BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig12674

Length=1097
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

dbj|BAD18097.1|  putative serine/threonine protein kinase               456   2e-158   Ipomoea batatas [batate]
dbj|BAD18102.1|  leucine-rich repeat receptor-like kinase               457   8e-153   Ipomoea batatas [batate]
emb|CAN75190.1|  hypothetical protein VITISV_035381                     432   2e-143   Vitis vinifera
ref|XP_010651607.1|  PREDICTED: protein NSP-INTERACTING KINASE 3        432   3e-143   Vitis vinifera
ref|XP_011086598.1|  PREDICTED: protein NSP-INTERACTING KINASE 3        427   2e-141   
ref|XP_009626005.1|  PREDICTED: protein NSP-INTERACTING KINASE 3        427   2e-141   
ref|XP_008444353.1|  PREDICTED: protein NSP-INTERACTING KINASE 3 ...    426   3e-141   Cucumis melo [Oriental melon]
ref|XP_004142972.1|  PREDICTED: protein NSP-INTERACTING KINASE 3 ...    427   4e-141   Cucumis sativus [cucumbers]
ref|XP_011649490.1|  PREDICTED: protein NSP-INTERACTING KINASE 3 ...    426   5e-141   Cucumis sativus [cucumbers]
ref|XP_008444352.1|  PREDICTED: protein NSP-INTERACTING KINASE 3 ...    426   6e-141   Cucumis melo [Oriental melon]
ref|XP_011045286.1|  PREDICTED: protein NSP-INTERACTING KINASE 3        420   7e-141   Populus euphratica
ref|XP_007044708.1|  Nsp-interacting kinase 3 isoform 1                 426   8e-141   Theobroma cacao [chocolate]
ref|XP_009800027.1|  PREDICTED: protein NSP-INTERACTING KINASE 3        426   1e-140   Nicotiana sylvestris
ref|XP_002525400.1|  BRASSINOSTEROID INSENSITIVE 1-associated rec...    425   2e-140   
ref|XP_004297396.1|  PREDICTED: protein NSP-INTERACTING KINASE 3 ...    424   4e-140   Fragaria vesca subsp. vesca
ref|XP_012085434.1|  PREDICTED: protein NSP-INTERACTING KINASE 3        424   5e-140   Jatropha curcas
ref|XP_011463143.1|  PREDICTED: protein NSP-INTERACTING KINASE 3 ...    424   5e-140   Fragaria vesca subsp. vesca
ref|XP_007044709.1|  Nsp-interacting kinase 3 isoform 2                 417   6e-140   
ref|XP_002315684.2|  hypothetical protein POPTR_0010s05300g             424   8e-140   
ref|XP_006378225.1|  hypothetical protein POPTR_0010s05300g             423   8e-140   
ref|XP_010100426.1|  Protein NSP-INTERACTING KINASE 3                   421   1e-138   Morus notabilis
ref|XP_007222911.1|  hypothetical protein PRUPE_ppa003642mg             417   2e-138   
ref|XP_002312685.1|  leucine-rich repeat family protein                 420   2e-138   
ref|XP_006380012.1|  hypothetical protein POPTR_0008s19310g             419   2e-138   
ref|XP_007222912.1|  hypothetical protein PRUPE_ppa003642mg             417   2e-138   
ref|XP_008221853.1|  PREDICTED: protein NSP-INTERACTING KINASE 3 ...    417   3e-138   Prunus mume [ume]
ref|XP_006366916.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...    419   6e-138   Solanum tuberosum [potatoes]
ref|XP_010251173.1|  PREDICTED: protein NSP-INTERACTING KINASE 3        417   3e-137   Nelumbo nucifera [Indian lotus]
ref|XP_008221852.1|  PREDICTED: protein NSP-INTERACTING KINASE 3 ...    418   3e-137   Prunus mume [ume]
ref|XP_008221850.1|  PREDICTED: protein NSP-INTERACTING KINASE 3 ...    418   3e-137   Prunus mume [ume]
ref|XP_010248542.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...    414   6e-137   Nelumbo nucifera [Indian lotus]
emb|CDP13189.1|  unnamed protein product                                416   9e-137   Coffea canephora [robusta coffee]
ref|XP_008389685.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...    416   1e-136   Malus domestica [apple tree]
ref|XP_011034114.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...    415   1e-136   Populus euphratica
ref|XP_011034116.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...    415   1e-136   Populus euphratica
ref|XP_008389688.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...    415   1e-136   Malus domestica [apple tree]
ref|XP_008389687.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...    415   2e-136   Malus domestica [apple tree]
ref|XP_010248541.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...    415   2e-136   Nelumbo nucifera [Indian lotus]
ref|XP_003613191.1|  Leucine-rich repeat receptor-like kinase           414   4e-136   Medicago truncatula
gb|KDO82334.1|  hypothetical protein CISIN_1g006968mg                   412   2e-135   Citrus sinensis [apfelsine]
gb|KHN14560.1|  Protein NSP-INTERACTING KINASE 3                        410   6e-135   Glycine soja [wild soybean]
ref|XP_003517653.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...    410   6e-135   Glycine max [soybeans]
ref|XP_007157369.1|  hypothetical protein PHAVU_002G064400g             410   7e-135   Phaseolus vulgaris [French bean]
gb|EYU28436.1|  hypothetical protein MIMGU_mgv1a002888mg                411   7e-135   Erythranthe guttata [common monkey flower]
ref|XP_003519642.1|  PREDICTED: protein NSP-INTERACTING KINASE 3 ...    410   1e-134   Glycine max [soybeans]
gb|KHN00370.1|  Protein NSP-INTERACTING KINASE 3                        410   1e-134   Glycine soja [wild soybean]
ref|XP_004489819.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...    410   2e-134   Cicer arietinum [garbanzo]
gb|KJB61041.1|  hypothetical protein B456_009G337000                    409   5e-134   Gossypium raimondii
gb|KJB61045.1|  hypothetical protein B456_009G337000                    408   5e-134   Gossypium raimondii
ref|XP_010319667.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...    406   9e-134   Solanum lycopersicum
ref|XP_006438322.1|  hypothetical protein CICLE_v10030967mg             407   1e-133   Citrus clementina [clementine]
ref|XP_006483905.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...    407   2e-133   Citrus sinensis [apfelsine]
ref|XP_004237339.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...    406   4e-133   Solanum lycopersicum
ref|XP_008340071.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...    405   2e-132   
ref|XP_009596637.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...    404   2e-132   Nicotiana tomentosiformis
ref|XP_008340070.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...    404   2e-132   
ref|XP_008340072.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...    404   2e-132   
ref|XP_006841062.1|  PREDICTED: protein NSP-INTERACTING KINASE 3        404   2e-132   Amborella trichopoda
ref|XP_010023506.1|  PREDICTED: protein NSP-INTERACTING KINASE 3        403   6e-132   Eucalyptus grandis [rose gum]
ref|XP_010682518.1|  PREDICTED: protein NSP-INTERACTING KINASE 3        402   1e-131   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010940158.1|  PREDICTED: protein NSP-INTERACTING KINASE 3        402   1e-131   Elaeis guineensis
ref|XP_010910388.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...    402   2e-131   Elaeis guineensis
ref|XP_008812173.1|  PREDICTED: protein NSP-INTERACTING KINASE 3        399   2e-130   Phoenix dactylifera
ref|XP_008813583.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...    400   2e-130   Phoenix dactylifera
ref|XP_008813582.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...    400   3e-130   Phoenix dactylifera
ref|XP_006356418.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...    395   2e-129   Solanum tuberosum [potatoes]
ref|XP_009390158.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...    397   3e-129   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009390157.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...    397   3e-129   
ref|XP_009403878.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...    394   1e-128   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009403877.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...    394   3e-128   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002455108.1|  hypothetical protein SORBIDRAFT_03g004450          381   1e-123   
ref|XP_006844161.1|  PREDICTED: protein NSP-INTERACTING KINASE 1        381   2e-123   Amborella trichopoda
ref|XP_011070875.1|  PREDICTED: protein NSP-INTERACTING KINASE 2-...    380   5e-123   Sesamum indicum [beniseed]
ref|XP_010261784.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    377   9e-123   Nelumbo nucifera [Indian lotus]
ref|XP_004238646.1|  PREDICTED: protein NSP-INTERACTING KINASE 3        377   3e-122   Solanum lycopersicum
ref|XP_006643812.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...    376   6e-122   
ref|XP_010261776.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    377   9e-122   Nelumbo nucifera [Indian lotus]
emb|CAN63733.1|  hypothetical protein VITISV_025883                     376   9e-122   Vitis vinifera
dbj|BAD68255.1|  putative brassinosteroid insensitive 1-associate...    377   1e-121   Oryza sativa Japonica Group [Japonica rice]
emb|CDP00520.1|  unnamed protein product                                377   1e-121   Coffea canephora [robusta coffee]
ref|XP_004968347.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...    377   1e-121   Setaria italica
ref|XP_008446509.1|  PREDICTED: protein NSP-INTERACTING KINASE 2 ...    373   2e-121   Cucumis melo [Oriental melon]
ref|XP_003637897.1|  Receptor-like kinase                               372   2e-121   
ref|XP_002269902.1|  PREDICTED: protein NSP-INTERACTING KINASE 1        376   2e-121   Vitis vinifera
ref|XP_008797566.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    376   2e-121   Phoenix dactylifera
ref|XP_011655742.1|  PREDICTED: protein NSP-INTERACTING KINASE 2 ...    372   3e-121   Cucumis sativus [cucumbers]
ref|XP_002886588.1|  nsp-interacting kinase 3                           376   3e-121   
ref|XP_004490300.1|  PREDICTED: protein NSP-INTERACTING KINASE 2-...    375   3e-121   Cicer arietinum [garbanzo]
ref|XP_010681338.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    375   4e-121   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006301740.1|  hypothetical protein CARUB_v10022201mg             375   4e-121   
ref|XP_010257839.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    375   5e-121   Nelumbo nucifera [Indian lotus]
gb|AAB71968.1|  Putative Serine/Threonine protein kinase                374   5e-121   Arabidopsis thaliana [mouse-ear cress]
ref|NP_176279.1|  NSP-interacting kinase 3                              375   6e-121   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004238998.1|  PREDICTED: protein NSP-INTERACTING KINASE 1        375   7e-121   Solanum lycopersicum
emb|CDY44608.1|  BnaCnng11570D                                          370   9e-121   Brassica napus [oilseed rape]
ref|NP_001140727.1|  uncharacterized LOC100272802                       361   9e-121   
emb|CDY61508.1|  BnaCnng37930D                                          370   1e-120   Brassica napus [oilseed rape]
ref|XP_002532890.1|  BRASSINOSTEROID INSENSITIVE 1-associated rec...    374   1e-120   Ricinus communis
tpg|DAA53257.1|  TPA: putative leucine-rich repeat receptor-like ...    367   2e-120   
gb|KEH21800.1|  NSP-interacting kinase-like protein                     373   2e-120   Medicago truncatula
gb|KDO58880.1|  hypothetical protein CISIN_1g036225mg                   373   3e-120   Citrus sinensis [apfelsine]
ref|XP_010418025.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...    373   3e-120   Camelina sativa [gold-of-pleasure]
ref|XP_008446508.1|  PREDICTED: protein NSP-INTERACTING KINASE 1 ...    373   3e-120   Cucumis melo [Oriental melon]
ref|XP_010418023.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...    373   3e-120   Camelina sativa [gold-of-pleasure]
ref|XP_011020829.1|  PREDICTED: protein NSP-INTERACTING KINASE 2-...    373   3e-120   Populus euphratica
ref|XP_006482337.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    373   3e-120   Citrus sinensis [apfelsine]
ref|XP_008446507.1|  PREDICTED: protein NSP-INTERACTING KINASE 1 ...    373   4e-120   Cucumis melo [Oriental melon]
ref|XP_006348615.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    373   4e-120   
ref|XP_010510907.1|  PREDICTED: protein NSP-INTERACTING KINASE 3 ...    373   4e-120   Camelina sativa [gold-of-pleasure]
ref|XP_010510906.1|  PREDICTED: protein NSP-INTERACTING KINASE 3 ...    373   5e-120   Camelina sativa [gold-of-pleasure]
ref|XP_010533910.1|  PREDICTED: protein NSP-INTERACTING KINASE 3        373   5e-120   Tarenaya hassleriana [spider flower]
ref|XP_011655741.1|  PREDICTED: protein NSP-INTERACTING KINASE 2 ...    372   7e-120   Cucumis sativus [cucumbers]
ref|XP_004135130.1|  PREDICTED: protein NSP-INTERACTING KINASE 1 ...    372   8e-120   Cucumis sativus [cucumbers]
ref|XP_011655740.1|  PREDICTED: protein NSP-INTERACTING KINASE 2 ...    372   8e-120   Cucumis sativus [cucumbers]
gb|KEH17048.1|  NSP-interacting kinase-like protein                     370   1e-119   Medicago truncatula
gb|KDO70180.1|  hypothetical protein CISIN_1g007025mg                   369   1e-119   Citrus sinensis [apfelsine]
ref|XP_006603947.1|  PREDICTED: protein NSP-INTERACTING KINASE 1 ...    367   1e-119   
ref|XP_010473260.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...    371   2e-119   Camelina sativa [gold-of-pleasure]
gb|KHN07744.1|  Protein NSP-INTERACTING KINASE 2                        371   2e-119   Glycine soja [wild soybean]
ref|XP_010473259.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...    372   2e-119   Camelina sativa [gold-of-pleasure]
gb|KDO70181.1|  hypothetical protein CISIN_1g007025mg                   369   2e-119   Citrus sinensis [apfelsine]
ref|XP_003517902.1|  PREDICTED: protein NSP-INTERACTING KINASE 2-...    371   2e-119   Glycine max [soybeans]
ref|XP_006574993.1|  PREDICTED: protein NSP-INTERACTING KINASE 2-...    371   2e-119   
ref|XP_006392114.1|  hypothetical protein EUTSA_v10023342mg             371   2e-119   Eutrema salsugineum [saltwater cress]
ref|XP_006593318.1|  PREDICTED: NSP-interacting kinase isoform X2       367   2e-119   Glycine max [soybeans]
ref|XP_006430876.1|  hypothetical protein CICLE_v10011302mg             370   2e-119   Citrus clementina [clementine]
ref|XP_007153543.1|  hypothetical protein PHAVU_003G044400g             370   3e-119   Phaseolus vulgaris [French bean]
ref|XP_012088120.1|  PREDICTED: protein NSP-INTERACTING KINASE 1        370   3e-119   Jatropha curcas
ref|XP_008465988.1|  PREDICTED: protein NSP-INTERACTING KINASE 2-...    370   3e-119   Cucumis melo [Oriental melon]
ref|XP_010942232.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    370   4e-119   Elaeis guineensis
gb|KJB80538.1|  hypothetical protein B456_013G102600                    370   5e-119   Gossypium raimondii
gb|KHG05227.1|  nsp-interacting kinase 2 -like protein                  370   5e-119   Gossypium arboreum [tree cotton]
ref|XP_002311408.2|  hypothetical protein POPTR_0008s10970g             370   5e-119   Populus trichocarpa [western balsam poplar]
ref|XP_011009019.1|  PREDICTED: protein NSP-INTERACTING KINASE 2-...    370   5e-119   Populus euphratica
ref|XP_009104025.1|  PREDICTED: protein NSP-INTERACTING KINASE 3 ...    370   5e-119   Brassica rapa
ref|XP_010528022.1|  PREDICTED: protein NSP-INTERACTING KINASE 2        370   6e-119   Tarenaya hassleriana [spider flower]
ref|XP_009104018.1|  PREDICTED: protein NSP-INTERACTING KINASE 3 ...    370   6e-119   Brassica rapa
gb|ABG73621.1|  leucine-rich repeat receptor-like kinase                369   6e-119   Populus tomentosa [Chinese white poplar]
gb|KEH17047.1|  NSP-interacting kinase-like protein                     369   7e-119   Medicago truncatula
gb|AFO67891.1|  leucine-rich repeat receptor-like kinase                370   7e-119   Brassica rapa subsp. oleifera [biennial turnip rape]
emb|CDY46185.1|  BnaA01g23070D                                          370   7e-119   Brassica napus [oilseed rape]
ref|XP_011077619.1|  PREDICTED: protein NSP-INTERACTING KINASE 2        370   8e-119   Sesamum indicum [beniseed]
ref|XP_011011496.1|  PREDICTED: protein NSP-INTERACTING KINASE 2-...    369   1e-118   Populus euphratica
ref|XP_009765506.1|  PREDICTED: protein NSP-INTERACTING KINASE 2-...    369   1e-118   Nicotiana sylvestris
ref|XP_009625494.1|  PREDICTED: protein NSP-INTERACTING KINASE 2-...    369   2e-118   Nicotiana tomentosiformis
ref|XP_006437790.1|  hypothetical protein CICLE_v10030970mg             368   2e-118   Citrus clementina [clementine]
ref|XP_006484307.1|  PREDICTED: protein NSP-INTERACTING KINASE 2-...    368   2e-118   Citrus sinensis [apfelsine]
ref|XP_003552626.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    368   2e-118   Glycine max [soybeans]
gb|KHN13790.1|  Protein NSP-INTERACTING KINASE 1                        368   2e-118   Glycine soja [wild soybean]
ref|XP_007033440.1|  NSP-interacting kinase 1                           369   3e-118   
ref|XP_010032589.1|  PREDICTED: protein NSP-INTERACTING KINASE 1        368   3e-118   Eucalyptus grandis [rose gum]
ref|XP_002305306.2|  hypothetical protein POPTR_0004s10790g             368   3e-118   Populus trichocarpa [western balsam poplar]
ref|XP_006384231.1|  hypothetical protein POPTR_0004s10790g             368   4e-118   Populus trichocarpa [western balsam poplar]
ref|XP_002514536.1|  BRASSINOSTEROID INSENSITIVE 1-associated rec...    366   4e-118   
ref|XP_003555046.1|  PREDICTED: protein NSP-INTERACTING KINASE 1 ...    367   4e-118   Glycine max [soybeans]
ref|NP_001169689.1|  LOC100383570 precursor                             368   5e-118   Zea mays [maize]
ref|XP_004507264.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    367   5e-118   Cicer arietinum [garbanzo]
ref|XP_004149504.1|  PREDICTED: protein NSP-INTERACTING KINASE 2-...    367   5e-118   Cucumis sativus [cucumbers]
emb|CDY61461.1|  BnaC01g43240D                                          367   5e-118   Brassica napus [oilseed rape]
ref|NP_001238448.1|  NSP-interacting kinase precursor                   366   5e-118   Glycine max [soybeans]
gb|KJB43139.1|  hypothetical protein B456_007G186300                    362   6e-118   Gossypium raimondii
gb|KHN30771.1|  Protein NSP-INTERACTING KINASE 1                        367   6e-118   Glycine soja [wild soybean]
ref|XP_006593317.1|  PREDICTED: NSP-interacting kinase isoform X1       367   7e-118   Glycine max [soybeans]
dbj|BAK02609.1|  predicted protein                                      367   9e-118   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010929457.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    367   9e-118   Elaeis guineensis
ref|XP_011099082.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    366   1e-117   Sesamum indicum [beniseed]
ref|XP_011012714.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    366   2e-117   Populus euphratica
emb|CDP02372.1|  unnamed protein product                                366   2e-117   Coffea canephora [robusta coffee]
ref|XP_011099081.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    366   2e-117   Sesamum indicum [beniseed]
ref|XP_007139356.1|  hypothetical protein PHAVU_008G022700g             366   2e-117   Phaseolus vulgaris [French bean]
emb|CBI16897.3|  unnamed protein product                                365   2e-117   Vitis vinifera
ref|XP_011012715.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    366   2e-117   Populus euphratica
ref|XP_002278965.1|  PREDICTED: protein NSP-INTERACTING KINASE 1        365   2e-117   Vitis vinifera
ref|XP_008807034.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    365   3e-117   Phoenix dactylifera
ref|XP_006373507.1|  hypothetical protein POPTR_0017s14360g             364   3e-117   
ref|XP_009378313.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    365   5e-117   Pyrus x bretschneideri [bai li]
ref|XP_008807033.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    365   5e-117   Phoenix dactylifera
gb|KHN14464.1|  Protein NSP-INTERACTING KINASE 1                        365   5e-117   Glycine soja [wild soybean]
ref|XP_006647834.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    365   5e-117   Oryza brachyantha
gb|ABD96908.1|  hypothetical protein                                    365   6e-117   Tarenaya spinosa
ref|XP_011021146.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    364   6e-117   Populus euphratica
ref|XP_011021148.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    364   7e-117   Populus euphratica
ref|XP_010558548.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    365   7e-117   Tarenaya hassleriana [spider flower]
ref|XP_010558545.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    364   8e-117   Tarenaya hassleriana [spider flower]
ref|XP_008379484.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    364   1e-116   
gb|EEE57731.1|  hypothetical protein OsJ_08242                          363   1e-116   Oryza sativa Japonica Group [Japonica rice]
gb|EEC73926.1|  hypothetical protein OsI_08784                          363   2e-116   Oryza sativa Indica Group [Indian rice]
ref|XP_010230511.1|  PREDICTED: protein NSP-INTERACTING KINASE 3 ...    363   2e-116   
ref|XP_008783060.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    363   2e-116   Phoenix dactylifera
ref|XP_010230510.1|  PREDICTED: protein NSP-INTERACTING KINASE 3 ...    362   2e-116   
ref|XP_003531900.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    363   2e-116   Glycine max [soybeans]
gb|KEH25223.1|  NSP-interacting kinase-like protein                     363   2e-116   Medicago truncatula
ref|XP_008459453.1|  PREDICTED: protein NSP-INTERACTING KINASE 1        363   3e-116   Cucumis melo [Oriental melon]
ref|XP_010927979.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    362   3e-116   
ref|XP_004141483.1|  PREDICTED: protein NSP-INTERACTING KINASE 1        363   3e-116   Cucumis sativus [cucumbers]
ref|XP_008230341.1|  PREDICTED: protein NSP-INTERACTING KINASE 1        363   3e-116   Prunus mume [ume]
ref|XP_003569325.2|  PREDICTED: protein NSP-INTERACTING KINASE 3 ...    363   3e-116   Brachypodium distachyon [annual false brome]
ref|XP_004953781.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    362   3e-116   Setaria italica
ref|XP_010230509.1|  PREDICTED: protein NSP-INTERACTING KINASE 3 ...    363   3e-116   Brachypodium distachyon [annual false brome]
ref|XP_007151443.1|  hypothetical protein PHAVU_004G046800g             362   4e-116   Phaseolus vulgaris [French bean]
ref|XP_009803320.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    362   5e-116   Nicotiana sylvestris
ref|XP_010927978.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    362   6e-116   Elaeis guineensis
ref|XP_009803321.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    362   8e-116   Nicotiana sylvestris
ref|XP_009803966.1|  PREDICTED: protein NSP-INTERACTING KINASE 2-...    361   8e-116   Nicotiana sylvestris
gb|KJB43138.1|  hypothetical protein B456_007G186300                    362   8e-116   Gossypium raimondii
ref|XP_008341829.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    362   8e-116   Malus domestica [apple tree]
ref|XP_009596697.1|  PREDICTED: protein NSP-INTERACTING KINASE 2-...    361   8e-116   Nicotiana tomentosiformis
ref|XP_009803965.1|  PREDICTED: protein NSP-INTERACTING KINASE 2-...    361   8e-116   Nicotiana sylvestris
ref|XP_002314905.1|  hypothetical protein POPTR_0010s14410g             362   8e-116   
ref|XP_009596696.1|  PREDICTED: protein NSP-INTERACTING KINASE 2-...    361   1e-115   Nicotiana tomentosiformis
gb|EPS73511.1|  hypothetical protein M569_01245                         361   1e-115   Genlisea aurea
ref|XP_002436855.1|  hypothetical protein SORBIDRAFT_10g010010          361   2e-115   Sorghum bicolor [broomcorn]
ref|XP_008654537.1|  PREDICTED: uncharacterized LOC100272802 isof...    361   2e-115   
ref|XP_007045670.1|  LRR receptor-like serine/threonine-protein k...    369   2e-115   
ref|XP_007214944.1|  hypothetical protein PRUPE_ppa002897mg             360   2e-115   Prunus persica
ref|XP_006344295.1|  PREDICTED: protein NSP-INTERACTING KINASE 2-...    360   2e-115   Solanum tuberosum [potatoes]
ref|XP_009630581.1|  PREDICTED: protein NSP-INTERACTING KINASE 1        360   3e-115   Nicotiana tomentosiformis
ref|XP_004491764.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    360   4e-115   Cicer arietinum [garbanzo]
ref|XP_010236002.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    360   4e-115   Brachypodium distachyon [annual false brome]
ref|XP_003572984.2|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    360   4e-115   Brachypodium distachyon [annual false brome]
ref|XP_009373732.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    360   6e-115   Pyrus x bretschneideri [bai li]
ref|XP_010905760.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    359   7e-115   Elaeis guineensis
gb|EYU44266.1|  hypothetical protein MIMGU_mgv1a002951mg                359   7e-115   Erythranthe guttata [common monkey flower]
dbj|BAB01326.1|  receptor-like kinase                                   359   8e-115   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004232118.1|  PREDICTED: protein NSP-INTERACTING KINASE 1        359   9e-115   Solanum lycopersicum
ref|NP_974360.1|  NSP-interacting kinase 2                              359   9e-115   Arabidopsis thaliana [mouse-ear cress]
ref|NP_189183.2|  NSP-interacting kinase 2                              359   9e-115   Arabidopsis thaliana [mouse-ear cress]
dbj|BAJ89901.1|  predicted protein                                      359   1e-114   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004297175.1|  PREDICTED: protein NSP-INTERACTING KINASE 2        358   1e-114   Fragaria vesca subsp. vesca
ref|XP_004965216.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    360   1e-114   Setaria italica
ref|XP_009407942.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    358   1e-114   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009396215.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    358   1e-114   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004304172.1|  PREDICTED: protein NSP-INTERACTING KINASE 1        358   2e-114   Fragaria vesca subsp. vesca
ref|XP_004236956.1|  PREDICTED: protein NSP-INTERACTING KINASE 2        358   2e-114   Solanum lycopersicum
ref|XP_008243752.1|  PREDICTED: protein NSP-INTERACTING KINASE 2        358   2e-114   
ref|XP_012080508.1|  PREDICTED: protein NSP-INTERACTING KINASE 2-...    357   3e-114   Jatropha curcas
ref|XP_008389350.1|  PREDICTED: LOW QUALITY PROTEIN: protein NSP-...    357   3e-114   
gb|KJB60823.1|  hypothetical protein B456_009G327400                    357   4e-114   Gossypium raimondii
ref|XP_010091686.1|  Protein NSP-INTERACTING KINASE 2                   357   6e-114   
ref|XP_002452616.1|  hypothetical protein SORBIDRAFT_04g029170          356   9e-114   Sorghum bicolor [broomcorn]
gb|AHF18212.1|  brassinosteroid insensitive 1-associated receptor...    356   1e-113   Saccharum hybrid cultivar [sugarcane]
ref|XP_003563960.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    356   1e-113   Brachypodium distachyon [annual false brome]
ref|XP_010044599.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...    355   1e-113   Eucalyptus grandis [rose gum]
ref|XP_006395648.1|  hypothetical protein EUTSA_v10003811mg             356   2e-113   Eutrema salsugineum [saltwater cress]
gb|KCW86687.1|  hypothetical protein EUGRSUZ_B03306                     355   3e-113   Eucalyptus grandis [rose gum]
ref|XP_009356495.1|  PREDICTED: protein NSP-INTERACTING KINASE 2-...    355   3e-113   Pyrus x bretschneideri [bai li]
gb|KFK39862.1|  hypothetical protein AALP_AA3G298400                    355   3e-113   Arabis alpina [alpine rockcress]
ref|XP_002876917.1|  nsp-interacting kinase 2                           355   4e-113   
ref|XP_006338306.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    355   4e-113   Solanum tuberosum [potatoes]
ref|NP_197104.1|  NSP-interacting kinase 1                              355   5e-113   Arabidopsis thaliana [mouse-ear cress]
gb|AAM65586.1|  receptor protein kinase-like protein                    355   5e-113   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007221991.1|  hypothetical protein PRUPE_ppa002873mg             354   6e-113   Prunus persica
gb|EYU28925.1|  hypothetical protein MIMGU_mgv1a003010mg                354   7e-113   Erythranthe guttata [common monkey flower]
ref|XP_010044598.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...    354   7e-113   
ref|XP_006290715.1|  hypothetical protein CARUB_v10016813mg             355   7e-113   Capsella rubella
ref|XP_010044597.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...    354   8e-113   
ref|NP_001146634.1|  uncharacterized LOC100280233 precursor             354   8e-113   Zea mays [maize]
ref|XP_010044594.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...    354   8e-113   Eucalyptus grandis [rose gum]
ref|XP_009391272.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    355   8e-113   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010044596.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...    354   8e-113   
ref|XP_010044595.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...    354   8e-113   
ref|XP_009391273.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    354   1e-112   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001189971.1|  NSP-interacting kinase 2                           354   1e-112   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010549936.1|  PREDICTED: protein NSP-INTERACTING KINASE 1        353   1e-112   Tarenaya hassleriana [spider flower]
ref|XP_010492459.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    353   2e-112   Camelina sativa [gold-of-pleasure]
ref|XP_008339771.1|  PREDICTED: protein NSP-INTERACTING KINASE 2-...    353   2e-112   
ref|XP_010453748.1|  PREDICTED: protein NSP-INTERACTING KINASE 1        353   2e-112   Camelina sativa [gold-of-pleasure]
ref|XP_010514169.1|  PREDICTED: protein NSP-INTERACTING KINASE 2-...    353   2e-112   Camelina sativa [gold-of-pleasure]
ref|XP_010044332.1|  PREDICTED: protein NSP-INTERACTING KINASE 2        352   4e-112   Eucalyptus grandis [rose gum]
emb|CDY48073.1|  BnaA06g33550D                                          352   5e-112   Brassica napus [oilseed rape]
ref|XP_006400129.1|  hypothetical protein EUTSA_v10012948mg             352   5e-112   Eutrema salsugineum [saltwater cress]
ref|XP_009417562.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    352   6e-112   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009152132.1|  PREDICTED: LOW QUALITY PROTEIN: protein NSP-...    352   6e-112   Brassica rapa
ref|XP_009418103.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    350   8e-112   
ref|XP_008811184.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    351   1e-111   Phoenix dactylifera
ref|XP_006287253.1|  hypothetical protein CARUB_v10000442mg             350   2e-111   Capsella rubella
gb|EMT25229.1|  Putative LRR receptor-like serine/threonine-prote...    353   3e-111   
emb|CDX83534.1|  BnaC07g22740D                                          350   3e-111   
ref|XP_009418102.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    350   3e-111   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002871697.1|  nsp-interacting kinase 1                           350   4e-111   
ref|XP_010502426.1|  PREDICTED: protein NSP-INTERACTING KINASE 2        349   9e-111   
ref|NP_001168791.1|  uncharacterized LOC100382590                       343   1e-110   
gb|EMT30099.1|  Putative LRR receptor-like serine/threonine-prote...    346   4e-110   
gb|AFW86330.1|  putative leucine-rich repeat receptor-like protei...    343   5e-110   
ref|XP_009131513.1|  PREDICTED: protein NSP-INTERACTING KINASE 1        345   2e-109   
gb|KFK25832.1|  hypothetical protein AALP_AA8G167900                    345   2e-109   
ref|XP_008658830.1|  PREDICTED: uncharacterized LOC100382590 isof...    343   9e-109   
gb|ACN30679.1|  unknown                                                 343   9e-109   
gb|AFW76893.1|  putative leucine-rich repeat receptor-like protei...    337   6e-108   
gb|ADD60669.1|  putative somatic embryogenesis protein kinase 1         340   2e-107   
ref|XP_009400110.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    339   3e-107   
ref|XP_010100900.1|  Protein NSP-INTERACTING KINASE 1                   342   3e-107   
ref|XP_009400102.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    339   3e-107   
dbj|BAF79962.1|  receptor-like kinase                                   338   5e-107   
gb|ACN34523.1|  unknown                                                 337   8e-107   
ref|XP_008647815.1|  PREDICTED: BRASSINOSTEROID INSENSITIVE 1-ass...    337   1e-106   
ref|NP_001147975.1|  BRASSINOSTEROID INSENSITIVE 1-associated rec...    338   1e-106   
gb|AFW76897.1|  putative leucine-rich repeat receptor-like protei...    339   1e-106   
ref|XP_008658828.1|  PREDICTED: uncharacterized LOC100382590 isof...    336   1e-105   
gb|AFO67892.1|  leucine-rich repeat receptor-like kinase                333   1e-104   
ref|XP_009121529.1|  PREDICTED: protein NSP-INTERACTING KINASE 1        333   1e-104   
emb|CDY26481.1|  BnaC09g41870D                                          333   1e-104   
emb|CDX69484.1|  BnaA10g18330D                                          333   1e-104   
gb|ADD60706.1|  putative somatic embryogenesis protein kinase 1         332   4e-104   
ref|XP_010914291.1|  PREDICTED: probable LRR receptor-like serine...    330   1e-103   
ref|XP_009394555.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    328   6e-103   
gb|EPS59992.1|  hypothetical protein M569_14812                         324   2e-102   
gb|KCW86689.1|  hypothetical protein EUGRSUZ_B03306                     325   4e-102   
ref|XP_008781387.1|  PREDICTED: probable LRR receptor-like serine...    326   5e-102   
gb|KCW86690.1|  hypothetical protein EUGRSUZ_B03306                     325   7e-102   
gb|KCW86693.1|  hypothetical protein EUGRSUZ_B03306                     325   7e-102   
gb|KCW86692.1|  hypothetical protein EUGRSUZ_B03306                     325   7e-102   
gb|KCW86691.1|  hypothetical protein EUGRSUZ_B03306                     325   7e-102   
ref|XP_002965655.1|  hypothetical protein SELMODRAFT_167872             325   3e-101   
gb|ADD60695.1|  putative somatic embryogenesis protein kinase 1         324   3e-101   
ref|XP_002971685.1|  hypothetical protein SELMODRAFT_172211             325   3e-101   
ref|XP_006845438.1|  PREDICTED: protein NSP-INTERACTING KINASE 1        322   2e-100   
ref|XP_010277988.1|  PREDICTED: probable LRR receptor-like serine...    321   2e-100   
ref|NP_001057376.1|  Os06g0274500                                       322   2e-100   
dbj|BAD10033.1|  somatic embryogenesis receptor kinase-like protein     317   4e-100   
ref|XP_010268431.1|  PREDICTED: probable LRR receptor-like serine...    322   4e-100   
ref|XP_010277987.1|  PREDICTED: probable LRR receptor-like serine...    321   1e-99    
ref|XP_011462643.1|  PREDICTED: LOW QUALITY PROTEIN: probable LRR...    320   2e-99    
ref|XP_010235160.1|  PREDICTED: probable LRR receptor-like serine...    315   3e-99    
gb|ADD60682.1|  putative somatic embryogenesis protein kinase 1         319   3e-99    
ref|XP_008664639.1|  PREDICTED: probable LRR receptor-like serine...    317   6e-99    
ref|XP_006659455.1|  PREDICTED: probable LRR receptor-like serine...    313   1e-98    
ref|XP_004973571.1|  PREDICTED: probable LRR receptor-like serine...    318   2e-98    
ref|XP_010687665.1|  PREDICTED: probable LRR receptor-like serine...    317   3e-98    
emb|CDX78667.1|  BnaA03g05790D                                          318   4e-98    
ref|XP_010687666.1|  PREDICTED: probable LRR receptor-like serine...    316   4e-98    
gb|KHN07168.1|  Protein NSP-INTERACTING KINASE 1                        314   5e-98    
ref|XP_011069822.1|  PREDICTED: probable LRR receptor-like serine...    316   5e-98    
ref|XP_010047875.1|  PREDICTED: probable LRR receptor-like serine...    316   6e-98    
dbj|BAJ91470.1|  predicted protein                                      316   6e-98    
ref|XP_009345903.1|  PREDICTED: probable LRR receptor-like serine...    316   6e-98    
ref|XP_002325107.1|  leucine-rich repeat family protein                 315   7e-98    
ref|XP_011033358.1|  PREDICTED: probable LRR receptor-like serine...    315   8e-98    
ref|XP_008664637.1|  PREDICTED: probable LRR receptor-like serine...    317   9e-98    
ref|XP_009360005.1|  PREDICTED: probable LRR receptor-like serine...    315   1e-97    
ref|NP_001061919.1|  Os08g0442700                                       316   1e-97    
emb|CDX70667.1|  BnaC03g07510D                                          317   1e-97    
gb|KDO62317.1|  hypothetical protein CISIN_1g039819mg                   312   1e-97    
ref|XP_001785606.1|  predicted protein                                  314   1e-97    
ref|XP_008359493.1|  PREDICTED: probable LRR receptor-like serine...    315   1e-97    
ref|XP_008647814.1|  PREDICTED: BRASSINOSTEROID INSENSITIVE 1-ass...    314   2e-97    
ref|XP_008664635.1|  PREDICTED: probable LRR receptor-like serine...    317   2e-97    
ref|XP_008664636.1|  PREDICTED: probable LRR receptor-like serine...    317   2e-97    
ref|XP_011018089.1|  PREDICTED: probable LRR receptor-like serine...    314   2e-97    
ref|XP_007013912.1|  Leucine-rich repeat protein kinase family pr...    314   2e-97    
ref|XP_001756895.1|  predicted protein                                  312   2e-97    
ref|XP_002309372.1|  leucine-rich repeat family protein                 314   3e-97    
ref|XP_002445573.1|  hypothetical protein SORBIDRAFT_07g021820          315   3e-97    
ref|XP_007225632.1|  hypothetical protein PRUPE_ppa003371mg             312   4e-97    
emb|CDP02874.1|  unnamed protein product                                313   5e-97    
gb|EAZ07144.1|  hypothetical protein OsI_29394                          315   8e-97    
ref|XP_009417455.1|  PREDICTED: probable LRR receptor-like serine...    313   8e-97    
gb|ADT91694.1|  somatic embryogenesis receptor-like kinase 1            300   1e-96    
ref|XP_001763339.1|  predicted protein                                  311   1e-96    
ref|XP_008664634.1|  PREDICTED: probable LRR receptor-like serine...    317   1e-96    
ref|XP_008664633.1|  PREDICTED: probable LRR receptor-like serine...    317   2e-96    
ref|XP_006453537.1|  hypothetical protein CICLE_v10007718mg             312   2e-96    
ref|XP_010059023.1|  PREDICTED: probable LRR receptor-like serine...    307   2e-96    
gb|KEH32608.1|  LRR receptor-like kinase                                310   2e-96    
ref|XP_006474063.1|  PREDICTED: probable LRR receptor-like serine...    312   2e-96    
ref|XP_008223590.1|  PREDICTED: probable LRR receptor-like serine...    311   3e-96    
ref|XP_003633168.1|  PREDICTED: probable LRR receptor-like serine...    311   4e-96    
ref|XP_009611184.1|  PREDICTED: probable LRR receptor-like serine...    310   4e-96    
ref|XP_003610256.1|  Somatic embryogenesis receptor-like kinase         311   4e-96    
gb|EAZ42894.1|  hypothetical protein OsJ_27488                          314   4e-96    
ref|XP_002533758.1|  BRASSINOSTEROID INSENSITIVE 1-associated rec...    303   8e-96    
emb|CAN63294.1|  hypothetical protein VITISV_040285                     310   8e-96    
ref|XP_012071584.1|  PREDICTED: probable LRR receptor-like serine...    310   9e-96    
ref|XP_009390537.1|  PREDICTED: LOW QUALITY PROTEIN: probable LRR...    310   1e-95    
ref|XP_009796362.1|  PREDICTED: probable LRR receptor-like serine...    309   1e-95    
ref|XP_008443821.1|  PREDICTED: probable LRR receptor-like serine...    310   1e-95    
ref|XP_010274437.1|  PREDICTED: probable LRR receptor-like serine...    309   1e-95    
gb|AAC63680.1|  putative LRR receptor protein kinase                    308   1e-95    
ref|XP_010274436.1|  PREDICTED: probable LRR receptor-like serine...    310   2e-95    
ref|XP_004146714.1|  PREDICTED: probable LRR receptor-like serine...    309   2e-95    
ref|XP_010274433.1|  PREDICTED: probable LRR receptor-like serine...    310   3e-95    
ref|XP_010108365.1|  putative LRR receptor-like serine/threonine-...    309   3e-95    
ref|NP_179973.2|  leucine-rich repeat protein kinase family protein     308   3e-95    
gb|ADW65656.1|  somatic embryogenesis receptor kinase 1                 299   4e-95    
ref|XP_010274434.1|  PREDICTED: probable LRR receptor-like serine...    309   4e-95    
ref|XP_010274435.1|  PREDICTED: probable LRR receptor-like serine...    309   5e-95    
gb|EYU37129.1|  hypothetical protein MIMGU_mgv1a003448mg                306   5e-95    
ref|XP_010274432.1|  PREDICTED: probable LRR receptor-like serine...    309   5e-95    
ref|XP_010274431.1|  PREDICTED: probable LRR receptor-like serine...    310   5e-95    
ref|XP_003518230.1|  PREDICTED: probable LRR receptor-like serine...    308   6e-95    
gb|KFK32690.1|  hypothetical protein AALP_AA6G276300                    308   6e-95    
gb|ACZ56417.1|  somatic embryogenesis receptor-like kinase 1            307   7e-95    
gb|KHN30285.1|  Putative LRR receptor-like serine/threonine-prote...    308   8e-95    
ref|XP_007154851.1|  hypothetical protein PHAVU_003G152900g             307   8e-95    
gb|KCW74133.1|  hypothetical protein EUGRSUZ_E02764                     307   8e-95    
emb|CDX72249.1|  BnaC07g42710D                                          307   8e-95    
gb|AGS80343.1|  somatic embryogenesis receptor kinase 1                 307   9e-95    
gb|ACY91853.1|  somatic embryogenesis receptor-like kinase 1            307   9e-95    
ref|XP_009137929.1|  PREDICTED: probable LRR receptor-like serine...    307   9e-95    
ref|XP_002880534.1|  leucine-rich repeat family protein                 307   1e-94    
ref|XP_004242632.1|  PREDICTED: probable LRR receptor-like serine...    307   1e-94    
ref|XP_006343723.1|  PREDICTED: probable LRR receptor-like serine...    307   1e-94    
gb|AET86626.2|  somatic embryogenesis receptor kinase 1                 297   1e-94    
ref|XP_006282454.1|  hypothetical protein CARUB_v10004330mg             307   1e-94    
ref|XP_010472390.1|  PREDICTED: probable LRR receptor-like serine...    307   1e-94    
gb|KJB53859.1|  hypothetical protein B456_009G008400                    306   1e-94    
ref|XP_010417134.1|  PREDICTED: probable LRR receptor-like serine...    306   2e-94    
ref|XP_011079354.1|  PREDICTED: probable LRR receptor-like serine...    306   2e-94    
gb|KDO83985.1|  hypothetical protein CISIN_1g007020mg                   301   2e-94    
ref|XP_007213585.1|  hypothetical protein PRUPE_ppa003046mg             305   2e-94    
ref|XP_001767678.1|  predicted protein                                  305   2e-94    
ref|XP_002867342.1|  predicted protein                                  306   2e-94    
ref|XP_010429349.1|  PREDICTED: probable LRR receptor-like serine...    306   3e-94    
ref|XP_009105842.1|  PREDICTED: somatic embryogenesis receptor ki...    306   3e-94    
emb|CDX72833.1|  BnaC06g32810D                                          306   3e-94    
gb|AFO67896.1|  leucine-rich repeat receptor-like kinase                306   3e-94    
ref|XP_009591346.1|  PREDICTED: somatic embryogenesis receptor ki...    299   3e-94    
emb|CDY65182.1|  BnaC04g56200D                                          306   3e-94    
ref|XP_001759122.1|  predicted protein                                  305   3e-94    
emb|CDY39685.1|  BnaA04g14020D                                          306   3e-94    
ref|XP_010438169.1|  PREDICTED: probable LRR receptor-like serine...    306   4e-94    
emb|CAB79770.1|  receptor-like kinase homolog                           304   4e-94    
ref|XP_010530140.1|  PREDICTED: somatic embryogenesis receptor ki...    305   4e-94    
ref|XP_010447704.1|  PREDICTED: probable LRR receptor-like serine...    306   5e-94    
ref|XP_007020221.1|  Somatic embryogenesis receptor-like kinase 1...    300   5e-94    
ref|XP_004507770.1|  PREDICTED: probable LRR receptor-like serine...    305   5e-94    
gb|AIA99455.1|  putative somatic embryogenesis receptor kinase          305   5e-94    
ref|XP_009140509.1|  PREDICTED: probable LRR receptor-like serine...    305   5e-94    
gb|KDP21117.1|  hypothetical protein JCGZ_21588                         303   5e-94    
ref|XP_002976976.1|  hypothetical protein SELMODRAFT_443356             305   6e-94    
ref|XP_002980714.1|  hypothetical protein SELMODRAFT_444590             305   6e-94    
ref|XP_010432978.1|  PREDICTED: probable LRR receptor-like serine...    305   6e-94    
gb|EMS66270.1|  Somatic embryogenesis receptor kinase 1                 300   6e-94    
ref|XP_010548642.1|  PREDICTED: probable LRR receptor-like serine...    305   8e-94    
ref|XP_012075205.1|  PREDICTED: somatic embryogenesis receptor ki...    304   1e-93    
ref|XP_008366037.1|  PREDICTED: probable LRR receptor-like serine...    292   1e-93    
gb|ACM89547.1|  somatic embryogenesis receptor kinase                   298   1e-93    
ref|XP_006404888.1|  hypothetical protein EUTSA_v10000081mg             304   2e-93    
ref|NP_194781.2|  senescence-associated receptor-like kinase            304   2e-93    
ref|XP_006295562.1|  hypothetical protein CARUB_v10024669mg             304   2e-93    
gb|KHG18235.1|  hypothetical protein F383_07279                         304   2e-93    
ref|XP_009104891.1|  PREDICTED: somatic embryogenesis receptor ki...    303   2e-93    
ref|XP_012091804.1|  PREDICTED: probable LRR receptor-like serine...    303   2e-93    
emb|CDY36679.1|  BnaCnng07810D                                          303   2e-93    
ref|XP_010543171.1|  PREDICTED: somatic embryogenesis receptor ki...    303   3e-93    
gb|EPS63998.1|  somatic embryogenesis receptor-like kinase 1            303   3e-93    
ref|XP_002270847.1|  PREDICTED: somatic embryogenesis receptor ki...    303   3e-93    
emb|CDP01160.1|  unnamed protein product                                303   3e-93    
ref|NP_001237909.1|  somatic embryogenesis receptor-like kinase-l...    300   4e-93    
dbj|BAD32780.1|  somatic embryogenesis receptor kinase 1                303   4e-93    
gb|KFK29623.1|  hypothetical protein AALP_AA7G158000                    303   4e-93    
ref|XP_004149147.1|  PREDICTED: somatic embryogenesis receptor ki...    303   5e-93    
gb|AEC46975.1|  somatic embryogenesis receptor-like kinase              303   5e-93    
gb|EEC82980.1|  hypothetical protein OsI_28003                          302   5e-93    
ref|XP_010525766.1|  PREDICTED: probable LRR receptor-like serine...    303   5e-93    
ref|NP_001061108.1|  Os08g0174700                                       302   6e-93    
ref|XP_006300879.1|  hypothetical protein CARUB_v10019969mg             302   6e-93    
gb|AAF43236.1|AC012654_20  Contains similarity to the somatic emb...    301   6e-93    
ref|XP_011074139.1|  PREDICTED: somatic embryogenesis receptor ki...    302   6e-93    
ref|XP_010415894.1|  PREDICTED: somatic embryogenesis receptor ki...    302   6e-93    
ref|NP_001275800.1|  somatic embryogenesis receptor-like kinase p...    302   6e-93    
ref|XP_010471192.1|  PREDICTED: somatic embryogenesis receptor ki...    302   7e-93    
ref|XP_010245869.1|  PREDICTED: somatic embryogenesis receptor ki...    302   7e-93    
ref|XP_010063799.1|  PREDICTED: somatic embryogenesis receptor ki...    301   7e-93    
ref|XP_010428030.1|  PREDICTED: somatic embryogenesis receptor ki...    302   8e-93    
ref|NP_177328.1|  somatic embryogenesis receptor kinase 1               302   8e-93    
ref|XP_002276414.2|  PREDICTED: somatic embryogenesis receptor ki...    302   8e-93    
ref|XP_007201734.1|  hypothetical protein PRUPE_ppa002871mg             302   8e-93    
gb|KJB69704.1|  hypothetical protein B456_011G038400                    301   9e-93    
ref|XP_008225339.1|  PREDICTED: probable LRR receptor-like serine...    302   9e-93    
gb|AAR26543.1|  benzothiadiazole-induced somatic embryogenesis re...    302   9e-93    
gb|AAK82463.1|  At1g71830/F14O23_24                                     302   9e-93    
ref|XP_010063800.1|  PREDICTED: somatic embryogenesis receptor ki...    300   9e-93    
ref|XP_002310599.2|  hypothetical protein POPTR_0007s06460g             301   1e-92    
gb|KJB69703.1|  hypothetical protein B456_011G038400                    301   1e-92    
gb|AAT64032.1|  putative leucine-rich repeat transmembrane protein      301   1e-92    
gb|KJB76635.1|  hypothetical protein B456_012G097800                    300   1e-92    
ref|XP_008453749.1|  PREDICTED: somatic embryogenesis receptor ki...    301   1e-92    
ref|XP_003556185.1|  PREDICTED: somatic embryogenesis receptor ki...    301   1e-92    
ref|XP_008439728.1|  PREDICTED: probable LRR receptor-like serine...    301   1e-92    
gb|AFQ07900.1|  somatic embryogenesis receptor-like kinase              290   1e-92    
ref|XP_008245841.1|  PREDICTED: somatic embryogenesis receptor ki...    302   1e-92    
gb|ACD56664.1|  putative leucine-rich repeat transmembrane protein      301   1e-92    
gb|KHG07759.1|  hypothetical protein F383_34545                         301   1e-92    
ref|XP_004496399.1|  PREDICTED: somatic embryogenesis receptor ki...    301   1e-92    
gb|AEP14552.1|  somatic embryogenesis receptor kinase 2                 300   1e-92    
ref|XP_008464350.1|  PREDICTED: somatic embryogenesis receptor ki...    300   1e-92    
gb|KJB69702.1|  hypothetical protein B456_011G038400                    301   1e-92    
ref|XP_002454054.1|  hypothetical protein SORBIDRAFT_04g023810          301   2e-92    
ref|XP_011656471.1|  PREDICTED: somatic embryogenesis receptor ki...    300   2e-92    
ref|XP_004295585.1|  PREDICTED: probable LRR receptor-like serine...    301   2e-92    
ref|XP_010100747.1|  putative LRR receptor-like serine/threonine-...    300   2e-92    
emb|CAM31941.1|  hypothetical protein                                   300   2e-92    
gb|KFK41603.1|  hypothetical protein AALP_AA2G149900                    301   2e-92    
gb|AAT64017.1|  putative leucine-rich repeat transmembrane protein      301   2e-92    
gb|KEH36623.1|  LRR receptor-like kinase                                301   2e-92    
gb|ABO14173.1|  somatic embryogenesis receptor-like kinase 1            301   2e-92    
ref|XP_007020220.1|  Somatic embryogenesis receptor-like kinase 2...    301   2e-92    
gb|AHI59639.1|  somatic embryogenesis receptor-like kinase              301   2e-92    
ref|XP_006390738.1|  hypothetical protein EUTSA_v10019435mg             300   2e-92    



