BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig12714

Length=919
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009767474.1|  PREDICTED: serine/threonine protein phosphat...    261   1e-78   Nicotiana sylvestris
ref|XP_009611860.1|  PREDICTED: serine/threonine protein phosphat...    261   1e-78   Nicotiana tomentosiformis
ref|XP_004236780.1|  PREDICTED: serine/threonine protein phosphat...    259   4e-78   
ref|XP_006361409.1|  PREDICTED: probable serine/threonine protein...    259   5e-78   Solanum tuberosum [potatoes]
gb|EYU19894.1|  hypothetical protein MIMGU_mgv1a004196mg                258   1e-77   Erythranthe guttata [common monkey flower]
emb|CAN77418.1|  hypothetical protein VITISV_023449                     251   4e-77   Vitis vinifera
gb|EYU33164.1|  hypothetical protein MIMGU_mgv1a004218mg                256   4e-77   Erythranthe guttata [common monkey flower]
ref|XP_011077220.1|  PREDICTED: serine/threonine protein phosphat...    256   7e-77   Sesamum indicum [beniseed]
ref|XP_006589213.1|  PREDICTED: probable serine/threonine protein...    249   1e-76   
gb|KHN35322.1|  Serine/threonine-protein phosphatase 2A regulator...    254   3e-76   Glycine soja [wild soybean]
ref|XP_003521774.1|  PREDICTED: probable serine/threonine protein...    254   3e-76   Glycine max [soybeans]
ref|XP_007147220.1|  hypothetical protein PHAVU_006G105800g             253   6e-76   Phaseolus vulgaris [French bean]
emb|CDO99998.1|  unnamed protein product                                253   6e-76   Coffea canephora [robusta coffee]
gb|KHG15281.1|  Serine/threonine-protein phosphatase 2A regulator...    253   7e-76   Gossypium arboreum [tree cotton]
ref|XP_011091457.1|  PREDICTED: serine/threonine protein phosphat...    253   9e-76   Sesamum indicum [beniseed]
gb|KJB44838.1|  hypothetical protein B456_007G275600                    253   9e-76   Gossypium raimondii
ref|XP_003554724.1|  PREDICTED: probable serine/threonine protein...    253   1e-75   Glycine max [soybeans]
ref|XP_010694949.1|  PREDICTED: serine/threonine protein phosphat...    253   1e-75   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002521983.1|  calcium ion binding protein, putative              253   1e-75   Ricinus communis
ref|XP_009801029.1|  PREDICTED: serine/threonine protein phosphat...    253   1e-75   Nicotiana sylvestris
ref|XP_008218333.1|  PREDICTED: serine/threonine protein phosphat...    252   1e-75   Prunus mume [ume]
ref|XP_011036315.1|  PREDICTED: serine/threonine protein phosphat...    252   2e-75   Populus euphratica
ref|XP_009801030.1|  PREDICTED: serine/threonine protein phosphat...    252   2e-75   Nicotiana sylvestris
ref|XP_002325339.1|  calcium-binding EF hand family protein             252   2e-75   Populus trichocarpa [western balsam poplar]
ref|XP_007208462.1|  hypothetical protein PRUPE_ppa003942mg             252   2e-75   Prunus persica
ref|XP_010694950.1|  PREDICTED: serine/threonine protein phosphat...    252   2e-75   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006606447.1|  PREDICTED: probable serine/threonine protein...    246   2e-75   Glycine max [soybeans]
gb|AEQ28761.1|  calcium ion binding protein                             252   2e-75   Prunus salicina [Japanese plum]
ref|XP_003590953.1|  Protein phosphatase 2A regulatory subunit B'...    252   2e-75   Medicago truncatula
ref|XP_009598612.1|  PREDICTED: serine/threonine protein phosphat...    252   3e-75   Nicotiana tomentosiformis
ref|XP_009598614.1|  PREDICTED: serine/threonine protein phosphat...    251   3e-75   Nicotiana tomentosiformis
ref|XP_007030396.1|  Calcium-binding EF-hand family protein isofo...    251   3e-75   Theobroma cacao [chocolate]
ref|XP_006470928.1|  PREDICTED: probable serine/threonine protein...    251   3e-75   Citrus sinensis [apfelsine]
ref|XP_006442649.1|  hypothetical protein CICLE_v10019630mg             251   3e-75   Citrus clementina [clementine]
ref|XP_011038501.1|  PREDICTED: serine/threonine protein phosphat...    251   4e-75   Populus euphratica
ref|XP_002269177.1|  PREDICTED: serine/threonine protein phosphat...    251   4e-75   
ref|XP_006345897.1|  PREDICTED: probable serine/threonine protein...    251   5e-75   Solanum tuberosum [potatoes]
ref|XP_006345898.1|  PREDICTED: probable serine/threonine protein...    251   5e-75   Solanum tuberosum [potatoes]
ref|XP_002319110.2|  calcium-binding EF hand family protein             251   5e-75   
ref|XP_010523368.1|  PREDICTED: serine/threonine protein phosphat...    251   7e-75   Tarenaya hassleriana [spider flower]
ref|XP_004495571.1|  PREDICTED: serine/threonine-protein phosphat...    250   7e-75   Cicer arietinum [garbanzo]
ref|XP_004302093.1|  PREDICTED: serine/threonine protein phosphat...    251   7e-75   Fragaria vesca subsp. vesca
ref|XP_010024945.1|  PREDICTED: serine/threonine protein phosphat...    250   9e-75   
ref|XP_010024944.1|  PREDICTED: serine/threonine protein phosphat...    250   1e-74   Eucalyptus grandis [rose gum]
ref|XP_010102216.1|  hypothetical protein L484_024497                   250   1e-74   
ref|XP_008804279.1|  PREDICTED: probable serine/threonine protein...    244   1e-74   Phoenix dactylifera
ref|XP_007144011.1|  hypothetical protein PHAVU_007G121700g             245   1e-74   Phaseolus vulgaris [French bean]
ref|XP_006589210.1|  PREDICTED: probable serine/threonine protein...    249   2e-74   Glycine max [soybeans]
gb|KJB82292.1|  hypothetical protein B456_013G187900                    249   2e-74   Gossypium raimondii
ref|XP_010321356.1|  PREDICTED: serine/threonine protein phosphat...    249   2e-74   Solanum lycopersicum
ref|XP_004239749.1|  PREDICTED: serine/threonine protein phosphat...    249   3e-74   Solanum lycopersicum
ref|XP_012089346.1|  PREDICTED: serine/threonine protein phosphat...    249   3e-74   Jatropha curcas
gb|EPS71483.1|  hypothetical protein M569_03272                         249   4e-74   Genlisea aurea
emb|CDK13062.1|  putative predicted protein                             249   4e-74   Malus domestica [apple tree]
ref|XP_009379751.1|  PREDICTED: serine/threonine protein phosphat...    248   4e-74   Pyrus x bretschneideri [bai li]
ref|XP_009343765.1|  PREDICTED: serine/threonine protein phosphat...    248   8e-74   Pyrus x bretschneideri [bai li]
ref|XP_009379749.1|  PREDICTED: serine/threonine protein phosphat...    248   8e-74   
ref|XP_006395034.1|  hypothetical protein EUTSA_v10003963mg             248   1e-73   Eutrema salsugineum [saltwater cress]
ref|XP_010043302.1|  PREDICTED: serine/threonine protein phosphat...    248   1e-73   Eucalyptus grandis [rose gum]
ref|XP_009413732.1|  PREDICTED: serine/threonine protein phosphat...    247   1e-73   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004152820.1|  PREDICTED: serine/threonine protein phosphat...    247   1e-73   Cucumis sativus [cucumbers]
ref|XP_008441828.1|  PREDICTED: serine/threonine protein phosphat...    247   1e-73   Cucumis melo [Oriental melon]
ref|XP_009151268.1|  PREDICTED: serine/threonine protein phosphat...    247   2e-73   Brassica rapa
ref|XP_010524949.1|  PREDICTED: serine/threonine protein phosphat...    247   2e-73   
gb|AES82677.2|  calcium-binding EF-hand protein                         246   2e-73   Medicago truncatula
ref|XP_010421710.1|  PREDICTED: serine/threonine protein phosphat...    240   2e-73   Camelina sativa [gold-of-pleasure]
ref|XP_010906785.1|  PREDICTED: serine/threonine protein phosphat...    246   3e-73   Elaeis guineensis
ref|XP_003556454.1|  PREDICTED: probable serine/threonine protein...    246   3e-73   Glycine max [soybeans]
gb|KHN04952.1|  Serine/threonine-protein phosphatase 2A regulator...    246   3e-73   Glycine soja [wild soybean]
ref|XP_008804278.1|  PREDICTED: serine/threonine protein phosphat...    244   4e-73   
ref|XP_007144012.1|  hypothetical protein PHAVU_007G121700g             246   5e-73   Phaseolus vulgaris [French bean]
ref|XP_012085282.1|  PREDICTED: serine/threonine protein phosphat...    239   9e-73   Jatropha curcas
ref|XP_009382000.1|  PREDICTED: serine/threonine protein phosphat...    245   9e-73   Musa acuminata subsp. malaccensis [pisang utan]
gb|KFK24119.1|  hypothetical protein AALP_AAs60715U000300               244   9e-73   Arabis alpina [alpine rockcress]
gb|AFW68589.1|  hypothetical protein ZEAMMB73_277032                    239   1e-72   
ref|XP_002272394.1|  PREDICTED: serine/threonine protein phosphat...    244   1e-72   Vitis vinifera
ref|XP_008804277.1|  PREDICTED: serine/threonine protein phosphat...    244   1e-72   Phoenix dactylifera
emb|CBI37142.3|  unnamed protein product                                244   2e-72   Vitis vinifera
ref|XP_010265004.1|  PREDICTED: serine/threonine protein phosphat...    244   2e-72   Nelumbo nucifera [Indian lotus]
dbj|BAD94815.1|  protein phosphatase 2A regulatory subunit B'-lik...    238   2e-72   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010652386.1|  PREDICTED: serine/threonine protein phosphat...    244   2e-72   Vitis vinifera
ref|XP_010652387.1|  PREDICTED: serine/threonine protein phosphat...    244   3e-72   Vitis vinifera
ref|XP_010905824.1|  PREDICTED: serine/threonine protein phosphat...    244   3e-72   Elaeis guineensis
ref|XP_010934299.1|  PREDICTED: serine/threonine protein phosphat...    243   4e-72   Elaeis guineensis
ref|NP_851089.1|  serine/threonine protein phosphatase 2A regulat...    237   4e-72   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008644784.1|  PREDICTED: serine/threonine protein phosphat...    239   4e-72   
gb|ERN18799.1|  hypothetical protein AMTR_s00067p00087050               241   4e-72   Amborella trichopoda
ref|XP_006395035.1|  hypothetical protein EUTSA_v10003957mg             243   4e-72   Eutrema salsugineum [saltwater cress]
ref|XP_002467085.1|  hypothetical protein SORBIDRAFT_01g019370          243   5e-72   Sorghum bicolor [broomcorn]
ref|XP_009387292.1|  PREDICTED: serine/threonine protein phosphat...    243   6e-72   Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB26598.1|  hypothetical protein B456_004G249400                    243   7e-72   Gossypium raimondii
ref|XP_004982873.1|  PREDICTED: serine/threonine-protein phosphat...    243   8e-72   Setaria italica
ref|XP_004494751.1|  PREDICTED: serine/threonine-protein phosphat...    243   8e-72   Cicer arietinum [garbanzo]
ref|XP_011628172.1|  PREDICTED: serine/threonine protein phosphat...    241   9e-72   
gb|KJB11371.1|  hypothetical protein B456_001G254900                    237   9e-72   Gossypium raimondii
gb|EMT07773.1|  Serine/threonine-protein phosphatase 2A regulator...    243   1e-71   
gb|EMS52372.1|  Serine/threonine-protein phosphatase 2A regulator...    243   2e-71   Triticum urartu
ref|XP_006489708.1|  PREDICTED: probable serine/threonine protein...    236   2e-71   
dbj|BAJ95594.1|  predicted protein                                      242   2e-71   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008664881.1|  PREDICTED: probable serine/threonine protein...    241   3e-71   Zea mays [maize]
ref|XP_006661862.1|  PREDICTED: probable serine/threonine protein...    241   3e-71   Oryza brachyantha
ref|XP_002529841.1|  calcium ion binding protein, putative              241   3e-71   Ricinus communis
gb|EEC67163.1|  hypothetical protein OsI_34023                          239   3e-71   Oryza sativa Indica Group [Indian rice]
ref|XP_003536224.1|  PREDICTED: probable serine/threonine protein...    241   3e-71   Glycine max [soybeans]
ref|XP_009111902.1|  PREDICTED: serine/threonine protein phosphat...    241   4e-71   Brassica rapa
ref|XP_003556377.1|  PREDICTED: probable serine/threonine protein...    241   4e-71   
ref|XP_012069859.1|  PREDICTED: serine/threonine protein phosphat...    241   5e-71   Jatropha curcas
ref|XP_010234819.1|  PREDICTED: probable serine/threonine protein...    240   5e-71   Brachypodium distachyon [annual false brome]
ref|XP_003574057.1|  PREDICTED: probable serine/threonine protein...    240   5e-71   Brachypodium distachyon [annual false brome]
gb|KJB72387.1|  hypothetical protein B456_011G175300                    240   6e-71   Gossypium raimondii
ref|XP_007035142.1|  Calcium-binding EF-hand family protein isofo...    239   7e-71   
gb|KHF99466.1|  Serine/threonine-protein phosphatase 2A regulator...    240   1e-70   Gossypium arboreum [tree cotton]
ref|XP_003626459.1|  Serine/threonine protein phosphatase 2A regu...    241   1e-70   
gb|KJB11374.1|  hypothetical protein B456_001G254900                    237   1e-70   Gossypium raimondii
ref|XP_010455206.1|  PREDICTED: serine/threonine protein phosphat...    239   2e-70   
ref|XP_010494119.1|  PREDICTED: serine/threonine protein phosphat...    239   2e-70   Camelina sativa [gold-of-pleasure]
gb|KHG27042.1|  Serine/threonine-protein phosphatase 2A regulator...    239   2e-70   Gossypium arboreum [tree cotton]
emb|CBI22370.3|  unnamed protein product                                249   2e-70   Vitis vinifera
ref|XP_008785214.1|  PREDICTED: serine/threonine protein phosphat...    239   2e-70   
ref|NP_001064850.1|  Os10g0476600                                       239   2e-70   
ref|XP_010494115.1|  PREDICTED: serine/threonine protein phosphat...    239   2e-70   Camelina sativa [gold-of-pleasure]
ref|XP_010421708.1|  PREDICTED: serine/threonine protein phosphat...    239   2e-70   Camelina sativa [gold-of-pleasure]
ref|XP_012085280.1|  PREDICTED: serine/threonine protein phosphat...    239   2e-70   Jatropha curcas
ref|XP_008785219.1|  PREDICTED: probable serine/threonine protein...    239   2e-70   
ref|XP_010494118.1|  PREDICTED: serine/threonine protein phosphat...    239   2e-70   Camelina sativa [gold-of-pleasure]
ref|NP_198242.1|  probable serine/threonine protein phosphatase 2...    239   2e-70   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002872330.1|  calcium-binding EF hand family protein             239   2e-70   
ref|XP_007035140.1|  Calcium-binding EF-hand family protein isofo...    239   2e-70   
gb|AAK13162.1|AC078829_14  putative protein phosphatase 2A regula...    239   3e-70   Oryza sativa Japonica Group [Japonica rice]
emb|CDY00020.1|  BnaC09g02810D                                          238   3e-70   
ref|XP_011458019.1|  PREDICTED: serine/threonine protein phosphat...    238   4e-70   Fragaria vesca subsp. vesca
ref|XP_004289966.1|  PREDICTED: probable serine/threonine protein...    238   5e-70   Fragaria vesca subsp. vesca
gb|KJB11372.1|  hypothetical protein B456_001G254900                    238   5e-70   Gossypium raimondii
ref|NP_568509.1|  serine/threonine protein phosphatase 2A regulat...    238   6e-70   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006420257.1|  hypothetical protein CICLE_v10007050mg             238   6e-70   
gb|KHN30578.1|  Serine/threonine-protein phosphatase 2A regulator...    238   7e-70   Glycine soja [wild soybean]
ref|XP_010262368.1|  PREDICTED: serine/threonine protein phosphat...    237   8e-70   Nelumbo nucifera [Indian lotus]
gb|KHN05074.1|  Serine/threonine-protein phosphatase 2A regulator...    237   1e-69   Glycine soja [wild soybean]
ref|XP_006489706.1|  PREDICTED: probable serine/threonine protein...    236   2e-69   Citrus sinensis [apfelsine]
ref|XP_008382840.1|  PREDICTED: serine/threonine protein phosphat...    236   2e-69   Malus domestica [apple tree]
gb|KDO57568.1|  hypothetical protein CISIN_1g043857mg                   236   2e-69   Citrus sinensis [apfelsine]
ref|XP_006282584.1|  hypothetical protein CARUB_v10004535mg             236   2e-69   Capsella rubella
gb|ABR18438.1|  unknown                                                 236   2e-69   Picea sitchensis
ref|XP_008235642.1|  PREDICTED: serine/threonine protein phosphat...    236   3e-69   Prunus mume [ume]
ref|XP_007050234.1|  Calcium-binding EF-hand family protein             236   3e-69   
ref|XP_007199781.1|  hypothetical protein PRUPE_ppa003921mg             236   3e-69   Prunus persica
gb|EPS71035.1|  hypothetical protein M569_03725                         235   7e-69   Genlisea aurea
ref|XP_010550352.1|  PREDICTED: probable serine/threonine protein...    234   1e-68   Tarenaya hassleriana [spider flower]
ref|XP_011004021.1|  PREDICTED: serine/threonine protein phosphat...    234   1e-68   Populus euphratica
ref|XP_009336125.1|  PREDICTED: serine/threonine protein phosphat...    234   1e-68   Pyrus x bretschneideri [bai li]
ref|XP_002528837.1|  calcium ion binding protein, putative              234   1e-68   Ricinus communis
ref|XP_008372352.1|  PREDICTED: serine/threonine protein phosphat...    234   1e-68   Malus domestica [apple tree]
ref|XP_009336124.1|  PREDICTED: serine/threonine protein phosphat...    234   1e-68   Pyrus x bretschneideri [bai li]
emb|CDY71370.1|  BnaCnng72610D                                          225   1e-68   Brassica napus [oilseed rape]
ref|XP_008372351.1|  PREDICTED: serine/threonine protein phosphat...    234   2e-68   Malus domestica [apple tree]
ref|XP_009369451.1|  PREDICTED: serine/threonine protein phosphat...    234   2e-68   Pyrus x bretschneideri [bai li]
gb|KEH42756.1|  calcium-binding EF-hand protein                         233   2e-68   Medicago truncatula
ref|XP_011007482.1|  PREDICTED: serine/threonine protein phosphat...    233   4e-68   Populus euphratica
ref|XP_004495369.1|  PREDICTED: serine/threonine-protein phosphat...    233   4e-68   Cicer arietinum [garbanzo]
gb|AES61092.2|  calcium-binding EF-hand protein                         233   4e-68   Medicago truncatula
gb|KJB72386.1|  hypothetical protein B456_011G175300                    233   4e-68   Gossypium raimondii
ref|XP_010522572.1|  PREDICTED: serine/threonine protein phosphat...    231   5e-68   Tarenaya hassleriana [spider flower]
gb|KJB09998.1|  hypothetical protein B456_001G179600                    232   7e-68   Gossypium raimondii
ref|XP_003590841.1|  Serine/threonine protein phosphatase 2A regu...    233   7e-68   
ref|XP_002302033.1|  hypothetical protein POPTR_0002s03710g             231   1e-67   Populus trichocarpa [western balsam poplar]
ref|XP_010470340.1|  PREDICTED: probable serine/threonine protein...    231   2e-67   Camelina sativa [gold-of-pleasure]
ref|XP_006392526.1|  hypothetical protein EUTSA_v10023407mg             231   2e-67   
ref|XP_010511185.1|  PREDICTED: probable serine/threonine protein...    231   2e-67   Camelina sativa [gold-of-pleasure]
ref|XP_010522571.1|  PREDICTED: serine/threonine protein phosphat...    231   2e-67   Tarenaya hassleriana [spider flower]
ref|XP_010511184.1|  PREDICTED: probable serine/threonine protein...    231   2e-67   Camelina sativa [gold-of-pleasure]
gb|KFK35630.1|  hypothetical protein AALP_AA4G016100                    231   2e-67   Arabis alpina [alpine rockcress]
ref|XP_002306866.1|  hypothetical protein POPTR_0005s24880g             231   2e-67   Populus trichocarpa [western balsam poplar]
ref|XP_010414886.1|  PREDICTED: probable serine/threonine protein...    231   3e-67   Camelina sativa [gold-of-pleasure]
gb|KHG22923.1|  Serine/threonine-protein phosphatase 2A regulator...    230   4e-67   Gossypium arboreum [tree cotton]
gb|KHG15282.1|  Serine/threonine-protein phosphatase 2A regulator...    231   5e-67   Gossypium arboreum [tree cotton]
ref|XP_010528763.1|  PREDICTED: probable serine/threonine protein...    228   5e-67   Tarenaya hassleriana [spider flower]
ref|XP_006300408.1|  hypothetical protein CARUB_v10021330mg             229   6e-67   Capsella rubella
ref|NP_175847.1|  calcium-binding EF-hand-containing protein            229   8e-67   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002894582.1|  predicted protein                                  229   8e-67   Arabidopsis lyrata subsp. lyrata
ref|XP_011028847.1|  PREDICTED: serine/threonine protein phosphat...    228   2e-66   Populus euphratica
ref|XP_011028845.1|  PREDICTED: serine/threonine protein phosphat...    228   2e-66   Populus euphratica
ref|XP_006403143.1|  hypothetical protein EUTSA_v10003178mg             228   2e-66   Eutrema salsugineum [saltwater cress]
ref|NP_199222.1|  serine/threonine protein phosphatase 2A regulat...    228   2e-66   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009119377.1|  PREDICTED: probable serine/threonine protein...    228   2e-66   Brassica rapa
ref|XP_002863612.1|  hypothetical protein ARALYDRAFT_494587             228   2e-66   
ref|XP_010481779.1|  PREDICTED: serine/threonine protein phosphat...    228   2e-66   Camelina sativa [gold-of-pleasure]
ref|XP_010494408.1|  PREDICTED: serine/threonine protein phosphat...    228   2e-66   Camelina sativa [gold-of-pleasure]
ref|XP_010441946.1|  PREDICTED: serine/threonine protein phosphat...    228   2e-66   Camelina sativa [gold-of-pleasure]
ref|XP_006281535.1|  hypothetical protein CARUB_v10027636mg             228   3e-66   Capsella rubella
ref|XP_010528761.1|  PREDICTED: probable serine/threonine protein...    228   3e-66   Tarenaya hassleriana [spider flower]
gb|KJB38395.1|  hypothetical protein B456_006G253100                    228   4e-66   Gossypium raimondii
ref|XP_002977985.1|  hypothetical protein SELMODRAFT_152267             226   1e-65   
ref|XP_002966764.1|  hypothetical protein SELMODRAFT_85336              226   2e-65   
ref|XP_010475029.1|  PREDICTED: probable serine/threonine protein...    222   2e-65   
ref|XP_010482911.1|  PREDICTED: probable serine/threonine protein...    221   2e-65   Camelina sativa [gold-of-pleasure]
ref|NP_001046159.2|  Os02g0191700                                       213   3e-65   
ref|NP_973757.1|  calcium-binding EF-hand-containing protein            220   8e-65   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010475028.1|  PREDICTED: probable serine/threonine protein...    223   2e-64   Camelina sativa [gold-of-pleasure]
ref|XP_002889485.1|  calcium-binding EF hand family protein             223   2e-64   
ref|XP_010482903.1|  PREDICTED: probable serine/threonine protein...    223   3e-64   Camelina sativa [gold-of-pleasure]
ref|XP_008460653.1|  PREDICTED: probable serine/threonine protein...    222   6e-64   Cucumis melo [Oriental melon]
ref|XP_004147151.1|  PREDICTED: probable serine/threonine protein...    222   7e-64   Cucumis sativus [cucumbers]
gb|AAD10674.1|  Highly similar to protein phosphatase 2A regulato...    221   1e-63   Arabidopsis thaliana [mouse-ear cress]
ref|NP_171892.2|  calcium-binding EF-hand-containing protein            221   1e-63   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009113951.1|  PREDICTED: serine/threonine protein phosphat...    219   8e-63   Brassica rapa
ref|XP_004951612.1|  PREDICTED: serine/threonine-protein phosphat...    218   2e-62   
ref|XP_006648406.1|  PREDICTED: probable serine/threonine protein...    216   2e-62   
gb|EEE56483.1|  hypothetical protein OsJ_05710                          214   7e-62   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010093066.1|  hypothetical protein L484_005924                   216   1e-61   
ref|XP_001752983.1|  predicted protein                                  216   2e-61   
dbj|BAD34016.1|  putative protein phosphatase 2A 48 kDa regulator...    215   3e-61   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008643437.1|  PREDICTED: uncharacterized protein LOC100279...    215   3e-61   Zea mays [maize]
gb|EEC72658.1|  hypothetical protein OsI_06192                          215   3e-61   Oryza sativa Indica Group [Indian rice]
emb|CDY36971.1|  BnaC09g17870D                                          214   5e-61   Brassica napus [oilseed rape]
ref|NP_001170273.1|  hypothetical protein                               214   6e-61   Zea mays [maize]
ref|XP_001772199.1|  predicted protein                                  214   6e-61   
emb|CDY13127.1|  BnaA09g16900D                                          214   7e-61   Brassica napus [oilseed rape]
ref|XP_002453453.1|  hypothetical protein SORBIDRAFT_04g006190          213   1e-60   Sorghum bicolor [broomcorn]
ref|XP_001758946.1|  predicted protein                                  214   2e-60   
ref|XP_003571084.1|  PREDICTED: probable serine/threonine protein...    213   2e-60   
gb|EMS52417.1|  Serine/threonine-protein phosphatase 2A regulator...    210   4e-60   Triticum urartu
dbj|BAJ95001.1|  predicted protein                                      211   1e-59   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMT18000.1|  Serine/threonine-protein phosphatase 2A regulator...    211   1e-59   
emb|CDY15483.1|  BnaA08g27670D                                          207   3e-58   Brassica napus [oilseed rape]
ref|XP_009111132.1|  PREDICTED: probable serine/threonine protein...    206   3e-58   
emb|CDX86655.1|  BnaC08g00480D                                          205   1e-57   
gb|KHN29775.1|  Serine/threonine-protein phosphatase 2A regulator...    192   3e-57   Glycine soja [wild soybean]
ref|XP_010462553.1|  PREDICTED: probable serine/threonine protein...    204   1e-56   Camelina sativa [gold-of-pleasure]
ref|XP_001764395.1|  predicted protein                                  191   2e-52   
gb|KHN43156.1|  Serine/threonine-protein phosphatase 2A regulator...    182   9e-51   Glycine soja [wild soybean]
ref|XP_001775422.1|  predicted protein                                  179   3e-48   
ref|XP_005649287.1|  phosphatase 2A regulatory subunit B                172   5e-47   Coccomyxa subellipsoidea C-169
ref|XP_001418951.1|  predicted protein                                  176   5e-47   Ostreococcus lucimarinus CCE9901
ref|XP_003080381.1|  protein phosphatase 2A 62 kDa B'' regulatory...    174   2e-46   
emb|CEF98759.1|  EF-hand domain pair                                    174   3e-46   Ostreococcus tauri
ref|XP_002500124.1|  predicted protein                                  169   3e-44   Micromonas commoda
gb|KHN24827.1|  Serine/threonine-protein phosphatase 2A regulator...    154   7e-43   Glycine soja [wild soybean]
gb|KJB44839.1|  hypothetical protein B456_007G275600                    164   1e-42   Gossypium raimondii
ref|XP_003057811.1|  predicted protein                                  161   1e-41   Micromonas pusilla CCMP1545
gb|KJB82291.1|  hypothetical protein B456_013G187900                    160   3e-41   Gossypium raimondii
gb|EPS58366.1|  hypothetical protein M569_16449                         149   5e-41   Genlisea aurea
ref|XP_007511063.1|  predicted protein                                  151   1e-37   Bathycoccus prasinos
ref|XP_012085281.1|  PREDICTED: serine/threonine protein phosphat...    148   5e-37   Jatropha curcas
gb|KJB11373.1|  hypothetical protein B456_001G254900                    147   9e-37   Gossypium raimondii
gb|AAL31038.1|AC078893_1  putative phosphatase subunit, 3'-partial      147   1e-36   Oryza sativa Japonica Group [Japonica rice]
gb|KDD74550.1|  hypothetical protein H632_c1234p1                       145   2e-36   Helicosporidium sp. ATCC 50920
ref|XP_011400271.1|  Serine/threonine-protein phosphatase 2A regu...    137   5e-33   Auxenochlorella protothecoides
ref|XP_005715246.1|  unnamed protein product                            135   2e-31   Chondrus crispus [carageen]
ref|XP_005537556.1|  probable protein phosphatase 2A regulatory s...    134   2e-31   Cyanidioschyzon merolae strain 10D
ref|XP_002779684.1|  conserved hypothetical protein                     125   4e-31   Perkinsus marinus ATCC 50983
gb|KJB10002.1|  hypothetical protein B456_001G179600                    129   4e-30   Gossypium raimondii
ref|XP_005828689.1|  hypothetical protein GUITHDRAFT_158184             124   4e-29   Guillardia theta CCMP2712
ref|XP_005703826.1|  protein phosphatase 2 (formerly 2A), regulat...    126   8e-29   Galdieria sulphuraria
ref|XP_007030397.1|  Calcium-binding EF-hand family protein isofo...    124   9e-29   
gb|KIZ06645.1|  protein phosphatase 2 (formerly 2A), regulatory s...    118   2e-28   Monoraphidium neglectum
ref|XP_002997335.1|  conserved hypothetical protein                     124   4e-28   Phytophthora infestans T30-4
ref|XP_009539680.1|  hypothetical protein PHYSODRAFT_551578             124   8e-28   Phytophthora sojae
ref|XP_009838775.1|  hypothetical protein H257_13052                    123   9e-28   Aphanomyces astaci
ref|XP_001696329.1|  protein phosphatase 2A regulatory subunit          120   9e-28   Chlamydomonas reinhardtii
gb|ETP35785.1|  hypothetical protein F442_16120                         124   1e-27   Phytophthora parasitica P10297
gb|ETL84745.1|  hypothetical protein L917_15516                         124   1e-27   Phytophthora parasitica
gb|ETK78074.1|  hypothetical protein L915_15815                         124   1e-27   Phytophthora parasitica
gb|ETI37890.1|  hypothetical protein F443_16263                         124   1e-27   Phytophthora parasitica P1569
ref|XP_008873682.1|  hypothetical protein H310_09400                    122   2e-27   Aphanomyces invadans
gb|KDO32137.1|  hypothetical protein SPRG_03354                         121   3e-27   Saprolegnia parasitica CBS 223.65
ref|XP_008618233.1|  hypothetical protein SDRG_13910                    121   4e-27   Saprolegnia diclina VS20
emb|CCA22536.1|  conserved hypothetical protein                         119   4e-26   Albugo laibachii Nc14
ref|XP_002293625.1|  phosphatase 2A (PP2A) regulatory subunit B-l...    115   5e-26   Thalassiosira pseudonana CCMP1335
emb|CDW83392.1|  serine threonine-protein phosphatase 2a regulato...    117   8e-26   Stylonychia lemnae
gb|EJY70439.1|  EF hand family protein                                  117   9e-26   Oxytricha trifallax
emb|CCI46051.1|  unnamed protein product                                117   2e-25   Albugo candida
emb|CCI46041.1|  unnamed protein product                                116   3e-25   Albugo candida
emb|CCI46044.1|  unnamed protein product                                116   3e-25   Albugo candida
emb|CCI46045.1|  unnamed protein product                                116   3e-25   Albugo candida
emb|CCI46047.1|  unnamed protein product                                116   3e-25   Albugo candida
emb|CCI46040.1|  unnamed protein product                                116   3e-25   Albugo candida
emb|CCI46039.1|  unnamed protein product                                116   3e-25   Albugo candida
emb|CCI46048.1|  unnamed protein product                                116   3e-25   Albugo candida
emb|CCI46043.1|  unnamed protein product                                116   3e-25   Albugo candida
emb|CCI46049.1|  unnamed protein product                                116   3e-25   
emb|CCI46042.1|  unnamed protein product                                116   3e-25   
emb|CCI46036.1|  unnamed protein product                                116   3e-25   
emb|CCI46052.1|  unnamed protein product                                116   3e-25   
emb|CCI46050.1|  unnamed protein product                                116   3e-25   
emb|CCI46038.1|  unnamed protein product                                116   3e-25   
emb|CCI46037.1|  unnamed protein product                                116   3e-25   
emb|CCI46035.1|  unnamed protein product                                116   3e-25   
emb|CCI46046.1|  unnamed protein product                                116   3e-25   
emb|CCI46034.1|  unnamed protein product                                116   3e-25   
ref|XP_002181921.1|  predicted protein                                  110   5e-24   
ref|XP_004039012.1|  hypothetical protein IMG5_037820                   110   8e-24   
ref|XP_005196040.1|  PREDICTED: serine/threonine-protein phosphat...    105   2e-23   
ref|XP_009035978.1|  hypothetical protein AURANDRAFT_3205               107   2e-23   
ref|XP_002924863.2|  PREDICTED: serine/threonine-protein phosphat...    104   2e-23   
ref|XP_007889274.1|  PREDICTED: serine/threonine-protein phosphat...    108   4e-23   
ref|XP_007889273.1|  PREDICTED: serine/threonine-protein phosphat...    108   4e-23   
gb|EJK76668.1|  hypothetical protein THAOC_01563                        109   5e-23   
ref|XP_007889272.1|  PREDICTED: serine/threonine-protein phosphat...    108   5e-23   
gb|AAH31532.1|  3222402P14Rik protein                                   103   6e-23   
ref|XP_001347004.1|  Phosphatase regulatory subunit                     108   7e-23   
ref|XP_001438471.1|  hypothetical protein                               108   9e-23   
ref|XP_009954069.1|  PREDICTED: serine/threonine-protein phosphat...    107   9e-23   
ref|XP_001439560.1|  hypothetical protein                               108   9e-23   
gb|EWS74498.1|  EF hand protein                                         108   9e-23   
ref|XP_009580668.1|  PREDICTED: serine/threonine-protein phosphat...    106   1e-22   
ref|XP_002946173.1|  hypothetical protein VOLCADRAFT_42247              105   1e-22   
ref|XP_009693500.1|  PREDICTED: serine/threonine-protein phosphat...    107   1e-22   
ref|XP_004324990.1|  PREDICTED: serine/threonine-protein phosphat...    104   1e-22   
ref|XP_009954061.1|  PREDICTED: serine/threonine-protein phosphat...    108   2e-22   
ref|XP_009990136.1|  PREDICTED: serine/threonine-protein phosphat...    107   2e-22   
ref|XP_007670391.1|  PREDICTED: serine/threonine-protein phosphat...    102   2e-22   
ref|XP_010715019.1|  PREDICTED: serine/threonine-protein phosphat...    104   2e-22   
gb|KFW80542.1|  Serine/threonine-protein phosphatase 2A regulator...    108   2e-22   
ref|XP_001015505.1|  EF hand family protein                             108   2e-22   
ref|XP_010204935.1|  PREDICTED: serine/threonine-protein phosphat...    105   2e-22   
ref|XP_005019425.1|  PREDICTED: serine/threonine-protein phosphat...    106   3e-22   
ref|XP_005501647.1|  PREDICTED: serine/threonine-protein phosphat...    106   3e-22   
ref|XP_009477524.1|  PREDICTED: serine/threonine-protein phosphat...    104   3e-22   
gb|KFQ03476.1|  Serine/threonine-protein phosphatase 2A regulator...    108   3e-22   
ref|XP_009087513.1|  PREDICTED: serine/threonine-protein phosphat...    108   3e-22   
gb|KFP56689.1|  Serine/threonine-protein phosphatase 2A regulator...    105   3e-22   
ref|XP_005489628.1|  PREDICTED: serine/threonine-protein phosphat...    106   3e-22   
gb|KFW11679.1|  Serine/threonine-protein phosphatase 2A regulator...    105   3e-22   
ref|XP_005241162.1|  PREDICTED: serine/threonine-protein phosphat...    106   4e-22   
ref|XP_010884650.1|  PREDICTED: serine/threonine-protein phosphat...    108   4e-22   
ref|XP_009990135.1|  PREDICTED: serine/threonine-protein phosphat...    107   4e-22   
ref|XP_011958379.1|  PREDICTED: serine/threonine-protein phosphat...    104   4e-22   
ref|XP_010799897.1|  PREDICTED: serine/threonine-protein phosphat...    104   4e-22   
emb|CAF87727.1|  unnamed protein product                                100   4e-22   
gb|KFR15624.1|  Serine/threonine-protein phosphatase 2A regulator...    107   4e-22   
ref|XP_009939078.1|  PREDICTED: serine/threonine-protein phosphat...    107   4e-22   
ref|XP_005501646.1|  PREDICTED: serine/threonine-protein phosphat...    105   4e-22   
gb|KFV06503.1|  Serine/threonine-protein phosphatase 2A regulator...    107   5e-22   
ref|XP_009642711.1|  PREDICTED: serine/threonine-protein phosphat...    105   5e-22   
ref|XP_009461026.1|  PREDICTED: serine/threonine-protein phosphat...    105   5e-22   
ref|XP_005501643.1|  PREDICTED: serine/threonine-protein phosphat...    107   5e-22   
gb|EPY82676.1|  hypothetical protein CB1_000633006                      104   5e-22   
ref|XP_005425138.1|  PREDICTED: serine/threonine-protein phosphat...    107   5e-22   
ref|XP_005019423.1|  PREDICTED: serine/threonine-protein phosphat...    107   5e-22   
ref|XP_005072078.1|  PREDICTED: serine/threonine-protein phosphat...    105   6e-22   
ref|XP_011678193.1|  PREDICTED: serine/threonine-protein phosphat...    103   6e-22   
ref|XP_010156868.1|  PREDICTED: serine/threonine-protein phosphat...    105   6e-22   
ref|XP_008489226.1|  PREDICTED: serine/threonine-protein phosphat...    105   6e-22   
gb|EOB01505.1|  Serine/threonine-protein phosphatase 2A regulator...    107   6e-22   
ref|XP_005019424.1|  PREDICTED: serine/threonine-protein phosphat...    107   7e-22   
ref|XP_010559445.1|  PREDICTED: serine/threonine-protein phosphat...    105   7e-22   
ref|XP_005019422.1|  PREDICTED: serine/threonine-protein phosphat...    107   7e-22   
ref|XP_004712160.1|  PREDICTED: serine/threonine-protein phosphat...    105   7e-22   
ref|XP_005019420.1|  PREDICTED: serine/threonine-protein phosphat...    107   7e-22   
gb|ELK16717.1|  Serine/threonine-protein phosphatase 2A regulator...    107   7e-22   
ref|XP_542792.3|  PREDICTED: serine/threonine-protein phosphatase...    105   7e-22   
ref|XP_005143116.1|  PREDICTED: serine/threonine-protein phosphat...    105   7e-22   
ref|XP_005489627.1|  PREDICTED: serine/threonine-protein phosphat...    107   7e-22   
ref|XP_011371495.1|  PREDICTED: serine/threonine-protein phosphat...    107   8e-22   
ref|XP_005050962.1|  PREDICTED: serine/threonine-protein phosphat...    105   8e-22   
ref|XP_006907283.1|  PREDICTED: serine/threonine-protein phosphat...    107   8e-22   
ref|XP_005019421.1|  PREDICTED: serine/threonine-protein phosphat...    107   8e-22   
ref|XP_010118959.1|  PREDICTED: serine/threonine-protein phosphat...    107   8e-22   
ref|XP_007521858.1|  PREDICTED: serine/threonine-protein phosphat...    105   8e-22   
ref|XP_004936980.1|  PREDICTED: serine/threonine-protein phosphat...    105   8e-22   
ref|XP_005441759.1|  PREDICTED: serine/threonine-protein phosphat...    106   9e-22   
emb|CAB97532.1|  protein phosphatase 2A 72 kDa regulatory subunit       103   9e-22   
ref|XP_005241161.1|  PREDICTED: serine/threonine-protein phosphat...    106   9e-22   
ref|XP_009283228.1|  PREDICTED: serine/threonine-protein phosphat...    105   9e-22   
ref|XP_004603016.1|  PREDICTED: serine/threonine-protein phosphat...    105   9e-22   
ref|XP_009567246.1|  PREDICTED: serine/threonine-protein phosphat...    106   9e-22   
ref|XP_009909672.1|  PREDICTED: serine/threonine-protein phosphat...    106   1e-21   
ref|XP_003310091.1|  PREDICTED: serine/threonine-protein phosphat...    103   1e-21   
gb|KFV63580.1|  Serine/threonine-protein phosphatase 2A regulator...    106   1e-21   
ref|XP_011593118.1|  PREDICTED: serine/threonine-protein phosphat...    104   1e-21   
ref|XP_004037746.1|  PREDICTED: serine/threonine-protein phosphat...    103   1e-21   
ref|NP_001177376.1|  serine/threonine-protein phosphatase 2A regu...    103   1e-21   
ref|XP_006511767.1|  PREDICTED: serine/threonine-protein phosphat...    104   1e-21   
ref|XP_009642710.1|  PREDICTED: serine/threonine-protein phosphat...    106   1e-21   
ref|XP_010899685.1|  PREDICTED: serine/threonine-protein phosphat...    105   1e-21   
ref|XP_005501644.1|  PREDICTED: serine/threonine-protein phosphat...    106   1e-21   
ref|XP_005050963.1|  PREDICTED: serine/threonine-protein phosphat...    104   1e-21   
ref|XP_005501642.1|  PREDICTED: serine/threonine-protein phosphat...    106   1e-21   
dbj|BAC28935.1|  unnamed protein product                                104   1e-21   
ref|XP_010176974.1|  PREDICTED: serine/threonine-protein phosphat...    106   1e-21   
ref|XP_005501645.1|  PREDICTED: serine/threonine-protein phosphat...    106   1e-21   
ref|XP_009461024.1|  PREDICTED: serine/threonine-protein phosphat...    106   1e-21   
ref|XP_008104629.1|  PREDICTED: serine/threonine-protein phosphat...    104   1e-21   
ref|XP_008264436.1|  PREDICTED: serine/threonine-protein phosphat...    104   1e-21   
ref|XP_005529608.1|  PREDICTED: serine/threonine-protein phosphat...    104   1e-21   
ref|XP_005863602.1|  PREDICTED: serine/threonine-protein phosphat...    104   1e-21   
ref|XP_008489225.1|  PREDICTED: serine/threonine-protein phosphat...    106   1e-21   
ref|XP_005367854.1|  PREDICTED: serine/threonine-protein phosphat...    104   1e-21   
ref|XP_005201979.1|  PREDICTED: serine/threonine-protein phosphat...    104   1e-21   
gb|KFQ20763.1|  Serine/threonine-protein phosphatase 2A regulator...    106   1e-21   
ref|XP_008326442.1|  PREDICTED: serine/threonine-protein phosphat...    105   1e-21   
ref|XP_006083790.1|  PREDICTED: serine/threonine-protein phosphat...    104   1e-21   
ref|XP_008280604.1|  PREDICTED: serine/threonine-protein phosphat...    103   1e-21   
ref|XP_005143115.1|  PREDICTED: serine/threonine-protein phosphat...    106   1e-21   
ref|XP_008933919.1|  PREDICTED: LOW QUALITY PROTEIN: serine/threo...    106   1e-21   
ref|XP_004003369.1|  PREDICTED: serine/threonine-protein phosphat...    104   1e-21   
ref|XP_002193306.1|  PREDICTED: serine/threonine-protein phosphat...    106   1e-21   
ref|NP_742156.2|  serine/threonine-protein phosphatase 2A regulat...    104   1e-21   
ref|XP_010216954.1|  PREDICTED: serine/threonine-protein phosphat...    106   1e-21   
ref|XP_003265306.1|  PREDICTED: serine/threonine-protein phosphat...    103   1e-21   
ref|XP_008151151.1|  PREDICTED: serine/threonine-protein phosphat...    104   1e-21   
ref|XP_422556.4|  PREDICTED: serine/threonine-protein phosphatase...    106   1e-21   
ref|XP_004936978.1|  PREDICTED: serine/threonine-protein phosphat...    106   1e-21   
ref|XP_006216102.1|  PREDICTED: serine/threonine-protein phosphat...    104   1e-21   
ref|XP_009511542.1|  PREDICTED: serine/threonine-protein phosphat...    106   1e-21   
gb|KFO98716.1|  Serine/threonine-protein phosphatase 2A regulator...    106   1e-21   
ref|XP_003363212.1|  PREDICTED: serine/threonine-protein phosphat...    104   1e-21   
ref|XP_004682238.1|  PREDICTED: serine/threonine-protein phosphat...    104   1e-21   
gb|KFQ25490.1|  Serine/threonine-protein phosphatase 2A regulator...    106   1e-21   
ref|XP_003992147.1|  PREDICTED: serine/threonine-protein phosphat...    104   1e-21   
ref|XP_006182875.1|  PREDICTED: serine/threonine-protein phosphat...    104   1e-21   
dbj|BAE21013.1|  unnamed protein product                                104   1e-21   
ref|XP_008839861.1|  PREDICTED: serine/threonine-protein phosphat...    104   1e-21   
ref|XP_006171609.1|  PREDICTED: serine/threonine-protein phosphat...    104   1e-21   
ref|XP_010301274.1|  PREDICTED: serine/threonine-protein phosphat...    106   1e-21   
ref|XP_008628275.1|  PREDICTED: serine/threonine-protein phosphat...    106   1e-21   
ref|XP_007457605.1|  PREDICTED: serine/threonine-protein phosphat...    104   1e-21   
ref|XP_004278986.1|  PREDICTED: serine/threonine-protein phosphat...    104   1e-21   
gb|KFP42068.1|  Serine/threonine-protein phosphatase 2A regulator...    106   1e-21   
ref|XP_007170425.1|  PREDICTED: serine/threonine-protein phosphat...    104   1e-21   
ref|XP_005050960.1|  PREDICTED: serine/threonine-protein phosphat...    106   1e-21   
ref|XP_004762515.1|  PREDICTED: serine/threonine-protein phosphat...    104   1e-21   
ref|XP_004664403.1|  PREDICTED: serine/threonine-protein phosphat...    104   1e-21   
ref|XP_010409438.1|  PREDICTED: serine/threonine-protein phosphat...    106   1e-21   
ref|XP_006727980.1|  PREDICTED: serine/threonine-protein phosphat...    104   1e-21   
ref|XP_007087471.1|  PREDICTED: serine/threonine-protein phosphat...    104   1e-21   
ref|XP_005072077.1|  PREDICTED: serine/threonine-protein phosphat...    106   2e-21   
ref|XP_004712159.1|  PREDICTED: serine/threonine-protein phosphat...    106   2e-21   
ref|XP_010973821.1|  PREDICTED: serine/threonine-protein phosphat...    104   2e-21   
ref|XP_008921647.1|  PREDICTED: serine/threonine-protein phosphat...    106   2e-21   
ref|XP_003639877.1|  PREDICTED: serine/threonine-protein phosphat...    106   2e-21   
ref|XP_004936979.1|  PREDICTED: serine/threonine-protein phosphat...    105   2e-21   
ref|XP_004417101.1|  PREDICTED: serine/threonine-protein phosphat...    104   2e-21   
ref|XP_009283226.1|  PREDICTED: serine/threonine-protein phosphat...    105   2e-21   
ref|XP_006975191.1|  PREDICTED: serine/threonine-protein phosphat...    104   2e-21   
ref|XP_010738436.1|  PREDICTED: serine/threonine-protein phosphat...    104   2e-21   
ref|XP_010339880.1|  PREDICTED: serine/threonine-protein phosphat...    103   2e-21   
ref|XP_004477703.1|  PREDICTED: serine/threonine-protein phosphat...    104   2e-21   
ref|XP_010363133.1|  PREDICTED: serine/threonine-protein phosphat...    104   2e-21   
ref|XP_010175761.1|  PREDICTED: serine/threonine-protein phosphat...    104   2e-21   
ref|XP_005529607.1|  PREDICTED: serine/threonine-protein phosphat...    105   2e-21   
ref|XP_009920099.1|  PREDICTED: serine/threonine-protein phosphat...    105   2e-21   
ref|XP_007435100.1|  PREDICTED: serine/threonine-protein phosphat...    104   2e-21   
ref|XP_011593110.1|  PREDICTED: serine/threonine-protein phosphat...    105   2e-21   
ref|XP_010738433.1|  PREDICTED: serine/threonine-protein phosphat...    104   2e-21   
ref|XP_008280596.1|  PREDICTED: serine/threonine-protein phosphat...    103   2e-21   
ref|XP_006243696.1|  PREDICTED: serine/threonine-protein phosphat...    104   2e-21   
ref|XP_009971717.1|  PREDICTED: serine/threonine-protein phosphat...    105   2e-21   
gb|KFO82121.1|  Serine/threonine-protein phosphatase 2A regulator...    105   2e-21   
ref|XP_007521856.1|  PREDICTED: serine/threonine-protein phosphat...    105   2e-21   
ref|XP_003218426.1|  PREDICTED: serine/threonine-protein phosphat...    105   2e-21   
ref|XP_006883430.1|  PREDICTED: serine/threonine-protein phosphat...    104   2e-21   
ref|XP_010730506.1|  PREDICTED: serine/threonine-protein phosphat...    105   2e-21   
gb|KFV59271.1|  Serine/threonine-protein phosphatase 2A regulator...    105   2e-21   
gb|KFQ83496.1|  Serine/threonine-protein phosphatase 2A regulator...    105   2e-21   
ref|XP_006565609.1|  PREDICTED: uncharacterized protein LOC412914...    105   2e-21   
ref|XP_008982027.1|  PREDICTED: serine/threonine-protein phosphat...    103   2e-21   
ref|XP_004603015.1|  PREDICTED: serine/threonine-protein phosphat...    105   2e-21   
gb|KFQ83106.1|  Serine/threonine-protein phosphatase 2A regulator...    105   2e-21   
ref|XP_010293548.1|  PREDICTED: serine/threonine-protein phosphat...    105   2e-21   
ref|XP_010138870.1|  PREDICTED: serine/threonine-protein phosphat...    105   2e-21   
ref|XP_002716398.1|  PREDICTED: serine/threonine-protein phosphat...    105   2e-21   
ref|XP_010175760.1|  PREDICTED: serine/threonine-protein phosphat...    105   2e-21   
gb|KFO11126.1|  Serine/threonine-protein phosphatase 2A regulator...    105   2e-21   
ref|XP_004664402.1|  PREDICTED: serine/threonine-protein phosphat...    105   2e-21   
gb|KFM11374.1|  Serine/threonine-protein phosphatase 2A regulator...    105   2e-21   
ref|XP_004003368.1|  PREDICTED: serine/threonine-protein phosphat...    105   2e-21   
ref|XP_396366.3|  PREDICTED: uncharacterized protein LOC412914 is...    105   2e-21   
gb|KFW95593.1|  Serine/threonine-protein phosphatase 2A regulator...    105   2e-21   
ref|XP_008280589.1|  PREDICTED: serine/threonine-protein phosphat...    104   2e-21   
gb|KFZ62367.1|  Serine/threonine-protein phosphatase 2A regulator...    105   2e-21   
gb|KGL95223.1|  Serine/threonine-protein phosphatase 2A regulator...    105   2e-21   
gb|KFO92495.1|  Serine/threonine-protein phosphatase 2A regulator...    105   2e-21   
ref|XP_004419402.1|  PREDICTED: serine/threonine-protein phosphat...    103   2e-21   
gb|KFP20619.1|  Serine/threonine-protein phosphatase 2A regulator...    105   2e-21   
ref|XP_009873842.1|  PREDICTED: serine/threonine-protein phosphat...    105   2e-21   
ref|XP_009322268.1|  PREDICTED: LOW QUALITY PROTEIN: serine/threo...    105   3e-21   
ref|XP_001498880.3|  PREDICTED: serine/threonine-protein phosphat...    105   3e-21   
ref|XP_005966658.1|  PREDICTED: serine/threonine-protein phosphat...    105   3e-21   
ref|XP_007493975.1|  PREDICTED: serine/threonine-protein phosphat...    102   3e-21   
gb|KFV58470.1|  Serine/threonine-protein phosphatase 2A regulator...    105   3e-21   
ref|XP_009816089.1|  PREDICTED: serine/threonine-protein phosphat...    105   3e-21   
gb|KFP91818.1|  Serine/threonine-protein phosphatase 2A regulator...    105   3e-21   
ref|XP_007087470.1|  PREDICTED: serine/threonine-protein phosphat...    105   3e-21   
ref|XP_011284435.1|  PREDICTED: serine/threonine-protein phosphat...    105   3e-21   
gb|KFQ95178.1|  Serine/threonine-protein phosphatase 2A regulator...    105   3e-21   
ref|XP_008839859.1|  PREDICTED: serine/threonine-protein phosphat...    105   3e-21   
ref|XP_005675594.1|  PREDICTED: serine/threonine-protein phosphat...    105   3e-21   
ref|XP_006050888.1|  PREDICTED: LOW QUALITY PROTEIN: serine/threo...    105   3e-21   
ref|XP_008151145.1|  PREDICTED: serine/threonine-protein phosphat...    105   3e-21   
gb|KGL80026.1|  Serine/threonine-protein phosphatase 2A regulator...    105   3e-21   
ref|XP_010559444.1|  PREDICTED: serine/threonine-protein phosphat...    105   3e-21   
ref|XP_007170423.1|  PREDICTED: serine/threonine-protein phosphat...    105   3e-21   
ref|XP_008524298.1|  PREDICTED: serine/threonine-protein phosphat...    105   3e-21   
ref|XP_006083789.1|  PREDICTED: serine/threonine-protein phosphat...    105   3e-21   
ref|XP_004682237.1|  PREDICTED: serine/threonine-protein phosphat...    105   3e-21   
ref|XP_005367853.1|  PREDICTED: serine/threonine-protein phosphat...    105   3e-21   
ref|XP_005201978.1|  PREDICTED: serine/threonine-protein phosphat...    105   3e-21   
ref|XP_004588389.1|  PREDICTED: LOW QUALITY PROTEIN: serine/threo...    105   3e-21   
ref|XP_010856558.1|  PREDICTED: serine/threonine-protein phosphat...    105   3e-21   



