFLSSRLSVKELAVLSL  464

Query  210   SLFSHASNTSRLEIMTKGTLPLVNMINNL  124
              LF HASN +RL+I+TK T+PLV ++ NL
Sbjct  465   YLFGHASNLARLDIVTKCTVPLVKLLGNL  493



>ref|XP_011043447.1| PREDICTED: capsanthin/capsorubin synthase, chromoplast-like [Populus 
euphratica]
Length=496

 Score =   506 bits (1303),  Expect = 2e-169, Method: Compositional matrix adjust.
 Identities = 263/441 (60%), Positives = 341/441 (77%), Gaps = 1/441 (0%)
 Frame = -2

Query  1443  ALLELVPVTKKENLDFELPMFEPS-KGIvvdlavvgggpaglavaqqVSQAGLSVCSIDP  1267
             + L+L P +K E LDF+L  F+P+ +    D+ ++G GPAGL +A+QVS  G+ VC +DP
Sbjct  51    SFLDLNPESKPEFLDFDLSWFDPADRPRCFDVIIIGAGPAGLRLAEQVSGYGIKVCCVDP  110

Query  1266  SPKLIWPNNYGVWVDEFEAMDLLDCLDTTWSGAMVYIDDRTTKDLDRPYGRVNRKKLKSK  1087
             SP  +WPNNYGVWVDEFE + L+DCLD TW    V+IDD  TK LDRPYGRV RK+LK+K
Sbjct  111   SPLSMWPNNYGVWVDEFENLGLVDCLDKTWPMTCVHIDDDKTKYLDRPYGRVGRKELKTK  170

Query  1086  MMQKCITNGVKFHQAKVIKVIHEESKSMLICSDGVTIQATVVLDATGFSRCLVQYDKPYN  907
             +++ C +NGV+FH+AKV+ + H+E +S ++C DG  ++A++V+DA+GF+    +YDKP N
Sbjct  171   LLENCASNGVRFHKAKVLNLEHKEFQSSIVCDDGTELRASLVVDASGFASTFTEYDKPRN  230

Query  906   PGYQVAYGILAEVEEHPYDLNKMVFMDWRDSHLNSNLELKERNKRIPTFLYAMPFSSTRI  727
              GYQ+A+GILAEV+ HP+DL+KMV MDWRDSH+ +   L+  N +IPTFLYAMPF S  +
Sbjct  231   HGYQIAHGILAEVDCHPFDLDKMVLMDWRDSHMGNEPYLRANNSKIPTFLYAMPFDSNLV  290

Query  726   FLEETSLVARPGLDMKDIQERMVARLRHLGINVKSIEEDERCVIPMGGPLPVIPQRVVGI  547
             FLEETSLV+RP L   +++ RMVARLRHLGI VK++ E+E+CVIPMGGPLP IPQ V+ I
Sbjct  291   FLEETSLVSRPLLSYMEVKNRMVARLRHLGIRVKNVIENEKCVIPMGGPLPKIPQSVMAI  350

Query  546   GGTAGMVHPSTGYMVARTLAAAPVVANAIIQYLGSERSLLGNELSASVWKDLWPIERRRQ  367
             GGT+G+VHPSTGY VAR +A +P+VA+AI++ LGS R + G  L   VW  LWP+ERR  
Sbjct  351   GGTSGLVHPSTGYTVARAMALSPIVADAIVECLGSTRMIRGRPLHHRVWNGLWPLERRCT  410

Query  366   REFFCFGMDILLKLDLPATRRFFDAFFDLEPRYWHGFLSSRLFLRELIFFGLSLFSHASN  187
             REF+ FGM+ LLKLDL  TRRFFDAFFDL+P YW GFLSSRL LREL+F  LSLFS+ASN
Sbjct  411   REFYSFGMETLLKLDLNGTRRFFDAFFDLDPYYWQGFLSSRLSLRELLFLSLSLFSNASN  470

Query  186   TSRLEIMTKGTLPLVNMINNL  124
              SR +I+TK  +PLV M+ NL
Sbjct  471   PSRFDIVTKCPVPLVKMMGNL  491



>ref|XP_006384755.1| hypothetical protein POPTR_0004s20800g [Populus trichocarpa]
 gb|ERP62552.1| hypothetical protein POPTR_0004s20800g [Populus trichocarpa]
Length=496

 Score =   506 bits (1302),  Expect = 2e-169, Method: Compositional matrix adjust.
 Identities = 270/474 (57%), Positives = 351/474 (74%), Gaps = 7/474 (1%)
 Frame = -2

Query  1533  FTSLKPQKQEIRIGSWKACRNVGRVKASSSALLELVPVTKKENLDFELPMFEPS-KGIvv  1357
             F+S KPQ    R    K+   +   K  S   L+L P++K E+LDF+L  F+P+ +    
Sbjct  27    FSSRKPQTTPSR----KSHHGIQSSKFGS--FLDLKPLSKPESLDFDLSWFDPADRHRCF  80

Query  1356  dlavvgggpaglavaqqVSQAGLSVCSIDPSPKLIWPNNYGVWVDEFEAMDLLDCLDTTW  1177
             D+ V+G GPAGL +A+QVS+ G+ VC +DPSP  +WPNNYGVWVDEFE++ L+DCLD TW
Sbjct  81    DVIVIGTGPAGLRLAEQVSRYGVKVCCVDPSPLSMWPNNYGVWVDEFESLGLVDCLDKTW  140

Query  1176  SGAMVYIDDRTTKDLDRPYGRVNRKKLKSKMMQKCITNGVKFHQAKVIKVIHEESKSMLI  997
                 VYIDD  TK LDRPY RV RK+ K+K+++ C +NGV+FH+AKV KV HEE +S ++
Sbjct  141   PMTCVYIDDDKTKYLDRPYARVGRKEFKTKLLENCASNGVRFHKAKVWKVKHEEFESSIV  200

Query  996   CSDGVTIQATVVLDATGFSRCLVQYDKPYNPGYQVAYGILAEVEEHPYDLNKMVFMDWRD  817
             C DG+ ++A++V+DA+GF+    +YDKP N GYQ+A+GILAEV+ HP+DL+KMV MDWRD
Sbjct  201   CDDGIELRASLVVDASGFASTFTEYDKPRNHGYQIAHGILAEVDYHPFDLDKMVLMDWRD  260

Query  816   SHLNSNLELKERNKRIPTFLYAMPFSSTRIFLEETSLVARPGLDMKDIQERMVARLRHLG  637
             SHL +   L+  N ++PTFLYAMPF S  +FLEETSLV++P L   +++ RMVARLRHLG
Sbjct  261   SHLGNEPCLRANNSKLPTFLYAMPFDSNLVFLEETSLVSKPLLSYMEVKNRMVARLRHLG  320

Query  636   INVKSIEEDERCVIPMGGPLPVIPQRVVGIGGTAGMVHPSTGYMVARTLAAAPVVANAII  457
             I VK++ E+E+C+IPMGGPLP IPQ V+ IGGT+G+VHPSTGYMVART+A AP+VA AI+
Sbjct  321   IRVKNVIEEEKCLIPMGGPLPRIPQSVMAIGGTSGVVHPSTGYMVARTMALAPIVAGAIV  380

Query  456   QYLGSERSLLGNELSASVWKDLWPIERRRQREFFCFGMDILLKLDLPATRRFFDAFFDLE  277
             + LGS R + G  L   VW  LWP+ERR  REF+ FGM+ LLKLDL  TRRFFDAFFDL+
Sbjct  381   ECLGSTRMIRGRPLHHRVWNGLWPLERRCTREFYSFGMETLLKLDLKGTRRFFDAFFDLD  440

Query  276   PRYWHGFLSSRLFLRELIFFGLSLFSHASNTSRLEIMTKGTLPLVNMINNLLQD  115
             P YW GFLSS L L EL+    SLF +ASN SR +I+TK  +PL  M+ NL  +
Sbjct  441   PYYWQGFLSSSLSLGELLLLSFSLFRNASNPSRFDIVTKCPVPLARMVGNLAHE  494



>sp|Q9M424.1|NXS_SOLTU RecName: Full=Neoxanthin synthase, chloroplastic; Flags: Precursor 
[Solanum tuberosum]
 emb|CAB92977.1| neoxanthin synthase [Solanum tuberosum]
Length=498

 Score =   505 bits (1300),  Expect = 6e-169, Method: Compositional matrix adjust.
 Identities = 247/441 (56%), Positives = 328/441 (74%), Gaps = 1/441 (0%)
 Frame = -2

Query  1443  ALLELVPVTKKENLDFELPMFEPSKG-IvvdlavvgggpaglavaqqVSQAGLSVCSIDP  1267
             + L+L P++K E+ D  + + +P+ G    D+ ++G GPAGL +A+ VS+ G+ VC +DP
Sbjct  53    SFLDLAPISKPESFDVNISLVDPNSGRAQFDVIIIGAGPAGLRLAEHVSKYGIKVCCVDP  112

Query  1266  SPKLIWPNNYGVWVDEFEAMDLLDCLDTTWSGAMVYIDDRTTKDLDRPYGRVNRKKLKSK  1087
             SP  +WPNNYGVWVDEFE + L DCLD  W    V+I+D  TK L RPYGRV+RKKLK +
Sbjct  113   SPLSMWPNNYGVWVDEFENLGLEDCLDHKWPMTCVHINDHKTKYLGRPYGRVSRKKLKLR  172

Query  1086  MMQKCITNGVKFHQAKVIKVIHEESKSMLICSDGVTIQATVVLDATGFSRCLVQYDKPYN  907
             ++  C+ N VKF++AKV KV HEE +S ++C DG  I+ ++V+DA+GF+   ++YDKP N
Sbjct  173   LLNSCVENRVKFYKAKVWKVEHEEFESSIVCDDGKKIRGSLVVDASGFASDFIEYDKPRN  232