>dbj|BAD18097.1| putative serine/threonine protein kinase [Ipomoea batatas]
Length=232

 Score =   456 bits (1174),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 221/223 (99%), Positives = 222/223 (99%), Gaps = 0/223 (0%)
 Frame = -1

Query  1097  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVS  918
             RKRIALG ARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVS
Sbjct  10    RKRIALGTARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVS  69

Query  917   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVK  738
             TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVK
Sbjct  70    TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVK  129

Query  737   TLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAE  558
             TLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAE
Sbjct  130   TLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAE  189

Query  557   KWEASQRNDTPRFRTHENTPQRYSDFIEESSLIVEAMELSGPR  429
             KWEASQRNDTPR+RTHENTPQRYSDFIEESSLIVEAMELSGPR
Sbjct  190   KWEASQRNDTPRYRTHENTPQRYSDFIEESSLIVEAMELSGPR  232



>dbj|BAD18102.1| leucine-rich repeat receptor-like kinase [Ipomoea batatas]
Length=627

 Score =   457 bits (1175),  Expect = 8e-153, Method: Compositional matrix adjust.
 Identities = 221/223 (99%), Positives = 222/223 (99%), Gaps = 0/223 (0%)
 Frame = -1

Query  1097  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVS  918
             RKRIALG ARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVS
Sbjct  405   RKRIALGTARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVS  464

Query  917   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVK  738
             TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVK
Sbjct  465   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVK  524

Query  737   TLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAE  558
             TLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAE
Sbjct  525   TLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAE  584

Query  557   KWEASQRNDTPRFRTHENTPQRYSDFIEESSLIVEAMELSGPR  429
             KWEASQRNDTPR+RTHENTPQRYSDFIEESSLIVEAMELSGPR
Sbjct  585   KWEASQRNDTPRYRTHENTPQRYSDFIEESSLIVEAMELSGPR  627



>emb|CAN75190.1| hypothetical protein VITISV_035381 [Vitis vinifera]
Length=608

 Score =   432 bits (1111),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 205/223 (92%), Positives = 217/223 (97%), Gaps = 0/223 (0%)
 Frame = -1

Query  1097  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVS  918
             RKRIALG ARGL+YLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHV+
Sbjct  386   RKRIALGTARGLLYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVT  445

Query  917   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVK  738
             TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKA+DFGR ANQKGV+LDWVK
Sbjct  446   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKALDFGRAANQKGVMLDWVK  505

Query  737   TLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAE  558
              LHQEGKLNLMVDKDLKNNFDRVELEEMV+VALLCTQFNPSHRPKMSE+LRMLEGDGLAE
Sbjct  506   KLHQEGKLNLMVDKDLKNNFDRVELEEMVKVALLCTQFNPSHRPKMSEILRMLEGDGLAE  565

Query  557   KWEASQRNDTPRFRTHENTPQRYSDFIEESSLIVEAMELSGPR  429
             KWEASQ+ +TPRFR+ EN PQRYSD+IEESSL++EAMELSGPR
Sbjct  566   KWEASQKVETPRFRSCENPPQRYSDYIEESSLVIEAMELSGPR  608



>ref|XP_010651607.1| PREDICTED: protein NSP-INTERACTING KINASE 3 [Vitis vinifera]
 emb|CBI28568.3| unnamed protein product [Vitis vinifera]
Length=626

 Score =   432 bits (1111),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 205/223 (92%), Positives = 217/223 (97%), Gaps = 0/223 (0%)
 Frame = -1

Query  1097  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVS  918
             RKRIALG ARGL+YLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHV+
Sbjct  404   RKRIALGTARGLLYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVT  463

Query  917   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVK  738
             TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKA+DFGR ANQKGV+LDWVK
Sbjct  464   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKALDFGRAANQKGVMLDWVK  523

Query  737   TLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAE  558
              LHQEGKLNLMVDKDLKNNFDRVELEEMV+VALLCTQFNPSHRPKMSE+LRMLEGDGLAE
Sbjct  524   KLHQEGKLNLMVDKDLKNNFDRVELEEMVKVALLCTQFNPSHRPKMSEILRMLEGDGLAE  583

Query  557   KWEASQRNDTPRFRTHENTPQRYSDFIEESSLIVEAMELSGPR  429
             KWEASQ+ +TPRFR+ EN PQRYSD+IEESSL++EAMELSGPR
Sbjct  584   KWEASQKVETPRFRSCENPPQRYSDYIEESSLVIEAMELSGPR  626



>ref|XP_011086598.1| PREDICTED: protein NSP-INTERACTING KINASE 3 [Sesamum indicum]
Length=625

 Score =   427 bits (1099),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 206/223 (92%), Positives = 214/223 (96%), Gaps = 0/223 (0%)
 Frame = -1

Query  1097  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVS  918
             RK IALG ARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHR+SHV+
Sbjct  403   RKSIALGTARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRDSHVT  462

Query  917   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVK  738
             TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRG NQKGVILDWVK
Sbjct  463   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGTNQKGVILDWVK  522

Query  737   TLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAE  558
              LHQEGKLNLMVDKDLKN+FDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAE
Sbjct  523   KLHQEGKLNLMVDKDLKNDFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAE  582

Query  557   KWEASQRNDTPRFRTHENTPQRYSDFIEESSLIVEAMELSGPR  429
             KWE SQ  +TPR+R+ E+ PQRYSDFIEESSL+VEAMELSGPR
Sbjct  583   KWEQSQNIETPRYRSFEHPPQRYSDFIEESSLVVEAMELSGPR  625



>ref|XP_009626005.1| PREDICTED: protein NSP-INTERACTING KINASE 3 [Nicotiana tomentosiformis]
Length=626

 Score =   427 bits (1098),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 204/223 (91%), Positives = 217/223 (97%), Gaps = 0/223 (0%)
 Frame = -1

Query  1097  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVS  918
             RK IALG ARGLVYLHEQCDPKIIHRDVKAANILLDE+FEAVVGDFGLAKLLDHR+SHV+
Sbjct  404   RKNIALGTARGLVYLHEQCDPKIIHRDVKAANILLDEEFEAVVGDFGLAKLLDHRDSHVT  463

Query  917   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVK  738
             TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGV+LDWVK
Sbjct  464   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVMLDWVK  523

Query  737   TLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAE  558
             TLHQE KLNLMVDKDLKN+FDR+ELEEMVQVALLCT F+PSHRPKMSEVLRMLEGDGLAE
Sbjct  524   TLHQEKKLNLMVDKDLKNSFDRIELEEMVQVALLCTHFSPSHRPKMSEVLRMLEGDGLAE  583

Query  557   KWEASQRNDTPRFRTHENTPQRYSDFIEESSLIVEAMELSGPR  429
             KWEASQ+ +TPR+RT ENTP+RYSD+IEESSL+VEAMELSGPR
Sbjct  584   KWEASQKVETPRYRTSENTPKRYSDYIEESSLVVEAMELSGPR  626



>ref|XP_008444353.1| PREDICTED: protein NSP-INTERACTING KINASE 3 isoform X2 [Cucumis 
melo]
Length=609

 Score =   426 bits (1096),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 206/223 (92%), Positives = 214/223 (96%), Gaps = 0/223 (0%)
 Frame = -1

Query  1097  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVS  918
             RKRIALG ARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHR+SHV+
Sbjct  387   RKRIALGTARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRDSHVT  446

Query  917   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVK  738
             TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKA+DFGRGANQKGV+LDWVK
Sbjct  447   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKALDFGRGANQKGVMLDWVK  506

Query  737   TLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAE  558
              LHQEGKLN+MVDKDLK NFDRVELEEMVQVALLCTQFNPSHRPKMSEVL+MLEGDGLAE
Sbjct  507   KLHQEGKLNMMVDKDLKGNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLKMLEGDGLAE  566

Query  557   KWEASQRNDTPRFRTHENTPQRYSDFIEESSLIVEAMELSGPR  429
             KWEASQ  +TPR R  EN PQRYSD+IEESSLIVEAMELSGPR
Sbjct  567   KWEASQHIETPRCRPCENPPQRYSDYIEESSLIVEAMELSGPR  609



>ref|XP_004142972.1| PREDICTED: protein NSP-INTERACTING KINASE 3 isoform X1 [Cucumis 
sativus]
 gb|KGN62304.1| hypothetical protein Csa_2G348900 [Cucumis sativus]
Length=621

 Score =   427 bits (1097),  Expect = 4e-141, Method: Compositional matrix adjust.
 Identities = 206/223 (92%), Positives = 214/223 (96%), Gaps = 0/223 (0%)
 Frame = -1

Query  1097  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVS  918
             RKRIALG ARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHR+SHV+
Sbjct  399   RKRIALGTARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRDSHVT  458

Query  917   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVK  738
             TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKA+DFGRGANQKGV+LDWVK
Sbjct  459   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKALDFGRGANQKGVMLDWVK  518

Query  737   TLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAE  558
              LHQEGKLN+MVDKDLK NFDRVELEEMVQVALLCTQFNPSHRPKMSEVL+MLEGDGLAE
Sbjct  519   KLHQEGKLNMMVDKDLKGNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLKMLEGDGLAE  578

Query  557   KWEASQRNDTPRFRTHENTPQRYSDFIEESSLIVEAMELSGPR  429
             KWEASQ  +TPR R  EN PQRYSD+IEESSLIVEAMELSGPR
Sbjct  579   KWEASQHIETPRCRPCENPPQRYSDYIEESSLIVEAMELSGPR  621



>ref|XP_011649490.1| PREDICTED: protein NSP-INTERACTING KINASE 3 isoform X2 [Cucumis 
sativus]
Length=609

 Score =   426 bits (1095),  Expect = 5e-141, Method: Compositional matrix adjust.
 Identities = 206/223 (92%), Positives = 214/223 (96%), Gaps = 0/223 (0%)
 Frame = -1

Query  1097  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVS  918
             RKRIALG ARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHR+SHV+
Sbjct  387   RKRIALGTARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRDSHVT  446

Query  917   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVK  738
             TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKA+DFGRGANQKGV+LDWVK
Sbjct  447   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKALDFGRGANQKGVMLDWVK  506

Query  737   TLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAE  558
              LHQEGKLN+MVDKDLK NFDRVELEEMVQVALLCTQFNPSHRPKMSEVL+MLEGDGLAE
Sbjct  507   KLHQEGKLNMMVDKDLKGNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLKMLEGDGLAE  566

Query  557   KWEASQRNDTPRFRTHENTPQRYSDFIEESSLIVEAMELSGPR  429
             KWEASQ  +TPR R  EN PQRYSD+IEESSLIVEAMELSGPR
Sbjct  567   KWEASQHIETPRCRPCENPPQRYSDYIEESSLIVEAMELSGPR  609



>ref|XP_008444352.1| PREDICTED: protein NSP-INTERACTING KINASE 3 isoform X1 [Cucumis 
melo]
Length=621

 Score =   426 bits (1096),  Expect = 6e-141, Method: Compositional matrix adjust.
 Identities = 206/223 (92%), Positives = 214/223 (96%), Gaps = 0/223 (0%)
 Frame = -1

Query  1097  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVS  918
             RKRIALG ARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHR+SHV+
Sbjct  399   RKRIALGTARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRDSHVT  458

Query  917   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVK  738
             TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKA+DFGRGANQKGV+LDWVK
Sbjct  459   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKALDFGRGANQKGVMLDWVK  518

Query  737   TLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAE  558
              LHQEGKLN+MVDKDLK NFDRVELEEMVQVALLCTQFNPSHRPKMSEVL+MLEGDGLAE
Sbjct  519   KLHQEGKLNMMVDKDLKGNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLKMLEGDGLAE  578

Query  557   KWEASQRNDTPRFRTHENTPQRYSDFIEESSLIVEAMELSGPR  429
             KWEASQ  +TPR R  EN PQRYSD+IEESSLIVEAMELSGPR
Sbjct  579   KWEASQHIETPRCRPCENPPQRYSDYIEESSLIVEAMELSGPR  621



>ref|XP_011045286.1| PREDICTED: protein NSP-INTERACTING KINASE 3 [Populus euphratica]
Length=452

 Score =   420 bits (1080),  Expect = 7e-141, Method: Compositional matrix adjust.
 Identities = 200/223 (90%), Positives = 214/223 (96%), Gaps = 0/223 (0%)
 Frame = -1

Query  1097  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVS  918
             RKRIALG ARGL+YLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHR+SHV+
Sbjct  230   RKRIALGTARGLLYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRDSHVT  289

Query  917   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVK  738
             TAVRGT+GHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKA+DFGR ANQKGV+LDWVK
Sbjct  290   TAVRGTIGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKALDFGRAANQKGVMLDWVK  349

Query  737   TLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAE  558
              LH + KLNLMVDKDL+ NFDR+ELEEMVQVALLCTQFNPSHRPKMSEVL+MLEGDGLAE
Sbjct  350   KLHHDRKLNLMVDKDLRGNFDRIELEEMVQVALLCTQFNPSHRPKMSEVLKMLEGDGLAE  409

Query  557   KWEASQRNDTPRFRTHENTPQRYSDFIEESSLIVEAMELSGPR  429
             KWEASQR +TPRFR+ EN PQRYSD+IEESSL+VEAMELSGPR
Sbjct  410   KWEASQRVETPRFRSCENPPQRYSDYIEESSLVVEAMELSGPR  452



>ref|XP_007044708.1| Nsp-interacting kinase 3 isoform 1 [Theobroma cacao]
 gb|EOY00540.1| Nsp-interacting kinase 3 isoform 1 [Theobroma cacao]
Length=626

 Score =   426 bits (1095),  Expect = 8e-141, Method: Compositional matrix adjust.
 Identities = 202/223 (91%), Positives = 216/223 (97%), Gaps = 0/223 (0%)
 Frame = -1

Query  1097  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVS  918
             RKRIALG ARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHR+SHV+
Sbjct  404   RKRIALGTARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRDSHVT  463

Query  917   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVK  738
             TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKA+DFGR ANQKGV+LDWVK
Sbjct  464   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKALDFGRAANQKGVMLDWVK  523

Query  737   TLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAE  558
              LHQEGKL+L+VDKDLK NFDR+ELEEMVQVALLCTQFNPSHRP+MSEVLRMLEGDGLAE
Sbjct  524   KLHQEGKLSLLVDKDLKGNFDRIELEEMVQVALLCTQFNPSHRPRMSEVLRMLEGDGLAE  583

Query  557   KWEASQRNDTPRFRTHENTPQRYSDFIEESSLIVEAMELSGPR  429
             KWEASQ+ +TPRFR+ +N PQRYSDFIEESSL++EAMELSGPR
Sbjct  584   KWEASQKVETPRFRSCDNPPQRYSDFIEESSLVIEAMELSGPR  626



>ref|XP_009800027.1| PREDICTED: protein NSP-INTERACTING KINASE 3 [Nicotiana sylvestris]
Length=626

 Score =   426 bits (1094),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 203/223 (91%), Positives = 216/223 (97%), Gaps = 0/223 (0%)
 Frame = -1

Query  1097  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVS  918
             RK IALG ARGLVYLHEQCDPKIIHRDVKAANILLDE+FEAVVGDFGLAKLLDHR+SHV+
Sbjct  404   RKNIALGTARGLVYLHEQCDPKIIHRDVKAANILLDEEFEAVVGDFGLAKLLDHRDSHVT  463

Query  917   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVK  738
             TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGV+LDWVK
Sbjct  464   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVMLDWVK  523

Query  737   TLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAE  558
              LHQE KLNLMVDKDLKN+FDR+ELEEMVQVALLCT F+PSHRPKMSEVLRMLEGDGLAE
Sbjct  524   KLHQEKKLNLMVDKDLKNSFDRIELEEMVQVALLCTHFSPSHRPKMSEVLRMLEGDGLAE  583

Query  557   KWEASQRNDTPRFRTHENTPQRYSDFIEESSLIVEAMELSGPR  429
             KWEASQ+ +TPR+RT ENTP+RYSD+IEESSL+VEAMELSGPR
Sbjct  584   KWEASQKVETPRYRTSENTPKRYSDYIEESSLVVEAMELSGPR  626



>ref|XP_002525400.1| BRASSINOSTEROID INSENSITIVE 1-associated receptor kinase 1 precursor, 
putative [Ricinus communis]
 gb|EEF37038.1| BRASSINOSTEROID INSENSITIVE 1-associated receptor kinase 1 precursor, 
putative [Ricinus communis]
Length=618

 Score =   425 bits (1092),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 203/223 (91%), Positives = 216/223 (97%), Gaps = 0/223 (0%)
 Frame = -1

Query  1097  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVS  918
             RK+IALG ARGL+YLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHR+SHV+
Sbjct  396   RKKIALGTARGLLYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRDSHVT  455

Query  917   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVK  738
             TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKA+DFGR ANQKGV+LDWVK
Sbjct  456   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKALDFGRAANQKGVMLDWVK  515

Query  737   TLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAE  558
              LHQEGKLNL+VDKDLK NFDRVELEEMVQVALLCTQFNPSHRPKMSEVL+MLEGDGLAE
Sbjct  516   KLHQEGKLNLLVDKDLKGNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLKMLEGDGLAE  575

Query  557   KWEASQRNDTPRFRTHENTPQRYSDFIEESSLIVEAMELSGPR  429
             KWEASQ+ +TPRFR+ E+ PQRYSDFIEESSL+VEAMELSGPR
Sbjct  576   KWEASQKIETPRFRSCESHPQRYSDFIEESSLVVEAMELSGPR  618



>ref|XP_004297396.1| PREDICTED: protein NSP-INTERACTING KINASE 3 isoform X1 [Fragaria 
vesca subsp. vesca]
Length=629

 Score =   424 bits (1091),  Expect = 4e-140, Method: Compositional matrix adjust.
 Identities = 204/223 (91%), Positives = 214/223 (96%), Gaps = 0/223 (0%)
 Frame = -1

Query  1097  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVS  918
             RKRIALG ARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHV+
Sbjct  407   RKRIALGTARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVT  466

Query  917   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVK  738
             TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKA+DFGR ANQKGV+LDWVK
Sbjct  467   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKALDFGRAANQKGVMLDWVK  526

Query  737   TLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAE  558
              LHQEGKLNLMVDKDLK NFDR+ELEEMVQVALLCTQFNP HRPKMSEVL+MLEGDGLAE
Sbjct  527   KLHQEGKLNLMVDKDLKGNFDRIELEEMVQVALLCTQFNPLHRPKMSEVLKMLEGDGLAE  586

Query  557   KWEASQRNDTPRFRTHENTPQRYSDFIEESSLIVEAMELSGPR  429
             KWEASQ  +TPRFR+ E+ PQRYSDFI+ESSL+VEAMELSGPR
Sbjct  587   KWEASQGVETPRFRSCEHPPQRYSDFIDESSLVVEAMELSGPR  629



>ref|XP_012085434.1| PREDICTED: protein NSP-INTERACTING KINASE 3 [Jatropha curcas]
 gb|KDP26621.1| hypothetical protein JCGZ_17779 [Jatropha curcas]
Length=626

 Score =   424 bits (1090),  Expect = 5e-140, Method: Compositional matrix adjust.
 Identities = 202/223 (91%), Positives = 215/223 (96%), Gaps = 0/223 (0%)
 Frame = -1

Query  1097  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVS  918
             RK+IALG ARGL+YLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHR+SHV+
Sbjct  404   RKKIALGTARGLLYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRDSHVT  463

Query  917   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVK  738
             TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKA+DFGR ANQKGV+LDWVK
Sbjct  464   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKALDFGRAANQKGVMLDWVK  523

Query  737   TLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAE  558
              LHQEGKLNL+VDKDLK NFDR+ELEEMVQVALLCTQFNPSHRPKMSEVL+MLEGDGLAE
Sbjct  524   KLHQEGKLNLLVDKDLKGNFDRIELEEMVQVALLCTQFNPSHRPKMSEVLKMLEGDGLAE  583

Query  557   KWEASQRNDTPRFRTHENTPQRYSDFIEESSLIVEAMELSGPR  429
             KWEASQ+ +TPR R+ EN PQRYSDFIEESSL+VEAMELSGPR
Sbjct  584   KWEASQKIETPRLRSCENHPQRYSDFIEESSLVVEAMELSGPR  626



>ref|XP_011463143.1| PREDICTED: protein NSP-INTERACTING KINASE 3 isoform X2 [Fragaria 
vesca subsp. vesca]
Length=626

 Score =   424 bits (1090),  Expect = 5e-140, Method: Compositional matrix adjust.
 Identities = 204/223 (91%), Positives = 214/223 (96%), Gaps = 0/223 (0%)
 Frame = -1

Query  1097  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVS  918
             RKRIALG ARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHV+
Sbjct  404   RKRIALGTARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVT  463

Query  917   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVK  738
             TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKA+DFGR ANQKGV+LDWVK
Sbjct  464   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKALDFGRAANQKGVMLDWVK  523

Query  737   TLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAE  558
              LHQEGKLNLMVDKDLK NFDR+ELEEMVQVALLCTQFNP HRPKMSEVL+MLEGDGLAE
Sbjct  524   KLHQEGKLNLMVDKDLKGNFDRIELEEMVQVALLCTQFNPLHRPKMSEVLKMLEGDGLAE  583

Query  557   KWEASQRNDTPRFRTHENTPQRYSDFIEESSLIVEAMELSGPR  429
             KWEASQ  +TPRFR+ E+ PQRYSDFI+ESSL+VEAMELSGPR
Sbjct  584   KWEASQGVETPRFRSCEHPPQRYSDFIDESSLVVEAMELSGPR  626



>ref|XP_007044709.1| Nsp-interacting kinase 3 isoform 2 [Theobroma cacao]
 gb|EOY00541.1| Nsp-interacting kinase 3 isoform 2 [Theobroma cacao]
Length=451

 Score =   417 bits (1073),  Expect = 6e-140, Method: Compositional matrix adjust.
 Identities = 202/226 (89%), Positives = 216/226 (96%), Gaps = 3/226 (1%)
 Frame = -1

Query  1097  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVS  918
             RKRIALG ARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHR+SHV+
Sbjct  226   RKRIALGTARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRDSHVT  285

Query  917   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDW--  744
             TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKA+DFGR ANQKGV+LDW  
Sbjct  286   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKALDFGRAANQKGVMLDWVL  345

Query  743   -VKTLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDG  567
              VK LHQEGKL+L+VDKDLK NFDR+ELEEMVQVALLCTQFNPSHRP+MSEVLRMLEGDG
Sbjct  346   SVKKLHQEGKLSLLVDKDLKGNFDRIELEEMVQVALLCTQFNPSHRPRMSEVLRMLEGDG  405

Query  566   LAEKWEASQRNDTPRFRTHENTPQRYSDFIEESSLIVEAMELSGPR  429
             LAEKWEASQ+ +TPRFR+ +N PQRYSDFIEESSL++EAMELSGPR
Sbjct  406   LAEKWEASQKVETPRFRSCDNPPQRYSDFIEESSLVIEAMELSGPR  451



>ref|XP_002315684.2| hypothetical protein POPTR_0010s05300g [Populus trichocarpa]
 gb|EEF01855.2| hypothetical protein POPTR_0010s05300g [Populus trichocarpa]
Length=628

 Score =   424 bits (1089),  Expect = 8e-140, Method: Compositional matrix adjust.
 Identities = 201/223 (90%), Positives = 214/223 (96%), Gaps = 0/223 (0%)
 Frame = -1

Query  1097  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVS  918
             RKRIALG ARGL+YLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHR+SHV+
Sbjct  406   RKRIALGTARGLLYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRDSHVT  465

Query  917   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVK  738
             TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLEL+TGQKA+DFGR ANQKGV+LDWVK
Sbjct  466   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELVTGQKALDFGRAANQKGVMLDWVK  525

Query  737   TLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAE  558
              LH E KLNLMVDKDL+ NFDR+ELEEMVQVALLCTQFNPSHRPKMSEVL+MLEGDGLAE
Sbjct  526   KLHHERKLNLMVDKDLRGNFDRIELEEMVQVALLCTQFNPSHRPKMSEVLKMLEGDGLAE  585

Query  557   KWEASQRNDTPRFRTHENTPQRYSDFIEESSLIVEAMELSGPR  429
             KWEASQR +TPRFR+ EN PQRYSD+IEESSL+VEAMELSGPR
Sbjct  586   KWEASQRVETPRFRSCENPPQRYSDYIEESSLVVEAMELSGPR  628



>ref|XP_006378225.1| hypothetical protein POPTR_0010s05300g [Populus trichocarpa]
 gb|ERP56022.1| hypothetical protein POPTR_0010s05300g [Populus trichocarpa]
Length=624

 Score =   423 bits (1088),  Expect = 8e-140, Method: Compositional matrix adjust.
 Identities = 201/223 (90%), Positives = 214/223 (96%), Gaps = 0/223 (0%)
 Frame = -1

Query  1097  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVS  918
             RKRIALG ARGL+YLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHR+SHV+
Sbjct  402   RKRIALGTARGLLYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRDSHVT  461

Query  917   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVK  738
             TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLEL+TGQKA+DFGR ANQKGV+LDWVK
Sbjct  462   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELVTGQKALDFGRAANQKGVMLDWVK  521

Query  737   TLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAE  558
              LH E KLNLMVDKDL+ NFDR+ELEEMVQVALLCTQFNPSHRPKMSEVL+MLEGDGLAE
Sbjct  522   KLHHERKLNLMVDKDLRGNFDRIELEEMVQVALLCTQFNPSHRPKMSEVLKMLEGDGLAE  581

Query  557   KWEASQRNDTPRFRTHENTPQRYSDFIEESSLIVEAMELSGPR  429
             KWEASQR +TPRFR+ EN PQRYSD+IEESSL+VEAMELSGPR
Sbjct  582   KWEASQRVETPRFRSCENPPQRYSDYIEESSLVVEAMELSGPR  624



>ref|XP_010100426.1| Protein NSP-INTERACTING KINASE 3 [Morus notabilis]
 gb|EXB82560.1| Protein NSP-INTERACTING KINASE 3 [Morus notabilis]
Length=637

 Score =   421 bits (1081),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 200/223 (90%), Positives = 213/223 (96%), Gaps = 0/223 (0%)
 Frame = -1

Query  1097  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVS  918
             RKRIALG ARGLVYLHE CDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHR+SHV+
Sbjct  415   RKRIALGTARGLVYLHESCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRDSHVT  474

Query  917   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVK  738
             TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKA+DFGR A QKGV+LDWVK
Sbjct  475   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKALDFGRQAKQKGVMLDWVK  534

Query  737   TLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAE  558
              LHQEGKLNLMVDKD+K NFDRVELEEMVQ+ALLCTQFNPSHRPKMS+VL+MLEGDGLAE
Sbjct  535   KLHQEGKLNLMVDKDIKGNFDRVELEEMVQIALLCTQFNPSHRPKMSDVLKMLEGDGLAE  594

Query  557   KWEASQRNDTPRFRTHENTPQRYSDFIEESSLIVEAMELSGPR  429
             KWEASQ+ +TPR R+ EN PQRYSDFIEESSL++EAMELSGPR
Sbjct  595   KWEASQKVETPRIRSCENPPQRYSDFIEESSLVIEAMELSGPR  637



>ref|XP_007222911.1| hypothetical protein PRUPE_ppa003642mg [Prunus persica]
 gb|EMJ24110.1| hypothetical protein PRUPE_ppa003642mg [Prunus persica]
Length=559

 Score =   417 bits (1073),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 201/223 (90%), Positives = 214/223 (96%), Gaps = 0/223 (0%)
 Frame = -1

Query  1097  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVS  918
             RKRIALG ARGLVYLHEQCDP+IIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHV+
Sbjct  337   RKRIALGTARGLVYLHEQCDPRIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVT  396

Query  917   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVK  738
             TAVRGTVGHIAPEYLSTGQSS+KTDVFGFGILLLELITGQKA+DFGR ANQKGV+LDWVK
Sbjct  397   TAVRGTVGHIAPEYLSTGQSSDKTDVFGFGILLLELITGQKALDFGRVANQKGVMLDWVK  456

Query  737   TLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAE  558
              LHQEGK+NLMVDKDLK NFDRVELEEMVQVALLCTQFNP HRPKMSEVL+MLEGDGLAE
Sbjct  457   KLHQEGKVNLMVDKDLKGNFDRVELEEMVQVALLCTQFNPLHRPKMSEVLKMLEGDGLAE  516

Query  557   KWEASQRNDTPRFRTHENTPQRYSDFIEESSLIVEAMELSGPR  429
             KWEASQ+ +TPRFR+ E+  QRYSDFIEESSL++EAMELSGPR
Sbjct  517   KWEASQKVETPRFRSCEHPRQRYSDFIEESSLVLEAMELSGPR  559



>ref|XP_002312685.1| leucine-rich repeat family protein [Populus trichocarpa]
 gb|EEE90052.1| leucine-rich repeat family protein [Populus trichocarpa]
Length=625

 Score =   420 bits (1079),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 199/223 (89%), Positives = 214/223 (96%), Gaps = 0/223 (0%)
 Frame = -1

Query  1097  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVS  918
             RKRIALG ARGL+YLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHR+SHV+
Sbjct  403   RKRIALGTARGLLYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRDSHVT  462

Query  917   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVK  738
             TAVRGTVGHI+PEYLSTGQSSEKTDVFGFGILLLELITGQKA+DFGR ANQKGV+LDWVK
Sbjct  463   TAVRGTVGHISPEYLSTGQSSEKTDVFGFGILLLELITGQKALDFGRAANQKGVMLDWVK  522

Query  737   TLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAE  558
              LHQ+ KLNLMVDKDL+  FDR+ELEEMVQVALLCTQFNPSHRPKMSEVL+MLEGDGLAE
Sbjct  523   KLHQDRKLNLMVDKDLRGKFDRIELEEMVQVALLCTQFNPSHRPKMSEVLKMLEGDGLAE  582

Query  557   KWEASQRNDTPRFRTHENTPQRYSDFIEESSLIVEAMELSGPR  429
             KWEASQ+ +TPRFR+ EN PQ+YSDFIEESSL+VEAMELSGPR
Sbjct  583   KWEASQKVETPRFRSCENPPQKYSDFIEESSLVVEAMELSGPR  625



>ref|XP_006380012.1| hypothetical protein POPTR_0008s19310g [Populus trichocarpa]
 gb|ERP57809.1| hypothetical protein POPTR_0008s19310g [Populus trichocarpa]
Length=622

 Score =   419 bits (1078),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 199/223 (89%), Positives = 214/223 (96%), Gaps = 0/223 (0%)
 Frame = -1

Query  1097  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVS  918
             RKRIALG ARGL+YLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHR+SHV+
Sbjct  400   RKRIALGTARGLLYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRDSHVT  459

Query  917   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVK  738
             TAVRGTVGHI+PEYLSTGQSSEKTDVFGFGILLLELITGQKA+DFGR ANQKGV+LDWVK
Sbjct  460   TAVRGTVGHISPEYLSTGQSSEKTDVFGFGILLLELITGQKALDFGRAANQKGVMLDWVK  519

Query  737   TLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAE  558
              LHQ+ KLNLMVDKDL+  FDR+ELEEMVQVALLCTQFNPSHRPKMSEVL+MLEGDGLAE
Sbjct  520   KLHQDRKLNLMVDKDLRGKFDRIELEEMVQVALLCTQFNPSHRPKMSEVLKMLEGDGLAE  579

Query  557   KWEASQRNDTPRFRTHENTPQRYSDFIEESSLIVEAMELSGPR  429
             KWEASQ+ +TPRFR+ EN PQ+YSDFIEESSL+VEAMELSGPR
Sbjct  580   KWEASQKVETPRFRSCENPPQKYSDFIEESSLVVEAMELSGPR  622



>ref|XP_007222912.1| hypothetical protein PRUPE_ppa003642mg [Prunus persica]
 gb|EMJ24111.1| hypothetical protein PRUPE_ppa003642mg [Prunus persica]
Length=560

 Score =   417 bits (1073),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 201/223 (90%), Positives = 214/223 (96%), Gaps = 0/223 (0%)
 Frame = -1

Query  1097  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVS  918
             RKRIALG ARGLVYLHEQCDP+IIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHV+
Sbjct  338   RKRIALGTARGLVYLHEQCDPRIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVT  397

Query  917   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVK  738
             TAVRGTVGHIAPEYLSTGQSS+KTDVFGFGILLLELITGQKA+DFGR ANQKGV+LDWVK
Sbjct  398   TAVRGTVGHIAPEYLSTGQSSDKTDVFGFGILLLELITGQKALDFGRVANQKGVMLDWVK  457

Query  737   TLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAE  558
              LHQEGK+NLMVDKDLK NFDRVELEEMVQVALLCTQFNP HRPKMSEVL+MLEGDGLAE
Sbjct  458   KLHQEGKVNLMVDKDLKGNFDRVELEEMVQVALLCTQFNPLHRPKMSEVLKMLEGDGLAE  517

Query  557   KWEASQRNDTPRFRTHENTPQRYSDFIEESSLIVEAMELSGPR  429
             KWEASQ+ +TPRFR+ E+  QRYSDFIEESSL++EAMELSGPR
Sbjct  518   KWEASQKVETPRFRSCEHPRQRYSDFIEESSLVLEAMELSGPR  560



>ref|XP_008221853.1| PREDICTED: protein NSP-INTERACTING KINASE 3 isoform X3 [Prunus 
mume]
Length=560

 Score =   417 bits (1072),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 201/223 (90%), Positives = 214/223 (96%), Gaps = 0/223 (0%)
 Frame = -1

Query  1097  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVS  918
             RKRIALG ARGLVYLHEQCDP+IIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHV+
Sbjct  338   RKRIALGTARGLVYLHEQCDPRIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVT  397

Query  917   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVK  738
             TAVRGTVGHIAPEYLSTGQSS+KTDVFGFGILLLELITGQKA+DFGR ANQKGV+LDWVK
Sbjct  398   TAVRGTVGHIAPEYLSTGQSSDKTDVFGFGILLLELITGQKALDFGRVANQKGVMLDWVK  457

Query  737   TLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAE  558
              LHQEGK+NLMVDKDLK NFDRVELEEMVQVALLCTQFNP HRPKMSEVL+MLEGDGLAE
Sbjct  458   KLHQEGKVNLMVDKDLKGNFDRVELEEMVQVALLCTQFNPLHRPKMSEVLKMLEGDGLAE  517

Query  557   KWEASQRNDTPRFRTHENTPQRYSDFIEESSLIVEAMELSGPR  429
             KWEASQ+ +TPRFR+ E+  QRYSDFIEESSL++EAMELSGPR
Sbjct  518   KWEASQKIETPRFRSCEHPRQRYSDFIEESSLVLEAMELSGPR  560



>ref|XP_006366916.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like [Solanum tuberosum]
Length=622

 Score =   419 bits (1076),  Expect = 6e-138, Method: Compositional matrix adjust.
 Identities = 200/223 (90%), Positives = 214/223 (96%), Gaps = 0/223 (0%)
 Frame = -1

Query  1097  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVS  918
             RK IA+G ARGLVYLHEQCDPKIIHRDVKAANILLDE+FEAVVGDFGLAKLLDHR+SHV+
Sbjct  400   RKGIAVGTARGLVYLHEQCDPKIIHRDVKAANILLDEEFEAVVGDFGLAKLLDHRDSHVT  459

Query  917   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVK  738
             TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRG NQKGV+LDWVK
Sbjct  460   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGVNQKGVMLDWVK  519

Query  737   TLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAE  558
              LH E KLNLMVDKDLKNNFDR+ELEEMVQVALLCTQF P++RPKMSEVLRMLEGDGLAE
Sbjct  520   KLHAEKKLNLMVDKDLKNNFDRIELEEMVQVALLCTQFIPTYRPKMSEVLRMLEGDGLAE  579

Query  557   KWEASQRNDTPRFRTHENTPQRYSDFIEESSLIVEAMELSGPR  429
             KWEASQ+ +TPR+RT ENTP+RYSD+IEESSL+VEAMELSGPR
Sbjct  580   KWEASQKVETPRYRTSENTPKRYSDYIEESSLVVEAMELSGPR  622



>ref|XP_010251173.1| PREDICTED: protein NSP-INTERACTING KINASE 3 [Nelumbo nucifera]
 ref|XP_010251174.1| PREDICTED: protein NSP-INTERACTING KINASE 3 [Nelumbo nucifera]
Length=628

 Score =   417 bits (1072),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 201/223 (90%), Positives = 211/223 (95%), Gaps = 0/223 (0%)
 Frame = -1

Query  1097  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVS  918
             RKRIALG ARGL+YLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHR+SHV+
Sbjct  406   RKRIALGTARGLLYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRDSHVT  465

Query  917   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVK  738
             TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKA+DFGR ANQKGV+LDWVK
Sbjct  466   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKALDFGRVANQKGVMLDWVK  525

Query  737   TLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAE  558
              LHQEGKLN MVDK L NNFDRVELEEMVQVALLCTQF+PS RPKM EVLRMLEGDGLAE
Sbjct  526   KLHQEGKLNQMVDKCLNNNFDRVELEEMVQVALLCTQFHPSQRPKMCEVLRMLEGDGLAE  585

Query  557   KWEASQRNDTPRFRTHENTPQRYSDFIEESSLIVEAMELSGPR  429
             KWEASQ+ +TPRFR+ E  PQRYSDFIEESSL+VEAMELSGPR
Sbjct  586   KWEASQKVETPRFRSSETMPQRYSDFIEESSLVVEAMELSGPR  628



>ref|XP_008221852.1| PREDICTED: protein NSP-INTERACTING KINASE 3 isoform X2 [Prunus 
mume]
Length=655

 Score =   418 bits (1074),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 201/223 (90%), Positives = 214/223 (96%), Gaps = 0/223 (0%)
 Frame = -1

Query  1097  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVS  918
             RKRIALG ARGLVYLHEQCDP+IIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHV+
Sbjct  433   RKRIALGTARGLVYLHEQCDPRIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVT  492

Query  917   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVK  738
             TAVRGTVGHIAPEYLSTGQSS+KTDVFGFGILLLELITGQKA+DFGR ANQKGV+LDWVK
Sbjct  493   TAVRGTVGHIAPEYLSTGQSSDKTDVFGFGILLLELITGQKALDFGRVANQKGVMLDWVK  552

Query  737   TLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAE  558
              LHQEGK+NLMVDKDLK NFDRVELEEMVQVALLCTQFNP HRPKMSEVL+MLEGDGLAE
Sbjct  553   KLHQEGKVNLMVDKDLKGNFDRVELEEMVQVALLCTQFNPLHRPKMSEVLKMLEGDGLAE  612

Query  557   KWEASQRNDTPRFRTHENTPQRYSDFIEESSLIVEAMELSGPR  429
             KWEASQ+ +TPRFR+ E+  QRYSDFIEESSL++EAMELSGPR
Sbjct  613   KWEASQKIETPRFRSCEHPRQRYSDFIEESSLVLEAMELSGPR  655



>ref|XP_008221850.1| PREDICTED: protein NSP-INTERACTING KINASE 3 isoform X1 [Prunus 
mume]
Length=656

 Score =   418 bits (1074),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 201/223 (90%), Positives = 214/223 (96%), Gaps = 0/223 (0%)
 Frame = -1

Query  1097  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVS  918
             RKRIALG ARGLVYLHEQCDP+IIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHV+
Sbjct  434   RKRIALGTARGLVYLHEQCDPRIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVT  493

Query  917   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVK  738
             TAVRGTVGHIAPEYLSTGQSS+KTDVFGFGILLLELITGQKA+DFGR ANQKGV+LDWVK
Sbjct  494   TAVRGTVGHIAPEYLSTGQSSDKTDVFGFGILLLELITGQKALDFGRVANQKGVMLDWVK  553

Query  737   TLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAE  558
              LHQEGK+NLMVDKDLK NFDRVELEEMVQVALLCTQFNP HRPKMSEVL+MLEGDGLAE
Sbjct  554   KLHQEGKVNLMVDKDLKGNFDRVELEEMVQVALLCTQFNPLHRPKMSEVLKMLEGDGLAE  613

Query  557   KWEASQRNDTPRFRTHENTPQRYSDFIEESSLIVEAMELSGPR  429
             KWEASQ+ +TPRFR+ E+  QRYSDFIEESSL++EAMELSGPR
Sbjct  614   KWEASQKIETPRFRSCEHPRQRYSDFIEESSLVLEAMELSGPR  656



>ref|XP_010248542.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X2 [Nelumbo 
nucifera]
Length=582

 Score =   414 bits (1065),  Expect = 6e-137, Method: Compositional matrix adjust.
 Identities = 198/223 (89%), Positives = 211/223 (95%), Gaps = 0/223 (0%)
 Frame = -1

Query  1097  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVS  918
             RK IALG ARGL+YLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHR+SHV+
Sbjct  360   RKSIALGTARGLLYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRDSHVT  419

Query  917   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVK  738
             TA+RGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKA+DFGR  +QKGV+LDWVK
Sbjct  420   TAIRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKALDFGRAVSQKGVMLDWVK  479

Query  737   TLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAE  558
              LHQEGKLNLMVDK L NNFDRVELEEMV+VALLCTQF+PS RPKMSEVLRMLEGDGLAE
Sbjct  480   KLHQEGKLNLMVDKCLNNNFDRVELEEMVKVALLCTQFHPSQRPKMSEVLRMLEGDGLAE  539

Query  557   KWEASQRNDTPRFRTHENTPQRYSDFIEESSLIVEAMELSGPR  429
             KWEASQR +TPR R+ EN PQRYSD+IEESSL+VEAMELSGPR
Sbjct  540   KWEASQRAETPRLRSSENLPQRYSDYIEESSLVVEAMELSGPR  582



>emb|CDP13189.1| unnamed protein product [Coffea canephora]
Length=624

 Score =   416 bits (1068),  Expect = 9e-137, Method: Compositional matrix adjust.
 Identities = 199/223 (89%), Positives = 212/223 (95%), Gaps = 0/223 (0%)
 Frame = -1

Query  1097  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVS  918
             RK+IALG ARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHV+
Sbjct  402   RKKIALGTARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVT  461

Query  917   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVK  738
             TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKA+DFGRGA QKG++LDWVK
Sbjct  462   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKALDFGRGAKQKGIMLDWVK  521

Query  737   TLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAE  558
              LHQ+ KL LMVDKDLKN++D VELEEMVQVALLCT FNPS+RPKMSEVLRMLEGDGLAE
Sbjct  522   KLHQDAKLELMVDKDLKNDYDNVELEEMVQVALLCTVFNPSNRPKMSEVLRMLEGDGLAE  581

Query  557   KWEASQRNDTPRFRTHENTPQRYSDFIEESSLIVEAMELSGPR  429
             KWEASQ  +TPRFRT E+ PQRYSD+IEESSL+VEAMELSGPR
Sbjct  582   KWEASQTIETPRFRTFEHIPQRYSDYIEESSLVVEAMELSGPR  624



>ref|XP_008389685.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X1 [Malus 
domestica]
 ref|XP_008389686.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X1 [Malus 
domestica]
Length=632

 Score =   416 bits (1068),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 201/223 (90%), Positives = 213/223 (96%), Gaps = 0/223 (0%)
 Frame = -1

Query  1097  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVS  918
             RKRIALG ARGLVYLHEQCDP+IIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHV+
Sbjct  410   RKRIALGTARGLVYLHEQCDPRIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVT  469

Query  917   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVK  738
             TAVRGTVGHIAPEYLSTGQSS+KTDVFGFGILLLELITGQKA+DFGR ANQKGV+LDWVK
Sbjct  470   TAVRGTVGHIAPEYLSTGQSSDKTDVFGFGILLLELITGQKALDFGRVANQKGVMLDWVK  529

Query  737   TLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAE  558
              LHQEGKLNLMVDKDLK N DRVELEEMVQVALLCTQFNP +RPKMSEVL+MLEGDGLAE
Sbjct  530   KLHQEGKLNLMVDKDLKGNIDRVELEEMVQVALLCTQFNPLYRPKMSEVLKMLEGDGLAE  589

Query  557   KWEASQRNDTPRFRTHENTPQRYSDFIEESSLIVEAMELSGPR  429
             KWEASQ+ +TPRFR+ E+  QRYSDFIEESSL+VEAMELSGPR
Sbjct  590   KWEASQKVETPRFRSCEHPRQRYSDFIEESSLVVEAMELSGPR  632



>ref|XP_011034114.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X1 [Populus 
euphratica]
 ref|XP_011034115.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X1 [Populus 
euphratica]
Length=627

 Score =   415 bits (1067),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 197/223 (88%), Positives = 212/223 (95%), Gaps = 0/223 (0%)
 Frame = -1

Query  1097  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVS  918
             RKRIALG ARGL+YLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHR+SHV+
Sbjct  405   RKRIALGTARGLLYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRDSHVT  464

Query  917   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVK  738
             TAVRGT+GHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKA+DFGR ANQKGV+LDWVK
Sbjct  465   TAVRGTIGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKALDFGRAANQKGVMLDWVK  524

Query  737   TLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAE  558
              LH + KLNLMVDKDL+  FDR+ELEEMVQVALLCTQFNPSHRPKMSEVL+MLEGDGLAE
Sbjct  525   KLHHDRKLNLMVDKDLRGKFDRIELEEMVQVALLCTQFNPSHRPKMSEVLKMLEGDGLAE  584

Query  557   KWEASQRNDTPRFRTHENTPQRYSDFIEESSLIVEAMELSGPR  429
             KWEASQ+ +TPRFR+ EN  Q+YSDFIEESSL+VEAMELSGPR
Sbjct  585   KWEASQKVETPRFRSCENPAQKYSDFIEESSLVVEAMELSGPR  627



>ref|XP_011034116.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X2 [Populus 
euphratica]
Length=624

 Score =   415 bits (1067),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 197/223 (88%), Positives = 212/223 (95%), Gaps = 0/223 (0%)
 Frame = -1

Query  1097  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVS  918
             RKRIALG ARGL+YLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHR+SHV+
Sbjct  402   RKRIALGTARGLLYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRDSHVT  461

Query  917   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVK  738
             TAVRGT+GHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKA+DFGR ANQKGV+LDWVK
Sbjct  462   TAVRGTIGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKALDFGRAANQKGVMLDWVK  521

Query  737   TLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAE  558
              LH + KLNLMVDKDL+  FDR+ELEEMVQVALLCTQFNPSHRPKMSEVL+MLEGDGLAE
Sbjct  522   KLHHDRKLNLMVDKDLRGKFDRIELEEMVQVALLCTQFNPSHRPKMSEVLKMLEGDGLAE  581

Query  557   KWEASQRNDTPRFRTHENTPQRYSDFIEESSLIVEAMELSGPR  429
             KWEASQ+ +TPRFR+ EN  Q+YSDFIEESSL+VEAMELSGPR
Sbjct  582   KWEASQKVETPRFRSCENPAQKYSDFIEESSLVVEAMELSGPR  624



>ref|XP_008389688.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X3 [Malus 
domestica]
Length=630

 Score =   415 bits (1067),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 201/223 (90%), Positives = 213/223 (96%), Gaps = 0/223 (0%)
 Frame = -1

Query  1097  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVS  918
             RKRIALG ARGLVYLHEQCDP+IIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHV+
Sbjct  408   RKRIALGTARGLVYLHEQCDPRIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVT  467

Query  917   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVK  738
             TAVRGTVGHIAPEYLSTGQSS+KTDVFGFGILLLELITGQKA+DFGR ANQKGV+LDWVK
Sbjct  468   TAVRGTVGHIAPEYLSTGQSSDKTDVFGFGILLLELITGQKALDFGRVANQKGVMLDWVK  527

Query  737   TLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAE  558
              LHQEGKLNLMVDKDLK N DRVELEEMVQVALLCTQFNP +RPKMSEVL+MLEGDGLAE
Sbjct  528   KLHQEGKLNLMVDKDLKGNIDRVELEEMVQVALLCTQFNPLYRPKMSEVLKMLEGDGLAE  587

Query  557   KWEASQRNDTPRFRTHENTPQRYSDFIEESSLIVEAMELSGPR  429
             KWEASQ+ +TPRFR+ E+  QRYSDFIEESSL+VEAMELSGPR
Sbjct  588   KWEASQKVETPRFRSCEHPRQRYSDFIEESSLVVEAMELSGPR  630



>ref|XP_008389687.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X2 [Malus 
domestica]
Length=631

 Score =   415 bits (1067),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 201/223 (90%), Positives = 213/223 (96%), Gaps = 0/223 (0%)
 Frame = -1

Query  1097  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVS  918
             RKRIALG ARGLVYLHEQCDP+IIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHV+
Sbjct  409   RKRIALGTARGLVYLHEQCDPRIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVT  468

Query  917   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVK  738
             TAVRGTVGHIAPEYLSTGQSS+KTDVFGFGILLLELITGQKA+DFGR ANQKGV+LDWVK
Sbjct  469   TAVRGTVGHIAPEYLSTGQSSDKTDVFGFGILLLELITGQKALDFGRVANQKGVMLDWVK  528

Query  737   TLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAE  558
              LHQEGKLNLMVDKDLK N DRVELEEMVQVALLCTQFNP +RPKMSEVL+MLEGDGLAE
Sbjct  529   KLHQEGKLNLMVDKDLKGNIDRVELEEMVQVALLCTQFNPLYRPKMSEVLKMLEGDGLAE  588

Query  557   KWEASQRNDTPRFRTHENTPQRYSDFIEESSLIVEAMELSGPR  429
             KWEASQ+ +TPRFR+ E+  QRYSDFIEESSL+VEAMELSGPR
Sbjct  589   KWEASQKVETPRFRSCEHPRQRYSDFIEESSLVVEAMELSGPR  631



>ref|XP_010248541.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X1 [Nelumbo 
nucifera]
Length=626

 Score =   415 bits (1066),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 198/223 (89%), Positives = 211/223 (95%), Gaps = 0/223 (0%)
 Frame = -1

Query  1097  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVS  918
             RK IALG ARGL+YLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHR+SHV+
Sbjct  404   RKSIALGTARGLLYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRDSHVT  463

Query  917   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVK  738
             TA+RGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKA+DFGR  +QKGV+LDWVK
Sbjct  464   TAIRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKALDFGRAVSQKGVMLDWVK  523

Query  737   TLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAE  558
              LHQEGKLNLMVDK L NNFDRVELEEMV+VALLCTQF+PS RPKMSEVLRMLEGDGLAE
Sbjct  524   KLHQEGKLNLMVDKCLNNNFDRVELEEMVKVALLCTQFHPSQRPKMSEVLRMLEGDGLAE  583

Query  557   KWEASQRNDTPRFRTHENTPQRYSDFIEESSLIVEAMELSGPR  429
             KWEASQR +TPR R+ EN PQRYSD+IEESSL+VEAMELSGPR
Sbjct  584   KWEASQRAETPRLRSSENLPQRYSDYIEESSLVVEAMELSGPR  626



>ref|XP_003613191.1| Leucine-rich repeat receptor-like kinase [Medicago truncatula]
 gb|ADO15296.1| somatic embryogenesis receptor kinase-like protein 2 [Medicago 
truncatula]
 gb|AES96149.1| LRR receptor-like kinase [Medicago truncatula]
Length=625

 Score =   414 bits (1064),  Expect = 4e-136, Method: Compositional matrix adjust.
 Identities = 200/223 (90%), Positives = 210/223 (94%), Gaps = 0/223 (0%)
 Frame = -1

Query  1097  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVS  918
             RKRIALG ARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHR++HV+
Sbjct  403   RKRIALGTARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRDTHVT  462

Query  917   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVK  738
             TAVRGT+GHIAPEYLSTGQSSEKTDVFG+GILLLELITG KA+DFGR ANQKGV+LDWVK
Sbjct  463   TAVRGTIGHIAPEYLSTGQSSEKTDVFGYGILLLELITGHKALDFGRAANQKGVMLDWVK  522