>ref|XP_009767474.1| PREDICTED: serine/threonine protein phosphatase 2A regulatory 
subunit B''beta-like [Nicotiana sylvestris]
 ref|XP_009767475.1| PREDICTED: serine/threonine protein phosphatase 2A regulatory 
subunit B''beta-like [Nicotiana sylvestris]
 ref|XP_009767476.1| PREDICTED: serine/threonine protein phosphatase 2A regulatory 
subunit B''beta-like [Nicotiana sylvestris]
Length=539

 Score =   261 bits (666),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 125/127 (98%), Positives = 125/127 (98%), Gaps = 0/127 (0%)
 Frame = -2

Query  918  RNEMQFFYEEQLHRMECMAQEPVLFEDILCQIVDMISPEEESYVTLRDLKGSKLSGSVFN  739
            RNEMQFFYEEQLHRMECMAQEPVLFEDILCQIVDMISPE ESY TLRDLKGSKLSGSVFN
Sbjct  413  RNEMQFFYEEQLHRMECMAQEPVLFEDILCQIVDMISPENESYFTLRDLKGSKLSGSVFN  472

Query  738  ILFNLNKFMAFETRDPFLIRQERENPNLTEWDRFAHREYIRLSMEEDAEDASNGSADVWD  559
            ILFNLNKFMAFETRDPFLIRQERENPNLTEWDRFAHREYIRLSMEEDAEDASNGSADVWD
Sbjct  473  ILFNLNKFMAFETRDPFLIRQERENPNLTEWDRFAHREYIRLSMEEDAEDASNGSADVWD  532

Query  558  ESLEAPF  538
            ESLEAPF
Sbjct  533  ESLEAPF  539



>ref|XP_009611860.1| PREDICTED: serine/threonine protein phosphatase 2A regulatory 
subunit B''beta-like [Nicotiana tomentosiformis]
 ref|XP_009611867.1| PREDICTED: serine/threonine protein phosphatase 2A regulatory 
subunit B''beta-like [Nicotiana tomentosiformis]
 ref|XP_009611875.1| PREDICTED: serine/threonine protein phosphatase 2A regulatory 
subunit B''beta-like [Nicotiana tomentosiformis]
Length=539

 Score =   261 bits (666),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 125/127 (98%), Positives = 125/127 (98%), Gaps = 0/127 (0%)
 Frame = -2

Query  918  RNEMQFFYEEQLHRMECMAQEPVLFEDILCQIVDMISPEEESYVTLRDLKGSKLSGSVFN  739
            RNEMQFFYEEQLHRMECMAQEPVLFEDILCQIVDMISPE ESY TLRDLKGSKLSGSVFN
Sbjct  413  RNEMQFFYEEQLHRMECMAQEPVLFEDILCQIVDMISPENESYFTLRDLKGSKLSGSVFN  472

Query  738  ILFNLNKFMAFETRDPFLIRQERENPNLTEWDRFAHREYIRLSMEEDAEDASNGSADVWD  559
            ILFNLNKFMAFETRDPFLIRQERENPNLTEWDRFAHREYIRLSMEEDAEDASNGSADVWD
Sbjct  473  ILFNLNKFMAFETRDPFLIRQERENPNLTEWDRFAHREYIRLSMEEDAEDASNGSADVWD  532

Query  558  ESLEAPF  538
            ESLEAPF
Sbjct  533  ESLEAPF  539



>ref|XP_004236780.1| PREDICTED: serine/threonine protein phosphatase 2A regulatory 
subunit B''beta [Solanum lycopersicum]
 ref|XP_010319272.1| PREDICTED: serine/threonine protein phosphatase 2A regulatory 
subunit B''beta [Solanum lycopersicum]
Length=539

 Score =   259 bits (661),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 123/127 (97%), Positives = 125/127 (98%), Gaps = 0/127 (0%)
 Frame = -2

Query  918  RNEMQFFYEEQLHRMECMAQEPVLFEDILCQIVDMISPEEESYVTLRDLKGSKLSGSVFN  739
            RNEMQFFYEEQLHRMECMAQEPVLFEDILCQIVDM+SPE ESY TLRDLKGS+LSGSVFN
Sbjct  413  RNEMQFFYEEQLHRMECMAQEPVLFEDILCQIVDMVSPENESYFTLRDLKGSRLSGSVFN  472

Query  738  ILFNLNKFMAFETRDPFLIRQERENPNLTEWDRFAHREYIRLSMEEDAEDASNGSADVWD  559
            ILFNLNKFMAFETRDPFLIRQERENPNLTEWDRFAHREYIRLSMEEDAEDASNGSADVWD
Sbjct  473  ILFNLNKFMAFETRDPFLIRQERENPNLTEWDRFAHREYIRLSMEEDAEDASNGSADVWD  532

Query  558  ESLEAPF  538
            ESLEAPF
Sbjct  533  ESLEAPF  539



>ref|XP_006361409.1| PREDICTED: probable serine/threonine protein phosphatase 2A regulatory 
subunit B''gamma-like [Solanum tuberosum]
Length=539

 Score =   259 bits (661),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 123/127 (97%), Positives = 125/127 (98%), Gaps = 0/127 (0%)
 Frame = -2

Query  918  RNEMQFFYEEQLHRMECMAQEPVLFEDILCQIVDMISPEEESYVTLRDLKGSKLSGSVFN  739
            RNEMQFFYEEQLHRMECMAQEPVLFEDILCQIVDM+SPE ESY TLRDLKGS+LSGSVFN
Sbjct  413  RNEMQFFYEEQLHRMECMAQEPVLFEDILCQIVDMVSPENESYFTLRDLKGSRLSGSVFN  472

Query  738  ILFNLNKFMAFETRDPFLIRQERENPNLTEWDRFAHREYIRLSMEEDAEDASNGSADVWD  559
            ILFNLNKFMAFETRDPFLIRQERENPNLTEWDRFAHREYIRLSMEEDAEDASNGSADVWD
Sbjct  473  ILFNLNKFMAFETRDPFLIRQERENPNLTEWDRFAHREYIRLSMEEDAEDASNGSADVWD  532

Query  558  ESLEAPF  538
            ESLEAPF
Sbjct  533  ESLEAPF  539



>gb|EYU19894.1| hypothetical protein MIMGU_mgv1a004196mg [Erythranthe guttata]
Length=539

 Score =   258 bits (658),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 123/127 (97%), Positives = 125/127 (98%), Gaps = 0/127 (0%)
 Frame = -2

Query  918  RNEMQFFYEEQLHRMECMAQEPVLFEDILCQIVDMISPEEESYVTLRDLKGSKLSGSVFN  739
            RNEMQFFYEEQLHRMECMAQEPVLFEDILCQIVDMI+PEEESY TLRDLKGS+LSGSVFN
Sbjct  413  RNEMQFFYEEQLHRMECMAQEPVLFEDILCQIVDMINPEEESYFTLRDLKGSRLSGSVFN  472

Query  738  ILFNLNKFMAFETRDPFLIRQERENPNLTEWDRFAHREYIRLSMEEDAEDASNGSADVWD  559
            ILFNLNKFMAFETRDPFLIRQERENP LTEWDRFAHREYIRLSMEEDAEDASNGSADVWD
Sbjct  473  ILFNLNKFMAFETRDPFLIRQERENPTLTEWDRFAHREYIRLSMEEDAEDASNGSADVWD  532

Query  558  ESLEAPF  538
            ESLEAPF
Sbjct  533  ESLEAPF  539



>emb|CAN77418.1| hypothetical protein VITISV_023449 [Vitis vinifera]
Length=341

 Score =   251 bits (640),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 119/127 (94%), Positives = 122/127 (96%), Gaps = 0/127 (0%)
 Frame = -2

Query  918  RNEMQFFYEEQLHRMECMAQEPVLFEDILCQIVDMISPEEESYVTLRDLKGSKLSGSVFN  739
            RNEMQFFYEEQLHRMECMAQEPVLFEDILCQIVDMI PE ESY+TLRDLKG KLSGSVFN
Sbjct  215  RNEMQFFYEEQLHRMECMAQEPVLFEDILCQIVDMIGPENESYITLRDLKGCKLSGSVFN  274

Query  738  ILFNLNKFMAFETRDPFLIRQERENPNLTEWDRFAHREYIRLSMEEDAEDASNGSADVWD  559
            ILFNLNKFMAFETRDPFLIRQERENP LTEWDRFAHREYIRLSMEED E+ASNGSA+VWD
Sbjct  275  ILFNLNKFMAFETRDPFLIRQERENPTLTEWDRFAHREYIRLSMEEDVEEASNGSAEVWD  334

Query  558  ESLEAPF  538
            ESLEAPF
Sbjct  335  ESLEAPF  341



>gb|EYU33164.1| hypothetical protein MIMGU_mgv1a004218mg [Erythranthe guttata]
Length=539

 Score =   256 bits (655),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 122/127 (96%), Positives = 125/127 (98%), Gaps = 0/127 (0%)
 Frame = -2

Query  918  RNEMQFFYEEQLHRMECMAQEPVLFEDILCQIVDMISPEEESYVTLRDLKGSKLSGSVFN  739
            RNEMQFFYEEQLHRMECMAQEPVLFEDILCQIVDMI PE++SY TLRDLKGSKLSGSVFN
Sbjct  413  RNEMQFFYEEQLHRMECMAQEPVLFEDILCQIVDMIHPEDQSYFTLRDLKGSKLSGSVFN  472

Query  738  ILFNLNKFMAFETRDPFLIRQERENPNLTEWDRFAHREYIRLSMEEDAEDASNGSADVWD  559
            ILFNLNKFMAFETRDPFLIRQERENP+LTEWDRFAHREYIRLSMEEDAEDASNGSADVWD
Sbjct  473  ILFNLNKFMAFETRDPFLIRQERENPSLTEWDRFAHREYIRLSMEEDAEDASNGSADVWD  532

Query  558  ESLEAPF  538
            ESLEAPF
Sbjct  533  ESLEAPF  539



>ref|XP_011077220.1| PREDICTED: serine/threonine protein phosphatase 2A regulatory 
subunit B''beta-like [Sesamum indicum]
Length=539

 Score =   256 bits (653),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 122/127 (96%), Positives = 125/127 (98%), Gaps = 0/127 (0%)
 Frame = -2

Query  918  RNEMQFFYEEQLHRMECMAQEPVLFEDILCQIVDMISPEEESYVTLRDLKGSKLSGSVFN  739
            RNEMQFFYEEQLHRMECMAQEPVLFEDILCQIVDMISPE+ESY T+RDLKGSKLSGSVFN
Sbjct  413  RNEMQFFYEEQLHRMECMAQEPVLFEDILCQIVDMISPEDESYFTIRDLKGSKLSGSVFN  472

Query  738  ILFNLNKFMAFETRDPFLIRQERENPNLTEWDRFAHREYIRLSMEEDAEDASNGSADVWD  559
            ILFNLNKFMAFETRDPFLIRQERENP LT+WDRFAHREYIRLSMEEDAEDASNGSADVWD
Sbjct  473  ILFNLNKFMAFETRDPFLIRQERENPTLTDWDRFAHREYIRLSMEEDAEDASNGSADVWD  532

Query  558  ESLEAPF  538
            ESLEAPF
Sbjct  533  ESLEAPF  539



>ref|XP_006589213.1| PREDICTED: probable serine/threonine protein phosphatase 2A regulatory 
subunit B''delta-like isoform X4 [Glycine max]
Length=328

 Score =   249 bits (636),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 117/127 (92%), Positives = 122/127 (96%), Gaps = 0/127 (0%)
 Frame = -2

Query  918  RNEMQFFYEEQLHRMECMAQEPVLFEDILCQIVDMISPEEESYVTLRDLKGSKLSGSVFN  739
            RNE+QFFYEEQLHRMECMAQEPVLFEDILCQI+DMI PE+ES +TLRDLKG KLSGSVFN
Sbjct  202  RNELQFFYEEQLHRMECMAQEPVLFEDILCQIIDMIKPEDESVITLRDLKGGKLSGSVFN  261

Query  738  ILFNLNKFMAFETRDPFLIRQERENPNLTEWDRFAHREYIRLSMEEDAEDASNGSADVWD  559
            ILFNLNKFMAFETRDPFLIRQERENP LTEWDRFAHREYIRLSMEED EDASNGSA+VWD
Sbjct  262  ILFNLNKFMAFETRDPFLIRQERENPTLTEWDRFAHREYIRLSMEEDVEDASNGSAEVWD  321

Query  558  ESLEAPF  538
            ESLEAPF
Sbjct  322  ESLEAPF  328



>gb|KHN35322.1| Serine/threonine-protein phosphatase 2A regulatory subunit B'' 
subunit alpha [Glycine soja]
Length=535

 Score =   254 bits (649),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 119/127 (94%), Positives = 123/127 (97%), Gaps = 0/127 (0%)
 Frame = -2

Query  918  RNEMQFFYEEQLHRMECMAQEPVLFEDILCQIVDMISPEEESYVTLRDLKGSKLSGSVFN  739
            RNE+QFFYEEQLHRMECMAQEPVLFEDILCQI+DMI PEEESY+TLRDLKG KLSGSVFN
Sbjct  409  RNELQFFYEEQLHRMECMAQEPVLFEDILCQIIDMIGPEEESYITLRDLKGGKLSGSVFN  468

Query  738  ILFNLNKFMAFETRDPFLIRQERENPNLTEWDRFAHREYIRLSMEEDAEDASNGSADVWD  559
            ILFNLNKFMAFETRDPFLIRQERENP LTEWDRFAHREYIRLSMEED EDASNGSA+VWD
Sbjct  469  ILFNLNKFMAFETRDPFLIRQERENPTLTEWDRFAHREYIRLSMEEDVEDASNGSAEVWD  528

Query  558  ESLEAPF  538
            ESLEAPF
Sbjct  529  ESLEAPF  535



>ref|XP_003521774.1| PREDICTED: probable serine/threonine protein phosphatase 2A regulatory 
subunit B''delta-like [Glycine max]
Length=537

 Score =   254 bits (649),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 119/127 (94%), Positives = 123/127 (97%), Gaps = 0/127 (0%)
 Frame = -2

Query  918  RNEMQFFYEEQLHRMECMAQEPVLFEDILCQIVDMISPEEESYVTLRDLKGSKLSGSVFN  739
            RNE+QFFYEEQLHRMECMAQEPVLFEDILCQI+DMI PEEESY+TLRDLKG KLSGSVFN
Sbjct  411  RNELQFFYEEQLHRMECMAQEPVLFEDILCQIIDMIGPEEESYITLRDLKGGKLSGSVFN  470

Query  738  ILFNLNKFMAFETRDPFLIRQERENPNLTEWDRFAHREYIRLSMEEDAEDASNGSADVWD  559
            ILFNLNKFMAFETRDPFLIRQERENP LTEWDRFAHREYIRLSMEED EDASNGSA+VWD
Sbjct  471  ILFNLNKFMAFETRDPFLIRQERENPTLTEWDRFAHREYIRLSMEEDVEDASNGSAEVWD  530

Query  558  ESLEAPF  538
            ESLEAPF
Sbjct  531  ESLEAPF  537



>ref|XP_007147220.1| hypothetical protein PHAVU_006G105800g [Phaseolus vulgaris]
 gb|ESW19214.1| hypothetical protein PHAVU_006G105800g [Phaseolus vulgaris]
Length=537

 Score =   253 bits (647),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 118/127 (93%), Positives = 123/127 (97%), Gaps = 0/127 (0%)
 Frame = -2

Query  918  RNEMQFFYEEQLHRMECMAQEPVLFEDILCQIVDMISPEEESYVTLRDLKGSKLSGSVFN  739
            RNE+QFFYEEQLHRMECMAQEPVLFEDILCQI+DM+ PEEESY+TLRDLKG KLSGSVFN
Sbjct  411  RNELQFFYEEQLHRMECMAQEPVLFEDILCQIIDMVGPEEESYITLRDLKGGKLSGSVFN  470

Query  738  ILFNLNKFMAFETRDPFLIRQERENPNLTEWDRFAHREYIRLSMEEDAEDASNGSADVWD  559
            ILFNLNKFMAFETRDPFLIRQERENP LTEWDRFAHREYIRLSMEED EDASNGSA+VWD
Sbjct  471  ILFNLNKFMAFETRDPFLIRQERENPTLTEWDRFAHREYIRLSMEEDVEDASNGSAEVWD  530

Query  558  ESLEAPF  538
            ESLEAPF
Sbjct  531  ESLEAPF  537



>emb|CDO99998.1| unnamed protein product [Coffea canephora]
Length=538

 Score =   253 bits (647),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 121/127 (95%), Positives = 124/127 (98%), Gaps = 0/127 (0%)
 Frame = -2

Query  918  RNEMQFFYEEQLHRMECMAQEPVLFEDILCQIVDMISPEEESYVTLRDLKGSKLSGSVFN  739
            RNE+QFFYEEQLHRMECMAQEPVLFEDILCQ+VDMISPE ESY TLRDLKGS+LSGSVFN
Sbjct  412  RNELQFFYEEQLHRMECMAQEPVLFEDILCQMVDMISPENESYFTLRDLKGSRLSGSVFN  471

Query  738  ILFNLNKFMAFETRDPFLIRQERENPNLTEWDRFAHREYIRLSMEEDAEDASNGSADVWD  559
            ILFNLNKFMAFETRDPFLIRQERENP LTEWDRFAHREYIRLSMEEDAEDASNGSADVWD
Sbjct  472  ILFNLNKFMAFETRDPFLIRQERENPTLTEWDRFAHREYIRLSMEEDAEDASNGSADVWD  531

Query  558  ESLEAPF  538
            ESLEAPF
Sbjct  532  ESLEAPF  538



>gb|KHG15281.1| Serine/threonine-protein phosphatase 2A regulatory subunit B'' 
subunit alpha [Gossypium arboreum]
Length=539

 Score =   253 bits (646),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 119/127 (94%), Positives = 123/127 (97%), Gaps = 0/127 (0%)
 Frame = -2

Query  918  RNEMQFFYEEQLHRMECMAQEPVLFEDILCQIVDMISPEEESYVTLRDLKGSKLSGSVFN  739
            RNEMQFFYEEQLHRMECMAQEPVLFEDILCQI+DMI PE ESY+TLRDLKGSKLSGSVFN
Sbjct  413  RNEMQFFYEEQLHRMECMAQEPVLFEDILCQIIDMIKPEAESYITLRDLKGSKLSGSVFN  472

Query  738  ILFNLNKFMAFETRDPFLIRQERENPNLTEWDRFAHREYIRLSMEEDAEDASNGSADVWD  559
            ILFNLNKFMAFETRDPFLIRQERENP LTEWDRFAHREYIRLSME+D EDASNGSA+VWD
Sbjct  473  ILFNLNKFMAFETRDPFLIRQERENPTLTEWDRFAHREYIRLSMEDDVEDASNGSAEVWD  532

Query  558  ESLEAPF  538
            ESLEAPF
Sbjct  533  ESLEAPF  539



>ref|XP_011091457.1| PREDICTED: serine/threonine protein phosphatase 2A regulatory 
subunit B''beta-like [Sesamum indicum]
Length=539

 Score =   253 bits (646),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 121/127 (95%), Positives = 123/127 (97%), Gaps = 0/127 (0%)
 Frame = -2

Query  918  RNEMQFFYEEQLHRMECMAQEPVLFEDILCQIVDMISPEEESYVTLRDLKGSKLSGSVFN  739
            RNEMQFFYEEQLHRMECMAQEPVLFEDILCQIVDMI PE+ESY TL DLKGSKLSGSVFN
Sbjct  413  RNEMQFFYEEQLHRMECMAQEPVLFEDILCQIVDMIHPEDESYFTLHDLKGSKLSGSVFN  472

Query  738  ILFNLNKFMAFETRDPFLIRQERENPNLTEWDRFAHREYIRLSMEEDAEDASNGSADVWD  559
            ILFNLNKFMAFETRDPFLIRQERENP+LTEWDRFAHREYIRLSMEED EDASNGSADVWD
Sbjct  473  ILFNLNKFMAFETRDPFLIRQERENPHLTEWDRFAHREYIRLSMEEDTEDASNGSADVWD  532

Query  558  ESLEAPF  538
            ESLEAPF
Sbjct  533  ESLEAPF  539



>gb|KJB44838.1| hypothetical protein B456_007G275600 [Gossypium raimondii]
 gb|KJB44840.1| hypothetical protein B456_007G275600 [Gossypium raimondii]
 gb|KJB44841.1| hypothetical protein B456_007G275600 [Gossypium raimondii]
 gb|KJB44842.1| hypothetical protein B456_007G275600 [Gossypium raimondii]
 gb|KJB44843.1| hypothetical protein B456_007G275600 [Gossypium raimondii]
Length=539

 Score =   253 bits (646),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 119/127 (94%), Positives = 123/127 (97%), Gaps = 0/127 (0%)
 Frame = -2

Query  918  RNEMQFFYEEQLHRMECMAQEPVLFEDILCQIVDMISPEEESYVTLRDLKGSKLSGSVFN  739
            RNEMQFFYEEQLHRMECMAQEPVLFEDILCQI+DMI PE ESY+TLRDLKGSKLSGSVFN
Sbjct  413  RNEMQFFYEEQLHRMECMAQEPVLFEDILCQIIDMIKPEAESYITLRDLKGSKLSGSVFN  472

Query  738  ILFNLNKFMAFETRDPFLIRQERENPNLTEWDRFAHREYIRLSMEEDAEDASNGSADVWD  559
            ILFNLNKFMAFETRDPFLIRQERENP LTEWDRFAHREYIRLSME+D EDASNGSA+VWD
Sbjct  473  ILFNLNKFMAFETRDPFLIRQERENPTLTEWDRFAHREYIRLSMEDDVEDASNGSAEVWD  532

Query  558  ESLEAPF  538
            ESLEAPF
Sbjct  533  ESLEAPF  539



>ref|XP_003554724.1| PREDICTED: probable serine/threonine protein phosphatase 2A regulatory 
subunit B''delta-like [Glycine max]
Length=537

 Score =   253 bits (645),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 118/127 (93%), Positives = 123/127 (97%), Gaps = 0/127 (0%)
 Frame = -2

Query  918  RNEMQFFYEEQLHRMECMAQEPVLFEDILCQIVDMISPEEESYVTLRDLKGSKLSGSVFN  739
            RNE+QFFYEEQLHRMECMAQEPVLFEDILCQI+DMI PE+ESY+TLRDLKG KLSGSVFN
Sbjct  411  RNELQFFYEEQLHRMECMAQEPVLFEDILCQIIDMIGPEDESYITLRDLKGGKLSGSVFN  470

Query  738  ILFNLNKFMAFETRDPFLIRQERENPNLTEWDRFAHREYIRLSMEEDAEDASNGSADVWD  559
            ILFNLNKFMAFETRDPFLIRQERENP LTEWDRFAHREYIRLSMEED EDASNGSA+VWD
Sbjct  471  ILFNLNKFMAFETRDPFLIRQERENPTLTEWDRFAHREYIRLSMEEDVEDASNGSAEVWD  530

Query  558  ESLEAPF  538
            ESLEAPF
Sbjct  531  ESLEAPF  537



>ref|XP_010694949.1| PREDICTED: serine/threonine protein phosphatase 2A regulatory 
subunit B''beta-like isoform X1 [Beta vulgaris subsp. vulgaris]
Length=540

 Score =   253 bits (645),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 119/127 (94%), Positives = 122/127 (96%), Gaps = 0/127 (0%)
 Frame = -2

Query  918  RNEMQFFYEEQLHRMECMAQEPVLFEDILCQIVDMISPEEESYVTLRDLKGSKLSGSVFN  739
            RNEMQFFYEEQLHRMECMAQEPVLFEDILCQI+DMI PE ESY T+RDLKGSKLSGSVFN
Sbjct  414  RNEMQFFYEEQLHRMECMAQEPVLFEDILCQIIDMIGPENESYFTIRDLKGSKLSGSVFN  473

Query  738  ILFNLNKFMAFETRDPFLIRQERENPNLTEWDRFAHREYIRLSMEEDAEDASNGSADVWD  559
            ILFNLNKFMAFETRDPFLIRQERENP LTEWDRFAHREYIRLSMEED EDASNGSA+VWD
Sbjct  474  ILFNLNKFMAFETRDPFLIRQERENPTLTEWDRFAHREYIRLSMEEDVEDASNGSAEVWD  533

Query  558  ESLEAPF  538
            ESLEAPF
Sbjct  534  ESLEAPF  540



>ref|XP_002521983.1| calcium ion binding protein, putative [Ricinus communis]
 gb|EEF40387.1| calcium ion binding protein, putative [Ricinus communis]
Length=542

 Score =   253 bits (645),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 120/127 (94%), Positives = 122/127 (96%), Gaps = 0/127 (0%)
 Frame = -2

Query  918  RNEMQFFYEEQLHRMECMAQEPVLFEDILCQIVDMISPEEESYVTLRDLKGSKLSGSVFN  739
            RNEMQFFYEEQLHRMECMAQEPVLFEDILCQI+DMI PE ESYVTLRDLKG KLSGSVFN
Sbjct  416  RNEMQFFYEEQLHRMECMAQEPVLFEDILCQIIDMIGPENESYVTLRDLKGCKLSGSVFN  475

Query  738  ILFNLNKFMAFETRDPFLIRQERENPNLTEWDRFAHREYIRLSMEEDAEDASNGSADVWD  559
            ILFNLNKFMAFETRDPFLIRQERENP LTEWDRFAHREYIRLSMEED EDASNGSA+VWD
Sbjct  476  ILFNLNKFMAFETRDPFLIRQERENPTLTEWDRFAHREYIRLSMEEDVEDASNGSAEVWD  535

Query  558  ESLEAPF  538
            ESLEAPF
Sbjct  536  ESLEAPF  542



>ref|XP_009801029.1| PREDICTED: serine/threonine protein phosphatase 2A regulatory 
subunit B''beta-like isoform X1 [Nicotiana sylvestris]
Length=539

 Score =   253 bits (645),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 120/127 (94%), Positives = 123/127 (97%), Gaps = 0/127 (0%)
 Frame = -2

Query  918  RNEMQFFYEEQLHRMECMAQEPVLFEDILCQIVDMISPEEESYVTLRDLKGSKLSGSVFN  739
            RNEMQFFYEEQLHRMECM QEPVLFEDILCQ+VDMISPE+ESY  L DLKG+KLSGSVFN
Sbjct  413  RNEMQFFYEEQLHRMECMGQEPVLFEDILCQMVDMISPEDESYFMLHDLKGNKLSGSVFN  472

Query  738  ILFNLNKFMAFETRDPFLIRQERENPNLTEWDRFAHREYIRLSMEEDAEDASNGSADVWD  559
            ILFNLNKFMAFETRDPFLIRQERENPNLTEWDRFAHREYIRLSMEEDAEDASNGSADVWD
Sbjct  473  ILFNLNKFMAFETRDPFLIRQERENPNLTEWDRFAHREYIRLSMEEDAEDASNGSADVWD  532

Query  558  ESLEAPF  538
            ESLEAPF
Sbjct  533  ESLEAPF  539



>ref|XP_008218333.1| PREDICTED: serine/threonine protein phosphatase 2A regulatory 
subunit B''beta-like [Prunus mume]
Length=539

 Score =   252 bits (644),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 119/127 (94%), Positives = 122/127 (96%), Gaps = 0/127 (0%)
 Frame = -2

Query  918  RNEMQFFYEEQLHRMECMAQEPVLFEDILCQIVDMISPEEESYVTLRDLKGSKLSGSVFN  739
            RNE+QFFYEEQLHRMECMAQEPVLFEDILCQI+DMI PE ESYVTLRDLKG KLSGSVFN
Sbjct  413  RNELQFFYEEQLHRMECMAQEPVLFEDILCQIIDMIGPENESYVTLRDLKGCKLSGSVFN  472

Query  738  ILFNLNKFMAFETRDPFLIRQERENPNLTEWDRFAHREYIRLSMEEDAEDASNGSADVWD  559
            ILFNLNKFMAFETRDPFLIRQERENP LTEWDRFAHREYIRLSMEED EDASNGSA+VWD
Sbjct  473  ILFNLNKFMAFETRDPFLIRQERENPTLTEWDRFAHREYIRLSMEEDVEDASNGSAEVWD  532

Query  558  ESLEAPF  538
            ESLEAPF
Sbjct  533  ESLEAPF  539



>ref|XP_011036315.1| PREDICTED: serine/threonine protein phosphatase 2A regulatory 
subunit B''beta-like isoform X1 [Populus euphratica]
Length=538

 Score =   252 bits (644),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 118/127 (93%), Positives = 123/127 (97%), Gaps = 0/127 (0%)
 Frame = -2

Query  918  RNEMQFFYEEQLHRMECMAQEPVLFEDILCQIVDMISPEEESYVTLRDLKGSKLSGSVFN  739
            RNEMQFFYEEQLHRMECMAQEPVLFEDILCQI+DMI PE+ESY+TLRDLKG KLSGSVFN
Sbjct  412  RNEMQFFYEEQLHRMECMAQEPVLFEDILCQIIDMIGPEDESYITLRDLKGCKLSGSVFN  471

Query  738  ILFNLNKFMAFETRDPFLIRQERENPNLTEWDRFAHREYIRLSMEEDAEDASNGSADVWD  559
            ILFNLNKFMAFETRDPFLIRQERENP LT+WDRFAHREYIRLSMEED EDASNGSA+VWD
Sbjct  472  ILFNLNKFMAFETRDPFLIRQERENPTLTDWDRFAHREYIRLSMEEDVEDASNGSAEVWD  531

Query  558  ESLEAPF  538
            ESLEAPF
Sbjct  532  ESLEAPF  538



>ref|XP_009801030.1| PREDICTED: serine/threonine protein phosphatase 2A regulatory 
subunit B''beta-like isoform X2 [Nicotiana sylvestris]
Length=538

 Score =   252 bits (644),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 120/127 (94%), Positives = 123/127 (97%), Gaps = 0/127 (0%)
 Frame = -2

Query  918  RNEMQFFYEEQLHRMECMAQEPVLFEDILCQIVDMISPEEESYVTLRDLKGSKLSGSVFN  739
            RNEMQFFYEEQLHRMECM QEPVLFEDILCQ+VDMISPE+ESY  L DLKG+KLSGSVFN
Sbjct  412  RNEMQFFYEEQLHRMECMGQEPVLFEDILCQMVDMISPEDESYFMLHDLKGNKLSGSVFN  471

Query  738  ILFNLNKFMAFETRDPFLIRQERENPNLTEWDRFAHREYIRLSMEEDAEDASNGSADVWD  559
            ILFNLNKFMAFETRDPFLIRQERENPNLTEWDRFAHREYIRLSMEEDAEDASNGSADVWD
Sbjct  472  ILFNLNKFMAFETRDPFLIRQERENPNLTEWDRFAHREYIRLSMEEDAEDASNGSADVWD  531

Query  558  ESLEAPF  538
            ESLEAPF
Sbjct  532  ESLEAPF  538



>ref|XP_002325339.1| calcium-binding EF hand family protein [Populus trichocarpa]
 gb|EEE99720.1| calcium-binding EF hand family protein [Populus trichocarpa]
Length=538

 Score =   252 bits (644),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 118/127 (93%), Positives = 123/127 (97%), Gaps = 0/127 (0%)
 Frame = -2

Query  918  RNEMQFFYEEQLHRMECMAQEPVLFEDILCQIVDMISPEEESYVTLRDLKGSKLSGSVFN  739
            RNEMQFFYEEQLHRMECMAQEPVLFEDILCQI+DMI PE+ESY+TLRDLKG KLSGSVFN
Sbjct  412  RNEMQFFYEEQLHRMECMAQEPVLFEDILCQIIDMIGPEDESYITLRDLKGCKLSGSVFN  471

Query  738  ILFNLNKFMAFETRDPFLIRQERENPNLTEWDRFAHREYIRLSMEEDAEDASNGSADVWD  559
            ILFNLNKFMAFETRDPFLIRQERENP LT+WDRFAHREYIRLSMEED EDASNGSA+VWD
Sbjct  472  ILFNLNKFMAFETRDPFLIRQERENPTLTDWDRFAHREYIRLSMEEDVEDASNGSAEVWD  531

Query  558  ESLEAPF  538
            ESLEAPF
Sbjct  532  ESLEAPF  538



>ref|XP_007208462.1| hypothetical protein PRUPE_ppa003942mg [Prunus persica]
 gb|EMJ09661.1| hypothetical protein PRUPE_ppa003942mg [Prunus persica]
Length=539

 Score =   252 bits (644),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 118/127 (93%), Positives = 122/127 (96%), Gaps = 0/127 (0%)
 Frame = -2

Query  918  RNEMQFFYEEQLHRMECMAQEPVLFEDILCQIVDMISPEEESYVTLRDLKGSKLSGSVFN  739
            RNE+QFFYEEQLHRMECMAQEPVLFEDILCQI+DMI PE ESY+TLRDLKG KLSGSVFN
Sbjct  413  RNELQFFYEEQLHRMECMAQEPVLFEDILCQIIDMIGPENESYITLRDLKGCKLSGSVFN  472

Query  738  ILFNLNKFMAFETRDPFLIRQERENPNLTEWDRFAHREYIRLSMEEDAEDASNGSADVWD  559
            ILFNLNKFMAFETRDPFLIRQERENP LTEWDRFAHREYIRLSMEED EDASNGSA+VWD
Sbjct  473  ILFNLNKFMAFETRDPFLIRQERENPTLTEWDRFAHREYIRLSMEEDVEDASNGSAEVWD  532

Query  558  ESLEAPF  538
            ESLEAPF
Sbjct  533  ESLEAPF  539



>ref|XP_010694950.1| PREDICTED: serine/threonine protein phosphatase 2A regulatory 
subunit B''beta-like isoform X2 [Beta vulgaris subsp. vulgaris]
Length=539

 Score =   252 bits (644),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 119/127 (94%), Positives = 122/127 (96%), Gaps = 0/127 (0%)
 Frame = -2

Query  918  RNEMQFFYEEQLHRMECMAQEPVLFEDILCQIVDMISPEEESYVTLRDLKGSKLSGSVFN  739
            RNEMQFFYEEQLHRMECMAQEPVLFEDILCQI+DMI PE ESY T+RDLKGSKLSGSVFN
Sbjct  413  RNEMQFFYEEQLHRMECMAQEPVLFEDILCQIIDMIGPENESYFTIRDLKGSKLSGSVFN  472

Query  738  ILFNLNKFMAFETRDPFLIRQERENPNLTEWDRFAHREYIRLSMEEDAEDASNGSADVWD  559
            ILFNLNKFMAFETRDPFLIRQERENP LTEWDRFAHREYIRLSMEED EDASNGSA+VWD
Sbjct  473  ILFNLNKFMAFETRDPFLIRQERENPTLTEWDRFAHREYIRLSMEEDVEDASNGSAEVWD  532

Query  558  ESLEAPF  538
            ESLEAPF
Sbjct  533  ESLEAPF  539



>ref|XP_006606447.1| PREDICTED: probable serine/threonine protein phosphatase 2A regulatory 
subunit B''delta-like isoform X4 [Glycine max]
Length=328

 Score =   246 bits (627),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 116/127 (91%), Positives = 121/127 (95%), Gaps = 0/127 (0%)
 Frame = -2

Query  918  RNEMQFFYEEQLHRMECMAQEPVLFEDILCQIVDMISPEEESYVTLRDLKGSKLSGSVFN  739
            RNE+QFFYEEQLHRMECMAQEPVLFEDILCQI+DMI PE+ES +TL DLKG KLSGSVFN
Sbjct  202  RNELQFFYEEQLHRMECMAQEPVLFEDILCQIIDMIKPEDESVITLHDLKGGKLSGSVFN  261

Query  738  ILFNLNKFMAFETRDPFLIRQERENPNLTEWDRFAHREYIRLSMEEDAEDASNGSADVWD  559
            ILFNLNKFMAFETRDPFLIRQERENP LTEWDRFAHREYIRLSMEED EDASNGSA+VWD
Sbjct  262  ILFNLNKFMAFETRDPFLIRQERENPTLTEWDRFAHREYIRLSMEEDIEDASNGSAEVWD  321

Query  558  ESLEAPF  538
            ESLEAPF
Sbjct  322  ESLEAPF  328



>gb|AEQ28761.1| calcium ion binding protein [Prunus salicina]
Length=539

 Score =   252 bits (643),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 118/127 (93%), Positives = 122/127 (96%), Gaps = 0/127 (0%)
 Frame = -2

Query  918  RNEMQFFYEEQLHRMECMAQEPVLFEDILCQIVDMISPEEESYVTLRDLKGSKLSGSVFN  739
            RNE+QFFYEEQLHRMECMAQEPVLFEDILCQI+DMI PE ESY+TLRDLKG KLSGSVFN
Sbjct  413  RNELQFFYEEQLHRMECMAQEPVLFEDILCQIIDMIGPENESYITLRDLKGCKLSGSVFN  472

Query  738  ILFNLNKFMAFETRDPFLIRQERENPNLTEWDRFAHREYIRLSMEEDAEDASNGSADVWD  559
            ILFNLNKFMAFETRDPFLIRQERENP LTEWDRFAHREYIRLSMEED EDASNGSA+VWD
Sbjct  473  ILFNLNKFMAFETRDPFLIRQERENPTLTEWDRFAHREYIRLSMEEDVEDASNGSAEVWD  532

Query  558  ESLEAPF  538
            ESLEAPF
Sbjct  533  ESLEAPF  539



>ref|XP_003590953.1| Protein phosphatase 2A regulatory subunit B'-like protein [Medicago 
truncatula]
 gb|AES61204.1| calcium-binding EF-hand protein [Medicago truncatula]
Length=537

 Score =   252 bits (643),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 118/127 (93%), Positives = 123/127 (97%), Gaps = 0/127 (0%)
 Frame = -2

Query  918  RNEMQFFYEEQLHRMECMAQEPVLFEDILCQIVDMISPEEESYVTLRDLKGSKLSGSVFN  739
            RNE+QFFYEEQLHRMECMAQEPVLFEDILCQI+DMI PE++SYVTLRDLKGSKLSGSVFN
Sbjct  411  RNELQFFYEEQLHRMECMAQEPVLFEDILCQIIDMIGPEDDSYVTLRDLKGSKLSGSVFN  470

Query  738  ILFNLNKFMAFETRDPFLIRQERENPNLTEWDRFAHREYIRLSMEEDAEDASNGSADVWD  559
            ILFNLNKFMAFETRDPFLIRQERENP LTEWDRFAHREYIRLSMEED ED SNGSA+VWD
Sbjct  471  ILFNLNKFMAFETRDPFLIRQERENPTLTEWDRFAHREYIRLSMEEDVEDVSNGSAEVWD  530

Query  558  ESLEAPF  538
            ESLEAPF
Sbjct  531  ESLEAPF  537



>ref|XP_009598612.1| PREDICTED: serine/threonine protein phosphatase 2A regulatory 
subunit B''beta-like isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009598613.1| PREDICTED: serine/threonine protein phosphatase 2A regulatory 
subunit B''beta-like isoform X1 [Nicotiana tomentosiformis]
Length=539

 Score =   252 bits (643),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 120/127 (94%), Positives = 123/127 (97%), Gaps = 0/127 (0%)
 Frame = -2

Query  918  RNEMQFFYEEQLHRMECMAQEPVLFEDILCQIVDMISPEEESYVTLRDLKGSKLSGSVFN  739
            RNEMQFFYEEQLHRMECM QEPVLFEDILCQ+VDMISPE+ESY  L DLKG+KLSGSVFN
Sbjct  413  RNEMQFFYEEQLHRMECMGQEPVLFEDILCQMVDMISPEDESYFMLHDLKGNKLSGSVFN  472

Query  738  ILFNLNKFMAFETRDPFLIRQERENPNLTEWDRFAHREYIRLSMEEDAEDASNGSADVWD  559
            ILFNLNKFMAFETRDPFLIRQERENPNLTEWDRFAHREYIRLSMEEDAEDASNGSADVWD
Sbjct  473  ILFNLNKFMAFETRDPFLIRQERENPNLTEWDRFAHREYIRLSMEEDAEDASNGSADVWD  532

Query  558  ESLEAPF  538
            ESLEAPF
Sbjct  533  ESLEAPF  539



>ref|XP_009598614.1| PREDICTED: serine/threonine protein phosphatase 2A regulatory 
subunit B''beta-like isoform X2 [Nicotiana tomentosiformis]
Length=538

 Score =   251 bits (642),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 120/127 (94%), Positives = 123/127 (97%), Gaps = 0/127 (0%)
 Frame = -2

Query  918  RNEMQFFYEEQLHRMECMAQEPVLFEDILCQIVDMISPEEESYVTLRDLKGSKLSGSVFN  739
            RNEMQFFYEEQLHRMECM QEPVLFEDILCQ+VDMISPE+ESY  L DLKG+KLSGSVFN
Sbjct  412  RNEMQFFYEEQLHRMECMGQEPVLFEDILCQMVDMISPEDESYFMLHDLKGNKLSGSVFN  471

Query  738  ILFNLNKFMAFETRDPFLIRQERENPNLTEWDRFAHREYIRLSMEEDAEDASNGSADVWD  559
            ILFNLNKFMAFETRDPFLIRQERENPNLTEWDRFAHREYIRLSMEEDAEDASNGSADVWD
Sbjct  472  ILFNLNKFMAFETRDPFLIRQERENPNLTEWDRFAHREYIRLSMEEDAEDASNGSADVWD  531

Query  558  ESLEAPF  538
            ESLEAPF
Sbjct  532  ESLEAPF  538



>ref|XP_007030396.1| Calcium-binding EF-hand family protein isoform 1 [Theobroma cacao]
 gb|EOY10898.1| Calcium-binding EF-hand family protein isoform 1 [Theobroma cacao]
Length=539

 Score =   251 bits (642),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 119/127 (94%), Positives = 123/127 (97%), Gaps = 0/127 (0%)
 Frame = -2