Query  906   PGYQVAYGILAEVEEHPYDLNKMVFMDWRDSHLNSNLELKERNKRIPTFLYAMPFSSTRI  727
              GYQ+A+G+L EV+ HP+DL+KMV MDWRDSHL +   L+  N + PTFLYAMPF    +
Sbjct  233   HGYQIAHGVLVEVDNHPFDLDKMVLMDWRDSHLGNEPYLRVNNAKEPTFLYAMPFDRNLV  292

Query  726   FLEETSLVARPGLDMKDIQERMVARLRHLGINVKSIEEDERCVIPMGGPLPVIPQRVVGI  547
             FLEETSLV+RP L   +++ RMVARLRHLGI V+S+ E+E+CVIPMGGPLP IPQ V+ I
Sbjct  293   FLEETSLVSRPVLSYMEVKRRMVARLRHLGIKVRSVIEEEKCVIPMGGPLPRIPQNVMAI  352

Query  546   GGTAGMVHPSTGYMVARTLAAAPVVANAIIQYLGSERSLLGNELSASVWKDLWPIERRRQ  367
             GG +G+VHPSTGYMVAR++A APV+A AI++ LGS R + G++L   VW  LWP++RR  
Sbjct  353   GGNSGIVHPSTGYMVARSMALAPVLAEAIVKGLGSTRMIRGSQLYHRVWNGLWPLDRRCI  412

Query  366   REFFCFGMDILLKLDLPATRRFFDAFFDLEPRYWHGFLSSRLFLRELIFFGLSLFSHASN  187
              E + FGM+ LLKLDL  TRR FDAFFDL+P+YW GFLSSRL ++EL    L LF H SN
Sbjct  413   GECYSFGMETLLKLDLKGTRRLFDAFFDLDPKYWQGFLSSRLSVKELAILSLCLFGHGSN  472

Query  186   TSRLEIMTKGTLPLVNMINNL  124
              +RL+I+TK  +PLV +I NL
Sbjct  473   LTRLDIVTKCPVPLVRLIGNL  493



>ref|XP_010102012.1| Capsanthin/capsorubin synthase [Morus notabilis]
 gb|EXB91232.1| Capsanthin/capsorubin synthase [Morus notabilis]
Length=495

 Score =   504 bits (1299),  Expect = 7e-169, Method: Compositional matrix adjust.
 Identities = 264/498 (53%), Positives = 348/498 (70%), Gaps = 13/498 (3%)
 Frame = -2

Query  1617  RVMDTLLKTPNELEFLHPHHGFAVKASAFTSLKPQKQEIRIGSWKACRNVGRVKASSSAL  1438
             ++    L T     FL P   F       TS   +  +++   +                
Sbjct  6     KLFSPFLTTKTHQSFLSPTPQFPFPKPHHTSSPTKHHKLKTSKF-------------GNF  52

Query  1437  LELVPVTKKENLDFELPMFEPSKGIvvdlavvgggpaglavaqqVSQAGLSVCSIDPSPK  1258
             L L P TK E+LD +LPM+ PS    +D+ ++G GPAGL +A+QVS+ G+ VC +DP P 
Sbjct  53    LSLQPETKPESLDVDLPMWGPSDRSPLDVIIIGAGPAGLRLAEQVSRYGIQVCCVDPCPL  112

Query  1257  LIWPNNYGVWVDEFEAMDLLDCLDTTWSGAMVYIDDRTTKDLDRPYGRVNRKKLKSKMMQ  1078
               WPNNYGVWVDEFE++DL  CLD TW    V+I+D  TK LDRPYGRVNRK+LK +++ 
Sbjct  113   SSWPNNYGVWVDEFESLDLGSCLDKTWPMTSVHINDNKTKYLDRPYGRVNRKRLKKELIN  172

Query  1077  KCITNGVKFHQAKVIKVIHEESKSMLICSDGVTIQATVVLDATGFSRCLVQYDKPYNPGY  898
             +C+ NGVKFH+AKV ++ H+E +S ++C DG  I+ ++V+DA+GF    ++YDKP N GY
Sbjct  173   RCLLNGVKFHKAKVWEIEHQEFESFVVCDDGNRIKGSLVVDASGFGSKFIEYDKPRNHGY  232

Query  897   QVAYGILAEVEEHPYDLNKMVFMDWRDSHLNSNLELKERNKRIPTFLYAMPFSSTRIFLE  718
             Q+A+GILAEV+ HP+DL+KMV MDWRDSHL +   L+  N ++PTFLYAMPF S  +FLE
Sbjct  233   QIAHGILAEVDFHPFDLDKMVLMDWRDSHLGNEPSLRNANSKLPTFLYAMPFDSNLVFLE  292

Query  717   ETSLVARPGLDMKDIQERMVARLRHLGINVKSIEEDERCVIPMGGPLPVIPQRVVGIGGT  538
             ETSLV+RP L   ++++RM ARLRHLGI VK + EDE+C+IPMGGPLP IPQ V+ IGG 
Sbjct  293   ETSLVSRPVLSYVEVKKRMAARLRHLGIRVKRVLEDEKCLIPMGGPLPKIPQNVMAIGGN  352

Query  537   AGMVHPSTGYMVARTLAAAPVVANAIIQYLGSERSLLGNELSASVWKDLWPIERRRQREF  358
             +G+VHPSTGYM+ART+  A V+A AI++ LGS R + G  L   VW  LWPIE R  REF
Sbjct  353   SGIVHPSTGYMLARTMGMAAVLAEAIVEGLGSTRMIRGKPLYHRVWNGLWPIESRCVREF  412

Query  357   FCFGMDILLKLDLPATRRFFDAFFDLEPRYWHGFLSSRLFLRELIFFGLSLFSHASNTSR  178
             + FGM+ LL+LDL  TRRFFDAFFDL+P YWHGFLSSRL L EL+   LSLF +AS  S+
Sbjct  413   YSFGMETLLRLDLNGTRRFFDAFFDLKPHYWHGFLSSRLTLGELLLLSLSLFGNASAPSK  472

Query  177   LEIMTKGTLPLVNMINNL  124
             ++I+TK  +PL+ M++NL
Sbjct  473   VDIVTKCPVPLLRMMSNL  490



>gb|ADH04285.1| capsanthin/capsorubin synthase, partial [Capsicum annuum]
 gb|ADH04286.1| capsanthin/capsorubin synthase, partial [Capsicum annuum]
 gb|ADH04287.1| capsanthin/capsorubin synthase, partial [Capsicum annuum]
 gb|ADH04288.1| capsanthin/capsorubin synthase, partial [Capsicum annuum]
 gb|ADH04289.1| capsanthin/capsorubin synthase, partial [Capsicum annuum]
 gb|ADH04290.1| capsanthin/capsorubin synthase, partial [Capsicum annuum]
Length=498

 Score =   504 bits (1299),  Expect = 1e-168, Method: Compositional matrix adjust.
 Identities = 269/509 (53%), Positives = 355/509 (70%), Gaps = 29/509 (6%)
 Frame = -2

Query  1611  MDTLLK----------TPNELEFLHPHHGFAVKASAFTSLKPQKQEIRIGSWKACRNVGR  1462
             M+TLLK          TPN   F H         S F +   QK   +           R
Sbjct  1     METLLKPFPSPLLSIPTPNMYSFKH--------NSTFPNPTKQKDSRKFHY--------R  44

Query  1461  VKASS--SALLELVPVTKKENLDFELPMFEPS-KGIvvdlavvgggpaglavaqqVSQAG  1291
              K+S+   + L+L P +K E+LD  +   +    G   D+ ++G GPAGL +A+QVS+ G
Sbjct  45    NKSSTHFCSFLDLAPTSKPESLDVNISWVDTDLDGAEFDVIIIGTGPAGLRLAEQVSKYG  104

Query  1290  LSVCSIDPSPKLIWPNNYGVWVDEFEAMDLLDCLDTTWSGAMVYIDDRTTKDLDRPYGRV  1111
             + VC +DPSP  +WPNNYGVWVDEFE + L DCLD  W  + V+I D  TK LDRPYGRV
Sbjct  105   IKVCCVDPSPLSMWPNNYGVWVDEFEKLGLEDCLDHKWPVSCVHISDHKTKYLDRPYGRV  164

Query  1110  NRKKLKSKMMQKCITNGVKFHQAKVIKVIHEESKSMLICSDGVTIQATVVLDATGFSRCL  931
             +RKKLK K++  C+ N VKF++AKV+KV HEE +S ++C DG  I  ++++DA+G++   
Sbjct  165   SRKKLKLKLLNSCVENRVKFYKAKVLKVKHEEFESSIVCDDGRKISGSLIVDASGYASDF  224

Query  930   VQYDKPYNPGYQVAYGILAEVEEHPYDLNKMVFMDWRDSHLNSNLELKERNKRIPTFLYA  751
             ++YDKP N GYQVA+GILAEV+ HP+DL+KM+ MDWRDSHL +   L+ +N + PTFLYA
Sbjct  225   IEYDKPRNHGYQVAHGILAEVDNHPFDLDKMMLMDWRDSHLGNEPYLRVKNTKEPTFLYA  284

Query  750   MPFSSTRIFLEETSLVARPGLDMKDIQERMVARLRHLGINVKSIEEDERCVIPMGGPLPV  571
             MPF    +FLEETSLV+RP L   +++ RMVARLRHLGI V+S+ E+E+CVI MGGPLP 
Sbjct  285   MPFDRNLVFLEETSLVSRPMLSYMEVKRRMVARLRHLGIKVRSVLEEEKCVITMGGPLPR  344

Query  570   IPQRVVGIGGTAGMVHPSTGYMVARTLAAAPVVANAIIQYLGSERSLLGNELSASVWKDL  391
             IPQ V+ IGGT+G+VHPS+GYMVAR++A APV+A AI++ LGS R + G++L   VW  L
Sbjct  345   IPQNVMAIGGTSGIVHPSSGYMVARSMALAPVLAEAIVESLGSTRMIRGSQLYHRVWNGL  404