Query  737   TLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAE  558
              LH EGKL+ MVDKDLK NFD VEL EMVQVALLCTQFNPSHRPKMSEVL+MLEGDGLAE
Sbjct  523   KLHLEGKLSQMVDKDLKGNFDIVELGEMVQVALLCTQFNPSHRPKMSEVLKMLEGDGLAE  582

Query  557   KWEASQRNDTPRFRTHENTPQRYSDFIEESSLIVEAMELSGPR  429
             KWEASQR +TPRFR  EN PQRYSDFIEESSLIVEAMELSGPR
Sbjct  583   KWEASQRIETPRFRFCENPPQRYSDFIEESSLIVEAMELSGPR  625



>gb|KDO82334.1| hypothetical protein CISIN_1g006968mg [Citrus sinensis]
Length=623

 Score =   412 bits (1058),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 197/223 (88%), Positives = 213/223 (96%), Gaps = 3/223 (1%)
 Frame = -1

Query  1097  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVS  918
             RKRIALG ARGL+YLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHR+SHV+
Sbjct  404   RKRIALGTARGLLYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRDSHVT  463

Query  917   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVK  738
             TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQ+A+DFGR ANQ+GV+LDWVK
Sbjct  464   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQRALDFGRAANQRGVMLDWVK  523

Query  737   TLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAE  558
              LHQEGKL+ MVDKDLK NFDR+ELEEMVQVALLCTQFNP HRPKMSEVL+MLEGDGLAE
Sbjct  524   KLHQEGKLSQMVDKDLKGNFDRIELEEMVQVALLCTQFNPLHRPKMSEVLKMLEGDGLAE  583

Query  557   KWEASQRNDTPRFRTHENTPQRYSDFIEESSLIVEAMELSGPR  429
             KWEASQ+ +TPR+RTHE   +RYSDFIEESSL++EAMELSGPR
Sbjct  584   KWEASQKIETPRYRTHE---KRYSDFIEESSLVIEAMELSGPR  623



>gb|KHN14560.1| Protein NSP-INTERACTING KINASE 3 [Glycine soja]
Length=623

 Score =   410 bits (1055),  Expect = 6e-135, Method: Compositional matrix adjust.
 Identities = 199/223 (89%), Positives = 211/223 (95%), Gaps = 2/223 (1%)
 Frame = -1

Query  1097  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVS  918
             RKRIALG ARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHR+SHV+
Sbjct  403   RKRIALGTARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRDSHVT  462

Query  917   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVK  738
             TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITG KA+DFGR ANQKGV+LDWVK
Sbjct  463   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGHKALDFGRAANQKGVMLDWVK  522

Query  737   TLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAE  558
              LHQ+G+L+ MVDKDLK NFD +ELEEMVQVALLCTQFNPSHRPKMSEVL+MLEGDGLAE
Sbjct  523   KLHQDGRLSQMVDKDLKGNFDLIELEEMVQVALLCTQFNPSHRPKMSEVLKMLEGDGLAE  582

Query  557   KWEASQRNDTPRFRTHENTPQRYSDFIEESSLIVEAMELSGPR  429
             +WEASQR +TPRFR+ E  PQRYSD IEESSLIVEAMELSGPR
Sbjct  583   RWEASQRIETPRFRSCE--PQRYSDLIEESSLIVEAMELSGPR  623



>ref|XP_003517653.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like [Glycine max]
Length=623

 Score =   410 bits (1055),  Expect = 6e-135, Method: Compositional matrix adjust.
 Identities = 199/223 (89%), Positives = 211/223 (95%), Gaps = 2/223 (1%)
 Frame = -1

Query  1097  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVS  918
             RKRIALG ARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHR+SHV+
Sbjct  403   RKRIALGTARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRDSHVT  462

Query  917   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVK  738
             TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITG KA+DFGR ANQKGV+LDWVK
Sbjct  463   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGHKALDFGRAANQKGVMLDWVK  522

Query  737   TLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAE  558
              LHQ+G+L+ MVDKDLK NFD +ELEEMVQVALLCTQFNPSHRPKMSEVL+MLEGDGLAE
Sbjct  523   KLHQDGRLSQMVDKDLKGNFDLIELEEMVQVALLCTQFNPSHRPKMSEVLKMLEGDGLAE  582

Query  557   KWEASQRNDTPRFRTHENTPQRYSDFIEESSLIVEAMELSGPR  429
             +WEASQR +TPRFR+ E  PQRYSD IEESSLIVEAMELSGPR
Sbjct  583   RWEASQRIETPRFRSCE--PQRYSDLIEESSLIVEAMELSGPR  623



>ref|XP_007157369.1| hypothetical protein PHAVU_002G064400g [Phaseolus vulgaris]
 gb|ESW29363.1| hypothetical protein PHAVU_002G064400g [Phaseolus vulgaris]
Length=623

 Score =   410 bits (1055),  Expect = 7e-135, Method: Compositional matrix adjust.
 Identities = 199/223 (89%), Positives = 211/223 (95%), Gaps = 2/223 (1%)
 Frame = -1

Query  1097  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVS  918
             RKRIALG ARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHR+SHV+
Sbjct  403   RKRIALGTARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRDSHVT  462

Query  917   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVK  738
             TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITG KA+DFGR ANQKGV+LDWVK
Sbjct  463   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGHKALDFGRAANQKGVMLDWVK  522

Query  737   TLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAE  558
              LHQ+G+L+ MVDKDLK NFD +ELEEMVQVALLCTQFNPSHRPKMSEVL+MLEGDGLAE
Sbjct  523   KLHQDGRLSQMVDKDLKGNFDLIELEEMVQVALLCTQFNPSHRPKMSEVLKMLEGDGLAE  582

Query  557   KWEASQRNDTPRFRTHENTPQRYSDFIEESSLIVEAMELSGPR  429
             +WEASQR +TPRFR+ E  PQRYSD IEESSLIVEAMELSGPR
Sbjct  583   RWEASQRIETPRFRSCE--PQRYSDLIEESSLIVEAMELSGPR  623



>gb|EYU28436.1| hypothetical protein MIMGU_mgv1a002888mg [Erythranthe guttata]
Length=628

 Score =   411 bits (1056),  Expect = 7e-135, Method: Compositional matrix adjust.
 Identities = 197/226 (87%), Positives = 212/226 (94%), Gaps = 3/226 (1%)
 Frame = -1

Query  1097  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVS  918
             RK IALG ARGLVYLHEQCDPK+IHRDVKAANILLDEDFEAVVGDFGLAKLLDHR+SHV+
Sbjct  403   RKSIALGTARGLVYLHEQCDPKVIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRDSHVT  462

Query  917   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVK  738
             TAVRGT+GHIAPEYLSTGQSSEKTDVFGFGILLLELITG KAVDFGRGANQKGVILDWVK
Sbjct  463   TAVRGTLGHIAPEYLSTGQSSEKTDVFGFGILLLELITGHKAVDFGRGANQKGVILDWVK  522

Query  737   TLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAE  558
              LHQEGKLNLMVDK+LK++FD +ELEEMVQVALLCT FNP+HRPKMSEVLRMLEGDGLAE
Sbjct  523   KLHQEGKLNLMVDKELKSDFDMIELEEMVQVALLCTHFNPTHRPKMSEVLRMLEGDGLAE  582

Query  557   KWEASQRNDTPRF---RTHENTPQRYSDFIEESSLIVEAMELSGPR  429
             KWE SQ+ DTPR+   R+ +N PQRYSD+IEESSL+VE MELSGPR
Sbjct  583   KWEQSQKVDTPRYNNSRSFQNLPQRYSDYIEESSLVVEDMELSGPR  628



>ref|XP_003519642.1| PREDICTED: protein NSP-INTERACTING KINASE 3 isoform 1 [Glycine 
max]
Length=624

 Score =   410 bits (1054),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 198/223 (89%), Positives = 211/223 (95%), Gaps = 2/223 (1%)
 Frame = -1

Query  1097  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVS  918
             RKRIALG ARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHR+SHV+
Sbjct  404   RKRIALGTARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRDSHVT  463

Query  917   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVK  738
             TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITG KA+DFGR ANQKGV+LDWVK
Sbjct  464   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGHKALDFGRAANQKGVMLDWVK  523

Query  737   TLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAE  558
              LHQ+G+L+ MVDKDLK NFD +ELEEMVQVALLCTQFNPSHRPKMSEVL+MLEGDGLAE
Sbjct  524   KLHQDGRLSQMVDKDLKGNFDLIELEEMVQVALLCTQFNPSHRPKMSEVLKMLEGDGLAE  583

Query  557   KWEASQRNDTPRFRTHENTPQRYSDFIEESSLIVEAMELSGPR  429
             +WEASQR +TPRFR+ E  PQRYSD IEESSL+VEAMELSGPR
Sbjct  584   RWEASQRIETPRFRSCE--PQRYSDLIEESSLVVEAMELSGPR  624



>gb|KHN00370.1| Protein NSP-INTERACTING KINASE 3 [Glycine soja]
Length=624

 Score =   410 bits (1053),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 198/223 (89%), Positives = 211/223 (95%), Gaps = 2/223 (1%)
 Frame = -1

Query  1097  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVS  918
             RKRIALG ARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHR+SHV+
Sbjct  404   RKRIALGTARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRDSHVT  463

Query  917   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVK  738
             TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITG KA+DFGR ANQKGV+LDWVK
Sbjct  464   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGHKALDFGRAANQKGVMLDWVK  523

Query  737   TLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAE  558
              LHQ+G+L+ MVDKDLK NFD +ELEEMVQVALLCTQFNPSHRPKMSEVL+MLEGDGLAE
Sbjct  524   KLHQDGRLSQMVDKDLKGNFDLIELEEMVQVALLCTQFNPSHRPKMSEVLKMLEGDGLAE  583

Query  557   KWEASQRNDTPRFRTHENTPQRYSDFIEESSLIVEAMELSGPR  429
             +WEASQR +TPRFR+ E  PQRYSD IEESSL+VEAMELSGPR
Sbjct  584   RWEASQRIETPRFRSCE--PQRYSDLIEESSLVVEAMELSGPR  624



>ref|XP_004489819.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like [Cicer arietinum]
Length=625

 Score =   410 bits (1053),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 199/223 (89%), Positives = 209/223 (94%), Gaps = 0/223 (0%)
 Frame = -1

Query  1097  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVS  918
             RKRIALG ARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHR++HV+
Sbjct  403   RKRIALGTARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRDTHVT  462

Query  917   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVK  738
             TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITG KA+DFGR ANQKGV+LDWVK
Sbjct  463   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGHKALDFGRAANQKGVMLDWVK  522

Query  737   TLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAE  558
              LH EG+L+ MVDKDLK  FD VEL EMVQVALLCTQFNPSHRPKMSEVL+MLEGDGLAE
Sbjct  523   KLHLEGRLSQMVDKDLKGIFDIVELGEMVQVALLCTQFNPSHRPKMSEVLKMLEGDGLAE  582

Query  557   KWEASQRNDTPRFRTHENTPQRYSDFIEESSLIVEAMELSGPR  429
             +WEASQR +TPRFR  EN PQRYSDFIEESSLIVEAMELSGPR
Sbjct  583   RWEASQRIETPRFRLCENPPQRYSDFIEESSLIVEAMELSGPR  625



>gb|KJB61041.1| hypothetical protein B456_009G337000 [Gossypium raimondii]
Length=628

 Score =   409 bits (1050),  Expect = 5e-134, Method: Compositional matrix adjust.
 Identities = 197/225 (88%), Positives = 212/225 (94%), Gaps = 2/225 (1%)
 Frame = -1

Query  1097  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVS  918
             RKRIALG ARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHR+SHV+
Sbjct  404   RKRIALGTARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRDSHVT  463

Query  917   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVK  738
             TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKA+DFGR ANQKGV+LDWVK
Sbjct  464   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKALDFGRAANQKGVMLDWVK  523

Query  737   TLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAE  558
              LHQ+GKL+L+VDKDLK NFDR+ELEEMVQVALLCTQFNP HRP+MSEVLRMLEGDGLAE
Sbjct  524   KLHQDGKLSLLVDKDLKGNFDRIELEEMVQVALLCTQFNPLHRPRMSEVLRMLEGDGLAE  583

Query  557   KWEASQRNDTPRFRT--HENTPQRYSDFIEESSLIVEAMELSGPR  429
             KWEASQ   T + R+  ++N PQRYSDFIEESSL++EAMELSGPR
Sbjct  584   KWEASQMIKTLKLRSCDNDNPPQRYSDFIEESSLVLEAMELSGPR  628



>gb|KJB61045.1| hypothetical protein B456_009G337000 [Gossypium raimondii]
Length=625

 Score =   408 bits (1049),  Expect = 5e-134, Method: Compositional matrix adjust.
 Identities = 197/225 (88%), Positives = 212/225 (94%), Gaps = 2/225 (1%)
 Frame = -1

Query  1097  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVS  918
             RKRIALG ARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHR+SHV+
Sbjct  401   RKRIALGTARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRDSHVT  460

Query  917   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVK  738
             TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKA+DFGR ANQKGV+LDWVK
Sbjct  461   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKALDFGRAANQKGVMLDWVK  520

Query  737   TLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAE  558
              LHQ+GKL+L+VDKDLK NFDR+ELEEMVQVALLCTQFNP HRP+MSEVLRMLEGDGLAE
Sbjct  521   KLHQDGKLSLLVDKDLKGNFDRIELEEMVQVALLCTQFNPLHRPRMSEVLRMLEGDGLAE  580

Query  557   KWEASQRNDTPRFRT--HENTPQRYSDFIEESSLIVEAMELSGPR  429
             KWEASQ   T + R+  ++N PQRYSDFIEESSL++EAMELSGPR
Sbjct  581   KWEASQMIKTLKLRSCDNDNPPQRYSDFIEESSLVLEAMELSGPR  625



>ref|XP_010319667.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X2 [Solanum 
lycopersicum]
Length=575

 Score =   406 bits (1044),  Expect = 9e-134, Method: Compositional matrix adjust.
 Identities = 197/225 (88%), Positives = 211/225 (94%), Gaps = 2/225 (1%)
 Frame = -1

Query  1097  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVS  918
             RK IA+G ARGLVYLHEQCDPKIIHRDVKAANILLDE+FEAVVGDFGLAKLLDHR+SHV+
Sbjct  351   RKGIAVGTARGLVYLHEQCDPKIIHRDVKAANILLDEEFEAVVGDFGLAKLLDHRDSHVT  410

Query  917   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVK  738
             TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAV+FGRGANQKGV+LDWVK
Sbjct  411   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVEFGRGANQKGVMLDWVK  470

Query  737   TLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAE  558
              LH E KLNLMVDKDLKNNFD +ELEEMVQVALLCT F P++RPKMSEVLRMLEGDGLAE
Sbjct  471   KLHVEKKLNLMVDKDLKNNFDGIELEEMVQVALLCTHFIPTYRPKMSEVLRMLEGDGLAE  530

Query  557   KWEASQR--NDTPRFRTHENTPQRYSDFIEESSLIVEAMELSGPR  429
             KWEASQ+    TPRF T ENTP+RYSD+I+ESSL+VEAMELSGPR
Sbjct  531   KWEASQKVETPTPRFTTSENTPKRYSDYIQESSLVVEAMELSGPR  575



>ref|XP_006438322.1| hypothetical protein CICLE_v10030967mg [Citrus clementina]
 gb|ESR51562.1| hypothetical protein CICLE_v10030967mg [Citrus clementina]
Length=623

 Score =   407 bits (1047),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 195/223 (87%), Positives = 211/223 (95%), Gaps = 3/223 (1%)
 Frame = -1

Query  1097  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVS  918
             RKRIALG ARGL+YLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHR+SHV+
Sbjct  404   RKRIALGTARGLLYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRDSHVT  463

Query  917   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVK  738
             TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQ+A+DFGR ANQ+GV+LDWVK
Sbjct  464   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQRALDFGRAANQRGVMLDWVK  523

Query  737   TLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAE  558
              LHQEGKL+ MVDKDLK   DR+ELEEMVQVALLCTQFNP HRPKMSEVL+MLEGDGLAE
Sbjct  524   KLHQEGKLSQMVDKDLKGKLDRIELEEMVQVALLCTQFNPLHRPKMSEVLKMLEGDGLAE  583

Query  557   KWEASQRNDTPRFRTHENTPQRYSDFIEESSLIVEAMELSGPR  429
             KWEASQ+ +TPR+RTHE   +RYSDFIEESSL++EAMELSGPR
Sbjct  584   KWEASQKIETPRYRTHE---KRYSDFIEESSLVIEAMELSGPR  623



>ref|XP_006483905.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like [Citrus sinensis]
Length=623

 Score =   407 bits (1046),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 195/223 (87%), Positives = 211/223 (95%), Gaps = 3/223 (1%)
 Frame = -1

Query  1097  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVS  918
             RKRIALG ARGL+YLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHR+SHV+
Sbjct  404   RKRIALGTARGLLYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRDSHVT  463

Query  917   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVK  738
             TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQ+A+DFGR ANQ+GV+LDWVK
Sbjct  464   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQRALDFGRAANQRGVMLDWVK  523

Query  737   TLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAE  558
              LHQEGKL+ MVDKDLK   DR+ELEEMVQVALLCTQFNP HRPKMSEVL+MLEGDGLAE
Sbjct  524   KLHQEGKLSQMVDKDLKGKLDRIELEEMVQVALLCTQFNPLHRPKMSEVLKMLEGDGLAE  583

Query  557   KWEASQRNDTPRFRTHENTPQRYSDFIEESSLIVEAMELSGPR  429
             KWEASQ+ +TPR+RTHE   +RYSDFIEESSL++EAMELSGPR
Sbjct  584   KWEASQKIETPRYRTHE---KRYSDFIEESSLVIEAMELSGPR  623



>ref|XP_004237339.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X1 [Solanum 
lycopersicum]
 ref|XP_010319665.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X1 [Solanum 
lycopersicum]
 ref|XP_010319666.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X1 [Solanum 
lycopersicum]
Length=623

 Score =   406 bits (1044),  Expect = 4e-133, Method: Compositional matrix adjust.
 Identities = 197/225 (88%), Positives = 211/225 (94%), Gaps = 2/225 (1%)
 Frame = -1

Query  1097  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVS  918
             RK IA+G ARGLVYLHEQCDPKIIHRDVKAANILLDE+FEAVVGDFGLAKLLDHR+SHV+
Sbjct  399   RKGIAVGTARGLVYLHEQCDPKIIHRDVKAANILLDEEFEAVVGDFGLAKLLDHRDSHVT  458

Query  917   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVK  738
             TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAV+FGRGANQKGV+LDWVK
Sbjct  459   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVEFGRGANQKGVMLDWVK  518

Query  737   TLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAE  558
              LH E KLNLMVDKDLKNNFD +ELEEMVQVALLCT F P++RPKMSEVLRMLEGDGLAE
Sbjct  519   KLHVEKKLNLMVDKDLKNNFDGIELEEMVQVALLCTHFIPTYRPKMSEVLRMLEGDGLAE  578

Query  557   KWEASQR--NDTPRFRTHENTPQRYSDFIEESSLIVEAMELSGPR  429
             KWEASQ+    TPRF T ENTP+RYSD+I+ESSL+VEAMELSGPR
Sbjct  579   KWEASQKVETPTPRFTTSENTPKRYSDYIQESSLVVEAMELSGPR  623



>ref|XP_008340071.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X2 [Malus 
domestica]
Length=629

 Score =   405 bits (1040),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 197/223 (88%), Positives = 210/223 (94%), Gaps = 1/223 (0%)
 Frame = -1

Query  1097  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVS  918
             RKRIALG ARGLVYLHEQCDP+IIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVS
Sbjct  408   RKRIALGTARGLVYLHEQCDPRIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVS  467

Query  917   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVK  738
             TAVRGTVGHIAPEYLSTGQSS+KTDVFGFGILLLELITGQ+A+DFGR ANQKGV+LDWVK
Sbjct  468   TAVRGTVGHIAPEYLSTGQSSDKTDVFGFGILLLELITGQRALDFGRVANQKGVMLDWVK  527

Query  737   TLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAE  558
              LHQEGKLNLMVDKDL+   DRVELEEMVQVALLCTQFNP +RPKMSEVL+MLEGDGLAE
Sbjct  528   KLHQEGKLNLMVDKDLRGKLDRVELEEMVQVALLCTQFNPLYRPKMSEVLKMLEGDGLAE  587

Query  557   KWEASQRNDTPRFRTHENTPQRYSDFIEESSLIVEAMELSGPR  429
             KWEASQ+ +TPRFR  +   QRYSDFIEESSL++EAMELSGPR
Sbjct  588   KWEASQKVETPRFRPCDPR-QRYSDFIEESSLVLEAMELSGPR  629



>ref|XP_009596637.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like [Nicotiana tomentosiformis]
Length=601

 Score =   404 bits (1037),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 196/224 (88%), Positives = 210/224 (94%), Gaps = 2/224 (1%)
 Frame = -1

Query  1097  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVS  918
             RK IA G ARGLVYLHEQCDPKIIHRDVKAANILLDE+FEAVVGDFGLAKLLDHR+SHV+
Sbjct  379   RKTIAQGTARGLVYLHEQCDPKIIHRDVKAANILLDEEFEAVVGDFGLAKLLDHRDSHVT  438

Query  917   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVI-LDWV  741
             TAVRGT+GHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKA+DFGRGANQKGV+ LDWV
Sbjct  439   TAVRGTIGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAMDFGRGANQKGVVMLDWV  498

Query  740   KTLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLA  561
             K LHQEGK NLMVDKDLKNNFDR+ELEEMV+VALLCTQFNPSHRPKMSE LRMLEGDGLA
Sbjct  499   KELHQEGKSNLMVDKDLKNNFDRIELEEMVKVALLCTQFNPSHRPKMSEALRMLEGDGLA  558

Query  560   EKWEASQRNDTPRFRTHENTPQRYSDFIEESSLIVEAMELSGPR  429
             EKWEASQ+ + PR R  E+TPQRYS+++EESSL VE MELSGPR
Sbjct  559   EKWEASQKLEAPRNRAFEHTPQRYSNYVEESSL-VEPMELSGPR  601



>ref|XP_008340070.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X1 [Malus 
domestica]
Length=630

 Score =   404 bits (1039),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 197/223 (88%), Positives = 210/223 (94%), Gaps = 1/223 (0%)
 Frame = -1

Query  1097  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVS  918
             RKRIALG ARGLVYLHEQCDP+IIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVS
Sbjct  409   RKRIALGTARGLVYLHEQCDPRIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVS  468

Query  917   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVK  738
             TAVRGTVGHIAPEYLSTGQSS+KTDVFGFGILLLELITGQ+A+DFGR ANQKGV+LDWVK
Sbjct  469   TAVRGTVGHIAPEYLSTGQSSDKTDVFGFGILLLELITGQRALDFGRVANQKGVMLDWVK  528

Query  737   TLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAE  558
              LHQEGKLNLMVDKDL+   DRVELEEMVQVALLCTQFNP +RPKMSEVL+MLEGDGLAE
Sbjct  529   KLHQEGKLNLMVDKDLRGKLDRVELEEMVQVALLCTQFNPLYRPKMSEVLKMLEGDGLAE  588

Query  557   KWEASQRNDTPRFRTHENTPQRYSDFIEESSLIVEAMELSGPR  429
             KWEASQ+ +TPRFR  +   QRYSDFIEESSL++EAMELSGPR
Sbjct  589   KWEASQKVETPRFRPCDPR-QRYSDFIEESSLVLEAMELSGPR  630



>ref|XP_008340072.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X3 [Malus 
domestica]
Length=628

 Score =   404 bits (1039),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 197/223 (88%), Positives = 210/223 (94%), Gaps = 1/223 (0%)
 Frame = -1

Query  1097  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVS  918
             RKRIALG ARGLVYLHEQCDP+IIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVS
Sbjct  407   RKRIALGTARGLVYLHEQCDPRIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVS  466

Query  917   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVK  738
             TAVRGTVGHIAPEYLSTGQSS+KTDVFGFGILLLELITGQ+A+DFGR ANQKGV+LDWVK
Sbjct  467   TAVRGTVGHIAPEYLSTGQSSDKTDVFGFGILLLELITGQRALDFGRVANQKGVMLDWVK  526

Query  737   TLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAE  558
              LHQEGKLNLMVDKDL+   DRVELEEMVQVALLCTQFNP +RPKMSEVL+MLEGDGLAE
Sbjct  527   KLHQEGKLNLMVDKDLRGKLDRVELEEMVQVALLCTQFNPLYRPKMSEVLKMLEGDGLAE  586

Query  557   KWEASQRNDTPRFRTHENTPQRYSDFIEESSLIVEAMELSGPR  429
             KWEASQ+ +TPRFR  +   QRYSDFIEESSL++EAMELSGPR
Sbjct  587   KWEASQKVETPRFRPCDPR-QRYSDFIEESSLVLEAMELSGPR  628



>ref|XP_006841062.1| PREDICTED: protein NSP-INTERACTING KINASE 3 [Amborella trichopoda]
 gb|ERN02737.1| hypothetical protein AMTR_s00085p00173590 [Amborella trichopoda]
Length=629

 Score =   404 bits (1039),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 198/224 (88%), Positives = 211/224 (94%), Gaps = 1/224 (0%)
 Frame = -1

Query  1097  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVS  918
             RKRIALG ARGL+YLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDH +SHV+
Sbjct  406   RKRIALGTARGLLYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHHDSHVT  465

Query  917   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVK  738
             TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGR ANQKGV+LDWVK
Sbjct  466   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRLANQKGVMLDWVK  525

Query  737   TLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAE  558
              LHQE KLNLMVDKDLKNNFDRVELEEMV+VALLCTQF+P+ RPKMSEV+RMLEGDGLAE
Sbjct  526   KLHQEKKLNLMVDKDLKNNFDRVELEEMVRVALLCTQFHPACRPKMSEVVRMLEGDGLAE  585

Query  557   KWEASQRN-DTPRFRTHENTPQRYSDFIEESSLIVEAMELSGPR  429
             KWEASQ+  +TPRFR  E  P++YSD IEESSL+VEAMELSGPR
Sbjct  586   KWEASQQKVETPRFRGSEFFPRKYSDLIEESSLVVEAMELSGPR  629



>ref|XP_010023506.1| PREDICTED: protein NSP-INTERACTING KINASE 3 [Eucalyptus grandis]
 gb|KCW59799.1| hypothetical protein EUGRSUZ_H02547 [Eucalyptus grandis]
Length=621

 Score =   403 bits (1035),  Expect = 6e-132, Method: Compositional matrix adjust.
 Identities = 194/223 (87%), Positives = 209/223 (94%), Gaps = 0/223 (0%)
 Frame = -1

Query  1097  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVS  918
             RKRIALG ARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHR+SHV+
Sbjct  399   RKRIALGTARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRDSHVT  458

Query  917   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVK  738
             TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKA+DFGR ANQKGV+LDWV 
Sbjct  459   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKALDFGRVANQKGVMLDWVN  518

Query  737   TLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAE  558
              LH++GKLN +VDKDL  NFDR+ELEEMV+V+LLCT+FNP  RPKMSEVLRMLEGDGLAE
Sbjct  519   KLHKDGKLNQLVDKDLGVNFDRIELEEMVKVSLLCTKFNPLERPKMSEVLRMLEGDGLAE  578

Query  557   KWEASQRNDTPRFRTHENTPQRYSDFIEESSLIVEAMELSGPR  429
             KWEASQ+ +TPRFR+ EN   RYSDFIEESSL+VEAMELSGPR
Sbjct  579   KWEASQKVETPRFRSCENPTPRYSDFIEESSLVVEAMELSGPR  621



>ref|XP_010682518.1| PREDICTED: protein NSP-INTERACTING KINASE 3 [Beta vulgaris subsp. 
vulgaris]
Length=621

 Score =   402 bits (1034),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 192/223 (86%), Positives = 209/223 (94%), Gaps = 2/223 (1%)
 Frame = -1

Query  1097  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVS  918
             R+ IALG ARGL+YLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHV+
Sbjct  401   RRSIALGTARGLLYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVT  460

Query  917   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVK  738
             TAVRGT+GHIAPEYL TGQSSEKTDVFG+GILLLELITGQKA+DFGR +NQKGV+LDWVK
Sbjct  461   TAVRGTIGHIAPEYLCTGQSSEKTDVFGYGILLLELITGQKAIDFGRASNQKGVMLDWVK  520

Query  737   TLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAE  558
              LH EGKLN +VDKDLKNN+DRVEL EMVQVALLCTQFNP HRPKMS+VLRMLE DGLAE
Sbjct  521   KLHTEGKLNQLVDKDLKNNYDRVELGEMVQVALLCTQFNPLHRPKMSDVLRMLEDDGLAE  580

Query  557   KWEASQRNDTPRFRTHENTPQRYSDFIEESSLIVEAMELSGPR  429
             KW+ASQR++TPR R+ E  PQRYSD+IEESSL+VEAMELSGPR
Sbjct  581   KWDASQRSETPRSRSSE--PQRYSDYIEESSLVVEAMELSGPR  621



>ref|XP_010940158.1| PREDICTED: protein NSP-INTERACTING KINASE 3 [Elaeis guineensis]
Length=629

 Score =   402 bits (1033),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 190/223 (85%), Positives = 210/223 (94%), Gaps = 0/223 (0%)
 Frame = -1

Query  1097  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVS  918
             RKRIALG ARGL+YLHEQCDPKIIHRDVKAANILLDE+FEAVVGDFGLAKLLDHRESHV+
Sbjct  407   RKRIALGTARGLLYLHEQCDPKIIHRDVKAANILLDEEFEAVVGDFGLAKLLDHRESHVT  466

Query  917   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVK  738
             TAVRGTVGHIAPEYLSTGQSSEKTDVFGFG+LLLELITGQKA+DFGR ANQKGV+LDWVK
Sbjct  467   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGVLLLELITGQKALDFGRLANQKGVMLDWVK  526

Query  737   TLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAE  558
              LHQE KL++MVDKDLKNN+D VELEEMVQVALLCTQ++PSHRPKMSEV+RMLEGDGLAE
Sbjct  527   KLHQENKLSMMVDKDLKNNYDSVELEEMVQVALLCTQYHPSHRPKMSEVVRMLEGDGLAE  586

Query  557   KWEASQRNDTPRFRTHENTPQRYSDFIEESSLIVEAMELSGPR  429
             KWEASQ+ DTP+  + E  P +Y DF+EESSL+V+A+ELSGPR
Sbjct  587   KWEASQKTDTPKSLSSEQPPPKYLDFVEESSLVVDAIELSGPR  629



>ref|XP_010910388.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like [Elaeis guineensis]
Length=629

 Score =   402 bits (1033),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 192/223 (86%), Positives = 211/223 (95%), Gaps = 0/223 (0%)
 Frame = -1

Query  1097  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVS  918
             RKRIALG ARGL+YLHEQCDPKIIHRDVKAANILLDE+FEAVVGDFGLAKLLDH+ESHV+
Sbjct  407   RKRIALGTARGLLYLHEQCDPKIIHRDVKAANILLDEEFEAVVGDFGLAKLLDHQESHVT  466

Query  917   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVK  738
             TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKA+DFGR ANQKGV+LDWVK
Sbjct  467   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKALDFGRLANQKGVMLDWVK  526

Query  737   TLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAE  558
              LHQE KL +MVDKDLKNN+DRVELEEMVQVALLCTQF+PSHRPKMSEV+RMLEGDGLAE
Sbjct  527   KLHQENKLRVMVDKDLKNNYDRVELEEMVQVALLCTQFHPSHRPKMSEVVRMLEGDGLAE  586

Query  557   KWEASQRNDTPRFRTHENTPQRYSDFIEESSLIVEAMELSGPR  429
             KWEASQ+ +TP+ R+ E  P +Y DF+E+SSL+VEA+ELSGPR
Sbjct  587   KWEASQKIETPKSRSCEQPPPKYLDFVEDSSLVVEAIELSGPR  629



>ref|XP_008812173.1| PREDICTED: protein NSP-INTERACTING KINASE 3 [Phoenix dactylifera]
Length=629

 Score =   399 bits (1026),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 190/223 (85%), Positives = 209/223 (94%), Gaps = 0/223 (0%)
 Frame = -1

Query  1097  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVS  918
             RK IALG ARGL+YLHEQCDPKIIHRDVKAANILLDE+FEAVVGDFGLAKLLDHRESHV+
Sbjct  407   RKMIALGTARGLLYLHEQCDPKIIHRDVKAANILLDEEFEAVVGDFGLAKLLDHRESHVT  466

Query  917   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVK  738
             TAVRGTVGHIAPEYLSTGQSSEKTDVFGFG+LLLELITGQKA+DFGR ANQKGV+LDWVK
Sbjct  467   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGVLLLELITGQKALDFGRLANQKGVMLDWVK  526

Query  737   TLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAE  558
              LHQE KL++MVDKDLKNN+DRVELEEMVQVALLCTQ++PSHRPKMSEV+RMLEGDGLAE
Sbjct  527   KLHQENKLSMMVDKDLKNNYDRVELEEMVQVALLCTQYHPSHRPKMSEVVRMLEGDGLAE  586

Query  557   KWEASQRNDTPRFRTHENTPQRYSDFIEESSLIVEAMELSGPR  429
             KWEASQ+ D P+  + E  P RY DF+EESSL+V+A+ELSGPR
Sbjct  587   KWEASQKIDAPKSLSSEQPPPRYLDFVEESSLVVDAIELSGPR  629



>ref|XP_008813583.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X2 [Phoenix 
dactylifera]
Length=643

 Score =   400 bits (1027),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 189/223 (85%), Positives = 212/223 (95%), Gaps = 0/223 (0%)
 Frame = -1

Query  1097  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVS  918
             RKRIALG ARGL+YLHEQCDPKIIHRDVKAANILLDE+FEAVVGDFGLAKLLDH+ESHV+
Sbjct  421   RKRIALGTARGLLYLHEQCDPKIIHRDVKAANILLDEEFEAVVGDFGLAKLLDHQESHVT  480

Query  917   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVK  738
             TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQ+A+DFGR ANQKGV+LDWVK
Sbjct  481   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQRALDFGRLANQKGVMLDWVK  540

Query  737   TLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAE  558
              LHQE KL++MVDKDL+NN+DRVELEEMVQVALLCTQF+PSHRPKMSEV+RMLEGDGLAE
Sbjct  541   RLHQENKLSMMVDKDLRNNYDRVELEEMVQVALLCTQFHPSHRPKMSEVVRMLEGDGLAE  600

Query  557   KWEASQRNDTPRFRTHENTPQRYSDFIEESSLIVEAMELSGPR  429
             KWEASQ+ DTP+  + E  P ++SD++E+SSL+VEA+ELSGPR
Sbjct  601   KWEASQKVDTPKSGSSEQAPPKHSDYVEDSSLVVEAIELSGPR  643



>ref|XP_008813582.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X1 [Phoenix 
dactylifera]
Length=649

 Score =   400 bits (1027),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 189/223 (85%), Positives = 212/223 (95%), Gaps = 0/223 (0%)
 Frame = -1

Query  1097  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVS  918
             RKRIALG ARGL+YLHEQCDPKIIHRDVKAANILLDE+FEAVVGDFGLAKLLDH+ESHV+
Sbjct  427   RKRIALGTARGLLYLHEQCDPKIIHRDVKAANILLDEEFEAVVGDFGLAKLLDHQESHVT  486

Query  917   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVK  738
             TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQ+A+DFGR ANQKGV+LDWVK
Sbjct  487   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQRALDFGRLANQKGVMLDWVK  546

Query  737   TLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAE  558
              LHQE KL++MVDKDL+NN+DRVELEEMVQVALLCTQF+PSHRPKMSEV+RMLEGDGLAE
Sbjct  547   RLHQENKLSMMVDKDLRNNYDRVELEEMVQVALLCTQFHPSHRPKMSEVVRMLEGDGLAE  606

Query  557   KWEASQRNDTPRFRTHENTPQRYSDFIEESSLIVEAMELSGPR  429
             KWEASQ+ DTP+  + E  P ++SD++E+SSL+VEA+ELSGPR
Sbjct  607   KWEASQKVDTPKSGSSEQAPPKHSDYVEDSSLVVEAIELSGPR  649



>ref|XP_006356418.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X1 [Solanum 
tuberosum]
 ref|XP_006356419.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X2 [Solanum 
tuberosum]
 ref|XP_006356420.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X3 [Solanum 
tuberosum]
Length=600

 Score =   395 bits (1016),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 191/224 (85%), Positives = 209/224 (93%), Gaps = 2/224 (1%)
 Frame = -1

Query  1097  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVS  918
             RK+IA G ARGLVYLHEQCDPKIIHRDVKAANILLDE+FEAVVGDFGLAKLLDH +SHV+
Sbjct  378   RKKIAQGTARGLVYLHEQCDPKIIHRDVKAANILLDEEFEAVVGDFGLAKLLDHHDSHVT  437

Query  917   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVI-LDWV  741
             TAVRGT+GHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKA+DFGRGANQKGV+ LDWV
Sbjct  438   TAVRGTIGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAMDFGRGANQKGVVMLDWV  497

Query  740   KTLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLA  561
             + LHQE KLNLMVD +LKNNFD++ELEEMV+VALLCT FNPSHRPKMSE LRMLEGDGLA
Sbjct  498   RNLHQEEKLNLMVDSNLKNNFDQIELEEMVKVALLCTHFNPSHRPKMSEALRMLEGDGLA  557

Query  560   EKWEASQRNDTPRFRTHENTPQRYSDFIEESSLIVEAMELSGPR  429
             EKWEASQ+ +TPR R  E+TPQRYS+F+E+SSL VE MELSGPR
Sbjct  558   EKWEASQKLETPRNRAFEHTPQRYSNFVEDSSL-VEPMELSGPR  600



>ref|XP_009390158.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=659

 Score =   397 bits (1021),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 190/223 (85%), Positives = 207/223 (93%), Gaps = 0/223 (0%)
 Frame = -1

Query  1097  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVS  918
             RKRIALG ARGL+YLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHV+
Sbjct  437   RKRIALGTARGLLYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVT  496

Query  917   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVK  738
             TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKA+DFGR  NQKGV+LDWVK
Sbjct  497   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKALDFGRLTNQKGVMLDWVK  556

Query  737   TLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAE  558
              LHQE KL +MVDKDLKNN++RVELEEM+QVALLCTQF+PS RPKMSEV+RMLEGDGLAE
Sbjct  557   KLHQENKLYMMVDKDLKNNYNRVELEEMIQVALLCTQFHPSQRPKMSEVVRMLEGDGLAE  616

Query  557   KWEASQRNDTPRFRTHENTPQRYSDFIEESSLIVEAMELSGPR  429
             KWEASQR DTP+ R+ E    +Y DF+E+SS +VEA+ELSGPR
Sbjct  617   KWEASQRMDTPKSRSSEQLTPKYIDFMEDSSFVVEAIELSGPR  659



>ref|XP_009390157.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X1 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009390159.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X1 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009390160.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=665

 Score =   397 bits (1021),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 190/223 (85%), Positives = 207/223 (93%), Gaps = 0/223 (0%)
 Frame = -1

Query  1097  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVS  918
             RKRIALG ARGL+YLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHV+
Sbjct  443   RKRIALGTARGLLYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVT  502

Query  917   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVK  738
             TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKA+DFGR  NQKGV+LDWVK
Sbjct  503   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKALDFGRLTNQKGVMLDWVK  562

Query  737   TLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAE  558
              LHQE KL +MVDKDLKNN++RVELEEM+QVALLCTQF+PS RPKMSEV+RMLEGDGLAE
Sbjct  563   KLHQENKLYMMVDKDLKNNYNRVELEEMIQVALLCTQFHPSQRPKMSEVVRMLEGDGLAE  622

Query  557   KWEASQRNDTPRFRTHENTPQRYSDFIEESSLIVEAMELSGPR  429
             KWEASQR DTP+ R+ E    +Y DF+E+SS +VEA+ELSGPR
Sbjct  623   KWEASQRMDTPKSRSSEQLTPKYIDFMEDSSFVVEAIELSGPR  665



>ref|XP_009403878.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=607

 Score =   394 bits (1013),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 187/223 (84%), Positives = 207/223 (93%), Gaps = 0/223 (0%)
 Frame = -1

Query  1097  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVS  918
             RK+IALG ARGL YLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDH+ESHV+
Sbjct  385   RKKIALGTARGLFYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHQESHVT  444

Query  917   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVK  738
             TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKA+DFGR ANQKGV+LDWVK
Sbjct  445   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKALDFGRLANQKGVMLDWVK  504

Query  737   TLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAE  558
              LHQE +LN+MVDKDLKNN+DRVELEEMVQVALLCTQF+PSHRPKMSEV+RMLEGDGL E
Sbjct  505   KLHQENRLNIMVDKDLKNNYDRVELEEMVQVALLCTQFHPSHRPKMSEVVRMLEGDGLVE  564

Query  557   KWEASQRNDTPRFRTHENTPQRYSDFIEESSLIVEAMELSGPR  429
              W+A Q+ DTP+ R+ E    +Y DF+E+SSL++EA+ELSGPR
Sbjct  565   SWDALQKMDTPKCRSLERQSPKYVDFMEDSSLVLEAIELSGPR  607



>ref|XP_009403877.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=626

 Score =   394 bits (1011),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 187/223 (84%), Positives = 207/223 (93%), Gaps = 0/223 (0%)
 Frame = -1

Query  1097  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVS  918
             RK+IALG ARGL YLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDH+ESHV+
Sbjct  404   RKKIALGTARGLFYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHQESHVT  463

Query  917   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVK  738
             TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKA+DFGR ANQKGV+LDWVK
Sbjct  464   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKALDFGRLANQKGVMLDWVK  523

Query  737   TLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAE  558
              LHQE +LN+MVDKDLKNN+DRVELEEMVQVALLCTQF+PSHRPKMSEV+RMLEGDGL E
Sbjct  524   KLHQENRLNIMVDKDLKNNYDRVELEEMVQVALLCTQFHPSHRPKMSEVVRMLEGDGLVE  583

Query  557   KWEASQRNDTPRFRTHENTPQRYSDFIEESSLIVEAMELSGPR  429
              W+A Q+ DTP+ R+ E    +Y DF+E+SSL++EA+ELSGPR
Sbjct  584   SWDALQKMDTPKCRSLERQSPKYVDFMEDSSLVLEAIELSGPR  626



>ref|XP_002455108.1| hypothetical protein SORBIDRAFT_03g004450 [Sorghum bicolor]
 gb|EES00228.1| hypothetical protein SORBIDRAFT_03g004450 [Sorghum bicolor]
Length=615

 Score =   381 bits (979),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 183/224 (82%), Positives = 205/224 (92%), Gaps = 1/224 (0%)
 Frame = -1

Query  1097  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVS  918
             RKRIALG ARGL+YLHEQCDPKIIHRDVKA+N+LLDE FEA+VGDFGLAKLLDHRESHV+
Sbjct  392   RKRIALGTARGLLYLHEQCDPKIIHRDVKASNVLLDEYFEAIVGDFGLAKLLDHRESHVT  451

Query  917   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVK  738
             TAVRGTVGHIAPEYLSTGQSSEKTDVFGFG+LL+ELITGQKA+DFGR ANQKG +LDWVK
Sbjct  452   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGVLLVELITGQKALDFGRVANQKGGVLDWVK  511

Query  737   TLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAE  558
              LHQE +LN+MVDKDL +N+DRVELEEMVQVALLCTQ++PSHRP+MSEV+RMLEGDGLAE
Sbjct  512   KLHQEKQLNMMVDKDLGSNYDRVELEEMVQVALLCTQYHPSHRPRMSEVIRMLEGDGLAE  571

Query  557   KWEASQRNDTPRFRTHENTPQRYSDF-IEESSLIVEAMELSGPR  429
             KWEASQ  DTP+  + E  P +Y DF  +ESSL +EAMELSGPR
Sbjct  572   KWEASQNVDTPKSVSSEILPPKYMDFAADESSLGLEAMELSGPR  615



>ref|XP_006844161.1| PREDICTED: protein NSP-INTERACTING KINASE 1 [Amborella trichopoda]
 gb|ERN05836.1| hypothetical protein AMTR_s00006p00261510 [Amborella trichopoda]
Length=620

 Score =   381 bits (978),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 180/223 (81%), Positives = 205/223 (92%), Gaps = 0/223 (0%)
 Frame = -1

Query  1097  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVS  918
             RKRIALG ARGL+YLHEQCDPKIIHRDVKAANILLD+  EAVVGDFGLAKLLDHR+SHV+
Sbjct  398   RKRIALGAARGLLYLHEQCDPKIIHRDVKAANILLDDYCEAVVGDFGLAKLLDHRDSHVT  457

Query  917   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVK  738
             TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKA++FG+ ANQKG +LDWVK
Sbjct  458   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKALEFGKAANQKGAMLDWVK  517

Query  737   TLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAE  558
              +HQE KL+L+VDKDLK N+DR+ELEEMVQVALLCTQ+ P HRPKMSEV+RMLEGDGLAE
Sbjct  518   KIHQEKKLDLLVDKDLKINYDRIELEEMVQVALLCTQYLPGHRPKMSEVVRMLEGDGLAE  577

Query  557   KWEASQRNDTPRFRTHENTPQRYSDFIEESSLIVEAMELSGPR  429
             +WEASQR+DT +FR  + + +RYSD  ++SSL+ +AMELSGPR
Sbjct  578   RWEASQRSDTSKFRGSDLSSERYSDLTDDSSLLAQAMELSGPR  620



>ref|XP_011070875.1| PREDICTED: protein NSP-INTERACTING KINASE 2-like [Sesamum indicum]
Length=623

 Score =   380 bits (976),  Expect = 5e-123, Method: Compositional matrix adjust.
 Identities = 180/224 (80%), Positives = 208/224 (93%), Gaps = 1/224 (0%)
 Frame = -1

Query  1097  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVS  918
             RKRIALG ARGL+YLHEQCDPKIIHRDVKAANILLDE +EAVVGDFGLAKLLDHR+SHV+
Sbjct  400   RKRIALGAARGLLYLHEQCDPKIIHRDVKAANILLDEYYEAVVGDFGLAKLLDHRDSHVT  459

Query  917   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVK  738
             TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQ+A++FG+ ANQKG +LDWVK
Sbjct  460   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQRALEFGKAANQKGAMLDWVK  519

Query  737   TLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAE  558
              +HQE KL+++VDKDL+NN+DR+ELEEMVQVALLCTQ+ P+HRPKMSEV+RMLEGDGLAE
Sbjct  520   KIHQEKKLDMLVDKDLRNNYDRIELEEMVQVALLCTQYLPNHRPKMSEVVRMLEGDGLAE  579

Query  557   KWEASQRNDTPRFRTHE-NTPQRYSDFIEESSLIVEAMELSGPR  429
             KWEASQR +  R R +E ++ +RYSD  ++SSL+V+AMELSGPR
Sbjct  580   KWEASQRAEVTRCRANEFSSSERYSDLTDDSSLLVQAMELSGPR  623



>ref|XP_010261784.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like isoform X2 [Nelumbo 
nucifera]
Length=550

 Score =   377 bits (968),  Expect = 9e-123, Method: Compositional matrix adjust.
 Identities = 179/224 (80%), Positives = 205/224 (92%), Gaps = 1/224 (0%)
 Frame = -1

Query  1097  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVS  918
             RKRIALG ARGL+YLHEQCDPKIIHRDVKAANILLD+  EAVVGDFGLAKLLDHR+SHV+
Sbjct  327   RKRIALGAARGLLYLHEQCDPKIIHRDVKAANILLDDYCEAVVGDFGLAKLLDHRDSHVT  386

Query  917   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVK  738
             TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQ+A+DFG+ ANQKG +LDWVK
Sbjct  387   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQRALDFGKAANQKGAMLDWVK  446

Query  737   TLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAE  558
              +HQE KL+ +VDKD+KNN+DRVELEEMVQVALLCTQ+ P HRPKMSEV+RMLEGDGLAE
Sbjct  447   KIHQEKKLDALVDKDMKNNYDRVELEEMVQVALLCTQYLPGHRPKMSEVVRMLEGDGLAE  506

Query  557   KWEASQRNDTPRFRTHE-NTPQRYSDFIEESSLIVEAMELSGPR  429
             +WEASQR +  + + HE ++ +RYSD  ++SSL+V+AMELSGPR
Sbjct  507   RWEASQRAEATKCKPHEFSSSERYSDLTDDSSLLVQAMELSGPR  550



>ref|XP_004238646.1| PREDICTED: protein NSP-INTERACTING KINASE 3 [Solanum lycopersicum]
Length=603

 Score =   377 bits (969),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 183/224 (82%), Positives = 203/224 (91%), Gaps = 2/224 (1%)
 Frame = -1

Query  1097  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVS  918
             RK+IA G ARGLVYLHEQCDPKIIHRDVKAANILLDE+FEAVVGDFGLAKLLDH +SHV+
Sbjct  381   RKKIAQGTARGLVYLHEQCDPKIIHRDVKAANILLDEEFEAVVGDFGLAKLLDHCDSHVT  440

Query  917   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVI-LDWV  741
             TAVRGT+GHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKA+DFGRGANQKGV+ LDWV
Sbjct  441   TAVRGTIGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAMDFGRGANQKGVVMLDWV  500

Query  740   KTLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLA  561
             + LHQE KLNLMVD +L+N+F+R+ELEEMV+VALLCT FNP HRPKMSE LRMLEGDGLA
Sbjct  501   RKLHQEDKLNLMVDSNLRNSFERIELEEMVKVALLCTHFNPCHRPKMSEALRMLEGDGLA  560

Query  560   EKWEASQRNDTPRFRTHENTPQRYSDFIEESSLIVEAMELSGPR  429
             E+W ASQ  +T R R  E TPQ YSD++++SSL VE MELSGPR
Sbjct  561   EQWAASQNLETRRKRAFEPTPQTYSDYVQDSSL-VEPMELSGPR  603



>ref|XP_006643812.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like [Oryza brachyantha]
Length=590

 Score =   376 bits (966),  Expect = 6e-122, Method: Compositional matrix adjust.
 Identities = 181/224 (81%), Positives = 204/224 (91%), Gaps = 1/224 (0%)
 Frame = -1

Query  1097  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVS  918
             RKRIALG ARGL+YLHEQCDPKIIHRDVKA+N+LLDE FEA+VGDFGLAKLLDHRESHV+
Sbjct  367   RKRIALGTARGLLYLHEQCDPKIIHRDVKASNVLLDEYFEAIVGDFGLAKLLDHRESHVT  426

Query  917   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVK  738
             TAVRGTVGHIAPEYLSTGQSSEKTDVFGFG+LL+ELITGQKA+DFGR ANQKG +LDWVK
Sbjct  427   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGVLLVELITGQKALDFGRIANQKGGVLDWVK  486

Query  737   TLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAE  558
              LHQE +L++MVDKDL +N+DRVELEEMVQVALLCTQ+ PSHRP+MSEV+RMLEGDGLAE
Sbjct  487   KLHQEKQLSMMVDKDLGSNYDRVELEEMVQVALLCTQYYPSHRPRMSEVIRMLEGDGLAE  546

Query  557   KWEASQRNDTPRFRTHENTPQRYSDF-IEESSLIVEAMELSGPR  429
             KWEASQ  DTP+  + E  P ++ DF  +ESSL +EAMELSGPR
Sbjct  547   KWEASQNVDTPKSVSSELLPPKFMDFAADESSLGLEAMELSGPR  590



>ref|XP_010261776.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like isoform X1 [Nelumbo 
nucifera]
Length=623