Query  918  RNEMQFFYEEQLHRMECMAQEPVLFEDILCQIVDMISPEEESYVTLRDLKGSKLSGSVFN  739
            RNEMQFFYEEQLHRMECMAQEPVLFEDILCQI+DMI PE+ESY+TL DLKGSKLSGSVFN
Sbjct  413  RNEMQFFYEEQLHRMECMAQEPVLFEDILCQIIDMIKPEDESYITLCDLKGSKLSGSVFN  472

Query  738  ILFNLNKFMAFETRDPFLIRQERENPNLTEWDRFAHREYIRLSMEEDAEDASNGSADVWD  559
            ILFNLNKFMAFETRDPFLIRQERENP LTEWDRFAHREYIRLSMEED EDASNGSA+VWD
Sbjct  473  ILFNLNKFMAFETRDPFLIRQERENPTLTEWDRFAHREYIRLSMEEDVEDASNGSAEVWD  532

Query  558  ESLEAPF  538
            ESLEAPF
Sbjct  533  ESLEAPF  539



>ref|XP_006470928.1| PREDICTED: probable serine/threonine protein phosphatase 2A regulatory 
subunit B''gamma-like [Citrus sinensis]
Length=539

 Score =   251 bits (642),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 118/127 (93%), Positives = 122/127 (96%), Gaps = 0/127 (0%)
 Frame = -2

Query  918  RNEMQFFYEEQLHRMECMAQEPVLFEDILCQIVDMISPEEESYVTLRDLKGSKLSGSVFN  739
            RNEMQFFYEEQLHRMECMAQEPVLFEDILCQI+DMI PE +SY+TLRDLKG KLSGSVFN
Sbjct  413  RNEMQFFYEEQLHRMECMAQEPVLFEDILCQIIDMIGPENQSYITLRDLKGCKLSGSVFN  472

Query  738  ILFNLNKFMAFETRDPFLIRQERENPNLTEWDRFAHREYIRLSMEEDAEDASNGSADVWD  559
            ILFNLNKFMAFETRDPFLIRQERENP LTEWDRFAHREYIRLSMEED EDASNGSA+VWD
Sbjct  473  ILFNLNKFMAFETRDPFLIRQERENPTLTEWDRFAHREYIRLSMEEDVEDASNGSAEVWD  532

Query  558  ESLEAPF  538
            ESLEAPF
Sbjct  533  ESLEAPF  539



>ref|XP_006442649.1| hypothetical protein CICLE_v10019630mg [Citrus clementina]
 gb|ESR55889.1| hypothetical protein CICLE_v10019630mg [Citrus clementina]
 gb|KDO45411.1| hypothetical protein CISIN_1g009229mg [Citrus sinensis]
Length=539

 Score =   251 bits (642),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 118/127 (93%), Positives = 122/127 (96%), Gaps = 0/127 (0%)
 Frame = -2

Query  918  RNEMQFFYEEQLHRMECMAQEPVLFEDILCQIVDMISPEEESYVTLRDLKGSKLSGSVFN  739
            RNEMQFFYEEQLHRMECMAQEPVLFEDILCQI+DMI PE +SY+TLRDLKG KLSGSVFN
Sbjct  413  RNEMQFFYEEQLHRMECMAQEPVLFEDILCQIIDMIGPENQSYITLRDLKGCKLSGSVFN  472

Query  738  ILFNLNKFMAFETRDPFLIRQERENPNLTEWDRFAHREYIRLSMEEDAEDASNGSADVWD  559
            ILFNLNKFMAFETRDPFLIRQERENP LTEWDRFAHREYIRLSMEED EDASNGSA+VWD
Sbjct  473  ILFNLNKFMAFETRDPFLIRQERENPTLTEWDRFAHREYIRLSMEEDVEDASNGSAEVWD  532

Query  558  ESLEAPF  538
            ESLEAPF
Sbjct  533  ESLEAPF  539



>ref|XP_011038501.1| PREDICTED: serine/threonine protein phosphatase 2A regulatory 
subunit B''beta-like [Populus euphratica]
 ref|XP_011038502.1| PREDICTED: serine/threonine protein phosphatase 2A regulatory 
subunit B''beta-like [Populus euphratica]
Length=538

 Score =   251 bits (641),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 117/127 (92%), Positives = 122/127 (96%), Gaps = 0/127 (0%)
 Frame = -2

Query  918  RNEMQFFYEEQLHRMECMAQEPVLFEDILCQIVDMISPEEESYVTLRDLKGSKLSGSVFN  739
            RNEMQFFYEEQLHRMECMAQEPVLFEDILCQI+DMI PE++ Y+TLRDLKG KLSGSVFN
Sbjct  412  RNEMQFFYEEQLHRMECMAQEPVLFEDILCQIIDMIGPEDDGYITLRDLKGCKLSGSVFN  471

Query  738  ILFNLNKFMAFETRDPFLIRQERENPNLTEWDRFAHREYIRLSMEEDAEDASNGSADVWD  559
            ILFNLNKFMAFETRDPFLIRQERENP LTEWDRFAHREYIRLSMEED EDASNGSA+VWD
Sbjct  472  ILFNLNKFMAFETRDPFLIRQERENPTLTEWDRFAHREYIRLSMEEDVEDASNGSAEVWD  531

Query  558  ESLEAPF  538
            ESLEAPF
Sbjct  532  ESLEAPF  538



>ref|XP_002269177.1| PREDICTED: serine/threonine protein phosphatase 2A regulatory 
subunit B''beta [Vitis vinifera]
 ref|XP_010660207.1| PREDICTED: serine/threonine protein phosphatase 2A regulatory 
subunit B''beta [Vitis vinifera]
 ref|XP_010660208.1| PREDICTED: serine/threonine protein phosphatase 2A regulatory 
subunit B''beta [Vitis vinifera]
Length=539

 Score =   251 bits (641),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 119/127 (94%), Positives = 122/127 (96%), Gaps = 0/127 (0%)
 Frame = -2

Query  918  RNEMQFFYEEQLHRMECMAQEPVLFEDILCQIVDMISPEEESYVTLRDLKGSKLSGSVFN  739
            RNEMQFFYEEQLHRMECMAQEPVLFEDILCQIVDMI PE ESY+TLRDLKG KLSGSVFN
Sbjct  413  RNEMQFFYEEQLHRMECMAQEPVLFEDILCQIVDMIGPENESYITLRDLKGCKLSGSVFN  472

Query  738  ILFNLNKFMAFETRDPFLIRQERENPNLTEWDRFAHREYIRLSMEEDAEDASNGSADVWD  559
            ILFNLNKFMAFETRDPFLIRQERENP LTEWDRFAHREYIRLSMEED E+ASNGSA+VWD
Sbjct  473  ILFNLNKFMAFETRDPFLIRQERENPTLTEWDRFAHREYIRLSMEEDVEEASNGSAEVWD  532

Query  558  ESLEAPF  538
            ESLEAPF
Sbjct  533  ESLEAPF  539



>ref|XP_006345897.1| PREDICTED: probable serine/threonine protein phosphatase 2A regulatory 
subunit B''gamma-like isoform X1 [Solanum tuberosum]
Length=540

 Score =   251 bits (641),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 118/127 (93%), Positives = 124/127 (98%), Gaps = 0/127 (0%)
 Frame = -2

Query  918  RNEMQFFYEEQLHRMECMAQEPVLFEDILCQIVDMISPEEESYVTLRDLKGSKLSGSVFN  739
            RNEMQFFYEEQLHRMECM QEPVLFEDILCQ+VDMI+PE++SY TLRDLKG+KLS SVFN
Sbjct  414  RNEMQFFYEEQLHRMECMGQEPVLFEDILCQMVDMINPEDQSYFTLRDLKGNKLSSSVFN  473

Query  738  ILFNLNKFMAFETRDPFLIRQERENPNLTEWDRFAHREYIRLSMEEDAEDASNGSADVWD  559
            +LFNLNKFMAFETRDPFLIRQERENPNLTEWDRFAHREYIRLSMEEDAEDASNGSADVWD
Sbjct  474  VLFNLNKFMAFETRDPFLIRQERENPNLTEWDRFAHREYIRLSMEEDAEDASNGSADVWD  533

Query  558  ESLEAPF  538
            ESLEAPF
Sbjct  534  ESLEAPF  540



>ref|XP_006345898.1| PREDICTED: probable serine/threonine protein phosphatase 2A regulatory 
subunit B''gamma-like isoform X2 [Solanum tuberosum]
Length=539

 Score =   251 bits (641),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 118/127 (93%), Positives = 124/127 (98%), Gaps = 0/127 (0%)
 Frame = -2

Query  918  RNEMQFFYEEQLHRMECMAQEPVLFEDILCQIVDMISPEEESYVTLRDLKGSKLSGSVFN  739
            RNEMQFFYEEQLHRMECM QEPVLFEDILCQ+VDMI+PE++SY TLRDLKG+KLS SVFN
Sbjct  413  RNEMQFFYEEQLHRMECMGQEPVLFEDILCQMVDMINPEDQSYFTLRDLKGNKLSSSVFN  472

Query  738  ILFNLNKFMAFETRDPFLIRQERENPNLTEWDRFAHREYIRLSMEEDAEDASNGSADVWD  559
            +LFNLNKFMAFETRDPFLIRQERENPNLTEWDRFAHREYIRLSMEEDAEDASNGSADVWD
Sbjct  473  VLFNLNKFMAFETRDPFLIRQERENPNLTEWDRFAHREYIRLSMEEDAEDASNGSADVWD  532

Query  558  ESLEAPF  538
            ESLEAPF
Sbjct  533  ESLEAPF  539



>ref|XP_002319110.2| calcium-binding EF hand family protein [Populus trichocarpa]
 gb|EEE95033.2| calcium-binding EF hand family protein [Populus trichocarpa]
Length=538

 Score =   251 bits (640),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 117/127 (92%), Positives = 122/127 (96%), Gaps = 0/127 (0%)
 Frame = -2

Query  918  RNEMQFFYEEQLHRMECMAQEPVLFEDILCQIVDMISPEEESYVTLRDLKGSKLSGSVFN  739
            RNEMQFFYEEQLHRMECMAQEPVLFEDILCQI+DMI PE++ Y+TLRDLKG KLSGSVFN
Sbjct  412  RNEMQFFYEEQLHRMECMAQEPVLFEDILCQIIDMIGPEDDGYITLRDLKGCKLSGSVFN  471

Query  738  ILFNLNKFMAFETRDPFLIRQERENPNLTEWDRFAHREYIRLSMEEDAEDASNGSADVWD  559
            ILFNLNKFMAFETRDPFLIRQERENP LTEWDRFAHREYIRLSMEED EDASNGSA+VWD
Sbjct  472  ILFNLNKFMAFETRDPFLIRQERENPTLTEWDRFAHREYIRLSMEEDVEDASNGSAEVWD  531

Query  558  ESLEAPF  538
            ESLEAPF
Sbjct  532  ESLEAPF  538



>ref|XP_010523368.1| PREDICTED: serine/threonine protein phosphatase 2A regulatory 
subunit B''beta-like [Tarenaya hassleriana]
Length=537

 Score =   251 bits (640),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 118/127 (93%), Positives = 122/127 (96%), Gaps = 0/127 (0%)
 Frame = -2

Query  918  RNEMQFFYEEQLHRMECMAQEPVLFEDILCQIVDMISPEEESYVTLRDLKGSKLSGSVFN  739
            RNEMQFFYEEQLHRMECMAQEPV+FEDILCQI+DMI PE ESY+TL DLKGSKLSGSVFN
Sbjct  411  RNEMQFFYEEQLHRMECMAQEPVIFEDILCQIIDMIGPENESYITLHDLKGSKLSGSVFN  470

Query  738  ILFNLNKFMAFETRDPFLIRQERENPNLTEWDRFAHREYIRLSMEEDAEDASNGSADVWD  559
            ILFNLNKFMAFETRDPFLIRQERENP LTEWDRFAHREYIRLSMEED EDASNGSA+VWD
Sbjct  471  ILFNLNKFMAFETRDPFLIRQERENPMLTEWDRFAHREYIRLSMEEDVEDASNGSAEVWD  530

Query  558  ESLEAPF  538
            ESLEAPF
Sbjct  531  ESLEAPF  537



>ref|XP_004495571.1| PREDICTED: serine/threonine-protein phosphatase 2A regulatory 
subunit B'' subunit alpha-like [Cicer arietinum]
Length=537

 Score =   250 bits (639),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 118/127 (93%), Positives = 122/127 (96%), Gaps = 0/127 (0%)
 Frame = -2

Query  918  RNEMQFFYEEQLHRMECMAQEPVLFEDILCQIVDMISPEEESYVTLRDLKGSKLSGSVFN  739
            RNE+QFFYEEQLHRMECMAQEPVLFEDILCQI+DMI PE E+YVTLRDLKGSKLSGSVFN
Sbjct  411  RNELQFFYEEQLHRMECMAQEPVLFEDILCQIIDMIGPEVENYVTLRDLKGSKLSGSVFN  470

Query  738  ILFNLNKFMAFETRDPFLIRQERENPNLTEWDRFAHREYIRLSMEEDAEDASNGSADVWD  559
            ILFNLNKFMAFETRDPFLIRQERENP LTEWDRFAHREYIRLSMEED ED SNGSA+VWD
Sbjct  471  ILFNLNKFMAFETRDPFLIRQERENPTLTEWDRFAHREYIRLSMEEDVEDVSNGSAEVWD  530

Query  558  ESLEAPF  538
            ESLEAPF
Sbjct  531  ESLEAPF  537



>ref|XP_004302093.1| PREDICTED: serine/threonine protein phosphatase 2A regulatory 
subunit B''beta-like [Fragaria vesca subsp. vesca]
Length=540

 Score =   251 bits (640),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 118/127 (93%), Positives = 122/127 (96%), Gaps = 0/127 (0%)
 Frame = -2

Query  918  RNEMQFFYEEQLHRMECMAQEPVLFEDILCQIVDMISPEEESYVTLRDLKGSKLSGSVFN  739
            RNE+QFFYEEQLHRMECMAQEPVLFEDILCQI+DMI PE ESY+TLRDLKG KLSGSVFN
Sbjct  414  RNELQFFYEEQLHRMECMAQEPVLFEDILCQIIDMIYPENESYITLRDLKGCKLSGSVFN  473

Query  738  ILFNLNKFMAFETRDPFLIRQERENPNLTEWDRFAHREYIRLSMEEDAEDASNGSADVWD  559
            ILFNLNKFMAFETRDPFLIRQERENP LTEWDRFAHREYIRLSMEED EDASNGSA+VWD
Sbjct  474  ILFNLNKFMAFETRDPFLIRQERENPTLTEWDRFAHREYIRLSMEEDVEDASNGSAEVWD  533

Query  558  ESLEAPF  538
            ESLEAPF
Sbjct  534  ESLEAPF  540



>ref|XP_010024945.1| PREDICTED: serine/threonine protein phosphatase 2A regulatory 
subunit B''beta-like isoform X2 [Eucalyptus grandis]
Length=529

 Score =   250 bits (638),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 118/127 (93%), Positives = 121/127 (95%), Gaps = 0/127 (0%)
 Frame = -2

Query  918  RNEMQFFYEEQLHRMECMAQEPVLFEDILCQIVDMISPEEESYVTLRDLKGSKLSGSVFN  739
            RNEMQFFYEEQLHRMECMAQEPVLFEDILCQI+DMI PE ESY+TL DLKG KLSGSVFN
Sbjct  403  RNEMQFFYEEQLHRMECMAQEPVLFEDILCQIIDMIGPENESYITLHDLKGCKLSGSVFN  462

Query  738  ILFNLNKFMAFETRDPFLIRQERENPNLTEWDRFAHREYIRLSMEEDAEDASNGSADVWD  559
            ILFNLNKFMAFETRDPFLIRQERENP LTEWDRFAHREYIRLSMEED EDASNGSA+VWD
Sbjct  463  ILFNLNKFMAFETRDPFLIRQERENPTLTEWDRFAHREYIRLSMEEDVEDASNGSAEVWD  522

Query  558  ESLEAPF  538
            ESLEAPF
Sbjct  523  ESLEAPF  529



>ref|XP_010024944.1| PREDICTED: serine/threonine protein phosphatase 2A regulatory 
subunit B''beta-like isoform X1 [Eucalyptus grandis]
 gb|KCW61495.1| hypothetical protein EUGRSUZ_H04226 [Eucalyptus grandis]
 gb|KCW61496.1| hypothetical protein EUGRSUZ_H04226 [Eucalyptus grandis]
 gb|KCW61497.1| hypothetical protein EUGRSUZ_H04226 [Eucalyptus grandis]
Length=540

 Score =   250 bits (639),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 118/127 (93%), Positives = 121/127 (95%), Gaps = 0/127 (0%)
 Frame = -2

Query  918  RNEMQFFYEEQLHRMECMAQEPVLFEDILCQIVDMISPEEESYVTLRDLKGSKLSGSVFN  739
            RNEMQFFYEEQLHRMECMAQEPVLFEDILCQI+DMI PE ESY+TL DLKG KLSGSVFN
Sbjct  414  RNEMQFFYEEQLHRMECMAQEPVLFEDILCQIIDMIGPENESYITLHDLKGCKLSGSVFN  473

Query  738  ILFNLNKFMAFETRDPFLIRQERENPNLTEWDRFAHREYIRLSMEEDAEDASNGSADVWD  559
            ILFNLNKFMAFETRDPFLIRQERENP LTEWDRFAHREYIRLSMEED EDASNGSA+VWD
Sbjct  474  ILFNLNKFMAFETRDPFLIRQERENPTLTEWDRFAHREYIRLSMEEDVEDASNGSAEVWD  533

Query  558  ESLEAPF  538
            ESLEAPF
Sbjct  534  ESLEAPF  540



>ref|XP_010102216.1| hypothetical protein L484_024497 [Morus notabilis]
 gb|EXB93159.1| hypothetical protein L484_024497 [Morus notabilis]
Length=537

 Score =   250 bits (638),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 117/127 (92%), Positives = 122/127 (96%), Gaps = 0/127 (0%)
 Frame = -2

Query  918  RNEMQFFYEEQLHRMECMAQEPVLFEDILCQIVDMISPEEESYVTLRDLKGSKLSGSVFN  739
            RNE+QFFYEEQLHRMECMAQEPVLFEDILCQI+DMI PE E+Y+TLRDLKG KLSGSVFN
Sbjct  411  RNELQFFYEEQLHRMECMAQEPVLFEDILCQIIDMIGPENENYITLRDLKGCKLSGSVFN  470

Query  738  ILFNLNKFMAFETRDPFLIRQERENPNLTEWDRFAHREYIRLSMEEDAEDASNGSADVWD  559
            ILFNLNKFMAFETRDPFLIRQERENP LTEWDRFAHREYIRLSMEED EDASNGSA+VWD
Sbjct  471  ILFNLNKFMAFETRDPFLIRQERENPTLTEWDRFAHREYIRLSMEEDVEDASNGSAEVWD  530

Query  558  ESLEAPF  538
            ESLEAPF
Sbjct  531  ESLEAPF  537



>ref|XP_008804279.1| PREDICTED: probable serine/threonine protein phosphatase 2A regulatory 
subunit B''delta isoform X3 [Phoenix dactylifera]
Length=328

 Score =   244 bits (622),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 115/126 (91%), Positives = 121/126 (96%), Gaps = 0/126 (0%)
 Frame = -2

Query  915  NEMQFFYEEQLHRMECMAQEPVLFEDILCQIVDMISPEEESYVTLRDLKGSKLSGSVFNI  736
            NEMQFFYEEQLHRMECMAQEPVLFEDILCQ++DMI+PE ESY TLRDLKG+KLSG+VFNI
Sbjct  203  NEMQFFYEEQLHRMECMAQEPVLFEDILCQMIDMIAPENESYFTLRDLKGNKLSGNVFNI  262

Query  735  LFNLNKFMAFETRDPFLIRQERENPNLTEWDRFAHREYIRLSMEEDAEDASNGSADVWDE  556
            LFNLNKFMAFETRDPFLIRQERE P LTEWDRFAHREYIRLSMEE+AEDASNGS DVWDE
Sbjct  263  LFNLNKFMAFETRDPFLIRQEREEPTLTEWDRFAHREYIRLSMEEEAEDASNGSGDVWDE  322

Query  555  SLEAPF  538
            SLEAPF
Sbjct  323  SLEAPF  328



>ref|XP_007144011.1| hypothetical protein PHAVU_007G121700g [Phaseolus vulgaris]
 gb|ESW16005.1| hypothetical protein PHAVU_007G121700g [Phaseolus vulgaris]
Length=379

 Score =   245 bits (626),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 115/127 (91%), Positives = 121/127 (95%), Gaps = 0/127 (0%)
 Frame = -2

Query  918  RNEMQFFYEEQLHRMECMAQEPVLFEDILCQIVDMISPEEESYVTLRDLKGSKLSGSVFN  739
            RNE+QFFYEEQLHRMECMAQEPVLFEDILCQ++DMI PE+ES VTLRDLKG KLSGSVFN
Sbjct  253  RNELQFFYEEQLHRMECMAQEPVLFEDILCQLIDMIKPEDESLVTLRDLKGGKLSGSVFN  312

Query  738  ILFNLNKFMAFETRDPFLIRQERENPNLTEWDRFAHREYIRLSMEEDAEDASNGSADVWD  559
            ILFNLNKF+AFETRDPFLIRQERENP LTEWDRFAHREYIRLSMEED ED SNGSA+VWD
Sbjct  313  ILFNLNKFIAFETRDPFLIRQERENPTLTEWDRFAHREYIRLSMEEDVEDVSNGSAEVWD  372

Query  558  ESLEAPF  538
            ESLEAPF
Sbjct  373  ESLEAPF  379



>ref|XP_006589210.1| PREDICTED: probable serine/threonine protein phosphatase 2A regulatory 
subunit B''delta-like isoform X1 [Glycine max]
 ref|XP_006589211.1| PREDICTED: probable serine/threonine protein phosphatase 2A regulatory 
subunit B''delta-like isoform X2 [Glycine max]
 ref|XP_006589212.1| PREDICTED: probable serine/threonine protein phosphatase 2A regulatory 
subunit B''delta-like isoform X3 [Glycine max]
 gb|KHN14813.1| Serine/threonine-protein phosphatase 2A regulatory subunit B'' 
subunit alpha [Glycine soja]
Length=537

 Score =   249 bits (637),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 117/127 (92%), Positives = 122/127 (96%), Gaps = 0/127 (0%)
 Frame = -2

Query  918  RNEMQFFYEEQLHRMECMAQEPVLFEDILCQIVDMISPEEESYVTLRDLKGSKLSGSVFN  739
            RNE+QFFYEEQLHRMECMAQEPVLFEDILCQI+DMI PE+ES +TLRDLKG KLSGSVFN
Sbjct  411  RNELQFFYEEQLHRMECMAQEPVLFEDILCQIIDMIKPEDESVITLRDLKGGKLSGSVFN  470

Query  738  ILFNLNKFMAFETRDPFLIRQERENPNLTEWDRFAHREYIRLSMEEDAEDASNGSADVWD  559
            ILFNLNKFMAFETRDPFLIRQERENP LTEWDRFAHREYIRLSMEED EDASNGSA+VWD
Sbjct  471  ILFNLNKFMAFETRDPFLIRQERENPTLTEWDRFAHREYIRLSMEEDVEDASNGSAEVWD  530

Query  558  ESLEAPF  538
            ESLEAPF
Sbjct  531  ESLEAPF  537



>gb|KJB82292.1| hypothetical protein B456_013G187900 [Gossypium raimondii]
 gb|KJB82293.1| hypothetical protein B456_013G187900 [Gossypium raimondii]
Length=539

 Score =   249 bits (637),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 116/127 (91%), Positives = 123/127 (97%), Gaps = 0/127 (0%)
 Frame = -2

Query  918  RNEMQFFYEEQLHRMECMAQEPVLFEDILCQIVDMISPEEESYVTLRDLKGSKLSGSVFN  739
            RNEMQFFYEEQLHRMECMAQEPVLFEDILCQ++DMI P++ESY+ LRDLKGSKLSGSVFN
Sbjct  413  RNEMQFFYEEQLHRMECMAQEPVLFEDILCQMIDMIKPQDESYIMLRDLKGSKLSGSVFN  472

Query  738  ILFNLNKFMAFETRDPFLIRQERENPNLTEWDRFAHREYIRLSMEEDAEDASNGSADVWD  559
            ILFNLNKFMAFETRDPFLIRQERENP LTEWDRFAHREYIRLSME+D EDASNGSA+VWD
Sbjct  473  ILFNLNKFMAFETRDPFLIRQERENPTLTEWDRFAHREYIRLSMEDDVEDASNGSAEVWD  532

Query  558  ESLEAPF  538
            ESLEAPF
Sbjct  533  ESLEAPF  539



>ref|XP_010321356.1| PREDICTED: serine/threonine protein phosphatase 2A regulatory 
subunit B''beta-like isoform X1 [Solanum lycopersicum]
Length=540

 Score =   249 bits (636),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 117/127 (92%), Positives = 123/127 (97%), Gaps = 0/127 (0%)
 Frame = -2

Query  918  RNEMQFFYEEQLHRMECMAQEPVLFEDILCQIVDMISPEEESYVTLRDLKGSKLSGSVFN  739
            RNEMQFFYEEQLHRMECM QEPVLFEDILCQ+VDMI+PE++SY  LRDLKG+KLS SVFN
Sbjct  414  RNEMQFFYEEQLHRMECMGQEPVLFEDILCQMVDMINPEDQSYFALRDLKGNKLSSSVFN  473

Query  738  ILFNLNKFMAFETRDPFLIRQERENPNLTEWDRFAHREYIRLSMEEDAEDASNGSADVWD  559
            +LFNLNKFMAFETRDPFLIRQERENPNLTEWDRFAHREYIRLSMEEDAEDASNGSADVWD
Sbjct  474  VLFNLNKFMAFETRDPFLIRQERENPNLTEWDRFAHREYIRLSMEEDAEDASNGSADVWD  533

Query  558  ESLEAPF  538
            ESLEAPF
Sbjct  534  ESLEAPF  540



>ref|XP_004239749.1| PREDICTED: serine/threonine protein phosphatase 2A regulatory 
subunit B''beta-like isoform X2 [Solanum lycopersicum]
Length=539

 Score =   249 bits (636),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 117/127 (92%), Positives = 123/127 (97%), Gaps = 0/127 (0%)
 Frame = -2

Query  918  RNEMQFFYEEQLHRMECMAQEPVLFEDILCQIVDMISPEEESYVTLRDLKGSKLSGSVFN  739
            RNEMQFFYEEQLHRMECM QEPVLFEDILCQ+VDMI+PE++SY  LRDLKG+KLS SVFN
Sbjct  413  RNEMQFFYEEQLHRMECMGQEPVLFEDILCQMVDMINPEDQSYFALRDLKGNKLSSSVFN  472

Query  738  ILFNLNKFMAFETRDPFLIRQERENPNLTEWDRFAHREYIRLSMEEDAEDASNGSADVWD  559
            +LFNLNKFMAFETRDPFLIRQERENPNLTEWDRFAHREYIRLSMEEDAEDASNGSADVWD
Sbjct  473  VLFNLNKFMAFETRDPFLIRQERENPNLTEWDRFAHREYIRLSMEEDAEDASNGSADVWD  532

Query  558  ESLEAPF  538
            ESLEAPF
Sbjct  533  ESLEAPF  539



>ref|XP_012089346.1| PREDICTED: serine/threonine protein phosphatase 2A regulatory 
subunit B''beta-like [Jatropha curcas]
 gb|KDP23720.1| hypothetical protein JCGZ_23553 [Jatropha curcas]
Length=541

 Score =   249 bits (635),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 117/126 (93%), Positives = 121/126 (96%), Gaps = 0/126 (0%)
 Frame = -2

Query  915  NEMQFFYEEQLHRMECMAQEPVLFEDILCQIVDMISPEEESYVTLRDLKGSKLSGSVFNI  736
            NEMQFFYEEQLHRMECMAQEPVLFEDILCQI+DMI PE ESY+TLRDLKG +LSGSVFNI
Sbjct  416  NEMQFFYEEQLHRMECMAQEPVLFEDILCQIIDMIGPENESYITLRDLKGCRLSGSVFNI  475

Query  735  LFNLNKFMAFETRDPFLIRQERENPNLTEWDRFAHREYIRLSMEEDAEDASNGSADVWDE  556
            LFNLNKFMAFETRDPFLIRQERENP LTEWDRFAHREYIRLSMEED EDASNGSA+VWDE
Sbjct  476  LFNLNKFMAFETRDPFLIRQERENPTLTEWDRFAHREYIRLSMEEDVEDASNGSAEVWDE  535

Query  555  SLEAPF  538
            SLEAPF
Sbjct  536  SLEAPF  541



>gb|EPS71483.1| hypothetical protein M569_03272, partial [Genlisea aurea]
Length=551

 Score =   249 bits (636),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 116/127 (91%), Positives = 125/127 (98%), Gaps = 0/127 (0%)
 Frame = -2

Query  918  RNEMQFFYEEQLHRMECMAQEPVLFEDILCQIVDMISPEEESYVTLRDLKGSKLSGSVFN  739
            RNEMQFFYEEQLHRMECMAQEPVLFEDILCQ+VDM++PE E Y+TLRD+KGSKLSG+VFN
Sbjct  425  RNEMQFFYEEQLHRMECMAQEPVLFEDILCQMVDMLNPENEGYITLRDVKGSKLSGNVFN  484

Query  738  ILFNLNKFMAFETRDPFLIRQERENPNLTEWDRFAHREYIRLSMEEDAEDASNGSADVWD  559
            ILF+LNKFMAFETRDPF+IRQERENP+LTEWDRFAHREYIRLSMEEDAEDASNGSADVWD
Sbjct  485  ILFDLNKFMAFETRDPFMIRQERENPHLTEWDRFAHREYIRLSMEEDAEDASNGSADVWD  544

Query  558  ESLEAPF  538
            ESLEAPF
Sbjct  545  ESLEAPF  551



>emb|CDK13062.1| putative predicted protein [Malus domestica]
Length=539

 Score =   249 bits (635),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 116/127 (91%), Positives = 121/127 (95%), Gaps = 0/127 (0%)
 Frame = -2

Query  918  RNEMQFFYEEQLHRMECMAQEPVLFEDILCQIVDMISPEEESYVTLRDLKGSKLSGSVFN  739
            RNE+QFFYEEQLHRMECMAQEPVLFEDILCQI+DMI PE +SY+TL DLKG KLSGSVFN
Sbjct  413  RNELQFFYEEQLHRMECMAQEPVLFEDILCQIIDMIGPENDSYITLHDLKGCKLSGSVFN  472

Query  738  ILFNLNKFMAFETRDPFLIRQERENPNLTEWDRFAHREYIRLSMEEDAEDASNGSADVWD  559
            ILFNLNKFMAFETRDPFLIRQERENP LTEWDRFAHREYIRLSMEED EDASNGSA+VWD
Sbjct  473  ILFNLNKFMAFETRDPFLIRQERENPTLTEWDRFAHREYIRLSMEEDVEDASNGSAEVWD  532

Query  558  ESLEAPF  538
            ESLEAPF
Sbjct  533  ESLEAPF  539



>ref|XP_009379751.1| PREDICTED: serine/threonine protein phosphatase 2A regulatory 
subunit B''beta-like isoform X2 [Pyrus x bretschneideri]
Length=539

 Score =   248 bits (634),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 116/127 (91%), Positives = 121/127 (95%), Gaps = 0/127 (0%)
 Frame = -2

Query  918  RNEMQFFYEEQLHRMECMAQEPVLFEDILCQIVDMISPEEESYVTLRDLKGSKLSGSVFN  739
            RNE+QFFYEEQLHRMECMAQEPVLFEDILCQI+DMI PE +SY+TL DLKG KLSGSVFN
Sbjct  413  RNELQFFYEEQLHRMECMAQEPVLFEDILCQIIDMIGPENDSYITLHDLKGCKLSGSVFN  472

Query  738  ILFNLNKFMAFETRDPFLIRQERENPNLTEWDRFAHREYIRLSMEEDAEDASNGSADVWD  559
            ILFNLNKFMAFETRDPFLIRQERENP LTEWDRFAHREYIRLSMEED EDASNGSA+VWD
Sbjct  473  ILFNLNKFMAFETRDPFLIRQERENPTLTEWDRFAHREYIRLSMEEDVEDASNGSAEVWD  532

Query  558  ESLEAPF  538
            ESLEAPF
Sbjct  533  ESLEAPF  539



>ref|XP_009343765.1| PREDICTED: serine/threonine protein phosphatase 2A regulatory 
subunit B''beta-like [Pyrus x bretschneideri]
Length=539

 Score =   248 bits (632),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 116/127 (91%), Positives = 120/127 (94%), Gaps = 0/127 (0%)
 Frame = -2

Query  918  RNEMQFFYEEQLHRMECMAQEPVLFEDILCQIVDMISPEEESYVTLRDLKGSKLSGSVFN  739
            RNE+ FFYEEQLHRMECMAQEPVLFEDILCQI+DMI PE ESY+TL DLKG KLSGSVFN
Sbjct  413  RNELNFFYEEQLHRMECMAQEPVLFEDILCQIIDMIGPENESYITLHDLKGCKLSGSVFN  472

Query  738  ILFNLNKFMAFETRDPFLIRQERENPNLTEWDRFAHREYIRLSMEEDAEDASNGSADVWD  559
            ILFNLNKFMAFETRDPFLIRQERENP LTEWDRFAHREYIRLSMEED EDASNGSA+VWD
Sbjct  473  ILFNLNKFMAFETRDPFLIRQERENPTLTEWDRFAHREYIRLSMEEDVEDASNGSAEVWD  532

Query  558  ESLEAPF  538
            ESLEAPF
Sbjct  533  ESLEAPF  539



>ref|XP_009379749.1| PREDICTED: serine/threonine protein phosphatase 2A regulatory 
subunit B''beta-like isoform X1 [Pyrus x bretschneideri]
Length=542

 Score =   248 bits (633),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 116/127 (91%), Positives = 121/127 (95%), Gaps = 0/127 (0%)
 Frame = -2

Query  918  RNEMQFFYEEQLHRMECMAQEPVLFEDILCQIVDMISPEEESYVTLRDLKGSKLSGSVFN  739
            RNE+QFFYEEQLHRMECMAQEPVLFEDILCQI+DMI PE +SY+TL DLKG KLSGSVFN
Sbjct  416  RNELQFFYEEQLHRMECMAQEPVLFEDILCQIIDMIGPENDSYITLHDLKGCKLSGSVFN  475

Query  738  ILFNLNKFMAFETRDPFLIRQERENPNLTEWDRFAHREYIRLSMEEDAEDASNGSADVWD  559
            ILFNLNKFMAFETRDPFLIRQERENP LTEWDRFAHREYIRLSMEED EDASNGSA+VWD
Sbjct  476  ILFNLNKFMAFETRDPFLIRQERENPTLTEWDRFAHREYIRLSMEEDVEDASNGSAEVWD  535

Query  558  ESLEAPF  538
            ESLEAPF
Sbjct  536  ESLEAPF  542



>ref|XP_006395034.1| hypothetical protein EUTSA_v10003963mg [Eutrema salsugineum]
 gb|ESQ32320.1| hypothetical protein EUTSA_v10003963mg [Eutrema salsugineum]
Length=539

 Score =   248 bits (632),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 117/127 (92%), Positives = 121/127 (95%), Gaps = 0/127 (0%)
 Frame = -2

Query  918  RNEMQFFYEEQLHRMECMAQEPVLFEDILCQIVDMISPEEESYVTLRDLKGSKLSGSVFN  739
            RNEMQFFYEEQLHRMECMAQE VLFEDILCQI+DMI PE ESY+TL DLKGSKLSG+VFN
Sbjct  413  RNEMQFFYEEQLHRMECMAQEAVLFEDILCQIIDMIGPEHESYITLHDLKGSKLSGNVFN  472

Query  738  ILFNLNKFMAFETRDPFLIRQERENPNLTEWDRFAHREYIRLSMEEDAEDASNGSADVWD  559
            ILFNLNKFMAFETRDPFLIRQERENP LTEWDRFAHREYIRLSMEED EDASNGSA+VWD
Sbjct  473  ILFNLNKFMAFETRDPFLIRQERENPTLTEWDRFAHREYIRLSMEEDVEDASNGSAEVWD  532

Query  558  ESLEAPF  538
            ESLEAPF
Sbjct  533  ESLEAPF  539



>ref|XP_010043302.1| PREDICTED: serine/threonine protein phosphatase 2A regulatory 
subunit B''beta-like [Eucalyptus grandis]
 gb|KCW85304.1| hypothetical protein EUGRSUZ_B02150 [Eucalyptus grandis]
 gb|KCW85305.1| hypothetical protein EUGRSUZ_B02150 [Eucalyptus grandis]
Length=538

 Score =   248 bits (632),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 116/127 (91%), Positives = 121/127 (95%), Gaps = 0/127 (0%)
 Frame = -2

Query  918  RNEMQFFYEEQLHRMECMAQEPVLFEDILCQIVDMISPEEESYVTLRDLKGSKLSGSVFN  739
            RNE+Q+FYEEQLHRMECMAQEPVLFEDILCQI+DMI PE ESY+TL DLKG KLSGSVFN
Sbjct  412  RNELQYFYEEQLHRMECMAQEPVLFEDILCQIIDMIGPENESYITLNDLKGCKLSGSVFN  471

Query  738  ILFNLNKFMAFETRDPFLIRQERENPNLTEWDRFAHREYIRLSMEEDAEDASNGSADVWD  559
            ILFNLNKFMAFETRDPFLIRQERENP LTEWDRFAHREYIRLSMEED EDASNGSA+VWD
Sbjct  472  ILFNLNKFMAFETRDPFLIRQERENPTLTEWDRFAHREYIRLSMEEDVEDASNGSAEVWD  531

Query  558  ESLEAPF  538
            ESLEAPF
Sbjct  532  ESLEAPF  538



>ref|XP_009413732.1| PREDICTED: serine/threonine protein phosphatase 2A regulatory 
subunit B''beta-like [Musa acuminata subsp. malaccensis]
 ref|XP_009413733.1| PREDICTED: serine/threonine protein phosphatase 2A regulatory 
subunit B''beta-like [Musa acuminata subsp. malaccensis]
Length=541

 Score =   247 bits (631),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 114/126 (90%), Positives = 119/126 (94%), Gaps = 0/126 (0%)
 Frame = -2

Query  915  NEMQFFYEEQLHRMECMAQEPVLFEDILCQIVDMISPEEESYVTLRDLKGSKLSGSVFNI  736
            NEMQFFYEEQLHRMECMAQEPVLFEDILCQ++DMI PE ESY TLRDLKG KLSG++FNI
Sbjct  416  NEMQFFYEEQLHRMECMAQEPVLFEDILCQMIDMIGPENESYFTLRDLKGGKLSGNIFNI  475

Query  735  LFNLNKFMAFETRDPFLIRQERENPNLTEWDRFAHREYIRLSMEEDAEDASNGSADVWDE  556
            LFNLNKFMAFETRDPFLIRQERENP LTEWDRFAHREYIRLSMEED EDASNGS D+WDE
Sbjct  476  LFNLNKFMAFETRDPFLIRQERENPTLTEWDRFAHREYIRLSMEEDGEDASNGSGDIWDE  535

Query  555  SLEAPF  538
            SLEAPF
Sbjct  536  SLEAPF  541



>ref|XP_004152820.1| PREDICTED: serine/threonine protein phosphatase 2A regulatory 
subunit B''beta-like [Cucumis sativus]
 gb|KGN61275.1| hypothetical protein Csa_2G075340 [Cucumis sativus]
Length=539

 Score =   247 bits (631),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 116/127 (91%), Positives = 121/127 (95%), Gaps = 0/127 (0%)
 Frame = -2

Query  918  RNEMQFFYEEQLHRMECMAQEPVLFEDILCQIVDMISPEEESYVTLRDLKGSKLSGSVFN  739
            RNE+QFFYEEQLHRMECMAQEPVLFEDILCQI+DMI PE E+Y+TLRDLK  KLSGSVFN
Sbjct  413  RNELQFFYEEQLHRMECMAQEPVLFEDILCQIIDMIGPENETYITLRDLKSCKLSGSVFN  472

Query  738  ILFNLNKFMAFETRDPFLIRQERENPNLTEWDRFAHREYIRLSMEEDAEDASNGSADVWD  559
            ILFNLNKFMAFETRDPFLIRQERENP LTEWDRFAHREYIRLSMEED EDASNGSA+VWD
Sbjct  473  ILFNLNKFMAFETRDPFLIRQERENPTLTEWDRFAHREYIRLSMEEDVEDASNGSAEVWD  532

Query  558  ESLEAPF  538
            ESLEAPF
Sbjct  533  ESLEAPF  539



>ref|XP_008441828.1| PREDICTED: serine/threonine protein phosphatase 2A regulatory 
subunit B''beta-like [Cucumis melo]
Length=539

 Score =   247 bits (631),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 116/127 (91%), Positives = 121/127 (95%), Gaps = 0/127 (0%)
 Frame = -2

Query  918  RNEMQFFYEEQLHRMECMAQEPVLFEDILCQIVDMISPEEESYVTLRDLKGSKLSGSVFN  739
            RNE+QFFYEEQLHRMECMAQEPVLFEDILCQI+DMI PE E+Y+TLRDLK  KLSGSVFN
Sbjct  413  RNELQFFYEEQLHRMECMAQEPVLFEDILCQIIDMIGPENETYITLRDLKSCKLSGSVFN  472

Query  738  ILFNLNKFMAFETRDPFLIRQERENPNLTEWDRFAHREYIRLSMEEDAEDASNGSADVWD  559
            ILFNLNKFMAFETRDPFLIRQERENP LTEWDRFAHREYIRLSMEED EDASNGSA+VWD
Sbjct  473  ILFNLNKFMAFETRDPFLIRQERENPTLTEWDRFAHREYIRLSMEEDVEDASNGSAEVWD  532

Query  558  ESLEAPF  538
            ESLEAPF
Sbjct  533  ESLEAPF  539



>ref|XP_009151268.1| PREDICTED: serine/threonine protein phosphatase 2A regulatory 
subunit B''beta [Brassica rapa]
 emb|CDY48668.1| BnaC07g27410D [Brassica napus]
 emb|CDX86212.1| BnaA06g29290D [Brassica napus]
Length=538

 Score =   247 bits (630),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 116/127 (91%), Positives = 122/127 (96%), Gaps = 0/127 (0%)
 Frame = -2

Query  918  RNEMQFFYEEQLHRMECMAQEPVLFEDILCQIVDMISPEEESYVTLRDLKGSKLSGSVFN  739
            RNEMQFFYEEQLHRMECMAQE VLFEDILCQ++DMI PE+ESY+TL DLKGSKLSG+VFN
Sbjct  412  RNEMQFFYEEQLHRMECMAQEAVLFEDILCQLIDMIGPEDESYITLNDLKGSKLSGNVFN  471

Query  738  ILFNLNKFMAFETRDPFLIRQERENPNLTEWDRFAHREYIRLSMEEDAEDASNGSADVWD  559
            ILFNLNKFMAFETRDPFLIRQERENP LTEWDRFAHREYIRLSMEED EDASNGSA+VWD
Sbjct  472  ILFNLNKFMAFETRDPFLIRQERENPTLTEWDRFAHREYIRLSMEEDVEDASNGSAEVWD  531

Query  558  ESLEAPF  538
            ESLEAPF
Sbjct  532  ESLEAPF  538



>ref|XP_010524949.1| PREDICTED: serine/threonine protein phosphatase 2A regulatory 
subunit B''beta [Tarenaya hassleriana]
 ref|XP_010524951.1| PREDICTED: serine/threonine protein phosphatase 2A regulatory 
subunit B''beta [Tarenaya hassleriana]
Length=539

 Score =   247 bits (630),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 114/127 (90%), Positives = 121/127 (95%), Gaps = 0/127 (0%)
 Frame = -2

Query  918  RNEMQFFYEEQLHRMECMAQEPVLFEDILCQIVDMISPEEESYVTLRDLKGSKLSGSVFN  739
            RNEMQFFYEEQLHRMECMAQEPV F+DILCQI+DM+ PE ESY+TL D+KGSKLSGSVFN
Sbjct  413  RNEMQFFYEEQLHRMECMAQEPVFFDDILCQIIDMVGPENESYITLHDMKGSKLSGSVFN  472

Query  738  ILFNLNKFMAFETRDPFLIRQERENPNLTEWDRFAHREYIRLSMEEDAEDASNGSADVWD  559
            ILFNLNKFMAFETRDPFLIRQERENP LTEWDRFAHREYIRLSMEED EDASNGSA+VWD
Sbjct  473  ILFNLNKFMAFETRDPFLIRQERENPTLTEWDRFAHREYIRLSMEEDVEDASNGSAEVWD  532

Query  558  ESLEAPF  538
            ESLE+PF
Sbjct  533  ESLESPF  539



>gb|AES82677.2| calcium-binding EF-hand protein [Medicago truncatula]
Length=524

 Score =   246 bits (628),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 116/127 (91%), Positives = 120/127 (94%), Gaps = 0/127 (0%)
 Frame = -2

Query  918  RNEMQFFYEEQLHRMECMAQEPVLFEDILCQIVDMISPEEESYVTLRDLKGSKLSGSVFN  739
            RNE+QFFYEEQLHRMECMAQEPVLFEDILCQI+DMI  E ESY+TLRDLKG KLSGSVFN
Sbjct  398  RNELQFFYEEQLHRMECMAQEPVLFEDILCQIIDMIRSENESYITLRDLKGGKLSGSVFN  457

Query  738  ILFNLNKFMAFETRDPFLIRQERENPNLTEWDRFAHREYIRLSMEEDAEDASNGSADVWD  559
            ILFNLNKFMAFETRDPFLIRQERENP LTEWDRFAHREYIRLSMEED ED SNGSA+VWD
Sbjct  458  ILFNLNKFMAFETRDPFLIRQERENPTLTEWDRFAHREYIRLSMEEDVEDVSNGSAEVWD  517

Query  558  ESLEAPF  538
            ESLEAPF
Sbjct  518  ESLEAPF  524



>ref|XP_010421710.1| PREDICTED: serine/threonine protein phosphatase 2A regulatory 
subunit B''beta-like [Camelina sativa]
Length=329

 Score =   240 bits (613),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 115/128 (90%), Positives = 121/128 (95%), Gaps = 1/128 (1%)
 Frame = -2

Query  918  RNEMQFFYEEQLHRMECMAQEPVLFEDILCQIVDMISPEEESYVTLRDLKGSKLSGSVFN  739
            RNEMQFFYEEQLHRMECMAQE VLFEDILCQ++DMI PE ES++TL DLKGSKLSG+VFN
Sbjct  202  RNEMQFFYEEQLHRMECMAQEAVLFEDILCQMIDMIGPENESHITLHDLKGSKLSGNVFN  261

Query  738  ILFNLNKFMAFETRDPFLIRQERENPNLTEWDRFAHREYIRLSMEEDAEDASNGSADVWD  559
            ILFNLNKFMAFETRDPFLIRQERENP LTEWDRFAHREYIRLSMEED EDASNGSA+VWD
Sbjct  262  ILFNLNKFMAFETRDPFLIRQERENPTLTEWDRFAHREYIRLSMEEDVEDASNGSAEVWD  321

Query  558  E-SLEAPF  538
            E SLEAPF
Sbjct  322  ESSLEAPF  329



>ref|XP_010906785.1| PREDICTED: serine/threonine protein phosphatase 2A regulatory 
subunit B''beta-like [Elaeis guineensis]
 ref|XP_010906786.1| PREDICTED: serine/threonine protein phosphatase 2A regulatory 
subunit B''beta-like [Elaeis guineensis]
Length=541

 Score =   246 bits (629),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 116/126 (92%), Positives = 121/126 (96%), Gaps = 0/126 (0%)
 Frame = -2

Query  915  NEMQFFYEEQLHRMECMAQEPVLFEDILCQIVDMISPEEESYVTLRDLKGSKLSGSVFNI  736
            NEMQFFYEEQLHRMECMAQEPVLFEDILCQ++DMI+PE ESY TLRDLKG+KLSG+VFNI
Sbjct  416  NEMQFFYEEQLHRMECMAQEPVLFEDILCQMIDMIAPENESYFTLRDLKGNKLSGNVFNI  475