Query  390   WPIERRRQREFFCFGMDILLKLDLPATRRFFDAFFDLEPRYWHGFLSSRLFLRELIFFGL  211
             WP +RRR RE +CFGM+ LLKLDL   RR FDAFFD++P+YWHGFLSSRL ++EL    L
Sbjct  405   WPSDRRRVRECYCFGMETLLKLDLEGARRLFDAFFDVDPKYWHGFLSSRLSVKELAVLSL  464

Query  210   SLFSHASNTSRLEIMTKGTLPLVNMINNL  124
              LF HASN +RL+I+TK T+PLV ++ NL
Sbjct  465   YLFGHASNLARLDIVTKCTVPLVKLLGNL  493



>ref|XP_003596842.1| Capsanthin/capsorubin synthase, chromoplast [Medicago truncatula]
 gb|AES67093.1| capsanthin/capsorubin synthase, chromoplast protein [Medicago 
truncatula]
Length=502

 Score =   504 bits (1297),  Expect = 2e-168, Method: Compositional matrix adjust.
 Identities = 261/494 (53%), Positives = 340/494 (69%), Gaps = 21/494 (4%)
 Frame = -2

Query  1593  TPNELEFLHPHHGFAVKASAFTSLKPQKQEIRIGSWKACRNVGRVKASSSALLELVPVTK  1414
             TP+   FL  H   ++ +S       +K    I S K   N           L+L    +
Sbjct  20    TPSTFPFLKTHQTISLPSS-------RKTNTMINSTKKFGN----------FLDLKSEYQ  62

Query  1413  KENLDFELPMFEPSKGIvvdlavvgggpaglavaqqVSQAGLSVCSIDPSPKLIWPNNYG  1234
              E LDF+LP   PS     D+ +VG GPAG+ +A+QVS  G+ VC +DP+P  +WPNNYG
Sbjct  63    PEALDFDLPWHHPSDRSQFDVIIVGAGPAGIRLAEQVSLYGIKVCCVDPNPLSMWPNNYG  122

Query  1233  VWVDEFEAMDLLDCLDTTWSGAMVYIDDRTTKDLDRPYGRVNRKKLKSKMMQKCITNGVK  1054
             VW+DEFE + L DCLD TW  A +YIDD  TK LDR YGRV+RKKLK K+++ C+ NGV+
Sbjct  123   VWLDEFEGLGLEDCLDKTWPMASIYIDDNKTKYLDRCYGRVSRKKLKEKLVKGCVFNGVR  182

Query  1053  FHQAKVIKVIHEESKSMLICSDGVTIQATVVLDATGFSRCLVQYD----KPYNPGYQVAY  886
             F++AKV ++ H E +S+++C DG  ++ ++V+DA+GF      YD    +  N G Q+A+
Sbjct  183   FYKAKVWEIKHHEFESIVVCDDGTKLKGSLVVDASGFGSNFTDYDNHKLRKKNYGCQIAH  242

Query  885   GILAEVEEHPYDLNKMVFMDWRDSHLNSNLELKERNKRIPTFLYAMPFSSTRIFLEETSL  706
             G+L EV+ HP+DL+KMV MDWRDSHL +   L++ N + PTFLYAMPFSS  IFLEETSL
Sbjct  243   GVLVEVDGHPFDLDKMVLMDWRDSHLGNEPYLRDGNSKFPTFLYAMPFSSNLIFLEETSL  302

Query  705   VARPGLDMKDIQERMVARLRHLGINVKSIEEDERCVIPMGGPLPVIPQRVVGIGGTAGMV  526
             V+RP L   D++ RMVARLRHLGINVK + EDE+C+IPMGGPLP I Q V+  GG +G+V
Sbjct  303   VSRPVLSYMDVKRRMVARLRHLGINVKRVLEDEKCLIPMGGPLPRISQNVMPFGGNSGIV  362

Query  525   HPSTGYMVARTLAAAPVVANAIIQYLGSERSLLGNELSASVWKDLWPIERRRQREFFCFG  346
             HPSTGYMVART+A AP+VA +I + LGS R + G  L A+VW  +WPIERR  RE +CFG
Sbjct  363   HPSTGYMVARTMALAPIVAASINECLGSTRMIRGKNLYANVWNSMWPIERRFVRECYCFG  422

Query  345   MDILLKLDLPATRRFFDAFFDLEPRYWHGFLSSRLFLRELIFFGLSLFSHASNTSRLEIM  166
             M+ LLKLDL  TR FFDAFFDL+P YW GFLSS+L L++     LSLF HASN+SR +I+
Sbjct  423   METLLKLDLNETRSFFDAFFDLKPYYWQGFLSSKLSLKDFALLSLSLFGHASNSSRFDIV  482

Query  165   TKGTLPLVNMINNL  124
             TK  +PL  +I N+
Sbjct  483   TKCPVPLAQLIGNI  496



>gb|AIQ82719.1| capsanthin/capsorubin synthase [Capsicum annuum]
 gb|AIQ82720.1| capsanthin/capsorubin synthase [Capsicum annuum]
 gb|AIQ82721.1| capsanthin/capsorubin synthase [Capsicum annuum]
 gb|AIQ82722.1| capsanthin/capsorubin synthase [Capsicum annuum]
 gb|AIQ82723.1| capsanthin/capsorubin synthase [Capsicum annuum]
 gb|AIQ82724.1| capsanthin/capsorubin synthase [Capsicum annuum]
 gb|AIQ82725.1| capsanthin/capsorubin synthase [Capsicum annuum]
 gb|AIQ82726.1| capsanthin/capsorubin synthase [Capsicum annuum]
 gb|AIQ82727.1| capsanthin/capsorubin synthase [Capsicum annuum]
 gb|AIQ82728.1| capsanthin/capsorubin synthase [Capsicum annuum]
 gb|AIQ82729.1| capsanthin/capsorubin synthase [Capsicum annuum]
 gb|AIQ82730.1| capsanthin/capsorubin synthase [Capsicum annuum]
 gb|AIQ82731.1| capsanthin/capsorubin synthase [Capsicum annuum]
 gb|AIQ82732.1| capsanthin/capsorubin synthase [Capsicum annuum]
 gb|AIX02795.1| capsanthin/capsorubin synthase protein [Capsicum annuum]
 gb|AIX02796.1| capsanthin/capsorubin synthase protein [Capsicum annuum]
Length=498

 Score =   503 bits (1295),  Expect = 3e-168, Method: Compositional matrix adjust.
 Identities = 269/509 (53%), Positives = 355/509 (70%), Gaps = 29/509 (6%)
 Frame = -2

Query  1611  MDTLLK----------TPNELEFLHPHHGFAVKASAFTSLKPQKQEIRIGSWKACRNVGR  1462
             M+TLLK          TPN   F H         S F +   QK   +           R
Sbjct  1     METLLKPFPSPLLSIPTPNMYSFKH--------NSTFPNPTKQKDSRKFHY--------R  44

Query  1461  VKASS--SALLELVPVTKKENLDFELPMFEPS-KGIvvdlavvgggpaglavaqqVSQAG  1291
              K+S+   + L+L P +K E+LD  +   +        D+ ++G GPAGL +A+QVS+ G
Sbjct  45    NKSSTHFCSFLDLAPTSKPESLDVNISWVDTDLDRAEFDVIIIGTGPAGLRLAEQVSKYG  104

Query  1290  LSVCSIDPSPKLIWPNNYGVWVDEFEAMDLLDCLDTTWSGAMVYIDDRTTKDLDRPYGRV  1111
             + VC +DPSP  +WPNNYGVWVDEFE + L DCLD  W  + V+I D  TK LDRPYGRV
Sbjct  105   IKVCCVDPSPLSMWPNNYGVWVDEFEKLGLEDCLDHKWPVSCVHISDHKTKYLDRPYGRV  164

Query  1110  NRKKLKSKMMQKCITNGVKFHQAKVIKVIHEESKSMLICSDGVTIQATVVLDATGFSRCL  931
             +RKKLK K++  C+ N VKF++AKV+KV HEE +S ++C DG  I  ++++DA+G++   
Sbjct  165   SRKKLKLKLLNSCVENRVKFYKAKVLKVKHEEFESSIVCDDGRKISGSLIVDASGYASDF  224

Query  930   VQYDKPYNPGYQVAYGILAEVEEHPYDLNKMVFMDWRDSHLNSNLELKERNKRIPTFLYA  751
             ++YDKP N GYQVA+GILAEV+ HP+DL+KM+ MDWRDSHL +   L+ +N + PTFLYA
Sbjct  225   IEYDKPRNHGYQVAHGILAEVDNHPFDLDKMMLMDWRDSHLGNEPYLRVKNTKEPTFLYA  284

Query  750   MPFSSTRIFLEETSLVARPGLDMKDIQERMVARLRHLGINVKSIEEDERCVIPMGGPLPV  571
             MPF    +FLEETSLV+RP L   +++ RMVARLRHLGI V+S+ E+E+CVI MGGPLP 
Sbjct  285   MPFDRNLVFLEETSLVSRPMLSYMEVKRRMVARLRHLGIKVRSVLEEEKCVITMGGPLPR  344

Query  570   IPQRVVGIGGTAGMVHPSTGYMVARTLAAAPVVANAIIQYLGSERSLLGNELSASVWKDL  391
             IPQ V+ IGGT+G+VHPS+GYMVAR++A APV+A AI++ LGS R + G++L   VW  L
Sbjct  345   IPQNVMAIGGTSGIVHPSSGYMVARSMALAPVLAEAIVESLGSTRMIRGSQLYHRVWNGL  404

Query  390   WPIERRRQREFFCFGMDILLKLDLPATRRFFDAFFDLEPRYWHGFLSSRLFLRELIFFGL  211
             WP +RRR RE +CFGM+ LLKLDL  TRR FDAFFD++P+YWHGFLSSRL ++EL    L
Sbjct  405   WPSDRRRVRECYCFGMETLLKLDLEGTRRLFDAFFDVDPKYWHGFLSSRLSVKELAVLSL  464