 Score =   377 bits (968),  Expect = 9e-122, Method: Compositional matrix adjust.
 Identities = 179/224 (80%), Positives = 205/224 (92%), Gaps = 1/224 (0%)
 Frame = -1

Query  1097  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVS  918
             RKRIALG ARGL+YLHEQCDPKIIHRDVKAANILLD+  EAVVGDFGLAKLLDHR+SHV+
Sbjct  400   RKRIALGAARGLLYLHEQCDPKIIHRDVKAANILLDDYCEAVVGDFGLAKLLDHRDSHVT  459

Query  917   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVK  738
             TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQ+A+DFG+ ANQKG +LDWVK
Sbjct  460   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQRALDFGKAANQKGAMLDWVK  519

Query  737   TLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAE  558
              +HQE KL+ +VDKD+KNN+DRVELEEMVQVALLCTQ+ P HRPKMSEV+RMLEGDGLAE
Sbjct  520   KIHQEKKLDALVDKDMKNNYDRVELEEMVQVALLCTQYLPGHRPKMSEVVRMLEGDGLAE  579

Query  557   KWEASQRNDTPRFRTHE-NTPQRYSDFIEESSLIVEAMELSGPR  429
             +WEASQR +  + + HE ++ +RYSD  ++SSL+V+AMELSGPR
Sbjct  580   RWEASQRAEATKCKPHEFSSSERYSDLTDDSSLLVQAMELSGPR  623



>emb|CAN63733.1| hypothetical protein VITISV_025883 [Vitis vinifera]
Length=609

 Score =   376 bits (966),  Expect = 9e-122, Method: Compositional matrix adjust.
 Identities = 178/224 (79%), Positives = 206/224 (92%), Gaps = 1/224 (0%)
 Frame = -1

Query  1097  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVS  918
             RKRIALG ARGL+YLHEQCDPKIIHRDVKAANILLD+  EAVVGDFGLAKLLDHR+SHV+
Sbjct  386   RKRIALGAARGLLYLHEQCDPKIIHRDVKAANILLDDYCEAVVGDFGLAKLLDHRDSHVT  445

Query  917   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVK  738
             TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQ+A++FG+ ANQKG +LDWVK
Sbjct  446   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQRALEFGKAANQKGAMLDWVK  505

Query  737   TLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAE  558
              +HQE KL+++VDKDLK N+DR+ELEEMVQVALLCTQ+ PSHRPKMSEV+RMLEGDGLAE
Sbjct  506   KIHQEKKLDMLVDKDLKANYDRIELEEMVQVALLCTQYLPSHRPKMSEVVRMLEGDGLAE  565

Query  557   KWEASQRNDTPRFRTHE-NTPQRYSDFIEESSLIVEAMELSGPR  429
             KWEA+QR +  R + +E ++ +RYSD  ++SSL+V+AMELSGPR
Sbjct  566   KWEATQRAEATRCKANEFSSSERYSDLTDDSSLLVQAMELSGPR  609



>dbj|BAD68255.1| putative brassinosteroid insensitive 1-associated receptor kinase 
1 [Oryza sativa Japonica Group]
 dbj|BAE96298.1| SERK like protein kinase [Oryza sativa Japonica Group]
 gb|EAZ10713.1| hypothetical protein OsJ_00547 [Oryza sativa Japonica Group]
 dbj|BAG94399.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC70017.1| hypothetical protein OsI_00578 [Oryza sativa Indica Group]
Length=628

 Score =   377 bits (968),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 181/224 (81%), Positives = 204/224 (91%), Gaps = 1/224 (0%)
 Frame = -1

Query  1097  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVS  918
             RKRIALG ARGL+YLHEQCDPKIIHRDVKA+N+LLDE FEA+VGDFGLAKLLDHRESHV+
Sbjct  405   RKRIALGTARGLLYLHEQCDPKIIHRDVKASNVLLDEYFEAIVGDFGLAKLLDHRESHVT  464

Query  917   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVK  738
             TAVRGTVGHIAPEYLSTGQSSEKTDVFGFG+LL+ELITGQKA+DFGR ANQKG +LDWVK
Sbjct  465   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGVLLVELITGQKALDFGRLANQKGGVLDWVK  524

Query  737   TLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAE  558
              LHQE +L++MVDKDL +N+DRVELEEMVQVALLCTQ+ PSHRP+MSEV+RMLEGDGLAE
Sbjct  525   KLHQEKQLSMMVDKDLGSNYDRVELEEMVQVALLCTQYYPSHRPRMSEVIRMLEGDGLAE  584

Query  557   KWEASQRNDTPRFRTHENTPQRYSDF-IEESSLIVEAMELSGPR  429
             KWEASQ  DTP+  + E  P ++ DF  +ESSL +EAMELSGPR
Sbjct  585   KWEASQNVDTPKSVSSELLPPKFMDFAADESSLGLEAMELSGPR  628



>emb|CDP00520.1| unnamed protein product [Coffea canephora]
Length=623

 Score =   377 bits (967),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 180/224 (80%), Positives = 205/224 (92%), Gaps = 1/224 (0%)
 Frame = -1

Query  1097  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVS  918
             RKRIALG ARGL+YLHEQCDPKIIHRDVKAANILLD+  EAVVGDFGLAKLLDHR+SHV+
Sbjct  400   RKRIALGAARGLLYLHEQCDPKIIHRDVKAANILLDDYCEAVVGDFGLAKLLDHRDSHVT  459

Query  917   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVK  738
             TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQ+A++FG+ ANQKG +LDWVK
Sbjct  460   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQRALEFGKAANQKGAMLDWVK  519

Query  737   TLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAE  558
              +HQE KL L+VDKDLKN++DR+ELEEM QVALLCTQ+ PSHRPKMSEV+RMLEGDGLAE
Sbjct  520   KIHQEKKLELLVDKDLKNSYDRIELEEMAQVALLCTQYLPSHRPKMSEVVRMLEGDGLAE  579

Query  557   KWEASQRNDTPRFRTHE-NTPQRYSDFIEESSLIVEAMELSGPR  429
             KWEASQR +  R R +E ++ +RYSD  ++SSL+V+AMELSGPR
Sbjct  580   KWEASQRAEATRCRANEFSSSERYSDLTDDSSLLVQAMELSGPR  623



>ref|XP_004968347.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like [Setaria italica]
Length=633

 Score =   377 bits (967),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 181/224 (81%), Positives = 204/224 (91%), Gaps = 1/224 (0%)
 Frame = -1

Query  1097  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVS  918
             RKRIALG ARGL+YLHEQCDPKIIHRDVKA+N+LLDE FEA+VGDFGLAKLLDH+ESHV+
Sbjct  410   RKRIALGTARGLLYLHEQCDPKIIHRDVKASNVLLDEYFEAIVGDFGLAKLLDHQESHVT  469

Query  917   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVK  738
             TAVRGTVGHIAPEYLSTGQSSEKTDVFGFG+LL+ELITGQKA+DFGR ANQKG +LDWVK
Sbjct  470   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGVLLVELITGQKALDFGRVANQKGGVLDWVK  529

Query  737   TLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAE  558
              LHQE +L++MVDKDL +N+DRVELEEMVQVALLCTQ+ PSHRP+MSEV+RMLEGDGLAE
Sbjct  530   KLHQEKQLSMMVDKDLGSNYDRVELEEMVQVALLCTQYYPSHRPRMSEVIRMLEGDGLAE  589

Query  557   KWEASQRNDTPRFRTHENTPQRYSDF-IEESSLIVEAMELSGPR  429
             KWEASQ  DTP+  + E  P +Y DF  +ESSL +EAMELSGPR
Sbjct  590   KWEASQNVDTPKSVSSELLPPKYMDFAADESSLGLEAMELSGPR  633



>ref|XP_008446509.1| PREDICTED: protein NSP-INTERACTING KINASE 2 isoform X3 [Cucumis 
melo]
Length=510

 Score =   373 bits (957),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 176/224 (79%), Positives = 204/224 (91%), Gaps = 1/224 (0%)
 Frame = -1

Query  1097  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVS  918
             RKRIALG ARGL+YLHEQCDPKIIHRDVKAANILLD+  EAVVGDFGLAKLLDHR+SHV+
Sbjct  287   RKRIALGAARGLLYLHEQCDPKIIHRDVKAANILLDDYCEAVVGDFGLAKLLDHRDSHVT  346

Query  917   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVK  738
             TAVRGTVGHIAPEYLSTGQSSEKTDVFG+GILLLELITGQ+A++FG+  NQKG +LDWVK
Sbjct  347   TAVRGTVGHIAPEYLSTGQSSEKTDVFGYGILLLELITGQRALEFGKAVNQKGAMLDWVK  406

Query  737   TLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAE  558
              +HQE KL L+VDKDL++N+DR+ELEEMVQVALLCTQ+ P+ RPKMSEV+RMLEGDGLAE
Sbjct  407   KIHQEKKLELLVDKDLRSNYDRIELEEMVQVALLCTQYLPTTRPKMSEVVRMLEGDGLAE  466

Query  557   KWEASQRNDTPRFRTHE-NTPQRYSDFIEESSLIVEAMELSGPR  429
             KWEASQR D  R+R +E ++ +RYSD  ++SSL+ +AMELSGPR
Sbjct  467   KWEASQRADANRYRVNEFSSSERYSDLTDDSSLLAQAMELSGPR  510



>ref|XP_003637897.1| Receptor-like kinase [Medicago truncatula]
Length=496

 Score =   372 bits (955),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 174/224 (78%), Positives = 205/224 (92%), Gaps = 1/224 (0%)
 Frame = -1

Query  1097  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVS  918
             RKRIALG  RGL+YLHEQCDPKIIHRDVKAANILLD+  EAVVGDFGLAKLLDHR+SHV+
Sbjct  273   RKRIALGAGRGLLYLHEQCDPKIIHRDVKAANILLDDYCEAVVGDFGLAKLLDHRDSHVT  332

Query  917   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVK  738
             TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELI+GQ+A++FG+ ANQKG +LDWVK
Sbjct  333   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELISGQRALEFGKAANQKGAMLDWVK  392

Query  737   TLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAE  558
              +HQE K++++VDKDLKN +DR+EL+E+VQVALLCTQ+ PSHRPKMSEV+RMLEGDGLAE
Sbjct  393   KIHQEKKIDVLVDKDLKNKYDRIELDEIVQVALLCTQYLPSHRPKMSEVVRMLEGDGLAE  452

Query  557   KWEASQRNDTPRFRTHE-NTPQRYSDFIEESSLIVEAMELSGPR  429
             KWEASQR ++ R R +E ++ +RYSD  ++SSL+ +AMELSGPR
Sbjct  453   KWEASQRAESTRSRGNELSSSERYSDLTDDSSLLAQAMELSGPR  496



>ref|XP_002269902.1| PREDICTED: protein NSP-INTERACTING KINASE 1 [Vitis vinifera]
 emb|CBI27432.3| unnamed protein product [Vitis vinifera]
Length=625

 Score =   376 bits (965),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 178/224 (79%), Positives = 206/224 (92%), Gaps = 1/224 (0%)
 Frame = -1

Query  1097  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVS  918
             RKRIALG ARGL+YLHEQCDPKIIHRDVKAANILLD+  EAVVGDFGLAKLLDHR+SHV+
Sbjct  402   RKRIALGAARGLLYLHEQCDPKIIHRDVKAANILLDDYCEAVVGDFGLAKLLDHRDSHVT  461

Query  917   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVK  738
             TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQ+A++FG+ ANQKG +LDWVK
Sbjct  462   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQRALEFGKAANQKGAMLDWVK  521

Query  737   TLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAE  558
              +HQE KL+++VDKDLK N+DR+ELEEMVQVALLCTQ+ PSHRPKMSEV+RMLEGDGLAE
Sbjct  522   KIHQEKKLDMLVDKDLKANYDRIELEEMVQVALLCTQYLPSHRPKMSEVVRMLEGDGLAE  581

Query  557   KWEASQRNDTPRFRTHE-NTPQRYSDFIEESSLIVEAMELSGPR  429
             KWEA+QR +  R + +E ++ +RYSD  ++SSL+V+AMELSGPR
Sbjct  582   KWEATQRAEATRCKANEFSSSERYSDLTDDSSLLVQAMELSGPR  625



>ref|XP_008797566.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like [Phoenix dactylifera]
Length=624

 Score =   376 bits (965),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 178/224 (79%), Positives = 206/224 (92%), Gaps = 1/224 (0%)
 Frame = -1

Query  1097  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVS  918
             RKRIALG ARGL+YLHEQCDPKIIHRDVKAANILLD+  EAVVGDFGLAKLLDHRESHV+
Sbjct  401   RKRIALGAARGLLYLHEQCDPKIIHRDVKAANILLDDYCEAVVGDFGLAKLLDHRESHVT  460

Query  917   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVK  738
             TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITG +A++FG+ ANQKG +LDWVK
Sbjct  461   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGLRAMEFGKAANQKGAMLDWVK  520

Query  737   TLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAE  558
              +HQE KL+++VDKDLKN++DR+ELEE VQVALLCTQ+ PSHRPKMSEV+RMLEGDGLAE
Sbjct  521   KIHQEKKLDMLVDKDLKNDYDRIELEETVQVALLCTQYLPSHRPKMSEVVRMLEGDGLAE  580

Query  557   KWEASQRNDTPRFRTHE-NTPQRYSDFIEESSLIVEAMELSGPR  429
             +WEASQR + P+F+  E ++ +RYSD  ++SSL+V+AMELSGPR
Sbjct  581   RWEASQRAEAPKFKMPEVSSSERYSDLTDDSSLLVQAMELSGPR  624



>ref|XP_011655742.1| PREDICTED: protein NSP-INTERACTING KINASE 2 isoform X4 [Cucumis 
sativus]
Length=510

 Score =   372 bits (955),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 175/224 (78%), Positives = 204/224 (91%), Gaps = 1/224 (0%)
 Frame = -1

Query  1097  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVS  918
             RKRIALG ARGL+YLHEQCDPKIIHRDVKAANILLD+  EAVVGDFGLAKLLDHR+SHV+
Sbjct  287   RKRIALGAARGLLYLHEQCDPKIIHRDVKAANILLDDYCEAVVGDFGLAKLLDHRDSHVT  346

Query  917   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVK  738
             TAVRGTVGHIAPEYLSTGQSSEKTDVFG+GILLLELITGQ+A++FG+  NQKG +LDWVK
Sbjct  347   TAVRGTVGHIAPEYLSTGQSSEKTDVFGYGILLLELITGQRALEFGKAVNQKGAMLDWVK  406

Query  737   TLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAE  558
              +HQE KL ++VDKDL++N+DR+ELEEMVQVALLCTQ+ P+ RPKMSEV+RMLEGDGLAE
Sbjct  407   KIHQEKKLEILVDKDLRSNYDRIELEEMVQVALLCTQYLPTTRPKMSEVVRMLEGDGLAE  466

Query  557   KWEASQRNDTPRFRTHE-NTPQRYSDFIEESSLIVEAMELSGPR  429
             KWEASQR D  R+R +E ++ +RYSD  ++SSL+ +AMELSGPR
Sbjct  467   KWEASQRADANRYRVNEFSSSERYSDLTDDSSLLAQAMELSGPR  510



>ref|XP_002886588.1| nsp-interacting kinase 3 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH62847.1| nsp-interacting kinase 3 [Arabidopsis lyrata subsp. lyrata]
Length=629

 Score =   376 bits (965),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 182/231 (79%), Positives = 203/231 (88%), Gaps = 8/231 (3%)
 Frame = -1

Query  1097  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVS  918
             RK+IA+G ARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHR+SHV+
Sbjct  399   RKKIAVGTARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRDSHVT  458

Query  917   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVK  738
             TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKA+DFGR A+QKGV+LDWVK
Sbjct  459   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKALDFGRSAHQKGVMLDWVK  518

Query  737   TLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAE  558
              LHQEGKL  ++DKDL + FDRVELEE+VQVALLCTQFNPSHRPKMSEV++MLEGDGLAE
Sbjct  519   KLHQEGKLKQLIDKDLNDKFDRVELEEIVQVALLCTQFNPSHRPKMSEVMKMLEGDGLAE  578

Query  557   KWEASQRNDT--------PRFRTHENTPQRYSDFIEESSLIVEAMELSGPR  429
             +WEA+Q            P   +     + YSD+I+ESSL+VEA+ELSGPR
Sbjct  579   RWEATQNGTAEHQPPPLPPGMVSSSPRVRYYSDYIQESSLVVEAIELSGPR  629



>ref|XP_004490300.1| PREDICTED: protein NSP-INTERACTING KINASE 2-like [Cicer arietinum]
Length=622

 Score =   375 bits (964),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 177/224 (79%), Positives = 207/224 (92%), Gaps = 1/224 (0%)
 Frame = -1

Query  1097  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVS  918
             RKRIALG  RGL+YLHEQCDPKIIHRDVKAANILLDED EAVVGDFGLAKLLDHR+SHV+
Sbjct  399   RKRIALGAGRGLLYLHEQCDPKIIHRDVKAANILLDEDCEAVVGDFGLAKLLDHRDSHVT  458

Query  917   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVK  738
             TAVRGTVGHIAPEYLSTGQSS+KTDVFGFGILLLELI+GQ+A++FG+ ANQKG +LDWVK
Sbjct  459   TAVRGTVGHIAPEYLSTGQSSDKTDVFGFGILLLELISGQRALEFGKAANQKGAMLDWVK  518

Query  737   TLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAE  558
              +HQE K++L+VDKDLKNN+DR+EL+E+VQVALLCTQ+ PSHRPKMSEV+RMLEGDGLAE
Sbjct  519   KIHQEKKIDLLVDKDLKNNYDRIELDEIVQVALLCTQYLPSHRPKMSEVVRMLEGDGLAE  578

Query  557   KWEASQRNDTPRFRTHE-NTPQRYSDFIEESSLIVEAMELSGPR  429
             KWEASQR ++ R R +E ++ +RYSD  ++SSL+ +AMELSGPR
Sbjct  579   KWEASQRAESTRSRGNELSSSERYSDLTDDSSLLAQAMELSGPR  622



>ref|XP_010681338.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like [Beta vulgaris 
subsp. vulgaris]
Length=627

 Score =   375 bits (964),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 179/224 (80%), Positives = 205/224 (92%), Gaps = 1/224 (0%)
 Frame = -1

Query  1097  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVS  918
             RKRIALG ARGL+YLHEQCDPKIIHRDVKAANILLD+D EAVVGDFGLAKLLDHR+SHV+
Sbjct  404   RKRIALGAARGLLYLHEQCDPKIIHRDVKAANILLDDDCEAVVGDFGLAKLLDHRDSHVT  463

Query  917   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVK  738
             TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQ+A+DFG+ ANQKG +LDWVK
Sbjct  464   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQRAIDFGKAANQKGAMLDWVK  523

Query  737   TLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAE  558
              ++QE KL ++VDKDLKNN+D +ELEE+VQVALLCTQF P+ RP+MSEV+RMLEGDGLAE
Sbjct  524   KINQEKKLEMLVDKDLKNNYDSIELEEIVQVALLCTQFLPNQRPRMSEVVRMLEGDGLAE  583

Query  557   KWEASQRNDTPRFRTHE-NTPQRYSDFIEESSLIVEAMELSGPR  429
             KWEASQR D+ R R  E ++ +RYSD  ++SSL+V+AMELSGPR
Sbjct  584   KWEASQRADSTRSRVTEFSSSERYSDLTDDSSLLVQAMELSGPR  627



>ref|XP_006301740.1| hypothetical protein CARUB_v10022201mg [Capsella rubella]
 gb|EOA34638.1| hypothetical protein CARUB_v10022201mg [Capsella rubella]
Length=634

 Score =   375 bits (964),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 182/231 (79%), Positives = 204/231 (88%), Gaps = 8/231 (3%)
 Frame = -1

Query  1097  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVS  918
             RK+IA+G ARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHR+SHV+
Sbjct  404   RKKIAVGTARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRDSHVT  463

Query  917   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVK  738
             TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKA+DFGR ++QKGV+LDWVK
Sbjct  464   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKALDFGRSSHQKGVMLDWVK  523

Query  737   TLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAE  558
              LHQEGKL  ++DKDL + FDRVELEE+VQVALLCTQFNPSHRPKMSEV++MLEGDGLAE
Sbjct  524   KLHQEGKLKQLIDKDLSDKFDRVELEEIVQVALLCTQFNPSHRPKMSEVMKMLEGDGLAE  583

Query  557   KWEASQRND--------TPRFRTHENTPQRYSDFIEESSLIVEAMELSGPR  429
             +WEASQ  +         P   +     + YSD+I+ESSL+VEA+ELSGPR
Sbjct  584   RWEASQTGNGDSQPPPLPPGMVSSSPRVRYYSDYIQESSLVVEAIELSGPR  634



>ref|XP_010257839.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like [Nelumbo nucifera]
Length=624

 Score =   375 bits (963),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 177/224 (79%), Positives = 207/224 (92%), Gaps = 1/224 (0%)
 Frame = -1

Query  1097  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVS  918
             RKRIALG ARGL+YLHEQCDPKIIHRDVKAANILLD+  EAVVGDFGLAKLLDH++SHV+
Sbjct  401   RKRIALGAARGLLYLHEQCDPKIIHRDVKAANILLDDYCEAVVGDFGLAKLLDHQDSHVT  460

Query  917   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVK  738
             TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQ+A++FG+ ANQKG +LDWVK
Sbjct  461   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQRALEFGKAANQKGAMLDWVK  520

Query  737   TLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAE  558
              +HQE KL+++VDKDLK+N+DR+ELEEMVQVALLCTQ+ P HRPKMSEV+RMLEGDGLAE
Sbjct  521   KIHQEKKLDMLVDKDLKDNYDRIELEEMVQVALLCTQYLPGHRPKMSEVVRMLEGDGLAE  580

Query  557   KWEASQRNDTPRFRTHE-NTPQRYSDFIEESSLIVEAMELSGPR  429
             +WEASQR +T + + HE ++ +RYSD  ++SSL+V+AMELSGPR
Sbjct  581   RWEASQRAETTKCKPHEFSSSERYSDLTDDSSLLVQAMELSGPR  624



>gb|AAB71968.1| Putative Serine/Threonine protein kinase [Arabidopsis thaliana]
Length=588

 Score =   374 bits (960),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 182/231 (79%), Positives = 203/231 (88%), Gaps = 8/231 (3%)
 Frame = -1

Query  1097  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVS  918
             RK+IA+G ARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHR+SHV+
Sbjct  358   RKKIAVGTARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRDSHVT  417

Query  917   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVK  738
             TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKA+DFGR A+QKGV+LDWVK
Sbjct  418   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKALDFGRSAHQKGVMLDWVK  477

Query  737   TLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAE  558
              LHQEGKL  ++DKDL + FDRVELEE+VQVALLCTQFNPSHRPKMSEV++MLEGDGLAE
Sbjct  478   KLHQEGKLKQLIDKDLNDKFDRVELEEIVQVALLCTQFNPSHRPKMSEVMKMLEGDGLAE  537

Query  557   KWEASQRND--------TPRFRTHENTPQRYSDFIEESSLIVEAMELSGPR  429
             +WEA+Q            P   +     + YSD+I+ESSL+VEA+ELSGPR
Sbjct  538   RWEATQNGTGEHQPPPLPPGMVSSSPRVRYYSDYIQESSLVVEAIELSGPR  588



>ref|NP_176279.1| NSP-interacting kinase 3 [Arabidopsis thaliana]
 sp|Q93ZS4.1|NIK3_ARATH RecName: Full=Protein NSP-INTERACTING KINASE 3; AltName: Full=LRR 
receptor-like serine/threonine-protein kinase NIK3; Flags: 
Precursor [Arabidopsis thaliana]
 gb|AAL07143.1| putative receptor kinase [Arabidopsis thaliana]
 gb|AAN12912.1| putative receptor kinase [Arabidopsis thaliana]
 gb|ACN59261.1| leucine-rich repeat receptor-like protein kinase [Arabidopsis 
thaliana]
 gb|AEE33734.1| NSP-interacting kinase 3 [Arabidopsis thaliana]
Length=632

 Score =   375 bits (963),  Expect = 6e-121, Method: Compositional matrix adjust.
 Identities = 182/231 (79%), Positives = 203/231 (88%), Gaps = 8/231 (3%)
 Frame = -1

Query  1097  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVS  918
             RK+IA+G ARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHR+SHV+
Sbjct  402   RKKIAVGTARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRDSHVT  461

Query  917   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVK  738
             TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKA+DFGR A+QKGV+LDWVK
Sbjct  462   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKALDFGRSAHQKGVMLDWVK  521

Query  737   TLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAE  558
              LHQEGKL  ++DKDL + FDRVELEE+VQVALLCTQFNPSHRPKMSEV++MLEGDGLAE
Sbjct  522   KLHQEGKLKQLIDKDLNDKFDRVELEEIVQVALLCTQFNPSHRPKMSEVMKMLEGDGLAE  581

Query  557   KWEASQRND--------TPRFRTHENTPQRYSDFIEESSLIVEAMELSGPR  429
             +WEA+Q            P   +     + YSD+I+ESSL+VEA+ELSGPR
Sbjct  582   RWEATQNGTGEHQPPPLPPGMVSSSPRVRYYSDYIQESSLVVEAIELSGPR  632



>ref|XP_004238998.1| PREDICTED: protein NSP-INTERACTING KINASE 1 [Solanum lycopersicum]
Length=621

 Score =   375 bits (962),  Expect = 7e-121, Method: Compositional matrix adjust.
 Identities = 177/224 (79%), Positives = 208/224 (93%), Gaps = 1/224 (0%)
 Frame = -1

Query  1097  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVS  918
             RKRIALG ARGL+YLHEQCDPKIIHRDVKAANILLD+D EAVVGDFGLAKLLDHR+SHV+
Sbjct  398   RKRIALGAARGLLYLHEQCDPKIIHRDVKAANILLDDDCEAVVGDFGLAKLLDHRDSHVT  457

Query  917   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVK  738
             TAVRGTVGHIAPEYLSTGQSS+KTDVFGFGILLLELI+GQ+A++FG+ ANQKGV+LDWVK
Sbjct  458   TAVRGTVGHIAPEYLSTGQSSDKTDVFGFGILLLELISGQRALEFGKAANQKGVMLDWVK  517

Query  737   TLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAE  558
              +H E KL+L+V KDLK+ +DR+ELEEMVQVAL+CTQ++PSHRPKMSEV+RMLEGDGLAE
Sbjct  518   KIHLEKKLDLLVSKDLKDKYDRIELEEMVQVALICTQYHPSHRPKMSEVVRMLEGDGLAE  577

Query  557   KWEASQRNDTPRFRTHE-NTPQRYSDFIEESSLIVEAMELSGPR  429
             KWEASQR ++ R R +E ++ +RYSD  ++SSL+V+AMELSGPR
Sbjct  578   KWEASQRAESTRCRANEFSSSERYSDLTDDSSLLVQAMELSGPR  621



>emb|CDY44608.1| BnaCnng11570D [Brassica napus]
Length=507

 Score =   370 bits (951),  Expect = 9e-121, Method: Compositional matrix adjust.
 Identities = 178/223 (80%), Positives = 200/223 (90%), Gaps = 5/223 (2%)
 Frame = -1

Query  1097  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVS  918
             RK+IA+G ARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHR+SHV+
Sbjct  290   RKKIAVGTARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRDSHVT  349

Query  917   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVK  738
             TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKA+DFGR ++QKGV+LDWVK
Sbjct  350   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKALDFGRSSHQKGVMLDWVK  409

Query  737   TLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAE  558
              LHQEGKL  ++DKDL + +D VELEE+VQVALLCTQFNPS+RPKMSEV++MLEGDGLA+
Sbjct  410   KLHQEGKLKQLIDKDLNDKYDTVELEEIVQVALLCTQFNPSNRPKMSEVMKMLEGDGLAD  469

Query  557   KWEASQRNDTPRFRTHENTPQRYSDFIEESSLIVEAMELSGPR  429
             +WEASQ             P  YSD+I+ESSL+VEA+ELSGPR
Sbjct  470   RWEASQSGGAKSL-----PPPYYSDYIQESSLVVEAIELSGPR  507



>ref|NP_001140727.1| uncharacterized LOC100272802 [Zea mays]
 gb|ACF84475.1| unknown [Zea mays]
 gb|ACR35282.1| unknown [Zea mays]
 gb|AFW80156.1| putative leucine-rich repeat receptor-like protein kinase family 
protein [Zea mays]
Length=251

 Score =   361 bits (927),  Expect = 9e-121, Method: Compositional matrix adjust.
 Identities = 176/227 (78%), Positives = 204/227 (90%), Gaps = 4/227 (2%)
 Frame = -1

Query  1097  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVS  918
             RKR+ALG ARGL+YLHEQCDPKIIHRDVKA+N+LLDE FEA+VGDFGLAKLLDHRESHV+
Sbjct  25    RKRVALGTARGLLYLHEQCDPKIIHRDVKASNVLLDEYFEAIVGDFGLAKLLDHRESHVT  84

Query  917   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVK  738
             TAVRGTVGHIAPEYLSTGQSSEKTDVFGFG+LL+EL+TGQKA+DFGR ANQKG +LDWVK
Sbjct  85    TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGVLLVELVTGQKALDFGRVANQKGGVLDWVK  144

Query  737   TLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGD-GLA  561
              LHQE +L +MVDKDL +++D VELEEMVQ+ALLCTQ++PSHRP+MSEV+RMLEG+ GLA
Sbjct  145   KLHQEKQLGVMVDKDLGSSYDGVELEEMVQLALLCTQYHPSHRPRMSEVIRMLEGEPGLA  204

Query  560   EKWEASQRN-DTPRFRTHENTPQRYSDF--IEESSLIVEAMELSGPR  429
             E+WEASQ N DTP+  + E  P +Y DF   +ESSL +EAMELSGPR
Sbjct  205   ERWEASQSNVDTPKSVSSELLPPKYVDFAAADESSLGLEAMELSGPR  251



>emb|CDY61508.1| BnaCnng37930D [Brassica napus]
Length=507

 Score =   370 bits (951),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 178/223 (80%), Positives = 200/223 (90%), Gaps = 5/223 (2%)
 Frame = -1

Query  1097  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVS  918
             RK+IA+G ARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHR+SHV+
Sbjct  290   RKKIAVGTARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRDSHVT  349

Query  917   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVK  738
             TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKA+DFGR ++QKGV+LDWVK
Sbjct  350   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKALDFGRSSHQKGVMLDWVK  409

Query  737   TLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAE  558
              LHQEGKL  ++DKDL + +D VELEE+VQVALLCTQFNPS+RPKMSEV++MLEGDGLA+
Sbjct  410   KLHQEGKLKQLIDKDLNDKYDTVELEEIVQVALLCTQFNPSNRPKMSEVMKMLEGDGLAD  469

Query  557   KWEASQRNDTPRFRTHENTPQRYSDFIEESSLIVEAMELSGPR  429
             +WEASQ             P  YSD+I+ESSL+VEA+ELSGPR
Sbjct  470   RWEASQSGGAKSL-----PPPYYSDYIQESSLVVEAIELSGPR  507



>ref|XP_002532890.1| BRASSINOSTEROID INSENSITIVE 1-associated receptor kinase 1 precursor, 
putative [Ricinus communis]
 gb|EEF29495.1| BRASSINOSTEROID INSENSITIVE 1-associated receptor kinase 1 precursor, 
putative [Ricinus communis]
Length=624

 Score =   374 bits (960),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 178/224 (79%), Positives = 206/224 (92%), Gaps = 1/224 (0%)
 Frame = -1

Query  1097  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVS  918
             RKRIALG ARGL+YLHEQCDPKIIHRDVKAANILLD+  EAVVGDFGLAKLLDH++SHV+
Sbjct  401   RKRIALGAARGLLYLHEQCDPKIIHRDVKAANILLDDYCEAVVGDFGLAKLLDHQDSHVT  460

Query  917   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVK  738
             TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQ+A++FG+ ANQKG +LDWVK
Sbjct  461   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQRALEFGKAANQKGAMLDWVK  520

Query  737   TLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAE  558
              +HQE KL ++VDKDLK+N+DR+ELEEMVQVALLCTQF PSHRPKMSEV+RMLEGDGLAE
Sbjct  521   KIHQEKKLEMLVDKDLKSNYDRIELEEMVQVALLCTQFLPSHRPKMSEVVRMLEGDGLAE  580

Query  557   KWEASQRNDTPRFRTHE-NTPQRYSDFIEESSLIVEAMELSGPR  429
             +WEASQR ++ + + HE ++  RYSD  ++SSL+V+AMELSGPR
Sbjct  581   RWEASQRAESTKSKLHEFSSSDRYSDLTDDSSLLVQAMELSGPR  624



>tpg|DAA53257.1| TPA: putative leucine-rich repeat receptor-like protein kinase 
family protein [Zea mays]
Length=428

 Score =   367 bits (942),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 178/224 (79%), Positives = 201/224 (90%), Gaps = 1/224 (0%)
 Frame = -1

Query  1097  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVS  918
             RKRIALG ARGL+YLHEQCDPKIIHRDVKA+N+LLDE FEA+VGDFGLAKLLDHRESHV+
Sbjct  205   RKRIALGTARGLLYLHEQCDPKIIHRDVKASNVLLDEYFEAIVGDFGLAKLLDHRESHVT  264

Query  917   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVK  738
             TAVRGTVGHIAPEYLSTGQSSEKTDVFGFG+LL+ELITGQKA+DFGR ANQKG +LDWVK
Sbjct  265   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGVLLVELITGQKALDFGRVANQKGGVLDWVK  324

Query  737   TLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAE  558
              LHQE +L  MVDKDL +++DRVELEEMVQV+LLCTQ++PSHRP+MSEV+RMLEGDGLAE
Sbjct  325   KLHQEKQLGTMVDKDLGSSYDRVELEEMVQVSLLCTQYHPSHRPRMSEVIRMLEGDGLAE  384

Query  557   KWEASQRNDTPRFRTHENTPQRYSDF-IEESSLIVEAMELSGPR  429
             +WEASQ  DTP   + E   Q+Y DF  +E SL +EAMELSGPR
Sbjct  385   RWEASQNVDTPESVSSELLLQKYMDFAADECSLGLEAMELSGPR  428



>gb|KEH21800.1| NSP-interacting kinase-like protein [Medicago truncatula]
Length=626

 Score =   373 bits (958),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 176/224 (79%), Positives = 204/224 (91%), Gaps = 1/224 (0%)
 Frame = -1

Query  1097  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVS  918
             RK IALG ARGL+YLHEQCDPKIIHRDVKAANILLD  +EAVVGDFGLAKLLDH++SHV+
Sbjct  403   RKNIALGAARGLLYLHEQCDPKIIHRDVKAANILLDNYYEAVVGDFGLAKLLDHQDSHVT  462

Query  917   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVK  738
             TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQ+A++FG+ ANQKG +LDWVK
Sbjct  463   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQRALEFGKAANQKGAMLDWVK  522

Query  737   TLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAE  558
              +HQE KL L+VDKDLK+N+D++ELEEMVQVALLCTQ+ PSHRPKMSEV+RMLEGDGLAE
Sbjct  523   KIHQEKKLELLVDKDLKSNYDKIELEEMVQVALLCTQYLPSHRPKMSEVVRMLEGDGLAE  582

Query  557   KWEASQRNDTPRFRTHENT-PQRYSDFIEESSLIVEAMELSGPR  429
             +WEASQ+ DT +F+  E++   RYSD  ++S L+V+AMELSGPR
Sbjct  583   RWEASQKTDTSKFKHQESSLSDRYSDLTDDSLLLVQAMELSGPR  626



>gb|KDO58880.1| hypothetical protein CISIN_1g036225mg [Citrus sinensis]
Length=622

 Score =   373 bits (957),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 176/224 (79%), Positives = 205/224 (92%), Gaps = 1/224 (0%)
 Frame = -1

Query  1097  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVS  918
             RKRIALG ARGL+YLHEQCDPKIIHRDVKAANILLD+  EAVVGDFGLAKLLDH++SHV+
Sbjct  399   RKRIALGAARGLLYLHEQCDPKIIHRDVKAANILLDDCCEAVVGDFGLAKLLDHQDSHVT  458

Query  917   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVK  738
             TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQ+A+++G+ ANQKG +LDWVK
Sbjct  459   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQRALEYGKAANQKGAMLDWVK  518

Query  737   TLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAE  558
              +HQE KL ++VDKDLKNN+DR+ELEEMVQVALLCTQ+ P+HRPKMSEV+RMLEGDGLAE
Sbjct  519   KIHQEKKLEMLVDKDLKNNYDRIELEEMVQVALLCTQYLPAHRPKMSEVVRMLEGDGLAE  578

Query  557   KWEASQRNDTPRFRTHE-NTPQRYSDFIEESSLIVEAMELSGPR  429
             +WEASQR +  + + HE ++  RYSD  ++SSL+V+AMELSGPR
Sbjct  579   RWEASQRAEATKSKPHEFSSSDRYSDLTDDSSLLVQAMELSGPR  622



>ref|XP_010418025.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X2 [Camelina 
sativa]
Length=633

 Score =   373 bits (958),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 180/231 (78%), Positives = 203/231 (88%), Gaps = 8/231 (3%)
 Frame = -1

Query  1097  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVS  918
             RK+IA+G ARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHR+SHV+
Sbjct  403   RKKIAVGTARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRDSHVT  462

Query  917   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVK  738
             TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKA+DFGR ++QKGV+LDWVK
Sbjct  463   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKALDFGRSSHQKGVMLDWVK  522

Query  737   TLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAE  558
              LHQEGKL  ++DK+L + FDRVELEE+VQVALLCTQFNPSHRPKMSEV++MLEGDGLAE
Sbjct  523   KLHQEGKLKQLIDKELNDKFDRVELEEIVQVALLCTQFNPSHRPKMSEVMKMLEGDGLAE  582

Query  557   KWEASQRND--------TPRFRTHENTPQRYSDFIEESSLIVEAMELSGPR  429
             +WEA+Q            P   +     + YSD+I+ESSL+VEA+ELSGPR
Sbjct  583   RWEATQNGTGESQPPPLPPGMMSSSPRVRYYSDYIQESSLVVEAIELSGPR  633



>ref|XP_008446508.1| PREDICTED: protein NSP-INTERACTING KINASE 1 isoform X2 [Cucumis 
melo]
Length=622

 Score =   373 bits (957),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 176/224 (79%), Positives = 204/224 (91%), Gaps = 1/224 (0%)
 Frame = -1

Query  1097  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVS  918
             RKRIALG ARGL+YLHEQCDPKIIHRDVKAANILLD+  EAVVGDFGLAKLLDHR+SHV+
Sbjct  399   RKRIALGAARGLLYLHEQCDPKIIHRDVKAANILLDDYCEAVVGDFGLAKLLDHRDSHVT  458

Query  917   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVK  738
             TAVRGTVGHIAPEYLSTGQSSEKTDVFG+GILLLELITGQ+A++FG+  NQKG +LDWVK
Sbjct  459   TAVRGTVGHIAPEYLSTGQSSEKTDVFGYGILLLELITGQRALEFGKAVNQKGAMLDWVK  518

Query  737   TLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAE  558
              +HQE KL L+VDKDL++N+DR+ELEEMVQVALLCTQ+ P+ RPKMSEV+RMLEGDGLAE
Sbjct  519   KIHQEKKLELLVDKDLRSNYDRIELEEMVQVALLCTQYLPTTRPKMSEVVRMLEGDGLAE  578

Query  557   KWEASQRNDTPRFRTHE-NTPQRYSDFIEESSLIVEAMELSGPR  429
             KWEASQR D  R+R +E ++ +RYSD  ++SSL+ +AMELSGPR
Sbjct  579   KWEASQRADANRYRVNEFSSSERYSDLTDDSSLLAQAMELSGPR  622



>ref|XP_010418023.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X1 [Camelina 
sativa]
Length=636

 Score =   373 bits (958),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 180/231 (78%), Positives = 203/231 (88%), Gaps = 8/231 (3%)
 Frame = -1

Query  1097  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVS  918
             RK+IA+G ARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHR+SHV+
Sbjct  406   RKKIAVGTARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRDSHVT  465

Query  917   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVK  738
             TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKA+DFGR ++QKGV+LDWVK
Sbjct  466   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKALDFGRSSHQKGVMLDWVK  525

Query  737   TLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAE  558
              LHQEGKL  ++DK+L + FDRVELEE+VQVALLCTQFNPSHRPKMSEV++MLEGDGLAE
Sbjct  526   KLHQEGKLKQLIDKELNDKFDRVELEEIVQVALLCTQFNPSHRPKMSEVMKMLEGDGLAE  585

Query  557   KWEASQRND--------TPRFRTHENTPQRYSDFIEESSLIVEAMELSGPR  429
             +WEA+Q            P   +     + YSD+I+ESSL+VEA+ELSGPR
Sbjct  586   RWEATQNGTGESQPPPLPPGMMSSSPRVRYYSDYIQESSLVVEAIELSGPR  636



>ref|XP_011020829.1| PREDICTED: protein NSP-INTERACTING KINASE 2-like [Populus euphratica]
Length=622

 Score =   373 bits (957),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 178/224 (79%), Positives = 204/224 (91%), Gaps = 1/224 (0%)
 Frame = -1

Query  1097  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVS  918
             RKRIALG ARGL+YLHEQCDPKIIHRDVKAANILLD+  EAVVGDFGLAKLLDHR+SHV+
Sbjct  399   RKRIALGAARGLLYLHEQCDPKIIHRDVKAANILLDDYCEAVVGDFGLAKLLDHRDSHVT  458

Query  917   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVK  738
             TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELI+G +A++FG+  NQKG +LDWVK
Sbjct  459   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELISGLRALEFGKSTNQKGALLDWVK  518

Query  737   TLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAE  558
              +HQE KL L+VDKDLKNN+DR+ELEE+VQVALLCTQ+ PSHRPKMSEV+RMLEGDGLAE
Sbjct  519   KIHQEKKLELLVDKDLKNNYDRIELEEIVQVALLCTQYLPSHRPKMSEVVRMLEGDGLAE  578

Query  557   KWEASQRNDTPRFRTHE-NTPQRYSDFIEESSLIVEAMELSGPR  429
             KWEASQR +  R R +E ++ +RYSD  ++SSL+V+AMELSGPR
Sbjct  579   KWEASQRAEETRSRANEFSSSERYSDLTDDSSLLVQAMELSGPR  622



>ref|XP_006482337.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like [Citrus sinensis]
Length=622

 Score =   373 bits (957),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 176/224 (79%), Positives = 205/224 (92%), Gaps = 1/224 (0%)
 Frame = -1

Query  1097  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVS  918
             RKRIALG ARGL+YLHEQCDPKIIHRDVKAANILLD+  EAVVGDFGLAKLLDH++SHV+
Sbjct  399   RKRIALGAARGLLYLHEQCDPKIIHRDVKAANILLDDCCEAVVGDFGLAKLLDHQDSHVT  458

Query  917   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVK  738
             TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQ+A+++G+ ANQKG +LDWVK
Sbjct  459   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQRALEYGKAANQKGAMLDWVK  518

Query  737   TLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAE  558
              +HQE KL ++VDKDLKNN+DR+ELEEMVQVALLCTQ+ P+HRPKMSEV+RMLEGDGLAE
Sbjct  519   KIHQEKKLEMLVDKDLKNNYDRIELEEMVQVALLCTQYLPAHRPKMSEVVRMLEGDGLAE  578

Query  557   KWEASQRNDTPRFRTHE-NTPQRYSDFIEESSLIVEAMELSGPR  429
             +WEASQR +  + + HE ++  RYSD  ++SSL+V+AMELSGPR
Sbjct  579   RWEASQRAEATKSKPHEFSSSDRYSDLTDDSSLLVQAMELSGPR  622



>ref|XP_008446507.1| PREDICTED: protein NSP-INTERACTING KINASE 1 isoform X1 [Cucumis 
melo]
Length=624

 Score =   373 bits (957),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 176/224 (79%), Positives = 204/224 (91%), Gaps = 1/224 (0%)
 Frame = -1

Query  1097  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVS  918
             RKRIALG ARGL+YLHEQCDPKIIHRDVKAANILLD+  EAVVGDFGLAKLLDHR+SHV+
Sbjct  401   RKRIALGAARGLLYLHEQCDPKIIHRDVKAANILLDDYCEAVVGDFGLAKLLDHRDSHVT  460

Query  917   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVK  738
             TAVRGTVGHIAPEYLSTGQSSEKTDVFG+GILLLELITGQ+A++FG+  NQKG +LDWVK
Sbjct  461   TAVRGTVGHIAPEYLSTGQSSEKTDVFGYGILLLELITGQRALEFGKAVNQKGAMLDWVK  520

Query  737   TLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAE  558
              +HQE KL L+VDKDL++N+DR+ELEEMVQVALLCTQ+ P+ RPKMSEV+RMLEGDGLAE
Sbjct  521   KIHQEKKLELLVDKDLRSNYDRIELEEMVQVALLCTQYLPTTRPKMSEVVRMLEGDGLAE  580

Query  557   KWEASQRNDTPRFRTHE-NTPQRYSDFIEESSLIVEAMELSGPR  429
             KWEASQR D  R+R +E ++ +RYSD  ++SSL+ +AMELSGPR
Sbjct  581   KWEASQRADANRYRVNEFSSSERYSDLTDDSSLLAQAMELSGPR  624



>ref|XP_006348615.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like [Solanum tuberosum]
Length=621

 Score =   373 bits (957),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 175/224 (78%), Positives = 208/224 (93%), Gaps = 1/224 (0%)
 Frame = -1

Query  1097  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVS  918
             RKRIALG ARGL+YLHEQCDPKIIHRDVKAANILLD+D EAVVGDFGLAKLLDHR+SHV+
Sbjct  398   RKRIALGAARGLLYLHEQCDPKIIHRDVKAANILLDDDCEAVVGDFGLAKLLDHRDSHVT  457

Query  917   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVK  738
             TAVRGTVGHIAPEYLSTGQSS+KTDVFGFGILLLELI+GQ+A++FG+ ANQKG++LDWVK
Sbjct  458   TAVRGTVGHIAPEYLSTGQSSDKTDVFGFGILLLELISGQRALEFGKAANQKGIMLDWVK  517

Query  737   TLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAE  558
              +H E KL+L+V KDLK+ +DR+ELEEMVQVAL+CTQ++PSHRPK+SEV+RMLEGDGLAE
Sbjct  518   KIHLEKKLDLLVSKDLKDKYDRIELEEMVQVALICTQYHPSHRPKISEVVRMLEGDGLAE  577

Query  557   KWEASQRNDTPRFRTHE-NTPQRYSDFIEESSLIVEAMELSGPR  429
             KWEASQR ++ R R +E ++ +RYSD  ++SSL+V+AMELSGPR
Sbjct  578   KWEASQRAESTRCRANEFSSSERYSDLTDDSSLLVQAMELSGPR  621



>ref|XP_010510907.1| PREDICTED: protein NSP-INTERACTING KINASE 3 isoform X2 [Camelina 
sativa]
Length=633

 Score =   373 bits (957),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 180/231 (78%), Positives = 203/231 (88%), Gaps = 8/231 (3%)
 Frame = -1

Query  1097  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVS  918
             RK+IA+G ARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHR+SHV+
Sbjct  403   RKKIAVGTARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRDSHVT  462

Query  917   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVK  738
             TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKA+DFGR ++QKGV+LDWVK
Sbjct  463   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKALDFGRSSHQKGVMLDWVK  522

Query  737   TLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAE  558
              LHQEGKL  ++DK+L + FDRVELEE+VQVALLCTQFNPSHRPKMSEV++MLEGDGLAE
Sbjct  523   KLHQEGKLKQLIDKELNDKFDRVELEEIVQVALLCTQFNPSHRPKMSEVMKMLEGDGLAE  582

Query  557   KWEASQRND--------TPRFRTHENTPQRYSDFIEESSLIVEAMELSGPR  429
             +WEA+Q            P   +     + YSD+I+ESSL+VEA+ELSGPR
Sbjct  583   RWEATQNGTGESQPPPLPPGMMSSSPRVRYYSDYIQESSLVVEAIELSGPR  633



>ref|XP_010510906.1| PREDICTED: protein NSP-INTERACTING KINASE 3 isoform X1 [Camelina 
sativa]
Length=636

 Score =   373 bits (957),  Expect = 5e-120, Method: Compositional matrix adjust.
 Identities = 180/231 (78%), Positives = 203/231 (88%), Gaps = 8/231 (3%)
 Frame = -1

Query  1097  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVS  918
             RK+IA+G ARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHR+SHV+
Sbjct  406   RKKIAVGTARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRDSHVT  465

Query  917   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVK  738
             TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKA+DFGR ++QKGV+LDWVK
Sbjct  466   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKALDFGRSSHQKGVMLDWVK  525

Query  737   TLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAE  558
              LHQEGKL  ++DK+L + FDRVELEE+VQVALLCTQFNPSHRPKMSEV++MLEGDGLAE
Sbjct  526   KLHQEGKLKQLIDKELNDKFDRVELEEIVQVALLCTQFNPSHRPKMSEVMKMLEGDGLAE  585

Query  557   KWEASQRND--------TPRFRTHENTPQRYSDFIEESSLIVEAMELSGPR  429
             +WEA+Q            P   +     + YSD+I+ESSL+VEA+ELSGPR
Sbjct  586   RWEATQNGTGESQPPPLPPGMMSSSPRVRYYSDYIQESSLVVEAIELSGPR  636



>ref|XP_010533910.1| PREDICTED: protein NSP-INTERACTING KINASE 3 [Tarenaya hassleriana]
Length=640

 Score =   373 bits (957),  Expect = 5e-120, Method: Compositional matrix adjust.
 Identities = 183/237 (77%), Positives = 202/237 (85%), Gaps = 14/237 (6%)
 Frame = -1

Query  1097  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVS  918
             RK+IALG ARGLVYLHEQCDPKIIHRDVKAANILLDEDFEA+VGDFGLAKLLDHR+SHV+
Sbjct  404   RKKIALGTARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAIVGDFGLAKLLDHRDSHVT  463

Query  917   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVK  738
             T VRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKA+DFGR ++QKGV+LDWVK
Sbjct  464   TVVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKALDFGRSSHQKGVMLDWVK  523

Query  737   TLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAE  558
              LHQEGKLN +VDKDLK  FDRVELEE+VQVALLCTQFNP HRPKMSEVL+MLEGDGLAE
Sbjct  524   KLHQEGKLNQIVDKDLKGKFDRVELEEIVQVALLCTQFNPLHRPKMSEVLKMLEGDGLAE  583

Query  557   KWEASQRNDTPR--------------FRTHENTPQRYSDFIEESSLIVEAMELSGPR  429
             +WEASQ     R                   + P  YS++I++SSL+VEA+ELSGPR
Sbjct  584   RWEASQSQSQNRNAEQMLMRLRSRSWCEPSSSPPVMYSEYIQDSSLVVEAIELSGPR  640



>ref|XP_011655741.1| PREDICTED: protein NSP-INTERACTING KINASE 2 isoform X3 [Cucumis 
sativus]
Length=622

 Score =   372 bits (955),  Expect = 7e-120, Method: Compositional matrix adjust.
 Identities = 175/224 (78%), Positives = 204/224 (91%), Gaps = 1/224 (0%)
 Frame = -1

Query  1097  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVS  918
             RKRIALG ARGL+YLHEQCDPKIIHRDVKAANILLD+  EAVVGDFGLAKLLDHR+SHV+
Sbjct  399   RKRIALGAARGLLYLHEQCDPKIIHRDVKAANILLDDYCEAVVGDFGLAKLLDHRDSHVT  458