Query  735  LFNLNKFMAFETRDPFLIRQERENPNLTEWDRFAHREYIRLSMEEDAEDASNGSADVWDE  556
            LFNLNKFMAFETRDPFLIRQERE P LTEWDRFAHREYIRLSMEEDAEDASNGS DVWDE
Sbjct  476  LFNLNKFMAFETRDPFLIRQEREEPTLTEWDRFAHREYIRLSMEEDAEDASNGSGDVWDE  535

Query  555  SLEAPF  538
            SLEAPF
Sbjct  536  SLEAPF  541



>ref|XP_003556454.1| PREDICTED: probable serine/threonine protein phosphatase 2A regulatory 
subunit B''delta-like isoform X1 [Glycine max]
 ref|XP_006606445.1| PREDICTED: probable serine/threonine protein phosphatase 2A regulatory 
subunit B''delta-like isoform X2 [Glycine max]
 ref|XP_006606446.1| PREDICTED: probable serine/threonine protein phosphatase 2A regulatory 
subunit B''delta-like isoform X3 [Glycine max]
Length=537

 Score =   246 bits (629),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 116/127 (91%), Positives = 121/127 (95%), Gaps = 0/127 (0%)
 Frame = -2

Query  918  RNEMQFFYEEQLHRMECMAQEPVLFEDILCQIVDMISPEEESYVTLRDLKGSKLSGSVFN  739
            RNE+QFFYEEQLHRMECMAQEPVLFEDILCQI+DMI PE+ES +TL DLKG KLSGSVFN
Sbjct  411  RNELQFFYEEQLHRMECMAQEPVLFEDILCQIIDMIKPEDESVITLHDLKGGKLSGSVFN  470

Query  738  ILFNLNKFMAFETRDPFLIRQERENPNLTEWDRFAHREYIRLSMEEDAEDASNGSADVWD  559
            ILFNLNKFMAFETRDPFLIRQERENP LTEWDRFAHREYIRLSMEED EDASNGSA+VWD
Sbjct  471  ILFNLNKFMAFETRDPFLIRQERENPTLTEWDRFAHREYIRLSMEEDIEDASNGSAEVWD  530

Query  558  ESLEAPF  538
            ESLEAPF
Sbjct  531  ESLEAPF  537



>gb|KHN04952.1| Serine/threonine-protein phosphatase 2A regulatory subunit B'' 
subunit alpha [Glycine soja]
Length=535

 Score =   246 bits (628),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 116/127 (91%), Positives = 121/127 (95%), Gaps = 0/127 (0%)
 Frame = -2

Query  918  RNEMQFFYEEQLHRMECMAQEPVLFEDILCQIVDMISPEEESYVTLRDLKGSKLSGSVFN  739
            RNE+QFFYEEQLHRMECMAQEPVLFEDILCQI+DMI PE+ES +TL DLKG KLSGSVFN
Sbjct  409  RNELQFFYEEQLHRMECMAQEPVLFEDILCQIIDMIKPEDESVITLHDLKGGKLSGSVFN  468

Query  738  ILFNLNKFMAFETRDPFLIRQERENPNLTEWDRFAHREYIRLSMEEDAEDASNGSADVWD  559
            ILFNLNKFMAFETRDPFLIRQERENP LTEWDRFAHREYIRLSMEED EDASNGSA+VWD
Sbjct  469  ILFNLNKFMAFETRDPFLIRQERENPTLTEWDRFAHREYIRLSMEEDIEDASNGSAEVWD  528

Query  558  ESLEAPF  538
            ESLEAPF
Sbjct  529  ESLEAPF  535



>ref|XP_008804278.1| PREDICTED: serine/threonine protein phosphatase 2A regulatory 
subunit B''beta-like isoform X2 [Phoenix dactylifera]
Length=458

 Score =   244 bits (622),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 115/126 (91%), Positives = 121/126 (96%), Gaps = 0/126 (0%)
 Frame = -2

Query  915  NEMQFFYEEQLHRMECMAQEPVLFEDILCQIVDMISPEEESYVTLRDLKGSKLSGSVFNI  736
            NEMQFFYEEQLHRMECMAQEPVLFEDILCQ++DMI+PE ESY TLRDLKG+KLSG+VFNI
Sbjct  333  NEMQFFYEEQLHRMECMAQEPVLFEDILCQMIDMIAPENESYFTLRDLKGNKLSGNVFNI  392

Query  735  LFNLNKFMAFETRDPFLIRQERENPNLTEWDRFAHREYIRLSMEEDAEDASNGSADVWDE  556
            LFNLNKFMAFETRDPFLIRQERE P LTEWDRFAHREYIRLSMEE+AEDASNGS DVWDE
Sbjct  393  LFNLNKFMAFETRDPFLIRQEREEPTLTEWDRFAHREYIRLSMEEEAEDASNGSGDVWDE  452

Query  555  SLEAPF  538
            SLEAPF
Sbjct  453  SLEAPF  458



>ref|XP_007144012.1| hypothetical protein PHAVU_007G121700g [Phaseolus vulgaris]
 ref|XP_007144013.1| hypothetical protein PHAVU_007G121700g [Phaseolus vulgaris]
 gb|ESW16006.1| hypothetical protein PHAVU_007G121700g [Phaseolus vulgaris]
 gb|ESW16007.1| hypothetical protein PHAVU_007G121700g [Phaseolus vulgaris]
Length=535

 Score =   246 bits (627),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 115/127 (91%), Positives = 121/127 (95%), Gaps = 0/127 (0%)
 Frame = -2

Query  918  RNEMQFFYEEQLHRMECMAQEPVLFEDILCQIVDMISPEEESYVTLRDLKGSKLSGSVFN  739
            RNE+QFFYEEQLHRMECMAQEPVLFEDILCQ++DMI PE+ES VTLRDLKG KLSGSVFN
Sbjct  409  RNELQFFYEEQLHRMECMAQEPVLFEDILCQLIDMIKPEDESLVTLRDLKGGKLSGSVFN  468

Query  738  ILFNLNKFMAFETRDPFLIRQERENPNLTEWDRFAHREYIRLSMEEDAEDASNGSADVWD  559
            ILFNLNKF+AFETRDPFLIRQERENP LTEWDRFAHREYIRLSMEED ED SNGSA+VWD
Sbjct  469  ILFNLNKFIAFETRDPFLIRQERENPTLTEWDRFAHREYIRLSMEEDVEDVSNGSAEVWD  528

Query  558  ESLEAPF  538
            ESLEAPF
Sbjct  529  ESLEAPF  535



>ref|XP_012085282.1| PREDICTED: serine/threonine protein phosphatase 2A regulatory 
subunit B''beta isoform X3 [Jatropha curcas]
Length=328

 Score =   239 bits (609),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 112/126 (89%), Positives = 120/126 (95%), Gaps = 0/126 (0%)
 Frame = -2

Query  915  NEMQFFYEEQLHRMECMAQEPVLFEDILCQIVDMISPEEESYVTLRDLKGSKLSGSVFNI  736
            NEMQFFYEEQLHRMECMAQEPVLFEDILCQIVDMI+PE E Y+TL+DLK SKLSG+VFNI
Sbjct  203  NEMQFFYEEQLHRMECMAQEPVLFEDILCQIVDMIAPEREDYITLQDLKASKLSGNVFNI  262

Query  735  LFNLNKFMAFETRDPFLIRQERENPNLTEWDRFAHREYIRLSMEEDAEDASNGSADVWDE  556
            LFNLNKF+AFE+RDPFLIRQERE+P LTEWDRFAHREYIRLSMEED ED SNGSADVW+E
Sbjct  263  LFNLNKFIAFESRDPFLIRQEREDPTLTEWDRFAHREYIRLSMEEDVEDVSNGSADVWEE  322

Query  555  SLEAPF  538
            SLEAPF
Sbjct  323  SLEAPF  328



>ref|XP_009382000.1| PREDICTED: serine/threonine protein phosphatase 2A regulatory 
subunit B''beta-like [Musa acuminata subsp. malaccensis]
Length=541

 Score =   245 bits (625),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 113/126 (90%), Positives = 118/126 (94%), Gaps = 0/126 (0%)
 Frame = -2

Query  915  NEMQFFYEEQLHRMECMAQEPVLFEDILCQIVDMISPEEESYVTLRDLKGSKLSGSVFNI  736
            NEMQFFYEEQLHRMECMAQEPVLFEDILCQ++DMI PE ESY TL DLKG KLSG++FNI
Sbjct  416  NEMQFFYEEQLHRMECMAQEPVLFEDILCQMIDMIGPENESYFTLHDLKGGKLSGNIFNI  475

Query  735  LFNLNKFMAFETRDPFLIRQERENPNLTEWDRFAHREYIRLSMEEDAEDASNGSADVWDE  556
            LFNLNKFMAFETRDPFLIRQERENP LTEWDRFAHREYIRLSMEED EDASNGS D+WDE
Sbjct  476  LFNLNKFMAFETRDPFLIRQERENPTLTEWDRFAHREYIRLSMEEDGEDASNGSGDIWDE  535

Query  555  SLEAPF  538
            SLEAPF
Sbjct  536  SLEAPF  541



>gb|KFK24119.1| hypothetical protein AALP_AAs60715U000300 [Arabis alpina]
Length=528

 Score =   244 bits (624),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 115/127 (91%), Positives = 122/127 (96%), Gaps = 0/127 (0%)
 Frame = -2

Query  918  RNEMQFFYEEQLHRMECMAQEPVLFEDILCQIVDMISPEEESYVTLRDLKGSKLSGSVFN  739
            RNEMQFFYEEQLHRMECMAQE VLFEDILCQI+DMI PE ES++TL+DLKGSKLSG+VFN
Sbjct  402  RNEMQFFYEEQLHRMECMAQEAVLFEDILCQIIDMIGPENESHITLQDLKGSKLSGNVFN  461

Query  738  ILFNLNKFMAFETRDPFLIRQERENPNLTEWDRFAHREYIRLSMEEDAEDASNGSADVWD  559
            ILFNLNKFMAFETRDPFLIRQERENP LT+WDRFAHREYIRLSMEED EDASNGSA+VWD
Sbjct  462  ILFNLNKFMAFETRDPFLIRQERENPTLTDWDRFAHREYIRLSMEEDVEDASNGSAEVWD  521

Query  558  ESLEAPF  538
            ESLEAPF
Sbjct  522  ESLEAPF  528



>gb|AFW68589.1| hypothetical protein ZEAMMB73_277032 [Zea mays]
 gb|AFW68590.1| hypothetical protein ZEAMMB73_277032 [Zea mays]
Length=332

 Score =   239 bits (609),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 112/126 (89%), Positives = 117/126 (93%), Gaps = 0/126 (0%)
 Frame = -2

Query  915  NEMQFFYEEQLHRMECMAQEPVLFEDILCQIVDMISPEEESYVTLRDLKGSKLSGSVFNI  736
            NEMQFFYEEQLHRMECMAQEPV+F DILCQ++DMI PE ESY TLRDLK  KLSG++FNI
Sbjct  207  NEMQFFYEEQLHRMECMAQEPVVFGDILCQMIDMIGPENESYFTLRDLKRCKLSGNIFNI  266

Query  735  LFNLNKFMAFETRDPFLIRQERENPNLTEWDRFAHREYIRLSMEEDAEDASNGSADVWDE  556
            LFNLNKFMAFETRDPFLIRQERENP LTEWDRFAHREYIRLSMEED EDASNGS DVWDE
Sbjct  267  LFNLNKFMAFETRDPFLIRQERENPTLTEWDRFAHREYIRLSMEEDGEDASNGSGDVWDE  326

Query  555  SLEAPF  538
            SLEAPF
Sbjct  327  SLEAPF  332



>ref|XP_002272394.1| PREDICTED: serine/threonine protein phosphatase 2A regulatory 
subunit B''beta isoform X3 [Vitis vinifera]
Length=539

 Score =   244 bits (624),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 115/126 (91%), Positives = 120/126 (95%), Gaps = 0/126 (0%)
 Frame = -2

Query  915  NEMQFFYEEQLHRMECMAQEPVLFEDILCQIVDMISPEEESYVTLRDLKGSKLSGSVFNI  736
            NEMQFFYEEQLHRMECMAQEPVLFEDILCQIVDMI+PE E Y+TLRDLKG KLSG+VFNI
Sbjct  414  NEMQFFYEEQLHRMECMAQEPVLFEDILCQIVDMIAPEREEYITLRDLKGCKLSGNVFNI  473

Query  735  LFNLNKFMAFETRDPFLIRQERENPNLTEWDRFAHREYIRLSMEEDAEDASNGSADVWDE  556
            LFNLNKFMAFETRDPFLIRQERE+P LTEWDRFAHREYIRLSMEED ED SNGSA+VWDE
Sbjct  474  LFNLNKFMAFETRDPFLIRQEREDPTLTEWDRFAHREYIRLSMEEDGEDVSNGSAEVWDE  533

Query  555  SLEAPF  538
            SLEAPF
Sbjct  534  SLEAPF  539



>ref|XP_008804277.1| PREDICTED: serine/threonine protein phosphatase 2A regulatory 
subunit B''beta-like isoform X1 [Phoenix dactylifera]
Length=544

 Score =   244 bits (624),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 115/126 (91%), Positives = 121/126 (96%), Gaps = 0/126 (0%)
 Frame = -2

Query  915  NEMQFFYEEQLHRMECMAQEPVLFEDILCQIVDMISPEEESYVTLRDLKGSKLSGSVFNI  736
            NEMQFFYEEQLHRMECMAQEPVLFEDILCQ++DMI+PE ESY TLRDLKG+KLSG+VFNI
Sbjct  419  NEMQFFYEEQLHRMECMAQEPVLFEDILCQMIDMIAPENESYFTLRDLKGNKLSGNVFNI  478

Query  735  LFNLNKFMAFETRDPFLIRQERENPNLTEWDRFAHREYIRLSMEEDAEDASNGSADVWDE  556
            LFNLNKFMAFETRDPFLIRQERE P LTEWDRFAHREYIRLSMEE+AEDASNGS DVWDE
Sbjct  479  LFNLNKFMAFETRDPFLIRQEREEPTLTEWDRFAHREYIRLSMEEEAEDASNGSGDVWDE  538

Query  555  SLEAPF  538
            SLEAPF
Sbjct  539  SLEAPF  544



>emb|CBI37142.3| unnamed protein product [Vitis vinifera]
Length=547

 Score =   244 bits (624),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 115/126 (91%), Positives = 120/126 (95%), Gaps = 0/126 (0%)
 Frame = -2

Query  915  NEMQFFYEEQLHRMECMAQEPVLFEDILCQIVDMISPEEESYVTLRDLKGSKLSGSVFNI  736
            NEMQFFYEEQLHRMECMAQEPVLFEDILCQIVDMI+PE E Y+TLRDLKG KLSG+VFNI
Sbjct  422  NEMQFFYEEQLHRMECMAQEPVLFEDILCQIVDMIAPEREEYITLRDLKGCKLSGNVFNI  481

Query  735  LFNLNKFMAFETRDPFLIRQERENPNLTEWDRFAHREYIRLSMEEDAEDASNGSADVWDE  556
            LFNLNKFMAFETRDPFLIRQERE+P LTEWDRFAHREYIRLSMEED ED SNGSA+VWDE
Sbjct  482  LFNLNKFMAFETRDPFLIRQEREDPTLTEWDRFAHREYIRLSMEEDGEDVSNGSAEVWDE  541

Query  555  SLEAPF  538
            SLEAPF
Sbjct  542  SLEAPF  547



>ref|XP_010265004.1| PREDICTED: serine/threonine protein phosphatase 2A regulatory 
subunit B''beta-like [Nelumbo nucifera]
Length=539

 Score =   244 bits (623),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 115/126 (91%), Positives = 120/126 (95%), Gaps = 0/126 (0%)
 Frame = -2

Query  915  NEMQFFYEEQLHRMECMAQEPVLFEDILCQIVDMISPEEESYVTLRDLKGSKLSGSVFNI  736
            NEMQFFYEEQLHRMECMAQEPVLFEDILCQ+VDM+ PE ESY TLRDLKG KLSG+VFNI
Sbjct  414  NEMQFFYEEQLHRMECMAQEPVLFEDILCQMVDMVGPENESYFTLRDLKGCKLSGNVFNI  473

Query  735  LFNLNKFMAFETRDPFLIRQERENPNLTEWDRFAHREYIRLSMEEDAEDASNGSADVWDE  556
            LFNLNKFMAFETRDPFLIRQERE+P LTEWDRFAHREYIRLSMEED EDASNGSA+VWDE
Sbjct  474  LFNLNKFMAFETRDPFLIRQEREDPTLTEWDRFAHREYIRLSMEEDGEDASNGSAEVWDE  533

Query  555  SLEAPF  538
            SLEAPF
Sbjct  534  SLEAPF  539



>dbj|BAD94815.1| protein phosphatase 2A regulatory subunit B'-like protein [Arabidopsis 
thaliana]
Length=329

 Score =   238 bits (607),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 113/128 (88%), Positives = 121/128 (95%), Gaps = 1/128 (1%)
 Frame = -2

Query  918  RNEMQFFYEEQLHRMECMAQEPVLFEDILCQIVDMISPEEESYVTLRDLKGSKLSGSVFN  739
            RNEMQFFYEEQLHRMECMAQE VLFEDILCQ++DMI PE ES++TL DLKGSKLSG+VFN
Sbjct  202  RNEMQFFYEEQLHRMECMAQEAVLFEDILCQMIDMIGPENESHITLHDLKGSKLSGNVFN  261

Query  738  ILFNLNKFMAFETRDPFLIRQERENPNLTEWDRFAHREYIRLSMEEDAEDASNGSADVWD  559
            ILFNLNKFMAFETRDPFLIRQERENP LT+WDRFAHREYIRLSMEED EDASNGSA+VWD
Sbjct  262  ILFNLNKFMAFETRDPFLIRQERENPTLTDWDRFAHREYIRLSMEEDVEDASNGSAEVWD  321

Query  558  E-SLEAPF  538
            + SLEAPF
Sbjct  322  DSSLEAPF  329



>ref|XP_010652386.1| PREDICTED: serine/threonine protein phosphatase 2A regulatory 
subunit B''beta isoform X1 [Vitis vinifera]
Length=557

 Score =   244 bits (624),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 115/126 (91%), Positives = 120/126 (95%), Gaps = 0/126 (0%)
 Frame = -2

Query  915  NEMQFFYEEQLHRMECMAQEPVLFEDILCQIVDMISPEEESYVTLRDLKGSKLSGSVFNI  736
            NEMQFFYEEQLHRMECMAQEPVLFEDILCQIVDMI+PE E Y+TLRDLKG KLSG+VFNI
Sbjct  432  NEMQFFYEEQLHRMECMAQEPVLFEDILCQIVDMIAPEREEYITLRDLKGCKLSGNVFNI  491

Query  735  LFNLNKFMAFETRDPFLIRQERENPNLTEWDRFAHREYIRLSMEEDAEDASNGSADVWDE  556
            LFNLNKFMAFETRDPFLIRQERE+P LTEWDRFAHREYIRLSMEED ED SNGSA+VWDE
Sbjct  492  LFNLNKFMAFETRDPFLIRQEREDPTLTEWDRFAHREYIRLSMEEDGEDVSNGSAEVWDE  551

Query  555  SLEAPF  538
            SLEAPF
Sbjct  552  SLEAPF  557



>ref|XP_010652387.1| PREDICTED: serine/threonine protein phosphatase 2A regulatory 
subunit B''beta isoform X2 [Vitis vinifera]
Length=556

 Score =   244 bits (623),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 115/126 (91%), Positives = 120/126 (95%), Gaps = 0/126 (0%)
 Frame = -2

Query  915  NEMQFFYEEQLHRMECMAQEPVLFEDILCQIVDMISPEEESYVTLRDLKGSKLSGSVFNI  736
            NEMQFFYEEQLHRMECMAQEPVLFEDILCQIVDMI+PE E Y+TLRDLKG KLSG+VFNI
Sbjct  431  NEMQFFYEEQLHRMECMAQEPVLFEDILCQIVDMIAPEREEYITLRDLKGCKLSGNVFNI  490

Query  735  LFNLNKFMAFETRDPFLIRQERENPNLTEWDRFAHREYIRLSMEEDAEDASNGSADVWDE  556
            LFNLNKFMAFETRDPFLIRQERE+P LTEWDRFAHREYIRLSMEED ED SNGSA+VWDE
Sbjct  491  LFNLNKFMAFETRDPFLIRQEREDPTLTEWDRFAHREYIRLSMEEDGEDVSNGSAEVWDE  550

Query  555  SLEAPF  538
            SLEAPF
Sbjct  551  SLEAPF  556



>ref|XP_010905824.1| PREDICTED: serine/threonine protein phosphatase 2A regulatory 
subunit B''beta-like [Elaeis guineensis]
Length=544

 Score =   244 bits (622),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 114/126 (90%), Positives = 119/126 (94%), Gaps = 0/126 (0%)
 Frame = -2

Query  915  NEMQFFYEEQLHRMECMAQEPVLFEDILCQIVDMISPEEESYVTLRDLKGSKLSGSVFNI  736
            NEMQFFYEEQLHRMECMAQEPVLFEDILCQ++DMI PE ESY+TLRDLKG KLSG+VFNI
Sbjct  419  NEMQFFYEEQLHRMECMAQEPVLFEDILCQMIDMIGPENESYLTLRDLKGCKLSGNVFNI  478

Query  735  LFNLNKFMAFETRDPFLIRQERENPNLTEWDRFAHREYIRLSMEEDAEDASNGSADVWDE  556
            LFNLNKFMAFETRDPFLIRQERE+P LTEWDRFAHREYIRLSMEED ED SNGS DVWDE
Sbjct  479  LFNLNKFMAFETRDPFLIRQEREDPTLTEWDRFAHREYIRLSMEEDGEDVSNGSGDVWDE  538

Query  555  SLEAPF  538
            SLEAPF
Sbjct  539  SLEAPF  544



>ref|XP_010934299.1| PREDICTED: serine/threonine protein phosphatase 2A regulatory 
subunit B''beta-like [Elaeis guineensis]
 ref|XP_010934300.1| PREDICTED: serine/threonine protein phosphatase 2A regulatory 
subunit B''beta-like [Elaeis guineensis]
Length=541

 Score =   243 bits (621),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 114/126 (90%), Positives = 121/126 (96%), Gaps = 0/126 (0%)
 Frame = -2

Query  915  NEMQFFYEEQLHRMECMAQEPVLFEDILCQIVDMISPEEESYVTLRDLKGSKLSGSVFNI  736
            NEMQFFYEEQLHRMECMAQEPVLFEDILCQ++DMI+PE ES+ +LRDLKG+KLSG+VFNI
Sbjct  416  NEMQFFYEEQLHRMECMAQEPVLFEDILCQMIDMIAPENESFFSLRDLKGNKLSGNVFNI  475

Query  735  LFNLNKFMAFETRDPFLIRQERENPNLTEWDRFAHREYIRLSMEEDAEDASNGSADVWDE  556
            LFNLNKFMAFETRDPFLIRQERE P LTEWDRFAHREYIRLSMEEDAEDASNGS DVWDE
Sbjct  476  LFNLNKFMAFETRDPFLIRQEREEPTLTEWDRFAHREYIRLSMEEDAEDASNGSGDVWDE  535

Query  555  SLEAPF  538
            SLEAPF
Sbjct  536  SLEAPF  541



>ref|NP_851089.1| serine/threonine protein phosphatase 2A regulatory subunit B''beta 
[Arabidopsis thaliana]
 gb|AAL06997.1| AT5g28850/F7P1_30 [Arabidopsis thaliana]
 gb|AAO23892.1| At5g28850/F7P1_30 [Arabidopsis thaliana]
 gb|AED93845.1| protein phosphatase 2A regulatory subunit B' beta [Arabidopsis 
thaliana]
Length=324

 Score =   237 bits (605),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 113/128 (88%), Positives = 121/128 (95%), Gaps = 1/128 (1%)
 Frame = -2

Query  918  RNEMQFFYEEQLHRMECMAQEPVLFEDILCQIVDMISPEEESYVTLRDLKGSKLSGSVFN  739
            RNEMQFFYEEQLHRMECMAQE VLFEDILCQ++DMI PE ES++TL DLKGSKLSG+VFN
Sbjct  197  RNEMQFFYEEQLHRMECMAQEAVLFEDILCQMIDMIGPENESHITLHDLKGSKLSGNVFN  256

Query  738  ILFNLNKFMAFETRDPFLIRQERENPNLTEWDRFAHREYIRLSMEEDAEDASNGSADVWD  559
            ILFNLNKFMAFETRDPFLIRQERENP LT+WDRFAHREYIRLSMEED EDASNGSA+VWD
Sbjct  257  ILFNLNKFMAFETRDPFLIRQERENPTLTDWDRFAHREYIRLSMEEDVEDASNGSAEVWD  316

Query  558  E-SLEAPF  538
            + SLEAPF
Sbjct  317  DSSLEAPF  324



>ref|XP_008644784.1| PREDICTED: serine/threonine protein phosphatase 2A regulatory 
subunit B''alpha-like, partial [Zea mays]
Length=374

 Score =   239 bits (609),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 112/126 (89%), Positives = 117/126 (93%), Gaps = 0/126 (0%)
 Frame = -2

Query  915  NEMQFFYEEQLHRMECMAQEPVLFEDILCQIVDMISPEEESYVTLRDLKGSKLSGSVFNI  736
            NEMQFFYEEQLHRMECMAQEPV+F DILCQ++DMI PE ESY TLRDLK  KLSG++FNI
Sbjct  249  NEMQFFYEEQLHRMECMAQEPVVFGDILCQMIDMIGPENESYFTLRDLKRCKLSGNIFNI  308

Query  735  LFNLNKFMAFETRDPFLIRQERENPNLTEWDRFAHREYIRLSMEEDAEDASNGSADVWDE  556
            LFNLNKFMAFETRDPFLIRQERENP LTEWDRFAHREYIRLSMEED EDASNGS DVWDE
Sbjct  309  LFNLNKFMAFETRDPFLIRQERENPTLTEWDRFAHREYIRLSMEEDGEDASNGSGDVWDE  368

Query  555  SLEAPF  538
            SLEAPF
Sbjct  369  SLEAPF  374



>gb|ERN18799.1| hypothetical protein AMTR_s00067p00087050 [Amborella trichopoda]
Length=472

 Score =   241 bits (616),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 113/126 (90%), Positives = 119/126 (94%), Gaps = 0/126 (0%)
 Frame = -2

Query  915  NEMQFFYEEQLHRMECMAQEPVLFEDILCQIVDMISPEEESYVTLRDLKGSKLSGSVFNI  736
            NEMQFFYEEQLHRMECM+QEPV+FEDILCQ+VDMI PE E Y TLRDLKG KLSG+VFNI
Sbjct  347  NEMQFFYEEQLHRMECMSQEPVIFEDILCQMVDMIGPERECYFTLRDLKGCKLSGNVFNI  406

Query  735  LFNLNKFMAFETRDPFLIRQERENPNLTEWDRFAHREYIRLSMEEDAEDASNGSADVWDE  556
            LFNLNKFMAFETRDPFLIRQERE+P LTEWDRFAHREYIRLSMEED EDASNGSA+VWDE
Sbjct  407  LFNLNKFMAFETRDPFLIRQEREDPTLTEWDRFAHREYIRLSMEEDGEDASNGSAEVWDE  466

Query  555  SLEAPF  538
            SLEAPF
Sbjct  467  SLEAPF  472



>ref|XP_006395035.1| hypothetical protein EUTSA_v10003957mg [Eutrema salsugineum]
 gb|ESQ32321.1| hypothetical protein EUTSA_v10003957mg [Eutrema salsugineum]
Length=541

 Score =   243 bits (621),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 115/127 (91%), Positives = 120/127 (94%), Gaps = 0/127 (0%)
 Frame = -2

Query  918  RNEMQFFYEEQLHRMECMAQEPVLFEDILCQIVDMISPEEESYVTLRDLKGSKLSGSVFN  739
            RNEMQFFYEEQLHRMECMAQE VLFEDILCQI+DMI PE ES++ L DLKGSKLSG+VFN
Sbjct  415  RNEMQFFYEEQLHRMECMAQEAVLFEDILCQIIDMIGPENESHIMLHDLKGSKLSGNVFN  474

Query  738  ILFNLNKFMAFETRDPFLIRQERENPNLTEWDRFAHREYIRLSMEEDAEDASNGSADVWD  559
            ILFNLNKFMAFETRDPFLIRQERENP LTEWDRFAHREYIRLSMEED EDASNGSA+VWD
Sbjct  475  ILFNLNKFMAFETRDPFLIRQERENPTLTEWDRFAHREYIRLSMEEDVEDASNGSAEVWD  534

Query  558  ESLEAPF  538
            ESLEAPF
Sbjct  535  ESLEAPF  541



>ref|XP_002467085.1| hypothetical protein SORBIDRAFT_01g019370 [Sorghum bicolor]
 gb|EER94083.1| hypothetical protein SORBIDRAFT_01g019370 [Sorghum bicolor]
Length=541

 Score =   243 bits (620),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 114/126 (90%), Positives = 118/126 (94%), Gaps = 0/126 (0%)
 Frame = -2

Query  915  NEMQFFYEEQLHRMECMAQEPVLFEDILCQIVDMISPEEESYVTLRDLKGSKLSGSVFNI  736
            NEMQFFYEEQLHRMECMAQEPVLFEDILCQ++DMI PE ESY TLRDLK  KLSG++FNI
Sbjct  416  NEMQFFYEEQLHRMECMAQEPVLFEDILCQMIDMIGPENESYFTLRDLKRCKLSGNIFNI  475

Query  735  LFNLNKFMAFETRDPFLIRQERENPNLTEWDRFAHREYIRLSMEEDAEDASNGSADVWDE  556
            LFNLNKFMAFETRDPFLIRQERENP LTEWDRFAHREYIRLSMEED EDASNGS DVWDE
Sbjct  476  LFNLNKFMAFETRDPFLIRQERENPTLTEWDRFAHREYIRLSMEEDGEDASNGSGDVWDE  535

Query  555  SLEAPF  538
            SLEAPF
Sbjct  536  SLEAPF  541



>ref|XP_009387292.1| PREDICTED: serine/threonine protein phosphatase 2A regulatory 
subunit B''beta-like [Musa acuminata subsp. malaccensis]
Length=542

 Score =   243 bits (620),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 114/126 (90%), Positives = 118/126 (94%), Gaps = 0/126 (0%)
 Frame = -2

Query  915  NEMQFFYEEQLHRMECMAQEPVLFEDILCQIVDMISPEEESYVTLRDLKGSKLSGSVFNI  736
            NEMQFFYEEQLHRMECMAQEPVLFEDILCQ++DMI  E ESY TLRDLKG KLSG+VFNI
Sbjct  417  NEMQFFYEEQLHRMECMAQEPVLFEDILCQMIDMIGSENESYFTLRDLKGCKLSGNVFNI  476

Query  735  LFNLNKFMAFETRDPFLIRQERENPNLTEWDRFAHREYIRLSMEEDAEDASNGSADVWDE  556
            LFNLNKFMAFETRDPFLIRQERENP LTEWDRFAHREYIRLSMEED EDASNGS D+WDE
Sbjct  477  LFNLNKFMAFETRDPFLIRQERENPTLTEWDRFAHREYIRLSMEEDGEDASNGSGDIWDE  536

Query  555  SLEAPF  538
            SLEAPF
Sbjct  537  SLEAPF  542



>gb|KJB26598.1| hypothetical protein B456_004G249400 [Gossypium raimondii]
Length=539

 Score =   243 bits (619),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 114/127 (90%), Positives = 121/127 (95%), Gaps = 0/127 (0%)
 Frame = -2

Query  918  RNEMQFFYEEQLHRMECMAQEPVLFEDILCQIVDMISPEEESYVTLRDLKGSKLSGSVFN  739
            RNEMQFFYEEQLHRMECMAQEPV FEDILCQI+DMI PE++S +TLRDLKGSKLSG+ FN
Sbjct  413  RNEMQFFYEEQLHRMECMAQEPVFFEDILCQIMDMIKPEDDSCITLRDLKGSKLSGNAFN  472

Query  738  ILFNLNKFMAFETRDPFLIRQERENPNLTEWDRFAHREYIRLSMEEDAEDASNGSADVWD  559
            ILFNLNKFMAFE+RDPFLIRQERENP LTEWDRFAHREYIRLSMEED EDASNGSA+VWD
Sbjct  473  ILFNLNKFMAFESRDPFLIRQERENPTLTEWDRFAHREYIRLSMEEDVEDASNGSAEVWD  532

Query  558  ESLEAPF  538
            ESLEAPF
Sbjct  533  ESLEAPF  539



>ref|XP_004982873.1| PREDICTED: serine/threonine-protein phosphatase 2A regulatory 
subunit B'' subunit alpha-like [Setaria italica]
Length=541

 Score =   243 bits (619),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 114/126 (90%), Positives = 118/126 (94%), Gaps = 0/126 (0%)
 Frame = -2

Query  915  NEMQFFYEEQLHRMECMAQEPVLFEDILCQIVDMISPEEESYVTLRDLKGSKLSGSVFNI  736
            NEMQFFYEEQLHRMECMAQEPVLFEDILCQ++DMI PE ESY TLRDLK  KLSG++FNI
Sbjct  416  NEMQFFYEEQLHRMECMAQEPVLFEDILCQMIDMIGPENESYFTLRDLKRCKLSGNIFNI  475

Query  735  LFNLNKFMAFETRDPFLIRQERENPNLTEWDRFAHREYIRLSMEEDAEDASNGSADVWDE  556
            LFNLNKFMAFETRDPFLIRQERENP LTEWDRFAHREYIRLSMEED EDASNGS DVWDE
Sbjct  476  LFNLNKFMAFETRDPFLIRQERENPTLTEWDRFAHREYIRLSMEEDGEDASNGSGDVWDE  535

Query  555  SLEAPF  538
            SLEAPF
Sbjct  536  SLEAPF  541



>ref|XP_004494751.1| PREDICTED: serine/threonine-protein phosphatase 2A regulatory 
subunit B'' subunit alpha-like [Cicer arietinum]
Length=537

 Score =   243 bits (619),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 113/127 (89%), Positives = 119/127 (94%), Gaps = 0/127 (0%)
 Frame = -2

Query  918  RNEMQFFYEEQLHRMECMAQEPVLFEDILCQIVDMISPEEESYVTLRDLKGSKLSGSVFN  739
            RNE+QFFYEEQLHRMECMAQEPVLFEDILCQI+DMI  E ESY+TL DLKG KLSGS+FN
Sbjct  411  RNELQFFYEEQLHRMECMAQEPVLFEDILCQIIDMIGSENESYITLLDLKGGKLSGSIFN  470

Query  738  ILFNLNKFMAFETRDPFLIRQERENPNLTEWDRFAHREYIRLSMEEDAEDASNGSADVWD  559
            ILFNLNKFMAFE+RDPFLIRQERENP LTEWDRFAHREYIRLSMEED ED SNGSA+VWD
Sbjct  471  ILFNLNKFMAFESRDPFLIRQERENPTLTEWDRFAHREYIRLSMEEDVEDVSNGSAEVWD  530

Query  558  ESLEAPF  538
            ESLEAPF
Sbjct  531  ESLEAPF  537



>ref|XP_011628172.1| PREDICTED: serine/threonine protein phosphatase 2A regulatory 
subunit B''beta [Amborella trichopoda]
Length=505

 Score =   241 bits (616),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 113/126 (90%), Positives = 119/126 (94%), Gaps = 0/126 (0%)
 Frame = -2

Query  915  NEMQFFYEEQLHRMECMAQEPVLFEDILCQIVDMISPEEESYVTLRDLKGSKLSGSVFNI  736
            NEMQFFYEEQLHRMECM+QEPV+FEDILCQ+VDMI PE E Y TLRDLKG KLSG+VFNI
Sbjct  380  NEMQFFYEEQLHRMECMSQEPVIFEDILCQMVDMIGPERECYFTLRDLKGCKLSGNVFNI  439

Query  735  LFNLNKFMAFETRDPFLIRQERENPNLTEWDRFAHREYIRLSMEEDAEDASNGSADVWDE  556
            LFNLNKFMAFETRDPFLIRQERE+P LTEWDRFAHREYIRLSMEED EDASNGSA+VWDE
Sbjct  440  LFNLNKFMAFETRDPFLIRQEREDPTLTEWDRFAHREYIRLSMEEDGEDASNGSAEVWDE  499

Query  555  SLEAPF  538
            SLEAPF
Sbjct  500  SLEAPF  505



>gb|KJB11371.1| hypothetical protein B456_001G254900 [Gossypium raimondii]
 gb|KJB11375.1| hypothetical protein B456_001G254900 [Gossypium raimondii]
Length=345

 Score =   237 bits (604),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 112/126 (89%), Positives = 120/126 (95%), Gaps = 0/126 (0%)
 Frame = -2

Query  915  NEMQFFYEEQLHRMECMAQEPVLFEDILCQIVDMISPEEESYVTLRDLKGSKLSGSVFNI  736
            NEMQFFYEEQLHRMEC+A EPVLFEDILCQI+DMI+PE E  +TL+DLKGSKLSG+VFNI
Sbjct  220  NEMQFFYEEQLHRMECLALEPVLFEDILCQIIDMIAPEREDCITLQDLKGSKLSGNVFNI  279

Query  735  LFNLNKFMAFETRDPFLIRQERENPNLTEWDRFAHREYIRLSMEEDAEDASNGSADVWDE  556
            LFNLNKF+AFETRDPFLIRQERE+P LTEWDRFAHREYIRLSMEED EDASNGSADVWDE
Sbjct  280  LFNLNKFVAFETRDPFLIRQEREDPTLTEWDRFAHREYIRLSMEEDVEDASNGSADVWDE  339

Query  555  SLEAPF  538
            SLEAPF
Sbjct  340  SLEAPF  345



>gb|EMT07773.1| Serine/threonine-protein phosphatase 2A regulatory subunit B'' 
subunit alpha [Aegilops tauschii]
Length=595

 Score =   243 bits (621),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 113/126 (90%), Positives = 118/126 (94%), Gaps = 0/126 (0%)
 Frame = -2

Query  915  NEMQFFYEEQLHRMECMAQEPVLFEDILCQIVDMISPEEESYVTLRDLKGSKLSGSVFNI  736
            NEMQFFYEEQLHRMECMAQEPVLFEDILCQ++DMI PE E+Y TLRDLK  KLSG++FNI
Sbjct  470  NEMQFFYEEQLHRMECMAQEPVLFEDILCQMIDMIGPENETYFTLRDLKKCKLSGNIFNI  529

Query  735  LFNLNKFMAFETRDPFLIRQERENPNLTEWDRFAHREYIRLSMEEDAEDASNGSADVWDE  556
            LFNLNKFMAFETRDPFLIRQERENP LTEWDRFAHREYIRLSMEED EDASNGS DVWDE
Sbjct  530  LFNLNKFMAFETRDPFLIRQERENPTLTEWDRFAHREYIRLSMEEDGEDASNGSGDVWDE  589

Query  555  SLEAPF  538
            SLEAPF
Sbjct  590  SLEAPF  595



>gb|EMS52372.1| Serine/threonine-protein phosphatase 2A regulatory subunit B'' 
subunit alpha [Triticum urartu]
Length=595

 Score =   243 bits (620),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 113/126 (90%), Positives = 118/126 (94%), Gaps = 0/126 (0%)
 Frame = -2

Query  915  NEMQFFYEEQLHRMECMAQEPVLFEDILCQIVDMISPEEESYVTLRDLKGSKLSGSVFNI  736
            NEMQFFYEEQLHRMECMAQEPVLFEDILCQ++DMI PE E+Y TLRDLK  KLSG++FNI
Sbjct  470  NEMQFFYEEQLHRMECMAQEPVLFEDILCQMIDMIGPENETYFTLRDLKKCKLSGNIFNI  529

Query  735  LFNLNKFMAFETRDPFLIRQERENPNLTEWDRFAHREYIRLSMEEDAEDASNGSADVWDE  556
            LFNLNKFMAFETRDPFLIRQERENP LTEWDRFAHREYIRLSMEED EDASNGS DVWDE
Sbjct  530  LFNLNKFMAFETRDPFLIRQERENPTLTEWDRFAHREYIRLSMEEDGEDASNGSGDVWDE  589

Query  555  SLEAPF  538
            SLEAPF
Sbjct  590  SLEAPF  595



>ref|XP_006489708.1| PREDICTED: probable serine/threonine protein phosphatase 2A regulatory 
subunit B''delta-like isoform X3 [Citrus sinensis]
Length=332

 Score =   236 bits (601),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 108/126 (86%), Positives = 118/126 (94%), Gaps = 0/126 (0%)
 Frame = -2

Query  915  NEMQFFYEEQLHRMECMAQEPVLFEDILCQIVDMISPEEESYVTLRDLKGSKLSGSVFNI  736
            NE+Q+FYEEQLHRMECMAQEPVLFED+LCQIVDMI PE + Y+TL DLKG KLSG+VFNI
Sbjct  207  NELQYFYEEQLHRMECMAQEPVLFEDVLCQIVDMIGPENQGYITLCDLKGCKLSGNVFNI  266

Query  735  LFNLNKFMAFETRDPFLIRQERENPNLTEWDRFAHREYIRLSMEEDAEDASNGSADVWDE  556
            LFNLNKF+AFE+RDPFLIRQERENP LTEWDRFAHREYIRLSMEEDAE+ SNGS D+WDE
Sbjct  267  LFNLNKFIAFESRDPFLIRQERENPTLTEWDRFAHREYIRLSMEEDAENVSNGSGDIWDE  326

Query  555  SLEAPF  538
            SLEAPF
Sbjct  327  SLEAPF  332



>dbj|BAJ95594.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ91708.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=541

 Score =   242 bits (617),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 113/126 (90%), Positives = 118/126 (94%), Gaps = 0/126 (0%)
 Frame = -2

Query  915  NEMQFFYEEQLHRMECMAQEPVLFEDILCQIVDMISPEEESYVTLRDLKGSKLSGSVFNI  736
            NEMQFFYEEQLHRMECMAQEPVLFEDILCQ++DMI PE E+Y TLRDLK  KLSG++FNI
Sbjct  416  NEMQFFYEEQLHRMECMAQEPVLFEDILCQMIDMIGPENETYFTLRDLKRCKLSGNIFNI  475

Query  735  LFNLNKFMAFETRDPFLIRQERENPNLTEWDRFAHREYIRLSMEEDAEDASNGSADVWDE  556
            LFNLNKFMAFETRDPFLIRQERENP LTEWDRFAHREYIRLSMEED EDASNGS DVWDE
Sbjct  476  LFNLNKFMAFETRDPFLIRQERENPTLTEWDRFAHREYIRLSMEEDGEDASNGSGDVWDE  535

Query  555  SLEAPF  538
            SLEAPF
Sbjct  536  SLEAPF  541



>ref|XP_008664881.1| PREDICTED: probable serine/threonine protein phosphatase 2A regulatory 
subunit B''delta [Zea mays]
 tpg|DAA49641.1| TPA: hypothetical protein ZEAMMB73_593702 [Zea mays]
Length=540

 Score =   241 bits (615),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 113/126 (90%), Positives = 118/126 (94%), Gaps = 0/126 (0%)
 Frame = -2

Query  915  NEMQFFYEEQLHRMECMAQEPVLFEDILCQIVDMISPEEESYVTLRDLKGSKLSGSVFNI  736
            NEMQFFYEEQLHRMECMAQEPVLF DILCQ++DMI PE ESY+TLRDLK  KLSG++FNI
Sbjct  415  NEMQFFYEEQLHRMECMAQEPVLFLDILCQMIDMIGPENESYLTLRDLKRCKLSGNIFNI  474

Query  735  LFNLNKFMAFETRDPFLIRQERENPNLTEWDRFAHREYIRLSMEEDAEDASNGSADVWDE  556
            LFNLNKFMAFETRDPFLIRQERENP LTEWDRFAHREYIRLSMEED EDASNGS DVWDE
Sbjct  475  LFNLNKFMAFETRDPFLIRQERENPTLTEWDRFAHREYIRLSMEEDGEDASNGSGDVWDE  534

Query  555  SLEAPF  538
            SLEAPF
Sbjct  535  SLEAPF  540



>ref|XP_006661862.1| PREDICTED: probable serine/threonine protein phosphatase 2A regulatory 
subunit B''delta-like [Oryza brachyantha]
Length=541

 Score =   241 bits (615),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 113/126 (90%), Positives = 117/126 (93%), Gaps = 0/126 (0%)
 Frame = -2

Query  915  NEMQFFYEEQLHRMECMAQEPVLFEDILCQIVDMISPEEESYVTLRDLKGSKLSGSVFNI  736
            NEMQFFYEEQLHRMECMAQEPVLFEDILCQ++DMI PE E Y TLRDLK  KLSG++FNI
Sbjct  416  NEMQFFYEEQLHRMECMAQEPVLFEDILCQMIDMIGPENECYFTLRDLKRCKLSGNIFNI  475

Query  735  LFNLNKFMAFETRDPFLIRQERENPNLTEWDRFAHREYIRLSMEEDAEDASNGSADVWDE  556
            LFNLNKFMAFETRDPFLIRQERENP LTEWDRFAHREYIRLSMEED EDASNGS DVWDE
Sbjct  476  LFNLNKFMAFETRDPFLIRQERENPTLTEWDRFAHREYIRLSMEEDGEDASNGSGDVWDE  535

Query  555  SLEAPF  538
            SLEAPF
Sbjct  536  SLEAPF  541



>ref|XP_002529841.1| calcium ion binding protein, putative [Ricinus communis]
 gb|EEF32542.1| calcium ion binding protein, putative [Ricinus communis]
Length=545

 Score =   241 bits (615),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 112/127 (88%), Positives = 122/127 (96%), Gaps = 0/127 (0%)
 Frame = -2

Query  918  RNEMQFFYEEQLHRMECMAQEPVLFEDILCQIVDMISPEEESYVTLRDLKGSKLSGSVFN  739
            RNEMQFFYEEQLHRMECMAQE V+FED+LCQIVDMI+PE+E+Y+TL+DLKGSKLSG+VFN
Sbjct  419  RNEMQFFYEEQLHRMECMAQEAVVFEDVLCQIVDMIAPEKENYITLQDLKGSKLSGNVFN  478

Query  738  ILFNLNKFMAFETRDPFLIRQERENPNLTEWDRFAHREYIRLSMEEDAEDASNGSADVWD  559
            ILFNLNKFMAFE+RDPFLIRQERE+P LTEWDRFAHREYIRLSMEED ED SNGS DVWD
Sbjct  479  ILFNLNKFMAFESRDPFLIRQEREDPTLTEWDRFAHREYIRLSMEEDVEDVSNGSVDVWD  538

Query  558  ESLEAPF  538
            ESLEAPF
Sbjct  539  ESLEAPF  545



>gb|EEC67163.1| hypothetical protein OsI_34023 [Oryza sativa Indica Group]
Length=461

 Score =   239 bits (609),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 112/126 (89%), Positives = 116/126 (92%), Gaps = 0/126 (0%)
 Frame = -2

Query  915  NEMQFFYEEQLHRMECMAQEPVLFEDILCQIVDMISPEEESYVTLRDLKGSKLSGSVFNI  736
             EMQFFYEEQLHRMECMAQEPVLFEDILCQ++DMI PE E Y TLRDLK  KLSG++FNI
Sbjct  336  TEMQFFYEEQLHRMECMAQEPVLFEDILCQMIDMIGPENECYFTLRDLKRCKLSGNIFNI  395

Query  735  LFNLNKFMAFETRDPFLIRQERENPNLTEWDRFAHREYIRLSMEEDAEDASNGSADVWDE  556
            LFNLNKFMAFETRDPFLIRQERENP LTEWDRFAHREYIRLSMEED EDASNGS DVWDE
Sbjct  396  LFNLNKFMAFETRDPFLIRQERENPTLTEWDRFAHREYIRLSMEEDGEDASNGSGDVWDE  455

Query  555  SLEAPF  538
            SLEAPF
Sbjct  456  SLEAPF  461



>ref|XP_003536224.1| PREDICTED: probable serine/threonine protein phosphatase 2A regulatory 
subunit B''gamma-like [Glycine max]
Length=541