Query  210   SLFSHASNTSRLEIMTKGTLPLVNMINNL  124
              LF HASN +RL+I+TK T+PLV ++ NL
Sbjct  465   YLFGHASNLARLDIVTKCTVPLVKLLGNL  493



>ref|XP_006361083.1| PREDICTED: neoxanthin synthase, chloroplastic-like [Solanum tuberosum]
Length=498

 Score =   503 bits (1295),  Expect = 4e-168, Method: Compositional matrix adjust.
 Identities = 247/441 (56%), Positives = 327/441 (74%), Gaps = 1/441 (0%)
 Frame = -2

Query  1443  ALLELVPVTKKENLDFELPMFEPSKG-IvvdlavvgggpaglavaqqVSQAGLSVCSIDP  1267
             + L+L P +K E+ D  + + +P+ G    D+ ++G GPAGL +A+QVS+ G+ VC +DP
Sbjct  53    SFLDLAPTSKPESFDVNISLVDPNSGRAQFDVIIIGAGPAGLRLAEQVSKYGIKVCCVDP  112

Query  1266  SPKLIWPNNYGVWVDEFEAMDLLDCLDTTWSGAMVYIDDRTTKDLDRPYGRVNRKKLKSK  1087
             SP  +WPNNYGVWVDEFE + L DCLD  W    V+I+D  TK L RPYGRV+RKKLK +
Sbjct  113   SPLSMWPNNYGVWVDEFENLGLEDCLDHKWPMTCVHINDHKTKYLGRPYGRVSRKKLKLR  172

Query  1086  MMQKCITNGVKFHQAKVIKVIHEESKSMLICSDGVTIQATVVLDATGFSRCLVQYDKPYN  907
             ++  C+ N VKF++AKV KV HEE +S ++C DG  I+ ++V+DA+GF+   ++YDKP N
Sbjct  173   LLNSCVENRVKFYKAKVWKVEHEEFESSIVCDDGKKIRGSLVVDASGFASDFIEYDKPRN  232

Query  906   PGYQVAYGILAEVEEHPYDLNKMVFMDWRDSHLNSNLELKERNKRIPTFLYAMPFSSTRI  727
              GYQ+A+G+L EV+ HP+DL+KMV MDWRDSHL +   L+  N + PTFLYAMPF    +
Sbjct  233   HGYQIAHGVLVEVDNHPFDLDKMVLMDWRDSHLGNEPYLRVNNAKEPTFLYAMPFDRNLV  292

Query  726   FLEETSLVARPGLDMKDIQERMVARLRHLGINVKSIEEDERCVIPMGGPLPVIPQRVVGI  547
             FLEETSLV+RP L   +++ RMVARLRHLGI V+S+ E+E+CVIPMGGPLP IPQ V+ I
Sbjct  293   FLEETSLVSRPVLSYMEVKRRMVARLRHLGIKVRSVIEEEKCVIPMGGPLPRIPQNVMAI  352

Query  546   GGTAGMVHPSTGYMVARTLAAAPVVANAIIQYLGSERSLLGNELSASVWKDLWPIERRRQ  367
             GG +G+VHPSTGYMVAR++A APV+A AI++ LGS R + G++L   VW  LWP++RR  
Sbjct  353   GGNSGIVHPSTGYMVARSMALAPVLAEAIVEGLGSTRMIRGSQLYHRVWNGLWPLDRRCV  412

Query  366   REFFCFGMDILLKLDLPATRRFFDAFFDLEPRYWHGFLSSRLFLRELIFFGLSLFSHASN  187
             RE + FGM+ LLKLDL  TRR FDAFFDL+ +YW GFLSSRL ++EL    L LF H SN
Sbjct  413   RECYSFGMETLLKLDLKGTRRLFDAFFDLDSKYWQGFLSSRLSVKELAILSLCLFGHGSN  472

Query  186   TSRLEIMTKGTLPLVNMINNL  124
              +R +I+TK  +PLV +I NL
Sbjct  473   LTRFDIVTKCPVPLVRLIGNL  493



>ref|XP_009609006.1| PREDICTED: neoxanthin synthase, chloroplastic [Nicotiana tomentosiformis]
Length=499

 Score =   502 bits (1293),  Expect = 7e-168, Method: Compositional matrix adjust.
 Identities = 276/503 (55%), Positives = 350/503 (70%), Gaps = 16/503 (3%)
 Frame = -2

Query  1611  MDTLLKT-PNEL-EFLHPHHGFAVKASAFTSLKPQKQEIRIGSWKACRNVGRVKASSS--  1444
             M+TLLK  P+ L     PH       S F  L P  Q          R V     SSS  
Sbjct  1     METLLKPFPSPLLSTPTPHRSIFQLNSPF--LNPTTQNF-------SRKVHHRNKSSSKI  51

Query  1443  --ALLELVPVTKKENLDFELPMFEPSKG-IvvdlavvgggpaglavaqqVSQAGLSVCSI  1273
               + L+L P +K E+LD E+   +P+ G  + D+ ++G GPAGL +A+QVS+ G+ VC +
Sbjct  52    FCSFLDLSPTSKPESLDVEISWVDPNLGRALFDVIIIGAGPAGLRLAEQVSRYGIKVCCV  111

Query  1272  DPSPKLIWPNNYGVWVDEFEAMDLLDCLDTTWSGAMVYIDDRTTKDLDRPYGRVNRKKLK  1093
             D SP  +WPNNYGVWVDEFE + L DCLD  W    V+I+D  TK L RPYGRV+RKKLK
Sbjct  112   DSSPLSMWPNNYGVWVDEFEKLGLEDCLDHKWPMTCVHINDNKTKYLGRPYGRVSRKKLK  171

Query  1092  SKMMQKCITNGVKFHQAKVIKVIHEESKSMLICSDGVTIQATVVLDATGFSRCLVQYDKP  913
              K++  C+ NGVKF++AKV KV HEE +S +IC DG  I+ ++++DA+GF+   ++YDKP
Sbjct  172   LKLLNSCVENGVKFYKAKVWKVEHEEFESSVICDDGRKIRGSLIVDASGFASPFIEYDKP  231

Query  912   YNPGYQVAYGILAEVEEHPYDLNKMVFMDWRDSHLNSNLELKERNKRIPTFLYAMPFSST  733
              N GYQ+A+GILAEV+ HP+DL+KMV MDWRDSHL +   L+  N + PTFLYAMPF   
Sbjct  232   RNHGYQIAHGILAEVDNHPFDLDKMVLMDWRDSHLGNEPYLRVNNTKEPTFLYAMPFDRN  291

Query  732   RIFLEETSLVARPGLDMKDIQERMVARLRHLGINVKSIEEDERCVIPMGGPLPVIPQRVV  553
              +FLEETSLV+RP L  ++++ RMVARLRHLGI V+S+ EDE+CVIPMGGPLP IPQ V+
Sbjct  292   LVFLEETSLVSRPVLSYREVKNRMVARLRHLGIKVRSVIEDEKCVIPMGGPLPRIPQNVM  351

Query  552   GIGGTAGMVHPSTGYMVARTLAAAPVVANAIIQYLGSERSLLGNELSASVWKDLWPIERR  373
              IGG +G+VHPSTGYMVART+A APV+A AI + LGS R + G  L   VW  LWP+ERR
Sbjct  352   AIGGNSGIVHPSTGYMVARTMALAPVLAEAIAEGLGSTRMIRGCPLYHRVWNGLWPLERR  411

Query  372   RQREFFCFGMDILLKLDLPATRRFFDAFFDLEPRYWHGFLSSRLFLRELIFFGLSLFSHA  193
               RE + FGM+ LLKLDL  TRR FDAFFDL+P+YW GFLSSRL ++EL    L LF HA
Sbjct  412   SVRECYSFGMETLLKLDLKGTRRLFDAFFDLDPKYWQGFLSSRLSVKELAILSLYLFGHA  471

Query  192   SNTSRLEIMTKGTLPLVNMINNL  124
             SN +R +I+TK  +PL  MI NL
Sbjct  472   SNLARFDIVTKCPVPLARMIGNL  494



>gb|AIX87499.1| chromoplast-specific lycopene beta-cyclase [Lycium barbarum]
Length=498

 Score =   502 bits (1292),  Expect = 9e-168, Method: Compositional matrix adjust.
 Identities = 247/443 (56%), Positives = 327/443 (74%), Gaps = 1/443 (0%)
 Frame = -2

Query  1449  SSALLELVPVTKKENLDFELPMFEPSKG-IvvdlavvgggpaglavaqqVSQAGLSVCSI  1273
             S + L+L P +K E+LD  +   +P+ G    D+ ++G GPAGL +A+QVS+ G+ VC +
Sbjct  51    SCSFLDLTPTSKPESLDVNISWVDPNSGRAQFDVIIIGAGPAGLRLAEQVSKYGIKVCCV  110

Query  1272  DPSPKLIWPNNYGVWVDEFEAMDLLDCLDTTWSGAMVYIDDRTTKDLDRPYGRVNRKKLK  1093
             DPSP  +WPNNYG WVDEFE + L DCLD  W    V+I+D  TK LDRPYGRV+RK LK
Sbjct  111   DPSPLSMWPNNYGAWVDEFEKLGLEDCLDHKWPLTCVHINDNKTKYLDRPYGRVSRKMLK  170

Query  1092  SKMMQKCITNGVKFHQAKVIKVIHEESKSMLICSDGVTIQATVVLDATGFSRCLVQYDKP  913
              K++  C+ N VKF++AKV +V HEE +S ++C DG  ++ ++++DA+GF+   ++YDK 
Sbjct  171   LKLLNSCVENRVKFYKAKVWEVKHEEFESTIVCDDGRKMKGSLIVDASGFASPFIEYDKR  230