Query  917   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVK  738
             TAVRGTVGHIAPEYLSTGQSSEKTDVFG+GILLLELITGQ+A++FG+  NQKG +LDWVK
Sbjct  459   TAVRGTVGHIAPEYLSTGQSSEKTDVFGYGILLLELITGQRALEFGKAVNQKGAMLDWVK  518

Query  737   TLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAE  558
              +HQE KL ++VDKDL++N+DR+ELEEMVQVALLCTQ+ P+ RPKMSEV+RMLEGDGLAE
Sbjct  519   KIHQEKKLEILVDKDLRSNYDRIELEEMVQVALLCTQYLPTTRPKMSEVVRMLEGDGLAE  578

Query  557   KWEASQRNDTPRFRTHE-NTPQRYSDFIEESSLIVEAMELSGPR  429
             KWEASQR D  R+R +E ++ +RYSD  ++SSL+ +AMELSGPR
Sbjct  579   KWEASQRADANRYRVNEFSSSERYSDLTDDSSLLAQAMELSGPR  622



>ref|XP_004135130.1| PREDICTED: protein NSP-INTERACTING KINASE 1 isoform X2 [Cucumis 
sativus]
 gb|KGN52017.1| hypothetical protein Csa_5G608050 [Cucumis sativus]
Length=623

 Score =   372 bits (955),  Expect = 8e-120, Method: Compositional matrix adjust.
 Identities = 175/224 (78%), Positives = 204/224 (91%), Gaps = 1/224 (0%)
 Frame = -1

Query  1097  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVS  918
             RKRIALG ARGL+YLHEQCDPKIIHRDVKAANILLD+  EAVVGDFGLAKLLDHR+SHV+
Sbjct  400   RKRIALGAARGLLYLHEQCDPKIIHRDVKAANILLDDYCEAVVGDFGLAKLLDHRDSHVT  459

Query  917   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVK  738
             TAVRGTVGHIAPEYLSTGQSSEKTDVFG+GILLLELITGQ+A++FG+  NQKG +LDWVK
Sbjct  460   TAVRGTVGHIAPEYLSTGQSSEKTDVFGYGILLLELITGQRALEFGKAVNQKGAMLDWVK  519

Query  737   TLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAE  558
              +HQE KL ++VDKDL++N+DR+ELEEMVQVALLCTQ+ P+ RPKMSEV+RMLEGDGLAE
Sbjct  520   KIHQEKKLEILVDKDLRSNYDRIELEEMVQVALLCTQYLPTTRPKMSEVVRMLEGDGLAE  579

Query  557   KWEASQRNDTPRFRTHE-NTPQRYSDFIEESSLIVEAMELSGPR  429
             KWEASQR D  R+R +E ++ +RYSD  ++SSL+ +AMELSGPR
Sbjct  580   KWEASQRADANRYRVNEFSSSERYSDLTDDSSLLAQAMELSGPR  623



>ref|XP_011655740.1| PREDICTED: protein NSP-INTERACTING KINASE 2 isoform X1 [Cucumis 
sativus]
Length=624

 Score =   372 bits (955),  Expect = 8e-120, Method: Compositional matrix adjust.
 Identities = 175/224 (78%), Positives = 204/224 (91%), Gaps = 1/224 (0%)
 Frame = -1

Query  1097  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVS  918
             RKRIALG ARGL+YLHEQCDPKIIHRDVKAANILLD+  EAVVGDFGLAKLLDHR+SHV+
Sbjct  401   RKRIALGAARGLLYLHEQCDPKIIHRDVKAANILLDDYCEAVVGDFGLAKLLDHRDSHVT  460

Query  917   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVK  738
             TAVRGTVGHIAPEYLSTGQSSEKTDVFG+GILLLELITGQ+A++FG+  NQKG +LDWVK
Sbjct  461   TAVRGTVGHIAPEYLSTGQSSEKTDVFGYGILLLELITGQRALEFGKAVNQKGAMLDWVK  520

Query  737   TLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAE  558
              +HQE KL ++VDKDL++N+DR+ELEEMVQVALLCTQ+ P+ RPKMSEV+RMLEGDGLAE
Sbjct  521   KIHQEKKLEILVDKDLRSNYDRIELEEMVQVALLCTQYLPTTRPKMSEVVRMLEGDGLAE  580

Query  557   KWEASQRNDTPRFRTHE-NTPQRYSDFIEESSLIVEAMELSGPR  429
             KWEASQR D  R+R +E ++ +RYSD  ++SSL+ +AMELSGPR
Sbjct  581   KWEASQRADANRYRVNEFSSSERYSDLTDDSSLLAQAMELSGPR  624



>gb|KEH17048.1| NSP-interacting kinase-like protein [Medicago truncatula]
Length=558

 Score =   370 bits (949),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 174/224 (78%), Positives = 205/224 (92%), Gaps = 1/224 (0%)
 Frame = -1

Query  1097  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVS  918
             RKRIALG  RGL+YLHEQCDPKIIHRDVKAANILLD+  EAVVGDFGLAKLLDHR+SHV+
Sbjct  335   RKRIALGAGRGLLYLHEQCDPKIIHRDVKAANILLDDYCEAVVGDFGLAKLLDHRDSHVT  394

Query  917   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVK  738
             TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELI+GQ+A++FG+ ANQKG +LDWVK
Sbjct  395   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELISGQRALEFGKAANQKGAMLDWVK  454

Query  737   TLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAE  558
              +HQE K++++VDKDLKN +DR+EL+E+VQVALLCTQ+ PSHRPKMSEV+RMLEGDGLAE
Sbjct  455   KIHQEKKIDVLVDKDLKNKYDRIELDEIVQVALLCTQYLPSHRPKMSEVVRMLEGDGLAE  514

Query  557   KWEASQRNDTPRFRTHE-NTPQRYSDFIEESSLIVEAMELSGPR  429
             KWEASQR ++ R R +E ++ +RYSD  ++SSL+ +AMELSGPR
Sbjct  515   KWEASQRAESTRSRGNELSSSERYSDLTDDSSLLAQAMELSGPR  558



>gb|KDO70180.1| hypothetical protein CISIN_1g007025mg [Citrus sinensis]
Length=552

 Score =   369 bits (948),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 176/224 (79%), Positives = 203/224 (91%), Gaps = 1/224 (0%)
 Frame = -1

Query  1097  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVS  918
             RKRIALG ARGL+YLHEQCDPKIIHRDVKAANILLDE +EAVVGDFGLAKLLDH +SHV+
Sbjct  329   RKRIALGAARGLLYLHEQCDPKIIHRDVKAANILLDEYYEAVVGDFGLAKLLDHCDSHVT  388

Query  917   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVK  738
             TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELI+G +A++FG+ ANQKG +LDWVK
Sbjct  389   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELISGLRALEFGKTANQKGAMLDWVK  448

Query  737   TLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAE  558
              +HQE KL ++VDKDLKNN+DR+ELEEMVQVALLCTQ+ PS RPKMSEV+RMLEGDGLAE
Sbjct  449   KIHQEKKLEMLVDKDLKNNYDRIELEEMVQVALLCTQYLPSLRPKMSEVVRMLEGDGLAE  508

Query  557   KWEASQRNDTPRFRTHE-NTPQRYSDFIEESSLIVEAMELSGPR  429
             KW ASQ+ +  R R +E ++ +RYSD  ++SSL+V+AMELSGPR
Sbjct  509   KWAASQKAEATRSRANEFSSSERYSDLTDDSSLLVQAMELSGPR  552



>ref|XP_006603947.1| PREDICTED: protein NSP-INTERACTING KINASE 1 isoform X2 [Glycine 
max]
Length=510

 Score =   367 bits (943),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 176/224 (79%), Positives = 202/224 (90%), Gaps = 1/224 (0%)
 Frame = -1

Query  1097  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVS  918
             RK+IALG ARGL+YLHEQCDPKIIHRDVKAANILLD+  EAVVGDFGLAKLLDH++SHV+
Sbjct  287   RKQIALGAARGLLYLHEQCDPKIIHRDVKAANILLDDYCEAVVGDFGLAKLLDHQDSHVT  346

Query  917   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVK  738
             TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQ+A++FG+ ANQKG +LDWV+
Sbjct  347   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQRALEFGKAANQKGAMLDWVR  406

Query  737   TLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAE  558
              LHQE KL L+VDKDLK N+DR+ELEE+VQVALLCTQ+ P HRPKMSEV+RMLEGDGLAE
Sbjct  407   KLHQEKKLELLVDKDLKTNYDRIELEEIVQVALLCTQYLPGHRPKMSEVVRMLEGDGLAE  466

Query  557   KWEASQRNDTPRFRTHE-NTPQRYSDFIEESSLIVEAMELSGPR  429
             KWEASQ  DT + +  E ++  RYSD  ++SSL+V+AMELSGPR
Sbjct  467   KWEASQSADTTKCKPQELSSSDRYSDLTDDSSLLVQAMELSGPR  510



>ref|XP_010473260.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X2 [Camelina 
sativa]
Length=633

 Score =   371 bits (953),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 179/231 (77%), Positives = 202/231 (87%), Gaps = 8/231 (3%)
 Frame = -1

Query  1097  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVS  918
             RK+IA+G ARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHR+SHV+
Sbjct  403   RKKIAVGTARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRDSHVT  462

Query  917   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVK  738
             TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKA+DFGR ++QKGV+LDWV 
Sbjct  463   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKALDFGRSSHQKGVMLDWVT  522

Query  737   TLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAE  558
              LHQEGKL  ++DK+L + FDRVELEE+VQVALLCTQFNPSHRPKMSEV++MLEGDGLAE
Sbjct  523   KLHQEGKLKQLIDKELNDKFDRVELEEIVQVALLCTQFNPSHRPKMSEVMKMLEGDGLAE  582

Query  557   KWEASQRND--------TPRFRTHENTPQRYSDFIEESSLIVEAMELSGPR  429
             +WEA+Q            P   +     + YSD+I+ESSL+VEA+ELSGPR
Sbjct  583   RWEATQNGTGESQPPPLPPGMMSSSPRVRYYSDYIQESSLVVEAIELSGPR  633



>gb|KHN07744.1| Protein NSP-INTERACTING KINASE 2 [Glycine soja]
Length=621

 Score =   371 bits (952),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 175/224 (78%), Positives = 205/224 (92%), Gaps = 1/224 (0%)
 Frame = -1

Query  1097  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVS  918
             RKRIALG  RGL+YLHEQCDPKIIHRDVKAANILLD+  EAVVGDFGLAKLLDHR+SHV+
Sbjct  398   RKRIALGAGRGLLYLHEQCDPKIIHRDVKAANILLDDYCEAVVGDFGLAKLLDHRDSHVT  457

Query  917   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVK  738
             TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELI+GQ+A++FG+ ANQKG +LDWVK
Sbjct  458   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELISGQRALEFGKAANQKGAMLDWVK  517

Query  737   TLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAE  558
              +HQE K++L+VDKDLKNN+DR+EL+E+VQVALLCTQ+ PSHRPKMSEV+RMLEGDGLAE
Sbjct  518   KIHQEKKIDLLVDKDLKNNYDRIELDEIVQVALLCTQYLPSHRPKMSEVVRMLEGDGLAE  577

Query  557   KWEASQRNDTPRFRTHE-NTPQRYSDFIEESSLIVEAMELSGPR  429
             KWEASQ  ++ R R +E ++ +RYSD  ++SSL+ +AMELSGPR
Sbjct  578   KWEASQSAESTRSRGNELSSSERYSDLTDDSSLLAQAMELSGPR  621



>ref|XP_010473259.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X1 [Camelina 
sativa]
Length=636

 Score =   372 bits (954),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 179/231 (77%), Positives = 202/231 (87%), Gaps = 8/231 (3%)
 Frame = -1

Query  1097  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVS  918
             RK+IA+G ARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHR+SHV+
Sbjct  406   RKKIAVGTARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRDSHVT  465

Query  917   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVK  738
             TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKA+DFGR ++QKGV+LDWV 
Sbjct  466   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKALDFGRSSHQKGVMLDWVT  525

Query  737   TLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAE  558
              LHQEGKL  ++DK+L + FDRVELEE+VQVALLCTQFNPSHRPKMSEV++MLEGDGLAE
Sbjct  526   KLHQEGKLKQLIDKELNDKFDRVELEEIVQVALLCTQFNPSHRPKMSEVMKMLEGDGLAE  585

Query  557   KWEASQRND--------TPRFRTHENTPQRYSDFIEESSLIVEAMELSGPR  429
             +WEA+Q            P   +     + YSD+I+ESSL+VEA+ELSGPR
Sbjct  586   RWEATQNGTGESQPPPLPPGMMSSSPRVRYYSDYIQESSLVVEAIELSGPR  636



>gb|KDO70181.1| hypothetical protein CISIN_1g007025mg [Citrus sinensis]
Length=549

 Score =   369 bits (946),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 176/224 (79%), Positives = 203/224 (91%), Gaps = 1/224 (0%)
 Frame = -1

Query  1097  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVS  918
             RKRIALG ARGL+YLHEQCDPKIIHRDVKAANILLDE +EAVVGDFGLAKLLDH +SHV+
Sbjct  326   RKRIALGAARGLLYLHEQCDPKIIHRDVKAANILLDEYYEAVVGDFGLAKLLDHCDSHVT  385

Query  917   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVK  738
             TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELI+G +A++FG+ ANQKG +LDWVK
Sbjct  386   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELISGLRALEFGKTANQKGAMLDWVK  445

Query  737   TLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAE  558
              +HQE KL ++VDKDLKNN+DR+ELEEMVQVALLCTQ+ PS RPKMSEV+RMLEGDGLAE
Sbjct  446   KIHQEKKLEMLVDKDLKNNYDRIELEEMVQVALLCTQYLPSLRPKMSEVVRMLEGDGLAE  505

Query  557   KWEASQRNDTPRFRTHE-NTPQRYSDFIEESSLIVEAMELSGPR  429
             KW ASQ+ +  R R +E ++ +RYSD  ++SSL+V+AMELSGPR
Sbjct  506   KWAASQKAEATRSRANEFSSSERYSDLTDDSSLLVQAMELSGPR  549



>ref|XP_003517902.1| PREDICTED: protein NSP-INTERACTING KINASE 2-like [Glycine max]
Length=621

 Score =   371 bits (952),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 175/224 (78%), Positives = 206/224 (92%), Gaps = 1/224 (0%)
 Frame = -1

Query  1097  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVS  918
             RKRIALG  RGL+YLHEQCDPKIIHRDVKAANILLD+  EAVVGDFGLAKLLDHR+SHV+
Sbjct  398   RKRIALGAGRGLLYLHEQCDPKIIHRDVKAANILLDDYCEAVVGDFGLAKLLDHRDSHVT  457

Query  917   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVK  738
             TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELI+GQ+A++FG+ ANQKG +LDWVK
Sbjct  458   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELISGQRALEFGKAANQKGAMLDWVK  517

Query  737   TLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAE  558
              +HQE K++L+VDKDLKNN+DR+EL+E+VQVALLCTQ+ PS+RPKMSEV+RMLEGDGLAE
Sbjct  518   KIHQEKKIDLLVDKDLKNNYDRIELDEIVQVALLCTQYLPSYRPKMSEVVRMLEGDGLAE  577

Query  557   KWEASQRNDTPRFRTHE-NTPQRYSDFIEESSLIVEAMELSGPR  429
             KWEASQR ++ R R +E ++ +RYSD  ++SSL+ +AMELSGPR
Sbjct  578   KWEASQRAESTRSRGNELSSSERYSDLTDDSSLLAQAMELSGPR  621



>ref|XP_006574993.1| PREDICTED: protein NSP-INTERACTING KINASE 2-like isoform X1 [Glycine 
max]
 ref|XP_006574994.1| PREDICTED: protein NSP-INTERACTING KINASE 2-like isoform X2 [Glycine 
max]
Length=621

 Score =   371 bits (952),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 175/224 (78%), Positives = 205/224 (92%), Gaps = 1/224 (0%)
 Frame = -1

Query  1097  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVS  918
             RKRIALG  RGL+YLHEQCDPKIIHRDVKAANILLD+  EAVVGDFGLAKLLDHR+SHV+
Sbjct  398   RKRIALGAGRGLLYLHEQCDPKIIHRDVKAANILLDDYCEAVVGDFGLAKLLDHRDSHVT  457

Query  917   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVK  738
             TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELI+GQ+A++FG+ ANQKG +LDWVK
Sbjct  458   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELISGQRALEFGKAANQKGAMLDWVK  517

Query  737   TLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAE  558
              +HQE K++L+VDKDLKNN+DR+EL+E+VQVALLCTQ+ PSHRPKMSEV+RMLEGDGLAE
Sbjct  518   KIHQEKKIDLLVDKDLKNNYDRIELDEIVQVALLCTQYLPSHRPKMSEVVRMLEGDGLAE  577

Query  557   KWEASQRNDTPRFRTHE-NTPQRYSDFIEESSLIVEAMELSGPR  429
             KWEASQ  ++ R R +E ++ +RYSD  ++SSL+ +AMELSGPR
Sbjct  578   KWEASQSAESTRSRGNELSSSERYSDLTDDSSLLAQAMELSGPR  621



>ref|XP_006392114.1| hypothetical protein EUTSA_v10023342mg [Eutrema salsugineum]
 gb|ESQ29400.1| hypothetical protein EUTSA_v10023342mg [Eutrema salsugineum]
Length=634

 Score =   371 bits (953),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 183/238 (77%), Positives = 204/238 (86%), Gaps = 22/238 (9%)
 Frame = -1

Query  1097  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVS  918
             RK+IA+G ARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHR+SHV+
Sbjct  404   RKKIAVGTARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRDSHVT  463

Query  917   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVK  738
             TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKA+DFGR ++QKGV+LDWVK
Sbjct  464   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKALDFGRSSHQKGVMLDWVK  523

Query  737   TLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAE  558
              LHQEGKL  ++DKDL + FDRVELEE+VQVALLCTQFNPS RPKMSEV++MLEGDGLAE
Sbjct  524   KLHQEGKLKQLIDKDLNDKFDRVELEEIVQVALLCTQFNPSFRPKMSEVMKMLEGDGLAE  583

Query  557   KWEASQR---------------NDTPRFRTHENTPQRYSDFIEESSLIVEAMELSGPR  429
             +WEASQ                + +PR R        YSD+I+ESSL+VEA+ELSGPR
Sbjct  584   RWEASQNGAAESLPPPLPSGMVSSSPRVR-------YYSDYIQESSLVVEAIELSGPR  634



>ref|XP_006593318.1| PREDICTED: NSP-interacting kinase isoform X2 [Glycine max]
Length=510

 Score =   367 bits (943),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 176/224 (79%), Positives = 201/224 (90%), Gaps = 1/224 (0%)
 Frame = -1

Query  1097  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVS  918
             RK+IALG ARGL+YLHEQCDPKIIHRDVKAANILLD+  EAVVGDFGLAKLLDH++SHV+
Sbjct  287   RKQIALGAARGLLYLHEQCDPKIIHRDVKAANILLDDYCEAVVGDFGLAKLLDHQDSHVT  346

Query  917   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVK  738
             TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQ+A++FG+ ANQKG +LDWV+
Sbjct  347   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQRALEFGKAANQKGAMLDWVR  406

Query  737   TLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAE  558
              LHQE KL L+VDKDLK N+DR+ELEE+VQVALLCTQ+ P HRPKMSEV+RMLEGDGLAE
Sbjct  407   KLHQEKKLELLVDKDLKTNYDRIELEEIVQVALLCTQYLPGHRPKMSEVVRMLEGDGLAE  466

Query  557   KWEASQRNDTPRFRTHE-NTPQRYSDFIEESSLIVEAMELSGPR  429
             KWEASQ  DT   +  E ++  RYSD  ++SSL+V+AMELSGPR
Sbjct  467   KWEASQSADTSNCKPQELSSSDRYSDLTDDSSLLVQAMELSGPR  510



>ref|XP_006430876.1| hypothetical protein CICLE_v10011302mg [Citrus clementina]
 gb|ESR44116.1| hypothetical protein CICLE_v10011302mg [Citrus clementina]
Length=622

 Score =   370 bits (951),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 175/224 (78%), Positives = 204/224 (91%), Gaps = 1/224 (0%)
 Frame = -1

Query  1097  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVS  918
             RKRIALG ARGL+YLHEQCDPKIIHRDVKAANILLD+  EAVVGDFGLAKLLDH++SHV+
Sbjct  399   RKRIALGAARGLLYLHEQCDPKIIHRDVKAANILLDDCCEAVVGDFGLAKLLDHQDSHVT  458

Query  917   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVK  738
             TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQ+A+++G+ ANQKG +LDWVK
Sbjct  459   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQRALEYGKAANQKGAMLDWVK  518

Query  737   TLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAE  558
              +H E KL ++VDKDLKNN+DR+ELEEMVQVALLCTQ+ P+HRPKMSEV+RMLEGDGLAE
Sbjct  519   KIHHEKKLEMLVDKDLKNNYDRIELEEMVQVALLCTQYLPAHRPKMSEVVRMLEGDGLAE  578

Query  557   KWEASQRNDTPRFRTHE-NTPQRYSDFIEESSLIVEAMELSGPR  429
             +WEASQR +  + + HE ++  RYSD  ++SSL+V+AMELSGPR
Sbjct  579   RWEASQRAEATKSKPHEFSSSDRYSDLTDDSSLLVQAMELSGPR  622



>ref|XP_007153543.1| hypothetical protein PHAVU_003G044400g [Phaseolus vulgaris]
 gb|ESW25537.1| hypothetical protein PHAVU_003G044400g [Phaseolus vulgaris]
Length=621

 Score =   370 bits (951),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 175/224 (78%), Positives = 206/224 (92%), Gaps = 1/224 (0%)
 Frame = -1

Query  1097  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVS  918
             RKRIALG  RGL+YLHEQCDPKIIHRDVKAANILLD+  EAVVGDFGLAKLLDHR+SHV+
Sbjct  398   RKRIALGAGRGLLYLHEQCDPKIIHRDVKAANILLDDYCEAVVGDFGLAKLLDHRDSHVT  457

Query  917   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVK  738
             TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELI+GQ+A++FG+ ANQKG +LDWVK
Sbjct  458   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELISGQRALEFGKAANQKGAMLDWVK  517

Query  737   TLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAE  558
              +HQE K++L+VDKDLKN++DR+EL+E+VQVALLCTQ+ PSHRPKMSEV+RMLEGDGLAE
Sbjct  518   KIHQEKKIDLLVDKDLKNHYDRIELDEIVQVALLCTQYLPSHRPKMSEVVRMLEGDGLAE  577

Query  557   KWEASQRNDTPRFRTHE-NTPQRYSDFIEESSLIVEAMELSGPR  429
             KWEASQR ++ R R +E ++ +RYSD  ++SSL+ +AMELSGPR
Sbjct  578   KWEASQRAESTRSRGNELSSSERYSDLTDDSSLLTQAMELSGPR  621



>ref|XP_012088120.1| PREDICTED: protein NSP-INTERACTING KINASE 1 [Jatropha curcas]
 gb|KDP24340.1| hypothetical protein JCGZ_25636 [Jatropha curcas]
Length=624

 Score =   370 bits (951),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 178/224 (79%), Positives = 204/224 (91%), Gaps = 1/224 (0%)
 Frame = -1

Query  1097  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVS  918
             RKRIALG ARGL+YLHEQCDPKIIHRDVKAANILLD+  EAVVGDFGLAKLLDH++SHV+
Sbjct  401   RKRIALGAARGLLYLHEQCDPKIIHRDVKAANILLDDYCEAVVGDFGLAKLLDHQDSHVT  460

Query  917   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVK  738
             TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQ+A++FG+ ANQKG ILDWVK
Sbjct  461   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQRALEFGKAANQKGAILDWVK  520

Query  737   TLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAE  558
              +HQE KL ++VDKDLK N+DR+ELEE+VQVALLCTQF PSHRPKMSEV+RMLEGDGLAE
Sbjct  521   KIHQEKKLEMLVDKDLKANYDRIELEEIVQVALLCTQFLPSHRPKMSEVVRMLEGDGLAE  580

Query  557   KWEASQRNDTPRFRTHE-NTPQRYSDFIEESSLIVEAMELSGPR  429
             +WEASQR +  + + HE ++  RYSD  ++SSL+V+AMELSGPR
Sbjct  581   RWEASQRVEATKPKPHEFSSSDRYSDLTDDSSLLVQAMELSGPR  624



>ref|XP_008465988.1| PREDICTED: protein NSP-INTERACTING KINASE 2-like [Cucumis melo]
Length=623

 Score =   370 bits (950),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 174/223 (78%), Positives = 202/223 (91%), Gaps = 0/223 (0%)
 Frame = -1

Query  1097  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVS  918
             RKRIALG ARGL+YLHEQCDPKIIHRDVKAANILLD+  EAVVGDFGLAKLLDHR+SHV+
Sbjct  401   RKRIALGAARGLLYLHEQCDPKIIHRDVKAANILLDDFCEAVVGDFGLAKLLDHRDSHVT  460

Query  917   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVK  738
             TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELI+GQ+A++FG+ ANQKG ILDWVK
Sbjct  461   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELISGQRALEFGKAANQKGAILDWVK  520

Query  737   TLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAE  558
              +HQE KL ++VDKDL++N+DR+ELEE+V+VALLC Q+ PSHRPKMSEV+RMLEGDGLAE
Sbjct  521   KIHQEKKLEMLVDKDLRSNYDRIELEEIVRVALLCIQYLPSHRPKMSEVVRMLEGDGLAE  580

Query  557   KWEASQRNDTPRFRTHENTPQRYSDFIEESSLIVEAMELSGPR  429
             KWEASQR +  R R +E + +RYSD  ++SSL  +A+ELSGPR
Sbjct  581   KWEASQRAEASRSRANEFSSERYSDLTDDSSLFAQAIELSGPR  623



>ref|XP_010942232.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like [Elaeis guineensis]
Length=624

 Score =   370 bits (950),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 175/224 (78%), Positives = 205/224 (92%), Gaps = 1/224 (0%)
 Frame = -1

Query  1097  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVS  918
             RKRIALG ARGL+YLHEQCDPKIIHRDVKAANILLD+  EAVVGDFGLAKLLDHR+SHV+
Sbjct  401   RKRIALGAARGLLYLHEQCDPKIIHRDVKAANILLDDYCEAVVGDFGLAKLLDHRDSHVT  460

Query  917   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVK  738
             TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITG +AV+FG+ ANQKG +LDWVK
Sbjct  461   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGLRAVEFGKAANQKGAMLDWVK  520

Query  737   TLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAE  558
              +HQE KL+++VDKDLK+++DR+ELEE V+VALLCTQ+ P HRPKMSEV+RMLEGDGLAE
Sbjct  521   KIHQEKKLDMLVDKDLKSDYDRIELEETVRVALLCTQYLPGHRPKMSEVVRMLEGDGLAE  580

Query  557   KWEASQRNDTPRFRTHE-NTPQRYSDFIEESSLIVEAMELSGPR  429
             +WEASQR + P+F+  E ++ +RYSD  ++SSL+V+AMELSGPR
Sbjct  581   RWEASQRVEAPKFKMPEVSSSERYSDLTDDSSLLVQAMELSGPR  624



>gb|KJB80538.1| hypothetical protein B456_013G102600 [Gossypium raimondii]
Length=624

 Score =   370 bits (950),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 176/224 (79%), Positives = 205/224 (92%), Gaps = 1/224 (0%)
 Frame = -1

Query  1097  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVS  918
             RKRIALG ARGL+YLHEQCDPKIIHRDVKAANILLD+  EA+VGDFGLAKLLDHR+SHV+
Sbjct  401   RKRIALGTARGLLYLHEQCDPKIIHRDVKAANILLDDYCEAIVGDFGLAKLLDHRDSHVT  460

Query  917   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVK  738
             TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELI+G +A++FG+ ANQKG ILDWV+
Sbjct  461   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELISGLRALEFGKTANQKGAILDWVR  520

Query  737   TLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAE  558
              +HQE KL+++VDKDLKNN+DR+ELEEMVQVALLCTQ+ PS RPKMSEV+RMLEGDGLAE
Sbjct  521   KVHQEKKLDMLVDKDLKNNYDRIELEEMVQVALLCTQYLPSQRPKMSEVVRMLEGDGLAE  580

Query  557   KWEASQRNDTPRFRTHE-NTPQRYSDFIEESSLIVEAMELSGPR  429
             KWEASQ+ +  R R +E ++ +RYSD  ++SSL+V+AMELSGPR
Sbjct  581   KWEASQKAEATRSRANEFSSSERYSDLTDDSSLLVQAMELSGPR  624



>gb|KHG05227.1| nsp-interacting kinase 2 -like protein [Gossypium arboreum]
Length=624

 Score =   370 bits (950),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 176/224 (79%), Positives = 205/224 (92%), Gaps = 1/224 (0%)
 Frame = -1

Query  1097  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVS  918
             RKRIALG ARGL+YLHEQCDPKIIHRDVKAANILLD+  EA+VGDFGLAKLLDHR+SHV+
Sbjct  401   RKRIALGTARGLLYLHEQCDPKIIHRDVKAANILLDDYCEAIVGDFGLAKLLDHRDSHVT  460

Query  917   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVK  738
             TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELI+G +A++FG+ ANQKG ILDWV+
Sbjct  461   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELISGLRALEFGKTANQKGAILDWVR  520

Query  737   TLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAE  558
              +HQE KL+++VDKDLKNN+DR+ELEEMVQVALLCTQ+ PS RPKMSEV+RMLEGDGLAE
Sbjct  521   KVHQEKKLDMLVDKDLKNNYDRIELEEMVQVALLCTQYLPSQRPKMSEVVRMLEGDGLAE  580

Query  557   KWEASQRNDTPRFRTHE-NTPQRYSDFIEESSLIVEAMELSGPR  429
             KWEASQ+ +  R R +E ++ +RYSD  ++SSL+V+AMELSGPR
Sbjct  581   KWEASQKAEATRSRANEFSSSERYSDLTDDSSLLVQAMELSGPR  624



>ref|XP_002311408.2| hypothetical protein POPTR_0008s10970g [Populus trichocarpa]
 gb|EEE88775.2| hypothetical protein POPTR_0008s10970g [Populus trichocarpa]
Length=622

 Score =   370 bits (949),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 176/224 (79%), Positives = 204/224 (91%), Gaps = 1/224 (0%)
 Frame = -1

Query  1097  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVS  918
             RKRIALG ARGL+YLHEQCDPKIIHRDVKAANILLD+  EAVVGDFGLAKLLDH++SHV+
Sbjct  399   RKRIALGAARGLLYLHEQCDPKIIHRDVKAANILLDDYCEAVVGDFGLAKLLDHQDSHVT  458

Query  917   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVK  738
             TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELI+G +A++FG+  NQKG +LDWVK
Sbjct  459   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELISGLRALEFGKSTNQKGALLDWVK  518

Query  737   TLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAE  558
              +HQE KL L+VDKDLKNN+DR+ELEE+VQVALLCTQ+ PSHRPKMSEV+RMLEGDGLAE
Sbjct  519   KIHQEKKLELLVDKDLKNNYDRIELEEIVQVALLCTQYLPSHRPKMSEVVRMLEGDGLAE  578

Query  557   KWEASQRNDTPRFRTHE-NTPQRYSDFIEESSLIVEAMELSGPR  429
             KWEASQR +  + R +E ++ +RYSD  ++SSL+V+AMELSGPR
Sbjct  579   KWEASQRAEETKSRANEFSSSERYSDLTDDSSLLVQAMELSGPR  622



>ref|XP_011009019.1| PREDICTED: protein NSP-INTERACTING KINASE 2-like [Populus euphratica]
Length=622

 Score =   370 bits (949),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 176/224 (79%), Positives = 203/224 (91%), Gaps = 1/224 (0%)
 Frame = -1

Query  1097  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVS  918
             RKR+ALG  RGL+YLHEQCDPKIIHRDVKAANILLD+  EAVVGDFGLAKLLDHR+SHV+
Sbjct  399   RKRVALGAGRGLLYLHEQCDPKIIHRDVKAANILLDDYCEAVVGDFGLAKLLDHRDSHVT  458

Query  917   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVK  738
             TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELI+G +A++FG+  NQKG +LDWVK
Sbjct  459   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELISGLRALEFGKSTNQKGALLDWVK  518

Query  737   TLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAE  558
              +HQE KL L+VDKDLKNN+DR+ELEE+VQVALLCTQ+ PSHRPKMSEV+RMLEGDGLAE
Sbjct  519   KIHQEKKLELLVDKDLKNNYDRIELEEIVQVALLCTQYLPSHRPKMSEVVRMLEGDGLAE  578

Query  557   KWEASQRNDTPRFRTHE-NTPQRYSDFIEESSLIVEAMELSGPR  429
             KWEASQR +  R R +E ++ +RYSD  ++SSL+V+AMELSGPR
Sbjct  579   KWEASQRAEETRSRANEFSSSERYSDLTDDSSLLVQAMELSGPR  622



>ref|XP_009104025.1| PREDICTED: protein NSP-INTERACTING KINASE 3 isoform X2 [Brassica 
rapa]
Length=635

 Score =   370 bits (950),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 181/238 (76%), Positives = 205/238 (86%), Gaps = 22/238 (9%)
 Frame = -1

Query  1097  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVS  918
             RK+IA+G ARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHR+SHV+
Sbjct  405   RKKIAVGTARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRDSHVT  464

Query  917   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVK  738
             TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKA+DFGR ++QKGV+LDWVK
Sbjct  465   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKALDFGRSSHQKGVMLDWVK  524

Query  737   TLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAE  558
              LHQEGKL  ++DKDL + +DRVELEE+VQVALLCTQFNPS+RPKMSEV++MLEGDGLA+
Sbjct  525   KLHQEGKLKQLIDKDLNDKYDRVELEEIVQVALLCTQFNPSNRPKMSEVMKMLEGDGLAD  584

Query  557   KWEASQR---------------NDTPRFRTHENTPQRYSDFIEESSLIVEAMELSGPR  429
             +WEASQ                + +PR R        YSD+I+ESSL+VEA+ELSGPR
Sbjct  585   RWEASQSGGAKSLPPPLPSGMVSSSPRVR-------YYSDYIQESSLVVEAIELSGPR  635



>ref|XP_010528022.1| PREDICTED: protein NSP-INTERACTING KINASE 2 [Tarenaya hassleriana]
Length=637

 Score =   370 bits (950),  Expect = 6e-119, Method: Compositional matrix adjust.
 Identities = 176/228 (77%), Positives = 205/228 (90%), Gaps = 5/228 (2%)
 Frame = -1

Query  1097  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVS  918
             RKRIALG ARGL+YLHEQCDPKIIHRDVKAANILLD+  EAVVGDFGLAKLLDHRESHV+
Sbjct  410   RKRIALGAARGLLYLHEQCDPKIIHRDVKAANILLDDFCEAVVGDFGLAKLLDHRESHVT  469

Query  917   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVK  738
             TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELI+G +A++FG+ ANQKG +LDWVK
Sbjct  470   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELISGLRALEFGKAANQKGAMLDWVK  529

Query  737   TLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAE  558
              +HQE KL L+VDKDLKNN+DR+E+EEMVQVALLCTQ+ PSHRPKMSEV+RMLEGDGLAE
Sbjct  530   KVHQEKKLELIVDKDLKNNYDRIEVEEMVQVALLCTQYLPSHRPKMSEVVRMLEGDGLAE  589

Query  557   KWEASQRNDTPRFRTHE-----NTPQRYSDFIEESSLIVEAMELSGPR  429
             KWEASQ+ ++   R++      ++ +RYSD  ++S+L+V+AMELSGPR
Sbjct  590   KWEASQQRNSETHRSYSRPNEFSSSERYSDLTDDSTLLVQAMELSGPR  637



>ref|XP_009104018.1| PREDICTED: protein NSP-INTERACTING KINASE 3 isoform X1 [Brassica 
rapa]
Length=636

 Score =   370 bits (950),  Expect = 6e-119, Method: Compositional matrix adjust.
 Identities = 181/238 (76%), Positives = 205/238 (86%), Gaps = 22/238 (9%)
 Frame = -1

Query  1097  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVS  918
             RK+IA+G ARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHR+SHV+
Sbjct  406   RKKIAVGTARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRDSHVT  465

Query  917   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVK  738
             TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKA+DFGR ++QKGV+LDWVK
Sbjct  466   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKALDFGRSSHQKGVMLDWVK  525

Query  737   TLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAE  558
              LHQEGKL  ++DKDL + +DRVELEE+VQVALLCTQFNPS+RPKMSEV++MLEGDGLA+
Sbjct  526   KLHQEGKLKQLIDKDLNDKYDRVELEEIVQVALLCTQFNPSNRPKMSEVMKMLEGDGLAD  585

Query  557   KWEASQR---------------NDTPRFRTHENTPQRYSDFIEESSLIVEAMELSGPR  429
             +WEASQ                + +PR R        YSD+I+ESSL+VEA+ELSGPR
Sbjct  586   RWEASQSGGAKSLPPPLPSGMVSSSPRVR-------YYSDYIQESSLVVEAIELSGPR  636



>gb|ABG73621.1| leucine-rich repeat receptor-like kinase [Populus tomentosa]
Length=622

 Score =   369 bits (948),  Expect = 6e-119, Method: Compositional matrix adjust.
 Identities = 177/224 (79%), Positives = 203/224 (91%), Gaps = 1/224 (0%)
 Frame = -1

Query  1097  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVS  918
             RKRIALG ARGL+YLHEQCDPKIIHRDVKAANILLD+  EAVVGDFGLAKLLDHR+SHV+
Sbjct  399   RKRIALGAARGLLYLHEQCDPKIIHRDVKAANILLDDYCEAVVGDFGLAKLLDHRDSHVT  458

Query  917   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVK  738
             TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELI+G +A++FG+  NQKG +LDWVK
Sbjct  459   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELISGLRALEFGKSTNQKGALLDWVK  518

Query  737   TLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAE  558
              +H E KL L+VDKDLKNN+DR+ELEE+VQVALLCTQ+ PSHRPKMSEV+RMLEGDGLAE
Sbjct  519   KIHLEKKLELLVDKDLKNNYDRIELEEIVQVALLCTQYLPSHRPKMSEVVRMLEGDGLAE  578

Query  557   KWEASQRNDTPRFRTHE-NTPQRYSDFIEESSLIVEAMELSGPR  429
             KWEASQR +  R R +E ++ +RYSD  ++SSL+V+AMELSGPR
Sbjct  579   KWEASQRAEESRSRANEFSSSERYSDLTDDSSLLVQAMELSGPR  622



>gb|KEH17047.1| NSP-interacting kinase-like protein [Medicago truncatula]
Length=621

 Score =   369 bits (948),  Expect = 7e-119, Method: Compositional matrix adjust.
 Identities = 174/224 (78%), Positives = 205/224 (92%), Gaps = 1/224 (0%)
 Frame = -1

Query  1097  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVS  918
             RKRIALG  RGL+YLHEQCDPKIIHRDVKAANILLD+  EAVVGDFGLAKLLDHR+SHV+
Sbjct  398   RKRIALGAGRGLLYLHEQCDPKIIHRDVKAANILLDDYCEAVVGDFGLAKLLDHRDSHVT  457

Query  917   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVK  738
             TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELI+GQ+A++FG+ ANQKG +LDWVK
Sbjct  458   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELISGQRALEFGKAANQKGAMLDWVK  517

Query  737   TLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAE  558
              +HQE K++++VDKDLKN +DR+EL+E+VQVALLCTQ+ PSHRPKMSEV+RMLEGDGLAE
Sbjct  518   KIHQEKKIDVLVDKDLKNKYDRIELDEIVQVALLCTQYLPSHRPKMSEVVRMLEGDGLAE  577

Query  557   KWEASQRNDTPRFRTHE-NTPQRYSDFIEESSLIVEAMELSGPR  429
             KWEASQR ++ R R +E ++ +RYSD  ++SSL+ +AMELSGPR
Sbjct  578   KWEASQRAESTRSRGNELSSSERYSDLTDDSSLLAQAMELSGPR  621



>gb|AFO67891.1| leucine-rich repeat receptor-like kinase (mitochondrion) [Brassica 
rapa subsp. oleifera]
Length=635

 Score =   370 bits (949),  Expect = 7e-119, Method: Compositional matrix adjust.
 Identities = 181/238 (76%), Positives = 205/238 (86%), Gaps = 22/238 (9%)
 Frame = -1

Query  1097  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVS  918
             RK+IA+G ARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHR+SHV+
Sbjct  405   RKKIAVGTARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRDSHVT  464

Query  917   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVK  738
             TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKA+DFGR ++QKGV+LDWVK
Sbjct  465   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKALDFGRSSHQKGVMLDWVK  524

Query  737   TLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAE  558
              LHQEGKL  ++DKDL + +DRVELEE+VQVALLCTQFNPS+RPKMSEV++MLEGDGLA+
Sbjct  525   KLHQEGKLKQLIDKDLNDKYDRVELEEIVQVALLCTQFNPSNRPKMSEVMKMLEGDGLAD  584

Query  557   KWEASQR---------------NDTPRFRTHENTPQRYSDFIEESSLIVEAMELSGPR  429
             +WEASQ                + +PR R        YSD+I+ESSL+VEA+ELSGPR
Sbjct  585   RWEASQSGGAKSLPPPLPSGMVSSSPRVR-------YYSDYIQESSLVVEAIELSGPR  635



>emb|CDY46185.1| BnaA01g23070D [Brassica napus]
Length=636

 Score =   370 bits (949),  Expect = 7e-119, Method: Compositional matrix adjust.
 Identities = 181/238 (76%), Positives = 205/238 (86%), Gaps = 22/238 (9%)
 Frame = -1

Query  1097  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVS  918
             RK+IA+G ARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHR+SHV+
Sbjct  406   RKKIAVGTARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRDSHVT  465

Query  917   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVK  738
             TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKA+DFGR ++QKGV+LDWVK
Sbjct  466   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKALDFGRSSHQKGVMLDWVK  525

Query  737   TLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAE  558
              LHQEGKL  ++DKDL + +DRVELEE+VQVALLCTQFNPS+RPKMSEV++MLEGDGLA+
Sbjct  526   KLHQEGKLKQLIDKDLNDKYDRVELEEIVQVALLCTQFNPSNRPKMSEVMKMLEGDGLAD  585

Query  557   KWEASQR---------------NDTPRFRTHENTPQRYSDFIEESSLIVEAMELSGPR  429
             +WEASQ                + +PR R        YSD+I+ESSL+VEA+ELSGPR
Sbjct  586   RWEASQSGGAKSLPPPLPSGMVSSSPRVR-------YYSDYIQESSLVVEAIELSGPR  636



>ref|XP_011077619.1| PREDICTED: protein NSP-INTERACTING KINASE 2 [Sesamum indicum]
Length=648

 Score =   370 bits (950),  Expect = 8e-119, Method: Compositional matrix adjust.
 Identities = 178/224 (79%), Positives = 203/224 (91%), Gaps = 1/224 (0%)
 Frame = -1

Query  1097  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVS  918
             RKRIALG ARGL+YLHEQCDPKIIHRDVKAANILLD+  EAVVGDFGLAKLLDHR+SHV+
Sbjct  425   RKRIALGAARGLLYLHEQCDPKIIHRDVKAANILLDDYCEAVVGDFGLAKLLDHRDSHVT  484

Query  917   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVK  738
             TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQ+A++FG+ ANQKG +LDWVK
Sbjct  485   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQRALEFGKAANQKGAMLDWVK  544

Query  737   TLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAE  558
              +HQE KL+++VDK+ +NN+D VELEEMVQVALLCTQF P HRPKMSEV+RMLEGDGLAE
Sbjct  545   KIHQEKKLDVLVDKNFRNNYDPVELEEMVQVALLCTQFLPIHRPKMSEVVRMLEGDGLAE  604

Query  557   KWEASQRNDTPRFRTHE-NTPQRYSDFIEESSLIVEAMELSGPR  429
             KWEASQR +  R R +E ++  RYSD  ++SSL+V+AMELSGPR
Sbjct  605   KWEASQRAEATRCRANEFSSSGRYSDLTDDSSLLVQAMELSGPR  648



>ref|XP_011011496.1| PREDICTED: protein NSP-INTERACTING KINASE 2-like [Populus euphratica]
Length=622

 Score =   369 bits (947),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 177/224 (79%), Positives = 202/224 (90%), Gaps = 1/224 (0%)
 Frame = -1

Query  1097  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVS  918
             RKRIALG ARGL+YLHEQCDPKIIHRDVKAANILLD   EAVVGDFGLAKLLDHR+SHV+
Sbjct  399   RKRIALGAARGLLYLHEQCDPKIIHRDVKAANILLDGYCEAVVGDFGLAKLLDHRDSHVT  458

Query  917   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVK  738
             TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELI+G +A++FG+  NQKG +LDWVK
Sbjct  459   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELISGLRALEFGKSTNQKGALLDWVK  518

Query  737   TLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAE  558
              +HQE KL L+VDKDLKNN+DR+ELEE+VQVALLC Q+ PSHRPKMSEV+RMLEGDGLAE
Sbjct  519   KIHQEKKLELLVDKDLKNNYDRIELEEIVQVALLCIQYLPSHRPKMSEVVRMLEGDGLAE  578

Query  557   KWEASQRNDTPRFRTHE-NTPQRYSDFIEESSLIVEAMELSGPR  429
             KWEASQR +  R R +E ++ +RYSD  ++SSL+V+AMELSGPR
Sbjct  579   KWEASQRAEETRSRANEFSSSERYSDMTDDSSLLVQAMELSGPR  622



>ref|XP_009765506.1| PREDICTED: protein NSP-INTERACTING KINASE 2-like [Nicotiana sylvestris]
Length=624

 Score =   369 bits (947),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 173/224 (77%), Positives = 208/224 (93%), Gaps = 1/224 (0%)
 Frame = -1

Query  1097  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVS  918
             RKRIALG ARGL+YLHEQCDPKIIHRDVKAANILLD+  EAVVGDFGLAKLLDHR+SHV+
Sbjct  401   RKRIALGAARGLLYLHEQCDPKIIHRDVKAANILLDDYCEAVVGDFGLAKLLDHRDSHVT  460

Query  917   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVK  738
             TAVRGTVGHIAPEYLSTGQSS+KTDVFGFGILLLELI+GQ+A++FG+ ANQKG +LDWVK
Sbjct  461   TAVRGTVGHIAPEYLSTGQSSDKTDVFGFGILLLELISGQRALEFGKAANQKGAMLDWVK  520

Query  737   TLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAE  558
              +HQE KL+L+V+KDLK+N+DR+E+EE+VQVAL+CTQ++PS RPKMSEV+RMLEGDGLAE
Sbjct  521   KIHQEKKLDLLVNKDLKDNYDRIEVEELVQVALICTQYHPSQRPKMSEVVRMLEGDGLAE  580

Query  557   KWEASQRNDTPRFRTHE-NTPQRYSDFIEESSLIVEAMELSGPR  429
             KWEASQ+ ++ R R +E ++ +RYSD  ++SSL+V+AMELSGPR
Sbjct  581   KWEASQKAESTRCRANEFSSSERYSDLTDDSSLLVQAMELSGPR  624



>ref|XP_009625494.1| PREDICTED: protein NSP-INTERACTING KINASE 2-like [Nicotiana tomentosiformis]
Length=624

 Score =   369 bits (946),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 173/224 (77%), Positives = 207/224 (92%), Gaps = 1/224 (0%)
 Frame = -1

Query  1097  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVS  918
             RKRIALG ARGL+YLHEQCDPKIIHRDVKAANILLD+  EAVVGDFGLAKLLDH +SHV+
Sbjct  401   RKRIALGAARGLLYLHEQCDPKIIHRDVKAANILLDDYCEAVVGDFGLAKLLDHSDSHVT  460

Query  917   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVK  738
             TAVRGTVGHIAPEYLSTGQSS+KTDVFGFGILLLELI+GQ+A++FG+ ANQKG +LDWVK
Sbjct  461   TAVRGTVGHIAPEYLSTGQSSDKTDVFGFGILLLELISGQRALEFGKAANQKGAMLDWVK  520

Query  737   TLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAE  558
              + QE KL+L+V+KDLK+N+DR+E+EEMVQVAL+CTQ++PSHRPKMSEV+RMLEGDGLAE
Sbjct  521   KIQQEKKLDLLVNKDLKDNYDRIEVEEMVQVALICTQYHPSHRPKMSEVVRMLEGDGLAE  580

Query  557   KWEASQRNDTPRFRTHE-NTPQRYSDFIEESSLIVEAMELSGPR  429
             KWEASQ+ ++ R R +E ++ +RYSD  ++SSL+V+AMELSGPR
Sbjct  581   KWEASQKAESTRCRANEFSSSERYSDLTDDSSLLVQAMELSGPR  624



>ref|XP_006437790.1| hypothetical protein CICLE_v10030970mg [Citrus clementina]
 gb|ESR51030.1| hypothetical protein CICLE_v10030970mg [Citrus clementina]
Length=621

 Score =   368 bits (945),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 176/224 (79%), Positives = 203/224 (91%), Gaps = 1/224 (0%)
 Frame = -1

Query  1097  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVS  918
             RKRIALG ARGL+YLHEQCDPKIIHRDVKAANILLDE +EAVVGDFGLAKLLDH +SHV+
Sbjct  398   RKRIALGAARGLLYLHEQCDPKIIHRDVKAANILLDEYYEAVVGDFGLAKLLDHCDSHVT  457

Query  917   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVK  738
             TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELI+G +A++FG+ ANQKG +LDWVK
Sbjct  458   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELISGLRALEFGKTANQKGAMLDWVK  517

Query  737   TLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAE  558
              +HQE KL ++VDKDLKNN+DR+ELEEMVQVALLCTQ+ PS RPKMSEV+RMLEGDGLAE
Sbjct  518   KIHQEKKLEMLVDKDLKNNYDRIELEEMVQVALLCTQYLPSLRPKMSEVVRMLEGDGLAE  577

Query  557   KWEASQRNDTPRFRTHE-NTPQRYSDFIEESSLIVEAMELSGPR  429
             KW ASQ+ +  R R +E ++ +RYSD  ++SSL+V+AMELSGPR
Sbjct  578   KWAASQKAEATRSRANEFSSSERYSDLTDDSSLLVQAMELSGPR  621



>ref|XP_006484307.1| PREDICTED: protein NSP-INTERACTING KINASE 2-like [Citrus sinensis]
 gb|KDO70177.1| hypothetical protein CISIN_1g007025mg [Citrus sinensis]
Length=621

 Score =   368 bits (945),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 176/224 (79%), Positives = 203/224 (91%), Gaps = 1/224 (0%)
 Frame = -1

Query  1097  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVS  918
             RKRIALG ARGL+YLHEQCDPKIIHRDVKAANILLDE +EAVVGDFGLAKLLDH +SHV+
Sbjct  398   RKRIALGAARGLLYLHEQCDPKIIHRDVKAANILLDEYYEAVVGDFGLAKLLDHCDSHVT  457

Query  917   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVK  738
             TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELI+G +A++FG+ ANQKG +LDWVK
Sbjct  458   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELISGLRALEFGKTANQKGAMLDWVK  517

Query  737   TLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAE  558
              +HQE KL ++VDKDLKNN+DR+ELEEMVQVALLCTQ+ PS RPKMSEV+RMLEGDGLAE
Sbjct  518   KIHQEKKLEMLVDKDLKNNYDRIELEEMVQVALLCTQYLPSLRPKMSEVVRMLEGDGLAE  577