 Score =   241 bits (615),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 112/126 (89%), Positives = 119/126 (94%), Gaps = 0/126 (0%)
 Frame = -2

Query  915  NEMQFFYEEQLHRMECMAQEPVLFEDILCQIVDMISPEEESYVTLRDLKGSKLSGSVFNI  736
            NEMQFFYEEQLHRMECMAQEPVLFEDILCQIVDMI PE E Y+T+RD+KGSKLSG+VFNI
Sbjct  416  NEMQFFYEEQLHRMECMAQEPVLFEDILCQIVDMIGPENEGYITIRDVKGSKLSGNVFNI  475

Query  735  LFNLNKFMAFETRDPFLIRQERENPNLTEWDRFAHREYIRLSMEEDAEDASNGSADVWDE  556
            LFNLNKF+AFETRDPFLIRQERE+PNLTEWDRFAHREYIRLSMEED ED SN S DVW+E
Sbjct  476  LFNLNKFIAFETRDPFLIRQEREDPNLTEWDRFAHREYIRLSMEEDGEDMSNASGDVWEE  535

Query  555  SLEAPF  538
            SLEAPF
Sbjct  536  SLEAPF  541



>ref|XP_009111902.1| PREDICTED: serine/threonine protein phosphatase 2A regulatory 
subunit B''beta-like [Brassica rapa]
 ref|XP_009111903.1| PREDICTED: serine/threonine protein phosphatase 2A regulatory 
subunit B''beta-like [Brassica rapa]
 emb|CDY57012.1| BnaA09g03510D [Brassica napus]
Length=537

 Score =   241 bits (614),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 114/127 (90%), Positives = 119/127 (94%), Gaps = 0/127 (0%)
 Frame = -2

Query  918  RNEMQFFYEEQLHRMECMAQEPVLFEDILCQIVDMISPEEESYVTLRDLKGSKLSGSVFN  739
            RNEMQFFYEEQL RMECMAQE VLFEDILCQ++DMI PE ESYVTL DLKGSKLSG+VFN
Sbjct  411  RNEMQFFYEEQLRRMECMAQEAVLFEDILCQMIDMIGPENESYVTLHDLKGSKLSGNVFN  470

Query  738  ILFNLNKFMAFETRDPFLIRQERENPNLTEWDRFAHREYIRLSMEEDAEDASNGSADVWD  559
            ILFNLNKFMAFETRDPFLIRQERENP LTEWDRFAHREYIRLSMEED EDASNGSA+ WD
Sbjct  471  ILFNLNKFMAFETRDPFLIRQERENPTLTEWDRFAHREYIRLSMEEDVEDASNGSAEAWD  530

Query  558  ESLEAPF  538
            ESLE+PF
Sbjct  531  ESLESPF  537



>ref|XP_003556377.1| PREDICTED: probable serine/threonine protein phosphatase 2A regulatory 
subunit B''gamma-like isoform X1 [Glycine max]
 ref|XP_006606383.1| PREDICTED: probable serine/threonine protein phosphatase 2A regulatory 
subunit B''gamma-like isoform X2 [Glycine max]
Length=540

 Score =   241 bits (614),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 112/126 (89%), Positives = 118/126 (94%), Gaps = 0/126 (0%)
 Frame = -2

Query  915  NEMQFFYEEQLHRMECMAQEPVLFEDILCQIVDMISPEEESYVTLRDLKGSKLSGSVFNI  736
            NEMQFFYEEQLHRMECMAQEPVLFEDILCQIVDMI PE E Y+TLRD+KGSKLSG+VFNI
Sbjct  415  NEMQFFYEEQLHRMECMAQEPVLFEDILCQIVDMIGPENEGYITLRDVKGSKLSGNVFNI  474

Query  735  LFNLNKFMAFETRDPFLIRQERENPNLTEWDRFAHREYIRLSMEEDAEDASNGSADVWDE  556
            LFNLNKF+ FETRDPFLIRQERE+PNLTEWDRFAHREYIRLSMEED ED SN S DVW+E
Sbjct  475  LFNLNKFITFETRDPFLIRQEREDPNLTEWDRFAHREYIRLSMEEDGEDMSNASGDVWEE  534

Query  555  SLEAPF  538
            SLEAPF
Sbjct  535  SLEAPF  540



>ref|XP_012069859.1| PREDICTED: serine/threonine protein phosphatase 2A regulatory 
subunit B''beta-like [Jatropha curcas]
 gb|KDP40349.1| hypothetical protein JCGZ_02347 [Jatropha curcas]
Length=540

 Score =   241 bits (614),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 109/127 (86%), Positives = 119/127 (94%), Gaps = 0/127 (0%)
 Frame = -2

Query  918  RNEMQFFYEEQLHRMECMAQEPVLFEDILCQIVDMISPEEESYVTLRDLKGSKLSGSVFN  739
            +NEMQFFYEEQLHRMECMAQEPVLFEDILCQ+VDMI P+ E Y+TLRD+KGSKL+  VFN
Sbjct  414  KNEMQFFYEEQLHRMECMAQEPVLFEDILCQMVDMIGPQNEGYITLRDMKGSKLAAHVFN  473

Query  738  ILFNLNKFMAFETRDPFLIRQERENPNLTEWDRFAHREYIRLSMEEDAEDASNGSADVWD  559
            ILFNLN+F+AFE+RDPFLIRQERENP LTEWDRFAHREYIRLSMEED EDASNGSAD+WD
Sbjct  474  ILFNLNRFIAFESRDPFLIRQERENPTLTEWDRFAHREYIRLSMEEDGEDASNGSADIWD  533

Query  558  ESLEAPF  538
            ES EAPF
Sbjct  534  ESFEAPF  540



>ref|XP_010234819.1| PREDICTED: probable serine/threonine protein phosphatase 2A regulatory 
subunit B''delta isoform X2 [Brachypodium distachyon]
Length=537

 Score =   240 bits (613),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 112/126 (89%), Positives = 117/126 (93%), Gaps = 0/126 (0%)
 Frame = -2

Query  915  NEMQFFYEEQLHRMECMAQEPVLFEDILCQIVDMISPEEESYVTLRDLKGSKLSGSVFNI  736
            NEMQFFYEEQLHRMECM QEPVLFEDILCQ++DMI PE E+Y TLRDLK  KLSG++FNI
Sbjct  412  NEMQFFYEEQLHRMECMGQEPVLFEDILCQMIDMIGPENETYFTLRDLKRCKLSGNIFNI  471

Query  735  LFNLNKFMAFETRDPFLIRQERENPNLTEWDRFAHREYIRLSMEEDAEDASNGSADVWDE  556
            LFNLNKFMAFETRDPFLIRQERENP LTEWDRFAHREYIRLSMEED EDASNGS DVWDE
Sbjct  472  LFNLNKFMAFETRDPFLIRQERENPTLTEWDRFAHREYIRLSMEEDGEDASNGSGDVWDE  531

Query  555  SLEAPF  538
            SLEAPF
Sbjct  532  SLEAPF  537



>ref|XP_003574057.1| PREDICTED: probable serine/threonine protein phosphatase 2A regulatory 
subunit B''delta isoform X1 [Brachypodium distachyon]
Length=541

 Score =   240 bits (613),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 112/126 (89%), Positives = 117/126 (93%), Gaps = 0/126 (0%)
 Frame = -2

Query  915  NEMQFFYEEQLHRMECMAQEPVLFEDILCQIVDMISPEEESYVTLRDLKGSKLSGSVFNI  736
            NEMQFFYEEQLHRMECM QEPVLFEDILCQ++DMI PE E+Y TLRDLK  KLSG++FNI
Sbjct  416  NEMQFFYEEQLHRMECMGQEPVLFEDILCQMIDMIGPENETYFTLRDLKRCKLSGNIFNI  475

Query  735  LFNLNKFMAFETRDPFLIRQERENPNLTEWDRFAHREYIRLSMEEDAEDASNGSADVWDE  556
            LFNLNKFMAFETRDPFLIRQERENP LTEWDRFAHREYIRLSMEED EDASNGS DVWDE
Sbjct  476  LFNLNKFMAFETRDPFLIRQERENPTLTEWDRFAHREYIRLSMEEDGEDASNGSGDVWDE  535

Query  555  SLEAPF  538
            SLEAPF
Sbjct  536  SLEAPF  541



>gb|KJB72387.1| hypothetical protein B456_011G175300 [Gossypium raimondii]
 gb|KJB72388.1| hypothetical protein B456_011G175300 [Gossypium raimondii]
Length=535

 Score =   240 bits (613),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 111/126 (88%), Positives = 116/126 (92%), Gaps = 0/126 (0%)
 Frame = -2

Query  915  NEMQFFYEEQLHRMECMAQEPVLFEDILCQIVDMISPEEESYVTLRDLKGSKLSGSVFNI  736
            NEMQFFYEEQLHRMECM QEPVLFEDILCQI DMI PE E Y+TLRDLKG KLSG+VFNI
Sbjct  410  NEMQFFYEEQLHRMECMTQEPVLFEDILCQIFDMIGPENEGYITLRDLKGCKLSGNVFNI  469

Query  735  LFNLNKFMAFETRDPFLIRQERENPNLTEWDRFAHREYIRLSMEEDAEDASNGSADVWDE  556
            LFNLNKF+AFE+RDPFLIRQERENP LTEWDRFAHREYIRLSMEED EDASNGS D+WDE
Sbjct  470  LFNLNKFIAFESRDPFLIRQERENPTLTEWDRFAHREYIRLSMEEDVEDASNGSGDIWDE  529

Query  555  SLEAPF  538
            S EAPF
Sbjct  530  SFEAPF  535



>ref|XP_007035142.1| Calcium-binding EF-hand family protein isoform 3 [Theobroma cacao]
 gb|EOY06068.1| Calcium-binding EF-hand family protein isoform 3 [Theobroma cacao]
Length=485

 Score =   239 bits (609),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 111/126 (88%), Positives = 116/126 (92%), Gaps = 0/126 (0%)
 Frame = -2

Query  915  NEMQFFYEEQLHRMECMAQEPVLFEDILCQIVDMISPEEESYVTLRDLKGSKLSGSVFNI  736
             EMQFFYEEQL RMECMAQEPVLFEDILCQIVDMI PE E Y+TLRDLKG KLSG+VFNI
Sbjct  360  TEMQFFYEEQLRRMECMAQEPVLFEDILCQIVDMIGPENEGYITLRDLKGCKLSGNVFNI  419

Query  735  LFNLNKFMAFETRDPFLIRQERENPNLTEWDRFAHREYIRLSMEEDAEDASNGSADVWDE  556
            LFNLNKF+AFE+RDPFLIRQERENP LTEWDRFAHREYIRLSMEED EDASNGS D+WDE
Sbjct  420  LFNLNKFIAFESRDPFLIRQERENPTLTEWDRFAHREYIRLSMEEDVEDASNGSGDIWDE  479

Query  555  SLEAPF  538
            S EAPF
Sbjct  480  SFEAPF  485



>gb|KHF99466.1| Serine/threonine-protein phosphatase 2A regulatory subunit B'' 
subunit alpha [Gossypium arboreum]
Length=545

 Score =   240 bits (612),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 113/126 (90%), Positives = 120/126 (95%), Gaps = 0/126 (0%)
 Frame = -2

Query  915  NEMQFFYEEQLHRMECMAQEPVLFEDILCQIVDMISPEEESYVTLRDLKGSKLSGSVFNI  736
            NEMQFFYEEQLHRMEC+A EPVLFEDILCQI+DMI+PE E  +TL+DLKGSKLSG+VFNI
Sbjct  420  NEMQFFYEEQLHRMECLALEPVLFEDILCQIIDMIAPEREDCITLQDLKGSKLSGNVFNI  479

Query  735  LFNLNKFMAFETRDPFLIRQERENPNLTEWDRFAHREYIRLSMEEDAEDASNGSADVWDE  556
            LFNLNKFMAFETRDPFLIRQERE+P LTEWDRFAHREYIRLSMEED EDASNGSADVWDE
Sbjct  480  LFNLNKFMAFETRDPFLIRQEREDPTLTEWDRFAHREYIRLSMEEDVEDASNGSADVWDE  539

Query  555  SLEAPF  538
            SLEAPF
Sbjct  540  SLEAPF  545



>ref|XP_003626459.1| Serine/threonine protein phosphatase 2A regulatory subunit B' 
subunit beta [Medicago truncatula]
Length=627

 Score =   241 bits (616),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 117/148 (79%), Positives = 125/148 (84%), Gaps = 5/148 (3%)
 Frame = -2

Query  918  RNEMQFFYEEQLHRMECMAQEPVLFEDILCQIVDMISPEEESYVTLRDLKGSKLSGSVFN  739
            RNE+QFFYEEQLHRMECMAQEPVLFEDILCQI+DMI  E ESY+TLRDLKG KLSGSVFN
Sbjct  429  RNELQFFYEEQLHRMECMAQEPVLFEDILCQIIDMIRSENESYITLRDLKGGKLSGSVFN  488

Query  738  ILFNLNKFMAFETRDPFLIRQERENPNLTEWDRFAHREYIRLSMEEDAEDASNGSADVWD  559
            ILFNLNKFMAFETRDPFLIRQERENP LTEWDRFAHREYIRLSMEED ED SNGSA+VWD
Sbjct  489  ILFNLNKFMAFETRDPFLIRQERENPTLTEWDRFAHREYIRLSMEEDVEDVSNGSAEVWD  548

Query  558  ESLEAPF*VLVVSYAKYMKGDCREFYLA  475
            ESLE      +  Y +     CRE+ + 
Sbjct  549  ESLE-----FMKRYQRPRSDGCREYRVG  571



>gb|KJB11374.1| hypothetical protein B456_001G254900 [Gossypium raimondii]
Length=456

 Score =   237 bits (605),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 112/126 (89%), Positives = 120/126 (95%), Gaps = 0/126 (0%)
 Frame = -2

Query  915  NEMQFFYEEQLHRMECMAQEPVLFEDILCQIVDMISPEEESYVTLRDLKGSKLSGSVFNI  736
            NEMQFFYEEQLHRMEC+A EPVLFEDILCQI+DMI+PE E  +TL+DLKGSKLSG+VFNI
Sbjct  331  NEMQFFYEEQLHRMECLALEPVLFEDILCQIIDMIAPEREDCITLQDLKGSKLSGNVFNI  390

Query  735  LFNLNKFMAFETRDPFLIRQERENPNLTEWDRFAHREYIRLSMEEDAEDASNGSADVWDE  556
            LFNLNKF+AFETRDPFLIRQERE+P LTEWDRFAHREYIRLSMEED EDASNGSADVWDE
Sbjct  391  LFNLNKFVAFETRDPFLIRQEREDPTLTEWDRFAHREYIRLSMEEDVEDASNGSADVWDE  450

Query  555  SLEAPF  538
            SLEAPF
Sbjct  451  SLEAPF  456



>ref|XP_010455206.1| PREDICTED: serine/threonine protein phosphatase 2A regulatory 
subunit B''beta-like [Camelina sativa]
Length=541

 Score =   239 bits (610),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 115/128 (90%), Positives = 121/128 (95%), Gaps = 1/128 (1%)
 Frame = -2

Query  918  RNEMQFFYEEQLHRMECMAQEPVLFEDILCQIVDMISPEEESYVTLRDLKGSKLSGSVFN  739
            RNEMQFFYEEQLHRMECMAQE VLFEDILCQ++DMI PE ES++TL DLKGSKLSG+VFN
Sbjct  414  RNEMQFFYEEQLHRMECMAQEAVLFEDILCQMIDMIGPENESHITLHDLKGSKLSGNVFN  473

Query  738  ILFNLNKFMAFETRDPFLIRQERENPNLTEWDRFAHREYIRLSMEEDAEDASNGSADVWD  559
            ILFNLNKFMAFETRDPFLIRQERENP LTEWDRFAHREYIRLSMEED EDASNGSA+VWD
Sbjct  474  ILFNLNKFMAFETRDPFLIRQERENPTLTEWDRFAHREYIRLSMEEDVEDASNGSAEVWD  533

Query  558  E-SLEAPF  538
            E SLEAPF
Sbjct  534  ESSLEAPF  541



>ref|XP_010494119.1| PREDICTED: serine/threonine protein phosphatase 2A regulatory 
subunit B''beta-like [Camelina sativa]
Length=539

 Score =   239 bits (610),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 115/128 (90%), Positives = 121/128 (95%), Gaps = 1/128 (1%)
 Frame = -2

Query  918  RNEMQFFYEEQLHRMECMAQEPVLFEDILCQIVDMISPEEESYVTLRDLKGSKLSGSVFN  739
            RNEMQFFYEEQLHRMECMAQE VLFEDILCQ++DMI PE ES++TL DLKGSKLSG+VFN
Sbjct  412  RNEMQFFYEEQLHRMECMAQEAVLFEDILCQMIDMIGPENESHITLHDLKGSKLSGNVFN  471

Query  738  ILFNLNKFMAFETRDPFLIRQERENPNLTEWDRFAHREYIRLSMEEDAEDASNGSADVWD  559
            ILFNLNKFMAFETRDPFLIRQERENP LTEWDRFAHREYIRLSMEED EDASNGSA+VWD
Sbjct  472  ILFNLNKFMAFETRDPFLIRQERENPTLTEWDRFAHREYIRLSMEEDVEDASNGSAEVWD  531

Query  558  E-SLEAPF  538
            E SLEAPF
Sbjct  532  ESSLEAPF  539



>gb|KHG27042.1| Serine/threonine-protein phosphatase 2A regulatory subunit B'' 
subunit alpha [Gossypium arboreum]
Length=533

 Score =   239 bits (610),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 110/126 (87%), Positives = 116/126 (92%), Gaps = 0/126 (0%)
 Frame = -2

Query  915  NEMQFFYEEQLHRMECMAQEPVLFEDILCQIVDMISPEEESYVTLRDLKGSKLSGSVFNI  736
            NEMQFFYEEQLHRMECM QEPVLFEDILCQI DMI PE + Y+TLRDLKG KLSG+VFNI
Sbjct  408  NEMQFFYEEQLHRMECMTQEPVLFEDILCQIFDMIGPENDGYITLRDLKGCKLSGNVFNI  467

Query  735  LFNLNKFMAFETRDPFLIRQERENPNLTEWDRFAHREYIRLSMEEDAEDASNGSADVWDE  556
            LFNLNKF+AFE+RDPFLIRQERENP LTEWDRFAHREYIRLSMEED EDASNGS D+WDE
Sbjct  468  LFNLNKFIAFESRDPFLIRQERENPTLTEWDRFAHREYIRLSMEEDVEDASNGSGDIWDE  527

Query  555  SLEAPF  538
            S EAPF
Sbjct  528  SFEAPF  533



>emb|CBI22370.3| unnamed protein product [Vitis vinifera]
Length=2099

 Score =   249 bits (637),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 119/127 (94%), Positives = 122/127 (96%), Gaps = 0/127 (0%)
 Frame = -2

Query  918   RNEMQFFYEEQLHRMECMAQEPVLFEDILCQIVDMISPEEESYVTLRDLKGSKLSGSVFN  739
             RNEMQFFYEEQLHRMECMAQEPVLFEDILCQIVDMI PE ESY+TLRDLKG KLSGSVFN
Sbjct  1973  RNEMQFFYEEQLHRMECMAQEPVLFEDILCQIVDMIGPENESYITLRDLKGCKLSGSVFN  2032

Query  738   ILFNLNKFMAFETRDPFLIRQERENPNLTEWDRFAHREYIRLSMEEDAEDASNGSADVWD  559
             ILFNLNKFMAFETRDPFLIRQERENP LTEWDRFAHREYIRLSMEED E+ASNGSA+VWD
Sbjct  2033  ILFNLNKFMAFETRDPFLIRQERENPTLTEWDRFAHREYIRLSMEEDVEEASNGSAEVWD  2092

Query  558   ESLEAPF  538
             ESLEAPF
Sbjct  2093  ESLEAPF  2099



>ref|XP_008785214.1| PREDICTED: serine/threonine protein phosphatase 2A regulatory 
subunit B''beta-like isoform X1 [Phoenix dactylifera]
 ref|XP_008785215.1| PREDICTED: serine/threonine protein phosphatase 2A regulatory 
subunit B''beta-like isoform X1 [Phoenix dactylifera]
 ref|XP_008785216.1| PREDICTED: serine/threonine protein phosphatase 2A regulatory 
subunit B''beta-like isoform X1 [Phoenix dactylifera]
 ref|XP_008785217.1| PREDICTED: serine/threonine protein phosphatase 2A regulatory 
subunit B''beta-like isoform X1 [Phoenix dactylifera]
Length=554

 Score =   239 bits (611),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 112/126 (89%), Positives = 119/126 (94%), Gaps = 0/126 (0%)
 Frame = -2

Query  915  NEMQFFYEEQLHRMECMAQEPVLFEDILCQIVDMISPEEESYVTLRDLKGSKLSGSVFNI  736
            NEMQFFYEEQLHRMECM QEPVLFEDILCQ++DMI+PE ES+ +LRDLKG+KLSG+VFNI
Sbjct  429  NEMQFFYEEQLHRMECMTQEPVLFEDILCQMIDMIAPENESHFSLRDLKGNKLSGNVFNI  488

Query  735  LFNLNKFMAFETRDPFLIRQERENPNLTEWDRFAHREYIRLSMEEDAEDASNGSADVWDE  556
            LFNLNKFMAFETRDPFL RQERE PNLTEWDRFAH EYIRLSMEEDAEDASNGS DVWDE
Sbjct  489  LFNLNKFMAFETRDPFLARQEREEPNLTEWDRFAHTEYIRLSMEEDAEDASNGSGDVWDE  548

Query  555  SLEAPF  538
            SLEAPF
Sbjct  549  SLEAPF  554



>ref|NP_001064850.1| Os10g0476600 [Oryza sativa Japonica Group]
 gb|AAP54271.2| EF hand family protein, expressed [Oryza sativa Japonica Group]
 dbj|BAF26764.1| Os10g0476600 [Oryza sativa Japonica Group]
 dbj|BAG90614.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG95043.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE51135.1| hypothetical protein OsJ_31883 [Oryza sativa Japonica Group]
Length=541

 Score =   239 bits (610),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 112/126 (89%), Positives = 116/126 (92%), Gaps = 0/126 (0%)
 Frame = -2

Query  915  NEMQFFYEEQLHRMECMAQEPVLFEDILCQIVDMISPEEESYVTLRDLKGSKLSGSVFNI  736
             EMQFFYEEQLHRMECMAQEPVLFEDILCQ++DMI PE E Y TLRDLK  KLSG++FNI
Sbjct  416  TEMQFFYEEQLHRMECMAQEPVLFEDILCQMIDMIGPENECYFTLRDLKRCKLSGNIFNI  475

Query  735  LFNLNKFMAFETRDPFLIRQERENPNLTEWDRFAHREYIRLSMEEDAEDASNGSADVWDE  556
            LFNLNKFMAFETRDPFLIRQERENP LTEWDRFAHREYIRLSMEED EDASNGS DVWDE
Sbjct  476  LFNLNKFMAFETRDPFLIRQERENPTLTEWDRFAHREYIRLSMEEDGEDASNGSGDVWDE  535

Query  555  SLEAPF  538
            SLEAPF
Sbjct  536  SLEAPF  541



>ref|XP_010494115.1| PREDICTED: serine/threonine protein phosphatase 2A regulatory 
subunit B''beta-like [Camelina sativa]
 ref|XP_010494117.1| PREDICTED: serine/threonine protein phosphatase 2A regulatory 
subunit B''beta-like [Camelina sativa]
Length=539

 Score =   239 bits (610),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 115/128 (90%), Positives = 121/128 (95%), Gaps = 1/128 (1%)
 Frame = -2

Query  918  RNEMQFFYEEQLHRMECMAQEPVLFEDILCQIVDMISPEEESYVTLRDLKGSKLSGSVFN  739
            RNEMQFFYEEQLHRMECMAQE VLFEDILCQ++DMI PE ES++TL DLKGSKLSG+VFN
Sbjct  412  RNEMQFFYEEQLHRMECMAQEAVLFEDILCQMIDMIGPENESHITLHDLKGSKLSGNVFN  471

Query  738  ILFNLNKFMAFETRDPFLIRQERENPNLTEWDRFAHREYIRLSMEEDAEDASNGSADVWD  559
            ILFNLNKFMAFETRDPFLIRQERENP LTEWDRFAHREYIRLSMEED EDASNGSA+VWD
Sbjct  472  ILFNLNKFMAFETRDPFLIRQERENPTLTEWDRFAHREYIRLSMEEDVEDASNGSAEVWD  531

Query  558  E-SLEAPF  538
            E SLEAPF
Sbjct  532  ESSLEAPF  539



>ref|XP_010421708.1| PREDICTED: serine/threonine protein phosphatase 2A regulatory 
subunit B''beta [Camelina sativa]
Length=541

 Score =   239 bits (610),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 115/128 (90%), Positives = 121/128 (95%), Gaps = 1/128 (1%)
 Frame = -2

Query  918  RNEMQFFYEEQLHRMECMAQEPVLFEDILCQIVDMISPEEESYVTLRDLKGSKLSGSVFN  739
            RNEMQFFYEEQLHRMECMAQE VLFEDILCQ++DMI PE ES++TL DLKGSKLSG+VFN
Sbjct  414  RNEMQFFYEEQLHRMECMAQEAVLFEDILCQMIDMIGPENESHITLHDLKGSKLSGNVFN  473

Query  738  ILFNLNKFMAFETRDPFLIRQERENPNLTEWDRFAHREYIRLSMEEDAEDASNGSADVWD  559
            ILFNLNKFMAFETRDPFLIRQERENP LTEWDRFAHREYIRLSMEED EDASNGSA+VWD
Sbjct  474  ILFNLNKFMAFETRDPFLIRQERENPTLTEWDRFAHREYIRLSMEEDVEDASNGSAEVWD  533

Query  558  E-SLEAPF  538
            E SLEAPF
Sbjct  534  ESSLEAPF  541



>ref|XP_012085280.1| PREDICTED: serine/threonine protein phosphatase 2A regulatory 
subunit B''alpha isoform X1 [Jatropha curcas]
 gb|KDP26508.1| hypothetical protein JCGZ_17666 [Jatropha curcas]
Length=542

 Score =   239 bits (610),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 112/126 (89%), Positives = 120/126 (95%), Gaps = 0/126 (0%)
 Frame = -2

Query  915  NEMQFFYEEQLHRMECMAQEPVLFEDILCQIVDMISPEEESYVTLRDLKGSKLSGSVFNI  736
            NEMQFFYEEQLHRMECMAQEPVLFEDILCQIVDMI+PE E Y+TL+DLK SKLSG+VFNI
Sbjct  417  NEMQFFYEEQLHRMECMAQEPVLFEDILCQIVDMIAPEREDYITLQDLKASKLSGNVFNI  476

Query  735  LFNLNKFMAFETRDPFLIRQERENPNLTEWDRFAHREYIRLSMEEDAEDASNGSADVWDE  556
            LFNLNKF+AFE+RDPFLIRQERE+P LTEWDRFAHREYIRLSMEED ED SNGSADVW+E
Sbjct  477  LFNLNKFIAFESRDPFLIRQEREDPTLTEWDRFAHREYIRLSMEEDVEDVSNGSADVWEE  536

Query  555  SLEAPF  538
            SLEAPF
Sbjct  537  SLEAPF  542



>ref|XP_008785219.1| PREDICTED: probable serine/threonine protein phosphatase 2A regulatory 
subunit B''delta isoform X2 [Phoenix dactylifera]
Length=541

 Score =   239 bits (609),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 112/126 (89%), Positives = 119/126 (94%), Gaps = 0/126 (0%)
 Frame = -2

Query  915  NEMQFFYEEQLHRMECMAQEPVLFEDILCQIVDMISPEEESYVTLRDLKGSKLSGSVFNI  736
            NEMQFFYEEQLHRMECM QEPVLFEDILCQ++DMI+PE ES+ +LRDLKG+KLSG+VFNI
Sbjct  416  NEMQFFYEEQLHRMECMTQEPVLFEDILCQMIDMIAPENESHFSLRDLKGNKLSGNVFNI  475

Query  735  LFNLNKFMAFETRDPFLIRQERENPNLTEWDRFAHREYIRLSMEEDAEDASNGSADVWDE  556
            LFNLNKFMAFETRDPFL RQERE PNLTEWDRFAH EYIRLSMEEDAEDASNGS DVWDE
Sbjct  476  LFNLNKFMAFETRDPFLARQEREEPNLTEWDRFAHTEYIRLSMEEDAEDASNGSGDVWDE  535

Query  555  SLEAPF  538
            SLEAPF
Sbjct  536  SLEAPF  541



>ref|XP_010494118.1| PREDICTED: serine/threonine protein phosphatase 2A regulatory 
subunit B''beta-like [Camelina sativa]
Length=539

 Score =   239 bits (609),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 115/128 (90%), Positives = 121/128 (95%), Gaps = 1/128 (1%)
 Frame = -2

Query  918  RNEMQFFYEEQLHRMECMAQEPVLFEDILCQIVDMISPEEESYVTLRDLKGSKLSGSVFN  739
            RNEMQFFYEEQLHRMECMAQE VLFEDILCQ++DMI PE ES++TL DLKGSKLSG+VFN
Sbjct  412  RNEMQFFYEEQLHRMECMAQEAVLFEDILCQMIDMIGPENESHITLHDLKGSKLSGNVFN  471

Query  738  ILFNLNKFMAFETRDPFLIRQERENPNLTEWDRFAHREYIRLSMEEDAEDASNGSADVWD  559
            ILFNLNKFMAFETRDPFLIRQERENP LTEWDRFAHREYIRLSMEED EDASNGSA+VWD
Sbjct  472  ILFNLNKFMAFETRDPFLIRQERENPTLTEWDRFAHREYIRLSMEEDVEDASNGSAEVWD  531

Query  558  E-SLEAPF  538
            E SLEAPF
Sbjct  532  ESSLEAPF  539



>ref|NP_198242.1| probable serine/threonine protein phosphatase 2A regulatory subunit 
B''gamma [Arabidopsis thaliana]
 sp|Q8VZQ4.1|2AB2C_ARATH RecName: Full=Probable serine/threonine protein phosphatase 2A 
regulatory subunit B''gamma; Short=AtB''gamma; AltName: Full=Serine/threonine 
protein phosphatase 2A regulatory subunit 
B''beta 2 isoform; Short=AtB''beta 2; Short=PP2A, B'' subunit, 
beta 2 isoform [Arabidopsis thaliana]
 gb|AAL36293.1| putative protein phosphatase 2A regulatory subunit B [Arabidopsis 
thaliana]
 gb|AAM20122.1| putative phosphatase 2A regulatory subunit B protein [Arabidopsis 
thaliana]
 gb|AED93848.1| protein phosphatase 2A B' gamma [Arabidopsis thaliana]
Length=536

 Score =   239 bits (609),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 114/128 (89%), Positives = 121/128 (95%), Gaps = 1/128 (1%)
 Frame = -2

Query  918  RNEMQFFYEEQLHRMECMAQEPVLFEDILCQIVDMISPEEESYVTLRDLKGSKLSGSVFN  739
            RNEMQFFYEEQLHRMECMAQE VLFEDILCQ++DMI PE ES++TL DLKGSKLSG+VFN
Sbjct  409  RNEMQFFYEEQLHRMECMAQEAVLFEDILCQMIDMIGPENESHITLHDLKGSKLSGNVFN  468

Query  738  ILFNLNKFMAFETRDPFLIRQERENPNLTEWDRFAHREYIRLSMEEDAEDASNGSADVWD  559
            ILFNLNKFMAFETRDPFLIRQERENP LT+WDRFAHREYIRLSMEED EDASNGSA+VWD
Sbjct  469  ILFNLNKFMAFETRDPFLIRQERENPTLTDWDRFAHREYIRLSMEEDVEDASNGSAEVWD  528

Query  558  E-SLEAPF  538
            E SLEAPF
Sbjct  529  ESSLEAPF  536



>ref|XP_002872330.1| calcium-binding EF hand family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH48589.1| calcium-binding EF hand family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=536

 Score =   239 bits (609),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 114/128 (89%), Positives = 121/128 (95%), Gaps = 1/128 (1%)
 Frame = -2

Query  918  RNEMQFFYEEQLHRMECMAQEPVLFEDILCQIVDMISPEEESYVTLRDLKGSKLSGSVFN  739
            RNEMQFFYEEQLHRMECMAQE VLFEDILCQ++DMI PE ES++TL DLKGSKLSG+VFN
Sbjct  409  RNEMQFFYEEQLHRMECMAQEAVLFEDILCQMIDMIGPENESHITLHDLKGSKLSGNVFN  468

Query  738  ILFNLNKFMAFETRDPFLIRQERENPNLTEWDRFAHREYIRLSMEEDAEDASNGSADVWD  559
            ILFNLNKFMAFETRDPFLIRQERENP LT+WDRFAHREYIRLSMEED EDASNGSA+VWD
Sbjct  469  ILFNLNKFMAFETRDPFLIRQERENPTLTDWDRFAHREYIRLSMEEDVEDASNGSAEVWD  528

Query  558  E-SLEAPF  538
            E SLEAPF
Sbjct  529  ESSLEAPF  536



>ref|XP_007035140.1| Calcium-binding EF-hand family protein isoform 1 [Theobroma cacao]
 ref|XP_007035141.1| Calcium-binding EF-hand family protein isoform 1 [Theobroma cacao]
 gb|EOY06066.1| Calcium-binding EF-hand family protein isoform 1 [Theobroma cacao]
 gb|EOY06067.1| Calcium-binding EF-hand family protein isoform 1 [Theobroma cacao]
Length=536

 Score =   239 bits (609),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 111/126 (88%), Positives = 116/126 (92%), Gaps = 0/126 (0%)
 Frame = -2

Query  915  NEMQFFYEEQLHRMECMAQEPVLFEDILCQIVDMISPEEESYVTLRDLKGSKLSGSVFNI  736
             EMQFFYEEQL RMECMAQEPVLFEDILCQIVDMI PE E Y+TLRDLKG KLSG+VFNI
Sbjct  411  TEMQFFYEEQLRRMECMAQEPVLFEDILCQIVDMIGPENEGYITLRDLKGCKLSGNVFNI  470

Query  735  LFNLNKFMAFETRDPFLIRQERENPNLTEWDRFAHREYIRLSMEEDAEDASNGSADVWDE  556
            LFNLNKF+AFE+RDPFLIRQERENP LTEWDRFAHREYIRLSMEED EDASNGS D+WDE
Sbjct  471  LFNLNKFIAFESRDPFLIRQERENPTLTEWDRFAHREYIRLSMEEDVEDASNGSGDIWDE  530

Query  555  SLEAPF  538
            S EAPF
Sbjct  531  SFEAPF  536



>gb|AAK13162.1|AC078829_14 putative protein phosphatase 2A regulatory subunit [Oryza sativa 
Japonica Group]
Length=578

 Score =   239 bits (611),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 112/126 (89%), Positives = 116/126 (92%), Gaps = 0/126 (0%)
 Frame = -2

Query  915  NEMQFFYEEQLHRMECMAQEPVLFEDILCQIVDMISPEEESYVTLRDLKGSKLSGSVFNI  736
             EMQFFYEEQLHRMECMAQEPVLFEDILCQ++DMI PE E Y TLRDLK  KLSG++FNI
Sbjct  453  TEMQFFYEEQLHRMECMAQEPVLFEDILCQMIDMIGPENECYFTLRDLKRCKLSGNIFNI  512

Query  735  LFNLNKFMAFETRDPFLIRQERENPNLTEWDRFAHREYIRLSMEEDAEDASNGSADVWDE  556
            LFNLNKFMAFETRDPFLIRQERENP LTEWDRFAHREYIRLSMEED EDASNGS DVWDE
Sbjct  513  LFNLNKFMAFETRDPFLIRQERENPTLTEWDRFAHREYIRLSMEEDGEDASNGSGDVWDE  572

Query  555  SLEAPF  538
            SLEAPF
Sbjct  573  SLEAPF  578



>emb|CDY00020.1| BnaC09g02810D [Brassica napus]
Length=541

 Score =   238 bits (608),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 112/127 (88%), Positives = 120/127 (94%), Gaps = 0/127 (0%)
 Frame = -2

Query  918  RNEMQFFYEEQLHRMECMAQEPVLFEDILCQIVDMISPEEESYVTLRDLKGSKLSGSVFN  739
            RNEMQFFYEEQL RMECMAQE VLFEDILCQ++DMI PE ES+VTL+DLKGSKLSG+VFN
Sbjct  415  RNEMQFFYEEQLRRMECMAQEAVLFEDILCQMIDMIGPENESHVTLQDLKGSKLSGNVFN  474

Query  738  ILFNLNKFMAFETRDPFLIRQERENPNLTEWDRFAHREYIRLSMEEDAEDASNGSADVWD  559
            ILFNLNKFMAFETRDPFLIRQERENP LTEWDRFAHREY+RLSMEED EDASNGSA+ WD
Sbjct  475  ILFNLNKFMAFETRDPFLIRQERENPTLTEWDRFAHREYVRLSMEEDVEDASNGSAEAWD  534

Query  558  ESLEAPF  538
            ESLE+PF
Sbjct  535  ESLESPF  541



>ref|XP_011458019.1| PREDICTED: serine/threonine protein phosphatase 2A regulatory 
subunit B''alpha-like isoform X2 [Fragaria vesca subsp. vesca]
Length=529

 Score =   238 bits (607),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 111/127 (87%), Positives = 120/127 (94%), Gaps = 0/127 (0%)
 Frame = -2

Query  918  RNEMQFFYEEQLHRMECMAQEPVLFEDILCQIVDMISPEEESYVTLRDLKGSKLSGSVFN  739
            RNE+QFFYEEQLHRMECMAQEPVLFEDILCQIVDMI PE+E Y TLRDLKG KLSG+ FN
Sbjct  403  RNELQFFYEEQLHRMECMAQEPVLFEDILCQIVDMIGPEKEDYFTLRDLKGCKLSGNFFN  462

Query  738  ILFNLNKFMAFETRDPFLIRQERENPNLTEWDRFAHREYIRLSMEEDAEDASNGSADVWD  559
            ILFNLNKF+AFE+RDPFLIRQERE+P+LTEWDRFAHREYIRLSMEED E+ASNGS +VWD
Sbjct  463  ILFNLNKFIAFESRDPFLIRQEREDPSLTEWDRFAHREYIRLSMEEDGENASNGSVEVWD  522

Query  558  ESLEAPF  538
            ESLEAPF
Sbjct  523  ESLEAPF  529



>ref|XP_004289966.1| PREDICTED: probable serine/threonine protein phosphatase 2A regulatory 
subunit B''epsilon isoform X1 [Fragaria vesca subsp. 
vesca]
Length=540

 Score =   238 bits (607),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 111/127 (87%), Positives = 120/127 (94%), Gaps = 0/127 (0%)
 Frame = -2

Query  918  RNEMQFFYEEQLHRMECMAQEPVLFEDILCQIVDMISPEEESYVTLRDLKGSKLSGSVFN  739
            RNE+QFFYEEQLHRMECMAQEPVLFEDILCQIVDMI PE+E Y TLRDLKG KLSG+ FN
Sbjct  414  RNELQFFYEEQLHRMECMAQEPVLFEDILCQIVDMIGPEKEDYFTLRDLKGCKLSGNFFN  473

Query  738  ILFNLNKFMAFETRDPFLIRQERENPNLTEWDRFAHREYIRLSMEEDAEDASNGSADVWD  559
            ILFNLNKF+AFE+RDPFLIRQERE+P+LTEWDRFAHREYIRLSMEED E+ASNGS +VWD
Sbjct  474  ILFNLNKFIAFESRDPFLIRQEREDPSLTEWDRFAHREYIRLSMEEDGENASNGSVEVWD  533

Query  558  ESLEAPF  538
            ESLEAPF
Sbjct  534  ESLEAPF  540



>gb|KJB11372.1| hypothetical protein B456_001G254900 [Gossypium raimondii]
Length=545

 Score =   238 bits (607),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 112/126 (89%), Positives = 120/126 (95%), Gaps = 0/126 (0%)
 Frame = -2

Query  915  NEMQFFYEEQLHRMECMAQEPVLFEDILCQIVDMISPEEESYVTLRDLKGSKLSGSVFNI  736
            NEMQFFYEEQLHRMEC+A EPVLFEDILCQI+DMI+PE E  +TL+DLKGSKLSG+VFNI
Sbjct  420  NEMQFFYEEQLHRMECLALEPVLFEDILCQIIDMIAPEREDCITLQDLKGSKLSGNVFNI  479

Query  735  LFNLNKFMAFETRDPFLIRQERENPNLTEWDRFAHREYIRLSMEEDAEDASNGSADVWDE  556
            LFNLNKF+AFETRDPFLIRQERE+P LTEWDRFAHREYIRLSMEED EDASNGSADVWDE
Sbjct  480  LFNLNKFVAFETRDPFLIRQEREDPTLTEWDRFAHREYIRLSMEEDVEDASNGSADVWDE  539

Query  555  SLEAPF  538
            SLEAPF
Sbjct  540  SLEAPF  545



>ref|NP_568509.1| serine/threonine protein phosphatase 2A regulatory subunit B''beta 
[Arabidopsis thaliana]
 sp|Q5QIT3.1|2AB2B_ARATH RecName: Full=Serine/threonine protein phosphatase 2A regulatory 
subunit B''beta; Short=AtB''beta; AltName: Full=Serine/threonine 
protein phosphatase 2A regulatory subunit B'' beta 
1 isoform; Short=PP2A, B'' subunit, beta 1 isoform [Arabidopsis 
thaliana]
 gb|AAS44557.1| protein phosphatase 2A beta [Arabidopsis thaliana]
 gb|AED93846.1| protein phosphatase 2A regulatory subunit B' beta [Arabidopsis 
thaliana]
Length=536

 Score =   238 bits (606),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 113/128 (88%), Positives = 121/128 (95%), Gaps = 1/128 (1%)
 Frame = -2

Query  918  RNEMQFFYEEQLHRMECMAQEPVLFEDILCQIVDMISPEEESYVTLRDLKGSKLSGSVFN  739
            RNEMQFFYEEQLHRMECMAQE VLFEDILCQ++DMI PE ES++TL DLKGSKLSG+VFN
Sbjct  409  RNEMQFFYEEQLHRMECMAQEAVLFEDILCQMIDMIGPENESHITLHDLKGSKLSGNVFN  468

Query  738  ILFNLNKFMAFETRDPFLIRQERENPNLTEWDRFAHREYIRLSMEEDAEDASNGSADVWD  559
            ILFNLNKFMAFETRDPFLIRQERENP LT+WDRFAHREYIRLSMEED EDASNGSA+VWD
Sbjct  469  ILFNLNKFMAFETRDPFLIRQERENPTLTDWDRFAHREYIRLSMEEDVEDASNGSAEVWD  528

Query  558  E-SLEAPF  538
            + SLEAPF
Sbjct  529  DSSLEAPF  536



>ref|XP_006420257.1| hypothetical protein CICLE_v10007050mg [Citrus clementina]
 gb|ESR33497.1| hypothetical protein CICLE_v10007050mg [Citrus clementina]
Length=538

 Score =   238 bits (606),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 108/126 (86%), Positives = 118/126 (94%), Gaps = 0/126 (0%)
 Frame = -2

Query  915  NEMQFFYEEQLHRMECMAQEPVLFEDILCQIVDMISPEEESYVTLRDLKGSKLSGSVFNI  736
            NE+Q+ YEEQLHRMECMAQEPVLFED+LCQIVDMI PE + Y+TLRDLKG KLSG+VFNI
Sbjct  413  NELQYLYEEQLHRMECMAQEPVLFEDVLCQIVDMIGPENQGYITLRDLKGCKLSGNVFNI  472

Query  735  LFNLNKFMAFETRDPFLIRQERENPNLTEWDRFAHREYIRLSMEEDAEDASNGSADVWDE  556
            LFNLNKF+AFE+RDPFLIRQERENP LTEWDRFAHREYIRLSMEEDAE+ SNGS D+WDE
Sbjct  473  LFNLNKFIAFESRDPFLIRQERENPTLTEWDRFAHREYIRLSMEEDAENVSNGSGDIWDE  532

Query  555  SLEAPF  538
            SLEAPF
Sbjct  533  SLEAPF  538



>gb|KHN30578.1| Serine/threonine-protein phosphatase 2A regulatory subunit B'' 
subunit alpha [Glycine soja]
Length=541

 Score =   238 bits (606),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 110/126 (87%), Positives = 117/126 (93%), Gaps = 0/126 (0%)
 Frame = -2

Query  915  NEMQFFYEEQLHRMECMAQEPVLFEDILCQIVDMISPEEESYVTLRDLKGSKLSGSVFNI  736
            NEMQFFYEEQLHRMECMAQEPVLFEDILCQIVDMI PE E Y+T+RD+KGSKLSG+VFNI
Sbjct  416  NEMQFFYEEQLHRMECMAQEPVLFEDILCQIVDMIGPENEGYITIRDVKGSKLSGNVFNI  475

Query  735  LFNLNKFMAFETRDPFLIRQERENPNLTEWDRFAHREYIRLSMEEDAEDASNGSADVWDE  556
            LFNLNKF+AFETRDPFLIRQERE+PNLTEWDRFAHREYIRLSMEED ED  N S D W+E
Sbjct  476  LFNLNKFIAFETRDPFLIRQEREDPNLTEWDRFAHREYIRLSMEEDGEDMPNASGDAWEE  535

Query  555  SLEAPF  538
            SLEAPF
Sbjct  536  SLEAPF  541



>ref|XP_010262368.1| PREDICTED: serine/threonine protein phosphatase 2A regulatory 
subunit B''beta-like [Nelumbo nucifera]
Length=539

 Score =   237 bits (605),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 112/126 (89%), Positives = 119/126 (94%), Gaps = 0/126 (0%)
 Frame = -2

Query  915  NEMQFFYEEQLHRMECMAQEPVLFEDILCQIVDMISPEEESYVTLRDLKGSKLSGSVFNI  736
            NEMQFFYEEQLHRMECMAQEPVLFEDILCQ++DMI PE+ESY+TL D K  KLSG+VFNI
Sbjct  414  NEMQFFYEEQLHRMECMAQEPVLFEDILCQMIDMIGPEKESYLTLLDFKRCKLSGNVFNI  473

Query  735  LFNLNKFMAFETRDPFLIRQERENPNLTEWDRFAHREYIRLSMEEDAEDASNGSADVWDE  556
            LFNLNKFMAFETRDPFLIRQERE+P LTEWDRFAHREYIRLSMEED EDASNGSA+VWDE
Sbjct  474  LFNLNKFMAFETRDPFLIRQEREDPTLTEWDRFAHREYIRLSMEEDGEDASNGSAEVWDE  533

Query  555  SLEAPF  538
            SLEAPF
Sbjct  534  SLEAPF  539



>gb|KHN05074.1| Serine/threonine-protein phosphatase 2A regulatory subunit B'' 
subunit alpha [Glycine soja]
Length=540

 Score =   237 bits (604),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 110/126 (87%), Positives = 116/126 (92%), Gaps = 0/126 (0%)
 Frame = -2

Query  915  NEMQFFYEEQLHRMECMAQEPVLFEDILCQIVDMISPEEESYVTLRDLKGSKLSGSVFNI  736
            NEMQFFYEEQLHRMECMAQEPVLFEDILCQIVDMI PE E Y+TLRD+KGSKLSG+VFNI
Sbjct  415  NEMQFFYEEQLHRMECMAQEPVLFEDILCQIVDMIGPENEGYITLRDVKGSKLSGNVFNI  474

Query  735  LFNLNKFMAFETRDPFLIRQERENPNLTEWDRFAHREYIRLSMEEDAEDASNGSADVWDE  556
            LFNLNKF+ FETRDPFLIRQERE+PNLTEWDRFAHREYIRLSMEED ED  N S D W+E
Sbjct  475  LFNLNKFITFETRDPFLIRQEREDPNLTEWDRFAHREYIRLSMEEDGEDMPNASGDAWEE  534