Query  912   YNPGYQVAYGILAEVEEHPYDLNKMVFMDWRDSHLNSNLELKERNKRIPTFLYAMPFSST  733
              N GYQ+A+GILAEV+ HP+DL+KM+ MDWRDSHL +   L+  N + PTFLYAMPF   
Sbjct  231   RNHGYQIAHGILAEVDNHPFDLDKMLLMDWRDSHLGNEPYLRVNNTKEPTFLYAMPFDKN  290

Query  732   RIFLEETSLVARPGLDMKDIQERMVARLRHLGINVKSIEEDERCVIPMGGPLPVIPQRVV  553
              +FLEETSLV+RP L    ++ RMVARLRH+GI V+ + E+E+CVIPMGGPLP IPQ V+
Sbjct  291   LVFLEETSLVSRPVLSYMQVKRRMVARLRHMGIKVRCVIEEEKCVIPMGGPLPRIPQNVM  350

Query  552   GIGGTAGMVHPSTGYMVARTLAAAPVVANAIIQYLGSERSLLGNELSASVWKDLWPIERR  373
              IGG +G+VHPSTGYMVAR++A APV+A AI++ LGS R + G++L   VW  LWP+E+R
Sbjct  351   AIGGNSGIVHPSTGYMVARSMALAPVLAEAIVEGLGSTRMIRGSQLYHKVWNGLWPLEKR  410

Query  372   RQREFFCFGMDILLKLDLPATRRFFDAFFDLEPRYWHGFLSSRLFLRELIFFGLSLFSHA  193
               RE + FGM+ LLKLDL  TRR FDAFFDL+P+YW GFLSSRL ++EL    L LF HA
Sbjct  411   CVRECYSFGMETLLKLDLKGTRRLFDAFFDLDPKYWQGFLSSRLSVKELAILSLGLFGHA  470

Query  192   SNTSRLEIMTKGTLPLVNMINNL  124
             SN +RL+I+TK  +PL  MI NL
Sbjct  471   SNLARLDIVTKCPVPLARMIGNL  493



>gb|AIQ82733.1| capsanthin/capsorubin synthase [Capsicum annuum]
Length=498

 Score =   501 bits (1291),  Expect = 1e-167, Method: Compositional matrix adjust.
 Identities = 267/509 (52%), Positives = 354/509 (70%), Gaps = 29/509 (6%)
 Frame = -2

Query  1611  MDTLLK----------TPNELEFLHPHHGFAVKASAFTSLKPQKQEIRIGSWKACRNVGR  1462
             M+TLLK          TPN   F H         S F +   QK   +           R
Sbjct  1     METLLKPFPSPLLSIPTPNMYSFKH--------NSTFPNPTKQKDSRKFHY--------R  44

Query  1461  VKASS--SALLELVPVTKKENLDFELPMFEPS-KGIvvdlavvgggpaglavaqqVSQAG  1291
              K+S+   + L+L P +K E+LD  +   +        D+ ++G GPAGL +A+QVS+ G
Sbjct  45    NKSSTHFCSFLDLAPTSKPESLDVNISWVDTDLDRAEFDVIIIGTGPAGLRLAEQVSKYG  104

Query  1290  LSVCSIDPSPKLIWPNNYGVWVDEFEAMDLLDCLDTTWSGAMVYIDDRTTKDLDRPYGRV  1111
             + VC +DPSP  +WPNNYGVW+DEFE + L DCLD  W  + V+I D  TK LDRPYGRV
Sbjct  105   IKVCCVDPSPLSMWPNNYGVWIDEFEKLGLEDCLDHKWPVSCVHISDHKTKYLDRPYGRV  164

Query  1110  NRKKLKSKMMQKCITNGVKFHQAKVIKVIHEESKSMLICSDGVTIQATVVLDATGFSRCL  931
             +RKKLK K++  C+ N VKF++AKV+KV HEE +S ++C DG  I  ++++DA+G++   
Sbjct  165   SRKKLKLKLLNSCVENRVKFYKAKVLKVKHEEFESSIVCDDGRKISGSLIVDASGYASDF  224

Query  930   VQYDKPYNPGYQVAYGILAEVEEHPYDLNKMVFMDWRDSHLNSNLELKERNKRIPTFLYA  751
             ++YDKP N GYQVA+GILAEV+ HP+DL+KM+ MDWRDSHL +   L+ +N + PTFLYA
Sbjct  225   IEYDKPRNHGYQVAHGILAEVDNHPFDLDKMMLMDWRDSHLGNEPHLRVKNTKEPTFLYA  284

Query  750   MPFSSTRIFLEETSLVARPGLDMKDIQERMVARLRHLGINVKSIEEDERCVIPMGGPLPV  571
             MPF    +FLEETSLV+RP L   +++ RMVARLRHLGI V+S+ E+E+CVI MGGPLP 
Sbjct  285   MPFDRNLVFLEETSLVSRPMLSYMEVKRRMVARLRHLGIKVRSVLEEEKCVITMGGPLPR  344

Query  570   IPQRVVGIGGTAGMVHPSTGYMVARTLAAAPVVANAIIQYLGSERSLLGNELSASVWKDL  391
             IPQ V+ IGGT+G+VHPS+GYMVAR++A APV+A AI++ LGS R + G++L   VW  L
Sbjct  345   IPQNVMAIGGTSGIVHPSSGYMVARSMALAPVLAEAIVESLGSTRMIRGSQLYHRVWNGL  404

Query  390   WPIERRRQREFFCFGMDILLKLDLPATRRFFDAFFDLEPRYWHGFLSSRLFLRELIFFGL  211
             WP +RRR RE +CFGM+ LLKLDL  TRR FDAFFD++P+YWHGFLSSRL ++EL    L
Sbjct  405   WPSDRRRVRECYCFGMETLLKLDLEGTRRLFDAFFDVDPKYWHGFLSSRLSVKELAVLSL  464

Query  210   SLFSHASNTSRLEIMTKGTLPLVNMINNL  124
              LF HASN +RL+I+TK  +PLV ++ NL
Sbjct  465   YLFGHASNLARLDIVTKCAVPLVKLLGNL  493



>ref|XP_007207101.1| hypothetical protein PRUPE_ppa021329mg [Prunus persica]
 gb|EMJ08300.1| hypothetical protein PRUPE_ppa021329mg [Prunus persica]
Length=495

 Score =   499 bits (1285),  Expect = 8e-167, Method: Compositional matrix adjust.
 Identities = 248/448 (55%), Positives = 332/448 (74%), Gaps = 3/448 (1%)
 Frame = -2

Query  1458  KASSSA---LLELVPVTKKENLDFELPMFEPSKGIvvdlavvgggpaglavaqqVSQAGL  1288
             KA SS     L+L P  K E LDF++P F+ S     D+ ++G GPAGL +A+QVSQ G+
Sbjct  39    KAQSSERGNFLDLKPEAKPEFLDFDIPQFDTSTRSSSDVIIIGTGPAGLRLAEQVSQHGI  98

Query  1287  SVCSIDPSPKLIWPNNYGVWVDEFEAMDLLDCLDTTWSGAMVYIDDRTTKDLDRPYGRVN  1108
              VC +DPSP+ +WPN YGVWVDEFE++ L  CL+ TW  +  YID+   K +DRP+GR++
Sbjct  99    KVCCVDPSPQSLWPNTYGVWVDEFESLQLESCLEKTWPRSCFYIDEDNVKYIDRPFGRIS  158

Query  1107  RKKLKSKMMQKCITNGVKFHQAKVIKVIHEESKSMLICSDGVTIQATVVLDATGFSRCLV  928
             RKK K+ +M++C++N VKFH+AKV+K+ H+E +S + C DG  ++A++++DA+GF+   +
Sbjct  159   RKKFKTLLMERCLSNDVKFHKAKVLKIEHQEFESSIFCDDGNELKASLIVDASGFASTFM  218

Query  927   QYDKPYNPGYQVAYGILAEVEEHPYDLNKMVFMDWRDSHLNSNLELKERNKRIPTFLYAM  748
             +YDKP N GYQ  +GILAEV+ HP+DL+K+V +DWRDSHL +   +  RN R PTFL+AM
Sbjct  219   EYDKPRNHGYQTGHGILAEVDFHPFDLDKVVQLDWRDSHLRNEPSMLTRNSRFPTFLFAM  278

Query  747   PFSSTRIFLEETSLVARPGLDMKDIQERMVARLRHLGINVKSIEEDERCVIPMGGPLPVI  568
             PF S+ I+L ETSLV RP L  +++++RMVARLRHLGI VK + E E+C+IPMGGPLP +
Sbjct  279   PFDSSLIYLMETSLVGRPVLSYEEVKKRMVARLRHLGIRVKRVLEAEKCLIPMGGPLPRM  338

Query  567   PQRVVGIGGTAGMVHPSTGYMVARTLAAAPVVANAIIQYLGSERSLLGNELSASVWKDLW  388
              Q V+ +GGT+G+V+PS GYMVA  +A APV+A AI+Q LGS   + G  L   VWK LW
Sbjct  339   SQEVMAMGGTSGLVNPSAGYMVASAMALAPVLAEAIVQCLGSTPMIRGQPLYDRVWKGLW  398

Query  387   PIERRRQREFFCFGMDILLKLDLPATRRFFDAFFDLEPRYWHGFLSSRLFLRELIFFGLS  208
             PIERR  REF+ FGM+ LLKLDL  TRRFFDAFFDL+P Y +G+LSSRL   EL FF LS
Sbjct  399   PIERRCVREFYSFGMETLLKLDLNETRRFFDAFFDLDPYYLNGYLSSRLSPTELAFFSLS  458

Query  207   LFSHASNTSRLEIMTKGTLPLVNMINNL  124
             LF +AS +SR+E++TK  +P V MI NL
Sbjct  459   LFGNASVSSRVELLTKSAVPFVKMIGNL  486