Query  557   KWEASQRNDTPRFRTHE-NTPQRYSDFIEESSLIVEAMELSGPR  429
             KW ASQ+ +  R R +E ++ +RYSD  ++SSL+V+AMELSGPR
Sbjct  578   KWAASQKAEATRSRANEFSSSERYSDLTDDSSLLVQAMELSGPR  621



>ref|XP_003552626.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like isoform X1 [Glycine 
max]
 ref|XP_006602982.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like isoform X2 [Glycine 
max]
Length=623

 Score =   368 bits (945),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 175/224 (78%), Positives = 202/224 (90%), Gaps = 1/224 (0%)
 Frame = -1

Query  1097  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVS  918
             RK IALG  RGL+YLHEQCDPKIIHRDVKAANILLD+ +EAVVGDFGLAKLLDH++SHV+
Sbjct  400   RKHIALGAGRGLLYLHEQCDPKIIHRDVKAANILLDDYYEAVVGDFGLAKLLDHQDSHVT  459

Query  917   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVK  738
             TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQ+A++FG+ AN KG +LDWVK
Sbjct  460   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQRALEFGKSANNKGAMLDWVK  519

Query  737   TLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAE  558
              +HQE KL+++VDKDLKNN+DR+ELEEMVQVALLCTQ+ P HRPKMSEV+RMLEGDGLAE
Sbjct  520   KIHQEKKLDMLVDKDLKNNYDRIELEEMVQVALLCTQYLPGHRPKMSEVVRMLEGDGLAE  579

Query  557   KWEASQRNDTPRFRTHENTPQ-RYSDFIEESSLIVEAMELSGPR  429
             KWEASQR DT + +  E++   RYSD  ++S L+V+AMELSGPR
Sbjct  580   KWEASQRVDTTKCKPQESSSSDRYSDLTDDSLLLVQAMELSGPR  623



>gb|KHN13790.1| Protein NSP-INTERACTING KINASE 1 [Glycine soja]
Length=623

 Score =   368 bits (945),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 175/224 (78%), Positives = 202/224 (90%), Gaps = 1/224 (0%)
 Frame = -1

Query  1097  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVS  918
             RK IALG  RGL+YLHEQCDPKIIHRDVKAANILLD+ +EAVVGDFGLAKLLDH++SHV+
Sbjct  400   RKHIALGAGRGLLYLHEQCDPKIIHRDVKAANILLDDYYEAVVGDFGLAKLLDHQDSHVT  459

Query  917   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVK  738
             TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQ+A++FG+ AN KG +LDWVK
Sbjct  460   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQRALEFGKSANNKGAMLDWVK  519

Query  737   TLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAE  558
              +HQE KL+++VDKDLKNN+DR+ELEEMVQVALLCTQ+ P HRPKMSEV+RMLEGDGLAE
Sbjct  520   KIHQEKKLDMLVDKDLKNNYDRIELEEMVQVALLCTQYLPGHRPKMSEVVRMLEGDGLAE  579

Query  557   KWEASQRNDTPRFRTHENTPQ-RYSDFIEESSLIVEAMELSGPR  429
             KWEASQR DT + +  E++   RYSD  ++S L+V+AMELSGPR
Sbjct  580   KWEASQRVDTTKCKPQESSSSDRYSDLTDDSLLLVQAMELSGPR  623



>ref|XP_007033440.1| NSP-interacting kinase 1 [Theobroma cacao]
 gb|EOY04366.1| NSP-interacting kinase 1 [Theobroma cacao]
Length=649

 Score =   369 bits (946),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 175/224 (78%), Positives = 203/224 (91%), Gaps = 1/224 (0%)
 Frame = -1

Query  1097  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVS  918
             RKRIALG ARGL+YLHEQCDPKIIHRDVKAANILLD+  EAVVGDFGLAKLLDH++SHV+
Sbjct  406   RKRIALGAARGLLYLHEQCDPKIIHRDVKAANILLDDYCEAVVGDFGLAKLLDHQDSHVT  465

Query  917   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVK  738
             TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQ+A++FG+ ANQKG +LDWV+
Sbjct  466   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQRALEFGKAANQKGAMLDWVR  525

Query  737   TLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAE  558
              +HQE KL  +VDKDLK+N+DR+ELEEMVQVALLCTQ+ P HRPKMSEV+RMLEGDGLAE
Sbjct  526   KIHQEKKLEGLVDKDLKSNYDRIELEEMVQVALLCTQYLPGHRPKMSEVVRMLEGDGLAE  585

Query  557   KWEASQRNDTPRFRTHE-NTPQRYSDFIEESSLIVEAMELSGPR  429
             +WEASQR +  + + HE ++  RYSD  ++SSL+V+AMELSGPR
Sbjct  586   RWEASQRAEATKCKPHEFSSSDRYSDLTDDSSLLVQAMELSGPR  629



>ref|XP_010032589.1| PREDICTED: protein NSP-INTERACTING KINASE 1 [Eucalyptus grandis]
 gb|KCW52001.1| hypothetical protein EUGRSUZ_J01441 [Eucalyptus grandis]
 gb|KCW52002.1| hypothetical protein EUGRSUZ_J01441 [Eucalyptus grandis]
Length=629

 Score =   368 bits (944),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 174/224 (78%), Positives = 206/224 (92%), Gaps = 1/224 (0%)
 Frame = -1

Query  1097  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVS  918
             RKRIALG ARGL+YLHEQCDPKIIHRDVKAANILLD+  EAVVGDFGLAKLLDH++SHV+
Sbjct  406   RKRIALGAARGLLYLHEQCDPKIIHRDVKAANILLDDYCEAVVGDFGLAKLLDHQDSHVT  465

Query  917   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVK  738
             TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQ+A++FG+ ANQKG +LDWVK
Sbjct  466   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQRALEFGKAANQKGAMLDWVK  525

Query  737   TLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAE  558
              +HQE KL ++VDKDL++N+DR+ELEE+VQVALLCTQ+ P+HRPKMSEV+RMLEGDGLAE
Sbjct  526   KIHQEKKLEMLVDKDLRSNYDRIELEEIVQVALLCTQYLPAHRPKMSEVVRMLEGDGLAE  585

Query  557   KWEASQRNDTPRFRTHE-NTPQRYSDFIEESSLIVEAMELSGPR  429
             +WEASQR ++ + + HE ++  RYSD  ++SSL+V+AMELSGPR
Sbjct  586   RWEASQRVESNKGKPHEFSSSDRYSDLTDDSSLLVQAMELSGPR  629



>ref|XP_002305306.2| hypothetical protein POPTR_0004s10790g [Populus trichocarpa]
 gb|EEE85817.2| hypothetical protein POPTR_0004s10790g [Populus trichocarpa]
Length=627

 Score =   368 bits (944),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 175/224 (78%), Positives = 203/224 (91%), Gaps = 1/224 (0%)
 Frame = -1

Query  1097  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVS  918
             RKRIALG ARGL+YLHEQCDPKIIHRDVKAANILLD+  EAVVGDFGLAKLLDH++SHV+
Sbjct  404   RKRIALGAARGLLYLHEQCDPKIIHRDVKAANILLDDYCEAVVGDFGLAKLLDHQDSHVT  463

Query  917   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVK  738
             TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQ+A++FG+ ANQKG +LDWVK
Sbjct  464   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQRAIEFGKAANQKGAMLDWVK  523

Query  737   TLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAE  558
              +HQE KL ++VDKD+K N+DR+ELEEMVQVALL TQ+ PSHRPKMSEV+RMLEGDGLAE
Sbjct  524   KIHQEKKLEMLVDKDIKGNYDRIELEEMVQVALLSTQYLPSHRPKMSEVVRMLEGDGLAE  583

Query  557   KWEASQRNDTPRFRTHE-NTPQRYSDFIEESSLIVEAMELSGPR  429
             +WEASQR +  + + HE ++  RYSD  ++SSL+V+AMELSGPR
Sbjct  584   RWEASQRAEATKSKPHEFSSSDRYSDLTDDSSLLVQAMELSGPR  627



>ref|XP_006384231.1| hypothetical protein POPTR_0004s10790g [Populus trichocarpa]
 gb|ERP62028.1| hypothetical protein POPTR_0004s10790g [Populus trichocarpa]
Length=626

 Score =   368 bits (944),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 175/224 (78%), Positives = 203/224 (91%), Gaps = 1/224 (0%)
 Frame = -1

Query  1097  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVS  918
             RKRIALG ARGL+YLHEQCDPKIIHRDVKAANILLD+  EAVVGDFGLAKLLDH++SHV+
Sbjct  403   RKRIALGAARGLLYLHEQCDPKIIHRDVKAANILLDDYCEAVVGDFGLAKLLDHQDSHVT  462

Query  917   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVK  738
             TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQ+A++FG+ ANQKG +LDWVK
Sbjct  463   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQRAIEFGKAANQKGAMLDWVK  522

Query  737   TLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAE  558
              +HQE KL ++VDKD+K N+DR+ELEEMVQVALL TQ+ PSHRPKMSEV+RMLEGDGLAE
Sbjct  523   KIHQEKKLEMLVDKDIKGNYDRIELEEMVQVALLSTQYLPSHRPKMSEVVRMLEGDGLAE  582

Query  557   KWEASQRNDTPRFRTHE-NTPQRYSDFIEESSLIVEAMELSGPR  429
             +WEASQR +  + + HE ++  RYSD  ++SSL+V+AMELSGPR
Sbjct  583   RWEASQRAEATKSKPHEFSSSDRYSDLTDDSSLLVQAMELSGPR  626



>ref|XP_002514536.1| BRASSINOSTEROID INSENSITIVE 1-associated receptor kinase 1 precursor, 
putative [Ricinus communis]
 gb|EEF47642.1| BRASSINOSTEROID INSENSITIVE 1-associated receptor kinase 1 precursor, 
putative [Ricinus communis]
Length=576

 Score =   366 bits (940),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 174/224 (78%), Positives = 202/224 (90%), Gaps = 1/224 (0%)
 Frame = -1

Query  1097  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVS  918
             RKRIALG ARGL+YLHEQCDPKIIHRDVKAANILLDE  EAVVGDFGLAKLLDHR+SHV+
Sbjct  353   RKRIALGTARGLLYLHEQCDPKIIHRDVKAANILLDEYCEAVVGDFGLAKLLDHRDSHVT  412

Query  917   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVK  738
             TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLEL+ G +A++FG+ ANQKG +LDW+K
Sbjct  413   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELVHGLRALEFGKSANQKGAMLDWIK  472

Query  737   TLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAE  558
              +HQ+ KL L+VDK+LKNN+D +ELEE+V+VALLCTQF P HRPKMSEV+RMLEGDGLAE
Sbjct  473   KIHQDKKLELLVDKNLKNNYDPIELEEIVRVALLCTQFIPGHRPKMSEVVRMLEGDGLAE  532

Query  557   KWEASQRNDTPRFRTHE-NTPQRYSDFIEESSLIVEAMELSGPR  429
             KWEASQR +  R R +E ++ +RYSD  ++SSL+V+AMELSGPR
Sbjct  533   KWEASQRAEATRSRANEFSSSERYSDLTDDSSLLVQAMELSGPR  576



>ref|XP_003555046.1| PREDICTED: protein NSP-INTERACTING KINASE 1 isoformX1 [Glycine 
max]
Length=624

 Score =   367 bits (943),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 176/224 (79%), Positives = 202/224 (90%), Gaps = 1/224 (0%)
 Frame = -1

Query  1097  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVS  918
             RK+IALG ARGL+YLHEQCDPKIIHRDVKAANILLD+  EAVVGDFGLAKLLDH++SHV+
Sbjct  401   RKQIALGAARGLLYLHEQCDPKIIHRDVKAANILLDDYCEAVVGDFGLAKLLDHQDSHVT  460

Query  917   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVK  738
             TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQ+A++FG+ ANQKG +LDWV+
Sbjct  461   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQRALEFGKAANQKGAMLDWVR  520

Query  737   TLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAE  558
              LHQE KL L+VDKDLK N+DR+ELEE+VQVALLCTQ+ P HRPKMSEV+RMLEGDGLAE
Sbjct  521   KLHQEKKLELLVDKDLKTNYDRIELEEIVQVALLCTQYLPGHRPKMSEVVRMLEGDGLAE  580

Query  557   KWEASQRNDTPRFRTHE-NTPQRYSDFIEESSLIVEAMELSGPR  429
             KWEASQ  DT + +  E ++  RYSD  ++SSL+V+AMELSGPR
Sbjct  581   KWEASQSADTTKCKPQELSSSDRYSDLTDDSSLLVQAMELSGPR  624



>ref|NP_001169689.1| LOC100383570 precursor [Zea mays]
 gb|ACN34528.1| unknown [Zea mays]
 tpg|DAA53256.1| TPA: putative leucine-rich repeat receptor-like protein kinase 
family protein [Zea mays]
Length=634

 Score =   368 bits (944),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 178/224 (79%), Positives = 201/224 (90%), Gaps = 1/224 (0%)
 Frame = -1

Query  1097  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVS  918
             RKRIALG ARGL+YLHEQCDPKIIHRDVKA+N+LLDE FEA+VGDFGLAKLLDHRESHV+
Sbjct  411   RKRIALGTARGLLYLHEQCDPKIIHRDVKASNVLLDEYFEAIVGDFGLAKLLDHRESHVT  470

Query  917   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVK  738
             TAVRGTVGHIAPEYLSTGQSSEKTDVFGFG+LL+ELITGQKA+DFGR ANQKG +LDWVK
Sbjct  471   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGVLLVELITGQKALDFGRVANQKGGVLDWVK  530

Query  737   TLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAE  558
              LHQE +L  MVDKDL +++DRVELEEMVQV+LLCTQ++PSHRP+MSEV+RMLEGDGLAE
Sbjct  531   KLHQEKQLGTMVDKDLGSSYDRVELEEMVQVSLLCTQYHPSHRPRMSEVIRMLEGDGLAE  590

Query  557   KWEASQRNDTPRFRTHENTPQRYSDF-IEESSLIVEAMELSGPR  429
             +WEASQ  DTP   + E   Q+Y DF  +E SL +EAMELSGPR
Sbjct  591   RWEASQNVDTPESVSSELLLQKYMDFAADECSLGLEAMELSGPR  634



>ref|XP_004507264.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like [Cicer arietinum]
Length=626

 Score =   367 bits (943),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 175/226 (77%), Positives = 205/226 (91%), Gaps = 3/226 (1%)
 Frame = -1

Query  1097  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVS  918
             RK+IALG ARGL+YLHEQCDPKIIHRDVKAANILLD+  EAVVGDFGLAKLLDH++SHV+
Sbjct  401   RKQIALGAARGLLYLHEQCDPKIIHRDVKAANILLDDYCEAVVGDFGLAKLLDHKDSHVT  460

Query  917   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVK  738
             TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITG +A++FG+ ANQKG +LDWVK
Sbjct  461   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGLRALEFGKAANQKGAMLDWVK  520

Query  737   TLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAE  558
              +HQE KL L+VDKDLKNN+DR+EL+EMVQVALLCTQ+ P HRPKMSEV+RMLEGDGLA+
Sbjct  521   KIHQEKKLELLVDKDLKNNYDRIELDEMVQVALLCTQYLPGHRPKMSEVVRMLEGDGLAD  580

Query  557   KWEASQRN--DTPRFRTHE-NTPQRYSDFIEESSLIVEAMELSGPR  429
             KWEASQ+N  +T + + HE ++  RYSD  ++SSL+++AMELSGPR
Sbjct  581   KWEASQKNVDNTTKCKQHELSSSDRYSDLTDDSSLLIQAMELSGPR  626



>ref|XP_004149504.1| PREDICTED: protein NSP-INTERACTING KINASE 2-like [Cucumis sativus]
Length=623

 Score =   367 bits (943),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 174/224 (78%), Positives = 204/224 (91%), Gaps = 1/224 (0%)
 Frame = -1

Query  1097  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVS  918
             RKRIALG ARGL+YLHEQCDPKIIHRDVKAANILLD+  EAVVGDFGLAKLLDHR+SHV+
Sbjct  400   RKRIALGAARGLLYLHEQCDPKIIHRDVKAANILLDDFCEAVVGDFGLAKLLDHRDSHVT  459

Query  917   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVK  738
             TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELI+GQ+A++FG+ ANQKG ILDWVK
Sbjct  460   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELISGQRALEFGKAANQKGAILDWVK  519

Query  737   TLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAE  558
              +HQE KL ++VDKDL++N+DR+ELEE+V+VALLC Q+ PSHRPKMSEV+RMLEGDGLAE
Sbjct  520   KIHQEKKLEMLVDKDLRSNYDRIELEEIVRVALLCIQYLPSHRPKMSEVVRMLEGDGLAE  579

Query  557   KWEASQRNDTPRFRTHE-NTPQRYSDFIEESSLIVEAMELSGPR  429
             KWEASQR +  R R +E ++ +RYSD  ++SSL V+A++LSGPR
Sbjct  580   KWEASQRAEASRSRANEFSSSERYSDLTDDSSLFVQAIQLSGPR  623



>emb|CDY61461.1| BnaC01g43240D [Brassica napus]
Length=635

 Score =   367 bits (943),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 180/238 (76%), Positives = 204/238 (86%), Gaps = 22/238 (9%)
 Frame = -1

Query  1097  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVS  918
             RK+IA+G ARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHR+SHV+
Sbjct  405   RKKIAVGTARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRDSHVT  464

Query  917   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVK  738
             TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKA+DFGR ++QKGV+LDWVK
Sbjct  465   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKALDFGRSSHQKGVMLDWVK  524

Query  737   TLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAE  558
              LHQEGKL  ++DKDL + +D VELEE+VQVALLCTQFNPS+RPKMSEV++MLEGDGLA+
Sbjct  525   KLHQEGKLKQLIDKDLNDKYDTVELEEIVQVALLCTQFNPSNRPKMSEVMKMLEGDGLAD  584

Query  557   KWEASQR---------------NDTPRFRTHENTPQRYSDFIEESSLIVEAMELSGPR  429
             +WEASQ                + +PR R        YSD+I+ESSL+VEA+ELSGPR
Sbjct  585   RWEASQSGGAKSLPPPLPSGMVSSSPRVR-------YYSDYIQESSLVVEAIELSGPR  635



>ref|NP_001238448.1| NSP-interacting kinase precursor [Glycine max]
 gb|ACM89473.1| NSP-interacting kinase [Glycine max]
Length=600

 Score =   366 bits (940),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 176/224 (79%), Positives = 201/224 (90%), Gaps = 1/224 (0%)
 Frame = -1

Query  1097  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVS  918
             RK+IALG ARGL+YLHEQCDPKIIHRDVKAANILLD+  EAVVGDFGLAKLLDH++SHV+
Sbjct  377   RKQIALGAARGLLYLHEQCDPKIIHRDVKAANILLDDYCEAVVGDFGLAKLLDHQDSHVT  436

Query  917   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVK  738
             TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQ+A++FG+ ANQKG +LDWV+
Sbjct  437   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQRALEFGKAANQKGAMLDWVR  496

Query  737   TLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAE  558
              LHQE KL L+VDKDLK N+DR+ELEE+VQVALLCTQ+ P HRPKMSEV+RMLEGDGLAE
Sbjct  497   KLHQEKKLELLVDKDLKTNYDRIELEEIVQVALLCTQYLPGHRPKMSEVVRMLEGDGLAE  556

Query  557   KWEASQRNDTPRFRTHE-NTPQRYSDFIEESSLIVEAMELSGPR  429
             KWEASQ  DT   +  E ++  RYSD  ++SSL+V+AMELSGPR
Sbjct  557   KWEASQSADTSNCKPQELSSSDRYSDLTDDSSLLVQAMELSGPR  600



>gb|KJB43139.1| hypothetical protein B456_007G186300 [Gossypium raimondii]
Length=475

 Score =   362 bits (930),  Expect = 6e-118, Method: Compositional matrix adjust.
 Identities = 173/225 (77%), Positives = 202/225 (90%), Gaps = 2/225 (1%)
 Frame = -1

Query  1097  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVS  918
             RKRIALG  RGL+YLHEQCDPKIIHRDVKAANILLD+  EAVVGDFGLAKLLDH +SHV+
Sbjct  251   RKRIALGAGRGLLYLHEQCDPKIIHRDVKAANILLDDYCEAVVGDFGLAKLLDHHDSHVT  310

Query  917   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVK  738
             TAVRGTVGHIAPEYLSTGQSS+KTDVFGFGILLLELITGQ+A++FG+ ANQKG +LDWV+
Sbjct  311   TAVRGTVGHIAPEYLSTGQSSDKTDVFGFGILLLELITGQRALEFGKAANQKGAMLDWVR  370

Query  737   TLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAE  558
              +H E KL ++VDKDLKNN+DR+ELEEMVQVALLCTQ+ P HRPKMSEV+RMLEGDGLAE
Sbjct  371   KIHHEKKLEVLVDKDLKNNYDRIELEEMVQVALLCTQYLPGHRPKMSEVVRMLEGDGLAE  430

Query  557   KWEASQRNDTPRFR-THE-NTPQRYSDFIEESSLIVEAMELSGPR  429
             +WEASQR ++ + +  HE ++  RYSD  ++SSL+V+AMELSGPR
Sbjct  431   RWEASQRAESTKCKPPHEFSSSDRYSDLTDDSSLLVQAMELSGPR  475



>gb|KHN30771.1| Protein NSP-INTERACTING KINASE 1 [Glycine soja]
Length=619

 Score =   367 bits (942),  Expect = 6e-118, Method: Compositional matrix adjust.
 Identities = 176/224 (79%), Positives = 202/224 (90%), Gaps = 1/224 (0%)
 Frame = -1

Query  1097  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVS  918
             RK+IALG ARGL+YLHEQCDPKIIHRDVKAANILLD+  EAVVGDFGLAKLLDH++SHV+
Sbjct  396   RKQIALGAARGLLYLHEQCDPKIIHRDVKAANILLDDYCEAVVGDFGLAKLLDHQDSHVT  455

Query  917   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVK  738
             TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQ+A++FG+ ANQKG +LDWV+
Sbjct  456   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQRALEFGKAANQKGAMLDWVR  515

Query  737   TLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAE  558
              LHQE KL L+VDKDLK N+DR+ELEE+VQVALLCTQ+ P HRPKMSEV+RMLEGDGLAE
Sbjct  516   KLHQEKKLELLVDKDLKTNYDRIELEEIVQVALLCTQYLPGHRPKMSEVVRMLEGDGLAE  575

Query  557   KWEASQRNDTPRFRTHE-NTPQRYSDFIEESSLIVEAMELSGPR  429
             KWEASQ  DT + +  E ++  RYSD  ++SSL+V+AMELSGPR
Sbjct  576   KWEASQSADTTKCKPQELSSSDRYSDLTDDSSLLVQAMELSGPR  619



>ref|XP_006593317.1| PREDICTED: NSP-interacting kinase isoform X1 [Glycine max]
 gb|KHN02661.1| Protein NSP-INTERACTING KINASE 1 [Glycine soja]
Length=624

 Score =   367 bits (942),  Expect = 7e-118, Method: Compositional matrix adjust.
 Identities = 176/224 (79%), Positives = 201/224 (90%), Gaps = 1/224 (0%)
 Frame = -1

Query  1097  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVS  918
             RK+IALG ARGL+YLHEQCDPKIIHRDVKAANILLD+  EAVVGDFGLAKLLDH++SHV+
Sbjct  401   RKQIALGAARGLLYLHEQCDPKIIHRDVKAANILLDDYCEAVVGDFGLAKLLDHQDSHVT  460

Query  917   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVK  738
             TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQ+A++FG+ ANQKG +LDWV+
Sbjct  461   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQRALEFGKAANQKGAMLDWVR  520

Query  737   TLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAE  558
              LHQE KL L+VDKDLK N+DR+ELEE+VQVALLCTQ+ P HRPKMSEV+RMLEGDGLAE
Sbjct  521   KLHQEKKLELLVDKDLKTNYDRIELEEIVQVALLCTQYLPGHRPKMSEVVRMLEGDGLAE  580

Query  557   KWEASQRNDTPRFRTHE-NTPQRYSDFIEESSLIVEAMELSGPR  429
             KWEASQ  DT   +  E ++  RYSD  ++SSL+V+AMELSGPR
Sbjct  581   KWEASQSADTSNCKPQELSSSDRYSDLTDDSSLLVQAMELSGPR  624



>dbj|BAK02609.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=632

 Score =   367 bits (942),  Expect = 9e-118, Method: Compositional matrix adjust.
 Identities = 177/225 (79%), Positives = 203/225 (90%), Gaps = 2/225 (1%)
 Frame = -1

Query  1097  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVS  918
             RK IALG ARGL+YLHEQCDPKIIHRDVKA+N+LLDE FEA+VGDFGLAKLLDH+E+HV+
Sbjct  408   RKMIALGTARGLLYLHEQCDPKIIHRDVKASNVLLDEYFEAIVGDFGLAKLLDHQETHVT  467

Query  917   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVK  738
             TAVRGTVGHIAPEYLSTGQSSEKTDVFGFG+LL+ELITGQKA+DFGR ANQKG +LD VK
Sbjct  468   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGVLLVELITGQKALDFGRLANQKGGVLDLVK  527

Query  737   TLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAE  558
              LHQE +LN+MVDKDL +N+DRVELEEMVQVALLCTQ+ PSHRP+MSEV+RMLEGDGLAE
Sbjct  528   KLHQEKQLNMMVDKDLGSNYDRVELEEMVQVALLCTQYYPSHRPRMSEVIRMLEGDGLAE  587

Query  557   KWEASQRNDTPRFRTHENTPQRYSDF--IEESSLIVEAMELSGPR  429
             KWEASQ  DTP+  + E  P +++DF   +ESS+ +EAMELSGPR
Sbjct  588   KWEASQNVDTPKSVSSELLPLKFTDFAGADESSVGLEAMELSGPR  632



>ref|XP_010929457.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like [Elaeis guineensis]
Length=624

 Score =   367 bits (941),  Expect = 9e-118, Method: Compositional matrix adjust.
 Identities = 174/224 (78%), Positives = 204/224 (91%), Gaps = 1/224 (0%)
 Frame = -1

Query  1097  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVS  918
             RKRIALG ARGL+YLHEQCDPKIIHRDVKAANILLD+  EAVVGDFGLAKLLDHR+SHV+
Sbjct  401   RKRIALGAARGLLYLHEQCDPKIIHRDVKAANILLDDYCEAVVGDFGLAKLLDHRDSHVT  460

Query  917   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVK  738
             TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGIL+LELITG +A++FG+ ANQKG +LDWVK
Sbjct  461   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILILELITGLRAMEFGKAANQKGAMLDWVK  520

Query  737   TLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAE  558
              +HQE KL+++VDKDLKN++DR+ELEEMVQVALLCTQ+ P  RPKMSEV+RMLEGDGLAE
Sbjct  521   KIHQEKKLDMLVDKDLKNDYDRIELEEMVQVALLCTQYLPGQRPKMSEVVRMLEGDGLAE  580

Query  557   KWEASQRNDTPRFRTHE-NTPQRYSDFIEESSLIVEAMELSGPR  429
             +WEASQR +  +F+  E ++ +RYSD  ++SSL+V+AMELSGPR
Sbjct  581   RWEASQRVEAHKFKMPEFSSSERYSDLTDDSSLLVQAMELSGPR  624



>ref|XP_011099082.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like isoform X2 [Sesamum 
indicum]
Length=627

 Score =   366 bits (940),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 175/224 (78%), Positives = 202/224 (90%), Gaps = 1/224 (0%)
 Frame = -1

Query  1097  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVS  918
             RKRIALG ARGL+YLHEQCDPKIIHRDVKAANILLD+  EAVVGDFGLAKLLDH++SHV+
Sbjct  404   RKRIALGAARGLLYLHEQCDPKIIHRDVKAANILLDDYCEAVVGDFGLAKLLDHQDSHVT  463

Query  917   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVK  738
             TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQ+A+ FG+ ANQKG +LDWVK
Sbjct  464   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQRALQFGKSANQKGAVLDWVK  523

Query  737   TLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAE  558
              LHQE KL  +VDKDLKNN+DR+ELEEMVQVALLCTQ+ P  RPKMSEV+RMLEGDGLAE
Sbjct  524   KLHQEKKLEDLVDKDLKNNYDRIELEEMVQVALLCTQYLPGLRPKMSEVVRMLEGDGLAE  583

Query  557   KWEASQRNDTPRFRTHE-NTPQRYSDFIEESSLIVEAMELSGPR  429
             +WEASQR ++ + +T E ++ +RYSD  ++SSL+ +A+ELSGPR
Sbjct  584   RWEASQRLESNKLKTQELSSSERYSDLTDDSSLLAQAIELSGPR  627



>ref|XP_011012714.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like isoform X1 [Populus 
euphratica]
Length=627

 Score =   366 bits (940),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 173/224 (77%), Positives = 203/224 (91%), Gaps = 1/224 (0%)
 Frame = -1

Query  1097  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVS  918
             RKRIALG ARGL+YLHEQCDPKIIHRDVKAANILLD+  EAVVGDFGLAKLLDH++SHV+
Sbjct  404   RKRIALGAARGLLYLHEQCDPKIIHRDVKAANILLDDYCEAVVGDFGLAKLLDHQDSHVT  463

Query  917   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVK  738
             TAVRGT+GHIAPEYLSTGQSSEKTDVFGFGILLLELITGQ+A++FG+ ANQKG +LDWVK
Sbjct  464   TAVRGTIGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQRAIEFGKAANQKGAMLDWVK  523

Query  737   TLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAE  558
              +HQE KL ++VDKD+K N+DR+ELEEMVQVALL TQ+ P+HRPKMSEV+RMLEGDGLAE
Sbjct  524   KIHQEKKLEMLVDKDIKGNYDRIELEEMVQVALLSTQYLPNHRPKMSEVVRMLEGDGLAE  583

Query  557   KWEASQRNDTPRFRTHE-NTPQRYSDFIEESSLIVEAMELSGPR  429
             +WEASQR +  + + HE ++  RYSD  ++SSL+V+AMELSGPR
Sbjct  584   RWEASQRAEATKSKPHEFSSSDRYSDLTDDSSLLVQAMELSGPR  627



>emb|CDP02372.1| unnamed protein product [Coffea canephora]
Length=624

 Score =   366 bits (939),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 171/224 (76%), Positives = 204/224 (91%), Gaps = 1/224 (0%)
 Frame = -1

Query  1097  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVS  918
             RKRIA+G ARGL+YLHEQCDPKIIHRDVKAANILLD+  EAVVGDFGLAKLLDH++SHV+
Sbjct  401   RKRIAIGAARGLLYLHEQCDPKIIHRDVKAANILLDDYCEAVVGDFGLAKLLDHQDSHVT  460

Query  917   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVK  738
             TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQ+A++F + ANQKG +LDWVK
Sbjct  461   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQRALEFNKAANQKGAMLDWVK  520

Query  737   TLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAE  558
              +HQE KL+++VDKDL+NN+D +E+EEMVQVALLCTQ+ PSHRPKMSEV++MLEGDGLAE
Sbjct  521   RIHQEKKLDILVDKDLRNNYDCIEVEEMVQVALLCTQYLPSHRPKMSEVIQMLEGDGLAE  580

Query  557   KWEASQRNDTPRFRTHE-NTPQRYSDFIEESSLIVEAMELSGPR  429
             +WE SQR ++ ++RT E +  +RYSD  ++SSL+ +AMELSGPR
Sbjct  581   RWEVSQRLESSKYRTQELSASERYSDLTDDSSLLAQAMELSGPR  624



>ref|XP_011099081.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like isoform X1 [Sesamum 
indicum]
Length=631

 Score =   366 bits (939),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 175/224 (78%), Positives = 202/224 (90%), Gaps = 1/224 (0%)
 Frame = -1

Query  1097  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVS  918
             RKRIALG ARGL+YLHEQCDPKIIHRDVKAANILLD+  EAVVGDFGLAKLLDH++SHV+
Sbjct  408   RKRIALGAARGLLYLHEQCDPKIIHRDVKAANILLDDYCEAVVGDFGLAKLLDHQDSHVT  467

Query  917   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVK  738
             TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQ+A+ FG+ ANQKG +LDWVK
Sbjct  468   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQRALQFGKSANQKGAVLDWVK  527

Query  737   TLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAE  558
              LHQE KL  +VDKDLKNN+DR+ELEEMVQVALLCTQ+ P  RPKMSEV+RMLEGDGLAE
Sbjct  528   KLHQEKKLEDLVDKDLKNNYDRIELEEMVQVALLCTQYLPGLRPKMSEVVRMLEGDGLAE  587

Query  557   KWEASQRNDTPRFRTHE-NTPQRYSDFIEESSLIVEAMELSGPR  429
             +WEASQR ++ + +T E ++ +RYSD  ++SSL+ +A+ELSGPR
Sbjct  588   RWEASQRLESNKLKTQELSSSERYSDLTDDSSLLAQAIELSGPR  631



>ref|XP_007139356.1| hypothetical protein PHAVU_008G022700g [Phaseolus vulgaris]
 ref|XP_007139357.1| hypothetical protein PHAVU_008G022700g [Phaseolus vulgaris]
 gb|ESW11350.1| hypothetical protein PHAVU_008G022700g [Phaseolus vulgaris]
 gb|ESW11351.1| hypothetical protein PHAVU_008G022700g [Phaseolus vulgaris]
Length=623

 Score =   366 bits (939),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 174/224 (78%), Positives = 202/224 (90%), Gaps = 1/224 (0%)
 Frame = -1

Query  1097  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVS  918
             RK IALG ARGL+YLHEQCDPKIIHRDVKAANILLD+  EAVVGDFGLAKLLDH++SHV+
Sbjct  400   RKHIALGAARGLLYLHEQCDPKIIHRDVKAANILLDDYCEAVVGDFGLAKLLDHQDSHVT  459

Query  917   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVK  738
             TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQ+A++FG+ AN KG +LDWVK
Sbjct  460   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQRALEFGKSANNKGAMLDWVK  519

Query  737   TLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAE  558
              +HQE KL ++VDKDLK+N+DR+ELEEMVQVALLCTQ+ P HRPKMSEV+RMLEGDGLAE
Sbjct  520   KIHQEKKLEILVDKDLKSNYDRIELEEMVQVALLCTQYLPGHRPKMSEVVRMLEGDGLAE  579

Query  557   KWEASQRNDTPRFRTHENTPQ-RYSDFIEESSLIVEAMELSGPR  429
             +WEASQR DT +++  E++   RYSD  ++S L+V+AMELSGPR
Sbjct  580   RWEASQRVDTTKYKPQESSSSDRYSDLTDDSLLLVQAMELSGPR  623



>emb|CBI16897.3| unnamed protein product [Vitis vinifera]
Length=622

 Score =   365 bits (938),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 174/224 (78%), Positives = 204/224 (91%), Gaps = 1/224 (0%)
 Frame = -1

Query  1097  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVS  918
             RKRIALG ARGL+YLHEQCDPKIIHRDVKAANILLD+  EAVVGDFGLAKLLDH++SHV+
Sbjct  399   RKRIALGAARGLLYLHEQCDPKIIHRDVKAANILLDDYCEAVVGDFGLAKLLDHQDSHVT  458

Query  917   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVK  738
             TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQ+A++FG+ ANQKG +LDWVK
Sbjct  459   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQRALEFGKAANQKGAMLDWVK  518

Query  737   TLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAE  558
              +HQE +L ++VDKDLK+ +DRVELEEMVQVALLCTQ+ P HRPKMSEV++MLEGDGLAE
Sbjct  519   KIHQEKRLEILVDKDLKHFYDRVELEEMVQVALLCTQYLPGHRPKMSEVVQMLEGDGLAE  578

Query  557   KWEASQRNDTPRFRTHE-NTPQRYSDFIEESSLIVEAMELSGPR  429
             +WEASQR +  + + HE ++ +RYSD  ++SSL+V+AMELSGPR
Sbjct  579   RWEASQRGEVTKCKPHELSSSERYSDLTDDSSLLVQAMELSGPR  622



>ref|XP_011012715.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like isoform X2 [Populus 
euphratica]
Length=626

 Score =   366 bits (939),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 173/224 (77%), Positives = 203/224 (91%), Gaps = 1/224 (0%)
 Frame = -1

Query  1097  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVS  918
             RKRIALG ARGL+YLHEQCDPKIIHRDVKAANILLD+  EAVVGDFGLAKLLDH++SHV+
Sbjct  403   RKRIALGAARGLLYLHEQCDPKIIHRDVKAANILLDDYCEAVVGDFGLAKLLDHQDSHVT  462

Query  917   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVK  738
             TAVRGT+GHIAPEYLSTGQSSEKTDVFGFGILLLELITGQ+A++FG+ ANQKG +LDWVK
Sbjct  463   TAVRGTIGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQRAIEFGKAANQKGAMLDWVK  522

Query  737   TLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAE  558
              +HQE KL ++VDKD+K N+DR+ELEEMVQVALL TQ+ P+HRPKMSEV+RMLEGDGLAE
Sbjct  523   KIHQEKKLEMLVDKDIKGNYDRIELEEMVQVALLSTQYLPNHRPKMSEVVRMLEGDGLAE  582

Query  557   KWEASQRNDTPRFRTHE-NTPQRYSDFIEESSLIVEAMELSGPR  429
             +WEASQR +  + + HE ++  RYSD  ++SSL+V+AMELSGPR
Sbjct  583   RWEASQRAEATKSKPHEFSSSDRYSDLTDDSSLLVQAMELSGPR  626



>ref|XP_002278965.1| PREDICTED: protein NSP-INTERACTING KINASE 1 [Vitis vinifera]
Length=624

 Score =   365 bits (938),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 174/224 (78%), Positives = 204/224 (91%), Gaps = 1/224 (0%)
 Frame = -1

Query  1097  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVS  918
             RKRIALG ARGL+YLHEQCDPKIIHRDVKAANILLD+  EAVVGDFGLAKLLDH++SHV+
Sbjct  401   RKRIALGAARGLLYLHEQCDPKIIHRDVKAANILLDDYCEAVVGDFGLAKLLDHQDSHVT  460

Query  917   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVK  738
             TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQ+A++FG+ ANQKG +LDWVK
Sbjct  461   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQRALEFGKAANQKGAMLDWVK  520

Query  737   TLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAE  558
              +HQE +L ++VDKDLK+ +DRVELEEMVQVALLCTQ+ P HRPKMSEV++MLEGDGLAE
Sbjct  521   KIHQEKRLEILVDKDLKHFYDRVELEEMVQVALLCTQYLPGHRPKMSEVVQMLEGDGLAE  580

Query  557   KWEASQRNDTPRFRTHE-NTPQRYSDFIEESSLIVEAMELSGPR  429
             +WEASQR +  + + HE ++ +RYSD  ++SSL+V+AMELSGPR
Sbjct  581   RWEASQRGEVTKCKPHELSSSERYSDLTDDSSLLVQAMELSGPR  624



>ref|XP_008807034.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like isoform X2 [Phoenix 
dactylifera]
Length=604

 Score =   365 bits (936),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 174/224 (78%), Positives = 201/224 (90%), Gaps = 1/224 (0%)
 Frame = -1

Query  1097  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVS  918
             RKRIALG ARGL+YLHEQCDPKIIHRDVKAANILLD+  EA+VGDFGLAKLLDHR+SHV+
Sbjct  381   RKRIALGAARGLLYLHEQCDPKIIHRDVKAANILLDDCCEAIVGDFGLAKLLDHRDSHVT  440

Query  917   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVK  738
             TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQ A++FG+ ANQKG +LDWVK
Sbjct  441   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQTALEFGKAANQKGAMLDWVK  500

Query  737   TLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAE  558
              +HQE KL+ +VDKDL++N+DR+ELEEMVQVALLCTQ+ P HRPKMSEV+RMLEGDGLAE
Sbjct  501   KIHQEKKLDTLVDKDLRDNYDRIELEEMVQVALLCTQYLPGHRPKMSEVVRMLEGDGLAE  560

Query  557   KWEASQRNDTPRFRTHENTPQR-YSDFIEESSLIVEAMELSGPR  429
             +WEASQR D   F+  E + +R +SD  ++SSL+ +AMELSGPR
Sbjct  561   RWEASQRVDAHMFKLPEFSSERCFSDLTDDSSLLAQAMELSGPR  604



>ref|XP_006373507.1| hypothetical protein POPTR_0017s14360g [Populus trichocarpa]
 gb|ERP51304.1| hypothetical protein POPTR_0017s14360g [Populus trichocarpa]
Length=596

 Score =   364 bits (935),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 173/224 (77%), Positives = 201/224 (90%), Gaps = 1/224 (0%)
 Frame = -1

Query  1097  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVS  918
             RKRIALG ARGL+YLHEQCDPKIIHRDVKAANILLD+  EAVVGDFGLAKLLDH++SHV+
Sbjct  373   RKRIALGAARGLLYLHEQCDPKIIHRDVKAANILLDDYCEAVVGDFGLAKLLDHQDSHVT  432

Query  917   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVK  738
             TAVRGTVGHIAPEYLSTGQSS+KTDVFGFGILLLELITGQ+A++FG+ ANQKG +LDWVK
Sbjct  433   TAVRGTVGHIAPEYLSTGQSSDKTDVFGFGILLLELITGQRALEFGKAANQKGAMLDWVK  492

Query  737   TLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAE  558
              +HQE KL ++VDKDLK N+DR+ELEEMVQVALLCTQ+ PS RPKM EV++MLEGDGLAE
Sbjct  493   KIHQEKKLEMLVDKDLKGNYDRIELEEMVQVALLCTQYLPSQRPKMYEVVKMLEGDGLAE  552

Query  557   KWEASQRNDTPRFRTHE-NTPQRYSDFIEESSLIVEAMELSGPR  429
              WEASQR +  + + HE ++  RYSD  ++SSL+V+AMELSGPR
Sbjct  553   SWEASQRAEATKSKPHEFSSSDRYSDLTDDSSLLVQAMELSGPR  596



>ref|XP_009378313.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like [Pyrus x bretschneideri]
Length=636

 Score =   365 bits (937),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 173/224 (77%), Positives = 202/224 (90%), Gaps = 1/224 (0%)
 Frame = -1

Query  1097  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVS  918
             RKRIALG  RGL+YLHEQCDPKIIHRDVKAANILLD+  EAVVGDFGLAKLLDH++SHV+
Sbjct  413   RKRIALGAGRGLLYLHEQCDPKIIHRDVKAANILLDDYCEAVVGDFGLAKLLDHQDSHVT  472

Query  917   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVK  738
             TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQ+A++FG+ +NQKG ILDWVK
Sbjct  473   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQRALEFGKASNQKGAILDWVK  532

Query  737   TLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAE  558
              +HQE KL ++VDKDLK N+DR+ELEEMVQVALLCTQ+ PSHRPKMSEV+RMLEGDGL E
Sbjct  533   RIHQEKKLEMLVDKDLKTNYDRIELEEMVQVALLCTQYLPSHRPKMSEVVRMLEGDGLVE  592

Query  557   KWEASQRNDTPRFRTHE-NTPQRYSDFIEESSLIVEAMELSGPR  429
             +WEASQ+ ++ + +  E ++  RYSD  ++SSL+V+AMELSGPR
Sbjct  593   RWEASQKAESTKSKAPEFSSSDRYSDLTDDSSLLVQAMELSGPR  636



>ref|XP_008807033.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like isoform X1 [Phoenix 
dactylifera]
Length=624

 Score =   365 bits (936),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 174/224 (78%), Positives = 201/224 (90%), Gaps = 1/224 (0%)
 Frame = -1

Query  1097  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVS  918
             RKRIALG ARGL+YLHEQCDPKIIHRDVKAANILLD+  EA+VGDFGLAKLLDHR+SHV+
Sbjct  401   RKRIALGAARGLLYLHEQCDPKIIHRDVKAANILLDDCCEAIVGDFGLAKLLDHRDSHVT  460

Query  917   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVK  738
             TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQ A++FG+ ANQKG +LDWVK
Sbjct  461   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQTALEFGKAANQKGAMLDWVK  520

Query  737   TLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAE  558
              +HQE KL+ +VDKDL++N+DR+ELEEMVQVALLCTQ+ P HRPKMSEV+RMLEGDGLAE
Sbjct  521   KIHQEKKLDTLVDKDLRDNYDRIELEEMVQVALLCTQYLPGHRPKMSEVVRMLEGDGLAE  580

Query  557   KWEASQRNDTPRFRTHENTPQR-YSDFIEESSLIVEAMELSGPR  429
             +WEASQR D   F+  E + +R +SD  ++SSL+ +AMELSGPR
Sbjct  581   RWEASQRVDAHMFKLPEFSSERCFSDLTDDSSLLAQAMELSGPR  624



>gb|KHN14464.1| Protein NSP-INTERACTING KINASE 1 [Glycine soja]
Length=623

 Score =   365 bits (936),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 173/224 (77%), Positives = 201/224 (90%), Gaps = 1/224 (0%)
 Frame = -1

Query  1097  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVS  918
             RK IALG  RGL+YLHEQCDPKIIHRDVKAANILLD+ +EAVVGDFGLAKLLDH++SHV+
Sbjct  400   RKHIALGAGRGLLYLHEQCDPKIIHRDVKAANILLDDYYEAVVGDFGLAKLLDHQDSHVT  459

Query  917   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVK  738
             TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQ+A++FG+ AN KG +LDWVK
Sbjct  460   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQRALEFGKSANNKGAMLDWVK  519

Query  737   TLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAE  558
              +HQE KL ++VDKDLK+N+DR+ELEEMVQVALLCTQ+ P HRPKMSEV+RMLEGDGLAE
Sbjct  520   KIHQEKKLEMLVDKDLKSNYDRIELEEMVQVALLCTQYLPGHRPKMSEVVRMLEGDGLAE  579

Query  557   KWEASQRNDTPRFRTHENTPQ-RYSDFIEESSLIVEAMELSGPR  429
             +WEASQR DT + +  E++   RYSD  ++S L+V+AMELSGPR
Sbjct  580   RWEASQRVDTTKCKPQESSSSDRYSDLTDDSLLLVQAMELSGPR  623



>ref|XP_006647834.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like [Oryza brachyantha]
Length=626

 Score =   365 bits (936),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 174/224 (78%), Positives = 203/224 (91%), Gaps = 1/224 (0%)
 Frame = -1

Query  1097  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVS  918
             RKRIALG ARGL+YLHEQCDPKIIHRDVKAANILLD+  EA+VGDFGLAKLLDHR+SHV+
Sbjct  403   RKRIALGAARGLLYLHEQCDPKIIHRDVKAANILLDDYCEAIVGDFGLAKLLDHRDSHVT  462

Query  917   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVK  738
             TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQ A++FG+ +NQKG +LDWVK
Sbjct  463   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQTALEFGKSSNQKGAMLDWVK  522

Query  737   TLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAE  558
              +HQE KL+++VDK L++N+DRVELEEMVQVALLCTQ+ P HRP+MSEV+RMLEGDGLAE
Sbjct  523   KMHQEKKLDVLVDKGLRSNYDRVELEEMVQVALLCTQYLPGHRPRMSEVVRMLEGDGLAE  582

Query  557   KWEASQRNDTPRFRTHENTPQR-YSDFIEESSLIVEAMELSGPR  429
             +WEASQR D+ +F+  E T  R YSD  ++SSL+V+A+ELSGPR
Sbjct  583   RWEASQRADSHKFKVPEFTFGRCYSDLTDDSSLLVQAVELSGPR  626



>gb|ABD96908.1| hypothetical protein [Cleome spinosa]
Length=630

 Score =   365 bits (936),  Expect = 6e-117, Method: Compositional matrix adjust.
 Identities = 177/231 (77%), Positives = 200/231 (87%), Gaps = 8/231 (3%)
 Frame = -1

Query  1097  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVS  918
             RKRIA+G ARGLVYLHEQCDPKIIHRDVKAANILLD+  EAVVGDFGLAKLLDHRESHV+
Sbjct  400   RKRIAIGAARGLVYLHEQCDPKIIHRDVKAANILLDDYCEAVVGDFGLAKLLDHRESHVT  459

Query  917   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVK  738
             TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQ+A++FG+ ANQKG ILDWVK
Sbjct  460   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQRALEFGKSANQKGAILDWVK  519

Query  737   TLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAE  558
              +HQE KL ++VDKDLKNN+D +ELEE VQVALLCTQ+ P HRPKMSEV+RMLEGDGLAE
Sbjct  520   KIHQEKKLEVLVDKDLKNNYDHLELEETVQVALLCTQYLPGHRPKMSEVVRMLEGDGLAE  579

Query  557   KWEASQRNDTP--------RFRTHENTPQRYSDFIEESSLIVEAMELSGPR  429
             +WEASQR D+         R     ++  RYSD  ++S+L+V+AMELSGPR
Sbjct  580   RWEASQRTDSTAKCSSSSSRRLNELSSSDRYSDLTDDSTLLVQAMELSGPR  630



>ref|XP_011021146.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like isoform X1 [Populus 
euphratica]
Length=627

 Score =   364 bits (935),  Expect = 6e-117, Method: Compositional matrix adjust.
 Identities = 173/224 (77%), Positives = 201/224 (90%), Gaps = 1/224 (0%)
 Frame = -1

Query  1097  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVS  918
             RKRIALG ARGL+YLHEQCDPKIIHRDVKAANILLD+  EAVVGDFGLAKLLDH++SHV+
Sbjct  404   RKRIALGAARGLLYLHEQCDPKIIHRDVKAANILLDDYCEAVVGDFGLAKLLDHQDSHVT  463

Query  917   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVK  738
             TAVRGTVGHIAPEYLSTGQSS+KTDVFGFGILLLELITGQ+A++FG+ ANQKG +LDWVK
Sbjct  464   TAVRGTVGHIAPEYLSTGQSSDKTDVFGFGILLLELITGQRALEFGKAANQKGAMLDWVK  523

Query  737   TLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAE  558
              +HQE KL ++VDKDLK N+DR+ELEEMVQVALLCTQ+ PS RPKM EV++MLEGDGLAE
Sbjct  524   KIHQEKKLEMLVDKDLKGNYDRIELEEMVQVALLCTQYLPSQRPKMYEVVKMLEGDGLAE  583

Query  557   KWEASQRNDTPRFRTHE-NTPQRYSDFIEESSLIVEAMELSGPR  429
              WEASQR +  + + HE ++  RYSD  ++SSL+V+AMELSGPR
Sbjct  584   SWEASQRAEATKSKPHEFSSSDRYSDLTDDSSLLVQAMELSGPR  627



>ref|XP_011021148.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like isoform X2 [Populus 
euphratica]
Length=626

 Score =   364 bits (935),  Expect = 7e-117, Method: Compositional matrix adjust.
 Identities = 173/224 (77%), Positives = 201/224 (90%), Gaps = 1/224 (0%)
 Frame = -1

Query  1097  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVS  918
             RKRIALG ARGL+YLHEQCDPKIIHRDVKAANILLD+  EAVVGDFGLAKLLDH++SHV+
Sbjct  403   RKRIALGAARGLLYLHEQCDPKIIHRDVKAANILLDDYCEAVVGDFGLAKLLDHQDSHVT  462

Query  917   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVK  738
             TAVRGTVGHIAPEYLSTGQSS+KTDVFGFGILLLELITGQ+A++FG+ ANQKG +LDWVK
Sbjct  463   TAVRGTVGHIAPEYLSTGQSSDKTDVFGFGILLLELITGQRALEFGKAANQKGAMLDWVK  522

Query  737   TLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAE  558
              +HQE KL ++VDKDLK N+DR+ELEEMVQVALLCTQ+ PS RPKM EV++MLEGDGLAE
Sbjct  523   KIHQEKKLEMLVDKDLKGNYDRIELEEMVQVALLCTQYLPSQRPKMYEVVKMLEGDGLAE  582