Query  555  SLEAPF  538
            SLEAPF
Sbjct  535  SLEAPF  540



>ref|XP_006489706.1| PREDICTED: probable serine/threonine protein phosphatase 2A regulatory 
subunit B''delta-like isoform X1 [Citrus sinensis]
 ref|XP_006489707.1| PREDICTED: probable serine/threonine protein phosphatase 2A regulatory 
subunit B''delta-like isoform X2 [Citrus sinensis]
Length=539

 Score =   236 bits (603),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 108/126 (86%), Positives = 118/126 (94%), Gaps = 0/126 (0%)
 Frame = -2

Query  915  NEMQFFYEEQLHRMECMAQEPVLFEDILCQIVDMISPEEESYVTLRDLKGSKLSGSVFNI  736
            NE+Q+FYEEQLHRMECMAQEPVLFED+LCQIVDMI PE + Y+TL DLKG KLSG+VFNI
Sbjct  414  NELQYFYEEQLHRMECMAQEPVLFEDVLCQIVDMIGPENQGYITLCDLKGCKLSGNVFNI  473

Query  735  LFNLNKFMAFETRDPFLIRQERENPNLTEWDRFAHREYIRLSMEEDAEDASNGSADVWDE  556
            LFNLNKF+AFE+RDPFLIRQERENP LTEWDRFAHREYIRLSMEEDAE+ SNGS D+WDE
Sbjct  474  LFNLNKFIAFESRDPFLIRQERENPTLTEWDRFAHREYIRLSMEEDAENVSNGSGDIWDE  533

Query  555  SLEAPF  538
            SLEAPF
Sbjct  534  SLEAPF  539



>ref|XP_008382840.1| PREDICTED: serine/threonine protein phosphatase 2A regulatory 
subunit B''alpha-like [Malus domestica]
 ref|XP_008382841.1| PREDICTED: serine/threonine protein phosphatase 2A regulatory 
subunit B''alpha-like [Malus domestica]
Length=540

 Score =   236 bits (603),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 110/126 (87%), Positives = 119/126 (94%), Gaps = 0/126 (0%)
 Frame = -2

Query  915  NEMQFFYEEQLHRMECMAQEPVLFEDILCQIVDMISPEEESYVTLRDLKGSKLSGSVFNI  736
            NE+QFFYEEQLHRMECMAQEPVLFEDILCQIVDMI+PE E Y+TL DLKG KLSG+VFNI
Sbjct  415  NELQFFYEEQLHRMECMAQEPVLFEDILCQIVDMIAPEREDYITLADLKGCKLSGNVFNI  474

Query  735  LFNLNKFMAFETRDPFLIRQERENPNLTEWDRFAHREYIRLSMEEDAEDASNGSADVWDE  556
            LFNLNKF+AFE+RDPFLIRQERE+P LTEWDRFAHREYIRLSMEED E+ASNGS +VWDE
Sbjct  475  LFNLNKFIAFESRDPFLIRQEREDPTLTEWDRFAHREYIRLSMEEDGENASNGSVEVWDE  534

Query  555  SLEAPF  538
            SLEAPF
Sbjct  535  SLEAPF  540



>gb|KDO57568.1| hypothetical protein CISIN_1g043857mg [Citrus sinensis]
Length=539

 Score =   236 bits (602),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 108/126 (86%), Positives = 118/126 (94%), Gaps = 0/126 (0%)
 Frame = -2

Query  915  NEMQFFYEEQLHRMECMAQEPVLFEDILCQIVDMISPEEESYVTLRDLKGSKLSGSVFNI  736
            NE+Q+FYEEQLHRMECMAQEPVLFED+LCQIVDMI PE + Y+TL DLKG KLSG+VFNI
Sbjct  414  NELQYFYEEQLHRMECMAQEPVLFEDVLCQIVDMIGPENQGYITLCDLKGCKLSGNVFNI  473

Query  735  LFNLNKFMAFETRDPFLIRQERENPNLTEWDRFAHREYIRLSMEEDAEDASNGSADVWDE  556
            LFNLNKF+AFE+RDPFLIRQERENP LTEWDRFAHREYIRLSMEEDAE+ SNGS D+WDE
Sbjct  474  LFNLNKFIAFESRDPFLIRQERENPTLTEWDRFAHREYIRLSMEEDAENVSNGSGDIWDE  533

Query  555  SLEAPF  538
            SLEAPF
Sbjct  534  SLEAPF  539



>ref|XP_006282584.1| hypothetical protein CARUB_v10004535mg [Capsella rubella]
 gb|EOA15482.1| hypothetical protein CARUB_v10004535mg [Capsella rubella]
Length=541

 Score =   236 bits (602),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 114/128 (89%), Positives = 120/128 (94%), Gaps = 1/128 (1%)
 Frame = -2

Query  918  RNEMQFFYEEQLHRMECMAQEPVLFEDILCQIVDMISPEEESYVTLRDLKGSKLSGSVFN  739
            RNEMQFFYEEQLHRMECMAQE VLFEDILCQ++DMI PE ES++TL DLK SKLSG+VFN
Sbjct  414  RNEMQFFYEEQLHRMECMAQEAVLFEDILCQMIDMIGPENESHITLHDLKSSKLSGNVFN  473

Query  738  ILFNLNKFMAFETRDPFLIRQERENPNLTEWDRFAHREYIRLSMEEDAEDASNGSADVWD  559
            ILFNLNKFMAFETRDPFLIRQERENP LTEWDRFAHREYIRLSMEED EDASNGSA+VWD
Sbjct  474  ILFNLNKFMAFETRDPFLIRQERENPTLTEWDRFAHREYIRLSMEEDVEDASNGSAEVWD  533

Query  558  E-SLEAPF  538
            E SLEAPF
Sbjct  534  ESSLEAPF  541



>gb|ABR18438.1| unknown [Picea sitchensis]
Length=546

 Score =   236 bits (602),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 113/126 (90%), Positives = 119/126 (94%), Gaps = 0/126 (0%)
 Frame = -2

Query  915  NEMQFFYEEQLHRMECMAQEPVLFEDILCQIVDMISPEEESYVTLRDLKGSKLSGSVFNI  736
            NEMQFFYEEQLHRMECMAQEPVLFEDILCQ+VDMI+PE+E   TLRDLK  KLSGSVFNI
Sbjct  421  NEMQFFYEEQLHRMECMAQEPVLFEDILCQMVDMIAPEKEWLFTLRDLKRCKLSGSVFNI  480

Query  735  LFNLNKFMAFETRDPFLIRQERENPNLTEWDRFAHREYIRLSMEEDAEDASNGSADVWDE  556
            LFNLNKFMAFETRDPFLIRQERE+P LTEWDRFAH+EYIRLSMEED EDASNGSA+VWDE
Sbjct  481  LFNLNKFMAFETRDPFLIRQEREDPTLTEWDRFAHKEYIRLSMEEDGEDASNGSAEVWDE  540

Query  555  SLEAPF  538
            SLEAPF
Sbjct  541  SLEAPF  546



>ref|XP_008235642.1| PREDICTED: serine/threonine protein phosphatase 2A regulatory 
subunit B''alpha isoform X2 [Prunus mume]
Length=529

 Score =   236 bits (601),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 110/126 (87%), Positives = 119/126 (94%), Gaps = 0/126 (0%)
 Frame = -2

Query  915  NEMQFFYEEQLHRMECMAQEPVLFEDILCQIVDMISPEEESYVTLRDLKGSKLSGSVFNI  736
            NE+QFFYEEQLHRMECMAQEPVLFEDILCQIVDMI+PE E Y+TL DLKG KLSG+VFNI
Sbjct  404  NELQFFYEEQLHRMECMAQEPVLFEDILCQIVDMIAPEREDYLTLADLKGCKLSGNVFNI  463

Query  735  LFNLNKFMAFETRDPFLIRQERENPNLTEWDRFAHREYIRLSMEEDAEDASNGSADVWDE  556
            LFNLNKF+AFE+RDPFLIRQERE+P LTEWDRFAHREYIRLSMEED E+ASNGS +VWDE
Sbjct  464  LFNLNKFIAFESRDPFLIRQEREDPTLTEWDRFAHREYIRLSMEEDGENASNGSVEVWDE  523

Query  555  SLEAPF  538
            SLEAPF
Sbjct  524  SLEAPF  529



>ref|XP_007050234.1| Calcium-binding EF-hand family protein [Theobroma cacao]
 gb|EOX94391.1| Calcium-binding EF-hand family protein [Theobroma cacao]
Length=545

 Score =   236 bits (602),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 111/126 (88%), Positives = 119/126 (94%), Gaps = 0/126 (0%)
 Frame = -2

Query  915  NEMQFFYEEQLHRMECMAQEPVLFEDILCQIVDMISPEEESYVTLRDLKGSKLSGSVFNI  736
            NEMQFFYEEQLHRM+CMAQEPVLFEDILCQI DMI+PE E  +TL+DLKG KLSG+VFNI
Sbjct  420  NEMQFFYEEQLHRMKCMAQEPVLFEDILCQIFDMIAPEREDCITLQDLKGCKLSGNVFNI  479

Query  735  LFNLNKFMAFETRDPFLIRQERENPNLTEWDRFAHREYIRLSMEEDAEDASNGSADVWDE  556
            LFNLNKFMAFETRDPF+IRQERE+P LTEWDRFAHREYIRLSMEED EDASNGSA+VWDE
Sbjct  480  LFNLNKFMAFETRDPFVIRQEREDPTLTEWDRFAHREYIRLSMEEDVEDASNGSAEVWDE  539

Query  555  SLEAPF  538
            SLEAPF
Sbjct  540  SLEAPF  545



>ref|XP_007199781.1| hypothetical protein PRUPE_ppa003921mg [Prunus persica]
 ref|XP_008235641.1| PREDICTED: serine/threonine protein phosphatase 2A regulatory 
subunit B''beta isoform X1 [Prunus mume]
 gb|EMJ00980.1| hypothetical protein PRUPE_ppa003921mg [Prunus persica]
Length=540

 Score =   236 bits (601),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 110/126 (87%), Positives = 119/126 (94%), Gaps = 0/126 (0%)
 Frame = -2

Query  915  NEMQFFYEEQLHRMECMAQEPVLFEDILCQIVDMISPEEESYVTLRDLKGSKLSGSVFNI  736
            NE+QFFYEEQLHRMECMAQEPVLFEDILCQIVDMI+PE E Y+TL DLKG KLSG+VFNI
Sbjct  415  NELQFFYEEQLHRMECMAQEPVLFEDILCQIVDMIAPEREDYLTLADLKGCKLSGNVFNI  474

Query  735  LFNLNKFMAFETRDPFLIRQERENPNLTEWDRFAHREYIRLSMEEDAEDASNGSADVWDE  556
            LFNLNKF+AFE+RDPFLIRQERE+P LTEWDRFAHREYIRLSMEED E+ASNGS +VWDE
Sbjct  475  LFNLNKFIAFESRDPFLIRQEREDPTLTEWDRFAHREYIRLSMEEDGENASNGSVEVWDE  534

Query  555  SLEAPF  538
            SLEAPF
Sbjct  535  SLEAPF  540



>gb|EPS71035.1| hypothetical protein M569_03725 [Genlisea aurea]
Length=539

 Score =   235 bits (599),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 109/122 (89%), Positives = 119/122 (98%), Gaps = 0/122 (0%)
 Frame = -2

Query  918  RNEMQFFYEEQLHRMECMAQEPVLFEDILCQIVDMISPEEESYVTLRDLKGSKLSGSVFN  739
            RNEMQFFYEEQLHRMECMAQEPVLFEDILCQIVDM++PE+ES +TL+D+KGS+LSGSVFN
Sbjct  416  RNEMQFFYEEQLHRMECMAQEPVLFEDILCQIVDMLTPEDESCITLQDVKGSRLSGSVFN  475

Query  738  ILFNLNKFMAFETRDPFLIRQERENPNLTEWDRFAHREYIRLSMEEDAEDASNGSADVWD  559
            ILFNLNKFMAFETRDPFLIRQERENP++TEWDRFAHREYIRLSMEED E+ SNGSADVWD
Sbjct  476  ILFNLNKFMAFETRDPFLIRQERENPHMTEWDRFAHREYIRLSMEEDTEEGSNGSADVWD  535

Query  558  ES  553
            ES
Sbjct  536  ES  537



>ref|XP_010550352.1| PREDICTED: probable serine/threonine protein phosphatase 2A regulatory 
subunit B''delta [Tarenaya hassleriana]
Length=539

 Score =   234 bits (598),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 109/127 (86%), Positives = 118/127 (93%), Gaps = 0/127 (0%)
 Frame = -2

Query  918  RNEMQFFYEEQLHRMECMAQEPVLFEDILCQIVDMISPEEESYVTLRDLKGSKLSGSVFN  739
            RNE+QFFYEEQLHRMECMAQE VLFEDILCQI DM+ PE+ES +TL+DLKGSKLSG++FN
Sbjct  413  RNELQFFYEEQLHRMECMAQEAVLFEDILCQIFDMVKPEDESCITLKDLKGSKLSGNIFN  472

Query  738  ILFNLNKFMAFETRDPFLIRQERENPNLTEWDRFAHREYIRLSMEEDAEDASNGSADVWD  559
            ILFNLNKFMAFETRDPFLIRQER NP  TEWDRFAHREYIRLSMEED EDASNGSA+ WD
Sbjct  473  ILFNLNKFMAFETRDPFLIRQERANPTWTEWDRFAHREYIRLSMEEDVEDASNGSAEAWD  532

Query  558  ESLEAPF  538
            ES+EAPF
Sbjct  533  ESIEAPF  539



>ref|XP_011004021.1| PREDICTED: serine/threonine protein phosphatase 2A regulatory 
subunit B''alpha-like [Populus euphratica]
Length=541

 Score =   234 bits (598),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 109/126 (87%), Positives = 117/126 (93%), Gaps = 0/126 (0%)
 Frame = -2

Query  915  NEMQFFYEEQLHRMECMAQEPVLFEDILCQIVDMISPEEESYVTLRDLKGSKLSGSVFNI  736
            NE+Q+FYEEQLHRMECMAQEPVLFEDILCQIVDMI+PE E Y+TL DLKG KLSG+VFNI
Sbjct  416  NELQYFYEEQLHRMECMAQEPVLFEDILCQIVDMIAPEREGYITLHDLKGCKLSGNVFNI  475

Query  735  LFNLNKFMAFETRDPFLIRQERENPNLTEWDRFAHREYIRLSMEEDAEDASNGSADVWDE  556
            LFNLNKF+AFE+RDPFLIRQERE P LTEWDRFAHREYIRLSMEED ED SNGSA+VWDE
Sbjct  476  LFNLNKFVAFESRDPFLIRQEREEPTLTEWDRFAHREYIRLSMEEDVEDVSNGSAEVWDE  535

Query  555  SLEAPF  538
            S EAPF
Sbjct  536  SFEAPF  541



>ref|XP_009336125.1| PREDICTED: serine/threonine protein phosphatase 2A regulatory 
subunit B''alpha-like isoform X2 [Pyrus x bretschneideri]
Length=529

 Score =   234 bits (597),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 109/126 (87%), Positives = 118/126 (94%), Gaps = 0/126 (0%)
 Frame = -2

Query  915  NEMQFFYEEQLHRMECMAQEPVLFEDILCQIVDMISPEEESYVTLRDLKGSKLSGSVFNI  736
            NE+QFFYEEQLHRMECM QEPVLFEDILCQIVDMI+PE E Y+TL DLKG KLSG+VFNI
Sbjct  404  NELQFFYEEQLHRMECMGQEPVLFEDILCQIVDMIAPEREEYLTLADLKGCKLSGNVFNI  463

Query  735  LFNLNKFMAFETRDPFLIRQERENPNLTEWDRFAHREYIRLSMEEDAEDASNGSADVWDE  556
            LFNLNKF+AFE+RDPFLIRQERE+P LTEWDRFAHREYIRLSMEED E+ASNGS +VWDE
Sbjct  464  LFNLNKFIAFESRDPFLIRQEREDPTLTEWDRFAHREYIRLSMEEDGENASNGSVEVWDE  523

Query  555  SLEAPF  538
            SLEAPF
Sbjct  524  SLEAPF  529



>ref|XP_002528837.1| calcium ion binding protein, putative [Ricinus communis]
 gb|EEF33571.1| calcium ion binding protein, putative [Ricinus communis]
Length=544

 Score =   234 bits (597),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 108/126 (86%), Positives = 117/126 (93%), Gaps = 0/126 (0%)
 Frame = -2

Query  915  NEMQFFYEEQLHRMECMAQEPVLFEDILCQIVDMISPEEESYVTLRDLKGSKLSGSVFNI  736
            NEMQFFYEEQLHRMEC+AQEPVLFEDILCQI DMI PE E Y+TLRD+K SKLSG+VFNI
Sbjct  419  NEMQFFYEEQLHRMECLAQEPVLFEDILCQIFDMIGPENEGYITLRDMKNSKLSGNVFNI  478

Query  735  LFNLNKFMAFETRDPFLIRQERENPNLTEWDRFAHREYIRLSMEEDAEDASNGSADVWDE  556
            LFNLNKF+AFE+RDPFLIRQERENP LTEWDRFAHREYIRLSME+D +DASNGS D+WDE
Sbjct  479  LFNLNKFIAFESRDPFLIRQERENPALTEWDRFAHREYIRLSMEDDGDDASNGSPDIWDE  538

Query  555  SLEAPF  538
            S EAPF
Sbjct  539  SYEAPF  544



>ref|XP_008372352.1| PREDICTED: serine/threonine protein phosphatase 2A regulatory 
subunit B''alpha-like isoform X2 [Malus domestica]
Length=529

 Score =   234 bits (596),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 109/126 (87%), Positives = 119/126 (94%), Gaps = 0/126 (0%)
 Frame = -2

Query  915  NEMQFFYEEQLHRMECMAQEPVLFEDILCQIVDMISPEEESYVTLRDLKGSKLSGSVFNI  736
            NE+QFFYEEQLHRMECMAQEPVLFEDILCQIVDMI+PE E Y+T+ DLKG KLSG+VFNI
Sbjct  404  NELQFFYEEQLHRMECMAQEPVLFEDILCQIVDMIAPEREDYLTVADLKGCKLSGNVFNI  463

Query  735  LFNLNKFMAFETRDPFLIRQERENPNLTEWDRFAHREYIRLSMEEDAEDASNGSADVWDE  556
            LFNLNKF+AFE+RDPFLIRQERE+P LTEWDRFAHREYIRLSMEED E+ASNGS +VWDE
Sbjct  464  LFNLNKFIAFESRDPFLIRQEREDPTLTEWDRFAHREYIRLSMEEDVENASNGSVEVWDE  523

Query  555  SLEAPF  538
            SLEAPF
Sbjct  524  SLEAPF  529



>ref|XP_009336124.1| PREDICTED: serine/threonine protein phosphatase 2A regulatory 
subunit B''beta-like isoform X1 [Pyrus x bretschneideri]
Length=540

 Score =   234 bits (597),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 109/126 (87%), Positives = 118/126 (94%), Gaps = 0/126 (0%)
 Frame = -2

Query  915  NEMQFFYEEQLHRMECMAQEPVLFEDILCQIVDMISPEEESYVTLRDLKGSKLSGSVFNI  736
            NE+QFFYEEQLHRMECM QEPVLFEDILCQIVDMI+PE E Y+TL DLKG KLSG+VFNI
Sbjct  415  NELQFFYEEQLHRMECMGQEPVLFEDILCQIVDMIAPEREEYLTLADLKGCKLSGNVFNI  474

Query  735  LFNLNKFMAFETRDPFLIRQERENPNLTEWDRFAHREYIRLSMEEDAEDASNGSADVWDE  556
            LFNLNKF+AFE+RDPFLIRQERE+P LTEWDRFAHREYIRLSMEED E+ASNGS +VWDE
Sbjct  475  LFNLNKFIAFESRDPFLIRQEREDPTLTEWDRFAHREYIRLSMEEDGENASNGSVEVWDE  534

Query  555  SLEAPF  538
            SLEAPF
Sbjct  535  SLEAPF  540



>emb|CDY71370.1| BnaCnng72610D, partial [Brassica napus]
Length=240

 Score =   225 bits (574),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 105/127 (83%), Positives = 113/127 (89%), Gaps = 0/127 (0%)
 Frame = -2

Query  918  RNEMQFFYEEQLHRMECMAQEPVLFEDILCQIVDMISPEEESYVTLRDLKGSKLSGSVFN  739
            RNE+QFFYEEQLHRMECMAQE VLFEDILCQ+ DM+ PE+E Y+ L DLKGSKLSG+VFN
Sbjct  114  RNELQFFYEEQLHRMECMAQEAVLFEDILCQLFDMVKPEDEGYICLNDLKGSKLSGNVFN  173

Query  738  ILFNLNKFMAFETRDPFLIRQERENPNLTEWDRFAHREYIRLSMEEDAEDASNGSADVWD  559
            ILFNLNKFMAFETRDPFLIRQER NP  TEWDRFAHREYIRLSMEED ED SNGSA+ WD
Sbjct  174  ILFNLNKFMAFETRDPFLIRQERANPTWTEWDRFAHREYIRLSMEEDVEDVSNGSAEAWD  233

Query  558  ESLEAPF  538
            +SLE  F
Sbjct  234  DSLEVSF  240



>ref|XP_008372351.1| PREDICTED: serine/threonine protein phosphatase 2A regulatory 
subunit B''alpha-like isoform X1 [Malus domestica]
Length=540

 Score =   234 bits (597),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 109/126 (87%), Positives = 119/126 (94%), Gaps = 0/126 (0%)
 Frame = -2

Query  915  NEMQFFYEEQLHRMECMAQEPVLFEDILCQIVDMISPEEESYVTLRDLKGSKLSGSVFNI  736
            NE+QFFYEEQLHRMECMAQEPVLFEDILCQIVDMI+PE E Y+T+ DLKG KLSG+VFNI
Sbjct  415  NELQFFYEEQLHRMECMAQEPVLFEDILCQIVDMIAPEREDYLTVADLKGCKLSGNVFNI  474

Query  735  LFNLNKFMAFETRDPFLIRQERENPNLTEWDRFAHREYIRLSMEEDAEDASNGSADVWDE  556
            LFNLNKF+AFE+RDPFLIRQERE+P LTEWDRFAHREYIRLSMEED E+ASNGS +VWDE
Sbjct  475  LFNLNKFIAFESRDPFLIRQEREDPTLTEWDRFAHREYIRLSMEEDVENASNGSVEVWDE  534

Query  555  SLEAPF  538
            SLEAPF
Sbjct  535  SLEAPF  540



>ref|XP_009369451.1| PREDICTED: serine/threonine protein phosphatase 2A regulatory 
subunit B''alpha-like [Pyrus x bretschneideri]
Length=540

 Score =   234 bits (596),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 109/126 (87%), Positives = 118/126 (94%), Gaps = 0/126 (0%)
 Frame = -2

Query  915  NEMQFFYEEQLHRMECMAQEPVLFEDILCQIVDMISPEEESYVTLRDLKGSKLSGSVFNI  736
            NE+QFFYEEQLHRMECMAQEPVLFEDILCQIVDMI+PE E Y+T  DLKG KLSG+VFNI
Sbjct  415  NELQFFYEEQLHRMECMAQEPVLFEDILCQIVDMIAPEREDYITPADLKGCKLSGNVFNI  474

Query  735  LFNLNKFMAFETRDPFLIRQERENPNLTEWDRFAHREYIRLSMEEDAEDASNGSADVWDE  556
            LFNLNKF+AFE+RDPFLIRQERE+P LTEWDRFAHREYIRLSMEED E+ASNGS +VWDE
Sbjct  475  LFNLNKFIAFESRDPFLIRQEREDPTLTEWDRFAHREYIRLSMEEDGENASNGSVEVWDE  534

Query  555  SLEAPF  538
            SLEAPF
Sbjct  535  SLEAPF  540



>gb|KEH42756.1| calcium-binding EF-hand protein [Medicago truncatula]
Length=510

 Score =   233 bits (594),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 108/126 (86%), Positives = 117/126 (93%), Gaps = 0/126 (0%)
 Frame = -2

Query  915  NEMQFFYEEQLHRMECMAQEPVLFEDILCQIVDMISPEEESYVTLRDLKGSKLSGSVFNI  736
            NEM FFYEEQLHRMECMAQEPVLFEDILCQ+VDMI PE E Y+TLRD+K SKLSG+VFNI
Sbjct  385  NEMLFFYEEQLHRMECMAQEPVLFEDILCQLVDMIGPESEGYITLRDVKSSKLSGNVFNI  444

Query  735  LFNLNKFMAFETRDPFLIRQERENPNLTEWDRFAHREYIRLSMEEDAEDASNGSADVWDE  556
            LFNLNKF+AFE+RDPFLIRQERE+PN+TEWDRFAHREYIRLSMEED ED SN S DVW+E
Sbjct  445  LFNLNKFIAFESRDPFLIRQEREDPNMTEWDRFAHREYIRLSMEEDGEDMSNASGDVWEE  504

Query  555  SLEAPF  538
            SLEAPF
Sbjct  505  SLEAPF  510



>ref|XP_011007482.1| PREDICTED: serine/threonine protein phosphatase 2A regulatory 
subunit B''alpha-like [Populus euphratica]
Length=541

 Score =   233 bits (594),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 108/126 (86%), Positives = 117/126 (93%), Gaps = 0/126 (0%)
 Frame = -2

Query  915  NEMQFFYEEQLHRMECMAQEPVLFEDILCQIVDMISPEEESYVTLRDLKGSKLSGSVFNI  736
            NE+Q+FYEEQLHR+ECMAQEPVLFEDILCQIVDMI+PE E Y+TL DLKG KLSG+VFNI
Sbjct  416  NELQYFYEEQLHRIECMAQEPVLFEDILCQIVDMIAPEREGYITLHDLKGCKLSGNVFNI  475

Query  735  LFNLNKFMAFETRDPFLIRQERENPNLTEWDRFAHREYIRLSMEEDAEDASNGSADVWDE  556
            LFNLNKF+AFE+RDPFLIRQERE P LTEWDRFAHREYIRLSMEED ED SNGSA+VWDE
Sbjct  476  LFNLNKFVAFESRDPFLIRQEREEPTLTEWDRFAHREYIRLSMEEDVEDVSNGSAEVWDE  535

Query  555  SLEAPF  538
            S EAPF
Sbjct  536  SFEAPF  541



>ref|XP_004495369.1| PREDICTED: serine/threonine-protein phosphatase 2A regulatory 
subunit B'' subunit alpha-like [Cicer arietinum]
Length=539

 Score =   233 bits (594),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 109/126 (87%), Positives = 117/126 (93%), Gaps = 0/126 (0%)
 Frame = -2

Query  915  NEMQFFYEEQLHRMECMAQEPVLFEDILCQIVDMISPEEESYVTLRDLKGSKLSGSVFNI  736
            NEM FFYEEQLHRMECMAQEPVLFEDILCQIVDMI PE E Y+TLRD+K SKLSG+VFNI
Sbjct  414  NEMLFFYEEQLHRMECMAQEPVLFEDILCQIVDMIGPENEGYITLRDVKNSKLSGNVFNI  473

Query  735  LFNLNKFMAFETRDPFLIRQERENPNLTEWDRFAHREYIRLSMEEDAEDASNGSADVWDE  556
            LFNLNKF+AFETRDPFLIRQERE+P++TEWDRFAHREYIRLSMEED ED SN S DVW+E
Sbjct  474  LFNLNKFIAFETRDPFLIRQEREDPSMTEWDRFAHREYIRLSMEEDGEDMSNASGDVWEE  533

Query  555  SLEAPF  538
            SLEAPF
Sbjct  534  SLEAPF  539



>gb|AES61092.2| calcium-binding EF-hand protein [Medicago truncatula]
Length=539

 Score =   233 bits (593),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 108/126 (86%), Positives = 117/126 (93%), Gaps = 0/126 (0%)
 Frame = -2

Query  915  NEMQFFYEEQLHRMECMAQEPVLFEDILCQIVDMISPEEESYVTLRDLKGSKLSGSVFNI  736
            NEM FFYEEQLHRMECMAQEPVLFEDILCQ+VDMI PE E Y+TLRD+K SKLSG+VFNI
Sbjct  414  NEMLFFYEEQLHRMECMAQEPVLFEDILCQLVDMIGPESEGYITLRDVKSSKLSGNVFNI  473

Query  735  LFNLNKFMAFETRDPFLIRQERENPNLTEWDRFAHREYIRLSMEEDAEDASNGSADVWDE  556
            LFNLNKF+AFE+RDPFLIRQERE+PN+TEWDRFAHREYIRLSMEED ED SN S DVW+E
Sbjct  474  LFNLNKFIAFESRDPFLIRQEREDPNMTEWDRFAHREYIRLSMEEDGEDMSNASGDVWEE  533

Query  555  SLEAPF  538
            SLEAPF
Sbjct  534  SLEAPF  539



>gb|KJB72386.1| hypothetical protein B456_011G175300 [Gossypium raimondii]
Length=543

 Score =   233 bits (594),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 111/134 (83%), Positives = 116/134 (87%), Gaps = 8/134 (6%)
 Frame = -2

Query  915  NEMQFFYEEQLHRMECMAQEPVLFEDILCQIVDMISPE--------EESYVTLRDLKGSK  760
            NEMQFFYEEQLHRMECM QEPVLFEDILCQI DMI PE         E Y+TLRDLKG K
Sbjct  410  NEMQFFYEEQLHRMECMTQEPVLFEDILCQIFDMIGPEVTPGFSTDNEGYITLRDLKGCK  469

Query  759  LSGSVFNILFNLNKFMAFETRDPFLIRQERENPNLTEWDRFAHREYIRLSMEEDAEDASN  580
            LSG+VFNILFNLNKF+AFE+RDPFLIRQERENP LTEWDRFAHREYIRLSMEED EDASN
Sbjct  470  LSGNVFNILFNLNKFIAFESRDPFLIRQERENPTLTEWDRFAHREYIRLSMEEDVEDASN  529

Query  579  GSADVWDESLEAPF  538
            GS D+WDES EAPF
Sbjct  530  GSGDIWDESFEAPF  543



>ref|XP_010522572.1| PREDICTED: serine/threonine protein phosphatase 2A regulatory 
subunit B''alpha isoform X2 [Tarenaya hassleriana]
Length=459

 Score =   231 bits (588),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 108/126 (86%), Positives = 117/126 (93%), Gaps = 0/126 (0%)
 Frame = -2

Query  915  NEMQFFYEEQLHRMECMAQEPVLFEDILCQIVDMISPEEESYVTLRDLKGSKLSGSVFNI  736
            NE+QFFYEEQLHRMEC+ QEPVLFEDILCQI+DMI PEEE+ VTLRD+KGSKLSG+VFNI
Sbjct  334  NEIQFFYEEQLHRMECITQEPVLFEDILCQIIDMIGPEEENCVTLRDIKGSKLSGNVFNI  393

Query  735  LFNLNKFMAFETRDPFLIRQERENPNLTEWDRFAHREYIRLSMEEDAEDASNGSADVWDE  556
            LFNLNKFMAFETRDPFLIRQERE+P LTEWDRFA REY+RLSMEED E+ SNGSADVWDE
Sbjct  394  LFNLNKFMAFETRDPFLIRQEREDPTLTEWDRFAQREYVRLSMEEDVEEVSNGSADVWDE  453

Query  555  SLEAPF  538
             LE PF
Sbjct  454  PLEHPF  459



>gb|KJB09998.1| hypothetical protein B456_001G179600 [Gossypium raimondii]
 gb|KJB09999.1| hypothetical protein B456_001G179600 [Gossypium raimondii]
 gb|KJB10000.1| hypothetical protein B456_001G179600 [Gossypium raimondii]
 gb|KJB10001.1| hypothetical protein B456_001G179600 [Gossypium raimondii]
Length=545

 Score =   232 bits (592),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 110/126 (87%), Positives = 118/126 (94%), Gaps = 0/126 (0%)
 Frame = -2

Query  915  NEMQFFYEEQLHRMECMAQEPVLFEDILCQIVDMISPEEESYVTLRDLKGSKLSGSVFNI  736
            NEMQFFYEEQLHRMECMAQEPVLFEDILCQI+DMI+PE E  +TL+DLK  KLSG+VFNI
Sbjct  420  NEMQFFYEEQLHRMECMAQEPVLFEDILCQIIDMIAPEREYCITLQDLKRCKLSGNVFNI  479

Query  735  LFNLNKFMAFETRDPFLIRQERENPNLTEWDRFAHREYIRLSMEEDAEDASNGSADVWDE  556
            LFNLNKF+AFE+RDPFLIRQERE P LTEWDRFAHREYIRLSMEED EDASNGSA+VWDE
Sbjct  480  LFNLNKFVAFESRDPFLIRQEREEPTLTEWDRFAHREYIRLSMEEDVEDASNGSAEVWDE  539

Query  555  SLEAPF  538
            SLEAPF
Sbjct  540  SLEAPF  545



>ref|XP_003590841.1| Serine/threonine protein phosphatase 2A regulatory subunit B' 
subunit alpha [Medicago truncatula]
Length=557

 Score =   233 bits (593),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 108/126 (86%), Positives = 117/126 (93%), Gaps = 0/126 (0%)
 Frame = -2

Query  915  NEMQFFYEEQLHRMECMAQEPVLFEDILCQIVDMISPEEESYVTLRDLKGSKLSGSVFNI  736
            NEM FFYEEQLHRMECMAQEPVLFEDILCQ+VDMI PE E Y+TLRD+K SKLSG+VFNI
Sbjct  432  NEMLFFYEEQLHRMECMAQEPVLFEDILCQLVDMIGPESEGYITLRDVKSSKLSGNVFNI  491

Query  735  LFNLNKFMAFETRDPFLIRQERENPNLTEWDRFAHREYIRLSMEEDAEDASNGSADVWDE  556
            LFNLNKF+AFE+RDPFLIRQERE+PN+TEWDRFAHREYIRLSMEED ED SN S DVW+E
Sbjct  492  LFNLNKFIAFESRDPFLIRQEREDPNMTEWDRFAHREYIRLSMEEDGEDMSNASGDVWEE  551

Query  555  SLEAPF  538
            SLEAPF
Sbjct  552  SLEAPF  557



>ref|XP_002302033.1| hypothetical protein POPTR_0002s03710g [Populus trichocarpa]
 gb|EEE81306.1| hypothetical protein POPTR_0002s03710g [Populus trichocarpa]
Length=541

 Score =   231 bits (590),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 107/125 (86%), Positives = 117/125 (94%), Gaps = 0/125 (0%)
 Frame = -2

Query  912  EMQFFYEEQLHRMECMAQEPVLFEDILCQIVDMISPEEESYVTLRDLKGSKLSGSVFNIL  733
            E+Q+FYEEQLHR+ECMAQEPVLFEDILCQIVDMI+PE E Y+TLRDLKG KLSG+VFNIL
Sbjct  417  ELQYFYEEQLHRIECMAQEPVLFEDILCQIVDMIAPEREDYITLRDLKGCKLSGNVFNIL  476

Query  732  FNLNKFMAFETRDPFLIRQERENPNLTEWDRFAHREYIRLSMEEDAEDASNGSADVWDES  553
            FNLNKF+AFE+RDPF+IRQERE P LTEWDRFAHREYIRLSMEED ED SNGSA+VWDES
Sbjct  477  FNLNKFVAFESRDPFVIRQEREEPTLTEWDRFAHREYIRLSMEEDVEDVSNGSAEVWDES  536

Query  552  LEAPF  538
             EAPF
Sbjct  537  FEAPF  541



>ref|XP_010470340.1| PREDICTED: probable serine/threonine protein phosphatase 2A regulatory 
subunit B''delta [Camelina sativa]
Length=535

 Score =   231 bits (589),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 107/127 (84%), Positives = 115/127 (91%), Gaps = 0/127 (0%)
 Frame = -2

Query  918  RNEMQFFYEEQLHRMECMAQEPVLFEDILCQIVDMISPEEESYVTLRDLKGSKLSGSVFN  739
            RNE+QFFYEEQLHRMECMAQE VLFEDILCQ+ DM+ PE+E Y+ L DLKGSKLSG+VFN
Sbjct  409  RNELQFFYEEQLHRMECMAQEAVLFEDILCQLFDMVKPEDEGYICLNDLKGSKLSGNVFN  468

Query  738  ILFNLNKFMAFETRDPFLIRQERENPNLTEWDRFAHREYIRLSMEEDAEDASNGSADVWD  559
            ILFNLNKFMAFETRDPFLIRQER NP  TEWDRFAHREYIRLSMEED EDASNGSA+ WD
Sbjct  469  ILFNLNKFMAFETRDPFLIRQERANPTWTEWDRFAHREYIRLSMEEDVEDASNGSAEAWD  528

Query  558  ESLEAPF  538
            +SLE PF
Sbjct  529  DSLEVPF  535



>ref|XP_006392526.1| hypothetical protein EUTSA_v10023407mg [Eutrema salsugineum]
 gb|ESQ29812.1| hypothetical protein EUTSA_v10023407mg [Eutrema salsugineum]
Length=535

 Score =   231 bits (589),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 107/127 (84%), Positives = 115/127 (91%), Gaps = 0/127 (0%)
 Frame = -2

Query  918  RNEMQFFYEEQLHRMECMAQEPVLFEDILCQIVDMISPEEESYVTLRDLKGSKLSGSVFN  739
            RNE+QFFYEEQLHRMECMAQE VLFEDILCQ+ DM+ PE+E Y+ L DLKGSKLSG+VFN
Sbjct  409  RNELQFFYEEQLHRMECMAQEAVLFEDILCQLFDMVKPEDEGYICLSDLKGSKLSGNVFN  468

Query  738  ILFNLNKFMAFETRDPFLIRQERENPNLTEWDRFAHREYIRLSMEEDAEDASNGSADVWD  559
            ILFNLNKFMAFETRDPFLIRQER NP  TEWDRFAHREYIRLSMEED EDASNGSA+ WD
Sbjct  469  ILFNLNKFMAFETRDPFLIRQERANPTWTEWDRFAHREYIRLSMEEDVEDASNGSAEAWD  528

Query  558  ESLEAPF  538
            +SLE PF
Sbjct  529  DSLEVPF  535



>ref|XP_010511185.1| PREDICTED: probable serine/threonine protein phosphatase 2A regulatory 
subunit B''delta isoform X2 [Camelina sativa]
Length=533

 Score =   231 bits (589),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 107/127 (84%), Positives = 115/127 (91%), Gaps = 0/127 (0%)
 Frame = -2

Query  918  RNEMQFFYEEQLHRMECMAQEPVLFEDILCQIVDMISPEEESYVTLRDLKGSKLSGSVFN  739
            RNE+QFFYEEQLHRMECMAQE VLFEDILCQ+ DM+ PE+E Y+ L DLKGSKLSG+VFN
Sbjct  407  RNELQFFYEEQLHRMECMAQEAVLFEDILCQLFDMVKPEDEGYICLNDLKGSKLSGNVFN  466

Query  738  ILFNLNKFMAFETRDPFLIRQERENPNLTEWDRFAHREYIRLSMEEDAEDASNGSADVWD  559
            ILFNLNKFMAFETRDPFLIRQER NP  TEWDRFAHREYIRLSMEED EDASNGSA+ WD
Sbjct  467  ILFNLNKFMAFETRDPFLIRQERANPTWTEWDRFAHREYIRLSMEEDVEDASNGSAEAWD  526

Query  558  ESLEAPF  538
            +SLE PF
Sbjct  527  DSLEVPF  533



>ref|XP_010522571.1| PREDICTED: serine/threonine protein phosphatase 2A regulatory 
subunit B''alpha isoform X1 [Tarenaya hassleriana]
Length=539

 Score =   231 bits (589),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 108/126 (86%), Positives = 117/126 (93%), Gaps = 0/126 (0%)
 Frame = -2

Query  915  NEMQFFYEEQLHRMECMAQEPVLFEDILCQIVDMISPEEESYVTLRDLKGSKLSGSVFNI  736
            NE+QFFYEEQLHRMEC+ QEPVLFEDILCQI+DMI PEEE+ VTLRD+KGSKLSG+VFNI
Sbjct  414  NEIQFFYEEQLHRMECITQEPVLFEDILCQIIDMIGPEEENCVTLRDIKGSKLSGNVFNI  473

Query  735  LFNLNKFMAFETRDPFLIRQERENPNLTEWDRFAHREYIRLSMEEDAEDASNGSADVWDE  556
            LFNLNKFMAFETRDPFLIRQERE+P LTEWDRFA REY+RLSMEED E+ SNGSADVWDE
Sbjct  474  LFNLNKFMAFETRDPFLIRQEREDPTLTEWDRFAQREYVRLSMEEDVEEVSNGSADVWDE  533

Query  555  SLEAPF  538
             LE PF
Sbjct  534  PLEHPF  539



>ref|XP_010511184.1| PREDICTED: probable serine/threonine protein phosphatase 2A regulatory 
subunit B''delta isoform X1 [Camelina sativa]
Length=535

 Score =   231 bits (589),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 107/127 (84%), Positives = 115/127 (91%), Gaps = 0/127 (0%)
 Frame = -2

Query  918  RNEMQFFYEEQLHRMECMAQEPVLFEDILCQIVDMISPEEESYVTLRDLKGSKLSGSVFN  739
            RNE+QFFYEEQLHRMECMAQE VLFEDILCQ+ DM+ PE+E Y+ L DLKGSKLSG+VFN
Sbjct  409  RNELQFFYEEQLHRMECMAQEAVLFEDILCQLFDMVKPEDEGYICLNDLKGSKLSGNVFN  468

Query  738  ILFNLNKFMAFETRDPFLIRQERENPNLTEWDRFAHREYIRLSMEEDAEDASNGSADVWD  559
            ILFNLNKFMAFETRDPFLIRQER NP  TEWDRFAHREYIRLSMEED EDASNGSA+ WD
Sbjct  469  ILFNLNKFMAFETRDPFLIRQERANPTWTEWDRFAHREYIRLSMEEDVEDASNGSAEAWD  528

Query  558  ESLEAPF  538
            +SLE PF
Sbjct  529  DSLEVPF  535



>gb|KFK35630.1| hypothetical protein AALP_AA4G016100 [Arabis alpina]
Length=534

 Score =   231 bits (588),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 107/127 (84%), Positives = 115/127 (91%), Gaps = 0/127 (0%)
 Frame = -2

Query  918  RNEMQFFYEEQLHRMECMAQEPVLFEDILCQIVDMISPEEESYVTLRDLKGSKLSGSVFN  739
            RNE+QFFYEEQLHRMECMAQE VLFEDILCQ+ DM+ PE+E Y+ L DLKGSKLSG+VFN
Sbjct  408  RNELQFFYEEQLHRMECMAQEAVLFEDILCQLFDMVKPEDEGYICLNDLKGSKLSGNVFN  467

Query  738  ILFNLNKFMAFETRDPFLIRQERENPNLTEWDRFAHREYIRLSMEEDAEDASNGSADVWD  559
            ILFNLNKFMAFETRDPFLIRQER NP  TEWDRFAHREYIRLSMEED EDASNGSA+ WD
Sbjct  468  ILFNLNKFMAFETRDPFLIRQERANPTWTEWDRFAHREYIRLSMEEDVEDASNGSAEAWD  527

Query  558  ESLEAPF  538
            +SLE PF
Sbjct  528  DSLEVPF  534



>ref|XP_002306866.1| hypothetical protein POPTR_0005s24880g [Populus trichocarpa]
 gb|EEE93862.1| hypothetical protein POPTR_0005s24880g [Populus trichocarpa]
Length=541

 Score =   231 bits (589),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 108/126 (86%), Positives = 116/126 (92%), Gaps = 0/126 (0%)
 Frame = -2

Query  915  NEMQFFYEEQLHRMECMAQEPVLFEDILCQIVDMISPEEESYVTLRDLKGSKLSGSVFNI  736
            NE+Q+FYEEQLHRMECMAQEPVLFEDILCQIVDMI+PE E  +TL DLKG KLSG+VFNI
Sbjct  416  NELQYFYEEQLHRMECMAQEPVLFEDILCQIVDMIAPEREGCITLSDLKGCKLSGNVFNI  475

Query  735  LFNLNKFMAFETRDPFLIRQERENPNLTEWDRFAHREYIRLSMEEDAEDASNGSADVWDE  556
            LFNLNKF+AFE+RDPFLIRQERE P LTEWDRFAHREYIRLSMEED ED SNGSA+VWDE
Sbjct  476  LFNLNKFVAFESRDPFLIRQEREEPTLTEWDRFAHREYIRLSMEEDVEDVSNGSAEVWDE  535

Query  555  SLEAPF  538
            S EAPF
Sbjct  536  SFEAPF  541



>ref|XP_010414886.1| PREDICTED: probable serine/threonine protein phosphatase 2A regulatory 
subunit B''delta [Camelina sativa]
Length=538

 Score =   231 bits (588),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 107/127 (84%), Positives = 114/127 (90%), Gaps = 0/127 (0%)
 Frame = -2

Query  918  RNEMQFFYEEQLHRMECMAQEPVLFEDILCQIVDMISPEEESYVTLRDLKGSKLSGSVFN  739
            RNE+QFFYEEQLHRMECMAQE VLFEDILCQ+ DM+ PE+E Y+ L DLKGSKLSG+VFN
Sbjct  409  RNELQFFYEEQLHRMECMAQEAVLFEDILCQLFDMVKPEDEGYICLNDLKGSKLSGNVFN  468

Query  738  ILFNLNKFMAFETRDPFLIRQERENPNLTEWDRFAHREYIRLSMEEDAEDASNGSADVWD  559
            ILFNLNKFMAFETRDPFLIRQER NP  TEWDRFAHREYIRLSMEED EDASNGSA  WD
Sbjct  469  ILFNLNKFMAFETRDPFLIRQERANPTWTEWDRFAHREYIRLSMEEDVEDASNGSAQAWD  528

Query  558  ESLEAPF  538
            +SLE PF
Sbjct  529  DSLEVPF  535



>gb|KHG22923.1| Serine/threonine-protein phosphatase 2A regulatory subunit B'' 
subunit alpha [Gossypium arboreum]
Length=543

 Score =   230 bits (587),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 109/126 (87%), Positives = 117/126 (93%), Gaps = 0/126 (0%)
 Frame = -2

Query  915  NEMQFFYEEQLHRMECMAQEPVLFEDILCQIVDMISPEEESYVTLRDLKGSKLSGSVFNI  736
            NEMQFFYEEQLHRMECMAQEPVLFEDILCQI+DMI+PE E  +TL+DLK  KLSG+VFNI
Sbjct  418  NEMQFFYEEQLHRMECMAQEPVLFEDILCQIIDMIAPEREYCITLQDLKRCKLSGNVFNI  477

Query  735  LFNLNKFMAFETRDPFLIRQERENPNLTEWDRFAHREYIRLSMEEDAEDASNGSADVWDE  556
            LFNLNKF+AFE+RDPFLIRQERE P LTEWD FAHREYIRLSMEED EDASNGSA+VWDE
Sbjct  478  LFNLNKFVAFESRDPFLIRQEREEPTLTEWDHFAHREYIRLSMEEDVEDASNGSAEVWDE  537

Query  555  SLEAPF  538
            SLEAPF
Sbjct  538  SLEAPF  543



>gb|KHG15282.1| Serine/threonine-protein phosphatase 2A regulatory subunit B'' 
subunit alpha [Gossypium arboreum]
Length=573

 Score =   231 bits (588),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 108/116 (93%), Positives = 112/116 (97%), Gaps = 0/116 (0%)
 Frame = -2

Query  918  RNEMQFFYEEQLHRMECMAQEPVLFEDILCQIVDMISPEEESYVTLRDLKGSKLSGSVFN  739
            RNEMQFFYEEQLHRMECMAQEPVLFEDILCQI+DMI PE ESY+TLRDLKGSKLSGSVFN
Sbjct  413  RNEMQFFYEEQLHRMECMAQEPVLFEDILCQIIDMIKPEAESYITLRDLKGSKLSGSVFN  472

Query  738  ILFNLNKFMAFETRDPFLIRQERENPNLTEWDRFAHREYIRLSMEEDAEDASNGSA  571
            ILFNLNKFMAFETRDPFLIRQERENP LTEWDRFAHREYIRLSME+D EDASNG+A
Sbjct  473  ILFNLNKFMAFETRDPFLIRQERENPTLTEWDRFAHREYIRLSMEDDVEDASNGNA  528