>gb|ADZ24717.1| lycopene b-cyclase [Solanum pennellii]
Length=498

 Score =   498 bits (1281),  Expect = 4e-166, Method: Compositional matrix adjust.
 Identities = 258/482 (54%), Positives = 341/482 (71%), Gaps = 7/482 (1%)
 Frame = -2

Query  1566  PHHGFAVKASAFTSLKPQKQEIRIGSWKACRNVGRVKASSSALLELVPVTKKENLDFELP  1387
             PH     +  +F S   QK+       + C    +      + L+L P +K E+LD  + 
Sbjct  18    PHRSIFQQNPSFLSPTTQKKS------RKCLLRNKSSKLFCSFLDLAPTSKPESLDVNIS  71

Query  1386  MFEPSKG-IvvdlavvgggpaglavaqqVSQAGLSVCSIDPSPKLIWPNNYGVWVDEFEA  1210
               +P+ G    D+ ++G GPAGL +A+QVS+ G+ VC +DPSP  +WPNNYGVWVDEFE 
Sbjct  72    WVDPNSGRAQFDVIIIGAGPAGLRLAEQVSKYGIKVCCVDPSPLSMWPNNYGVWVDEFEN  131

Query  1209  MDLLDCLDTTWSGAMVYIDDRTTKDLDRPYGRVNRKKLKSKMMQKCITNGVKFHQAKVIK  1030
             + L DCLD  W    V+I+D  TK L RPYGRV+RKKLK K++  C+ N VKF++AKV K
Sbjct  132   LGLEDCLDHKWPMTCVHINDNKTKYLGRPYGRVSRKKLKLKLLNSCVENRVKFYKAKVWK  191

Query  1029  VIHEESKSMLICSDGVTIQATVVLDATGFSRCLVQYDKPYNPGYQVAYGILAEVEEHPYD  850
             V HEE +S ++C DG  I+ ++V+DA+GF+   ++YDKP N GYQ+A+G+L EV+ HP+D
Sbjct  192   VEHEEFESSIVCDDGKKIRGSLVVDASGFASDFIEYDKPRNHGYQIAHGVLVEVDNHPFD  251

Query  849   LNKMVFMDWRDSHLNSNLELKERNKRIPTFLYAMPFSSTRIFLEETSLVARPGLDMKDIQ  670
             L+KMV MDWRDSHL +   L+  N + PTFLYAMPF    +FLEETSLV+RP L   +++
Sbjct  252   LDKMVLMDWRDSHLGNEPYLRVNNAKEPTFLYAMPFDRNLVFLEETSLVSRPVLSYMEVK  311

Query  669   ERMVARLRHLGINVKSIEEDERCVIPMGGPLPVIPQRVVGIGGTAGMVHPSTGYMVARTL  490
              RMVARLRHLGI V+S+ E+E+CVIPMGGPLP IPQ V+ IGG +G+VHPSTGYMVAR++
Sbjct  312   RRMVARLRHLGIKVRSVIEEEKCVIPMGGPLPRIPQNVMAIGGNSGIVHPSTGYMVARSM  371

Query  489   AAAPVVANAIIQYLGSERSLLGNELSASVWKDLWPIERRRQREFFCFGMDILLKLDLPAT  310
             A APV+A AI++ LGS R + G++L   VW  LWP++RR  RE + FGM+ LLKLDL  T
Sbjct  372   ALAPVLAEAIVEGLGSTRMIRGSQLYHRVWNGLWPLDRRCVRECYSFGMETLLKLDLKGT  431

Query  309   RRFFDAFFDLEPRYWHGFLSSRLFLRELIFFGLSLFSHASNTSRLEIMTKGTLPLVNMIN  130
             RR FDAFFDL+P+YW GFLSSRL ++EL    L LF H SN +RL+I+TK  +PLV +I 
Sbjct  432   RRLFDAFFDLDPKYWQGFLSSRLSVKELGLLSLCLFGHGSNLTRLDIVTKCPVPLVRLIG  491

Query  129   NL  124
             NL
Sbjct  492   NL  493



>ref|XP_005648449.1| beta cyclase [Coccomyxa subellipsoidea C-169]
 gb|EIE23905.1| beta cyclase [Coccomyxa subellipsoidea C-169]
Length=457

 Score =   495 bits (1275),  Expect = 7e-166, Method: Compositional matrix adjust.
 Identities = 236/413 (57%), Positives = 296/413 (72%), Gaps = 16/413 (4%)
 Frame = -2

Query  1302  SQAGLSVCSIDPSPKLIWPNNYGVWVDEFEAMDLLDCLDTTWSGAMVYIDDRTT--KDLD  1129
             SQAG  VC IDPSP   WPNNYGVWVDEF AM L DCLD  W  A V++D   +  K L 
Sbjct  31    SQAGYKVCVIDPSPLAAWPNNYGVWVDEFRAMGLDDCLDHVWDRAEVFLDSSPSGLKHLA  90

Query  1128  RPYGRVNRKKLKSKMMQKCITNGVKFHQAKVIKVIHEESKSMLICSDGVTIQATVVLDAT  949
             RPYGRV+R KLK K++Q+C+ +GV F +A+V +V+H +  S + CSDG  I   +VLDAT
Sbjct  91    RPYGRVDRAKLKRKLLQRCVAHGVVFQEARVEEVVHADGSSQITCSDGTRIPGCMVLDAT  150

Query  948   GFSRCLVQYDKPYNPGYQVAYGILAEVEEHPYDLNKMVFMDWRDSHLNSNLELKERNKRI  769
             G +R LV+YDKP+NPGYQ AYGILAEVE HP+  + M+FMDWRD H  SNL+++E N+++
Sbjct  151   GHARKLVEYDKPFNPGYQGAYGILAEVESHPFPTDAMLFMDWRDEHTASNLQMQESNRKL  210

Query  768   PTFLYAMPFSSTRIFLEETSLVARPGLDMKDIQERMVARLRHLGINVKSIEEDERCVIPM  589
             PTFLYAMPFS TRIFLEETSLVARP +   ++++R+ AR+   GI +K+IEE+E C+IPM
Sbjct  211   PTFLYAMPFSKTRIFLEETSLVARPAVPFLELKQRLEARMAKYGIKIKAIEEEEYCLIPM  270

Query  588   GGPLPVIPQRVVGIGGTAGMVHPSTGYMVARTLAAAPVVANAIIQYL-------------  448
             GG LP +PQR +GIGGTAGMVHPSTGYMVAR L AAPV+A+AI++ L             
Sbjct  271   GGVLPRLPQRTLGIGGTAGMVHPSTGYMVARMLGAAPVLADAIVEQLCAASDAAAQSHLP  330

Query  447   -GSERSLLGNELSASVWKDLWPIERRRQREFFCFGMDILLKLDLPATRRFFDAFFDLEPR  271
              G+      + LSA+VW  +WP+ER RQR FF FGMD+LL LDL  TR+FF AFF L   
Sbjct  331   PGAVTESDADRLSAAVWHSIWPVERIRQRAFFSFGMDVLLSLDLTETRQFFAAFFALSDH  390

Query  270   YWHGFLSSRLFLRELIFFGLSLFSHASNTSRLEIMTKGTLPLVNMINNLLQDI  112
             +W GFLS+RL   ELI FGLSLF+ +SN +RL ++ KG   LV M+  L   I
Sbjct  391   HWQGFLSARLSFLELIGFGLSLFAKSSNEARLNLLVKGVPGLVGMLAGLTGTI  443



>gb|AFN54026.1| lycopene beta-cyclase 1, partial [Daucus carota subsp. sativus]
 gb|AFN54027.1| lycopene beta-cyclase 1, partial [Daucus carota subsp. sativus]
 gb|AFN54028.1| lycopene beta-cyclase 1, partial [Daucus carota subsp. sativus]
 gb|AFN54029.1| lycopene beta-cyclase 1, partial [Daucus carota subsp. sativus]
 gb|AFN54030.1| lycopene beta-cyclase 1, partial [Daucus carota subsp. sativus]
 gb|AFN54031.1| lycopene beta-cyclase 1, partial [Daucus carota subsp. sativus]
 gb|AFN54032.1| lycopene beta-cyclase 1, partial [Daucus carota subsp. sativus]
 gb|AFN54033.1| lycopene beta-cyclase 1, partial [Daucus carota subsp. sativus]
 gb|AFN54034.1| lycopene beta-cyclase 1, partial [Daucus carota subsp. sativus]
 gb|AFN54035.1| lycopene beta-cyclase 1, partial [Daucus carota subsp. sativus]
 gb|AFN54036.1| lycopene beta-cyclase 1, partial [Daucus carota subsp. sativus]
Length=256

 Score =   484 bits (1246),  Expect = 2e-164, Method: Compositional matrix adjust.
 Identities = 230/256 (90%), Positives = 241/256 (94%), Gaps = 1/256 (0%)
 Frame = -2

Query  936  CLVQYDKPYNPGYQVAYGILAEVEEHPYDLNKMVFMDWRDSHLNSNLELKERNKRIPTFL  757
            CLVQYDKPYNPGYQVAYGI+AEVEEHP+D+NKM+FMDWRDSHLN N ELKERN +IPTFL
Sbjct  1    CLVQYDKPYNPGYQVAYGIVAEVEEHPFDVNKMIFMDWRDSHLNGNTELKERNSKIPTFL  60

Query  756  YAMPFSSTRIFLEETSLVARPGLDMKDIQERMVARLRHLGINVKSIEEDERCVIPMGGPL  577
            YAMPFSS RIFLEETSLVARPGL M DIQERMVARLRHLGI VKSIEEDERCVIPMGGPL
Sbjct  61   YAMPFSSDRIFLEETSLVARPGLAMGDIQERMVARLRHLGIKVKSIEEDERCVIPMGGPL  120