Query  557   KWEASQRNDTPRFRTHE-NTPQRYSDFIEESSLIVEAMELSGPR  429
              WEASQR +  + + HE ++  RYSD  ++SSL+V+AMELSGPR
Sbjct  583   SWEASQRAEATKSKPHEFSSSDRYSDLTDDSSLLVQAMELSGPR  626



>ref|XP_010558548.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like isoform X2 [Tarenaya 
hassleriana]
Length=636

 Score =   365 bits (936),  Expect = 7e-117, Method: Compositional matrix adjust.
 Identities = 177/231 (77%), Positives = 200/231 (87%), Gaps = 8/231 (3%)
 Frame = -1

Query  1097  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVS  918
             RKRIA+G ARGLVYLHEQCDPKIIHRDVKAANILLD+  EAVVGDFGLAKLLDHRESHV+
Sbjct  406   RKRIAIGAARGLVYLHEQCDPKIIHRDVKAANILLDDYCEAVVGDFGLAKLLDHRESHVT  465

Query  917   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVK  738
             TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQ+A++FG+ ANQKG ILDWVK
Sbjct  466   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQRALEFGKSANQKGAILDWVK  525

Query  737   TLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAE  558
              +HQE KL ++VDKDLKNN+D +ELEE VQVALLCTQ+ P HRPKMSEV+RMLEGDGLAE
Sbjct  526   KIHQEKKLEVLVDKDLKNNYDHLELEETVQVALLCTQYLPGHRPKMSEVVRMLEGDGLAE  585

Query  557   KWEASQRNDTP--------RFRTHENTPQRYSDFIEESSLIVEAMELSGPR  429
             +WEASQR D+         R     ++  RYSD  ++S+L+V+AMELSGPR
Sbjct  586   RWEASQRTDSTAKCSSSSSRRLNELSSSDRYSDLTDDSTLLVQAMELSGPR  636



>ref|XP_010558545.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010558546.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like isoform X1 [Tarenaya 
hassleriana]
Length=637

 Score =   364 bits (935),  Expect = 8e-117, Method: Compositional matrix adjust.
 Identities = 177/231 (77%), Positives = 200/231 (87%), Gaps = 8/231 (3%)
 Frame = -1

Query  1097  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVS  918
             RKRIA+G ARGLVYLHEQCDPKIIHRDVKAANILLD+  EAVVGDFGLAKLLDHRESHV+
Sbjct  407   RKRIAIGAARGLVYLHEQCDPKIIHRDVKAANILLDDYCEAVVGDFGLAKLLDHRESHVT  466

Query  917   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVK  738
             TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQ+A++FG+ ANQKG ILDWVK
Sbjct  467   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQRALEFGKSANQKGAILDWVK  526

Query  737   TLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAE  558
              +HQE KL ++VDKDLKNN+D +ELEE VQVALLCTQ+ P HRPKMSEV+RMLEGDGLAE
Sbjct  527   KIHQEKKLEVLVDKDLKNNYDHLELEETVQVALLCTQYLPGHRPKMSEVVRMLEGDGLAE  586

Query  557   KWEASQRNDTP--------RFRTHENTPQRYSDFIEESSLIVEAMELSGPR  429
             +WEASQR D+         R     ++  RYSD  ++S+L+V+AMELSGPR
Sbjct  587   RWEASQRTDSTAKCSSSSSRRLNELSSSDRYSDLTDDSTLLVQAMELSGPR  637



>ref|XP_008379484.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like [Malus domestica]
Length=625

 Score =   364 bits (934),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 173/224 (77%), Positives = 201/224 (90%), Gaps = 1/224 (0%)
 Frame = -1

Query  1097  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVS  918
             RKRIALG  RGL+YLHEQCDPKIIHRDVKAANILLD+  EAVVGDFGLAKLLDH++SHV+
Sbjct  402   RKRIALGAGRGLLYLHEQCDPKIIHRDVKAANILLDDYCEAVVGDFGLAKLLDHQDSHVT  461

Query  917   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVK  738
             TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQ+A++FG+ ANQKG ILDWVK
Sbjct  462   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQRALEFGKAANQKGAILDWVK  521

Query  737   TLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAE  558
              +H E KL ++VDKDLK N+DR+ELEEMVQVALLCTQ+ PSHRPKMSEV+RMLEGDGL E
Sbjct  522   RIHHEKKLEMLVDKDLKTNYDRIELEEMVQVALLCTQYLPSHRPKMSEVVRMLEGDGLVE  581

Query  557   KWEASQRNDTPRFRTHE-NTPQRYSDFIEESSLIVEAMELSGPR  429
             +WEASQ+ ++ + +  E ++  RYSD  ++SSL+V+AMELSGPR
Sbjct  582   RWEASQKAESAKSKAPEFSSSDRYSDLTDDSSLLVQAMELSGPR  625



>gb|EEE57731.1| hypothetical protein OsJ_08242 [Oryza sativa Japonica Group]
Length=627

 Score =   363 bits (933),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 173/224 (77%), Positives = 203/224 (91%), Gaps = 1/224 (0%)
 Frame = -1

Query  1097  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVS  918
             R+RIALG ARGL+YLHEQCDPKIIHRDVKAANILLD+  EA+VGDFGLAKLLDHR+SHV+
Sbjct  404   RQRIALGAARGLLYLHEQCDPKIIHRDVKAANILLDDYCEAIVGDFGLAKLLDHRDSHVT  463

Query  917   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVK  738
             TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQ A++FG+ +NQKG +LDWVK
Sbjct  464   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQTALEFGKSSNQKGAMLDWVK  523

Query  737   TLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAE  558
              +HQE KL+++VDK L++N+DRVELEEMVQVALLCTQ+ P HRP+MSEV+RMLEGDGLAE
Sbjct  524   KMHQEKKLDVLVDKGLRSNYDRVELEEMVQVALLCTQYLPGHRPRMSEVVRMLEGDGLAE  583

Query  557   KWEASQRNDTPRFRTHENTPQR-YSDFIEESSLIVEAMELSGPR  429
             +WEASQR D+ +F+  E T  R YSD  ++SSL+V+A+ELSGPR
Sbjct  584   RWEASQRADSHKFKVPEFTFGRCYSDLTDDSSLLVQAVELSGPR  627



>gb|EEC73926.1| hypothetical protein OsI_08784 [Oryza sativa Indica Group]
Length=627

 Score =   363 bits (933),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 173/224 (77%), Positives = 203/224 (91%), Gaps = 1/224 (0%)
 Frame = -1

Query  1097  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVS  918
             R+RIALG ARGL+YLHEQCDPKIIHRDVKAANILLD+  EA+VGDFGLAKLLDHR+SHV+
Sbjct  404   RQRIALGAARGLLYLHEQCDPKIIHRDVKAANILLDDYCEAIVGDFGLAKLLDHRDSHVT  463

Query  917   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVK  738
             TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQ A++FG+ +NQKG +LDWVK
Sbjct  464   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQTALEFGKSSNQKGAMLDWVK  523

Query  737   TLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAE  558
              +HQE KL+++VDK L++N+DRVELEEMVQVALLCTQ+ P HRP+MSEV+RMLEGDGLAE
Sbjct  524   KMHQEKKLDVLVDKGLRSNYDRVELEEMVQVALLCTQYLPGHRPRMSEVVRMLEGDGLAE  583

Query  557   KWEASQRNDTPRFRTHENTPQR-YSDFIEESSLIVEAMELSGPR  429
             +WEASQR D+ +F+  E T  R YSD  ++SSL+V+A+ELSGPR
Sbjct  584   RWEASQRADSHKFKVPEFTFGRCYSDLTDDSSLLVQAVELSGPR  627



>ref|XP_010230511.1| PREDICTED: protein NSP-INTERACTING KINASE 3 isoform X4 [Brachypodium 
distachyon]
Length=601

 Score =   363 bits (931),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 176/225 (78%), Positives = 201/225 (89%), Gaps = 2/225 (1%)
 Frame = -1

Query  1097  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVS  918
             RK IALG ARGL+YLHEQCDPKIIHRDVKA+N+LLDE FEA+VGDFGLAKLLDH+ESHV+
Sbjct  377   RKMIALGTARGLLYLHEQCDPKIIHRDVKASNVLLDEYFEAIVGDFGLAKLLDHQESHVT  436

Query  917   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVK  738
             TAVRGTVGHIAPEYLSTGQSSEKTDVFGFG+LL+ELITGQKA+DFGR ANQKG +LD VK
Sbjct  437   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGVLLVELITGQKALDFGRLANQKGGVLDMVK  496

Query  737   TLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAE  558
              LH E +L++MVDKDL +N+DRVELEEMVQVALLCTQ++PSHRP+MSEV+RMLEGDGLAE
Sbjct  497   KLHHEKQLSMMVDKDLGSNYDRVELEEMVQVALLCTQYHPSHRPRMSEVIRMLEGDGLAE  556

Query  557   KWEASQRNDTPRFRTHENTPQRYSDF--IEESSLIVEAMELSGPR  429
             KWEASQ  DTP+  + E  P ++ D    +ESSL +EAMELSGPR
Sbjct  557   KWEASQNVDTPKSVSSELIPPKFMDLAAADESSLGLEAMELSGPR  601



>ref|XP_008783060.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like [Phoenix dactylifera]
Length=624

 Score =   363 bits (932),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 173/224 (77%), Positives = 202/224 (90%), Gaps = 1/224 (0%)
 Frame = -1

Query  1097  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVS  918
             RKRIALG ARGL+YLHEQCDPKIIHRDVKAANILLD+  EAVVGDFGLAKLLDHR+SHV+
Sbjct  401   RKRIALGAARGLLYLHEQCDPKIIHRDVKAANILLDDYCEAVVGDFGLAKLLDHRDSHVT  460

Query  917   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVK  738
             TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITG +A++FG+ ANQKG +LDWVK
Sbjct  461   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGLRAMEFGKAANQKGAMLDWVK  520

Query  737   TLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAE  558
              +HQE  L+++VDKDLKN++DR+ELEEMVQVALLCT + P  RPKMSEV+RMLEGDGLAE
Sbjct  521   KIHQEKNLDMLVDKDLKNDYDRIELEEMVQVALLCTLYLPGQRPKMSEVVRMLEGDGLAE  580

Query  557   KWEASQRNDTPRFRTHE-NTPQRYSDFIEESSLIVEAMELSGPR  429
             +WEASQR +  +F+  E ++ +RYSD  ++SSL+V+AMELSGPR
Sbjct  581   RWEASQRVEAHKFKMPEFSSSERYSDLTDDSSLLVQAMELSGPR  624



>ref|XP_010230510.1| PREDICTED: protein NSP-INTERACTING KINASE 3 isoform X3 [Brachypodium 
distachyon]
Length=603

 Score =   362 bits (930),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 176/225 (78%), Positives = 201/225 (89%), Gaps = 2/225 (1%)
 Frame = -1

Query  1097  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVS  918
             RK IALG ARGL+YLHEQCDPKIIHRDVKA+N+LLDE FEA+VGDFGLAKLLDH+ESHV+
Sbjct  379   RKMIALGTARGLLYLHEQCDPKIIHRDVKASNVLLDEYFEAIVGDFGLAKLLDHQESHVT  438

Query  917   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVK  738
             TAVRGTVGHIAPEYLSTGQSSEKTDVFGFG+LL+ELITGQKA+DFGR ANQKG +LD VK
Sbjct  439   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGVLLVELITGQKALDFGRLANQKGGVLDMVK  498

Query  737   TLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAE  558
              LH E +L++MVDKDL +N+DRVELEEMVQVALLCTQ++PSHRP+MSEV+RMLEGDGLAE
Sbjct  499   KLHHEKQLSMMVDKDLGSNYDRVELEEMVQVALLCTQYHPSHRPRMSEVIRMLEGDGLAE  558

Query  557   KWEASQRNDTPRFRTHENTPQRYSDF--IEESSLIVEAMELSGPR  429
             KWEASQ  DTP+  + E  P ++ D    +ESSL +EAMELSGPR
Sbjct  559   KWEASQNVDTPKSVSSELIPPKFMDLAAADESSLGLEAMELSGPR  603



>ref|XP_003531900.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like [Glycine max]
Length=623

 Score =   363 bits (931),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 172/224 (77%), Positives = 200/224 (89%), Gaps = 1/224 (0%)
 Frame = -1

Query  1097  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVS  918
             RK IALG  RGL+YLHEQCDPKIIHRDVKAANILLD+ +EAVVGDFGLAKLLDH++SHV+
Sbjct  400   RKHIALGAGRGLLYLHEQCDPKIIHRDVKAANILLDDYYEAVVGDFGLAKLLDHQDSHVT  459

Query  917   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVK  738
             TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQ+A++FG+ AN KG +LDWVK
Sbjct  460   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQRALEFGKSANNKGAMLDWVK  519

Query  737   TLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAE  558
              +HQE KL ++VDKDLK+N+DR+E EEMVQVALLCTQ+ P HRPKMSEV+RMLEGDGLAE
Sbjct  520   KIHQEKKLEMLVDKDLKSNYDRIEFEEMVQVALLCTQYLPGHRPKMSEVVRMLEGDGLAE  579

Query  557   KWEASQRNDTPRFRTHENTPQ-RYSDFIEESSLIVEAMELSGPR  429
             +WEASQR DT + +  E++   RYSD  ++S L+V+AMELSGPR
Sbjct  580   RWEASQRVDTTKCKPQESSSSDRYSDLTDDSLLLVQAMELSGPR  623



>gb|KEH25223.1| NSP-interacting kinase-like protein [Medicago truncatula]
Length=625

 Score =   363 bits (931),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 174/225 (77%), Positives = 206/225 (92%), Gaps = 2/225 (1%)
 Frame = -1

Query  1097  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVS  918
             RK+IALG ARGL+YLHEQCDPKIIHRDVKAANILLD+  EA+VGDFGLAKLLDH++SHV+
Sbjct  401   RKQIALGAARGLLYLHEQCDPKIIHRDVKAANILLDDYCEAIVGDFGLAKLLDHKDSHVT  460

Query  917   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVK  738
             TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITG +A++FG+ ANQKGV+LDWVK
Sbjct  461   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGLRALEFGKAANQKGVMLDWVK  520

Query  737   TLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAE  558
              +HQE KL+L+VDKDLKNN+D+ ELEE+VQVALLCTQ+ P+HRPKMSEV+RMLEGDGLAE
Sbjct  521   KIHQEKKLDLLVDKDLKNNYDKNELEEIVQVALLCTQYLPAHRPKMSEVVRMLEGDGLAE  580

Query  557   KWEASQRND-TPRFRTHE-NTPQRYSDFIEESSLIVEAMELSGPR  429
             KWEASQR D T + + +E ++  R+SD  ++SSL+++AMELSGPR
Sbjct  581   KWEASQRADNTTKGKPYELSSSDRFSDLTDDSSLLIQAMELSGPR  625



>ref|XP_008459453.1| PREDICTED: protein NSP-INTERACTING KINASE 1 [Cucumis melo]
Length=626

 Score =   363 bits (931),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 174/224 (78%), Positives = 202/224 (90%), Gaps = 1/224 (0%)
 Frame = -1

Query  1097  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVS  918
             RKRIA+G ARGL+YLHEQCDPKIIHRDVKAANILLD+  EAVVGDFGLAKLLDH++SHV+
Sbjct  403   RKRIAIGAARGLLYLHEQCDPKIIHRDVKAANILLDDYCEAVVGDFGLAKLLDHQDSHVT  462

Query  917   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVK  738
             TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQ+A++FG+ ANQKG ILDWVK
Sbjct  463   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQRALEFGKAANQKGGILDWVK  522

Query  737   TLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAE  558
              +H E KL ++VDKDLK N+DRVELEEMVQVALLCTQ+ P HRPKMSEV+RMLEG+GLA 
Sbjct  523   RIHLEKKLEVLVDKDLKANYDRVELEEMVQVALLCTQYLPGHRPKMSEVVRMLEGEGLAV  582

Query  557   KWEASQRNDTPRFRTHE-NTPQRYSDFIEESSLIVEAMELSGPR  429
             +WEASQR D+ + + H+ ++  RYSD  ++SSL+V+AMELSGPR
Sbjct  583   RWEASQRVDSTKCKPHDFSSSDRYSDLTDDSSLLVQAMELSGPR  626



>ref|XP_010927979.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like isoform X2 [Elaeis 
guineensis]
Length=591

 Score =   362 bits (928),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 172/224 (77%), Positives = 201/224 (90%), Gaps = 1/224 (0%)
 Frame = -1

Query  1097  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVS  918
             RKRIALG ARGL+YLHEQCDPKIIHRDVKAANILLD+  EA+VGDFGLAKLLDHR+SHV+
Sbjct  368   RKRIALGAARGLLYLHEQCDPKIIHRDVKAANILLDDCCEAIVGDFGLAKLLDHRDSHVT  427

Query  917   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVK  738
             TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQ A++FG+ ANQKG +LDWVK
Sbjct  428   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQTALEFGKAANQKGAMLDWVK  487

Query  737   TLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAE  558
              +HQ+ KL+++VDKDL++ +DR+ELEEMVQVALLCTQ+ P HRPKMSEV+RMLEGDGLAE
Sbjct  488   KIHQDKKLDMLVDKDLRDKYDRIELEEMVQVALLCTQYLPGHRPKMSEVVRMLEGDGLAE  547

Query  557   KWEASQRNDTPRFRTHENTPQR-YSDFIEESSLIVEAMELSGPR  429
             +WEASQR D   F+  E + +R +SD  ++SSL+ +AMELSGPR
Sbjct  548   RWEASQRVDAHMFKLPEFSSERCFSDLTDDSSLLAQAMELSGPR  591



>ref|XP_004141483.1| PREDICTED: protein NSP-INTERACTING KINASE 1 [Cucumis sativus]
 gb|KGN52542.1| hypothetical protein Csa_5G642730 [Cucumis sativus]
Length=626

 Score =   363 bits (931),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 174/224 (78%), Positives = 202/224 (90%), Gaps = 1/224 (0%)
 Frame = -1

Query  1097  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVS  918
             RKRIA+G ARGL+YLHEQCDPKIIHRDVKAANILLD+  EAVVGDFGLAKLLDH++SHV+
Sbjct  403   RKRIAIGAARGLLYLHEQCDPKIIHRDVKAANILLDDYCEAVVGDFGLAKLLDHQDSHVT  462

Query  917   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVK  738
             TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQ+A++FG+ ANQKG ILDWVK
Sbjct  463   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQRALEFGKAANQKGGILDWVK  522

Query  737   TLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAE  558
              +H E KL ++VDKDLK N+DRVELEEMVQVALLCTQ+ P HRPKMSEV+RMLEG+GLA 
Sbjct  523   RIHLEKKLEVLVDKDLKANYDRVELEEMVQVALLCTQYLPGHRPKMSEVVRMLEGEGLAV  582

Query  557   KWEASQRNDTPRFRTHE-NTPQRYSDFIEESSLIVEAMELSGPR  429
             +WEASQR D+ + + H+ ++  RYSD  ++SSL+V+AMELSGPR
Sbjct  583   RWEASQRVDSTKCKPHDFSSSDRYSDLTDDSSLLVQAMELSGPR  626



>ref|XP_008230341.1| PREDICTED: protein NSP-INTERACTING KINASE 1 [Prunus mume]
Length=623

 Score =   363 bits (931),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 173/224 (77%), Positives = 200/224 (89%), Gaps = 1/224 (0%)
 Frame = -1

Query  1097  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVS  918
             RKRIALG  RGL+YLHEQCDPKIIHRDVKAANILLD+  EAVVGDFGLAKLLDH++SHV+
Sbjct  400   RKRIALGAGRGLLYLHEQCDPKIIHRDVKAANILLDDYCEAVVGDFGLAKLLDHQDSHVT  459

Query  917   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVK  738
             TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQ+A++FG+  NQKG ILDWVK
Sbjct  460   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQRALEFGKATNQKGAILDWVK  519

Query  737   TLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAE  558
              +HQE KL ++VDKDLK N+DR+ELEEMVQVALLCTQ+ P HRPKMSEV+RMLEGDGL E
Sbjct  520   KIHQEKKLEVLVDKDLKTNYDRIELEEMVQVALLCTQYLPGHRPKMSEVVRMLEGDGLVE  579

Query  557   KWEASQRNDTPRFRTHE-NTPQRYSDFIEESSLIVEAMELSGPR  429
             +WEASQR ++ + +  E ++  RYSD  ++SSL+V+AMELSGPR
Sbjct  580   RWEASQRVESTKSKAPEFSSSDRYSDLTDDSSLLVQAMELSGPR  623



>ref|XP_003569325.2| PREDICTED: protein NSP-INTERACTING KINASE 3 isoform X2 [Brachypodium 
distachyon]
Length=631

 Score =   363 bits (931),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 176/225 (78%), Positives = 201/225 (89%), Gaps = 2/225 (1%)
 Frame = -1

Query  1097  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVS  918
             RK IALG ARGL+YLHEQCDPKIIHRDVKA+N+LLDE FEA+VGDFGLAKLLDH+ESHV+
Sbjct  407   RKMIALGTARGLLYLHEQCDPKIIHRDVKASNVLLDEYFEAIVGDFGLAKLLDHQESHVT  466

Query  917   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVK  738
             TAVRGTVGHIAPEYLSTGQSSEKTDVFGFG+LL+ELITGQKA+DFGR ANQKG +LD VK
Sbjct  467   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGVLLVELITGQKALDFGRLANQKGGVLDMVK  526

Query  737   TLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAE  558
              LH E +L++MVDKDL +N+DRVELEEMVQVALLCTQ++PSHRP+MSEV+RMLEGDGLAE
Sbjct  527   KLHHEKQLSMMVDKDLGSNYDRVELEEMVQVALLCTQYHPSHRPRMSEVIRMLEGDGLAE  586

Query  557   KWEASQRNDTPRFRTHENTPQRYSDF--IEESSLIVEAMELSGPR  429
             KWEASQ  DTP+  + E  P ++ D    +ESSL +EAMELSGPR
Sbjct  587   KWEASQNVDTPKSVSSELIPPKFMDLAAADESSLGLEAMELSGPR  631



>ref|XP_004953781.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like isoform X1 [Setaria 
italica]
 ref|XP_004953782.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like isoform X2 [Setaria 
italica]
 ref|XP_004953783.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like isoform X3 [Setaria 
italica]
Length=624

 Score =   362 bits (930),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 173/224 (77%), Positives = 200/224 (89%), Gaps = 1/224 (0%)
 Frame = -1

Query  1097  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVS  918
             RKRIALG ARGL+YLHEQCDPKIIHRDVKAANILLD+  EA+VGDFGLAKLLDHRESHV+
Sbjct  401   RKRIALGAARGLLYLHEQCDPKIIHRDVKAANILLDDCCEAIVGDFGLAKLLDHRESHVT  460

Query  917   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVK  738
             TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQ A++FG+ +NQKG +LDWVK
Sbjct  461   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQTALEFGKSSNQKGAMLDWVK  520

Query  737   TLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAE  558
              +HQE +L+++VDK L + +DR+ELEEMVQVALLCTQF P HRPKMSEV+RMLEGDGLAE
Sbjct  521   KMHQEKQLDILVDKGLGSKYDRIELEEMVQVALLCTQFLPGHRPKMSEVVRMLEGDGLAE  580

Query  557   KWEASQRNDTPRFRTHENTPQR-YSDFIEESSLIVEAMELSGPR  429
             +WEASQ  D+ +F+  E T  R YSD  ++SSL+V+A+ELSGPR
Sbjct  581   RWEASQHTDSHKFKVPEFTFSRCYSDLTDDSSLLVQAVELSGPR  624



>ref|XP_010230509.1| PREDICTED: protein NSP-INTERACTING KINASE 3 isoform X1 [Brachypodium 
distachyon]
Length=633

 Score =   363 bits (931),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 176/225 (78%), Positives = 201/225 (89%), Gaps = 2/225 (1%)
 Frame = -1

Query  1097  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVS  918
             RK IALG ARGL+YLHEQCDPKIIHRDVKA+N+LLDE FEA+VGDFGLAKLLDH+ESHV+
Sbjct  409   RKMIALGTARGLLYLHEQCDPKIIHRDVKASNVLLDEYFEAIVGDFGLAKLLDHQESHVT  468

Query  917   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVK  738
             TAVRGTVGHIAPEYLSTGQSSEKTDVFGFG+LL+ELITGQKA+DFGR ANQKG +LD VK
Sbjct  469   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGVLLVELITGQKALDFGRLANQKGGVLDMVK  528

Query  737   TLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAE  558
              LH E +L++MVDKDL +N+DRVELEEMVQVALLCTQ++PSHRP+MSEV+RMLEGDGLAE
Sbjct  529   KLHHEKQLSMMVDKDLGSNYDRVELEEMVQVALLCTQYHPSHRPRMSEVIRMLEGDGLAE  588

Query  557   KWEASQRNDTPRFRTHENTPQRYSDF--IEESSLIVEAMELSGPR  429
             KWEASQ  DTP+  + E  P ++ D    +ESSL +EAMELSGPR
Sbjct  589   KWEASQNVDTPKSVSSELIPPKFMDLAAADESSLGLEAMELSGPR  633



>ref|XP_007151443.1| hypothetical protein PHAVU_004G046800g [Phaseolus vulgaris]
 gb|ESW23437.1| hypothetical protein PHAVU_004G046800g [Phaseolus vulgaris]
Length=626

 Score =   362 bits (930),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 174/225 (77%), Positives = 203/225 (90%), Gaps = 2/225 (1%)
 Frame = -1

Query  1097  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVS  918
             RK+IA+G ARGL+YLHEQCDPKIIHRDVKAANILLD+  EAVVGDFGLAKLLDH++SHV+
Sbjct  402   RKQIAIGAARGLLYLHEQCDPKIIHRDVKAANILLDDYCEAVVGDFGLAKLLDHQDSHVT  461

Query  917   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVK  738
             TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQ+A++FG+ ANQKG +LDWV+
Sbjct  462   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQRALEFGKAANQKGAMLDWVR  521

Query  737   TLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAE  558
              +HQE KL L+VDKDL NN+DR+ELEE+VQVALLCTQ+ P HRP+MSEV+RMLEGDGLAE
Sbjct  522   KIHQEKKLELLVDKDLMNNYDRIELEEIVQVALLCTQYLPGHRPRMSEVVRMLEGDGLAE  581

Query  557   KWEASQRNDTPRF-RTHE-NTPQRYSDFIEESSLIVEAMELSGPR  429
             KWEASQ  DT +  + HE ++  RYSD  ++SSL+V+AMELSGPR
Sbjct  582   KWEASQSADTTKCNKPHELSSSDRYSDLTDDSSLLVQAMELSGPR  626



>ref|XP_009803320.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like isoform X1 [Nicotiana 
sylvestris]
Length=625

 Score =   362 bits (929),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 171/225 (76%), Positives = 206/225 (92%), Gaps = 2/225 (1%)
 Frame = -1

Query  1097  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVS  918
             RKRIALG ARGL+YLHEQCDPKIIHRDVKAANILLD+  EAVVGDFGLAKLLDH+++HV+
Sbjct  401   RKRIALGAARGLLYLHEQCDPKIIHRDVKAANILLDDYCEAVVGDFGLAKLLDHQDTHVT  460

Query  917   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVK  738
             TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITG +A++FG+ ANQKG +LDWVK
Sbjct  461   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGMRAIEFGKAANQKGAMLDWVK  520

Query  737   TLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAE  558
              +HQE KL+++VDKDLK+N+DR+ELEEMVQVALLCTQ+ P HRPKMSE++RMLEGDGLAE
Sbjct  521   KIHQEKKLDILVDKDLKSNYDRIELEEMVQVALLCTQYLPGHRPKMSEIVRMLEGDGLAE  580

Query  557   KWEASQRND-TPRFRTHE-NTPQRYSDFIEESSLIVEAMELSGPR  429
             +WEASQ+ D + +++T E ++ +R+SD  ++S L+V+AMELSGPR
Sbjct  581   RWEASQKFDGSNKYKTKELSSSERFSDLTDDSLLLVQAMELSGPR  625



>ref|XP_010927978.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like isoform X1 [Elaeis 
guineensis]
Length=635

 Score =   362 bits (929),  Expect = 6e-116, Method: Compositional matrix adjust.
 Identities = 172/224 (77%), Positives = 201/224 (90%), Gaps = 1/224 (0%)
 Frame = -1

Query  1097  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVS  918
             RKRIALG ARGL+YLHEQCDPKIIHRDVKAANILLD+  EA+VGDFGLAKLLDHR+SHV+
Sbjct  412   RKRIALGAARGLLYLHEQCDPKIIHRDVKAANILLDDCCEAIVGDFGLAKLLDHRDSHVT  471

Query  917   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVK  738
             TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQ A++FG+ ANQKG +LDWVK
Sbjct  472   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQTALEFGKAANQKGAMLDWVK  531

Query  737   TLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAE  558
              +HQ+ KL+++VDKDL++ +DR+ELEEMVQVALLCTQ+ P HRPKMSEV+RMLEGDGLAE
Sbjct  532   KIHQDKKLDMLVDKDLRDKYDRIELEEMVQVALLCTQYLPGHRPKMSEVVRMLEGDGLAE  591

Query  557   KWEASQRNDTPRFRTHENTPQR-YSDFIEESSLIVEAMELSGPR  429
             +WEASQR D   F+  E + +R +SD  ++SSL+ +AMELSGPR
Sbjct  592   RWEASQRVDAHMFKLPEFSSERCFSDLTDDSSLLAQAMELSGPR  635



>ref|XP_009803321.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like isoform X2 [Nicotiana 
sylvestris]
Length=622

 Score =   362 bits (928),  Expect = 8e-116, Method: Compositional matrix adjust.
 Identities = 171/225 (76%), Positives = 206/225 (92%), Gaps = 2/225 (1%)
 Frame = -1

Query  1097  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVS  918
             RKRIALG ARGL+YLHEQCDPKIIHRDVKAANILLD+  EAVVGDFGLAKLLDH+++HV+
Sbjct  398   RKRIALGAARGLLYLHEQCDPKIIHRDVKAANILLDDYCEAVVGDFGLAKLLDHQDTHVT  457

Query  917   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVK  738
             TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITG +A++FG+ ANQKG +LDWVK
Sbjct  458   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGMRAIEFGKAANQKGAMLDWVK  517

Query  737   TLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAE  558
              +HQE KL+++VDKDLK+N+DR+ELEEMVQVALLCTQ+ P HRPKMSE++RMLEGDGLAE
Sbjct  518   KIHQEKKLDILVDKDLKSNYDRIELEEMVQVALLCTQYLPGHRPKMSEIVRMLEGDGLAE  577

Query  557   KWEASQRND-TPRFRTHE-NTPQRYSDFIEESSLIVEAMELSGPR  429
             +WEASQ+ D + +++T E ++ +R+SD  ++S L+V+AMELSGPR
Sbjct  578   RWEASQKFDGSNKYKTKELSSSERFSDLTDDSLLLVQAMELSGPR  622



>ref|XP_009803966.1| PREDICTED: protein NSP-INTERACTING KINASE 2-like isoform X2 [Nicotiana 
sylvestris]
Length=602

 Score =   361 bits (926),  Expect = 8e-116, Method: Compositional matrix adjust.
 Identities = 176/227 (78%), Positives = 205/227 (90%), Gaps = 4/227 (2%)
 Frame = -1

Query  1097  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVS  918
             RK IALG ARGL+YLHEQCDPKIIHRDVKAANILLD+  EAVVGDFGLAKLLDH +SHV+
Sbjct  376   RKSIALGAARGLLYLHEQCDPKIIHRDVKAANILLDDYCEAVVGDFGLAKLLDHHDSHVT  435

Query  917   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVK  738
             TAVRGTVGHIAPEYLSTGQSS+KTDVFGFGILLLELITGQ+A++FG+ ANQKG +LDWVK
Sbjct  436   TAVRGTVGHIAPEYLSTGQSSDKTDVFGFGILLLELITGQRALEFGKAANQKGAMLDWVK  495

Query  737   TLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAE  558
              +HQE KL+++VDKD+KNN+DR+ELEEMVQVALLCTQ++PS RPKMSEV+RMLEGDGLAE
Sbjct  496   KIHQEKKLDMLVDKDMKNNYDRIELEEMVQVALLCTQYHPSQRPKMSEVVRMLEGDGLAE  555

Query  557   KWEASQRN--DTPRFRTHE-NTPQRYSDFIE-ESSLIVEAMELSGPR  429
             KWEASQR   +T   R +E ++ +RYSD  + +SSL+V+AMELSGPR
Sbjct  556   KWEASQRAEPNTRCSRANEFSSSERYSDLTDNDSSLLVQAMELSGPR  602



>gb|KJB43138.1| hypothetical protein B456_007G186300 [Gossypium raimondii]
Length=625

 Score =   362 bits (928),  Expect = 8e-116, Method: Compositional matrix adjust.
 Identities = 173/225 (77%), Positives = 202/225 (90%), Gaps = 2/225 (1%)
 Frame = -1

Query  1097  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVS  918
             RKRIALG  RGL+YLHEQCDPKIIHRDVKAANILLD+  EAVVGDFGLAKLLDH +SHV+
Sbjct  401   RKRIALGAGRGLLYLHEQCDPKIIHRDVKAANILLDDYCEAVVGDFGLAKLLDHHDSHVT  460

Query  917   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVK  738
             TAVRGTVGHIAPEYLSTGQSS+KTDVFGFGILLLELITGQ+A++FG+ ANQKG +LDWV+
Sbjct  461   TAVRGTVGHIAPEYLSTGQSSDKTDVFGFGILLLELITGQRALEFGKAANQKGAMLDWVR  520

Query  737   TLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAE  558
              +H E KL ++VDKDLKNN+DR+ELEEMVQVALLCTQ+ P HRPKMSEV+RMLEGDGLAE
Sbjct  521   KIHHEKKLEVLVDKDLKNNYDRIELEEMVQVALLCTQYLPGHRPKMSEVVRMLEGDGLAE  580

Query  557   KWEASQRNDTPRFR-THE-NTPQRYSDFIEESSLIVEAMELSGPR  429
             +WEASQR ++ + +  HE ++  RYSD  ++SSL+V+AMELSGPR
Sbjct  581   RWEASQRAESTKCKPPHEFSSSDRYSDLTDDSSLLVQAMELSGPR  625



>ref|XP_008341829.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like [Malus domestica]
Length=636

 Score =   362 bits (929),  Expect = 8e-116, Method: Compositional matrix adjust.
 Identities = 172/224 (77%), Positives = 200/224 (89%), Gaps = 1/224 (0%)
 Frame = -1

Query  1097  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVS  918
             RKRIALG  RGL+YLHEQCDPKIIHRDVKAANILLD+  EAVVGDFGLAKLLDH++SHV+
Sbjct  413   RKRIALGAGRGLLYLHEQCDPKIIHRDVKAANILLDDYCEAVVGDFGLAKLLDHQDSHVT  472

Query  917   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVK  738
             TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQ+A++FG+ ANQKG ILDWVK
Sbjct  473   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQRALEFGKAANQKGAILDWVK  532

Query  737   TLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAE  558
              +HQE  L ++VDKDLK N+DR+ELEEMVQVALLCTQ+ P HRPKMSEV+RMLEGDGL E
Sbjct  533   KIHQEKTLEMLVDKDLKTNYDRIELEEMVQVALLCTQYLPGHRPKMSEVVRMLEGDGLVE  592

Query  557   KWEASQRNDTPRFRTHE-NTPQRYSDFIEESSLIVEAMELSGPR  429
             +WEASQ+ ++ + +  E ++  RYSD  ++SSL+V+AMELSGPR
Sbjct  593   RWEASQKVESTKSKAPEFSSSDRYSDLTDDSSLLVQAMELSGPR  636



>ref|XP_009596697.1| PREDICTED: protein NSP-INTERACTING KINASE 2-like isoform X2 [Nicotiana 
tomentosiformis]
Length=603

 Score =   361 bits (926),  Expect = 8e-116, Method: Compositional matrix adjust.
 Identities = 176/227 (78%), Positives = 205/227 (90%), Gaps = 4/227 (2%)
 Frame = -1

Query  1097  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVS  918
             RK IALG ARGL+YLHEQCDPKIIHRDVKAANILLD+  EAVVGDFGLAKLLDH +SHV+
Sbjct  377   RKSIALGAARGLLYLHEQCDPKIIHRDVKAANILLDDYCEAVVGDFGLAKLLDHHDSHVT  436

Query  917   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVK  738
             TAVRGTVGHIAPEYLSTGQSS+KTDVFGFGILLLELITGQ+A++FG+ ANQKG +LDWVK
Sbjct  437   TAVRGTVGHIAPEYLSTGQSSDKTDVFGFGILLLELITGQRALEFGKAANQKGAMLDWVK  496

Query  737   TLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAE  558
              +HQE KL+++VDKD+KNN+DR+ELEEMVQVALLCTQ++PS RP+MSEV+RMLEGDGLAE
Sbjct  497   KIHQEKKLDMLVDKDMKNNYDRIELEEMVQVALLCTQYHPSQRPRMSEVVRMLEGDGLAE  556

Query  557   KWEASQRN--DTPRFRTHE-NTPQRYSDFIE-ESSLIVEAMELSGPR  429
             KWEASQR   +T   R +E ++ +RYSD  E +SSL+V+AMELSGPR
Sbjct  557   KWEASQRAEPNTRCSRANEFSSSERYSDLTENDSSLLVQAMELSGPR  603



>ref|XP_009803965.1| PREDICTED: protein NSP-INTERACTING KINASE 2-like isoform X1 [Nicotiana 
sylvestris]
Length=620

 Score =   361 bits (927),  Expect = 8e-116, Method: Compositional matrix adjust.
 Identities = 176/227 (78%), Positives = 205/227 (90%), Gaps = 4/227 (2%)
 Frame = -1

Query  1097  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVS  918
             RK IALG ARGL+YLHEQCDPKIIHRDVKAANILLD+  EAVVGDFGLAKLLDH +SHV+
Sbjct  394   RKSIALGAARGLLYLHEQCDPKIIHRDVKAANILLDDYCEAVVGDFGLAKLLDHHDSHVT  453

Query  917   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVK  738
             TAVRGTVGHIAPEYLSTGQSS+KTDVFGFGILLLELITGQ+A++FG+ ANQKG +LDWVK
Sbjct  454   TAVRGTVGHIAPEYLSTGQSSDKTDVFGFGILLLELITGQRALEFGKAANQKGAMLDWVK  513

Query  737   TLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAE  558
              +HQE KL+++VDKD+KNN+DR+ELEEMVQVALLCTQ++PS RPKMSEV+RMLEGDGLAE
Sbjct  514   KIHQEKKLDMLVDKDMKNNYDRIELEEMVQVALLCTQYHPSQRPKMSEVVRMLEGDGLAE  573

Query  557   KWEASQRN--DTPRFRTHE-NTPQRYSDFIE-ESSLIVEAMELSGPR  429
             KWEASQR   +T   R +E ++ +RYSD  + +SSL+V+AMELSGPR
Sbjct  574   KWEASQRAEPNTRCSRANEFSSSERYSDLTDNDSSLLVQAMELSGPR  620



>ref|XP_002314905.1| hypothetical protein POPTR_0010s14410g [Populus trichocarpa]
 gb|EEF01076.1| hypothetical protein POPTR_0010s14410g [Populus trichocarpa]
Length=627

 Score =   362 bits (928),  Expect = 8e-116, Method: Compositional matrix adjust.
 Identities = 174/224 (78%), Positives = 200/224 (89%), Gaps = 1/224 (0%)
 Frame = -1

Query  1097  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVS  918
             RKR+ALG  RGL+YLHEQCDPKIIHRDVKAANILLD+  EAVVGDFGLAKLLDH++SHV+
Sbjct  404   RKRVALGAGRGLLYLHEQCDPKIIHRDVKAANILLDDYCEAVVGDFGLAKLLDHQDSHVT  463

Query  917   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVK  738
             TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELI+G +A++FG+  NQKG +LDWVK
Sbjct  464   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELISGLRALEFGKSTNQKGALLDWVK  523

Query  737   TLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAE  558
              +HQE KL L+VDKDLKNN+D +EL+E VQVALLCTQ  PSHRPKMSEV+RMLEGDGLAE
Sbjct  524   KIHQEKKLELLVDKDLKNNYDPIELDETVQVALLCTQNLPSHRPKMSEVVRMLEGDGLAE  583

Query  557   KWEASQRNDTPRFRTHE-NTPQRYSDFIEESSLIVEAMELSGPR  429
             KWEASQR +  R RT E ++ +RYSD  ++SSL+V+AMELSGPR
Sbjct  584   KWEASQRAEATRTRTIEFSSSERYSDLTDDSSLLVQAMELSGPR  627



>ref|XP_009596696.1| PREDICTED: protein NSP-INTERACTING KINASE 2-like isoform X1 [Nicotiana 
tomentosiformis]
Length=621

 Score =   361 bits (927),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 176/227 (78%), Positives = 205/227 (90%), Gaps = 4/227 (2%)
 Frame = -1

Query  1097  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVS  918
             RK IALG ARGL+YLHEQCDPKIIHRDVKAANILLD+  EAVVGDFGLAKLLDH +SHV+
Sbjct  395   RKSIALGAARGLLYLHEQCDPKIIHRDVKAANILLDDYCEAVVGDFGLAKLLDHHDSHVT  454

Query  917   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVK  738
             TAVRGTVGHIAPEYLSTGQSS+KTDVFGFGILLLELITGQ+A++FG+ ANQKG +LDWVK
Sbjct  455   TAVRGTVGHIAPEYLSTGQSSDKTDVFGFGILLLELITGQRALEFGKAANQKGAMLDWVK  514

Query  737   TLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAE  558
              +HQE KL+++VDKD+KNN+DR+ELEEMVQVALLCTQ++PS RP+MSEV+RMLEGDGLAE
Sbjct  515   KIHQEKKLDMLVDKDMKNNYDRIELEEMVQVALLCTQYHPSQRPRMSEVVRMLEGDGLAE  574

Query  557   KWEASQRN--DTPRFRTHE-NTPQRYSDFIE-ESSLIVEAMELSGPR  429
             KWEASQR   +T   R +E ++ +RYSD  E +SSL+V+AMELSGPR
Sbjct  575   KWEASQRAEPNTRCSRANEFSSSERYSDLTENDSSLLVQAMELSGPR  621



>gb|EPS73511.1| hypothetical protein M569_01245, partial [Genlisea aurea]
Length=636

 Score =   361 bits (927),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 182/226 (81%), Positives = 200/226 (88%), Gaps = 4/226 (2%)
 Frame = -1

Query  1097  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVS  918
             RKRIA+G ARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHR+SHV+
Sbjct  412   RKRIAVGTARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRDSHVT  471

Query  917   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVK  738
             TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQ+AVDFGRG N+KG+ILDWV+
Sbjct  472   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQRAVDFGRGVNEKGLILDWVR  531

Query  737   TLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAE  558
              L QEG L+L+ DKDLK  +D +EL EM +VALLCT FNP+ RPKMSEVLRMLEGDGLAE
Sbjct  532   RLQQEGDLDLIADKDLKKEYDAMELVEMARVALLCTHFNPAIRPKMSEVLRMLEGDGLAE  591

Query  557   KWEASQRNDT-PRFRTHENTPQ--RYSDFIEESSLIVEAMELSGPR  429
             KWE S   ++ PR R+    P+  RYSDFIEESSL V+AMELSGPR
Sbjct  592   KWEQSLDIESPPRQRSFGFPPEIRRYSDFIEESSL-VDAMELSGPR  636



>ref|XP_002436855.1| hypothetical protein SORBIDRAFT_10g010010 [Sorghum bicolor]
 gb|EER88222.1| hypothetical protein SORBIDRAFT_10g010010 [Sorghum bicolor]
Length=629

 Score =   361 bits (926),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 172/224 (77%), Positives = 200/224 (89%), Gaps = 1/224 (0%)
 Frame = -1

Query  1097  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVS  918
             RKRIALG  RGL+YLHEQCDPKIIHRDVKAANILLD+  EA+VGDFGLAKLLDHR+SHV+
Sbjct  406   RKRIALGAGRGLLYLHEQCDPKIIHRDVKAANILLDDYCEAIVGDFGLAKLLDHRDSHVT  465

Query  917   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVK  738
             TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQ A++FG+ ANQKG +LDWVK
Sbjct  466   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQTALEFGKAANQKGAMLDWVK  525

Query  737   TLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAE  558
              +HQE KL+++VDK L+  +DR+ELEEMVQVALLCTQ+ P HRPKMSEV+RMLEGDGLAE
Sbjct  526   KMHQEKKLDVLVDKGLRGGYDRIELEEMVQVALLCTQYLPGHRPKMSEVVRMLEGDGLAE  585

Query  557   KWEASQRNDTPRFRTHENTPQR-YSDFIEESSLIVEAMELSGPR  429
             +WEASQR D+ +F+  + T  R YSD  ++SSL+V+A+ELSGPR
Sbjct  586   RWEASQRADSHKFKVPDFTFSRCYSDLTDDSSLLVQAVELSGPR  629



>ref|XP_008654537.1| PREDICTED: uncharacterized LOC100272802 isoform X1 [Zea mays]
 gb|AFW80157.1| putative leucine-rich repeat receptor-like protein kinase family 
protein [Zea mays]
Length=630

 Score =   361 bits (926),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 176/227 (78%), Positives = 204/227 (90%), Gaps = 4/227 (2%)
 Frame = -1

Query  1097  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVS  918
             RKR+ALG ARGL+YLHEQCDPKIIHRDVKA+N+LLDE FEA+VGDFGLAKLLDHRESHV+
Sbjct  404   RKRVALGTARGLLYLHEQCDPKIIHRDVKASNVLLDEYFEAIVGDFGLAKLLDHRESHVT  463

Query  917   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVK  738
             TAVRGTVGHIAPEYLSTGQSSEKTDVFGFG+LL+EL+TGQKA+DFGR ANQKG +LDWVK
Sbjct  464   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGVLLVELVTGQKALDFGRVANQKGGVLDWVK  523

Query  737   TLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGD-GLA  561
              LHQE +L +MVDKDL +++D VELEEMVQ+ALLCTQ++PSHRP+MSEV+RMLEG+ GLA
Sbjct  524   KLHQEKQLGVMVDKDLGSSYDGVELEEMVQLALLCTQYHPSHRPRMSEVIRMLEGEPGLA  583

Query  560   EKWEASQRN-DTPRFRTHENTPQRYSDF--IEESSLIVEAMELSGPR  429
             E+WEASQ N DTP+  + E  P +Y DF   +ESSL +EAMELSGPR
Sbjct  584   ERWEASQSNVDTPKSVSSELLPPKYVDFAAADESSLGLEAMELSGPR  630



>ref|XP_007045670.1| LRR receptor-like serine/threonine-protein kinase [Theobroma 
cacao]
 gb|EOY01502.1| LRR receptor-like serine/threonine-protein kinase [Theobroma 
cacao]
Length=926

 Score =   369 bits (946),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 175/224 (78%), Positives = 203/224 (91%), Gaps = 1/224 (0%)
 Frame = -1

Query  1097  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVS  918
             RKRIALG ARGL+YLHEQCDPKIIHRDVKAANILLD+  EA+VGDFGLAKLLDHR+SHV+
Sbjct  703   RKRIALGAARGLLYLHEQCDPKIIHRDVKAANILLDDYCEAIVGDFGLAKLLDHRDSHVT  762

Query  917   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVK  738
             TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELI+G +A++FG+ ANQKG +LDWV+
Sbjct  763   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELISGLRALEFGKTANQKGAMLDWVR  822

Query  737   TLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAE  558
              +H E KL ++VDKDLKNN+DR+ELEEM QVALLCTQ+ PSHRPKMSEV+RMLEGDGLAE
Sbjct  823   KIHLEKKLEMLVDKDLKNNYDRIELEEMAQVALLCTQYLPSHRPKMSEVVRMLEGDGLAE  882

Query  557   KWEASQRNDTPRFRTHE-NTPQRYSDFIEESSLIVEAMELSGPR  429
             KWEASQR +  R R +E ++ +RYSD  ++SSL+V+AMELSGPR
Sbjct  883   KWEASQRAEATRSRANEFSSSERYSDLTDDSSLLVQAMELSGPR  926



>ref|XP_007214944.1| hypothetical protein PRUPE_ppa002897mg [Prunus persica]
 gb|EMJ16143.1| hypothetical protein PRUPE_ppa002897mg [Prunus persica]
Length=623

 Score =   360 bits (925),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 172/224 (77%), Positives = 199/224 (89%), Gaps = 1/224 (0%)
 Frame = -1

Query  1097  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVS  918
             RKRIALG  RGL+YLHEQCDPKIIHRDVKAANILLD+  EAVVGDFGLAKLLDH++SHV+
Sbjct  400   RKRIALGAGRGLLYLHEQCDPKIIHRDVKAANILLDDYCEAVVGDFGLAKLLDHQDSHVT  459

Query  917   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVK  738
             TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQ+A++FG+  NQKG ILDWVK
Sbjct  460   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQRALEFGKATNQKGAILDWVK  519

Query  737   TLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAE  558
              +HQE KL ++VDKDLK N+DR+ELEEMVQVALLCTQ+ P  RPKMSEV+RMLEGDGL E
Sbjct  520   KIHQEKKLEMLVDKDLKTNYDRIELEEMVQVALLCTQYLPGQRPKMSEVVRMLEGDGLVE  579

Query  557   KWEASQRNDTPRFRTHE-NTPQRYSDFIEESSLIVEAMELSGPR  429
             +WEASQR ++ + +  E ++  RYSD  ++SSL+V+AMELSGPR
Sbjct  580   RWEASQRVESTKSKAPEFSSSDRYSDLTDDSSLLVQAMELSGPR  623



>ref|XP_006344295.1| PREDICTED: protein NSP-INTERACTING KINASE 2-like [Solanum tuberosum]
Length=620

 Score =   360 bits (924),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 173/225 (77%), Positives = 203/225 (90%), Gaps = 2/225 (1%)
 Frame = -1

Query  1097  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVS  918
             RK IALG ARGL+YLHEQCDPKIIHRDVKAANILLD+  EAVVGDFGLAKLLDH +SHV+
Sbjct  396   RKGIALGSARGLLYLHEQCDPKIIHRDVKAANILLDDYCEAVVGDFGLAKLLDHHDSHVT  455

Query  917   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVK  738
             TAVRGTVGHIAPEYLSTGQSS+KTDVFGFGILLLELITGQ+A++FG+ ANQKG +LDWV+
Sbjct  456   TAVRGTVGHIAPEYLSTGQSSDKTDVFGFGILLLELITGQRALEFGKAANQKGAMLDWVR  515

Query  737   TLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAE  558
              + QE KL+++VDKD+KN +D +ELEEMVQVALLCTQ++PSHRPKMSEV+RMLEGDGLAE
Sbjct  516   KIQQEKKLDMLVDKDMKNEYDTIELEEMVQVALLCTQYHPSHRPKMSEVVRMLEGDGLAE  575

Query  557   KWEASQRNDTPRF-RTHE-NTPQRYSDFIEESSLIVEAMELSGPR  429
             KWEASQR +  R  R +E ++ +RYSD  ++SSL+V+AMELSGPR
Sbjct  576   KWEASQRAEPTRCSRANEFSSSERYSDLTDDSSLLVQAMELSGPR  620



>ref|XP_009630581.1| PREDICTED: protein NSP-INTERACTING KINASE 1 [Nicotiana tomentosiformis]
Length=625

 Score =   360 bits (924),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 170/225 (76%), Positives = 206/225 (92%), Gaps = 2/225 (1%)
 Frame = -1