>ref|XP_010528763.1| PREDICTED: probable serine/threonine protein phosphatase 2A regulatory 
subunit B''delta isoform X2 [Tarenaya hassleriana]
Length=456

 Score =   228 bits (580),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 106/127 (83%), Positives = 116/127 (91%), Gaps = 0/127 (0%)
 Frame = -2

Query  918  RNEMQFFYEEQLHRMECMAQEPVLFEDILCQIVDMISPEEESYVTLRDLKGSKLSGSVFN  739
            RNE+QFFYEEQLHRMECMAQE V+FEDILCQ+ DMI PE++S +TL+DLKGSKLSG+ FN
Sbjct  330  RNELQFFYEEQLHRMECMAQEAVIFEDILCQLFDMIKPEDKSCITLKDLKGSKLSGNFFN  389

Query  738  ILFNLNKFMAFETRDPFLIRQERENPNLTEWDRFAHREYIRLSMEEDAEDASNGSADVWD  559
            ILFNLNKFMAFETRDPFLIRQER NP  TEWDRFAHREYIRLSMEED EDASNGS + WD
Sbjct  390  ILFNLNKFMAFETRDPFLIRQERANPTWTEWDRFAHREYIRLSMEEDVEDASNGSTEAWD  449

Query  558  ESLEAPF  538
            +SLEAPF
Sbjct  450  DSLEAPF  456



>ref|XP_006300408.1| hypothetical protein CARUB_v10021330mg [Capsella rubella]
 gb|EOA33306.1| hypothetical protein CARUB_v10021330mg [Capsella rubella]
Length=533

 Score =   229 bits (585),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 106/127 (83%), Positives = 115/127 (91%), Gaps = 0/127 (0%)
 Frame = -2

Query  918  RNEMQFFYEEQLHRMECMAQEPVLFEDILCQIVDMISPEEESYVTLRDLKGSKLSGSVFN  739
            RNE+QFFYEEQLHRMECMAQE VLFEDILCQ+ DM+ PE+E ++ L DLKGSKLSG+VFN
Sbjct  407  RNELQFFYEEQLHRMECMAQEAVLFEDILCQLFDMVKPEDEGFICLNDLKGSKLSGNVFN  466

Query  738  ILFNLNKFMAFETRDPFLIRQERENPNLTEWDRFAHREYIRLSMEEDAEDASNGSADVWD  559
            ILFNLNKFMAFETRDPFLIRQER NP  TEWDRFAHREYIRLSMEED EDASNGSA+ WD
Sbjct  467  ILFNLNKFMAFETRDPFLIRQERANPTWTEWDRFAHREYIRLSMEEDVEDASNGSAEAWD  526

Query  558  ESLEAPF  538
            +SLE PF
Sbjct  527  DSLEVPF  533



>ref|NP_175847.1| calcium-binding EF-hand-containing protein [Arabidopsis thaliana]
 sp|Q9SLI8.1|2AB2D_ARATH RecName: Full=Probable serine/threonine protein phosphatase 2A 
regulatory subunit B''delta; Short=AtB''delta [Arabidopsis 
thaliana]
 gb|AAD25624.1|AC005287_26 Similar to phosphoprotein phosphatase 2A regulatory subunit [Arabidopsis 
thaliana]
 gb|AEE33105.1| calcium-binding EF-hand-containing protein [Arabidopsis thaliana]
Length=535

 Score =   229 bits (584),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 106/127 (83%), Positives = 115/127 (91%), Gaps = 0/127 (0%)
 Frame = -2

Query  918  RNEMQFFYEEQLHRMECMAQEPVLFEDILCQIVDMISPEEESYVTLRDLKGSKLSGSVFN  739
            RNE+QFFYEEQLHRMECMAQE VLFEDILCQ+ DM+ PE+E ++ L DLKGSKLSG+VFN
Sbjct  409  RNELQFFYEEQLHRMECMAQEAVLFEDILCQLFDMVKPEDEGFICLNDLKGSKLSGNVFN  468

Query  738  ILFNLNKFMAFETRDPFLIRQERENPNLTEWDRFAHREYIRLSMEEDAEDASNGSADVWD  559
            ILFNLNKFMAFETRDPFLIRQER NP  TEWDRFAHREYIRLSMEED EDASNGSA+ WD
Sbjct  469  ILFNLNKFMAFETRDPFLIRQERANPTWTEWDRFAHREYIRLSMEEDVEDASNGSAEAWD  528

Query  558  ESLEAPF  538
            +SLE PF
Sbjct  529  DSLEVPF  535



>ref|XP_002894582.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH70841.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=535

 Score =   229 bits (584),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 106/127 (83%), Positives = 115/127 (91%), Gaps = 0/127 (0%)
 Frame = -2

Query  918  RNEMQFFYEEQLHRMECMAQEPVLFEDILCQIVDMISPEEESYVTLRDLKGSKLSGSVFN  739
            RNE+QFFYEEQLHRMECMAQE VLFEDILCQ+ DM+ PE+E ++ L DLKGSKLSG+VFN
Sbjct  409  RNELQFFYEEQLHRMECMAQEAVLFEDILCQLFDMVKPEDEGFICLNDLKGSKLSGNVFN  468

Query  738  ILFNLNKFMAFETRDPFLIRQERENPNLTEWDRFAHREYIRLSMEEDAEDASNGSADVWD  559
            ILFNLNKFMAFETRDPFLIRQER NP  TEWDRFAHREYIRLSMEED EDASNGSA+ WD
Sbjct  469  ILFNLNKFMAFETRDPFLIRQERANPTWTEWDRFAHREYIRLSMEEDVEDASNGSAEAWD  528

Query  558  ESLEAPF  538
            +SLE PF
Sbjct  529  DSLEVPF  535



>ref|XP_011028847.1| PREDICTED: serine/threonine protein phosphatase 2A regulatory 
subunit B''alpha-like isoform X2 [Populus euphratica]
Length=498

 Score =   228 bits (580),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 107/126 (85%), Positives = 116/126 (92%), Gaps = 0/126 (0%)
 Frame = -2

Query  915  NEMQFFYEEQLHRMECMAQEPVLFEDILCQIVDMISPEEESYVTLRDLKGSKLSGSVFNI  736
            NE+Q+FYEEQLHR+ECMAQEPVLFEDILCQIVDMI+PE E Y+TLRDLKG KLSG+VFNI
Sbjct  373  NELQYFYEEQLHRIECMAQEPVLFEDILCQIVDMIAPEREDYITLRDLKGCKLSGNVFNI  432

Query  735  LFNLNKFMAFETRDPFLIRQERENPNLTEWDRFAHREYIRLSMEEDAEDASNGSADVWDE  556
            LFNLNKF+AFE+RDPFLIRQERE P LT  DRFAHREYIRLSMEED ED SNGSA+VWDE
Sbjct  433  LFNLNKFVAFESRDPFLIRQEREEPTLTGGDRFAHREYIRLSMEEDVEDVSNGSAEVWDE  492

Query  555  SLEAPF  538
            S EAPF
Sbjct  493  SFEAPF  498



>ref|XP_011028845.1| PREDICTED: serine/threonine protein phosphatase 2A regulatory 
subunit B''alpha-like isoform X1 [Populus euphratica]
 ref|XP_011028846.1| PREDICTED: serine/threonine protein phosphatase 2A regulatory 
subunit B''alpha-like isoform X1 [Populus euphratica]
Length=541

 Score =   228 bits (582),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 107/126 (85%), Positives = 116/126 (92%), Gaps = 0/126 (0%)
 Frame = -2

Query  915  NEMQFFYEEQLHRMECMAQEPVLFEDILCQIVDMISPEEESYVTLRDLKGSKLSGSVFNI  736
            NE+Q+FYEEQLHR+ECMAQEPVLFEDILCQIVDMI+PE E Y+TLRDLKG KLSG+VFNI
Sbjct  416  NELQYFYEEQLHRIECMAQEPVLFEDILCQIVDMIAPEREDYITLRDLKGCKLSGNVFNI  475

Query  735  LFNLNKFMAFETRDPFLIRQERENPNLTEWDRFAHREYIRLSMEEDAEDASNGSADVWDE  556
            LFNLNKF+AFE+RDPFLIRQERE P LT  DRFAHREYIRLSMEED ED SNGSA+VWDE
Sbjct  476  LFNLNKFVAFESRDPFLIRQEREEPTLTGGDRFAHREYIRLSMEEDVEDVSNGSAEVWDE  535

Query  555  SLEAPF  538
            S EAPF
Sbjct  536  SFEAPF  541



>ref|XP_006403143.1| hypothetical protein EUTSA_v10003178mg [Eutrema salsugineum]
 gb|ESQ44596.1| hypothetical protein EUTSA_v10003178mg [Eutrema salsugineum]
Length=539

 Score =   228 bits (582),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 106/126 (84%), Positives = 116/126 (92%), Gaps = 0/126 (0%)
 Frame = -2

Query  915  NEMQFFYEEQLHRMECMAQEPVLFEDILCQIVDMISPEEESYVTLRDLKGSKLSGSVFNI  736
            NEMQFFYEEQLHRMEC+ QEPVLFEDILCQI DMI PE+E+ +TL+DLK SKLSG++FNI
Sbjct  414  NEMQFFYEEQLHRMECITQEPVLFEDILCQIFDMIKPEKENCITLQDLKASKLSGNIFNI  473

Query  735  LFNLNKFMAFETRDPFLIRQERENPNLTEWDRFAHREYIRLSMEEDAEDASNGSADVWDE  556
            LFNLNKFMAFETRDPFLIRQERENP LTEWDRFA REY+RLSMEED E+ SNGSADVWDE
Sbjct  474  LFNLNKFMAFETRDPFLIRQERENPTLTEWDRFAQREYVRLSMEEDVEEVSNGSADVWDE  533

Query  555  SLEAPF  538
             LE+PF
Sbjct  534  PLESPF  539



>ref|NP_199222.1| serine/threonine protein phosphatase 2A regulatory subunit B''alpha 
[Arabidopsis thaliana]
 sp|Q9XGR4.1|2AB2A_ARATH RecName: Full=Serine/threonine protein phosphatase 2A regulatory 
subunit B''alpha; Short=AtB''alpha; Short=PP2A, B'' subunit, 
alpha isoform [Arabidopsis thaliana]
 gb|AAD45158.1|AF165429_1 protein phosphatase 2A 62 kDa B'' regulatory subunit [Arabidopsis 
thaliana]
 dbj|BAB10976.1| protein phosphatase 2A 62 kDa B'' regulatory subunit [Arabidopsis 
thaliana]
 gb|AAM20405.1| protein phosphatase 2A 62 kDa B regulatory subunit [Arabidopsis 
thaliana]
 gb|AAN72135.1| protein phosphatase 2A 62 kDa B regulatory subunit [Arabidopsis 
thaliana]
 gb|AAS44556.1| protein phosphatase 2A alpha [Arabidopsis thaliana]
 gb|AED95057.1| protein phosphatase 2A B' alpha [Arabidopsis thaliana]
Length=538

 Score =   228 bits (582),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 106/126 (84%), Positives = 116/126 (92%), Gaps = 0/126 (0%)
 Frame = -2

Query  915  NEMQFFYEEQLHRMECMAQEPVLFEDILCQIVDMISPEEESYVTLRDLKGSKLSGSVFNI  736
            NEMQFFYEEQLHRMEC+ QEPVLFEDILCQI DMI PE+E+ +TL+DLK SKLSG++FNI
Sbjct  413  NEMQFFYEEQLHRMECITQEPVLFEDILCQIFDMIKPEKENCITLQDLKASKLSGNIFNI  472

Query  735  LFNLNKFMAFETRDPFLIRQERENPNLTEWDRFAHREYIRLSMEEDAEDASNGSADVWDE  556
            LFNLNKFMAFETRDPFLIRQERENP LTEWDRFA REY+RLSMEED E+ SNGSADVWDE
Sbjct  473  LFNLNKFMAFETRDPFLIRQERENPTLTEWDRFAQREYVRLSMEEDVEEVSNGSADVWDE  532

Query  555  SLEAPF  538
             LE+PF
Sbjct  533  PLESPF  538



>ref|XP_009119377.1| PREDICTED: probable serine/threonine protein phosphatase 2A regulatory 
subunit B''delta [Brassica rapa]
 emb|CDY44814.1| BnaCnng11700D [Brassica napus]
Length=540

 Score =   228 bits (582),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 106/127 (83%), Positives = 114/127 (90%), Gaps = 0/127 (0%)
 Frame = -2

Query  918  RNEMQFFYEEQLHRMECMAQEPVLFEDILCQIVDMISPEEESYVTLRDLKGSKLSGSVFN  739
            RNE+QFFYEEQLHRMECMAQE VLFEDILCQ+ DM+ PE+E Y+ L DLKGSKLSG+VFN
Sbjct  414  RNELQFFYEEQLHRMECMAQEAVLFEDILCQLFDMVKPEDEGYICLNDLKGSKLSGNVFN  473

Query  738  ILFNLNKFMAFETRDPFLIRQERENPNLTEWDRFAHREYIRLSMEEDAEDASNGSADVWD  559
            ILFNLNKFMAFETRDPFLIRQER NP  TEWDRFAHREYIRLSMEED EDASNGSA+ WD
Sbjct  474  ILFNLNKFMAFETRDPFLIRQERANPTWTEWDRFAHREYIRLSMEEDVEDASNGSAEAWD  533

Query  558  ESLEAPF  538
            +SLE  F
Sbjct  534  DSLEVSF  540



>ref|XP_002863612.1| hypothetical protein ARALYDRAFT_494587 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH39871.1| hypothetical protein ARALYDRAFT_494587 [Arabidopsis lyrata subsp. 
lyrata]
Length=538

 Score =   228 bits (582),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 106/126 (84%), Positives = 116/126 (92%), Gaps = 0/126 (0%)
 Frame = -2

Query  915  NEMQFFYEEQLHRMECMAQEPVLFEDILCQIVDMISPEEESYVTLRDLKGSKLSGSVFNI  736
            NEMQFFYEEQLHRMEC+ QEPVLFEDILCQI DMI PE+E+ +TL+DLK SKLSG++FNI
Sbjct  413  NEMQFFYEEQLHRMECITQEPVLFEDILCQIFDMIKPEKENCITLQDLKASKLSGNIFNI  472

Query  735  LFNLNKFMAFETRDPFLIRQERENPNLTEWDRFAHREYIRLSMEEDAEDASNGSADVWDE  556
            LFNLNKFMAFETRDPFLIRQERENP LTEWDRFA REY+RLSMEED E+ SNGSADVWDE
Sbjct  473  LFNLNKFMAFETRDPFLIRQERENPTLTEWDRFAQREYVRLSMEEDVEEVSNGSADVWDE  532

Query  555  SLEAPF  538
             LE+PF
Sbjct  533  PLESPF  538



>ref|XP_010481779.1| PREDICTED: serine/threonine protein phosphatase 2A regulatory 
subunit B''alpha [Camelina sativa]
Length=539

 Score =   228 bits (582),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 106/126 (84%), Positives = 116/126 (92%), Gaps = 0/126 (0%)
 Frame = -2

Query  915  NEMQFFYEEQLHRMECMAQEPVLFEDILCQIVDMISPEEESYVTLRDLKGSKLSGSVFNI  736
            NEMQFFYEEQLHRMEC+ QEPVLFEDILCQI DMI PE+E+ +TL+DLK SKLSG++FNI
Sbjct  414  NEMQFFYEEQLHRMECITQEPVLFEDILCQIFDMIKPEKENCITLQDLKASKLSGNIFNI  473

Query  735  LFNLNKFMAFETRDPFLIRQERENPNLTEWDRFAHREYIRLSMEEDAEDASNGSADVWDE  556
            LFNLNKFMAFETRDPFLIRQERENP LTEWDRFA REY+RLSMEED E+ SNGSADVWDE
Sbjct  474  LFNLNKFMAFETRDPFLIRQERENPTLTEWDRFAQREYVRLSMEEDVEEVSNGSADVWDE  533

Query  555  SLEAPF  538
             LE+PF
Sbjct  534  PLESPF  539



>ref|XP_010494408.1| PREDICTED: serine/threonine protein phosphatase 2A regulatory 
subunit B''alpha-like [Camelina sativa]
 ref|XP_010494409.1| PREDICTED: serine/threonine protein phosphatase 2A regulatory 
subunit B''alpha-like [Camelina sativa]
Length=539

 Score =   228 bits (581),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 106/126 (84%), Positives = 116/126 (92%), Gaps = 0/126 (0%)
 Frame = -2

Query  915  NEMQFFYEEQLHRMECMAQEPVLFEDILCQIVDMISPEEESYVTLRDLKGSKLSGSVFNI  736
            NEMQFFYEEQLHRMEC+ QEPVLFEDILCQI DMI PE+E+ +TL+DLK SKLSG++FNI
Sbjct  414  NEMQFFYEEQLHRMECITQEPVLFEDILCQIFDMIKPEKENCITLQDLKASKLSGNIFNI  473

Query  735  LFNLNKFMAFETRDPFLIRQERENPNLTEWDRFAHREYIRLSMEEDAEDASNGSADVWDE  556
            LFNLNKFMAFETRDPFLIRQERENP LTEWDRFA REY+RLSMEED E+ SNGSADVWDE
Sbjct  474  LFNLNKFMAFETRDPFLIRQERENPTLTEWDRFAQREYVRLSMEEDVEEVSNGSADVWDE  533

Query  555  SLEAPF  538
             LE+PF
Sbjct  534  PLESPF  539



>ref|XP_010441946.1| PREDICTED: serine/threonine protein phosphatase 2A regulatory 
subunit B''alpha-like [Camelina sativa]
Length=539

 Score =   228 bits (581),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 106/126 (84%), Positives = 116/126 (92%), Gaps = 0/126 (0%)
 Frame = -2

Query  915  NEMQFFYEEQLHRMECMAQEPVLFEDILCQIVDMISPEEESYVTLRDLKGSKLSGSVFNI  736
            NEMQFFYEEQLHRMEC+ QEPVLFEDILCQI DMI PE+E+ +TL+DLK SKLSG++FNI
Sbjct  414  NEMQFFYEEQLHRMECITQEPVLFEDILCQIFDMIKPEKENCITLQDLKASKLSGNIFNI  473

Query  735  LFNLNKFMAFETRDPFLIRQERENPNLTEWDRFAHREYIRLSMEEDAEDASNGSADVWDE  556
            LFNLNKFMAFETRDPFLIRQERENP LTEWDRFA REY+RLSMEED E+ SNGSADVWDE
Sbjct  474  LFNLNKFMAFETRDPFLIRQERENPTLTEWDRFAQREYVRLSMEEDVEEVSNGSADVWDE  533

Query  555  SLEAPF  538
             LE+PF
Sbjct  534  PLESPF  539



>ref|XP_006281535.1| hypothetical protein CARUB_v10027636mg [Capsella rubella]
 gb|EOA14433.1| hypothetical protein CARUB_v10027636mg [Capsella rubella]
Length=538

 Score =   228 bits (581),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 106/126 (84%), Positives = 116/126 (92%), Gaps = 0/126 (0%)
 Frame = -2

Query  915  NEMQFFYEEQLHRMECMAQEPVLFEDILCQIVDMISPEEESYVTLRDLKGSKLSGSVFNI  736
            NEMQFFYEEQLHRMEC+ QEPVLFEDILCQI DMI PE+E+ +TL+DLK SKLSG++FNI
Sbjct  413  NEMQFFYEEQLHRMECITQEPVLFEDILCQIFDMIKPEKENCITLQDLKASKLSGNIFNI  472

Query  735  LFNLNKFMAFETRDPFLIRQERENPNLTEWDRFAHREYIRLSMEEDAEDASNGSADVWDE  556
            LFNLNKFMAFETRDPFLIRQERENP LTEWDRFA REY+RLSMEED E+ SNGSADVWDE
Sbjct  473  LFNLNKFMAFETRDPFLIRQERENPTLTEWDRFAQREYVRLSMEEDVEEVSNGSADVWDE  532

Query  555  SLEAPF  538
             LE+PF
Sbjct  533  PLESPF  538



>ref|XP_010528761.1| PREDICTED: probable serine/threonine protein phosphatase 2A regulatory 
subunit B''delta isoform X1 [Tarenaya hassleriana]
 ref|XP_010528762.1| PREDICTED: probable serine/threonine protein phosphatase 2A regulatory 
subunit B''delta isoform X1 [Tarenaya hassleriana]
Length=539

 Score =   228 bits (581),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 106/127 (83%), Positives = 116/127 (91%), Gaps = 0/127 (0%)
 Frame = -2

Query  918  RNEMQFFYEEQLHRMECMAQEPVLFEDILCQIVDMISPEEESYVTLRDLKGSKLSGSVFN  739
            RNE+QFFYEEQLHRMECMAQE V+FEDILCQ+ DMI PE++S +TL+DLKGSKLSG+ FN
Sbjct  413  RNELQFFYEEQLHRMECMAQEAVIFEDILCQLFDMIKPEDKSCITLKDLKGSKLSGNFFN  472

Query  738  ILFNLNKFMAFETRDPFLIRQERENPNLTEWDRFAHREYIRLSMEEDAEDASNGSADVWD  559
            ILFNLNKFMAFETRDPFLIRQER NP  TEWDRFAHREYIRLSMEED EDASNGS + WD
Sbjct  473  ILFNLNKFMAFETRDPFLIRQERANPTWTEWDRFAHREYIRLSMEEDVEDASNGSTEAWD  532

Query  558  ESLEAPF  538
            +SLEAPF
Sbjct  533  DSLEAPF  539



>gb|KJB38395.1| hypothetical protein B456_006G253100 [Gossypium raimondii]
Length=550

 Score =   228 bits (581),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 106/126 (84%), Positives = 114/126 (90%), Gaps = 0/126 (0%)
 Frame = -2

Query  915  NEMQFFYEEQLHRMECMAQEPVLFEDILCQIVDMISPEEESYVTLRDLKGSKLSGSVFNI  736
            NE+QFFYEEQLHRMECMAQE VLFED+LCQIVDMI PE+E Y++LRD+K  KLSG VFNI
Sbjct  425  NELQFFYEEQLHRMECMAQEIVLFEDVLCQIVDMIRPEKEDYISLRDMKSCKLSGHVFNI  484

Query  735  LFNLNKFMAFETRDPFLIRQERENPNLTEWDRFAHREYIRLSMEEDAEDASNGSADVWDE  556
            LFN NKF+AFETRDPFLIRQERENP LTEWDR AHREYIRLSMEED EDASNGS D+WDE
Sbjct  485  LFNNNKFIAFETRDPFLIRQERENPTLTEWDRLAHREYIRLSMEEDIEDASNGSGDIWDE  544

Query  555  SLEAPF  538
            S EAPF
Sbjct  545  SFEAPF  550



>ref|XP_002977985.1| hypothetical protein SELMODRAFT_152267 [Selaginella moellendorffii]
 gb|EFJ20642.1| hypothetical protein SELMODRAFT_152267 [Selaginella moellendorffii]
Length=512

 Score =   226 bits (575),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 105/126 (83%), Positives = 118/126 (94%), Gaps = 0/126 (0%)
 Frame = -2

Query  915  NEMQFFYEEQLHRMECMAQEPVLFEDILCQIVDMISPEEESYVTLRDLKGSKLSGSVFNI  736
            NEMQ+FYEEQLHRMEC+AQ+PVLFEDI+CQ+ DMI PE++  +TLRDLK  KLSG+ FNI
Sbjct  387  NEMQYFYEEQLHRMECLAQDPVLFEDIVCQMTDMICPEKQGQLTLRDLKRCKLSGNFFNI  446

Query  735  LFNLNKFMAFETRDPFLIRQERENPNLTEWDRFAHREYIRLSMEEDAEDASNGSADVWDE  556
            LFNLNKF+AFETRDPFLIRQERE+P LTEWDRFAH+EYIRLSMEEDAEDASNGSA+VWDE
Sbjct  447  LFNLNKFVAFETRDPFLIRQEREDPTLTEWDRFAHQEYIRLSMEEDAEDASNGSAEVWDE  506

Query  555  SLEAPF  538
            SLEAPF
Sbjct  507  SLEAPF  512



>ref|XP_002966764.1| hypothetical protein SELMODRAFT_85336 [Selaginella moellendorffii]
 gb|EFJ32791.1| hypothetical protein SELMODRAFT_85336 [Selaginella moellendorffii]
Length=541

 Score =   226 bits (576),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 105/126 (83%), Positives = 118/126 (94%), Gaps = 0/126 (0%)
 Frame = -2

Query  915  NEMQFFYEEQLHRMECMAQEPVLFEDILCQIVDMISPEEESYVTLRDLKGSKLSGSVFNI  736
            NEMQ+FYEEQLHRMEC+AQ+PVLFEDI+CQ+ DMI PE++  +TLRDLK  KLSG+ FNI
Sbjct  416  NEMQYFYEEQLHRMECLAQDPVLFEDIVCQMTDMICPEKQGQLTLRDLKRCKLSGNFFNI  475

Query  735  LFNLNKFMAFETRDPFLIRQERENPNLTEWDRFAHREYIRLSMEEDAEDASNGSADVWDE  556
            LFNLNKF+AFETRDPFLIRQERE+P LTEWDRFAH+EYIRLSMEEDAEDASNGSA+VWDE
Sbjct  476  LFNLNKFVAFETRDPFLIRQEREDPTLTEWDRFAHQEYIRLSMEEDAEDASNGSAEVWDE  535

Query  555  SLEAPF  538
            SLEAPF
Sbjct  536  SLEAPF  541



>ref|XP_010475029.1| PREDICTED: probable serine/threonine protein phosphatase 2A regulatory 
subunit B''epsilon isoform X2 [Camelina sativa]
Length=389

 Score =   222 bits (565),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 104/127 (82%), Positives = 115/127 (91%), Gaps = 0/127 (0%)
 Frame = -2

Query  918  RNEMQFFYEEQLHRMECMAQEPVLFEDILCQIVDMISPEEESYVTLRDLKGSKLSGSVFN  739
            RNEM FF+EEQLHRMEC+ QEPVLF+DILCQI+DMI PEEE+ +TL+DLKGSKLSG+VFN
Sbjct  263  RNEMHFFFEEQLHRMECITQEPVLFKDILCQIIDMIGPEEENCITLQDLKGSKLSGNVFN  322

Query  738  ILFNLNKFMAFETRDPFLIRQERENPNLTEWDRFAHREYIRLSMEEDAEDASNGSADVWD  559
            ILFNLNKFMAFETRDPFLIRQERE PNLTEWDRFA REY+RLSMEED E+ SNGS DVW+
Sbjct  323  ILFNLNKFMAFETRDPFLIRQEREEPNLTEWDRFAQREYLRLSMEEDVEEVSNGSPDVWE  382

Query  558  ESLEAPF  538
            E LE  F
Sbjct  383  EPLEPQF  389



>ref|XP_010482911.1| PREDICTED: probable serine/threonine protein phosphatase 2A regulatory 
subunit B''epsilon isoform X2 [Camelina sativa]
 ref|XP_010482919.1| PREDICTED: probable serine/threonine protein phosphatase 2A regulatory 
subunit B''epsilon isoform X2 [Camelina sativa]
Length=389

 Score =   221 bits (564),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 104/127 (82%), Positives = 114/127 (90%), Gaps = 0/127 (0%)
 Frame = -2

Query  918  RNEMQFFYEEQLHRMECMAQEPVLFEDILCQIVDMISPEEESYVTLRDLKGSKLSGSVFN  739
            RNEM FF+EEQLHRMEC+ QEPV F DILCQI+DMI PE+E+ +TL+DLKGSKLSG+VFN
Sbjct  263  RNEMHFFFEEQLHRMECITQEPVPFNDILCQIIDMIGPEKENCITLKDLKGSKLSGNVFN  322

Query  738  ILFNLNKFMAFETRDPFLIRQERENPNLTEWDRFAHREYIRLSMEEDAEDASNGSADVWD  559
            ILFNLNKFMAFETRDPFLIRQERE PNLTEWDRFA REY+RLSMEED E+ SNGSADVWD
Sbjct  323  ILFNLNKFMAFETRDPFLIRQEREEPNLTEWDRFAQREYLRLSMEEDVEEVSNGSADVWD  382

Query  558  ESLEAPF  538
            E LE  F
Sbjct  383  EPLEPQF  389



>ref|NP_001046159.2| Os02g0191700 [Oryza sativa Japonica Group]
 dbj|BAF08073.2| Os02g0191700, partial [Oryza sativa Japonica Group]
Length=136

 Score =   213 bits (542),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 99/126 (79%), Positives = 111/126 (88%), Gaps = 0/126 (0%)
 Frame = -2

Query  915  NEMQFFYEEQLHRMECMAQEPVLFEDILCQIVDMISPEEESYVTLRDLKGSKLSGSVFNI  736
            NE+QFF+EEQLHRMECMAQEPVLFEDILCQ++DMI PE E++ TL+D +  KLSG  FNI
Sbjct  11   NELQFFFEEQLHRMECMAQEPVLFEDILCQLIDMIGPENETFFTLKDFRRCKLSGHFFNI  70

Query  735  LFNLNKFMAFETRDPFLIRQERENPNLTEWDRFAHREYIRLSMEEDAEDASNGSADVWDE  556
            LFNLNKFMAFE RDPFLIRQ RE P+LT+WDRFA REYIRL+MEED EDASN S DVWDE
Sbjct  71   LFNLNKFMAFEARDPFLIRQMREEPSLTDWDRFARREYIRLAMEEDGEDASNASGDVWDE  130

Query  555  SLEAPF  538
            SLE+PF
Sbjct  131  SLESPF  136



>ref|NP_973757.1| calcium-binding EF-hand-containing protein [Arabidopsis thaliana]
 gb|AEE27638.1| calcium-binding EF-hand-containing protein [Arabidopsis thaliana]
Length=389

 Score =   220 bits (561),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 103/126 (82%), Positives = 114/126 (90%), Gaps = 0/126 (0%)
 Frame = -2

Query  915  NEMQFFYEEQLHRMECMAQEPVLFEDILCQIVDMISPEEESYVTLRDLKGSKLSGSVFNI  736
            NEMQFF+EEQLHRMEC+ QE VLF DILCQI+DMI PE+E+ +TL+DLKGSKLS +VFNI
Sbjct  264  NEMQFFFEEQLHRMECITQEAVLFSDILCQIIDMIGPEKENCITLQDLKGSKLSANVFNI  323

Query  735  LFNLNKFMAFETRDPFLIRQERENPNLTEWDRFAHREYIRLSMEEDAEDASNGSADVWDE  556
            LFNLNKFMAFETRDPFLIRQERE+PNLTEWDRFA REY RLSMEED ++ SNGSADVWDE
Sbjct  324  LFNLNKFMAFETRDPFLIRQEREDPNLTEWDRFAQREYARLSMEEDVDEVSNGSADVWDE  383

Query  555  SLEAPF  538
             LE PF
Sbjct  384  PLEPPF  389



>ref|XP_010475028.1| PREDICTED: probable serine/threonine protein phosphatase 2A regulatory 
subunit B''epsilon isoform X1 [Camelina sativa]
Length=543

 Score =   223 bits (569),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 104/127 (82%), Positives = 115/127 (91%), Gaps = 0/127 (0%)
 Frame = -2

Query  918  RNEMQFFYEEQLHRMECMAQEPVLFEDILCQIVDMISPEEESYVTLRDLKGSKLSGSVFN  739
            RNEM FF+EEQLHRMEC+ QEPVLF+DILCQI+DMI PEEE+ +TL+DLKGSKLSG+VFN
Sbjct  417  RNEMHFFFEEQLHRMECITQEPVLFKDILCQIIDMIGPEEENCITLQDLKGSKLSGNVFN  476

Query  738  ILFNLNKFMAFETRDPFLIRQERENPNLTEWDRFAHREYIRLSMEEDAEDASNGSADVWD  559
            ILFNLNKFMAFETRDPFLIRQERE PNLTEWDRFA REY+RLSMEED E+ SNGS DVW+
Sbjct  477  ILFNLNKFMAFETRDPFLIRQEREEPNLTEWDRFAQREYLRLSMEEDVEEVSNGSPDVWE  536

Query  558  ESLEAPF  538
            E LE  F
Sbjct  537  EPLEPQF  543



>ref|XP_002889485.1| calcium-binding EF hand family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH65744.1| calcium-binding EF hand family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=539

 Score =   223 bits (568),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 103/126 (82%), Positives = 115/126 (91%), Gaps = 0/126 (0%)
 Frame = -2

Query  915  NEMQFFYEEQLHRMECMAQEPVLFEDILCQIVDMISPEEESYVTLRDLKGSKLSGSVFNI  736
            NEMQFF+EEQLHRMEC+ QE VLF DILCQI+DMI PE+E+ +T +DLKGSKLSG+VFNI
Sbjct  414  NEMQFFFEEQLHRMECVTQEAVLFSDILCQIIDMIGPEKENCITFQDLKGSKLSGNVFNI  473

Query  735  LFNLNKFMAFETRDPFLIRQERENPNLTEWDRFAHREYIRLSMEEDAEDASNGSADVWDE  556
            LFNLNKFMAFETRDPFLIRQERE+PNLTEWDRFA REY+RLSMEED ++ SNGSADVWDE
Sbjct  474  LFNLNKFMAFETRDPFLIRQEREDPNLTEWDRFAQREYVRLSMEEDVDEVSNGSADVWDE  533

Query  555  SLEAPF  538
             LE PF
Sbjct  534  PLEPPF  539



>ref|XP_010482903.1| PREDICTED: probable serine/threonine protein phosphatase 2A regulatory 
subunit B''epsilon isoform X1 [Camelina sativa]
Length=543

 Score =   223 bits (568),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 104/127 (82%), Positives = 114/127 (90%), Gaps = 0/127 (0%)
 Frame = -2

Query  918  RNEMQFFYEEQLHRMECMAQEPVLFEDILCQIVDMISPEEESYVTLRDLKGSKLSGSVFN  739
            RNEM FF+EEQLHRMEC+ QEPV F DILCQI+DMI PE+E+ +TL+DLKGSKLSG+VFN
Sbjct  417  RNEMHFFFEEQLHRMECITQEPVPFNDILCQIIDMIGPEKENCITLKDLKGSKLSGNVFN  476

Query  738  ILFNLNKFMAFETRDPFLIRQERENPNLTEWDRFAHREYIRLSMEEDAEDASNGSADVWD  559
            ILFNLNKFMAFETRDPFLIRQERE PNLTEWDRFA REY+RLSMEED E+ SNGSADVWD
Sbjct  477  ILFNLNKFMAFETRDPFLIRQEREEPNLTEWDRFAQREYLRLSMEEDVEEVSNGSADVWD  536

Query  558  ESLEAPF  538
            E LE  F
Sbjct  537  EPLEPQF  543



>ref|XP_008460653.1| PREDICTED: probable serine/threonine protein phosphatase 2A regulatory 
subunit B''delta [Cucumis melo]
 ref|XP_008460654.1| PREDICTED: probable serine/threonine protein phosphatase 2A regulatory 
subunit B''delta [Cucumis melo]
Length=539

 Score =   222 bits (565),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 106/127 (83%), Positives = 115/127 (91%), Gaps = 1/127 (1%)
 Frame = -2

Query  918  RNEMQFFYEEQLHRMECMAQEPVLFEDILCQIVDMISPEEESYVTLRDLKGSKLSGSVFN  739
            RNEMQ+F+EEQLHRMECMAQEPVLFEDILCQI DMI PE E  +TLRD+K  KL+G VFN
Sbjct  414  RNEMQYFFEEQLHRMECMAQEPVLFEDILCQIFDMIGPENEECITLRDIKNCKLAGHVFN  473

Query  738  ILFNLNKFMAFETRDPFLIRQERENPNLTEWDRFAHREYIRLSMEEDAEDASNGSADVWD  559
            ILFNLNKF+AFE+RDPFLIRQE E+P LTEWDRFAHREYIRLSMEE+AEDASN S DVWD
Sbjct  474  ILFNLNKFVAFESRDPFLIRQEHEDPTLTEWDRFAHREYIRLSMEEEAEDASNAS-DVWD  532

Query  558  ESLEAPF  538
            ESLEAPF
Sbjct  533  ESLEAPF  539



>ref|XP_004147151.1| PREDICTED: probable serine/threonine protein phosphatase 2A regulatory 
subunit B''delta [Cucumis sativus]
 ref|XP_011649148.1| PREDICTED: probable serine/threonine protein phosphatase 2A regulatory 
subunit B''delta [Cucumis sativus]
 gb|KGN61592.1| hypothetical protein Csa_2G174090 [Cucumis sativus]
Length=539

 Score =   222 bits (565),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 106/127 (83%), Positives = 115/127 (91%), Gaps = 1/127 (1%)
 Frame = -2

Query  918  RNEMQFFYEEQLHRMECMAQEPVLFEDILCQIVDMISPEEESYVTLRDLKGSKLSGSVFN  739
            RNEMQ+F+EEQLHRMECMAQEPVLFEDILCQI DMI PE E  +TLRD+K  KL+G VFN
Sbjct  414  RNEMQYFFEEQLHRMECMAQEPVLFEDILCQIFDMIGPENEECITLRDIKNCKLAGHVFN  473

Query  738  ILFNLNKFMAFETRDPFLIRQERENPNLTEWDRFAHREYIRLSMEEDAEDASNGSADVWD  559
            ILFNLNKF+AFE+RDPFLIRQE E+P LTEWDRFAHREYIRLSMEE+AEDASN S DVWD
Sbjct  474  ILFNLNKFVAFESRDPFLIRQEHEDPTLTEWDRFAHREYIRLSMEEEAEDASNAS-DVWD  532

Query  558  ESLEAPF  538
            ESLEAPF
Sbjct  533  ESLEAPF  539



>gb|AAD10674.1| Highly similar to protein phosphatase 2A regulatory subunit [Arabidopsis 
thaliana]
Length=534

 Score =   221 bits (562),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 103/126 (82%), Positives = 114/126 (90%), Gaps = 0/126 (0%)
 Frame = -2

Query  915  NEMQFFYEEQLHRMECMAQEPVLFEDILCQIVDMISPEEESYVTLRDLKGSKLSGSVFNI  736
            NEMQFF+EEQLHRMEC+ QE VLF DILCQI+DMI PE+E+ +TL+DLKGSKLS +VFNI
Sbjct  409  NEMQFFFEEQLHRMECITQEAVLFSDILCQIIDMIGPEKENCITLQDLKGSKLSANVFNI  468

Query  735  LFNLNKFMAFETRDPFLIRQERENPNLTEWDRFAHREYIRLSMEEDAEDASNGSADVWDE  556
            LFNLNKFMAFETRDPFLIRQERE+PNLTEWDRFA REY RLSMEED ++ SNGSADVWDE
Sbjct  469  LFNLNKFMAFETRDPFLIRQEREDPNLTEWDRFAQREYARLSMEEDVDEVSNGSADVWDE  528

Query  555  SLEAPF  538
             LE PF
Sbjct  529  PLEPPF  534



>ref|NP_171892.2| calcium-binding EF-hand-containing protein [Arabidopsis thaliana]
 sp|Q84JI6.1|2AB2E_ARATH RecName: Full=Probable serine/threonine protein phosphatase 2A 
regulatory subunit B''epsilon; Short=AtB''epsilon [Arabidopsis 
thaliana]
 gb|AAO42077.1| putative protein phosphatase 2A [Arabidopsis thaliana]
 gb|AAO50478.1| putative protein phosphatase 2A [Arabidopsis thaliana]
 gb|AEE27639.1| calcium-binding EF-hand-containing protein [Arabidopsis thaliana]
Length=529

 Score =   221 bits (562),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 103/126 (82%), Positives = 114/126 (90%), Gaps = 0/126 (0%)
 Frame = -2

Query  915  NEMQFFYEEQLHRMECMAQEPVLFEDILCQIVDMISPEEESYVTLRDLKGSKLSGSVFNI  736
            NEMQFF+EEQLHRMEC+ QE VLF DILCQI+DMI PE+E+ +TL+DLKGSKLS +VFNI
Sbjct  404  NEMQFFFEEQLHRMECITQEAVLFSDILCQIIDMIGPEKENCITLQDLKGSKLSANVFNI  463

Query  735  LFNLNKFMAFETRDPFLIRQERENPNLTEWDRFAHREYIRLSMEEDAEDASNGSADVWDE  556
            LFNLNKFMAFETRDPFLIRQERE+PNLTEWDRFA REY RLSMEED ++ SNGSADVWDE
Sbjct  464  LFNLNKFMAFETRDPFLIRQEREDPNLTEWDRFAQREYARLSMEEDVDEVSNGSADVWDE  523

Query  555  SLEAPF  538
             LE PF
Sbjct  524  PLEPPF  529



>ref|XP_009113951.1| PREDICTED: serine/threonine protein phosphatase 2A regulatory 
subunit B''alpha [Brassica rapa]
Length=531

 Score =   219 bits (557),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 105/126 (83%), Positives = 114/126 (90%), Gaps = 2/126 (2%)
 Frame = -2

Query  915  NEMQFFYEEQLHRMECMAQEPVLFEDILCQIVDMISPEEESYVTLRDLKGSKLSGSVFNI  736
            NEMQFFYEEQLHRMEC+ QEPVLFEDILCQI DMI PE+E+ +TL+DLK SKLS +VFNI
Sbjct  408  NEMQFFYEEQLHRMECITQEPVLFEDILCQIFDMIKPEKENCITLKDLKASKLSRNVFNI  467

Query  735  LFNLNKFMAFETRDPFLIRQERENPNLTEWDRFAHREYIRLSMEEDAEDASNGSADVWDE  556
            LFNLNKFMAFETRDPFLIRQERENP LTEWDRFA REY+RLSMEED  + SNGSADVWDE
Sbjct  468  LFNLNKFMAFETRDPFLIRQERENPTLTEWDRFAQREYVRLSMEED--EVSNGSADVWDE  525

Query  555  SLEAPF  538
             LE+PF
Sbjct  526  PLESPF  531



>ref|XP_004951612.1| PREDICTED: serine/threonine-protein phosphatase 2A regulatory 
subunit B'' subunit beta-like [Setaria italica]
Length=545

 Score =   218 bits (555),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 100/126 (79%), Positives = 112/126 (89%), Gaps = 0/126 (0%)
 Frame = -2

Query  915  NEMQFFYEEQLHRMECMAQEPVLFEDILCQIVDMISPEEESYVTLRDLKGSKLSGSVFNI  736
            NE+QFF+EEQLHRMECMAQEPVLFEDILCQ++DMI PE ESY+TL+D +  KLSG  FNI
Sbjct  420  NELQFFFEEQLHRMECMAQEPVLFEDILCQLIDMIGPENESYLTLKDFRRCKLSGHFFNI  479

Query  735  LFNLNKFMAFETRDPFLIRQERENPNLTEWDRFAHREYIRLSMEEDAEDASNGSADVWDE  556
            LFNLNKFMAFE RDPFLIRQ RE P+LT+WDRFA REY+RL+MEED EDASN S DVWDE
Sbjct  480  LFNLNKFMAFEARDPFLIRQMREEPSLTDWDRFARREYVRLAMEEDGEDASNASGDVWDE  539

Query  555  SLEAPF  538
            SLE+PF
Sbjct  540  SLESPF  545



>ref|XP_006648406.1| PREDICTED: probable serine/threonine protein phosphatase 2A regulatory 
subunit B''gamma-like [Oryza brachyantha]
Length=444

 Score =   216 bits (549),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 99/126 (79%), Positives = 112/126 (89%), Gaps = 0/126 (0%)
 Frame = -2

Query  915  NEMQFFYEEQLHRMECMAQEPVLFEDILCQIVDMISPEEESYVTLRDLKGSKLSGSVFNI  736
            NE+QFF+EEQLHRMECMAQEPVLFEDILCQ++DMI PE E++ TL+D +  KLSG  FNI
Sbjct  319  NELQFFFEEQLHRMECMAQEPVLFEDILCQLIDMIGPENETFFTLKDFRRCKLSGHFFNI  378

Query  735  LFNLNKFMAFETRDPFLIRQERENPNLTEWDRFAHREYIRLSMEEDAEDASNGSADVWDE  556
            LFNLNKFMAFE+RDPFLIRQ RE P+LT+WDRFA REYIRL+MEED EDASN S DVWDE
Sbjct  379  LFNLNKFMAFESRDPFLIRQMREEPSLTDWDRFARREYIRLAMEEDGEDASNASGDVWDE  438

Query  555  SLEAPF  538
            SLE+PF
Sbjct  439  SLESPF  444



>gb|EEE56483.1| hypothetical protein OsJ_05710 [Oryza sativa Japonica Group]
Length=462

 Score =   214 bits (546),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 99/127 (78%), Positives = 111/127 (87%), Gaps = 0/127 (0%)
 Frame = -2

Query  918  RNEMQFFYEEQLHRMECMAQEPVLFEDILCQIVDMISPEEESYVTLRDLKGSKLSGSVFN  739
             NE+QFF+EEQLHRMECMAQEPVLFEDILCQ++DMI PE E++ TL+D +  KLSG  FN
Sbjct  336  HNELQFFFEEQLHRMECMAQEPVLFEDILCQLIDMIGPENETFFTLKDFRRCKLSGHFFN  395

Query  738  ILFNLNKFMAFETRDPFLIRQERENPNLTEWDRFAHREYIRLSMEEDAEDASNGSADVWD  559
            ILFNLNKFMAFE RDPFLIRQ RE P+LT+WDRFA REYIRL+MEED EDASN S DVWD
Sbjct  396  ILFNLNKFMAFEARDPFLIRQMREEPSLTDWDRFARREYIRLAMEEDGEDASNASGDVWD  455

Query  558  ESLEAPF  538
            ESLE+PF
Sbjct  456  ESLESPF  462



>ref|XP_010093066.1| hypothetical protein L484_005924 [Morus notabilis]
 gb|EXB53494.1| hypothetical protein L484_005924 [Morus notabilis]
Length=560

 Score =   216 bits (550),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 102/126 (81%), Positives = 113/126 (90%), Gaps = 0/126 (0%)
 Frame = -2

Query  915  NEMQFFYEEQLHRMECMAQEPVLFEDILCQIVDMISPEEESYVTLRDLKGSKLSGSVFNI  736
            NEMQ+FYEEQLHRMECM QEPVLFEDI CQIVDMI+PE E  +TL DLK SKLSG+VFNI
Sbjct  435  NEMQYFYEEQLHRMECMGQEPVLFEDIRCQIVDMIAPEREDSITLHDLKQSKLSGNVFNI  494

Query  735  LFNLNKFMAFETRDPFLIRQERENPNLTEWDRFAHREYIRLSMEEDAEDASNGSADVWDE  556
            LFNLNKF++FE RD  LIRQER++P+LTEWDRFAHREY+RLSMEED EDASNGS +VWDE
Sbjct  495  LFNLNKFISFECRDQSLIRQERDDPSLTEWDRFAHREYLRLSMEEDGEDASNGSIEVWDE  554

Query  555  SLEAPF  538
            S EAPF
Sbjct  555  SFEAPF  560



>ref|XP_001752983.1| predicted protein [Physcomitrella patens]
 gb|EDQ82024.1| predicted protein [Physcomitrella patens]
Length=547

 Score =   216 bits (549),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 104/127 (82%), Positives = 113/127 (89%), Gaps = 1/127 (1%)
 Frame = -2

Query  915  NEMQFFYEEQLHRMECMAQEPVLFEDILCQIVDMISPEEESYVTLRDLKGSKLSGSVFNI  736
            NEMQ+FYEEQLHRMECMAQEPVLFEDI+CQ+ DMI P  E  +TLRDLK  KLSG+ FNI
Sbjct  421  NEMQYFYEEQLHRMECMAQEPVLFEDIVCQMTDMIGPANEGRLTLRDLKRCKLSGNFFNI  480

Query  735  LFNLNKFMAFETRDPFLIRQERENPNLTEWDRFAHREYIRLSMEEDAEDASNGSADVWDE  556
            LFNLNKF+AFETRDPFLIRQERE+P+LTEWDRFAH EYIRLSMEED EDASNGSA+VWDE
Sbjct  481  LFNLNKFVAFETRDPFLIRQEREDPSLTEWDRFAHIEYIRLSMEEDGEDASNGSAEVWDE  540