Query  576  PVIPQRVVGIGGTAGMVHPSTGYMVARTLAAAPVVANAIIQYL-GSERSLLGNELSASVW  400
            PV+PQRVVGIGGTAGMVHPSTGYMVARTLAAAPVVANAI+QYL GS++  LGNELSA VW
Sbjct  121  PVLPQRVVGIGGTAGMVHPSTGYMVARTLAAAPVVANAIVQYLGGSKKGALGNELSAEVW  180

Query  399  KDLWPIERRRQREFFCFGMDILLKLDLPATRRFFDAFFDLEPRYWHGFLSSRLFLRELIF  220
            KDLWPIERRRQREFFCFGMDILLKLDLP TRRFF AFFDLEPRYWHGFLSSRLFL EL F
Sbjct  181  KDLWPIERRRQREFFCFGMDILLKLDLPGTRRFFSAFFDLEPRYWHGFLSSRLFLPELFF  240

Query  219  FGLSLFSHASNTSRLE  172
            FGLSLFS+ASNTSR+E
Sbjct  241  FGLSLFSNASNTSRIE  256



>ref|NP_001234445.1| chromoplast-specific lycopene beta-cyclase [Solanum lycopersicum]
 gb|AAG21133.1| chromoplast-specific lycopene beta-cyclase [Solanum lycopersicum]
Length=498

 Score =   493 bits (1270),  Expect = 2e-164, Method: Compositional matrix adjust.
 Identities = 257/482 (53%), Positives = 340/482 (71%), Gaps = 7/482 (1%)
 Frame = -2

Query  1566  PHHGFAVKASAFTSLKPQKQEIRIGSWKACRNVGRVKASSSALLELVPVTKKENLDFELP  1387
             PH     +  +F S   +K+       + C    +      + L+L P +K E+LD  + 
Sbjct  18    PHRSIFQQNPSFLSPTTKKKS------RKCLLRNKSSKLFCSFLDLAPTSKPESLDVNIS  71

Query  1386  MFEP-SKGIvvdlavvgggpaglavaqqVSQAGLSVCSIDPSPKLIWPNNYGVWVDEFEA  1210
               +P S     D+ ++G GPAGL +A+QVS+ G+ VC +DPSP  +WPNNYGVWVDEFE 
Sbjct  72    WVDPNSNRAQFDVIIIGAGPAGLRLAEQVSKYGIKVCCVDPSPLSMWPNNYGVWVDEFEN  131

Query  1209  MDLLDCLDTTWSGAMVYIDDRTTKDLDRPYGRVNRKKLKSKMMQKCITNGVKFHQAKVIK  1030
             + L +CLD  W    V+I+D  TK L RPYGRV+RKKLK K++  C+ N VKF++AKV K
Sbjct  132   LGLENCLDHKWPMTCVHINDNKTKYLGRPYGRVSRKKLKLKLLNSCVENRVKFYKAKVWK  191

Query  1029  VIHEESKSMLICSDGVTIQATVVLDATGFSRCLVQYDKPYNPGYQVAYGILAEVEEHPYD  850
             V HEE +S ++C DG  I+ ++V+DA+GF+   ++YD+P N GYQ+A+G+L EV+ HP+D
Sbjct  192   VEHEEFESSIVCDDGKKIRGSLVVDASGFASDFIEYDRPRNHGYQIAHGVLVEVDNHPFD  251

Query  849   LNKMVFMDWRDSHLNSNLELKERNKRIPTFLYAMPFSSTRIFLEETSLVARPGLDMKDIQ  670
             L+KMV MDWRDSHL +   L+  N + PTFLYAMPF    +FLEETSLV+RP L   +++
Sbjct  252   LDKMVLMDWRDSHLGNEPYLRVNNAKEPTFLYAMPFDRDLVFLEETSLVSRPVLSYMEVK  311

Query  669   ERMVARLRHLGINVKSIEEDERCVIPMGGPLPVIPQRVVGIGGTAGMVHPSTGYMVARTL  490
              RMVARLRHLGI VKS+ E+E+CVIPMGGPLP IPQ V+ IGG +G+VHPSTGYMVAR++
Sbjct  312   RRMVARLRHLGIKVKSVIEEEKCVIPMGGPLPRIPQNVMAIGGNSGIVHPSTGYMVARSM  371

Query  489   AAAPVVANAIIQYLGSERSLLGNELSASVWKDLWPIERRRQREFFCFGMDILLKLDLPAT  310
             A APV+A AI++ LGS R + G++L   VW  LWP++RR  RE + FGM+ LLKLDL  T
Sbjct  372   ALAPVLAEAIVEGLGSTRMIRGSQLYHRVWNGLWPLDRRCVRECYSFGMETLLKLDLKGT  431

Query  309   RRFFDAFFDLEPRYWHGFLSSRLFLRELIFFGLSLFSHASNTSRLEIMTKGTLPLVNMIN  130
             RR FDAFFDL+P+YW GFLSSRL ++EL    L LF H SN +RL+I+TK  LPLV +I 
Sbjct  432   RRLFDAFFDLDPKYWQGFLSSRLSVKELGLLSLCLFGHGSNMTRLDIVTKCPLPLVRLIG  491

Query  129   NL  124
             NL
Sbjct  492   NL  493



>gb|AFN54038.1| lycopene beta-cyclase 1, partial [Daucus carota subsp. sativus]
 gb|AFN54039.1| lycopene beta-cyclase 1, partial [Daucus carota subsp. sativus]
 gb|AFN54040.1| lycopene beta-cyclase 1, partial [Daucus carota subsp. sativus]
 gb|AFN54041.1| lycopene beta-cyclase 1, partial [Daucus carota subsp. sativus]
 gb|AFN54042.1| lycopene beta-cyclase 1, partial [Daucus carota subsp. sativus]
 gb|AFN54043.1| lycopene beta-cyclase 1, partial [Daucus carota subsp. sativus]
 gb|AFN54044.1| lycopene beta-cyclase 1, partial [Daucus carota subsp. sativus]
Length=256

 Score =   484 bits (1245),  Expect = 3e-164, Method: Compositional matrix adjust.
 Identities = 229/256 (89%), Positives = 241/256 (94%), Gaps = 1/256 (0%)
 Frame = -2

Query  936  CLVQYDKPYNPGYQVAYGILAEVEEHPYDLNKMVFMDWRDSHLNSNLELKERNKRIPTFL  757
            CLVQYDKPYNPGYQVAYGI+AEVEEHP+D+NKM+FMDWRDSHLN N ELKERN +IPTFL
Sbjct  1    CLVQYDKPYNPGYQVAYGIVAEVEEHPFDVNKMIFMDWRDSHLNGNTELKERNSKIPTFL  60

Query  756  YAMPFSSTRIFLEETSLVARPGLDMKDIQERMVARLRHLGINVKSIEEDERCVIPMGGPL  577
            YAMPFSS RIFLEETSLVARPGL M DIQERMVARLRHLGI VKSIEEDERCVIPMGGPL
Sbjct  61   YAMPFSSDRIFLEETSLVARPGLAMGDIQERMVARLRHLGIKVKSIEEDERCVIPMGGPL  120

Query  576  PVIPQRVVGIGGTAGMVHPSTGYMVARTLAAAPVVANAIIQYL-GSERSLLGNELSASVW  400
            PV+PQRVVGIGGTAGMVHPSTGYMVARTLAAAP+VANAI+QYL GS++  LGNELSA VW
Sbjct  121  PVLPQRVVGIGGTAGMVHPSTGYMVARTLAAAPIVANAIVQYLGGSKKGALGNELSAEVW  180

Query  399  KDLWPIERRRQREFFCFGMDILLKLDLPATRRFFDAFFDLEPRYWHGFLSSRLFLRELIF  220
            KDLWPIERRRQREFFCFGMDILLKLDLP TRRFF AFFDLEPRYWHGFLSSRLFL EL F
Sbjct  181  KDLWPIERRRQREFFCFGMDILLKLDLPGTRRFFSAFFDLEPRYWHGFLSSRLFLPELFF  240

Query  219  FGLSLFSHASNTSRLE  172
            FGLSLFS+ASNTSR+E
Sbjct  241  FGLSLFSNASNTSRIE  256



>emb|CBJ19449.1| lycopene beta-cyclase 1 [Daucus carota subsp. sativus]
 gb|AFN54009.1| lycopene beta-cyclase 1, partial [Daucus carota subsp. sativus]
 gb|AFN54010.1| lycopene beta-cyclase 1, partial [Daucus carota subsp. sativus]
 gb|AFN54011.1| lycopene beta-cyclase 1, partial [Daucus carota subsp. sativus]
 gb|AFN54012.1| lycopene beta-cyclase 1, partial [Daucus carota subsp. sativus]
 gb|AFN54013.1| lycopene beta-cyclase 1, partial [Daucus carota subsp. sativus]
 gb|AFN54014.1| lycopene beta-cyclase 1, partial [Daucus carota subsp. sativus]
 gb|AFN54015.1| lycopene beta-cyclase 1, partial [Daucus carota subsp. sativus]
 gb|AFN54016.1| lycopene beta-cyclase 1, partial [Daucus carota subsp. sativus]
 gb|AFN54017.1| lycopene beta-cyclase 1, partial [Daucus carota subsp. sativus]
 gb|AFN54018.1| lycopene beta-cyclase 1, partial [Daucus carota subsp. sativus]
 gb|AFN54019.1| lycopene beta-cyclase 1, partial [Daucus carota subsp. sativus]
 gb|AFN54020.1| lycopene beta-cyclase 1, partial [Daucus carota subsp. sativus]
 gb|AFN54021.1| lycopene beta-cyclase 1, partial [Daucus carota subsp. sativus]
 gb|AFN54022.1| lycopene beta-cyclase 1, partial [Daucus carota subsp. sativus]
 gb|AFN54023.1| lycopene beta-cyclase 1, partial [Daucus carota subsp. sativus]
 gb|AFN54024.1| lycopene beta-cyclase 1, partial [Daucus carota subsp. sativus]
 gb|AFN54025.1| lycopene beta-cyclase 1, partial [Daucus carota subsp. sativus]
 gb|AFN54037.1| lycopene beta-cyclase 1, partial [Daucus carota subsp. sativus]
Length=256