Query  1097  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVS  918
             RKRIALG ARGL+YLHEQCDPKIIHRDVKAANILLD+  EAVVGDFGLAKLLDH+++HV+
Sbjct  401   RKRIALGAARGLLYLHEQCDPKIIHRDVKAANILLDDYCEAVVGDFGLAKLLDHQDTHVT  460

Query  917   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVK  738
             TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITG +A++FG+ ANQKG +LDWVK
Sbjct  461   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGMRAIEFGKAANQKGAMLDWVK  520

Query  737   TLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAE  558
              +HQE KL+++VDK+LK+N+DR+ELEEMVQVALLCTQ+ P HRPKMSE++RMLEGDGLAE
Sbjct  521   KIHQEKKLDILVDKELKSNYDRIELEEMVQVALLCTQYLPGHRPKMSEIVRMLEGDGLAE  580

Query  557   KWEASQRND-TPRFRTHE-NTPQRYSDFIEESSLIVEAMELSGPR  429
             +WEASQ+ D + +++T E ++ +R+SD  ++S L+V+AMELSGPR
Sbjct  581   RWEASQKFDGSNKYKTKELSSSERFSDLTDDSLLLVQAMELSGPR  625



>ref|XP_004491764.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like [Cicer arietinum]
Length=629

 Score =   360 bits (924),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 173/227 (76%), Positives = 202/227 (89%), Gaps = 4/227 (2%)
 Frame = -1

Query  1097  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVS  918
             RK IALG ARGL+YLHEQCDPKIIHRDVKAANILLD  +EAVVGDFGLAKLLDH++SHV+
Sbjct  403   RKNIALGAARGLLYLHEQCDPKIIHRDVKAANILLDNYYEAVVGDFGLAKLLDHQDSHVT  462

Query  917   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVK  738
             TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQ+A++FG+ ANQKG +LDWVK
Sbjct  463   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQRALEFGKAANQKGAMLDWVK  522

Query  737   TLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAE  558
              +HQE KL L+VDKDLK+N+D+ ELEEMVQVALLCTQ+ PS+RPKMSEV+RMLEGDGLAE
Sbjct  523   KIHQEKKLELLVDKDLKSNYDKNELEEMVQVALLCTQYLPSNRPKMSEVVRMLEGDGLAE  582

Query  557   KWEASQR---NDTPRFRTHENT-PQRYSDFIEESSLIVEAMELSGPR  429
             +WEA Q+   N   +++ HE++   RYSD  ++S L+V+AMELSGPR
Sbjct  583   RWEAYQKTTDNSNAKYKPHESSLSDRYSDLTDDSLLLVQAMELSGPR  629



>ref|XP_010236002.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like isoform X2 [Brachypodium 
distachyon]
Length=627

 Score =   360 bits (924),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 171/224 (76%), Positives = 201/224 (90%), Gaps = 1/224 (0%)
 Frame = -1

Query  1097  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVS  918
             RK IALG ARGL+YLHEQCDPKIIHRDVKAAN+LLD+  EA+VGDFGLAKLLDHR+SHV+
Sbjct  404   RKGIALGAARGLLYLHEQCDPKIIHRDVKAANVLLDDFCEAIVGDFGLAKLLDHRDSHVT  463

Query  917   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVK  738
             TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQ A++FG+ +NQKG +LDWVK
Sbjct  464   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQTALEFGKSSNQKGAMLDWVK  523

Query  737   TLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAE  558
              +HQE KL+++VDK L+N++D +ELEEMVQVALLCTQ+ P HRPKMSEV+RMLEGDGLAE
Sbjct  524   KMHQEKKLDVLVDKGLRNSYDHIELEEMVQVALLCTQYLPGHRPKMSEVVRMLEGDGLAE  583

Query  557   KWEASQRNDTPRFRTHENTPQR-YSDFIEESSLIVEAMELSGPR  429
             +WEASQR D+ +F+  E T  R YSD  ++SSL+V+A+ELSGPR
Sbjct  584   RWEASQRTDSHKFKVPEFTFGRCYSDLTDDSSLLVQAVELSGPR  627



>ref|XP_003572984.2| PREDICTED: protein NSP-INTERACTING KINASE 1-like isoform X1 [Brachypodium 
distachyon]
Length=628

 Score =   360 bits (923),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 171/224 (76%), Positives = 201/224 (90%), Gaps = 1/224 (0%)
 Frame = -1

Query  1097  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVS  918
             RK IALG ARGL+YLHEQCDPKIIHRDVKAAN+LLD+  EA+VGDFGLAKLLDHR+SHV+
Sbjct  405   RKGIALGAARGLLYLHEQCDPKIIHRDVKAANVLLDDFCEAIVGDFGLAKLLDHRDSHVT  464

Query  917   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVK  738
             TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQ A++FG+ +NQKG +LDWVK
Sbjct  465   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQTALEFGKSSNQKGAMLDWVK  524

Query  737   TLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAE  558
              +HQE KL+++VDK L+N++D +ELEEMVQVALLCTQ+ P HRPKMSEV+RMLEGDGLAE
Sbjct  525   KMHQEKKLDVLVDKGLRNSYDHIELEEMVQVALLCTQYLPGHRPKMSEVVRMLEGDGLAE  584

Query  557   KWEASQRNDTPRFRTHENTPQR-YSDFIEESSLIVEAMELSGPR  429
             +WEASQR D+ +F+  E T  R YSD  ++SSL+V+A+ELSGPR
Sbjct  585   RWEASQRTDSHKFKVPEFTFGRCYSDLTDDSSLLVQAVELSGPR  628



>ref|XP_009373732.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like [Pyrus x bretschneideri]
Length=636

 Score =   360 bits (923),  Expect = 6e-115, Method: Compositional matrix adjust.
 Identities = 171/224 (76%), Positives = 199/224 (89%), Gaps = 1/224 (0%)
 Frame = -1

Query  1097  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVS  918
             RKRIALG  RGL+YLHEQCDPKIIHRDVKAANILLD+  EAVVGDFGLAKLLDH++SHV+
Sbjct  413   RKRIALGAGRGLLYLHEQCDPKIIHRDVKAANILLDDYCEAVVGDFGLAKLLDHQDSHVT  472

Query  917   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVK  738
             TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQ+A++FG+ ANQKG ILDWVK
Sbjct  473   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQRALEFGKAANQKGAILDWVK  532

Query  737   TLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAE  558
              +HQE  L ++VDKDL  N+DR+ELEEMVQVALLCTQ+ P HRPKMSEV+RMLEGDGL E
Sbjct  533   KIHQEKTLEMLVDKDLTTNYDRIELEEMVQVALLCTQYLPGHRPKMSEVVRMLEGDGLVE  592

Query  557   KWEASQRNDTPRFRTHE-NTPQRYSDFIEESSLIVEAMELSGPR  429
             +WEASQ+ ++ + +  E ++  RYSD  ++SSL+V+AMELSGPR
Sbjct  593   RWEASQKVESTKSKAPEFSSSDRYSDLTDDSSLLVQAMELSGPR  636



>ref|XP_010905760.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like [Elaeis guineensis]
Length=635

 Score =   359 bits (922),  Expect = 7e-115, Method: Compositional matrix adjust.
 Identities = 172/224 (77%), Positives = 201/224 (90%), Gaps = 1/224 (0%)
 Frame = -1

Query  1097  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVS  918
             RKRI+LG ARGL+YLHEQCDPKIIHRDVKAANILLD+  EA+VGDFGLAKLLDHR+SHV+
Sbjct  412   RKRISLGAARGLLYLHEQCDPKIIHRDVKAANILLDDYCEAIVGDFGLAKLLDHRDSHVT  471

Query  917   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVK  738
             TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQ A++FG+ ANQKG +LDWVK
Sbjct  472   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQTALEFGKAANQKGAMLDWVK  531

Query  737   TLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAE  558
              +HQE KL+ +VDK L+N++DR+ELEEMVQVALLCTQ+ P HRPKMSEV+RMLEGDGLAE
Sbjct  532   RIHQEKKLDTIVDKVLRNHYDRIELEEMVQVALLCTQYLPGHRPKMSEVVRMLEGDGLAE  591

Query  557   KWEASQRNDTPRFRTHENTPQRY-SDFIEESSLIVEAMELSGPR  429
             +WEASQR +  + + HE + +R  SD  ++SSL+V+AMELSGPR
Sbjct  592   RWEASQRVEAYKCKLHEFSSERCSSDLTDDSSLLVQAMELSGPR  635



>gb|EYU44266.1| hypothetical protein MIMGU_mgv1a002951mg [Erythranthe guttata]
Length=622

 Score =   359 bits (921),  Expect = 7e-115, Method: Compositional matrix adjust.
 Identities = 172/224 (77%), Positives = 201/224 (90%), Gaps = 1/224 (0%)
 Frame = -1

Query  1097  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVS  918
             RKRIALG ARGL+YLHEQCDPKIIHRDVKAANILLDE  EAVVGDFGLAKLLDH++SHV+
Sbjct  399   RKRIALGAARGLLYLHEQCDPKIIHRDVKAANILLDEYCEAVVGDFGLAKLLDHQDSHVT  458

Query  917   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVK  738
             TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITG +A+ FG+ ANQKG +LDWVK
Sbjct  459   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGLRALQFGKSANQKGAVLDWVK  518

Query  737   TLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAE  558
              LHQE KL  +VDKDL++N+D +ELEE+VQVALLCTQ+ P  RPKMSE++RMLEGDGLAE
Sbjct  519   KLHQEKKLEEVVDKDLRSNYDIIELEEIVQVALLCTQYLPGLRPKMSEIVRMLEGDGLAE  578

Query  557   KWEASQRNDTPRFRTHE-NTPQRYSDFIEESSLIVEAMELSGPR  429
             +WEASQR ++ +F+T E ++ +RYSD  ++SSLI +A+ELSGPR
Sbjct  579   RWEASQRLESNKFKTQELSSSERYSDLTDDSSLIAQAIELSGPR  622



>dbj|BAB01326.1| receptor-like kinase [Arabidopsis thaliana]
Length=630

 Score =   359 bits (922),  Expect = 8e-115, Method: Compositional matrix adjust.
 Identities = 175/227 (77%), Positives = 199/227 (88%), Gaps = 4/227 (2%)
 Frame = -1

Query  1097  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVS  918
             RKRIALG  RGL+YLHEQCDPKIIHRDVKAANILLD+ FEAVVGDFGLAKLLDH ESHV+
Sbjct  404   RKRIALGAGRGLLYLHEQCDPKIIHRDVKAANILLDDYFEAVVGDFGLAKLLDHEESHVT  463

Query  917   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVK  738
             TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITG +A++FG+ ANQ+G ILDWVK
Sbjct  464   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGLRALEFGKAANQRGAILDWVK  523

Query  737   TLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAE  558
              L QE KL  +VDKDLK+N+DR+E+EEMVQVALLCTQ+ P HRPKMSEV+RMLEGDGL E
Sbjct  524   KLQQEKKLEQIVDKDLKSNYDRIEVEEMVQVALLCTQYLPIHRPKMSEVVRMLEGDGLVE  583

Query  557   KWEA-SQRNDTPRFRTHEN---TPQRYSDFIEESSLIVEAMELSGPR  429
             KWEA SQR +T R  +  N   + +RYSD  ++SS++V+AMELSGPR
Sbjct  584   KWEASSQRAETNRSYSKPNEFSSSERYSDLTDDSSVLVQAMELSGPR  630



>ref|XP_004232118.1| PREDICTED: protein NSP-INTERACTING KINASE 1 [Solanum lycopersicum]
Length=626

 Score =   359 bits (921),  Expect = 9e-115, Method: Compositional matrix adjust.
 Identities = 170/225 (76%), Positives = 206/225 (92%), Gaps = 2/225 (1%)
 Frame = -1

Query  1097  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVS  918
             RKRIA+G ARGL+YLHEQCDPKIIHRDVKAANILLD+  EAVVGDFGLAKLLDH++SHV+
Sbjct  402   RKRIAIGAARGLLYLHEQCDPKIIHRDVKAANILLDDFCEAVVGDFGLAKLLDHQDSHVT  461

Query  917   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVK  738
             TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITG +A++FG+ ANQKGV+LDWV+
Sbjct  462   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGMRAIEFGKAANQKGVMLDWVR  521

Query  737   TLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAE  558
              +HQE KL+++VDKDL+ N+DR+ELEEMVQVALLCTQ+ P HRPKMSE++RMLEGDGLAE
Sbjct  522   KIHQEKKLDVLVDKDLRINYDRIELEEMVQVALLCTQYLPGHRPKMSEIVRMLEGDGLAE  581

Query  557   KWEASQRND-TPRFRTHE-NTPQRYSDFIEESSLIVEAMELSGPR  429
             +WEASQ+ D + +++T E ++ +R+SD  ++S L+V+AMELSGPR
Sbjct  582   RWEASQKFDGSNKYKTKELSSSERFSDLTDDSLLLVQAMELSGPR  626



>ref|NP_974360.1| NSP-interacting kinase 2 [Arabidopsis thaliana]
 gb|AEE77027.1| NSP-interacting kinase 2 [Arabidopsis thaliana]
Length=636

 Score =   359 bits (922),  Expect = 9e-115, Method: Compositional matrix adjust.
 Identities = 175/227 (77%), Positives = 199/227 (88%), Gaps = 4/227 (2%)
 Frame = -1

Query  1097  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVS  918
             RKRIALG  RGL+YLHEQCDPKIIHRDVKAANILLD+ FEAVVGDFGLAKLLDH ESHV+
Sbjct  410   RKRIALGAGRGLLYLHEQCDPKIIHRDVKAANILLDDYFEAVVGDFGLAKLLDHEESHVT  469

Query  917   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVK  738
             TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITG +A++FG+ ANQ+G ILDWVK
Sbjct  470   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGLRALEFGKAANQRGAILDWVK  529

Query  737   TLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAE  558
              L QE KL  +VDKDLK+N+DR+E+EEMVQVALLCTQ+ P HRPKMSEV+RMLEGDGL E
Sbjct  530   KLQQEKKLEQIVDKDLKSNYDRIEVEEMVQVALLCTQYLPIHRPKMSEVVRMLEGDGLVE  589

Query  557   KWEA-SQRNDTPRFRTHEN---TPQRYSDFIEESSLIVEAMELSGPR  429
             KWEA SQR +T R  +  N   + +RYSD  ++SS++V+AMELSGPR
Sbjct  590   KWEASSQRAETNRSYSKPNEFSSSERYSDLTDDSSVLVQAMELSGPR  636



>ref|NP_189183.2| NSP-interacting kinase 2 [Arabidopsis thaliana]
 sp|Q8RY65.1|NIK2_ARATH RecName: Full=Protein NSP-INTERACTING KINASE 2; AltName: Full=LRR 
receptor-like serine/threonine-protein kinase NIK2; Flags: 
Precursor [Arabidopsis thaliana]
 gb|AAL91629.1| AT3g25560/MWL2_18 [Arabidopsis thaliana]
 gb|AAO11535.1| At3g25560/MWL2_18 [Arabidopsis thaliana]
 gb|ACN59323.1| leucine-rich repeat receptor-like protein kinase [Arabidopsis 
thaliana]
 gb|AEE77026.1| NSP-interacting kinase 2 [Arabidopsis thaliana]
Length=635

 Score =   359 bits (922),  Expect = 9e-115, Method: Compositional matrix adjust.
 Identities = 175/227 (77%), Positives = 199/227 (88%), Gaps = 4/227 (2%)
 Frame = -1

Query  1097  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVS  918
             RKRIALG  RGL+YLHEQCDPKIIHRDVKAANILLD+ FEAVVGDFGLAKLLDH ESHV+
Sbjct  409   RKRIALGAGRGLLYLHEQCDPKIIHRDVKAANILLDDYFEAVVGDFGLAKLLDHEESHVT  468

Query  917   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVK  738
             TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITG +A++FG+ ANQ+G ILDWVK
Sbjct  469   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGLRALEFGKAANQRGAILDWVK  528

Query  737   TLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAE  558
              L QE KL  +VDKDLK+N+DR+E+EEMVQVALLCTQ+ P HRPKMSEV+RMLEGDGL E
Sbjct  529   KLQQEKKLEQIVDKDLKSNYDRIEVEEMVQVALLCTQYLPIHRPKMSEVVRMLEGDGLVE  588

Query  557   KWEA-SQRNDTPRFRTHEN---TPQRYSDFIEESSLIVEAMELSGPR  429
             KWEA SQR +T R  +  N   + +RYSD  ++SS++V+AMELSGPR
Sbjct  589   KWEASSQRAETNRSYSKPNEFSSSERYSDLTDDSSVLVQAMELSGPR  635



>dbj|BAJ89901.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=625

 Score =   359 bits (921),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 169/224 (75%), Positives = 202/224 (90%), Gaps = 1/224 (0%)
 Frame = -1

Query  1097  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVS  918
             RKRIALG ARGL+YLHEQCDPKIIHRDVKAAN+LLD+  EA+VGDFGLAKLLDH++SHV+
Sbjct  402   RKRIALGAARGLLYLHEQCDPKIIHRDVKAANVLLDDCCEAIVGDFGLAKLLDHQDSHVT  461

Query  917   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVK  738
             TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQ A++FG+ +NQKG +LDWVK
Sbjct  462   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQTALEFGKASNQKGAMLDWVK  521

Query  737   TLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAE  558
              +HQE KL+++VDK L++++DR+ELEEMVQVALLCTQ+ P HRP+MSEV+RMLEGDGLAE
Sbjct  522   KMHQEKKLDMLVDKGLRSSYDRIELEEMVQVALLCTQYLPGHRPRMSEVVRMLEGDGLAE  581

Query  557   KWEASQRNDTPRFRTHENTPQR-YSDFIEESSLIVEAMELSGPR  429
             +W+ASQR D+ +F   E T  R YSD  ++SSL+V+A+ELSGPR
Sbjct  582   RWQASQRADSHKFTVPEFTFSRCYSDLTDDSSLLVQAVELSGPR  625



>ref|XP_004297175.1| PREDICTED: protein NSP-INTERACTING KINASE 2 [Fragaria vesca subsp. 
vesca]
Length=624

 Score =   358 bits (920),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 169/225 (75%), Positives = 201/225 (89%), Gaps = 2/225 (1%)
 Frame = -1

Query  1097  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVS  918
             RKRIA+G ARGL+YLHEQCDPKIIHRDVKAANILLD+ +EAVVGDFGLAKLLDH ESH++
Sbjct  400   RKRIAIGAARGLLYLHEQCDPKIIHRDVKAANILLDDYYEAVVGDFGLAKLLDHHESHIT  459

Query  917   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVK  738
             TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGIL+LELI+GQ+A++FG+ ANQKG ILDWVK
Sbjct  460   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILVLELISGQRALEFGKAANQKGAILDWVK  519

Query  737   TLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAE  558
              + QE K +++VDK+LKN++D +ELEEM+QVALLCTQ  P  RPKMSEV+RMLEGDGLAE
Sbjct  520   KIQQEKKFDMLVDKELKNDYDPIELEEMIQVALLCTQNLPGQRPKMSEVVRMLEGDGLAE  579

Query  557   KWEASQRNDTPRFRTHEN--TPQRYSDFIEESSLIVEAMELSGPR  429
             KWEASQR ++ R RT+ +  + +RYSD  ++SSL+ +AMELSGPR
Sbjct  580   KWEASQRAESNRCRTNNDFSSSERYSDLTDDSSLLAQAMELSGPR  624



>ref|XP_004965216.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like [Setaria italica]
Length=661

 Score =   360 bits (923),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 172/224 (77%), Positives = 200/224 (89%), Gaps = 1/224 (0%)
 Frame = -1

Query  1097  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVS  918
             RKRIALG  RGL+YLHEQCDPKIIHRDVKAANILLD+  EA+VGDFGLAKLLDHR+SHV+
Sbjct  438   RKRIALGAGRGLLYLHEQCDPKIIHRDVKAANILLDDYCEAIVGDFGLAKLLDHRDSHVT  497

Query  917   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVK  738
             TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQ A++FG+ ANQKG +LDWVK
Sbjct  498   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQTALEFGKAANQKGAMLDWVK  557

Query  737   TLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAE  558
              +HQE KL+++VDK LK  +DR+ELEEMVQVALLCTQ+ P HRPKMSEV+RMLEGDGLAE
Sbjct  558   KMHQEKKLDVLVDKGLKGGYDRIELEEMVQVALLCTQYLPGHRPKMSEVVRMLEGDGLAE  617

Query  557   KWEASQRNDTPRFRTHENTPQR-YSDFIEESSLIVEAMELSGPR  429
             +WEASQ  D+ +F+  E + +R YSD  ++SSL+V+A+ELSGPR
Sbjct  618   RWEASQCADSHKFKVPEFSFRRCYSDLTDDSSLLVQAVELSGPR  661



>ref|XP_009407942.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like [Musa acuminata 
subsp. malaccensis]
Length=623

 Score =   358 bits (920),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 167/223 (75%), Positives = 200/223 (90%), Gaps = 0/223 (0%)
 Frame = -1

Query  1097  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVS  918
             RKRIALG ARGL+YLHEQCDPKIIHRDVKAANILLD+  EAVVGDFGLAKLLDHR+SHV+
Sbjct  401   RKRIALGAARGLLYLHEQCDPKIIHRDVKAANILLDDYCEAVVGDFGLAKLLDHRDSHVT  460

Query  917   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVK  738
             TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITG +AV+FG+ ANQKG ILDWV+
Sbjct  461   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGLRAVEFGKAANQKGAILDWVR  520

Query  737   TLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAE  558
              +HQE  L+++VD+DLKNN+DRVE+EE++QV +LCTQ+ P HRPKMSEV+RMLEGDGLAE
Sbjct  521   KIHQEKSLDMLVDRDLKNNYDRVEVEEIIQVVILCTQYLPGHRPKMSEVVRMLEGDGLAE  580

Query  557   KWEASQRNDTPRFRTHENTPQRYSDFIEESSLIVEAMELSGPR  429
             +WEAS+R +  + +  E   ++YSD  ++SSL+++A+ELSGPR
Sbjct  581   RWEASRRIEAHKLKVPEIFSEQYSDITDDSSLLIDAIELSGPR  623



>ref|XP_009396215.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009396224.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like [Musa acuminata 
subsp. malaccensis]
Length=621

 Score =   358 bits (919),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 172/223 (77%), Positives = 201/223 (90%), Gaps = 2/223 (1%)
 Frame = -1

Query  1097  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVS  918
             RKRIALG ARGL+YLHEQCDPKIIHRDVKAANILLD+  EAVVGDFGLAKLLDHR++HV+
Sbjct  401   RKRIALGAARGLLYLHEQCDPKIIHRDVKAANILLDDYCEAVVGDFGLAKLLDHRDTHVT  460

Query  917   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVK  738
             TAVRGTVGHIAPEYLSTGQSS+KTDVFGFGILLLELITG +A+++G+ A QKG +LDWV+
Sbjct  461   TAVRGTVGHIAPEYLSTGQSSDKTDVFGFGILLLELITGLRALEYGKAAKQKGAMLDWVR  520

Query  737   TLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAE  558
              +HQE KL+++VDKDLK N+DR+ELEEMVQVALLCTQ+ P HRPKMSEV+RMLEGDGLAE
Sbjct  521   KMHQEKKLDVLVDKDLK-NYDRIELEEMVQVALLCTQYVPGHRPKMSEVVRMLEGDGLAE  579

Query  557   KWEASQRNDTPRFRTHENTPQRYSDFIEESSLIVEAMELSGPR  429
             +WEASQR +  +FR  E + +RYSD  ++ SL+VEAMELSGPR
Sbjct  580   RWEASQRTEVHKFRVPEFSSERYSDLTDD-SLLVEAMELSGPR  621



>ref|XP_004304172.1| PREDICTED: protein NSP-INTERACTING KINASE 1 [Fragaria vesca subsp. 
vesca]
Length=622

 Score =   358 bits (919),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 166/223 (74%), Positives = 197/223 (88%), Gaps = 0/223 (0%)
 Frame = -1

Query  1097  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVS  918
             RKRIALG ARGL+YLHEQCDPKIIHRDVKAAN+LLD+  EAVVGDF LAKLLDH++SHV+
Sbjct  400   RKRIALGAARGLLYLHEQCDPKIIHRDVKAANVLLDDYCEAVVGDFDLAKLLDHQDSHVT  459

Query  917   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVK  738
             TAVRGT+GHIAPEYLSTGQSS+KTDVFGFGILLLELITGQ A++F +  NQKG ILDWVK
Sbjct  460   TAVRGTIGHIAPEYLSTGQSSDKTDVFGFGILLLELITGQTALEFAKSTNQKGAILDWVK  519

Query  737   TLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAE  558
              LHQE KL ++VDKDL  N+DR+ELEEM+QVALLCTQ+ P HRP+MSEV+RMLEGDGL E
Sbjct  520   KLHQEKKLEMLVDKDLNTNYDRIELEEMIQVALLCTQYLPGHRPRMSEVVRMLEGDGLVE  579

Query  557   KWEASQRNDTPRFRTHENTPQRYSDFIEESSLIVEAMELSGPR  429
             +WEASQR ++ + + + ++  RYSD  ++SSL+V+AMELSGPR
Sbjct  580   RWEASQRAESTKSKAYFSSSDRYSDLTDDSSLLVQAMELSGPR  622



>ref|XP_004236956.1| PREDICTED: protein NSP-INTERACTING KINASE 2 [Solanum lycopersicum]
Length=620

 Score =   358 bits (918),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 170/225 (76%), Positives = 203/225 (90%), Gaps = 2/225 (1%)
 Frame = -1

Query  1097  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVS  918
             RK IALG ARGL+YLHEQCDPKIIHRDVKAANILLD+  EAVVGDFGLAKLLDH +SHV+
Sbjct  396   RKGIALGAARGLLYLHEQCDPKIIHRDVKAANILLDDYCEAVVGDFGLAKLLDHHDSHVT  455

Query  917   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVK  738
             TAVRGTVGHIAPEYLSTGQSS+KTDVFGFGILLLELITG++A++FG+ ANQKG +LDWV+
Sbjct  456   TAVRGTVGHIAPEYLSTGQSSDKTDVFGFGILLLELITGERALEFGKAANQKGAMLDWVR  515

Query  737   TLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAE  558
              + QE +L+++VDKD+KN +D +ELEEMVQVALLCTQ++PSHRPKMSEV+RMLEGDGLAE
Sbjct  516   KIQQEKRLDMLVDKDMKNEYDTIELEEMVQVALLCTQYHPSHRPKMSEVVRMLEGDGLAE  575

Query  557   KWEASQRNDTPRF-RTHE-NTPQRYSDFIEESSLIVEAMELSGPR  429
             KWEASQ  +  R+ R +E ++ +RYSD  ++SSL+V+AMELSGPR
Sbjct  576   KWEASQTAEPTRYSRANEFSSSERYSDLTDDSSLLVQAMELSGPR  620



>ref|XP_008243752.1| PREDICTED: protein NSP-INTERACTING KINASE 2 [Prunus mume]
 ref|XP_008243753.1| PREDICTED: protein NSP-INTERACTING KINASE 2 [Prunus mume]
Length=625

 Score =   358 bits (918),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 170/224 (76%), Positives = 200/224 (89%), Gaps = 1/224 (0%)
 Frame = -1

Query  1097  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVS  918
             RKRIALG  RGL+YLHEQCDPKIIHRDVKAANILLDE  EAVVGDFGLAKLLDH +SH++
Sbjct  402   RKRIALGAGRGLLYLHEQCDPKIIHRDVKAANILLDEYCEAVVGDFGLAKLLDHHDSHIT  461

Query  917   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVK  738
             TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGIL+LELI+GQ+A++FG+ ANQKG ILDWVK
Sbjct  462   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILILELISGQRALEFGKAANQKGAILDWVK  521

Query  737   TLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAE  558
              + QE K +++VDK+LKN++D +ELEEM+QVALLCTQ  PS RPKMSEV+RMLEGDGLAE
Sbjct  522   KIQQEKKFDVLVDKELKNDYDPIELEEMIQVALLCTQNLPSQRPKMSEVVRMLEGDGLAE  581

Query  557   KWEASQRNDTPRFRTHE-NTPQRYSDFIEESSLIVEAMELSGPR  429
             KWEASQR ++ R R +E ++ +RYSD  ++SSL+ +AMELSGPR
Sbjct  582   KWEASQRAESNRCRANEFSSSERYSDLTDDSSLLAQAMELSGPR  625



>ref|XP_012080508.1| PREDICTED: protein NSP-INTERACTING KINASE 2-like [Jatropha curcas]
 gb|KDP31451.1| hypothetical protein JCGZ_11827 [Jatropha curcas]
Length=621

 Score =   357 bits (917),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 169/224 (75%), Positives = 200/224 (89%), Gaps = 1/224 (0%)
 Frame = -1

Query  1097  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVS  918
             RKRIALG ARGL+YLHEQCDPKIIHRDVKAANILLD+  EAVVGDFGLAKLLDHRESH++
Sbjct  398   RKRIALGAARGLLYLHEQCDPKIIHRDVKAANILLDDYCEAVVGDFGLAKLLDHRESHIT  457

Query  917   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVK  738
             T V+GTVGHIAPEYLSTGQSSEKTDVFGFG+LL+ELI+G +A++FG+ + QKG +LDWVK
Sbjct  458   TTVKGTVGHIAPEYLSTGQSSEKTDVFGFGMLLVELISGLRALEFGKSSKQKGAMLDWVK  517

Query  737   TLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAE  558
              ++ E KL L+VDKDLKNN+DR+ELEEMV+VALLCTQ+ P+HRPKMSEV+RMLEGDGLAE
Sbjct  518   KINHEKKLELLVDKDLKNNYDRIELEEMVRVALLCTQYYPTHRPKMSEVVRMLEGDGLAE  577

Query  557   KWEASQRNDTPRFRTHE-NTPQRYSDFIEESSLIVEAMELSGPR  429
             KWEASQR +    R  E ++ +RYSD  ++SSL+V+AMELSGPR
Sbjct  578   KWEASQRAEATGSRVAEFSSSERYSDLTDDSSLLVQAMELSGPR  621



>ref|XP_008389350.1| PREDICTED: LOW QUALITY PROTEIN: protein NSP-INTERACTING KINASE 
2-like [Malus domestica]
Length=621

 Score =   357 bits (917),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 168/224 (75%), Positives = 201/224 (90%), Gaps = 1/224 (0%)
 Frame = -1

Query  1097  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVS  918
             RKRIALG  RGL+YLHEQCDPKIIHRDVKAANILLD+ +EAVVGDFGLAKLLDH +SH++
Sbjct  398   RKRIALGAGRGLLYLHEQCDPKIIHRDVKAANILLDDYYEAVVGDFGLAKLLDHHDSHIT  457

Query  917   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVK  738
             TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGIL+LELI+GQ+A++FG+ ANQKG ILDWVK
Sbjct  458   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILILELISGQRALEFGKAANQKGAILDWVK  517

Query  737   TLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAE  558
              + QE K +++VDK+LKN++D +ELEEM+QVALLCTQ  P+ RPKMSEV+RMLEGDGLAE
Sbjct  518   KIQQEKKFDVLVDKELKNDYDAIELEEMIQVALLCTQNLPNQRPKMSEVVRMLEGDGLAE  577

Query  557   KWEASQRNDTPRFRTHE-NTPQRYSDFIEESSLIVEAMELSGPR  429
             KWEASQR ++ R R +E ++ +RYSD  ++SSL+ +AMELSGPR
Sbjct  578   KWEASQRAESNRCRANEFSSSERYSDLTDDSSLLAQAMELSGPR  621



>gb|KJB60823.1| hypothetical protein B456_009G327400 [Gossypium raimondii]
Length=624

 Score =   357 bits (917),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 173/224 (77%), Positives = 197/224 (88%), Gaps = 1/224 (0%)
 Frame = -1

Query  1097  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVS  918
             RKRIALG ARGL+YLHEQCDPKIIHRDVKAANILLD+D EA+VGDFGLAKLLDH+ESHV+
Sbjct  401   RKRIALGAARGLLYLHEQCDPKIIHRDVKAANILLDDDCEAIVGDFGLAKLLDHQESHVT  460

Query  917   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVK  738
             TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELI+G +A+  G+ ANQKG ILDWV 
Sbjct  461   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELISGLRALQVGKTANQKGAILDWVI  520

Query  737   TLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAE  558
              +HQE KL L+VDKDLKNN+DR+E+EEMV+VALLC Q  PS RPKMSEV+RMLEGDGLAE
Sbjct  521   KIHQEKKLELLVDKDLKNNYDRIEVEEMVRVALLCVQNQPSQRPKMSEVVRMLEGDGLAE  580

Query  557   KWEASQRNDTPRFRTHE-NTPQRYSDFIEESSLIVEAMELSGPR  429
              WEAS R +  R R +E ++ +RYSD  ++SSL+V AMELSGPR
Sbjct  581   TWEASHRAEPNRSRANEFSSSERYSDLTDDSSLLVPAMELSGPR  624



>ref|XP_010091686.1| Protein NSP-INTERACTING KINASE 2 [Morus notabilis]
 gb|EXB44952.1| Protein NSP-INTERACTING KINASE 2 [Morus notabilis]
Length=619

 Score =   357 bits (915),  Expect = 6e-114, Method: Compositional matrix adjust.
 Identities = 171/224 (76%), Positives = 201/224 (90%), Gaps = 7/224 (3%)
 Frame = -1

Query  1097  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVS  918
             RKRIALG ARGL+YLHEQCDPKIIHRDVKAANILLD+  EAVVGDFGLAKLLDH +SHV+
Sbjct  402   RKRIALGAARGLLYLHEQCDPKIIHRDVKAANILLDDYCEAVVGDFGLAKLLDHHDSHVT  461

Query  917   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVK  738
             TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELI+GQ+A+DFG+ ANQKG +LDW  
Sbjct  462   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELISGQRALDFGKAANQKGAMLDW--  519

Query  737   TLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAE  558
                 E KL+++VDKDLKNN+DR+ELEE++QVALLCTQ+ PS+RPKMSEV+RMLEGDGLAE
Sbjct  520   ----EKKLDMLVDKDLKNNYDRIELEEIIQVALLCTQYLPSYRPKMSEVVRMLEGDGLAE  575

Query  557   KWEASQRNDTPRFRTHE-NTPQRYSDFIEESSLIVEAMELSGPR  429
             KWEASQR ++ R R ++ ++ +RYSD  ++SSL+ +AMELSGPR
Sbjct  576   KWEASQRAESTRCRANDFSSSERYSDLTDDSSLLAQAMELSGPR  619



>ref|XP_002452616.1| hypothetical protein SORBIDRAFT_04g029170 [Sorghum bicolor]
 gb|EES05592.1| hypothetical protein SORBIDRAFT_04g029170 [Sorghum bicolor]
Length=626

 Score =   356 bits (914),  Expect = 9e-114, Method: Compositional matrix adjust.
 Identities = 170/224 (76%), Positives = 200/224 (89%), Gaps = 1/224 (0%)
 Frame = -1

Query  1097  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVS  918
             RKRIALG ARGL+YLHEQCDPKIIHRDVKAANILLD+  EA+VGDFGLAKLLDHRESHV+
Sbjct  403   RKRIALGAARGLLYLHEQCDPKIIHRDVKAANILLDDCCEAIVGDFGLAKLLDHRESHVT  462

Query  917   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVK  738
             TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQ A++FG+ +NQKG +LDWVK
Sbjct  463   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQTALEFGKSSNQKGAMLDWVK  522

Query  737   TLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAE  558
              +HQE +L+++VDK L + +DR+ELEEMVQVALLCTQF P HRPKMSEV+RMLEGDGLAE
Sbjct  523   KMHQEKQLDILVDKGLGSKYDRIELEEMVQVALLCTQFLPGHRPKMSEVVRMLEGDGLAE  582

Query  557   KWEASQRNDTPRFRTHENTPQR-YSDFIEESSLIVEAMELSGPR  429
             +WEASQ  ++ +F+  E +  R +SD  ++SSL+V+A+ELSGPR
Sbjct  583   RWEASQHTESHKFKVPEFSFSRCHSDLTDDSSLLVQAVELSGPR  626



>gb|AHF18212.1| brassinosteroid insensitive 1-associated receptor kinase 1 [Saccharum 
hybrid cultivar]
Length=626

 Score =   356 bits (914),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 170/224 (76%), Positives = 200/224 (89%), Gaps = 1/224 (0%)
 Frame = -1

Query  1097  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVS  918
             RKRIALG ARGL+YLHEQCDPKIIHRDVKAANILLD+  EA+VGDFGLAKLLDHRESHV+
Sbjct  403   RKRIALGAARGLLYLHEQCDPKIIHRDVKAANILLDDCCEAIVGDFGLAKLLDHRESHVT  462

Query  917   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVK  738
             TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQ A++FG+ +NQKG +LDWVK
Sbjct  463   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQTALEFGKSSNQKGAMLDWVK  522

Query  737   TLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAE  558
              +HQE +L+++VDK L + +DR+ELEEMVQVALLCTQF P HRPKMSEV+RMLEGDGLAE
Sbjct  523   KMHQEKQLDILVDKGLGSKYDRIELEEMVQVALLCTQFLPGHRPKMSEVVRMLEGDGLAE  582

Query  557   KWEASQRNDTPRFRTHENTPQR-YSDFIEESSLIVEAMELSGPR  429
             +WEASQ  ++ +F+  E +  R +SD  ++SSL+V+A+ELSGPR
Sbjct  583   RWEASQHTESHKFKVPEFSFSRCHSDLTDDSSLLVQAVELSGPR  626



>ref|XP_003563960.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like [Brachypodium 
distachyon]
Length=629

 Score =   356 bits (914),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 168/224 (75%), Positives = 202/224 (90%), Gaps = 1/224 (0%)
 Frame = -1

Query  1097  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVS  918
             RKRIALG ARGL+YLHEQCDPKIIHRDVKAAN+LLD+  +A+VGDFGLAKLLDH++SHV+
Sbjct  406   RKRIALGAARGLLYLHEQCDPKIIHRDVKAANVLLDDYCDAIVGDFGLAKLLDHQDSHVT  465

Query  917   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVK  738
             TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQ A++FG+ +NQKG +LDWVK
Sbjct  466   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQTALEFGKASNQKGAMLDWVK  525

Query  737   TLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAE  558
              +HQE KL+++VDK L++++DR+ELEEMVQVALLCTQ+ P HRP+MSEV+RMLEGDGLAE
Sbjct  526   KMHQEKKLDVLVDKGLRSSYDRIELEEMVQVALLCTQYLPGHRPRMSEVVRMLEGDGLAE  585

Query  557   KWEASQRNDTPRFRTHENTPQR-YSDFIEESSLIVEAMELSGPR  429
             +W+ASQR D+ +F   E T  R YSD  ++SSL+V+A+ELSGPR
Sbjct  586   RWQASQRADSHKFTVPEFTFSRCYSDLTDDSSLLVQAVELSGPR  629



>ref|XP_010044599.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X6 [Eucalyptus 
grandis]
Length=578

 Score =   355 bits (910),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 170/223 (76%), Positives = 201/223 (90%), Gaps = 1/223 (0%)
 Frame = -1

Query  1097  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVS  918
             R+RIALG ARGL+YLHEQC+PKIIHRDVKAANILLDEDFEA+VGDFGLAKLLDH++SHV+
Sbjct  357   RRRIALGTARGLLYLHEQCEPKIIHRDVKAANILLDEDFEAIVGDFGLAKLLDHKDSHVT  416

Query  917   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVK  738
             TAVRGTVGHIAPEYLSTGQSSEKTDVFG+GILLLELITGQ+A+DFGR  NQKGV+LDWV 
Sbjct  417   TAVRGTVGHIAPEYLSTGQSSEKTDVFGYGILLLELITGQRALDFGRIPNQKGVMLDWVI  476

Query  737   TLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAE  558
              L+++GKLN MVDK+L++NF+R+ELE MV+VALLCT+ NP  RPKMSEVL+M E DGLA+
Sbjct  477   KLYEDGKLNQMVDKNLQDNFNRLELEVMVKVALLCTKVNPLQRPKMSEVLKMFEDDGLAD  536

Query  557   KWEASQRNDTPRFRTHENTPQRYSDFIEESSLIVEAMELSGPR  429
               +A+QR +TPR  +  + P+RY+D+IEE SL VEAMELSGPR
Sbjct  537   NQDAAQRAETPRCLSGSSPPRRYADYIEEYSL-VEAMELSGPR  578



>ref|XP_006395648.1| hypothetical protein EUTSA_v10003811mg [Eutrema salsugineum]
 gb|ESQ32934.1| hypothetical protein EUTSA_v10003811mg [Eutrema salsugineum]
Length=643

 Score =   356 bits (914),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 174/227 (77%), Positives = 198/227 (87%), Gaps = 4/227 (2%)
 Frame = -1

Query  1097  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVS  918
             RKRIALG  RGL+YLHEQCDPKIIHRDVKAANILLDE FEAVVGDFGLAKLLDH ESHV+
Sbjct  417   RKRIALGAGRGLLYLHEQCDPKIIHRDVKAANILLDEFFEAVVGDFGLAKLLDHEESHVT  476

Query  917   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVK  738
             TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITG +A++FG+ ANQ+G ILDWVK
Sbjct  477   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGLRALEFGKAANQRGAILDWVK  536

Query  737   TLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAE  558
              L QE KL  ++DKDLK ++DR+E+EEMVQVALLCTQ+ P HRPKMSEV+RMLEGDGL E
Sbjct  537   KLQQEKKLEQIIDKDLKMHYDRIEVEEMVQVALLCTQYLPIHRPKMSEVVRMLEGDGLVE  596

Query  557   KWEA-SQRNDTPRFRTHEN---TPQRYSDFIEESSLIVEAMELSGPR  429
             KWEA SQR +T R  +  N   + +RYSD  ++SS++V+AMELSGPR
Sbjct  597   KWEASSQRTETNRSYSKPNEFSSSERYSDLTDDSSVLVQAMELSGPR  643



>gb|KCW86687.1| hypothetical protein EUGRSUZ_B03306 [Eucalyptus grandis]
 gb|KCW86688.1| hypothetical protein EUGRSUZ_B03306 [Eucalyptus grandis]
Length=622

 Score =   355 bits (911),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 170/223 (76%), Positives = 201/223 (90%), Gaps = 1/223 (0%)
 Frame = -1

Query  1097  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVS  918
             R+RIALG ARGL+YLHEQC+PKIIHRDVKAANILLDEDFEA+VGDFGLAKLLDH++SHV+
Sbjct  401   RRRIALGTARGLLYLHEQCEPKIIHRDVKAANILLDEDFEAIVGDFGLAKLLDHKDSHVT  460

Query  917   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVK  738
             TAVRGTVGHIAPEYLSTGQSSEKTDVFG+GILLLELITGQ+A+DFGR  NQKGV+LDWV 
Sbjct  461   TAVRGTVGHIAPEYLSTGQSSEKTDVFGYGILLLELITGQRALDFGRIPNQKGVMLDWVI  520

Query  737   TLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAE  558
              L+++GKLN MVDK+L++NF+R+ELE MV+VALLCT+ NP  RPKMSEVL+M E DGLA+
Sbjct  521   KLYEDGKLNQMVDKNLQDNFNRLELEVMVKVALLCTKVNPLQRPKMSEVLKMFEDDGLAD  580

Query  557   KWEASQRNDTPRFRTHENTPQRYSDFIEESSLIVEAMELSGPR  429
               +A+QR +TPR  +  + P+RY+D+IEE SL VEAMELSGPR
Sbjct  581   NQDAAQRAETPRLLSGSSPPRRYADYIEEYSL-VEAMELSGPR  622



>ref|XP_009356495.1| PREDICTED: protein NSP-INTERACTING KINASE 2-like [Pyrus x bretschneideri]
 ref|XP_009356496.1| PREDICTED: protein NSP-INTERACTING KINASE 2-like [Pyrus x bretschneideri]
Length=624

 Score =   355 bits (911),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 168/224 (75%), Positives = 200/224 (89%), Gaps = 1/224 (0%)
 Frame = -1

Query  1097  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVS  918
             RKRIALG  RGL+YLHEQCDPKIIHRDVKAANILLD+ +EAVVGDFGLAKLLDH +SH++
Sbjct  401   RKRIALGAGRGLLYLHEQCDPKIIHRDVKAANILLDDYYEAVVGDFGLAKLLDHHDSHIT  460

Query  917   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVK  738
             TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGIL+LELI+GQ+A++FG+ ANQKG ILDWVK
Sbjct  461   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILILELISGQRALEFGKAANQKGAILDWVK  520

Query  737   TLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAE  558
              + QE K +++VDK+LK ++D +ELEEM+QVALLCTQ  PS RPKMSEV+RMLEGDGLAE
Sbjct  521   KIQQEKKFDVLVDKELKYDYDAIELEEMIQVALLCTQNLPSQRPKMSEVVRMLEGDGLAE  580

Query  557   KWEASQRNDTPRFRTHE-NTPQRYSDFIEESSLIVEAMELSGPR  429
             KWEASQR ++ R R +E ++ +RYSD  ++SSL+ +AMELSGPR
Sbjct  581   KWEASQRAESNRCRANEFSSSERYSDLTDDSSLLAQAMELSGPR  624



>gb|KFK39862.1| hypothetical protein AALP_AA3G298400 [Arabis alpina]
Length=631

 Score =   355 bits (911),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 173/227 (76%), Positives = 198/227 (87%), Gaps = 4/227 (2%)
 Frame = -1

Query  1097  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVS  918
             RKRIALG  RGL+YLHEQCDPKIIHRDVKAANILLD+  EAVVGDFGLAKLLDH ESHV+
Sbjct  405   RKRIALGAGRGLLYLHEQCDPKIIHRDVKAANILLDDYCEAVVGDFGLAKLLDHEESHVT  464

Query  917   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVK  738
             TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITG +A++FG+ ANQ+G IL+WVK
Sbjct  465   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGLRALEFGKAANQRGAILEWVK  524

Query  737   TLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAE  558
              L QE KL  +VDKDLK+N+DR+E+EEMVQVALLCTQ+ P HRPKMSEV+RMLEGDGL E
Sbjct  525   KLQQEKKLEQIVDKDLKSNYDRIEIEEMVQVALLCTQYLPIHRPKMSEVVRMLEGDGLVE  584

Query  557   KWEA-SQRNDTPRFRTHEN---TPQRYSDFIEESSLIVEAMELSGPR  429
             +WEA SQR +T R  +  N   T +RYSD  ++SS++V+AMELSGPR
Sbjct  585   RWEASSQRTETNRSYSKPNEFSTSERYSDLTDDSSVLVQAMELSGPR  631



>ref|XP_002876917.1| nsp-interacting kinase 2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH53176.1| nsp-interacting kinase 2 [Arabidopsis lyrata subsp. lyrata]
Length=636

 Score =   355 bits (911),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 174/227 (77%), Positives = 197/227 (87%), Gaps = 4/227 (2%)
 Frame = -1

Query  1097  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVS  918
             RKRIALG  RGL+YLHEQCDPKIIHRDVKAANILLD   EAVVGDFGLAKLLDH ESHV+
Sbjct  410   RKRIALGAGRGLLYLHEQCDPKIIHRDVKAANILLDHYCEAVVGDFGLAKLLDHEESHVT  469

Query  917   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVK  738
             TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITG +A++FG+ ANQ+G ILDWVK
Sbjct  470   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGLRALEFGKAANQRGAILDWVK  529

Query  737   TLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAE  558
              L QE KL  +VDKDLK+N+DR+E+EEMVQVALLCTQ+ P HRPKMSEV+RMLEGDGL E
Sbjct  530   KLQQEKKLEQIVDKDLKSNYDRIEVEEMVQVALLCTQYLPIHRPKMSEVVRMLEGDGLVE  589

Query  557   KWEA-SQRNDTPRFRTHEN---TPQRYSDFIEESSLIVEAMELSGPR  429
             KWEA SQR +T R  +  N   + +RYSD  ++SS++V+AMELSGPR
Sbjct  590   KWEASSQRAETNRSYSKPNEFSSSERYSDLTDDSSVLVQAMELSGPR  636



>ref|XP_006338306.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like [Solanum tuberosum]
Length=626

 Score =   355 bits (910),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 169/225 (75%), Positives = 205/225 (91%), Gaps = 2/225 (1%)
 Frame = -1

Query  1097  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVS  918
             RKRIA+G ARGL+YLHEQCDPKIIHRDVKAANILLD+  EAVVGDFGLAKLLDH++SHV+
Sbjct  402   RKRIAIGAARGLLYLHEQCDPKIIHRDVKAANILLDDFCEAVVGDFGLAKLLDHQDSHVT  461

Query  917   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVK  738
             TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITG +A++FG+ ANQKGV+LDWV+
Sbjct  462   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGMRAIEFGKAANQKGVMLDWVR  521

Query  737   TLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAE  558
              +HQE KL+++VDKDL+ N+DR+ELEEMVQVALL TQ+ P HRPKMSE++RMLEGDGLAE
Sbjct  522   KIHQEKKLDVLVDKDLRINYDRIELEEMVQVALLSTQYLPGHRPKMSEIVRMLEGDGLAE  581

Query  557   KWEASQRND-TPRFRTHE-NTPQRYSDFIEESSLIVEAMELSGPR  429
             +WEASQ+ D + +++T E ++ +R+SD  ++S L+V+AMELSGPR
Sbjct  582   RWEASQKFDGSNKYKTKELSSSERFSDLTDDSLLLVQAMELSGPR  626



>ref|NP_197104.1| NSP-interacting kinase 1 [Arabidopsis thaliana]
 sp|Q9LFS4.1|NIK1_ARATH RecName: Full=Protein NSP-INTERACTING KINASE 1; AltName: Full=LRR 
receptor-like serine/threonine-protein kinase NIK1; Flags: 
Precursor [Arabidopsis thaliana]
 emb|CAC01799.1| receptor protein kinase-like protein [Arabidopsis thaliana]
 gb|AAL66960.1| putative receptor protein kinase [Arabidopsis thaliana]
 gb|AAN86199.1| putative receptor protein kinase [Arabidopsis thaliana]
 gb|ACN59368.1| leucine-rich repeat receptor-like protein kinase [Arabidopsis 
thaliana]
 gb|AED92233.1| NSP-interacting kinase 1 [Arabidopsis thaliana]
Length=638

 Score =   355 bits (910),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 173/230 (75%), Positives = 201/230 (87%), Gaps = 7/230 (3%)
 Frame = -1

Query  1097  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVS  918
             RKRIA+G ARGLVYLHEQCDPKIIHRDVKAANILLD+  EAVVGDFGLAKLLDH++SHV+
Sbjct  409   RKRIAIGAARGLVYLHEQCDPKIIHRDVKAANILLDDYCEAVVGDFGLAKLLDHQDSHVT  468

Query  917   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVK  738
             TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLEL+TGQ+A +FG+ ANQKGV+LDWVK
Sbjct  469   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELVTGQRAFEFGKAANQKGVMLDWVK  528

Query  737   TLHQEGKLNLMVDKDL--KNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGL  564
              +HQE KL L+VDK+L  K ++D +EL+EMV+VALLCTQ+ P HRPKMSEV+RMLEGDGL
Sbjct  529   KIHQEKKLELLVDKELLKKKSYDEIELDEMVRVALLCTQYLPGHRPKMSEVVRMLEGDGL  588

Query  563   AEKWEASQRND-----TPRFRTHENTPQRYSDFIEESSLIVEAMELSGPR  429
             AEKWEASQR+D     + R     ++  RYSD  ++SSL+V+AMELSGPR
Sbjct  589   AEKWEASQRSDSVSKCSNRINELMSSSDRYSDLTDDSSLLVQAMELSGPR  638



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2896626386480