Query  555  -SLEAPF  538
               EAPF
Sbjct  541  PGYEAPF  547



>dbj|BAD34016.1| putative protein phosphatase 2A 48 kDa regulatory subunit isoform 
1 [Oryza sativa Japonica Group]
Length=552

 Score =   215 bits (547),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 99/126 (79%), Positives = 111/126 (88%), Gaps = 0/126 (0%)
 Frame = -2

Query  915  NEMQFFYEEQLHRMECMAQEPVLFEDILCQIVDMISPEEESYVTLRDLKGSKLSGSVFNI  736
            NE+QFF+EEQLHRMECMAQEPVLFEDILCQ++DMI PE E++ TL+D +  KLSG  FNI
Sbjct  427  NELQFFFEEQLHRMECMAQEPVLFEDILCQLIDMIGPENETFFTLKDFRRCKLSGHFFNI  486

Query  735  LFNLNKFMAFETRDPFLIRQERENPNLTEWDRFAHREYIRLSMEEDAEDASNGSADVWDE  556
            LFNLNKFMAFE RDPFLIRQ RE P+LT+WDRFA REYIRL+MEED EDASN S DVWDE
Sbjct  487  LFNLNKFMAFEARDPFLIRQMREEPSLTDWDRFARREYIRLAMEEDGEDASNASGDVWDE  546

Query  555  SLEAPF  538
            SLE+PF
Sbjct  547  SLESPF  552



>ref|XP_008643437.1| PREDICTED: uncharacterized protein LOC100279229 isoform X1 [Zea 
mays]
 ref|XP_008643438.1| PREDICTED: uncharacterized protein LOC100279229 isoform X1 [Zea 
mays]
 gb|AFW70572.1| hypothetical protein ZEAMMB73_706811 [Zea mays]
Length=543

 Score =   215 bits (547),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 98/125 (78%), Positives = 111/125 (89%), Gaps = 0/125 (0%)
 Frame = -2

Query  912  EMQFFYEEQLHRMECMAQEPVLFEDILCQIVDMISPEEESYVTLRDLKGSKLSGSVFNIL  733
            E+QFF+EEQLHRMECMAQEPVLFEDILCQ++DMI PE +SY+TL+D +  KLSG  FNIL
Sbjct  419  ELQFFFEEQLHRMECMAQEPVLFEDILCQLIDMIGPENDSYLTLKDFRRCKLSGHFFNIL  478

Query  732  FNLNKFMAFETRDPFLIRQERENPNLTEWDRFAHREYIRLSMEEDAEDASNGSADVWDES  553
            FNLNKFMAFE RDPFLIRQ RE P+LT+WDRFA REY+RL+MEED EDASN S DVWDES
Sbjct  479  FNLNKFMAFEARDPFLIRQMREEPSLTDWDRFARREYVRLAMEEDGEDASNASGDVWDES  538

Query  552  LEAPF  538
            LE+PF
Sbjct  539  LESPF  543



>gb|EEC72658.1| hypothetical protein OsI_06192 [Oryza sativa Indica Group]
Length=548

 Score =   215 bits (547),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 99/126 (79%), Positives = 111/126 (88%), Gaps = 0/126 (0%)
 Frame = -2

Query  915  NEMQFFYEEQLHRMECMAQEPVLFEDILCQIVDMISPEEESYVTLRDLKGSKLSGSVFNI  736
            NE+QFF+EEQLHRMECMAQEPVLFEDILCQ++DMI PE E++ TL+D +  KLSG  FNI
Sbjct  423  NELQFFFEEQLHRMECMAQEPVLFEDILCQLIDMIGPENETFFTLKDFRRCKLSGHFFNI  482

Query  735  LFNLNKFMAFETRDPFLIRQERENPNLTEWDRFAHREYIRLSMEEDAEDASNGSADVWDE  556
            LFNLNKFMAFE RDPFLIRQ RE P+LT+WDRFA REYIRL+MEED EDASN S DVWDE
Sbjct  483  LFNLNKFMAFEARDPFLIRQMREEPSLTDWDRFARREYIRLAMEEDGEDASNASGDVWDE  542

Query  555  SLEAPF  538
            SLE+PF
Sbjct  543  SLESPF  548



>emb|CDY36971.1| BnaC09g17870D [Brassica napus]
Length=530

 Score =   214 bits (544),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 105/128 (82%), Positives = 114/128 (89%), Gaps = 4/128 (3%)
 Frame = -2

Query  915  NEMQFFYEEQLHRMECMAQEPVLFEDILCQIVDMISPE--EESYVTLRDLKGSKLSGSVF  742
            NEMQFFYEEQLHRMEC+ QEPVLFEDILCQI DMI PE  +E+ +TL+DLK SKLS +VF
Sbjct  405  NEMQFFYEEQLHRMECITQEPVLFEDILCQIFDMIKPEARKENCITLKDLKASKLSRNVF  464

Query  741  NILFNLNKFMAFETRDPFLIRQERENPNLTEWDRFAHREYIRLSMEEDAEDASNGSADVW  562
            NILFNLNKFMAFETRDPFLIRQERENP LTEWDRFA REY+RLSMEED  + SNGSADVW
Sbjct  465  NILFNLNKFMAFETRDPFLIRQERENPTLTEWDRFAQREYVRLSMEED--EVSNGSADVW  522

Query  561  DESLEAPF  538
            DE LE+PF
Sbjct  523  DEPLESPF  530



>ref|NP_001170273.1| hypothetical protein [Zea mays]
 gb|ACN36449.1| unknown [Zea mays]
 gb|AFW66238.1| hypothetical protein ZEAMMB73_487532 [Zea mays]
Length=543

 Score =   214 bits (545),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 98/125 (78%), Positives = 111/125 (89%), Gaps = 0/125 (0%)
 Frame = -2

Query  912  EMQFFYEEQLHRMECMAQEPVLFEDILCQIVDMISPEEESYVTLRDLKGSKLSGSVFNIL  733
            E+QFF+EEQLHRMECMAQEPVLFEDILCQ++DMI PE +SY+TL+D +  KLSG  FNIL
Sbjct  419  EIQFFFEEQLHRMECMAQEPVLFEDILCQLIDMIGPENDSYLTLKDFRRCKLSGHFFNIL  478

Query  732  FNLNKFMAFETRDPFLIRQERENPNLTEWDRFAHREYIRLSMEEDAEDASNGSADVWDES  553
            FNLNKFMAFE RDPFLIRQ RE P+LT+WDRFA REY+RL+MEED EDASN S DVWDES
Sbjct  479  FNLNKFMAFEARDPFLIRQMREEPSLTDWDRFARREYVRLAMEEDGEDASNASGDVWDES  538

Query  552  LEAPF  538
            LE+PF
Sbjct  539  LESPF  543



>ref|XP_001772199.1| predicted protein [Physcomitrella patens]
 gb|EDQ63012.1| predicted protein [Physcomitrella patens]
Length=567

 Score =   214 bits (546),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 102/127 (80%), Positives = 113/127 (89%), Gaps = 1/127 (1%)
 Frame = -2

Query  915  NEMQFFYEEQLHRMECMAQEPVLFEDILCQIVDMISPEEESYVTLRDLKGSKLSGSVFNI  736
            NEMQ+FYEEQLHRMECMAQEPVLFEDI+CQ+ DMI P +E  +TL+DLK  KLSG+ FNI
Sbjct  441  NEMQYFYEEQLHRMECMAQEPVLFEDIVCQMADMIGPAKEGQLTLKDLKRCKLSGNFFNI  500

Query  735  LFNLNKFMAFETRDPFLIRQERENPNLTEWDRFAHREYIRLSMEEDAEDASNGSADVWDE  556
            LFNLNKF+AFETRDPFLIRQERE+P+LTEWDRFAH EYIRLS EED EDASNGSA+VWDE
Sbjct  501  LFNLNKFVAFETRDPFLIRQEREDPSLTEWDRFAHMEYIRLSTEEDGEDASNGSAEVWDE  560

Query  555  -SLEAPF  538
               EAPF
Sbjct  561  PGYEAPF  567



>emb|CDY13127.1| BnaA09g16900D [Brassica napus]
Length=532

 Score =   214 bits (544),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 105/127 (83%), Positives = 113/127 (89%), Gaps = 3/127 (2%)
 Frame = -2

Query  915  NEMQFFYEEQLHRMECMAQEPVLFEDILCQIVDMISPE-EESYVTLRDLKGSKLSGSVFN  739
            NEMQFFYEEQLHRMEC+ QEPVLFEDILCQI DMI PE  E+ +TL+DLK SKLS +VFN
Sbjct  408  NEMQFFYEEQLHRMECITQEPVLFEDILCQIFDMIKPEARENCITLKDLKASKLSRNVFN  467

Query  738  ILFNLNKFMAFETRDPFLIRQERENPNLTEWDRFAHREYIRLSMEEDAEDASNGSADVWD  559
            ILFNLNKFMAFETRDPFLIRQERENP LTEWDRFA REY+RLSMEED  + SNGSADVWD
Sbjct  468  ILFNLNKFMAFETRDPFLIRQERENPTLTEWDRFAQREYVRLSMEED--EVSNGSADVWD  525

Query  558  ESLEAPF  538
            E LE+PF
Sbjct  526  EPLESPF  532



>ref|XP_002453453.1| hypothetical protein SORBIDRAFT_04g006190 [Sorghum bicolor]
 gb|EES06429.1| hypothetical protein SORBIDRAFT_04g006190 [Sorghum bicolor]
Length=543

 Score =   213 bits (542),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 97/125 (78%), Positives = 110/125 (88%), Gaps = 0/125 (0%)
 Frame = -2

Query  912  EMQFFYEEQLHRMECMAQEPVLFEDILCQIVDMISPEEESYVTLRDLKGSKLSGSVFNIL  733
            E+QFF+EEQLHRMECMAQEPVLFEDILCQ++DMI PE + Y+TL+D +  KLSG  FNIL
Sbjct  419  ELQFFFEEQLHRMECMAQEPVLFEDILCQLIDMIGPENDKYLTLKDFRRCKLSGHFFNIL  478

Query  732  FNLNKFMAFETRDPFLIRQERENPNLTEWDRFAHREYIRLSMEEDAEDASNGSADVWDES  553
            FNLNKFMAFE RDPFLIRQ RE P+LT+WDRFA REY+RL+MEED EDASN S DVWDES
Sbjct  479  FNLNKFMAFEARDPFLIRQMREEPSLTDWDRFARREYVRLAMEEDGEDASNASGDVWDES  538

Query  552  LEAPF  538
            LE+PF
Sbjct  539  LESPF  543



>ref|XP_001758946.1| predicted protein [Physcomitrella patens]
 gb|EDQ76452.1| predicted protein [Physcomitrella patens]
Length=594

 Score =   214 bits (544),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 101/126 (80%), Positives = 112/126 (89%), Gaps = 0/126 (0%)
 Frame = -2

Query  915  NEMQFFYEEQLHRMECMAQEPVLFEDILCQIVDMISPEEESYVTLRDLKGSKLSGSVFNI  736
            NEMQ+FYEEQLHRMECMAQEPVLFED++CQ+ DMI P +E  +TLRDLK  KLSG+ FNI
Sbjct  469  NEMQYFYEEQLHRMECMAQEPVLFEDVVCQMADMIGPAKEGQLTLRDLKRCKLSGNFFNI  528

Query  735  LFNLNKFMAFETRDPFLIRQERENPNLTEWDRFAHREYIRLSMEEDAEDASNGSADVWDE  556
            LFNLNKF+AFETRDPFLIRQERE+P+LTEWDRFAH EY RLSMEED EDASNGSA+VWDE
Sbjct  529  LFNLNKFVAFETRDPFLIRQEREDPSLTEWDRFAHMEYSRLSMEEDGEDASNGSAEVWDE  588

Query  555  SLEAPF  538
              EA F
Sbjct  589  PYEALF  594



>ref|XP_003571084.1| PREDICTED: probable serine/threonine protein phosphatase 2A regulatory 
subunit B''delta [Brachypodium distachyon]
Length=547

 Score =   213 bits (541),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 96/126 (76%), Positives = 111/126 (88%), Gaps = 0/126 (0%)
 Frame = -2

Query  915  NEMQFFYEEQLHRMECMAQEPVLFEDILCQIVDMISPEEESYVTLRDLKGSKLSGSVFNI  736
            NE+Q+F+EEQLHRMECMAQEPVLFEDILCQ+VDM+ PE++++ TL+D +  KLSG  FN+
Sbjct  422  NELQYFFEEQLHRMECMAQEPVLFEDILCQLVDMVGPEDDTFFTLKDFRRCKLSGHFFNV  481

Query  735  LFNLNKFMAFETRDPFLIRQERENPNLTEWDRFAHREYIRLSMEEDAEDASNGSADVWDE  556
            LFNLNKFMAFE RDPFLIRQ RE P LT+WDRFA REYIRL+MEED EDASN S DVWDE
Sbjct  482  LFNLNKFMAFEARDPFLIRQMREEPTLTDWDRFARREYIRLAMEEDGEDASNASGDVWDE  541

Query  555  SLEAPF  538
            SLE+PF
Sbjct  542  SLESPF  547



>gb|EMS52417.1| Serine/threonine-protein phosphatase 2A regulatory subunit B'' 
subunit alpha [Triticum urartu]
Length=471

 Score =   210 bits (535),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 95/125 (76%), Positives = 112/125 (90%), Gaps = 0/125 (0%)
 Frame = -2

Query  912  EMQFFYEEQLHRMECMAQEPVLFEDILCQIVDMISPEEESYVTLRDLKGSKLSGSVFNIL  733
            E+Q+F+EEQLHRMECMAQEPVLFEDILCQ+VDMI PE++++ T++D +  KLSG  FN+L
Sbjct  347  ELQYFFEEQLHRMECMAQEPVLFEDILCQLVDMIGPEDDTFFTIKDFRRCKLSGHFFNVL  406

Query  732  FNLNKFMAFETRDPFLIRQERENPNLTEWDRFAHREYIRLSMEEDAEDASNGSADVWDES  553
            FNLNKFMAFE+RDPFLIRQ RE P+LT+WDRFA REYIRL+MEED EDASN S DVWDES
Sbjct  407  FNLNKFMAFESRDPFLIRQMREEPSLTDWDRFARREYIRLAMEEDGEDASNASGDVWDES  466

Query  552  LEAPF  538
            LE+PF
Sbjct  467  LESPF  471



>dbj|BAJ95001.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=537

 Score =   211 bits (536),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 95/126 (75%), Positives = 112/126 (89%), Gaps = 0/126 (0%)
 Frame = -2

Query  915  NEMQFFYEEQLHRMECMAQEPVLFEDILCQIVDMISPEEESYVTLRDLKGSKLSGSVFNI  736
            NE+Q+F+EEQLHRMECMAQEPVLFEDILCQ+VDMI PE++++  ++D +  KLSG  FN+
Sbjct  412  NELQYFFEEQLHRMECMAQEPVLFEDILCQLVDMIGPEDDTFFIIKDFRRCKLSGHFFNV  471

Query  735  LFNLNKFMAFETRDPFLIRQERENPNLTEWDRFAHREYIRLSMEEDAEDASNGSADVWDE  556
            LFNLNKFMAFE+RDPFLIRQ RE P+LT+WDRFA REYIRL+MEED EDASN S DVWDE
Sbjct  472  LFNLNKFMAFESRDPFLIRQMREEPSLTDWDRFARREYIRLAMEEDGEDASNASGDVWDE  531

Query  555  SLEAPF  538
            SLE+PF
Sbjct  532  SLESPF  537



>gb|EMT18000.1| Serine/threonine-protein phosphatase 2A regulatory subunit B'' 
subunit alpha [Aegilops tauschii]
Length=544

 Score =   211 bits (536),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 95/125 (76%), Positives = 112/125 (90%), Gaps = 0/125 (0%)
 Frame = -2

Query  912  EMQFFYEEQLHRMECMAQEPVLFEDILCQIVDMISPEEESYVTLRDLKGSKLSGSVFNIL  733
            E+Q+F+EEQLHRMECMAQEPVLFEDILCQ+VDMI PE++++ T++D +  KLSG  FN+L
Sbjct  420  ELQYFFEEQLHRMECMAQEPVLFEDILCQLVDMIGPEDDTFFTIKDFRRCKLSGHFFNVL  479

Query  732  FNLNKFMAFETRDPFLIRQERENPNLTEWDRFAHREYIRLSMEEDAEDASNGSADVWDES  553
            FNLNKFMAFE+RDPFLIRQ RE P+LT+WDRFA REYIRL+MEED EDASN S DVWDES
Sbjct  480  FNLNKFMAFESRDPFLIRQMREEPSLTDWDRFARREYIRLAMEEDGEDASNASGDVWDES  539

Query  552  LEAPF  538
            LE+PF
Sbjct  540  LESPF  544



>emb|CDY15483.1| BnaA08g27670D [Brassica napus]
Length=534

 Score =   207 bits (526),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 100/126 (79%), Positives = 112/126 (89%), Gaps = 3/126 (2%)
 Frame = -2

Query  915  NEMQFFYEEQLHRMECMAQEPVLFEDILCQIVDMISPEEESYVTLRDLKGSKLSGSVFNI  736
            NE+QFF+EEQLHRME + QEPV F DILCQI+DMI PEEE+ +TL+DLKGSKLSG+VFNI
Sbjct  412  NEIQFFFEEQLHRMESITQEPVHFNDILCQIIDMIKPEEENCITLQDLKGSKLSGNVFNI  471

Query  735  LFNLNKFMAFETRDPFLIRQERENPNLTEWDRFAHREYIRLSMEEDAEDASNGSADVWDE  556
            LFNLNKFMAFETRDPFLIRQERE+P+LTEWDRFA REY+RLSMEED E+ SNGSA   DE
Sbjct  472  LFNLNKFMAFETRDPFLIRQEREDPSLTEWDRFAQREYVRLSMEEDVEEVSNGSA---DE  528

Query  555  SLEAPF  538
             LE PF
Sbjct  529  PLEPPF  534



>ref|XP_009111132.1| PREDICTED: probable serine/threonine protein phosphatase 2A regulatory 
subunit B''epsilon [Brassica rapa]
 ref|XP_009111133.1| PREDICTED: probable serine/threonine protein phosphatase 2A regulatory 
subunit B''epsilon [Brassica rapa]
Length=536

 Score =   206 bits (525),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 100/126 (79%), Positives = 112/126 (89%), Gaps = 3/126 (2%)
 Frame = -2

Query  915  NEMQFFYEEQLHRMECMAQEPVLFEDILCQIVDMISPEEESYVTLRDLKGSKLSGSVFNI  736
            NE+QFF+EEQLHRME + QEPV F DILCQI+DMI PEEE+ +TL+DLKGSKLSG+VFNI
Sbjct  414  NEIQFFFEEQLHRMESITQEPVHFNDILCQIIDMIKPEEENCITLQDLKGSKLSGNVFNI  473

Query  735  LFNLNKFMAFETRDPFLIRQERENPNLTEWDRFAHREYIRLSMEEDAEDASNGSADVWDE  556
            LFNLNKFMAFETRDPFLIRQERE+P+LTEWDRFA REY+RLSMEED E+ SNGSA   DE
Sbjct  474  LFNLNKFMAFETRDPFLIRQEREDPSLTEWDRFAQREYVRLSMEEDVEEVSNGSA---DE  530

Query  555  SLEAPF  538
             LE PF
Sbjct  531  PLEPPF  536



>emb|CDX86655.1| BnaC08g00480D [Brassica napus]
Length=527

 Score =   205 bits (521),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 99/126 (79%), Positives = 112/126 (89%), Gaps = 3/126 (2%)
 Frame = -2

Query  915  NEMQFFYEEQLHRMECMAQEPVLFEDILCQIVDMISPEEESYVTLRDLKGSKLSGSVFNI  736
            NE+QFF+EEQLHRME + QEPV F DILCQI+DMI PEEE+ +TL+DLKGSKLSG+VFNI
Sbjct  405  NEIQFFFEEQLHRMESITQEPVHFNDILCQIIDMIKPEEENCITLQDLKGSKLSGNVFNI  464

Query  735  LFNLNKFMAFETRDPFLIRQERENPNLTEWDRFAHREYIRLSMEEDAEDASNGSADVWDE  556
            LFNLNKFMAFETRDPFLIRQERE+P+LTEWDRFA REY+RLSMEED E+ +NGSA   DE
Sbjct  465  LFNLNKFMAFETRDPFLIRQEREDPSLTEWDRFAQREYVRLSMEEDVEEVANGSA---DE  521

Query  555  SLEAPF  538
             LE PF
Sbjct  522  PLEPPF  527



>gb|KHN29775.1| Serine/threonine-protein phosphatase 2A regulatory subunit B'' 
subunit alpha [Glycine soja]
Length=113

 Score =   192 bits (487),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 91/113 (81%), Positives = 99/113 (88%), Gaps = 0/113 (0%)
 Frame = -2

Query  876  MECMAQEPVLFEDILCQIVDMISPEEESYVTLRDLKGSKLSGSVFNILFNLNKFMAFETR  697
            MECMAQEPVLFEDILCQIVDM  P+ E Y+TLRD+KGSKLS +VFNILFNLNKF+AFET 
Sbjct  1    MECMAQEPVLFEDILCQIVDMFGPKNEGYITLRDVKGSKLSVNVFNILFNLNKFIAFETC  60

Query  696  DPFLIRQERENPNLTEWDRFAHREYIRLSMEEDAEDASNGSADVWDESLEAPF  538
            DPFLI QERE+ +LTEWDRFAHREYIRLSMEED ED  N S D W+ESLEAPF
Sbjct  61   DPFLIHQEREDSHLTEWDRFAHREYIRLSMEEDGEDMPNASGDAWEESLEAPF  113



>ref|XP_010462553.1| PREDICTED: probable serine/threonine protein phosphatase 2A regulatory 
subunit B''epsilon [Camelina sativa]
Length=614

 Score =   204 bits (518),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 101/149 (68%), Positives = 118/149 (79%), Gaps = 2/149 (1%)
 Frame = -2

Query  918  RNEMQFFYEEQLHRMECMAQEPVLFEDILCQIVDMISPEEESYVTLRDLKGSKLSGSVFN  739
            RNEM FF+EEQLHRMEC+ QEPVLF+DILCQIVDMI PEEE+ +TL+DLKGSKLSG+VFN
Sbjct  417  RNEMHFFFEEQLHRMECITQEPVLFKDILCQIVDMIGPEEENCITLKDLKGSKLSGNVFN  476

Query  738  ILFNLNKFMAFETRDPFLIRQERENPNLTEWDRFAHREYIRLSMEEDAEDASN--GSADV  565
            ILFNLNKFMAFETRDPFLIRQERE PNLTEWDRFA REY+RLSMEED E+  N     D+
Sbjct  477  ILFNLNKFMAFETRDPFLIRQEREEPNLTEWDRFAQREYLRLSMEEDVEEKENCITLKDL  536

Query  564  WDESLEAPF*VLVVSYAKYMKGDCREFYL  478
                L      ++ +  K+M  + R+ +L
Sbjct  537  KGSKLSGNVFNILFNLNKFMAFETRDPFL  565


 Score =   150 bits (380),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 72/87 (83%), Positives = 79/87 (91%), Gaps = 0/87 (0%)
 Frame = -2

Query  804  EEESYVTLRDLKGSKLSGSVFNILFNLNKFMAFETRDPFLIRQERENPNLTEWDRFAHRE  625
            E+E+ +TL+DLKGSKLSG+VFNILFNLNKFMAFETRDPFLIRQERE PNLTEWDRFA RE
Sbjct  526  EKENCITLKDLKGSKLSGNVFNILFNLNKFMAFETRDPFLIRQEREEPNLTEWDRFAQRE  585

Query  624  YIRLSMEEDAEDASNGSADVWDESLEA  544
            Y+RLSMEED E+ SN SADVWDE LE 
Sbjct  586  YLRLSMEEDVEEVSNESADVWDEPLEP  612



>ref|XP_001764395.1| predicted protein [Physcomitrella patens]
 gb|EDQ70662.1| predicted protein [Physcomitrella patens]
Length=524

 Score =   191 bits (485),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 90/124 (73%), Positives = 107/124 (86%), Gaps = 1/124 (1%)
 Frame = -2

Query  915  NEMQFFYEEQLHRMECMAQEPVLFEDILCQIVDMISPEEESYVTLRDLKGSKLSGSVFNI  736
            NEM  FYEEQ+HR+ECMAQEPVLFEDI+CQ+ DMI P+++ ++TLRDLK  KLSG+ FNI
Sbjct  399  NEMHHFYEEQVHRVECMAQEPVLFEDIVCQMSDMIKPKKDGHLTLRDLKNCKLSGNFFNI  458

Query  735  LFNLNKFMAFETRDPFLIRQERENPNLTEWDRFAHREYIRLSMEEDAEDA-SNGSADVWD  559
            LFNLNKF+AFETRDPFLIR ERE+P LTEWDRFAH EYIRL+MEED ED   +GSA+V D
Sbjct  459  LFNLNKFVAFETRDPFLIRMEREDPTLTEWDRFAHAEYIRLAMEEDGEDVFMDGSAEVLD  518

Query  558  ESLE  547
            ++ E
Sbjct  519  DAFE  522



>gb|KHN43156.1| Serine/threonine-protein phosphatase 2A regulatory subunit B'' 
subunit alpha [Glycine soja]
Length=344

 Score =   182 bits (462),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 84/92 (91%), Positives = 88/92 (96%), Gaps = 0/92 (0%)
 Frame = -2

Query  918  RNEMQFFYEEQLHRMECMAQEPVLFEDILCQIVDMISPEEESYVTLRDLKGSKLSGSVFN  739
            RNE+QFFYEEQLHRMECMAQEPVLFEDILCQI+DMI PE+ESY+TLRDLKG KLSGSVFN
Sbjct  238  RNELQFFYEEQLHRMECMAQEPVLFEDILCQIIDMIGPEDESYITLRDLKGGKLSGSVFN  297

Query  738  ILFNLNKFMAFETRDPFLIRQERENPNLTEWD  643
            ILFNLNKFMAFETRDPFLIRQERENP L EWD
Sbjct  298  ILFNLNKFMAFETRDPFLIRQERENPTLAEWD  329



>ref|XP_001775422.1| predicted protein [Physcomitrella patens]
 gb|EDQ59751.1| predicted protein [Physcomitrella patens]
Length=521

 Score =   179 bits (455),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 83/107 (78%), Positives = 93/107 (87%), Gaps = 0/107 (0%)
 Frame = -2

Query  915  NEMQFFYEEQLHRMECMAQEPVLFEDILCQIVDMISPEEESYVTLRDLKGSKLSGSVFNI  736
            NEM +FYEEQLHRMECMAQE +LFEDI+CQ+ DMI P++  Y+TL DLK  KLSG+ FNI
Sbjct  413  NEMHYFYEEQLHRMECMAQEAILFEDIVCQMCDMIKPKKNGYLTLSDLKNCKLSGNFFNI  472

Query  735  LFNLNKFMAFETRDPFLIRQERENPNLTEWDRFAHREYIRLSMEEDA  595
            LFNLNKF+AFETRDPFLIR ERE+P LTEWDRFAH EYIRLSMEED 
Sbjct  473  LFNLNKFVAFETRDPFLIRLEREDPTLTEWDRFAHTEYIRLSMEEDG  519



>ref|XP_005649287.1| phosphatase 2A regulatory subunit B [Coccomyxa subellipsoidea 
C-169]
 gb|EIE24743.1| phosphatase 2A regulatory subunit B [Coccomyxa subellipsoidea 
C-169]
Length=338

 Score =   172 bits (436),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 83/129 (64%), Positives = 105/129 (81%), Gaps = 3/129 (2%)
 Frame = -2

Query  915  NEMQFFYEEQLHRMECMAQEPVLFEDILCQIVDMISPEEESYVTLRDLKGSK-LSGSVFN  739
            NEM +FYEEQLHRMEC++QEPVLFED+LCQ+ DM+ PE E   TL+DLK  K L+G +FN
Sbjct  210  NEMLYFYEEQLHRMECLSQEPVLFEDVLCQMHDMVQPEAEGVFTLQDLKRQKSLAGILFN  269

Query  738  ILFNLNKFMAFETRDPFLIRQERENPNLTEWDRFAHREYIRLSMEEDAE-DASNGSADVW  562
            ILFNLNKF+AFETRDPF++RQERE+P LT+WDRFA  EY+RL+MEE+ E   S+   ++W
Sbjct  270  ILFNLNKFIAFETRDPFVVRQEREDPTLTDWDRFARTEYVRLAMEEEGEFRGSDNQNELW  329

Query  561  -DESLEAPF  538
              ++LE PF
Sbjct  330  VQQNLEGPF  338



>ref|XP_001418951.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO97244.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=531

 Score =   176 bits (447),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 83/122 (68%), Positives = 104/122 (85%), Gaps = 1/122 (1%)
 Frame = -2

Query  918  RNEMQFFYEEQLHRMECMAQEPVLFEDILCQIVDMISPEEESYVTLRDLKGSKLSGSVFN  739
            R+E+ +FYEEQ+ RMEC+AQEPVLFEDILCQ++DM+ PE ++ VTL DL+ SK+SG+ FN
Sbjct  409  RDEIYYFYEEQIQRMECLAQEPVLFEDILCQMMDMLKPEVDARVTLNDLRSSKMSGNFFN  468

Query  738  ILFNLNKFMAFETRDPFLIRQERENPNLTEWDRFAHREYIRLSMEEDAEDASNGSADVWD  559
            +LFN+NKF+AFETRDPFL+RQERE P+LTEWDRFA  EY+RLSMEED E   + S  VW+
Sbjct  469  VLFNMNKFIAFETRDPFLMRQEREEPHLTEWDRFARGEYLRLSMEEDDE-MDHASDVVWE  527

Query  558  ES  553
            ES
Sbjct  528  ES  529



>ref|XP_003080381.1| protein phosphatase 2A 62 kDa B'' regulatory subunit (ISS) [Ostreococcus 
tauri]
Length=513

 Score =   174 bits (442),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 83/122 (68%), Positives = 102/122 (84%), Gaps = 1/122 (1%)
 Frame = -2

Query  918  RNEMQFFYEEQLHRMECMAQEPVLFEDILCQIVDMISPEEESYVTLRDLKGSKLSGSVFN  739
            R+E+ +FYEEQ+ RMEC+AQEPVLFEDILCQ++DMI PE +  VTL DLK +K+SG+ FN
Sbjct  391  RDEIFYFYEEQIQRMECLAQEPVLFEDILCQMMDMIKPEVDGRVTLHDLKRNKMSGNFFN  450

Query  738  ILFNLNKFMAFETRDPFLIRQERENPNLTEWDRFAHREYIRLSMEEDAEDASNGSADVWD  559
            +LFN+NKF+AFETRDPFL+RQERE P+LTEWDRFA  EY+RLSMEED ED    +   W+
Sbjct  451  VLFNMNKFIAFETRDPFLMRQEREEPHLTEWDRFARGEYLRLSMEED-EDMDTNNVVSWE  509

Query  558  ES  553
            ES
Sbjct  510  ES  511



>emb|CEF98759.1| EF-hand domain pair [Ostreococcus tauri]
Length=529

 Score =   174 bits (441),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 83/122 (68%), Positives = 102/122 (84%), Gaps = 1/122 (1%)
 Frame = -2

Query  918  RNEMQFFYEEQLHRMECMAQEPVLFEDILCQIVDMISPEEESYVTLRDLKGSKLSGSVFN  739
            R+E+ +FYEEQ+ RMEC+AQEPVLFEDILCQ++DMI PE +  VTL DLK +K+SG+ FN
Sbjct  407  RDEIFYFYEEQIQRMECLAQEPVLFEDILCQMMDMIKPEVDGRVTLHDLKRNKMSGNFFN  466

Query  738  ILFNLNKFMAFETRDPFLIRQERENPNLTEWDRFAHREYIRLSMEEDAEDASNGSADVWD  559
            +LFN+NKF+AFETRDPFL+RQERE P+LTEWDRFA  EY+RLSMEED ED    +   W+
Sbjct  467  VLFNMNKFIAFETRDPFLMRQEREEPHLTEWDRFARGEYLRLSMEED-EDMDTNNVVSWE  525

Query  558  ES  553
            ES
Sbjct  526  ES  527



>ref|XP_002500124.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO61382.1| predicted protein [Micromonas sp. RCC299]
Length=572

 Score =   169 bits (428),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 81/116 (70%), Positives = 97/116 (84%), Gaps = 1/116 (1%)
 Frame = -2

Query  915  NEMQFFYEEQLHRMECMAQEPVLFEDILCQIVDMISPEEESYVTLRDLKGSKLSGSVFNI  736
            +E  FFYEEQL RMEC++QEPVLFEDILCQ+ DM+ PE    +TLRDL+  KL+G+ FN+
Sbjct  449  SECSFFYEEQLQRMECLSQEPVLFEDILCQMSDMLHPEVPGRITLRDLRRCKLAGNFFNV  508

Query  735  LFNLNKFMAFETRDPFLIRQERENPNLTEWDRFAHREYIRLSMEEDAEDASNGSAD  568
            LFNLNKF+AFETRDPFLIRQERE P+LTEWDRFA +EYIRLSMEE+ E   +G+ D
Sbjct  509  LFNLNKFIAFETRDPFLIRQEREEPHLTEWDRFARQEYIRLSMEEE-EGMQDGNWD  563



>gb|KHN24827.1| Serine/threonine-protein phosphatase 2A regulatory subunit B'' 
subunit alpha [Glycine soja]
Length=93

 Score =   154 bits (388),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 71/78 (91%), Positives = 74/78 (95%), Gaps = 0/78 (0%)
 Frame = -2

Query  876  MECMAQEPVLFEDILCQIVDMISPEEESYVTLRDLKGSKLSGSVFNILFNLNKFMAFETR  697
            MECMAQEPVLFEDILCQI+DMI PE+ESY+TLRDLKG KLSGSVFNILFNLNKFMAFETR
Sbjct  1    MECMAQEPVLFEDILCQIIDMIGPEDESYITLRDLKGGKLSGSVFNILFNLNKFMAFETR  60

Query  696  DPFLIRQERENPNLTEWD  643
            DPFLIRQERENP L EWD
Sbjct  61   DPFLIRQERENPTLAEWD  78



>gb|KJB44839.1| hypothetical protein B456_007G275600 [Gossypium raimondii]
Length=498

 Score =   164 bits (414),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 77/81 (95%), Positives = 79/81 (98%), Gaps = 0/81 (0%)
 Frame = -2

Query  918  RNEMQFFYEEQLHRMECMAQEPVLFEDILCQIVDMISPEEESYVTLRDLKGSKLSGSVFN  739
            RNEMQFFYEEQLHRMECMAQEPVLFEDILCQI+DMI PE ESY+TLRDLKGSKLSGSVFN
Sbjct  413  RNEMQFFYEEQLHRMECMAQEPVLFEDILCQIIDMIKPEAESYITLRDLKGSKLSGSVFN  472

Query  738  ILFNLNKFMAFETRDPFLIRQ  676
            ILFNLNKFMAFETRDPFLIRQ
Sbjct  473  ILFNLNKFMAFETRDPFLIRQ  493



>ref|XP_003057811.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH57762.1| predicted protein [Micromonas pusilla CCMP1545]
Length=506

 Score =   161 bits (408),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 74/102 (73%), Positives = 87/102 (85%), Gaps = 0/102 (0%)
 Frame = -2

Query  915  NEMQFFYEEQLHRMECMAQEPVLFEDILCQIVDMISPEEESYVTLRDLKGSKLSGSVFNI  736
            +E  FFYEEQL RMEC++QEPVLFEDILCQ+ DM+ P E   +TLRDL+  KL+G+ FN+
Sbjct  381  SECAFFYEEQLQRMECLSQEPVLFEDILCQMCDMLKPAENGKITLRDLRRCKLAGNFFNV  440

Query  735  LFNLNKFMAFETRDPFLIRQERENPNLTEWDRFAHREYIRLS  610
            LFNLNKF+AFETRDP LIRQERE P+LTEWDRFA +EYIRLS
Sbjct  441  LFNLNKFIAFETRDPVLIRQEREEPHLTEWDRFARQEYIRLS  482



>gb|KJB82291.1| hypothetical protein B456_013G187900 [Gossypium raimondii]
Length=505

 Score =   160 bits (405),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 74/81 (91%), Positives = 79/81 (98%), Gaps = 0/81 (0%)
 Frame = -2

Query  918  RNEMQFFYEEQLHRMECMAQEPVLFEDILCQIVDMISPEEESYVTLRDLKGSKLSGSVFN  739
            RNEMQFFYEEQLHRMECMAQEPVLFEDILCQ++DMI P++ESY+ LRDLKGSKLSGSVFN
Sbjct  413  RNEMQFFYEEQLHRMECMAQEPVLFEDILCQMIDMIKPQDESYIMLRDLKGSKLSGSVFN  472

Query  738  ILFNLNKFMAFETRDPFLIRQ  676
            ILFNLNKFMAFETRDPFLIRQ
Sbjct  473  ILFNLNKFMAFETRDPFLIRQ  493



>gb|EPS58366.1| hypothetical protein M569_16449 [Genlisea aurea]
Length=81

 Score =   149 bits (375),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 73/81 (90%), Positives = 76/81 (94%), Gaps = 2/81 (2%)
 Frame = -2

Query  774  LKGSKLSGSVFNILFNLNKFMAFETRDPFLIRQERENPNLTEWDRFAHREYIRLSMEEDA  595
            +KGSKLSGSVFNILFNLNKFMAFETRDPFLIRQERENP+LTEWD FA REYIRLSMEEDA
Sbjct  1    MKGSKLSGSVFNILFNLNKFMAFETRDPFLIRQERENPHLTEWDHFARREYIRLSMEEDA  60

Query  594  EDASNGSADVWDE--SLEAPF  538
            EDASNGS D+WDE  SLEAPF
Sbjct  61   EDASNGSVDIWDEASSLEAPF  81



>ref|XP_007511063.1| predicted protein [Bathycoccus prasinos]
 emb|CCO66623.1| predicted protein [Bathycoccus prasinos]
Length=708

 Score =   151 bits (382),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 73/121 (60%), Positives = 92/121 (76%), Gaps = 6/121 (5%)
 Frame = -2

Query  915  NEMQFFYEEQLHRMECMAQEPVLFEDILCQIVDMISPEEESYVTLRDLKGS-KLSGSVFN  739
             ++ +FYEEQL RMEC+AQEPV FEDI+CQ+ DMI P+ E ++TL D+  S  +SG+ FN
Sbjct  534  GDLAYFYEEQLQRMECLAQEPVFFEDIVCQLTDMIKPKIEGFITLEDMVRSLPMSGNTFN  593

Query  738  ILFNLNKFMAFETRDPFLIRQERENPNLTEWDRFAHREYIRLSMEED-----AEDASNGS  574
            +LFNLNKF+ FETRDPF IRQERE  +LTEWDRFA  EY+RLS E+D     A+D  N S
Sbjct  594  VLFNLNKFILFETRDPFTIRQEREEKHLTEWDRFARVEYMRLSQEDDEIMSEADDVENLS  653

Query  573  A  571
            +
Sbjct  654  S  654



>ref|XP_012085281.1| PREDICTED: serine/threonine protein phosphatase 2A regulatory 
subunit B''alpha isoform X2 [Jatropha curcas]
Length=500

 Score =   148 bits (374),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 78/126 (62%), Positives = 81/126 (64%), Gaps = 42/126 (33%)
 Frame = -2

Query  915  NEMQFFYEEQLHRMECMAQEPVLFEDILCQIVDMISPEEESYVTLRDLKGSKLSGSVFNI  736
            NEMQFFYEEQLHRMECMAQEPVLFEDILCQIVDMI+PEE                     
Sbjct  417  NEMQFFYEEQLHRMECMAQEPVLFEDILCQIVDMIAPEE---------------------  455

Query  735  LFNLNKFMAFETRDPFLIRQERENPNLTEWDRFAHREYIRLSMEEDAEDASNGSADVWDE  556
                                 RE+P LTEWDRFAHREYIRLSMEED ED SNGSADVW+E
Sbjct  456  ---------------------REDPTLTEWDRFAHREYIRLSMEEDVEDVSNGSADVWEE  494

Query  555  SLEAPF  538
            SLEAPF
Sbjct  495  SLEAPF  500



>gb|KJB11373.1| hypothetical protein B456_001G254900 [Gossypium raimondii]
Length=505

 Score =   147 bits (372),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 69/80 (86%), Positives = 76/80 (95%), Gaps = 0/80 (0%)
 Frame = -2

Query  915  NEMQFFYEEQLHRMECMAQEPVLFEDILCQIVDMISPEEESYVTLRDLKGSKLSGSVFNI  736
            NEMQFFYEEQLHRMEC+A EPVLFEDILCQI+DMI+PE E  +TL+DLKGSKLSG+VFNI
Sbjct  420  NEMQFFYEEQLHRMECLALEPVLFEDILCQIIDMIAPEREDCITLQDLKGSKLSGNVFNI  479

Query  735  LFNLNKFMAFETRDPFLIRQ  676
            LFNLNKF+AFETRDPFLIRQ
Sbjct  480  LFNLNKFVAFETRDPFLIRQ  499



>gb|AAL31038.1|AC078893_1 putative phosphatase subunit, 3'-partial [Oryza sativa Japonica 
Group]
Length=532

 Score =   147 bits (372),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 69/80 (86%), Positives = 73/80 (91%), Gaps = 0/80 (0%)
 Frame = -2

Query  915  NEMQFFYEEQLHRMECMAQEPVLFEDILCQIVDMISPEEESYVTLRDLKGSKLSGSVFNI  736
             EMQFFYEEQLHRMECMAQEPVLFEDILCQ++DMI PE E Y TLRDLK  KLSG++FNI
Sbjct  453  TEMQFFYEEQLHRMECMAQEPVLFEDILCQMIDMIGPENECYFTLRDLKRCKLSGNIFNI  512

Query  735  LFNLNKFMAFETRDPFLIRQ  676
            LFNLNKFMAFETRDPFLIRQ
Sbjct  513  LFNLNKFMAFETRDPFLIRQ  532



>gb|KDD74550.1| hypothetical protein H632_c1234p1, partial [Helicosporidium sp. 
ATCC 50920]
Length=363

 Score =   145 bits (365),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 64/109 (59%), Positives = 91/109 (83%), Gaps = 1/109 (1%)
 Frame = -2

Query  915  NEMQFFYEEQLHRMECMAQEPVLFEDILCQIVDMISPEEESYVTLRDLKGSK-LSGSVFN  739
            +E+ +FYEEQLHRMEC++QE V F D++ Q+ DM++P++   +TLRDL+ ++ L+G++FN
Sbjct  237  SELLYFYEEQLHRMECLSQESVAFTDVMSQMHDMLNPDDSKLITLRDLRRNRALAGNLFN  296

Query  738  ILFNLNKFMAFETRDPFLIRQERENPNLTEWDRFAHREYIRLSMEEDAE  592
            ILFNLNKF+AFETRDPF++RQERE  +L +WDRFA  EY RL++EED +
Sbjct  297  ILFNLNKFIAFETRDPFIVRQEREEGDLGDWDRFARSEYARLAVEEDGD  345



>ref|XP_011400271.1| Serine/threonine-protein phosphatase 2A regulatory subunit B'' 
subunit alpha [Auxenochlorella protothecoides]
 gb|KFM27304.1| Serine/threonine-protein phosphatase 2A regulatory subunit B'' 
subunit alpha [Auxenochlorella protothecoides]
Length=483

 Score =   137 bits (344),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 63/122 (52%), Positives = 91/122 (75%), Gaps = 1/122 (1%)
 Frame = -2

Query  915  NEMQFFYEEQLHRMECMAQEPVLFEDILCQIVDMISPEEESYVTLRDLKGSK-LSGSVFN  739
            +E+ +FYEEQLHRMEC++QE V + D++ Q+ DM++PE  +Y TL DLK ++ ++G++FN
Sbjct  356  SELYYFYEEQLHRMECLSQESVSYFDVMGQLHDMLNPENSTYYTLGDLKRNRAMAGTLFN  415

Query  738  ILFNLNKFMAFETRDPFLIRQERENPNLTEWDRFAHREYIRLSMEEDAEDASNGSADVWD  559
            +LFNLNKF+ FETRDPF  RQERE   +TEWDRFA +EY RL+ ++   +A +   + W 
Sbjct  416  VLFNLNKFVQFETRDPFSARQEREEIGVTEWDRFARQEYQRLADDDGEVEAVDAGGNTWG  475

Query  558  ES  553
             S
Sbjct  476  AS  477



>ref|XP_005715246.1| unnamed protein product [Chondrus crispus]
 emb|CDF35427.1| unnamed protein product [Chondrus crispus]
Length=996

 Score =   135 bits (340),  Expect = 2e-31, Method: Composition-based stats.
 Identities = 62/102 (61%), Positives = 75/102 (74%), Gaps = 1/102 (1%)
 Frame = -2

Query  912  EMQFFYEEQLHRMECMAQEPVLFEDILCQIVDMISPE-EESYVTLRDLKGSKLSGSVFNI  736
            +M+FFY EQLHRMEC   EPV   DILCQ++DMI+P  +   +  RDLK  KL+G+ FN+
Sbjct  867  DMEFFYTEQLHRMECFGHEPVQIRDILCQLLDMINPNVKPPVIRRRDLKKCKLAGNFFNV  926

Query  735  LFNLNKFMAFETRDPFLIRQERENPNLTEWDRFAHREYIRLS  610
            LFNLNKF A E RDP  IRQE   P+LT+WDRFA  EY+RLS
Sbjct  927  LFNLNKFFAIEARDPLQIRQEHATPDLTDWDRFAALEYLRLS  968



>ref|XP_005537556.1| probable protein phosphatase 2A regulatory subunit [Cyanidioschyzon 
merolae strain 10D]
 dbj|BAM81520.1| probable protein phosphatase 2A regulatory subunit [Cyanidioschyzon 
merolae strain 10D]
Length=791

 Score =   134 bits (338),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 70/136 (51%), Positives = 92/136 (68%), Gaps = 7/136 (5%)
 Frame = -2

Query  912  EMQFFYEEQLHRMECMAQEPVLFEDILCQIVDMISPEEESYVTLRD-LKGSKLSGSVFNI  736
            ++ + Y EQLHRMEC+  EPV FEDILCQ++DMIS + +  V  R  L+ S++    FNI
Sbjct  658  DVDWLYSEQLHRMECLGHEPVAFEDILCQLLDMISKDLDPPVITRSALRSSRMQSHFFNI  717

Query  735  LFNLNKFMAFETRDPFLIRQERENPNLTEWDRFAHREYIRLSMEEDAEDASNGSADVWDE  556
            LFNLNKF+A E+RDP L+RQER  P+LT+WDRFA  EY+RLS E+D       + D W  
Sbjct  718  LFNLNKFIAIESRDPSLLRQERAVPDLTDWDRFAALEYLRLSAEDD-----EANMDAWSA  772

Query  555  S-LEAPF*VLVVSYAK  511
            S LE  + V  +S A+
Sbjct  773  SDLEGMYAVSSLSGAE  788



>ref|XP_002779684.1| conserved hypothetical protein [Perkinsus marinus ATCC 50983]
 gb|EER11479.1| conserved hypothetical protein [Perkinsus marinus ATCC 50983]
Length=153

 Score =   125 bits (313),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 61/114 (54%), Positives = 86/114 (75%), Gaps = 2/114 (2%)
 Frame = -2

Query  915  NEMQFFYEEQLHRMECMAQEPVLFEDILCQIVDMISPEEESYVTLRDLKGS-KLSGSVFN  739
            +EM +FY EQ+ R+EC+ QE V F+DILCQ+ D+I PE E    L D K + K+SG  F+
Sbjct  40   HEMAYFYLEQVQRLECLHQEAVRFQDILCQMNDLIMPEMEGQFELEDFKRTRKISGIFFS  99

Query  738  ILFNLNKFMAFETRDPFLIRQER-ENPNLTEWDRFAHREYIRLSMEEDAEDASN  580
            IL +LNKF+A+E RDPF I+QE+ E+P+ +EWDRF  +EYIRL+ME+D +D ++
Sbjct  100  ILLSLNKFLAYEQRDPFSIKQEQLEHPDYSEWDRFCAQEYIRLAMEDDVDDQAS  153



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2145599438534