 Score =   482 bits (1240),  Expect = 1e-163, Method: Compositional matrix adjust.
 Identities = 229/256 (89%), Positives = 241/256 (94%), Gaps = 1/256 (0%)
 Frame = -2

Query  936  CLVQYDKPYNPGYQVAYGILAEVEEHPYDLNKMVFMDWRDSHLNSNLELKERNKRIPTFL  757
            CLVQYDKPYNPGYQVAYGI+AEVEEHP+D+NKM+FMDWRDSHLN N ELKERN +IPTFL
Sbjct  1    CLVQYDKPYNPGYQVAYGIVAEVEEHPFDVNKMIFMDWRDSHLNGNTELKERNSKIPTFL  60

Query  756  YAMPFSSTRIFLEETSLVARPGLDMKDIQERMVARLRHLGINVKSIEEDERCVIPMGGPL  577
            YAMPFSS RIFLEETSLVARPGL M DIQERMVARLRHLGI VKSIEEDERCVIPMGGPL
Sbjct  61   YAMPFSSDRIFLEETSLVARPGLAMGDIQERMVARLRHLGIKVKSIEEDERCVIPMGGPL  120

Query  576  PVIPQRVVGIGGTAGMVHPSTGYMVARTLAAAPVVANAIIQYL-GSERSLLGNELSASVW  400
            PV+PQRVVGIGGTAGMVHPSTGYMVARTLAAAPVVANAI+QYL GS++  LGNELSA VW
Sbjct  121  PVLPQRVVGIGGTAGMVHPSTGYMVARTLAAAPVVANAIVQYLGGSKKGALGNELSAEVW  180

Query  399  KDLWPIERRRQREFFCFGMDILLKLDLPATRRFFDAFFDLEPRYWHGFLSSRLFLRELIF  220
            KDLWPIERRRQREFFCFGMDILLKLDLP TRRFF AFFDLEPRYWHGFLSSRLFL EL F
Sbjct  181  KDLWPIERRRQREFFCFGMDILLKLDLPGTRRFFSAFFDLEPRYWHGFLSSRLFLPELFF  240

Query  219  FGLSLFSHASNTSRLE  172
            FGLSLFS+AS+TSR+E
Sbjct  241  FGLSLFSNASHTSRIE  256



>gb|AIX87523.1| chromoplast-specific lycopene beta-cyclase [Lycium ruthenicum]
Length=498

 Score =   491 bits (1264),  Expect = 1e-163, Method: Compositional matrix adjust.
 Identities = 250/443 (56%), Positives = 330/443 (74%), Gaps = 1/443 (0%)
 Frame = -2

Query  1449  SSALLELVPVTKKENLDFELPMFEPSKG-IvvdlavvgggpaglavaqqVSQAGLSVCSI  1273
             S + L+L P +K E+LD  +   +P+ G    D+ ++GGGPAGL +A+QVS+ G+ VC +
Sbjct  51    SCSFLDLTPTSKPESLDVNISWVDPNSGRAQFDVIIIGGGPAGLRLAEQVSKYGIKVCCV  110

Query  1272  DPSPKLIWPNNYGVWVDEFEAMDLLDCLDTTWSGAMVYIDDRTTKDLDRPYGRVNRKKLK  1093
             DPSP  +WPNNYGVWVDEFE + L DCLD  W    V+I+D  TK LDR YGRV+RKKLK
Sbjct  111   DPSPLSMWPNNYGVWVDEFEKLGLEDCLDHKWPMTCVHINDNKTKYLDRQYGRVSRKKLK  170

Query  1092  SKMMQKCITNGVKFHQAKVIKVIHEESKSMLICSDGVTIQATVVLDATGFSRCLVQYDKP  913
              K++  C+ N VKF +AKV +V HEE +S ++C DG  I+ ++++DA+GF+   ++YDK 
Sbjct  171   LKLLNTCVENRVKFCKAKVWEVKHEEFESTIVCDDGRKIKGSLIVDASGFASPFIEYDKR  230

Query  912   YNPGYQVAYGILAEVEEHPYDLNKMVFMDWRDSHLNSNLELKERNKRIPTFLYAMPFSST  733
              N GYQ+A+GILAEV+ HP+DL+KM+ MDWRDSHL +   L+  N + PTFLYAMPF   
Sbjct  231   RNHGYQIAHGILAEVDNHPFDLDKMLLMDWRDSHLGNEPYLRVNNTKEPTFLYAMPFDKN  290

Query  732   RIFLEETSLVARPGLDMKDIQERMVARLRHLGINVKSIEEDERCVIPMGGPLPVIPQRVV  553
              +FLEETSLV+RP L   +++ RMVARLRH+GI V+S+ E+E+CVIPMGGPLP IPQ V+
Sbjct  291   LVFLEETSLVSRPVLSYMEVKRRMVARLRHMGIKVRSVIEEEKCVIPMGGPLPRIPQNVM  350

Query  552   GIGGTAGMVHPSTGYMVARTLAAAPVVANAIIQYLGSERSLLGNELSASVWKDLWPIERR  373
              IGG +G+VHPSTGYMVAR++A APV+A AI++ LGS R + G++L   VW  LWP+E+R
Sbjct  351   AIGGNSGIVHPSTGYMVARSMALAPVLAEAIVEGLGSTRMIRGSQLYHKVWNGLWPLEKR  410

Query  372   RQREFFCFGMDILLKLDLPATRRFFDAFFDLEPRYWHGFLSSRLFLRELIFFGLSLFSHA  193
               RE + FGM+ LLKLDL  TRR FDAFFDL+P+YW GFLSSRL ++EL    L LF H+
Sbjct  411   CVRECYSFGMETLLKLDLKGTRRLFDAFFDLDPKYWQGFLSSRLSVKELAILSLCLFGHS  470

Query  192   SNTSRLEIMTKGTLPLVNMINNL  124
             SN +RL+I+TK  +PL  MI NL
Sbjct  471   SNLARLDIVTKCPVPLARMIGNL  493



>gb|ADV31551.1| capsanthin/capsorubin synthase [Lilium lancifolium]
 gb|AEC33265.1| capsanthin/capsorubin synthase [Lilium lancifolium]
Length=474

 Score =   490 bits (1261),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 243/454 (54%), Positives = 317/454 (70%), Gaps = 3/454 (1%)
 Frame = -2

Query  1464  RVKASS-SALLELVPVTKKENLDFELPMFEPSKGIvvdlavvgggpaglavaqqVSQAGL  1288
             R K SS  + L+L PV+K E L  ++P  +PS     D A++G GPAGL +A+  +  GL
Sbjct  21    RTKCSSLRSFLDLTPVSKPEPLTIDIPYHDPSSAHRYDAAIIGCGPAGLRLAECAAARGL  80

Query  1287  SVCSIDPSPKLIWPNNYGVWVDEFEAMDLLDCLDTTWSGAMVYIDDRTTKDLDRPYGRVN  1108
              VC IDP+P   WPNNYG W+DE   + L    D  W  A + ID    K L RPYGRVN
Sbjct  81    RVCCIDPAPLSPWPNNYGAWLDELHPLGLASIFDHIWPTATIAIDGDNIKHLSRPYGRVN  140

Query  1107  RKKLKSKMMQKCITNGVKFHQAKVIKVIHEESKSMLICSDGVTIQATVVLDATGFSRCLV  928
             R  LK+ +++ C T GV+FH +K   + HEE +S + CSDG  + A++V+DA GFS   +
Sbjct  141   RSSLKTLLLENCTTTGVRFHPSKAWNIEHEELRSSVSCSDGSAVTASLVIDAGGFSTPFI  200

Query  927   QYDKPYNP-GYQVAYGILAEVEEHPYDLNKMVFMDWRDSHLNSNLELKERNKRIPTFLYA  751
             +YD+P N  GYQ+A+GILAEV  HP+DLN+M+ MDW D+HL++   L+  N  IPTFLYA
Sbjct  201   EYDRPRNRRGYQIAHGILAEVNRHPFDLNQMLLMDWSDAHLDNEPHLRAHNAAIPTFLYA  260

Query  750   MPFSSTRIFLEETSLVARPGLDMKDIQERMVARLRHLGINVKSIEEDERCVIPMGGPLPV  571
             MPF+   +FLEETSLV RP LD  ++++RMVARLRHLGI V+ + E+E+C+ PMGGPLP 
Sbjct  261   MPFNENLVFLEETSLVGRPVLDYSEVKKRMVARLRHLGIKVERVLEEEKCLFPMGGPLPR  320

Query  570   IPQRVVGIGGTAGMVHPSTGYMVARTLAAAPVVANAIIQYLGSERSLLGNELSASVWKDL  391
             +PQRV+G GG  GMVHPS+GY +AR LA AP +A A+++ LGS R + G  ++  VW  L
Sbjct  321   MPQRVMGYGGAGGMVHPSSGYQIARALALAPELAEAMVECLGSTRMITGKSMNCKVWGSL  380

Query  390   WPIERRRQREFFCFGMDILLKLDLPATRRFFDAFFDLEPRYWHGFLSSRLFLRELIFFGL  211
             WP  RR +RE++CFGM+ LL LDL  TRRFFDAFF+LEPRYWHGF+SSRL + EL    L
Sbjct  381   WPAGRRWEREYYCFGMETLLSLDLKQTRRFFDAFFNLEPRYWHGFMSSRLSITELAQLSL  440

Query  210   SLFSHASNTSRLEIMTKGTLPLVNMINNL-LQDI  112
             SLF+HAS  SR++++TK  LPL  MI NL LQ I
Sbjct  441   SLFAHASWKSRVDVVTKCPLPLARMIGNLALQAI  474



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 6611348448682